data_1F4J
# 
_entry.id   1F4J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F4J         
RCSB  RCSB011233   
WWPDB D_1000011233 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1qqw 
_pdbx_database_related.details        'another structure in orthorhombic crystal' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F4J 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Safo, M.K.'    1 
'Musayev, F.N.' 2 
'Wu, S.H.'      3 
'Abraham, D.J.' 4 
'Ko, T.P.'      5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of tetragonal crystals of human erythrocyte catalase.' 'Acta Crystallogr.,Sect.D' 57 1   7   2001 ABCRE6 DK 
0907-4449 0766 ? 11134921 10.1107/S0907444900013767 
1       'Structure of Human Erythrocyte Catalase'                         'Acta Crystallogr.,Sect.D' 56 241 245 2000 ABCRE6 DK 
0907-4449 0766 ? ?        10.1107/S0907444999015930 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Safo, M.K.'     1  
primary 'Musayev, F.N.'  2  
primary 'Wu, S.H.'       3  
primary 'Abraham, D.J.'  4  
primary 'Ko, T.P.'       5  
1       'Ko, T.P.'       6  
1       'Safo, M.K.'     7  
1       'Musayev, F.N.'  8  
1       'Di Salvo, M.L.' 9  
1       'Wang, C.'       10 
1       'Wu, S.H.'       11 
1       'Abraham, D.J.'  12 
# 
_cell.entry_id           1F4J 
_cell.length_a           203.600 
_cell.length_b           203.600 
_cell.length_c           144.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F4J 
_symmetry.space_group_name_H-M             'I 41' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                80 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat CATALASE                          59836.996 4    1.11.1.6 ? 'INTACT BUT LACKS THE FIRST AND LAST EXONS' ? 
2 non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE' 616.487   4    ?        ? ?                                           ? 
3 water       nat water                             18.015    1239 ?        ? ?                                           ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   SER n 
1 5   ARG n 
1 6   ASP n 
1 7   PRO n 
1 8   ALA n 
1 9   SER n 
1 10  ASP n 
1 11  GLN n 
1 12  MET n 
1 13  GLN n 
1 14  HIS n 
1 15  TRP n 
1 16  LYS n 
1 17  GLU n 
1 18  GLN n 
1 19  ARG n 
1 20  ALA n 
1 21  ALA n 
1 22  GLN n 
1 23  LYS n 
1 24  ALA n 
1 25  ASP n 
1 26  VAL n 
1 27  LEU n 
1 28  THR n 
1 29  THR n 
1 30  GLY n 
1 31  ALA n 
1 32  GLY n 
1 33  ASN n 
1 34  PRO n 
1 35  VAL n 
1 36  GLY n 
1 37  ASP n 
1 38  LYS n 
1 39  LEU n 
1 40  ASN n 
1 41  VAL n 
1 42  ILE n 
1 43  THR n 
1 44  VAL n 
1 45  GLY n 
1 46  PRO n 
1 47  ARG n 
1 48  GLY n 
1 49  PRO n 
1 50  LEU n 
1 51  LEU n 
1 52  VAL n 
1 53  GLN n 
1 54  ASP n 
1 55  VAL n 
1 56  VAL n 
1 57  PHE n 
1 58  THR n 
1 59  ASP n 
1 60  GLU n 
1 61  MET n 
1 62  ALA n 
1 63  HIS n 
1 64  PHE n 
1 65  ASP n 
1 66  ARG n 
1 67  GLU n 
1 68  ARG n 
1 69  ILE n 
1 70  PRO n 
1 71  GLU n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  HIS n 
1 76  ALA n 
1 77  LYS n 
1 78  GLY n 
1 79  ALA n 
1 80  GLY n 
1 81  ALA n 
1 82  PHE n 
1 83  GLY n 
1 84  TYR n 
1 85  PHE n 
1 86  GLU n 
1 87  VAL n 
1 88  THR n 
1 89  HIS n 
1 90  ASP n 
1 91  ILE n 
1 92  THR n 
1 93  LYS n 
1 94  TYR n 
1 95  SER n 
1 96  LYS n 
1 97  ALA n 
1 98  LYS n 
1 99  VAL n 
1 100 PHE n 
1 101 GLU n 
1 102 HIS n 
1 103 ILE n 
1 104 GLY n 
1 105 LYS n 
1 106 LYS n 
1 107 THR n 
1 108 PRO n 
1 109 ILE n 
1 110 ALA n 
1 111 VAL n 
1 112 ARG n 
1 113 PHE n 
1 114 SER n 
1 115 THR n 
1 116 VAL n 
1 117 ALA n 
1 118 GLY n 
1 119 GLU n 
1 120 SER n 
1 121 GLY n 
1 122 SER n 
1 123 ALA n 
1 124 ASP n 
1 125 THR n 
1 126 VAL n 
1 127 ARG n 
1 128 ASP n 
1 129 PRO n 
1 130 ARG n 
1 131 GLY n 
1 132 PHE n 
1 133 ALA n 
1 134 VAL n 
1 135 LYS n 
1 136 PHE n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 ASP n 
1 141 GLY n 
1 142 ASN n 
1 143 TRP n 
1 144 ASP n 
1 145 LEU n 
1 146 VAL n 
1 147 GLY n 
1 148 ASN n 
1 149 ASN n 
1 150 THR n 
1 151 PRO n 
1 152 ILE n 
1 153 PHE n 
1 154 PHE n 
1 155 ILE n 
1 156 ARG n 
1 157 ASP n 
1 158 PRO n 
1 159 ILE n 
1 160 LEU n 
1 161 PHE n 
1 162 PRO n 
1 163 SER n 
1 164 PHE n 
1 165 ILE n 
1 166 HIS n 
1 167 SER n 
1 168 GLN n 
1 169 LYS n 
1 170 ARG n 
1 171 ASN n 
1 172 PRO n 
1 173 GLN n 
1 174 THR n 
1 175 HIS n 
1 176 LEU n 
1 177 LYS n 
1 178 ASP n 
1 179 PRO n 
1 180 ASP n 
1 181 MET n 
1 182 VAL n 
1 183 TRP n 
1 184 ASP n 
1 185 PHE n 
1 186 TRP n 
1 187 SER n 
1 188 LEU n 
1 189 ARG n 
1 190 PRO n 
1 191 GLU n 
1 192 SER n 
1 193 LEU n 
1 194 HIS n 
1 195 GLN n 
1 196 VAL n 
1 197 SER n 
1 198 PHE n 
1 199 LEU n 
1 200 PHE n 
1 201 SER n 
1 202 ASP n 
1 203 ARG n 
1 204 GLY n 
1 205 ILE n 
1 206 PRO n 
1 207 ASP n 
1 208 GLY n 
1 209 HIS n 
1 210 ARG n 
1 211 HIS n 
1 212 MET n 
1 213 ASN n 
1 214 GLY n 
1 215 TYR n 
1 216 GLY n 
1 217 SER n 
1 218 HIS n 
1 219 THR n 
1 220 PHE n 
1 221 LYS n 
1 222 LEU n 
1 223 VAL n 
1 224 ASN n 
1 225 ALA n 
1 226 ASN n 
1 227 GLY n 
1 228 GLU n 
1 229 ALA n 
1 230 VAL n 
1 231 TYR n 
1 232 CYS n 
1 233 LYS n 
1 234 PHE n 
1 235 HIS n 
1 236 TYR n 
1 237 LYS n 
1 238 THR n 
1 239 ASP n 
1 240 GLN n 
1 241 GLY n 
1 242 ILE n 
1 243 LYS n 
1 244 ASN n 
1 245 LEU n 
1 246 SER n 
1 247 VAL n 
1 248 GLU n 
1 249 ASP n 
1 250 ALA n 
1 251 ALA n 
1 252 ARG n 
1 253 LEU n 
1 254 SER n 
1 255 GLN n 
1 256 GLU n 
1 257 ASP n 
1 258 PRO n 
1 259 ASP n 
1 260 TYR n 
1 261 GLY n 
1 262 ILE n 
1 263 ARG n 
1 264 ASP n 
1 265 LEU n 
1 266 PHE n 
1 267 ASN n 
1 268 ALA n 
1 269 ILE n 
1 270 ALA n 
1 271 THR n 
1 272 GLY n 
1 273 LYS n 
1 274 TYR n 
1 275 PRO n 
1 276 SER n 
1 277 TRP n 
1 278 THR n 
1 279 PHE n 
1 280 TYR n 
1 281 ILE n 
1 282 GLN n 
1 283 VAL n 
1 284 MET n 
1 285 THR n 
1 286 PHE n 
1 287 ASN n 
1 288 GLN n 
1 289 ALA n 
1 290 GLU n 
1 291 THR n 
1 292 PHE n 
1 293 PRO n 
1 294 PHE n 
1 295 ASN n 
1 296 PRO n 
1 297 PHE n 
1 298 ASP n 
1 299 LEU n 
1 300 THR n 
1 301 LYS n 
1 302 VAL n 
1 303 TRP n 
1 304 PRO n 
1 305 HIS n 
1 306 LYS n 
1 307 ASP n 
1 308 TYR n 
1 309 PRO n 
1 310 LEU n 
1 311 ILE n 
1 312 PRO n 
1 313 VAL n 
1 314 GLY n 
1 315 LYS n 
1 316 LEU n 
1 317 VAL n 
1 318 LEU n 
1 319 ASN n 
1 320 ARG n 
1 321 ASN n 
1 322 PRO n 
1 323 VAL n 
1 324 ASN n 
1 325 TYR n 
1 326 PHE n 
1 327 ALA n 
1 328 GLU n 
1 329 VAL n 
1 330 GLU n 
1 331 GLN n 
1 332 ILE n 
1 333 ALA n 
1 334 PHE n 
1 335 ASP n 
1 336 PRO n 
1 337 SER n 
1 338 ASN n 
1 339 MET n 
1 340 PRO n 
1 341 PRO n 
1 342 GLY n 
1 343 ILE n 
1 344 GLU n 
1 345 ALA n 
1 346 SER n 
1 347 PRO n 
1 348 ASP n 
1 349 LYS n 
1 350 MET n 
1 351 LEU n 
1 352 GLN n 
1 353 GLY n 
1 354 ARG n 
1 355 LEU n 
1 356 PHE n 
1 357 ALA n 
1 358 TYR n 
1 359 PRO n 
1 360 ASP n 
1 361 THR n 
1 362 HIS n 
1 363 ARG n 
1 364 HIS n 
1 365 ARG n 
1 366 LEU n 
1 367 GLY n 
1 368 PRO n 
1 369 ASN n 
1 370 TYR n 
1 371 LEU n 
1 372 HIS n 
1 373 ILE n 
1 374 PRO n 
1 375 VAL n 
1 376 ASN n 
1 377 CYS n 
1 378 PRO n 
1 379 TYR n 
1 380 ARG n 
1 381 ALA n 
1 382 ARG n 
1 383 VAL n 
1 384 ALA n 
1 385 ASN n 
1 386 TYR n 
1 387 GLN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 PRO n 
1 392 MET n 
1 393 CYS n 
1 394 MET n 
1 395 GLN n 
1 396 ASP n 
1 397 ASN n 
1 398 GLN n 
1 399 GLY n 
1 400 GLY n 
1 401 ALA n 
1 402 PRO n 
1 403 ASN n 
1 404 TYR n 
1 405 TYR n 
1 406 PRO n 
1 407 ASN n 
1 408 SER n 
1 409 PHE n 
1 410 GLY n 
1 411 ALA n 
1 412 PRO n 
1 413 GLU n 
1 414 GLN n 
1 415 GLN n 
1 416 PRO n 
1 417 SER n 
1 418 ALA n 
1 419 LEU n 
1 420 GLU n 
1 421 HIS n 
1 422 SER n 
1 423 ILE n 
1 424 GLN n 
1 425 TYR n 
1 426 SER n 
1 427 GLY n 
1 428 GLU n 
1 429 VAL n 
1 430 ARG n 
1 431 ARG n 
1 432 PHE n 
1 433 ASN n 
1 434 THR n 
1 435 ALA n 
1 436 ASN n 
1 437 ASP n 
1 438 ASP n 
1 439 ASN n 
1 440 VAL n 
1 441 THR n 
1 442 GLN n 
1 443 VAL n 
1 444 ARG n 
1 445 ALA n 
1 446 PHE n 
1 447 TYR n 
1 448 VAL n 
1 449 ASN n 
1 450 VAL n 
1 451 LEU n 
1 452 ASN n 
1 453 GLU n 
1 454 GLU n 
1 455 GLN n 
1 456 ARG n 
1 457 LYS n 
1 458 ARG n 
1 459 LEU n 
1 460 CYS n 
1 461 GLU n 
1 462 ASN n 
1 463 ILE n 
1 464 ALA n 
1 465 GLY n 
1 466 HIS n 
1 467 LEU n 
1 468 LYS n 
1 469 ASP n 
1 470 ALA n 
1 471 GLN n 
1 472 ILE n 
1 473 PHE n 
1 474 ILE n 
1 475 GLN n 
1 476 LYS n 
1 477 LYS n 
1 478 ALA n 
1 479 VAL n 
1 480 LYS n 
1 481 ASN n 
1 482 PHE n 
1 483 THR n 
1 484 GLU n 
1 485 VAL n 
1 486 HIS n 
1 487 PRO n 
1 488 ASP n 
1 489 TYR n 
1 490 GLY n 
1 491 SER n 
1 492 HIS n 
1 493 ILE n 
1 494 GLN n 
1 495 ALA n 
1 496 LEU n 
1 497 LEU n 
1 498 ASP n 
1 499 LYS n 
1 500 TYR n 
1 501 ASN n 
1 502 ALA n 
1 503 GLU n 
1 504 LYS n 
1 505 PRO n 
1 506 LYS n 
1 507 ASN n 
1 508 ALA n 
1 509 ILE n 
1 510 HIS n 
1 511 THR n 
1 512 PHE n 
1 513 VAL n 
1 514 GLN n 
1 515 SER n 
1 516 GLY n 
1 517 SER n 
1 518 HIS n 
1 519 LEU n 
1 520 ALA n 
1 521 ALA n 
1 522 ARG n 
1 523 GLU n 
1 524 LYS n 
1 525 ALA n 
1 526 ASN n 
1 527 LEU n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     BLOOD 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ERYTHROCYTE 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    CATA_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04040 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAG
AFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPIL
FPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQ
GIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFYIQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNR
NPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGG
APNYYPNSFGAPEQQPSALEHSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVK
NFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F4J A 1 ? 527 ? P04040 1 ? 527 ? 1 527 
2 1 1F4J B 1 ? 527 ? P04040 1 ? 527 ? 1 527 
3 1 1F4J C 1 ? 527 ? P04040 1 ? 527 ? 1 527 
4 1 1F4J D 1 ? 527 ? P04040 1 ? 527 ? 1 527 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                           ?    'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                          ?    'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                        ?    'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                   ?    'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                          ?    'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                         ?    'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                   ?    'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                           ?    'C2 H5 N O2'       75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE' HEME 'C34 H32 Fe N4 O4' 616.487 
HIS 'L-peptide linking' y HISTIDINE                         ?    'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                             ?    'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                        ?    'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                           ?    'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                            ?    'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                        ?    'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                     ?    'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                           ?    'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                            ?    'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                         ?    'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                        ?    'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                          ?    'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                            ?    'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1F4J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.68 
_exptl_crystal.density_Matthews      3.13 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.temp            298.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;potassium sodium tartrate, HEPES, 
sodium acetate, potassium chloride, 
2-mercaptoethanol, EDTA, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS II' 
_diffrn_detector.pdbx_collection_date   2000-01-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1F4J 
_reflns.observed_criterion_sigma_I   1.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             204.0 
_reflns.d_resolution_high            2.40 
_reflns.number_obs                   107950 
_reflns.number_all                   116954 
_reflns.percent_possible_obs         92.3 
_reflns.pdbx_Rmerge_I_obs            0.0680000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.8 
_reflns.B_iso_Wilson_estimate        41.3 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.4 
_reflns_shell.d_res_low              2.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   76.4 
_reflns_shell.Rmerge_I_obs           0.2490000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2.3 
_reflns_shell.number_unique_all      10206 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1F4J 
_refine.ls_number_reflns_obs                     107871 
_refine.ls_number_reflns_all                     107871 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             204.0 
_refine.ls_d_res_high                            2.40 
_refine.ls_percent_reflns_obs                    93.8 
_refine.ls_R_factor_obs                          0.2000000 
_refine.ls_R_factor_all                          0.2000000 
_refine.ls_R_factor_R_work                       0.1960000 
_refine.ls_R_factor_R_free                       0.2440000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  8677 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;Used noncrystallographic symmetry 
restraints but released in final 
cycles of refinement.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        15402 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         172 
_refine_hist.number_atoms_solvent             1239 
_refine_hist.number_atoms_total               16813 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        204.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg        0.0083 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d           1.45   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.19   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1F4J 
_struct.title                     'STRUCTURE OF TETRAGONAL CRYSTALS OF HUMAN ERYTHROCYTE CATALASE' 
_struct.pdbx_descriptor           'CATALASE (E.C.1.11.1.6)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F4J 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            'heme protein, no bound NADPH, OXIDOREDUCTASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;Tetramer of identical subunits 
A, B, C and D. Assembled with a 
222 point-group symmetry
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 54  ? ASP A 65  ? ASP A 54  ASP A 65  1 ? 12 
HELX_P HELX_P2  2  ALA A 97  ? GLU A 101 ? ALA A 97  GLU A 101 5 ? 5  
HELX_P HELX_P3  3  ASP A 157 ? ILE A 159 ? ASP A 157 ILE A 159 5 ? 3  
HELX_P HELX_P4  4  LEU A 160 ? LYS A 169 ? LEU A 160 LYS A 169 1 ? 10 
HELX_P HELX_P5  5  ASP A 178 ? ARG A 189 ? ASP A 178 ARG A 189 1 ? 12 
HELX_P HELX_P6  6  SER A 192 ? PHE A 200 ? SER A 192 PHE A 200 1 ? 9  
HELX_P HELX_P7  7  SER A 201 ? ILE A 205 ? SER A 201 ILE A 205 5 ? 5  
HELX_P HELX_P8  8  GLY A 208 ? MET A 212 ? GLY A 208 MET A 212 5 ? 5  
HELX_P HELX_P9  9  SER A 246 ? ASP A 257 ? SER A 246 ASP A 257 1 ? 12 
HELX_P HELX_P10 10 ASP A 259 ? THR A 271 ? ASP A 259 THR A 271 1 ? 13 
HELX_P HELX_P11 11 THR A 285 ? PHE A 292 ? THR A 285 PHE A 292 1 ? 8  
HELX_P HELX_P12 12 ASN A 324 ? VAL A 329 ? ASN A 324 VAL A 329 1 ? 6  
HELX_P HELX_P13 13 ASP A 348 ? LEU A 366 ? ASP A 348 LEU A 366 1 ? 19 
HELX_P HELX_P14 14 ASN A 369 ? ILE A 373 ? ASN A 369 ILE A 373 5 ? 5  
HELX_P HELX_P15 15 ILE A 373 ? CYS A 377 ? ILE A 373 CYS A 377 5 ? 5  
HELX_P HELX_P16 16 GLN A 415 ? LEU A 419 ? GLN A 415 LEU A 419 5 ? 5  
HELX_P HELX_P17 17 VAL A 440 ? ASN A 449 ? VAL A 440 ASN A 449 1 ? 10 
HELX_P HELX_P18 18 ASN A 452 ? LYS A 468 ? ASN A 452 LYS A 468 1 ? 17 
HELX_P HELX_P19 19 GLN A 471 ? HIS A 486 ? GLN A 471 HIS A 486 1 ? 16 
HELX_P HELX_P20 20 HIS A 486 ? ALA A 502 ? HIS A 486 ALA A 502 1 ? 17 
HELX_P HELX_P21 21 ASP B 54  ? ASP B 65  ? ASP B 54  ASP B 65  1 ? 12 
HELX_P HELX_P22 22 ALA B 97  ? GLU B 101 ? ALA B 97  GLU B 101 5 ? 5  
HELX_P HELX_P23 23 ASP B 157 ? ILE B 159 ? ASP B 157 ILE B 159 5 ? 3  
HELX_P HELX_P24 24 LEU B 160 ? LYS B 169 ? LEU B 160 LYS B 169 1 ? 10 
HELX_P HELX_P25 25 ASP B 178 ? ARG B 189 ? ASP B 178 ARG B 189 1 ? 12 
HELX_P HELX_P26 26 SER B 192 ? SER B 201 ? SER B 192 SER B 201 1 ? 10 
HELX_P HELX_P27 27 ASP B 202 ? ILE B 205 ? ASP B 202 ILE B 205 5 ? 4  
HELX_P HELX_P28 28 SER B 246 ? ASP B 257 ? SER B 246 ASP B 257 1 ? 12 
HELX_P HELX_P29 29 ASP B 259 ? THR B 271 ? ASP B 259 THR B 271 1 ? 13 
HELX_P HELX_P30 30 THR B 285 ? PHE B 292 ? THR B 285 PHE B 292 1 ? 8  
HELX_P HELX_P31 31 ASN B 324 ? VAL B 329 ? ASN B 324 VAL B 329 1 ? 6  
HELX_P HELX_P32 32 ASP B 348 ? LEU B 366 ? ASP B 348 LEU B 366 1 ? 19 
HELX_P HELX_P33 33 ASN B 369 ? ILE B 373 ? ASN B 369 ILE B 373 5 ? 5  
HELX_P HELX_P34 34 ILE B 373 ? CYS B 377 ? ILE B 373 CYS B 377 5 ? 5  
HELX_P HELX_P35 35 GLN B 415 ? LEU B 419 ? GLN B 415 LEU B 419 5 ? 5  
HELX_P HELX_P36 36 VAL B 440 ? ASN B 449 ? VAL B 440 ASN B 449 1 ? 10 
HELX_P HELX_P37 37 ASN B 452 ? LYS B 468 ? ASN B 452 LYS B 468 1 ? 17 
HELX_P HELX_P38 38 GLN B 471 ? HIS B 486 ? GLN B 471 HIS B 486 1 ? 16 
HELX_P HELX_P39 39 HIS B 486 ? ALA B 502 ? HIS B 486 ALA B 502 1 ? 17 
HELX_P HELX_P40 40 ASP C 54  ? ASP C 65  ? ASP C 54  ASP C 65  1 ? 12 
HELX_P HELX_P41 41 ALA C 97  ? GLU C 101 ? ALA C 97  GLU C 101 5 ? 5  
HELX_P HELX_P42 42 ASP C 157 ? ILE C 159 ? ASP C 157 ILE C 159 5 ? 3  
HELX_P HELX_P43 43 LEU C 160 ? LYS C 169 ? LEU C 160 LYS C 169 1 ? 10 
HELX_P HELX_P44 44 ASP C 178 ? ARG C 189 ? ASP C 178 ARG C 189 1 ? 12 
HELX_P HELX_P45 45 SER C 192 ? PHE C 200 ? SER C 192 PHE C 200 1 ? 9  
HELX_P HELX_P46 46 SER C 201 ? ILE C 205 ? SER C 201 ILE C 205 5 ? 5  
HELX_P HELX_P47 47 GLY C 208 ? MET C 212 ? GLY C 208 MET C 212 5 ? 5  
HELX_P HELX_P48 48 SER C 246 ? ASP C 257 ? SER C 246 ASP C 257 1 ? 12 
HELX_P HELX_P49 49 ASP C 259 ? THR C 271 ? ASP C 259 THR C 271 1 ? 13 
HELX_P HELX_P50 50 THR C 285 ? THR C 291 ? THR C 285 THR C 291 1 ? 7  
HELX_P HELX_P51 51 ASN C 324 ? VAL C 329 ? ASN C 324 VAL C 329 1 ? 6  
HELX_P HELX_P52 52 ASP C 348 ? LEU C 366 ? ASP C 348 LEU C 366 1 ? 19 
HELX_P HELX_P53 53 ASN C 369 ? ILE C 373 ? ASN C 369 ILE C 373 5 ? 5  
HELX_P HELX_P54 54 GLN C 415 ? LEU C 419 ? GLN C 415 LEU C 419 5 ? 5  
HELX_P HELX_P55 55 VAL C 440 ? ASN C 449 ? VAL C 440 ASN C 449 1 ? 10 
HELX_P HELX_P56 56 ASN C 452 ? LYS C 468 ? ASN C 452 LYS C 468 1 ? 17 
HELX_P HELX_P57 57 GLN C 471 ? HIS C 486 ? GLN C 471 HIS C 486 1 ? 16 
HELX_P HELX_P58 58 HIS C 486 ? LYS C 504 ? HIS C 486 LYS C 504 1 ? 19 
HELX_P HELX_P59 59 ASP D 54  ? ASP D 65  ? ASP D 54  ASP D 65  1 ? 12 
HELX_P HELX_P60 60 ASP D 157 ? ILE D 159 ? ASP D 157 ILE D 159 5 ? 3  
HELX_P HELX_P61 61 LEU D 160 ? LYS D 169 ? LEU D 160 LYS D 169 1 ? 10 
HELX_P HELX_P62 62 ASP D 178 ? ARG D 189 ? ASP D 178 ARG D 189 1 ? 12 
HELX_P HELX_P63 63 SER D 192 ? PHE D 200 ? SER D 192 PHE D 200 1 ? 9  
HELX_P HELX_P64 64 SER D 201 ? ILE D 205 ? SER D 201 ILE D 205 5 ? 5  
HELX_P HELX_P65 65 GLY D 208 ? MET D 212 ? GLY D 208 MET D 212 5 ? 5  
HELX_P HELX_P66 66 SER D 246 ? ASP D 257 ? SER D 246 ASP D 257 1 ? 12 
HELX_P HELX_P67 67 ASP D 259 ? THR D 271 ? ASP D 259 THR D 271 1 ? 13 
HELX_P HELX_P68 68 THR D 285 ? PHE D 292 ? THR D 285 PHE D 292 1 ? 8  
HELX_P HELX_P69 69 ASN D 324 ? VAL D 329 ? ASN D 324 VAL D 329 1 ? 6  
HELX_P HELX_P70 70 ASP D 348 ? LEU D 366 ? ASP D 348 LEU D 366 1 ? 19 
HELX_P HELX_P71 71 ASN D 369 ? ILE D 373 ? ASN D 369 ILE D 373 5 ? 5  
HELX_P HELX_P72 72 ILE D 373 ? CYS D 377 ? ILE D 373 CYS D 377 5 ? 5  
HELX_P HELX_P73 73 GLN D 415 ? LEU D 419 ? GLN D 415 LEU D 419 5 ? 5  
HELX_P HELX_P74 74 VAL D 440 ? ASN D 449 ? VAL D 440 ASN D 449 1 ? 10 
HELX_P HELX_P75 75 ASN D 452 ? LYS D 468 ? ASN D 452 LYS D 468 1 ? 17 
HELX_P HELX_P76 76 GLN D 471 ? HIS D 486 ? GLN D 471 HIS D 486 1 ? 16 
HELX_P HELX_P77 77 HIS D 486 ? ASN D 501 ? HIS D 486 ASN D 501 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? E HEM . FE ? ? ? 1_555 A TYR 358 OH ? ? A HEM 600 A TYR 358 1_555 ? ? ? ? ? ? ? 1.932 ? 
metalc2 metalc ? ? F HEM . FE ? ? ? 1_555 B TYR 358 OH ? ? B HEM 600 B TYR 358 1_555 ? ? ? ? ? ? ? 1.927 ? 
metalc3 metalc ? ? G HEM . FE ? ? ? 1_555 C TYR 358 OH ? ? C HEM 600 C TYR 358 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc4 metalc ? ? H HEM . FE ? ? ? 1_555 D TYR 358 OH ? ? D HEM 600 D TYR 358 1_555 ? ? ? ? ? ? ? 1.945 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 405 A . ? TYR 405 A PRO 406 A ? PRO 406 A 1 -0.02 
2 TYR 405 B . ? TYR 405 B PRO 406 B ? PRO 406 B 1 0.04  
3 TYR 405 C . ? TYR 405 C PRO 406 C ? PRO 406 C 1 0.00  
4 TYR 405 D . ? TYR 405 D PRO 406 D ? PRO 406 D 1 -0.09 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 12 ? 
C ? 3  ? 
D ? 3  ? 
E ? 11 ? 
F ? 2  ? 
G ? 11 ? 
H ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
B 9  10 ? anti-parallel 
B 10 11 ? anti-parallel 
B 11 12 ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
D 1  2  ? anti-parallel 
D 2  3  ? anti-parallel 
E 1  2  ? anti-parallel 
E 2  3  ? anti-parallel 
E 3  4  ? anti-parallel 
E 4  5  ? anti-parallel 
E 5  6  ? anti-parallel 
E 6  7  ? anti-parallel 
E 7  8  ? anti-parallel 
E 8  9  ? anti-parallel 
E 9  10 ? anti-parallel 
E 10 11 ? anti-parallel 
F 1  2  ? anti-parallel 
G 1  2  ? anti-parallel 
G 2  3  ? anti-parallel 
G 3  4  ? anti-parallel 
G 4  5  ? anti-parallel 
G 5  6  ? anti-parallel 
G 6  7  ? anti-parallel 
G 7  8  ? anti-parallel 
G 8  9  ? anti-parallel 
G 9  10 ? anti-parallel 
G 10 11 ? anti-parallel 
H 1  2  ? anti-parallel 
H 2  3  ? anti-parallel 
H 3  4  ? anti-parallel 
H 4  5  ? anti-parallel 
H 5  6  ? anti-parallel 
H 6  7  ? anti-parallel 
H 7  8  ? anti-parallel 
H 8  9  ? anti-parallel 
H 9  10 ? anti-parallel 
H 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ILE A 42  ? VAL A 44  ? ILE A 42  VAL A 44  
A 2  GLU D 428 ? ARG D 431 ? GLU D 428 ARG D 431 
A 3  ILE C 423 ? GLN C 424 ? ILE C 423 GLN C 424 
B 1  ILE A 343 ? ALA A 345 ? ILE A 343 ALA A 345 
B 2  PHE A 220 ? VAL A 223 ? PHE A 220 VAL A 223 
B 3  ALA A 229 ? THR A 238 ? ALA A 229 THR A 238 
B 4  SER A 276 ? MET A 284 ? SER A 276 MET A 284 
B 5  ILE A 311 ? ARG A 320 ? ILE A 311 ARG A 320 
B 6  GLY A 78  ? VAL A 87  ? GLY A 78  VAL A 87  
B 7  LYS A 106 ? SER A 114 ? LYS A 106 SER A 114 
B 8  GLY A 131 ? THR A 138 ? GLY A 131 THR A 138 
B 9  GLY A 141 ? ASN A 148 ? GLY A 141 ASN A 148 
B 10 GLY A 214 ? TYR A 215 ? GLY A 214 TYR A 215 
B 11 ALA A 229 ? THR A 238 ? ALA A 229 THR A 238 
B 12 PHE A 220 ? VAL A 223 ? PHE A 220 VAL A 223 
C 1  ILE B 423 ? GLN B 424 ? ILE B 423 GLN B 424 
C 2  GLU A 428 ? ARG A 431 ? GLU A 428 ARG A 431 
C 3  ILE D 42  ? VAL D 44  ? ILE D 42  VAL D 44  
D 1  ILE B 42  ? VAL B 44  ? ILE B 42  VAL B 44  
D 2  GLU C 428 ? ARG C 431 ? GLU C 428 ARG C 431 
D 3  ILE D 423 ? GLN D 424 ? ILE D 423 GLN D 424 
E 1  ILE B 343 ? ALA B 345 ? ILE B 343 ALA B 345 
E 2  PHE B 220 ? VAL B 223 ? PHE B 220 VAL B 223 
E 3  ALA B 229 ? THR B 238 ? ALA B 229 THR B 238 
E 4  SER B 276 ? MET B 284 ? SER B 276 MET B 284 
E 5  ILE B 311 ? ARG B 320 ? ILE B 311 ARG B 320 
E 6  GLY B 78  ? VAL B 87  ? GLY B 78  VAL B 87  
E 7  LYS B 106 ? SER B 114 ? LYS B 106 SER B 114 
E 8  GLY B 131 ? THR B 138 ? GLY B 131 THR B 138 
E 9  GLY B 141 ? ASN B 148 ? GLY B 141 ASN B 148 
E 10 GLY B 214 ? TYR B 215 ? GLY B 214 TYR B 215 
E 11 ALA B 229 ? THR B 238 ? ALA B 229 THR B 238 
F 1  VAL B 429 ? ARG B 431 ? VAL B 429 ARG B 431 
F 2  ILE C 42  ? VAL C 44  ? ILE C 42  VAL C 44  
G 1  ILE C 343 ? ALA C 345 ? ILE C 343 ALA C 345 
G 2  PHE C 220 ? VAL C 223 ? PHE C 220 VAL C 223 
G 3  ALA C 229 ? THR C 238 ? ALA C 229 THR C 238 
G 4  SER C 276 ? MET C 284 ? SER C 276 MET C 284 
G 5  ILE C 311 ? ARG C 320 ? ILE C 311 ARG C 320 
G 6  GLY C 78  ? VAL C 87  ? GLY C 78  VAL C 87  
G 7  LYS C 106 ? SER C 114 ? LYS C 106 SER C 114 
G 8  GLY C 131 ? THR C 138 ? GLY C 131 THR C 138 
G 9  GLY C 141 ? ASN C 148 ? GLY C 141 ASN C 148 
G 10 GLY C 214 ? TYR C 215 ? GLY C 214 TYR C 215 
G 11 ALA C 229 ? THR C 238 ? ALA C 229 THR C 238 
H 1  ILE D 343 ? ALA D 345 ? ILE D 343 ALA D 345 
H 2  PHE D 220 ? VAL D 223 ? PHE D 220 VAL D 223 
H 3  ALA D 229 ? THR D 238 ? ALA D 229 THR D 238 
H 4  SER D 276 ? MET D 284 ? SER D 276 MET D 284 
H 5  ILE D 311 ? ARG D 320 ? ILE D 311 ARG D 320 
H 6  GLY D 78  ? VAL D 87  ? GLY D 78  VAL D 87  
H 7  LYS D 106 ? SER D 114 ? LYS D 106 SER D 114 
H 8  GLY D 131 ? THR D 138 ? GLY D 131 THR D 138 
H 9  GLY D 141 ? ASN D 148 ? GLY D 141 ASN D 148 
H 10 GLY D 214 ? TYR D 215 ? GLY D 214 TYR D 215 
H 11 ALA D 229 ? THR D 238 ? ALA D 229 THR D 238 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O THR A 43  ? O THR A 43  N ARG D 430 ? N ARG D 430 
A 2  3  N VAL D 429 ? N VAL D 429 O ILE C 423 ? O ILE C 423 
B 1  2  N GLU A 344 ? N GLU A 344 O LYS A 221 ? O LYS A 221 
B 2  3  N LEU A 222 ? N LEU A 222 O VAL A 230 ? O VAL A 230 
B 3  4  O LYS A 237 ? O LYS A 237 N THR A 278 ? N THR A 278 
B 4  5  O ILE A 281 ? O ILE A 281 N ILE A 311 ? N ILE A 311 
B 5  6  O ARG A 320 ? O ARG A 320 N PHE A 82  ? N PHE A 82  
B 6  7  N PHE A 85  ? N PHE A 85  O THR A 107 ? O THR A 107 
B 7  8  O SER A 114 ? O SER A 114 N GLY A 131 ? N GLY A 131 
B 8  9  O THR A 138 ? O THR A 138 N GLY A 141 ? N GLY A 141 
B 9  10 O ASN A 148 ? O ASN A 148 N TYR A 215 ? N TYR A 215 
B 10 11 O GLY A 214 ? O GLY A 214 N TYR A 236 ? N TYR A 236 
B 11 12 O CYS A 232 ? O CYS A 232 N PHE A 220 ? N PHE A 220 
C 1  2  O ILE B 423 ? O ILE B 423 N VAL A 429 ? N VAL A 429 
C 2  3  O ARG A 430 ? O ARG A 430 N THR D 43  ? N THR D 43  
D 1  2  N THR B 43  ? N THR B 43  O ARG C 430 ? O ARG C 430 
D 2  3  N VAL C 429 ? N VAL C 429 O ILE D 423 ? O ILE D 423 
E 1  2  O GLU B 344 ? O GLU B 344 N LYS B 221 ? N LYS B 221 
E 2  3  N LEU B 222 ? N LEU B 222 O VAL B 230 ? O VAL B 230 
E 3  4  O LYS B 237 ? O LYS B 237 N THR B 278 ? N THR B 278 
E 4  5  O ILE B 281 ? O ILE B 281 N ILE B 311 ? N ILE B 311 
E 5  6  O ARG B 320 ? O ARG B 320 N PHE B 82  ? N PHE B 82  
E 6  7  N PHE B 85  ? N PHE B 85  O THR B 107 ? O THR B 107 
E 7  8  O SER B 114 ? O SER B 114 N GLY B 131 ? N GLY B 131 
E 8  9  O THR B 138 ? O THR B 138 N GLY B 141 ? N GLY B 141 
E 9  10 O ASN B 148 ? O ASN B 148 N TYR B 215 ? N TYR B 215 
E 10 11 N GLY B 214 ? N GLY B 214 O TYR B 236 ? O TYR B 236 
F 1  2  O ARG B 430 ? O ARG B 430 N THR C 43  ? N THR C 43  
G 1  2  O GLU C 344 ? O GLU C 344 N LYS C 221 ? N LYS C 221 
G 2  3  N LEU C 222 ? N LEU C 222 O VAL C 230 ? O VAL C 230 
G 3  4  O LYS C 237 ? O LYS C 237 N THR C 278 ? N THR C 278 
G 4  5  O ILE C 281 ? O ILE C 281 N ILE C 311 ? N ILE C 311 
G 5  6  O ARG C 320 ? O ARG C 320 N PHE C 82  ? N PHE C 82  
G 6  7  O PHE C 85  ? O PHE C 85  N THR C 107 ? N THR C 107 
G 7  8  O SER C 114 ? O SER C 114 N GLY C 131 ? N GLY C 131 
G 8  9  O THR C 138 ? O THR C 138 N GLY C 141 ? N GLY C 141 
G 9  10 O ASN C 148 ? O ASN C 148 N TYR C 215 ? N TYR C 215 
G 10 11 O GLY C 214 ? O GLY C 214 N TYR C 236 ? N TYR C 236 
H 1  2  N GLU D 344 ? N GLU D 344 O LYS D 221 ? O LYS D 221 
H 2  3  N LEU D 222 ? N LEU D 222 O VAL D 230 ? O VAL D 230 
H 3  4  O LYS D 237 ? O LYS D 237 N THR D 278 ? N THR D 278 
H 4  5  O ILE D 281 ? O ILE D 281 N ILE D 311 ? N ILE D 311 
H 5  6  O ARG D 320 ? O ARG D 320 N PHE D 82  ? N PHE D 82  
H 6  7  O PHE D 85  ? O PHE D 85  N THR D 107 ? N THR D 107 
H 7  8  O SER D 114 ? O SER D 114 N GLY D 131 ? N GLY D 131 
H 8  9  O THR D 138 ? O THR D 138 N GLY D 141 ? N GLY D 141 
H 9  10 O ASN D 148 ? O ASN D 148 N TYR D 215 ? N TYR D 215 
H 10 11 O GLY D 214 ? O GLY D 214 N TYR D 236 ? N TYR D 236 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM A 600' 
AC2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE HEM B 600' 
AC3 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM C 600' 
AC4 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE HEM D 600' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ARG A 72  ? ARG A 72  . ? 1_555 ? 
2  AC1 21 VAL A 73  ? VAL A 73  . ? 1_555 ? 
3  AC1 21 VAL A 74  ? VAL A 74  . ? 1_555 ? 
4  AC1 21 HIS A 75  ? HIS A 75  . ? 1_555 ? 
5  AC1 21 ARG A 112 ? ARG A 112 . ? 1_555 ? 
6  AC1 21 GLY A 131 ? GLY A 131 . ? 1_555 ? 
7  AC1 21 VAL A 146 ? VAL A 146 . ? 1_555 ? 
8  AC1 21 ASN A 148 ? ASN A 148 . ? 1_555 ? 
9  AC1 21 PRO A 158 ? PRO A 158 . ? 1_555 ? 
10 AC1 21 PHE A 161 ? PHE A 161 . ? 1_555 ? 
11 AC1 21 SER A 217 ? SER A 217 . ? 1_555 ? 
12 AC1 21 PHE A 334 ? PHE A 334 . ? 1_555 ? 
13 AC1 21 MET A 350 ? MET A 350 . ? 1_555 ? 
14 AC1 21 ARG A 354 ? ARG A 354 . ? 1_555 ? 
15 AC1 21 TYR A 358 ? TYR A 358 . ? 1_555 ? 
16 AC1 21 THR A 361 ? THR A 361 . ? 1_555 ? 
17 AC1 21 HIS A 362 ? HIS A 362 . ? 1_555 ? 
18 AC1 21 ARG A 365 ? ARG A 365 . ? 1_555 ? 
19 AC1 21 HOH I .   ? HOH A 638 . ? 1_555 ? 
20 AC1 21 MET D 61  ? MET D 61  . ? 1_555 ? 
21 AC1 21 ASP D 65  ? ASP D 65  . ? 1_555 ? 
22 AC2 24 ARG B 72  ? ARG B 72  . ? 1_555 ? 
23 AC2 24 VAL B 73  ? VAL B 73  . ? 1_555 ? 
24 AC2 24 VAL B 74  ? VAL B 74  . ? 1_555 ? 
25 AC2 24 HIS B 75  ? HIS B 75  . ? 1_555 ? 
26 AC2 24 ARG B 112 ? ARG B 112 . ? 1_555 ? 
27 AC2 24 GLY B 131 ? GLY B 131 . ? 1_555 ? 
28 AC2 24 VAL B 146 ? VAL B 146 . ? 1_555 ? 
29 AC2 24 GLY B 147 ? GLY B 147 . ? 1_555 ? 
30 AC2 24 ASN B 148 ? ASN B 148 . ? 1_555 ? 
31 AC2 24 PHE B 153 ? PHE B 153 . ? 1_555 ? 
32 AC2 24 PRO B 158 ? PRO B 158 . ? 1_555 ? 
33 AC2 24 PHE B 161 ? PHE B 161 . ? 1_555 ? 
34 AC2 24 SER B 217 ? SER B 217 . ? 1_555 ? 
35 AC2 24 PHE B 334 ? PHE B 334 . ? 1_555 ? 
36 AC2 24 MET B 350 ? MET B 350 . ? 1_555 ? 
37 AC2 24 ARG B 354 ? ARG B 354 . ? 1_555 ? 
38 AC2 24 TYR B 358 ? TYR B 358 . ? 1_555 ? 
39 AC2 24 THR B 361 ? THR B 361 . ? 1_555 ? 
40 AC2 24 HIS B 362 ? HIS B 362 . ? 1_555 ? 
41 AC2 24 ARG B 365 ? ARG B 365 . ? 1_555 ? 
42 AC2 24 HOH J .   ? HOH B 633 . ? 1_555 ? 
43 AC2 24 HOH J .   ? HOH B 653 . ? 1_555 ? 
44 AC2 24 HOH J .   ? HOH B 654 . ? 1_555 ? 
45 AC2 24 ASP C 65  ? ASP C 65  . ? 1_555 ? 
46 AC3 21 ASP B 65  ? ASP B 65  . ? 1_555 ? 
47 AC3 21 ARG C 72  ? ARG C 72  . ? 1_555 ? 
48 AC3 21 VAL C 73  ? VAL C 73  . ? 1_555 ? 
49 AC3 21 VAL C 74  ? VAL C 74  . ? 1_555 ? 
50 AC3 21 HIS C 75  ? HIS C 75  . ? 1_555 ? 
51 AC3 21 ARG C 112 ? ARG C 112 . ? 1_555 ? 
52 AC3 21 GLY C 131 ? GLY C 131 . ? 1_555 ? 
53 AC3 21 VAL C 146 ? VAL C 146 . ? 1_555 ? 
54 AC3 21 GLY C 147 ? GLY C 147 . ? 1_555 ? 
55 AC3 21 ASN C 148 ? ASN C 148 . ? 1_555 ? 
56 AC3 21 PHE C 161 ? PHE C 161 . ? 1_555 ? 
57 AC3 21 PHE C 334 ? PHE C 334 . ? 1_555 ? 
58 AC3 21 MET C 350 ? MET C 350 . ? 1_555 ? 
59 AC3 21 ARG C 354 ? ARG C 354 . ? 1_555 ? 
60 AC3 21 ALA C 357 ? ALA C 357 . ? 1_555 ? 
61 AC3 21 TYR C 358 ? TYR C 358 . ? 1_555 ? 
62 AC3 21 THR C 361 ? THR C 361 . ? 1_555 ? 
63 AC3 21 HIS C 362 ? HIS C 362 . ? 1_555 ? 
64 AC3 21 ARG C 365 ? ARG C 365 . ? 1_555 ? 
65 AC3 21 HOH K .   ? HOH C 717 . ? 1_555 ? 
66 AC3 21 HOH K .   ? HOH C 722 . ? 1_555 ? 
67 AC4 19 MET A 61  ? MET A 61  . ? 1_555 ? 
68 AC4 19 ASP A 65  ? ASP A 65  . ? 1_555 ? 
69 AC4 19 ARG D 72  ? ARG D 72  . ? 1_555 ? 
70 AC4 19 VAL D 74  ? VAL D 74  . ? 1_555 ? 
71 AC4 19 HIS D 75  ? HIS D 75  . ? 1_555 ? 
72 AC4 19 ARG D 112 ? ARG D 112 . ? 1_555 ? 
73 AC4 19 GLY D 131 ? GLY D 131 . ? 1_555 ? 
74 AC4 19 VAL D 146 ? VAL D 146 . ? 1_555 ? 
75 AC4 19 GLY D 147 ? GLY D 147 . ? 1_555 ? 
76 AC4 19 ASN D 148 ? ASN D 148 . ? 1_555 ? 
77 AC4 19 PHE D 161 ? PHE D 161 . ? 1_555 ? 
78 AC4 19 PHE D 334 ? PHE D 334 . ? 1_555 ? 
79 AC4 19 MET D 350 ? MET D 350 . ? 1_555 ? 
80 AC4 19 ARG D 354 ? ARG D 354 . ? 1_555 ? 
81 AC4 19 TYR D 358 ? TYR D 358 . ? 1_555 ? 
82 AC4 19 THR D 361 ? THR D 361 . ? 1_555 ? 
83 AC4 19 HIS D 362 ? HIS D 362 . ? 1_555 ? 
84 AC4 19 ARG D 365 ? ARG D 365 . ? 1_555 ? 
85 AC4 19 HOH L .   ? HOH D 646 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F4J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F4J 
_atom_sites.fract_transf_matrix[1][1]   0.004912 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004912 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006916 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . ALA A 1 24  ? 12.745 96.098  28.158  1.00 52.56 ? 24  ALA A N   1 
ATOM   2     C  CA  . ALA A 1 24  ? 14.211 96.378  28.302  1.00 52.27 ? 24  ALA A CA  1 
ATOM   3     C  C   . ALA A 1 24  ? 14.686 96.248  29.751  1.00 52.09 ? 24  ALA A C   1 
ATOM   4     O  O   . ALA A 1 24  ? 13.883 96.087  30.684  1.00 52.12 ? 24  ALA A O   1 
ATOM   5     C  CB  . ALA A 1 24  ? 14.544 97.777  27.772  1.00 51.81 ? 24  ALA A CB  1 
ATOM   6     N  N   . ASP A 1 25  ? 16.000 96.320  29.932  1.00 51.34 ? 25  ASP A N   1 
ATOM   7     C  CA  . ASP A 1 25  ? 16.579 96.203  31.257  1.00 50.18 ? 25  ASP A CA  1 
ATOM   8     C  C   . ASP A 1 25  ? 16.778 97.566  31.910  1.00 48.43 ? 25  ASP A C   1 
ATOM   9     O  O   . ASP A 1 25  ? 17.151 98.542  31.251  1.00 48.62 ? 25  ASP A O   1 
ATOM   10    C  CB  . ASP A 1 25  ? 17.912 95.473  31.178  1.00 52.18 ? 25  ASP A CB  1 
ATOM   11    C  CG  . ASP A 1 25  ? 18.079 94.463  32.290  1.00 54.12 ? 25  ASP A CG  1 
ATOM   12    O  OD1 . ASP A 1 25  ? 17.755 94.799  33.455  1.00 55.87 ? 25  ASP A OD1 1 
ATOM   13    O  OD2 . ASP A 1 25  ? 18.538 93.336  31.999  1.00 55.49 ? 25  ASP A OD2 1 
ATOM   14    N  N   . VAL A 1 26  ? 16.518 97.627  33.210  1.00 45.61 ? 26  VAL A N   1 
ATOM   15    C  CA  . VAL A 1 26  ? 16.671 98.865  33.957  1.00 43.36 ? 26  VAL A CA  1 
ATOM   16    C  C   . VAL A 1 26  ? 18.115 99.335  33.892  1.00 42.13 ? 26  VAL A C   1 
ATOM   17    O  O   . VAL A 1 26  ? 19.038 98.559  34.105  1.00 42.88 ? 26  VAL A O   1 
ATOM   18    C  CB  . VAL A 1 26  ? 16.273 98.671  35.439  1.00 42.83 ? 26  VAL A CB  1 
ATOM   19    C  CG1 . VAL A 1 26  ? 16.732 99.851  36.268  1.00 41.52 ? 26  VAL A CG1 1 
ATOM   20    C  CG2 . VAL A 1 26  ? 14.775 98.496  35.546  1.00 41.49 ? 26  VAL A CG2 1 
ATOM   21    N  N   . LEU A 1 27  ? 18.297 100.611 33.591  1.00 40.75 ? 27  LEU A N   1 
ATOM   22    C  CA  . LEU A 1 27  ? 19.619 101.211 33.503  1.00 39.36 ? 27  LEU A CA  1 
ATOM   23    C  C   . LEU A 1 27  ? 20.104 101.536 34.914  1.00 38.70 ? 27  LEU A C   1 
ATOM   24    O  O   . LEU A 1 27  ? 19.406 102.202 35.682  1.00 38.26 ? 27  LEU A O   1 
ATOM   25    C  CB  . LEU A 1 27  ? 19.538 102.482 32.651  1.00 38.91 ? 27  LEU A CB  1 
ATOM   26    C  CG  . LEU A 1 27  ? 20.757 103.378 32.415  1.00 38.95 ? 27  LEU A CG  1 
ATOM   27    C  CD1 . LEU A 1 27  ? 21.936 102.575 31.899  1.00 37.91 ? 27  LEU A CD1 1 
ATOM   28    C  CD2 . LEU A 1 27  ? 20.370 104.463 31.406  1.00 38.91 ? 27  LEU A CD2 1 
ATOM   29    N  N   . THR A 1 28  ? 21.289 101.049 35.268  1.00 38.14 ? 28  THR A N   1 
ATOM   30    C  CA  . THR A 1 28  ? 21.828 101.313 36.601  1.00 38.16 ? 28  THR A CA  1 
ATOM   31    C  C   . THR A 1 28  ? 23.174 102.013 36.609  1.00 37.20 ? 28  THR A C   1 
ATOM   32    O  O   . THR A 1 28  ? 23.793 102.263 35.571  1.00 36.99 ? 28  THR A O   1 
ATOM   33    C  CB  . THR A 1 28  ? 22.043 100.007 37.442  1.00 38.96 ? 28  THR A CB  1 
ATOM   34    O  OG1 . THR A 1 28  ? 22.900 99.101  36.726  1.00 39.70 ? 28  THR A OG1 1 
ATOM   35    C  CG2 . THR A 1 28  ? 20.723 99.330  37.757  1.00 38.96 ? 28  THR A CG2 1 
ATOM   36    N  N   . THR A 1 29  ? 23.607 102.339 37.817  1.00 36.11 ? 29  THR A N   1 
ATOM   37    C  CA  . THR A 1 29  ? 24.917 102.908 38.009  1.00 35.09 ? 29  THR A CA  1 
ATOM   38    C  C   . THR A 1 29  ? 25.720 101.612 38.155  1.00 35.35 ? 29  THR A C   1 
ATOM   39    O  O   . THR A 1 29  ? 25.139 100.516 38.161  1.00 35.96 ? 29  THR A O   1 
ATOM   40    C  CB  . THR A 1 29  ? 24.996 103.723 39.312  1.00 34.13 ? 29  THR A CB  1 
ATOM   41    O  OG1 . THR A 1 29  ? 24.549 102.922 40.407  1.00 33.82 ? 29  THR A OG1 1 
ATOM   42    C  CG2 . THR A 1 29  ? 24.144 104.963 39.216  1.00 33.01 ? 29  THR A CG2 1 
ATOM   43    N  N   . GLY A 1 30  ? 27.037 101.714 38.261  1.00 35.21 ? 30  GLY A N   1 
ATOM   44    C  CA  . GLY A 1 30  ? 27.841 100.518 38.410  1.00 35.07 ? 30  GLY A CA  1 
ATOM   45    C  C   . GLY A 1 30  ? 27.520 99.736  39.675  1.00 34.99 ? 30  GLY A C   1 
ATOM   46    O  O   . GLY A 1 30  ? 27.700 98.518  39.725  1.00 35.60 ? 30  GLY A O   1 
ATOM   47    N  N   . ALA A 1 31  ? 27.035 100.431 40.695  1.00 34.57 ? 31  ALA A N   1 
ATOM   48    C  CA  . ALA A 1 31  ? 26.715 99.801  41.962  1.00 34.36 ? 31  ALA A CA  1 
ATOM   49    C  C   . ALA A 1 31  ? 25.367 99.092  41.950  1.00 34.89 ? 31  ALA A C   1 
ATOM   50    O  O   . ALA A 1 31  ? 24.945 98.519  42.963  1.00 35.28 ? 31  ALA A O   1 
ATOM   51    C  CB  . ALA A 1 31  ? 26.755 100.843 43.067  1.00 34.59 ? 31  ALA A CB  1 
ATOM   52    N  N   . GLY A 1 32  ? 24.678 99.141  40.814  1.00 35.09 ? 32  GLY A N   1 
ATOM   53    C  CA  . GLY A 1 32  ? 23.395 98.465  40.712  1.00 34.97 ? 32  GLY A CA  1 
ATOM   54    C  C   . GLY A 1 32  ? 22.194 99.303  41.089  1.00 35.34 ? 32  GLY A C   1 
ATOM   55    O  O   . GLY A 1 32  ? 21.085 98.791  41.263  1.00 34.89 ? 32  GLY A O   1 
ATOM   56    N  N   . ASN A 1 33  ? 22.412 100.603 41.220  1.00 36.15 ? 33  ASN A N   1 
ATOM   57    C  CA  . ASN A 1 33  ? 21.336 101.517 41.566  1.00 36.74 ? 33  ASN A CA  1 
ATOM   58    C  C   . ASN A 1 33  ? 20.634 101.978 40.276  1.00 37.04 ? 33  ASN A C   1 
ATOM   59    O  O   . ASN A 1 33  ? 21.293 102.394 39.315  1.00 36.54 ? 33  ASN A O   1 
ATOM   60    C  CB  . ASN A 1 33  ? 21.911 102.717 42.322  1.00 37.60 ? 33  ASN A CB  1 
ATOM   61    C  CG  . ASN A 1 33  ? 22.618 102.317 43.611  1.00 38.20 ? 33  ASN A CG  1 
ATOM   62    O  OD1 . ASN A 1 33  ? 23.487 103.042 44.100  1.00 38.81 ? 33  ASN A OD1 1 
ATOM   63    N  ND2 . ASN A 1 33  ? 22.240 101.172 44.173  1.00 37.76 ? 33  ASN A ND2 1 
ATOM   64    N  N   . PRO A 1 34  ? 19.285 101.908 40.243  1.00 37.24 ? 34  PRO A N   1 
ATOM   65    C  CA  . PRO A 1 34  ? 18.472 102.309 39.081  1.00 36.83 ? 34  PRO A CA  1 
ATOM   66    C  C   . PRO A 1 34  ? 18.631 103.777 38.729  1.00 36.81 ? 34  PRO A C   1 
ATOM   67    O  O   . PRO A 1 34  ? 18.602 104.644 39.607  1.00 36.59 ? 34  PRO A O   1 
ATOM   68    C  CB  . PRO A 1 34  ? 17.045 101.997 39.526  1.00 36.13 ? 34  PRO A CB  1 
ATOM   69    C  CG  . PRO A 1 34  ? 17.231 100.921 40.552  1.00 36.48 ? 34  PRO A CG  1 
ATOM   70    C  CD  . PRO A 1 34  ? 18.422 101.398 41.321  1.00 36.41 ? 34  PRO A CD  1 
ATOM   71    N  N   . VAL A 1 35  ? 18.796 104.058 37.444  1.00 36.96 ? 35  VAL A N   1 
ATOM   72    C  CA  . VAL A 1 35  ? 18.945 105.442 36.997  1.00 37.11 ? 35  VAL A CA  1 
ATOM   73    C  C   . VAL A 1 35  ? 17.614 105.973 36.470  1.00 37.38 ? 35  VAL A C   1 
ATOM   74    O  O   . VAL A 1 35  ? 17.024 105.393 35.553  1.00 37.00 ? 35  VAL A O   1 
ATOM   75    C  CB  . VAL A 1 35  ? 20.041 105.558 35.910  1.00 36.95 ? 35  VAL A CB  1 
ATOM   76    C  CG1 . VAL A 1 35  ? 19.976 106.907 35.225  1.00 36.33 ? 35  VAL A CG1 1 
ATOM   77    C  CG2 . VAL A 1 35  ? 21.419 105.365 36.557  1.00 36.19 ? 35  VAL A CG2 1 
ATOM   78    N  N   . GLY A 1 36  ? 17.144 107.070 37.067  1.00 37.53 ? 36  GLY A N   1 
ATOM   79    C  CA  . GLY A 1 36  ? 15.881 107.661 36.664  1.00 37.40 ? 36  GLY A CA  1 
ATOM   80    C  C   . GLY A 1 36  ? 15.952 108.429 35.353  1.00 37.83 ? 36  GLY A C   1 
ATOM   81    O  O   . GLY A 1 36  ? 15.040 108.366 34.513  1.00 38.03 ? 36  GLY A O   1 
ATOM   82    N  N   . ASP A 1 37  ? 17.041 109.160 35.169  1.00 37.28 ? 37  ASP A N   1 
ATOM   83    C  CA  . ASP A 1 37  ? 17.227 109.957 33.966  1.00 36.98 ? 37  ASP A CA  1 
ATOM   84    C  C   . ASP A 1 37  ? 18.721 110.073 33.736  1.00 36.82 ? 37  ASP A C   1 
ATOM   85    O  O   . ASP A 1 37  ? 19.427 110.704 34.524  1.00 36.65 ? 37  ASP A O   1 
ATOM   86    C  CB  . ASP A 1 37  ? 16.612 111.346 34.177  1.00 37.82 ? 37  ASP A CB  1 
ATOM   87    C  CG  . ASP A 1 37  ? 16.756 112.259 32.968  1.00 39.10 ? 37  ASP A CG  1 
ATOM   88    O  OD1 . ASP A 1 37  ? 16.269 113.407 33.061  1.00 39.54 ? 37  ASP A OD1 1 
ATOM   89    O  OD2 . ASP A 1 37  ? 17.343 111.849 31.938  1.00 39.66 ? 37  ASP A OD2 1 
ATOM   90    N  N   . LYS A 1 38  ? 19.212 109.443 32.676  1.00 36.36 ? 38  LYS A N   1 
ATOM   91    C  CA  . LYS A 1 38  ? 20.631 109.516 32.378  1.00 35.87 ? 38  LYS A CA  1 
ATOM   92    C  C   . LYS A 1 38  ? 20.857 110.336 31.107  1.00 35.95 ? 38  LYS A C   1 
ATOM   93    O  O   . LYS A 1 38  ? 21.767 110.054 30.327  1.00 35.77 ? 38  LYS A O   1 
ATOM   94    C  CB  . LYS A 1 38  ? 21.213 108.111 32.209  1.00 35.72 ? 38  LYS A CB  1 
ATOM   95    C  CG  . LYS A 1 38  ? 22.670 108.013 32.648  1.00 34.79 ? 38  LYS A CG  1 
ATOM   96    C  CD  . LYS A 1 38  ? 23.397 106.905 31.927  1.00 34.26 ? 38  LYS A CD  1 
ATOM   97    C  CE  . LYS A 1 38  ? 23.484 107.205 30.444  1.00 33.96 ? 38  LYS A CE  1 
ATOM   98    N  NZ  . LYS A 1 38  ? 24.135 108.512 30.192  1.00 33.96 ? 38  LYS A NZ  1 
ATOM   99    N  N   . LEU A 1 39  ? 20.024 111.352 30.903  1.00 35.75 ? 39  LEU A N   1 
ATOM   100   C  CA  . LEU A 1 39  ? 20.137 112.200 29.719  1.00 35.63 ? 39  LEU A CA  1 
ATOM   101   C  C   . LEU A 1 39  ? 20.220 113.682 30.072  1.00 35.06 ? 39  LEU A C   1 
ATOM   102   O  O   . LEU A 1 39  ? 20.399 114.533 29.196  1.00 34.28 ? 39  LEU A O   1 
ATOM   103   C  CB  . LEU A 1 39  ? 18.940 111.978 28.800  1.00 35.40 ? 39  LEU A CB  1 
ATOM   104   C  CG  . LEU A 1 39  ? 18.819 110.630 28.100  1.00 35.27 ? 39  LEU A CG  1 
ATOM   105   C  CD1 . LEU A 1 39  ? 17.484 110.556 27.383  1.00 35.00 ? 39  LEU A CD1 1 
ATOM   106   C  CD2 . LEU A 1 39  ? 19.958 110.468 27.121  1.00 35.26 ? 39  LEU A CD2 1 
ATOM   107   N  N   . ASN A 1 40  ? 20.083 113.972 31.360  1.00 34.16 ? 40  ASN A N   1 
ATOM   108   C  CA  . ASN A 1 40  ? 20.118 115.334 31.863  1.00 33.27 ? 40  ASN A CA  1 
ATOM   109   C  C   . ASN A 1 40  ? 20.785 115.288 33.216  1.00 32.98 ? 40  ASN A C   1 
ATOM   110   O  O   . ASN A 1 40  ? 20.459 114.449 34.054  1.00 33.47 ? 40  ASN A O   1 
ATOM   111   C  CB  . ASN A 1 40  ? 18.694 115.881 31.984  1.00 32.75 ? 40  ASN A CB  1 
ATOM   112   C  CG  . ASN A 1 40  ? 17.984 115.934 30.647  1.00 32.76 ? 40  ASN A CG  1 
ATOM   113   O  OD1 . ASN A 1 40  ? 18.342 116.732 29.784  1.00 33.27 ? 40  ASN A OD1 1 
ATOM   114   N  ND2 . ASN A 1 40  ? 16.989 115.071 30.458  1.00 31.13 ? 40  ASN A ND2 1 
ATOM   115   N  N   . VAL A 1 41  ? 21.714 116.205 33.423  1.00 32.37 ? 41  VAL A N   1 
ATOM   116   C  CA  . VAL A 1 41  ? 22.477 116.269 34.650  1.00 31.85 ? 41  VAL A CA  1 
ATOM   117   C  C   . VAL A 1 41  ? 21.765 117.149 35.680  1.00 31.73 ? 41  VAL A C   1 
ATOM   118   O  O   . VAL A 1 41  ? 20.993 118.032 35.314  1.00 32.68 ? 41  VAL A O   1 
ATOM   119   C  CB  . VAL A 1 41  ? 23.893 116.794 34.307  1.00 31.98 ? 41  VAL A CB  1 
ATOM   120   C  CG1 . VAL A 1 41  ? 23.961 118.287 34.474  1.00 31.92 ? 41  VAL A CG1 1 
ATOM   121   C  CG2 . VAL A 1 41  ? 24.925 116.072 35.112  1.00 32.30 ? 41  VAL A CG2 1 
ATOM   122   N  N   . ILE A 1 42  ? 22.013 116.897 36.966  1.00 31.49 ? 42  ILE A N   1 
ATOM   123   C  CA  . ILE A 1 42  ? 21.388 117.650 38.055  1.00 30.31 ? 42  ILE A CA  1 
ATOM   124   C  C   . ILE A 1 42  ? 22.023 119.013 38.199  1.00 31.02 ? 42  ILE A C   1 
ATOM   125   O  O   . ILE A 1 42  ? 23.223 119.118 38.462  1.00 31.25 ? 42  ILE A O   1 
ATOM   126   C  CB  . ILE A 1 42  ? 21.539 116.927 39.394  1.00 30.45 ? 42  ILE A CB  1 
ATOM   127   C  CG1 . ILE A 1 42  ? 20.905 115.541 39.310  1.00 30.57 ? 42  ILE A CG1 1 
ATOM   128   C  CG2 . ILE A 1 42  ? 20.899 117.748 40.503  1.00 29.19 ? 42  ILE A CG2 1 
ATOM   129   C  CD1 . ILE A 1 42  ? 21.146 114.680 40.531  1.00 31.16 ? 42  ILE A CD1 1 
ATOM   130   N  N   . THR A 1 43  ? 21.215 120.060 38.049  1.00 31.79 ? 43  THR A N   1 
ATOM   131   C  CA  . THR A 1 43  ? 21.705 121.435 38.141  1.00 32.33 ? 43  THR A CA  1 
ATOM   132   C  C   . THR A 1 43  ? 20.812 122.250 39.052  1.00 33.23 ? 43  THR A C   1 
ATOM   133   O  O   . THR A 1 43  ? 19.665 121.883 39.290  1.00 34.44 ? 43  THR A O   1 
ATOM   134   C  CB  . THR A 1 43  ? 21.689 122.122 36.769  1.00 31.92 ? 43  THR A CB  1 
ATOM   135   O  OG1 . THR A 1 43  ? 20.331 122.295 36.350  1.00 31.85 ? 43  THR A OG1 1 
ATOM   136   C  CG2 . THR A 1 43  ? 22.422 121.274 35.732  1.00 31.74 ? 43  THR A CG2 1 
ATOM   137   N  N   . VAL A 1 44  ? 21.337 123.357 39.564  1.00 34.25 ? 44  VAL A N   1 
ATOM   138   C  CA  . VAL A 1 44  ? 20.547 124.232 40.425  1.00 35.04 ? 44  VAL A CA  1 
ATOM   139   C  C   . VAL A 1 44  ? 19.720 125.154 39.514  1.00 34.80 ? 44  VAL A C   1 
ATOM   140   O  O   . VAL A 1 44  ? 20.183 126.204 39.053  1.00 33.14 ? 44  VAL A O   1 
ATOM   141   C  CB  . VAL A 1 44  ? 21.466 125.033 41.410  1.00 36.00 ? 44  VAL A CB  1 
ATOM   142   C  CG1 . VAL A 1 44  ? 22.845 125.220 40.807  1.00 37.04 ? 44  VAL A CG1 1 
ATOM   143   C  CG2 . VAL A 1 44  ? 20.847 126.374 41.757  1.00 36.13 ? 44  VAL A CG2 1 
ATOM   144   N  N   . GLY A 1 45  ? 18.489 124.724 39.247  1.00 34.80 ? 45  GLY A N   1 
ATOM   145   C  CA  . GLY A 1 45  ? 17.620 125.482 38.370  1.00 35.83 ? 45  GLY A CA  1 
ATOM   146   C  C   . GLY A 1 45  ? 17.952 125.165 36.916  1.00 35.90 ? 45  GLY A C   1 
ATOM   147   O  O   . GLY A 1 45  ? 19.050 124.674 36.624  1.00 35.87 ? 45  GLY A O   1 
ATOM   148   N  N   . PRO A 1 46  ? 17.038 125.451 35.973  1.00 35.75 ? 46  PRO A N   1 
ATOM   149   C  CA  . PRO A 1 46  ? 17.309 125.158 34.563  1.00 35.36 ? 46  PRO A CA  1 
ATOM   150   C  C   . PRO A 1 46  ? 18.574 125.819 34.016  1.00 35.04 ? 46  PRO A C   1 
ATOM   151   O  O   . PRO A 1 46  ? 19.221 125.281 33.127  1.00 35.50 ? 46  PRO A O   1 
ATOM   152   C  CB  . PRO A 1 46  ? 16.032 125.626 33.864  1.00 35.58 ? 46  PRO A CB  1 
ATOM   153   C  CG  . PRO A 1 46  ? 15.593 126.778 34.717  1.00 35.96 ? 46  PRO A CG  1 
ATOM   154   C  CD  . PRO A 1 46  ? 15.802 126.243 36.120  1.00 35.62 ? 46  PRO A CD  1 
ATOM   155   N  N   . ARG A 1 47  ? 18.944 126.972 34.551  1.00 35.26 ? 47  ARG A N   1 
ATOM   156   C  CA  . ARG A 1 47  ? 20.140 127.643 34.061  1.00 35.67 ? 47  ARG A CA  1 
ATOM   157   C  C   . ARG A 1 47  ? 21.248 127.757 35.105  1.00 35.62 ? 47  ARG A C   1 
ATOM   158   O  O   . ARG A 1 47  ? 22.075 128.673 35.043  1.00 36.63 ? 47  ARG A O   1 
ATOM   159   C  CB  . ARG A 1 47  ? 19.788 129.042 33.532  1.00 35.97 ? 47  ARG A CB  1 
ATOM   160   C  CG  . ARG A 1 47  ? 18.854 129.053 32.325  1.00 36.33 ? 47  ARG A CG  1 
ATOM   161   C  CD  . ARG A 1 47  ? 19.525 128.510 31.079  1.00 35.97 ? 47  ARG A CD  1 
ATOM   162   N  NE  . ARG A 1 47  ? 18.636 128.563 29.925  1.00 37.93 ? 47  ARG A NE  1 
ATOM   163   C  CZ  . ARG A 1 47  ? 18.184 129.682 29.357  1.00 38.18 ? 47  ARG A CZ  1 
ATOM   164   N  NH1 . ARG A 1 47  ? 18.536 130.872 29.825  1.00 38.86 ? 47  ARG A NH1 1 
ATOM   165   N  NH2 . ARG A 1 47  ? 17.366 129.608 28.316  1.00 37.98 ? 47  ARG A NH2 1 
ATOM   166   N  N   . GLY A 1 48  ? 21.285 126.830 36.054  1.00 34.40 ? 48  GLY A N   1 
ATOM   167   C  CA  . GLY A 1 48  ? 22.318 126.900 37.067  1.00 33.08 ? 48  GLY A CA  1 
ATOM   168   C  C   . GLY A 1 48  ? 23.441 125.905 36.859  1.00 32.95 ? 48  GLY A C   1 
ATOM   169   O  O   . GLY A 1 48  ? 23.450 125.165 35.873  1.00 32.87 ? 48  GLY A O   1 
ATOM   170   N  N   . PRO A 1 49  ? 24.428 125.886 37.767  1.00 32.49 ? 49  PRO A N   1 
ATOM   171   C  CA  . PRO A 1 49  ? 25.586 124.982 37.727  1.00 32.40 ? 49  PRO A CA  1 
ATOM   172   C  C   . PRO A 1 49  ? 25.287 123.518 38.114  1.00 31.85 ? 49  PRO A C   1 
ATOM   173   O  O   . PRO A 1 49  ? 24.218 123.202 38.653  1.00 31.47 ? 49  PRO A O   1 
ATOM   174   C  CB  . PRO A 1 49  ? 26.571 125.647 38.683  1.00 32.89 ? 49  PRO A CB  1 
ATOM   175   C  CG  . PRO A 1 49  ? 25.653 126.375 39.654  1.00 32.23 ? 49  PRO A CG  1 
ATOM   176   C  CD  . PRO A 1 49  ? 24.662 126.984 38.720  1.00 31.82 ? 49  PRO A CD  1 
ATOM   177   N  N   . LEU A 1 50  ? 26.260 122.650 37.837  1.00 30.79 ? 50  LEU A N   1 
ATOM   178   C  CA  . LEU A 1 50  ? 26.186 121.210 38.094  1.00 30.28 ? 50  LEU A CA  1 
ATOM   179   C  C   . LEU A 1 50  ? 26.436 120.799 39.543  1.00 30.60 ? 50  LEU A C   1 
ATOM   180   O  O   . LEU A 1 50  ? 27.343 121.318 40.191  1.00 30.50 ? 50  LEU A O   1 
ATOM   181   C  CB  . LEU A 1 50  ? 27.191 120.493 37.194  1.00 28.12 ? 50  LEU A CB  1 
ATOM   182   C  CG  . LEU A 1 50  ? 27.369 119.004 37.456  1.00 27.72 ? 50  LEU A CG  1 
ATOM   183   C  CD1 . LEU A 1 50  ? 26.059 118.303 37.203  1.00 26.61 ? 50  LEU A CD1 1 
ATOM   184   C  CD2 . LEU A 1 50  ? 28.485 118.438 36.580  1.00 26.44 ? 50  LEU A CD2 1 
ATOM   185   N  N   . LEU A 1 51  ? 25.660 119.836 40.034  1.00 31.03 ? 51  LEU A N   1 
ATOM   186   C  CA  . LEU A 1 51  ? 25.805 119.379 41.421  1.00 32.04 ? 51  LEU A CA  1 
ATOM   187   C  C   . LEU A 1 51  ? 26.569 118.077 41.645  1.00 32.66 ? 51  LEU A C   1 
ATOM   188   O  O   . LEU A 1 51  ? 26.522 117.148 40.833  1.00 33.13 ? 51  LEU A O   1 
ATOM   189   C  CB  . LEU A 1 51  ? 24.431 119.291 42.082  1.00 31.80 ? 51  LEU A CB  1 
ATOM   190   C  CG  . LEU A 1 51  ? 23.970 120.718 42.358  1.00 32.55 ? 51  LEU A CG  1 
ATOM   191   C  CD1 . LEU A 1 51  ? 22.603 120.948 41.779  1.00 32.03 ? 51  LEU A CD1 1 
ATOM   192   C  CD2 . LEU A 1 51  ? 24.021 120.984 43.856  1.00 32.60 ? 51  LEU A CD2 1 
ATOM   193   N  N   . VAL A 1 52  ? 27.281 118.026 42.765  1.00 32.29 ? 52  VAL A N   1 
ATOM   194   C  CA  . VAL A 1 52  ? 28.075 116.858 43.115  1.00 31.34 ? 52  VAL A CA  1 
ATOM   195   C  C   . VAL A 1 52  ? 27.198 115.683 43.505  1.00 30.39 ? 52  VAL A C   1 
ATOM   196   O  O   . VAL A 1 52  ? 27.640 114.547 43.435  1.00 30.28 ? 52  VAL A O   1 
ATOM   197   C  CB  . VAL A 1 52  ? 29.065 117.163 44.284  1.00 31.66 ? 52  VAL A CB  1 
ATOM   198   C  CG1 . VAL A 1 52  ? 29.844 115.903 44.671  1.00 30.63 ? 52  VAL A CG1 1 
ATOM   199   C  CG2 . VAL A 1 52  ? 30.038 118.260 43.864  1.00 31.55 ? 52  VAL A CG2 1 
ATOM   200   N  N   . GLN A 1 53  ? 25.959 115.936 43.908  1.00 29.57 ? 53  GLN A N   1 
ATOM   201   C  CA  . GLN A 1 53  ? 25.111 114.825 44.284  1.00 29.95 ? 53  GLN A CA  1 
ATOM   202   C  C   . GLN A 1 53  ? 24.541 114.130 43.071  1.00 30.19 ? 53  GLN A C   1 
ATOM   203   O  O   . GLN A 1 53  ? 23.703 113.233 43.193  1.00 30.86 ? 53  GLN A O   1 
ATOM   204   C  CB  . GLN A 1 53  ? 23.998 115.260 45.218  1.00 31.11 ? 53  GLN A CB  1 
ATOM   205   C  CG  . GLN A 1 53  ? 23.052 116.240 44.627  1.00 32.50 ? 53  GLN A CG  1 
ATOM   206   C  CD  . GLN A 1 53  ? 22.090 116.725 45.656  1.00 32.98 ? 53  GLN A CD  1 
ATOM   207   O  OE1 . GLN A 1 53  ? 22.494 117.142 46.744  1.00 34.18 ? 53  GLN A OE1 1 
ATOM   208   N  NE2 . GLN A 1 53  ? 20.808 116.685 45.332  1.00 33.37 ? 53  GLN A NE2 1 
ATOM   209   N  N   . ASP A 1 54  ? 24.990 114.553 41.895  1.00 30.35 ? 54  ASP A N   1 
ATOM   210   C  CA  . ASP A 1 54  ? 24.590 113.891 40.665  1.00 30.78 ? 54  ASP A CA  1 
ATOM   211   C  C   . ASP A 1 54  ? 25.670 112.809 40.520  1.00 31.35 ? 54  ASP A C   1 
ATOM   212   O  O   . ASP A 1 54  ? 26.588 112.916 39.702  1.00 32.27 ? 54  ASP A O   1 
ATOM   213   C  CB  . ASP A 1 54  ? 24.635 114.831 39.454  1.00 30.45 ? 54  ASP A CB  1 
ATOM   214   C  CG  . ASP A 1 54  ? 24.209 114.137 38.166  1.00 29.94 ? 54  ASP A CG  1 
ATOM   215   O  OD1 . ASP A 1 54  ? 24.371 112.908 38.079  1.00 29.95 ? 54  ASP A OD1 1 
ATOM   216   O  OD2 . ASP A 1 54  ? 23.723 114.805 37.233  1.00 29.50 ? 54  ASP A OD2 1 
ATOM   217   N  N   . VAL A 1 55  ? 25.555 111.785 41.360  1.00 31.38 ? 55  VAL A N   1 
ATOM   218   C  CA  . VAL A 1 55  ? 26.464 110.654 41.382  1.00 30.63 ? 55  VAL A CA  1 
ATOM   219   C  C   . VAL A 1 55  ? 26.326 109.808 40.123  1.00 30.29 ? 55  VAL A C   1 
ATOM   220   O  O   . VAL A 1 55  ? 27.271 109.141 39.720  1.00 30.39 ? 55  VAL A O   1 
ATOM   221   C  CB  . VAL A 1 55  ? 26.176 109.780 42.602  1.00 31.32 ? 55  VAL A CB  1 
ATOM   222   C  CG1 . VAL A 1 55  ? 26.902 108.448 42.482  1.00 31.92 ? 55  VAL A CG1 1 
ATOM   223   C  CG2 . VAL A 1 55  ? 26.593 110.524 43.865  1.00 31.66 ? 55  VAL A CG2 1 
ATOM   224   N  N   . VAL A 1 56  ? 25.144 109.823 39.515  1.00 29.74 ? 56  VAL A N   1 
ATOM   225   C  CA  . VAL A 1 56  ? 24.919 109.074 38.284  1.00 29.36 ? 56  VAL A CA  1 
ATOM   226   C  C   . VAL A 1 56  ? 25.906 109.592 37.236  1.00 29.64 ? 56  VAL A C   1 
ATOM   227   O  O   . VAL A 1 56  ? 26.582 108.812 36.557  1.00 29.63 ? 56  VAL A O   1 
ATOM   228   C  CB  . VAL A 1 56  ? 23.475 109.268 37.771  1.00 28.80 ? 56  VAL A CB  1 
ATOM   229   C  CG1 . VAL A 1 56  ? 23.295 108.619 36.406  1.00 27.97 ? 56  VAL A CG1 1 
ATOM   230   C  CG2 . VAL A 1 56  ? 22.507 108.667 38.757  1.00 28.33 ? 56  VAL A CG2 1 
ATOM   231   N  N   . PHE A 1 57  ? 26.002 110.914 37.127  1.00 29.64 ? 57  PHE A N   1 
ATOM   232   C  CA  . PHE A 1 57  ? 26.916 111.532 36.176  1.00 29.55 ? 57  PHE A CA  1 
ATOM   233   C  C   . PHE A 1 57  ? 28.366 111.183 36.477  1.00 30.14 ? 57  PHE A C   1 
ATOM   234   O  O   . PHE A 1 57  ? 29.087 110.681 35.606  1.00 29.54 ? 57  PHE A O   1 
ATOM   235   C  CB  . PHE A 1 57  ? 26.786 113.055 36.194  1.00 28.49 ? 57  PHE A CB  1 
ATOM   236   C  CG  . PHE A 1 57  ? 27.875 113.748 35.426  1.00 28.53 ? 57  PHE A CG  1 
ATOM   237   C  CD1 . PHE A 1 57  ? 27.960 113.609 34.034  1.00 27.69 ? 57  PHE A CD1 1 
ATOM   238   C  CD2 . PHE A 1 57  ? 28.864 114.472 36.096  1.00 26.63 ? 57  PHE A CD2 1 
ATOM   239   C  CE1 . PHE A 1 57  ? 29.023 114.182 33.322  1.00 27.40 ? 57  PHE A CE1 1 
ATOM   240   C  CE2 . PHE A 1 57  ? 29.921 115.042 35.403  1.00 26.03 ? 57  PHE A CE2 1 
ATOM   241   C  CZ  . PHE A 1 57  ? 30.008 114.900 34.011  1.00 26.52 ? 57  PHE A CZ  1 
ATOM   242   N  N   . THR A 1 58  ? 28.790 111.463 37.711  1.00 30.38 ? 58  THR A N   1 
ATOM   243   C  CA  . THR A 1 58  ? 30.164 111.211 38.114  1.00 30.86 ? 58  THR A CA  1 
ATOM   244   C  C   . THR A 1 58  ? 30.524 109.760 37.894  1.00 31.42 ? 58  THR A C   1 
ATOM   245   O  O   . THR A 1 58  ? 31.563 109.464 37.312  1.00 32.14 ? 58  THR A O   1 
ATOM   246   C  CB  . THR A 1 58  ? 30.392 111.561 39.583  1.00 31.22 ? 58  THR A CB  1 
ATOM   247   O  OG1 . THR A 1 58  ? 29.946 112.897 39.821  1.00 32.63 ? 58  THR A OG1 1 
ATOM   248   C  CG2 . THR A 1 58  ? 31.869 111.480 39.927  1.00 31.10 ? 58  THR A CG2 1 
ATOM   249   N  N   . ASP A 1 59  ? 29.654 108.857 38.340  1.00 31.33 ? 59  ASP A N   1 
ATOM   250   C  CA  . ASP A 1 59  ? 29.892 107.426 38.184  1.00 31.04 ? 59  ASP A CA  1 
ATOM   251   C  C   . ASP A 1 59  ? 30.140 107.045 36.727  1.00 30.93 ? 59  ASP A C   1 
ATOM   252   O  O   . ASP A 1 59  ? 31.112 106.364 36.415  1.00 31.58 ? 59  ASP A O   1 
ATOM   253   C  CB  . ASP A 1 59  ? 28.706 106.620 38.731  1.00 30.78 ? 59  ASP A CB  1 
ATOM   254   C  CG  . ASP A 1 59  ? 28.822 105.126 38.439  1.00 31.17 ? 59  ASP A CG  1 
ATOM   255   O  OD1 . ASP A 1 59  ? 29.747 104.473 38.970  1.00 32.91 ? 59  ASP A OD1 1 
ATOM   256   O  OD2 . ASP A 1 59  ? 27.989 104.604 37.675  1.00 29.34 ? 59  ASP A OD2 1 
ATOM   257   N  N   . GLU A 1 60  ? 29.264 107.472 35.827  1.00 30.98 ? 60  GLU A N   1 
ATOM   258   C  CA  . GLU A 1 60  ? 29.460 107.122 34.428  1.00 30.37 ? 60  GLU A CA  1 
ATOM   259   C  C   . GLU A 1 60  ? 30.682 107.821 33.847  1.00 29.59 ? 60  GLU A C   1 
ATOM   260   O  O   . GLU A 1 60  ? 31.443 107.218 33.103  1.00 30.09 ? 60  GLU A O   1 
ATOM   261   C  CB  . GLU A 1 60  ? 28.220 107.457 33.588  1.00 30.45 ? 60  GLU A CB  1 
ATOM   262   C  CG  . GLU A 1 60  ? 28.475 107.255 32.093  1.00 31.88 ? 60  GLU A CG  1 
ATOM   263   C  CD  . GLU A 1 60  ? 27.252 107.493 31.224  1.00 32.37 ? 60  GLU A CD  1 
ATOM   264   O  OE1 . GLU A 1 60  ? 26.518 108.474 31.479  1.00 31.13 ? 60  GLU A OE1 1 
ATOM   265   O  OE2 . GLU A 1 60  ? 27.047 106.700 30.272  1.00 33.18 ? 60  GLU A OE2 1 
ATOM   266   N  N   . MET A 1 61  ? 30.884 109.084 34.207  1.00 28.88 ? 61  MET A N   1 
ATOM   267   C  CA  . MET A 1 61  ? 32.009 109.842 33.680  1.00 27.52 ? 61  MET A CA  1 
ATOM   268   C  C   . MET A 1 61  ? 33.342 109.304 34.176  1.00 27.41 ? 61  MET A C   1 
ATOM   269   O  O   . MET A 1 61  ? 34.282 109.184 33.394  1.00 27.86 ? 61  MET A O   1 
ATOM   270   C  CB  . MET A 1 61  ? 31.864 111.333 34.032  1.00 26.88 ? 61  MET A CB  1 
ATOM   271   C  CG  . MET A 1 61  ? 32.868 112.259 33.338  1.00 25.36 ? 61  MET A CG  1 
ATOM   272   S  SD  . MET A 1 61  ? 32.997 112.010 31.521  1.00 27.51 ? 61  MET A SD  1 
ATOM   273   C  CE  . MET A 1 61  ? 31.481 112.804 30.932  1.00 23.86 ? 61  MET A CE  1 
ATOM   274   N  N   . ALA A 1 62  ? 33.424 108.979 35.465  1.00 26.55 ? 62  ALA A N   1 
ATOM   275   C  CA  . ALA A 1 62  ? 34.660 108.456 36.037  1.00 26.85 ? 62  ALA A CA  1 
ATOM   276   C  C   . ALA A 1 62  ? 35.081 107.193 35.300  1.00 27.76 ? 62  ALA A C   1 
ATOM   277   O  O   . ALA A 1 62  ? 36.267 106.991 35.024  1.00 28.65 ? 62  ALA A O   1 
ATOM   278   C  CB  . ALA A 1 62  ? 34.488 108.161 37.533  1.00 25.65 ? 62  ALA A CB  1 
ATOM   279   N  N   . HIS A 1 63  ? 34.116 106.341 34.971  1.00 28.76 ? 63  HIS A N   1 
ATOM   280   C  CA  . HIS A 1 63  ? 34.446 105.122 34.250  1.00 29.12 ? 63  HIS A CA  1 
ATOM   281   C  C   . HIS A 1 63  ? 34.904 105.436 32.831  1.00 29.08 ? 63  HIS A C   1 
ATOM   282   O  O   . HIS A 1 63  ? 35.932 104.946 32.401  1.00 30.14 ? 63  HIS A O   1 
ATOM   283   C  CB  . HIS A 1 63  ? 33.266 104.150 34.222  1.00 28.30 ? 63  HIS A CB  1 
ATOM   284   C  CG  . HIS A 1 63  ? 33.692 102.729 34.053  1.00 28.36 ? 63  HIS A CG  1 
ATOM   285   N  ND1 . HIS A 1 63  ? 34.099 102.217 32.839  1.00 28.47 ? 63  HIS A ND1 1 
ATOM   286   C  CD2 . HIS A 1 63  ? 33.920 101.756 34.967  1.00 28.64 ? 63  HIS A CD2 1 
ATOM   287   C  CE1 . HIS A 1 63  ? 34.566 100.994 33.014  1.00 27.75 ? 63  HIS A CE1 1 
ATOM   288   N  NE2 . HIS A 1 63  ? 34.470 100.690 34.296  1.00 28.62 ? 63  HIS A NE2 1 
ATOM   289   N  N   . PHE A 1 64  ? 34.147 106.250 32.104  1.00 29.24 ? 64  PHE A N   1 
ATOM   290   C  CA  . PHE A 1 64  ? 34.536 106.628 30.744  1.00 29.41 ? 64  PHE A CA  1 
ATOM   291   C  C   . PHE A 1 64  ? 35.979 107.146 30.754  1.00 29.31 ? 64  PHE A C   1 
ATOM   292   O  O   . PHE A 1 64  ? 36.745 106.874 29.823  1.00 29.01 ? 64  PHE A O   1 
ATOM   293   C  CB  . PHE A 1 64  ? 33.602 107.731 30.208  1.00 28.56 ? 64  PHE A CB  1 
ATOM   294   C  CG  . PHE A 1 64  ? 34.117 108.435 28.966  1.00 26.44 ? 64  PHE A CG  1 
ATOM   295   C  CD1 . PHE A 1 64  ? 33.998 107.854 27.714  1.00 25.06 ? 64  PHE A CD1 1 
ATOM   296   C  CD2 . PHE A 1 64  ? 34.724 109.687 29.062  1.00 25.62 ? 64  PHE A CD2 1 
ATOM   297   C  CE1 . PHE A 1 64  ? 34.473 108.506 26.576  1.00 24.16 ? 64  PHE A CE1 1 
ATOM   298   C  CE2 . PHE A 1 64  ? 35.202 110.339 27.929  1.00 24.73 ? 64  PHE A CE2 1 
ATOM   299   C  CZ  . PHE A 1 64  ? 35.076 109.744 26.683  1.00 23.92 ? 64  PHE A CZ  1 
ATOM   300   N  N   . ASP A 1 65  ? 36.323 107.888 31.813  1.00 28.09 ? 65  ASP A N   1 
ATOM   301   C  CA  . ASP A 1 65  ? 37.649 108.477 31.993  1.00 28.13 ? 65  ASP A CA  1 
ATOM   302   C  C   . ASP A 1 65  ? 38.786 107.472 32.143  1.00 29.05 ? 65  ASP A C   1 
ATOM   303   O  O   . ASP A 1 65  ? 39.959 107.832 32.016  1.00 30.68 ? 65  ASP A O   1 
ATOM   304   C  CB  . ASP A 1 65  ? 37.677 109.381 33.230  1.00 27.33 ? 65  ASP A CB  1 
ATOM   305   C  CG  . ASP A 1 65  ? 36.927 110.669 33.030  1.00 27.38 ? 65  ASP A CG  1 
ATOM   306   O  OD1 . ASP A 1 65  ? 36.715 111.063 31.865  1.00 28.66 ? 65  ASP A OD1 1 
ATOM   307   O  OD2 . ASP A 1 65  ? 36.566 111.301 34.039  1.00 26.64 ? 65  ASP A OD2 1 
ATOM   308   N  N   . ARG A 1 66  ? 38.454 106.219 32.418  1.00 29.00 ? 66  ARG A N   1 
ATOM   309   C  CA  . ARG A 1 66  ? 39.476 105.199 32.608  1.00 28.89 ? 66  ARG A CA  1 
ATOM   310   C  C   . ARG A 1 66  ? 39.348 104.039 31.625  1.00 28.88 ? 66  ARG A C   1 
ATOM   311   O  O   . ARG A 1 66  ? 39.929 102.981 31.836  1.00 28.24 ? 66  ARG A O   1 
ATOM   312   C  CB  . ARG A 1 66  ? 39.410 104.669 34.054  1.00 28.15 ? 66  ARG A CB  1 
ATOM   313   C  CG  . ARG A 1 66  ? 39.448 105.778 35.089  1.00 28.37 ? 66  ARG A CG  1 
ATOM   314   C  CD  . ARG A 1 66  ? 39.376 105.291 36.539  1.00 27.42 ? 66  ARG A CD  1 
ATOM   315   N  NE  . ARG A 1 66  ? 39.896 106.335 37.408  1.00 26.80 ? 66  ARG A NE  1 
ATOM   316   C  CZ  . ARG A 1 66  ? 39.263 107.474 37.669  1.00 27.79 ? 66  ARG A CZ  1 
ATOM   317   N  NH1 . ARG A 1 66  ? 38.069 107.706 37.148  1.00 28.02 ? 66  ARG A NH1 1 
ATOM   318   N  NH2 . ARG A 1 66  ? 39.854 108.414 38.393  1.00 27.78 ? 66  ARG A NH2 1 
ATOM   319   N  N   . GLU A 1 67  ? 38.602 104.229 30.547  1.00 28.73 ? 67  GLU A N   1 
ATOM   320   C  CA  . GLU A 1 67  ? 38.448 103.143 29.591  1.00 29.35 ? 67  GLU A CA  1 
ATOM   321   C  C   . GLU A 1 67  ? 39.765 102.639 29.023  1.00 29.32 ? 67  GLU A C   1 
ATOM   322   O  O   . GLU A 1 67  ? 39.916 101.450 28.781  1.00 29.78 ? 67  GLU A O   1 
ATOM   323   C  CB  . GLU A 1 67  ? 37.526 103.547 28.440  1.00 28.64 ? 67  GLU A CB  1 
ATOM   324   C  CG  . GLU A 1 67  ? 36.085 103.750 28.886  1.00 30.25 ? 67  GLU A CG  1 
ATOM   325   C  CD  . GLU A 1 67  ? 35.154 104.104 27.745  1.00 30.24 ? 67  GLU A CD  1 
ATOM   326   O  OE1 . GLU A 1 67  ? 33.964 104.347 28.017  1.00 30.84 ? 67  GLU A OE1 1 
ATOM   327   O  OE2 . GLU A 1 67  ? 35.605 104.135 26.583  1.00 30.87 ? 67  GLU A OE2 1 
ATOM   328   N  N   . ARG A 1 68  ? 40.731 103.526 28.845  1.00 29.21 ? 68  ARG A N   1 
ATOM   329   C  CA  . ARG A 1 68  ? 42.000 103.132 28.248  1.00 29.92 ? 68  ARG A CA  1 
ATOM   330   C  C   . ARG A 1 68  ? 43.098 102.546 29.122  1.00 30.21 ? 68  ARG A C   1 
ATOM   331   O  O   . ARG A 1 68  ? 43.338 102.990 30.247  1.00 30.03 ? 68  ARG A O   1 
ATOM   332   C  CB  . ARG A 1 68  ? 42.587 104.324 27.508  1.00 29.97 ? 68  ARG A CB  1 
ATOM   333   C  CG  . ARG A 1 68  ? 41.609 104.984 26.595  1.00 30.31 ? 68  ARG A CG  1 
ATOM   334   C  CD  . ARG A 1 68  ? 41.373 104.179 25.344  1.00 30.96 ? 68  ARG A CD  1 
ATOM   335   N  NE  . ARG A 1 68  ? 40.440 104.890 24.488  1.00 32.41 ? 68  ARG A NE  1 
ATOM   336   C  CZ  . ARG A 1 68  ? 39.118 104.780 24.565  1.00 33.70 ? 68  ARG A CZ  1 
ATOM   337   N  NH1 . ARG A 1 68  ? 38.560 103.957 25.458  1.00 33.36 ? 68  ARG A NH1 1 
ATOM   338   N  NH2 . ARG A 1 68  ? 38.352 105.537 23.780  1.00 33.05 ? 68  ARG A NH2 1 
ATOM   339   N  N   . ILE A 1 69  ? 43.766 101.540 28.566  1.00 30.69 ? 69  ILE A N   1 
ATOM   340   C  CA  . ILE A 1 69  ? 44.909 100.894 29.202  1.00 30.78 ? 69  ILE A CA  1 
ATOM   341   C  C   . ILE A 1 69  ? 46.018 101.013 28.152  1.00 31.12 ? 69  ILE A C   1 
ATOM   342   O  O   . ILE A 1 69  ? 45.748 101.295 26.976  1.00 31.59 ? 69  ILE A O   1 
ATOM   343   C  CB  . ILE A 1 69  ? 44.663 99.405  29.503  1.00 30.76 ? 69  ILE A CB  1 
ATOM   344   C  CG1 . ILE A 1 69  ? 44.309 98.667  28.217  1.00 31.22 ? 69  ILE A CG1 1 
ATOM   345   C  CG2 . ILE A 1 69  ? 43.561 99.258  30.543  1.00 30.80 ? 69  ILE A CG2 1 
ATOM   346   C  CD1 . ILE A 1 69  ? 44.506 97.166  28.307  1.00 30.77 ? 69  ILE A CD1 1 
ATOM   347   N  N   . PRO A 1 70  ? 47.279 100.815 28.551  1.00 30.58 ? 70  PRO A N   1 
ATOM   348   C  CA  . PRO A 1 70  ? 48.350 100.928 27.561  1.00 29.85 ? 70  PRO A CA  1 
ATOM   349   C  C   . PRO A 1 70  ? 48.238 99.838  26.504  1.00 29.78 ? 70  PRO A C   1 
ATOM   350   O  O   . PRO A 1 70  ? 47.921 98.695  26.818  1.00 30.23 ? 70  PRO A O   1 
ATOM   351   C  CB  . PRO A 1 70  ? 49.617 100.763 28.395  1.00 29.89 ? 70  PRO A CB  1 
ATOM   352   C  CG  . PRO A 1 70  ? 49.181 101.136 29.797  1.00 29.83 ? 70  PRO A CG  1 
ATOM   353   C  CD  . PRO A 1 70  ? 47.822 100.516 29.884  1.00 29.85 ? 70  PRO A CD  1 
ATOM   354   N  N   . GLU A 1 71  ? 48.482 100.185 25.248  1.00 29.79 ? 71  GLU A N   1 
ATOM   355   C  CA  . GLU A 1 71  ? 48.437 99.189  24.193  1.00 28.84 ? 71  GLU A CA  1 
ATOM   356   C  C   . GLU A 1 71  ? 49.787 98.482  24.266  1.00 28.76 ? 71  GLU A C   1 
ATOM   357   O  O   . GLU A 1 71  ? 50.714 98.981  24.895  1.00 28.50 ? 71  GLU A O   1 
ATOM   358   C  CB  . GLU A 1 71  ? 48.298 99.866  22.843  1.00 28.98 ? 71  GLU A CB  1 
ATOM   359   C  CG  . GLU A 1 71  ? 49.427 100.845 22.568  1.00 29.67 ? 71  GLU A CG  1 
ATOM   360   C  CD  . GLU A 1 71  ? 49.389 101.397 21.166  1.00 30.25 ? 71  GLU A CD  1 
ATOM   361   O  OE1 . GLU A 1 71  ? 48.281 101.704 20.682  1.00 32.49 ? 71  GLU A OE1 1 
ATOM   362   O  OE2 . GLU A 1 71  ? 50.462 101.538 20.548  1.00 29.94 ? 71  GLU A OE2 1 
ATOM   363   N  N   . ARG A 1 72  ? 49.895 97.330  23.615  1.00 29.13 ? 72  ARG A N   1 
ATOM   364   C  CA  . ARG A 1 72  ? 51.134 96.555  23.590  1.00 28.54 ? 72  ARG A CA  1 
ATOM   365   C  C   . ARG A 1 72  ? 52.293 97.405  23.065  1.00 28.19 ? 72  ARG A C   1 
ATOM   366   O  O   . ARG A 1 72  ? 52.102 98.277  22.217  1.00 28.33 ? 72  ARG A O   1 
ATOM   367   C  CB  . ARG A 1 72  ? 50.947 95.321  22.702  1.00 28.57 ? 72  ARG A CB  1 
ATOM   368   C  CG  . ARG A 1 72  ? 49.795 94.401  23.129  1.00 27.77 ? 72  ARG A CG  1 
ATOM   369   C  CD  . ARG A 1 72  ? 49.295 93.550  21.959  1.00 26.10 ? 72  ARG A CD  1 
ATOM   370   N  NE  . ARG A 1 72  ? 48.390 92.492  22.394  1.00 25.82 ? 72  ARG A NE  1 
ATOM   371   C  CZ  . ARG A 1 72  ? 47.179 92.685  22.911  1.00 24.83 ? 72  ARG A CZ  1 
ATOM   372   N  NH1 . ARG A 1 72  ? 46.698 93.904  23.065  1.00 24.00 ? 72  ARG A NH1 1 
ATOM   373   N  NH2 . ARG A 1 72  ? 46.452 91.647  23.286  1.00 25.31 ? 72  ARG A NH2 1 
ATOM   374   N  N   . VAL A 1 73  ? 53.495 97.156  23.570  1.00 27.80 ? 73  VAL A N   1 
ATOM   375   C  CA  . VAL A 1 73  ? 54.646 97.921  23.129  1.00 28.59 ? 73  VAL A CA  1 
ATOM   376   C  C   . VAL A 1 73  ? 54.958 97.619  21.651  1.00 28.83 ? 73  VAL A C   1 
ATOM   377   O  O   . VAL A 1 73  ? 55.519 98.454  20.944  1.00 29.43 ? 73  VAL A O   1 
ATOM   378   C  CB  . VAL A 1 73  ? 55.866 97.659  24.052  1.00 28.76 ? 73  VAL A CB  1 
ATOM   379   C  CG1 . VAL A 1 73  ? 56.432 96.278  23.810  1.00 30.24 ? 73  VAL A CG1 1 
ATOM   380   C  CG2 . VAL A 1 73  ? 56.916 98.729  23.843  1.00 28.98 ? 73  VAL A CG2 1 
ATOM   381   N  N   . VAL A 1 74  ? 54.584 96.426  21.195  1.00 29.09 ? 74  VAL A N   1 
ATOM   382   C  CA  . VAL A 1 74  ? 54.742 96.013  19.796  1.00 29.06 ? 74  VAL A CA  1 
ATOM   383   C  C   . VAL A 1 74  ? 53.532 95.164  19.467  1.00 29.50 ? 74  VAL A C   1 
ATOM   384   O  O   . VAL A 1 74  ? 52.910 94.604  20.366  1.00 28.62 ? 74  VAL A O   1 
ATOM   385   C  CB  . VAL A 1 74  ? 56.000 95.135  19.518  1.00 29.08 ? 74  VAL A CB  1 
ATOM   386   C  CG1 . VAL A 1 74  ? 57.095 95.969  18.867  1.00 26.88 ? 74  VAL A CG1 1 
ATOM   387   C  CG2 . VAL A 1 74  ? 56.485 94.495  20.800  1.00 28.52 ? 74  VAL A CG2 1 
ATOM   388   N  N   . HIS A 1 75  ? 53.207 95.071  18.178  1.00 30.68 ? 75  HIS A N   1 
ATOM   389   C  CA  . HIS A 1 75  ? 52.066 94.288  17.714  1.00 31.06 ? 75  HIS A CA  1 
ATOM   390   C  C   . HIS A 1 75  ? 50.766 94.854  18.295  1.00 31.87 ? 75  HIS A C   1 
ATOM   391   O  O   . HIS A 1 75  ? 49.800 94.112  18.538  1.00 33.27 ? 75  HIS A O   1 
ATOM   392   C  CB  . HIS A 1 75  ? 52.240 92.809  18.114  1.00 30.75 ? 75  HIS A CB  1 
ATOM   393   C  CG  . HIS A 1 75  ? 53.387 92.125  17.429  1.00 30.50 ? 75  HIS A CG  1 
ATOM   394   N  ND1 . HIS A 1 75  ? 53.225 91.348  16.303  1.00 30.29 ? 75  HIS A ND1 1 
ATOM   395   C  CD2 . HIS A 1 75  ? 54.719 92.141  17.685  1.00 30.50 ? 75  HIS A CD2 1 
ATOM   396   C  CE1 . HIS A 1 75  ? 54.406 90.917  15.894  1.00 29.88 ? 75  HIS A CE1 1 
ATOM   397   N  NE2 . HIS A 1 75  ? 55.329 91.385  16.713  1.00 29.69 ? 75  HIS A NE2 1 
ATOM   398   N  N   . ALA A 1 76  ? 50.742 96.171  18.496  1.00 31.46 ? 76  ALA A N   1 
ATOM   399   C  CA  . ALA A 1 76  ? 49.574 96.850  19.056  1.00 31.38 ? 76  ALA A CA  1 
ATOM   400   C  C   . ALA A 1 76  ? 48.289 96.700  18.244  1.00 31.14 ? 76  ALA A C   1 
ATOM   401   O  O   . ALA A 1 76  ? 47.224 96.508  18.819  1.00 31.28 ? 76  ALA A O   1 
ATOM   402   C  CB  . ALA A 1 76  ? 49.877 98.331  19.271  1.00 31.19 ? 76  ALA A CB  1 
ATOM   403   N  N   . LYS A 1 77  ? 48.377 96.796  16.920  1.00 30.67 ? 77  LYS A N   1 
ATOM   404   C  CA  . LYS A 1 77  ? 47.186 96.672  16.079  1.00 30.22 ? 77  LYS A CA  1 
ATOM   405   C  C   . LYS A 1 77  ? 46.901 95.195  15.852  1.00 30.74 ? 77  LYS A C   1 
ATOM   406   O  O   . LYS A 1 77  ? 47.698 94.487  15.244  1.00 30.07 ? 77  LYS A O   1 
ATOM   407   C  CB  . LYS A 1 77  ? 47.406 97.394  14.738  1.00 30.05 ? 77  LYS A CB  1 
ATOM   408   C  CG  . LYS A 1 77  ? 46.228 97.406  13.761  1.00 28.16 ? 77  LYS A CG  1 
ATOM   409   C  CD  . LYS A 1 77  ? 44.997 98.007  14.375  1.00 28.86 ? 77  LYS A CD  1 
ATOM   410   C  CE  . LYS A 1 77  ? 44.187 98.825  13.381  1.00 30.03 ? 77  LYS A CE  1 
ATOM   411   N  NZ  . LYS A 1 77  ? 43.860 98.159  12.090  1.00 29.60 ? 77  LYS A NZ  1 
ATOM   412   N  N   . GLY A 1 78  ? 45.755 94.726  16.343  1.00 32.08 ? 78  GLY A N   1 
ATOM   413   C  CA  . GLY A 1 78  ? 45.428 93.317  16.183  1.00 31.94 ? 78  GLY A CA  1 
ATOM   414   C  C   . GLY A 1 78  ? 44.004 92.898  15.874  1.00 30.93 ? 78  GLY A C   1 
ATOM   415   O  O   . GLY A 1 78  ? 43.074 93.699  15.875  1.00 30.62 ? 78  GLY A O   1 
ATOM   416   N  N   . ALA A 1 79  ? 43.861 91.607  15.604  1.00 31.28 ? 79  ALA A N   1 
ATOM   417   C  CA  . ALA A 1 79  ? 42.585 90.976  15.290  1.00 31.37 ? 79  ALA A CA  1 
ATOM   418   C  C   . ALA A 1 79  ? 42.582 89.626  16.008  1.00 32.04 ? 79  ALA A C   1 
ATOM   419   O  O   . ALA A 1 79  ? 43.565 88.885  15.940  1.00 32.22 ? 79  ALA A O   1 
ATOM   420   C  CB  . ALA A 1 79  ? 42.462 90.772  13.788  1.00 30.56 ? 79  ALA A CB  1 
ATOM   421   N  N   . GLY A 1 80  ? 41.489 89.303  16.693  1.00 32.40 ? 80  GLY A N   1 
ATOM   422   C  CA  . GLY A 1 80  ? 41.442 88.043  17.401  1.00 31.88 ? 80  GLY A CA  1 
ATOM   423   C  C   . GLY A 1 80  ? 40.276 87.128  17.094  1.00 32.40 ? 80  GLY A C   1 
ATOM   424   O  O   . GLY A 1 80  ? 39.215 87.571  16.634  1.00 32.41 ? 80  GLY A O   1 
ATOM   425   N  N   . ALA A 1 81  ? 40.478 85.837  17.370  1.00 32.63 ? 81  ALA A N   1 
ATOM   426   C  CA  . ALA A 1 81  ? 39.455 84.827  17.152  1.00 33.08 ? 81  ALA A CA  1 
ATOM   427   C  C   . ALA A 1 81  ? 39.638 83.642  18.096  1.00 33.26 ? 81  ALA A C   1 
ATOM   428   O  O   . ALA A 1 81  ? 40.566 83.608  18.898  1.00 32.49 ? 81  ALA A O   1 
ATOM   429   C  CB  . ALA A 1 81  ? 39.485 84.361  15.705  1.00 33.84 ? 81  ALA A CB  1 
ATOM   430   N  N   . PHE A 1 82  ? 38.730 82.678  18.003  1.00 33.66 ? 82  PHE A N   1 
ATOM   431   C  CA  . PHE A 1 82  ? 38.781 81.488  18.842  1.00 34.38 ? 82  PHE A CA  1 
ATOM   432   C  C   . PHE A 1 82  ? 38.416 80.223  18.077  1.00 34.38 ? 82  PHE A C   1 
ATOM   433   O  O   . PHE A 1 82  ? 37.681 80.262  17.086  1.00 35.46 ? 82  PHE A O   1 
ATOM   434   C  CB  . PHE A 1 82  ? 37.862 81.654  20.045  1.00 34.56 ? 82  PHE A CB  1 
ATOM   435   C  CG  . PHE A 1 82  ? 38.202 82.836  20.884  1.00 35.34 ? 82  PHE A CG  1 
ATOM   436   C  CD1 . PHE A 1 82  ? 37.874 84.117  20.460  1.00 35.59 ? 82  PHE A CD1 1 
ATOM   437   C  CD2 . PHE A 1 82  ? 38.903 82.676  22.073  1.00 36.50 ? 82  PHE A CD2 1 
ATOM   438   C  CE1 . PHE A 1 82  ? 38.242 85.228  21.204  1.00 37.55 ? 82  PHE A CE1 1 
ATOM   439   C  CE2 . PHE A 1 82  ? 39.282 83.777  22.837  1.00 37.72 ? 82  PHE A CE2 1 
ATOM   440   C  CZ  . PHE A 1 82  ? 38.953 85.060  22.403  1.00 38.36 ? 82  PHE A CZ  1 
ATOM   441   N  N   . GLY A 1 83  ? 38.939 79.097  18.535  1.00 33.87 ? 83  GLY A N   1 
ATOM   442   C  CA  . GLY A 1 83  ? 38.667 77.849  17.856  1.00 32.92 ? 83  GLY A CA  1 
ATOM   443   C  C   . GLY A 1 83  ? 39.239 76.690  18.627  1.00 32.28 ? 83  GLY A C   1 
ATOM   444   O  O   . GLY A 1 83  ? 39.084 76.621  19.844  1.00 32.70 ? 83  GLY A O   1 
ATOM   445   N  N   . TYR A 1 84  ? 39.903 75.776  17.936  1.00 31.52 ? 84  TYR A N   1 
ATOM   446   C  CA  . TYR A 1 84  ? 40.460 74.619  18.612  1.00 31.09 ? 84  TYR A CA  1 
ATOM   447   C  C   . TYR A 1 84  ? 41.585 74.016  17.815  1.00 30.49 ? 84  TYR A C   1 
ATOM   448   O  O   . TYR A 1 84  ? 41.766 74.333  16.642  1.00 29.74 ? 84  TYR A O   1 
ATOM   449   C  CB  . TYR A 1 84  ? 39.378 73.557  18.831  1.00 31.60 ? 84  TYR A CB  1 
ATOM   450   C  CG  . TYR A 1 84  ? 38.817 72.952  17.550  1.00 33.56 ? 84  TYR A CG  1 
ATOM   451   C  CD1 . TYR A 1 84  ? 39.378 71.806  16.985  1.00 34.33 ? 84  TYR A CD1 1 
ATOM   452   C  CD2 . TYR A 1 84  ? 37.739 73.539  16.893  1.00 34.17 ? 84  TYR A CD2 1 
ATOM   453   C  CE1 . TYR A 1 84  ? 38.876 71.257  15.800  1.00 34.85 ? 84  TYR A CE1 1 
ATOM   454   C  CE2 . TYR A 1 84  ? 37.232 73.002  15.709  1.00 35.31 ? 84  TYR A CE2 1 
ATOM   455   C  CZ  . TYR A 1 84  ? 37.801 71.860  15.168  1.00 35.72 ? 84  TYR A CZ  1 
ATOM   456   O  OH  . TYR A 1 84  ? 37.264 71.314  14.018  1.00 36.13 ? 84  TYR A OH  1 
ATOM   457   N  N   . PHE A 1 85  ? 42.348 73.158  18.487  1.00 30.54 ? 85  PHE A N   1 
ATOM   458   C  CA  . PHE A 1 85  ? 43.455 72.428  17.884  1.00 30.41 ? 85  PHE A CA  1 
ATOM   459   C  C   . PHE A 1 85  ? 43.009 70.982  17.947  1.00 30.61 ? 85  PHE A C   1 
ATOM   460   O  O   . PHE A 1 85  ? 42.364 70.569  18.915  1.00 30.02 ? 85  PHE A O   1 
ATOM   461   C  CB  . PHE A 1 85  ? 44.733 72.593  18.702  1.00 30.07 ? 85  PHE A CB  1 
ATOM   462   C  CG  . PHE A 1 85  ? 45.842 71.638  18.312  1.00 29.86 ? 85  PHE A CG  1 
ATOM   463   C  CD1 . PHE A 1 85  ? 46.475 71.745  17.062  1.00 30.05 ? 85  PHE A CD1 1 
ATOM   464   C  CD2 . PHE A 1 85  ? 46.259 70.640  19.194  1.00 27.84 ? 85  PHE A CD2 1 
ATOM   465   C  CE1 . PHE A 1 85  ? 47.514 70.866  16.694  1.00 29.03 ? 85  PHE A CE1 1 
ATOM   466   C  CE2 . PHE A 1 85  ? 47.292 69.757  18.846  1.00 27.95 ? 85  PHE A CE2 1 
ATOM   467   C  CZ  . PHE A 1 85  ? 47.922 69.868  17.596  1.00 29.03 ? 85  PHE A CZ  1 
ATOM   468   N  N   . GLU A 1 86  ? 43.328 70.220  16.911  1.00 31.43 ? 86  GLU A N   1 
ATOM   469   C  CA  . GLU A 1 86  ? 42.959 68.809  16.891  1.00 32.99 ? 86  GLU A CA  1 
ATOM   470   C  C   . GLU A 1 86  ? 44.139 67.964  16.455  1.00 32.79 ? 86  GLU A C   1 
ATOM   471   O  O   . GLU A 1 86  ? 44.740 68.221  15.409  1.00 32.82 ? 86  GLU A O   1 
ATOM   472   C  CB  . GLU A 1 86  ? 41.788 68.565  15.943  1.00 33.85 ? 86  GLU A CB  1 
ATOM   473   C  CG  . GLU A 1 86  ? 41.448 67.103  15.809  1.00 36.31 ? 86  GLU A CG  1 
ATOM   474   C  CD  . GLU A 1 86  ? 40.200 66.846  14.992  1.00 37.88 ? 86  GLU A CD  1 
ATOM   475   O  OE1 . GLU A 1 86  ? 39.917 65.658  14.740  1.00 39.66 ? 86  GLU A OE1 1 
ATOM   476   O  OE2 . GLU A 1 86  ? 39.499 67.807  14.604  1.00 38.72 ? 86  GLU A OE2 1 
ATOM   477   N  N   . VAL A 1 87  ? 44.477 66.957  17.252  1.00 32.18 ? 87  VAL A N   1 
ATOM   478   C  CA  . VAL A 1 87  ? 45.597 66.101  16.894  1.00 32.23 ? 87  VAL A CA  1 
ATOM   479   C  C   . VAL A 1 87  ? 45.191 65.150  15.784  1.00 32.49 ? 87  VAL A C   1 
ATOM   480   O  O   . VAL A 1 87  ? 44.187 64.463  15.903  1.00 32.72 ? 87  VAL A O   1 
ATOM   481   C  CB  . VAL A 1 87  ? 46.067 65.253  18.070  1.00 31.92 ? 87  VAL A CB  1 
ATOM   482   C  CG1 . VAL A 1 87  ? 47.296 64.455  17.656  1.00 30.64 ? 87  VAL A CG1 1 
ATOM   483   C  CG2 . VAL A 1 87  ? 46.343 66.131  19.265  1.00 30.46 ? 87  VAL A CG2 1 
ATOM   484   N  N   . THR A 1 88  ? 45.976 65.107  14.713  1.00 33.26 ? 88  THR A N   1 
ATOM   485   C  CA  . THR A 1 88  ? 45.679 64.225  13.599  1.00 34.22 ? 88  THR A CA  1 
ATOM   486   C  C   . THR A 1 88  ? 46.691 63.107  13.515  1.00 35.65 ? 88  THR A C   1 
ATOM   487   O  O   . THR A 1 88  ? 46.357 61.989  13.115  1.00 37.89 ? 88  THR A O   1 
ATOM   488   C  CB  . THR A 1 88  ? 45.667 64.976  12.272  1.00 33.92 ? 88  THR A CB  1 
ATOM   489   O  OG1 . THR A 1 88  ? 46.957 65.545  12.024  1.00 33.02 ? 88  THR A OG1 1 
ATOM   490   C  CG2 . THR A 1 88  ? 44.638 66.083  12.319  1.00 33.55 ? 88  THR A CG2 1 
ATOM   491   N  N   . HIS A 1 89  ? 47.927 63.390  13.898  1.00 36.06 ? 89  HIS A N   1 
ATOM   492   C  CA  . HIS A 1 89  ? 48.958 62.365  13.861  1.00 37.15 ? 89  HIS A CA  1 
ATOM   493   C  C   . HIS A 1 89  ? 49.547 62.104  15.237  1.00 38.25 ? 89  HIS A C   1 
ATOM   494   O  O   . HIS A 1 89  ? 49.224 62.795  16.204  1.00 38.31 ? 89  HIS A O   1 
ATOM   495   C  CB  . HIS A 1 89  ? 50.058 62.757  12.884  1.00 37.28 ? 89  HIS A CB  1 
ATOM   496   C  CG  . HIS A 1 89  ? 49.599 62.807  11.464  1.00 38.34 ? 89  HIS A CG  1 
ATOM   497   N  ND1 . HIS A 1 89  ? 48.641 63.693  11.025  1.00 38.97 ? 89  HIS A ND1 1 
ATOM   498   C  CD2 . HIS A 1 89  ? 49.945 62.062  10.387  1.00 39.48 ? 89  HIS A CD2 1 
ATOM   499   C  CE1 . HIS A 1 89  ? 48.418 63.494  9.737   1.00 39.80 ? 89  HIS A CE1 1 
ATOM   500   N  NE2 . HIS A 1 89  ? 49.197 62.509  9.325   1.00 39.35 ? 89  HIS A NE2 1 
ATOM   501   N  N   . ASP A 1 90  ? 50.417 61.106  15.324  1.00 39.09 ? 90  ASP A N   1 
ATOM   502   C  CA  . ASP A 1 90  ? 51.020 60.756  16.598  1.00 39.75 ? 90  ASP A CA  1 
ATOM   503   C  C   . ASP A 1 90  ? 52.477 61.193  16.715  1.00 39.71 ? 90  ASP A C   1 
ATOM   504   O  O   . ASP A 1 90  ? 53.331 60.715  15.968  1.00 40.12 ? 90  ASP A O   1 
ATOM   505   C  CB  . ASP A 1 90  ? 50.919 59.243  16.796  1.00 40.78 ? 90  ASP A CB  1 
ATOM   506   C  CG  . ASP A 1 90  ? 51.371 58.798  18.173  1.00 41.95 ? 90  ASP A CG  1 
ATOM   507   O  OD1 . ASP A 1 90  ? 52.509 59.134  18.565  1.00 42.56 ? 90  ASP A OD1 1 
ATOM   508   O  OD2 . ASP A 1 90  ? 50.587 58.104  18.860  1.00 43.12 ? 90  ASP A OD2 1 
ATOM   509   N  N   . ILE A 1 91  ? 52.763 62.101  17.645  1.00 39.17 ? 91  ILE A N   1 
ATOM   510   C  CA  . ILE A 1 91  ? 54.142 62.538  17.855  1.00 39.14 ? 91  ILE A CA  1 
ATOM   511   C  C   . ILE A 1 91  ? 54.558 62.245  19.288  1.00 39.10 ? 91  ILE A C   1 
ATOM   512   O  O   . ILE A 1 91  ? 55.578 62.742  19.770  1.00 38.38 ? 91  ILE A O   1 
ATOM   513   C  CB  . ILE A 1 91  ? 54.347 64.048  17.569  1.00 38.75 ? 91  ILE A CB  1 
ATOM   514   C  CG1 . ILE A 1 91  ? 53.400 64.896  18.417  1.00 39.04 ? 91  ILE A CG1 1 
ATOM   515   C  CG2 . ILE A 1 91  ? 54.128 64.325  16.095  1.00 39.91 ? 91  ILE A CG2 1 
ATOM   516   C  CD1 . ILE A 1 91  ? 53.597 66.395  18.244  1.00 37.93 ? 91  ILE A CD1 1 
ATOM   517   N  N   . THR A 1 92  ? 53.755 61.423  19.959  1.00 39.90 ? 92  THR A N   1 
ATOM   518   C  CA  . THR A 1 92  ? 54.022 61.048  21.343  1.00 40.67 ? 92  THR A CA  1 
ATOM   519   C  C   . THR A 1 92  ? 55.427 60.481  21.532  1.00 41.18 ? 92  THR A C   1 
ATOM   520   O  O   . THR A 1 92  ? 55.935 60.410  22.657  1.00 41.89 ? 92  THR A O   1 
ATOM   521   C  CB  . THR A 1 92  ? 52.998 60.024  21.856  1.00 40.00 ? 92  THR A CB  1 
ATOM   522   O  OG1 . THR A 1 92  ? 52.928 58.922  20.949  1.00 40.70 ? 92  THR A OG1 1 
ATOM   523   C  CG2 . THR A 1 92  ? 51.637 60.654  21.966  1.00 40.01 ? 92  THR A CG2 1 
ATOM   524   N  N   . LYS A 1 93  ? 56.062 60.069  20.444  1.00 41.11 ? 93  LYS A N   1 
ATOM   525   C  CA  . LYS A 1 93  ? 57.409 59.551  20.580  1.00 41.59 ? 93  LYS A CA  1 
ATOM   526   C  C   . LYS A 1 93  ? 58.374 60.717  20.769  1.00 40.78 ? 93  LYS A C   1 
ATOM   527   O  O   . LYS A 1 93  ? 59.485 60.531  21.261  1.00 40.68 ? 93  LYS A O   1 
ATOM   528   C  CB  . LYS A 1 93  ? 57.818 58.713  19.363  1.00 43.31 ? 93  LYS A CB  1 
ATOM   529   C  CG  . LYS A 1 93  ? 57.997 59.471  18.065  1.00 45.03 ? 93  LYS A CG  1 
ATOM   530   C  CD  . LYS A 1 93  ? 58.915 58.660  17.145  1.00 47.92 ? 93  LYS A CD  1 
ATOM   531   C  CE  . LYS A 1 93  ? 58.719 58.991  15.652  1.00 50.16 ? 93  LYS A CE  1 
ATOM   532   N  NZ  . LYS A 1 93  ? 57.392 58.538  15.092  1.00 50.64 ? 93  LYS A NZ  1 
ATOM   533   N  N   . TYR A 1 94  ? 57.955 61.921  20.382  1.00 39.83 ? 94  TYR A N   1 
ATOM   534   C  CA  . TYR A 1 94  ? 58.807 63.097  20.556  1.00 38.74 ? 94  TYR A CA  1 
ATOM   535   C  C   . TYR A 1 94  ? 58.378 63.916  21.771  1.00 38.30 ? 94  TYR A C   1 
ATOM   536   O  O   . TYR A 1 94  ? 59.219 64.511  22.458  1.00 38.39 ? 94  TYR A O   1 
ATOM   537   C  CB  . TYR A 1 94  ? 58.767 63.994  19.332  1.00 37.44 ? 94  TYR A CB  1 
ATOM   538   C  CG  . TYR A 1 94  ? 59.223 63.328  18.069  1.00 37.81 ? 94  TYR A CG  1 
ATOM   539   C  CD1 . TYR A 1 94  ? 60.479 62.746  17.976  1.00 37.57 ? 94  TYR A CD1 1 
ATOM   540   C  CD2 . TYR A 1 94  ? 58.406 63.314  16.943  1.00 38.26 ? 94  TYR A CD2 1 
ATOM   541   C  CE1 . TYR A 1 94  ? 60.913 62.166  16.781  1.00 37.76 ? 94  TYR A CE1 1 
ATOM   542   C  CE2 . TYR A 1 94  ? 58.825 62.741  15.749  1.00 37.96 ? 94  TYR A CE2 1 
ATOM   543   C  CZ  . TYR A 1 94  ? 60.074 62.169  15.670  1.00 38.19 ? 94  TYR A CZ  1 
ATOM   544   O  OH  . TYR A 1 94  ? 60.461 61.594  14.481  1.00 38.91 ? 94  TYR A OH  1 
ATOM   545   N  N   . SER A 1 95  ? 57.078 63.944  22.050  1.00 37.06 ? 95  SER A N   1 
ATOM   546   C  CA  . SER A 1 95  ? 56.614 64.727  23.182  1.00 36.38 ? 95  SER A CA  1 
ATOM   547   C  C   . SER A 1 95  ? 55.548 64.102  24.047  1.00 36.05 ? 95  SER A C   1 
ATOM   548   O  O   . SER A 1 95  ? 54.563 63.573  23.550  1.00 35.88 ? 95  SER A O   1 
ATOM   549   C  CB  . SER A 1 95  ? 56.100 66.079  22.711  1.00 35.63 ? 95  SER A CB  1 
ATOM   550   O  OG  . SER A 1 95  ? 55.623 66.806  23.823  1.00 35.70 ? 95  SER A OG  1 
ATOM   551   N  N   . LYS A 1 96  ? 55.742 64.197  25.357  1.00 36.31 ? 96  LYS A N   1 
ATOM   552   C  CA  . LYS A 1 96  ? 54.779 63.659  26.309  1.00 36.05 ? 96  LYS A CA  1 
ATOM   553   C  C   . LYS A 1 96  ? 53.669 64.673  26.617  1.00 35.92 ? 96  LYS A C   1 
ATOM   554   O  O   . LYS A 1 96  ? 52.714 64.354  27.309  1.00 36.20 ? 96  LYS A O   1 
ATOM   555   C  CB  . LYS A 1 96  ? 55.485 63.251  27.602  1.00 35.37 ? 96  LYS A CB  1 
ATOM   556   C  CG  . LYS A 1 96  ? 56.387 64.316  28.184  1.00 35.99 ? 96  LYS A CG  1 
ATOM   557   C  CD  . LYS A 1 96  ? 56.641 64.045  29.651  1.00 37.43 ? 96  LYS A CD  1 
ATOM   558   C  CE  . LYS A 1 96  ? 57.369 65.203  30.304  1.00 39.35 ? 96  LYS A CE  1 
ATOM   559   N  NZ  . LYS A 1 96  ? 57.323 65.098  31.792  1.00 40.42 ? 96  LYS A NZ  1 
ATOM   560   N  N   . ALA A 1 97  ? 53.795 65.887  26.093  1.00 35.99 ? 97  ALA A N   1 
ATOM   561   C  CA  . ALA A 1 97  ? 52.802 66.931  26.323  1.00 37.06 ? 97  ALA A CA  1 
ATOM   562   C  C   . ALA A 1 97  ? 51.386 66.452  26.028  1.00 37.89 ? 97  ALA A C   1 
ATOM   563   O  O   . ALA A 1 97  ? 51.095 66.001  24.913  1.00 38.71 ? 97  ALA A O   1 
ATOM   564   C  CB  . ALA A 1 97  ? 53.120 68.145  25.470  1.00 37.02 ? 97  ALA A CB  1 
ATOM   565   N  N   . LYS A 1 98  ? 50.510 66.582  27.024  1.00 37.96 ? 98  LYS A N   1 
ATOM   566   C  CA  . LYS A 1 98  ? 49.124 66.150  26.919  1.00 38.53 ? 98  LYS A CA  1 
ATOM   567   C  C   . LYS A 1 98  ? 48.375 66.665  25.701  1.00 38.66 ? 98  LYS A C   1 
ATOM   568   O  O   . LYS A 1 98  ? 47.560 65.947  25.131  1.00 39.01 ? 98  LYS A O   1 
ATOM   569   C  CB  . LYS A 1 98  ? 48.360 66.534  28.184  1.00 40.32 ? 98  LYS A CB  1 
ATOM   570   C  CG  . LYS A 1 98  ? 48.753 65.723  29.409  1.00 43.13 ? 98  LYS A CG  1 
ATOM   571   C  CD  . LYS A 1 98  ? 47.841 66.045  30.586  1.00 46.46 ? 98  LYS A CD  1 
ATOM   572   C  CE  . LYS A 1 98  ? 48.154 65.207  31.838  1.00 47.67 ? 98  LYS A CE  1 
ATOM   573   N  NZ  . LYS A 1 98  ? 47.272 65.618  32.993  1.00 48.40 ? 98  LYS A NZ  1 
ATOM   574   N  N   . VAL A 1 99  ? 48.628 67.906  25.301  1.00 38.17 ? 99  VAL A N   1 
ATOM   575   C  CA  . VAL A 1 99  ? 47.956 68.458  24.136  1.00 37.66 ? 99  VAL A CA  1 
ATOM   576   C  C   . VAL A 1 99  ? 48.119 67.560  22.895  1.00 37.85 ? 99  VAL A C   1 
ATOM   577   O  O   . VAL A 1 99  ? 47.315 67.626  21.961  1.00 37.40 ? 99  VAL A O   1 
ATOM   578   C  CB  . VAL A 1 99  ? 48.486 69.873  23.810  1.00 38.07 ? 99  VAL A CB  1 
ATOM   579   C  CG1 . VAL A 1 99  ? 49.954 69.808  23.425  1.00 36.88 ? 99  VAL A CG1 1 
ATOM   580   C  CG2 . VAL A 1 99  ? 47.658 70.495  22.685  1.00 37.63 ? 99  VAL A CG2 1 
ATOM   581   N  N   . PHE A 1 100 ? 49.150 66.718  22.888  1.00 37.74 ? 100 PHE A N   1 
ATOM   582   C  CA  . PHE A 1 100 ? 49.398 65.817  21.763  1.00 38.04 ? 100 PHE A CA  1 
ATOM   583   C  C   . PHE A 1 100 ? 49.083 64.380  22.150  1.00 38.80 ? 100 PHE A C   1 
ATOM   584   O  O   . PHE A 1 100 ? 49.252 63.467  21.347  1.00 38.44 ? 100 PHE A O   1 
ATOM   585   C  CB  . PHE A 1 100 ? 50.864 65.858  21.357  1.00 37.19 ? 100 PHE A CB  1 
ATOM   586   C  CG  . PHE A 1 100 ? 51.393 67.232  21.096  1.00 37.07 ? 100 PHE A CG  1 
ATOM   587   C  CD1 . PHE A 1 100 ? 50.927 67.981  20.023  1.00 36.25 ? 100 PHE A CD1 1 
ATOM   588   C  CD2 . PHE A 1 100 ? 52.407 67.756  21.891  1.00 35.92 ? 100 PHE A CD2 1 
ATOM   589   C  CE1 . PHE A 1 100 ? 51.464 69.229  19.738  1.00 35.67 ? 100 PHE A CE1 1 
ATOM   590   C  CE2 . PHE A 1 100 ? 52.952 69.004  21.613  1.00 35.81 ? 100 PHE A CE2 1 
ATOM   591   C  CZ  . PHE A 1 100 ? 52.478 69.742  20.531  1.00 36.24 ? 100 PHE A CZ  1 
ATOM   592   N  N   . GLU A 1 101 ? 48.645 64.198  23.390  1.00 39.82 ? 101 GLU A N   1 
ATOM   593   C  CA  . GLU A 1 101 ? 48.345 62.890  23.975  1.00 41.08 ? 101 GLU A CA  1 
ATOM   594   C  C   . GLU A 1 101 ? 47.872 61.757  23.074  1.00 40.57 ? 101 GLU A C   1 
ATOM   595   O  O   . GLU A 1 101 ? 48.398 60.654  23.163  1.00 41.06 ? 101 GLU A O   1 
ATOM   596   C  CB  . GLU A 1 101 ? 47.346 63.066  25.106  1.00 43.63 ? 101 GLU A CB  1 
ATOM   597   C  CG  . GLU A 1 101 ? 47.440 62.024  26.182  1.00 47.28 ? 101 GLU A CG  1 
ATOM   598   C  CD  . GLU A 1 101 ? 46.710 62.470  27.435  1.00 50.38 ? 101 GLU A CD  1 
ATOM   599   O  OE1 . GLU A 1 101 ? 45.479 62.700  27.344  1.00 51.45 ? 101 GLU A OE1 1 
ATOM   600   O  OE2 . GLU A 1 101 ? 47.364 62.603  28.503  1.00 52.21 ? 101 GLU A OE2 1 
ATOM   601   N  N   . HIS A 1 102 ? 46.873 62.005  22.232  1.00 39.87 ? 102 HIS A N   1 
ATOM   602   C  CA  . HIS A 1 102 ? 46.368 60.963  21.334  1.00 39.31 ? 102 HIS A CA  1 
ATOM   603   C  C   . HIS A 1 102 ? 45.688 61.546  20.103  1.00 38.41 ? 102 HIS A C   1 
ATOM   604   O  O   . HIS A 1 102 ? 45.160 62.650  20.136  1.00 38.50 ? 102 HIS A O   1 
ATOM   605   C  CB  . HIS A 1 102 ? 45.392 60.043  22.074  1.00 39.43 ? 102 HIS A CB  1 
ATOM   606   C  CG  . HIS A 1 102 ? 44.133 60.724  22.490  1.00 40.75 ? 102 HIS A CG  1 
ATOM   607   N  ND1 . HIS A 1 102 ? 43.168 61.113  21.586  1.00 41.24 ? 102 HIS A ND1 1 
ATOM   608   C  CD2 . HIS A 1 102 ? 43.708 61.150  23.705  1.00 41.64 ? 102 HIS A CD2 1 
ATOM   609   C  CE1 . HIS A 1 102 ? 42.203 61.754  22.226  1.00 41.88 ? 102 HIS A CE1 1 
ATOM   610   N  NE2 . HIS A 1 102 ? 42.506 61.791  23.512  1.00 42.01 ? 102 HIS A NE2 1 
ATOM   611   N  N   . ILE A 1 103 ? 45.717 60.797  19.009  1.00 37.86 ? 103 ILE A N   1 
ATOM   612   C  CA  . ILE A 1 103 ? 45.110 61.244  17.770  1.00 37.08 ? 103 ILE A CA  1 
ATOM   613   C  C   . ILE A 1 103 ? 43.653 61.523  18.015  1.00 37.24 ? 103 ILE A C   1 
ATOM   614   O  O   . ILE A 1 103 ? 42.969 60.717  18.654  1.00 37.93 ? 103 ILE A O   1 
ATOM   615   C  CB  . ILE A 1 103 ? 45.200 60.173  16.688  1.00 36.61 ? 103 ILE A CB  1 
ATOM   616   C  CG1 . ILE A 1 103 ? 46.654 59.960  16.304  1.00 36.47 ? 103 ILE A CG1 1 
ATOM   617   C  CG2 . ILE A 1 103 ? 44.402 60.585  15.471  1.00 35.35 ? 103 ILE A CG2 1 
ATOM   618   C  CD1 . ILE A 1 103 ? 46.866 58.684  15.534  1.00 38.34 ? 103 ILE A CD1 1 
ATOM   619   N  N   . GLY A 1 104 ? 43.192 62.667  17.509  1.00 36.83 ? 104 GLY A N   1 
ATOM   620   C  CA  . GLY A 1 104 ? 41.804 63.056  17.645  1.00 36.07 ? 104 GLY A CA  1 
ATOM   621   C  C   . GLY A 1 104 ? 41.528 63.930  18.847  1.00 35.96 ? 104 GLY A C   1 
ATOM   622   O  O   . GLY A 1 104 ? 40.411 64.419  19.013  1.00 36.28 ? 104 GLY A O   1 
ATOM   623   N  N   . LYS A 1 105 ? 42.532 64.127  19.693  1.00 35.41 ? 105 LYS A N   1 
ATOM   624   C  CA  . LYS A 1 105 ? 42.358 64.958  20.877  1.00 35.12 ? 105 LYS A CA  1 
ATOM   625   C  C   . LYS A 1 105 ? 42.244 66.420  20.452  1.00 34.82 ? 105 LYS A C   1 
ATOM   626   O  O   . LYS A 1 105 ? 43.026 66.913  19.629  1.00 34.71 ? 105 LYS A O   1 
ATOM   627   C  CB  . LYS A 1 105 ? 43.535 64.778  21.830  1.00 35.36 ? 105 LYS A CB  1 
ATOM   628   C  CG  . LYS A 1 105 ? 43.320 65.395  23.194  1.00 35.60 ? 105 LYS A CG  1 
ATOM   629   C  CD  . LYS A 1 105 ? 44.610 65.374  23.997  1.00 35.99 ? 105 LYS A CD  1 
ATOM   630   C  CE  . LYS A 1 105 ? 44.425 65.946  25.395  1.00 35.76 ? 105 LYS A CE  1 
ATOM   631   N  NZ  . LYS A 1 105 ? 43.639 65.037  26.270  1.00 34.57 ? 105 LYS A NZ  1 
ATOM   632   N  N   . LYS A 1 106 ? 41.263 67.109  21.025  1.00 34.63 ? 106 LYS A N   1 
ATOM   633   C  CA  . LYS A 1 106 ? 41.004 68.508  20.701  1.00 34.16 ? 106 LYS A CA  1 
ATOM   634   C  C   . LYS A 1 106 ? 41.218 69.477  21.872  1.00 32.99 ? 106 LYS A C   1 
ATOM   635   O  O   . LYS A 1 106 ? 40.791 69.209  22.997  1.00 32.65 ? 106 LYS A O   1 
ATOM   636   C  CB  . LYS A 1 106 ? 39.568 68.637  20.188  1.00 35.09 ? 106 LYS A CB  1 
ATOM   637   C  CG  . LYS A 1 106 ? 39.344 68.047  18.811  1.00 38.26 ? 106 LYS A CG  1 
ATOM   638   C  CD  . LYS A 1 106 ? 37.865 67.791  18.547  1.00 40.88 ? 106 LYS A CD  1 
ATOM   639   C  CE  . LYS A 1 106 ? 37.373 66.530  19.282  1.00 42.43 ? 106 LYS A CE  1 
ATOM   640   N  NZ  . LYS A 1 106 ? 35.876 66.407  19.279  1.00 43.91 ? 106 LYS A NZ  1 
ATOM   641   N  N   . THR A 1 107 ? 41.876 70.601  21.600  1.00 31.68 ? 107 THR A N   1 
ATOM   642   C  CA  . THR A 1 107 ? 42.114 71.613  22.626  1.00 31.09 ? 107 THR A CA  1 
ATOM   643   C  C   . THR A 1 107 ? 41.655 72.987  22.149  1.00 30.44 ? 107 THR A C   1 
ATOM   644   O  O   . THR A 1 107 ? 41.987 73.413  21.048  1.00 30.80 ? 107 THR A O   1 
ATOM   645   C  CB  . THR A 1 107 ? 43.604 71.716  22.998  1.00 31.20 ? 107 THR A CB  1 
ATOM   646   O  OG1 . THR A 1 107 ? 44.055 70.460  23.518  1.00 32.38 ? 107 THR A OG1 1 
ATOM   647   C  CG2 . THR A 1 107 ? 43.818 72.790  24.053  1.00 29.89 ? 107 THR A CG2 1 
ATOM   648   N  N   . PRO A 1 108 ? 40.886 73.701  22.982  1.00 29.65 ? 108 PRO A N   1 
ATOM   649   C  CA  . PRO A 1 108 ? 40.388 75.033  22.632  1.00 29.12 ? 108 PRO A CA  1 
ATOM   650   C  C   . PRO A 1 108 ? 41.549 75.994  22.463  1.00 29.41 ? 108 PRO A C   1 
ATOM   651   O  O   . PRO A 1 108 ? 42.512 75.937  23.224  1.00 30.02 ? 108 PRO A O   1 
ATOM   652   C  CB  . PRO A 1 108 ? 39.539 75.414  23.839  1.00 28.38 ? 108 PRO A CB  1 
ATOM   653   C  CG  . PRO A 1 108 ? 39.156 74.081  24.434  1.00 27.96 ? 108 PRO A CG  1 
ATOM   654   C  CD  . PRO A 1 108 ? 40.424 73.313  24.324  1.00 28.77 ? 108 PRO A CD  1 
ATOM   655   N  N   . ILE A 1 109 ? 41.471 76.873  21.474  1.00 28.96 ? 109 ILE A N   1 
ATOM   656   C  CA  . ILE A 1 109 ? 42.536 77.840  21.286  1.00 28.60 ? 109 ILE A CA  1 
ATOM   657   C  C   . ILE A 1 109 ? 42.006 79.256  21.137  1.00 29.46 ? 109 ILE A C   1 
ATOM   658   O  O   . ILE A 1 109 ? 40.829 79.465  20.808  1.00 29.48 ? 109 ILE A O   1 
ATOM   659   C  CB  . ILE A 1 109 ? 43.400 77.524  20.053  1.00 27.48 ? 109 ILE A CB  1 
ATOM   660   C  CG1 . ILE A 1 109 ? 42.598 77.762  18.775  1.00 26.02 ? 109 ILE A CG1 1 
ATOM   661   C  CG2 . ILE A 1 109 ? 43.931 76.110  20.154  1.00 26.63 ? 109 ILE A CG2 1 
ATOM   662   C  CD1 . ILE A 1 109 ? 43.384 77.482  17.516  1.00 25.33 ? 109 ILE A CD1 1 
ATOM   663   N  N   . ALA A 1 110 ? 42.888 80.217  21.424  1.00 29.16 ? 110 ALA A N   1 
ATOM   664   C  CA  . ALA A 1 110 ? 42.609 81.646  21.294  1.00 28.04 ? 110 ALA A CA  1 
ATOM   665   C  C   . ALA A 1 110 ? 43.749 82.113  20.408  1.00 27.44 ? 110 ALA A C   1 
ATOM   666   O  O   . ALA A 1 110 ? 44.883 81.670  20.578  1.00 26.91 ? 110 ALA A O   1 
ATOM   667   C  CB  . ALA A 1 110 ? 42.675 82.332  22.634  1.00 27.14 ? 110 ALA A CB  1 
ATOM   668   N  N   . VAL A 1 111 ? 43.449 82.974  19.446  1.00 27.53 ? 111 VAL A N   1 
ATOM   669   C  CA  . VAL A 1 111 ? 44.472 83.479  18.539  1.00 27.76 ? 111 VAL A CA  1 
ATOM   670   C  C   . VAL A 1 111 ? 44.364 84.985  18.305  1.00 28.34 ? 111 VAL A C   1 
ATOM   671   O  O   . VAL A 1 111 ? 43.277 85.559  18.368  1.00 28.27 ? 111 VAL A O   1 
ATOM   672   C  CB  . VAL A 1 111 ? 44.383 82.753  17.181  1.00 27.56 ? 111 VAL A CB  1 
ATOM   673   C  CG1 . VAL A 1 111 ? 45.310 83.401  16.157  1.00 27.43 ? 111 VAL A CG1 1 
ATOM   674   C  CG2 . VAL A 1 111 ? 44.743 81.294  17.368  1.00 27.19 ? 111 VAL A CG2 1 
ATOM   675   N  N   . ARG A 1 112 ? 45.502 85.628  18.054  1.00 28.94 ? 112 ARG A N   1 
ATOM   676   C  CA  . ARG A 1 112 ? 45.525 87.058  17.768  1.00 28.89 ? 112 ARG A CA  1 
ATOM   677   C  C   . ARG A 1 112 ? 46.580 87.313  16.688  1.00 29.87 ? 112 ARG A C   1 
ATOM   678   O  O   . ARG A 1 112 ? 47.749 86.951  16.848  1.00 29.60 ? 112 ARG A O   1 
ATOM   679   C  CB  . ARG A 1 112 ? 45.845 87.868  19.034  1.00 28.28 ? 112 ARG A CB  1 
ATOM   680   C  CG  . ARG A 1 112 ? 45.732 89.392  18.868  1.00 28.06 ? 112 ARG A CG  1 
ATOM   681   C  CD  . ARG A 1 112 ? 45.918 90.122  20.206  1.00 27.62 ? 112 ARG A CD  1 
ATOM   682   N  NE  . ARG A 1 112 ? 46.060 91.572  20.072  1.00 26.79 ? 112 ARG A NE  1 
ATOM   683   C  CZ  . ARG A 1 112 ? 47.137 92.187  19.591  1.00 26.69 ? 112 ARG A CZ  1 
ATOM   684   N  NH1 . ARG A 1 112 ? 48.184 91.485  19.195  1.00 28.04 ? 112 ARG A NH1 1 
ATOM   685   N  NH2 . ARG A 1 112 ? 47.166 93.507  19.499  1.00 27.40 ? 112 ARG A NH2 1 
ATOM   686   N  N   . PHE A 1 113 ? 46.142 87.901  15.576  1.00 30.16 ? 113 PHE A N   1 
ATOM   687   C  CA  . PHE A 1 113 ? 47.017 88.239  14.457  1.00 30.94 ? 113 PHE A CA  1 
ATOM   688   C  C   . PHE A 1 113 ? 47.330 89.702  14.679  1.00 31.54 ? 113 PHE A C   1 
ATOM   689   O  O   . PHE A 1 113 ? 46.618 90.367  15.435  1.00 31.46 ? 113 PHE A O   1 
ATOM   690   C  CB  . PHE A 1 113 ? 46.280 88.099  13.126  1.00 31.54 ? 113 PHE A CB  1 
ATOM   691   C  CG  . PHE A 1 113 ? 45.856 86.699  12.808  1.00 31.53 ? 113 PHE A CG  1 
ATOM   692   C  CD1 . PHE A 1 113 ? 46.788 85.754  12.410  1.00 31.08 ? 113 PHE A CD1 1 
ATOM   693   C  CD2 . PHE A 1 113 ? 44.520 86.325  12.904  1.00 31.67 ? 113 PHE A CD2 1 
ATOM   694   C  CE1 . PHE A 1 113 ? 46.400 84.461  12.112  1.00 31.50 ? 113 PHE A CE1 1 
ATOM   695   C  CE2 . PHE A 1 113 ? 44.122 85.029  12.609  1.00 31.50 ? 113 PHE A CE2 1 
ATOM   696   C  CZ  . PHE A 1 113 ? 45.065 84.096  12.212  1.00 31.60 ? 113 PHE A CZ  1 
ATOM   697   N  N   . SER A 1 114 ? 48.353 90.220  14.003  1.00 31.39 ? 114 SER A N   1 
ATOM   698   C  CA  . SER A 1 114 ? 48.727 91.612  14.201  1.00 30.54 ? 114 SER A CA  1 
ATOM   699   C  C   . SER A 1 114 ? 49.881 92.079  13.342  1.00 30.51 ? 114 SER A C   1 
ATOM   700   O  O   . SER A 1 114 ? 50.616 91.290  12.754  1.00 30.41 ? 114 SER A O   1 
ATOM   701   C  CB  . SER A 1 114 ? 49.144 91.820  15.655  1.00 30.90 ? 114 SER A CB  1 
ATOM   702   O  OG  . SER A 1 114 ? 50.291 91.027  15.946  1.00 30.10 ? 114 SER A OG  1 
ATOM   703   N  N   . THR A 1 115 ? 50.042 93.391  13.297  1.00 30.76 ? 115 THR A N   1 
ATOM   704   C  CA  . THR A 1 115 ? 51.148 93.989  12.583  1.00 30.50 ? 115 THR A CA  1 
ATOM   705   C  C   . THR A 1 115 ? 52.200 94.207  13.672  1.00 31.40 ? 115 THR A C   1 
ATOM   706   O  O   . THR A 1 115 ? 52.048 93.698  14.790  1.00 31.47 ? 115 THR A O   1 
ATOM   707   C  CB  . THR A 1 115 ? 50.736 95.307  11.950  1.00 29.88 ? 115 THR A CB  1 
ATOM   708   O  OG1 . THR A 1 115 ? 49.986 96.070  12.901  1.00 28.36 ? 115 THR A OG1 1 
ATOM   709   C  CG2 . THR A 1 115 ? 49.895 95.050  10.687  1.00 28.97 ? 115 THR A CG2 1 
ATOM   710   N  N   . VAL A 1 116 ? 53.255 94.959  13.378  1.00 32.02 ? 116 VAL A N   1 
ATOM   711   C  CA  . VAL A 1 116 ? 54.293 95.151  14.382  1.00 31.85 ? 116 VAL A CA  1 
ATOM   712   C  C   . VAL A 1 116 ? 54.570 96.565  14.847  1.00 31.83 ? 116 VAL A C   1 
ATOM   713   O  O   . VAL A 1 116 ? 54.444 96.859  16.030  1.00 32.47 ? 116 VAL A O   1 
ATOM   714   C  CB  . VAL A 1 116 ? 55.647 94.554  13.917  1.00 32.26 ? 116 VAL A CB  1 
ATOM   715   C  CG1 . VAL A 1 116 ? 56.641 94.577  15.073  1.00 31.21 ? 116 VAL A CG1 1 
ATOM   716   C  CG2 . VAL A 1 116 ? 55.452 93.118  13.394  1.00 32.18 ? 116 VAL A CG2 1 
ATOM   717   N  N   . ALA A 1 117 ? 54.948 97.439  13.922  1.00 30.95 ? 117 ALA A N   1 
ATOM   718   C  CA  . ALA A 1 117 ? 55.307 98.810  14.280  1.00 30.25 ? 117 ALA A CA  1 
ATOM   719   C  C   . ALA A 1 117 ? 54.166 99.778  14.545  1.00 30.29 ? 117 ALA A C   1 
ATOM   720   O  O   . ALA A 1 117 ? 54.298 100.685 15.373  1.00 29.73 ? 117 ALA A O   1 
ATOM   721   C  CB  . ALA A 1 117 ? 56.220 99.388  13.209  1.00 28.53 ? 117 ALA A CB  1 
ATOM   722   N  N   . GLY A 1 118 ? 53.057 99.594  13.839  1.00 30.53 ? 118 GLY A N   1 
ATOM   723   C  CA  . GLY A 1 118 ? 51.931 100.492 14.002  1.00 31.42 ? 118 GLY A CA  1 
ATOM   724   C  C   . GLY A 1 118 ? 51.278 100.478 15.367  1.00 32.55 ? 118 GLY A C   1 
ATOM   725   O  O   . GLY A 1 118 ? 51.243 99.443  16.040  1.00 33.00 ? 118 GLY A O   1 
ATOM   726   N  N   . GLU A 1 119 ? 50.777 101.631 15.801  1.00 33.04 ? 119 GLU A N   1 
ATOM   727   C  CA  . GLU A 1 119 ? 50.097 101.670 17.080  1.00 33.03 ? 119 GLU A CA  1 
ATOM   728   C  C   . GLU A 1 119 ? 48.614 101.373 16.817  1.00 32.97 ? 119 GLU A C   1 
ATOM   729   O  O   . GLU A 1 119 ? 48.207 101.167 15.664  1.00 32.06 ? 119 GLU A O   1 
ATOM   730   C  CB  . GLU A 1 119 ? 50.309 103.006 17.811  1.00 32.75 ? 119 GLU A CB  1 
ATOM   731   C  CG  . GLU A 1 119 ? 50.519 104.221 16.941  1.00 34.56 ? 119 GLU A CG  1 
ATOM   732   C  CD  . GLU A 1 119 ? 51.946 104.374 16.457  1.00 34.59 ? 119 GLU A CD  1 
ATOM   733   O  OE1 . GLU A 1 119 ? 52.868 104.509 17.289  1.00 34.29 ? 119 GLU A OE1 1 
ATOM   734   O  OE2 . GLU A 1 119 ? 52.144 104.368 15.226  1.00 36.67 ? 119 GLU A OE2 1 
ATOM   735   N  N   . SER A 1 120 ? 47.825 101.331 17.884  1.00 31.94 ? 120 SER A N   1 
ATOM   736   C  CA  . SER A 1 120 ? 46.415 100.991 17.802  1.00 31.90 ? 120 SER A CA  1 
ATOM   737   C  C   . SER A 1 120 ? 45.534 101.502 16.675  1.00 32.23 ? 120 SER A C   1 
ATOM   738   O  O   . SER A 1 120 ? 44.505 100.885 16.374  1.00 33.30 ? 120 SER A O   1 
ATOM   739   C  CB  . SER A 1 120 ? 45.747 101.312 19.126  1.00 31.31 ? 120 SER A CB  1 
ATOM   740   O  OG  . SER A 1 120 ? 46.185 100.396 20.096  1.00 30.95 ? 120 SER A OG  1 
ATOM   741   N  N   . GLY A 1 121 ? 45.887 102.609 16.046  1.00 31.29 ? 121 GLY A N   1 
ATOM   742   C  CA  . GLY A 1 121 ? 45.019 103.068 14.982  1.00 31.04 ? 121 GLY A CA  1 
ATOM   743   C  C   . GLY A 1 121 ? 45.581 102.942 13.583  1.00 31.09 ? 121 GLY A C   1 
ATOM   744   O  O   . GLY A 1 121 ? 44.987 103.467 12.648  1.00 32.13 ? 121 GLY A O   1 
ATOM   745   N  N   . SER A 1 122 ? 46.708 102.251 13.424  1.00 30.64 ? 122 SER A N   1 
ATOM   746   C  CA  . SER A 1 122 ? 47.340 102.110 12.112  1.00 30.43 ? 122 SER A CA  1 
ATOM   747   C  C   . SER A 1 122 ? 46.633 101.196 11.123  1.00 29.98 ? 122 SER A C   1 
ATOM   748   O  O   . SER A 1 122 ? 45.695 100.491 11.465  1.00 30.06 ? 122 SER A O   1 
ATOM   749   C  CB  . SER A 1 122 ? 48.778 101.642 12.278  1.00 30.58 ? 122 SER A CB  1 
ATOM   750   O  OG  . SER A 1 122 ? 48.841 100.462 13.055  1.00 32.61 ? 122 SER A OG  1 
ATOM   751   N  N   . ALA A 1 123 ? 47.105 101.210 9.885   1.00 30.48 ? 123 ALA A N   1 
ATOM   752   C  CA  . ALA A 1 123 ? 46.510 100.396 8.836   1.00 30.18 ? 123 ALA A CA  1 
ATOM   753   C  C   . ALA A 1 123 ? 46.990 98.964  8.878   1.00 30.39 ? 123 ALA A C   1 
ATOM   754   O  O   . ALA A 1 123 ? 48.153 98.698  9.173   1.00 31.37 ? 123 ALA A O   1 
ATOM   755   C  CB  . ALA A 1 123 ? 46.809 101.003 7.477   1.00 30.51 ? 123 ALA A CB  1 
ATOM   756   N  N   . ASP A 1 124 ? 46.084 98.042  8.568   1.00 30.70 ? 124 ASP A N   1 
ATOM   757   C  CA  . ASP A 1 124 ? 46.399 96.623  8.562   1.00 30.73 ? 124 ASP A CA  1 
ATOM   758   C  C   . ASP A 1 124 ? 47.224 96.253  7.333   1.00 31.39 ? 124 ASP A C   1 
ATOM   759   O  O   . ASP A 1 124 ? 48.222 95.545  7.435   1.00 31.61 ? 124 ASP A O   1 
ATOM   760   C  CB  . ASP A 1 124 ? 45.108 95.784  8.580   1.00 30.73 ? 124 ASP A CB  1 
ATOM   761   C  CG  . ASP A 1 124 ? 44.441 95.718  9.963   1.00 30.36 ? 124 ASP A CG  1 
ATOM   762   O  OD1 . ASP A 1 124 ? 44.946 96.339  10.916  1.00 31.15 ? 124 ASP A OD1 1 
ATOM   763   O  OD2 . ASP A 1 124 ? 43.405 95.032  10.100  1.00 29.11 ? 124 ASP A OD2 1 
ATOM   764   N  N   . THR A 1 125 ? 46.808 96.734  6.171   1.00 31.82 ? 125 THR A N   1 
ATOM   765   C  CA  . THR A 1 125 ? 47.506 96.404  4.939   1.00 32.98 ? 125 THR A CA  1 
ATOM   766   C  C   . THR A 1 125 ? 48.749 97.238  4.635   1.00 33.77 ? 125 THR A C   1 
ATOM   767   O  O   . THR A 1 125 ? 48.765 98.014  3.675   1.00 34.03 ? 125 THR A O   1 
ATOM   768   C  CB  . THR A 1 125 ? 46.551 96.501  3.750   1.00 33.21 ? 125 THR A CB  1 
ATOM   769   O  OG1 . THR A 1 125 ? 46.066 97.842  3.637   1.00 32.57 ? 125 THR A OG1 1 
ATOM   770   C  CG2 . THR A 1 125 ? 45.387 95.560  3.944   1.00 31.88 ? 125 THR A CG2 1 
ATOM   771   N  N   . VAL A 1 126 ? 49.793 97.050  5.441   1.00 34.22 ? 126 VAL A N   1 
ATOM   772   C  CA  . VAL A 1 126 ? 51.065 97.765  5.290   1.00 33.79 ? 126 VAL A CA  1 
ATOM   773   C  C   . VAL A 1 126 ? 52.202 96.749  5.366   1.00 34.51 ? 126 VAL A C   1 
ATOM   774   O  O   . VAL A 1 126 ? 51.999 95.639  5.849   1.00 35.22 ? 126 VAL A O   1 
ATOM   775   C  CB  . VAL A 1 126 ? 51.252 98.796  6.423   1.00 33.21 ? 126 VAL A CB  1 
ATOM   776   C  CG1 . VAL A 1 126 ? 50.131 99.796  6.398   1.00 32.38 ? 126 VAL A CG1 1 
ATOM   777   C  CG2 . VAL A 1 126 ? 51.279 98.092  7.769   1.00 32.17 ? 126 VAL A CG2 1 
ATOM   778   N  N   . ARG A 1 127 ? 53.397 97.101  4.896   1.00 35.05 ? 127 ARG A N   1 
ATOM   779   C  CA  . ARG A 1 127 ? 54.502 96.141  4.967   1.00 35.15 ? 127 ARG A CA  1 
ATOM   780   C  C   . ARG A 1 127 ? 54.945 96.000  6.408   1.00 34.90 ? 127 ARG A C   1 
ATOM   781   O  O   . ARG A 1 127 ? 55.196 97.003  7.084   1.00 35.08 ? 127 ARG A O   1 
ATOM   782   C  CB  . ARG A 1 127 ? 55.696 96.583  4.129   1.00 35.32 ? 127 ARG A CB  1 
ATOM   783   C  CG  . ARG A 1 127 ? 56.794 95.526  4.065   1.00 36.04 ? 127 ARG A CG  1 
ATOM   784   C  CD  . ARG A 1 127 ? 57.945 96.019  3.228   1.00 37.55 ? 127 ARG A CD  1 
ATOM   785   N  NE  . ARG A 1 127 ? 57.464 96.495  1.937   1.00 39.04 ? 127 ARG A NE  1 
ATOM   786   C  CZ  . ARG A 1 127 ? 57.022 95.698  0.968   1.00 39.71 ? 127 ARG A CZ  1 
ATOM   787   N  NH1 . ARG A 1 127 ? 57.010 94.381  1.148   1.00 38.57 ? 127 ARG A NH1 1 
ATOM   788   N  NH2 . ARG A 1 127 ? 56.583 96.221  -0.174  1.00 39.97 ? 127 ARG A NH2 1 
ATOM   789   N  N   . ASP A 1 128 ? 55.067 94.755  6.861   1.00 34.68 ? 128 ASP A N   1 
ATOM   790   C  CA  . ASP A 1 128 ? 55.452 94.476  8.238   1.00 33.75 ? 128 ASP A CA  1 
ATOM   791   C  C   . ASP A 1 128 ? 55.279 92.993  8.488   1.00 33.42 ? 128 ASP A C   1 
ATOM   792   O  O   . ASP A 1 128 ? 54.589 92.303  7.741   1.00 33.51 ? 128 ASP A O   1 
ATOM   793   C  CB  . ASP A 1 128 ? 54.505 95.225  9.185   1.00 34.23 ? 128 ASP A CB  1 
ATOM   794   C  CG  . ASP A 1 128 ? 55.222 95.927  10.311  1.00 33.53 ? 128 ASP A CG  1 
ATOM   795   O  OD1 . ASP A 1 128 ? 56.429 96.160  10.170  1.00 34.32 ? 128 ASP A OD1 1 
ATOM   796   O  OD2 . ASP A 1 128 ? 54.576 96.269  11.325  1.00 34.09 ? 128 ASP A OD2 1 
ATOM   797   N  N   . PRO A 1 129 ? 55.944 92.467  9.518   1.00 32.86 ? 129 PRO A N   1 
ATOM   798   C  CA  . PRO A 1 129 ? 55.763 91.046  9.792   1.00 31.86 ? 129 PRO A CA  1 
ATOM   799   C  C   . PRO A 1 129 ? 54.334 90.972  10.327  1.00 31.77 ? 129 PRO A C   1 
ATOM   800   O  O   . PRO A 1 129 ? 53.645 91.992  10.395  1.00 30.42 ? 129 PRO A O   1 
ATOM   801   C  CB  . PRO A 1 129 ? 56.788 90.783  10.885  1.00 31.76 ? 129 PRO A CB  1 
ATOM   802   C  CG  . PRO A 1 129 ? 57.888 91.697  10.525  1.00 30.72 ? 129 PRO A CG  1 
ATOM   803   C  CD  . PRO A 1 129 ? 57.166 92.968  10.171  1.00 32.39 ? 129 PRO A CD  1 
ATOM   804   N  N   . ARG A 1 130 ? 53.887 89.782  10.711  1.00 32.70 ? 130 ARG A N   1 
ATOM   805   C  CA  . ARG A 1 130 ? 52.537 89.618  11.259  1.00 32.29 ? 130 ARG A CA  1 
ATOM   806   C  C   . ARG A 1 130 ? 52.566 88.684  12.445  1.00 31.77 ? 130 ARG A C   1 
ATOM   807   O  O   . ARG A 1 130 ? 53.026 87.563  12.318  1.00 31.99 ? 130 ARG A O   1 
ATOM   808   C  CB  . ARG A 1 130 ? 51.587 89.022  10.215  1.00 32.20 ? 130 ARG A CB  1 
ATOM   809   C  CG  . ARG A 1 130 ? 51.310 89.920  9.024   1.00 32.69 ? 130 ARG A CG  1 
ATOM   810   C  CD  . ARG A 1 130 ? 50.478 91.115  9.414   1.00 31.50 ? 130 ARG A CD  1 
ATOM   811   N  NE  . ARG A 1 130 ? 50.006 91.833  8.240   1.00 31.69 ? 130 ARG A NE  1 
ATOM   812   C  CZ  . ARG A 1 130 ? 50.698 92.757  7.582   1.00 31.08 ? 130 ARG A CZ  1 
ATOM   813   N  NH1 . ARG A 1 130 ? 51.914 93.096  7.975   1.00 29.91 ? 130 ARG A NH1 1 
ATOM   814   N  NH2 . ARG A 1 130 ? 50.157 93.352  6.528   1.00 31.73 ? 130 ARG A NH2 1 
ATOM   815   N  N   . GLY A 1 131 ? 52.081 89.137  13.592  1.00 31.04 ? 131 GLY A N   1 
ATOM   816   C  CA  . GLY A 1 131 ? 52.041 88.256  14.742  1.00 30.26 ? 131 GLY A CA  1 
ATOM   817   C  C   . GLY A 1 131 ? 50.938 87.218  14.545  1.00 30.09 ? 131 GLY A C   1 
ATOM   818   O  O   . GLY A 1 131 ? 49.856 87.532  14.025  1.00 30.56 ? 131 GLY A O   1 
ATOM   819   N  N   . PHE A 1 132 ? 51.209 85.982  14.955  1.00 28.78 ? 132 PHE A N   1 
ATOM   820   C  CA  . PHE A 1 132 ? 50.256 84.881  14.826  1.00 27.96 ? 132 PHE A CA  1 
ATOM   821   C  C   . PHE A 1 132 ? 50.392 84.108  16.135  1.00 27.80 ? 132 PHE A C   1 
ATOM   822   O  O   . PHE A 1 132 ? 50.982 83.031  16.183  1.00 27.38 ? 132 PHE A O   1 
ATOM   823   C  CB  . PHE A 1 132 ? 50.644 83.992  13.633  1.00 27.04 ? 132 PHE A CB  1 
ATOM   824   C  CG  . PHE A 1 132 ? 49.565 83.028  13.189  1.00 27.83 ? 132 PHE A CG  1 
ATOM   825   C  CD1 . PHE A 1 132 ? 48.546 82.626  14.057  1.00 28.00 ? 132 PHE A CD1 1 
ATOM   826   C  CD2 . PHE A 1 132 ? 49.604 82.470  11.909  1.00 28.11 ? 132 PHE A CD2 1 
ATOM   827   C  CE1 . PHE A 1 132 ? 47.587 81.679  13.657  1.00 28.41 ? 132 PHE A CE1 1 
ATOM   828   C  CE2 . PHE A 1 132 ? 48.646 81.519  11.503  1.00 27.20 ? 132 PHE A CE2 1 
ATOM   829   C  CZ  . PHE A 1 132 ? 47.642 81.126  12.377  1.00 27.41 ? 132 PHE A CZ  1 
ATOM   830   N  N   . ALA A 1 133 ? 49.857 84.686  17.202  1.00 28.04 ? 133 ALA A N   1 
ATOM   831   C  CA  . ALA A 1 133 ? 49.934 84.084  18.529  1.00 27.95 ? 133 ALA A CA  1 
ATOM   832   C  C   . ALA A 1 133 ? 48.812 83.090  18.782  1.00 27.83 ? 133 ALA A C   1 
ATOM   833   O  O   . ALA A 1 133 ? 47.649 83.364  18.498  1.00 29.21 ? 133 ALA A O   1 
ATOM   834   C  CB  . ALA A 1 133 ? 49.915 85.182  19.591  1.00 27.80 ? 133 ALA A CB  1 
ATOM   835   N  N   . VAL A 1 134 ? 49.165 81.938  19.334  1.00 27.49 ? 134 VAL A N   1 
ATOM   836   C  CA  . VAL A 1 134 ? 48.184 80.897  19.616  1.00 27.11 ? 134 VAL A CA  1 
ATOM   837   C  C   . VAL A 1 134 ? 48.227 80.421  21.062  1.00 27.04 ? 134 VAL A C   1 
ATOM   838   O  O   . VAL A 1 134 ? 49.267 79.997  21.550  1.00 27.62 ? 134 VAL A O   1 
ATOM   839   C  CB  . VAL A 1 134 ? 48.414 79.657  18.728  1.00 26.90 ? 134 VAL A CB  1 
ATOM   840   C  CG1 . VAL A 1 134 ? 47.349 78.623  19.017  1.00 24.99 ? 134 VAL A CG1 1 
ATOM   841   C  CG2 . VAL A 1 134 ? 48.428 80.057  17.256  1.00 26.88 ? 134 VAL A CG2 1 
ATOM   842   N  N   . LYS A 1 135 ? 47.092 80.481  21.740  1.00 26.15 ? 135 LYS A N   1 
ATOM   843   C  CA  . LYS A 1 135 ? 47.017 80.024  23.112  1.00 24.62 ? 135 LYS A CA  1 
ATOM   844   C  C   . LYS A 1 135 ? 46.241 78.709  23.132  1.00 26.11 ? 135 LYS A C   1 
ATOM   845   O  O   . LYS A 1 135 ? 45.080 78.664  22.724  1.00 25.80 ? 135 LYS A O   1 
ATOM   846   C  CB  . LYS A 1 135 ? 46.286 81.050  23.977  1.00 23.52 ? 135 LYS A CB  1 
ATOM   847   C  CG  . LYS A 1 135 ? 46.052 80.579  25.398  1.00 21.03 ? 135 LYS A CG  1 
ATOM   848   C  CD  . LYS A 1 135 ? 45.167 81.518  26.152  1.00 19.69 ? 135 LYS A CD  1 
ATOM   849   C  CE  . LYS A 1 135 ? 45.724 82.905  26.170  1.00 19.72 ? 135 LYS A CE  1 
ATOM   850   N  NZ  . LYS A 1 135 ? 47.019 82.967  26.880  1.00 20.51 ? 135 LYS A NZ  1 
ATOM   851   N  N   . PHE A 1 136 ? 46.895 77.639  23.586  1.00 27.24 ? 136 PHE A N   1 
ATOM   852   C  CA  . PHE A 1 136 ? 46.263 76.325  23.702  1.00 27.07 ? 136 PHE A CA  1 
ATOM   853   C  C   . PHE A 1 136 ? 45.879 76.140  25.170  1.00 27.68 ? 136 PHE A C   1 
ATOM   854   O  O   . PHE A 1 136 ? 46.745 76.074  26.049  1.00 27.93 ? 136 PHE A O   1 
ATOM   855   C  CB  . PHE A 1 136 ? 47.232 75.209  23.307  1.00 26.74 ? 136 PHE A CB  1 
ATOM   856   C  CG  . PHE A 1 136 ? 47.730 75.284  21.886  1.00 26.89 ? 136 PHE A CG  1 
ATOM   857   C  CD1 . PHE A 1 136 ? 48.711 76.188  21.527  1.00 25.72 ? 136 PHE A CD1 1 
ATOM   858   C  CD2 . PHE A 1 136 ? 47.240 74.410  20.918  1.00 26.38 ? 136 PHE A CD2 1 
ATOM   859   C  CE1 . PHE A 1 136 ? 49.200 76.216  20.230  1.00 26.75 ? 136 PHE A CE1 1 
ATOM   860   C  CE2 . PHE A 1 136 ? 47.726 74.438  19.623  1.00 26.38 ? 136 PHE A CE2 1 
ATOM   861   C  CZ  . PHE A 1 136 ? 48.706 75.339  19.279  1.00 26.08 ? 136 PHE A CZ  1 
ATOM   862   N  N   . TYR A 1 137 ? 44.588 76.066  25.448  1.00 28.17 ? 137 TYR A N   1 
ATOM   863   C  CA  . TYR A 1 137 ? 44.154 75.889  26.824  1.00 29.64 ? 137 TYR A CA  1 
ATOM   864   C  C   . TYR A 1 137 ? 44.221 74.407  27.201  1.00 30.66 ? 137 TYR A C   1 
ATOM   865   O  O   . TYR A 1 137 ? 43.201 73.729  27.163  1.00 31.66 ? 137 TYR A O   1 
ATOM   866   C  CB  . TYR A 1 137 ? 42.720 76.397  26.992  1.00 29.04 ? 137 TYR A CB  1 
ATOM   867   C  CG  . TYR A 1 137 ? 42.485 77.857  26.611  1.00 28.58 ? 137 TYR A CG  1 
ATOM   868   C  CD1 . TYR A 1 137 ? 42.210 78.226  25.287  1.00 28.11 ? 137 TYR A CD1 1 
ATOM   869   C  CD2 . TYR A 1 137 ? 42.483 78.860  27.588  1.00 27.01 ? 137 TYR A CD2 1 
ATOM   870   C  CE1 . TYR A 1 137 ? 41.932 79.551  24.950  1.00 26.41 ? 137 TYR A CE1 1 
ATOM   871   C  CE2 . TYR A 1 137 ? 42.213 80.175  27.267  1.00 26.53 ? 137 TYR A CE2 1 
ATOM   872   C  CZ  . TYR A 1 137 ? 41.933 80.521  25.945  1.00 28.02 ? 137 TYR A CZ  1 
ATOM   873   O  OH  . TYR A 1 137 ? 41.637 81.842  25.634  1.00 29.50 ? 137 TYR A OH  1 
ATOM   874   N  N   . THR A 1 138 ? 45.403 73.899  27.569  1.00 31.37 ? 138 THR A N   1 
ATOM   875   C  CA  . THR A 1 138 ? 45.542 72.474  27.914  1.00 31.45 ? 138 THR A CA  1 
ATOM   876   C  C   . THR A 1 138 ? 45.316 72.123  29.379  1.00 31.47 ? 138 THR A C   1 
ATOM   877   O  O   . THR A 1 138 ? 45.307 72.996  30.246  1.00 31.47 ? 138 THR A O   1 
ATOM   878   C  CB  . THR A 1 138 ? 46.927 71.908  27.514  1.00 31.09 ? 138 THR A CB  1 
ATOM   879   O  OG1 . THR A 1 138 ? 47.807 71.922  28.647  1.00 31.21 ? 138 THR A OG1 1 
ATOM   880   C  CG2 . THR A 1 138 ? 47.527 72.726  26.399  1.00 30.07 ? 138 THR A CG2 1 
ATOM   881   N  N   . GLU A 1 139 ? 45.130 70.831  29.641  1.00 31.86 ? 139 GLU A N   1 
ATOM   882   C  CA  . GLU A 1 139 ? 44.905 70.349  31.001  1.00 33.22 ? 139 GLU A CA  1 
ATOM   883   C  C   . GLU A 1 139 ? 46.184 70.505  31.819  1.00 33.08 ? 139 GLU A C   1 
ATOM   884   O  O   . GLU A 1 139 ? 46.165 70.469  33.053  1.00 33.38 ? 139 GLU A O   1 
ATOM   885   C  CB  . GLU A 1 139 ? 44.490 68.876  31.003  1.00 34.26 ? 139 GLU A CB  1 
ATOM   886   C  CG  . GLU A 1 139 ? 43.494 68.484  29.928  1.00 37.31 ? 139 GLU A CG  1 
ATOM   887   C  CD  . GLU A 1 139 ? 44.168 67.773  28.765  1.00 39.94 ? 139 GLU A CD  1 
ATOM   888   O  OE1 . GLU A 1 139 ? 44.990 68.417  28.051  1.00 39.47 ? 139 GLU A OE1 1 
ATOM   889   O  OE2 . GLU A 1 139 ? 43.878 66.562  28.583  1.00 39.65 ? 139 GLU A OE2 1 
ATOM   890   N  N   . ASP A 1 140 ? 47.303 70.666  31.120  1.00 32.76 ? 140 ASP A N   1 
ATOM   891   C  CA  . ASP A 1 140 ? 48.585 70.850  31.781  1.00 31.64 ? 140 ASP A CA  1 
ATOM   892   C  C   . ASP A 1 140 ? 48.878 72.346  31.818  1.00 30.78 ? 140 ASP A C   1 
ATOM   893   O  O   . ASP A 1 140 ? 50.035 72.771  31.873  1.00 31.09 ? 140 ASP A O   1 
ATOM   894   C  CB  . ASP A 1 140 ? 49.696 70.097  31.030  1.00 31.97 ? 140 ASP A CB  1 
ATOM   895   C  CG  . ASP A 1 140 ? 50.110 68.800  31.731  1.00 32.47 ? 140 ASP A CG  1 
ATOM   896   O  OD1 . ASP A 1 140 ? 49.583 68.509  32.833  1.00 32.37 ? 140 ASP A OD1 1 
ATOM   897   O  OD2 . ASP A 1 140 ? 50.971 68.077  31.181  1.00 32.08 ? 140 ASP A OD2 1 
ATOM   898   N  N   . GLY A 1 141 ? 47.814 73.142  31.799  1.00 29.46 ? 141 GLY A N   1 
ATOM   899   C  CA  . GLY A 1 141 ? 47.970 74.578  31.826  1.00 27.98 ? 141 GLY A CA  1 
ATOM   900   C  C   . GLY A 1 141 ? 48.034 75.115  30.418  1.00 28.30 ? 141 GLY A C   1 
ATOM   901   O  O   . GLY A 1 141 ? 48.095 74.354  29.450  1.00 27.67 ? 141 GLY A O   1 
ATOM   902   N  N   . ASN A 1 142 ? 48.025 76.434  30.296  1.00 27.94 ? 142 ASN A N   1 
ATOM   903   C  CA  . ASN A 1 142 ? 48.075 77.051  28.988  1.00 28.06 ? 142 ASN A CA  1 
ATOM   904   C  C   . ASN A 1 142 ? 49.424 76.890  28.335  1.00 27.38 ? 142 ASN A C   1 
ATOM   905   O  O   . ASN A 1 142 ? 50.451 76.925  28.993  1.00 26.81 ? 142 ASN A O   1 
ATOM   906   C  CB  . ASN A 1 142 ? 47.748 78.543  29.080  1.00 27.85 ? 142 ASN A CB  1 
ATOM   907   C  CG  . ASN A 1 142 ? 46.291 78.801  29.381  1.00 27.41 ? 142 ASN A CG  1 
ATOM   908   O  OD1 . ASN A 1 142 ? 45.473 77.890  29.408  1.00 26.78 ? 142 ASN A OD1 1 
ATOM   909   N  ND2 . ASN A 1 142 ? 45.960 80.057  29.598  1.00 29.25 ? 142 ASN A ND2 1 
ATOM   910   N  N   . TRP A 1 143 ? 49.401 76.684  27.031  1.00 27.07 ? 143 TRP A N   1 
ATOM   911   C  CA  . TRP A 1 143 ? 50.619 76.578  26.268  1.00 27.41 ? 143 TRP A CA  1 
ATOM   912   C  C   . TRP A 1 143 ? 50.486 77.727  25.297  1.00 28.59 ? 143 TRP A C   1 
ATOM   913   O  O   . TRP A 1 143 ? 49.530 77.791  24.529  1.00 29.07 ? 143 TRP A O   1 
ATOM   914   C  CB  . TRP A 1 143 ? 50.698 75.246  25.521  1.00 27.22 ? 143 TRP A CB  1 
ATOM   915   C  CG  . TRP A 1 143 ? 51.742 75.231  24.438  1.00 26.61 ? 143 TRP A CG  1 
ATOM   916   C  CD1 . TRP A 1 143 ? 52.935 75.887  24.449  1.00 26.80 ? 143 TRP A CD1 1 
ATOM   917   C  CD2 . TRP A 1 143 ? 51.681 74.534  23.187  1.00 26.50 ? 143 TRP A CD2 1 
ATOM   918   N  NE1 . TRP A 1 143 ? 53.621 75.651  23.286  1.00 26.84 ? 143 TRP A NE1 1 
ATOM   919   C  CE2 . TRP A 1 143 ? 52.877 74.822  22.490  1.00 26.91 ? 143 TRP A CE2 1 
ATOM   920   C  CE3 . TRP A 1 143 ? 50.735 73.691  22.586  1.00 27.04 ? 143 TRP A CE3 1 
ATOM   921   C  CZ2 . TRP A 1 143 ? 53.155 74.298  21.211  1.00 25.58 ? 143 TRP A CZ2 1 
ATOM   922   C  CZ3 . TRP A 1 143 ? 51.014 73.166  21.308  1.00 25.81 ? 143 TRP A CZ3 1 
ATOM   923   C  CH2 . TRP A 1 143 ? 52.216 73.477  20.641  1.00 24.82 ? 143 TRP A CH2 1 
ATOM   924   N  N   . ASP A 1 144 ? 51.420 78.662  25.358  1.00 29.69 ? 144 ASP A N   1 
ATOM   925   C  CA  . ASP A 1 144 ? 51.387 79.814  24.474  1.00 30.58 ? 144 ASP A CA  1 
ATOM   926   C  C   . ASP A 1 144 ? 52.435 79.715  23.363  1.00 30.32 ? 144 ASP A C   1 
ATOM   927   O  O   . ASP A 1 144 ? 53.634 79.745  23.610  1.00 30.67 ? 144 ASP A O   1 
ATOM   928   C  CB  . ASP A 1 144 ? 51.605 81.103  25.285  1.00 31.53 ? 144 ASP A CB  1 
ATOM   929   C  CG  . ASP A 1 144 ? 50.349 81.576  25.997  1.00 31.81 ? 144 ASP A CG  1 
ATOM   930   O  OD1 . ASP A 1 144 ? 50.461 82.306  27.003  1.00 31.97 ? 144 ASP A OD1 1 
ATOM   931   O  OD2 . ASP A 1 144 ? 49.244 81.232  25.544  1.00 32.94 ? 144 ASP A OD2 1 
ATOM   932   N  N   . LEU A 1 145 ? 51.981 79.583  22.134  1.00 30.34 ? 145 LEU A N   1 
ATOM   933   C  CA  . LEU A 1 145 ? 52.908 79.529  21.026  1.00 31.32 ? 145 LEU A CA  1 
ATOM   934   C  C   . LEU A 1 145 ? 52.820 80.891  20.355  1.00 32.14 ? 145 LEU A C   1 
ATOM   935   O  O   . LEU A 1 145 ? 51.970 81.107  19.488  1.00 33.26 ? 145 LEU A O   1 
ATOM   936   C  CB  . LEU A 1 145 ? 52.505 78.432  20.047  1.00 30.93 ? 145 LEU A CB  1 
ATOM   937   C  CG  . LEU A 1 145 ? 53.507 78.262  18.912  1.00 31.86 ? 145 LEU A CG  1 
ATOM   938   C  CD1 . LEU A 1 145 ? 54.881 77.983  19.502  1.00 31.09 ? 145 LEU A CD1 1 
ATOM   939   C  CD2 . LEU A 1 145 ? 53.067 77.133  17.992  1.00 31.70 ? 145 LEU A CD2 1 
ATOM   940   N  N   . VAL A 1 146 ? 53.696 81.809  20.758  1.00 32.54 ? 146 VAL A N   1 
ATOM   941   C  CA  . VAL A 1 146 ? 53.697 83.167  20.215  1.00 32.25 ? 146 VAL A CA  1 
ATOM   942   C  C   . VAL A 1 146 ? 54.555 83.307  18.956  1.00 33.02 ? 146 VAL A C   1 
ATOM   943   O  O   . VAL A 1 146 ? 55.715 83.692  19.038  1.00 33.27 ? 146 VAL A O   1 
ATOM   944   C  CB  . VAL A 1 146 ? 54.211 84.177  21.277  1.00 31.60 ? 146 VAL A CB  1 
ATOM   945   C  CG1 . VAL A 1 146 ? 53.802 85.602  20.891  1.00 30.67 ? 146 VAL A CG1 1 
ATOM   946   C  CG2 . VAL A 1 146 ? 53.679 83.811  22.655  1.00 30.46 ? 146 VAL A CG2 1 
ATOM   947   N  N   . GLY A 1 147 ? 53.998 83.021  17.788  1.00 33.37 ? 147 GLY A N   1 
ATOM   948   C  CA  . GLY A 1 147 ? 54.815 83.136  16.590  1.00 35.67 ? 147 GLY A CA  1 
ATOM   949   C  C   . GLY A 1 147 ? 54.354 84.155  15.566  1.00 37.44 ? 147 GLY A C   1 
ATOM   950   O  O   . GLY A 1 147 ? 53.507 84.999  15.856  1.00 38.24 ? 147 GLY A O   1 
ATOM   951   N  N   . ASN A 1 148 ? 54.941 84.122  14.373  1.00 38.47 ? 148 ASN A N   1 
ATOM   952   C  CA  . ASN A 1 148 ? 54.489 85.026  13.332  1.00 40.12 ? 148 ASN A CA  1 
ATOM   953   C  C   . ASN A 1 148 ? 54.648 84.457  11.927  1.00 40.02 ? 148 ASN A C   1 
ATOM   954   O  O   . ASN A 1 148 ? 55.118 83.338  11.762  1.00 39.99 ? 148 ASN A O   1 
ATOM   955   C  CB  . ASN A 1 148 ? 55.101 86.437  13.466  1.00 42.05 ? 148 ASN A CB  1 
ATOM   956   C  CG  . ASN A 1 148 ? 56.578 86.431  13.617  1.00 43.74 ? 148 ASN A CG  1 
ATOM   957   O  OD1 . ASN A 1 148 ? 57.268 85.687  12.936  1.00 46.54 ? 148 ASN A OD1 1 
ATOM   958   N  ND2 . ASN A 1 148 ? 57.090 87.288  14.499  1.00 44.10 ? 148 ASN A ND2 1 
ATOM   959   N  N   . ASN A 1 149 ? 54.213 85.217  10.926  1.00 39.74 ? 149 ASN A N   1 
ATOM   960   C  CA  . ASN A 1 149 ? 54.235 84.761  9.542   1.00 40.03 ? 149 ASN A CA  1 
ATOM   961   C  C   . ASN A 1 149 ? 55.600 84.502  8.919   1.00 39.76 ? 149 ASN A C   1 
ATOM   962   O  O   . ASN A 1 149 ? 55.705 84.298  7.713   1.00 39.81 ? 149 ASN A O   1 
ATOM   963   C  CB  . ASN A 1 149 ? 53.456 85.743  8.672   1.00 40.49 ? 149 ASN A CB  1 
ATOM   964   C  CG  . ASN A 1 149 ? 54.138 87.072  8.558   1.00 41.02 ? 149 ASN A CG  1 
ATOM   965   O  OD1 . ASN A 1 149 ? 54.698 87.579  9.527   1.00 41.74 ? 149 ASN A OD1 1 
ATOM   966   N  ND2 . ASN A 1 149 ? 54.088 87.660  7.372   1.00 42.49 ? 149 ASN A ND2 1 
ATOM   967   N  N   . THR A 1 150 ? 56.647 84.512  9.730   1.00 39.04 ? 150 THR A N   1 
ATOM   968   C  CA  . THR A 1 150 ? 57.973 84.246  9.208   1.00 38.53 ? 150 THR A CA  1 
ATOM   969   C  C   . THR A 1 150 ? 58.715 83.294  10.130  1.00 38.09 ? 150 THR A C   1 
ATOM   970   O  O   . THR A 1 150 ? 58.541 83.323  11.348  1.00 37.45 ? 150 THR A O   1 
ATOM   971   C  CB  . THR A 1 150 ? 58.799 85.528  9.046   1.00 38.88 ? 150 THR A CB  1 
ATOM   972   O  OG1 . THR A 1 150 ? 60.097 85.186  8.545   1.00 40.21 ? 150 THR A OG1 1 
ATOM   973   C  CG2 . THR A 1 150 ? 58.948 86.241  10.376  1.00 38.94 ? 150 THR A CG2 1 
ATOM   974   N  N   . PRO A 1 151 ? 59.547 82.420  9.550   1.00 37.60 ? 151 PRO A N   1 
ATOM   975   C  CA  . PRO A 1 151 ? 60.320 81.450  10.325  1.00 36.79 ? 151 PRO A CA  1 
ATOM   976   C  C   . PRO A 1 151 ? 61.545 82.086  10.953  1.00 36.57 ? 151 PRO A C   1 
ATOM   977   O  O   . PRO A 1 151 ? 62.142 81.529  11.863  1.00 36.78 ? 151 PRO A O   1 
ATOM   978   C  CB  . PRO A 1 151 ? 60.701 80.420  9.280   1.00 36.32 ? 151 PRO A CB  1 
ATOM   979   C  CG  . PRO A 1 151 ? 60.927 81.272  8.082   1.00 36.63 ? 151 PRO A CG  1 
ATOM   980   C  CD  . PRO A 1 151 ? 59.766 82.231  8.105   1.00 36.30 ? 151 PRO A CD  1 
ATOM   981   N  N   . ILE A 1 152 ? 61.913 83.262  10.464  1.00 36.35 ? 152 ILE A N   1 
ATOM   982   C  CA  . ILE A 1 152 ? 63.099 83.943  10.964  1.00 36.08 ? 152 ILE A CA  1 
ATOM   983   C  C   . ILE A 1 152 ? 62.843 85.365  11.442  1.00 35.96 ? 152 ILE A C   1 
ATOM   984   O  O   . ILE A 1 152 ? 61.715 85.863  11.380  1.00 36.04 ? 152 ILE A O   1 
ATOM   985   C  CB  . ILE A 1 152 ? 64.153 84.005  9.872   1.00 35.31 ? 152 ILE A CB  1 
ATOM   986   C  CG1 . ILE A 1 152 ? 63.529 84.630  8.627   1.00 35.03 ? 152 ILE A CG1 1 
ATOM   987   C  CG2 . ILE A 1 152 ? 64.673 82.615  9.578   1.00 34.36 ? 152 ILE A CG2 1 
ATOM   988   C  CD1 . ILE A 1 152 ? 64.515 84.929  7.522   1.00 35.85 ? 152 ILE A CD1 1 
ATOM   989   N  N   . PHE A 1 153 ? 63.903 86.013  11.919  1.00 35.51 ? 153 PHE A N   1 
ATOM   990   C  CA  . PHE A 1 153 ? 63.797 87.389  12.386  1.00 35.26 ? 153 PHE A CA  1 
ATOM   991   C  C   . PHE A 1 153 ? 65.033 88.205  11.981  1.00 34.84 ? 153 PHE A C   1 
ATOM   992   O  O   . PHE A 1 153 ? 66.004 87.665  11.451  1.00 34.77 ? 153 PHE A O   1 
ATOM   993   C  CB  . PHE A 1 153 ? 63.596 87.424  13.907  1.00 35.72 ? 153 PHE A CB  1 
ATOM   994   C  CG  . PHE A 1 153 ? 62.931 88.679  14.392  1.00 35.77 ? 153 PHE A CG  1 
ATOM   995   C  CD1 . PHE A 1 153 ? 61.602 88.941  14.072  1.00 35.49 ? 153 PHE A CD1 1 
ATOM   996   C  CD2 . PHE A 1 153 ? 63.651 89.639  15.098  1.00 35.70 ? 153 PHE A CD2 1 
ATOM   997   C  CE1 . PHE A 1 153 ? 61.000 90.143  14.434  1.00 35.96 ? 153 PHE A CE1 1 
ATOM   998   C  CE2 . PHE A 1 153 ? 63.056 90.847  15.465  1.00 35.40 ? 153 PHE A CE2 1 
ATOM   999   C  CZ  . PHE A 1 153 ? 61.727 91.099  15.129  1.00 34.73 ? 153 PHE A CZ  1 
ATOM   1000  N  N   . PHE A 1 154 ? 64.986 89.509  12.233  1.00 34.63 ? 154 PHE A N   1 
ATOM   1001  C  CA  . PHE A 1 154 ? 66.065 90.438  11.872  1.00 33.27 ? 154 PHE A CA  1 
ATOM   1002  C  C   . PHE A 1 154 ? 67.306 90.366  12.738  1.00 32.50 ? 154 PHE A C   1 
ATOM   1003  O  O   . PHE A 1 154 ? 68.394 90.699  12.286  1.00 32.33 ? 154 PHE A O   1 
ATOM   1004  C  CB  . PHE A 1 154 ? 65.563 91.878  11.946  1.00 33.25 ? 154 PHE A CB  1 
ATOM   1005  C  CG  . PHE A 1 154 ? 64.323 92.132  11.162  1.00 33.45 ? 154 PHE A CG  1 
ATOM   1006  C  CD1 . PHE A 1 154 ? 64.398 92.510  9.822   1.00 33.56 ? 154 PHE A CD1 1 
ATOM   1007  C  CD2 . PHE A 1 154 ? 63.074 92.005  11.763  1.00 33.58 ? 154 PHE A CD2 1 
ATOM   1008  C  CE1 . PHE A 1 154 ? 63.249 92.764  9.088   1.00 33.47 ? 154 PHE A CE1 1 
ATOM   1009  C  CE2 . PHE A 1 154 ? 61.914 92.253  11.042  1.00 34.16 ? 154 PHE A CE2 1 
ATOM   1010  C  CZ  . PHE A 1 154 ? 62.000 92.637  9.695   1.00 34.13 ? 154 PHE A CZ  1 
ATOM   1011  N  N   . ILE A 1 155 ? 67.144 89.980  13.995  1.00 32.07 ? 155 ILE A N   1 
ATOM   1012  C  CA  . ILE A 1 155 ? 68.287 89.914  14.899  1.00 32.02 ? 155 ILE A CA  1 
ATOM   1013  C  C   . ILE A 1 155 ? 68.284 88.614  15.675  1.00 32.83 ? 155 ILE A C   1 
ATOM   1014  O  O   . ILE A 1 155 ? 67.262 87.928  15.745  1.00 32.97 ? 155 ILE A O   1 
ATOM   1015  C  CB  . ILE A 1 155 ? 68.287 91.095  15.893  1.00 30.84 ? 155 ILE A CB  1 
ATOM   1016  C  CG1 . ILE A 1 155 ? 66.983 91.122  16.689  1.00 29.30 ? 155 ILE A CG1 1 
ATOM   1017  C  CG2 . ILE A 1 155 ? 68.440 92.407  15.141  1.00 30.65 ? 155 ILE A CG2 1 
ATOM   1018  C  CD1 . ILE A 1 155 ? 66.899 92.272  17.644  1.00 27.48 ? 155 ILE A CD1 1 
ATOM   1019  N  N   . ARG A 1 156 ? 69.424 88.271  16.263  1.00 33.07 ? 156 ARG A N   1 
ATOM   1020  C  CA  . ARG A 1 156 ? 69.505 87.030  17.008  1.00 32.99 ? 156 ARG A CA  1 
ATOM   1021  C  C   . ARG A 1 156 ? 69.951 87.172  18.453  1.00 33.12 ? 156 ARG A C   1 
ATOM   1022  O  O   . ARG A 1 156 ? 70.332 86.191  19.087  1.00 33.26 ? 156 ARG A O   1 
ATOM   1023  C  CB  . ARG A 1 156 ? 70.400 86.039  16.275  1.00 33.57 ? 156 ARG A CB  1 
ATOM   1024  C  CG  . ARG A 1 156 ? 71.714 86.608  15.806  1.00 34.16 ? 156 ARG A CG  1 
ATOM   1025  C  CD  . ARG A 1 156 ? 72.525 85.533  15.119  1.00 35.06 ? 156 ARG A CD  1 
ATOM   1026  N  NE  . ARG A 1 156 ? 73.640 86.110  14.388  1.00 37.41 ? 156 ARG A NE  1 
ATOM   1027  C  CZ  . ARG A 1 156 ? 73.648 86.338  13.077  1.00 38.06 ? 156 ARG A CZ  1 
ATOM   1028  N  NH1 . ARG A 1 156 ? 72.597 86.026  12.327  1.00 36.89 ? 156 ARG A NH1 1 
ATOM   1029  N  NH2 . ARG A 1 156 ? 74.712 86.908  12.522  1.00 37.64 ? 156 ARG A NH2 1 
ATOM   1030  N  N   . ASP A 1 157 ? 69.936 88.395  18.964  1.00 32.22 ? 157 ASP A N   1 
ATOM   1031  C  CA  . ASP A 1 157 ? 70.267 88.617  20.361  1.00 32.09 ? 157 ASP A CA  1 
ATOM   1032  C  C   . ASP A 1 157 ? 69.233 89.604  20.904  1.00 32.46 ? 157 ASP A C   1 
ATOM   1033  O  O   . ASP A 1 157 ? 69.146 90.754  20.456  1.00 32.48 ? 157 ASP A O   1 
ATOM   1034  C  CB  . ASP A 1 157 ? 71.679 89.164  20.550  1.00 31.48 ? 157 ASP A CB  1 
ATOM   1035  C  CG  . ASP A 1 157 ? 72.092 89.164  22.014  1.00 31.57 ? 157 ASP A CG  1 
ATOM   1036  O  OD1 . ASP A 1 157 ? 71.440 89.874  22.802  1.00 32.44 ? 157 ASP A OD1 1 
ATOM   1037  O  OD2 . ASP A 1 157 ? 73.041 88.443  22.392  1.00 30.64 ? 157 ASP A OD2 1 
ATOM   1038  N  N   . PRO A 1 158 ? 68.438 89.163  21.887  1.00 31.71 ? 158 PRO A N   1 
ATOM   1039  C  CA  . PRO A 1 158 ? 67.378 89.941  22.533  1.00 31.22 ? 158 PRO A CA  1 
ATOM   1040  C  C   . PRO A 1 158 ? 67.742 91.344  23.040  1.00 31.48 ? 158 PRO A C   1 
ATOM   1041  O  O   . PRO A 1 158 ? 66.868 92.201  23.196  1.00 31.27 ? 158 PRO A O   1 
ATOM   1042  C  CB  . PRO A 1 158 ? 66.931 89.022  23.659  1.00 31.28 ? 158 PRO A CB  1 
ATOM   1043  C  CG  . PRO A 1 158 ? 68.207 88.358  24.039  1.00 31.38 ? 158 PRO A CG  1 
ATOM   1044  C  CD  . PRO A 1 158 ? 68.767 87.977  22.693  1.00 31.17 ? 158 PRO A CD  1 
ATOM   1045  N  N   . ILE A 1 159 ? 69.019 91.591  23.294  1.00 31.89 ? 159 ILE A N   1 
ATOM   1046  C  CA  . ILE A 1 159 ? 69.419 92.891  23.802  1.00 32.47 ? 159 ILE A CA  1 
ATOM   1047  C  C   . ILE A 1 159 ? 69.370 93.991  22.738  1.00 32.70 ? 159 ILE A C   1 
ATOM   1048  O  O   . ILE A 1 159 ? 69.447 95.181  23.057  1.00 33.09 ? 159 ILE A O   1 
ATOM   1049  C  CB  . ILE A 1 159 ? 70.822 92.823  24.405  1.00 32.66 ? 159 ILE A CB  1 
ATOM   1050  C  CG1 . ILE A 1 159 ? 70.946 93.846  25.543  1.00 33.18 ? 159 ILE A CG1 1 
ATOM   1051  C  CG2 . ILE A 1 159 ? 71.864 93.101  23.332  1.00 33.10 ? 159 ILE A CG2 1 
ATOM   1052  C  CD1 . ILE A 1 159 ? 72.228 93.702  26.366  1.00 31.51 ? 159 ILE A CD1 1 
ATOM   1053  N  N   . LEU A 1 160 ? 69.236 93.584  21.480  1.00 32.85 ? 160 LEU A N   1 
ATOM   1054  C  CA  . LEU A 1 160 ? 69.162 94.512  20.353  1.00 33.02 ? 160 LEU A CA  1 
ATOM   1055  C  C   . LEU A 1 160 ? 67.711 94.823  20.014  1.00 32.87 ? 160 LEU A C   1 
ATOM   1056  O  O   . LEU A 1 160 ? 67.427 95.748  19.251  1.00 32.87 ? 160 LEU A O   1 
ATOM   1057  C  CB  . LEU A 1 160 ? 69.801 93.894  19.099  1.00 34.32 ? 160 LEU A CB  1 
ATOM   1058  C  CG  . LEU A 1 160 ? 71.305 93.692  18.856  1.00 34.58 ? 160 LEU A CG  1 
ATOM   1059  C  CD1 . LEU A 1 160 ? 71.797 94.701  17.826  1.00 34.06 ? 160 LEU A CD1 1 
ATOM   1060  C  CD2 . LEU A 1 160 ? 72.066 93.805  20.163  1.00 36.20 ? 160 LEU A CD2 1 
ATOM   1061  N  N   . PHE A 1 161 ? 66.791 94.050  20.581  1.00 32.72 ? 161 PHE A N   1 
ATOM   1062  C  CA  . PHE A 1 161 ? 65.378 94.210  20.262  1.00 32.35 ? 161 PHE A CA  1 
ATOM   1063  C  C   . PHE A 1 161 ? 64.803 95.604  20.484  1.00 31.94 ? 161 PHE A C   1 
ATOM   1064  O  O   . PHE A 1 161 ? 64.231 96.191  19.560  1.00 31.96 ? 161 PHE A O   1 
ATOM   1065  C  CB  . PHE A 1 161 ? 64.536 93.147  20.995  1.00 31.88 ? 161 PHE A CB  1 
ATOM   1066  C  CG  . PHE A 1 161 ? 63.104 93.073  20.519  1.00 32.36 ? 161 PHE A CG  1 
ATOM   1067  C  CD1 . PHE A 1 161 ? 62.061 93.568  21.308  1.00 31.57 ? 161 PHE A CD1 1 
ATOM   1068  C  CD2 . PHE A 1 161 ? 62.798 92.547  19.255  1.00 32.28 ? 161 PHE A CD2 1 
ATOM   1069  C  CE1 . PHE A 1 161 ? 60.742 93.540  20.844  1.00 31.63 ? 161 PHE A CE1 1 
ATOM   1070  C  CE2 . PHE A 1 161 ? 61.476 92.514  18.782  1.00 30.65 ? 161 PHE A CE2 1 
ATOM   1071  C  CZ  . PHE A 1 161 ? 60.451 93.009  19.572  1.00 31.10 ? 161 PHE A CZ  1 
ATOM   1072  N  N   . PRO A 1 162 ? 64.940 96.156  21.700  1.00 31.29 ? 162 PRO A N   1 
ATOM   1073  C  CA  . PRO A 1 162 ? 64.404 97.494  21.968  1.00 30.88 ? 162 PRO A CA  1 
ATOM   1074  C  C   . PRO A 1 162 ? 64.930 98.551  20.999  1.00 30.77 ? 162 PRO A C   1 
ATOM   1075  O  O   . PRO A 1 162 ? 64.206 99.456  20.603  1.00 30.34 ? 162 PRO A O   1 
ATOM   1076  C  CB  . PRO A 1 162 ? 64.837 97.753  23.404  1.00 30.41 ? 162 PRO A CB  1 
ATOM   1077  C  CG  . PRO A 1 162 ? 64.828 96.391  23.998  1.00 31.20 ? 162 PRO A CG  1 
ATOM   1078  C  CD  . PRO A 1 162 ? 65.515 95.577  22.924  1.00 31.57 ? 162 PRO A CD  1 
ATOM   1079  N  N   . SER A 1 163 ? 66.199 98.439  20.620  1.00 31.76 ? 163 SER A N   1 
ATOM   1080  C  CA  . SER A 1 163 ? 66.770 99.393  19.686  1.00 32.31 ? 163 SER A CA  1 
ATOM   1081  C  C   . SER A 1 163 ? 66.145 99.175  18.321  1.00 32.88 ? 163 SER A C   1 
ATOM   1082  O  O   . SER A 1 163 ? 65.783 100.140 17.635  1.00 33.16 ? 163 SER A O   1 
ATOM   1083  C  CB  . SER A 1 163 ? 68.282 99.229  19.600  1.00 32.62 ? 163 SER A CB  1 
ATOM   1084  O  OG  . SER A 1 163 ? 68.898 99.675  20.795  1.00 35.06 ? 163 SER A OG  1 
ATOM   1085  N  N   . PHE A 1 164 ? 66.001 97.909  17.935  1.00 32.37 ? 164 PHE A N   1 
ATOM   1086  C  CA  . PHE A 1 164 ? 65.415 97.595  16.643  1.00 32.91 ? 164 PHE A CA  1 
ATOM   1087  C  C   . PHE A 1 164 ? 63.994 98.127  16.556  1.00 33.55 ? 164 PHE A C   1 
ATOM   1088  O  O   . PHE A 1 164 ? 63.588 98.693  15.535  1.00 34.10 ? 164 PHE A O   1 
ATOM   1089  C  CB  . PHE A 1 164 ? 65.409 96.092  16.398  1.00 33.18 ? 164 PHE A CB  1 
ATOM   1090  C  CG  . PHE A 1 164 ? 64.515 95.675  15.262  1.00 33.64 ? 164 PHE A CG  1 
ATOM   1091  C  CD1 . PHE A 1 164 ? 64.769 96.106  13.966  1.00 33.30 ? 164 PHE A CD1 1 
ATOM   1092  C  CD2 . PHE A 1 164 ? 63.391 94.893  15.495  1.00 33.12 ? 164 PHE A CD2 1 
ATOM   1093  C  CE1 . PHE A 1 164 ? 63.915 95.764  12.922  1.00 33.47 ? 164 PHE A CE1 1 
ATOM   1094  C  CE2 . PHE A 1 164 ? 62.537 94.553  14.455  1.00 33.55 ? 164 PHE A CE2 1 
ATOM   1095  C  CZ  . PHE A 1 164 ? 62.798 94.989  13.170  1.00 32.64 ? 164 PHE A CZ  1 
ATOM   1096  N  N   . ILE A 1 165 ? 63.237 97.944  17.630  1.00 33.38 ? 165 ILE A N   1 
ATOM   1097  C  CA  . ILE A 1 165 ? 61.863 98.409  17.665  1.00 32.73 ? 165 ILE A CA  1 
ATOM   1098  C  C   . ILE A 1 165 ? 61.851 99.928  17.640  1.00 32.92 ? 165 ILE A C   1 
ATOM   1099  O  O   . ILE A 1 165 ? 61.038 100.551 16.952  1.00 32.86 ? 165 ILE A O   1 
ATOM   1100  C  CB  . ILE A 1 165 ? 61.151 97.885  18.925  1.00 32.27 ? 165 ILE A CB  1 
ATOM   1101  C  CG1 . ILE A 1 165 ? 60.978 96.367  18.800  1.00 32.13 ? 165 ILE A CG1 1 
ATOM   1102  C  CG2 . ILE A 1 165 ? 59.828 98.592  19.130  1.00 31.00 ? 165 ILE A CG2 1 
ATOM   1103  C  CD1 . ILE A 1 165 ? 60.376 95.915  17.476  1.00 30.25 ? 165 ILE A CD1 1 
ATOM   1104  N  N   . HIS A 1 166 ? 62.762 100.534 18.384  1.00 32.12 ? 166 HIS A N   1 
ATOM   1105  C  CA  . HIS A 1 166 ? 62.817 101.972 18.385  1.00 31.66 ? 166 HIS A CA  1 
ATOM   1106  C  C   . HIS A 1 166 ? 63.028 102.430 16.955  1.00 31.60 ? 166 HIS A C   1 
ATOM   1107  O  O   . HIS A 1 166 ? 62.246 103.209 16.424  1.00 32.30 ? 166 HIS A O   1 
ATOM   1108  C  CB  . HIS A 1 166 ? 63.954 102.454 19.269  1.00 31.73 ? 166 HIS A CB  1 
ATOM   1109  C  CG  . HIS A 1 166 ? 63.621 102.444 20.723  1.00 32.00 ? 166 HIS A CG  1 
ATOM   1110  N  ND1 . HIS A 1 166 ? 64.493 102.894 21.691  1.00 32.11 ? 166 HIS A ND1 1 
ATOM   1111  C  CD2 . HIS A 1 166 ? 62.505 102.047 21.378  1.00 32.03 ? 166 HIS A CD2 1 
ATOM   1112  C  CE1 . HIS A 1 166 ? 63.928 102.774 22.879  1.00 31.41 ? 166 HIS A CE1 1 
ATOM   1113  N  NE2 . HIS A 1 166 ? 62.722 102.263 22.717  1.00 31.47 ? 166 HIS A NE2 1 
ATOM   1114  N  N   . SER A 1 167 ? 64.073 101.917 16.321  1.00 31.19 ? 167 SER A N   1 
ATOM   1115  C  CA  . SER A 1 167 ? 64.387 102.298 14.955  1.00 30.44 ? 167 SER A CA  1 
ATOM   1116  C  C   . SER A 1 167 ? 63.251 102.044 14.001  1.00 30.50 ? 167 SER A C   1 
ATOM   1117  O  O   . SER A 1 167 ? 63.266 102.555 12.890  1.00 31.07 ? 167 SER A O   1 
ATOM   1118  C  CB  . SER A 1 167 ? 65.612 101.545 14.459  1.00 29.77 ? 167 SER A CB  1 
ATOM   1119  O  OG  . SER A 1 167 ? 65.322 100.172 14.335  1.00 30.13 ? 167 SER A OG  1 
ATOM   1120  N  N   . GLN A 1 168 ? 62.269 101.257 14.425  1.00 30.75 ? 168 GLN A N   1 
ATOM   1121  C  CA  . GLN A 1 168 ? 61.127 100.934 13.568  1.00 31.71 ? 168 GLN A CA  1 
ATOM   1122  C  C   . GLN A 1 168 ? 59.941 101.854 13.799  1.00 32.23 ? 168 GLN A C   1 
ATOM   1123  O  O   . GLN A 1 168 ? 59.012 101.924 12.990  1.00 32.61 ? 168 GLN A O   1 
ATOM   1124  C  CB  . GLN A 1 168 ? 60.674 99.484  13.787  1.00 31.12 ? 168 GLN A CB  1 
ATOM   1125  C  CG  . GLN A 1 168 ? 61.527 98.412  13.098  1.00 31.74 ? 168 GLN A CG  1 
ATOM   1126  C  CD  . GLN A 1 168 ? 61.423 98.456  11.581  1.00 31.24 ? 168 GLN A CD  1 
ATOM   1127  O  OE1 . GLN A 1 168 ? 60.336 98.379  11.018  1.00 32.47 ? 168 GLN A OE1 1 
ATOM   1128  N  NE2 . GLN A 1 168 ? 62.560 98.574  10.917  1.00 32.59 ? 168 GLN A NE2 1 
ATOM   1129  N  N   . LYS A 1 169 ? 59.974 102.571 14.905  1.00 32.48 ? 169 LYS A N   1 
ATOM   1130  C  CA  . LYS A 1 169 ? 58.872 103.446 15.221  1.00 32.74 ? 169 LYS A CA  1 
ATOM   1131  C  C   . LYS A 1 169 ? 59.212 104.910 14.992  1.00 32.88 ? 169 LYS A C   1 
ATOM   1132  O  O   . LYS A 1 169 ? 60.158 105.229 14.287  1.00 33.64 ? 169 LYS A O   1 
ATOM   1133  C  CB  . LYS A 1 169 ? 58.422 103.180 16.660  1.00 33.17 ? 169 LYS A CB  1 
ATOM   1134  C  CG  . LYS A 1 169 ? 57.794 101.801 16.844  1.00 31.14 ? 169 LYS A CG  1 
ATOM   1135  C  CD  . LYS A 1 169 ? 57.686 101.455 18.310  1.00 31.11 ? 169 LYS A CD  1 
ATOM   1136  C  CE  . LYS A 1 169 ? 56.739 100.282 18.557  1.00 31.41 ? 169 LYS A CE  1 
ATOM   1137  N  NZ  . LYS A 1 169 ? 55.310 100.599 18.228  1.00 31.81 ? 169 LYS A NZ  1 
ATOM   1138  N  N   . ARG A 1 170 ? 58.440 105.797 15.597  1.00 33.05 ? 170 ARG A N   1 
ATOM   1139  C  CA  . ARG A 1 170 ? 58.622 107.225 15.414  1.00 33.09 ? 170 ARG A CA  1 
ATOM   1140  C  C   . ARG A 1 170 ? 59.889 107.876 15.967  1.00 33.51 ? 170 ARG A C   1 
ATOM   1141  O  O   . ARG A 1 170 ? 60.448 107.447 16.974  1.00 33.61 ? 170 ARG A O   1 
ATOM   1142  C  CB  . ARG A 1 170 ? 57.395 107.926 15.981  1.00 33.45 ? 170 ARG A CB  1 
ATOM   1143  C  CG  . ARG A 1 170 ? 56.099 107.365 15.430  1.00 32.90 ? 170 ARG A CG  1 
ATOM   1144  C  CD  . ARG A 1 170 ? 54.909 107.673 16.311  1.00 33.10 ? 170 ARG A CD  1 
ATOM   1145  N  NE  . ARG A 1 170 ? 53.697 107.174 15.679  1.00 34.28 ? 170 ARG A NE  1 
ATOM   1146  C  CZ  . ARG A 1 170 ? 53.061 107.800 14.693  1.00 35.01 ? 170 ARG A CZ  1 
ATOM   1147  N  NH1 . ARG A 1 170 ? 53.519 108.962 14.236  1.00 34.17 ? 170 ARG A NH1 1 
ATOM   1148  N  NH2 . ARG A 1 170 ? 51.983 107.251 14.142  1.00 34.92 ? 170 ARG A NH2 1 
ATOM   1149  N  N   . ASN A 1 171 ? 60.331 108.926 15.284  1.00 34.19 ? 171 ASN A N   1 
ATOM   1150  C  CA  . ASN A 1 171 ? 61.497 109.710 15.686  1.00 34.42 ? 171 ASN A CA  1 
ATOM   1151  C  C   . ASN A 1 171 ? 61.149 110.301 17.068  1.00 34.09 ? 171 ASN A C   1 
ATOM   1152  O  O   . ASN A 1 171 ? 60.074 110.889 17.246  1.00 34.52 ? 171 ASN A O   1 
ATOM   1153  C  CB  . ASN A 1 171 ? 61.722 110.803 14.631  1.00 35.83 ? 171 ASN A CB  1 
ATOM   1154  C  CG  . ASN A 1 171 ? 62.862 111.738 14.972  1.00 37.42 ? 171 ASN A CG  1 
ATOM   1155  O  OD1 . ASN A 1 171 ? 62.747 112.577 15.877  1.00 39.16 ? 171 ASN A OD1 1 
ATOM   1156  N  ND2 . ASN A 1 171 ? 63.973 111.607 14.246  1.00 36.76 ? 171 ASN A ND2 1 
ATOM   1157  N  N   . PRO A 1 172 ? 62.049 110.161 18.058  1.00 33.31 ? 172 PRO A N   1 
ATOM   1158  C  CA  . PRO A 1 172 ? 61.771 110.684 19.399  1.00 33.15 ? 172 PRO A CA  1 
ATOM   1159  C  C   . PRO A 1 172 ? 61.402 112.150 19.488  1.00 33.99 ? 172 PRO A C   1 
ATOM   1160  O  O   . PRO A 1 172 ? 60.759 112.570 20.463  1.00 34.14 ? 172 PRO A O   1 
ATOM   1161  C  CB  . PRO A 1 172 ? 63.036 110.338 20.182  1.00 32.57 ? 172 PRO A CB  1 
ATOM   1162  C  CG  . PRO A 1 172 ? 64.088 110.348 19.148  1.00 33.09 ? 172 PRO A CG  1 
ATOM   1163  C  CD  . PRO A 1 172 ? 63.438 109.684 17.961  1.00 33.06 ? 172 PRO A CD  1 
ATOM   1164  N  N   . GLN A 1 173 ? 61.783 112.933 18.477  1.00 34.42 ? 173 GLN A N   1 
ATOM   1165  C  CA  . GLN A 1 173 ? 61.461 114.358 18.490  1.00 34.60 ? 173 GLN A CA  1 
ATOM   1166  C  C   . GLN A 1 173 ? 60.309 114.783 17.593  1.00 34.19 ? 173 GLN A C   1 
ATOM   1167  O  O   . GLN A 1 173 ? 59.382 115.443 18.046  1.00 33.53 ? 173 GLN A O   1 
ATOM   1168  C  CB  . GLN A 1 173 ? 62.680 115.207 18.136  1.00 35.78 ? 173 GLN A CB  1 
ATOM   1169  C  CG  . GLN A 1 173 ? 62.279 116.628 17.751  1.00 38.01 ? 173 GLN A CG  1 
ATOM   1170  C  CD  . GLN A 1 173 ? 63.447 117.570 17.624  1.00 39.53 ? 173 GLN A CD  1 
ATOM   1171  O  OE1 . GLN A 1 173 ? 64.414 117.291 16.914  1.00 39.89 ? 173 GLN A OE1 1 
ATOM   1172  N  NE2 . GLN A 1 173 ? 63.357 118.713 18.305  1.00 40.71 ? 173 GLN A NE2 1 
ATOM   1173  N  N   . THR A 1 174 ? 60.369 114.418 16.321  1.00 34.26 ? 174 THR A N   1 
ATOM   1174  C  CA  . THR A 1 174 ? 59.321 114.803 15.390  1.00 34.72 ? 174 THR A CA  1 
ATOM   1175  C  C   . THR A 1 174 ? 58.107 113.893 15.496  1.00 35.52 ? 174 THR A C   1 
ATOM   1176  O  O   . THR A 1 174 ? 57.001 114.264 15.092  1.00 35.37 ? 174 THR A O   1 
ATOM   1177  C  CB  . THR A 1 174 ? 59.833 114.767 13.948  1.00 35.43 ? 174 THR A CB  1 
ATOM   1178  O  OG1 . THR A 1 174 ? 60.180 113.419 13.593  1.00 36.33 ? 174 THR A OG1 1 
ATOM   1179  C  CG2 . THR A 1 174 ? 61.066 115.659 13.808  1.00 34.81 ? 174 THR A CG2 1 
ATOM   1180  N  N   . HIS A 1 175 ? 58.321 112.693 16.035  1.00 35.81 ? 175 HIS A N   1 
ATOM   1181  C  CA  . HIS A 1 175 ? 57.246 111.721 16.196  1.00 35.40 ? 175 HIS A CA  1 
ATOM   1182  C  C   . HIS A 1 175 ? 56.791 111.236 14.818  1.00 35.73 ? 175 HIS A C   1 
ATOM   1183  O  O   . HIS A 1 175 ? 55.601 111.002 14.583  1.00 35.99 ? 175 HIS A O   1 
ATOM   1184  C  CB  . HIS A 1 175 ? 56.065 112.363 16.942  1.00 34.12 ? 175 HIS A CB  1 
ATOM   1185  C  CG  . HIS A 1 175 ? 55.146 111.372 17.576  1.00 32.97 ? 175 HIS A CG  1 
ATOM   1186  N  ND1 . HIS A 1 175 ? 55.566 110.487 18.547  1.00 32.17 ? 175 HIS A ND1 1 
ATOM   1187  C  CD2 . HIS A 1 175 ? 53.830 111.125 17.386  1.00 32.01 ? 175 HIS A CD2 1 
ATOM   1188  C  CE1 . HIS A 1 175 ? 54.547 109.739 18.929  1.00 30.99 ? 175 HIS A CE1 1 
ATOM   1189  N  NE2 . HIS A 1 175 ? 53.482 110.106 18.240  1.00 31.50 ? 175 HIS A NE2 1 
ATOM   1190  N  N   . LEU A 1 176 ? 57.749 111.073 13.915  1.00 35.43 ? 176 LEU A N   1 
ATOM   1191  C  CA  . LEU A 1 176 ? 57.450 110.636 12.561  1.00 35.39 ? 176 LEU A CA  1 
ATOM   1192  C  C   . LEU A 1 176 ? 58.233 109.390 12.192  1.00 35.63 ? 176 LEU A C   1 
ATOM   1193  O  O   . LEU A 1 176 ? 59.325 109.162 12.718  1.00 35.27 ? 176 LEU A O   1 
ATOM   1194  C  CB  . LEU A 1 176 ? 57.808 111.743 11.569  1.00 35.02 ? 176 LEU A CB  1 
ATOM   1195  C  CG  . LEU A 1 176 ? 57.185 113.125 11.740  1.00 34.55 ? 176 LEU A CG  1 
ATOM   1196  C  CD1 . LEU A 1 176 ? 57.875 114.101 10.799  1.00 34.75 ? 176 LEU A CD1 1 
ATOM   1197  C  CD2 . LEU A 1 176 ? 55.689 113.066 11.461  1.00 34.59 ? 176 LEU A CD2 1 
ATOM   1198  N  N   . LYS A 1 177 ? 57.670 108.588 11.289  1.00 36.19 ? 177 LYS A N   1 
ATOM   1199  C  CA  . LYS A 1 177 ? 58.342 107.385 10.811  1.00 36.85 ? 177 LYS A CA  1 
ATOM   1200  C  C   . LYS A 1 177 ? 59.642 107.931 10.224  1.00 36.96 ? 177 LYS A C   1 
ATOM   1201  O  O   . LYS A 1 177 ? 59.605 108.877 9.448   1.00 37.59 ? 177 LYS A O   1 
ATOM   1202  C  CB  . LYS A 1 177 ? 57.496 106.700 9.728   1.00 37.51 ? 177 LYS A CB  1 
ATOM   1203  C  CG  . LYS A 1 177 ? 56.320 105.869 10.245  1.00 38.28 ? 177 LYS A CG  1 
ATOM   1204  C  CD  . LYS A 1 177 ? 56.822 104.624 10.987  1.00 41.61 ? 177 LYS A CD  1 
ATOM   1205  C  CE  . LYS A 1 177 ? 55.742 103.534 11.178  1.00 42.29 ? 177 LYS A CE  1 
ATOM   1206  N  NZ  . LYS A 1 177 ? 54.629 103.924 12.118  1.00 43.25 ? 177 LYS A NZ  1 
ATOM   1207  N  N   . ASP A 1 178 ? 60.783 107.353 10.596  1.00 37.69 ? 178 ASP A N   1 
ATOM   1208  C  CA  . ASP A 1 178 ? 62.082 107.855 10.137  1.00 37.64 ? 178 ASP A CA  1 
ATOM   1209  C  C   . ASP A 1 178 ? 62.974 106.830 9.433   1.00 37.60 ? 178 ASP A C   1 
ATOM   1210  O  O   . ASP A 1 178 ? 63.561 105.945 10.067  1.00 37.71 ? 178 ASP A O   1 
ATOM   1211  C  CB  . ASP A 1 178 ? 62.829 108.462 11.336  1.00 38.10 ? 178 ASP A CB  1 
ATOM   1212  C  CG  . ASP A 1 178 ? 64.093 109.221 10.935  1.00 38.58 ? 178 ASP A CG  1 
ATOM   1213  O  OD1 . ASP A 1 178 ? 64.716 109.830 11.836  1.00 38.74 ? 178 ASP A OD1 1 
ATOM   1214  O  OD2 . ASP A 1 178 ? 64.470 109.210 9.737   1.00 38.18 ? 178 ASP A OD2 1 
ATOM   1215  N  N   . PRO A 1 179 ? 63.106 106.962 8.105   1.00 37.53 ? 179 PRO A N   1 
ATOM   1216  C  CA  . PRO A 1 179 ? 63.906 106.095 7.239   1.00 37.58 ? 179 PRO A CA  1 
ATOM   1217  C  C   . PRO A 1 179 ? 65.377 105.986 7.621   1.00 37.48 ? 179 PRO A C   1 
ATOM   1218  O  O   . PRO A 1 179 ? 66.007 104.974 7.347   1.00 37.41 ? 179 PRO A O   1 
ATOM   1219  C  CB  . PRO A 1 179 ? 63.715 106.719 5.861   1.00 37.72 ? 179 PRO A CB  1 
ATOM   1220  C  CG  . PRO A 1 179 ? 62.338 107.280 5.943   1.00 38.16 ? 179 PRO A CG  1 
ATOM   1221  C  CD  . PRO A 1 179 ? 62.363 107.943 7.296   1.00 37.77 ? 179 PRO A CD  1 
ATOM   1222  N  N   . ASP A 1 180 ? 65.941 107.020 8.233   1.00 38.13 ? 180 ASP A N   1 
ATOM   1223  C  CA  . ASP A 1 180 ? 67.346 106.936 8.626   1.00 38.93 ? 180 ASP A CA  1 
ATOM   1224  C  C   . ASP A 1 180 ? 67.461 105.943 9.770   1.00 38.09 ? 180 ASP A C   1 
ATOM   1225  O  O   . ASP A 1 180 ? 68.383 105.124 9.799   1.00 37.79 ? 180 ASP A O   1 
ATOM   1226  C  CB  . ASP A 1 180 ? 67.902 108.294 9.081   1.00 40.05 ? 180 ASP A CB  1 
ATOM   1227  C  CG  . ASP A 1 180 ? 68.153 109.244 7.927   1.00 41.73 ? 180 ASP A CG  1 
ATOM   1228  O  OD1 . ASP A 1 180 ? 68.375 108.773 6.791   1.00 43.48 ? 180 ASP A OD1 1 
ATOM   1229  O  OD2 . ASP A 1 180 ? 68.147 110.471 8.160   1.00 43.24 ? 180 ASP A OD2 1 
ATOM   1230  N  N   . MET A 1 181 ? 66.514 106.019 10.704  1.00 37.28 ? 181 MET A N   1 
ATOM   1231  C  CA  . MET A 1 181 ? 66.510 105.129 11.854  1.00 36.87 ? 181 MET A CA  1 
ATOM   1232  C  C   . MET A 1 181 ? 66.322 103.685 11.408  1.00 36.04 ? 181 MET A C   1 
ATOM   1233  O  O   . MET A 1 181 ? 66.972 102.779 11.918  1.00 35.07 ? 181 MET A O   1 
ATOM   1234  C  CB  . MET A 1 181 ? 65.407 105.523 12.826  1.00 37.01 ? 181 MET A CB  1 
ATOM   1235  C  CG  . MET A 1 181 ? 65.584 106.890 13.440  1.00 37.99 ? 181 MET A CG  1 
ATOM   1236  S  SD  . MET A 1 181 ? 64.499 107.115 14.869  1.00 40.00 ? 181 MET A SD  1 
ATOM   1237  C  CE  . MET A 1 181 ? 62.936 106.681 14.160  1.00 40.14 ? 181 MET A CE  1 
ATOM   1238  N  N   . VAL A 1 182 ? 65.431 103.479 10.450  1.00 35.24 ? 182 VAL A N   1 
ATOM   1239  C  CA  . VAL A 1 182 ? 65.189 102.146 9.928   1.00 34.41 ? 182 VAL A CA  1 
ATOM   1240  C  C   . VAL A 1 182 ? 66.452 101.556 9.293   1.00 35.05 ? 182 VAL A C   1 
ATOM   1241  O  O   . VAL A 1 182 ? 66.874 100.447 9.638   1.00 35.45 ? 182 VAL A O   1 
ATOM   1242  C  CB  . VAL A 1 182 ? 64.090 102.159 8.860   1.00 33.43 ? 182 VAL A CB  1 
ATOM   1243  C  CG1 . VAL A 1 182 ? 63.882 100.764 8.328   1.00 32.38 ? 182 VAL A CG1 1 
ATOM   1244  C  CG2 . VAL A 1 182 ? 62.807 102.714 9.443   1.00 32.45 ? 182 VAL A CG2 1 
ATOM   1245  N  N   . TRP A 1 183 ? 67.066 102.307 8.382   1.00 34.90 ? 183 TRP A N   1 
ATOM   1246  C  CA  . TRP A 1 183 ? 68.247 101.823 7.683   1.00 34.97 ? 183 TRP A CA  1 
ATOM   1247  C  C   . TRP A 1 183 ? 69.599 102.024 8.337   1.00 34.93 ? 183 TRP A C   1 
ATOM   1248  O  O   . TRP A 1 183 ? 70.558 101.327 8.010   1.00 34.86 ? 183 TRP A O   1 
ATOM   1249  C  CB  . TRP A 1 183 ? 68.257 102.380 6.271   1.00 34.81 ? 183 TRP A CB  1 
ATOM   1250  C  CG  . TRP A 1 183 ? 67.122 101.854 5.516   1.00 35.18 ? 183 TRP A CG  1 
ATOM   1251  C  CD1 . TRP A 1 183 ? 65.943 102.484 5.250   1.00 34.96 ? 183 TRP A CD1 1 
ATOM   1252  C  CD2 . TRP A 1 183 ? 67.007 100.539 4.982   1.00 35.75 ? 183 TRP A CD2 1 
ATOM   1253  N  NE1 . TRP A 1 183 ? 65.095 101.636 4.580   1.00 35.16 ? 183 TRP A NE1 1 
ATOM   1254  C  CE2 . TRP A 1 183 ? 65.725 100.433 4.403   1.00 35.51 ? 183 TRP A CE2 1 
ATOM   1255  C  CE3 . TRP A 1 183 ? 67.866 99.435  4.937   1.00 36.75 ? 183 TRP A CE3 1 
ATOM   1256  C  CZ2 . TRP A 1 183 ? 65.278 99.264  3.783   1.00 36.25 ? 183 TRP A CZ2 1 
ATOM   1257  C  CZ3 . TRP A 1 183 ? 67.418 98.262  4.314   1.00 37.34 ? 183 TRP A CZ3 1 
ATOM   1258  C  CH2 . TRP A 1 183 ? 66.135 98.191  3.747   1.00 36.00 ? 183 TRP A CH2 1 
ATOM   1259  N  N   . ASP A 1 184 ? 69.710 102.970 9.251   1.00 34.62 ? 184 ASP A N   1 
ATOM   1260  C  CA  . ASP A 1 184 ? 70.993 103.103 9.900   1.00 34.96 ? 184 ASP A CA  1 
ATOM   1261  C  C   . ASP A 1 184 ? 71.168 101.835 10.740  1.00 34.64 ? 184 ASP A C   1 
ATOM   1262  O  O   . ASP A 1 184 ? 72.252 101.270 10.811  1.00 34.85 ? 184 ASP A O   1 
ATOM   1263  C  CB  . ASP A 1 184 ? 71.048 104.348 10.785  1.00 34.82 ? 184 ASP A CB  1 
ATOM   1264  C  CG  . ASP A 1 184 ? 72.393 104.510 11.464  1.00 34.95 ? 184 ASP A CG  1 
ATOM   1265  O  OD1 . ASP A 1 184 ? 73.424 104.316 10.784  1.00 35.06 ? 184 ASP A OD1 1 
ATOM   1266  O  OD2 . ASP A 1 184 ? 72.421 104.831 12.670  1.00 34.94 ? 184 ASP A OD2 1 
ATOM   1267  N  N   . PHE A 1 185 ? 70.087 101.370 11.349  1.00 34.99 ? 185 PHE A N   1 
ATOM   1268  C  CA  . PHE A 1 185 ? 70.147 100.168 12.177  1.00 35.60 ? 185 PHE A CA  1 
ATOM   1269  C  C   . PHE A 1 185 ? 70.389 98.888  11.381  1.00 36.08 ? 185 PHE A C   1 
ATOM   1270  O  O   . PHE A 1 185 ? 71.258 98.087  11.725  1.00 35.79 ? 185 PHE A O   1 
ATOM   1271  C  CB  . PHE A 1 185 ? 68.854 99.999  12.968  1.00 35.22 ? 185 PHE A CB  1 
ATOM   1272  C  CG  . PHE A 1 185 ? 68.887 98.847  13.915  1.00 35.25 ? 185 PHE A CG  1 
ATOM   1273  C  CD1 . PHE A 1 185 ? 69.471 98.984  15.175  1.00 34.98 ? 185 PHE A CD1 1 
ATOM   1274  C  CD2 . PHE A 1 185 ? 68.358 97.615  13.546  1.00 35.07 ? 185 PHE A CD2 1 
ATOM   1275  C  CE1 . PHE A 1 185 ? 69.528 97.917  16.055  1.00 34.51 ? 185 PHE A CE1 1 
ATOM   1276  C  CE2 . PHE A 1 185 ? 68.410 96.531  14.423  1.00 35.52 ? 185 PHE A CE2 1 
ATOM   1277  C  CZ  . PHE A 1 185 ? 68.998 96.684  15.684  1.00 35.33 ? 185 PHE A CZ  1 
ATOM   1278  N  N   . TRP A 1 186 ? 69.601 98.686  10.329  1.00 36.87 ? 186 TRP A N   1 
ATOM   1279  C  CA  . TRP A 1 186 ? 69.743 97.491  9.509   1.00 37.39 ? 186 TRP A CA  1 
ATOM   1280  C  C   . TRP A 1 186 ? 71.084 97.422  8.790   1.00 38.44 ? 186 TRP A C   1 
ATOM   1281  O  O   . TRP A 1 186 ? 71.573 96.329  8.495   1.00 38.67 ? 186 TRP A O   1 
ATOM   1282  C  CB  . TRP A 1 186 ? 68.621 97.400  8.471   1.00 37.16 ? 186 TRP A CB  1 
ATOM   1283  C  CG  . TRP A 1 186 ? 67.312 96.877  9.006   1.00 36.99 ? 186 TRP A CG  1 
ATOM   1284  C  CD1 . TRP A 1 186 ? 67.106 96.174  10.171  1.00 37.06 ? 186 TRP A CD1 1 
ATOM   1285  C  CD2 . TRP A 1 186 ? 66.036 96.975  8.370   1.00 36.29 ? 186 TRP A CD2 1 
ATOM   1286  N  NE1 . TRP A 1 186 ? 65.775 95.830  10.291  1.00 36.40 ? 186 TRP A NE1 1 
ATOM   1287  C  CE2 . TRP A 1 186 ? 65.099 96.308  9.200   1.00 36.48 ? 186 TRP A CE2 1 
ATOM   1288  C  CE3 . TRP A 1 186 ? 65.591 97.561  7.176   1.00 35.34 ? 186 TRP A CE3 1 
ATOM   1289  C  CZ2 . TRP A 1 186 ? 63.749 96.213  8.870   1.00 35.67 ? 186 TRP A CZ2 1 
ATOM   1290  C  CZ3 . TRP A 1 186 ? 64.253 97.464  6.849   1.00 34.64 ? 186 TRP A CZ3 1 
ATOM   1291  C  CH2 . TRP A 1 186 ? 63.345 96.794  7.694   1.00 35.98 ? 186 TRP A CH2 1 
ATOM   1292  N  N   . SER A 1 187 ? 71.678 98.577  8.499   1.00 38.83 ? 187 SER A N   1 
ATOM   1293  C  CA  . SER A 1 187 ? 72.954 98.587  7.801   1.00 39.18 ? 187 SER A CA  1 
ATOM   1294  C  C   . SER A 1 187 ? 74.102 98.311  8.764   1.00 39.10 ? 187 SER A C   1 
ATOM   1295  O  O   . SER A 1 187 ? 75.103 97.691  8.397   1.00 39.59 ? 187 SER A O   1 
ATOM   1296  C  CB  . SER A 1 187 ? 73.161 99.920  7.081   1.00 39.07 ? 187 SER A CB  1 
ATOM   1297  O  OG  . SER A 1 187 ? 73.209 100.997 7.994   1.00 40.53 ? 187 SER A OG  1 
ATOM   1298  N  N   . LEU A 1 188 ? 73.958 98.755  10.004  1.00 38.99 ? 188 LEU A N   1 
ATOM   1299  C  CA  . LEU A 1 188 ? 75.002 98.514  10.987  1.00 38.77 ? 188 LEU A CA  1 
ATOM   1300  C  C   . LEU A 1 188 ? 74.869 97.088  11.512  1.00 39.00 ? 188 LEU A C   1 
ATOM   1301  O  O   . LEU A 1 188 ? 75.791 96.557  12.127  1.00 40.07 ? 188 LEU A O   1 
ATOM   1302  C  CB  . LEU A 1 188 ? 74.895 99.523  12.139  1.00 38.51 ? 188 LEU A CB  1 
ATOM   1303  C  CG  . LEU A 1 188 ? 75.174 100.985 11.757  1.00 38.28 ? 188 LEU A CG  1 
ATOM   1304  C  CD1 . LEU A 1 188 ? 74.791 101.943 12.896  1.00 37.31 ? 188 LEU A CD1 1 
ATOM   1305  C  CD2 . LEU A 1 188 ? 76.642 101.117 11.392  1.00 36.88 ? 188 LEU A CD2 1 
ATOM   1306  N  N   . ARG A 1 189 ? 73.719 96.467  11.267  1.00 38.84 ? 189 ARG A N   1 
ATOM   1307  C  CA  . ARG A 1 189 ? 73.486 95.100  11.717  1.00 38.41 ? 189 ARG A CA  1 
ATOM   1308  C  C   . ARG A 1 189 ? 72.978 94.260  10.544  1.00 38.52 ? 189 ARG A C   1 
ATOM   1309  O  O   . ARG A 1 189 ? 71.776 94.007  10.417  1.00 38.18 ? 189 ARG A O   1 
ATOM   1310  C  CB  . ARG A 1 189 ? 72.462 95.084  12.850  1.00 37.72 ? 189 ARG A CB  1 
ATOM   1311  C  CG  . ARG A 1 189 ? 72.805 95.981  14.023  1.00 37.77 ? 189 ARG A CG  1 
ATOM   1312  C  CD  . ARG A 1 189 ? 74.093 95.564  14.719  1.00 38.17 ? 189 ARG A CD  1 
ATOM   1313  N  NE  . ARG A 1 189 ? 74.057 94.156  15.104  1.00 38.71 ? 189 ARG A NE  1 
ATOM   1314  C  CZ  . ARG A 1 189 ? 74.855 93.603  16.008  1.00 38.49 ? 189 ARG A CZ  1 
ATOM   1315  N  NH1 . ARG A 1 189 ? 75.761 94.343  16.635  1.00 38.65 ? 189 ARG A NH1 1 
ATOM   1316  N  NH2 . ARG A 1 189 ? 74.750 92.306  16.278  1.00 39.07 ? 189 ARG A NH2 1 
ATOM   1317  N  N   . PRO A 1 190 ? 73.901 93.809  9.674   1.00 38.33 ? 190 PRO A N   1 
ATOM   1318  C  CA  . PRO A 1 190 ? 73.610 92.996  8.489   1.00 38.42 ? 190 PRO A CA  1 
ATOM   1319  C  C   . PRO A 1 190 ? 73.006 91.620  8.761   1.00 38.54 ? 190 PRO A C   1 
ATOM   1320  O  O   . PRO A 1 190 ? 72.519 90.965  7.831   1.00 38.79 ? 190 PRO A O   1 
ATOM   1321  C  CB  . PRO A 1 190 ? 74.966 92.914  7.787   1.00 38.07 ? 190 PRO A CB  1 
ATOM   1322  C  CG  . PRO A 1 190 ? 75.915 92.921  8.929   1.00 38.07 ? 190 PRO A CG  1 
ATOM   1323  C  CD  . PRO A 1 190 ? 75.353 94.014  9.811   1.00 38.16 ? 190 PRO A CD  1 
ATOM   1324  N  N   . GLU A 1 191 ? 73.036 91.169  10.014  1.00 38.09 ? 191 GLU A N   1 
ATOM   1325  C  CA  . GLU A 1 191 ? 72.446 89.869  10.321  1.00 37.91 ? 191 GLU A CA  1 
ATOM   1326  C  C   . GLU A 1 191 ? 70.967 89.977  9.952   1.00 37.69 ? 191 GLU A C   1 
ATOM   1327  O  O   . GLU A 1 191 ? 70.264 88.981  9.834   1.00 38.70 ? 191 GLU A O   1 
ATOM   1328  C  CB  . GLU A 1 191 ? 72.599 89.505  11.814  1.00 38.50 ? 191 GLU A CB  1 
ATOM   1329  C  CG  . GLU A 1 191 ? 71.771 90.333  12.804  1.00 39.37 ? 191 GLU A CG  1 
ATOM   1330  C  CD  . GLU A 1 191 ? 72.510 91.553  13.358  1.00 40.12 ? 191 GLU A CD  1 
ATOM   1331  O  OE1 . GLU A 1 191 ? 73.199 92.261  12.585  1.00 39.99 ? 191 GLU A OE1 1 
ATOM   1332  O  OE2 . GLU A 1 191 ? 72.385 91.814  14.575  1.00 40.63 ? 191 GLU A OE2 1 
ATOM   1333  N  N   . SER A 1 192 ? 70.514 91.206  9.739   1.00 36.84 ? 192 SER A N   1 
ATOM   1334  C  CA  . SER A 1 192 ? 69.132 91.469  9.392   1.00 36.21 ? 192 SER A CA  1 
ATOM   1335  C  C   . SER A 1 192 ? 68.783 91.121  7.945   1.00 36.65 ? 192 SER A C   1 
ATOM   1336  O  O   . SER A 1 192 ? 67.610 91.026  7.602   1.00 36.84 ? 192 SER A O   1 
ATOM   1337  C  CB  . SER A 1 192 ? 68.819 92.942  9.636   1.00 35.26 ? 192 SER A CB  1 
ATOM   1338  O  OG  . SER A 1 192 ? 69.530 93.761  8.727   1.00 35.61 ? 192 SER A OG  1 
ATOM   1339  N  N   . LEU A 1 193 ? 69.791 90.932  7.100   1.00 36.64 ? 193 LEU A N   1 
ATOM   1340  C  CA  . LEU A 1 193 ? 69.560 90.636  5.681   1.00 36.89 ? 193 LEU A CA  1 
ATOM   1341  C  C   . LEU A 1 193 ? 68.474 89.602  5.346   1.00 37.19 ? 193 LEU A C   1 
ATOM   1342  O  O   . LEU A 1 193 ? 67.567 89.872  4.555   1.00 36.87 ? 193 LEU A O   1 
ATOM   1343  C  CB  . LEU A 1 193 ? 70.879 90.209  5.024   1.00 36.72 ? 193 LEU A CB  1 
ATOM   1344  C  CG  . LEU A 1 193 ? 71.912 91.324  4.833   1.00 35.86 ? 193 LEU A CG  1 
ATOM   1345  C  CD1 . LEU A 1 193 ? 73.291 90.726  4.642   1.00 34.45 ? 193 LEU A CD1 1 
ATOM   1346  C  CD2 . LEU A 1 193 ? 71.505 92.200  3.649   1.00 35.27 ? 193 LEU A CD2 1 
ATOM   1347  N  N   . HIS A 1 194 ? 68.567 88.423  5.946   1.00 37.26 ? 194 HIS A N   1 
ATOM   1348  C  CA  . HIS A 1 194 ? 67.611 87.361  5.673   1.00 36.95 ? 194 HIS A CA  1 
ATOM   1349  C  C   . HIS A 1 194 ? 66.148 87.785  5.839   1.00 37.12 ? 194 HIS A C   1 
ATOM   1350  O  O   . HIS A 1 194 ? 65.371 87.789  4.881   1.00 37.20 ? 194 HIS A O   1 
ATOM   1351  C  CB  . HIS A 1 194 ? 67.915 86.177  6.574   1.00 36.70 ? 194 HIS A CB  1 
ATOM   1352  C  CG  . HIS A 1 194 ? 67.503 84.862  6.001   1.00 37.46 ? 194 HIS A CG  1 
ATOM   1353  N  ND1 . HIS A 1 194 ? 67.712 83.668  6.656   1.00 38.04 ? 194 HIS A ND1 1 
ATOM   1354  C  CD2 . HIS A 1 194 ? 66.887 84.549  4.837   1.00 37.91 ? 194 HIS A CD2 1 
ATOM   1355  C  CE1 . HIS A 1 194 ? 67.241 82.676  5.923   1.00 37.94 ? 194 HIS A CE1 1 
ATOM   1356  N  NE2 . HIS A 1 194 ? 66.734 83.182  4.813   1.00 37.94 ? 194 HIS A NE2 1 
ATOM   1357  N  N   . GLN A 1 195 ? 65.771 88.146  7.058   1.00 36.92 ? 195 GLN A N   1 
ATOM   1358  C  CA  . GLN A 1 195 ? 64.399 88.543  7.332   1.00 36.25 ? 195 GLN A CA  1 
ATOM   1359  C  C   . GLN A 1 195 ? 63.994 89.789  6.553   1.00 36.13 ? 195 GLN A C   1 
ATOM   1360  O  O   . GLN A 1 195 ? 62.809 89.996  6.277   1.00 36.01 ? 195 GLN A O   1 
ATOM   1361  C  CB  . GLN A 1 195 ? 64.212 88.745  8.839   1.00 35.40 ? 195 GLN A CB  1 
ATOM   1362  C  CG  . GLN A 1 195 ? 62.854 89.273  9.267   1.00 35.66 ? 195 GLN A CG  1 
ATOM   1363  C  CD  . GLN A 1 195 ? 61.693 88.594  8.573   1.00 36.28 ? 195 GLN A CD  1 
ATOM   1364  O  OE1 . GLN A 1 195 ? 61.720 87.391  8.327   1.00 37.21 ? 195 GLN A OE1 1 
ATOM   1365  N  NE2 . GLN A 1 195 ? 60.650 89.365  8.271   1.00 36.20 ? 195 GLN A NE2 1 
ATOM   1366  N  N   . VAL A 1 196 ? 64.969 90.615  6.191   1.00 36.11 ? 196 VAL A N   1 
ATOM   1367  C  CA  . VAL A 1 196 ? 64.676 91.824  5.425   1.00 36.50 ? 196 VAL A CA  1 
ATOM   1368  C  C   . VAL A 1 196 ? 64.327 91.439  3.990   1.00 36.98 ? 196 VAL A C   1 
ATOM   1369  O  O   . VAL A 1 196 ? 63.463 92.055  3.376   1.00 37.19 ? 196 VAL A O   1 
ATOM   1370  C  CB  . VAL A 1 196 ? 65.873 92.809  5.412   1.00 36.21 ? 196 VAL A CB  1 
ATOM   1371  C  CG1 . VAL A 1 196 ? 65.639 93.912  4.386   1.00 35.72 ? 196 VAL A CG1 1 
ATOM   1372  C  CG2 . VAL A 1 196 ? 66.048 93.418  6.782   1.00 35.78 ? 196 VAL A CG2 1 
ATOM   1373  N  N   . SER A 1 197 ? 64.999 90.422  3.461   1.00 37.46 ? 197 SER A N   1 
ATOM   1374  C  CA  . SER A 1 197 ? 64.717 89.967  2.108   1.00 38.70 ? 197 SER A CA  1 
ATOM   1375  C  C   . SER A 1 197 ? 63.318 89.366  2.091   1.00 39.67 ? 197 SER A C   1 
ATOM   1376  O  O   . SER A 1 197 ? 62.565 89.539  1.129   1.00 39.70 ? 197 SER A O   1 
ATOM   1377  C  CB  . SER A 1 197 ? 65.747 88.922  1.653   1.00 38.42 ? 197 SER A CB  1 
ATOM   1378  O  OG  . SER A 1 197 ? 67.026 89.507  1.455   1.00 37.49 ? 197 SER A OG  1 
ATOM   1379  N  N   . PHE A 1 198 ? 62.967 88.662  3.160   1.00 40.52 ? 198 PHE A N   1 
ATOM   1380  C  CA  . PHE A 1 198 ? 61.645 88.058  3.248   1.00 42.24 ? 198 PHE A CA  1 
ATOM   1381  C  C   . PHE A 1 198 ? 60.569 89.145  3.403   1.00 42.88 ? 198 PHE A C   1 
ATOM   1382  O  O   . PHE A 1 198 ? 59.546 89.114  2.720   1.00 43.40 ? 198 PHE A O   1 
ATOM   1383  C  CB  . PHE A 1 198 ? 61.585 87.071  4.427   1.00 43.43 ? 198 PHE A CB  1 
ATOM   1384  C  CG  . PHE A 1 198 ? 60.253 86.364  4.570   1.00 45.03 ? 198 PHE A CG  1 
ATOM   1385  C  CD1 . PHE A 1 198 ? 59.211 86.941  5.309   1.00 45.49 ? 198 PHE A CD1 1 
ATOM   1386  C  CD2 . PHE A 1 198 ? 60.026 85.137  3.931   1.00 45.14 ? 198 PHE A CD2 1 
ATOM   1387  C  CE1 . PHE A 1 198 ? 57.960 86.307  5.408   1.00 45.80 ? 198 PHE A CE1 1 
ATOM   1388  C  CE2 . PHE A 1 198 ? 58.782 84.491  4.019   1.00 44.87 ? 198 PHE A CE2 1 
ATOM   1389  C  CZ  . PHE A 1 198 ? 57.747 85.078  4.760   1.00 45.66 ? 198 PHE A CZ  1 
ATOM   1390  N  N   . LEU A 1 199 ? 60.810 90.110  4.287   1.00 42.95 ? 199 LEU A N   1 
ATOM   1391  C  CA  . LEU A 1 199 ? 59.860 91.195  4.537   1.00 43.06 ? 199 LEU A CA  1 
ATOM   1392  C  C   . LEU A 1 199 ? 59.543 92.061  3.328   1.00 43.19 ? 199 LEU A C   1 
ATOM   1393  O  O   . LEU A 1 199 ? 58.406 92.501  3.150   1.00 43.29 ? 199 LEU A O   1 
ATOM   1394  C  CB  . LEU A 1 199 ? 60.380 92.102  5.646   1.00 43.22 ? 199 LEU A CB  1 
ATOM   1395  C  CG  . LEU A 1 199 ? 59.553 93.356  5.920   1.00 43.32 ? 199 LEU A CG  1 
ATOM   1396  C  CD1 . LEU A 1 199 ? 58.245 92.977  6.616   1.00 43.54 ? 199 LEU A CD1 1 
ATOM   1397  C  CD2 . LEU A 1 199 ? 60.362 94.303  6.780   1.00 42.54 ? 199 LEU A CD2 1 
ATOM   1398  N  N   . PHE A 1 200 ? 60.548 92.339  2.510   1.00 43.31 ? 200 PHE A N   1 
ATOM   1399  C  CA  . PHE A 1 200 ? 60.309 93.170  1.342   1.00 43.69 ? 200 PHE A CA  1 
ATOM   1400  C  C   . PHE A 1 200 ? 59.879 92.390  0.116   1.00 44.06 ? 200 PHE A C   1 
ATOM   1401  O  O   . PHE A 1 200 ? 59.780 92.957  -0.973  1.00 44.31 ? 200 PHE A O   1 
ATOM   1402  C  CB  . PHE A 1 200 ? 61.536 94.024  1.016   1.00 42.89 ? 200 PHE A CB  1 
ATOM   1403  C  CG  . PHE A 1 200 ? 61.693 95.211  1.913   1.00 42.87 ? 200 PHE A CG  1 
ATOM   1404  C  CD1 . PHE A 1 200 ? 62.306 95.088  3.159   1.00 42.99 ? 200 PHE A CD1 1 
ATOM   1405  C  CD2 . PHE A 1 200 ? 61.199 96.457  1.528   1.00 42.84 ? 200 PHE A CD2 1 
ATOM   1406  C  CE1 . PHE A 1 200 ? 62.426 96.197  4.012   1.00 43.05 ? 200 PHE A CE1 1 
ATOM   1407  C  CE2 . PHE A 1 200 ? 61.313 97.576  2.372   1.00 42.60 ? 200 PHE A CE2 1 
ATOM   1408  C  CZ  . PHE A 1 200 ? 61.928 97.444  3.615   1.00 42.55 ? 200 PHE A CZ  1 
ATOM   1409  N  N   . SER A 1 201 ? 59.621 91.096  0.293   1.00 44.72 ? 201 SER A N   1 
ATOM   1410  C  CA  . SER A 1 201 ? 59.174 90.253  -0.813  1.00 45.55 ? 201 SER A CA  1 
ATOM   1411  C  C   . SER A 1 201 ? 57.649 90.252  -0.788  1.00 46.03 ? 201 SER A C   1 
ATOM   1412  O  O   . SER A 1 201 ? 57.046 90.868  0.097   1.00 46.31 ? 201 SER A O   1 
ATOM   1413  C  CB  . SER A 1 201 ? 59.693 88.820  -0.657  1.00 45.59 ? 201 SER A CB  1 
ATOM   1414  O  OG  . SER A 1 201 ? 58.882 88.063  0.231   1.00 47.65 ? 201 SER A OG  1 
ATOM   1415  N  N   . ASP A 1 202 ? 57.029 89.569  -1.750  1.00 46.08 ? 202 ASP A N   1 
ATOM   1416  C  CA  . ASP A 1 202 ? 55.570 89.505  -1.809  1.00 45.69 ? 202 ASP A CA  1 
ATOM   1417  C  C   . ASP A 1 202 ? 54.972 89.150  -0.447  1.00 44.82 ? 202 ASP A C   1 
ATOM   1418  O  O   . ASP A 1 202 ? 53.984 89.741  -0.028  1.00 44.47 ? 202 ASP A O   1 
ATOM   1419  C  CB  . ASP A 1 202 ? 55.093 88.458  -2.832  1.00 47.08 ? 202 ASP A CB  1 
ATOM   1420  C  CG  . ASP A 1 202 ? 55.521 88.771  -4.264  1.00 47.55 ? 202 ASP A CG  1 
ATOM   1421  O  OD1 . ASP A 1 202 ? 55.959 89.907  -4.550  1.00 48.02 ? 202 ASP A OD1 1 
ATOM   1422  O  OD2 . ASP A 1 202 ? 55.401 87.860  -5.112  1.00 47.77 ? 202 ASP A OD2 1 
ATOM   1423  N  N   . ARG A 1 203 ? 55.566 88.183  0.241   1.00 44.03 ? 203 ARG A N   1 
ATOM   1424  C  CA  . ARG A 1 203 ? 55.049 87.769  1.543   1.00 44.13 ? 203 ARG A CA  1 
ATOM   1425  C  C   . ARG A 1 203 ? 55.000 88.914  2.564   1.00 42.96 ? 203 ARG A C   1 
ATOM   1426  O  O   . ARG A 1 203 ? 54.529 88.733  3.688   1.00 42.83 ? 203 ARG A O   1 
ATOM   1427  C  CB  . ARG A 1 203 ? 55.904 86.641  2.121   1.00 45.59 ? 203 ARG A CB  1 
ATOM   1428  C  CG  . ARG A 1 203 ? 56.113 85.447  1.214   1.00 47.50 ? 203 ARG A CG  1 
ATOM   1429  C  CD  . ARG A 1 203 ? 54.809 84.765  0.863   1.00 48.71 ? 203 ARG A CD  1 
ATOM   1430  N  NE  . ARG A 1 203 ? 55.047 83.431  0.318   1.00 50.27 ? 203 ARG A NE  1 
ATOM   1431  C  CZ  . ARG A 1 203 ? 55.233 82.346  1.066   1.00 51.70 ? 203 ARG A CZ  1 
ATOM   1432  N  NH1 . ARG A 1 203 ? 55.205 82.435  2.394   1.00 52.33 ? 203 ARG A NH1 1 
ATOM   1433  N  NH2 . ARG A 1 203 ? 55.444 81.168  0.491   1.00 52.69 ? 203 ARG A NH2 1 
ATOM   1434  N  N   . GLY A 1 204 ? 55.491 90.084  2.169   1.00 41.77 ? 204 GLY A N   1 
ATOM   1435  C  CA  . GLY A 1 204 ? 55.510 91.224  3.067   1.00 40.30 ? 204 GLY A CA  1 
ATOM   1436  C  C   . GLY A 1 204 ? 54.152 91.805  3.401   1.00 39.20 ? 204 GLY A C   1 
ATOM   1437  O  O   . GLY A 1 204 ? 53.987 92.484  4.411   1.00 39.31 ? 204 GLY A O   1 
ATOM   1438  N  N   . ILE A 1 205 ? 53.171 91.548  2.552   1.00 38.23 ? 205 ILE A N   1 
ATOM   1439  C  CA  . ILE A 1 205 ? 51.846 92.067  2.791   1.00 37.14 ? 205 ILE A CA  1 
ATOM   1440  C  C   . ILE A 1 205 ? 50.782 91.047  2.419   1.00 37.03 ? 205 ILE A C   1 
ATOM   1441  O  O   . ILE A 1 205 ? 50.107 91.161  1.393   1.00 36.70 ? 205 ILE A O   1 
ATOM   1442  C  CB  . ILE A 1 205 ? 51.624 93.378  2.019   1.00 36.99 ? 205 ILE A CB  1 
ATOM   1443  C  CG1 . ILE A 1 205 ? 52.799 94.332  2.271   1.00 36.90 ? 205 ILE A CG1 1 
ATOM   1444  C  CG2 . ILE A 1 205 ? 50.362 94.055  2.506   1.00 36.58 ? 205 ILE A CG2 1 
ATOM   1445  C  CD1 . ILE A 1 205 ? 52.651 95.705  1.617   1.00 35.44 ? 205 ILE A CD1 1 
ATOM   1446  N  N   . PRO A 1 206 ? 50.621 90.025  3.267   1.00 37.08 ? 206 PRO A N   1 
ATOM   1447  C  CA  . PRO A 1 206 ? 49.641 88.955  3.070   1.00 37.37 ? 206 PRO A CA  1 
ATOM   1448  C  C   . PRO A 1 206 ? 48.244 89.541  2.926   1.00 37.55 ? 206 PRO A C   1 
ATOM   1449  O  O   . PRO A 1 206 ? 47.913 90.531  3.589   1.00 37.75 ? 206 PRO A O   1 
ATOM   1450  C  CB  . PRO A 1 206 ? 49.785 88.117  4.341   1.00 38.17 ? 206 PRO A CB  1 
ATOM   1451  C  CG  . PRO A 1 206 ? 50.218 89.129  5.367   1.00 38.19 ? 206 PRO A CG  1 
ATOM   1452  C  CD  . PRO A 1 206 ? 51.251 89.921  4.595   1.00 37.55 ? 206 PRO A CD  1 
ATOM   1453  N  N   . ASP A 1 207 ? 47.426 88.940  2.059   1.00 37.39 ? 207 ASP A N   1 
ATOM   1454  C  CA  . ASP A 1 207 ? 46.069 89.434  1.853   1.00 36.62 ? 207 ASP A CA  1 
ATOM   1455  C  C   . ASP A 1 207 ? 45.189 89.004  3.007   1.00 35.89 ? 207 ASP A C   1 
ATOM   1456  O  O   . ASP A 1 207 ? 44.347 88.124  2.864   1.00 36.10 ? 207 ASP A O   1 
ATOM   1457  C  CB  . ASP A 1 207 ? 45.487 88.910  0.542   1.00 37.11 ? 207 ASP A CB  1 
ATOM   1458  C  CG  . ASP A 1 207 ? 44.118 89.498  0.246   1.00 39.09 ? 207 ASP A CG  1 
ATOM   1459  O  OD1 . ASP A 1 207 ? 43.622 89.321  -0.886  1.00 41.12 ? 207 ASP A OD1 1 
ATOM   1460  O  OD2 . ASP A 1 207 ? 43.528 90.141  1.142   1.00 39.70 ? 207 ASP A OD2 1 
ATOM   1461  N  N   . GLY A 1 208 ? 45.386 89.635  4.157   1.00 34.99 ? 208 GLY A N   1 
ATOM   1462  C  CA  . GLY A 1 208 ? 44.599 89.278  5.316   1.00 34.06 ? 208 GLY A CA  1 
ATOM   1463  C  C   . GLY A 1 208 ? 45.306 88.177  6.067   1.00 34.08 ? 208 GLY A C   1 
ATOM   1464  O  O   . GLY A 1 208 ? 46.248 87.570  5.552   1.00 33.05 ? 208 GLY A O   1 
ATOM   1465  N  N   . HIS A 1 209 ? 44.830 87.902  7.276   1.00 33.50 ? 209 HIS A N   1 
ATOM   1466  C  CA  . HIS A 1 209 ? 45.422 86.889  8.133   1.00 33.92 ? 209 HIS A CA  1 
ATOM   1467  C  C   . HIS A 1 209 ? 45.236 85.446  7.685   1.00 34.66 ? 209 HIS A C   1 
ATOM   1468  O  O   . HIS A 1 209 ? 46.109 84.606  7.906   1.00 35.40 ? 209 HIS A O   1 
ATOM   1469  C  CB  . HIS A 1 209 ? 44.872 87.045  9.549   1.00 32.78 ? 209 HIS A CB  1 
ATOM   1470  C  CG  . HIS A 1 209 ? 44.954 88.444  10.068  1.00 33.07 ? 209 HIS A CG  1 
ATOM   1471  N  ND1 . HIS A 1 209 ? 46.140 89.145  10.128  1.00 32.45 ? 209 HIS A ND1 1 
ATOM   1472  C  CD2 . HIS A 1 209 ? 44.001 89.276  10.550  1.00 32.42 ? 209 HIS A CD2 1 
ATOM   1473  C  CE1 . HIS A 1 209 ? 45.914 90.347  10.625  1.00 32.56 ? 209 HIS A CE1 1 
ATOM   1474  N  NE2 . HIS A 1 209 ? 44.625 90.452  10.890  1.00 32.94 ? 209 HIS A NE2 1 
ATOM   1475  N  N   . ARG A 1 210 ? 44.107 85.151  7.056   1.00 34.99 ? 210 ARG A N   1 
ATOM   1476  C  CA  . ARG A 1 210 ? 43.818 83.789  6.627   1.00 35.43 ? 210 ARG A CA  1 
ATOM   1477  C  C   . ARG A 1 210 ? 44.676 83.238  5.478   1.00 35.52 ? 210 ARG A C   1 
ATOM   1478  O  O   . ARG A 1 210 ? 44.751 82.030  5.278   1.00 35.78 ? 210 ARG A O   1 
ATOM   1479  C  CB  . ARG A 1 210 ? 42.332 83.683  6.276   1.00 35.17 ? 210 ARG A CB  1 
ATOM   1480  C  CG  . ARG A 1 210 ? 41.423 84.230  7.377   1.00 35.14 ? 210 ARG A CG  1 
ATOM   1481  C  CD  . ARG A 1 210 ? 39.958 84.225  6.968   1.00 34.44 ? 210 ARG A CD  1 
ATOM   1482  N  NE  . ARG A 1 210 ? 39.757 84.969  5.733   1.00 34.00 ? 210 ARG A NE  1 
ATOM   1483  C  CZ  . ARG A 1 210 ? 39.350 84.426  4.595   1.00 33.85 ? 210 ARG A CZ  1 
ATOM   1484  N  NH1 . ARG A 1 210 ? 39.092 83.132  4.538   1.00 34.17 ? 210 ARG A NH1 1 
ATOM   1485  N  NH2 . ARG A 1 210 ? 39.221 85.173  3.507   1.00 35.14 ? 210 ARG A NH2 1 
ATOM   1486  N  N   . HIS A 1 211 ? 45.338 84.111  4.740   1.00 35.36 ? 211 HIS A N   1 
ATOM   1487  C  CA  . HIS A 1 211 ? 46.146 83.655  3.626   1.00 35.46 ? 211 HIS A CA  1 
ATOM   1488  C  C   . HIS A 1 211 ? 47.657 83.751  3.843   1.00 35.59 ? 211 HIS A C   1 
ATOM   1489  O  O   . HIS A 1 211 ? 48.406 84.036  2.900   1.00 35.19 ? 211 HIS A O   1 
ATOM   1490  C  CB  . HIS A 1 211 ? 45.737 84.416  2.362   1.00 36.34 ? 211 HIS A CB  1 
ATOM   1491  C  CG  . HIS A 1 211 ? 44.332 84.136  1.916   1.00 36.66 ? 211 HIS A CG  1 
ATOM   1492  N  ND1 . HIS A 1 211 ? 43.932 82.903  1.444   1.00 36.91 ? 211 HIS A ND1 1 
ATOM   1493  C  CD2 . HIS A 1 211 ? 43.235 84.928  1.868   1.00 36.91 ? 211 HIS A CD2 1 
ATOM   1494  C  CE1 . HIS A 1 211 ? 42.651 82.949  1.122   1.00 36.40 ? 211 HIS A CE1 1 
ATOM   1495  N  NE2 . HIS A 1 211 ? 42.204 84.167  1.370   1.00 37.41 ? 211 HIS A NE2 1 
ATOM   1496  N  N   . MET A 1 212 ? 48.092 83.510  5.082   1.00 35.21 ? 212 MET A N   1 
ATOM   1497  C  CA  . MET A 1 212 ? 49.514 83.522  5.444   1.00 35.51 ? 212 MET A CA  1 
ATOM   1498  C  C   . MET A 1 212 ? 49.812 82.321  6.349   1.00 36.35 ? 212 MET A C   1 
ATOM   1499  O  O   . MET A 1 212 ? 48.894 81.753  6.947   1.00 35.54 ? 212 MET A O   1 
ATOM   1500  C  CB  . MET A 1 212 ? 49.890 84.816  6.176   1.00 34.76 ? 212 MET A CB  1 
ATOM   1501  C  CG  . MET A 1 212 ? 49.172 85.009  7.509   1.00 34.02 ? 212 MET A CG  1 
ATOM   1502  S  SD  . MET A 1 212 ? 49.595 86.557  8.343   1.00 32.72 ? 212 MET A SD  1 
ATOM   1503  C  CE  . MET A 1 212 ? 48.781 86.318  9.888   1.00 32.67 ? 212 MET A CE  1 
ATOM   1504  N  N   . ASN A 1 213 ? 51.083 81.921  6.428   1.00 37.07 ? 213 ASN A N   1 
ATOM   1505  C  CA  . ASN A 1 213 ? 51.476 80.799  7.284   1.00 38.01 ? 213 ASN A CA  1 
ATOM   1506  C  C   . ASN A 1 213 ? 51.856 81.303  8.678   1.00 37.82 ? 213 ASN A C   1 
ATOM   1507  O  O   . ASN A 1 213 ? 52.056 82.498  8.883   1.00 38.19 ? 213 ASN A O   1 
ATOM   1508  C  CB  . ASN A 1 213 ? 52.678 80.046  6.697   1.00 39.48 ? 213 ASN A CB  1 
ATOM   1509  C  CG  . ASN A 1 213 ? 52.341 79.277  5.422   1.00 40.97 ? 213 ASN A CG  1 
ATOM   1510  O  OD1 . ASN A 1 213 ? 51.320 78.589  5.347   1.00 42.66 ? 213 ASN A OD1 1 
ATOM   1511  N  ND2 . ASN A 1 213 ? 53.220 79.365  4.425   1.00 40.66 ? 213 ASN A ND2 1 
ATOM   1512  N  N   . GLY A 1 214 ? 51.950 80.384  9.631   1.00 37.69 ? 214 GLY A N   1 
ATOM   1513  C  CA  . GLY A 1 214 ? 52.332 80.734  10.990  1.00 37.44 ? 214 GLY A CA  1 
ATOM   1514  C  C   . GLY A 1 214 ? 53.575 79.938  11.365  1.00 37.86 ? 214 GLY A C   1 
ATOM   1515  O  O   . GLY A 1 214 ? 53.711 78.766  10.990  1.00 37.86 ? 214 GLY A O   1 
ATOM   1516  N  N   . TYR A 1 215 ? 54.497 80.554  12.095  1.00 37.67 ? 215 TYR A N   1 
ATOM   1517  C  CA  . TYR A 1 215 ? 55.723 79.855  12.489  1.00 37.42 ? 215 TYR A CA  1 
ATOM   1518  C  C   . TYR A 1 215 ? 56.071 80.071  13.948  1.00 37.28 ? 215 TYR A C   1 
ATOM   1519  O  O   . TYR A 1 215 ? 55.764 81.114  14.519  1.00 38.72 ? 215 TYR A O   1 
ATOM   1520  C  CB  . TYR A 1 215 ? 56.902 80.350  11.660  1.00 37.16 ? 215 TYR A CB  1 
ATOM   1521  C  CG  . TYR A 1 215 ? 56.753 80.178  10.177  1.00 37.23 ? 215 TYR A CG  1 
ATOM   1522  C  CD1 . TYR A 1 215 ? 57.271 79.059  9.537   1.00 36.95 ? 215 TYR A CD1 1 
ATOM   1523  C  CD2 . TYR A 1 215 ? 56.141 81.165  9.397   1.00 37.58 ? 215 TYR A CD2 1 
ATOM   1524  C  CE1 . TYR A 1 215 ? 57.199 78.929  8.149   1.00 38.27 ? 215 TYR A CE1 1 
ATOM   1525  C  CE2 . TYR A 1 215 ? 56.058 81.047  8.004   1.00 37.63 ? 215 TYR A CE2 1 
ATOM   1526  C  CZ  . TYR A 1 215 ? 56.597 79.927  7.386   1.00 38.02 ? 215 TYR A CZ  1 
ATOM   1527  O  OH  . TYR A 1 215 ? 56.577 79.811  6.011   1.00 38.50 ? 215 TYR A OH  1 
ATOM   1528  N  N   . GLY A 1 216 ? 56.712 79.087  14.557  1.00 36.67 ? 216 GLY A N   1 
ATOM   1529  C  CA  . GLY A 1 216 ? 57.129 79.258  15.930  1.00 35.60 ? 216 GLY A CA  1 
ATOM   1530  C  C   . GLY A 1 216 ? 58.426 80.042  15.841  1.00 35.22 ? 216 GLY A C   1 
ATOM   1531  O  O   . GLY A 1 216 ? 58.887 80.634  16.815  1.00 35.03 ? 216 GLY A O   1 
ATOM   1532  N  N   . SER A 1 217 ? 59.007 80.044  14.645  1.00 34.84 ? 217 SER A N   1 
ATOM   1533  C  CA  . SER A 1 217 ? 60.262 80.739  14.380  1.00 34.59 ? 217 SER A CA  1 
ATOM   1534  C  C   . SER A 1 217 ? 61.419 80.133  15.161  1.00 33.68 ? 217 SER A C   1 
ATOM   1535  O  O   . SER A 1 217 ? 62.318 79.518  14.584  1.00 32.15 ? 217 SER A O   1 
ATOM   1536  C  CB  . SER A 1 217 ? 60.139 82.223  14.734  1.00 36.05 ? 217 SER A CB  1 
ATOM   1537  O  OG  . SER A 1 217 ? 59.189 82.881  13.909  1.00 37.51 ? 217 SER A OG  1 
ATOM   1538  N  N   . HIS A 1 218 ? 61.383 80.310  16.478  1.00 33.47 ? 218 HIS A N   1 
ATOM   1539  C  CA  . HIS A 1 218 ? 62.425 79.798  17.360  1.00 33.31 ? 218 HIS A CA  1 
ATOM   1540  C  C   . HIS A 1 218 ? 62.522 78.300  17.294  1.00 33.51 ? 218 HIS A C   1 
ATOM   1541  O  O   . HIS A 1 218 ? 61.561 77.623  16.916  1.00 33.62 ? 218 HIS A O   1 
ATOM   1542  C  CB  . HIS A 1 218 ? 62.134 80.144  18.823  1.00 34.03 ? 218 HIS A CB  1 
ATOM   1543  C  CG  . HIS A 1 218 ? 62.109 81.606  19.113  1.00 34.51 ? 218 HIS A CG  1 
ATOM   1544  N  ND1 . HIS A 1 218 ? 63.231 82.402  19.026  1.00 35.08 ? 218 HIS A ND1 1 
ATOM   1545  C  CD2 . HIS A 1 218 ? 61.091 82.422  19.471  1.00 34.36 ? 218 HIS A CD2 1 
ATOM   1546  C  CE1 . HIS A 1 218 ? 62.903 83.648  19.316  1.00 35.38 ? 218 HIS A CE1 1 
ATOM   1547  N  NE2 . HIS A 1 218 ? 61.610 83.687  19.589  1.00 35.79 ? 218 HIS A NE2 1 
ATOM   1548  N  N   . THR A 1 219 ? 63.692 77.790  17.675  1.00 33.54 ? 219 THR A N   1 
ATOM   1549  C  CA  . THR A 1 219 ? 63.913 76.357  17.762  1.00 33.18 ? 219 THR A CA  1 
ATOM   1550  C  C   . THR A 1 219 ? 63.497 76.061  19.204  1.00 33.18 ? 219 THR A C   1 
ATOM   1551  O  O   . THR A 1 219 ? 63.854 76.812  20.116  1.00 32.70 ? 219 THR A O   1 
ATOM   1552  C  CB  . THR A 1 219 ? 65.392 75.981  17.588  1.00 33.49 ? 219 THR A CB  1 
ATOM   1553  O  OG1 . THR A 1 219 ? 65.768 76.122  16.215  1.00 32.46 ? 219 THR A OG1 1 
ATOM   1554  C  CG2 . THR A 1 219 ? 65.627 74.542  18.030  1.00 33.18 ? 219 THR A CG2 1 
ATOM   1555  N  N   . PHE A 1 220 ? 62.714 74.999  19.397  1.00 33.05 ? 220 PHE A N   1 
ATOM   1556  C  CA  . PHE A 1 220 ? 62.239 74.601  20.724  1.00 32.44 ? 220 PHE A CA  1 
ATOM   1557  C  C   . PHE A 1 220 ? 62.710 73.193  21.051  1.00 32.51 ? 220 PHE A C   1 
ATOM   1558  O  O   . PHE A 1 220 ? 63.375 72.545  20.251  1.00 32.12 ? 220 PHE A O   1 
ATOM   1559  C  CB  . PHE A 1 220 ? 60.705 74.616  20.797  1.00 31.49 ? 220 PHE A CB  1 
ATOM   1560  C  CG  . PHE A 1 220 ? 60.091 75.987  20.724  1.00 30.95 ? 220 PHE A CG  1 
ATOM   1561  C  CD1 . PHE A 1 220 ? 59.927 76.631  19.496  1.00 30.91 ? 220 PHE A CD1 1 
ATOM   1562  C  CD2 . PHE A 1 220 ? 59.658 76.630  21.886  1.00 29.64 ? 220 PHE A CD2 1 
ATOM   1563  C  CE1 . PHE A 1 220 ? 59.337 77.898  19.425  1.00 30.40 ? 220 PHE A CE1 1 
ATOM   1564  C  CE2 . PHE A 1 220 ? 59.072 77.888  21.830  1.00 29.29 ? 220 PHE A CE2 1 
ATOM   1565  C  CZ  . PHE A 1 220 ? 58.908 78.528  20.600  1.00 30.20 ? 220 PHE A CZ  1 
ATOM   1566  N  N   . LYS A 1 221 ? 62.338 72.716  22.230  1.00 33.36 ? 221 LYS A N   1 
ATOM   1567  C  CA  . LYS A 1 221 ? 62.715 71.376  22.647  1.00 33.99 ? 221 LYS A CA  1 
ATOM   1568  C  C   . LYS A 1 221 ? 61.495 70.544  23.027  1.00 34.07 ? 221 LYS A C   1 
ATOM   1569  O  O   . LYS A 1 221 ? 60.600 71.024  23.708  1.00 34.30 ? 221 LYS A O   1 
ATOM   1570  C  CB  . LYS A 1 221 ? 63.672 71.462  23.831  1.00 35.14 ? 221 LYS A CB  1 
ATOM   1571  C  CG  . LYS A 1 221 ? 64.208 70.131  24.302  1.00 37.09 ? 221 LYS A CG  1 
ATOM   1572  C  CD  . LYS A 1 221 ? 65.322 70.317  25.311  1.00 38.42 ? 221 LYS A CD  1 
ATOM   1573  C  CE  . LYS A 1 221 ? 64.797 70.922  26.587  1.00 39.76 ? 221 LYS A CE  1 
ATOM   1574  N  NZ  . LYS A 1 221 ? 65.922 71.164  27.541  1.00 42.06 ? 221 LYS A NZ  1 
ATOM   1575  N  N   . LEU A 1 222 ? 61.453 69.299  22.567  1.00 34.49 ? 222 LEU A N   1 
ATOM   1576  C  CA  . LEU A 1 222 ? 60.352 68.406  22.897  1.00 35.61 ? 222 LEU A CA  1 
ATOM   1577  C  C   . LEU A 1 222 ? 60.912 67.297  23.774  1.00 36.13 ? 222 LEU A C   1 
ATOM   1578  O  O   . LEU A 1 222 ? 62.024 66.834  23.551  1.00 36.26 ? 222 LEU A O   1 
ATOM   1579  C  CB  . LEU A 1 222 ? 59.749 67.813  21.628  1.00 35.73 ? 222 LEU A CB  1 
ATOM   1580  C  CG  . LEU A 1 222 ? 59.110 68.821  20.670  1.00 36.78 ? 222 LEU A CG  1 
ATOM   1581  C  CD1 . LEU A 1 222 ? 58.750 68.121  19.375  1.00 36.72 ? 222 LEU A CD1 1 
ATOM   1582  C  CD2 . LEU A 1 222 ? 57.864 69.435  21.308  1.00 37.04 ? 222 LEU A CD2 1 
ATOM   1583  N  N   . VAL A 1 223 ? 60.156 66.878  24.778  1.00 36.54 ? 223 VAL A N   1 
ATOM   1584  C  CA  . VAL A 1 223 ? 60.620 65.817  25.664  1.00 37.48 ? 223 VAL A CA  1 
ATOM   1585  C  C   . VAL A 1 223 ? 59.579 64.699  25.749  1.00 38.69 ? 223 VAL A C   1 
ATOM   1586  O  O   . VAL A 1 223 ? 58.402 64.967  26.019  1.00 39.35 ? 223 VAL A O   1 
ATOM   1587  C  CB  . VAL A 1 223 ? 60.886 66.369  27.074  1.00 36.64 ? 223 VAL A CB  1 
ATOM   1588  C  CG1 . VAL A 1 223 ? 61.509 65.301  27.947  1.00 35.80 ? 223 VAL A CG1 1 
ATOM   1589  C  CG2 . VAL A 1 223 ? 61.796 67.573  26.981  1.00 36.53 ? 223 VAL A CG2 1 
ATOM   1590  N  N   . ASN A 1 224 ? 59.986 63.451  25.510  1.00 39.14 ? 224 ASN A N   1 
ATOM   1591  C  CA  . ASN A 1 224 ? 59.013 62.362  25.594  1.00 39.43 ? 224 ASN A CA  1 
ATOM   1592  C  C   . ASN A 1 224 ? 58.951 61.750  26.992  1.00 39.36 ? 224 ASN A C   1 
ATOM   1593  O  O   . ASN A 1 224 ? 59.709 62.120  27.884  1.00 38.05 ? 224 ASN A O   1 
ATOM   1594  C  CB  . ASN A 1 224 ? 59.291 61.273  24.555  1.00 39.33 ? 224 ASN A CB  1 
ATOM   1595  C  CG  . ASN A 1 224 ? 60.583 60.553  24.805  1.00 39.57 ? 224 ASN A CG  1 
ATOM   1596  O  OD1 . ASN A 1 224 ? 60.895 60.192  25.937  1.00 40.21 ? 224 ASN A OD1 1 
ATOM   1597  N  ND2 . ASN A 1 224 ? 61.345 60.325  23.745  1.00 39.18 ? 224 ASN A ND2 1 
ATOM   1598  N  N   . ALA A 1 225 ? 58.032 60.809  27.166  1.00 40.72 ? 225 ALA A N   1 
ATOM   1599  C  CA  . ALA A 1 225 ? 57.813 60.159  28.452  1.00 42.02 ? 225 ALA A CA  1 
ATOM   1600  C  C   . ALA A 1 225 ? 59.036 59.456  29.019  1.00 43.15 ? 225 ALA A C   1 
ATOM   1601  O  O   . ALA A 1 225 ? 59.094 59.183  30.216  1.00 43.73 ? 225 ALA A O   1 
ATOM   1602  C  CB  . ALA A 1 225 ? 56.657 59.187  28.336  1.00 41.03 ? 225 ALA A CB  1 
ATOM   1603  N  N   . ASN A 1 226 ? 60.008 59.164  28.159  1.00 44.43 ? 226 ASN A N   1 
ATOM   1604  C  CA  . ASN A 1 226 ? 61.237 58.491  28.577  1.00 44.64 ? 226 ASN A CA  1 
ATOM   1605  C  C   . ASN A 1 226 ? 62.319 59.453  29.040  1.00 44.10 ? 226 ASN A C   1 
ATOM   1606  O  O   . ASN A 1 226 ? 63.329 59.020  29.591  1.00 45.56 ? 226 ASN A O   1 
ATOM   1607  C  CB  . ASN A 1 226 ? 61.790 57.646  27.434  1.00 45.86 ? 226 ASN A CB  1 
ATOM   1608  C  CG  . ASN A 1 226 ? 60.947 56.428  27.157  1.00 47.80 ? 226 ASN A CG  1 
ATOM   1609  O  OD1 . ASN A 1 226 ? 61.097 55.779  26.122  1.00 48.86 ? 226 ASN A OD1 1 
ATOM   1610  N  ND2 . ASN A 1 226 ? 60.054 56.096  28.091  1.00 49.24 ? 226 ASN A ND2 1 
ATOM   1611  N  N   . GLY A 1 227 ? 62.115 60.747  28.816  1.00 42.60 ? 227 GLY A N   1 
ATOM   1612  C  CA  . GLY A 1 227 ? 63.102 61.731  29.220  1.00 40.92 ? 227 GLY A CA  1 
ATOM   1613  C  C   . GLY A 1 227 ? 64.035 62.096  28.081  1.00 39.79 ? 227 GLY A C   1 
ATOM   1614  O  O   . GLY A 1 227 ? 64.937 62.928  28.223  1.00 39.94 ? 227 GLY A O   1 
ATOM   1615  N  N   . GLU A 1 228 ? 63.815 61.467  26.937  1.00 39.03 ? 228 GLU A N   1 
ATOM   1616  C  CA  . GLU A 1 228 ? 64.630 61.723  25.758  1.00 38.42 ? 228 GLU A CA  1 
ATOM   1617  C  C   . GLU A 1 228 ? 64.156 63.045  25.138  1.00 37.01 ? 228 GLU A C   1 
ATOM   1618  O  O   . GLU A 1 228 ? 62.958 63.351  25.152  1.00 37.64 ? 228 GLU A O   1 
ATOM   1619  C  CB  . GLU A 1 228 ? 64.471 60.536  24.805  1.00 39.89 ? 228 GLU A CB  1 
ATOM   1620  C  CG  . GLU A 1 228 ? 64.445 59.211  25.596  1.00 43.55 ? 228 GLU A CG  1 
ATOM   1621  C  CD  . GLU A 1 228 ? 64.104 57.960  24.777  1.00 45.21 ? 228 GLU A CD  1 
ATOM   1622  O  OE1 . GLU A 1 228 ? 63.049 57.933  24.093  1.00 44.86 ? 228 GLU A OE1 1 
ATOM   1623  O  OE2 . GLU A 1 228 ? 64.898 56.989  24.847  1.00 46.33 ? 228 GLU A OE2 1 
ATOM   1624  N  N   . ALA A 1 229 ? 65.087 63.838  24.618  1.00 35.05 ? 229 ALA A N   1 
ATOM   1625  C  CA  . ALA A 1 229 ? 64.736 65.124  24.026  1.00 33.78 ? 229 ALA A CA  1 
ATOM   1626  C  C   . ALA A 1 229 ? 65.204 65.310  22.579  1.00 33.64 ? 229 ALA A C   1 
ATOM   1627  O  O   . ALA A 1 229 ? 66.174 64.692  22.149  1.00 34.08 ? 229 ALA A O   1 
ATOM   1628  C  CB  . ALA A 1 229 ? 65.299 66.246  24.888  1.00 32.51 ? 229 ALA A CB  1 
ATOM   1629  N  N   . VAL A 1 230 ? 64.498 66.165  21.838  1.00 33.57 ? 230 VAL A N   1 
ATOM   1630  C  CA  . VAL A 1 230 ? 64.838 66.513  20.450  1.00 33.06 ? 230 VAL A CA  1 
ATOM   1631  C  C   . VAL A 1 230 ? 64.547 68.005  20.272  1.00 33.22 ? 230 VAL A C   1 
ATOM   1632  O  O   . VAL A 1 230 ? 63.848 68.603  21.091  1.00 32.88 ? 230 VAL A O   1 
ATOM   1633  C  CB  . VAL A 1 230 ? 63.985 65.745  19.409  1.00 32.26 ? 230 VAL A CB  1 
ATOM   1634  C  CG1 . VAL A 1 230 ? 64.341 64.291  19.420  1.00 31.35 ? 230 VAL A CG1 1 
ATOM   1635  C  CG2 . VAL A 1 230 ? 62.512 65.938  19.704  1.00 31.60 ? 230 VAL A CG2 1 
ATOM   1636  N  N   . TYR A 1 231 ? 65.095 68.609  19.224  1.00 33.38 ? 231 TYR A N   1 
ATOM   1637  C  CA  . TYR A 1 231 ? 64.838 70.022  18.961  1.00 34.39 ? 231 TYR A CA  1 
ATOM   1638  C  C   . TYR A 1 231 ? 63.784 70.091  17.884  1.00 34.35 ? 231 TYR A C   1 
ATOM   1639  O  O   . TYR A 1 231 ? 63.635 69.144  17.101  1.00 34.62 ? 231 TYR A O   1 
ATOM   1640  C  CB  . TYR A 1 231 ? 66.102 70.759  18.499  1.00 35.27 ? 231 TYR A CB  1 
ATOM   1641  C  CG  . TYR A 1 231 ? 67.069 71.021  19.626  1.00 36.37 ? 231 TYR A CG  1 
ATOM   1642  C  CD1 . TYR A 1 231 ? 66.658 71.694  20.779  1.00 36.71 ? 231 TYR A CD1 1 
ATOM   1643  C  CD2 . TYR A 1 231 ? 68.382 70.567  19.562  1.00 36.47 ? 231 TYR A CD2 1 
ATOM   1644  C  CE1 . TYR A 1 231 ? 67.527 71.902  21.831  1.00 37.06 ? 231 TYR A CE1 1 
ATOM   1645  C  CE2 . TYR A 1 231 ? 69.259 70.767  20.609  1.00 36.89 ? 231 TYR A CE2 1 
ATOM   1646  C  CZ  . TYR A 1 231 ? 68.826 71.434  21.739  1.00 37.62 ? 231 TYR A CZ  1 
ATOM   1647  O  OH  . TYR A 1 231 ? 69.702 71.631  22.779  1.00 40.06 ? 231 TYR A OH  1 
ATOM   1648  N  N   . CYS A 1 232 ? 63.042 71.195  17.845  1.00 33.77 ? 232 CYS A N   1 
ATOM   1649  C  CA  . CYS A 1 232 ? 62.002 71.325  16.841  1.00 33.52 ? 232 CYS A CA  1 
ATOM   1650  C  C   . CYS A 1 232 ? 61.692 72.744  16.382  1.00 33.23 ? 232 CYS A C   1 
ATOM   1651  O  O   . CYS A 1 232 ? 62.163 73.732  16.944  1.00 32.95 ? 232 CYS A O   1 
ATOM   1652  C  CB  . CYS A 1 232 ? 60.702 70.663  17.331  1.00 33.03 ? 232 CYS A CB  1 
ATOM   1653  S  SG  . CYS A 1 232 ? 59.656 71.677  18.419  1.00 33.28 ? 232 CYS A SG  1 
ATOM   1654  N  N   . LYS A 1 233 ? 60.895 72.800  15.323  1.00 33.08 ? 233 LYS A N   1 
ATOM   1655  C  CA  . LYS A 1 233 ? 60.405 74.025  14.727  1.00 32.17 ? 233 LYS A CA  1 
ATOM   1656  C  C   . LYS A 1 233 ? 58.913 73.783  14.621  1.00 31.47 ? 233 LYS A C   1 
ATOM   1657  O  O   . LYS A 1 233 ? 58.498 72.689  14.255  1.00 32.14 ? 233 LYS A O   1 
ATOM   1658  C  CB  . LYS A 1 233 ? 60.963 74.212  13.320  1.00 31.93 ? 233 LYS A CB  1 
ATOM   1659  C  CG  . LYS A 1 233 ? 62.431 74.539  13.263  1.00 32.04 ? 233 LYS A CG  1 
ATOM   1660  C  CD  . LYS A 1 233 ? 62.720 75.905  13.823  1.00 30.50 ? 233 LYS A CD  1 
ATOM   1661  C  CE  . LYS A 1 233 ? 64.147 76.301  13.517  1.00 30.36 ? 233 LYS A CE  1 
ATOM   1662  N  NZ  . LYS A 1 233 ? 64.463 77.659  14.040  1.00 31.70 ? 233 LYS A NZ  1 
ATOM   1663  N  N   . PHE A 1 234 ? 58.102 74.775  14.964  1.00 30.75 ? 234 PHE A N   1 
ATOM   1664  C  CA  . PHE A 1 234 ? 56.664 74.624  14.837  1.00 29.66 ? 234 PHE A CA  1 
ATOM   1665  C  C   . PHE A 1 234 ? 56.271 75.326  13.542  1.00 30.46 ? 234 PHE A C   1 
ATOM   1666  O  O   . PHE A 1 234 ? 56.848 76.352  13.187  1.00 29.59 ? 234 PHE A O   1 
ATOM   1667  C  CB  . PHE A 1 234 ? 55.951 75.256  16.030  1.00 28.03 ? 234 PHE A CB  1 
ATOM   1668  C  CG  . PHE A 1 234 ? 56.051 74.449  17.293  1.00 27.56 ? 234 PHE A CG  1 
ATOM   1669  C  CD1 . PHE A 1 234 ? 55.414 73.224  17.401  1.00 27.71 ? 234 PHE A CD1 1 
ATOM   1670  C  CD2 . PHE A 1 234 ? 56.798 74.907  18.373  1.00 27.72 ? 234 PHE A CD2 1 
ATOM   1671  C  CE1 . PHE A 1 234 ? 55.522 72.467  18.562  1.00 27.79 ? 234 PHE A CE1 1 
ATOM   1672  C  CE2 . PHE A 1 234 ? 56.910 74.160  19.532  1.00 26.46 ? 234 PHE A CE2 1 
ATOM   1673  C  CZ  . PHE A 1 234 ? 56.272 72.938  19.627  1.00 27.25 ? 234 PHE A CZ  1 
ATOM   1674  N  N   . HIS A 1 235 ? 55.312 74.754  12.823  1.00 31.57 ? 235 HIS A N   1 
ATOM   1675  C  CA  . HIS A 1 235 ? 54.835 75.331  11.572  1.00 32.74 ? 235 HIS A CA  1 
ATOM   1676  C  C   . HIS A 1 235 ? 53.347 75.116  11.456  1.00 33.75 ? 235 HIS A C   1 
ATOM   1677  O  O   . HIS A 1 235 ? 52.852 74.050  11.822  1.00 34.75 ? 235 HIS A O   1 
ATOM   1678  C  CB  . HIS A 1 235 ? 55.443 74.639  10.361  1.00 31.99 ? 235 HIS A CB  1 
ATOM   1679  C  CG  . HIS A 1 235 ? 56.911 74.825  10.215  1.00 32.41 ? 235 HIS A CG  1 
ATOM   1680  N  ND1 . HIS A 1 235 ? 57.460 75.624  9.237   1.00 33.46 ? 235 HIS A ND1 1 
ATOM   1681  C  CD2 . HIS A 1 235 ? 57.952 74.279  10.885  1.00 33.52 ? 235 HIS A CD2 1 
ATOM   1682  C  CE1 . HIS A 1 235 ? 58.778 75.561  9.309   1.00 33.52 ? 235 HIS A CE1 1 
ATOM   1683  N  NE2 . HIS A 1 235 ? 59.102 74.752  10.302  1.00 33.83 ? 235 HIS A NE2 1 
ATOM   1684  N  N   . TYR A 1 236 ? 52.631 76.116  10.953  1.00 34.38 ? 236 TYR A N   1 
ATOM   1685  C  CA  . TYR A 1 236 ? 51.205 75.957  10.712  1.00 34.98 ? 236 TYR A CA  1 
ATOM   1686  C  C   . TYR A 1 236 ? 50.864 76.628  9.398   1.00 35.70 ? 236 TYR A C   1 
ATOM   1687  O  O   . TYR A 1 236 ? 50.669 77.838  9.336   1.00 35.73 ? 236 TYR A O   1 
ATOM   1688  C  CB  . TYR A 1 236 ? 50.321 76.487  11.856  1.00 34.41 ? 236 TYR A CB  1 
ATOM   1689  C  CG  . TYR A 1 236 ? 50.889 77.534  12.786  1.00 35.44 ? 236 TYR A CG  1 
ATOM   1690  C  CD1 . TYR A 1 236 ? 52.010 77.276  13.571  1.00 35.33 ? 236 TYR A CD1 1 
ATOM   1691  C  CD2 . TYR A 1 236 ? 50.231 78.746  12.967  1.00 35.62 ? 236 TYR A CD2 1 
ATOM   1692  C  CE1 . TYR A 1 236 ? 52.445 78.184  14.513  1.00 34.95 ? 236 TYR A CE1 1 
ATOM   1693  C  CE2 . TYR A 1 236 ? 50.661 79.662  13.904  1.00 35.57 ? 236 TYR A CE2 1 
ATOM   1694  C  CZ  . TYR A 1 236 ? 51.763 79.375  14.682  1.00 36.08 ? 236 TYR A CZ  1 
ATOM   1695  O  OH  . TYR A 1 236 ? 52.142 80.265  15.676  1.00 37.34 ? 236 TYR A OH  1 
ATOM   1696  N  N   . LYS A 1 237 ? 50.822 75.814  8.342   1.00 36.83 ? 237 LYS A N   1 
ATOM   1697  C  CA  . LYS A 1 237 ? 50.533 76.281  6.992   1.00 38.45 ? 237 LYS A CA  1 
ATOM   1698  C  C   . LYS A 1 237 ? 49.039 76.559  6.766   1.00 38.96 ? 237 LYS A C   1 
ATOM   1699  O  O   . LYS A 1 237 ? 48.158 75.810  7.211   1.00 38.51 ? 237 LYS A O   1 
ATOM   1700  C  CB  . LYS A 1 237 ? 51.043 75.258  5.957   1.00 40.20 ? 237 LYS A CB  1 
ATOM   1701  C  CG  . LYS A 1 237 ? 52.555 74.954  6.016   1.00 41.71 ? 237 LYS A CG  1 
ATOM   1702  C  CD  . LYS A 1 237 ? 53.394 76.206  5.725   1.00 45.08 ? 237 LYS A CD  1 
ATOM   1703  C  CE  . LYS A 1 237 ? 54.883 76.065  6.130   1.00 46.07 ? 237 LYS A CE  1 
ATOM   1704  N  NZ  . LYS A 1 237 ? 55.700 75.280  5.159   1.00 47.32 ? 237 LYS A NZ  1 
ATOM   1705  N  N   . THR A 1 238 ? 48.762 77.653  6.071   1.00 39.28 ? 238 THR A N   1 
ATOM   1706  C  CA  . THR A 1 238 ? 47.391 78.041  5.789   1.00 39.38 ? 238 THR A CA  1 
ATOM   1707  C  C   . THR A 1 238 ? 46.714 77.097  4.809   1.00 39.71 ? 238 THR A C   1 
ATOM   1708  O  O   . THR A 1 238 ? 47.251 76.811  3.733   1.00 39.29 ? 238 THR A O   1 
ATOM   1709  C  CB  . THR A 1 238 ? 47.319 79.440  5.192   1.00 39.18 ? 238 THR A CB  1 
ATOM   1710  O  OG1 . THR A 1 238 ? 46.046 79.600  4.562   1.00 40.42 ? 238 THR A OG1 1 
ATOM   1711  C  CG2 . THR A 1 238 ? 48.408 79.645  4.153   1.00 38.31 ? 238 THR A CG2 1 
ATOM   1712  N  N   . ASP A 1 239 ? 45.533 76.615  5.187   1.00 39.98 ? 239 ASP A N   1 
ATOM   1713  C  CA  . ASP A 1 239 ? 44.779 75.724  4.326   1.00 39.51 ? 239 ASP A CA  1 
ATOM   1714  C  C   . ASP A 1 239 ? 44.071 76.558  3.286   1.00 39.86 ? 239 ASP A C   1 
ATOM   1715  O  O   . ASP A 1 239 ? 43.607 76.037  2.276   1.00 41.21 ? 239 ASP A O   1 
ATOM   1716  C  CB  . ASP A 1 239 ? 43.755 74.938  5.123   1.00 39.59 ? 239 ASP A CB  1 
ATOM   1717  C  CG  . ASP A 1 239 ? 44.386 74.106  6.199   1.00 40.14 ? 239 ASP A CG  1 
ATOM   1718  O  OD1 . ASP A 1 239 ? 45.515 73.617  5.993   1.00 40.68 ? 239 ASP A OD1 1 
ATOM   1719  O  OD2 . ASP A 1 239 ? 43.748 73.924  7.251   1.00 41.12 ? 239 ASP A OD2 1 
ATOM   1720  N  N   . GLN A 1 240 ? 43.986 77.861  3.531   1.00 39.48 ? 240 GLN A N   1 
ATOM   1721  C  CA  . GLN A 1 240 ? 43.334 78.746  2.584   1.00 38.84 ? 240 GLN A CA  1 
ATOM   1722  C  C   . GLN A 1 240 ? 44.296 79.177  1.491   1.00 38.92 ? 240 GLN A C   1 
ATOM   1723  O  O   . GLN A 1 240 ? 43.925 79.930  0.604   1.00 39.47 ? 240 GLN A O   1 
ATOM   1724  C  CB  . GLN A 1 240 ? 42.777 79.975  3.292   1.00 38.28 ? 240 GLN A CB  1 
ATOM   1725  C  CG  . GLN A 1 240 ? 41.713 79.647  4.296   1.00 38.09 ? 240 GLN A CG  1 
ATOM   1726  C  CD  . GLN A 1 240 ? 42.288 79.016  5.528   1.00 39.37 ? 240 GLN A CD  1 
ATOM   1727  O  OE1 . GLN A 1 240 ? 41.814 77.979  5.995   1.00 41.18 ? 240 GLN A OE1 1 
ATOM   1728  N  NE2 . GLN A 1 240 ? 43.321 79.640  6.075   1.00 39.99 ? 240 GLN A NE2 1 
ATOM   1729  N  N   . GLY A 1 241 ? 45.536 78.701  1.568   1.00 39.18 ? 241 GLY A N   1 
ATOM   1730  C  CA  . GLY A 1 241 ? 46.538 79.036  0.568   1.00 38.99 ? 241 GLY A CA  1 
ATOM   1731  C  C   . GLY A 1 241 ? 47.173 80.397  0.747   1.00 39.50 ? 241 GLY A C   1 
ATOM   1732  O  O   . GLY A 1 241 ? 46.535 81.323  1.247   1.00 39.93 ? 241 GLY A O   1 
ATOM   1733  N  N   . ILE A 1 242 ? 48.433 80.527  0.339   1.00 39.64 ? 242 ILE A N   1 
ATOM   1734  C  CA  . ILE A 1 242 ? 49.144 81.798  0.450   1.00 39.47 ? 242 ILE A CA  1 
ATOM   1735  C  C   . ILE A 1 242 ? 48.600 82.820  -0.544  1.00 40.59 ? 242 ILE A C   1 
ATOM   1736  O  O   . ILE A 1 242 ? 48.422 82.519  -1.724  1.00 40.80 ? 242 ILE A O   1 
ATOM   1737  C  CB  . ILE A 1 242 ? 50.658 81.628  0.165   1.00 38.58 ? 242 ILE A CB  1 
ATOM   1738  C  CG1 . ILE A 1 242 ? 51.352 80.962  1.358   1.00 38.11 ? 242 ILE A CG1 1 
ATOM   1739  C  CG2 . ILE A 1 242 ? 51.290 82.977  -0.152  1.00 37.34 ? 242 ILE A CG2 1 
ATOM   1740  C  CD1 . ILE A 1 242 ? 51.354 81.781  2.627   1.00 37.43 ? 242 ILE A CD1 1 
ATOM   1741  N  N   . LYS A 1 243 ? 48.321 84.025  -0.063  1.00 41.09 ? 243 LYS A N   1 
ATOM   1742  C  CA  . LYS A 1 243 ? 47.842 85.086  -0.937  1.00 41.74 ? 243 LYS A CA  1 
ATOM   1743  C  C   . LYS A 1 243 ? 48.377 86.407  -0.412  1.00 41.67 ? 243 LYS A C   1 
ATOM   1744  O  O   . LYS A 1 243 ? 48.313 86.678  0.780   1.00 41.51 ? 243 LYS A O   1 
ATOM   1745  C  CB  . LYS A 1 243 ? 46.310 85.112  -1.014  1.00 42.31 ? 243 LYS A CB  1 
ATOM   1746  C  CG  . LYS A 1 243 ? 45.799 86.234  -1.915  1.00 44.06 ? 243 LYS A CG  1 
ATOM   1747  C  CD  . LYS A 1 243 ? 44.438 85.960  -2.580  1.00 45.36 ? 243 LYS A CD  1 
ATOM   1748  C  CE  . LYS A 1 243 ? 43.271 85.942  -1.598  1.00 45.15 ? 243 LYS A CE  1 
ATOM   1749  N  NZ  . LYS A 1 243 ? 41.998 86.261  -2.313  1.00 45.02 ? 243 LYS A NZ  1 
ATOM   1750  N  N   . ASN A 1 244 ? 48.923 87.219  -1.308  1.00 42.03 ? 244 ASN A N   1 
ATOM   1751  C  CA  . ASN A 1 244 ? 49.497 88.497  -0.918  1.00 42.61 ? 244 ASN A CA  1 
ATOM   1752  C  C   . ASN A 1 244 ? 48.846 89.647  -1.675  1.00 43.41 ? 244 ASN A C   1 
ATOM   1753  O  O   . ASN A 1 244 ? 48.205 89.437  -2.712  1.00 43.77 ? 244 ASN A O   1 
ATOM   1754  C  CB  . ASN A 1 244 ? 51.011 88.511  -1.195  1.00 42.54 ? 244 ASN A CB  1 
ATOM   1755  C  CG  . ASN A 1 244 ? 51.749 87.367  -0.517  1.00 42.22 ? 244 ASN A CG  1 
ATOM   1756  O  OD1 . ASN A 1 244 ? 51.679 87.214  0.699   1.00 42.35 ? 244 ASN A OD1 1 
ATOM   1757  N  ND2 . ASN A 1 244 ? 52.466 86.563  -1.304  1.00 41.84 ? 244 ASN A ND2 1 
ATOM   1758  N  N   . LEU A 1 245 ? 49.032 90.859  -1.147  1.00 43.38 ? 245 LEU A N   1 
ATOM   1759  C  CA  . LEU A 1 245 ? 48.499 92.082  -1.740  1.00 42.91 ? 245 LEU A CA  1 
ATOM   1760  C  C   . LEU A 1 245 ? 49.634 92.839  -2.400  1.00 43.23 ? 245 LEU A C   1 
ATOM   1761  O  O   . LEU A 1 245 ? 50.738 92.894  -1.855  1.00 43.82 ? 245 LEU A O   1 
ATOM   1762  C  CB  . LEU A 1 245 ? 47.901 92.984  -0.656  1.00 42.17 ? 245 LEU A CB  1 
ATOM   1763  C  CG  . LEU A 1 245 ? 46.566 92.622  -0.015  1.00 41.33 ? 245 LEU A CG  1 
ATOM   1764  C  CD1 . LEU A 1 245 ? 46.396 93.362  1.298   1.00 40.28 ? 245 LEU A CD1 1 
ATOM   1765  C  CD2 . LEU A 1 245 ? 45.460 92.956  -0.987  1.00 40.70 ? 245 LEU A CD2 1 
ATOM   1766  N  N   . SER A 1 246 ? 49.375 93.426  -3.563  1.00 43.58 ? 246 SER A N   1 
ATOM   1767  C  CA  . SER A 1 246 ? 50.403 94.209  -4.244  1.00 43.73 ? 246 SER A CA  1 
ATOM   1768  C  C   . SER A 1 246 ? 50.533 95.513  -3.455  1.00 44.46 ? 246 SER A C   1 
ATOM   1769  O  O   . SER A 1 246 ? 49.597 95.909  -2.743  1.00 44.49 ? 246 SER A O   1 
ATOM   1770  C  CB  . SER A 1 246 ? 49.988 94.507  -5.683  1.00 42.81 ? 246 SER A CB  1 
ATOM   1771  O  OG  . SER A 1 246 ? 48.737 95.166  -5.717  1.00 43.05 ? 246 SER A OG  1 
ATOM   1772  N  N   . VAL A 1 247 ? 51.675 96.186  -3.573  1.00 44.77 ? 247 VAL A N   1 
ATOM   1773  C  CA  . VAL A 1 247 ? 51.856 97.424  -2.831  1.00 45.35 ? 247 VAL A CA  1 
ATOM   1774  C  C   . VAL A 1 247 ? 50.740 98.412  -3.172  1.00 46.27 ? 247 VAL A C   1 
ATOM   1775  O  O   . VAL A 1 247 ? 50.220 99.101  -2.287  1.00 46.12 ? 247 VAL A O   1 
ATOM   1776  C  CB  . VAL A 1 247 ? 53.256 98.065  -3.103  1.00 44.56 ? 247 VAL A CB  1 
ATOM   1777  C  CG1 . VAL A 1 247 ? 54.328 97.005  -3.030  1.00 44.31 ? 247 VAL A CG1 1 
ATOM   1778  C  CG2 . VAL A 1 247 ? 53.288 98.734  -4.439  1.00 45.30 ? 247 VAL A CG2 1 
ATOM   1779  N  N   . GLU A 1 248 ? 50.352 98.458  -4.446  1.00 47.04 ? 248 GLU A N   1 
ATOM   1780  C  CA  . GLU A 1 248 ? 49.308 99.375  -4.877  1.00 48.12 ? 248 GLU A CA  1 
ATOM   1781  C  C   . GLU A 1 248 ? 48.004 99.090  -4.115  1.00 48.06 ? 248 GLU A C   1 
ATOM   1782  O  O   . GLU A 1 248 ? 47.383 99.995  -3.540  1.00 47.60 ? 248 GLU A O   1 
ATOM   1783  C  CB  . GLU A 1 248 ? 49.090 99.249  -6.388  1.00 49.43 ? 248 GLU A CB  1 
ATOM   1784  C  CG  . GLU A 1 248 ? 48.343 100.446 -6.995  1.00 53.54 ? 248 GLU A CG  1 
ATOM   1785  C  CD  . GLU A 1 248 ? 48.093 100.322 -8.509  1.00 56.14 ? 248 GLU A CD  1 
ATOM   1786  O  OE1 . GLU A 1 248 ? 49.072 100.118 -9.273  1.00 57.11 ? 248 GLU A OE1 1 
ATOM   1787  O  OE2 . GLU A 1 248 ? 46.913 100.440 -8.937  1.00 56.60 ? 248 GLU A OE2 1 
ATOM   1788  N  N   . ASP A 1 249 ? 47.603 97.823  -4.106  1.00 47.96 ? 249 ASP A N   1 
ATOM   1789  C  CA  . ASP A 1 249 ? 46.387 97.399  -3.424  1.00 47.08 ? 249 ASP A CA  1 
ATOM   1790  C  C   . ASP A 1 249 ? 46.501 97.735  -1.950  1.00 46.15 ? 249 ASP A C   1 
ATOM   1791  O  O   . ASP A 1 249 ? 45.597 98.326  -1.364  1.00 45.84 ? 249 ASP A O   1 
ATOM   1792  C  CB  . ASP A 1 249 ? 46.190 95.885  -3.580  1.00 48.23 ? 249 ASP A CB  1 
ATOM   1793  C  CG  . ASP A 1 249 ? 45.641 95.490  -4.950  1.00 49.26 ? 249 ASP A CG  1 
ATOM   1794  O  OD1 . ASP A 1 249 ? 45.623 94.269  -5.237  1.00 50.53 ? 249 ASP A OD1 1 
ATOM   1795  O  OD2 . ASP A 1 249 ? 45.223 96.379  -5.728  1.00 48.48 ? 249 ASP A OD2 1 
ATOM   1796  N  N   . ALA A 1 250 ? 47.623 97.337  -1.362  1.00 45.31 ? 250 ALA A N   1 
ATOM   1797  C  CA  . ALA A 1 250 ? 47.899 97.577  0.047   1.00 44.57 ? 250 ALA A CA  1 
ATOM   1798  C  C   . ALA A 1 250 ? 47.667 99.042  0.382   1.00 44.66 ? 250 ALA A C   1 
ATOM   1799  O  O   . ALA A 1 250 ? 47.006 99.377  1.371   1.00 45.10 ? 250 ALA A O   1 
ATOM   1800  C  CB  . ALA A 1 250 ? 49.337 97.195  0.356   1.00 44.31 ? 250 ALA A CB  1 
ATOM   1801  N  N   . ALA A 1 251 ? 48.221 99.912  -0.453  1.00 44.31 ? 251 ALA A N   1 
ATOM   1802  C  CA  . ALA A 1 251 ? 48.086 101.342 -0.266  1.00 43.67 ? 251 ALA A CA  1 
ATOM   1803  C  C   . ALA A 1 251 ? 46.622 101.730 -0.341  1.00 43.63 ? 251 ALA A C   1 
ATOM   1804  O  O   . ALA A 1 251 ? 46.086 102.331 0.589   1.00 43.06 ? 251 ALA A O   1 
ATOM   1805  C  CB  . ALA A 1 251 ? 48.868 102.074 -1.333  1.00 43.65 ? 251 ALA A CB  1 
ATOM   1806  N  N   . ARG A 1 252 ? 45.978 101.391 -1.455  1.00 43.32 ? 252 ARG A N   1 
ATOM   1807  C  CA  . ARG A 1 252 ? 44.571 101.719 -1.626  1.00 42.98 ? 252 ARG A CA  1 
ATOM   1808  C  C   . ARG A 1 252 ? 43.798 101.328 -0.377  1.00 42.45 ? 252 ARG A C   1 
ATOM   1809  O  O   . ARG A 1 252 ? 43.047 102.130 0.172   1.00 43.33 ? 252 ARG A O   1 
ATOM   1810  C  CB  . ARG A 1 252 ? 43.985 100.997 -2.838  1.00 43.16 ? 252 ARG A CB  1 
ATOM   1811  C  CG  . ARG A 1 252 ? 42.461 101.077 -2.930  1.00 44.32 ? 252 ARG A CG  1 
ATOM   1812  C  CD  . ARG A 1 252 ? 41.917 100.394 -4.196  1.00 45.54 ? 252 ARG A CD  1 
ATOM   1813  N  NE  . ARG A 1 252 ? 42.161 98.944  -4.263  1.00 46.25 ? 252 ARG A NE  1 
ATOM   1814  C  CZ  . ARG A 1 252 ? 41.362 98.005  -3.743  1.00 46.44 ? 252 ARG A CZ  1 
ATOM   1815  N  NH1 . ARG A 1 252 ? 40.246 98.347  -3.102  1.00 45.56 ? 252 ARG A NH1 1 
ATOM   1816  N  NH2 . ARG A 1 252 ? 41.671 96.713  -3.870  1.00 46.36 ? 252 ARG A NH2 1 
ATOM   1817  N  N   . LEU A 1 253 ? 43.997 100.103 0.088   1.00 41.43 ? 253 LEU A N   1 
ATOM   1818  C  CA  . LEU A 1 253 ? 43.285 99.633  1.264   1.00 41.25 ? 253 LEU A CA  1 
ATOM   1819  C  C   . LEU A 1 253 ? 43.633 100.335 2.576   1.00 41.02 ? 253 LEU A C   1 
ATOM   1820  O  O   . LEU A 1 253 ? 42.754 100.552 3.405   1.00 40.67 ? 253 LEU A O   1 
ATOM   1821  C  CB  . LEU A 1 253 ? 43.479 98.133  1.417   1.00 41.72 ? 253 LEU A CB  1 
ATOM   1822  C  CG  . LEU A 1 253 ? 42.942 97.330  0.236   1.00 42.35 ? 253 LEU A CG  1 
ATOM   1823  C  CD1 . LEU A 1 253 ? 43.267 95.856  0.438   1.00 42.90 ? 253 LEU A CD1 1 
ATOM   1824  C  CD2 . LEU A 1 253 ? 41.439 97.547  0.113   1.00 42.12 ? 253 LEU A CD2 1 
ATOM   1825  N  N   . SER A 1 254 ? 44.901 100.685 2.775   1.00 41.11 ? 254 SER A N   1 
ATOM   1826  C  CA  . SER A 1 254 ? 45.311 101.368 4.007   1.00 41.25 ? 254 SER A CA  1 
ATOM   1827  C  C   . SER A 1 254 ? 44.533 102.678 4.097   1.00 41.10 ? 254 SER A C   1 
ATOM   1828  O  O   . SER A 1 254 ? 44.346 103.254 5.168   1.00 40.31 ? 254 SER A O   1 
ATOM   1829  C  CB  . SER A 1 254 ? 46.817 101.660 3.987   1.00 41.63 ? 254 SER A CB  1 
ATOM   1830  O  OG  . SER A 1 254 ? 47.127 102.752 3.126   1.00 43.10 ? 254 SER A OG  1 
ATOM   1831  N  N   . GLN A 1 255 ? 44.083 103.134 2.938   1.00 41.82 ? 255 GLN A N   1 
ATOM   1832  C  CA  . GLN A 1 255 ? 43.315 104.363 2.809   1.00 42.04 ? 255 GLN A CA  1 
ATOM   1833  C  C   . GLN A 1 255 ? 41.835 104.010 3.008   1.00 41.35 ? 255 GLN A C   1 
ATOM   1834  O  O   . GLN A 1 255 ? 41.197 104.426 3.982   1.00 40.03 ? 255 GLN A O   1 
ATOM   1835  C  CB  . GLN A 1 255 ? 43.567 104.945 1.407   1.00 43.05 ? 255 GLN A CB  1 
ATOM   1836  C  CG  . GLN A 1 255 ? 43.050 106.357 1.149   1.00 45.16 ? 255 GLN A CG  1 
ATOM   1837  C  CD  . GLN A 1 255 ? 41.688 106.372 0.456   1.00 47.01 ? 255 GLN A CD  1 
ATOM   1838  O  OE1 . GLN A 1 255 ? 40.630 106.388 1.111   1.00 47.75 ? 255 GLN A OE1 1 
ATOM   1839  N  NE2 . GLN A 1 255 ? 41.708 106.360 -0.878  1.00 46.76 ? 255 GLN A NE2 1 
ATOM   1840  N  N   . GLU A 1 256 ? 41.316 103.209 2.085   1.00 40.29 ? 256 GLU A N   1 
ATOM   1841  C  CA  . GLU A 1 256 ? 39.936 102.786 2.112   1.00 39.96 ? 256 GLU A CA  1 
ATOM   1842  C  C   . GLU A 1 256 ? 39.489 102.028 3.352   1.00 39.43 ? 256 GLU A C   1 
ATOM   1843  O  O   . GLU A 1 256 ? 38.385 102.247 3.833   1.00 39.42 ? 256 GLU A O   1 
ATOM   1844  C  CB  . GLU A 1 256 ? 39.655 101.961 0.873   1.00 40.86 ? 256 GLU A CB  1 
ATOM   1845  C  CG  . GLU A 1 256 ? 39.732 102.796 -0.373  1.00 43.84 ? 256 GLU A CG  1 
ATOM   1846  C  CD  . GLU A 1 256 ? 39.661 101.977 -1.638  1.00 45.90 ? 256 GLU A CD  1 
ATOM   1847  O  OE1 . GLU A 1 256 ? 39.452 102.588 -2.708  1.00 47.80 ? 256 GLU A OE1 1 
ATOM   1848  O  OE2 . GLU A 1 256 ? 39.823 100.735 -1.569  1.00 46.49 ? 256 GLU A OE2 1 
ATOM   1849  N  N   . ASP A 1 257 ? 40.323 101.135 3.870   1.00 38.10 ? 257 ASP A N   1 
ATOM   1850  C  CA  . ASP A 1 257 ? 39.937 100.380 5.051   1.00 37.51 ? 257 ASP A CA  1 
ATOM   1851  C  C   . ASP A 1 257 ? 41.125 100.008 5.910   1.00 36.75 ? 257 ASP A C   1 
ATOM   1852  O  O   . ASP A 1 257 ? 41.745 98.966  5.715   1.00 36.31 ? 257 ASP A O   1 
ATOM   1853  C  CB  . ASP A 1 257 ? 39.208 99.108  4.649   1.00 38.67 ? 257 ASP A CB  1 
ATOM   1854  C  CG  . ASP A 1 257 ? 38.573 98.401  5.834   1.00 39.82 ? 257 ASP A CG  1 
ATOM   1855  O  OD1 . ASP A 1 257 ? 38.004 97.307  5.620   1.00 39.65 ? 257 ASP A OD1 1 
ATOM   1856  O  OD2 . ASP A 1 257 ? 38.636 98.940  6.968   1.00 40.07 ? 257 ASP A OD2 1 
ATOM   1857  N  N   . PRO A 1 258 ? 41.447 100.853 6.894   1.00 36.30 ? 258 PRO A N   1 
ATOM   1858  C  CA  . PRO A 1 258 ? 42.577 100.619 7.797   1.00 35.53 ? 258 PRO A CA  1 
ATOM   1859  C  C   . PRO A 1 258 ? 42.419 99.337  8.593   1.00 35.31 ? 258 PRO A C   1 
ATOM   1860  O  O   . PRO A 1 258 ? 43.389 98.785  9.098   1.00 34.96 ? 258 PRO A O   1 
ATOM   1861  C  CB  . PRO A 1 258 ? 42.567 101.855 8.691   1.00 35.23 ? 258 PRO A CB  1 
ATOM   1862  C  CG  . PRO A 1 258 ? 41.914 102.904 7.820   1.00 35.34 ? 258 PRO A CG  1 
ATOM   1863  C  CD  . PRO A 1 258 ? 40.791 102.135 7.194   1.00 35.40 ? 258 PRO A CD  1 
ATOM   1864  N  N   . ASP A 1 259 ? 41.190 98.855  8.701   1.00 35.41 ? 259 ASP A N   1 
ATOM   1865  C  CA  . ASP A 1 259 ? 40.957 97.636  9.456   1.00 35.58 ? 259 ASP A CA  1 
ATOM   1866  C  C   . ASP A 1 259 ? 40.562 96.467  8.579   1.00 35.38 ? 259 ASP A C   1 
ATOM   1867  O  O   . ASP A 1 259 ? 39.769 95.619  8.973   1.00 34.95 ? 259 ASP A O   1 
ATOM   1868  C  CB  . ASP A 1 259 ? 39.905 97.890  10.528  1.00 35.71 ? 259 ASP A CB  1 
ATOM   1869  C  CG  . ASP A 1 259 ? 40.282 99.048  11.430  1.00 35.98 ? 259 ASP A CG  1 
ATOM   1870  O  OD1 . ASP A 1 259 ? 41.457 99.099  11.857  1.00 36.58 ? 259 ASP A OD1 1 
ATOM   1871  O  OD2 . ASP A 1 259 ? 39.414 99.901  11.707  1.00 35.54 ? 259 ASP A OD2 1 
ATOM   1872  N  N   . TYR A 1 260 ? 41.146 96.426  7.390   1.00 35.32 ? 260 TYR A N   1 
ATOM   1873  C  CA  . TYR A 1 260 ? 40.881 95.364  6.437   1.00 35.92 ? 260 TYR A CA  1 
ATOM   1874  C  C   . TYR A 1 260 ? 41.055 94.006  7.098   1.00 35.82 ? 260 TYR A C   1 
ATOM   1875  O  O   . TYR A 1 260 ? 40.121 93.229  7.186   1.00 36.60 ? 260 TYR A O   1 
ATOM   1876  C  CB  . TYR A 1 260 ? 41.833 95.508  5.254   1.00 36.37 ? 260 TYR A CB  1 
ATOM   1877  C  CG  . TYR A 1 260 ? 41.725 94.447  4.186   1.00 37.01 ? 260 TYR A CG  1 
ATOM   1878  C  CD1 . TYR A 1 260 ? 42.419 93.247  4.291   1.00 37.32 ? 260 TYR A CD1 1 
ATOM   1879  C  CD2 . TYR A 1 260 ? 40.977 94.675  3.036   1.00 37.48 ? 260 TYR A CD2 1 
ATOM   1880  C  CE1 . TYR A 1 260 ? 42.378 92.298  3.262   1.00 38.32 ? 260 TYR A CE1 1 
ATOM   1881  C  CE2 . TYR A 1 260 ? 40.927 93.742  2.007   1.00 38.46 ? 260 TYR A CE2 1 
ATOM   1882  C  CZ  . TYR A 1 260 ? 41.630 92.555  2.119   1.00 39.11 ? 260 TYR A CZ  1 
ATOM   1883  O  OH  . TYR A 1 260 ? 41.595 91.650  1.071   1.00 39.17 ? 260 TYR A OH  1 
ATOM   1884  N  N   . GLY A 1 261 ? 42.259 93.734  7.576   1.00 35.68 ? 261 GLY A N   1 
ATOM   1885  C  CA  . GLY A 1 261 ? 42.531 92.464  8.218   1.00 34.42 ? 261 GLY A CA  1 
ATOM   1886  C  C   . GLY A 1 261 ? 41.544 92.053  9.282   1.00 33.47 ? 261 GLY A C   1 
ATOM   1887  O  O   . GLY A 1 261 ? 41.297 90.870  9.463   1.00 34.72 ? 261 GLY A O   1 
ATOM   1888  N  N   . ILE A 1 262 ? 40.971 93.008  9.995   1.00 32.87 ? 262 ILE A N   1 
ATOM   1889  C  CA  . ILE A 1 262 ? 40.014 92.668  11.043  1.00 32.32 ? 262 ILE A CA  1 
ATOM   1890  C  C   . ILE A 1 262 ? 38.671 92.233  10.467  1.00 32.04 ? 262 ILE A C   1 
ATOM   1891  O  O   . ILE A 1 262 ? 38.116 91.207  10.850  1.00 32.44 ? 262 ILE A O   1 
ATOM   1892  C  CB  . ILE A 1 262 ? 39.797 93.864  12.007  1.00 32.10 ? 262 ILE A CB  1 
ATOM   1893  C  CG1 . ILE A 1 262 ? 41.087 94.128  12.789  1.00 31.29 ? 262 ILE A CG1 1 
ATOM   1894  C  CG2 . ILE A 1 262 ? 38.644 93.577  12.953  1.00 31.57 ? 262 ILE A CG2 1 
ATOM   1895  C  CD1 . ILE A 1 262 ? 41.010 95.294  13.740  1.00 31.59 ? 262 ILE A CD1 1 
ATOM   1896  N  N   . ARG A 1 263 ? 38.156 93.027  9.542   1.00 32.26 ? 263 ARG A N   1 
ATOM   1897  C  CA  . ARG A 1 263 ? 36.884 92.753  8.893   1.00 32.16 ? 263 ARG A CA  1 
ATOM   1898  C  C   . ARG A 1 263 ? 36.906 91.404  8.161   1.00 32.76 ? 263 ARG A C   1 
ATOM   1899  O  O   . ARG A 1 263 ? 35.969 90.611  8.283   1.00 33.36 ? 263 ARG A O   1 
ATOM   1900  C  CB  . ARG A 1 263 ? 36.587 93.874  7.909   1.00 31.85 ? 263 ARG A CB  1 
ATOM   1901  C  CG  . ARG A 1 263 ? 35.207 93.860  7.329   1.00 31.18 ? 263 ARG A CG  1 
ATOM   1902  C  CD  . ARG A 1 263 ? 35.181 94.811  6.152   1.00 30.67 ? 263 ARG A CD  1 
ATOM   1903  N  NE  . ARG A 1 263 ? 35.687 96.127  6.530   1.00 30.67 ? 263 ARG A NE  1 
ATOM   1904  C  CZ  . ARG A 1 263 ? 34.999 97.021  7.232   1.00 30.09 ? 263 ARG A CZ  1 
ATOM   1905  N  NH1 . ARG A 1 263 ? 33.768 96.755  7.633   1.00 30.78 ? 263 ARG A NH1 1 
ATOM   1906  N  NH2 . ARG A 1 263 ? 35.549 98.174  7.550   1.00 30.47 ? 263 ARG A NH2 1 
ATOM   1907  N  N   . ASP A 1 264 ? 37.973 91.149  7.405   1.00 32.18 ? 264 ASP A N   1 
ATOM   1908  C  CA  . ASP A 1 264 ? 38.117 89.901  6.660   1.00 32.27 ? 264 ASP A CA  1 
ATOM   1909  C  C   . ASP A 1 264 ? 38.051 88.660  7.555   1.00 32.32 ? 264 ASP A C   1 
ATOM   1910  O  O   . ASP A 1 264 ? 37.315 87.706  7.269   1.00 32.60 ? 264 ASP A O   1 
ATOM   1911  C  CB  . ASP A 1 264 ? 39.438 89.907  5.894   1.00 32.99 ? 264 ASP A CB  1 
ATOM   1912  C  CG  . ASP A 1 264 ? 39.737 88.578  5.242   1.00 33.53 ? 264 ASP A CG  1 
ATOM   1913  O  OD1 . ASP A 1 264 ? 40.417 87.733  5.861   1.00 32.68 ? 264 ASP A OD1 1 
ATOM   1914  O  OD2 . ASP A 1 264 ? 39.277 88.379  4.101   1.00 36.66 ? 264 ASP A OD2 1 
ATOM   1915  N  N   . LEU A 1 265 ? 38.825 88.668  8.634   1.00 31.40 ? 265 LEU A N   1 
ATOM   1916  C  CA  . LEU A 1 265 ? 38.828 87.542  9.549   1.00 31.22 ? 265 LEU A CA  1 
ATOM   1917  C  C   . LEU A 1 265 ? 37.439 87.386  10.148  1.00 31.54 ? 265 LEU A C   1 
ATOM   1918  O  O   . LEU A 1 265 ? 36.829 86.320  10.096  1.00 30.95 ? 265 LEU A O   1 
ATOM   1919  C  CB  . LEU A 1 265 ? 39.849 87.761  10.672  1.00 30.70 ? 265 LEU A CB  1 
ATOM   1920  C  CG  . LEU A 1 265 ? 39.851 86.651  11.728  1.00 30.28 ? 265 LEU A CG  1 
ATOM   1921  C  CD1 . LEU A 1 265 ? 40.137 85.321  11.051  1.00 29.66 ? 265 LEU A CD1 1 
ATOM   1922  C  CD2 . LEU A 1 265 ? 40.876 86.933  12.802  1.00 29.45 ? 265 LEU A CD2 1 
ATOM   1923  N  N   . PHE A 1 266 ? 36.936 88.469  10.718  1.00 32.16 ? 266 PHE A N   1 
ATOM   1924  C  CA  . PHE A 1 266 ? 35.623 88.435  11.328  1.00 32.39 ? 266 PHE A CA  1 
ATOM   1925  C  C   . PHE A 1 266 ? 34.532 87.973  10.370  1.00 33.41 ? 266 PHE A C   1 
ATOM   1926  O  O   . PHE A 1 266 ? 33.722 87.121  10.726  1.00 34.27 ? 266 PHE A O   1 
ATOM   1927  C  CB  . PHE A 1 266 ? 35.267 89.810  11.884  1.00 30.89 ? 266 PHE A CB  1 
ATOM   1928  C  CG  . PHE A 1 266 ? 34.045 89.812  12.753  1.00 30.82 ? 266 PHE A CG  1 
ATOM   1929  C  CD1 . PHE A 1 266 ? 32.783 89.595  12.208  1.00 30.50 ? 266 PHE A CD1 1 
ATOM   1930  C  CD2 . PHE A 1 266 ? 34.156 90.014  14.128  1.00 29.85 ? 266 PHE A CD2 1 
ATOM   1931  C  CE1 . PHE A 1 266 ? 31.648 89.577  13.022  1.00 30.11 ? 266 PHE A CE1 1 
ATOM   1932  C  CE2 . PHE A 1 266 ? 33.035 89.998  14.945  1.00 29.50 ? 266 PHE A CE2 1 
ATOM   1933  C  CZ  . PHE A 1 266 ? 31.777 89.778  14.397  1.00 30.06 ? 266 PHE A CZ  1 
ATOM   1934  N  N   . ASN A 1 267 ? 34.493 88.507  9.153   1.00 34.02 ? 267 ASN A N   1 
ATOM   1935  C  CA  . ASN A 1 267 ? 33.417 88.099  8.266   1.00 34.83 ? 267 ASN A CA  1 
ATOM   1936  C  C   . ASN A 1 267 ? 33.478 86.636  7.915   1.00 34.04 ? 267 ASN A C   1 
ATOM   1937  O  O   . ASN A 1 267 ? 32.448 85.960  7.908   1.00 34.33 ? 267 ASN A O   1 
ATOM   1938  C  CB  . ASN A 1 267 ? 33.352 88.974  7.005   1.00 36.64 ? 267 ASN A CB  1 
ATOM   1939  C  CG  . ASN A 1 267 ? 32.726 90.356  7.284   1.00 39.60 ? 267 ASN A CG  1 
ATOM   1940  O  OD1 . ASN A 1 267 ? 32.102 90.587  8.344   1.00 40.79 ? 267 ASN A OD1 1 
ATOM   1941  N  ND2 . ASN A 1 267 ? 32.885 91.279  6.334   1.00 40.62 ? 267 ASN A ND2 1 
ATOM   1942  N  N   . ALA A 1 268 ? 34.678 86.131  7.653   1.00 33.09 ? 268 ALA A N   1 
ATOM   1943  C  CA  . ALA A 1 268 ? 34.820 84.722  7.316   1.00 31.62 ? 268 ALA A CA  1 
ATOM   1944  C  C   . ALA A 1 268 ? 34.182 83.867  8.403   1.00 31.22 ? 268 ALA A C   1 
ATOM   1945  O  O   . ALA A 1 268 ? 33.314 83.055  8.130   1.00 31.98 ? 268 ALA A O   1 
ATOM   1946  C  CB  . ALA A 1 268 ? 36.287 84.366  7.156   1.00 30.94 ? 268 ALA A CB  1 
ATOM   1947  N  N   . ILE A 1 269 ? 34.596 84.061  9.645   1.00 30.87 ? 269 ILE A N   1 
ATOM   1948  C  CA  . ILE A 1 269 ? 34.049 83.275  10.731  1.00 30.44 ? 269 ILE A CA  1 
ATOM   1949  C  C   . ILE A 1 269 ? 32.560 83.526  10.914  1.00 30.60 ? 269 ILE A C   1 
ATOM   1950  O  O   . ILE A 1 269 ? 31.794 82.615  11.221  1.00 30.23 ? 269 ILE A O   1 
ATOM   1951  C  CB  . ILE A 1 269 ? 34.790 83.580  12.046  1.00 31.48 ? 269 ILE A CB  1 
ATOM   1952  C  CG1 . ILE A 1 269 ? 36.285 83.333  11.848  1.00 32.47 ? 269 ILE A CG1 1 
ATOM   1953  C  CG2 . ILE A 1 269 ? 34.255 82.693  13.191  1.00 31.15 ? 269 ILE A CG2 1 
ATOM   1954  C  CD1 . ILE A 1 269 ? 37.132 83.506  13.101  1.00 34.25 ? 269 ILE A CD1 1 
ATOM   1955  N  N   . ALA A 1 270 ? 32.139 84.765  10.721  1.00 31.16 ? 270 ALA A N   1 
ATOM   1956  C  CA  . ALA A 1 270 ? 30.729 85.094  10.893  1.00 32.24 ? 270 ALA A CA  1 
ATOM   1957  C  C   . ALA A 1 270 ? 29.836 84.337  9.919   1.00 32.92 ? 270 ALA A C   1 
ATOM   1958  O  O   . ALA A 1 270 ? 28.692 84.010  10.256  1.00 33.08 ? 270 ALA A O   1 
ATOM   1959  C  CB  . ALA A 1 270 ? 30.518 86.584  10.731  1.00 31.84 ? 270 ALA A CB  1 
ATOM   1960  N  N   . THR A 1 271 ? 30.357 84.069  8.720   1.00 33.11 ? 271 THR A N   1 
ATOM   1961  C  CA  . THR A 1 271 ? 29.606 83.351  7.693   1.00 34.19 ? 271 THR A CA  1 
ATOM   1962  C  C   . THR A 1 271 ? 29.955 81.872  7.642   1.00 35.53 ? 271 THR A C   1 
ATOM   1963  O  O   . THR A 1 271 ? 29.540 81.166  6.726   1.00 36.89 ? 271 THR A O   1 
ATOM   1964  C  CB  . THR A 1 271 ? 29.843 83.921  6.274   1.00 34.00 ? 271 THR A CB  1 
ATOM   1965  O  OG1 . THR A 1 271 ? 31.235 83.833  5.936   1.00 33.05 ? 271 THR A OG1 1 
ATOM   1966  C  CG2 . THR A 1 271 ? 29.377 85.352  6.191   1.00 34.12 ? 271 THR A CG2 1 
ATOM   1967  N  N   . GLY A 1 272 ? 30.728 81.396  8.609   1.00 36.12 ? 272 GLY A N   1 
ATOM   1968  C  CA  . GLY A 1 272 ? 31.069 79.990  8.614   1.00 36.41 ? 272 GLY A CA  1 
ATOM   1969  C  C   . GLY A 1 272 ? 32.321 79.605  7.856   1.00 37.28 ? 272 GLY A C   1 
ATOM   1970  O  O   . GLY A 1 272 ? 32.795 78.492  8.041   1.00 37.45 ? 272 GLY A O   1 
ATOM   1971  N  N   . LYS A 1 273 ? 32.858 80.478  7.001   1.00 37.92 ? 273 LYS A N   1 
ATOM   1972  C  CA  . LYS A 1 273 ? 34.086 80.138  6.279   1.00 38.66 ? 273 LYS A CA  1 
ATOM   1973  C  C   . LYS A 1 273 ? 35.227 80.076  7.297   1.00 38.38 ? 273 LYS A C   1 
ATOM   1974  O  O   . LYS A 1 273 ? 36.149 80.896  7.244   1.00 38.45 ? 273 LYS A O   1 
ATOM   1975  C  CB  . LYS A 1 273 ? 34.466 81.204  5.249   1.00 40.33 ? 273 LYS A CB  1 
ATOM   1976  C  CG  . LYS A 1 273 ? 33.412 81.619  4.258   1.00 43.43 ? 273 LYS A CG  1 
ATOM   1977  C  CD  . LYS A 1 273 ? 33.968 82.791  3.400   1.00 46.23 ? 273 LYS A CD  1 
ATOM   1978  C  CE  . LYS A 1 273 ? 32.922 83.416  2.434   1.00 46.17 ? 273 LYS A CE  1 
ATOM   1979  N  NZ  . LYS A 1 273 ? 31.718 83.975  3.126   1.00 45.48 ? 273 LYS A NZ  1 
ATOM   1980  N  N   . TYR A 1 274 ? 35.173 79.113  8.213   1.00 37.22 ? 274 TYR A N   1 
ATOM   1981  C  CA  . TYR A 1 274 ? 36.202 78.977  9.240   1.00 36.77 ? 274 TYR A CA  1 
ATOM   1982  C  C   . TYR A 1 274 ? 37.583 78.725  8.675   1.00 36.26 ? 274 TYR A C   1 
ATOM   1983  O  O   . TYR A 1 274 ? 37.789 77.782  7.908   1.00 36.72 ? 274 TYR A O   1 
ATOM   1984  C  CB  . TYR A 1 274 ? 35.890 77.822  10.187  1.00 36.83 ? 274 TYR A CB  1 
ATOM   1985  C  CG  . TYR A 1 274 ? 34.542 77.876  10.846  1.00 37.27 ? 274 TYR A CG  1 
ATOM   1986  C  CD1 . TYR A 1 274 ? 34.068 79.053  11.424  1.00 37.05 ? 274 TYR A CD1 1 
ATOM   1987  C  CD2 . TYR A 1 274 ? 33.753 76.734  10.934  1.00 37.55 ? 274 TYR A CD2 1 
ATOM   1988  C  CE1 . TYR A 1 274 ? 32.844 79.091  12.076  1.00 37.39 ? 274 TYR A CE1 1 
ATOM   1989  C  CE2 . TYR A 1 274 ? 32.527 76.760  11.583  1.00 38.39 ? 274 TYR A CE2 1 
ATOM   1990  C  CZ  . TYR A 1 274 ? 32.078 77.941  12.152  1.00 38.38 ? 274 TYR A CZ  1 
ATOM   1991  O  OH  . TYR A 1 274 ? 30.857 77.960  12.789  1.00 39.99 ? 274 TYR A OH  1 
ATOM   1992  N  N   . PRO A 1 275 ? 38.559 79.562  9.051   1.00 35.96 ? 275 PRO A N   1 
ATOM   1993  C  CA  . PRO A 1 275 ? 39.913 79.350  8.540   1.00 35.00 ? 275 PRO A CA  1 
ATOM   1994  C  C   . PRO A 1 275 ? 40.620 78.260  9.360   1.00 34.87 ? 275 PRO A C   1 
ATOM   1995  O  O   . PRO A 1 275 ? 40.345 78.071  10.557  1.00 34.18 ? 275 PRO A O   1 
ATOM   1996  C  CB  . PRO A 1 275 ? 40.551 80.733  8.690   1.00 35.37 ? 275 PRO A CB  1 
ATOM   1997  C  CG  . PRO A 1 275 ? 39.898 81.272  9.924   1.00 34.55 ? 275 PRO A CG  1 
ATOM   1998  C  CD  . PRO A 1 275 ? 38.449 80.858  9.752   1.00 35.54 ? 275 PRO A CD  1 
ATOM   1999  N  N   . SER A 1 276 ? 41.520 77.530  8.712   1.00 34.34 ? 276 SER A N   1 
ATOM   2000  C  CA  . SER A 1 276 ? 42.248 76.474  9.392   1.00 34.22 ? 276 SER A CA  1 
ATOM   2001  C  C   . SER A 1 276 ? 43.712 76.490  8.999   1.00 33.99 ? 276 SER A C   1 
ATOM   2002  O  O   . SER A 1 276 ? 44.109 77.178  8.064   1.00 34.48 ? 276 SER A O   1 
ATOM   2003  C  CB  . SER A 1 276 ? 41.643 75.119  9.040   1.00 34.71 ? 276 SER A CB  1 
ATOM   2004  O  OG  . SER A 1 276 ? 41.618 74.957  7.632   1.00 34.65 ? 276 SER A OG  1 
ATOM   2005  N  N   . TRP A 1 277 ? 44.510 75.719  9.725   1.00 33.86 ? 277 TRP A N   1 
ATOM   2006  C  CA  . TRP A 1 277 ? 45.943 75.609  9.467   1.00 33.10 ? 277 TRP A CA  1 
ATOM   2007  C  C   . TRP A 1 277 ? 46.422 74.182  9.802   1.00 33.66 ? 277 TRP A C   1 
ATOM   2008  O  O   . TRP A 1 277 ? 46.018 73.584  10.814  1.00 33.12 ? 277 TRP A O   1 
ATOM   2009  C  CB  . TRP A 1 277 ? 46.717 76.623  10.327  1.00 31.12 ? 277 TRP A CB  1 
ATOM   2010  C  CG  . TRP A 1 277 ? 46.669 78.047  9.860   1.00 28.89 ? 277 TRP A CG  1 
ATOM   2011  C  CD1 . TRP A 1 277 ? 47.606 78.696  9.113   1.00 27.86 ? 277 TRP A CD1 1 
ATOM   2012  C  CD2 . TRP A 1 277 ? 45.643 79.010  10.141  1.00 28.32 ? 277 TRP A CD2 1 
ATOM   2013  N  NE1 . TRP A 1 277 ? 47.231 80.006  8.913   1.00 27.78 ? 277 TRP A NE1 1 
ATOM   2014  C  CE2 . TRP A 1 277 ? 46.030 80.222  9.533   1.00 27.79 ? 277 TRP A CE2 1 
ATOM   2015  C  CE3 . TRP A 1 277 ? 44.433 78.964  10.853  1.00 28.04 ? 277 TRP A CE3 1 
ATOM   2016  C  CZ2 . TRP A 1 277 ? 45.254 81.378  9.614   1.00 28.52 ? 277 TRP A CZ2 1 
ATOM   2017  C  CZ3 . TRP A 1 277 ? 43.656 80.118  10.935  1.00 26.69 ? 277 TRP A CZ3 1 
ATOM   2018  C  CH2 . TRP A 1 277 ? 44.072 81.306  10.320  1.00 27.85 ? 277 TRP A CH2 1 
ATOM   2019  N  N   . THR A 1 278 ? 47.278 73.636  8.947   1.00 34.17 ? 278 THR A N   1 
ATOM   2020  C  CA  . THR A 1 278 ? 47.824 72.308  9.177   1.00 34.98 ? 278 THR A CA  1 
ATOM   2021  C  C   . THR A 1 278 ? 49.081 72.526  10.011  1.00 34.72 ? 278 THR A C   1 
ATOM   2022  O  O   . THR A 1 278 ? 49.997 73.236  9.607   1.00 33.72 ? 278 THR A O   1 
ATOM   2023  C  CB  . THR A 1 278 ? 48.178 71.620  7.850   1.00 35.75 ? 278 THR A CB  1 
ATOM   2024  O  OG1 . THR A 1 278 ? 47.026 71.618  6.996   1.00 37.68 ? 278 THR A OG1 1 
ATOM   2025  C  CG2 . THR A 1 278 ? 48.594 70.193  8.092   1.00 35.74 ? 278 THR A CG2 1 
ATOM   2026  N  N   . PHE A 1 279 ? 49.107 71.912  11.184  1.00 35.35 ? 279 PHE A N   1 
ATOM   2027  C  CA  . PHE A 1 279 ? 50.210 72.062  12.119  1.00 35.93 ? 279 PHE A CA  1 
ATOM   2028  C  C   . PHE A 1 279 ? 51.259 70.973  11.937  1.00 36.40 ? 279 PHE A C   1 
ATOM   2029  O  O   . PHE A 1 279 ? 50.935 69.792  12.026  1.00 37.34 ? 279 PHE A O   1 
ATOM   2030  C  CB  . PHE A 1 279 ? 49.630 72.019  13.534  1.00 36.12 ? 279 PHE A CB  1 
ATOM   2031  C  CG  . PHE A 1 279 ? 50.548 72.538  14.603  1.00 37.26 ? 279 PHE A CG  1 
ATOM   2032  C  CD1 . PHE A 1 279 ? 51.413 71.685  15.273  1.00 37.28 ? 279 PHE A CD1 1 
ATOM   2033  C  CD2 . PHE A 1 279 ? 50.496 73.872  14.988  1.00 37.84 ? 279 PHE A CD2 1 
ATOM   2034  C  CE1 . PHE A 1 279 ? 52.208 72.154  16.319  1.00 37.70 ? 279 PHE A CE1 1 
ATOM   2035  C  CE2 . PHE A 1 279 ? 51.285 74.348  16.029  1.00 38.06 ? 279 PHE A CE2 1 
ATOM   2036  C  CZ  . PHE A 1 279 ? 52.142 73.484  16.699  1.00 37.80 ? 279 PHE A CZ  1 
ATOM   2037  N  N   . TYR A 1 280 ? 52.506 71.369  11.678  1.00 35.93 ? 280 TYR A N   1 
ATOM   2038  C  CA  . TYR A 1 280 ? 53.605 70.416  11.509  1.00 36.15 ? 280 TYR A CA  1 
ATOM   2039  C  C   . TYR A 1 280 ? 54.756 70.775  12.430  1.00 35.95 ? 280 TYR A C   1 
ATOM   2040  O  O   . TYR A 1 280 ? 54.772 71.842  13.031  1.00 36.43 ? 280 TYR A O   1 
ATOM   2041  C  CB  . TYR A 1 280 ? 54.204 70.451  10.100  1.00 36.60 ? 280 TYR A CB  1 
ATOM   2042  C  CG  . TYR A 1 280 ? 53.255 70.388  8.941   1.00 37.16 ? 280 TYR A CG  1 
ATOM   2043  C  CD1 . TYR A 1 280 ? 52.509 71.501  8.574   1.00 37.64 ? 280 TYR A CD1 1 
ATOM   2044  C  CD2 . TYR A 1 280 ? 53.165 69.236  8.154   1.00 37.81 ? 280 TYR A CD2 1 
ATOM   2045  C  CE1 . TYR A 1 280 ? 51.702 71.479  7.447   1.00 38.75 ? 280 TYR A CE1 1 
ATOM   2046  C  CE2 . TYR A 1 280 ? 52.355 69.201  7.019   1.00 38.77 ? 280 TYR A CE2 1 
ATOM   2047  C  CZ  . TYR A 1 280 ? 51.628 70.327  6.675   1.00 39.28 ? 280 TYR A CZ  1 
ATOM   2048  O  OH  . TYR A 1 280 ? 50.806 70.312  5.571   1.00 41.52 ? 280 TYR A OH  1 
ATOM   2049  N  N   . ILE A 1 281 ? 55.737 69.881  12.507  1.00 35.52 ? 281 ILE A N   1 
ATOM   2050  C  CA  . ILE A 1 281 ? 56.936 70.128  13.291  1.00 34.69 ? 281 ILE A CA  1 
ATOM   2051  C  C   . ILE A 1 281 ? 58.108 69.587  12.492  1.00 35.29 ? 281 ILE A C   1 
ATOM   2052  O  O   . ILE A 1 281 ? 57.954 68.644  11.731  1.00 35.32 ? 281 ILE A O   1 
ATOM   2053  C  CB  . ILE A 1 281 ? 56.953 69.394  14.663  1.00 33.18 ? 281 ILE A CB  1 
ATOM   2054  C  CG1 . ILE A 1 281 ? 56.994 67.889  14.454  1.00 32.92 ? 281 ILE A CG1 1 
ATOM   2055  C  CG2 . ILE A 1 281 ? 55.760 69.774  15.491  1.00 32.60 ? 281 ILE A CG2 1 
ATOM   2056  C  CD1 . ILE A 1 281 ? 57.281 67.121  15.721  1.00 31.67 ? 281 ILE A CD1 1 
ATOM   2057  N  N   . GLN A 1 282 ? 59.265 70.218  12.637  1.00 36.41 ? 282 GLN A N   1 
ATOM   2058  C  CA  . GLN A 1 282 ? 60.492 69.750  12.000  1.00 36.82 ? 282 GLN A CA  1 
ATOM   2059  C  C   . GLN A 1 282 ? 61.269 69.243  13.199  1.00 37.47 ? 282 GLN A C   1 
ATOM   2060  O  O   . GLN A 1 282 ? 61.260 69.875  14.250  1.00 37.35 ? 282 GLN A O   1 
ATOM   2061  C  CB  . GLN A 1 282 ? 61.282 70.890  11.366  1.00 36.17 ? 282 GLN A CB  1 
ATOM   2062  C  CG  . GLN A 1 282 ? 60.904 71.241  9.951   1.00 35.24 ? 282 GLN A CG  1 
ATOM   2063  C  CD  . GLN A 1 282 ? 61.725 72.400  9.439   1.00 35.62 ? 282 GLN A CD  1 
ATOM   2064  O  OE1 . GLN A 1 282 ? 61.623 73.515  9.943   1.00 36.14 ? 282 GLN A OE1 1 
ATOM   2065  N  NE2 . GLN A 1 282 ? 62.560 72.140  8.443   1.00 36.93 ? 282 GLN A NE2 1 
ATOM   2066  N  N   . VAL A 1 283 ? 61.933 68.107  13.060  1.00 38.47 ? 283 VAL A N   1 
ATOM   2067  C  CA  . VAL A 1 283 ? 62.692 67.575  14.179  1.00 38.73 ? 283 VAL A CA  1 
ATOM   2068  C  C   . VAL A 1 283 ? 64.177 67.535  13.868  1.00 39.47 ? 283 VAL A C   1 
ATOM   2069  O  O   . VAL A 1 283 ? 64.579 67.290  12.730  1.00 40.16 ? 283 VAL A O   1 
ATOM   2070  C  CB  . VAL A 1 283 ? 62.206 66.163  14.543  1.00 38.18 ? 283 VAL A CB  1 
ATOM   2071  C  CG1 . VAL A 1 283 ? 63.022 65.597  15.709  1.00 37.92 ? 283 VAL A CG1 1 
ATOM   2072  C  CG2 . VAL A 1 283 ? 60.726 66.218  14.893  1.00 37.30 ? 283 VAL A CG2 1 
ATOM   2073  N  N   . MET A 1 284 ? 64.985 67.804  14.887  1.00 39.77 ? 284 MET A N   1 
ATOM   2074  C  CA  . MET A 1 284 ? 66.432 67.768  14.758  1.00 40.27 ? 284 MET A CA  1 
ATOM   2075  C  C   . MET A 1 284 ? 66.975 67.143  16.035  1.00 41.47 ? 284 MET A C   1 
ATOM   2076  O  O   . MET A 1 284 ? 66.863 67.732  17.106  1.00 41.67 ? 284 MET A O   1 
ATOM   2077  C  CB  . MET A 1 284 ? 67.002 69.178  14.597  1.00 39.69 ? 284 MET A CB  1 
ATOM   2078  C  CG  . MET A 1 284 ? 68.520 69.208  14.418  1.00 38.50 ? 284 MET A CG  1 
ATOM   2079  S  SD  . MET A 1 284 ? 69.275 70.857  14.483  1.00 37.98 ? 284 MET A SD  1 
ATOM   2080  C  CE  . MET A 1 284 ? 69.243 71.352  12.712  1.00 34.68 ? 284 MET A CE  1 
ATOM   2081  N  N   . THR A 1 285 ? 67.547 65.945  15.927  1.00 43.07 ? 285 THR A N   1 
ATOM   2082  C  CA  . THR A 1 285 ? 68.111 65.257  17.090  1.00 43.98 ? 285 THR A CA  1 
ATOM   2083  C  C   . THR A 1 285 ? 69.299 66.050  17.613  1.00 45.34 ? 285 THR A C   1 
ATOM   2084  O  O   . THR A 1 285 ? 69.839 66.909  16.907  1.00 46.19 ? 285 THR A O   1 
ATOM   2085  C  CB  . THR A 1 285 ? 68.633 63.873  16.724  1.00 43.57 ? 285 THR A CB  1 
ATOM   2086  O  OG1 . THR A 1 285 ? 69.709 64.010  15.786  1.00 43.12 ? 285 THR A OG1 1 
ATOM   2087  C  CG2 . THR A 1 285 ? 67.522 63.030  16.126  1.00 43.20 ? 285 THR A CG2 1 
ATOM   2088  N  N   . PHE A 1 286 ? 69.728 65.763  18.836  1.00 45.77 ? 286 PHE A N   1 
ATOM   2089  C  CA  . PHE A 1 286 ? 70.866 66.487  19.373  1.00 46.42 ? 286 PHE A CA  1 
ATOM   2090  C  C   . PHE A 1 286 ? 72.129 66.180  18.571  1.00 46.68 ? 286 PHE A C   1 
ATOM   2091  O  O   . PHE A 1 286 ? 73.001 67.033  18.451  1.00 46.17 ? 286 PHE A O   1 
ATOM   2092  C  CB  . PHE A 1 286 ? 71.053 66.170  20.856  1.00 46.76 ? 286 PHE A CB  1 
ATOM   2093  C  CG  . PHE A 1 286 ? 70.092 66.906  21.757  1.00 47.27 ? 286 PHE A CG  1 
ATOM   2094  C  CD1 . PHE A 1 286 ? 68.722 66.717  21.645  1.00 47.35 ? 286 PHE A CD1 1 
ATOM   2095  C  CD2 . PHE A 1 286 ? 70.559 67.799  22.716  1.00 47.73 ? 286 PHE A CD2 1 
ATOM   2096  C  CE1 . PHE A 1 286 ? 67.829 67.408  22.479  1.00 46.89 ? 286 PHE A CE1 1 
ATOM   2097  C  CE2 . PHE A 1 286 ? 69.670 68.491  23.551  1.00 47.10 ? 286 PHE A CE2 1 
ATOM   2098  C  CZ  . PHE A 1 286 ? 68.308 68.293  23.430  1.00 46.61 ? 286 PHE A CZ  1 
ATOM   2099  N  N   . ASN A 1 287 ? 72.229 64.975  18.011  1.00 47.78 ? 287 ASN A N   1 
ATOM   2100  C  CA  . ASN A 1 287 ? 73.401 64.646  17.202  1.00 49.41 ? 287 ASN A CA  1 
ATOM   2101  C  C   . ASN A 1 287 ? 73.405 65.579  15.996  1.00 49.56 ? 287 ASN A C   1 
ATOM   2102  O  O   . ASN A 1 287 ? 74.419 66.195  15.676  1.00 49.88 ? 287 ASN A O   1 
ATOM   2103  C  CB  . ASN A 1 287 ? 73.368 63.200  16.681  1.00 51.12 ? 287 ASN A CB  1 
ATOM   2104  C  CG  . ASN A 1 287 ? 73.574 62.162  17.773  1.00 52.72 ? 287 ASN A CG  1 
ATOM   2105  O  OD1 . ASN A 1 287 ? 74.422 62.322  18.659  1.00 53.67 ? 287 ASN A OD1 1 
ATOM   2106  N  ND2 . ASN A 1 287 ? 72.808 61.072  17.699  1.00 53.68 ? 287 ASN A ND2 1 
ATOM   2107  N  N   . GLN A 1 288 ? 72.260 65.672  15.327  1.00 49.72 ? 288 GLN A N   1 
ATOM   2108  C  CA  . GLN A 1 288 ? 72.123 66.521  14.146  1.00 49.70 ? 288 GLN A CA  1 
ATOM   2109  C  C   . GLN A 1 288 ? 72.388 67.977  14.494  1.00 50.23 ? 288 GLN A C   1 
ATOM   2110  O  O   . GLN A 1 288 ? 72.918 68.738  13.679  1.00 50.48 ? 288 GLN A O   1 
ATOM   2111  C  CB  . GLN A 1 288 ? 70.719 66.386  13.562  1.00 49.24 ? 288 GLN A CB  1 
ATOM   2112  C  CG  . GLN A 1 288 ? 70.374 64.998  13.055  1.00 48.43 ? 288 GLN A CG  1 
ATOM   2113  C  CD  . GLN A 1 288 ? 68.943 64.924  12.579  1.00 48.64 ? 288 GLN A CD  1 
ATOM   2114  O  OE1 . GLN A 1 288 ? 68.007 64.903  13.380  1.00 48.65 ? 288 GLN A OE1 1 
ATOM   2115  N  NE2 . GLN A 1 288 ? 68.760 64.910  11.265  1.00 48.15 ? 288 GLN A NE2 1 
ATOM   2116  N  N   . ALA A 1 289 ? 72.021 68.354  15.715  1.00 50.59 ? 289 ALA A N   1 
ATOM   2117  C  CA  . ALA A 1 289 ? 72.215 69.716  16.184  1.00 51.23 ? 289 ALA A CA  1 
ATOM   2118  C  C   . ALA A 1 289 ? 73.694 70.106  16.163  1.00 51.95 ? 289 ALA A C   1 
ATOM   2119  O  O   . ALA A 1 289 ? 74.037 71.253  15.866  1.00 52.14 ? 289 ALA A O   1 
ATOM   2120  C  CB  . ALA A 1 289 ? 71.645 69.866  17.592  1.00 50.69 ? 289 ALA A CB  1 
ATOM   2121  N  N   . GLU A 1 290 ? 74.568 69.150  16.472  1.00 52.70 ? 290 GLU A N   1 
ATOM   2122  C  CA  . GLU A 1 290 ? 76.007 69.411  16.491  1.00 53.13 ? 290 GLU A CA  1 
ATOM   2123  C  C   . GLU A 1 290 ? 76.562 69.568  15.082  1.00 52.37 ? 290 GLU A C   1 
ATOM   2124  O  O   . GLU A 1 290 ? 77.330 70.484  14.806  1.00 52.37 ? 290 GLU A O   1 
ATOM   2125  C  CB  . GLU A 1 290 ? 76.737 68.278  17.208  1.00 54.07 ? 290 GLU A CB  1 
ATOM   2126  C  CG  . GLU A 1 290 ? 76.050 67.866  18.497  1.00 57.71 ? 290 GLU A CG  1 
ATOM   2127  C  CD  . GLU A 1 290 ? 76.812 66.801  19.276  1.00 59.72 ? 290 GLU A CD  1 
ATOM   2128  O  OE1 . GLU A 1 290 ? 77.406 65.896  18.634  1.00 61.05 ? 290 GLU A OE1 1 
ATOM   2129  O  OE2 . GLU A 1 290 ? 76.799 66.861  20.532  1.00 60.34 ? 290 GLU A OE2 1 
ATOM   2130  N  N   . THR A 1 291 ? 76.152 68.682  14.187  1.00 51.92 ? 291 THR A N   1 
ATOM   2131  C  CA  . THR A 1 291 ? 76.630 68.719  12.818  1.00 51.57 ? 291 THR A CA  1 
ATOM   2132  C  C   . THR A 1 291 ? 76.078 69.890  12.018  1.00 51.38 ? 291 THR A C   1 
ATOM   2133  O  O   . THR A 1 291 ? 76.641 70.227  10.981  1.00 52.19 ? 291 THR A O   1 
ATOM   2134  C  CB  . THR A 1 291 ? 76.278 67.414  12.059  1.00 52.05 ? 291 THR A CB  1 
ATOM   2135  O  OG1 . THR A 1 291 ? 74.876 67.402  11.738  1.00 52.84 ? 291 THR A OG1 1 
ATOM   2136  C  CG2 . THR A 1 291 ? 76.607 66.193  12.918  1.00 52.24 ? 291 THR A CG2 1 
ATOM   2137  N  N   . PHE A 1 292 ? 74.992 70.512  12.478  1.00 50.48 ? 292 PHE A N   1 
ATOM   2138  C  CA  . PHE A 1 292 ? 74.401 71.633  11.733  1.00 49.55 ? 292 PHE A CA  1 
ATOM   2139  C  C   . PHE A 1 292 ? 75.443 72.693  11.332  1.00 48.89 ? 292 PHE A C   1 
ATOM   2140  O  O   . PHE A 1 292 ? 76.262 73.121  12.150  1.00 49.10 ? 292 PHE A O   1 
ATOM   2141  C  CB  . PHE A 1 292 ? 73.265 72.279  12.540  1.00 50.26 ? 292 PHE A CB  1 
ATOM   2142  C  CG  . PHE A 1 292 ? 72.338 73.133  11.707  1.00 50.85 ? 292 PHE A CG  1 
ATOM   2143  C  CD1 . PHE A 1 292 ? 71.605 72.572  10.665  1.00 50.38 ? 292 PHE A CD1 1 
ATOM   2144  C  CD2 . PHE A 1 292 ? 72.232 74.509  11.937  1.00 51.39 ? 292 PHE A CD2 1 
ATOM   2145  C  CE1 . PHE A 1 292 ? 70.785 73.361  9.857   1.00 50.37 ? 292 PHE A CE1 1 
ATOM   2146  C  CE2 . PHE A 1 292 ? 71.411 75.311  11.131  1.00 51.16 ? 292 PHE A CE2 1 
ATOM   2147  C  CZ  . PHE A 1 292 ? 70.687 74.731  10.087  1.00 50.77 ? 292 PHE A CZ  1 
ATOM   2148  N  N   . PRO A 1 293 ? 75.415 73.130  10.055  1.00 48.18 ? 293 PRO A N   1 
ATOM   2149  C  CA  . PRO A 1 293 ? 76.304 74.124  9.432   1.00 46.91 ? 293 PRO A CA  1 
ATOM   2150  C  C   . PRO A 1 293 ? 76.325 75.480  10.109  1.00 46.02 ? 293 PRO A C   1 
ATOM   2151  O  O   . PRO A 1 293 ? 77.327 76.194  10.057  1.00 46.25 ? 293 PRO A O   1 
ATOM   2152  C  CB  . PRO A 1 293 ? 75.767 74.228  8.007   1.00 47.25 ? 293 PRO A CB  1 
ATOM   2153  C  CG  . PRO A 1 293 ? 75.139 72.886  7.773   1.00 47.82 ? 293 PRO A CG  1 
ATOM   2154  C  CD  . PRO A 1 293 ? 74.427 72.647  9.073   1.00 48.26 ? 293 PRO A CD  1 
ATOM   2155  N  N   . PHE A 1 294 ? 75.199 75.838  10.717  1.00 45.09 ? 294 PHE A N   1 
ATOM   2156  C  CA  . PHE A 1 294 ? 75.048 77.110  11.418  1.00 43.66 ? 294 PHE A CA  1 
ATOM   2157  C  C   . PHE A 1 294 ? 74.724 76.826  12.878  1.00 42.94 ? 294 PHE A C   1 
ATOM   2158  O  O   . PHE A 1 294 ? 74.850 75.696  13.355  1.00 43.21 ? 294 PHE A O   1 
ATOM   2159  C  CB  . PHE A 1 294 ? 73.886 77.892  10.819  1.00 43.23 ? 294 PHE A CB  1 
ATOM   2160  C  CG  . PHE A 1 294 ? 73.969 78.059  9.336   1.00 43.33 ? 294 PHE A CG  1 
ATOM   2161  C  CD1 . PHE A 1 294 ? 74.851 78.985  8.772   1.00 43.38 ? 294 PHE A CD1 1 
ATOM   2162  C  CD2 . PHE A 1 294 ? 73.170 77.291  8.494   1.00 43.25 ? 294 PHE A CD2 1 
ATOM   2163  C  CE1 . PHE A 1 294 ? 74.935 79.145  7.384   1.00 42.96 ? 294 PHE A CE1 1 
ATOM   2164  C  CE2 . PHE A 1 294 ? 73.246 77.443  7.107   1.00 43.21 ? 294 PHE A CE2 1 
ATOM   2165  C  CZ  . PHE A 1 294 ? 74.130 78.371  6.552   1.00 42.90 ? 294 PHE A CZ  1 
ATOM   2166  N  N   . ASN A 1 295 ? 74.322 77.864  13.594  1.00 41.99 ? 295 ASN A N   1 
ATOM   2167  C  CA  . ASN A 1 295 ? 73.910 77.681  14.974  1.00 41.00 ? 295 ASN A CA  1 
ATOM   2168  C  C   . ASN A 1 295 ? 72.422 77.338  14.878  1.00 40.43 ? 295 ASN A C   1 
ATOM   2169  O  O   . ASN A 1 295 ? 71.611 78.173  14.471  1.00 39.77 ? 295 ASN A O   1 
ATOM   2170  C  CB  . ASN A 1 295 ? 74.088 78.966  15.777  1.00 40.41 ? 295 ASN A CB  1 
ATOM   2171  C  CG  . ASN A 1 295 ? 73.413 78.895  17.134  1.00 40.34 ? 295 ASN A CG  1 
ATOM   2172  O  OD1 . ASN A 1 295 ? 72.853 77.858  17.509  1.00 39.43 ? 295 ASN A OD1 1 
ATOM   2173  N  ND2 . ASN A 1 295 ? 73.461 79.997  17.879  1.00 39.91 ? 295 ASN A ND2 1 
ATOM   2174  N  N   . PRO A 1 296 ? 72.046 76.099  15.234  1.00 40.26 ? 296 PRO A N   1 
ATOM   2175  C  CA  . PRO A 1 296 ? 70.639 75.694  15.167  1.00 40.29 ? 296 PRO A CA  1 
ATOM   2176  C  C   . PRO A 1 296 ? 69.674 76.539  16.028  1.00 40.20 ? 296 PRO A C   1 
ATOM   2177  O  O   . PRO A 1 296 ? 68.454 76.382  15.933  1.00 40.59 ? 296 PRO A O   1 
ATOM   2178  C  CB  . PRO A 1 296 ? 70.689 74.224  15.599  1.00 41.03 ? 296 PRO A CB  1 
ATOM   2179  C  CG  . PRO A 1 296 ? 71.870 74.179  16.532  1.00 40.54 ? 296 PRO A CG  1 
ATOM   2180  C  CD  . PRO A 1 296 ? 72.879 75.013  15.780  1.00 40.30 ? 296 PRO A CD  1 
ATOM   2181  N  N   . PHE A 1 297 ? 70.214 77.435  16.853  1.00 39.05 ? 297 PHE A N   1 
ATOM   2182  C  CA  . PHE A 1 297 ? 69.380 78.277  17.705  1.00 37.88 ? 297 PHE A CA  1 
ATOM   2183  C  C   . PHE A 1 297 ? 69.502 79.738  17.292  1.00 37.35 ? 297 PHE A C   1 
ATOM   2184  O  O   . PHE A 1 297 ? 69.152 80.648  18.037  1.00 37.26 ? 297 PHE A O   1 
ATOM   2185  C  CB  . PHE A 1 297 ? 69.797 78.105  19.165  1.00 37.71 ? 297 PHE A CB  1 
ATOM   2186  C  CG  . PHE A 1 297 ? 70.081 76.679  19.544  1.00 38.00 ? 297 PHE A CG  1 
ATOM   2187  C  CD1 . PHE A 1 297 ? 69.132 75.688  19.343  1.00 37.74 ? 297 PHE A CD1 1 
ATOM   2188  C  CD2 . PHE A 1 297 ? 71.310 76.322  20.088  1.00 38.13 ? 297 PHE A CD2 1 
ATOM   2189  C  CE1 . PHE A 1 297 ? 69.406 74.362  19.675  1.00 37.94 ? 297 PHE A CE1 1 
ATOM   2190  C  CE2 . PHE A 1 297 ? 71.587 74.999  20.422  1.00 37.92 ? 297 PHE A CE2 1 
ATOM   2191  C  CZ  . PHE A 1 297 ? 70.632 74.020  20.214  1.00 37.25 ? 297 PHE A CZ  1 
ATOM   2192  N  N   . ASP A 1 298 ? 70.023 79.949  16.094  1.00 37.04 ? 298 ASP A N   1 
ATOM   2193  C  CA  . ASP A 1 298 ? 70.188 81.281  15.548  1.00 37.45 ? 298 ASP A CA  1 
ATOM   2194  C  C   . ASP A 1 298 ? 68.839 81.632  14.924  1.00 37.53 ? 298 ASP A C   1 
ATOM   2195  O  O   . ASP A 1 298 ? 68.380 80.951  14.007  1.00 38.01 ? 298 ASP A O   1 
ATOM   2196  C  CB  . ASP A 1 298 ? 71.290 81.247  14.488  1.00 38.76 ? 298 ASP A CB  1 
ATOM   2197  C  CG  . ASP A 1 298 ? 71.487 82.582  13.784  1.00 39.76 ? 298 ASP A CG  1 
ATOM   2198  O  OD1 . ASP A 1 298 ? 70.648 83.493  13.941  1.00 39.73 ? 298 ASP A OD1 1 
ATOM   2199  O  OD2 . ASP A 1 298 ? 72.494 82.708  13.053  1.00 41.22 ? 298 ASP A OD2 1 
ATOM   2200  N  N   . LEU A 1 299 ? 68.201 82.690  15.418  1.00 37.16 ? 299 LEU A N   1 
ATOM   2201  C  CA  . LEU A 1 299 ? 66.895 83.082  14.910  1.00 36.31 ? 299 LEU A CA  1 
ATOM   2202  C  C   . LEU A 1 299 ? 66.911 83.555  13.451  1.00 36.28 ? 299 LEU A C   1 
ATOM   2203  O  O   . LEU A 1 299 ? 65.864 83.595  12.803  1.00 36.86 ? 299 LEU A O   1 
ATOM   2204  C  CB  . LEU A 1 299 ? 66.277 84.154  15.819  1.00 36.14 ? 299 LEU A CB  1 
ATOM   2205  C  CG  . LEU A 1 299 ? 64.764 84.392  15.678  1.00 36.59 ? 299 LEU A CG  1 
ATOM   2206  C  CD1 . LEU A 1 299 ? 64.019 83.097  15.940  1.00 35.62 ? 299 LEU A CD1 1 
ATOM   2207  C  CD2 . LEU A 1 299 ? 64.297 85.468  16.644  1.00 35.05 ? 299 LEU A CD2 1 
ATOM   2208  N  N   . THR A 1 300 ? 68.081 83.898  12.919  1.00 35.48 ? 300 THR A N   1 
ATOM   2209  C  CA  . THR A 1 300 ? 68.153 84.346  11.527  1.00 35.27 ? 300 THR A CA  1 
ATOM   2210  C  C   . THR A 1 300 ? 68.293 83.190  10.539  1.00 35.90 ? 300 THR A C   1 
ATOM   2211  O  O   . THR A 1 300 ? 68.556 83.413  9.355   1.00 35.65 ? 300 THR A O   1 
ATOM   2212  C  CB  . THR A 1 300 ? 69.341 85.299  11.270  1.00 34.28 ? 300 THR A CB  1 
ATOM   2213  O  OG1 . THR A 1 300 ? 70.572 84.595  11.483  1.00 34.22 ? 300 THR A OG1 1 
ATOM   2214  C  CG2 . THR A 1 300 ? 69.273 86.512  12.182  1.00 33.89 ? 300 THR A CG2 1 
ATOM   2215  N  N   . LYS A 1 301 ? 68.120 81.959  11.010  1.00 36.57 ? 301 LYS A N   1 
ATOM   2216  C  CA  . LYS A 1 301 ? 68.258 80.821  10.119  1.00 38.02 ? 301 LYS A CA  1 
ATOM   2217  C  C   . LYS A 1 301 ? 67.178 79.756  10.171  1.00 38.73 ? 301 LYS A C   1 
ATOM   2218  O  O   . LYS A 1 301 ? 66.556 79.505  11.207  1.00 39.31 ? 301 LYS A O   1 
ATOM   2219  C  CB  . LYS A 1 301 ? 69.628 80.181  10.321  1.00 39.00 ? 301 LYS A CB  1 
ATOM   2220  C  CG  . LYS A 1 301 ? 70.711 80.970  9.618   1.00 40.66 ? 301 LYS A CG  1 
ATOM   2221  C  CD  . LYS A 1 301 ? 72.072 80.706  10.171  1.00 41.60 ? 301 LYS A CD  1 
ATOM   2222  C  CE  . LYS A 1 301 ? 73.047 81.752  9.656   1.00 42.50 ? 301 LYS A CE  1 
ATOM   2223  N  NZ  . LYS A 1 301 ? 72.746 83.094  10.227  1.00 43.53 ? 301 LYS A NZ  1 
ATOM   2224  N  N   . VAL A 1 302 ? 66.969 79.131  9.021   1.00 38.77 ? 302 VAL A N   1 
ATOM   2225  C  CA  . VAL A 1 302 ? 65.976 78.084  8.877   1.00 39.56 ? 302 VAL A CA  1 
ATOM   2226  C  C   . VAL A 1 302 ? 66.628 76.712  8.849   1.00 39.98 ? 302 VAL A C   1 
ATOM   2227  O  O   . VAL A 1 302 ? 67.842 76.591  8.730   1.00 40.50 ? 302 VAL A O   1 
ATOM   2228  C  CB  . VAL A 1 302 ? 65.196 78.236  7.550   1.00 39.45 ? 302 VAL A CB  1 
ATOM   2229  C  CG1 . VAL A 1 302 ? 64.399 79.532  7.551   1.00 39.16 ? 302 VAL A CG1 1 
ATOM   2230  C  CG2 . VAL A 1 302 ? 66.173 78.199  6.370   1.00 38.34 ? 302 VAL A CG2 1 
ATOM   2231  N  N   . TRP A 1 303 ? 65.805 75.680  8.980   1.00 40.27 ? 303 TRP A N   1 
ATOM   2232  C  CA  . TRP A 1 303 ? 66.278 74.310  8.889   1.00 40.90 ? 303 TRP A CA  1 
ATOM   2233  C  C   . TRP A 1 303 ? 65.713 73.894  7.534   1.00 42.58 ? 303 TRP A C   1 
ATOM   2234  O  O   . TRP A 1 303 ? 64.497 73.810  7.380   1.00 42.96 ? 303 TRP A O   1 
ATOM   2235  C  CB  . TRP A 1 303 ? 65.654 73.440  9.973   1.00 38.89 ? 303 TRP A CB  1 
ATOM   2236  C  CG  . TRP A 1 303 ? 66.136 73.701  11.350  1.00 36.53 ? 303 TRP A CG  1 
ATOM   2237  C  CD1 . TRP A 1 303 ? 67.072 74.611  11.737  1.00 35.29 ? 303 TRP A CD1 1 
ATOM   2238  C  CD2 . TRP A 1 303 ? 65.701 73.035  12.543  1.00 34.69 ? 303 TRP A CD2 1 
ATOM   2239  N  NE1 . TRP A 1 303 ? 67.246 74.556  13.103  1.00 34.42 ? 303 TRP A NE1 1 
ATOM   2240  C  CE2 . TRP A 1 303 ? 66.415 73.596  13.620  1.00 34.58 ? 303 TRP A CE2 1 
ATOM   2241  C  CE3 . TRP A 1 303 ? 64.779 72.020  12.804  1.00 31.93 ? 303 TRP A CE3 1 
ATOM   2242  C  CZ2 . TRP A 1 303 ? 66.231 73.171  14.944  1.00 34.02 ? 303 TRP A CZ2 1 
ATOM   2243  C  CZ3 . TRP A 1 303 ? 64.599 71.601  14.119  1.00 32.75 ? 303 TRP A CZ3 1 
ATOM   2244  C  CH2 . TRP A 1 303 ? 65.319 72.174  15.168  1.00 32.14 ? 303 TRP A CH2 1 
ATOM   2245  N  N   . PRO A 1 304 ? 66.575 73.655  6.532   1.00 44.22 ? 304 PRO A N   1 
ATOM   2246  C  CA  . PRO A 1 304 ? 66.093 73.256  5.203   1.00 46.01 ? 304 PRO A CA  1 
ATOM   2247  C  C   . PRO A 1 304 ? 65.133 72.059  5.198   1.00 48.05 ? 304 PRO A C   1 
ATOM   2248  O  O   . PRO A 1 304 ? 65.463 70.973  5.689   1.00 48.38 ? 304 PRO A O   1 
ATOM   2249  C  CB  . PRO A 1 304 ? 67.388 72.981  4.442   1.00 45.63 ? 304 PRO A CB  1 
ATOM   2250  C  CG  . PRO A 1 304 ? 68.328 74.010  5.039   1.00 45.15 ? 304 PRO A CG  1 
ATOM   2251  C  CD  . PRO A 1 304 ? 68.034 73.871  6.519   1.00 44.37 ? 304 PRO A CD  1 
ATOM   2252  N  N   . HIS A 1 305 ? 63.945 72.276  4.637   1.00 50.26 ? 305 HIS A N   1 
ATOM   2253  C  CA  . HIS A 1 305 ? 62.904 71.253  4.546   1.00 52.92 ? 305 HIS A CA  1 
ATOM   2254  C  C   . HIS A 1 305 ? 63.458 69.967  3.942   1.00 53.18 ? 305 HIS A C   1 
ATOM   2255  O  O   . HIS A 1 305 ? 63.040 68.861  4.280   1.00 53.08 ? 305 HIS A O   1 
ATOM   2256  C  CB  . HIS A 1 305 ? 61.746 71.775  3.684   1.00 55.89 ? 305 HIS A CB  1 
ATOM   2257  C  CG  . HIS A 1 305 ? 60.907 72.825  4.356   1.00 60.12 ? 305 HIS A CG  1 
ATOM   2258  N  ND1 . HIS A 1 305 ? 59.962 73.572  3.680   1.00 62.01 ? 305 HIS A ND1 1 
ATOM   2259  C  CD2 . HIS A 1 305 ? 60.852 73.237  5.649   1.00 61.62 ? 305 HIS A CD2 1 
ATOM   2260  C  CE1 . HIS A 1 305 ? 59.363 74.396  4.524   1.00 62.72 ? 305 HIS A CE1 1 
ATOM   2261  N  NE2 . HIS A 1 305 ? 59.885 74.213  5.727   1.00 62.83 ? 305 HIS A NE2 1 
ATOM   2262  N  N   . LYS A 1 306 ? 64.417 70.138  3.046   1.00 53.94 ? 306 LYS A N   1 
ATOM   2263  C  CA  . LYS A 1 306 ? 65.066 69.041  2.341   1.00 54.25 ? 306 LYS A CA  1 
ATOM   2264  C  C   . LYS A 1 306 ? 65.795 68.124  3.303   1.00 53.50 ? 306 LYS A C   1 
ATOM   2265  O  O   . LYS A 1 306 ? 65.808 66.909  3.122   1.00 54.27 ? 306 LYS A O   1 
ATOM   2266  C  CB  . LYS A 1 306 ? 66.071 69.603  1.324   1.00 55.89 ? 306 LYS A CB  1 
ATOM   2267  C  CG  . LYS A 1 306 ? 65.582 70.875  0.595   1.00 57.89 ? 306 LYS A CG  1 
ATOM   2268  C  CD  . LYS A 1 306 ? 65.477 72.105  1.533   1.00 58.25 ? 306 LYS A CD  1 
ATOM   2269  C  CE  . LYS A 1 306 ? 64.183 72.900  1.287   1.00 59.30 ? 306 LYS A CE  1 
ATOM   2270  N  NZ  . LYS A 1 306 ? 63.985 74.045  2.247   1.00 60.04 ? 306 LYS A NZ  1 
ATOM   2271  N  N   . ASP A 1 307 ? 66.403 68.707  4.328   1.00 52.09 ? 307 ASP A N   1 
ATOM   2272  C  CA  . ASP A 1 307 ? 67.157 67.921  5.291   1.00 50.74 ? 307 ASP A CA  1 
ATOM   2273  C  C   . ASP A 1 307 ? 66.351 67.608  6.555   1.00 49.77 ? 307 ASP A C   1 
ATOM   2274  O  O   . ASP A 1 307 ? 66.629 66.635  7.254   1.00 48.78 ? 307 ASP A O   1 
ATOM   2275  C  CB  . ASP A 1 307 ? 68.457 68.664  5.640   1.00 51.09 ? 307 ASP A CB  1 
ATOM   2276  C  CG  . ASP A 1 307 ? 69.230 69.108  4.401   1.00 51.34 ? 307 ASP A CG  1 
ATOM   2277  O  OD1 . ASP A 1 307 ? 69.562 68.233  3.571   1.00 52.25 ? 307 ASP A OD1 1 
ATOM   2278  O  OD2 . ASP A 1 307 ? 69.507 70.323  4.250   1.00 50.53 ? 307 ASP A OD2 1 
ATOM   2279  N  N   . TYR A 1 308 ? 65.352 68.440  6.841   1.00 49.12 ? 308 TYR A N   1 
ATOM   2280  C  CA  . TYR A 1 308 ? 64.498 68.261  8.017   1.00 48.19 ? 308 TYR A CA  1 
ATOM   2281  C  C   . TYR A 1 308 ? 63.058 68.507  7.592   1.00 47.69 ? 308 TYR A C   1 
ATOM   2282  O  O   . TYR A 1 308 ? 62.544 69.613  7.724   1.00 47.67 ? 308 TYR A O   1 
ATOM   2283  C  CB  . TYR A 1 308 ? 64.890 69.253  9.118   1.00 48.05 ? 308 TYR A CB  1 
ATOM   2284  C  CG  . TYR A 1 308 ? 66.343 69.153  9.545   1.00 48.08 ? 308 TYR A CG  1 
ATOM   2285  C  CD1 . TYR A 1 308 ? 66.726 68.325  10.604  1.00 47.82 ? 308 TYR A CD1 1 
ATOM   2286  C  CD2 . TYR A 1 308 ? 67.345 69.838  8.849   1.00 47.60 ? 308 TYR A CD2 1 
ATOM   2287  C  CE1 . TYR A 1 308 ? 68.064 68.176  10.953  1.00 47.42 ? 308 TYR A CE1 1 
ATOM   2288  C  CE2 . TYR A 1 308 ? 68.682 69.693  9.190   1.00 47.33 ? 308 TYR A CE2 1 
ATOM   2289  C  CZ  . TYR A 1 308 ? 69.030 68.857  10.239  1.00 47.57 ? 308 TYR A CZ  1 
ATOM   2290  O  OH  . TYR A 1 308 ? 70.355 68.675  10.551  1.00 49.95 ? 308 TYR A OH  1 
ATOM   2291  N  N   . PRO A 1 309 ? 62.394 67.474  7.052   1.00 47.74 ? 309 PRO A N   1 
ATOM   2292  C  CA  . PRO A 1 309 ? 61.001 67.542  6.587   1.00 47.40 ? 309 PRO A CA  1 
ATOM   2293  C  C   . PRO A 1 309 ? 59.937 67.761  7.667   1.00 47.05 ? 309 PRO A C   1 
ATOM   2294  O  O   . PRO A 1 309 ? 60.087 67.322  8.815   1.00 47.02 ? 309 PRO A O   1 
ATOM   2295  C  CB  . PRO A 1 309 ? 60.819 66.204  5.875   1.00 47.14 ? 309 PRO A CB  1 
ATOM   2296  C  CG  . PRO A 1 309 ? 61.703 65.296  6.668   1.00 47.05 ? 309 PRO A CG  1 
ATOM   2297  C  CD  . PRO A 1 309 ? 62.951 66.134  6.798   1.00 47.41 ? 309 PRO A CD  1 
ATOM   2298  N  N   . LEU A 1 310 ? 58.857 68.434  7.278   1.00 46.02 ? 310 LEU A N   1 
ATOM   2299  C  CA  . LEU A 1 310 ? 57.749 68.708  8.182   1.00 45.16 ? 310 LEU A CA  1 
ATOM   2300  C  C   . LEU A 1 310 ? 57.016 67.421  8.520   1.00 45.00 ? 310 LEU A C   1 
ATOM   2301  O  O   . LEU A 1 310 ? 56.731 66.609  7.638   1.00 45.39 ? 310 LEU A O   1 
ATOM   2302  C  CB  . LEU A 1 310 ? 56.748 69.662  7.527   1.00 44.62 ? 310 LEU A CB  1 
ATOM   2303  C  CG  . LEU A 1 310 ? 57.263 71.015  7.045   1.00 43.96 ? 310 LEU A CG  1 
ATOM   2304  C  CD1 . LEU A 1 310 ? 56.128 71.750  6.346   1.00 43.69 ? 310 LEU A CD1 1 
ATOM   2305  C  CD2 . LEU A 1 310 ? 57.793 71.812  8.209   1.00 42.51 ? 310 LEU A CD2 1 
ATOM   2306  N  N   . ILE A 1 311 ? 56.711 67.233  9.796   1.00 44.29 ? 311 ILE A N   1 
ATOM   2307  C  CA  . ILE A 1 311 ? 55.971 66.056  10.211  1.00 43.57 ? 311 ILE A CA  1 
ATOM   2308  C  C   . ILE A 1 311 ? 54.585 66.580  10.562  1.00 42.95 ? 311 ILE A C   1 
ATOM   2309  O  O   . ILE A 1 311 ? 54.458 67.505  11.367  1.00 43.10 ? 311 ILE A O   1 
ATOM   2310  C  CB  . ILE A 1 311 ? 56.558 65.398  11.478  1.00 43.85 ? 311 ILE A CB  1 
ATOM   2311  C  CG1 . ILE A 1 311 ? 58.082 65.498  11.494  1.00 45.24 ? 311 ILE A CG1 1 
ATOM   2312  C  CG2 . ILE A 1 311 ? 56.178 63.946  11.507  1.00 44.30 ? 311 ILE A CG2 1 
ATOM   2313  C  CD1 . ILE A 1 311 ? 58.754 64.843  10.312  1.00 47.09 ? 311 ILE A CD1 1 
ATOM   2314  N  N   . PRO A 1 312 ? 53.527 66.019  9.949   1.00 42.31 ? 312 PRO A N   1 
ATOM   2315  C  CA  . PRO A 1 312 ? 52.161 66.472  10.244  1.00 40.89 ? 312 PRO A CA  1 
ATOM   2316  C  C   . PRO A 1 312 ? 51.837 66.174  11.710  1.00 38.92 ? 312 PRO A C   1 
ATOM   2317  O  O   . PRO A 1 312 ? 52.246 65.139  12.238  1.00 38.67 ? 312 PRO A O   1 
ATOM   2318  C  CB  . PRO A 1 312 ? 51.316 65.642  9.281   1.00 41.51 ? 312 PRO A CB  1 
ATOM   2319  C  CG  . PRO A 1 312 ? 52.080 64.348  9.239   1.00 41.97 ? 312 PRO A CG  1 
ATOM   2320  C  CD  . PRO A 1 312 ? 53.500 64.846  9.058   1.00 42.00 ? 312 PRO A CD  1 
ATOM   2321  N  N   . VAL A 1 313 ? 51.112 67.080  12.360  1.00 36.72 ? 313 VAL A N   1 
ATOM   2322  C  CA  . VAL A 1 313 ? 50.767 66.901  13.761  1.00 35.14 ? 313 VAL A CA  1 
ATOM   2323  C  C   . VAL A 1 313 ? 49.278 67.051  14.007  1.00 34.83 ? 313 VAL A C   1 
ATOM   2324  O  O   . VAL A 1 313 ? 48.624 66.147  14.524  1.00 34.72 ? 313 VAL A O   1 
ATOM   2325  C  CB  . VAL A 1 313 ? 51.484 67.932  14.671  1.00 34.32 ? 313 VAL A CB  1 
ATOM   2326  C  CG1 . VAL A 1 313 ? 51.141 67.644  16.127  1.00 33.63 ? 313 VAL A CG1 1 
ATOM   2327  C  CG2 . VAL A 1 313 ? 52.980 67.896  14.449  1.00 32.58 ? 313 VAL A CG2 1 
ATOM   2328  N  N   . GLY A 1 314 ? 48.743 68.209  13.649  1.00 34.76 ? 314 GLY A N   1 
ATOM   2329  C  CA  . GLY A 1 314 ? 47.333 68.442  13.873  1.00 34.25 ? 314 GLY A CA  1 
ATOM   2330  C  C   . GLY A 1 314 ? 46.744 69.516  12.998  1.00 33.76 ? 314 GLY A C   1 
ATOM   2331  O  O   . GLY A 1 314 ? 47.211 69.767  11.883  1.00 33.91 ? 314 GLY A O   1 
ATOM   2332  N  N   . LYS A 1 315 ? 45.713 70.164  13.524  1.00 34.22 ? 315 LYS A N   1 
ATOM   2333  C  CA  . LYS A 1 315 ? 45.008 71.213  12.799  1.00 34.25 ? 315 LYS A CA  1 
ATOM   2334  C  C   . LYS A 1 315 ? 44.564 72.346  13.708  1.00 32.90 ? 315 LYS A C   1 
ATOM   2335  O  O   . LYS A 1 315 ? 44.166 72.120  14.858  1.00 31.98 ? 315 LYS A O   1 
ATOM   2336  C  CB  . LYS A 1 315 ? 43.772 70.617  12.112  1.00 35.84 ? 315 LYS A CB  1 
ATOM   2337  C  CG  . LYS A 1 315 ? 43.597 71.058  10.674  1.00 38.17 ? 315 LYS A CG  1 
ATOM   2338  C  CD  . LYS A 1 315 ? 42.544 70.236  9.932   1.00 39.42 ? 315 LYS A CD  1 
ATOM   2339  C  CE  . LYS A 1 315 ? 42.644 70.486  8.418   1.00 40.69 ? 315 LYS A CE  1 
ATOM   2340  N  NZ  . LYS A 1 315 ? 44.039 70.227  7.913   1.00 40.59 ? 315 LYS A NZ  1 
ATOM   2341  N  N   . LEU A 1 316 ? 44.648 73.565  13.180  1.00 32.27 ? 316 LEU A N   1 
ATOM   2342  C  CA  . LEU A 1 316 ? 44.212 74.755  13.898  1.00 31.03 ? 316 LEU A CA  1 
ATOM   2343  C  C   . LEU A 1 316 ? 42.988 75.250  13.151  1.00 30.46 ? 316 LEU A C   1 
ATOM   2344  O  O   . LEU A 1 316 ? 43.022 75.424  11.928  1.00 29.51 ? 316 LEU A O   1 
ATOM   2345  C  CB  . LEU A 1 316 ? 45.299 75.832  13.907  1.00 31.40 ? 316 LEU A CB  1 
ATOM   2346  C  CG  . LEU A 1 316 ? 46.525 75.525  14.770  1.00 31.52 ? 316 LEU A CG  1 
ATOM   2347  C  CD1 . LEU A 1 316 ? 47.492 76.693  14.725  1.00 30.80 ? 316 LEU A CD1 1 
ATOM   2348  C  CD2 . LEU A 1 316 ? 46.090 75.255  16.206  1.00 31.88 ? 316 LEU A CD2 1 
ATOM   2349  N  N   . VAL A 1 317 ? 41.905 75.452  13.894  1.00 30.06 ? 317 VAL A N   1 
ATOM   2350  C  CA  . VAL A 1 317 ? 40.643 75.904  13.325  1.00 30.43 ? 317 VAL A CA  1 
ATOM   2351  C  C   . VAL A 1 317 ? 40.049 77.019  14.151  1.00 31.10 ? 317 VAL A C   1 
ATOM   2352  O  O   . VAL A 1 317 ? 39.860 76.879  15.363  1.00 32.01 ? 317 VAL A O   1 
ATOM   2353  C  CB  . VAL A 1 317 ? 39.599 74.770  13.288  1.00 30.82 ? 317 VAL A CB  1 
ATOM   2354  C  CG1 . VAL A 1 317 ? 38.277 75.310  12.755  1.00 30.60 ? 317 VAL A CG1 1 
ATOM   2355  C  CG2 . VAL A 1 317 ? 40.099 73.626  12.425  1.00 30.38 ? 317 VAL A CG2 1 
ATOM   2356  N  N   . LEU A 1 318 ? 39.733 78.122  13.492  1.00 31.11 ? 318 LEU A N   1 
ATOM   2357  C  CA  . LEU A 1 318 ? 39.141 79.257  14.185  1.00 31.84 ? 318 LEU A CA  1 
ATOM   2358  C  C   . LEU A 1 318 ? 37.667 79.328  13.797  1.00 32.48 ? 318 LEU A C   1 
ATOM   2359  O  O   . LEU A 1 318 ? 37.340 79.627  12.643  1.00 32.12 ? 318 LEU A O   1 
ATOM   2360  C  CB  . LEU A 1 318 ? 39.877 80.547  13.794  1.00 31.41 ? 318 LEU A CB  1 
ATOM   2361  C  CG  . LEU A 1 318 ? 41.334 80.670  14.265  1.00 29.24 ? 318 LEU A CG  1 
ATOM   2362  C  CD1 . LEU A 1 318 ? 41.932 81.963  13.747  1.00 28.85 ? 318 LEU A CD1 1 
ATOM   2363  C  CD2 . LEU A 1 318 ? 41.394 80.621  15.784  1.00 28.88 ? 318 LEU A CD2 1 
ATOM   2364  N  N   . ASN A 1 319 ? 36.787 79.052  14.760  1.00 32.72 ? 319 ASN A N   1 
ATOM   2365  C  CA  . ASN A 1 319 ? 35.353 79.044  14.490  1.00 33.58 ? 319 ASN A CA  1 
ATOM   2366  C  C   . ASN A 1 319 ? 34.441 79.955  15.307  1.00 33.58 ? 319 ASN A C   1 
ATOM   2367  O  O   . ASN A 1 319 ? 33.232 79.769  15.300  1.00 34.12 ? 319 ASN A O   1 
ATOM   2368  C  CB  . ASN A 1 319 ? 34.826 77.615  14.600  1.00 35.12 ? 319 ASN A CB  1 
ATOM   2369  C  CG  . ASN A 1 319 ? 34.975 77.046  15.993  1.00 35.80 ? 319 ASN A CG  1 
ATOM   2370  O  OD1 . ASN A 1 319 ? 35.274 77.765  16.948  1.00 36.08 ? 319 ASN A OD1 1 
ATOM   2371  N  ND2 . ASN A 1 319 ? 34.753 75.747  16.119  1.00 36.32 ? 319 ASN A ND2 1 
ATOM   2372  N  N   . ARG A 1 320 ? 35.004 80.929  16.011  1.00 34.33 ? 320 ARG A N   1 
ATOM   2373  C  CA  . ARG A 1 320 ? 34.206 81.863  16.800  1.00 34.06 ? 320 ARG A CA  1 
ATOM   2374  C  C   . ARG A 1 320 ? 34.883 83.226  16.933  1.00 34.03 ? 320 ARG A C   1 
ATOM   2375  O  O   . ARG A 1 320 ? 36.029 83.317  17.351  1.00 35.02 ? 320 ARG A O   1 
ATOM   2376  C  CB  . ARG A 1 320 ? 33.923 81.303  18.196  1.00 34.01 ? 320 ARG A CB  1 
ATOM   2377  C  CG  . ARG A 1 320 ? 33.386 82.363  19.159  1.00 36.95 ? 320 ARG A CG  1 
ATOM   2378  C  CD  . ARG A 1 320 ? 32.719 81.773  20.384  1.00 38.28 ? 320 ARG A CD  1 
ATOM   2379  N  NE  . ARG A 1 320 ? 33.592 80.811  21.045  1.00 41.66 ? 320 ARG A NE  1 
ATOM   2380  C  CZ  . ARG A 1 320 ? 34.622 81.134  21.822  1.00 42.77 ? 320 ARG A CZ  1 
ATOM   2381  N  NH1 . ARG A 1 320 ? 34.903 82.412  22.046  1.00 43.73 ? 320 ARG A NH1 1 
ATOM   2382  N  NH2 . ARG A 1 320 ? 35.385 80.176  22.356  1.00 43.50 ? 320 ARG A NH2 1 
ATOM   2383  N  N   . ASN A 1 321 ? 34.172 84.285  16.562  1.00 33.28 ? 321 ASN A N   1 
ATOM   2384  C  CA  . ASN A 1 321 ? 34.701 85.642  16.673  1.00 32.00 ? 321 ASN A CA  1 
ATOM   2385  C  C   . ASN A 1 321 ? 34.496 86.120  18.096  1.00 31.68 ? 321 ASN A C   1 
ATOM   2386  O  O   . ASN A 1 321 ? 33.718 85.528  18.859  1.00 31.38 ? 321 ASN A O   1 
ATOM   2387  C  CB  . ASN A 1 321 ? 33.934 86.600  15.771  1.00 32.42 ? 321 ASN A CB  1 
ATOM   2388  C  CG  . ASN A 1 321 ? 34.289 86.454  14.313  1.00 33.72 ? 321 ASN A CG  1 
ATOM   2389  O  OD1 . ASN A 1 321 ? 33.404 86.477  13.456  1.00 34.25 ? 321 ASN A OD1 1 
ATOM   2390  N  ND2 . ASN A 1 321 ? 35.583 86.331  14.013  1.00 33.44 ? 321 ASN A ND2 1 
ATOM   2391  N  N   . PRO A 1 322 ? 35.186 87.207  18.482  1.00 30.83 ? 322 PRO A N   1 
ATOM   2392  C  CA  . PRO A 1 322 ? 34.985 87.689  19.850  1.00 30.11 ? 322 PRO A CA  1 
ATOM   2393  C  C   . PRO A 1 322 ? 33.601 88.331  19.970  1.00 30.38 ? 322 PRO A C   1 
ATOM   2394  O  O   . PRO A 1 322 ? 33.004 88.764  18.983  1.00 30.81 ? 322 PRO A O   1 
ATOM   2395  C  CB  . PRO A 1 322 ? 36.118 88.703  20.031  1.00 29.05 ? 322 PRO A CB  1 
ATOM   2396  C  CG  . PRO A 1 322 ? 36.353 89.198  18.646  1.00 29.34 ? 322 PRO A CG  1 
ATOM   2397  C  CD  . PRO A 1 322 ? 36.272 87.946  17.814  1.00 29.60 ? 322 PRO A CD  1 
ATOM   2398  N  N   . VAL A 1 323 ? 33.079 88.385  21.182  1.00 30.23 ? 323 VAL A N   1 
ATOM   2399  C  CA  . VAL A 1 323 ? 31.789 89.004  21.411  1.00 29.41 ? 323 VAL A CA  1 
ATOM   2400  C  C   . VAL A 1 323 ? 32.007 90.457  21.846  1.00 28.97 ? 323 VAL A C   1 
ATOM   2401  O  O   . VAL A 1 323 ? 31.227 91.349  21.497  1.00 28.76 ? 323 VAL A O   1 
ATOM   2402  C  CB  . VAL A 1 323 ? 31.022 88.180  22.444  1.00 29.91 ? 323 VAL A CB  1 
ATOM   2403  C  CG1 . VAL A 1 323 ? 30.124 89.043  23.302  1.00 29.68 ? 323 VAL A CG1 1 
ATOM   2404  C  CG2 . VAL A 1 323 ? 30.222 87.144  21.700  1.00 29.96 ? 323 VAL A CG2 1 
ATOM   2405  N  N   . ASN A 1 324 ? 33.083 90.674  22.598  1.00 28.50 ? 324 ASN A N   1 
ATOM   2406  C  CA  . ASN A 1 324 ? 33.492 91.993  23.067  1.00 28.66 ? 324 ASN A CA  1 
ATOM   2407  C  C   . ASN A 1 324 ? 34.994 92.020  22.814  1.00 29.07 ? 324 ASN A C   1 
ATOM   2408  O  O   . ASN A 1 324 ? 35.751 91.310  23.472  1.00 28.88 ? 324 ASN A O   1 
ATOM   2409  C  CB  . ASN A 1 324 ? 33.213 92.166  24.558  1.00 29.08 ? 324 ASN A CB  1 
ATOM   2410  C  CG  . ASN A 1 324 ? 33.665 93.519  25.072  1.00 30.07 ? 324 ASN A CG  1 
ATOM   2411  O  OD1 . ASN A 1 324 ? 34.866 93.793  25.166  1.00 30.02 ? 324 ASN A OD1 1 
ATOM   2412  N  ND2 . ASN A 1 324 ? 32.705 94.384  25.389  1.00 29.70 ? 324 ASN A ND2 1 
ATOM   2413  N  N   . TYR A 1 325 ? 35.417 92.831  21.849  1.00 29.37 ? 325 TYR A N   1 
ATOM   2414  C  CA  . TYR A 1 325 ? 36.823 92.912  21.469  1.00 29.25 ? 325 TYR A CA  1 
ATOM   2415  C  C   . TYR A 1 325 ? 37.780 93.293  22.580  1.00 29.69 ? 325 TYR A C   1 
ATOM   2416  O  O   . TYR A 1 325 ? 38.798 92.629  22.776  1.00 30.15 ? 325 TYR A O   1 
ATOM   2417  C  CB  . TYR A 1 325 ? 36.999 93.896  20.313  1.00 29.05 ? 325 TYR A CB  1 
ATOM   2418  C  CG  . TYR A 1 325 ? 38.421 94.030  19.814  1.00 28.48 ? 325 TYR A CG  1 
ATOM   2419  C  CD1 . TYR A 1 325 ? 38.865 93.305  18.706  1.00 28.78 ? 325 TYR A CD1 1 
ATOM   2420  C  CD2 . TYR A 1 325 ? 39.315 94.909  20.430  1.00 28.30 ? 325 TYR A CD2 1 
ATOM   2421  C  CE1 . TYR A 1 325 ? 40.166 93.457  18.215  1.00 28.07 ? 325 TYR A CE1 1 
ATOM   2422  C  CE2 . TYR A 1 325 ? 40.614 95.069  19.955  1.00 28.44 ? 325 TYR A CE2 1 
ATOM   2423  C  CZ  . TYR A 1 325 ? 41.035 94.344  18.844  1.00 28.72 ? 325 TYR A CZ  1 
ATOM   2424  O  OH  . TYR A 1 325 ? 42.311 94.528  18.361  1.00 28.20 ? 325 TYR A OH  1 
ATOM   2425  N  N   . PHE A 1 326 ? 37.471 94.367  23.298  1.00 29.64 ? 326 PHE A N   1 
ATOM   2426  C  CA  . PHE A 1 326 ? 38.354 94.806  24.368  1.00 30.20 ? 326 PHE A CA  1 
ATOM   2427  C  C   . PHE A 1 326 ? 38.624 93.728  25.407  1.00 30.23 ? 326 PHE A C   1 
ATOM   2428  O  O   . PHE A 1 326 ? 39.739 93.617  25.912  1.00 31.60 ? 326 PHE A O   1 
ATOM   2429  C  CB  . PHE A 1 326 ? 37.797 96.037  25.082  1.00 28.97 ? 326 PHE A CB  1 
ATOM   2430  C  CG  . PHE A 1 326 ? 38.657 96.506  26.224  1.00 28.51 ? 326 PHE A CG  1 
ATOM   2431  C  CD1 . PHE A 1 326 ? 39.755 97.335  25.993  1.00 28.60 ? 326 PHE A CD1 1 
ATOM   2432  C  CD2 . PHE A 1 326 ? 38.391 96.091  27.529  1.00 27.54 ? 326 PHE A CD2 1 
ATOM   2433  C  CE1 . PHE A 1 326 ? 40.576 97.746  27.041  1.00 26.50 ? 326 PHE A CE1 1 
ATOM   2434  C  CE2 . PHE A 1 326 ? 39.200 96.494  28.580  1.00 26.54 ? 326 PHE A CE2 1 
ATOM   2435  C  CZ  . PHE A 1 326 ? 40.297 97.324  28.336  1.00 26.75 ? 326 PHE A CZ  1 
ATOM   2436  N  N   . ALA A 1 327 ? 37.612 92.930  25.717  1.00 30.06 ? 327 ALA A N   1 
ATOM   2437  C  CA  . ALA A 1 327 ? 37.762 91.892  26.733  1.00 30.03 ? 327 ALA A CA  1 
ATOM   2438  C  C   . ALA A 1 327 ? 38.428 90.611  26.262  1.00 29.54 ? 327 ALA A C   1 
ATOM   2439  O  O   . ALA A 1 327 ? 39.128 89.955  27.035  1.00 29.33 ? 327 ALA A O   1 
ATOM   2440  C  CB  . ALA A 1 327 ? 36.393 91.558  27.352  1.00 28.67 ? 327 ALA A CB  1 
ATOM   2441  N  N   . GLU A 1 328 ? 38.213 90.250  25.004  1.00 28.75 ? 328 GLU A N   1 
ATOM   2442  C  CA  . GLU A 1 328 ? 38.770 89.007  24.502  1.00 28.52 ? 328 GLU A CA  1 
ATOM   2443  C  C   . GLU A 1 328 ? 39.995 89.145  23.629  1.00 27.51 ? 328 GLU A C   1 
ATOM   2444  O  O   . GLU A 1 328 ? 40.750 88.199  23.469  1.00 27.08 ? 328 GLU A O   1 
ATOM   2445  C  CB  . GLU A 1 328 ? 37.696 88.237  23.744  1.00 29.70 ? 328 GLU A CB  1 
ATOM   2446  C  CG  . GLU A 1 328 ? 36.415 88.027  24.534  1.00 31.22 ? 328 GLU A CG  1 
ATOM   2447  C  CD  . GLU A 1 328 ? 35.275 87.497  23.668  1.00 32.27 ? 328 GLU A CD  1 
ATOM   2448  O  OE1 . GLU A 1 328 ? 35.384 86.376  23.115  1.00 33.96 ? 328 GLU A OE1 1 
ATOM   2449  O  OE2 . GLU A 1 328 ? 34.264 88.209  23.540  1.00 32.94 ? 328 GLU A OE2 1 
ATOM   2450  N  N   . VAL A 1 329 ? 40.196 90.320  23.054  1.00 27.83 ? 329 VAL A N   1 
ATOM   2451  C  CA  . VAL A 1 329 ? 41.354 90.520  22.199  1.00 27.64 ? 329 VAL A CA  1 
ATOM   2452  C  C   . VAL A 1 329 ? 42.351 91.507  22.795  1.00 28.06 ? 329 VAL A C   1 
ATOM   2453  O  O   . VAL A 1 329 ? 43.494 91.151  23.068  1.00 28.98 ? 329 VAL A O   1 
ATOM   2454  C  CB  . VAL A 1 329 ? 40.946 91.004  20.794  1.00 26.28 ? 329 VAL A CB  1 
ATOM   2455  C  CG1 . VAL A 1 329 ? 42.173 91.266  19.977  1.00 26.10 ? 329 VAL A CG1 1 
ATOM   2456  C  CG2 . VAL A 1 329 ? 40.094 89.964  20.110  1.00 26.27 ? 329 VAL A CG2 1 
ATOM   2457  N  N   . GLU A 1 330 ? 41.926 92.746  23.002  1.00 28.00 ? 330 GLU A N   1 
ATOM   2458  C  CA  . GLU A 1 330 ? 42.830 93.745  23.547  1.00 27.88 ? 330 GLU A CA  1 
ATOM   2459  C  C   . GLU A 1 330 ? 43.483 93.252  24.842  1.00 28.17 ? 330 GLU A C   1 
ATOM   2460  O  O   . GLU A 1 330 ? 44.706 93.324  24.996  1.00 27.18 ? 330 GLU A O   1 
ATOM   2461  C  CB  . GLU A 1 330 ? 42.071 95.040  23.800  1.00 27.46 ? 330 GLU A CB  1 
ATOM   2462  C  CG  . GLU A 1 330 ? 42.939 96.191  24.235  1.00 29.15 ? 330 GLU A CG  1 
ATOM   2463  C  CD  . GLU A 1 330 ? 44.072 96.497  23.261  1.00 30.97 ? 330 GLU A CD  1 
ATOM   2464  O  OE1 . GLU A 1 330 ? 43.853 96.428  22.030  1.00 31.59 ? 330 GLU A OE1 1 
ATOM   2465  O  OE2 . GLU A 1 330 ? 45.183 96.829  23.734  1.00 32.59 ? 330 GLU A OE2 1 
ATOM   2466  N  N   . GLN A 1 331 ? 42.665 92.737  25.758  1.00 27.90 ? 331 GLN A N   1 
ATOM   2467  C  CA  . GLN A 1 331 ? 43.159 92.256  27.039  1.00 28.17 ? 331 GLN A CA  1 
ATOM   2468  C  C   . GLN A 1 331 ? 43.862 90.900  27.011  1.00 28.43 ? 331 GLN A C   1 
ATOM   2469  O  O   . GLN A 1 331 ? 44.423 90.491  28.028  1.00 28.39 ? 331 GLN A O   1 
ATOM   2470  C  CB  . GLN A 1 331 ? 42.021 92.183  28.062  1.00 27.91 ? 331 GLN A CB  1 
ATOM   2471  C  CG  . GLN A 1 331 ? 41.568 93.505  28.645  1.00 26.96 ? 331 GLN A CG  1 
ATOM   2472  C  CD  . GLN A 1 331 ? 40.655 93.316  29.853  1.00 27.31 ? 331 GLN A CD  1 
ATOM   2473  O  OE1 . GLN A 1 331 ? 40.789 93.999  30.862  1.00 27.06 ? 331 GLN A OE1 1 
ATOM   2474  N  NE2 . GLN A 1 331 ? 39.720 92.387  29.748  1.00 28.64 ? 331 GLN A NE2 1 
ATOM   2475  N  N   . ILE A 1 332 ? 43.848 90.192  25.882  1.00 27.63 ? 332 ILE A N   1 
ATOM   2476  C  CA  . ILE A 1 332 ? 44.496 88.882  25.871  1.00 27.37 ? 332 ILE A CA  1 
ATOM   2477  C  C   . ILE A 1 332 ? 45.993 88.992  26.054  1.00 27.46 ? 332 ILE A C   1 
ATOM   2478  O  O   . ILE A 1 332 ? 46.597 90.006  25.720  1.00 27.36 ? 332 ILE A O   1 
ATOM   2479  C  CB  . ILE A 1 332 ? 44.202 88.072  24.585  1.00 26.85 ? 332 ILE A CB  1 
ATOM   2480  C  CG1 . ILE A 1 332 ? 44.675 86.629  24.780  1.00 25.45 ? 332 ILE A CG1 1 
ATOM   2481  C  CG2 . ILE A 1 332 ? 44.939 88.662  23.398  1.00 26.50 ? 332 ILE A CG2 1 
ATOM   2482  C  CD1 . ILE A 1 332 ? 43.878 85.621  24.007  1.00 24.30 ? 332 ILE A CD1 1 
ATOM   2483  N  N   . ALA A 1 333 ? 46.590 87.935  26.588  1.00 28.10 ? 333 ALA A N   1 
ATOM   2484  C  CA  . ALA A 1 333 ? 48.024 87.925  26.844  1.00 28.36 ? 333 ALA A CA  1 
ATOM   2485  C  C   . ALA A 1 333 ? 48.696 86.579  26.606  1.00 28.52 ? 333 ALA A C   1 
ATOM   2486  O  O   . ALA A 1 333 ? 48.350 85.594  27.255  1.00 29.33 ? 333 ALA A O   1 
ATOM   2487  C  CB  . ALA A 1 333 ? 48.274 88.355  28.275  1.00 28.09 ? 333 ALA A CB  1 
ATOM   2488  N  N   . PHE A 1 334 ? 49.662 86.535  25.691  1.00 28.74 ? 334 PHE A N   1 
ATOM   2489  C  CA  . PHE A 1 334 ? 50.394 85.296  25.445  1.00 28.47 ? 334 PHE A CA  1 
ATOM   2490  C  C   . PHE A 1 334 ? 51.803 85.423  26.031  1.00 28.77 ? 334 PHE A C   1 
ATOM   2491  O  O   . PHE A 1 334 ? 52.454 86.447  25.865  1.00 28.72 ? 334 PHE A O   1 
ATOM   2492  C  CB  . PHE A 1 334 ? 50.528 85.009  23.953  1.00 28.42 ? 334 PHE A CB  1 
ATOM   2493  C  CG  . PHE A 1 334 ? 49.235 85.085  23.186  1.00 29.52 ? 334 PHE A CG  1 
ATOM   2494  C  CD1 . PHE A 1 334 ? 48.625 86.314  22.934  1.00 28.99 ? 334 PHE A CD1 1 
ATOM   2495  C  CD2 . PHE A 1 334 ? 48.666 83.935  22.644  1.00 29.02 ? 334 PHE A CD2 1 
ATOM   2496  C  CE1 . PHE A 1 334 ? 47.474 86.396  22.145  1.00 29.45 ? 334 PHE A CE1 1 
ATOM   2497  C  CE2 . PHE A 1 334 ? 47.514 84.010  21.858  1.00 29.15 ? 334 PHE A CE2 1 
ATOM   2498  C  CZ  . PHE A 1 334 ? 46.917 85.243  21.605  1.00 28.34 ? 334 PHE A CZ  1 
ATOM   2499  N  N   . ASP A 1 335 ? 52.273 84.389  26.721  1.00 29.00 ? 335 ASP A N   1 
ATOM   2500  C  CA  . ASP A 1 335 ? 53.619 84.413  27.282  1.00 29.24 ? 335 ASP A CA  1 
ATOM   2501  C  C   . ASP A 1 335 ? 54.409 83.242  26.745  1.00 29.44 ? 335 ASP A C   1 
ATOM   2502  O  O   . ASP A 1 335 ? 54.099 82.110  27.059  1.00 31.32 ? 335 ASP A O   1 
ATOM   2503  C  CB  . ASP A 1 335 ? 53.590 84.298  28.803  1.00 29.18 ? 335 ASP A CB  1 
ATOM   2504  C  CG  . ASP A 1 335 ? 52.902 85.457  29.457  1.00 31.03 ? 335 ASP A CG  1 
ATOM   2505  O  OD1 . ASP A 1 335 ? 53.271 86.609  29.165  1.00 32.93 ? 335 ASP A OD1 1 
ATOM   2506  O  OD2 . ASP A 1 335 ? 51.992 85.223  30.270  1.00 32.36 ? 335 ASP A OD2 1 
ATOM   2507  N  N   . PRO A 1 336 ? 55.443 83.486  25.930  1.00 29.12 ? 336 PRO A N   1 
ATOM   2508  C  CA  . PRO A 1 336 ? 56.222 82.358  25.411  1.00 28.57 ? 336 PRO A CA  1 
ATOM   2509  C  C   . PRO A 1 336 ? 56.652 81.390  26.515  1.00 28.07 ? 336 PRO A C   1 
ATOM   2510  O  O   . PRO A 1 336 ? 56.813 80.205  26.271  1.00 27.66 ? 336 PRO A O   1 
ATOM   2511  C  CB  . PRO A 1 336 ? 57.427 83.039  24.767  1.00 28.52 ? 336 PRO A CB  1 
ATOM   2512  C  CG  . PRO A 1 336 ? 56.869 84.335  24.300  1.00 29.22 ? 336 PRO A CG  1 
ATOM   2513  C  CD  . PRO A 1 336 ? 56.001 84.765  25.461  1.00 28.87 ? 336 PRO A CD  1 
ATOM   2514  N  N   . SER A 1 337 ? 56.831 81.892  27.732  1.00 28.15 ? 337 SER A N   1 
ATOM   2515  C  CA  . SER A 1 337 ? 57.263 81.024  28.816  1.00 28.77 ? 337 SER A CA  1 
ATOM   2516  C  C   . SER A 1 337 ? 56.173 80.078  29.282  1.00 29.42 ? 337 SER A C   1 
ATOM   2517  O  O   . SER A 1 337 ? 56.403 79.260  30.169  1.00 31.25 ? 337 SER A O   1 
ATOM   2518  C  CB  . SER A 1 337 ? 57.801 81.842  30.004  1.00 28.18 ? 337 SER A CB  1 
ATOM   2519  O  OG  . SER A 1 337 ? 56.790 82.532  30.712  1.00 26.36 ? 337 SER A OG  1 
ATOM   2520  N  N   . ASN A 1 338 ? 54.980 80.201  28.710  1.00 29.70 ? 338 ASN A N   1 
ATOM   2521  C  CA  . ASN A 1 338 ? 53.866 79.307  29.054  1.00 29.74 ? 338 ASN A CA  1 
ATOM   2522  C  C   . ASN A 1 338 ? 54.011 78.039  28.218  1.00 29.91 ? 338 ASN A C   1 
ATOM   2523  O  O   . ASN A 1 338 ? 53.535 77.971  27.082  1.00 29.89 ? 338 ASN A O   1 
ATOM   2524  C  CB  . ASN A 1 338 ? 52.509 79.949  28.738  1.00 29.73 ? 338 ASN A CB  1 
ATOM   2525  C  CG  . ASN A 1 338 ? 52.076 80.958  29.780  1.00 29.53 ? 338 ASN A CG  1 
ATOM   2526  O  OD1 . ASN A 1 338 ? 52.666 81.056  30.856  1.00 31.06 ? 338 ASN A OD1 1 
ATOM   2527  N  ND2 . ASN A 1 338 ? 51.027 81.705  29.470  1.00 28.20 ? 338 ASN A ND2 1 
ATOM   2528  N  N   . MET A 1 339 ? 54.691 77.049  28.781  1.00 30.34 ? 339 MET A N   1 
ATOM   2529  C  CA  . MET A 1 339 ? 54.925 75.775  28.112  1.00 30.18 ? 339 MET A CA  1 
ATOM   2530  C  C   . MET A 1 339 ? 54.688 74.657  29.108  1.00 31.05 ? 339 MET A C   1 
ATOM   2531  O  O   . MET A 1 339 ? 55.230 74.672  30.217  1.00 32.11 ? 339 MET A O   1 
ATOM   2532  C  CB  . MET A 1 339 ? 56.362 75.700  27.588  1.00 29.68 ? 339 MET A CB  1 
ATOM   2533  C  CG  . MET A 1 339 ? 56.658 76.665  26.457  1.00 29.37 ? 339 MET A CG  1 
ATOM   2534  S  SD  . MET A 1 339 ? 58.405 76.687  26.021  1.00 31.81 ? 339 MET A SD  1 
ATOM   2535  C  CE  . MET A 1 339 ? 59.019 78.014  27.048  1.00 28.66 ? 339 MET A CE  1 
ATOM   2536  N  N   . PRO A 1 340 ? 53.873 73.668  28.725  1.00 31.11 ? 340 PRO A N   1 
ATOM   2537  C  CA  . PRO A 1 340 ? 53.544 72.523  29.570  1.00 30.27 ? 340 PRO A CA  1 
ATOM   2538  C  C   . PRO A 1 340 ? 54.585 71.435  29.409  1.00 30.21 ? 340 PRO A C   1 
ATOM   2539  O  O   . PRO A 1 340 ? 55.395 71.471  28.485  1.00 30.39 ? 340 PRO A O   1 
ATOM   2540  C  CB  . PRO A 1 340 ? 52.210 72.091  29.020  1.00 30.74 ? 340 PRO A CB  1 
ATOM   2541  C  CG  . PRO A 1 340 ? 52.466 72.227  27.537  1.00 31.18 ? 340 PRO A CG  1 
ATOM   2542  C  CD  . PRO A 1 340 ? 53.177 73.568  27.428  1.00 31.30 ? 340 PRO A CD  1 
ATOM   2543  N  N   . PRO A 1 341 ? 54.580 70.451  30.312  1.00 30.41 ? 341 PRO A N   1 
ATOM   2544  C  CA  . PRO A 1 341 ? 55.542 69.338  30.247  1.00 30.23 ? 341 PRO A CA  1 
ATOM   2545  C  C   . PRO A 1 341 ? 55.537 68.670  28.857  1.00 31.14 ? 341 PRO A C   1 
ATOM   2546  O  O   . PRO A 1 341 ? 54.473 68.389  28.291  1.00 31.81 ? 341 PRO A O   1 
ATOM   2547  C  CB  . PRO A 1 341 ? 55.050 68.416  31.341  1.00 29.56 ? 341 PRO A CB  1 
ATOM   2548  C  CG  . PRO A 1 341 ? 54.533 69.409  32.380  1.00 29.89 ? 341 PRO A CG  1 
ATOM   2549  C  CD  . PRO A 1 341 ? 53.766 70.391  31.539  1.00 29.42 ? 341 PRO A CD  1 
ATOM   2550  N  N   . GLY A 1 342 ? 56.719 68.424  28.307  1.00 30.75 ? 342 GLY A N   1 
ATOM   2551  C  CA  . GLY A 1 342 ? 56.802 67.827  26.988  1.00 31.01 ? 342 GLY A CA  1 
ATOM   2552  C  C   . GLY A 1 342 ? 57.245 68.877  25.988  1.00 32.22 ? 342 GLY A C   1 
ATOM   2553  O  O   . GLY A 1 342 ? 57.655 68.567  24.862  1.00 32.76 ? 342 GLY A O   1 
ATOM   2554  N  N   . ILE A 1 343 ? 57.159 70.136  26.415  1.00 32.69 ? 343 ILE A N   1 
ATOM   2555  C  CA  . ILE A 1 343 ? 57.542 71.289  25.601  1.00 32.18 ? 343 ILE A CA  1 
ATOM   2556  C  C   . ILE A 1 343 ? 58.410 72.226  26.445  1.00 32.80 ? 343 ILE A C   1 
ATOM   2557  O  O   . ILE A 1 343 ? 57.973 72.717  27.481  1.00 33.12 ? 343 ILE A O   1 
ATOM   2558  C  CB  . ILE A 1 343 ? 56.295 72.079  25.120  1.00 30.73 ? 343 ILE A CB  1 
ATOM   2559  C  CG1 . ILE A 1 343 ? 55.377 71.164  24.308  1.00 30.17 ? 343 ILE A CG1 1 
ATOM   2560  C  CG2 . ILE A 1 343 ? 56.725 73.281  24.303  1.00 29.72 ? 343 ILE A CG2 1 
ATOM   2561  C  CD1 . ILE A 1 343 ? 54.135 71.835  23.807  1.00 28.75 ? 343 ILE A CD1 1 
ATOM   2562  N  N   . GLU A 1 344 ? 59.642 72.459  26.002  1.00 33.34 ? 344 GLU A N   1 
ATOM   2563  C  CA  . GLU A 1 344 ? 60.564 73.339  26.710  1.00 33.41 ? 344 GLU A CA  1 
ATOM   2564  C  C   . GLU A 1 344 ? 61.293 74.281  25.751  1.00 33.29 ? 344 GLU A C   1 
ATOM   2565  O  O   . GLU A 1 344 ? 61.173 74.175  24.525  1.00 32.89 ? 344 GLU A O   1 
ATOM   2566  C  CB  . GLU A 1 344 ? 61.578 72.521  27.524  1.00 34.19 ? 344 GLU A CB  1 
ATOM   2567  C  CG  . GLU A 1 344 ? 60.946 71.718  28.658  1.00 36.75 ? 344 GLU A CG  1 
ATOM   2568  C  CD  . GLU A 1 344 ? 61.959 70.930  29.477  1.00 38.27 ? 344 GLU A CD  1 
ATOM   2569  O  OE1 . GLU A 1 344 ? 61.548 70.169  30.388  1.00 38.98 ? 344 GLU A OE1 1 
ATOM   2570  O  OE2 . GLU A 1 344 ? 63.170 71.075  29.213  1.00 40.25 ? 344 GLU A OE2 1 
ATOM   2571  N  N   . ALA A 1 345 ? 62.048 75.209  26.324  1.00 32.71 ? 345 ALA A N   1 
ATOM   2572  C  CA  . ALA A 1 345 ? 62.775 76.183  25.542  1.00 32.30 ? 345 ALA A CA  1 
ATOM   2573  C  C   . ALA A 1 345 ? 64.129 75.684  25.085  1.00 32.07 ? 345 ALA A C   1 
ATOM   2574  O  O   . ALA A 1 345 ? 64.728 74.824  25.709  1.00 32.34 ? 345 ALA A O   1 
ATOM   2575  C  CB  . ALA A 1 345 ? 62.949 77.452  26.355  1.00 32.17 ? 345 ALA A CB  1 
ATOM   2576  N  N   . SER A 1 346 ? 64.611 76.227  23.980  1.00 31.94 ? 346 SER A N   1 
ATOM   2577  C  CA  . SER A 1 346 ? 65.927 75.857  23.504  1.00 31.20 ? 346 SER A CA  1 
ATOM   2578  C  C   . SER A 1 346 ? 66.794 77.028  23.948  1.00 31.60 ? 346 SER A C   1 
ATOM   2579  O  O   . SER A 1 346 ? 66.290 78.012  24.478  1.00 30.79 ? 346 SER A O   1 
ATOM   2580  C  CB  . SER A 1 346 ? 65.946 75.756  21.985  1.00 30.05 ? 346 SER A CB  1 
ATOM   2581  O  OG  . SER A 1 346 ? 66.160 77.032  21.424  1.00 30.08 ? 346 SER A OG  1 
ATOM   2582  N  N   . PRO A 1 347 ? 68.111 76.934  23.748  1.00 32.24 ? 347 PRO A N   1 
ATOM   2583  C  CA  . PRO A 1 347 ? 69.004 78.028  24.149  1.00 32.75 ? 347 PRO A CA  1 
ATOM   2584  C  C   . PRO A 1 347 ? 69.025 79.301  23.269  1.00 33.48 ? 347 PRO A C   1 
ATOM   2585  O  O   . PRO A 1 347 ? 69.836 80.198  23.514  1.00 33.74 ? 347 PRO A O   1 
ATOM   2586  C  CB  . PRO A 1 347 ? 70.370 77.342  24.215  1.00 33.49 ? 347 PRO A CB  1 
ATOM   2587  C  CG  . PRO A 1 347 ? 70.244 76.212  23.221  1.00 32.56 ? 347 PRO A CG  1 
ATOM   2588  C  CD  . PRO A 1 347 ? 68.867 75.693  23.501  1.00 32.15 ? 347 PRO A CD  1 
ATOM   2589  N  N   . ASP A 1 348 ? 68.152 79.378  22.258  1.00 33.46 ? 348 ASP A N   1 
ATOM   2590  C  CA  . ASP A 1 348 ? 68.068 80.551  21.370  1.00 32.93 ? 348 ASP A CA  1 
ATOM   2591  C  C   . ASP A 1 348 ? 68.062 81.823  22.234  1.00 32.67 ? 348 ASP A C   1 
ATOM   2592  O  O   . ASP A 1 348 ? 67.141 82.041  23.029  1.00 32.21 ? 348 ASP A O   1 
ATOM   2593  C  CB  . ASP A 1 348 ? 66.770 80.470  20.547  1.00 34.12 ? 348 ASP A CB  1 
ATOM   2594  C  CG  . ASP A 1 348 ? 66.619 81.607  19.531  1.00 35.48 ? 348 ASP A CG  1 
ATOM   2595  O  OD1 . ASP A 1 348 ? 67.109 82.736  19.770  1.00 36.71 ? 348 ASP A OD1 1 
ATOM   2596  O  OD2 . ASP A 1 348 ? 65.978 81.372  18.484  1.00 35.95 ? 348 ASP A OD2 1 
ATOM   2597  N  N   . LYS A 1 349 ? 69.079 82.667  22.081  1.00 32.11 ? 349 LYS A N   1 
ATOM   2598  C  CA  . LYS A 1 349 ? 69.150 83.881  22.887  1.00 31.49 ? 349 LYS A CA  1 
ATOM   2599  C  C   . LYS A 1 349 ? 67.873 84.720  22.806  1.00 31.71 ? 349 LYS A C   1 
ATOM   2600  O  O   . LYS A 1 349 ? 67.417 85.265  23.818  1.00 31.17 ? 349 LYS A O   1 
ATOM   2601  C  CB  . LYS A 1 349 ? 70.370 84.726  22.489  1.00 31.21 ? 349 LYS A CB  1 
ATOM   2602  C  CG  . LYS A 1 349 ? 71.715 84.055  22.761  1.00 30.69 ? 349 LYS A CG  1 
ATOM   2603  C  CD  . LYS A 1 349 ? 72.891 84.924  22.344  1.00 29.68 ? 349 LYS A CD  1 
ATOM   2604  C  CE  . LYS A 1 349 ? 74.206 84.172  22.522  1.00 30.98 ? 349 LYS A CE  1 
ATOM   2605  N  NZ  . LYS A 1 349 ? 75.430 84.945  22.123  1.00 30.26 ? 349 LYS A NZ  1 
ATOM   2606  N  N   . MET A 1 350 ? 67.287 84.824  21.614  1.00 31.34 ? 350 MET A N   1 
ATOM   2607  C  CA  . MET A 1 350 ? 66.058 85.602  21.461  1.00 31.13 ? 350 MET A CA  1 
ATOM   2608  C  C   . MET A 1 350 ? 64.939 84.992  22.310  1.00 31.19 ? 350 MET A C   1 
ATOM   2609  O  O   . MET A 1 350 ? 64.371 85.662  23.183  1.00 30.88 ? 350 MET A O   1 
ATOM   2610  C  CB  . MET A 1 350 ? 65.628 85.645  19.998  1.00 31.40 ? 350 MET A CB  1 
ATOM   2611  C  CG  . MET A 1 350 ? 66.591 86.380  19.074  1.00 32.38 ? 350 MET A CG  1 
ATOM   2612  S  SD  . MET A 1 350 ? 66.560 88.161  19.268  1.00 34.33 ? 350 MET A SD  1 
ATOM   2613  C  CE  . MET A 1 350 ? 65.042 88.558  18.403  1.00 32.93 ? 350 MET A CE  1 
ATOM   2614  N  N   . LEU A 1 351 ? 64.626 83.723  22.051  1.00 30.76 ? 351 LEU A N   1 
ATOM   2615  C  CA  . LEU A 1 351 ? 63.584 83.037  22.800  1.00 30.72 ? 351 LEU A CA  1 
ATOM   2616  C  C   . LEU A 1 351 ? 63.856 83.216  24.291  1.00 31.38 ? 351 LEU A C   1 
ATOM   2617  O  O   . LEU A 1 351 ? 62.960 83.524  25.074  1.00 32.24 ? 351 LEU A O   1 
ATOM   2618  C  CB  . LEU A 1 351 ? 63.577 81.544  22.468  1.00 30.40 ? 351 LEU A CB  1 
ATOM   2619  C  CG  . LEU A 1 351 ? 62.683 80.654  23.351  1.00 29.77 ? 351 LEU A CG  1 
ATOM   2620  C  CD1 . LEU A 1 351 ? 61.225 81.029  23.158  1.00 28.86 ? 351 LEU A CD1 1 
ATOM   2621  C  CD2 . LEU A 1 351 ? 62.903 79.181  23.007  1.00 29.78 ? 351 LEU A CD2 1 
ATOM   2622  N  N   . GLN A 1 352 ? 65.109 83.033  24.672  1.00 31.03 ? 352 GLN A N   1 
ATOM   2623  C  CA  . GLN A 1 352 ? 65.499 83.156  26.058  1.00 31.17 ? 352 GLN A CA  1 
ATOM   2624  C  C   . GLN A 1 352 ? 65.055 84.465  26.695  1.00 31.56 ? 352 GLN A C   1 
ATOM   2625  O  O   . GLN A 1 352 ? 64.538 84.478  27.812  1.00 32.11 ? 352 GLN A O   1 
ATOM   2626  C  CB  . GLN A 1 352 ? 67.008 82.998  26.168  1.00 30.20 ? 352 GLN A CB  1 
ATOM   2627  C  CG  . GLN A 1 352 ? 67.465 81.573  26.004  1.00 29.58 ? 352 GLN A CG  1 
ATOM   2628  C  CD  . GLN A 1 352 ? 67.228 80.744  27.254  1.00 29.39 ? 352 GLN A CD  1 
ATOM   2629  O  OE1 . GLN A 1 352 ? 67.530 81.183  28.371  1.00 28.67 ? 352 GLN A OE1 1 
ATOM   2630  N  NE2 . GLN A 1 352 ? 66.711 79.532  27.074  1.00 27.17 ? 352 GLN A NE2 1 
ATOM   2631  N  N   . GLY A 1 353 ? 65.253 85.567  25.988  1.00 31.35 ? 353 GLY A N   1 
ATOM   2632  C  CA  . GLY A 1 353 ? 64.862 86.846  26.543  1.00 31.06 ? 353 GLY A CA  1 
ATOM   2633  C  C   . GLY A 1 353 ? 63.355 87.038  26.595  1.00 30.98 ? 353 GLY A C   1 
ATOM   2634  O  O   . GLY A 1 353 ? 62.831 87.687  27.515  1.00 30.95 ? 353 GLY A O   1 
ATOM   2635  N  N   . ARG A 1 354 ? 62.658 86.473  25.609  1.00 29.82 ? 354 ARG A N   1 
ATOM   2636  C  CA  . ARG A 1 354 ? 61.212 86.585  25.541  1.00 28.33 ? 354 ARG A CA  1 
ATOM   2637  C  C   . ARG A 1 354 ? 60.580 85.884  26.731  1.00 27.57 ? 354 ARG A C   1 
ATOM   2638  O  O   . ARG A 1 354 ? 59.472 86.224  27.150  1.00 27.18 ? 354 ARG A O   1 
ATOM   2639  C  CB  . ARG A 1 354 ? 60.701 85.997  24.226  1.00 28.54 ? 354 ARG A CB  1 
ATOM   2640  C  CG  . ARG A 1 354 ? 61.232 86.728  22.987  1.00 29.03 ? 354 ARG A CG  1 
ATOM   2641  C  CD  . ARG A 1 354 ? 60.753 86.077  21.702  1.00 28.86 ? 354 ARG A CD  1 
ATOM   2642  N  NE  . ARG A 1 354 ? 59.326 86.272  21.493  1.00 30.86 ? 354 ARG A NE  1 
ATOM   2643  C  CZ  . ARG A 1 354 ? 58.537 85.403  20.871  1.00 32.03 ? 354 ARG A CZ  1 
ATOM   2644  N  NH1 . ARG A 1 354 ? 59.031 84.266  20.396  1.00 31.72 ? 354 ARG A NH1 1 
ATOM   2645  N  NH2 . ARG A 1 354 ? 57.250 85.676  20.717  1.00 32.61 ? 354 ARG A NH2 1 
ATOM   2646  N  N   . LEU A 1 355 ? 61.295 84.908  27.282  1.00 26.61 ? 355 LEU A N   1 
ATOM   2647  C  CA  . LEU A 1 355 ? 60.797 84.183  28.435  1.00 26.08 ? 355 LEU A CA  1 
ATOM   2648  C  C   . LEU A 1 355 ? 60.529 85.166  29.567  1.00 25.91 ? 355 LEU A C   1 
ATOM   2649  O  O   . LEU A 1 355 ? 59.651 84.956  30.393  1.00 26.52 ? 355 LEU A O   1 
ATOM   2650  C  CB  . LEU A 1 355 ? 61.815 83.142  28.893  1.00 25.96 ? 355 LEU A CB  1 
ATOM   2651  C  CG  . LEU A 1 355 ? 62.061 81.940  27.993  1.00 26.16 ? 355 LEU A CG  1 
ATOM   2652  C  CD1 . LEU A 1 355 ? 63.183 81.105  28.569  1.00 26.39 ? 355 LEU A CD1 1 
ATOM   2653  C  CD2 . LEU A 1 355 ? 60.795 81.115  27.885  1.00 25.58 ? 355 LEU A CD2 1 
ATOM   2654  N  N   . PHE A 1 356 ? 61.278 86.257  29.597  1.00 26.27 ? 356 PHE A N   1 
ATOM   2655  C  CA  . PHE A 1 356 ? 61.103 87.241  30.649  1.00 26.20 ? 356 PHE A CA  1 
ATOM   2656  C  C   . PHE A 1 356 ? 60.215 88.407  30.260  1.00 26.99 ? 356 PHE A C   1 
ATOM   2657  O  O   . PHE A 1 356 ? 59.332 88.807  31.018  1.00 27.76 ? 356 PHE A O   1 
ATOM   2658  C  CB  . PHE A 1 356 ? 62.460 87.795  31.084  1.00 24.07 ? 356 PHE A CB  1 
ATOM   2659  C  CG  . PHE A 1 356 ? 62.373 89.142  31.746  1.00 23.78 ? 356 PHE A CG  1 
ATOM   2660  C  CD1 . PHE A 1 356 ? 61.944 89.264  33.062  1.00 23.46 ? 356 PHE A CD1 1 
ATOM   2661  C  CD2 . PHE A 1 356 ? 62.684 90.301  31.038  1.00 22.77 ? 356 PHE A CD2 1 
ATOM   2662  C  CE1 . PHE A 1 356 ? 61.828 90.522  33.663  1.00 22.37 ? 356 PHE A CE1 1 
ATOM   2663  C  CE2 . PHE A 1 356 ? 62.571 91.554  31.631  1.00 22.53 ? 356 PHE A CE2 1 
ATOM   2664  C  CZ  . PHE A 1 356 ? 62.141 91.664  32.946  1.00 21.93 ? 356 PHE A CZ  1 
ATOM   2665  N  N   . ALA A 1 357 ? 60.461 88.948  29.074  1.00 27.10 ? 357 ALA A N   1 
ATOM   2666  C  CA  . ALA A 1 357 ? 59.759 90.124  28.596  1.00 27.29 ? 357 ALA A CA  1 
ATOM   2667  C  C   . ALA A 1 357 ? 58.236 90.130  28.581  1.00 28.05 ? 357 ALA A C   1 
ATOM   2668  O  O   . ALA A 1 357 ? 57.619 91.158  28.893  1.00 28.53 ? 357 ALA A O   1 
ATOM   2669  C  CB  . ALA A 1 357 ? 60.285 90.502  27.224  1.00 26.78 ? 357 ALA A CB  1 
ATOM   2670  N  N   . TYR A 1 358 ? 57.614 89.010  28.236  1.00 27.79 ? 358 TYR A N   1 
ATOM   2671  C  CA  . TYR A 1 358 ? 56.169 89.005  28.162  1.00 28.01 ? 358 TYR A CA  1 
ATOM   2672  C  C   . TYR A 1 358 ? 55.429 89.069  29.497  1.00 27.64 ? 358 TYR A C   1 
ATOM   2673  O  O   . TYR A 1 358 ? 54.639 89.980  29.732  1.00 27.83 ? 358 TYR A O   1 
ATOM   2674  C  CB  . TYR A 1 358 ? 55.708 87.821  27.318  1.00 29.29 ? 358 TYR A CB  1 
ATOM   2675  C  CG  . TYR A 1 358 ? 56.105 87.934  25.855  1.00 30.22 ? 358 TYR A CG  1 
ATOM   2676  C  CD1 . TYR A 1 358 ? 57.442 87.888  25.462  1.00 31.37 ? 358 TYR A CD1 1 
ATOM   2677  C  CD2 . TYR A 1 358 ? 55.142 88.071  24.861  1.00 31.43 ? 358 TYR A CD2 1 
ATOM   2678  C  CE1 . TYR A 1 358 ? 57.807 87.976  24.104  1.00 31.84 ? 358 TYR A CE1 1 
ATOM   2679  C  CE2 . TYR A 1 358 ? 55.500 88.161  23.503  1.00 31.67 ? 358 TYR A CE2 1 
ATOM   2680  C  CZ  . TYR A 1 358 ? 56.829 88.114  23.134  1.00 31.42 ? 358 TYR A CZ  1 
ATOM   2681  O  OH  . TYR A 1 358 ? 57.174 88.224  21.801  1.00 32.08 ? 358 TYR A OH  1 
ATOM   2682  N  N   . PRO A 1 359 ? 55.666 88.118  30.391  1.00 27.44 ? 359 PRO A N   1 
ATOM   2683  C  CA  . PRO A 1 359 ? 54.943 88.213  31.665  1.00 28.12 ? 359 PRO A CA  1 
ATOM   2684  C  C   . PRO A 1 359 ? 55.236 89.551  32.348  1.00 28.64 ? 359 PRO A C   1 
ATOM   2685  O  O   . PRO A 1 359 ? 54.436 90.064  33.131  1.00 29.02 ? 359 PRO A O   1 
ATOM   2686  C  CB  . PRO A 1 359 ? 55.495 87.031  32.458  1.00 27.84 ? 359 PRO A CB  1 
ATOM   2687  C  CG  . PRO A 1 359 ? 55.787 86.028  31.377  1.00 27.75 ? 359 PRO A CG  1 
ATOM   2688  C  CD  . PRO A 1 359 ? 56.452 86.879  30.316  1.00 27.55 ? 359 PRO A CD  1 
ATOM   2689  N  N   . ASP A 1 360 ? 56.396 90.113  32.031  1.00 28.63 ? 360 ASP A N   1 
ATOM   2690  C  CA  . ASP A 1 360 ? 56.815 91.381  32.600  1.00 28.02 ? 360 ASP A CA  1 
ATOM   2691  C  C   . ASP A 1 360 ? 55.973 92.529  32.045  1.00 28.44 ? 360 ASP A C   1 
ATOM   2692  O  O   . ASP A 1 360 ? 55.363 93.308  32.789  1.00 28.21 ? 360 ASP A O   1 
ATOM   2693  C  CB  . ASP A 1 360 ? 58.282 91.621  32.277  1.00 27.50 ? 360 ASP A CB  1 
ATOM   2694  C  CG  . ASP A 1 360 ? 58.807 92.880  32.909  1.00 27.73 ? 360 ASP A CG  1 
ATOM   2695  O  OD1 . ASP A 1 360 ? 58.721 92.986  34.148  1.00 27.91 ? 360 ASP A OD1 1 
ATOM   2696  O  OD2 . ASP A 1 360 ? 59.298 93.761  32.174  1.00 26.68 ? 360 ASP A OD2 1 
ATOM   2697  N  N   . THR A 1 361 ? 55.954 92.644  30.727  1.00 27.61 ? 361 THR A N   1 
ATOM   2698  C  CA  . THR A 1 361 ? 55.181 93.692  30.100  1.00 26.79 ? 361 THR A CA  1 
ATOM   2699  C  C   . THR A 1 361 ? 53.688 93.473  30.415  1.00 27.15 ? 361 THR A C   1 
ATOM   2700  O  O   . THR A 1 361 ? 52.925 94.437  30.550  1.00 27.14 ? 361 THR A O   1 
ATOM   2701  C  CB  . THR A 1 361 ? 55.419 93.699  28.568  1.00 26.90 ? 361 THR A CB  1 
ATOM   2702  O  OG1 . THR A 1 361 ? 55.070 94.983  28.046  1.00 26.89 ? 361 THR A OG1 1 
ATOM   2703  C  CG2 . THR A 1 361 ? 54.589 92.614  27.870  1.00 24.33 ? 361 THR A CG2 1 
ATOM   2704  N  N   . HIS A 1 362 ? 53.270 92.214  30.557  1.00 26.76 ? 362 HIS A N   1 
ATOM   2705  C  CA  . HIS A 1 362 ? 51.863 91.941  30.847  1.00 26.73 ? 362 HIS A CA  1 
ATOM   2706  C  C   . HIS A 1 362 ? 51.470 92.417  32.233  1.00 26.80 ? 362 HIS A C   1 
ATOM   2707  O  O   . HIS A 1 362 ? 50.355 92.873  32.445  1.00 27.02 ? 362 HIS A O   1 
ATOM   2708  C  CB  . HIS A 1 362 ? 51.544 90.449  30.683  1.00 25.53 ? 362 HIS A CB  1 
ATOM   2709  C  CG  . HIS A 1 362 ? 51.476 90.004  29.255  1.00 25.92 ? 362 HIS A CG  1 
ATOM   2710  N  ND1 . HIS A 1 362 ? 51.791 88.722  28.858  1.00 25.44 ? 362 HIS A ND1 1 
ATOM   2711  C  CD2 . HIS A 1 362 ? 51.166 90.682  28.122  1.00 25.62 ? 362 HIS A CD2 1 
ATOM   2712  C  CE1 . HIS A 1 362 ? 51.688 88.633  27.544  1.00 25.67 ? 362 HIS A CE1 1 
ATOM   2713  N  NE2 . HIS A 1 362 ? 51.310 89.807  27.073  1.00 25.11 ? 362 HIS A NE2 1 
ATOM   2714  N  N   . ARG A 1 363 ? 52.381 92.317  33.186  1.00 26.96 ? 363 ARG A N   1 
ATOM   2715  C  CA  . ARG A 1 363 ? 52.061 92.780  34.524  1.00 27.86 ? 363 ARG A CA  1 
ATOM   2716  C  C   . ARG A 1 363 ? 51.934 94.308  34.493  1.00 28.89 ? 363 ARG A C   1 
ATOM   2717  O  O   . ARG A 1 363 ? 51.314 94.918  35.367  1.00 29.92 ? 363 ARG A O   1 
ATOM   2718  C  CB  . ARG A 1 363 ? 53.154 92.341  35.500  1.00 26.92 ? 363 ARG A CB  1 
ATOM   2719  C  CG  . ARG A 1 363 ? 53.156 90.860  35.757  1.00 25.35 ? 363 ARG A CG  1 
ATOM   2720  C  CD  . ARG A 1 363 ? 54.526 90.363  36.137  1.00 26.28 ? 363 ARG A CD  1 
ATOM   2721  N  NE  . ARG A 1 363 ? 54.559 88.903  36.169  1.00 27.25 ? 363 ARG A NE  1 
ATOM   2722  C  CZ  . ARG A 1 363 ? 55.612 88.162  35.831  1.00 27.34 ? 363 ARG A CZ  1 
ATOM   2723  N  NH1 . ARG A 1 363 ? 56.736 88.741  35.432  1.00 27.85 ? 363 ARG A NH1 1 
ATOM   2724  N  NH2 . ARG A 1 363 ? 55.539 86.837  35.886  1.00 27.93 ? 363 ARG A NH2 1 
ATOM   2725  N  N   . HIS A 1 364 ? 52.521 94.928  33.475  1.00 29.36 ? 364 HIS A N   1 
ATOM   2726  C  CA  . HIS A 1 364 ? 52.450 96.378  33.343  1.00 28.93 ? 364 HIS A CA  1 
ATOM   2727  C  C   . HIS A 1 364 ? 51.236 96.821  32.528  1.00 28.63 ? 364 HIS A C   1 
ATOM   2728  O  O   . HIS A 1 364 ? 50.490 97.683  32.961  1.00 29.67 ? 364 HIS A O   1 
ATOM   2729  C  CB  . HIS A 1 364 ? 53.723 96.916  32.697  1.00 28.81 ? 364 HIS A CB  1 
ATOM   2730  C  CG  . HIS A 1 364 ? 53.594 98.317  32.197  1.00 29.35 ? 364 HIS A CG  1 
ATOM   2731  N  ND1 . HIS A 1 364 ? 53.470 99.398  33.042  1.00 28.67 ? 364 HIS A ND1 1 
ATOM   2732  C  CD2 . HIS A 1 364 ? 53.514 98.807  30.935  1.00 28.43 ? 364 HIS A CD2 1 
ATOM   2733  C  CE1 . HIS A 1 364 ? 53.317 100.495 32.321  1.00 29.25 ? 364 HIS A CE1 1 
ATOM   2734  N  NE2 . HIS A 1 364 ? 53.340 100.164 31.040  1.00 28.22 ? 364 HIS A NE2 1 
ATOM   2735  N  N   . ARG A 1 365 ? 51.044 96.235  31.352  1.00 28.14 ? 365 ARG A N   1 
ATOM   2736  C  CA  . ARG A 1 365 ? 49.917 96.585  30.482  1.00 27.83 ? 365 ARG A CA  1 
ATOM   2737  C  C   . ARG A 1 365 ? 48.563 96.178  31.066  1.00 28.11 ? 365 ARG A C   1 
ATOM   2738  O  O   . ARG A 1 365 ? 47.595 96.938  31.003  1.00 28.32 ? 365 ARG A O   1 
ATOM   2739  C  CB  . ARG A 1 365 ? 50.097 95.919  29.114  1.00 27.06 ? 365 ARG A CB  1 
ATOM   2740  C  CG  . ARG A 1 365 ? 48.997 96.182  28.120  1.00 27.12 ? 365 ARG A CG  1 
ATOM   2741  C  CD  . ARG A 1 365 ? 49.442 95.770  26.711  1.00 28.76 ? 365 ARG A CD  1 
ATOM   2742  N  NE  . ARG A 1 365 ? 49.487 94.321  26.512  1.00 29.03 ? 365 ARG A NE  1 
ATOM   2743  C  CZ  . ARG A 1 365 ? 48.415 93.556  26.298  1.00 29.43 ? 365 ARG A CZ  1 
ATOM   2744  N  NH1 . ARG A 1 365 ? 47.207 94.096  26.248  1.00 29.53 ? 365 ARG A NH1 1 
ATOM   2745  N  NH2 . ARG A 1 365 ? 48.545 92.244  26.148  1.00 29.33 ? 365 ARG A NH2 1 
ATOM   2746  N  N   . LEU A 1 366 ? 48.493 94.977  31.630  1.00 27.76 ? 366 LEU A N   1 
ATOM   2747  C  CA  . LEU A 1 366 ? 47.247 94.493  32.195  1.00 26.85 ? 366 LEU A CA  1 
ATOM   2748  C  C   . LEU A 1 366 ? 47.213 94.595  33.708  1.00 27.14 ? 366 LEU A C   1 
ATOM   2749  O  O   . LEU A 1 366 ? 46.229 95.069  34.259  1.00 29.02 ? 366 LEU A O   1 
ATOM   2750  C  CB  . LEU A 1 366 ? 47.006 93.052  31.760  1.00 25.54 ? 366 LEU A CB  1 
ATOM   2751  C  CG  . LEU A 1 366 ? 47.036 92.873  30.237  1.00 24.67 ? 366 LEU A CG  1 
ATOM   2752  C  CD1 . LEU A 1 366 ? 47.268 91.416  29.872  1.00 21.79 ? 366 LEU A CD1 1 
ATOM   2753  C  CD2 . LEU A 1 366 ? 45.748 93.401  29.649  1.00 23.08 ? 366 LEU A CD2 1 
ATOM   2754  N  N   . GLY A 1 367 ? 48.273 94.161  34.382  1.00 26.33 ? 367 GLY A N   1 
ATOM   2755  C  CA  . GLY A 1 367 ? 48.286 94.235  35.833  1.00 26.19 ? 367 GLY A CA  1 
ATOM   2756  C  C   . GLY A 1 367 ? 48.731 92.949  36.502  1.00 27.20 ? 367 GLY A C   1 
ATOM   2757  O  O   . GLY A 1 367 ? 48.675 91.883  35.892  1.00 27.89 ? 367 GLY A O   1 
ATOM   2758  N  N   . PRO A 1 368 ? 49.193 93.011  37.759  1.00 27.07 ? 368 PRO A N   1 
ATOM   2759  C  CA  . PRO A 1 368 ? 49.648 91.832  38.500  1.00 26.94 ? 368 PRO A CA  1 
ATOM   2760  C  C   . PRO A 1 368 ? 48.849 90.545  38.272  1.00 27.46 ? 368 PRO A C   1 
ATOM   2761  O  O   . PRO A 1 368 ? 49.440 89.478  38.109  1.00 28.58 ? 368 PRO A O   1 
ATOM   2762  C  CB  . PRO A 1 368 ? 49.581 92.298  39.945  1.00 26.13 ? 368 PRO A CB  1 
ATOM   2763  C  CG  . PRO A 1 368 ? 50.039 93.708  39.830  1.00 26.75 ? 368 PRO A CG  1 
ATOM   2764  C  CD  . PRO A 1 368 ? 49.336 94.226  38.579  1.00 26.89 ? 368 PRO A CD  1 
ATOM   2765  N  N   . ASN A 1 369 ? 47.518 90.633  38.263  1.00 27.27 ? 369 ASN A N   1 
ATOM   2766  C  CA  . ASN A 1 369 ? 46.682 89.447  38.070  1.00 26.85 ? 369 ASN A CA  1 
ATOM   2767  C  C   . ASN A 1 369 ? 46.072 89.308  36.660  1.00 27.13 ? 369 ASN A C   1 
ATOM   2768  O  O   . ASN A 1 369 ? 44.962 88.816  36.498  1.00 26.70 ? 369 ASN A O   1 
ATOM   2769  C  CB  . ASN A 1 369 ? 45.570 89.431  39.125  1.00 26.30 ? 369 ASN A CB  1 
ATOM   2770  C  CG  . ASN A 1 369 ? 46.103 89.235  40.544  1.00 26.84 ? 369 ASN A CG  1 
ATOM   2771  O  OD1 . ASN A 1 369 ? 46.730 88.221  40.858  1.00 25.92 ? 369 ASN A OD1 1 
ATOM   2772  N  ND2 . ASN A 1 369 ? 45.854 90.212  41.405  1.00 26.73 ? 369 ASN A ND2 1 
ATOM   2773  N  N   . TYR A 1 370 ? 46.806 89.715  35.635  1.00 27.47 ? 370 TYR A N   1 
ATOM   2774  C  CA  . TYR A 1 370 ? 46.285 89.623  34.274  1.00 28.64 ? 370 TYR A CA  1 
ATOM   2775  C  C   . TYR A 1 370 ? 45.885 88.195  33.898  1.00 29.59 ? 370 TYR A C   1 
ATOM   2776  O  O   . TYR A 1 370 ? 45.130 87.972  32.943  1.00 30.14 ? 370 TYR A O   1 
ATOM   2777  C  CB  . TYR A 1 370 ? 47.310 90.176  33.268  1.00 27.72 ? 370 TYR A CB  1 
ATOM   2778  C  CG  . TYR A 1 370 ? 48.474 89.263  32.960  1.00 27.51 ? 370 TYR A CG  1 
ATOM   2779  C  CD1 . TYR A 1 370 ? 48.377 88.297  31.965  1.00 28.13 ? 370 TYR A CD1 1 
ATOM   2780  C  CD2 . TYR A 1 370 ? 49.680 89.376  33.646  1.00 27.39 ? 370 TYR A CD2 1 
ATOM   2781  C  CE1 . TYR A 1 370 ? 49.457 87.470  31.653  1.00 27.91 ? 370 TYR A CE1 1 
ATOM   2782  C  CE2 . TYR A 1 370 ? 50.768 88.545  33.345  1.00 26.96 ? 370 TYR A CE2 1 
ATOM   2783  C  CZ  . TYR A 1 370 ? 50.647 87.599  32.345  1.00 26.98 ? 370 TYR A CZ  1 
ATOM   2784  O  OH  . TYR A 1 370 ? 51.712 86.790  32.012  1.00 27.04 ? 370 TYR A OH  1 
ATOM   2785  N  N   . LEU A 1 371 ? 46.383 87.218  34.645  1.00 30.31 ? 371 LEU A N   1 
ATOM   2786  C  CA  . LEU A 1 371 ? 46.039 85.835  34.339  1.00 30.25 ? 371 LEU A CA  1 
ATOM   2787  C  C   . LEU A 1 371 ? 44.636 85.463  34.833  1.00 31.20 ? 371 LEU A C   1 
ATOM   2788  O  O   . LEU A 1 371 ? 44.138 84.375  34.530  1.00 31.19 ? 371 LEU A O   1 
ATOM   2789  C  CB  . LEU A 1 371 ? 47.090 84.880  34.910  1.00 28.22 ? 371 LEU A CB  1 
ATOM   2790  C  CG  . LEU A 1 371 ? 48.421 84.842  34.156  1.00 27.21 ? 371 LEU A CG  1 
ATOM   2791  C  CD1 . LEU A 1 371 ? 49.351 83.838  34.811  1.00 25.64 ? 371 LEU A CD1 1 
ATOM   2792  C  CD2 . LEU A 1 371 ? 48.188 84.449  32.706  1.00 26.10 ? 371 LEU A CD2 1 
ATOM   2793  N  N   . HIS A 1 372 ? 44.001 86.373  35.576  1.00 31.82 ? 372 HIS A N   1 
ATOM   2794  C  CA  . HIS A 1 372 ? 42.648 86.154  36.077  1.00 31.88 ? 372 HIS A CA  1 
ATOM   2795  C  C   . HIS A 1 372 ? 41.651 86.611  35.026  1.00 30.87 ? 372 HIS A C   1 
ATOM   2796  O  O   . HIS A 1 372 ? 40.486 86.229  35.047  1.00 30.50 ? 372 HIS A O   1 
ATOM   2797  C  CB  . HIS A 1 372 ? 42.393 86.954  37.346  1.00 35.34 ? 372 HIS A CB  1 
ATOM   2798  C  CG  . HIS A 1 372 ? 43.139 86.455  38.539  1.00 39.68 ? 372 HIS A CG  1 
ATOM   2799  N  ND1 . HIS A 1 372 ? 44.021 85.396  38.477  1.00 41.71 ? 372 HIS A ND1 1 
ATOM   2800  C  CD2 . HIS A 1 372 ? 43.140 86.877  39.827  1.00 41.17 ? 372 HIS A CD2 1 
ATOM   2801  C  CE1 . HIS A 1 372 ? 44.537 85.187  39.677  1.00 42.56 ? 372 HIS A CE1 1 
ATOM   2802  N  NE2 . HIS A 1 372 ? 44.018 86.072  40.514  1.00 43.85 ? 372 HIS A NE2 1 
ATOM   2803  N  N   . ILE A 1 373 ? 42.096 87.467  34.121  1.00 30.02 ? 373 ILE A N   1 
ATOM   2804  C  CA  . ILE A 1 373 ? 41.200 87.913  33.075  1.00 29.21 ? 373 ILE A CA  1 
ATOM   2805  C  C   . ILE A 1 373 ? 40.741 86.634  32.377  1.00 28.69 ? 373 ILE A C   1 
ATOM   2806  O  O   . ILE A 1 373 ? 41.550 85.787  32.021  1.00 29.57 ? 373 ILE A O   1 
ATOM   2807  C  CB  . ILE A 1 373 ? 41.925 88.844  32.081  1.00 28.44 ? 373 ILE A CB  1 
ATOM   2808  C  CG1 . ILE A 1 373 ? 42.552 90.017  32.838  1.00 27.36 ? 373 ILE A CG1 1 
ATOM   2809  C  CG2 . ILE A 1 373 ? 40.944 89.364  31.034  1.00 27.57 ? 373 ILE A CG2 1 
ATOM   2810  C  CD1 . ILE A 1 373 ? 43.095 91.089  31.938  1.00 26.41 ? 373 ILE A CD1 1 
ATOM   2811  N  N   . PRO A 1 374 ? 39.432 86.472  32.180  1.00 28.33 ? 374 PRO A N   1 
ATOM   2812  C  CA  . PRO A 1 374 ? 38.939 85.260  31.523  1.00 28.33 ? 374 PRO A CA  1 
ATOM   2813  C  C   . PRO A 1 374 ? 39.700 84.689  30.320  1.00 28.85 ? 374 PRO A C   1 
ATOM   2814  O  O   . PRO A 1 374 ? 40.053 83.514  30.348  1.00 29.57 ? 374 PRO A O   1 
ATOM   2815  C  CB  . PRO A 1 374 ? 37.500 85.619  31.192  1.00 27.39 ? 374 PRO A CB  1 
ATOM   2816  C  CG  . PRO A 1 374 ? 37.118 86.459  32.369  1.00 27.41 ? 374 PRO A CG  1 
ATOM   2817  C  CD  . PRO A 1 374 ? 38.317 87.368  32.531  1.00 27.60 ? 374 PRO A CD  1 
ATOM   2818  N  N   . VAL A 1 375 ? 39.973 85.469  29.274  1.00 28.58 ? 375 VAL A N   1 
ATOM   2819  C  CA  . VAL A 1 375 ? 40.665 84.865  28.128  1.00 29.10 ? 375 VAL A CA  1 
ATOM   2820  C  C   . VAL A 1 375 ? 42.047 84.354  28.432  1.00 30.02 ? 375 VAL A C   1 
ATOM   2821  O  O   . VAL A 1 375 ? 42.598 83.580  27.655  1.00 30.57 ? 375 VAL A O   1 
ATOM   2822  C  CB  . VAL A 1 375 ? 40.816 85.810  26.890  1.00 28.51 ? 375 VAL A CB  1 
ATOM   2823  C  CG1 . VAL A 1 375 ? 39.492 85.992  26.225  1.00 28.49 ? 375 VAL A CG1 1 
ATOM   2824  C  CG2 . VAL A 1 375 ? 41.430 87.145  27.288  1.00 26.63 ? 375 VAL A CG2 1 
ATOM   2825  N  N   . ASN A 1 376 ? 42.604 84.783  29.557  1.00 30.52 ? 376 ASN A N   1 
ATOM   2826  C  CA  . ASN A 1 376 ? 43.956 84.386  29.940  1.00 31.33 ? 376 ASN A CA  1 
ATOM   2827  C  C   . ASN A 1 376 ? 44.007 83.261  30.971  1.00 32.23 ? 376 ASN A C   1 
ATOM   2828  O  O   . ASN A 1 376 ? 45.050 82.642  31.170  1.00 32.19 ? 376 ASN A O   1 
ATOM   2829  C  CB  . ASN A 1 376 ? 44.725 85.593  30.513  1.00 30.09 ? 376 ASN A CB  1 
ATOM   2830  C  CG  . ASN A 1 376 ? 44.947 86.697  29.496  1.00 28.53 ? 376 ASN A CG  1 
ATOM   2831  O  OD1 . ASN A 1 376 ? 45.162 86.442  28.312  1.00 28.31 ? 376 ASN A OD1 1 
ATOM   2832  N  ND2 . ASN A 1 376 ? 44.923 87.931  29.964  1.00 27.03 ? 376 ASN A ND2 1 
ATOM   2833  N  N   . CYS A 1 377 ? 42.886 83.008  31.632  1.00 33.71 ? 377 CYS A N   1 
ATOM   2834  C  CA  . CYS A 1 377 ? 42.821 81.990  32.676  1.00 34.87 ? 377 CYS A CA  1 
ATOM   2835  C  C   . CYS A 1 377 ? 42.988 80.583  32.118  1.00 34.48 ? 377 CYS A C   1 
ATOM   2836  O  O   . CYS A 1 377 ? 42.407 80.237  31.100  1.00 34.90 ? 377 CYS A O   1 
ATOM   2837  C  CB  . CYS A 1 377 ? 41.485 82.123  33.427  1.00 35.60 ? 377 CYS A CB  1 
ATOM   2838  S  SG  . CYS A 1 377 ? 41.271 81.071  34.889  1.00 39.92 ? 377 CYS A SG  1 
ATOM   2839  N  N   . PRO A 1 378 ? 43.834 79.763  32.751  1.00 34.32 ? 378 PRO A N   1 
ATOM   2840  C  CA  . PRO A 1 378 ? 44.003 78.396  32.241  1.00 34.13 ? 378 PRO A CA  1 
ATOM   2841  C  C   . PRO A 1 378 ? 42.834 77.602  32.832  1.00 34.07 ? 378 PRO A C   1 
ATOM   2842  O  O   . PRO A 1 378 ? 42.983 76.859  33.803  1.00 33.68 ? 378 PRO A O   1 
ATOM   2843  C  CB  . PRO A 1 378 ? 45.367 77.997  32.799  1.00 33.84 ? 378 PRO A CB  1 
ATOM   2844  C  CG  . PRO A 1 378 ? 45.400 78.720  34.125  1.00 33.63 ? 378 PRO A CG  1 
ATOM   2845  C  CD  . PRO A 1 378 ? 44.801 80.069  33.820  1.00 33.69 ? 378 PRO A CD  1 
ATOM   2846  N  N   . TYR A 1 379 ? 41.660 77.785  32.235  1.00 34.26 ? 379 TYR A N   1 
ATOM   2847  C  CA  . TYR A 1 379 ? 40.440 77.166  32.742  1.00 34.05 ? 379 TYR A CA  1 
ATOM   2848  C  C   . TYR A 1 379 ? 40.292 75.659  32.624  1.00 33.88 ? 379 TYR A C   1 
ATOM   2849  O  O   . TYR A 1 379 ? 39.527 75.056  33.372  1.00 34.19 ? 379 TYR A O   1 
ATOM   2850  C  CB  . TYR A 1 379 ? 39.209 77.886  32.154  1.00 34.01 ? 379 TYR A CB  1 
ATOM   2851  C  CG  . TYR A 1 379 ? 38.904 77.597  30.703  1.00 33.80 ? 379 TYR A CG  1 
ATOM   2852  C  CD1 . TYR A 1 379 ? 37.899 76.687  30.345  1.00 33.25 ? 379 TYR A CD1 1 
ATOM   2853  C  CD2 . TYR A 1 379 ? 39.621 78.216  29.688  1.00 32.88 ? 379 TYR A CD2 1 
ATOM   2854  C  CE1 . TYR A 1 379 ? 37.622 76.405  29.006  1.00 32.37 ? 379 TYR A CE1 1 
ATOM   2855  C  CE2 . TYR A 1 379 ? 39.353 77.937  28.348  1.00 33.68 ? 379 TYR A CE2 1 
ATOM   2856  C  CZ  . TYR A 1 379 ? 38.353 77.034  28.013  1.00 33.14 ? 379 TYR A CZ  1 
ATOM   2857  O  OH  . TYR A 1 379 ? 38.089 76.785  26.680  1.00 34.03 ? 379 TYR A OH  1 
ATOM   2858  N  N   . ARG A 1 380 ? 41.019 75.036  31.711  1.00 33.72 ? 380 ARG A N   1 
ATOM   2859  C  CA  . ARG A 1 380 ? 40.924 73.590  31.588  1.00 34.04 ? 380 ARG A CA  1 
ATOM   2860  C  C   . ARG A 1 380 ? 42.012 72.929  32.432  1.00 34.83 ? 380 ARG A C   1 
ATOM   2861  O  O   . ARG A 1 380 ? 42.246 71.723  32.351  1.00 34.61 ? 380 ARG A O   1 
ATOM   2862  C  CB  . ARG A 1 380 ? 41.014 73.174  30.118  1.00 33.61 ? 380 ARG A CB  1 
ATOM   2863  C  CG  . ARG A 1 380 ? 39.905 73.804  29.294  1.00 32.91 ? 380 ARG A CG  1 
ATOM   2864  C  CD  . ARG A 1 380 ? 39.937 73.396  27.857  1.00 32.22 ? 380 ARG A CD  1 
ATOM   2865  N  NE  . ARG A 1 380 ? 39.497 72.021  27.681  1.00 33.79 ? 380 ARG A NE  1 
ATOM   2866  C  CZ  . ARG A 1 380 ? 40.315 70.993  27.496  1.00 34.20 ? 380 ARG A CZ  1 
ATOM   2867  N  NH1 . ARG A 1 380 ? 41.627 71.174  27.462  1.00 34.97 ? 380 ARG A NH1 1 
ATOM   2868  N  NH2 . ARG A 1 380 ? 39.817 69.781  27.330  1.00 34.88 ? 380 ARG A NH2 1 
ATOM   2869  N  N   . ALA A 1 381 ? 42.663 73.744  33.254  1.00 35.38 ? 381 ALA A N   1 
ATOM   2870  C  CA  . ALA A 1 381 ? 43.709 73.277  34.154  1.00 36.23 ? 381 ALA A CA  1 
ATOM   2871  C  C   . ALA A 1 381 ? 43.264 73.605  35.577  1.00 36.62 ? 381 ALA A C   1 
ATOM   2872  O  O   . ALA A 1 381 ? 42.365 74.402  35.777  1.00 37.42 ? 381 ALA A O   1 
ATOM   2873  C  CB  . ALA A 1 381 ? 45.026 73.967  33.841  1.00 35.17 ? 381 ALA A CB  1 
ATOM   2874  N  N   . ARG A 1 382 ? 43.874 72.980  36.567  1.00 37.79 ? 382 ARG A N   1 
ATOM   2875  C  CA  . ARG A 1 382 ? 43.497 73.259  37.934  1.00 39.41 ? 382 ARG A CA  1 
ATOM   2876  C  C   . ARG A 1 382 ? 44.660 73.974  38.609  1.00 38.93 ? 382 ARG A C   1 
ATOM   2877  O  O   . ARG A 1 382 ? 45.602 73.350  39.108  1.00 40.33 ? 382 ARG A O   1 
ATOM   2878  C  CB  . ARG A 1 382 ? 43.139 71.958  38.656  1.00 42.48 ? 382 ARG A CB  1 
ATOM   2879  C  CG  . ARG A 1 382 ? 42.894 72.133  40.154  1.00 48.41 ? 382 ARG A CG  1 
ATOM   2880  C  CD  . ARG A 1 382 ? 41.874 73.240  40.467  1.00 53.11 ? 382 ARG A CD  1 
ATOM   2881  N  NE  . ARG A 1 382 ? 41.866 73.576  41.896  1.00 57.33 ? 382 ARG A NE  1 
ATOM   2882  C  CZ  . ARG A 1 382 ? 41.589 72.708  42.872  1.00 59.24 ? 382 ARG A CZ  1 
ATOM   2883  N  NH1 . ARG A 1 382 ? 41.287 71.440  42.578  1.00 59.03 ? 382 ARG A NH1 1 
ATOM   2884  N  NH2 . ARG A 1 382 ? 41.628 73.104  44.147  1.00 59.50 ? 382 ARG A NH2 1 
ATOM   2885  N  N   . VAL A 1 383 ? 44.595 75.298  38.592  1.00 37.81 ? 383 VAL A N   1 
ATOM   2886  C  CA  . VAL A 1 383 ? 45.632 76.127  39.173  1.00 35.76 ? 383 VAL A CA  1 
ATOM   2887  C  C   . VAL A 1 383 ? 45.579 76.032  40.685  1.00 34.81 ? 383 VAL A C   1 
ATOM   2888  O  O   . VAL A 1 383 ? 44.515 76.173  41.282  1.00 34.82 ? 383 VAL A O   1 
ATOM   2889  C  CB  . VAL A 1 383 ? 45.458 77.609  38.754  1.00 35.38 ? 383 VAL A CB  1 
ATOM   2890  C  CG1 . VAL A 1 383 ? 46.566 78.457  39.336  1.00 35.49 ? 383 VAL A CG1 1 
ATOM   2891  C  CG2 . VAL A 1 383 ? 45.473 77.724  37.252  1.00 35.62 ? 383 VAL A CG2 1 
ATOM   2892  N  N   . ALA A 1 384 ? 46.735 75.782  41.290  1.00 33.77 ? 384 ALA A N   1 
ATOM   2893  C  CA  . ALA A 1 384 ? 46.867 75.688  42.738  1.00 32.63 ? 384 ALA A CA  1 
ATOM   2894  C  C   . ALA A 1 384 ? 48.321 75.965  43.084  1.00 31.72 ? 384 ALA A C   1 
ATOM   2895  O  O   . ALA A 1 384 ? 49.230 75.349  42.524  1.00 31.10 ? 384 ALA A O   1 
ATOM   2896  C  CB  . ALA A 1 384 ? 46.459 74.297  43.229  1.00 33.10 ? 384 ALA A CB  1 
ATOM   2897  N  N   . ASN A 1 385 ? 48.537 76.910  43.993  1.00 31.20 ? 385 ASN A N   1 
ATOM   2898  C  CA  . ASN A 1 385 ? 49.888 77.262  44.416  1.00 30.18 ? 385 ASN A CA  1 
ATOM   2899  C  C   . ASN A 1 385 ? 49.915 78.114  45.675  1.00 29.59 ? 385 ASN A C   1 
ATOM   2900  O  O   . ASN A 1 385 ? 48.927 78.195  46.398  1.00 29.32 ? 385 ASN A O   1 
ATOM   2901  C  CB  . ASN A 1 385 ? 50.630 77.983  43.293  1.00 28.90 ? 385 ASN A CB  1 
ATOM   2902  C  CG  . ASN A 1 385 ? 49.840 79.119  42.724  1.00 27.52 ? 385 ASN A CG  1 
ATOM   2903  O  OD1 . ASN A 1 385 ? 49.320 79.954  43.462  1.00 25.80 ? 385 ASN A OD1 1 
ATOM   2904  N  ND2 . ASN A 1 385 ? 49.742 79.167  41.394  1.00 27.70 ? 385 ASN A ND2 1 
ATOM   2905  N  N   . TYR A 1 386 ? 51.053 78.752  45.930  1.00 29.69 ? 386 TYR A N   1 
ATOM   2906  C  CA  . TYR A 1 386 ? 51.206 79.563  47.127  1.00 29.71 ? 386 TYR A CA  1 
ATOM   2907  C  C   . TYR A 1 386 ? 51.292 81.053  46.862  1.00 29.17 ? 386 TYR A C   1 
ATOM   2908  O  O   . TYR A 1 386 ? 51.815 81.823  47.673  1.00 29.41 ? 386 TYR A O   1 
ATOM   2909  C  CB  . TYR A 1 386 ? 52.410 79.062  47.916  1.00 29.25 ? 386 TYR A CB  1 
ATOM   2910  C  CG  . TYR A 1 386 ? 52.226 77.614  48.299  1.00 29.63 ? 386 TYR A CG  1 
ATOM   2911  C  CD1 . TYR A 1 386 ? 52.597 76.587  47.429  1.00 29.66 ? 386 TYR A CD1 1 
ATOM   2912  C  CD2 . TYR A 1 386 ? 51.584 77.269  49.486  1.00 29.60 ? 386 TYR A CD2 1 
ATOM   2913  C  CE1 . TYR A 1 386 ? 52.327 75.249  47.731  1.00 29.39 ? 386 TYR A CE1 1 
ATOM   2914  C  CE2 . TYR A 1 386 ? 51.308 75.941  49.798  1.00 28.94 ? 386 TYR A CE2 1 
ATOM   2915  C  CZ  . TYR A 1 386 ? 51.680 74.937  48.920  1.00 29.24 ? 386 TYR A CZ  1 
ATOM   2916  O  OH  . TYR A 1 386 ? 51.409 73.626  49.235  1.00 28.42 ? 386 TYR A OH  1 
ATOM   2917  N  N   . GLN A 1 387 ? 50.752 81.449  45.718  1.00 27.73 ? 387 GLN A N   1 
ATOM   2918  C  CA  . GLN A 1 387 ? 50.714 82.843  45.329  1.00 27.37 ? 387 GLN A CA  1 
ATOM   2919  C  C   . GLN A 1 387 ? 49.421 83.425  45.894  1.00 27.16 ? 387 GLN A C   1 
ATOM   2920  O  O   . GLN A 1 387 ? 48.428 82.719  46.010  1.00 28.13 ? 387 GLN A O   1 
ATOM   2921  C  CB  . GLN A 1 387 ? 50.771 82.939  43.806  1.00 27.52 ? 387 GLN A CB  1 
ATOM   2922  C  CG  . GLN A 1 387 ? 52.082 82.417  43.222  1.00 26.68 ? 387 GLN A CG  1 
ATOM   2923  C  CD  . GLN A 1 387 ? 52.115 82.502  41.700  1.00 28.41 ? 387 GLN A CD  1 
ATOM   2924  O  OE1 . GLN A 1 387 ? 51.594 83.457  41.118  1.00 28.56 ? 387 GLN A OE1 1 
ATOM   2925  N  NE2 . GLN A 1 387 ? 52.743 81.512  41.048  1.00 27.63 ? 387 GLN A NE2 1 
ATOM   2926  N  N   . ARG A 1 388 ? 49.426 84.698  46.267  1.00 27.81 ? 388 ARG A N   1 
ATOM   2927  C  CA  . ARG A 1 388 ? 48.233 85.308  46.851  1.00 28.97 ? 388 ARG A CA  1 
ATOM   2928  C  C   . ARG A 1 388 ? 48.170 86.819  46.629  1.00 29.41 ? 388 ARG A C   1 
ATOM   2929  O  O   . ARG A 1 388 ? 49.139 87.428  46.173  1.00 30.15 ? 388 ARG A O   1 
ATOM   2930  C  CB  . ARG A 1 388 ? 48.201 85.055  48.363  1.00 29.40 ? 388 ARG A CB  1 
ATOM   2931  C  CG  . ARG A 1 388 ? 48.212 83.601  48.798  1.00 30.86 ? 388 ARG A CG  1 
ATOM   2932  C  CD  . ARG A 1 388 ? 46.854 82.964  48.640  1.00 32.30 ? 388 ARG A CD  1 
ATOM   2933  N  NE  . ARG A 1 388 ? 46.797 81.652  49.282  1.00 34.65 ? 388 ARG A NE  1 
ATOM   2934  C  CZ  . ARG A 1 388 ? 47.286 80.530  48.756  1.00 35.94 ? 388 ARG A CZ  1 
ATOM   2935  N  NH1 . ARG A 1 388 ? 47.875 80.558  47.568  1.00 35.54 ? 388 ARG A NH1 1 
ATOM   2936  N  NH2 . ARG A 1 388 ? 47.172 79.375  49.412  1.00 35.73 ? 388 ARG A NH2 1 
ATOM   2937  N  N   . ASP A 1 389 ? 47.019 87.404  46.962  1.00 29.06 ? 389 ASP A N   1 
ATOM   2938  C  CA  . ASP A 1 389 ? 46.784 88.841  46.868  1.00 29.41 ? 389 ASP A CA  1 
ATOM   2939  C  C   . ASP A 1 389 ? 47.119 89.511  45.545  1.00 30.88 ? 389 ASP A C   1 
ATOM   2940  O  O   . ASP A 1 389 ? 47.032 88.892  44.478  1.00 31.68 ? 389 ASP A O   1 
ATOM   2941  C  CB  . ASP A 1 389 ? 47.544 89.556  47.976  1.00 29.70 ? 389 ASP A CB  1 
ATOM   2942  C  CG  . ASP A 1 389 ? 47.315 88.934  49.330  1.00 30.67 ? 389 ASP A CG  1 
ATOM   2943  O  OD1 . ASP A 1 389 ? 47.980 89.380  50.285  1.00 33.04 ? 389 ASP A OD1 1 
ATOM   2944  O  OD2 . ASP A 1 389 ? 46.480 88.006  49.446  1.00 29.78 ? 389 ASP A OD2 1 
ATOM   2945  N  N   . GLY A 1 390 ? 47.503 90.786  45.636  1.00 31.36 ? 390 GLY A N   1 
ATOM   2946  C  CA  . GLY A 1 390 ? 47.823 91.577  44.462  1.00 32.23 ? 390 GLY A CA  1 
ATOM   2947  C  C   . GLY A 1 390 ? 46.634 92.428  44.040  1.00 33.21 ? 390 GLY A C   1 
ATOM   2948  O  O   . GLY A 1 390 ? 45.492 92.107  44.392  1.00 32.90 ? 390 GLY A O   1 
ATOM   2949  N  N   . PRO A 1 391 ? 46.860 93.527  43.292  1.00 34.11 ? 391 PRO A N   1 
ATOM   2950  C  CA  . PRO A 1 391 ? 45.798 94.427  42.818  1.00 34.76 ? 391 PRO A CA  1 
ATOM   2951  C  C   . PRO A 1 391 ? 44.720 93.651  42.102  1.00 35.75 ? 391 PRO A C   1 
ATOM   2952  O  O   . PRO A 1 391 ? 45.028 92.801  41.268  1.00 35.69 ? 391 PRO A O   1 
ATOM   2953  C  CB  . PRO A 1 391 ? 46.522 95.343  41.846  1.00 34.65 ? 391 PRO A CB  1 
ATOM   2954  C  CG  . PRO A 1 391 ? 47.880 95.416  42.414  1.00 35.28 ? 391 PRO A CG  1 
ATOM   2955  C  CD  . PRO A 1 391 ? 48.175 93.994  42.825  1.00 34.27 ? 391 PRO A CD  1 
ATOM   2956  N  N   . MET A 1 392 ? 43.465 93.937  42.428  1.00 37.05 ? 392 MET A N   1 
ATOM   2957  C  CA  . MET A 1 392 ? 42.346 93.269  41.782  1.00 38.75 ? 392 MET A CA  1 
ATOM   2958  C  C   . MET A 1 392 ? 42.336 91.731  41.851  1.00 40.47 ? 392 MET A C   1 
ATOM   2959  O  O   . MET A 1 392 ? 42.254 91.064  40.811  1.00 40.58 ? 392 MET A O   1 
ATOM   2960  C  CB  . MET A 1 392 ? 42.282 93.706  40.313  1.00 38.39 ? 392 MET A CB  1 
ATOM   2961  C  CG  . MET A 1 392 ? 41.978 95.176  40.104  1.00 37.86 ? 392 MET A CG  1 
ATOM   2962  S  SD  . MET A 1 392 ? 40.272 95.621  40.518  1.00 39.41 ? 392 MET A SD  1 
ATOM   2963  C  CE  . MET A 1 392 ? 39.413 94.955  39.068  1.00 37.79 ? 392 MET A CE  1 
ATOM   2964  N  N   . CYS A 1 393 ? 42.418 91.161  43.051  1.00 42.31 ? 393 CYS A N   1 
ATOM   2965  C  CA  . CYS A 1 393 ? 42.364 89.708  43.168  1.00 44.79 ? 393 CYS A CA  1 
ATOM   2966  C  C   . CYS A 1 393 ? 40.903 89.374  42.911  1.00 46.32 ? 393 CYS A C   1 
ATOM   2967  O  O   . CYS A 1 393 ? 40.031 89.731  43.707  1.00 45.82 ? 393 CYS A O   1 
ATOM   2968  C  CB  . CYS A 1 393 ? 42.764 89.235  44.567  1.00 45.08 ? 393 CYS A CB  1 
ATOM   2969  S  SG  . CYS A 1 393 ? 43.000 87.439  44.649  1.00 47.99 ? 393 CYS A SG  1 
ATOM   2970  N  N   . MET A 1 394 ? 40.650 88.678  41.802  1.00 49.03 ? 394 MET A N   1 
ATOM   2971  C  CA  . MET A 1 394 ? 39.292 88.338  41.374  1.00 50.53 ? 394 MET A CA  1 
ATOM   2972  C  C   . MET A 1 394 ? 38.671 87.030  41.798  1.00 50.96 ? 394 MET A C   1 
ATOM   2973  O  O   . MET A 1 394 ? 37.498 86.792  41.505  1.00 51.59 ? 394 MET A O   1 
ATOM   2974  C  CB  . MET A 1 394 ? 39.208 88.416  39.860  1.00 51.51 ? 394 MET A CB  1 
ATOM   2975  C  CG  . MET A 1 394 ? 39.536 89.781  39.324  1.00 54.28 ? 394 MET A CG  1 
ATOM   2976  S  SD  . MET A 1 394 ? 38.390 91.013  39.940  1.00 57.32 ? 394 MET A SD  1 
ATOM   2977  C  CE  . MET A 1 394 ? 39.495 92.195  40.637  1.00 55.80 ? 394 MET A CE  1 
ATOM   2978  N  N   . GLN A 1 395 ? 39.424 86.168  42.464  1.00 51.35 ? 395 GLN A N   1 
ATOM   2979  C  CA  . GLN A 1 395 ? 38.834 84.908  42.883  1.00 52.14 ? 395 GLN A CA  1 
ATOM   2980  C  C   . GLN A 1 395 ? 38.610 84.863  44.377  1.00 51.72 ? 395 GLN A C   1 
ATOM   2981  O  O   . GLN A 1 395 ? 38.432 85.891  45.028  1.00 51.83 ? 395 GLN A O   1 
ATOM   2982  C  CB  . GLN A 1 395 ? 39.719 83.731  42.471  1.00 54.06 ? 395 GLN A CB  1 
ATOM   2983  C  CG  . GLN A 1 395 ? 39.493 83.208  41.041  1.00 55.89 ? 395 GLN A CG  1 
ATOM   2984  C  CD  . GLN A 1 395 ? 40.476 83.779  40.024  1.00 56.38 ? 395 GLN A CD  1 
ATOM   2985  O  OE1 . GLN A 1 395 ? 41.702 83.708  40.207  1.00 55.97 ? 395 GLN A OE1 1 
ATOM   2986  N  NE2 . GLN A 1 395 ? 39.941 84.334  38.933  1.00 56.96 ? 395 GLN A NE2 1 
ATOM   2987  N  N   . ASP A 1 396 ? 38.602 83.652  44.909  1.00 51.47 ? 396 ASP A N   1 
ATOM   2988  C  CA  . ASP A 1 396 ? 38.434 83.452  46.332  1.00 51.80 ? 396 ASP A CA  1 
ATOM   2989  C  C   . ASP A 1 396 ? 39.840 83.520  46.926  1.00 51.16 ? 396 ASP A C   1 
ATOM   2990  O  O   . ASP A 1 396 ? 40.034 83.287  48.122  1.00 51.52 ? 396 ASP A O   1 
ATOM   2991  C  CB  . ASP A 1 396 ? 37.804 82.082  46.590  1.00 53.25 ? 396 ASP A CB  1 
ATOM   2992  C  CG  . ASP A 1 396 ? 38.680 80.939  46.110  1.00 55.16 ? 396 ASP A CG  1 
ATOM   2993  O  OD1 . ASP A 1 396 ? 39.296 81.067  45.027  1.00 56.21 ? 396 ASP A OD1 1 
ATOM   2994  O  OD2 . ASP A 1 396 ? 38.749 79.905  46.812  1.00 56.60 ? 396 ASP A OD2 1 
ATOM   2995  N  N   . ASN A 1 397 ? 40.813 83.840  46.065  1.00 50.30 ? 397 ASN A N   1 
ATOM   2996  C  CA  . ASN A 1 397 ? 42.230 83.959  46.437  1.00 48.81 ? 397 ASN A CA  1 
ATOM   2997  C  C   . ASN A 1 397 ? 42.713 82.682  47.144  1.00 48.77 ? 397 ASN A C   1 
ATOM   2998  O  O   . ASN A 1 397 ? 43.531 82.715  48.069  1.00 48.73 ? 397 ASN A O   1 
ATOM   2999  C  CB  . ASN A 1 397 ? 42.418 85.204  47.320  1.00 47.49 ? 397 ASN A CB  1 
ATOM   3000  C  CG  . ASN A 1 397 ? 43.862 85.630  47.439  1.00 45.22 ? 397 ASN A CG  1 
ATOM   3001  O  OD1 . ASN A 1 397 ? 44.671 85.390  46.545  1.00 44.18 ? 397 ASN A OD1 1 
ATOM   3002  N  ND2 . ASN A 1 397 ? 44.188 86.292  48.539  1.00 44.75 ? 397 ASN A ND2 1 
ATOM   3003  N  N   . GLN A 1 398 ? 42.188 81.552  46.678  1.00 48.68 ? 398 GLN A N   1 
ATOM   3004  C  CA  . GLN A 1 398 ? 42.506 80.234  47.219  1.00 48.48 ? 398 GLN A CA  1 
ATOM   3005  C  C   . GLN A 1 398 ? 42.111 80.063  48.696  1.00 48.06 ? 398 GLN A C   1 
ATOM   3006  O  O   . GLN A 1 398 ? 42.742 79.305  49.440  1.00 48.58 ? 398 GLN A O   1 
ATOM   3007  C  CB  . GLN A 1 398 ? 43.992 79.921  46.983  1.00 48.14 ? 398 GLN A CB  1 
ATOM   3008  C  CG  . GLN A 1 398 ? 44.328 79.896  45.484  1.00 48.92 ? 398 GLN A CG  1 
ATOM   3009  C  CD  . GLN A 1 398 ? 45.748 79.448  45.150  1.00 49.16 ? 398 GLN A CD  1 
ATOM   3010  O  OE1 . GLN A 1 398 ? 46.104 78.272  45.302  1.00 48.74 ? 398 GLN A OE1 1 
ATOM   3011  N  NE2 . GLN A 1 398 ? 46.566 80.392  44.677  1.00 49.11 ? 398 GLN A NE2 1 
ATOM   3012  N  N   . GLY A 1 399 ? 41.050 80.767  49.095  1.00 46.61 ? 399 GLY A N   1 
ATOM   3013  C  CA  . GLY A 1 399 ? 40.533 80.693  50.450  1.00 45.11 ? 399 GLY A CA  1 
ATOM   3014  C  C   . GLY A 1 399 ? 41.529 80.794  51.584  1.00 44.76 ? 399 GLY A C   1 
ATOM   3015  O  O   . GLY A 1 399 ? 42.321 81.736  51.645  1.00 45.56 ? 399 GLY A O   1 
ATOM   3016  N  N   . GLY A 1 400 ? 41.481 79.822  52.492  1.00 43.47 ? 400 GLY A N   1 
ATOM   3017  C  CA  . GLY A 1 400 ? 42.380 79.816  53.630  1.00 42.31 ? 400 GLY A CA  1 
ATOM   3018  C  C   . GLY A 1 400 ? 43.494 78.780  53.544  1.00 41.99 ? 400 GLY A C   1 
ATOM   3019  O  O   . GLY A 1 400 ? 44.255 78.584  54.502  1.00 42.32 ? 400 GLY A O   1 
ATOM   3020  N  N   . ALA A 1 401 ? 43.604 78.116  52.398  1.00 40.65 ? 401 ALA A N   1 
ATOM   3021  C  CA  . ALA A 1 401 ? 44.639 77.108  52.210  1.00 39.88 ? 401 ALA A CA  1 
ATOM   3022  C  C   . ALA A 1 401 ? 46.010 77.598  52.700  1.00 39.39 ? 401 ALA A C   1 
ATOM   3023  O  O   . ALA A 1 401 ? 46.299 78.794  52.702  1.00 39.25 ? 401 ALA A O   1 
ATOM   3024  C  CB  . ALA A 1 401 ? 44.721 76.727  50.732  1.00 39.73 ? 401 ALA A CB  1 
ATOM   3025  N  N   . PRO A 1 402 ? 46.871 76.670  53.134  1.00 38.33 ? 402 PRO A N   1 
ATOM   3026  C  CA  . PRO A 1 402 ? 48.204 77.045  53.609  1.00 37.48 ? 402 PRO A CA  1 
ATOM   3027  C  C   . PRO A 1 402 ? 48.887 77.849  52.514  1.00 36.78 ? 402 PRO A C   1 
ATOM   3028  O  O   . PRO A 1 402 ? 48.961 77.398  51.369  1.00 35.90 ? 402 PRO A O   1 
ATOM   3029  C  CB  . PRO A 1 402 ? 48.882 75.699  53.818  1.00 37.05 ? 402 PRO A CB  1 
ATOM   3030  C  CG  . PRO A 1 402 ? 47.750 74.824  54.196  1.00 38.11 ? 402 PRO A CG  1 
ATOM   3031  C  CD  . PRO A 1 402 ? 46.677 75.217  53.219  1.00 38.18 ? 402 PRO A CD  1 
ATOM   3032  N  N   . ASN A 1 403 ? 49.400 79.026  52.851  1.00 35.97 ? 403 ASN A N   1 
ATOM   3033  C  CA  . ASN A 1 403 ? 50.043 79.832  51.822  1.00 35.25 ? 403 ASN A CA  1 
ATOM   3034  C  C   . ASN A 1 403 ? 51.561 79.741  51.802  1.00 34.46 ? 403 ASN A C   1 
ATOM   3035  O  O   . ASN A 1 403 ? 52.229 80.622  51.263  1.00 34.56 ? 403 ASN A O   1 
ATOM   3036  C  CB  . ASN A 1 403 ? 49.599 81.302  51.937  1.00 34.85 ? 403 ASN A CB  1 
ATOM   3037  C  CG  . ASN A 1 403 ? 49.997 81.936  53.250  1.00 34.38 ? 403 ASN A CG  1 
ATOM   3038  O  OD1 . ASN A 1 403 ? 49.762 83.129  53.471  1.00 33.59 ? 403 ASN A OD1 1 
ATOM   3039  N  ND2 . ASN A 1 403 ? 50.602 81.144  54.135  1.00 34.07 ? 403 ASN A ND2 1 
ATOM   3040  N  N   . TYR A 1 404 ? 52.106 78.676  52.384  1.00 33.68 ? 404 TYR A N   1 
ATOM   3041  C  CA  . TYR A 1 404 ? 53.558 78.486  52.413  1.00 32.63 ? 404 TYR A CA  1 
ATOM   3042  C  C   . TYR A 1 404 ? 53.914 77.050  52.066  1.00 32.06 ? 404 TYR A C   1 
ATOM   3043  O  O   . TYR A 1 404 ? 53.164 76.118  52.350  1.00 32.07 ? 404 TYR A O   1 
ATOM   3044  C  CB  . TYR A 1 404 ? 54.130 78.829  53.788  1.00 33.20 ? 404 TYR A CB  1 
ATOM   3045  C  CG  . TYR A 1 404 ? 53.558 77.988  54.904  1.00 33.45 ? 404 TYR A CG  1 
ATOM   3046  C  CD1 . TYR A 1 404 ? 52.320 78.293  55.479  1.00 33.53 ? 404 TYR A CD1 1 
ATOM   3047  C  CD2 . TYR A 1 404 ? 54.245 76.880  55.375  1.00 33.62 ? 404 TYR A CD2 1 
ATOM   3048  C  CE1 . TYR A 1 404 ? 51.786 77.510  56.505  1.00 33.85 ? 404 TYR A CE1 1 
ATOM   3049  C  CE2 . TYR A 1 404 ? 53.723 76.089  56.393  1.00 34.68 ? 404 TYR A CE2 1 
ATOM   3050  C  CZ  . TYR A 1 404 ? 52.497 76.408  56.960  1.00 34.32 ? 404 TYR A CZ  1 
ATOM   3051  O  OH  . TYR A 1 404 ? 52.024 75.640  58.003  1.00 33.34 ? 404 TYR A OH  1 
ATOM   3052  N  N   . TYR A 1 405 ? 55.070 76.880  51.447  1.00 31.50 ? 405 TYR A N   1 
ATOM   3053  C  CA  . TYR A 1 405 ? 55.525 75.572  51.032  1.00 30.63 ? 405 TYR A CA  1 
ATOM   3054  C  C   . TYR A 1 405 ? 56.948 75.427  51.516  1.00 31.03 ? 405 TYR A C   1 
ATOM   3055  O  O   . TYR A 1 405 ? 57.755 76.348  51.379  1.00 31.78 ? 405 TYR A O   1 
ATOM   3056  C  CB  . TYR A 1 405 ? 55.478 75.488  49.519  1.00 29.98 ? 405 TYR A CB  1 
ATOM   3057  C  CG  . TYR A 1 405 ? 55.649 74.106  48.945  1.00 30.52 ? 405 TYR A CG  1 
ATOM   3058  C  CD1 . TYR A 1 405 ? 54.726 73.093  49.214  1.00 30.10 ? 405 TYR A CD1 1 
ATOM   3059  C  CD2 . TYR A 1 405 ? 56.677 73.835  48.047  1.00 30.06 ? 405 TYR A CD2 1 
ATOM   3060  C  CE1 . TYR A 1 405 ? 54.819 71.855  48.589  1.00 30.24 ? 405 TYR A CE1 1 
ATOM   3061  C  CE2 . TYR A 1 405 ? 56.778 72.602  47.416  1.00 30.12 ? 405 TYR A CE2 1 
ATOM   3062  C  CZ  . TYR A 1 405 ? 55.848 71.616  47.682  1.00 30.61 ? 405 TYR A CZ  1 
ATOM   3063  O  OH  . TYR A 1 405 ? 55.924 70.412  47.001  1.00 30.47 ? 405 TYR A OH  1 
ATOM   3064  N  N   . PRO A 1 406 ? 57.277 74.276  52.106  1.00 30.83 ? 406 PRO A N   1 
ATOM   3065  C  CA  . PRO A 1 406 ? 56.382 73.145  52.325  1.00 31.11 ? 406 PRO A CA  1 
ATOM   3066  C  C   . PRO A 1 406 ? 55.487 73.413  53.520  1.00 31.59 ? 406 PRO A C   1 
ATOM   3067  O  O   . PRO A 1 406 ? 55.707 74.365  54.255  1.00 31.97 ? 406 PRO A O   1 
ATOM   3068  C  CB  . PRO A 1 406 ? 57.337 71.988  52.611  1.00 30.68 ? 406 PRO A CB  1 
ATOM   3069  C  CG  . PRO A 1 406 ? 58.732 72.590  52.569  1.00 31.44 ? 406 PRO A CG  1 
ATOM   3070  C  CD  . PRO A 1 406 ? 58.550 74.045  52.794  1.00 30.98 ? 406 PRO A CD  1 
ATOM   3071  N  N   . ASN A 1 407 ? 54.479 72.571  53.712  1.00 31.58 ? 407 ASN A N   1 
ATOM   3072  C  CA  . ASN A 1 407 ? 53.585 72.713  54.847  1.00 32.22 ? 407 ASN A CA  1 
ATOM   3073  C  C   . ASN A 1 407 ? 53.098 71.329  55.263  1.00 33.35 ? 407 ASN A C   1 
ATOM   3074  O  O   . ASN A 1 407 ? 53.185 70.369  54.492  1.00 33.54 ? 407 ASN A O   1 
ATOM   3075  C  CB  . ASN A 1 407 ? 52.407 73.626  54.496  1.00 31.65 ? 407 ASN A CB  1 
ATOM   3076  C  CG  . ASN A 1 407 ? 51.604 73.121  53.315  1.00 31.96 ? 407 ASN A CG  1 
ATOM   3077  O  OD1 . ASN A 1 407 ? 50.878 72.134  53.419  1.00 31.70 ? 407 ASN A OD1 1 
ATOM   3078  N  ND2 . ASN A 1 407 ? 51.735 73.796  52.179  1.00 30.62 ? 407 ASN A ND2 1 
ATOM   3079  N  N   . SER A 1 408 ? 52.613 71.220  56.491  1.00 34.02 ? 408 SER A N   1 
ATOM   3080  C  CA  . SER A 1 408 ? 52.118 69.949  56.982  1.00 35.78 ? 408 SER A CA  1 
ATOM   3081  C  C   . SER A 1 408 ? 50.596 69.901  56.952  1.00 36.78 ? 408 SER A C   1 
ATOM   3082  O  O   . SER A 1 408 ? 49.977 69.156  57.711  1.00 37.28 ? 408 SER A O   1 
ATOM   3083  C  CB  . SER A 1 408 ? 52.607 69.738  58.406  1.00 36.36 ? 408 SER A CB  1 
ATOM   3084  O  OG  . SER A 1 408 ? 54.023 69.723  58.440  1.00 38.21 ? 408 SER A OG  1 
ATOM   3085  N  N   . PHE A 1 409 ? 49.992 70.672  56.054  1.00 37.65 ? 409 PHE A N   1 
ATOM   3086  C  CA  . PHE A 1 409 ? 48.535 70.734  55.979  1.00 37.92 ? 409 PHE A CA  1 
ATOM   3087  C  C   . PHE A 1 409 ? 47.886 70.442  54.625  1.00 37.82 ? 409 PHE A C   1 
ATOM   3088  O  O   . PHE A 1 409 ? 46.929 71.106  54.238  1.00 37.81 ? 409 PHE A O   1 
ATOM   3089  C  CB  . PHE A 1 409 ? 48.076 72.098  56.485  1.00 37.11 ? 409 PHE A CB  1 
ATOM   3090  C  CG  . PHE A 1 409 ? 48.465 72.372  57.908  1.00 37.19 ? 409 PHE A CG  1 
ATOM   3091  C  CD1 . PHE A 1 409 ? 47.694 71.893  58.959  1.00 36.94 ? 409 PHE A CD1 1 
ATOM   3092  C  CD2 . PHE A 1 409 ? 49.596 73.120  58.198  1.00 37.44 ? 409 PHE A CD2 1 
ATOM   3093  C  CE1 . PHE A 1 409 ? 48.036 72.157  60.280  1.00 37.04 ? 409 PHE A CE1 1 
ATOM   3094  C  CE2 . PHE A 1 409 ? 49.949 73.390  59.523  1.00 38.19 ? 409 PHE A CE2 1 
ATOM   3095  C  CZ  . PHE A 1 409 ? 49.161 72.907  60.564  1.00 37.33 ? 409 PHE A CZ  1 
ATOM   3096  N  N   . GLY A 1 410 ? 48.416 69.445  53.924  1.00 38.27 ? 410 GLY A N   1 
ATOM   3097  C  CA  . GLY A 1 410 ? 47.875 69.026  52.642  1.00 38.16 ? 410 GLY A CA  1 
ATOM   3098  C  C   . GLY A 1 410 ? 47.671 70.035  51.525  1.00 38.40 ? 410 GLY A C   1 
ATOM   3099  O  O   . GLY A 1 410 ? 46.744 69.896  50.729  1.00 38.68 ? 410 GLY A O   1 
ATOM   3100  N  N   . ALA A 1 411 ? 48.520 71.046  51.443  1.00 38.03 ? 411 ALA A N   1 
ATOM   3101  C  CA  . ALA A 1 411 ? 48.377 72.020  50.380  1.00 38.30 ? 411 ALA A CA  1 
ATOM   3102  C  C   . ALA A 1 411 ? 49.042 71.422  49.138  1.00 38.39 ? 411 ALA A C   1 
ATOM   3103  O  O   . ALA A 1 411 ? 49.705 70.387  49.233  1.00 38.40 ? 411 ALA A O   1 
ATOM   3104  C  CB  . ALA A 1 411 ? 49.033 73.329  50.790  1.00 39.40 ? 411 ALA A CB  1 
ATOM   3105  N  N   . PRO A 1 412 ? 48.872 72.054  47.960  1.00 38.44 ? 412 PRO A N   1 
ATOM   3106  C  CA  . PRO A 1 412 ? 49.453 71.575  46.694  1.00 38.58 ? 412 PRO A CA  1 
ATOM   3107  C  C   . PRO A 1 412 ? 50.911 71.098  46.749  1.00 38.77 ? 412 PRO A C   1 
ATOM   3108  O  O   . PRO A 1 412 ? 51.746 71.716  47.405  1.00 37.92 ? 412 PRO A O   1 
ATOM   3109  C  CB  . PRO A 1 412 ? 49.265 72.772  45.766  1.00 38.48 ? 412 PRO A CB  1 
ATOM   3110  C  CG  . PRO A 1 412 ? 47.960 73.342  46.239  1.00 38.33 ? 412 PRO A CG  1 
ATOM   3111  C  CD  . PRO A 1 412 ? 48.121 73.307  47.746  1.00 38.00 ? 412 PRO A CD  1 
ATOM   3112  N  N   . GLU A 1 413 ? 51.207 70.005  46.040  1.00 39.79 ? 413 GLU A N   1 
ATOM   3113  C  CA  . GLU A 1 413 ? 52.558 69.428  46.009  1.00 40.70 ? 413 GLU A CA  1 
ATOM   3114  C  C   . GLU A 1 413 ? 53.132 69.345  44.603  1.00 41.08 ? 413 GLU A C   1 
ATOM   3115  O  O   . GLU A 1 413 ? 52.428 69.015  43.652  1.00 41.03 ? 413 GLU A O   1 
ATOM   3116  C  CB  . GLU A 1 413 ? 52.566 68.009  46.569  1.00 41.34 ? 413 GLU A CB  1 
ATOM   3117  C  CG  . GLU A 1 413 ? 51.991 67.827  47.955  1.00 44.96 ? 413 GLU A CG  1 
ATOM   3118  C  CD  . GLU A 1 413 ? 52.855 68.421  49.046  1.00 46.28 ? 413 GLU A CD  1 
ATOM   3119  O  OE1 . GLU A 1 413 ? 54.088 68.186  49.045  1.00 46.82 ? 413 GLU A OE1 1 
ATOM   3120  O  OE2 . GLU A 1 413 ? 52.288 69.117  49.915  1.00 47.89 ? 413 GLU A OE2 1 
ATOM   3121  N  N   . GLN A 1 414 ? 54.429 69.611  44.493  1.00 41.83 ? 414 GLN A N   1 
ATOM   3122  C  CA  . GLN A 1 414 ? 55.146 69.553  43.221  1.00 42.55 ? 414 GLN A CA  1 
ATOM   3123  C  C   . GLN A 1 414 ? 55.171 68.096  42.742  1.00 43.64 ? 414 GLN A C   1 
ATOM   3124  O  O   . GLN A 1 414 ? 55.376 67.185  43.549  1.00 43.48 ? 414 GLN A O   1 
ATOM   3125  C  CB  . GLN A 1 414 ? 56.582 70.065  43.425  1.00 42.07 ? 414 GLN A CB  1 
ATOM   3126  C  CG  . GLN A 1 414 ? 57.431 69.206  44.384  1.00 40.94 ? 414 GLN A CG  1 
ATOM   3127  C  CD  . GLN A 1 414 ? 58.667 69.917  44.941  1.00 40.61 ? 414 GLN A CD  1 
ATOM   3128  O  OE1 . GLN A 1 414 ? 59.540 69.286  45.519  1.00 39.85 ? 414 GLN A OE1 1 
ATOM   3129  N  NE2 . GLN A 1 414 ? 58.732 71.230  44.783  1.00 41.16 ? 414 GLN A NE2 1 
ATOM   3130  N  N   . GLN A 1 415 ? 54.950 67.869  41.446  1.00 44.75 ? 415 GLN A N   1 
ATOM   3131  C  CA  . GLN A 1 415 ? 54.979 66.505  40.910  1.00 45.87 ? 415 GLN A CA  1 
ATOM   3132  C  C   . GLN A 1 415 ? 56.231 66.308  40.065  1.00 45.81 ? 415 GLN A C   1 
ATOM   3133  O  O   . GLN A 1 415 ? 56.361 66.885  38.984  1.00 45.50 ? 415 GLN A O   1 
ATOM   3134  C  CB  . GLN A 1 415 ? 53.710 66.175  40.089  1.00 47.29 ? 415 GLN A CB  1 
ATOM   3135  C  CG  . GLN A 1 415 ? 53.499 66.927  38.765  1.00 49.07 ? 415 GLN A CG  1 
ATOM   3136  C  CD  . GLN A 1 415 ? 52.515 66.200  37.815  1.00 50.30 ? 415 GLN A CD  1 
ATOM   3137  O  OE1 . GLN A 1 415 ? 52.870 65.214  37.167  1.00 50.99 ? 415 GLN A OE1 1 
ATOM   3138  N  NE2 . GLN A 1 415 ? 51.279 66.684  37.750  1.00 50.40 ? 415 GLN A NE2 1 
ATOM   3139  N  N   . PRO A 1 416 ? 57.178 65.485  40.565  1.00 45.94 ? 416 PRO A N   1 
ATOM   3140  C  CA  . PRO A 1 416 ? 58.466 65.147  39.948  1.00 45.74 ? 416 PRO A CA  1 
ATOM   3141  C  C   . PRO A 1 416 ? 58.460 64.907  38.462  1.00 46.19 ? 416 PRO A C   1 
ATOM   3142  O  O   . PRO A 1 416 ? 59.412 65.261  37.786  1.00 47.15 ? 416 PRO A O   1 
ATOM   3143  C  CB  . PRO A 1 416 ? 58.905 63.923  40.724  1.00 44.83 ? 416 PRO A CB  1 
ATOM   3144  C  CG  . PRO A 1 416 ? 58.441 64.258  42.083  1.00 45.45 ? 416 PRO A CG  1 
ATOM   3145  C  CD  . PRO A 1 416 ? 57.025 64.753  41.834  1.00 45.60 ? 416 PRO A CD  1 
ATOM   3146  N  N   . SER A 1 417 ? 57.399 64.311  37.942  1.00 46.68 ? 417 SER A N   1 
ATOM   3147  C  CA  . SER A 1 417 ? 57.339 64.050  36.507  1.00 47.54 ? 417 SER A CA  1 
ATOM   3148  C  C   . SER A 1 417 ? 57.330 65.318  35.653  1.00 47.40 ? 417 SER A C   1 
ATOM   3149  O  O   . SER A 1 417 ? 57.502 65.250  34.440  1.00 47.97 ? 417 SER A O   1 
ATOM   3150  C  CB  . SER A 1 417 ? 56.098 63.220  36.180  1.00 48.52 ? 417 SER A CB  1 
ATOM   3151  O  OG  . SER A 1 417 ? 54.934 63.825  36.721  1.00 49.79 ? 417 SER A OG  1 
ATOM   3152  N  N   . ALA A 1 418 ? 57.129 66.472  36.279  1.00 47.26 ? 418 ALA A N   1 
ATOM   3153  C  CA  . ALA A 1 418 ? 57.079 67.735  35.539  1.00 46.89 ? 418 ALA A CA  1 
ATOM   3154  C  C   . ALA A 1 418 ? 58.424 68.440  35.553  1.00 46.45 ? 418 ALA A C   1 
ATOM   3155  O  O   . ALA A 1 418 ? 58.556 69.591  35.114  1.00 46.53 ? 418 ALA A O   1 
ATOM   3156  C  CB  . ALA A 1 418 ? 56.002 68.647  36.127  1.00 47.13 ? 418 ALA A CB  1 
ATOM   3157  N  N   . LEU A 1 419 ? 59.424 67.735  36.061  1.00 45.18 ? 419 LEU A N   1 
ATOM   3158  C  CA  . LEU A 1 419 ? 60.763 68.277  36.136  1.00 44.70 ? 419 LEU A CA  1 
ATOM   3159  C  C   . LEU A 1 419 ? 61.252 68.582  34.721  1.00 44.28 ? 419 LEU A C   1 
ATOM   3160  O  O   . LEU A 1 419 ? 60.821 67.944  33.755  1.00 43.98 ? 419 LEU A O   1 
ATOM   3161  C  CB  . LEU A 1 419 ? 61.670 67.257  36.817  1.00 45.14 ? 419 LEU A CB  1 
ATOM   3162  C  CG  . LEU A 1 419 ? 62.735 67.788  37.767  1.00 45.65 ? 419 LEU A CG  1 
ATOM   3163  C  CD1 . LEU A 1 419 ? 62.135 68.821  38.716  1.00 45.29 ? 419 LEU A CD1 1 
ATOM   3164  C  CD2 . LEU A 1 419 ? 63.315 66.617  38.535  1.00 45.60 ? 419 LEU A CD2 1 
ATOM   3165  N  N   . GLU A 1 420 ? 62.150 69.555  34.604  1.00 43.98 ? 420 GLU A N   1 
ATOM   3166  C  CA  . GLU A 1 420 ? 62.695 69.959  33.308  1.00 44.00 ? 420 GLU A CA  1 
ATOM   3167  C  C   . GLU A 1 420 ? 63.907 69.145  32.858  1.00 43.60 ? 420 GLU A C   1 
ATOM   3168  O  O   . GLU A 1 420 ? 64.733 68.713  33.660  1.00 43.53 ? 420 GLU A O   1 
ATOM   3169  C  CB  . GLU A 1 420 ? 63.071 71.441  33.348  1.00 44.24 ? 420 GLU A CB  1 
ATOM   3170  C  CG  . GLU A 1 420 ? 61.979 72.318  33.937  1.00 45.38 ? 420 GLU A CG  1 
ATOM   3171  C  CD  . GLU A 1 420 ? 62.274 72.769  35.358  1.00 45.78 ? 420 GLU A CD  1 
ATOM   3172  O  OE1 . GLU A 1 420 ? 62.937 72.012  36.108  1.00 44.74 ? 420 GLU A OE1 1 
ATOM   3173  O  OE2 . GLU A 1 420 ? 61.825 73.884  35.719  1.00 46.15 ? 420 GLU A OE2 1 
ATOM   3174  N  N   . HIS A 1 421 ? 64.010 68.968  31.553  1.00 43.66 ? 421 HIS A N   1 
ATOM   3175  C  CA  . HIS A 1 421 ? 65.096 68.216  30.946  1.00 44.37 ? 421 HIS A CA  1 
ATOM   3176  C  C   . HIS A 1 421 ? 66.478 68.805  31.237  1.00 44.92 ? 421 HIS A C   1 
ATOM   3177  O  O   . HIS A 1 421 ? 66.675 70.011  31.121  1.00 45.11 ? 421 HIS A O   1 
ATOM   3178  C  CB  . HIS A 1 421 ? 64.861 68.147  29.445  1.00 44.26 ? 421 HIS A CB  1 
ATOM   3179  C  CG  . HIS A 1 421 ? 65.917 67.391  28.714  1.00 44.05 ? 421 HIS A CG  1 
ATOM   3180  N  ND1 . HIS A 1 421 ? 66.968 68.014  28.079  1.00 43.40 ? 421 HIS A ND1 1 
ATOM   3181  C  CD2 . HIS A 1 421 ? 66.108 66.062  28.555  1.00 43.30 ? 421 HIS A CD2 1 
ATOM   3182  C  CE1 . HIS A 1 421 ? 67.764 67.098  27.559  1.00 43.66 ? 421 HIS A CE1 1 
ATOM   3183  N  NE2 . HIS A 1 421 ? 67.265 65.906  27.835  1.00 44.08 ? 421 HIS A NE2 1 
ATOM   3184  N  N   . SER A 1 422 ? 67.438 67.943  31.576  1.00 45.52 ? 422 SER A N   1 
ATOM   3185  C  CA  . SER A 1 422 ? 68.788 68.389  31.925  1.00 46.20 ? 422 SER A CA  1 
ATOM   3186  C  C   . SER A 1 422 ? 69.892 68.216  30.898  1.00 47.06 ? 422 SER A C   1 
ATOM   3187  O  O   . SER A 1 422 ? 70.152 67.117  30.413  1.00 47.03 ? 422 SER A O   1 
ATOM   3188  C  CB  . SER A 1 422 ? 69.241 67.717  33.221  1.00 45.49 ? 422 SER A CB  1 
ATOM   3189  O  OG  . SER A 1 422 ? 68.389 68.068  34.287  1.00 45.94 ? 422 SER A OG  1 
ATOM   3190  N  N   . ILE A 1 423 ? 70.564 69.323  30.605  1.00 48.82 ? 423 ILE A N   1 
ATOM   3191  C  CA  . ILE A 1 423 ? 71.678 69.352  29.657  1.00 49.72 ? 423 ILE A CA  1 
ATOM   3192  C  C   . ILE A 1 423 ? 72.825 70.094  30.323  1.00 50.24 ? 423 ILE A C   1 
ATOM   3193  O  O   . ILE A 1 423 ? 72.606 70.983  31.151  1.00 49.91 ? 423 ILE A O   1 
ATOM   3194  C  CB  . ILE A 1 423 ? 71.321 70.127  28.357  1.00 49.82 ? 423 ILE A CB  1 
ATOM   3195  C  CG1 . ILE A 1 423 ? 70.222 69.399  27.584  1.00 50.06 ? 423 ILE A CG1 1 
ATOM   3196  C  CG2 . ILE A 1 423 ? 72.556 70.292  27.483  1.00 49.31 ? 423 ILE A CG2 1 
ATOM   3197  C  CD1 . ILE A 1 423 ? 69.742 70.164  26.363  1.00 49.70 ? 423 ILE A CD1 1 
ATOM   3198  N  N   . GLN A 1 424 ? 74.046 69.721  29.956  1.00 51.37 ? 424 GLN A N   1 
ATOM   3199  C  CA  . GLN A 1 424 ? 75.241 70.364  30.482  1.00 52.15 ? 424 GLN A CA  1 
ATOM   3200  C  C   . GLN A 1 424 ? 75.873 71.126  29.325  1.00 51.74 ? 424 GLN A C   1 
ATOM   3201  O  O   . GLN A 1 424 ? 76.128 70.532  28.278  1.00 51.70 ? 424 GLN A O   1 
ATOM   3202  C  CB  . GLN A 1 424 ? 76.237 69.326  30.995  1.00 53.07 ? 424 GLN A CB  1 
ATOM   3203  C  CG  . GLN A 1 424 ? 77.492 69.965  31.567  1.00 55.45 ? 424 GLN A CG  1 
ATOM   3204  C  CD  . GLN A 1 424 ? 78.752 69.186  31.253  1.00 56.46 ? 424 GLN A CD  1 
ATOM   3205  O  OE1 . GLN A 1 424 ? 79.861 69.619  31.594  1.00 57.94 ? 424 GLN A OE1 1 
ATOM   3206  N  NE2 . GLN A 1 424 ? 78.597 68.037  30.598  1.00 56.05 ? 424 GLN A NE2 1 
ATOM   3207  N  N   . TYR A 1 425 ? 76.122 72.424  29.501  1.00 51.30 ? 425 TYR A N   1 
ATOM   3208  C  CA  . TYR A 1 425 ? 76.729 73.223  28.431  1.00 50.82 ? 425 TYR A CA  1 
ATOM   3209  C  C   . TYR A 1 425 ? 78.204 73.482  28.674  1.00 50.98 ? 425 TYR A C   1 
ATOM   3210  O  O   . TYR A 1 425 ? 78.675 73.440  29.812  1.00 51.41 ? 425 TYR A O   1 
ATOM   3211  C  CB  . TYR A 1 425 ? 76.019 74.566  28.271  1.00 49.71 ? 425 TYR A CB  1 
ATOM   3212  C  CG  . TYR A 1 425 ? 74.578 74.440  27.888  1.00 48.39 ? 425 TYR A CG  1 
ATOM   3213  C  CD1 . TYR A 1 425 ? 73.619 74.088  28.833  1.00 48.34 ? 425 TYR A CD1 1 
ATOM   3214  C  CD2 . TYR A 1 425 ? 74.169 74.637  26.570  1.00 47.82 ? 425 TYR A CD2 1 
ATOM   3215  C  CE1 . TYR A 1 425 ? 72.277 73.933  28.475  1.00 48.48 ? 425 TYR A CE1 1 
ATOM   3216  C  CE2 . TYR A 1 425 ? 72.834 74.485  26.200  1.00 47.73 ? 425 TYR A CE2 1 
ATOM   3217  C  CZ  . TYR A 1 425 ? 71.895 74.133  27.159  1.00 47.69 ? 425 TYR A CZ  1 
ATOM   3218  O  OH  . TYR A 1 425 ? 70.573 73.994  26.819  1.00 48.30 ? 425 TYR A OH  1 
ATOM   3219  N  N   . SER A 1 426 ? 78.926 73.765  27.595  1.00 50.78 ? 426 SER A N   1 
ATOM   3220  C  CA  . SER A 1 426 ? 80.356 74.027  27.677  1.00 50.84 ? 426 SER A CA  1 
ATOM   3221  C  C   . SER A 1 426 ? 80.686 75.489  27.403  1.00 49.90 ? 426 SER A C   1 
ATOM   3222  O  O   . SER A 1 426 ? 80.018 76.147  26.608  1.00 49.75 ? 426 SER A O   1 
ATOM   3223  C  CB  . SER A 1 426 ? 81.104 73.139  26.677  1.00 51.98 ? 426 SER A CB  1 
ATOM   3224  O  OG  . SER A 1 426 ? 82.481 73.496  26.612  1.00 54.43 ? 426 SER A OG  1 
ATOM   3225  N  N   . GLY A 1 427 ? 81.728 75.991  28.058  1.00 49.53 ? 427 GLY A N   1 
ATOM   3226  C  CA  . GLY A 1 427 ? 82.131 77.377  27.859  1.00 47.84 ? 427 GLY A CA  1 
ATOM   3227  C  C   . GLY A 1 427 ? 81.971 78.241  29.096  1.00 46.39 ? 427 GLY A C   1 
ATOM   3228  O  O   . GLY A 1 427 ? 81.329 77.844  30.071  1.00 46.44 ? 427 GLY A O   1 
ATOM   3229  N  N   . GLU A 1 428 ? 82.558 79.431  29.059  1.00 45.46 ? 428 GLU A N   1 
ATOM   3230  C  CA  . GLU A 1 428 ? 82.462 80.345  30.185  1.00 44.56 ? 428 GLU A CA  1 
ATOM   3231  C  C   . GLU A 1 428 ? 81.123 81.070  30.139  1.00 43.42 ? 428 GLU A C   1 
ATOM   3232  O  O   . GLU A 1 428 ? 80.474 81.165  29.092  1.00 42.44 ? 428 GLU A O   1 
ATOM   3233  C  CB  . GLU A 1 428 ? 83.572 81.404  30.140  1.00 46.02 ? 428 GLU A CB  1 
ATOM   3234  C  CG  . GLU A 1 428 ? 84.846 81.005  29.410  1.00 47.80 ? 428 GLU A CG  1 
ATOM   3235  C  CD  . GLU A 1 428 ? 85.697 82.215  29.013  1.00 49.07 ? 428 GLU A CD  1 
ATOM   3236  O  OE1 . GLU A 1 428 ? 86.408 82.766  29.889  1.00 49.23 ? 428 GLU A OE1 1 
ATOM   3237  O  OE2 . GLU A 1 428 ? 85.646 82.618  27.822  1.00 49.84 ? 428 GLU A OE2 1 
ATOM   3238  N  N   . VAL A 1 429 ? 80.711 81.573  31.294  1.00 42.37 ? 429 VAL A N   1 
ATOM   3239  C  CA  . VAL A 1 429 ? 79.485 82.340  31.389  1.00 41.32 ? 429 VAL A CA  1 
ATOM   3240  C  C   . VAL A 1 429 ? 79.918 83.768  31.088  1.00 41.43 ? 429 VAL A C   1 
ATOM   3241  O  O   . VAL A 1 429 ? 80.557 84.420  31.915  1.00 41.34 ? 429 VAL A O   1 
ATOM   3242  C  CB  . VAL A 1 429 ? 78.880 82.274  32.799  1.00 39.72 ? 429 VAL A CB  1 
ATOM   3243  C  CG1 . VAL A 1 429 ? 77.724 83.223  32.906  1.00 38.47 ? 429 VAL A CG1 1 
ATOM   3244  C  CG2 . VAL A 1 429 ? 78.413 80.878  33.082  1.00 39.51 ? 429 VAL A CG2 1 
ATOM   3245  N  N   . ARG A 1 430 ? 79.593 84.239  29.889  1.00 41.15 ? 430 ARG A N   1 
ATOM   3246  C  CA  . ARG A 1 430 ? 79.952 85.591  29.474  1.00 41.10 ? 430 ARG A CA  1 
ATOM   3247  C  C   . ARG A 1 430 ? 79.214 85.934  28.208  1.00 40.10 ? 430 ARG A C   1 
ATOM   3248  O  O   . ARG A 1 430 ? 78.538 85.094  27.619  1.00 39.12 ? 430 ARG A O   1 
ATOM   3249  C  CB  . ARG A 1 430 ? 81.453 85.697  29.196  1.00 41.80 ? 430 ARG A CB  1 
ATOM   3250  C  CG  . ARG A 1 430 ? 81.990 84.509  28.412  1.00 44.10 ? 430 ARG A CG  1 
ATOM   3251  C  CD  . ARG A 1 430 ? 83.340 84.772  27.739  1.00 45.18 ? 430 ARG A CD  1 
ATOM   3252  N  NE  . ARG A 1 430 ? 83.154 85.388  26.429  1.00 46.30 ? 430 ARG A NE  1 
ATOM   3253  C  CZ  . ARG A 1 430 ? 83.841 85.060  25.338  1.00 46.56 ? 430 ARG A CZ  1 
ATOM   3254  N  NH1 . ARG A 1 430 ? 84.777 84.117  25.391  1.00 45.51 ? 430 ARG A NH1 1 
ATOM   3255  N  NH2 . ARG A 1 430 ? 83.567 85.658  24.184  1.00 46.79 ? 430 ARG A NH2 1 
ATOM   3256  N  N   . ARG A 1 431 ? 79.356 87.183  27.793  1.00 39.65 ? 431 ARG A N   1 
ATOM   3257  C  CA  . ARG A 1 431 ? 78.724 87.648  26.570  1.00 39.28 ? 431 ARG A CA  1 
ATOM   3258  C  C   . ARG A 1 431 ? 79.584 87.167  25.389  1.00 38.74 ? 431 ARG A C   1 
ATOM   3259  O  O   . ARG A 1 431 ? 80.780 87.411  25.365  1.00 39.77 ? 431 ARG A O   1 
ATOM   3260  C  CB  . ARG A 1 431 ? 78.625 89.180  26.596  1.00 37.79 ? 431 ARG A CB  1 
ATOM   3261  C  CG  . ARG A 1 431 ? 77.902 89.724  27.822  1.00 36.72 ? 431 ARG A CG  1 
ATOM   3262  C  CD  . ARG A 1 431 ? 77.848 91.248  27.811  1.00 36.55 ? 431 ARG A CD  1 
ATOM   3263  N  NE  . ARG A 1 431 ? 77.288 91.801  29.044  1.00 36.59 ? 431 ARG A NE  1 
ATOM   3264  C  CZ  . ARG A 1 431 ? 75.997 91.782  29.367  1.00 36.88 ? 431 ARG A CZ  1 
ATOM   3265  N  NH1 . ARG A 1 431 ? 75.106 91.240  28.550  1.00 37.05 ? 431 ARG A NH1 1 
ATOM   3266  N  NH2 . ARG A 1 431 ? 75.594 92.300  30.518  1.00 36.79 ? 431 ARG A NH2 1 
ATOM   3267  N  N   . PHE A 1 432 ? 78.971 86.464  24.438  1.00 38.49 ? 432 PHE A N   1 
ATOM   3268  C  CA  . PHE A 1 432 ? 79.662 85.942  23.252  1.00 38.08 ? 432 PHE A CA  1 
ATOM   3269  C  C   . PHE A 1 432 ? 79.166 86.671  22.014  1.00 38.34 ? 432 PHE A C   1 
ATOM   3270  O  O   . PHE A 1 432 ? 78.011 86.554  21.641  1.00 38.96 ? 432 PHE A O   1 
ATOM   3271  C  CB  . PHE A 1 432 ? 79.371 84.453  23.064  1.00 36.66 ? 432 PHE A CB  1 
ATOM   3272  C  CG  . PHE A 1 432 ? 79.973 83.573  24.109  1.00 36.01 ? 432 PHE A CG  1 
ATOM   3273  C  CD1 . PHE A 1 432 ? 81.271 83.105  23.977  1.00 35.70 ? 432 PHE A CD1 1 
ATOM   3274  C  CD2 . PHE A 1 432 ? 79.237 83.189  25.218  1.00 35.92 ? 432 PHE A CD2 1 
ATOM   3275  C  CE1 . PHE A 1 432 ? 81.826 82.262  24.933  1.00 35.94 ? 432 PHE A CE1 1 
ATOM   3276  C  CE2 . PHE A 1 432 ? 79.786 82.345  26.184  1.00 35.98 ? 432 PHE A CE2 1 
ATOM   3277  C  CZ  . PHE A 1 432 ? 81.081 81.880  26.041  1.00 35.95 ? 432 PHE A CZ  1 
ATOM   3278  N  N   . ASN A 1 433 ? 80.035 87.410  21.357  1.00 39.71 ? 433 ASN A N   1 
ATOM   3279  C  CA  . ASN A 1 433 ? 79.608 88.133  20.177  1.00 41.43 ? 433 ASN A CA  1 
ATOM   3280  C  C   . ASN A 1 433 ? 79.095 87.190  19.083  1.00 41.65 ? 433 ASN A C   1 
ATOM   3281  O  O   . ASN A 1 433 ? 79.683 86.140  18.833  1.00 41.79 ? 433 ASN A O   1 
ATOM   3282  C  CB  . ASN A 1 433 ? 80.765 88.992  19.661  1.00 42.31 ? 433 ASN A CB  1 
ATOM   3283  C  CG  . ASN A 1 433 ? 80.345 89.913  18.539  1.00 44.23 ? 433 ASN A CG  1 
ATOM   3284  O  OD1 . ASN A 1 433 ? 79.232 90.458  18.547  1.00 45.59 ? 433 ASN A OD1 1 
ATOM   3285  N  ND2 . ASN A 1 433 ? 81.236 90.107  17.568  1.00 44.96 ? 433 ASN A ND2 1 
ATOM   3286  N  N   . THR A 1 434 ? 77.983 87.564  18.456  1.00 41.94 ? 434 THR A N   1 
ATOM   3287  C  CA  . THR A 1 434 ? 77.385 86.769  17.389  1.00 42.60 ? 434 THR A CA  1 
ATOM   3288  C  C   . THR A 1 434 ? 77.062 87.669  16.209  1.00 43.86 ? 434 THR A C   1 
ATOM   3289  O  O   . THR A 1 434 ? 76.429 87.253  15.241  1.00 43.86 ? 434 THR A O   1 
ATOM   3290  C  CB  . THR A 1 434 ? 76.066 86.088  17.823  1.00 42.24 ? 434 THR A CB  1 
ATOM   3291  O  OG1 . THR A 1 434 ? 75.044 87.076  17.995  1.00 41.54 ? 434 THR A OG1 1 
ATOM   3292  C  CG2 . THR A 1 434 ? 76.254 85.319  19.120  1.00 42.56 ? 434 THR A CG2 1 
ATOM   3293  N  N   . ALA A 1 435 ? 77.491 88.918  16.299  1.00 45.27 ? 435 ALA A N   1 
ATOM   3294  C  CA  . ALA A 1 435 ? 77.244 89.870  15.233  1.00 46.51 ? 435 ALA A CA  1 
ATOM   3295  C  C   . ALA A 1 435 ? 77.892 89.395  13.940  1.00 47.46 ? 435 ALA A C   1 
ATOM   3296  O  O   . ALA A 1 435 ? 77.424 89.709  12.843  1.00 46.85 ? 435 ALA A O   1 
ATOM   3297  C  CB  . ALA A 1 435 ? 77.801 91.223  15.619  1.00 46.45 ? 435 ALA A CB  1 
ATOM   3298  N  N   . ASN A 1 436 ? 78.968 88.626  14.078  1.00 48.91 ? 436 ASN A N   1 
ATOM   3299  C  CA  . ASN A 1 436 ? 79.700 88.145  12.917  1.00 50.01 ? 436 ASN A CA  1 
ATOM   3300  C  C   . ASN A 1 436 ? 79.419 86.714  12.484  1.00 49.83 ? 436 ASN A C   1 
ATOM   3301  O  O   . ASN A 1 436 ? 80.235 86.112  11.781  1.00 50.72 ? 436 ASN A O   1 
ATOM   3302  C  CB  . ASN A 1 436 ? 81.209 88.334  13.134  1.00 51.20 ? 436 ASN A CB  1 
ATOM   3303  C  CG  . ASN A 1 436 ? 81.602 89.810  13.285  1.00 52.76 ? 436 ASN A CG  1 
ATOM   3304  O  OD1 . ASN A 1 436 ? 81.112 90.684  12.548  1.00 52.73 ? 436 ASN A OD1 1 
ATOM   3305  N  ND2 . ASN A 1 436 ? 82.497 90.090  14.235  1.00 53.06 ? 436 ASN A ND2 1 
ATOM   3306  N  N   . ASP A 1 437 ? 78.284 86.160  12.903  1.00 48.60 ? 437 ASP A N   1 
ATOM   3307  C  CA  . ASP A 1 437 ? 77.920 84.813  12.488  1.00 47.69 ? 437 ASP A CA  1 
ATOM   3308  C  C   . ASP A 1 437 ? 77.551 84.931  11.009  1.00 47.41 ? 437 ASP A C   1 
ATOM   3309  O  O   . ASP A 1 437 ? 77.688 86.010  10.425  1.00 48.27 ? 437 ASP A O   1 
ATOM   3310  C  CB  . ASP A 1 437 ? 76.736 84.296  13.312  1.00 47.93 ? 437 ASP A CB  1 
ATOM   3311  C  CG  . ASP A 1 437 ? 77.176 83.617  14.606  1.00 48.00 ? 437 ASP A CG  1 
ATOM   3312  O  OD1 . ASP A 1 437 ? 78.031 84.185  15.321  1.00 48.31 ? 437 ASP A OD1 1 
ATOM   3313  O  OD2 . ASP A 1 437 ? 76.668 82.516  14.908  1.00 47.37 ? 437 ASP A OD2 1 
ATOM   3314  N  N   . ASP A 1 438 ? 77.089 83.855  10.383  1.00 46.22 ? 438 ASP A N   1 
ATOM   3315  C  CA  . ASP A 1 438 ? 76.762 83.958  8.964   1.00 44.97 ? 438 ASP A CA  1 
ATOM   3316  C  C   . ASP A 1 438 ? 75.555 84.879  8.688   1.00 43.93 ? 438 ASP A C   1 
ATOM   3317  O  O   . ASP A 1 438 ? 74.453 84.663  9.201   1.00 43.56 ? 438 ASP A O   1 
ATOM   3318  C  CB  . ASP A 1 438 ? 76.511 82.572  8.372   1.00 45.01 ? 438 ASP A CB  1 
ATOM   3319  C  CG  . ASP A 1 438 ? 76.584 82.574  6.857   1.00 45.55 ? 438 ASP A CG  1 
ATOM   3320  O  OD1 . ASP A 1 438 ? 75.882 83.394  6.217   1.00 46.05 ? 438 ASP A OD1 1 
ATOM   3321  O  OD2 . ASP A 1 438 ? 77.348 81.755  6.304   1.00 45.71 ? 438 ASP A OD2 1 
ATOM   3322  N  N   . ASN A 1 439 ? 75.773 85.899  7.865   1.00 42.22 ? 439 ASN A N   1 
ATOM   3323  C  CA  . ASN A 1 439 ? 74.719 86.844  7.539   1.00 41.22 ? 439 ASN A CA  1 
ATOM   3324  C  C   . ASN A 1 439 ? 74.286 86.812  6.078   1.00 41.19 ? 439 ASN A C   1 
ATOM   3325  O  O   . ASN A 1 439 ? 73.308 87.470  5.712   1.00 41.12 ? 439 ASN A O   1 
ATOM   3326  C  CB  . ASN A 1 439 ? 75.161 88.267  7.893   1.00 39.68 ? 439 ASN A CB  1 
ATOM   3327  C  CG  . ASN A 1 439 ? 75.589 88.393  9.331   1.00 38.70 ? 439 ASN A CG  1 
ATOM   3328  O  OD1 . ASN A 1 439 ? 74.981 87.810  10.207  1.00 38.58 ? 439 ASN A OD1 1 
ATOM   3329  N  ND2 . ASN A 1 439 ? 76.636 89.164  9.583   1.00 39.26 ? 439 ASN A ND2 1 
ATOM   3330  N  N   . VAL A 1 440 ? 74.990 86.042  5.251   1.00 41.18 ? 440 VAL A N   1 
ATOM   3331  C  CA  . VAL A 1 440 ? 74.676 85.991  3.820   1.00 40.95 ? 440 VAL A CA  1 
ATOM   3332  C  C   . VAL A 1 440 ? 74.286 84.636  3.218   1.00 41.18 ? 440 VAL A C   1 
ATOM   3333  O  O   . VAL A 1 440 ? 73.306 84.548  2.480   1.00 41.33 ? 440 VAL A O   1 
ATOM   3334  C  CB  . VAL A 1 440 ? 75.853 86.553  2.982   1.00 40.28 ? 440 VAL A CB  1 
ATOM   3335  C  CG1 . VAL A 1 440 ? 76.140 87.993  3.377   1.00 38.39 ? 440 VAL A CG1 1 
ATOM   3336  C  CG2 . VAL A 1 440 ? 77.086 85.693  3.184   1.00 39.19 ? 440 VAL A CG2 1 
ATOM   3337  N  N   . THR A 1 441 ? 75.045 83.588  3.517   1.00 41.24 ? 441 THR A N   1 
ATOM   3338  C  CA  . THR A 1 441 ? 74.756 82.268  2.953   1.00 41.67 ? 441 THR A CA  1 
ATOM   3339  C  C   . THR A 1 441 ? 73.273 81.932  2.749   1.00 42.06 ? 441 THR A C   1 
ATOM   3340  O  O   . THR A 1 441 ? 72.803 81.870  1.608   1.00 41.49 ? 441 THR A O   1 
ATOM   3341  C  CB  . THR A 1 441 ? 75.426 81.164  3.784   1.00 41.07 ? 441 THR A CB  1 
ATOM   3342  O  OG1 . THR A 1 441 ? 76.845 81.241  3.595   1.00 40.72 ? 441 THR A OG1 1 
ATOM   3343  C  CG2 . THR A 1 441 ? 74.937 79.792  3.361   1.00 40.33 ? 441 THR A CG2 1 
ATOM   3344  N  N   . GLN A 1 442 ? 72.530 81.720  3.833   1.00 42.93 ? 442 GLN A N   1 
ATOM   3345  C  CA  . GLN A 1 442 ? 71.115 81.386  3.689   1.00 43.19 ? 442 GLN A CA  1 
ATOM   3346  C  C   . GLN A 1 442 ? 70.303 82.464  2.999   1.00 43.19 ? 442 GLN A C   1 
ATOM   3347  O  O   . GLN A 1 442 ? 69.209 82.201  2.513   1.00 43.70 ? 442 GLN A O   1 
ATOM   3348  C  CB  . GLN A 1 442 ? 70.476 81.049  5.036   1.00 42.60 ? 442 GLN A CB  1 
ATOM   3349  C  CG  . GLN A 1 442 ? 70.729 79.618  5.465   1.00 43.32 ? 442 GLN A CG  1 
ATOM   3350  C  CD  . GLN A 1 442 ? 69.801 79.142  6.574   1.00 44.45 ? 442 GLN A CD  1 
ATOM   3351  O  OE1 . GLN A 1 442 ? 69.960 78.030  7.088   1.00 44.83 ? 442 GLN A OE1 1 
ATOM   3352  N  NE2 . GLN A 1 442 ? 68.825 79.973  6.945   1.00 44.05 ? 442 GLN A NE2 1 
ATOM   3353  N  N   . VAL A 1 443 ? 70.833 83.676  2.943   1.00 43.30 ? 443 VAL A N   1 
ATOM   3354  C  CA  . VAL A 1 443 ? 70.111 84.752  2.287   1.00 43.79 ? 443 VAL A CA  1 
ATOM   3355  C  C   . VAL A 1 443 ? 70.329 84.611  0.785   1.00 44.51 ? 443 VAL A C   1 
ATOM   3356  O  O   . VAL A 1 443 ? 69.399 84.790  -0.005  1.00 44.67 ? 443 VAL A O   1 
ATOM   3357  C  CB  . VAL A 1 443 ? 70.604 86.130  2.767   1.00 43.51 ? 443 VAL A CB  1 
ATOM   3358  C  CG1 . VAL A 1 443 ? 69.673 87.219  2.273   1.00 43.33 ? 443 VAL A CG1 1 
ATOM   3359  C  CG2 . VAL A 1 443 ? 70.671 86.149  4.283   1.00 44.08 ? 443 VAL A CG2 1 
ATOM   3360  N  N   . ARG A 1 444 ? 71.560 84.270  0.403   1.00 45.29 ? 444 ARG A N   1 
ATOM   3361  C  CA  . ARG A 1 444 ? 71.920 84.086  -0.997  1.00 45.40 ? 444 ARG A CA  1 
ATOM   3362  C  C   . ARG A 1 444 ? 71.116 82.928  -1.568  1.00 45.17 ? 444 ARG A C   1 
ATOM   3363  O  O   . ARG A 1 444 ? 70.787 82.912  -2.760  1.00 45.30 ? 444 ARG A O   1 
ATOM   3364  C  CB  . ARG A 1 444 ? 73.415 83.793  -1.134  1.00 47.00 ? 444 ARG A CB  1 
ATOM   3365  C  CG  . ARG A 1 444 ? 73.866 83.583  -2.579  1.00 49.02 ? 444 ARG A CG  1 
ATOM   3366  C  CD  . ARG A 1 444 ? 75.342 83.202  -2.681  1.00 49.70 ? 444 ARG A CD  1 
ATOM   3367  N  NE  . ARG A 1 444 ? 76.222 84.263  -2.193  1.00 51.74 ? 444 ARG A NE  1 
ATOM   3368  C  CZ  . ARG A 1 444 ? 76.886 84.221  -1.039  1.00 52.18 ? 444 ARG A CZ  1 
ATOM   3369  N  NH1 . ARG A 1 444 ? 76.774 83.161  -0.245  1.00 52.31 ? 444 ARG A NH1 1 
ATOM   3370  N  NH2 . ARG A 1 444 ? 77.662 85.238  -0.679  1.00 51.07 ? 444 ARG A NH2 1 
ATOM   3371  N  N   . ALA A 1 445 ? 70.790 81.963  -0.712  1.00 43.95 ? 445 ALA A N   1 
ATOM   3372  C  CA  . ALA A 1 445 ? 70.008 80.815  -1.146  1.00 43.59 ? 445 ALA A CA  1 
ATOM   3373  C  C   . ALA A 1 445 ? 68.561 81.230  -1.457  1.00 43.70 ? 445 ALA A C   1 
ATOM   3374  O  O   . ALA A 1 445 ? 67.967 80.810  -2.459  1.00 43.12 ? 445 ALA A O   1 
ATOM   3375  C  CB  . ALA A 1 445 ? 70.029 79.746  -0.070  1.00 42.61 ? 445 ALA A CB  1 
ATOM   3376  N  N   . PHE A 1 446 ? 68.010 82.066  -0.586  1.00 43.71 ? 446 PHE A N   1 
ATOM   3377  C  CA  . PHE A 1 446 ? 66.640 82.548  -0.714  1.00 44.00 ? 446 PHE A CA  1 
ATOM   3378  C  C   . PHE A 1 446 ? 66.483 83.473  -1.911  1.00 44.89 ? 446 PHE A C   1 
ATOM   3379  O  O   . PHE A 1 446 ? 65.474 83.443  -2.615  1.00 44.54 ? 446 PHE A O   1 
ATOM   3380  C  CB  . PHE A 1 446 ? 66.254 83.294  0.567   1.00 43.59 ? 446 PHE A CB  1 
ATOM   3381  C  CG  . PHE A 1 446 ? 64.962 84.047  0.473   1.00 42.13 ? 446 PHE A CG  1 
ATOM   3382  C  CD1 . PHE A 1 446 ? 63.750 83.402  0.680   1.00 42.10 ? 446 PHE A CD1 1 
ATOM   3383  C  CD2 . PHE A 1 446 ? 64.959 85.395  0.160   1.00 41.08 ? 446 PHE A CD2 1 
ATOM   3384  C  CE1 . PHE A 1 446 ? 62.552 84.089  0.576   1.00 41.61 ? 446 PHE A CE1 1 
ATOM   3385  C  CE2 . PHE A 1 446 ? 63.772 86.093  0.053   1.00 41.31 ? 446 PHE A CE2 1 
ATOM   3386  C  CZ  . PHE A 1 446 ? 62.562 85.439  0.261   1.00 41.82 ? 446 PHE A CZ  1 
ATOM   3387  N  N   . TYR A 1 447 ? 67.492 84.308  -2.125  1.00 46.20 ? 447 TYR A N   1 
ATOM   3388  C  CA  . TYR A 1 447 ? 67.472 85.265  -3.222  1.00 47.18 ? 447 TYR A CA  1 
ATOM   3389  C  C   . TYR A 1 447 ? 67.632 84.587  -4.581  1.00 47.75 ? 447 TYR A C   1 
ATOM   3390  O  O   . TYR A 1 447 ? 66.940 84.920  -5.545  1.00 47.28 ? 447 TYR A O   1 
ATOM   3391  C  CB  . TYR A 1 447 ? 68.580 86.309  -3.013  1.00 46.66 ? 447 TYR A CB  1 
ATOM   3392  C  CG  . TYR A 1 447 ? 68.667 87.345  -4.104  1.00 47.17 ? 447 TYR A CG  1 
ATOM   3393  C  CD1 . TYR A 1 447 ? 69.522 87.170  -5.197  1.00 48.03 ? 447 TYR A CD1 1 
ATOM   3394  C  CD2 . TYR A 1 447 ? 67.869 88.486  -4.067  1.00 47.01 ? 447 TYR A CD2 1 
ATOM   3395  C  CE1 . TYR A 1 447 ? 69.576 88.113  -6.230  1.00 48.37 ? 447 TYR A CE1 1 
ATOM   3396  C  CE2 . TYR A 1 447 ? 67.912 89.432  -5.090  1.00 47.72 ? 447 TYR A CE2 1 
ATOM   3397  C  CZ  . TYR A 1 447 ? 68.766 89.241  -6.165  1.00 48.06 ? 447 TYR A CZ  1 
ATOM   3398  O  OH  . TYR A 1 447 ? 68.821 90.183  -7.162  1.00 48.33 ? 447 TYR A OH  1 
ATOM   3399  N  N   . VAL A 1 448 ? 68.534 83.619  -4.642  1.00 48.81 ? 448 VAL A N   1 
ATOM   3400  C  CA  . VAL A 1 448 ? 68.809 82.922  -5.885  1.00 49.56 ? 448 VAL A CA  1 
ATOM   3401  C  C   . VAL A 1 448 ? 67.938 81.697  -6.167  1.00 50.60 ? 448 VAL A C   1 
ATOM   3402  O  O   . VAL A 1 448 ? 67.444 81.529  -7.286  1.00 51.06 ? 448 VAL A O   1 
ATOM   3403  C  CB  . VAL A 1 448 ? 70.293 82.509  -5.936  1.00 49.31 ? 448 VAL A CB  1 
ATOM   3404  C  CG1 . VAL A 1 448 ? 70.544 81.594  -7.124  1.00 49.18 ? 448 VAL A CG1 1 
ATOM   3405  C  CG2 . VAL A 1 448 ? 71.164 83.754  -6.025  1.00 48.30 ? 448 VAL A CG2 1 
ATOM   3406  N  N   . ASN A 1 449 ? 67.738 80.852  -5.160  1.00 50.87 ? 449 ASN A N   1 
ATOM   3407  C  CA  . ASN A 1 449 ? 66.957 79.631  -5.343  1.00 51.51 ? 449 ASN A CA  1 
ATOM   3408  C  C   . ASN A 1 449 ? 65.443 79.769  -5.240  1.00 51.50 ? 449 ASN A C   1 
ATOM   3409  O  O   . ASN A 1 449 ? 64.716 79.443  -6.182  1.00 51.76 ? 449 ASN A O   1 
ATOM   3410  C  CB  . ASN A 1 449 ? 67.442 78.573  -4.353  1.00 52.31 ? 449 ASN A CB  1 
ATOM   3411  C  CG  . ASN A 1 449 ? 68.863 78.118  -4.643  1.00 52.77 ? 449 ASN A CG  1 
ATOM   3412  O  OD1 . ASN A 1 449 ? 69.536 77.541  -3.778  1.00 52.51 ? 449 ASN A OD1 1 
ATOM   3413  N  ND2 . ASN A 1 449 ? 69.324 78.366  -5.871  1.00 52.10 ? 449 ASN A ND2 1 
ATOM   3414  N  N   . VAL A 1 450 ? 64.971 80.242  -4.092  1.00 51.08 ? 450 VAL A N   1 
ATOM   3415  C  CA  . VAL A 1 450 ? 63.543 80.405  -3.861  1.00 50.68 ? 450 VAL A CA  1 
ATOM   3416  C  C   . VAL A 1 450 ? 62.882 81.358  -4.849  1.00 51.31 ? 450 VAL A C   1 
ATOM   3417  O  O   . VAL A 1 450 ? 62.040 80.950  -5.648  1.00 51.33 ? 450 VAL A O   1 
ATOM   3418  C  CB  . VAL A 1 450 ? 63.263 80.935  -2.450  1.00 49.82 ? 450 VAL A CB  1 
ATOM   3419  C  CG1 . VAL A 1 450 ? 61.773 80.874  -2.171  1.00 49.14 ? 450 VAL A CG1 1 
ATOM   3420  C  CG2 . VAL A 1 450 ? 64.049 80.134  -1.426  1.00 49.26 ? 450 VAL A CG2 1 
ATOM   3421  N  N   . LEU A 1 451 ? 63.263 82.630  -4.788  1.00 51.80 ? 451 LEU A N   1 
ATOM   3422  C  CA  . LEU A 1 451 ? 62.685 83.643  -5.662  1.00 52.19 ? 451 LEU A CA  1 
ATOM   3423  C  C   . LEU A 1 451 ? 63.023 83.471  -7.137  1.00 52.97 ? 451 LEU A C   1 
ATOM   3424  O  O   . LEU A 1 451 ? 64.158 83.134  -7.491  1.00 52.56 ? 451 LEU A O   1 
ATOM   3425  C  CB  . LEU A 1 451 ? 63.146 85.033  -5.234  1.00 51.86 ? 451 LEU A CB  1 
ATOM   3426  C  CG  . LEU A 1 451 ? 62.984 85.473  -3.782  1.00 51.82 ? 451 LEU A CG  1 
ATOM   3427  C  CD1 . LEU A 1 451 ? 63.400 86.937  -3.689  1.00 51.18 ? 451 LEU A CD1 1 
ATOM   3428  C  CD2 . LEU A 1 451 ? 61.543 85.300  -3.320  1.00 51.24 ? 451 LEU A CD2 1 
ATOM   3429  N  N   . ASN A 1 452 ? 62.026 83.701  -7.989  1.00 53.85 ? 452 ASN A N   1 
ATOM   3430  C  CA  . ASN A 1 452 ? 62.220 83.635  -9.433  1.00 55.20 ? 452 ASN A CA  1 
ATOM   3431  C  C   . ASN A 1 452 ? 62.592 85.065  -9.795  1.00 56.34 ? 452 ASN A C   1 
ATOM   3432  O  O   . ASN A 1 452 ? 62.791 85.897  -8.901  1.00 56.74 ? 452 ASN A O   1 
ATOM   3433  C  CB  . ASN A 1 452 ? 60.932 83.254  -10.144 1.00 54.88 ? 452 ASN A CB  1 
ATOM   3434  C  CG  . ASN A 1 452 ? 59.827 84.236  -9.881  1.00 55.56 ? 452 ASN A CG  1 
ATOM   3435  O  OD1 . ASN A 1 452 ? 60.040 85.452  -9.929  1.00 56.04 ? 452 ASN A OD1 1 
ATOM   3436  N  ND2 . ASN A 1 452 ? 58.633 83.727  -9.603  1.00 55.40 ? 452 ASN A ND2 1 
ATOM   3437  N  N   . GLU A 1 453 ? 62.653 85.377  -11.085 1.00 57.37 ? 453 GLU A N   1 
ATOM   3438  C  CA  . GLU A 1 453 ? 63.045 86.724  -11.489 1.00 58.15 ? 453 GLU A CA  1 
ATOM   3439  C  C   . GLU A 1 453 ? 61.994 87.804  -11.220 1.00 58.10 ? 453 GLU A C   1 
ATOM   3440  O  O   . GLU A 1 453 ? 62.342 88.897  -10.778 1.00 57.61 ? 453 GLU A O   1 
ATOM   3441  C  CB  . GLU A 1 453 ? 63.474 86.723  -12.960 1.00 59.09 ? 453 GLU A CB  1 
ATOM   3442  C  CG  . GLU A 1 453 ? 64.372 87.894  -13.363 1.00 61.58 ? 453 GLU A CG  1 
ATOM   3443  C  CD  . GLU A 1 453 ? 65.538 88.147  -12.383 1.00 63.44 ? 453 GLU A CD  1 
ATOM   3444  O  OE1 . GLU A 1 453 ? 66.265 87.178  -12.040 1.00 63.96 ? 453 GLU A OE1 1 
ATOM   3445  O  OE2 . GLU A 1 453 ? 65.731 89.322  -11.966 1.00 63.39 ? 453 GLU A OE2 1 
ATOM   3446  N  N   . GLU A 1 454 ? 60.719 87.512  -11.474 1.00 59.05 ? 454 GLU A N   1 
ATOM   3447  C  CA  . GLU A 1 454 ? 59.645 88.495  -11.219 1.00 59.66 ? 454 GLU A CA  1 
ATOM   3448  C  C   . GLU A 1 454 ? 59.769 89.005  -9.787  1.00 58.84 ? 454 GLU A C   1 
ATOM   3449  O  O   . GLU A 1 454 ? 59.638 90.206  -9.509  1.00 58.56 ? 454 GLU A O   1 
ATOM   3450  C  CB  . GLU A 1 454 ? 58.253 87.859  -11.333 1.00 60.69 ? 454 GLU A CB  1 
ATOM   3451  C  CG  . GLU A 1 454 ? 57.756 87.527  -12.716 1.00 62.69 ? 454 GLU A CG  1 
ATOM   3452  C  CD  . GLU A 1 454 ? 56.303 87.055  -12.676 1.00 64.49 ? 454 GLU A CD  1 
ATOM   3453  O  OE1 . GLU A 1 454 ? 55.448 87.812  -12.150 1.00 65.01 ? 454 GLU A OE1 1 
ATOM   3454  O  OE2 . GLU A 1 454 ? 56.013 85.932  -13.161 1.00 65.54 ? 454 GLU A OE2 1 
ATOM   3455  N  N   . GLN A 1 455 ? 60.002 88.046  -8.893  1.00 57.59 ? 455 GLN A N   1 
ATOM   3456  C  CA  . GLN A 1 455 ? 60.132 88.281  -7.468  1.00 55.79 ? 455 GLN A CA  1 
ATOM   3457  C  C   . GLN A 1 455 ? 61.378 89.086  -7.126  1.00 55.68 ? 455 GLN A C   1 
ATOM   3458  O  O   . GLN A 1 455 ? 61.285 90.084  -6.408  1.00 55.97 ? 455 GLN A O   1 
ATOM   3459  C  CB  . GLN A 1 455 ? 60.130 86.931  -6.748  1.00 54.54 ? 455 GLN A CB  1 
ATOM   3460  C  CG  . GLN A 1 455 ? 58.905 86.088  -7.111  1.00 52.90 ? 455 GLN A CG  1 
ATOM   3461  C  CD  . GLN A 1 455 ? 58.904 84.718  -6.470  1.00 52.05 ? 455 GLN A CD  1 
ATOM   3462  O  OE1 . GLN A 1 455 ? 59.773 83.888  -6.745  1.00 52.12 ? 455 GLN A OE1 1 
ATOM   3463  N  NE2 . GLN A 1 455 ? 57.925 84.472  -5.610  1.00 51.31 ? 455 GLN A NE2 1 
ATOM   3464  N  N   . ARG A 1 456 ? 62.536 88.670  -7.637  1.00 55.12 ? 456 ARG A N   1 
ATOM   3465  C  CA  . ARG A 1 456 ? 63.772 89.401  -7.356  1.00 54.82 ? 456 ARG A CA  1 
ATOM   3466  C  C   . ARG A 1 456 ? 63.622 90.860  -7.773  1.00 54.42 ? 456 ARG A C   1 
ATOM   3467  O  O   . ARG A 1 456 ? 63.976 91.773  -7.018  1.00 54.10 ? 456 ARG A O   1 
ATOM   3468  C  CB  . ARG A 1 456 ? 64.963 88.791  -8.099  1.00 55.34 ? 456 ARG A CB  1 
ATOM   3469  C  CG  . ARG A 1 456 ? 65.291 87.361  -7.725  1.00 55.91 ? 456 ARG A CG  1 
ATOM   3470  C  CD  . ARG A 1 456 ? 66.641 86.964  -8.307  1.00 56.83 ? 456 ARG A CD  1 
ATOM   3471  N  NE  . ARG A 1 456 ? 66.756 85.521  -8.499  1.00 58.36 ? 456 ARG A NE  1 
ATOM   3472  C  CZ  . ARG A 1 456 ? 66.142 84.832  -9.464  1.00 59.29 ? 456 ARG A CZ  1 
ATOM   3473  N  NH1 . ARG A 1 456 ? 65.361 85.447  -10.346 1.00 58.82 ? 456 ARG A NH1 1 
ATOM   3474  N  NH2 . ARG A 1 456 ? 66.303 83.515  -9.545  1.00 60.08 ? 456 ARG A NH2 1 
ATOM   3475  N  N   . LYS A 1 457 ? 63.100 91.075  -8.977  1.00 54.10 ? 457 LYS A N   1 
ATOM   3476  C  CA  . LYS A 1 457 ? 62.898 92.428  -9.472  1.00 54.02 ? 457 LYS A CA  1 
ATOM   3477  C  C   . LYS A 1 457 ? 62.110 93.201  -8.421  1.00 53.37 ? 457 LYS A C   1 
ATOM   3478  O  O   . LYS A 1 457 ? 62.618 94.153  -7.824  1.00 53.56 ? 457 LYS A O   1 
ATOM   3479  C  CB  . LYS A 1 457 ? 62.121 92.410  -10.794 1.00 55.08 ? 457 LYS A CB  1 
ATOM   3480  C  CG  . LYS A 1 457 ? 61.957 93.800  -11.421 1.00 57.28 ? 457 LYS A CG  1 
ATOM   3481  C  CD  . LYS A 1 457 ? 61.321 93.765  -12.806 1.00 58.22 ? 457 LYS A CD  1 
ATOM   3482  C  CE  . LYS A 1 457 ? 61.433 95.130  -13.499 1.00 59.31 ? 457 LYS A CE  1 
ATOM   3483  N  NZ  . LYS A 1 457 ? 60.708 95.168  -14.814 1.00 60.29 ? 457 LYS A NZ  1 
ATOM   3484  N  N   . ARG A 1 458 ? 60.871 92.760  -8.202  1.00 52.75 ? 458 ARG A N   1 
ATOM   3485  C  CA  . ARG A 1 458 ? 59.936 93.348  -7.234  1.00 51.51 ? 458 ARG A CA  1 
ATOM   3486  C  C   . ARG A 1 458 ? 60.556 93.564  -5.846  1.00 50.91 ? 458 ARG A C   1 
ATOM   3487  O  O   . ARG A 1 458 ? 60.289 94.573  -5.190  1.00 50.36 ? 458 ARG A O   1 
ATOM   3488  C  CB  . ARG A 1 458 ? 58.708 92.443  -7.122  1.00 51.03 ? 458 ARG A CB  1 
ATOM   3489  C  CG  . ARG A 1 458 ? 57.401 93.173  -6.956  1.00 50.56 ? 458 ARG A CG  1 
ATOM   3490  C  CD  . ARG A 1 458 ? 56.328 92.496  -7.780  1.00 50.26 ? 458 ARG A CD  1 
ATOM   3491  N  NE  . ARG A 1 458 ? 56.131 91.104  -7.389  1.00 51.03 ? 458 ARG A NE  1 
ATOM   3492  C  CZ  . ARG A 1 458 ? 56.075 90.091  -8.252  1.00 52.23 ? 458 ARG A CZ  1 
ATOM   3493  N  NH1 . ARG A 1 458 ? 56.208 90.324  -9.555  1.00 52.97 ? 458 ARG A NH1 1 
ATOM   3494  N  NH2 . ARG A 1 458 ? 55.882 88.845  -7.820  1.00 51.81 ? 458 ARG A NH2 1 
ATOM   3495  N  N   . LEU A 1 459 ? 61.374 92.613  -5.398  1.00 50.18 ? 459 LEU A N   1 
ATOM   3496  C  CA  . LEU A 1 459 ? 62.051 92.737  -4.110  1.00 49.82 ? 459 LEU A CA  1 
ATOM   3497  C  C   . LEU A 1 459 ? 62.977 93.971  -4.123  1.00 50.26 ? 459 LEU A C   1 
ATOM   3498  O  O   . LEU A 1 459 ? 62.911 94.840  -3.245  1.00 50.10 ? 459 LEU A O   1 
ATOM   3499  C  CB  . LEU A 1 459 ? 62.862 91.471  -3.830  1.00 49.10 ? 459 LEU A CB  1 
ATOM   3500  C  CG  . LEU A 1 459 ? 63.876 91.531  -2.685  1.00 49.05 ? 459 LEU A CG  1 
ATOM   3501  C  CD1 . LEU A 1 459 ? 63.216 92.066  -1.436  1.00 49.06 ? 459 LEU A CD1 1 
ATOM   3502  C  CD2 . LEU A 1 459 ? 64.442 90.148  -2.435  1.00 48.85 ? 459 LEU A CD2 1 
ATOM   3503  N  N   . CYS A 1 460 ? 63.837 94.055  -5.130  1.00 50.30 ? 460 CYS A N   1 
ATOM   3504  C  CA  . CYS A 1 460 ? 64.739 95.189  -5.229  1.00 50.07 ? 460 CYS A CA  1 
ATOM   3505  C  C   . CYS A 1 460 ? 63.976 96.500  -5.390  1.00 49.65 ? 460 CYS A C   1 
ATOM   3506  O  O   . CYS A 1 460 ? 64.387 97.529  -4.863  1.00 49.36 ? 460 CYS A O   1 
ATOM   3507  C  CB  . CYS A 1 460 ? 65.718 94.975  -6.387  1.00 50.03 ? 460 CYS A CB  1 
ATOM   3508  S  SG  . CYS A 1 460 ? 66.880 93.609  -6.054  1.00 51.17 ? 460 CYS A SG  1 
ATOM   3509  N  N   . GLU A 1 461 ? 62.861 96.470  -6.107  1.00 49.71 ? 461 GLU A N   1 
ATOM   3510  C  CA  . GLU A 1 461 ? 62.071 97.683  -6.289  1.00 50.31 ? 461 GLU A CA  1 
ATOM   3511  C  C   . GLU A 1 461 ? 61.494 98.119  -4.938  1.00 49.66 ? 461 GLU A C   1 
ATOM   3512  O  O   . GLU A 1 461 ? 61.616 99.280  -4.550  1.00 49.27 ? 461 GLU A O   1 
ATOM   3513  C  CB  . GLU A 1 461 ? 60.939 97.433  -7.284  1.00 52.22 ? 461 GLU A CB  1 
ATOM   3514  C  CG  . GLU A 1 461 ? 61.358 96.565  -8.453  1.00 56.24 ? 461 GLU A CG  1 
ATOM   3515  C  CD  . GLU A 1 461 ? 60.368 96.579  -9.613  1.00 58.64 ? 461 GLU A CD  1 
ATOM   3516  O  OE1 . GLU A 1 461 ? 59.172 96.253  -9.402  1.00 59.12 ? 461 GLU A OE1 1 
ATOM   3517  O  OE2 . GLU A 1 461 ? 60.804 96.911  -10.745 1.00 60.43 ? 461 GLU A OE2 1 
ATOM   3518  N  N   . ASN A 1 462 ? 60.879 97.175  -4.220  1.00 49.21 ? 462 ASN A N   1 
ATOM   3519  C  CA  . ASN A 1 462 ? 60.287 97.451  -2.911  1.00 47.61 ? 462 ASN A CA  1 
ATOM   3520  C  C   . ASN A 1 462 ? 61.308 97.966  -1.907  1.00 46.61 ? 462 ASN A C   1 
ATOM   3521  O  O   . ASN A 1 462 ? 61.030 98.906  -1.166  1.00 46.47 ? 462 ASN A O   1 
ATOM   3522  C  CB  . ASN A 1 462 ? 59.620 96.196  -2.340  1.00 47.87 ? 462 ASN A CB  1 
ATOM   3523  C  CG  . ASN A 1 462 ? 58.492 95.679  -3.219  1.00 48.11 ? 462 ASN A CG  1 
ATOM   3524  O  OD1 . ASN A 1 462 ? 57.735 96.455  -3.812  1.00 46.90 ? 462 ASN A OD1 1 
ATOM   3525  N  ND2 . ASN A 1 462 ? 58.365 94.360  -3.294  1.00 48.49 ? 462 ASN A ND2 1 
ATOM   3526  N  N   . ILE A 1 463 ? 62.489 97.355  -1.880  1.00 45.79 ? 463 ILE A N   1 
ATOM   3527  C  CA  . ILE A 1 463 ? 63.537 97.781  -0.950  1.00 45.51 ? 463 ILE A CA  1 
ATOM   3528  C  C   . ILE A 1 463 ? 64.011 99.208  -1.234  1.00 45.51 ? 463 ILE A C   1 
ATOM   3529  O  O   . ILE A 1 463 ? 63.990 100.078 -0.358  1.00 45.54 ? 463 ILE A O   1 
ATOM   3530  C  CB  . ILE A 1 463 ? 64.761 96.838  -1.004  1.00 44.46 ? 463 ILE A CB  1 
ATOM   3531  C  CG1 . ILE A 1 463 ? 64.399 95.467  -0.427  1.00 43.67 ? 463 ILE A CG1 1 
ATOM   3532  C  CG2 . ILE A 1 463 ? 65.895 97.436  -0.224  1.00 44.45 ? 463 ILE A CG2 1 
ATOM   3533  C  CD1 . ILE A 1 463 ? 65.527 94.455  -0.469  1.00 42.71 ? 463 ILE A CD1 1 
ATOM   3534  N  N   . ALA A 1 464 ? 64.437 99.428  -2.472  1.00 45.86 ? 464 ALA A N   1 
ATOM   3535  C  CA  . ALA A 1 464 ? 64.930 100.719 -2.930  1.00 44.90 ? 464 ALA A CA  1 
ATOM   3536  C  C   . ALA A 1 464 ? 63.905 101.813 -2.707  1.00 44.69 ? 464 ALA A C   1 
ATOM   3537  O  O   . ALA A 1 464 ? 64.252 102.934 -2.332  1.00 45.50 ? 464 ALA A O   1 
ATOM   3538  C  CB  . ALA A 1 464 ? 65.277 100.636 -4.402  1.00 44.52 ? 464 ALA A CB  1 
ATOM   3539  N  N   . GLY A 1 465 ? 62.639 101.483 -2.935  1.00 43.95 ? 465 GLY A N   1 
ATOM   3540  C  CA  . GLY A 1 465 ? 61.587 102.467 -2.765  1.00 43.23 ? 465 GLY A CA  1 
ATOM   3541  C  C   . GLY A 1 465 ? 61.499 103.026 -1.362  1.00 43.24 ? 465 GLY A C   1 
ATOM   3542  O  O   . GLY A 1 465 ? 60.944 104.098 -1.145  1.00 42.22 ? 465 GLY A O   1 
ATOM   3543  N  N   . HIS A 1 466 ? 62.048 102.294 -0.402  1.00 44.17 ? 466 HIS A N   1 
ATOM   3544  C  CA  . HIS A 1 466 ? 62.022 102.723 0.986   1.00 44.95 ? 466 HIS A CA  1 
ATOM   3545  C  C   . HIS A 1 466 ? 63.404 103.196 1.403   1.00 44.66 ? 466 HIS A C   1 
ATOM   3546  O  O   . HIS A 1 466 ? 63.539 104.179 2.131   1.00 44.52 ? 466 HIS A O   1 
ATOM   3547  C  CB  . HIS A 1 466 ? 61.578 101.559 1.876   1.00 46.91 ? 466 HIS A CB  1 
ATOM   3548  C  CG  . HIS A 1 466 ? 61.404 101.924 3.319   1.00 48.84 ? 466 HIS A CG  1 
ATOM   3549  N  ND1 . HIS A 1 466 ? 62.422 102.454 4.084   1.00 49.99 ? 466 HIS A ND1 1 
ATOM   3550  C  CD2 . HIS A 1 466 ? 60.335 101.812 4.143   1.00 49.40 ? 466 HIS A CD2 1 
ATOM   3551  C  CE1 . HIS A 1 466 ? 61.989 102.652 5.317   1.00 49.87 ? 466 HIS A CE1 1 
ATOM   3552  N  NE2 . HIS A 1 466 ? 60.726 102.270 5.380   1.00 50.40 ? 466 HIS A NE2 1 
ATOM   3553  N  N   . LEU A 1 467 ? 64.426 102.496 0.925   1.00 44.31 ? 467 LEU A N   1 
ATOM   3554  C  CA  . LEU A 1 467 ? 65.807 102.826 1.261   1.00 44.34 ? 467 LEU A CA  1 
ATOM   3555  C  C   . LEU A 1 467 ? 66.255 104.173 0.716   1.00 44.10 ? 467 LEU A C   1 
ATOM   3556  O  O   . LEU A 1 467 ? 67.209 104.764 1.224   1.00 43.17 ? 467 LEU A O   1 
ATOM   3557  C  CB  . LEU A 1 467 ? 66.750 101.735 0.742   1.00 44.31 ? 467 LEU A CB  1 
ATOM   3558  C  CG  . LEU A 1 467 ? 68.249 101.983 0.928   1.00 43.36 ? 467 LEU A CG  1 
ATOM   3559  C  CD1 . LEU A 1 467 ? 68.608 101.971 2.400   1.00 41.92 ? 467 LEU A CD1 1 
ATOM   3560  C  CD2 . LEU A 1 467 ? 69.022 100.916 0.187   1.00 42.59 ? 467 LEU A CD2 1 
ATOM   3561  N  N   . LYS A 1 468 ? 65.561 104.664 -0.306  1.00 44.57 ? 468 LYS A N   1 
ATOM   3562  C  CA  . LYS A 1 468 ? 65.924 105.938 -0.913  1.00 44.86 ? 468 LYS A CA  1 
ATOM   3563  C  C   . LYS A 1 468 ? 65.652 107.170 -0.057  1.00 45.12 ? 468 LYS A C   1 
ATOM   3564  O  O   . LYS A 1 468 ? 66.206 108.238 -0.324  1.00 45.76 ? 468 LYS A O   1 
ATOM   3565  C  CB  . LYS A 1 468 ? 65.239 106.086 -2.276  1.00 45.29 ? 468 LYS A CB  1 
ATOM   3566  C  CG  . LYS A 1 468 ? 63.727 106.133 -2.237  1.00 45.74 ? 468 LYS A CG  1 
ATOM   3567  C  CD  . LYS A 1 468 ? 63.220 107.528 -1.963  1.00 46.34 ? 468 LYS A CD  1 
ATOM   3568  C  CE  . LYS A 1 468 ? 61.707 107.552 -1.952  1.00 46.54 ? 468 LYS A CE  1 
ATOM   3569  N  NZ  . LYS A 1 468 ? 61.166 106.917 -3.187  1.00 47.74 ? 468 LYS A NZ  1 
ATOM   3570  N  N   . ASP A 1 469 ? 64.801 107.050 0.959   1.00 44.98 ? 469 ASP A N   1 
ATOM   3571  C  CA  . ASP A 1 469 ? 64.537 108.200 1.822   1.00 44.80 ? 469 ASP A CA  1 
ATOM   3572  C  C   . ASP A 1 469 ? 65.680 108.367 2.818   1.00 44.60 ? 469 ASP A C   1 
ATOM   3573  O  O   . ASP A 1 469 ? 65.777 109.372 3.509   1.00 44.61 ? 469 ASP A O   1 
ATOM   3574  C  CB  . ASP A 1 469 ? 63.232 108.028 2.598   1.00 45.79 ? 469 ASP A CB  1 
ATOM   3575  C  CG  . ASP A 1 469 ? 62.009 108.024 1.704   1.00 46.22 ? 469 ASP A CG  1 
ATOM   3576  O  OD1 . ASP A 1 469 ? 61.919 108.912 0.825   1.00 45.60 ? 469 ASP A OD1 1 
ATOM   3577  O  OD2 . ASP A 1 469 ? 61.134 107.140 1.897   1.00 46.74 ? 469 ASP A OD2 1 
ATOM   3578  N  N   . ALA A 1 470 ? 66.555 107.377 2.884   1.00 44.95 ? 470 ALA A N   1 
ATOM   3579  C  CA  . ALA A 1 470 ? 67.671 107.424 3.814   1.00 45.55 ? 470 ALA A CA  1 
ATOM   3580  C  C   . ALA A 1 470 ? 68.837 108.216 3.252   1.00 46.15 ? 470 ALA A C   1 
ATOM   3581  O  O   . ALA A 1 470 ? 69.048 108.235 2.040   1.00 46.45 ? 470 ALA A O   1 
ATOM   3582  C  CB  . ALA A 1 470 ? 68.126 106.010 4.138   1.00 45.08 ? 470 ALA A CB  1 
ATOM   3583  N  N   . GLN A 1 471 ? 69.590 108.868 4.138   1.00 46.28 ? 471 GLN A N   1 
ATOM   3584  C  CA  . GLN A 1 471 ? 70.768 109.628 3.735   1.00 46.16 ? 471 GLN A CA  1 
ATOM   3585  C  C   . GLN A 1 471 ? 71.693 108.706 2.953   1.00 46.25 ? 471 GLN A C   1 
ATOM   3586  O  O   . GLN A 1 471 ? 71.700 107.490 3.161   1.00 46.08 ? 471 GLN A O   1 
ATOM   3587  C  CB  . GLN A 1 471 ? 71.498 110.151 4.959   1.00 46.29 ? 471 GLN A CB  1 
ATOM   3588  C  CG  . GLN A 1 471 ? 70.758 111.219 5.703   1.00 47.66 ? 471 GLN A CG  1 
ATOM   3589  C  CD  . GLN A 1 471 ? 71.550 111.711 6.892   1.00 49.41 ? 471 GLN A CD  1 
ATOM   3590  O  OE1 . GLN A 1 471 ? 72.700 112.139 6.756   1.00 50.42 ? 471 GLN A OE1 1 
ATOM   3591  N  NE2 . GLN A 1 471 ? 70.944 111.647 8.072   1.00 50.36 ? 471 GLN A NE2 1 
ATOM   3592  N  N   . ILE A 1 472 ? 72.497 109.280 2.070   1.00 46.75 ? 472 ILE A N   1 
ATOM   3593  C  CA  . ILE A 1 472 ? 73.377 108.471 1.234   1.00 46.95 ? 472 ILE A CA  1 
ATOM   3594  C  C   . ILE A 1 472 ? 74.380 107.559 1.942   1.00 46.61 ? 472 ILE A C   1 
ATOM   3595  O  O   . ILE A 1 472 ? 74.559 106.406 1.535   1.00 46.47 ? 472 ILE A O   1 
ATOM   3596  C  CB  . ILE A 1 472 ? 74.090 109.362 0.200   1.00 47.34 ? 472 ILE A CB  1 
ATOM   3597  C  CG1 . ILE A 1 472 ? 73.037 109.940 -0.745  1.00 47.41 ? 472 ILE A CG1 1 
ATOM   3598  C  CG2 . ILE A 1 472 ? 75.094 108.551 -0.619  1.00 47.38 ? 472 ILE A CG2 1 
ATOM   3599  C  CD1 . ILE A 1 472 ? 73.553 111.065 -1.604  1.00 49.83 ? 472 ILE A CD1 1 
ATOM   3600  N  N   . PHE A 1 473 ? 75.033 108.038 2.993   1.00 46.55 ? 473 PHE A N   1 
ATOM   3601  C  CA  . PHE A 1 473 ? 75.981 107.167 3.674   1.00 46.36 ? 473 PHE A CA  1 
ATOM   3602  C  C   . PHE A 1 473 ? 75.223 105.955 4.203   1.00 46.72 ? 473 PHE A C   1 
ATOM   3603  O  O   . PHE A 1 473 ? 75.739 104.835 4.191   1.00 47.20 ? 473 PHE A O   1 
ATOM   3604  C  CB  . PHE A 1 473 ? 76.713 107.919 4.795   1.00 46.00 ? 473 PHE A CB  1 
ATOM   3605  C  CG  . PHE A 1 473 ? 75.966 107.993 6.092   1.00 45.06 ? 473 PHE A CG  1 
ATOM   3606  C  CD1 . PHE A 1 473 ? 76.145 107.015 7.064   1.00 44.58 ? 473 PHE A CD1 1 
ATOM   3607  C  CD2 . PHE A 1 473 ? 75.140 109.083 6.373   1.00 44.97 ? 473 PHE A CD2 1 
ATOM   3608  C  CE1 . PHE A 1 473 ? 75.519 107.124 8.302   1.00 44.51 ? 473 PHE A CE1 1 
ATOM   3609  C  CE2 . PHE A 1 473 ? 74.508 109.204 7.609   1.00 44.56 ? 473 PHE A CE2 1 
ATOM   3610  C  CZ  . PHE A 1 473 ? 74.699 108.223 8.578   1.00 44.58 ? 473 PHE A CZ  1 
ATOM   3611  N  N   . ILE A 1 474 ? 73.985 106.166 4.642   1.00 46.60 ? 474 ILE A N   1 
ATOM   3612  C  CA  . ILE A 1 474 ? 73.195 105.046 5.123   1.00 46.33 ? 474 ILE A CA  1 
ATOM   3613  C  C   . ILE A 1 474 ? 72.927 104.143 3.933   1.00 46.64 ? 474 ILE A C   1 
ATOM   3614  O  O   . ILE A 1 474 ? 73.082 102.930 4.029   1.00 47.21 ? 474 ILE A O   1 
ATOM   3615  C  CB  . ILE A 1 474 ? 71.850 105.485 5.745   1.00 45.79 ? 474 ILE A CB  1 
ATOM   3616  C  CG1 . ILE A 1 474 ? 72.100 106.268 7.036   1.00 45.35 ? 474 ILE A CG1 1 
ATOM   3617  C  CG2 . ILE A 1 474 ? 70.999 104.253 6.056   1.00 45.37 ? 474 ILE A CG2 1 
ATOM   3618  C  CD1 . ILE A 1 474 ? 70.839 106.697 7.732   1.00 45.81 ? 474 ILE A CD1 1 
ATOM   3619  N  N   . GLN A 1 475 ? 72.534 104.731 2.807   1.00 46.90 ? 475 GLN A N   1 
ATOM   3620  C  CA  . GLN A 1 475 ? 72.272 103.939 1.607   1.00 47.66 ? 475 GLN A CA  1 
ATOM   3621  C  C   . GLN A 1 475 ? 73.508 103.118 1.232   1.00 48.43 ? 475 GLN A C   1 
ATOM   3622  O  O   . GLN A 1 475 ? 73.421 101.910 0.985   1.00 48.07 ? 475 GLN A O   1 
ATOM   3623  C  CB  . GLN A 1 475 ? 71.928 104.833 0.425   1.00 47.36 ? 475 GLN A CB  1 
ATOM   3624  C  CG  . GLN A 1 475 ? 70.637 105.576 0.526   1.00 47.02 ? 475 GLN A CG  1 
ATOM   3625  C  CD  . GLN A 1 475 ? 70.304 106.246 -0.781  1.00 47.18 ? 475 GLN A CD  1 
ATOM   3626  O  OE1 . GLN A 1 475 ? 70.637 105.732 -1.846  1.00 47.88 ? 475 GLN A OE1 1 
ATOM   3627  N  NE2 . GLN A 1 475 ? 69.636 107.389 -0.716  1.00 47.97 ? 475 GLN A NE2 1 
ATOM   3628  N  N   . LYS A 1 476 ? 74.657 103.787 1.183   1.00 48.84 ? 476 LYS A N   1 
ATOM   3629  C  CA  . LYS A 1 476 ? 75.906 103.125 0.827   1.00 49.52 ? 476 LYS A CA  1 
ATOM   3630  C  C   . LYS A 1 476 ? 76.094 101.819 1.591   1.00 49.17 ? 476 LYS A C   1 
ATOM   3631  O  O   . LYS A 1 476 ? 76.098 100.740 0.993   1.00 48.78 ? 476 LYS A O   1 
ATOM   3632  C  CB  . LYS A 1 476 ? 77.101 104.048 1.104   1.00 50.88 ? 476 LYS A CB  1 
ATOM   3633  C  CG  . LYS A 1 476 ? 77.195 105.257 0.188   1.00 53.02 ? 476 LYS A CG  1 
ATOM   3634  C  CD  . LYS A 1 476 ? 77.656 104.858 -1.210  1.00 55.03 ? 476 LYS A CD  1 
ATOM   3635  C  CE  . LYS A 1 476 ? 79.085 105.353 -1.499  1.00 56.35 ? 476 LYS A CE  1 
ATOM   3636  N  NZ  . LYS A 1 476 ? 79.173 106.854 -1.517  1.00 56.93 ? 476 LYS A NZ  1 
ATOM   3637  N  N   . LYS A 1 477 ? 76.225 101.921 2.913   1.00 48.67 ? 477 LYS A N   1 
ATOM   3638  C  CA  . LYS A 1 477 ? 76.453 100.745 3.735   1.00 48.20 ? 477 LYS A CA  1 
ATOM   3639  C  C   . LYS A 1 477 ? 75.427 99.662  3.479   1.00 47.25 ? 477 LYS A C   1 
ATOM   3640  O  O   . LYS A 1 477 ? 75.768 98.487  3.462   1.00 46.98 ? 477 LYS A O   1 
ATOM   3641  C  CB  . LYS A 1 477 ? 76.489 101.108 5.227   1.00 48.86 ? 477 LYS A CB  1 
ATOM   3642  C  CG  . LYS A 1 477 ? 77.318 100.107 6.044   1.00 50.46 ? 477 LYS A CG  1 
ATOM   3643  C  CD  . LYS A 1 477 ? 77.601 100.548 7.493   1.00 52.33 ? 477 LYS A CD  1 
ATOM   3644  C  CE  . LYS A 1 477 ? 78.471 101.818 7.600   1.00 53.98 ? 477 LYS A CE  1 
ATOM   3645  N  NZ  . LYS A 1 477 ? 77.747 103.104 7.271   1.00 53.75 ? 477 LYS A NZ  1 
ATOM   3646  N  N   . ALA A 1 478 ? 74.176 100.057 3.264   1.00 46.89 ? 478 ALA A N   1 
ATOM   3647  C  CA  . ALA A 1 478 ? 73.105 99.094  2.998   1.00 46.10 ? 478 ALA A CA  1 
ATOM   3648  C  C   . ALA A 1 478 ? 73.405 98.294  1.745   1.00 45.95 ? 478 ALA A C   1 
ATOM   3649  O  O   . ALA A 1 478 ? 73.443 97.065  1.785   1.00 45.32 ? 478 ALA A O   1 
ATOM   3650  C  CB  . ALA A 1 478 ? 71.767 99.813  2.832   1.00 45.73 ? 478 ALA A CB  1 
ATOM   3651  N  N   . VAL A 1 479 ? 73.615 99.006  0.635   1.00 46.33 ? 479 VAL A N   1 
ATOM   3652  C  CA  . VAL A 1 479 ? 73.899 98.386  -0.654  1.00 46.60 ? 479 VAL A CA  1 
ATOM   3653  C  C   . VAL A 1 479 ? 75.154 97.539  -0.556  1.00 47.27 ? 479 VAL A C   1 
ATOM   3654  O  O   . VAL A 1 479 ? 75.330 96.577  -1.310  1.00 47.51 ? 479 VAL A O   1 
ATOM   3655  C  CB  . VAL A 1 479 ? 74.103 99.448  -1.774  1.00 46.76 ? 479 VAL A CB  1 
ATOM   3656  C  CG1 . VAL A 1 479 ? 74.222 98.759  -3.133  1.00 46.22 ? 479 VAL A CG1 1 
ATOM   3657  C  CG2 . VAL A 1 479 ? 72.939 100.433 -1.789  1.00 46.38 ? 479 VAL A CG2 1 
ATOM   3658  N  N   . LYS A 1 480 ? 76.020 97.890  0.387   1.00 47.87 ? 480 LYS A N   1 
ATOM   3659  C  CA  . LYS A 1 480 ? 77.261 97.148  0.576   1.00 48.74 ? 480 LYS A CA  1 
ATOM   3660  C  C   . LYS A 1 480 ? 76.966 95.735  1.091   1.00 48.32 ? 480 LYS A C   1 
ATOM   3661  O  O   . LYS A 1 480 ? 77.613 94.770  0.674   1.00 47.85 ? 480 LYS A O   1 
ATOM   3662  C  CB  . LYS A 1 480 ? 78.180 97.899  1.553   1.00 50.04 ? 480 LYS A CB  1 
ATOM   3663  C  CG  . LYS A 1 480 ? 79.632 97.432  1.531   1.00 51.96 ? 480 LYS A CG  1 
ATOM   3664  C  CD  . LYS A 1 480 ? 80.499 98.104  2.615   1.00 53.88 ? 480 LYS A CD  1 
ATOM   3665  C  CE  . LYS A 1 480 ? 80.843 99.587  2.326   1.00 54.47 ? 480 LYS A CE  1 
ATOM   3666  N  NZ  . LYS A 1 480 ? 79.787 100.586 2.703   1.00 54.11 ? 480 LYS A NZ  1 
ATOM   3667  N  N   . ASN A 1 481 ? 75.977 95.618  1.980   1.00 48.37 ? 481 ASN A N   1 
ATOM   3668  C  CA  . ASN A 1 481 ? 75.592 94.322  2.544   1.00 48.54 ? 481 ASN A CA  1 
ATOM   3669  C  C   . ASN A 1 481 ? 74.803 93.487  1.537   1.00 48.89 ? 481 ASN A C   1 
ATOM   3670  O  O   . ASN A 1 481 ? 75.009 92.277  1.422   1.00 48.24 ? 481 ASN A O   1 
ATOM   3671  C  CB  . ASN A 1 481 ? 74.757 94.507  3.813   1.00 47.81 ? 481 ASN A CB  1 
ATOM   3672  C  CG  . ASN A 1 481 ? 75.503 95.253  4.897   1.00 48.12 ? 481 ASN A CG  1 
ATOM   3673  O  OD1 . ASN A 1 481 ? 76.707 95.054  5.084   1.00 48.57 ? 481 ASN A OD1 1 
ATOM   3674  N  ND2 . ASN A 1 481 ? 74.791 96.109  5.632   1.00 47.59 ? 481 ASN A ND2 1 
ATOM   3675  N  N   . PHE A 1 482 ? 73.887 94.128  0.816   1.00 49.68 ? 482 PHE A N   1 
ATOM   3676  C  CA  . PHE A 1 482 ? 73.111 93.413  -0.186  1.00 50.67 ? 482 PHE A CA  1 
ATOM   3677  C  C   . PHE A 1 482 ? 74.087 92.833  -1.203  1.00 51.46 ? 482 PHE A C   1 
ATOM   3678  O  O   . PHE A 1 482 ? 73.925 91.697  -1.643  1.00 52.44 ? 482 PHE A O   1 
ATOM   3679  C  CB  . PHE A 1 482 ? 72.114 94.347  -0.880  1.00 50.23 ? 482 PHE A CB  1 
ATOM   3680  C  CG  . PHE A 1 482 ? 70.911 94.687  -0.039  1.00 50.15 ? 482 PHE A CG  1 
ATOM   3681  C  CD1 . PHE A 1 482 ? 70.037 93.686  0.389   1.00 50.20 ? 482 PHE A CD1 1 
ATOM   3682  C  CD2 . PHE A 1 482 ? 70.643 96.006  0.324   1.00 49.96 ? 482 PHE A CD2 1 
ATOM   3683  C  CE1 . PHE A 1 482 ? 68.910 93.996  1.166   1.00 49.65 ? 482 PHE A CE1 1 
ATOM   3684  C  CE2 . PHE A 1 482 ? 69.518 96.325  1.103   1.00 49.35 ? 482 PHE A CE2 1 
ATOM   3685  C  CZ  . PHE A 1 482 ? 68.655 95.320  1.522   1.00 49.32 ? 482 PHE A CZ  1 
ATOM   3686  N  N   . THR A 1 483 ? 75.109 93.607  -1.562  1.00 51.76 ? 483 THR A N   1 
ATOM   3687  C  CA  . THR A 1 483 ? 76.110 93.141  -2.519  1.00 52.41 ? 483 THR A CA  1 
ATOM   3688  C  C   . THR A 1 483 ? 76.856 91.918  -1.977  1.00 52.97 ? 483 THR A C   1 
ATOM   3689  O  O   . THR A 1 483 ? 77.295 91.047  -2.737  1.00 52.83 ? 483 THR A O   1 
ATOM   3690  C  CB  . THR A 1 483 ? 77.128 94.250  -2.843  1.00 52.26 ? 483 THR A CB  1 
ATOM   3691  O  OG1 . THR A 1 483 ? 76.487 95.281  -3.607  1.00 53.28 ? 483 THR A OG1 1 
ATOM   3692  C  CG2 . THR A 1 483 ? 78.279 93.693  -3.648  1.00 52.28 ? 483 THR A CG2 1 
ATOM   3693  N  N   . GLU A 1 484 ? 76.995 91.867  -0.655  1.00 53.38 ? 484 GLU A N   1 
ATOM   3694  C  CA  . GLU A 1 484 ? 77.660 90.765  0.025   1.00 53.26 ? 484 GLU A CA  1 
ATOM   3695  C  C   . GLU A 1 484 ? 76.864 89.484  -0.154  1.00 52.91 ? 484 GLU A C   1 
ATOM   3696  O  O   . GLU A 1 484 ? 77.423 88.390  -0.161  1.00 52.67 ? 484 GLU A O   1 
ATOM   3697  C  CB  . GLU A 1 484 ? 77.769 91.080  1.508   1.00 54.73 ? 484 GLU A CB  1 
ATOM   3698  C  CG  . GLU A 1 484 ? 79.050 91.745  1.905   1.00 56.62 ? 484 GLU A CG  1 
ATOM   3699  C  CD  . GLU A 1 484 ? 80.166 90.743  1.995   1.00 58.35 ? 484 GLU A CD  1 
ATOM   3700  O  OE1 . GLU A 1 484 ? 80.020 89.777  2.787   1.00 58.61 ? 484 GLU A OE1 1 
ATOM   3701  O  OE2 . GLU A 1 484 ? 81.180 90.917  1.274   1.00 59.74 ? 484 GLU A OE2 1 
ATOM   3702  N  N   . VAL A 1 485 ? 75.550 89.631  -0.278  1.00 52.41 ? 485 VAL A N   1 
ATOM   3703  C  CA  . VAL A 1 485 ? 74.657 88.494  -0.463  1.00 52.25 ? 485 VAL A CA  1 
ATOM   3704  C  C   . VAL A 1 485 ? 74.823 88.003  -1.887  1.00 52.16 ? 485 VAL A C   1 
ATOM   3705  O  O   . VAL A 1 485 ? 74.852 86.806  -2.156  1.00 52.12 ? 485 VAL A O   1 
ATOM   3706  C  CB  . VAL A 1 485 ? 73.189 88.906  -0.258  1.00 51.95 ? 485 VAL A CB  1 
ATOM   3707  C  CG1 . VAL A 1 485 ? 72.271 87.698  -0.412  1.00 51.84 ? 485 VAL A CG1 1 
ATOM   3708  C  CG2 . VAL A 1 485 ? 73.026 89.538  1.105   1.00 52.09 ? 485 VAL A CG2 1 
ATOM   3709  N  N   . HIS A 1 486 ? 74.929 88.960  -2.796  1.00 52.80 ? 486 HIS A N   1 
ATOM   3710  C  CA  . HIS A 1 486 ? 75.093 88.681  -4.209  1.00 53.29 ? 486 HIS A CA  1 
ATOM   3711  C  C   . HIS A 1 486 ? 75.310 90.007  -4.930  1.00 53.68 ? 486 HIS A C   1 
ATOM   3712  O  O   . HIS A 1 486 ? 74.634 91.002  -4.648  1.00 53.77 ? 486 HIS A O   1 
ATOM   3713  C  CB  . HIS A 1 486 ? 73.853 87.988  -4.762  1.00 53.56 ? 486 HIS A CB  1 
ATOM   3714  C  CG  . HIS A 1 486 ? 74.012 87.520  -6.172  1.00 54.86 ? 486 HIS A CG  1 
ATOM   3715  N  ND1 . HIS A 1 486 ? 74.349 88.372  -7.204  1.00 55.27 ? 486 HIS A ND1 1 
ATOM   3716  C  CD2 . HIS A 1 486 ? 73.910 86.285  -6.720  1.00 54.65 ? 486 HIS A CD2 1 
ATOM   3717  C  CE1 . HIS A 1 486 ? 74.450 87.679  -8.325  1.00 55.38 ? 486 HIS A CE1 1 
ATOM   3718  N  NE2 . HIS A 1 486 ? 74.189 86.411  -8.059  1.00 55.07 ? 486 HIS A NE2 1 
ATOM   3719  N  N   . PRO A 1 487 ? 76.269 90.043  -5.866  1.00 54.02 ? 487 PRO A N   1 
ATOM   3720  C  CA  . PRO A 1 487 ? 76.574 91.258  -6.628  1.00 53.87 ? 487 PRO A CA  1 
ATOM   3721  C  C   . PRO A 1 487 ? 75.398 91.839  -7.411  1.00 53.82 ? 487 PRO A C   1 
ATOM   3722  O  O   . PRO A 1 487 ? 75.337 93.050  -7.631  1.00 53.81 ? 487 PRO A O   1 
ATOM   3723  C  CB  . PRO A 1 487 ? 77.737 90.822  -7.522  1.00 53.68 ? 487 PRO A CB  1 
ATOM   3724  C  CG  . PRO A 1 487 ? 77.552 89.335  -7.644  1.00 53.87 ? 487 PRO A CG  1 
ATOM   3725  C  CD  . PRO A 1 487 ? 77.172 88.945  -6.250  1.00 54.08 ? 487 PRO A CD  1 
ATOM   3726  N  N   . ASP A 1 488 ? 74.460 90.987  -7.816  1.00 53.93 ? 488 ASP A N   1 
ATOM   3727  C  CA  . ASP A 1 488 ? 73.291 91.455  -8.562  1.00 54.57 ? 488 ASP A CA  1 
ATOM   3728  C  C   . ASP A 1 488 ? 72.253 92.089  -7.651  1.00 54.09 ? 488 ASP A C   1 
ATOM   3729  O  O   . ASP A 1 488 ? 71.592 93.058  -8.029  1.00 53.68 ? 488 ASP A O   1 
ATOM   3730  C  CB  . ASP A 1 488 ? 72.641 90.303  -9.321  1.00 55.92 ? 488 ASP A CB  1 
ATOM   3731  C  CG  . ASP A 1 488 ? 73.462 89.858  -10.507 1.00 57.65 ? 488 ASP A CG  1 
ATOM   3732  O  OD1 . ASP A 1 488 ? 73.107 88.811  -11.095 1.00 59.09 ? 488 ASP A OD1 1 
ATOM   3733  O  OD2 . ASP A 1 488 ? 74.452 90.555  -10.851 1.00 58.30 ? 488 ASP A OD2 1 
ATOM   3734  N  N   . TYR A 1 489 ? 72.108 91.512  -6.459  1.00 53.77 ? 489 TYR A N   1 
ATOM   3735  C  CA  . TYR A 1 489 ? 71.167 91.988  -5.448  1.00 53.03 ? 489 TYR A CA  1 
ATOM   3736  C  C   . TYR A 1 489 ? 71.558 93.423  -5.083  1.00 53.25 ? 489 TYR A C   1 
ATOM   3737  O  O   . TYR A 1 489 ? 70.754 94.358  -5.197  1.00 53.21 ? 489 TYR A O   1 
ATOM   3738  C  CB  . TYR A 1 489 ? 71.251 91.083  -4.210  1.00 51.75 ? 489 TYR A CB  1 
ATOM   3739  C  CG  . TYR A 1 489 ? 70.138 91.260  -3.201  1.00 50.28 ? 489 TYR A CG  1 
ATOM   3740  C  CD1 . TYR A 1 489 ? 69.110 92.175  -3.413  1.00 49.69 ? 489 TYR A CD1 1 
ATOM   3741  C  CD2 . TYR A 1 489 ? 70.104 90.488  -2.042  1.00 50.13 ? 489 TYR A CD2 1 
ATOM   3742  C  CE1 . TYR A 1 489 ? 68.074 92.315  -2.499  1.00 49.41 ? 489 TYR A CE1 1 
ATOM   3743  C  CE2 . TYR A 1 489 ? 69.072 90.618  -1.121  1.00 49.43 ? 489 TYR A CE2 1 
ATOM   3744  C  CZ  . TYR A 1 489 ? 68.058 91.532  -1.355  1.00 49.53 ? 489 TYR A CZ  1 
ATOM   3745  O  OH  . TYR A 1 489 ? 67.022 91.650  -0.452  1.00 49.23 ? 489 TYR A OH  1 
ATOM   3746  N  N   . GLY A 1 490 ? 72.806 93.587  -4.658  1.00 53.00 ? 490 GLY A N   1 
ATOM   3747  C  CA  . GLY A 1 490 ? 73.285 94.902  -4.301  1.00 53.11 ? 490 GLY A CA  1 
ATOM   3748  C  C   . GLY A 1 490 ? 73.290 95.878  -5.466  1.00 53.46 ? 490 GLY A C   1 
ATOM   3749  O  O   . GLY A 1 490 ? 72.765 96.984  -5.335  1.00 54.13 ? 490 GLY A O   1 
ATOM   3750  N  N   . SER A 1 491 ? 73.856 95.481  -6.607  1.00 53.10 ? 491 SER A N   1 
ATOM   3751  C  CA  . SER A 1 491 ? 73.940 96.377  -7.765  1.00 52.96 ? 491 SER A CA  1 
ATOM   3752  C  C   . SER A 1 491 ? 72.609 96.865  -8.334  1.00 52.43 ? 491 SER A C   1 
ATOM   3753  O  O   . SER A 1 491 ? 72.491 98.032  -8.709  1.00 52.43 ? 491 SER A O   1 
ATOM   3754  C  CB  . SER A 1 491 ? 74.750 95.731  -8.894  1.00 53.09 ? 491 SER A CB  1 
ATOM   3755  O  OG  . SER A 1 491 ? 73.926 94.929  -9.724  1.00 54.22 ? 491 SER A OG  1 
ATOM   3756  N  N   . HIS A 1 492 ? 71.614 95.987  -8.411  1.00 52.36 ? 492 HIS A N   1 
ATOM   3757  C  CA  . HIS A 1 492 ? 70.307 96.373  -8.949  1.00 52.51 ? 492 HIS A CA  1 
ATOM   3758  C  C   . HIS A 1 492 ? 69.636 97.451  -8.089  1.00 51.51 ? 492 HIS A C   1 
ATOM   3759  O  O   . HIS A 1 492 ? 69.058 98.419  -8.611  1.00 50.81 ? 492 HIS A O   1 
ATOM   3760  C  CB  . HIS A 1 492 ? 69.387 95.158  -9.041  1.00 54.49 ? 492 HIS A CB  1 
ATOM   3761  C  CG  . HIS A 1 492 ? 68.056 95.456  -9.660  1.00 57.55 ? 492 HIS A CG  1 
ATOM   3762  N  ND1 . HIS A 1 492 ? 66.962 94.625  -9.514  1.00 59.37 ? 492 HIS A ND1 1 
ATOM   3763  C  CD2 . HIS A 1 492 ? 67.644 96.487  -10.439 1.00 58.57 ? 492 HIS A CD2 1 
ATOM   3764  C  CE1 . HIS A 1 492 ? 65.934 95.132  -10.176 1.00 59.74 ? 492 HIS A CE1 1 
ATOM   3765  N  NE2 . HIS A 1 492 ? 66.321 96.261  -10.746 1.00 59.82 ? 492 HIS A NE2 1 
ATOM   3766  N  N   . ILE A 1 493 ? 69.703 97.265  -6.772  1.00 50.26 ? 493 ILE A N   1 
ATOM   3767  C  CA  . ILE A 1 493 ? 69.128 98.215  -5.823  1.00 48.57 ? 493 ILE A CA  1 
ATOM   3768  C  C   . ILE A 1 493 ? 69.800 99.571  -6.055  1.00 48.22 ? 493 ILE A C   1 
ATOM   3769  O  O   . ILE A 1 493 ? 69.140 100.609 -6.180  1.00 47.33 ? 493 ILE A O   1 
ATOM   3770  C  CB  . ILE A 1 493 ? 69.361 97.723  -4.366  1.00 47.75 ? 493 ILE A CB  1 
ATOM   3771  C  CG1 . ILE A 1 493 ? 68.450 96.523  -4.079  1.00 47.18 ? 493 ILE A CG1 1 
ATOM   3772  C  CG2 . ILE A 1 493 ? 69.109 98.845  -3.374  1.00 47.59 ? 493 ILE A CG2 1 
ATOM   3773  C  CD1 . ILE A 1 493 ? 68.646 95.888  -2.712  1.00 46.30 ? 493 ILE A CD1 1 
ATOM   3774  N  N   . GLN A 1 494 ? 71.125 99.541  -6.133  1.00 48.33 ? 494 GLN A N   1 
ATOM   3775  C  CA  . GLN A 1 494 ? 71.905 100.740 -6.369  1.00 48.68 ? 494 GLN A CA  1 
ATOM   3776  C  C   . GLN A 1 494 ? 71.367 101.455 -7.593  1.00 49.43 ? 494 GLN A C   1 
ATOM   3777  O  O   . GLN A 1 494 ? 71.127 102.666 -7.570  1.00 49.46 ? 494 GLN A O   1 
ATOM   3778  C  CB  . GLN A 1 494 ? 73.369 100.384 -6.605  1.00 48.27 ? 494 GLN A CB  1 
ATOM   3779  C  CG  . GLN A 1 494 ? 74.225 101.607 -6.693  1.00 47.73 ? 494 GLN A CG  1 
ATOM   3780  C  CD  . GLN A 1 494 ? 73.954 102.532 -5.534  1.00 47.95 ? 494 GLN A CD  1 
ATOM   3781  O  OE1 . GLN A 1 494 ? 74.483 102.347 -4.436  1.00 47.61 ? 494 GLN A OE1 1 
ATOM   3782  N  NE2 . GLN A 1 494 ? 73.095 103.520 -5.761  1.00 47.72 ? 494 GLN A NE2 1 
ATOM   3783  N  N   . ALA A 1 495 ? 71.182 100.691 -8.667  1.00 50.14 ? 495 ALA A N   1 
ATOM   3784  C  CA  . ALA A 1 495 ? 70.665 101.234 -9.916  1.00 50.54 ? 495 ALA A CA  1 
ATOM   3785  C  C   . ALA A 1 495 ? 69.367 101.986 -9.651  1.00 50.83 ? 495 ALA A C   1 
ATOM   3786  O  O   . ALA A 1 495 ? 69.252 103.175 -9.967  1.00 51.08 ? 495 ALA A O   1 
ATOM   3787  C  CB  . ALA A 1 495 ? 70.427 100.109 -10.915 1.00 50.21 ? 495 ALA A CB  1 
ATOM   3788  N  N   . LEU A 1 496 ? 68.397 101.289 -9.061  1.00 51.02 ? 496 LEU A N   1 
ATOM   3789  C  CA  . LEU A 1 496 ? 67.107 101.885 -8.746  1.00 51.03 ? 496 LEU A CA  1 
ATOM   3790  C  C   . LEU A 1 496 ? 67.295 103.138 -7.897  1.00 51.13 ? 496 LEU A C   1 
ATOM   3791  O  O   . LEU A 1 496 ? 66.730 104.194 -8.206  1.00 50.99 ? 496 LEU A O   1 
ATOM   3792  C  CB  . LEU A 1 496 ? 66.226 100.868 -8.018  1.00 51.91 ? 496 LEU A CB  1 
ATOM   3793  C  CG  . LEU A 1 496 ? 65.693 99.721  -8.893  1.00 52.55 ? 496 LEU A CG  1 
ATOM   3794  C  CD1 . LEU A 1 496 ? 65.098 98.591  -8.035  1.00 51.37 ? 496 LEU A CD1 1 
ATOM   3795  C  CD2 . LEU A 1 496 ? 64.647 100.291 -9.849  1.00 51.85 ? 496 LEU A CD2 1 
ATOM   3796  N  N   . LEU A 1 497 ? 68.092 103.027 -6.834  1.00 50.65 ? 497 LEU A N   1 
ATOM   3797  C  CA  . LEU A 1 497 ? 68.356 104.174 -5.967  1.00 50.38 ? 497 LEU A CA  1 
ATOM   3798  C  C   . LEU A 1 497 ? 68.842 105.371 -6.777  1.00 50.87 ? 497 LEU A C   1 
ATOM   3799  O  O   . LEU A 1 497 ? 68.368 106.493 -6.595  1.00 51.19 ? 497 LEU A O   1 
ATOM   3800  C  CB  . LEU A 1 497 ? 69.414 103.827 -4.923  1.00 49.30 ? 497 LEU A CB  1 
ATOM   3801  C  CG  . LEU A 1 497 ? 69.002 102.860 -3.820  1.00 48.42 ? 497 LEU A CG  1 
ATOM   3802  C  CD1 . LEU A 1 497 ? 70.207 102.530 -2.951  1.00 47.35 ? 497 LEU A CD1 1 
ATOM   3803  C  CD2 . LEU A 1 497 ? 67.885 103.482 -2.997  1.00 47.50 ? 497 LEU A CD2 1 
ATOM   3804  N  N   . ASP A 1 498 ? 69.797 105.130 -7.668  1.00 51.77 ? 498 ASP A N   1 
ATOM   3805  C  CA  . ASP A 1 498 ? 70.339 106.199 -8.497  1.00 53.00 ? 498 ASP A CA  1 
ATOM   3806  C  C   . ASP A 1 498 ? 69.239 107.012 -9.168  1.00 53.77 ? 498 ASP A C   1 
ATOM   3807  O  O   . ASP A 1 498 ? 69.327 108.240 -9.253  1.00 53.48 ? 498 ASP A O   1 
ATOM   3808  C  CB  . ASP A 1 498 ? 71.279 105.629 -9.558  1.00 52.84 ? 498 ASP A CB  1 
ATOM   3809  C  CG  . ASP A 1 498 ? 72.566 105.106 -8.965  1.00 53.28 ? 498 ASP A CG  1 
ATOM   3810  O  OD1 . ASP A 1 498 ? 73.111 105.774 -8.059  1.00 53.67 ? 498 ASP A OD1 1 
ATOM   3811  O  OD2 . ASP A 1 498 ? 73.045 104.039 -9.403  1.00 54.15 ? 498 ASP A OD2 1 
ATOM   3812  N  N   . LYS A 1 499 ? 68.199 106.334 -9.637  1.00 54.68 ? 499 LYS A N   1 
ATOM   3813  C  CA  . LYS A 1 499 ? 67.107 107.044 -10.284 1.00 56.42 ? 499 LYS A CA  1 
ATOM   3814  C  C   . LYS A 1 499 ? 66.388 107.921 -9.257  1.00 56.42 ? 499 LYS A C   1 
ATOM   3815  O  O   . LYS A 1 499 ? 66.041 109.067 -9.545  1.00 56.98 ? 499 LYS A O   1 
ATOM   3816  C  CB  . LYS A 1 499 ? 66.119 106.058 -10.921 1.00 58.05 ? 499 LYS A CB  1 
ATOM   3817  C  CG  . LYS A 1 499 ? 66.766 104.975 -11.806 1.00 60.34 ? 499 LYS A CG  1 
ATOM   3818  C  CD  . LYS A 1 499 ? 67.663 105.540 -12.932 1.00 61.99 ? 499 LYS A CD  1 
ATOM   3819  C  CE  . LYS A 1 499 ? 66.876 106.389 -13.940 1.00 63.71 ? 499 LYS A CE  1 
ATOM   3820  N  NZ  . LYS A 1 499 ? 65.695 105.675 -14.523 1.00 64.12 ? 499 LYS A NZ  1 
ATOM   3821  N  N   . TYR A 1 500 ? 66.184 107.385 -8.055  1.00 56.27 ? 500 TYR A N   1 
ATOM   3822  C  CA  . TYR A 1 500 ? 65.506 108.121 -6.985  1.00 55.85 ? 500 TYR A CA  1 
ATOM   3823  C  C   . TYR A 1 500 ? 66.299 109.344 -6.536  1.00 56.23 ? 500 TYR A C   1 
ATOM   3824  O  O   . TYR A 1 500 ? 65.731 110.411 -6.294  1.00 55.71 ? 500 TYR A O   1 
ATOM   3825  C  CB  . TYR A 1 500 ? 65.258 107.205 -5.780  1.00 55.13 ? 500 TYR A CB  1 
ATOM   3826  C  CG  . TYR A 1 500 ? 64.069 106.268 -5.920  1.00 54.31 ? 500 TYR A CG  1 
ATOM   3827  C  CD1 . TYR A 1 500 ? 62.778 106.772 -6.075  1.00 54.01 ? 500 TYR A CD1 1 
ATOM   3828  C  CD2 . TYR A 1 500 ? 64.230 104.879 -5.856  1.00 53.81 ? 500 TYR A CD2 1 
ATOM   3829  C  CE1 . TYR A 1 500 ? 61.672 105.918 -6.158  1.00 54.04 ? 500 TYR A CE1 1 
ATOM   3830  C  CE2 . TYR A 1 500 ? 63.130 104.014 -5.940  1.00 53.45 ? 500 TYR A CE2 1 
ATOM   3831  C  CZ  . TYR A 1 500 ? 61.853 104.543 -6.087  1.00 53.95 ? 500 TYR A CZ  1 
ATOM   3832  O  OH  . TYR A 1 500 ? 60.749 103.716 -6.126  1.00 53.83 ? 500 TYR A OH  1 
ATOM   3833  N  N   . ASN A 1 501 ? 67.612 109.192 -6.414  1.00 57.13 ? 501 ASN A N   1 
ATOM   3834  C  CA  . ASN A 1 501 ? 68.443 110.313 -5.988  1.00 58.39 ? 501 ASN A CA  1 
ATOM   3835  C  C   . ASN A 1 501 ? 68.615 111.324 -7.119  1.00 59.00 ? 501 ASN A C   1 
ATOM   3836  O  O   . ASN A 1 501 ? 69.024 112.464 -6.892  1.00 59.25 ? 501 ASN A O   1 
ATOM   3837  C  CB  . ASN A 1 501 ? 69.810 109.818 -5.508  1.00 58.52 ? 501 ASN A CB  1 
ATOM   3838  C  CG  . ASN A 1 501 ? 69.704 108.869 -4.319  1.00 59.45 ? 501 ASN A CG  1 
ATOM   3839  O  OD1 . ASN A 1 501 ? 68.993 109.142 -3.340  1.00 60.16 ? 501 ASN A OD1 1 
ATOM   3840  N  ND2 . ASN A 1 501 ? 70.417 107.751 -4.394  1.00 59.50 ? 501 ASN A ND2 1 
ATOM   3841  N  N   . ALA A 1 502 ? 68.295 110.906 -8.340  1.00 59.56 ? 502 ALA A N   1 
ATOM   3842  C  CA  . ALA A 1 502 ? 68.399 111.793 -9.491  1.00 59.87 ? 502 ALA A CA  1 
ATOM   3843  C  C   . ALA A 1 502 ? 67.224 112.774 -9.491  1.00 60.41 ? 502 ALA A C   1 
ATOM   3844  O  O   . ALA A 1 502 ? 66.318 112.617 -8.642  1.00 60.71 ? 502 ALA A O   1 
ATOM   3845  C  CB  . ALA A 1 502 ? 68.398 110.982 -10.768 1.00 59.35 ? 502 ALA A CB  1 
ATOM   3846  N  N   . ASP B 1 25  ? 53.020 133.709 52.080  1.00 57.06 ? 25  ASP B N   1 
ATOM   3847  C  CA  . ASP B 1 25  ? 52.911 132.621 51.059  1.00 56.64 ? 25  ASP B CA  1 
ATOM   3848  C  C   . ASP B 1 25  ? 51.455 132.468 50.621  1.00 55.28 ? 25  ASP B C   1 
ATOM   3849  O  O   . ASP B 1 25  ? 50.569 132.318 51.465  1.00 55.52 ? 25  ASP B O   1 
ATOM   3850  C  CB  . ASP B 1 25  ? 53.431 131.304 51.654  1.00 58.35 ? 25  ASP B CB  1 
ATOM   3851  C  CG  . ASP B 1 25  ? 54.695 130.808 50.958  1.00 60.06 ? 25  ASP B CG  1 
ATOM   3852  O  OD1 . ASP B 1 25  ? 55.465 131.666 50.454  1.00 60.93 ? 25  ASP B OD1 1 
ATOM   3853  O  OD2 . ASP B 1 25  ? 54.923 129.571 50.926  1.00 60.49 ? 25  ASP B OD2 1 
ATOM   3854  N  N   . VAL B 1 26  ? 51.205 132.504 49.311  1.00 53.14 ? 26  VAL B N   1 
ATOM   3855  C  CA  . VAL B 1 26  ? 49.833 132.381 48.800  1.00 50.74 ? 26  VAL B CA  1 
ATOM   3856  C  C   . VAL B 1 26  ? 49.374 130.941 48.568  1.00 48.78 ? 26  VAL B C   1 
ATOM   3857  O  O   . VAL B 1 26  ? 49.968 130.206 47.778  1.00 48.64 ? 26  VAL B O   1 
ATOM   3858  C  CB  . VAL B 1 26  ? 49.656 133.142 47.474  1.00 51.05 ? 26  VAL B CB  1 
ATOM   3859  C  CG1 . VAL B 1 26  ? 48.182 133.233 47.130  1.00 50.73 ? 26  VAL B CG1 1 
ATOM   3860  C  CG2 . VAL B 1 26  ? 50.279 134.526 47.578  1.00 51.60 ? 26  VAL B CG2 1 
ATOM   3861  N  N   . LEU B 1 27  ? 48.303 130.554 49.253  1.00 46.27 ? 27  LEU B N   1 
ATOM   3862  C  CA  . LEU B 1 27  ? 47.750 129.210 49.136  1.00 43.96 ? 27  LEU B CA  1 
ATOM   3863  C  C   . LEU B 1 27  ? 47.174 128.962 47.737  1.00 42.30 ? 27  LEU B C   1 
ATOM   3864  O  O   . LEU B 1 27  ? 46.235 129.634 47.312  1.00 41.75 ? 27  LEU B O   1 
ATOM   3865  C  CB  . LEU B 1 27  ? 46.670 129.020 50.199  1.00 44.04 ? 27  LEU B CB  1 
ATOM   3866  C  CG  . LEU B 1 27  ? 46.015 127.649 50.346  1.00 44.04 ? 27  LEU B CG  1 
ATOM   3867  C  CD1 . LEU B 1 27  ? 47.063 126.567 50.354  1.00 44.49 ? 27  LEU B CD1 1 
ATOM   3868  C  CD2 . LEU B 1 27  ? 45.222 127.616 51.642  1.00 44.37 ? 27  LEU B CD2 1 
ATOM   3869  N  N   . THR B 1 28  ? 47.723 127.980 47.031  1.00 39.85 ? 28  THR B N   1 
ATOM   3870  C  CA  . THR B 1 28  ? 47.263 127.696 45.680  1.00 38.92 ? 28  THR B CA  1 
ATOM   3871  C  C   . THR B 1 28  ? 46.708 126.299 45.425  1.00 38.15 ? 28  THR B C   1 
ATOM   3872  O  O   . THR B 1 28  ? 46.734 125.418 46.290  1.00 38.07 ? 28  THR B O   1 
ATOM   3873  C  CB  . THR B 1 28  ? 48.398 127.874 44.665  1.00 39.06 ? 28  THR B CB  1 
ATOM   3874  O  OG1 . THR B 1 28  ? 49.346 126.816 44.842  1.00 37.84 ? 28  THR B OG1 1 
ATOM   3875  C  CG2 . THR B 1 28  ? 49.088 129.217 44.851  1.00 38.85 ? 28  THR B CG2 1 
ATOM   3876  N  N   . THR B 1 29  ? 46.195 126.119 44.212  1.00 36.80 ? 29  THR B N   1 
ATOM   3877  C  CA  . THR B 1 29  ? 45.694 124.827 43.781  1.00 35.76 ? 29  THR B CA  1 
ATOM   3878  C  C   . THR B 1 29  ? 46.921 124.179 43.157  1.00 35.30 ? 29  THR B C   1 
ATOM   3879  O  O   . THR B 1 29  ? 47.945 124.838 42.961  1.00 34.73 ? 29  THR B O   1 
ATOM   3880  C  CB  . THR B 1 29  ? 44.587 124.945 42.705  1.00 34.99 ? 29  THR B CB  1 
ATOM   3881  O  OG1 . THR B 1 29  ? 45.055 125.740 41.611  1.00 34.37 ? 29  THR B OG1 1 
ATOM   3882  C  CG2 . THR B 1 29  ? 43.335 125.572 43.294  1.00 34.72 ? 29  THR B CG2 1 
ATOM   3883  N  N   . GLY B 1 30  ? 46.821 122.893 42.852  1.00 35.40 ? 30  GLY B N   1 
ATOM   3884  C  CA  . GLY B 1 30  ? 47.939 122.190 42.253  1.00 34.74 ? 30  GLY B CA  1 
ATOM   3885  C  C   . GLY B 1 30  ? 48.467 122.881 41.012  1.00 34.59 ? 30  GLY B C   1 
ATOM   3886  O  O   . GLY B 1 30  ? 49.639 122.736 40.689  1.00 35.51 ? 30  GLY B O   1 
ATOM   3887  N  N   . ALA B 1 31  ? 47.617 123.636 40.322  1.00 34.10 ? 31  ALA B N   1 
ATOM   3888  C  CA  . ALA B 1 31  ? 48.030 124.334 39.110  1.00 33.48 ? 31  ALA B CA  1 
ATOM   3889  C  C   . ALA B 1 31  ? 48.486 125.769 39.382  1.00 33.69 ? 31  ALA B C   1 
ATOM   3890  O  O   . ALA B 1 31  ? 48.696 126.558 38.450  1.00 32.84 ? 31  ALA B O   1 
ATOM   3891  C  CB  . ALA B 1 31  ? 46.898 124.322 38.098  1.00 34.08 ? 31  ALA B CB  1 
ATOM   3892  N  N   . GLY B 1 32  ? 48.619 126.105 40.664  1.00 33.49 ? 32  GLY B N   1 
ATOM   3893  C  CA  . GLY B 1 32  ? 49.081 127.426 41.047  1.00 32.62 ? 32  GLY B CA  1 
ATOM   3894  C  C   . GLY B 1 32  ? 48.078 128.555 41.060  1.00 33.01 ? 32  GLY B C   1 
ATOM   3895  O  O   . GLY B 1 32  ? 48.459 129.714 41.129  1.00 34.01 ? 32  GLY B O   1 
ATOM   3896  N  N   . ASN B 1 33  ? 46.797 128.243 41.001  1.00 33.69 ? 33  ASN B N   1 
ATOM   3897  C  CA  . ASN B 1 33  ? 45.791 129.290 41.018  1.00 34.94 ? 33  ASN B CA  1 
ATOM   3898  C  C   . ASN B 1 33  ? 45.520 129.686 42.464  1.00 35.56 ? 33  ASN B C   1 
ATOM   3899  O  O   . ASN B 1 33  ? 45.195 128.845 43.297  1.00 36.07 ? 33  ASN B O   1 
ATOM   3900  C  CB  . ASN B 1 33  ? 44.502 128.790 40.371  1.00 35.78 ? 33  ASN B CB  1 
ATOM   3901  C  CG  . ASN B 1 33  ? 44.708 128.324 38.940  1.00 36.35 ? 33  ASN B CG  1 
ATOM   3902  O  OD1 . ASN B 1 33  ? 44.005 127.425 38.473  1.00 37.03 ? 33  ASN B OD1 1 
ATOM   3903  N  ND2 . ASN B 1 33  ? 45.666 128.933 38.235  1.00 33.84 ? 33  ASN B ND2 1 
ATOM   3904  N  N   . PRO B 1 34  ? 45.655 130.975 42.782  1.00 35.58 ? 34  PRO B N   1 
ATOM   3905  C  CA  . PRO B 1 34  ? 45.410 131.424 44.153  1.00 35.53 ? 34  PRO B CA  1 
ATOM   3906  C  C   . PRO B 1 34  ? 44.041 130.967 44.623  1.00 35.55 ? 34  PRO B C   1 
ATOM   3907  O  O   . PRO B 1 34  ? 43.106 130.917 43.833  1.00 35.67 ? 34  PRO B O   1 
ATOM   3908  C  CB  . PRO B 1 34  ? 45.502 132.936 44.033  1.00 35.83 ? 34  PRO B CB  1 
ATOM   3909  C  CG  . PRO B 1 34  ? 46.502 133.111 42.911  1.00 36.00 ? 34  PRO B CG  1 
ATOM   3910  C  CD  . PRO B 1 34  ? 46.033 132.099 41.910  1.00 34.97 ? 34  PRO B CD  1 
ATOM   3911  N  N   . VAL B 1 35  ? 43.928 130.632 45.907  1.00 36.33 ? 35  VAL B N   1 
ATOM   3912  C  CA  . VAL B 1 35  ? 42.661 130.181 46.497  1.00 36.09 ? 35  VAL B CA  1 
ATOM   3913  C  C   . VAL B 1 35  ? 42.080 131.312 47.329  1.00 36.48 ? 35  VAL B C   1 
ATOM   3914  O  O   . VAL B 1 35  ? 42.805 131.971 48.074  1.00 37.30 ? 35  VAL B O   1 
ATOM   3915  C  CB  . VAL B 1 35  ? 42.876 128.962 47.417  1.00 36.42 ? 35  VAL B CB  1 
ATOM   3916  C  CG1 . VAL B 1 35  ? 41.570 128.579 48.100  1.00 36.43 ? 35  VAL B CG1 1 
ATOM   3917  C  CG2 . VAL B 1 35  ? 43.437 127.800 46.612  1.00 35.28 ? 35  VAL B CG2 1 
ATOM   3918  N  N   . GLY B 1 36  ? 40.777 131.545 47.203  1.00 36.96 ? 36  GLY B N   1 
ATOM   3919  C  CA  . GLY B 1 36  ? 40.153 132.620 47.955  1.00 36.51 ? 36  GLY B CA  1 
ATOM   3920  C  C   . GLY B 1 36  ? 39.856 132.211 49.380  1.00 36.69 ? 36  GLY B C   1 
ATOM   3921  O  O   . GLY B 1 36  ? 40.156 132.933 50.331  1.00 37.31 ? 36  GLY B O   1 
ATOM   3922  N  N   . ASP B 1 37  ? 39.260 131.039 49.524  1.00 36.45 ? 37  ASP B N   1 
ATOM   3923  C  CA  . ASP B 1 37  ? 38.914 130.512 50.830  1.00 36.69 ? 37  ASP B CA  1 
ATOM   3924  C  C   . ASP B 1 37  ? 38.985 128.999 50.750  1.00 36.18 ? 37  ASP B C   1 
ATOM   3925  O  O   . ASP B 1 37  ? 38.312 128.390 49.920  1.00 36.63 ? 37  ASP B O   1 
ATOM   3926  C  CB  . ASP B 1 37  ? 37.496 130.948 51.212  1.00 37.59 ? 37  ASP B CB  1 
ATOM   3927  C  CG  . ASP B 1 37  ? 37.041 130.381 52.554  1.00 38.12 ? 37  ASP B CG  1 
ATOM   3928  O  OD1 . ASP B 1 37  ? 35.903 130.685 52.968  1.00 38.66 ? 37  ASP B OD1 1 
ATOM   3929  O  OD2 . ASP B 1 37  ? 37.813 129.634 53.191  1.00 39.17 ? 37  ASP B OD2 1 
ATOM   3930  N  N   . LYS B 1 38  ? 39.804 128.394 51.602  1.00 35.15 ? 38  LYS B N   1 
ATOM   3931  C  CA  . LYS B 1 38  ? 39.936 126.947 51.596  1.00 34.43 ? 38  LYS B CA  1 
ATOM   3932  C  C   . LYS B 1 38  ? 39.508 126.371 52.932  1.00 34.87 ? 38  LYS B C   1 
ATOM   3933  O  O   . LYS B 1 38  ? 40.042 125.353 53.380  1.00 34.96 ? 38  LYS B O   1 
ATOM   3934  C  CB  . LYS B 1 38  ? 41.376 126.526 51.288  1.00 33.25 ? 38  LYS B CB  1 
ATOM   3935  C  CG  . LYS B 1 38  ? 41.483 125.132 50.685  1.00 30.98 ? 38  LYS B CG  1 
ATOM   3936  C  CD  . LYS B 1 38  ? 42.892 124.584 50.812  1.00 31.45 ? 38  LYS B CD  1 
ATOM   3937  C  CE  . LYS B 1 38  ? 43.186 124.132 52.236  1.00 30.06 ? 38  LYS B CE  1 
ATOM   3938  N  NZ  . LYS B 1 38  ? 42.137 123.182 52.710  1.00 30.36 ? 38  LYS B NZ  1 
ATOM   3939  N  N   . LEU B 1 39  ? 38.538 127.032 53.560  1.00 34.92 ? 39  LEU B N   1 
ATOM   3940  C  CA  . LEU B 1 39  ? 38.005 126.586 54.839  1.00 34.80 ? 39  LEU B CA  1 
ATOM   3941  C  C   . LEU B 1 39  ? 36.515 126.269 54.738  1.00 34.95 ? 39  LEU B C   1 
ATOM   3942  O  O   . LEU B 1 39  ? 35.959 125.639 55.629  1.00 35.73 ? 39  LEU B O   1 
ATOM   3943  C  CB  . LEU B 1 39  ? 38.245 127.648 55.911  1.00 34.35 ? 39  LEU B CB  1 
ATOM   3944  C  CG  . LEU B 1 39  ? 39.730 127.826 56.225  1.00 34.55 ? 39  LEU B CG  1 
ATOM   3945  C  CD1 . LEU B 1 39  ? 39.925 128.977 57.185  1.00 33.88 ? 39  LEU B CD1 1 
ATOM   3946  C  CD2 . LEU B 1 39  ? 40.287 126.532 56.803  1.00 34.14 ? 39  LEU B CD2 1 
ATOM   3947  N  N   . ASN B 1 40  ? 35.884 126.702 53.646  1.00 34.59 ? 40  ASN B N   1 
ATOM   3948  C  CA  . ASN B 1 40  ? 34.456 126.471 53.401  1.00 34.38 ? 40  ASN B CA  1 
ATOM   3949  C  C   . ASN B 1 40  ? 34.263 126.148 51.917  1.00 33.70 ? 40  ASN B C   1 
ATOM   3950  O  O   . ASN B 1 40  ? 34.854 126.798 51.057  1.00 33.42 ? 40  ASN B O   1 
ATOM   3951  C  CB  . ASN B 1 40  ? 33.634 127.723 53.756  1.00 34.47 ? 40  ASN B CB  1 
ATOM   3952  C  CG  . ASN B 1 40  ? 33.765 128.127 55.223  1.00 35.01 ? 40  ASN B CG  1 
ATOM   3953  O  OD1 . ASN B 1 40  ? 33.097 127.566 56.105  1.00 34.47 ? 40  ASN B OD1 1 
ATOM   3954  N  ND2 . ASN B 1 40  ? 34.634 129.106 55.491  1.00 33.98 ? 40  ASN B ND2 1 
ATOM   3955  N  N   . VAL B 1 41  ? 33.429 125.155 51.620  1.00 33.39 ? 41  VAL B N   1 
ATOM   3956  C  CA  . VAL B 1 41  ? 33.176 124.743 50.238  1.00 32.44 ? 41  VAL B CA  1 
ATOM   3957  C  C   . VAL B 1 41  ? 32.026 125.517 49.608  1.00 31.53 ? 41  VAL B C   1 
ATOM   3958  O  O   . VAL B 1 41  ? 31.207 126.086 50.316  1.00 32.10 ? 41  VAL B O   1 
ATOM   3959  C  CB  . VAL B 1 41  ? 32.864 123.226 50.169  1.00 32.87 ? 41  VAL B CB  1 
ATOM   3960  C  CG1 . VAL B 1 41  ? 33.960 122.446 50.872  1.00 32.30 ? 41  VAL B CG1 1 
ATOM   3961  C  CG2 . VAL B 1 41  ? 31.517 122.928 50.808  1.00 32.48 ? 41  VAL B CG2 1 
ATOM   3962  N  N   . ILE B 1 42  ? 31.969 125.541 48.278  1.00 31.01 ? 42  ILE B N   1 
ATOM   3963  C  CA  . ILE B 1 42  ? 30.906 126.260 47.571  1.00 30.76 ? 42  ILE B CA  1 
ATOM   3964  C  C   . ILE B 1 42  ? 29.595 125.498 47.647  1.00 31.47 ? 42  ILE B C   1 
ATOM   3965  O  O   . ILE B 1 42  ? 29.540 124.304 47.371  1.00 31.90 ? 42  ILE B O   1 
ATOM   3966  C  CB  . ILE B 1 42  ? 31.244 126.508 46.070  1.00 30.44 ? 42  ILE B CB  1 
ATOM   3967  C  CG1 . ILE B 1 42  ? 32.531 127.342 45.932  1.00 29.73 ? 42  ILE B CG1 1 
ATOM   3968  C  CG2 . ILE B 1 42  ? 30.083 127.243 45.399  1.00 28.60 ? 42  ILE B CG2 1 
ATOM   3969  C  CD1 . ILE B 1 42  ? 33.054 127.471 44.492  1.00 28.67 ? 42  ILE B CD1 1 
ATOM   3970  N  N   . THR B 1 43  ? 28.535 126.211 48.010  1.00 32.42 ? 43  THR B N   1 
ATOM   3971  C  CA  . THR B 1 43  ? 27.209 125.622 48.158  1.00 33.81 ? 43  THR B CA  1 
ATOM   3972  C  C   . THR B 1 43  ? 26.138 126.547 47.587  1.00 34.24 ? 43  THR B C   1 
ATOM   3973  O  O   . THR B 1 43  ? 26.369 127.752 47.437  1.00 34.11 ? 43  THR B O   1 
ATOM   3974  C  CB  . THR B 1 43  ? 26.905 125.360 49.655  1.00 34.37 ? 43  THR B CB  1 
ATOM   3975  O  OG1 . THR B 1 43  ? 27.437 126.440 50.445  1.00 35.79 ? 43  THR B OG1 1 
ATOM   3976  C  CG2 . THR B 1 43  ? 27.531 124.055 50.108  1.00 33.27 ? 43  THR B CG2 1 
ATOM   3977  N  N   . VAL B 1 44  ? 24.979 125.981 47.248  1.00 34.93 ? 44  VAL B N   1 
ATOM   3978  C  CA  . VAL B 1 44  ? 23.878 126.782 46.717  1.00 36.00 ? 44  VAL B CA  1 
ATOM   3979  C  C   . VAL B 1 44  ? 23.001 127.147 47.917  1.00 36.24 ? 44  VAL B C   1 
ATOM   3980  O  O   . VAL B 1 44  ? 22.075 126.431 48.299  1.00 35.22 ? 44  VAL B O   1 
ATOM   3981  C  CB  . VAL B 1 44  ? 23.084 126.018 45.599  1.00 36.37 ? 44  VAL B CB  1 
ATOM   3982  C  CG1 . VAL B 1 44  ? 22.844 124.586 46.011  1.00 37.11 ? 44  VAL B CG1 1 
ATOM   3983  C  CG2 . VAL B 1 44  ? 21.760 126.726 45.303  1.00 35.45 ? 44  VAL B CG2 1 
ATOM   3984  N  N   . GLY B 1 45  ? 23.351 128.285 48.511  1.00 37.35 ? 45  GLY B N   1 
ATOM   3985  C  CA  . GLY B 1 45  ? 22.679 128.775 49.695  1.00 38.02 ? 45  GLY B CA  1 
ATOM   3986  C  C   . GLY B 1 45  ? 23.491 128.305 50.891  1.00 38.39 ? 45  GLY B C   1 
ATOM   3987  O  O   . GLY B 1 45  ? 24.307 127.394 50.768  1.00 37.95 ? 45  GLY B O   1 
ATOM   3988  N  N   . PRO B 1 46  ? 23.305 128.913 52.065  1.00 39.04 ? 46  PRO B N   1 
ATOM   3989  C  CA  . PRO B 1 46  ? 24.063 128.487 53.243  1.00 39.26 ? 46  PRO B CA  1 
ATOM   3990  C  C   . PRO B 1 46  ? 23.812 127.036 53.675  1.00 39.88 ? 46  PRO B C   1 
ATOM   3991  O  O   . PRO B 1 46  ? 24.701 126.399 54.229  1.00 40.86 ? 46  PRO B O   1 
ATOM   3992  C  CB  . PRO B 1 46  ? 23.653 129.507 54.302  1.00 39.00 ? 46  PRO B CB  1 
ATOM   3993  C  CG  . PRO B 1 46  ? 22.308 129.981 53.833  1.00 39.24 ? 46  PRO B CG  1 
ATOM   3994  C  CD  . PRO B 1 46  ? 22.508 130.113 52.358  1.00 38.70 ? 46  PRO B CD  1 
ATOM   3995  N  N   . ARG B 1 47  ? 22.615 126.512 53.419  1.00 39.83 ? 47  ARG B N   1 
ATOM   3996  C  CA  . ARG B 1 47  ? 22.292 125.131 53.773  1.00 39.08 ? 47  ARG B CA  1 
ATOM   3997  C  C   . ARG B 1 47  ? 21.928 124.281 52.544  1.00 39.07 ? 47  ARG B C   1 
ATOM   3998  O  O   . ARG B 1 47  ? 21.112 123.355 52.623  1.00 38.29 ? 47  ARG B O   1 
ATOM   3999  C  CB  . ARG B 1 47  ? 21.157 125.105 54.800  1.00 38.90 ? 47  ARG B CB  1 
ATOM   4000  C  CG  . ARG B 1 47  ? 21.585 125.602 56.157  1.00 39.45 ? 47  ARG B CG  1 
ATOM   4001  C  CD  . ARG B 1 47  ? 20.466 125.613 57.182  1.00 39.56 ? 47  ARG B CD  1 
ATOM   4002  N  NE  . ARG B 1 47  ? 20.976 126.133 58.447  1.00 41.54 ? 47  ARG B NE  1 
ATOM   4003  C  CZ  . ARG B 1 47  ? 20.343 126.061 59.614  1.00 42.45 ? 47  ARG B CZ  1 
ATOM   4004  N  NH1 . ARG B 1 47  ? 19.151 125.489 59.696  1.00 43.31 ? 47  ARG B NH1 1 
ATOM   4005  N  NH2 . ARG B 1 47  ? 20.917 126.546 60.709  1.00 42.94 ? 47  ARG B NH2 1 
ATOM   4006  N  N   . GLY B 1 48  ? 22.550 124.608 51.411  1.00 39.36 ? 48  GLY B N   1 
ATOM   4007  C  CA  . GLY B 1 48  ? 22.314 123.882 50.171  1.00 39.19 ? 48  GLY B CA  1 
ATOM   4008  C  C   . GLY B 1 48  ? 23.462 122.940 49.818  1.00 39.33 ? 48  GLY B C   1 
ATOM   4009  O  O   . GLY B 1 48  ? 24.518 122.955 50.474  1.00 40.27 ? 48  GLY B O   1 
ATOM   4010  N  N   . PRO B 1 49  ? 23.294 122.107 48.779  1.00 38.11 ? 49  PRO B N   1 
ATOM   4011  C  CA  . PRO B 1 49  ? 24.324 121.155 48.352  1.00 36.72 ? 49  PRO B CA  1 
ATOM   4012  C  C   . PRO B 1 49  ? 25.596 121.718 47.702  1.00 35.25 ? 49  PRO B C   1 
ATOM   4013  O  O   . PRO B 1 49  ? 25.653 122.893 47.298  1.00 34.55 ? 49  PRO B O   1 
ATOM   4014  C  CB  . PRO B 1 49  ? 23.550 120.204 47.435  1.00 37.55 ? 49  PRO B CB  1 
ATOM   4015  C  CG  . PRO B 1 49  ? 22.504 121.092 46.840  1.00 37.98 ? 49  PRO B CG  1 
ATOM   4016  C  CD  . PRO B 1 49  ? 22.040 121.892 48.035  1.00 38.62 ? 49  PRO B CD  1 
ATOM   4017  N  N   . LEU B 1 50  ? 26.602 120.837 47.623  1.00 33.05 ? 50  LEU B N   1 
ATOM   4018  C  CA  . LEU B 1 50  ? 27.940 121.102 47.085  1.00 31.18 ? 50  LEU B CA  1 
ATOM   4019  C  C   . LEU B 1 50  ? 28.014 121.156 45.565  1.00 30.75 ? 50  LEU B C   1 
ATOM   4020  O  O   . LEU B 1 50  ? 27.466 120.295 44.899  1.00 31.93 ? 50  LEU B O   1 
ATOM   4021  C  CB  . LEU B 1 50  ? 28.888 120.020 47.595  1.00 29.10 ? 50  LEU B CB  1 
ATOM   4022  C  CG  . LEU B 1 50  ? 30.349 120.010 47.149  1.00 28.87 ? 50  LEU B CG  1 
ATOM   4023  C  CD1 . LEU B 1 50  ? 31.063 121.315 47.503  1.00 28.16 ? 50  LEU B CD1 1 
ATOM   4024  C  CD2 . LEU B 1 50  ? 31.018 118.858 47.820  1.00 27.48 ? 50  LEU B CD2 1 
ATOM   4025  N  N   . LEU B 1 51  ? 28.712 122.146 45.017  1.00 30.35 ? 51  LEU B N   1 
ATOM   4026  C  CA  . LEU B 1 51  ? 28.821 122.270 43.561  1.00 30.58 ? 51  LEU B CA  1 
ATOM   4027  C  C   . LEU B 1 51  ? 30.134 121.819 42.940  1.00 30.54 ? 51  LEU B C   1 
ATOM   4028  O  O   . LEU B 1 51  ? 31.222 122.054 43.464  1.00 31.08 ? 51  LEU B O   1 
ATOM   4029  C  CB  . LEU B 1 51  ? 28.566 123.708 43.120  1.00 31.39 ? 51  LEU B CB  1 
ATOM   4030  C  CG  . LEU B 1 51  ? 27.191 124.290 43.436  1.00 32.71 ? 51  LEU B CG  1 
ATOM   4031  C  CD1 . LEU B 1 51  ? 27.146 124.823 44.870  1.00 31.90 ? 51  LEU B CD1 1 
ATOM   4032  C  CD2 . LEU B 1 51  ? 26.912 125.395 42.461  1.00 33.35 ? 51  LEU B CD2 1 
ATOM   4033  N  N   . VAL B 1 52  ? 30.016 121.174 41.792  1.00 30.53 ? 52  VAL B N   1 
ATOM   4034  C  CA  . VAL B 1 52  ? 31.169 120.694 41.058  1.00 29.58 ? 52  VAL B CA  1 
ATOM   4035  C  C   . VAL B 1 52  ? 32.158 121.817 40.750  1.00 29.85 ? 52  VAL B C   1 
ATOM   4036  O  O   . VAL B 1 52  ? 33.358 121.574 40.680  1.00 29.97 ? 52  VAL B O   1 
ATOM   4037  C  CB  . VAL B 1 52  ? 30.708 120.003 39.744  1.00 29.01 ? 52  VAL B CB  1 
ATOM   4038  C  CG1 . VAL B 1 52  ? 31.845 119.904 38.745  1.00 28.74 ? 52  VAL B CG1 1 
ATOM   4039  C  CG2 . VAL B 1 52  ? 30.180 118.625 40.065  1.00 29.12 ? 52  VAL B CG2 1 
ATOM   4040  N  N   . GLN B 1 53  ? 31.682 123.048 40.581  1.00 30.59 ? 53  GLN B N   1 
ATOM   4041  C  CA  . GLN B 1 53  ? 32.614 124.126 40.260  1.00 31.39 ? 53  GLN B CA  1 
ATOM   4042  C  C   . GLN B 1 53  ? 33.568 124.475 41.392  1.00 31.71 ? 53  GLN B C   1 
ATOM   4043  O  O   . GLN B 1 53  ? 34.492 125.265 41.205  1.00 32.91 ? 53  GLN B O   1 
ATOM   4044  C  CB  . GLN B 1 53  ? 31.885 125.381 39.737  1.00 31.36 ? 53  GLN B CB  1 
ATOM   4045  C  CG  . GLN B 1 53  ? 30.835 126.006 40.643  1.00 31.96 ? 53  GLN B CG  1 
ATOM   4046  C  CD  . GLN B 1 53  ? 30.008 127.070 39.912  1.00 30.67 ? 53  GLN B CD  1 
ATOM   4047  O  OE1 . GLN B 1 53  ? 29.686 126.921 38.738  1.00 29.53 ? 53  GLN B OE1 1 
ATOM   4048  N  NE2 . GLN B 1 53  ? 29.648 128.130 40.618  1.00 31.48 ? 53  GLN B NE2 1 
ATOM   4049  N  N   . ASP B 1 54  ? 33.370 123.878 42.563  1.00 31.82 ? 54  ASP B N   1 
ATOM   4050  C  CA  . ASP B 1 54  ? 34.287 124.125 43.671  1.00 32.23 ? 54  ASP B CA  1 
ATOM   4051  C  C   . ASP B 1 54  ? 35.536 123.282 43.402  1.00 32.90 ? 54  ASP B C   1 
ATOM   4052  O  O   . ASP B 1 54  ? 35.871 122.385 44.181  1.00 33.31 ? 54  ASP B O   1 
ATOM   4053  C  CB  . ASP B 1 54  ? 33.675 123.694 45.006  1.00 31.37 ? 54  ASP B CB  1 
ATOM   4054  C  CG  . ASP B 1 54  ? 34.540 124.087 46.201  1.00 30.58 ? 54  ASP B CG  1 
ATOM   4055  O  OD1 . ASP B 1 54  ? 35.761 124.300 46.017  1.00 30.08 ? 54  ASP B OD1 1 
ATOM   4056  O  OD2 . ASP B 1 54  ? 34.002 124.174 47.325  1.00 29.26 ? 54  ASP B OD2 1 
ATOM   4057  N  N   . VAL B 1 55  ? 36.217 123.562 42.295  1.00 33.32 ? 55  VAL B N   1 
ATOM   4058  C  CA  . VAL B 1 55  ? 37.410 122.804 41.932  1.00 33.78 ? 55  VAL B CA  1 
ATOM   4059  C  C   . VAL B 1 55  ? 38.522 122.849 42.981  1.00 33.87 ? 55  VAL B C   1 
ATOM   4060  O  O   . VAL B 1 55  ? 39.382 121.980 43.001  1.00 35.00 ? 55  VAL B O   1 
ATOM   4061  C  CB  . VAL B 1 55  ? 37.978 123.278 40.592  1.00 33.60 ? 55  VAL B CB  1 
ATOM   4062  C  CG1 . VAL B 1 55  ? 36.912 123.179 39.533  1.00 32.41 ? 55  VAL B CG1 1 
ATOM   4063  C  CG2 . VAL B 1 55  ? 38.471 124.711 40.716  1.00 35.11 ? 55  VAL B CG2 1 
ATOM   4064  N  N   . VAL B 1 56  ? 38.513 123.855 43.847  1.00 33.75 ? 56  VAL B N   1 
ATOM   4065  C  CA  . VAL B 1 56  ? 39.529 123.947 44.889  1.00 32.81 ? 56  VAL B CA  1 
ATOM   4066  C  C   . VAL B 1 56  ? 39.399 122.694 45.755  1.00 32.65 ? 56  VAL B C   1 
ATOM   4067  O  O   . VAL B 1 56  ? 40.376 121.983 46.007  1.00 31.84 ? 56  VAL B O   1 
ATOM   4068  C  CB  . VAL B 1 56  ? 39.326 125.223 45.763  1.00 32.92 ? 56  VAL B CB  1 
ATOM   4069  C  CG1 . VAL B 1 56  ? 40.294 125.231 46.936  1.00 32.98 ? 56  VAL B CG1 1 
ATOM   4070  C  CG2 . VAL B 1 56  ? 39.540 126.462 44.922  1.00 31.60 ? 56  VAL B CG2 1 
ATOM   4071  N  N   . PHE B 1 57  ? 38.174 122.425 46.196  1.00 33.12 ? 57  PHE B N   1 
ATOM   4072  C  CA  . PHE B 1 57  ? 37.896 121.248 47.025  1.00 32.97 ? 57  PHE B CA  1 
ATOM   4073  C  C   . PHE B 1 57  ? 38.309 119.939 46.340  1.00 32.24 ? 57  PHE B C   1 
ATOM   4074  O  O   . PHE B 1 57  ? 39.038 119.132 46.908  1.00 32.18 ? 57  PHE B O   1 
ATOM   4075  C  CB  . PHE B 1 57  ? 36.407 121.170 47.366  1.00 32.07 ? 57  PHE B CB  1 
ATOM   4076  C  CG  . PHE B 1 57  ? 36.009 119.862 47.979  1.00 32.32 ? 57  PHE B CG  1 
ATOM   4077  C  CD1 . PHE B 1 57  ? 36.394 119.545 49.284  1.00 32.46 ? 57  PHE B CD1 1 
ATOM   4078  C  CD2 . PHE B 1 57  ? 35.278 118.934 47.247  1.00 31.99 ? 57  PHE B CD2 1 
ATOM   4079  C  CE1 . PHE B 1 57  ? 36.061 118.332 49.849  1.00 31.53 ? 57  PHE B CE1 1 
ATOM   4080  C  CE2 . PHE B 1 57  ? 34.937 117.713 47.800  1.00 31.97 ? 57  PHE B CE2 1 
ATOM   4081  C  CZ  . PHE B 1 57  ? 35.331 117.409 49.107  1.00 32.78 ? 57  PHE B CZ  1 
ATOM   4082  N  N   . THR B 1 58  ? 37.825 119.740 45.120  1.00 31.32 ? 58  THR B N   1 
ATOM   4083  C  CA  . THR B 1 58  ? 38.135 118.544 44.362  1.00 30.83 ? 58  THR B CA  1 
ATOM   4084  C  C   . THR B 1 58  ? 39.644 118.379 44.178  1.00 31.34 ? 58  THR B C   1 
ATOM   4085  O  O   . THR B 1 58  ? 40.199 117.313 44.462  1.00 31.33 ? 58  THR B O   1 
ATOM   4086  C  CB  . THR B 1 58  ? 37.443 118.585 42.980  1.00 30.01 ? 58  THR B CB  1 
ATOM   4087  O  OG1 . THR B 1 58  ? 36.045 118.819 43.170  1.00 29.62 ? 58  THR B OG1 1 
ATOM   4088  C  CG2 . THR B 1 58  ? 37.618 117.256 42.237  1.00 29.15 ? 58  THR B CG2 1 
ATOM   4089  N  N   . ASP B 1 59  ? 40.311 119.433 43.720  1.00 30.80 ? 59  ASP B N   1 
ATOM   4090  C  CA  . ASP B 1 59  ? 41.748 119.367 43.497  1.00 30.98 ? 59  ASP B CA  1 
ATOM   4091  C  C   . ASP B 1 59  ? 42.487 118.831 44.717  1.00 31.58 ? 59  ASP B C   1 
ATOM   4092  O  O   . ASP B 1 59  ? 43.329 117.946 44.606  1.00 32.50 ? 59  ASP B O   1 
ATOM   4093  C  CB  . ASP B 1 59  ? 42.293 120.748 43.138  1.00 30.58 ? 59  ASP B CB  1 
ATOM   4094  C  CG  . ASP B 1 59  ? 43.791 120.742 42.921  1.00 31.04 ? 59  ASP B CG  1 
ATOM   4095  O  OD1 . ASP B 1 59  ? 44.257 120.007 42.026  1.00 31.72 ? 59  ASP B OD1 1 
ATOM   4096  O  OD2 . ASP B 1 59  ? 44.505 121.469 43.645  1.00 31.28 ? 59  ASP B OD2 1 
ATOM   4097  N  N   . GLU B 1 60  ? 42.176 119.376 45.883  1.00 31.61 ? 60  GLU B N   1 
ATOM   4098  C  CA  . GLU B 1 60  ? 42.822 118.942 47.103  1.00 31.45 ? 60  GLU B CA  1 
ATOM   4099  C  C   . GLU B 1 60  ? 42.350 117.549 47.488  1.00 31.34 ? 60  GLU B C   1 
ATOM   4100  O  O   . GLU B 1 60  ? 43.162 116.657 47.755  1.00 32.99 ? 60  GLU B O   1 
ATOM   4101  C  CB  . GLU B 1 60  ? 42.528 119.931 48.234  1.00 31.47 ? 60  GLU B CB  1 
ATOM   4102  C  CG  . GLU B 1 60  ? 43.041 119.479 49.573  1.00 32.60 ? 60  GLU B CG  1 
ATOM   4103  C  CD  . GLU B 1 60  ? 42.843 120.511 50.650  1.00 33.43 ? 60  GLU B CD  1 
ATOM   4104  O  OE1 . GLU B 1 60  ? 41.718 121.034 50.776  1.00 33.62 ? 60  GLU B OE1 1 
ATOM   4105  O  OE2 . GLU B 1 60  ? 43.814 120.794 51.380  1.00 34.88 ? 60  GLU B OE2 1 
ATOM   4106  N  N   . MET B 1 61  ? 41.039 117.350 47.503  1.00 30.32 ? 61  MET B N   1 
ATOM   4107  C  CA  . MET B 1 61  ? 40.496 116.053 47.877  1.00 29.23 ? 61  MET B CA  1 
ATOM   4108  C  C   . MET B 1 61  ? 41.007 114.915 47.014  1.00 28.60 ? 61  MET B C   1 
ATOM   4109  O  O   . MET B 1 61  ? 41.332 113.853 47.529  1.00 30.17 ? 61  MET B O   1 
ATOM   4110  C  CB  . MET B 1 61  ? 38.974 116.075 47.826  1.00 28.66 ? 61  MET B CB  1 
ATOM   4111  C  CG  . MET B 1 61  ? 38.339 114.832 48.395  1.00 29.20 ? 61  MET B CG  1 
ATOM   4112  S  SD  . MET B 1 61  ? 38.840 114.518 50.113  1.00 28.42 ? 61  MET B SD  1 
ATOM   4113  C  CE  . MET B 1 61  ? 38.096 115.961 50.914  1.00 28.18 ? 61  MET B CE  1 
ATOM   4114  N  N   . ALA B 1 62  ? 41.077 115.127 45.703  1.00 27.54 ? 62  ALA B N   1 
ATOM   4115  C  CA  . ALA B 1 62  ? 41.540 114.087 44.793  1.00 25.96 ? 62  ALA B CA  1 
ATOM   4116  C  C   . ALA B 1 62  ? 42.963 113.680 45.112  1.00 26.20 ? 62  ALA B C   1 
ATOM   4117  O  O   . ALA B 1 62  ? 43.320 112.509 44.996  1.00 25.94 ? 62  ALA B O   1 
ATOM   4118  C  CB  . ALA B 1 62  ? 41.450 114.564 43.349  1.00 25.95 ? 62  ALA B CB  1 
ATOM   4119  N  N   . HIS B 1 63  ? 43.786 114.647 45.503  1.00 26.64 ? 63  HIS B N   1 
ATOM   4120  C  CA  . HIS B 1 63  ? 45.167 114.336 45.831  1.00 27.37 ? 63  HIS B CA  1 
ATOM   4121  C  C   . HIS B 1 63  ? 45.219 113.609 47.177  1.00 28.41 ? 63  HIS B C   1 
ATOM   4122  O  O   . HIS B 1 63  ? 45.956 112.637 47.355  1.00 28.05 ? 63  HIS B O   1 
ATOM   4123  C  CB  . HIS B 1 63  ? 46.004 115.608 45.862  1.00 25.81 ? 63  HIS B CB  1 
ATOM   4124  C  CG  . HIS B 1 63  ? 47.468 115.355 45.693  1.00 26.21 ? 63  HIS B CG  1 
ATOM   4125  N  ND1 . HIS B 1 63  ? 48.287 114.970 46.735  1.00 26.53 ? 63  HIS B ND1 1 
ATOM   4126  C  CD2 . HIS B 1 63  ? 48.253 115.389 44.593  1.00 25.87 ? 63  HIS B CD2 1 
ATOM   4127  C  CE1 . HIS B 1 63  ? 49.513 114.779 46.284  1.00 25.29 ? 63  HIS B CE1 1 
ATOM   4128  N  NE2 . HIS B 1 63  ? 49.520 115.026 44.987  1.00 25.81 ? 63  HIS B NE2 1 
ATOM   4129  N  N   . PHE B 1 64  ? 44.428 114.081 48.130  1.00 29.22 ? 64  PHE B N   1 
ATOM   4130  C  CA  . PHE B 1 64  ? 44.382 113.425 49.428  1.00 30.01 ? 64  PHE B CA  1 
ATOM   4131  C  C   . PHE B 1 64  ? 44.037 111.960 49.189  1.00 30.83 ? 64  PHE B C   1 
ATOM   4132  O  O   . PHE B 1 64  ? 44.616 111.050 49.793  1.00 30.47 ? 64  PHE B O   1 
ATOM   4133  C  CB  . PHE B 1 64  ? 43.298 114.049 50.290  1.00 28.12 ? 64  PHE B CB  1 
ATOM   4134  C  CG  . PHE B 1 64  ? 42.999 113.275 51.522  1.00 26.82 ? 64  PHE B CG  1 
ATOM   4135  C  CD1 . PHE B 1 64  ? 43.829 113.359 52.632  1.00 26.95 ? 64  PHE B CD1 1 
ATOM   4136  C  CD2 . PHE B 1 64  ? 41.866 112.484 51.593  1.00 27.07 ? 64  PHE B CD2 1 
ATOM   4137  C  CE1 . PHE B 1 64  ? 43.532 112.667 53.806  1.00 26.42 ? 64  PHE B CE1 1 
ATOM   4138  C  CE2 . PHE B 1 64  ? 41.559 111.787 52.768  1.00 27.34 ? 64  PHE B CE2 1 
ATOM   4139  C  CZ  . PHE B 1 64  ? 42.398 111.883 53.876  1.00 26.74 ? 64  PHE B CZ  1 
ATOM   4140  N  N   . ASP B 1 65  ? 43.082 111.753 48.288  1.00 31.22 ? 65  ASP B N   1 
ATOM   4141  C  CA  . ASP B 1 65  ? 42.620 110.426 47.953  1.00 31.25 ? 65  ASP B CA  1 
ATOM   4142  C  C   . ASP B 1 65  ? 43.658 109.504 47.341  1.00 30.93 ? 65  ASP B C   1 
ATOM   4143  O  O   . ASP B 1 65  ? 43.461 108.291 47.326  1.00 31.94 ? 65  ASP B O   1 
ATOM   4144  C  CB  . ASP B 1 65  ? 41.430 110.523 47.012  1.00 32.30 ? 65  ASP B CB  1 
ATOM   4145  C  CG  . ASP B 1 65  ? 40.228 111.139 47.672  1.00 34.18 ? 65  ASP B CG  1 
ATOM   4146  O  OD1 . ASP B 1 65  ? 40.200 111.162 48.927  1.00 34.24 ? 65  ASP B OD1 1 
ATOM   4147  O  OD2 . ASP B 1 65  ? 39.312 111.582 46.937  1.00 33.93 ? 65  ASP B OD2 1 
ATOM   4148  N  N   . ARG B 1 66  ? 44.760 110.061 46.848  1.00 30.34 ? 66  ARG B N   1 
ATOM   4149  C  CA  . ARG B 1 66  ? 45.801 109.259 46.203  1.00 29.80 ? 66  ARG B CA  1 
ATOM   4150  C  C   . ARG B 1 66  ? 47.139 109.321 46.932  1.00 29.41 ? 66  ARG B C   1 
ATOM   4151  O  O   . ARG B 1 66  ? 48.179 108.939 46.405  1.00 28.72 ? 66  ARG B O   1 
ATOM   4152  C  CB  . ARG B 1 66  ? 45.958 109.725 44.747  1.00 29.15 ? 66  ARG B CB  1 
ATOM   4153  C  CG  . ARG B 1 66  ? 44.674 109.574 43.942  1.00 29.38 ? 66  ARG B CG  1 
ATOM   4154  C  CD  . ARG B 1 66  ? 44.743 110.230 42.566  1.00 30.65 ? 66  ARG B CD  1 
ATOM   4155  N  NE  . ARG B 1 66  ? 43.633 109.812 41.706  1.00 30.17 ? 66  ARG B NE  1 
ATOM   4156  C  CZ  . ARG B 1 66  ? 42.347 110.033 41.962  1.00 30.26 ? 66  ARG B CZ  1 
ATOM   4157  N  NH1 . ARG B 1 66  ? 41.978 110.683 43.059  1.00 31.05 ? 66  ARG B NH1 1 
ATOM   4158  N  NH2 . ARG B 1 66  ? 41.420 109.578 41.132  1.00 30.03 ? 66  ARG B NH2 1 
ATOM   4159  N  N   . GLU B 1 67  ? 47.103 109.786 48.166  1.00 30.07 ? 67  GLU B N   1 
ATOM   4160  C  CA  . GLU B 1 67  ? 48.323 109.914 48.939  1.00 31.02 ? 67  GLU B CA  1 
ATOM   4161  C  C   . GLU B 1 67  ? 49.125 108.641 49.157  1.00 31.16 ? 67  GLU B C   1 
ATOM   4162  O  O   . GLU B 1 67  ? 50.355 108.688 49.189  1.00 31.71 ? 67  GLU B O   1 
ATOM   4163  C  CB  . GLU B 1 67  ? 48.017 110.538 50.301  1.00 30.84 ? 67  GLU B CB  1 
ATOM   4164  C  CG  . GLU B 1 67  ? 47.625 112.002 50.223  1.00 32.19 ? 67  GLU B CG  1 
ATOM   4165  C  CD  . GLU B 1 67  ? 47.688 112.685 51.565  1.00 31.73 ? 67  GLU B CD  1 
ATOM   4166  O  OE1 . GLU B 1 67  ? 47.279 113.864 51.646  1.00 31.62 ? 67  GLU B OE1 1 
ATOM   4167  O  OE2 . GLU B 1 67  ? 48.150 112.037 52.532  1.00 32.41 ? 67  GLU B OE2 1 
ATOM   4168  N  N   . ARG B 1 68  ? 48.433 107.511 49.295  1.00 31.13 ? 68  ARG B N   1 
ATOM   4169  C  CA  . ARG B 1 68  ? 49.084 106.233 49.587  1.00 30.06 ? 68  ARG B CA  1 
ATOM   4170  C  C   . ARG B 1 68  ? 49.506 105.374 48.417  1.00 29.94 ? 68  ARG B C   1 
ATOM   4171  O  O   . ARG B 1 68  ? 48.813 105.280 47.404  1.00 30.95 ? 68  ARG B O   1 
ATOM   4172  C  CB  . ARG B 1 68  ? 48.180 105.386 50.485  1.00 28.70 ? 68  ARG B CB  1 
ATOM   4173  C  CG  . ARG B 1 68  ? 47.604 106.132 51.661  1.00 27.67 ? 68  ARG B CG  1 
ATOM   4174  C  CD  . ARG B 1 68  ? 48.589 106.271 52.792  1.00 27.87 ? 68  ARG B CD  1 
ATOM   4175  N  NE  . ARG B 1 68  ? 47.953 106.896 53.951  1.00 27.92 ? 68  ARG B NE  1 
ATOM   4176  C  CZ  . ARG B 1 68  ? 47.977 108.201 54.213  1.00 27.97 ? 68  ARG B CZ  1 
ATOM   4177  N  NH1 . ARG B 1 68  ? 48.616 109.041 53.407  1.00 28.06 ? 68  ARG B NH1 1 
ATOM   4178  N  NH2 . ARG B 1 68  ? 47.338 108.672 55.274  1.00 28.29 ? 68  ARG B NH2 1 
ATOM   4179  N  N   . ILE B 1 69  ? 50.664 104.747 48.579  1.00 29.47 ? 69  ILE B N   1 
ATOM   4180  C  CA  . ILE B 1 69  ? 51.188 103.830 47.591  1.00 28.85 ? 69  ILE B CA  1 
ATOM   4181  C  C   . ILE B 1 69  ? 51.367 102.529 48.372  1.00 29.15 ? 69  ILE B C   1 
ATOM   4182  O  O   . ILE B 1 69  ? 51.249 102.519 49.595  1.00 30.84 ? 69  ILE B O   1 
ATOM   4183  C  CB  . ILE B 1 69  ? 52.535 104.302 47.025  1.00 28.20 ? 69  ILE B CB  1 
ATOM   4184  C  CG1 . ILE B 1 69  ? 53.539 104.479 48.154  1.00 26.18 ? 69  ILE B CG1 1 
ATOM   4185  C  CG2 . ILE B 1 69  ? 52.348 105.600 46.228  1.00 27.24 ? 69  ILE B CG2 1 
ATOM   4186  C  CD1 . ILE B 1 69  ? 54.942 104.621 47.647  1.00 24.05 ? 69  ILE B CD1 1 
ATOM   4187  N  N   . PRO B 1 70  ? 51.620 101.408 47.688  1.00 28.92 ? 70  PRO B N   1 
ATOM   4188  C  CA  . PRO B 1 70  ? 51.782 100.187 48.489  1.00 28.83 ? 70  PRO B CA  1 
ATOM   4189  C  C   . PRO B 1 70  ? 53.073 100.158 49.306  1.00 28.09 ? 70  PRO B C   1 
ATOM   4190  O  O   . PRO B 1 70  ? 54.096 100.686 48.881  1.00 28.10 ? 70  PRO B O   1 
ATOM   4191  C  CB  . PRO B 1 70  ? 51.709 99.076  47.442  1.00 28.73 ? 70  PRO B CB  1 
ATOM   4192  C  CG  . PRO B 1 70  ? 52.157 99.746  46.188  1.00 28.91 ? 70  PRO B CG  1 
ATOM   4193  C  CD  . PRO B 1 70  ? 51.559 101.107 46.247  1.00 28.11 ? 70  PRO B CD  1 
ATOM   4194  N  N   . GLU B 1 71  ? 53.032 99.566  50.490  1.00 27.71 ? 71  GLU B N   1 
ATOM   4195  C  CA  . GLU B 1 71  ? 54.245 99.508  51.293  1.00 28.48 ? 71  GLU B CA  1 
ATOM   4196  C  C   . GLU B 1 71  ? 55.123 98.376  50.791  1.00 28.68 ? 71  GLU B C   1 
ATOM   4197  O  O   . GLU B 1 71  ? 54.662 97.493  50.065  1.00 29.01 ? 71  GLU B O   1 
ATOM   4198  C  CB  . GLU B 1 71  ? 53.924 99.279  52.766  1.00 28.90 ? 71  GLU B CB  1 
ATOM   4199  C  CG  . GLU B 1 71  ? 53.120 98.031  53.030  1.00 30.46 ? 71  GLU B CG  1 
ATOM   4200  C  CD  . GLU B 1 71  ? 52.848 97.819  54.503  1.00 32.06 ? 71  GLU B CD  1 
ATOM   4201  O  OE1 . GLU B 1 71  ? 52.625 98.825  55.215  1.00 32.36 ? 71  GLU B OE1 1 
ATOM   4202  O  OE2 . GLU B 1 71  ? 52.841 96.644  54.939  1.00 32.69 ? 71  GLU B OE2 1 
ATOM   4203  N  N   . ARG B 1 72  ? 56.395 98.406  51.169  1.00 29.15 ? 72  ARG B N   1 
ATOM   4204  C  CA  . ARG B 1 72  ? 57.322 97.361  50.760  1.00 29.29 ? 72  ARG B CA  1 
ATOM   4205  C  C   . ARG B 1 72  ? 56.725 96.008  51.158  1.00 29.46 ? 72  ARG B C   1 
ATOM   4206  O  O   . ARG B 1 72  ? 56.140 95.875  52.239  1.00 30.62 ? 72  ARG B O   1 
ATOM   4207  C  CB  . ARG B 1 72  ? 58.664 97.580  51.440  1.00 28.83 ? 72  ARG B CB  1 
ATOM   4208  C  CG  . ARG B 1 72  ? 59.310 98.890  51.070  1.00 28.51 ? 72  ARG B CG  1 
ATOM   4209  C  CD  . ARG B 1 72  ? 60.539 99.142  51.925  1.00 29.81 ? 72  ARG B CD  1 
ATOM   4210  N  NE  . ARG B 1 72  ? 61.303 100.288 51.453  1.00 29.22 ? 72  ARG B NE  1 
ATOM   4211  C  CZ  . ARG B 1 72  ? 60.860 101.539 51.463  1.00 29.94 ? 72  ARG B CZ  1 
ATOM   4212  N  NH1 . ARG B 1 72  ? 59.651 101.814 51.933  1.00 28.71 ? 72  ARG B NH1 1 
ATOM   4213  N  NH2 . ARG B 1 72  ? 61.626 102.513 50.987  1.00 30.22 ? 72  ARG B NH2 1 
ATOM   4214  N  N   . VAL B 1 73  ? 56.853 95.008  50.290  1.00 28.68 ? 73  VAL B N   1 
ATOM   4215  C  CA  . VAL B 1 73  ? 56.295 93.691  50.588  1.00 28.14 ? 73  VAL B CA  1 
ATOM   4216  C  C   . VAL B 1 73  ? 56.890 93.105  51.877  1.00 28.21 ? 73  VAL B C   1 
ATOM   4217  O  O   . VAL B 1 73  ? 56.278 92.261  52.520  1.00 28.07 ? 73  VAL B O   1 
ATOM   4218  C  CB  . VAL B 1 73  ? 56.497 92.719  49.387  1.00 27.58 ? 73  VAL B CB  1 
ATOM   4219  C  CG1 . VAL B 1 73  ? 57.952 92.315  49.276  1.00 28.74 ? 73  VAL B CG1 1 
ATOM   4220  C  CG2 . VAL B 1 73  ? 55.593 91.509  49.530  1.00 27.19 ? 73  VAL B CG2 1 
ATOM   4221  N  N   . VAL B 1 74  ? 58.093 93.556  52.232  1.00 28.73 ? 74  VAL B N   1 
ATOM   4222  C  CA  . VAL B 1 74  ? 58.783 93.148  53.460  1.00 28.34 ? 74  VAL B CA  1 
ATOM   4223  C  C   . VAL B 1 74  ? 59.614 94.349  53.869  1.00 28.71 ? 74  VAL B C   1 
ATOM   4224  O  O   . VAL B 1 74  ? 59.933 95.174  53.018  1.00 27.89 ? 74  VAL B O   1 
ATOM   4225  C  CB  . VAL B 1 74  ? 59.716 91.922  53.257  1.00 28.29 ? 74  VAL B CB  1 
ATOM   4226  C  CG1 . VAL B 1 74  ? 58.896 90.658  53.183  1.00 28.91 ? 74  VAL B CG1 1 
ATOM   4227  C  CG2 . VAL B 1 74  ? 60.527 92.074  52.000  1.00 27.32 ? 74  VAL B CG2 1 
ATOM   4228  N  N   . HIS B 1 75  ? 59.961 94.449  55.155  1.00 29.55 ? 75  HIS B N   1 
ATOM   4229  C  CA  . HIS B 1 75  ? 60.750 95.583  55.672  1.00 30.08 ? 75  HIS B CA  1 
ATOM   4230  C  C   . HIS B 1 75  ? 59.973 96.872  55.439  1.00 30.20 ? 75  HIS B C   1 
ATOM   4231  O  O   . HIS B 1 75  ? 60.530 97.874  54.993  1.00 32.48 ? 75  HIS B O   1 
ATOM   4232  C  CB  . HIS B 1 75  ? 62.107 95.705  54.961  1.00 31.15 ? 75  HIS B CB  1 
ATOM   4233  C  CG  . HIS B 1 75  ? 63.066 94.586  55.249  1.00 32.46 ? 75  HIS B CG  1 
ATOM   4234  N  ND1 . HIS B 1 75  ? 64.126 94.722  56.117  1.00 33.25 ? 75  HIS B ND1 1 
ATOM   4235  C  CD2 . HIS B 1 75  ? 63.146 93.328  54.753  1.00 32.99 ? 75  HIS B CD2 1 
ATOM   4236  C  CE1 . HIS B 1 75  ? 64.819 93.597  56.139  1.00 33.36 ? 75  HIS B CE1 1 
ATOM   4237  N  NE2 . HIS B 1 75  ? 64.247 92.735  55.320  1.00 32.48 ? 75  HIS B NE2 1 
ATOM   4238  N  N   . ALA B 1 76  ? 58.686 96.843  55.740  1.00 29.75 ? 76  ALA B N   1 
ATOM   4239  C  CA  . ALA B 1 76  ? 57.836 97.993  55.535  1.00 29.93 ? 76  ALA B CA  1 
ATOM   4240  C  C   . ALA B 1 76  ? 58.076 99.103  56.533  1.00 30.43 ? 76  ALA B C   1 
ATOM   4241  O  O   . ALA B 1 76  ? 58.035 100.274 56.170  1.00 30.91 ? 76  ALA B O   1 
ATOM   4242  C  CB  . ALA B 1 76  ? 56.392 97.571  55.583  1.00 29.93 ? 76  ALA B CB  1 
ATOM   4243  N  N   . LYS B 1 77  ? 58.305 98.753  57.795  1.00 30.73 ? 77  LYS B N   1 
ATOM   4244  C  CA  . LYS B 1 77  ? 58.538 99.780  58.813  1.00 31.20 ? 77  LYS B CA  1 
ATOM   4245  C  C   . LYS B 1 77  ? 59.996 100.186 58.725  1.00 31.51 ? 77  LYS B C   1 
ATOM   4246  O  O   . LYS B 1 77  ? 60.881 99.332  58.783  1.00 32.84 ? 77  LYS B O   1 
ATOM   4247  C  CB  . LYS B 1 77  ? 58.244 99.238  60.207  1.00 31.58 ? 77  LYS B CB  1 
ATOM   4248  C  CG  . LYS B 1 77  ? 58.202 100.299 61.271  1.00 31.26 ? 77  LYS B CG  1 
ATOM   4249  C  CD  . LYS B 1 77  ? 56.911 101.089 61.192  1.00 32.41 ? 77  LYS B CD  1 
ATOM   4250  C  CE  . LYS B 1 77  ? 56.920 102.269 62.157  1.00 34.26 ? 77  LYS B CE  1 
ATOM   4251  N  NZ  . LYS B 1 77  ? 57.300 101.880 63.562  1.00 34.95 ? 77  LYS B NZ  1 
ATOM   4252  N  N   . GLY B 1 78  ? 60.257 101.480 58.586  1.00 31.75 ? 78  GLY B N   1 
ATOM   4253  C  CA  . GLY B 1 78  ? 61.639 101.919 58.469  1.00 31.81 ? 78  GLY B CA  1 
ATOM   4254  C  C   . GLY B 1 78  ? 62.014 103.309 58.946  1.00 30.89 ? 78  GLY B C   1 
ATOM   4255  O  O   . GLY B 1 78  ? 61.164 104.149 59.214  1.00 31.03 ? 78  GLY B O   1 
ATOM   4256  N  N   . ALA B 1 79  ? 63.316 103.530 59.059  1.00 30.50 ? 79  ALA B N   1 
ATOM   4257  C  CA  . ALA B 1 79  ? 63.873 104.798 59.485  1.00 29.92 ? 79  ALA B CA  1 
ATOM   4258  C  C   . ALA B 1 79  ? 64.954 105.123 58.476  1.00 29.92 ? 79  ALA B C   1 
ATOM   4259  O  O   . ALA B 1 79  ? 65.583 104.219 57.941  1.00 29.22 ? 79  ALA B O   1 
ATOM   4260  C  CB  . ALA B 1 79  ? 64.462 104.666 60.861  1.00 30.69 ? 79  ALA B CB  1 
ATOM   4261  N  N   . GLY B 1 80  ? 65.166 106.406 58.204  1.00 31.10 ? 80  GLY B N   1 
ATOM   4262  C  CA  . GLY B 1 80  ? 66.181 106.781 57.230  1.00 32.56 ? 80  GLY B CA  1 
ATOM   4263  C  C   . GLY B 1 80  ? 67.005 108.017 57.552  1.00 32.71 ? 80  GLY B C   1 
ATOM   4264  O  O   . GLY B 1 80  ? 66.537 108.939 58.210  1.00 33.73 ? 80  GLY B O   1 
ATOM   4265  N  N   . ALA B 1 81  ? 68.243 108.032 57.075  1.00 32.85 ? 81  ALA B N   1 
ATOM   4266  C  CA  . ALA B 1 81  ? 69.139 109.154 57.308  1.00 33.28 ? 81  ALA B CA  1 
ATOM   4267  C  C   . ALA B 1 81  ? 70.156 109.214 56.169  1.00 33.51 ? 81  ALA B C   1 
ATOM   4268  O  O   . ALA B 1 81  ? 70.205 108.323 55.322  1.00 33.42 ? 81  ALA B O   1 
ATOM   4269  C  CB  . ALA B 1 81  ? 69.839 108.996 58.659  1.00 32.95 ? 81  ALA B CB  1 
ATOM   4270  N  N   . PHE B 1 82  ? 70.965 110.265 56.144  1.00 34.07 ? 82  PHE B N   1 
ATOM   4271  C  CA  . PHE B 1 82  ? 71.942 110.424 55.076  1.00 34.83 ? 82  PHE B CA  1 
ATOM   4272  C  C   . PHE B 1 82  ? 73.339 110.781 55.578  1.00 34.65 ? 82  PHE B C   1 
ATOM   4273  O  O   . PHE B 1 82  ? 73.507 111.241 56.707  1.00 34.59 ? 82  PHE B O   1 
ATOM   4274  C  CB  . PHE B 1 82  ? 71.420 111.474 54.085  1.00 34.98 ? 82  PHE B CB  1 
ATOM   4275  C  CG  . PHE B 1 82  ? 70.042 111.147 53.540  1.00 36.96 ? 82  PHE B CG  1 
ATOM   4276  C  CD1 . PHE B 1 82  ? 68.919 111.207 54.361  1.00 36.87 ? 82  PHE B CD1 1 
ATOM   4277  C  CD2 . PHE B 1 82  ? 69.878 110.710 52.227  1.00 37.25 ? 82  PHE B CD2 1 
ATOM   4278  C  CE1 . PHE B 1 82  ? 67.666 110.835 53.888  1.00 37.40 ? 82  PHE B CE1 1 
ATOM   4279  C  CE2 . PHE B 1 82  ? 68.631 110.334 51.748  1.00 36.98 ? 82  PHE B CE2 1 
ATOM   4280  C  CZ  . PHE B 1 82  ? 67.524 110.395 52.578  1.00 37.55 ? 82  PHE B CZ  1 
ATOM   4281  N  N   . GLY B 1 83  ? 74.345 110.544 54.741  1.00 33.97 ? 83  GLY B N   1 
ATOM   4282  C  CA  . GLY B 1 83  ? 75.708 110.848 55.129  1.00 33.15 ? 83  GLY B CA  1 
ATOM   4283  C  C   . GLY B 1 83  ? 76.708 110.584 54.025  1.00 33.54 ? 83  GLY B C   1 
ATOM   4284  O  O   . GLY B 1 83  ? 76.502 110.946 52.860  1.00 33.95 ? 83  GLY B O   1 
ATOM   4285  N  N   . TYR B 1 84  ? 77.810 109.943 54.392  1.00 34.12 ? 84  TYR B N   1 
ATOM   4286  C  CA  . TYR B 1 84  ? 78.870 109.638 53.433  1.00 32.87 ? 84  TYR B CA  1 
ATOM   4287  C  C   . TYR B 1 84  ? 79.660 108.417 53.850  1.00 32.06 ? 84  TYR B C   1 
ATOM   4288  O  O   . TYR B 1 84  ? 79.577 107.945 54.991  1.00 30.33 ? 84  TYR B O   1 
ATOM   4289  C  CB  . TYR B 1 84  ? 79.828 110.831 53.300  1.00 33.24 ? 84  TYR B CB  1 
ATOM   4290  C  CG  . TYR B 1 84  ? 80.595 111.157 54.570  1.00 32.91 ? 84  TYR B CG  1 
ATOM   4291  C  CD1 . TYR B 1 84  ? 81.774 110.491 54.890  1.00 34.32 ? 84  TYR B CD1 1 
ATOM   4292  C  CD2 . TYR B 1 84  ? 80.114 112.099 55.468  1.00 32.44 ? 84  TYR B CD2 1 
ATOM   4293  C  CE1 . TYR B 1 84  ? 82.451 110.756 56.077  1.00 35.15 ? 84  TYR B CE1 1 
ATOM   4294  C  CE2 . TYR B 1 84  ? 80.769 112.372 56.642  1.00 32.88 ? 84  TYR B CE2 1 
ATOM   4295  C  CZ  . TYR B 1 84  ? 81.937 111.705 56.952  1.00 34.84 ? 84  TYR B CZ  1 
ATOM   4296  O  OH  . TYR B 1 84  ? 82.597 112.002 58.128  1.00 34.33 ? 84  TYR B OH  1 
ATOM   4297  N  N   . PHE B 1 85  ? 80.418 107.911 52.887  1.00 32.40 ? 85  PHE B N   1 
ATOM   4298  C  CA  . PHE B 1 85  ? 81.285 106.761 53.080  1.00 32.79 ? 85  PHE B CA  1 
ATOM   4299  C  C   . PHE B 1 85  ? 82.685 107.287 52.855  1.00 33.43 ? 85  PHE B C   1 
ATOM   4300  O  O   . PHE B 1 85  ? 82.915 108.022 51.902  1.00 34.41 ? 85  PHE B O   1 
ATOM   4301  C  CB  . PHE B 1 85  ? 81.001 105.685 52.037  1.00 32.00 ? 85  PHE B CB  1 
ATOM   4302  C  CG  . PHE B 1 85  ? 82.113 104.683 51.889  1.00 31.38 ? 85  PHE B CG  1 
ATOM   4303  C  CD1 . PHE B 1 85  ? 82.412 103.798 52.923  1.00 30.73 ? 85  PHE B CD1 1 
ATOM   4304  C  CD2 . PHE B 1 85  ? 82.872 104.638 50.727  1.00 30.73 ? 85  PHE B CD2 1 
ATOM   4305  C  CE1 . PHE B 1 85  ? 83.447 102.887 52.798  1.00 31.24 ? 85  PHE B CE1 1 
ATOM   4306  C  CE2 . PHE B 1 85  ? 83.921 103.723 50.589  1.00 30.63 ? 85  PHE B CE2 1 
ATOM   4307  C  CZ  . PHE B 1 85  ? 84.209 102.848 51.623  1.00 30.87 ? 85  PHE B CZ  1 
ATOM   4308  N  N   . GLU B 1 86  ? 83.620 106.938 53.727  1.00 34.41 ? 86  GLU B N   1 
ATOM   4309  C  CA  . GLU B 1 86  ? 84.988 107.398 53.539  1.00 34.89 ? 86  GLU B CA  1 
ATOM   4310  C  C   . GLU B 1 86  ? 85.991 106.257 53.595  1.00 35.20 ? 86  GLU B C   1 
ATOM   4311  O  O   . GLU B 1 86  ? 85.995 105.454 54.544  1.00 34.89 ? 86  GLU B O   1 
ATOM   4312  C  CB  . GLU B 1 86  ? 85.370 108.441 54.583  1.00 35.35 ? 86  GLU B CB  1 
ATOM   4313  C  CG  . GLU B 1 86  ? 86.759 109.010 54.350  1.00 36.29 ? 86  GLU B CG  1 
ATOM   4314  C  CD  . GLU B 1 86  ? 87.238 109.921 55.465  1.00 37.25 ? 86  GLU B CD  1 
ATOM   4315  O  OE1 . GLU B 1 86  ? 88.314 110.527 55.283  1.00 38.64 ? 86  GLU B OE1 1 
ATOM   4316  O  OE2 . GLU B 1 86  ? 86.561 110.034 56.515  1.00 37.44 ? 86  GLU B OE2 1 
ATOM   4317  N  N   . VAL B 1 87  ? 86.839 106.202 52.569  1.00 34.85 ? 87  VAL B N   1 
ATOM   4318  C  CA  . VAL B 1 87  ? 87.876 105.186 52.473  1.00 34.74 ? 87  VAL B CA  1 
ATOM   4319  C  C   . VAL B 1 87  ? 88.993 105.484 53.459  1.00 34.59 ? 87  VAL B C   1 
ATOM   4320  O  O   . VAL B 1 87  ? 89.454 106.618 53.578  1.00 34.68 ? 87  VAL B O   1 
ATOM   4321  C  CB  . VAL B 1 87  ? 88.495 105.130 51.055  1.00 34.85 ? 87  VAL B CB  1 
ATOM   4322  C  CG1 . VAL B 1 87  ? 89.746 104.279 51.078  1.00 34.63 ? 87  VAL B CG1 1 
ATOM   4323  C  CG2 . VAL B 1 87  ? 87.500 104.557 50.061  1.00 34.01 ? 87  VAL B CG2 1 
ATOM   4324  N  N   . THR B 1 88  ? 89.429 104.453 54.164  1.00 34.74 ? 88  THR B N   1 
ATOM   4325  C  CA  . THR B 1 88  ? 90.504 104.606 55.121  1.00 34.49 ? 88  THR B CA  1 
ATOM   4326  C  C   . THR B 1 88  ? 91.686 103.714 54.755  1.00 35.11 ? 88  THR B C   1 
ATOM   4327  O  O   . THR B 1 88  ? 92.822 103.989 55.138  1.00 36.42 ? 88  THR B O   1 
ATOM   4328  C  CB  . THR B 1 88  ? 90.029 104.286 56.558  1.00 33.64 ? 88  THR B CB  1 
ATOM   4329  O  OG1 . THR B 1 88  ? 89.383 103.009 56.593  1.00 33.48 ? 88  THR B OG1 1 
ATOM   4330  C  CG2 . THR B 1 88  ? 89.058 105.336 57.029  1.00 31.91 ? 88  THR B CG2 1 
ATOM   4331  N  N   . HIS B 1 89  ? 91.436 102.660 53.993  1.00 34.77 ? 89  HIS B N   1 
ATOM   4332  C  CA  . HIS B 1 89  ? 92.523 101.770 53.627  1.00 34.84 ? 89  HIS B CA  1 
ATOM   4333  C  C   . HIS B 1 89  ? 92.502 101.373 52.171  1.00 34.87 ? 89  HIS B C   1 
ATOM   4334  O  O   . HIS B 1 89  ? 91.465 101.423 51.522  1.00 34.61 ? 89  HIS B O   1 
ATOM   4335  C  CB  . HIS B 1 89  ? 92.488 100.514 54.483  1.00 35.25 ? 89  HIS B CB  1 
ATOM   4336  C  CG  . HIS B 1 89  ? 92.622 100.781 55.944  1.00 35.88 ? 89  HIS B CG  1 
ATOM   4337  N  ND1 . HIS B 1 89  ? 91.688 101.501 56.656  1.00 35.82 ? 89  HIS B ND1 1 
ATOM   4338  C  CD2 . HIS B 1 89  ? 93.588 100.435 56.827  1.00 36.25 ? 89  HIS B CD2 1 
ATOM   4339  C  CE1 . HIS B 1 89  ? 92.073 101.587 57.917  1.00 36.13 ? 89  HIS B CE1 1 
ATOM   4340  N  NE2 . HIS B 1 89  ? 93.222 100.949 58.048  1.00 35.77 ? 89  HIS B NE2 1 
ATOM   4341  N  N   . ASP B 1 90  ? 93.656 100.950 51.673  1.00 34.64 ? 90  ASP B N   1 
ATOM   4342  C  CA  . ASP B 1 90  ? 93.772 100.553 50.292  1.00 34.54 ? 90  ASP B CA  1 
ATOM   4343  C  C   . ASP B 1 90  ? 93.415 99.091  50.051  1.00 35.02 ? 90  ASP B C   1 
ATOM   4344  O  O   . ASP B 1 90  ? 94.051 98.178  50.601  1.00 34.66 ? 90  ASP B O   1 
ATOM   4345  C  CB  . ASP B 1 90  ? 95.185 100.808 49.796  1.00 34.99 ? 90  ASP B CB  1 
ATOM   4346  C  CG  . ASP B 1 90  ? 95.301 100.656 48.303  1.00 35.64 ? 90  ASP B CG  1 
ATOM   4347  O  OD1 . ASP B 1 90  ? 94.724 99.687  47.758  1.00 36.14 ? 90  ASP B OD1 1 
ATOM   4348  O  OD2 . ASP B 1 90  ? 95.969 101.503 47.677  1.00 36.58 ? 90  ASP B OD2 1 
ATOM   4349  N  N   . ILE B 1 91  ? 92.391 98.876  49.224  1.00 34.51 ? 91  ILE B N   1 
ATOM   4350  C  CA  . ILE B 1 91  ? 91.962 97.527  48.871  1.00 34.12 ? 91  ILE B CA  1 
ATOM   4351  C  C   . ILE B 1 91  ? 91.845 97.471  47.356  1.00 34.38 ? 91  ILE B C   1 
ATOM   4352  O  O   . ILE B 1 91  ? 91.107 96.661  46.802  1.00 34.43 ? 91  ILE B O   1 
ATOM   4353  C  CB  . ILE B 1 91  ? 90.587 97.140  49.493  1.00 32.62 ? 91  ILE B CB  1 
ATOM   4354  C  CG1 . ILE B 1 91  ? 89.485 98.043  48.947  1.00 32.18 ? 91  ILE B CG1 1 
ATOM   4355  C  CG2 . ILE B 1 91  ? 90.645 97.229  50.998  1.00 32.13 ? 91  ILE B CG2 1 
ATOM   4356  C  CD1 . ILE B 1 91  ? 88.119 97.684  49.451  1.00 31.78 ? 91  ILE B CD1 1 
ATOM   4357  N  N   . THR B 1 92  ? 92.585 98.337  46.681  1.00 35.20 ? 92  THR B N   1 
ATOM   4358  C  CA  . THR B 1 92  ? 92.537 98.356  45.228  1.00 35.94 ? 92  THR B CA  1 
ATOM   4359  C  C   . THR B 1 92  ? 93.130 97.093  44.636  1.00 36.77 ? 92  THR B C   1 
ATOM   4360  O  O   . THR B 1 92  ? 92.921 96.800  43.463  1.00 37.91 ? 92  THR B O   1 
ATOM   4361  C  CB  . THR B 1 92  ? 93.295 99.537  44.659  1.00 35.72 ? 92  THR B CB  1 
ATOM   4362  O  OG1 . THR B 1 92  ? 94.670 99.445  45.056  1.00 36.34 ? 92  THR B OG1 1 
ATOM   4363  C  CG2 . THR B 1 92  ? 92.680 100.844 45.152  1.00 34.19 ? 92  THR B CG2 1 
ATOM   4364  N  N   . LYS B 1 93  ? 93.878 96.340  45.434  1.00 36.90 ? 93  LYS B N   1 
ATOM   4365  C  CA  . LYS B 1 93  ? 94.459 95.113  44.920  1.00 37.09 ? 93  LYS B CA  1 
ATOM   4366  C  C   . LYS B 1 93  ? 93.324 94.114  44.671  1.00 36.95 ? 93  LYS B C   1 
ATOM   4367  O  O   . LYS B 1 93  ? 93.456 93.194  43.861  1.00 36.97 ? 93  LYS B O   1 
ATOM   4368  C  CB  . LYS B 1 93  ? 95.479 94.549  45.914  1.00 37.13 ? 93  LYS B CB  1 
ATOM   4369  C  CG  . LYS B 1 93  ? 94.890 93.790  47.087  1.00 38.92 ? 93  LYS B CG  1 
ATOM   4370  C  CD  . LYS B 1 93  ? 95.731 93.997  48.353  1.00 40.61 ? 93  LYS B CD  1 
ATOM   4371  C  CE  . LYS B 1 93  ? 95.375 95.325  49.088  1.00 42.85 ? 93  LYS B CE  1 
ATOM   4372  N  NZ  . LYS B 1 93  ? 95.270 96.584  48.227  1.00 43.02 ? 93  LYS B NZ  1 
ATOM   4373  N  N   . TYR B 1 94  ? 92.201 94.330  45.355  1.00 36.61 ? 94  TYR B N   1 
ATOM   4374  C  CA  . TYR B 1 94  ? 91.020 93.473  45.246  1.00 35.44 ? 94  TYR B CA  1 
ATOM   4375  C  C   . TYR B 1 94  ? 89.931 94.033  44.340  1.00 34.80 ? 94  TYR B C   1 
ATOM   4376  O  O   . TYR B 1 94  ? 89.365 93.314  43.526  1.00 34.77 ? 94  TYR B O   1 
ATOM   4377  C  CB  . TYR B 1 94  ? 90.393 93.252  46.619  1.00 35.13 ? 94  TYR B CB  1 
ATOM   4378  C  CG  . TYR B 1 94  ? 91.286 92.566  47.608  1.00 36.38 ? 94  TYR B CG  1 
ATOM   4379  C  CD1 . TYR B 1 94  ? 91.757 91.284  47.367  1.00 36.46 ? 94  TYR B CD1 1 
ATOM   4380  C  CD2 . TYR B 1 94  ? 91.647 93.193  48.800  1.00 36.74 ? 94  TYR B CD2 1 
ATOM   4381  C  CE1 . TYR B 1 94  ? 92.568 90.632  48.284  1.00 37.66 ? 94  TYR B CE1 1 
ATOM   4382  C  CE2 . TYR B 1 94  ? 92.460 92.548  49.733  1.00 37.89 ? 94  TYR B CE2 1 
ATOM   4383  C  CZ  . TYR B 1 94  ? 92.919 91.265  49.467  1.00 37.99 ? 94  TYR B CZ  1 
ATOM   4384  O  OH  . TYR B 1 94  ? 93.730 90.611  50.373  1.00 38.64 ? 94  TYR B OH  1 
ATOM   4385  N  N   . SER B 1 95  ? 89.630 95.317  44.490  1.00 34.04 ? 95  SER B N   1 
ATOM   4386  C  CA  . SER B 1 95  ? 88.565 95.919  43.715  1.00 33.17 ? 95  SER B CA  1 
ATOM   4387  C  C   . SER B 1 95  ? 88.924 97.213  43.033  1.00 34.14 ? 95  SER B C   1 
ATOM   4388  O  O   . SER B 1 95  ? 89.464 98.134  43.652  1.00 34.11 ? 95  SER B O   1 
ATOM   4389  C  CB  . SER B 1 95  ? 87.352 96.162  44.613  1.00 32.78 ? 95  SER B CB  1 
ATOM   4390  O  OG  . SER B 1 95  ? 86.380 96.952  43.952  1.00 31.36 ? 95  SER B OG  1 
ATOM   4391  N  N   . LYS B 1 96  ? 88.576 97.282  41.753  1.00 34.30 ? 96  LYS B N   1 
ATOM   4392  C  CA  . LYS B 1 96  ? 88.827 98.461  40.942  1.00 34.83 ? 96  LYS B CA  1 
ATOM   4393  C  C   . LYS B 1 96  ? 87.679 99.464  41.030  1.00 34.98 ? 96  LYS B C   1 
ATOM   4394  O  O   . LYS B 1 96  ? 87.705 100.496 40.356  1.00 36.10 ? 96  LYS B O   1 
ATOM   4395  C  CB  . LYS B 1 96  ? 89.009 98.059  39.480  1.00 35.62 ? 96  LYS B CB  1 
ATOM   4396  C  CG  . LYS B 1 96  ? 87.763 97.443  38.851  1.00 36.48 ? 96  LYS B CG  1 
ATOM   4397  C  CD  . LYS B 1 96  ? 87.908 97.363  37.339  1.00 36.75 ? 96  LYS B CD  1 
ATOM   4398  C  CE  . LYS B 1 96  ? 86.723 96.677  36.717  1.00 37.65 ? 96  LYS B CE  1 
ATOM   4399  N  NZ  . LYS B 1 96  ? 86.783 96.751  35.235  1.00 39.40 ? 96  LYS B NZ  1 
ATOM   4400  N  N   . ALA B 1 97  ? 86.668 99.166  41.840  1.00 34.31 ? 97  ALA B N   1 
ATOM   4401  C  CA  . ALA B 1 97  ? 85.529 100.067 41.982  1.00 33.55 ? 97  ALA B CA  1 
ATOM   4402  C  C   . ALA B 1 97  ? 85.945 101.462 42.479  1.00 33.21 ? 97  ALA B C   1 
ATOM   4403  O  O   . ALA B 1 97  ? 86.665 101.596 43.470  1.00 33.09 ? 97  ALA B O   1 
ATOM   4404  C  CB  . ALA B 1 97  ? 84.498 99.450  42.915  1.00 32.59 ? 97  ALA B CB  1 
ATOM   4405  N  N   . LYS B 1 98  ? 85.484 102.496 41.781  1.00 32.79 ? 98  LYS B N   1 
ATOM   4406  C  CA  . LYS B 1 98  ? 85.804 103.874 42.132  1.00 33.09 ? 98  LYS B CA  1 
ATOM   4407  C  C   . LYS B 1 98  ? 85.497 104.284 43.567  1.00 32.25 ? 98  LYS B C   1 
ATOM   4408  O  O   . LYS B 1 98  ? 86.181 105.135 44.136  1.00 31.57 ? 98  LYS B O   1 
ATOM   4409  C  CB  . LYS B 1 98  ? 85.096 104.834 41.182  1.00 33.96 ? 98  LYS B CB  1 
ATOM   4410  C  CG  . LYS B 1 98  ? 85.727 104.876 39.826  1.00 36.58 ? 98  LYS B CG  1 
ATOM   4411  C  CD  . LYS B 1 98  ? 85.087 105.934 38.957  1.00 40.03 ? 98  LYS B CD  1 
ATOM   4412  C  CE  . LYS B 1 98  ? 85.695 105.934 37.553  1.00 42.38 ? 98  LYS B CE  1 
ATOM   4413  N  NZ  . LYS B 1 98  ? 85.542 104.602 36.873  1.00 43.49 ? 98  LYS B NZ  1 
ATOM   4414  N  N   . VAL B 1 99  ? 84.460 103.697 44.145  1.00 31.64 ? 99  VAL B N   1 
ATOM   4415  C  CA  . VAL B 1 99  ? 84.082 104.021 45.510  1.00 31.11 ? 99  VAL B CA  1 
ATOM   4416  C  C   . VAL B 1 99  ? 85.259 103.765 46.456  1.00 31.31 ? 99  VAL B C   1 
ATOM   4417  O  O   . VAL B 1 99  ? 85.345 104.402 47.500  1.00 30.58 ? 99  VAL B O   1 
ATOM   4418  C  CB  . VAL B 1 99  ? 82.840 103.190 45.952  1.00 30.82 ? 99  VAL B CB  1 
ATOM   4419  C  CG1 . VAL B 1 99  ? 83.169 101.706 45.919  1.00 30.34 ? 99  VAL B CG1 1 
ATOM   4420  C  CG2 . VAL B 1 99  ? 82.381 103.611 47.342  1.00 29.54 ? 99  VAL B CG2 1 
ATOM   4421  N  N   . PHE B 1 100 ? 86.161 102.847 46.073  1.00 31.89 ? 100 PHE B N   1 
ATOM   4422  C  CA  . PHE B 1 100 ? 87.356 102.489 46.872  1.00 32.46 ? 100 PHE B CA  1 
ATOM   4423  C  C   . PHE B 1 100 ? 88.653 103.085 46.288  1.00 33.40 ? 100 PHE B C   1 
ATOM   4424  O  O   . PHE B 1 100 ? 89.728 102.977 46.880  1.00 32.77 ? 100 PHE B O   1 
ATOM   4425  C  CB  . PHE B 1 100 ? 87.548 100.964 46.921  1.00 32.14 ? 100 PHE B CB  1 
ATOM   4426  C  CG  . PHE B 1 100 ? 86.333 100.203 47.335  1.00 31.99 ? 100 PHE B CG  1 
ATOM   4427  C  CD1 . PHE B 1 100 ? 85.736 100.430 48.572  1.00 32.24 ? 100 PHE B CD1 1 
ATOM   4428  C  CD2 . PHE B 1 100 ? 85.786 99.244  46.493  1.00 31.93 ? 100 PHE B CD2 1 
ATOM   4429  C  CE1 . PHE B 1 100 ? 84.604 99.707  48.964  1.00 32.29 ? 100 PHE B CE1 1 
ATOM   4430  C  CE2 . PHE B 1 100 ? 84.658 98.517  46.874  1.00 32.52 ? 100 PHE B CE2 1 
ATOM   4431  C  CZ  . PHE B 1 100 ? 84.067 98.751  48.114  1.00 32.53 ? 100 PHE B CZ  1 
ATOM   4432  N  N   . GLU B 1 101 ? 88.517 103.679 45.106  1.00 34.90 ? 101 GLU B N   1 
ATOM   4433  C  CA  . GLU B 1 101 ? 89.586 104.292 44.318  1.00 35.73 ? 101 GLU B CA  1 
ATOM   4434  C  C   . GLU B 1 101 ? 90.836 104.865 44.992  1.00 35.83 ? 101 GLU B C   1 
ATOM   4435  O  O   . GLU B 1 101 ? 91.930 104.732 44.460  1.00 35.87 ? 101 GLU B O   1 
ATOM   4436  C  CB  . GLU B 1 101 ? 88.953 105.350 43.435  1.00 37.70 ? 101 GLU B CB  1 
ATOM   4437  C  CG  . GLU B 1 101 ? 89.850 105.924 42.401  1.00 41.50 ? 101 GLU B CG  1 
ATOM   4438  C  CD  . GLU B 1 101 ? 89.086 106.857 41.507  1.00 44.22 ? 101 GLU B CD  1 
ATOM   4439  O  OE1 . GLU B 1 101 ? 88.395 107.751 42.047  1.00 46.38 ? 101 GLU B OE1 1 
ATOM   4440  O  OE2 . GLU B 1 101 ? 89.166 106.702 40.271  1.00 45.92 ? 101 GLU B OE2 1 
ATOM   4441  N  N   . HIS B 1 102 ? 90.690 105.532 46.127  1.00 35.88 ? 102 HIS B N   1 
ATOM   4442  C  CA  . HIS B 1 102 ? 91.853 106.073 46.822  1.00 36.46 ? 102 HIS B CA  1 
ATOM   4443  C  C   . HIS B 1 102 ? 91.513 106.365 48.276  1.00 36.09 ? 102 HIS B C   1 
ATOM   4444  O  O   . HIS B 1 102 ? 90.363 106.615 48.605  1.00 36.20 ? 102 HIS B O   1 
ATOM   4445  C  CB  . HIS B 1 102 ? 92.404 107.332 46.113  1.00 37.74 ? 102 HIS B CB  1 
ATOM   4446  C  CG  . HIS B 1 102 ? 91.522 108.541 46.206  1.00 38.81 ? 102 HIS B CG  1 
ATOM   4447  N  ND1 . HIS B 1 102 ? 91.244 109.176 47.400  1.00 40.19 ? 102 HIS B ND1 1 
ATOM   4448  C  CD2 . HIS B 1 102 ? 90.859 109.236 45.248  1.00 38.70 ? 102 HIS B CD2 1 
ATOM   4449  C  CE1 . HIS B 1 102 ? 90.446 110.206 47.173  1.00 40.22 ? 102 HIS B CE1 1 
ATOM   4450  N  NE2 . HIS B 1 102 ? 90.196 110.264 45.877  1.00 39.63 ? 102 HIS B NE2 1 
ATOM   4451  N  N   . ILE B 1 103 ? 92.519 106.310 49.146  1.00 36.17 ? 103 ILE B N   1 
ATOM   4452  C  CA  . ILE B 1 103 ? 92.316 106.545 50.575  1.00 35.03 ? 103 ILE B CA  1 
ATOM   4453  C  C   . ILE B 1 103 ? 91.787 107.934 50.845  1.00 35.17 ? 103 ILE B C   1 
ATOM   4454  O  O   . ILE B 1 103 ? 92.222 108.899 50.230  1.00 35.14 ? 103 ILE B O   1 
ATOM   4455  C  CB  . ILE B 1 103 ? 93.617 106.370 51.367  1.00 34.14 ? 103 ILE B CB  1 
ATOM   4456  C  CG1 . ILE B 1 103 ? 94.333 105.100 50.901  1.00 32.13 ? 103 ILE B CG1 1 
ATOM   4457  C  CG2 . ILE B 1 103 ? 93.304 106.322 52.859  1.00 33.44 ? 103 ILE B CG2 1 
ATOM   4458  C  CD1 . ILE B 1 103 ? 95.409 104.641 51.821  1.00 31.15 ? 103 ILE B CD1 1 
ATOM   4459  N  N   . GLY B 1 104 ? 90.839 108.028 51.771  1.00 36.02 ? 104 GLY B N   1 
ATOM   4460  C  CA  . GLY B 1 104 ? 90.259 109.315 52.101  1.00 35.41 ? 104 GLY B CA  1 
ATOM   4461  C  C   . GLY B 1 104 ? 89.186 109.772 51.123  1.00 35.61 ? 104 GLY B C   1 
ATOM   4462  O  O   . GLY B 1 104 ? 88.688 110.889 51.248  1.00 35.17 ? 104 GLY B O   1 
ATOM   4463  N  N   . LYS B 1 105 ? 88.825 108.941 50.143  1.00 35.32 ? 105 LYS B N   1 
ATOM   4464  C  CA  . LYS B 1 105 ? 87.780 109.344 49.202  1.00 34.76 ? 105 LYS B CA  1 
ATOM   4465  C  C   . LYS B 1 105 ? 86.412 109.255 49.859  1.00 33.85 ? 105 LYS B C   1 
ATOM   4466  O  O   . LYS B 1 105 ? 86.077 108.259 50.498  1.00 32.79 ? 105 LYS B O   1 
ATOM   4467  C  CB  . LYS B 1 105 ? 87.763 108.483 47.944  1.00 35.09 ? 105 LYS B CB  1 
ATOM   4468  C  CG  . LYS B 1 105 ? 86.577 108.832 47.054  1.00 35.81 ? 105 LYS B CG  1 
ATOM   4469  C  CD  . LYS B 1 105 ? 86.654 108.189 45.682  1.00 37.02 ? 105 LYS B CD  1 
ATOM   4470  C  CE  . LYS B 1 105 ? 85.562 108.749 44.772  1.00 37.21 ? 105 LYS B CE  1 
ATOM   4471  N  NZ  . LYS B 1 105 ? 85.831 108.489 43.321  1.00 37.98 ? 105 LYS B NZ  1 
ATOM   4472  N  N   . LYS B 1 106 ? 85.628 110.311 49.700  1.00 33.51 ? 106 LYS B N   1 
ATOM   4473  C  CA  . LYS B 1 106 ? 84.304 110.355 50.284  1.00 33.48 ? 106 LYS B CA  1 
ATOM   4474  C  C   . LYS B 1 106 ? 83.209 110.296 49.237  1.00 32.68 ? 106 LYS B C   1 
ATOM   4475  O  O   . LYS B 1 106 ? 83.230 111.034 48.250  1.00 32.69 ? 106 LYS B O   1 
ATOM   4476  C  CB  . LYS B 1 106 ? 84.143 111.617 51.119  1.00 34.76 ? 106 LYS B CB  1 
ATOM   4477  C  CG  . LYS B 1 106 ? 84.859 111.585 52.450  1.00 36.90 ? 106 LYS B CG  1 
ATOM   4478  C  CD  . LYS B 1 106 ? 84.532 112.867 53.192  1.00 40.16 ? 106 LYS B CD  1 
ATOM   4479  C  CE  . LYS B 1 106 ? 85.148 112.922 54.580  1.00 42.12 ? 106 LYS B CE  1 
ATOM   4480  N  NZ  . LYS B 1 106 ? 85.035 114.307 55.151  1.00 42.71 ? 106 LYS B NZ  1 
ATOM   4481  N  N   . THR B 1 107 ? 82.257 109.399 49.466  1.00 31.83 ? 107 THR B N   1 
ATOM   4482  C  CA  . THR B 1 107 ? 81.115 109.207 48.581  1.00 31.73 ? 107 THR B CA  1 
ATOM   4483  C  C   . THR B 1 107 ? 79.839 109.307 49.425  1.00 31.96 ? 107 THR B C   1 
ATOM   4484  O  O   . THR B 1 107 ? 79.754 108.760 50.536  1.00 31.38 ? 107 THR B O   1 
ATOM   4485  C  CB  . THR B 1 107 ? 81.183 107.819 47.874  1.00 31.78 ? 107 THR B CB  1 
ATOM   4486  O  OG1 . THR B 1 107 ? 82.266 107.821 46.935  1.00 31.96 ? 107 THR B OG1 1 
ATOM   4487  C  CG2 . THR B 1 107 ? 79.890 107.500 47.145  1.00 30.79 ? 107 THR B CG2 1 
ATOM   4488  N  N   . PRO B 1 108 ? 78.839 110.045 48.919  1.00 31.77 ? 108 PRO B N   1 
ATOM   4489  C  CA  . PRO B 1 108 ? 77.567 110.212 49.632  1.00 31.04 ? 108 PRO B CA  1 
ATOM   4490  C  C   . PRO B 1 108 ? 76.765 108.917 49.721  1.00 31.24 ? 108 PRO B C   1 
ATOM   4491  O  O   . PRO B 1 108 ? 76.751 108.093 48.790  1.00 30.39 ? 108 PRO B O   1 
ATOM   4492  C  CB  . PRO B 1 108 ? 76.852 111.289 48.826  1.00 31.18 ? 108 PRO B CB  1 
ATOM   4493  C  CG  . PRO B 1 108 ? 77.440 111.128 47.430  1.00 31.77 ? 108 PRO B CG  1 
ATOM   4494  C  CD  . PRO B 1 108 ? 78.891 110.871 47.699  1.00 30.98 ? 108 PRO B CD  1 
ATOM   4495  N  N   . ILE B 1 109 ? 76.104 108.733 50.859  1.00 31.02 ? 109 ILE B N   1 
ATOM   4496  C  CA  . ILE B 1 109 ? 75.303 107.544 51.066  1.00 29.57 ? 109 ILE B CA  1 
ATOM   4497  C  C   . ILE B 1 109 ? 73.926 107.867 51.597  1.00 29.66 ? 109 ILE B C   1 
ATOM   4498  O  O   . ILE B 1 109 ? 73.717 108.906 52.232  1.00 30.36 ? 109 ILE B O   1 
ATOM   4499  C  CB  . ILE B 1 109 ? 75.967 106.576 52.063  1.00 29.01 ? 109 ILE B CB  1 
ATOM   4500  C  CG1 . ILE B 1 109 ? 75.989 107.181 53.466  1.00 29.14 ? 109 ILE B CG1 1 
ATOM   4501  C  CG2 . ILE B 1 109 ? 77.373 106.285 51.634  1.00 28.70 ? 109 ILE B CG2 1 
ATOM   4502  C  CD1 . ILE B 1 109 ? 76.546 106.237 54.518  1.00 27.05 ? 109 ILE B CD1 1 
ATOM   4503  N  N   . ALA B 1 110 ? 72.986 106.971 51.308  1.00 29.06 ? 110 ALA B N   1 
ATOM   4504  C  CA  . ALA B 1 110 ? 71.614 107.073 51.799  1.00 27.97 ? 110 ALA B CA  1 
ATOM   4505  C  C   . ALA B 1 110 ? 71.410 105.741 52.526  1.00 27.75 ? 110 ALA B C   1 
ATOM   4506  O  O   . ALA B 1 110 ? 71.766 104.685 51.998  1.00 28.00 ? 110 ALA B O   1 
ATOM   4507  C  CB  . ALA B 1 110 ? 70.653 107.213 50.646  1.00 27.78 ? 110 ALA B CB  1 
ATOM   4508  N  N   . VAL B 1 111 ? 70.871 105.787 53.738  1.00 27.70 ? 111 VAL B N   1 
ATOM   4509  C  CA  . VAL B 1 111 ? 70.664 104.572 54.537  1.00 27.25 ? 111 VAL B CA  1 
ATOM   4510  C  C   . VAL B 1 111 ? 69.220 104.383 55.014  1.00 27.84 ? 111 VAL B C   1 
ATOM   4511  O  O   . VAL B 1 111 ? 68.541 105.355 55.359  1.00 28.04 ? 111 VAL B O   1 
ATOM   4512  C  CB  . VAL B 1 111 ? 71.571 104.590 55.801  1.00 26.62 ? 111 VAL B CB  1 
ATOM   4513  C  CG1 . VAL B 1 111 ? 71.209 103.454 56.733  1.00 25.81 ? 111 VAL B CG1 1 
ATOM   4514  C  CG2 . VAL B 1 111 ? 73.022 104.514 55.401  1.00 25.90 ? 111 VAL B CG2 1 
ATOM   4515  N  N   . ARG B 1 112 ? 68.756 103.132 55.034  1.00 28.33 ? 112 ARG B N   1 
ATOM   4516  C  CA  . ARG B 1 112 ? 67.413 102.830 55.520  1.00 28.28 ? 112 ARG B CA  1 
ATOM   4517  C  C   . ARG B 1 112 ? 67.387 101.621 56.454  1.00 28.62 ? 112 ARG B C   1 
ATOM   4518  O  O   . ARG B 1 112 ? 67.720 100.503 56.070  1.00 29.70 ? 112 ARG B O   1 
ATOM   4519  C  CB  . ARG B 1 112 ? 66.427 102.601 54.372  1.00 27.79 ? 112 ARG B CB  1 
ATOM   4520  C  CG  . ARG B 1 112 ? 64.991 102.407 54.881  1.00 28.12 ? 112 ARG B CG  1 
ATOM   4521  C  CD  . ARG B 1 112 ? 63.982 102.418 53.757  1.00 29.18 ? 112 ARG B CD  1 
ATOM   4522  N  NE  . ARG B 1 112 ? 62.612 102.173 54.208  1.00 30.95 ? 112 ARG B NE  1 
ATOM   4523  C  CZ  . ARG B 1 112 ? 62.114 100.985 54.557  1.00 32.50 ? 112 ARG B CZ  1 
ATOM   4524  N  NH1 . ARG B 1 112 ? 62.870 99.891  54.514  1.00 33.38 ? 112 ARG B NH1 1 
ATOM   4525  N  NH2 . ARG B 1 112 ? 60.848 100.893 54.949  1.00 32.35 ? 112 ARG B NH2 1 
ATOM   4526  N  N   . PHE B 1 113 ? 66.988 101.861 57.691  1.00 28.43 ? 113 PHE B N   1 
ATOM   4527  C  CA  . PHE B 1 113 ? 66.902 100.811 58.687  1.00 28.57 ? 113 PHE B CA  1 
ATOM   4528  C  C   . PHE B 1 113 ? 65.459 100.312 58.704  1.00 28.49 ? 113 PHE B C   1 
ATOM   4529  O  O   . PHE B 1 113 ? 64.563 101.019 58.276  1.00 28.32 ? 113 PHE B O   1 
ATOM   4530  C  CB  . PHE B 1 113 ? 67.295 101.385 60.047  1.00 29.39 ? 113 PHE B CB  1 
ATOM   4531  C  CG  . PHE B 1 113 ? 68.728 101.829 60.123  1.00 29.93 ? 113 PHE B CG  1 
ATOM   4532  C  CD1 . PHE B 1 113 ? 69.761 100.907 59.997  1.00 29.80 ? 113 PHE B CD1 1 
ATOM   4533  C  CD2 . PHE B 1 113 ? 69.049 103.169 60.323  1.00 30.98 ? 113 PHE B CD2 1 
ATOM   4534  C  CE1 . PHE B 1 113 ? 71.088 101.309 60.069  1.00 30.41 ? 113 PHE B CE1 1 
ATOM   4535  C  CE2 . PHE B 1 113 ? 70.392 103.584 60.397  1.00 30.47 ? 113 PHE B CE2 1 
ATOM   4536  C  CZ  . PHE B 1 113 ? 71.406 102.650 60.269  1.00 29.86 ? 113 PHE B CZ  1 
ATOM   4537  N  N   . SER B 1 114 ? 65.217 99.111  59.207  1.00 28.69 ? 114 SER B N   1 
ATOM   4538  C  CA  . SER B 1 114 ? 63.849 98.604  59.207  1.00 28.54 ? 114 SER B CA  1 
ATOM   4539  C  C   . SER B 1 114 ? 63.685 97.262  59.917  1.00 28.54 ? 114 SER B C   1 
ATOM   4540  O  O   . SER B 1 114 ? 64.649 96.648  60.342  1.00 27.02 ? 114 SER B O   1 
ATOM   4541  C  CB  . SER B 1 114 ? 63.400 98.431  57.764  1.00 28.26 ? 114 SER B CB  1 
ATOM   4542  O  OG  . SER B 1 114 ? 64.224 97.472  57.111  1.00 28.56 ? 114 SER B OG  1 
ATOM   4543  N  N   . THR B 1 115 ? 62.444 96.818  60.052  1.00 29.56 ? 115 THR B N   1 
ATOM   4544  C  CA  . THR B 1 115 ? 62.185 95.513  60.631  1.00 30.12 ? 115 THR B CA  1 
ATOM   4545  C  C   . THR B 1 115 ? 61.808 94.645  59.422  1.00 31.46 ? 115 THR B C   1 
ATOM   4546  O  O   . THR B 1 115 ? 62.086 95.026  58.270  1.00 31.62 ? 115 THR B O   1 
ATOM   4547  C  CB  . THR B 1 115 ? 61.053 95.557  61.639  1.00 30.00 ? 115 THR B CB  1 
ATOM   4548  O  OG1 . THR B 1 115 ? 59.893 96.134  61.032  1.00 30.37 ? 115 THR B OG1 1 
ATOM   4549  C  CG2 . THR B 1 115 ? 61.465 96.389  62.844  1.00 30.46 ? 115 THR B CG2 1 
ATOM   4550  N  N   . VAL B 1 116 ? 61.171 93.501  59.644  1.00 31.73 ? 116 VAL B N   1 
ATOM   4551  C  CA  . VAL B 1 116 ? 60.862 92.641  58.513  1.00 31.76 ? 116 VAL B CA  1 
ATOM   4552  C  C   . VAL B 1 116 ? 59.419 92.293  58.262  1.00 32.57 ? 116 VAL B C   1 
ATOM   4553  O  O   . VAL B 1 116 ? 58.868 92.635  57.225  1.00 32.85 ? 116 VAL B O   1 
ATOM   4554  C  CB  . VAL B 1 116 ? 61.638 91.315  58.618  1.00 30.65 ? 116 VAL B CB  1 
ATOM   4555  C  CG1 . VAL B 1 116 ? 61.497 90.518  57.337  1.00 29.62 ? 116 VAL B CG1 1 
ATOM   4556  C  CG2 . VAL B 1 116 ? 63.081 91.599  58.917  1.00 30.87 ? 116 VAL B CG2 1 
ATOM   4557  N  N   . ALA B 1 117 ? 58.816 91.594  59.211  1.00 34.27 ? 117 ALA B N   1 
ATOM   4558  C  CA  . ALA B 1 117 ? 57.439 91.127  59.068  1.00 36.25 ? 117 ALA B CA  1 
ATOM   4559  C  C   . ALA B 1 117 ? 56.359 92.190  59.166  1.00 37.19 ? 117 ALA B C   1 
ATOM   4560  O  O   . ALA B 1 117 ? 55.509 92.311  58.277  1.00 37.29 ? 117 ALA B O   1 
ATOM   4561  C  CB  . ALA B 1 117 ? 57.164 90.017  60.090  1.00 35.17 ? 117 ALA B CB  1 
ATOM   4562  N  N   . GLY B 1 118 ? 56.389 92.943  60.260  1.00 38.34 ? 118 GLY B N   1 
ATOM   4563  C  CA  . GLY B 1 118 ? 55.394 93.972  60.486  1.00 38.81 ? 118 GLY B CA  1 
ATOM   4564  C  C   . GLY B 1 118 ? 55.196 94.935  59.340  1.00 39.00 ? 118 GLY B C   1 
ATOM   4565  O  O   . GLY B 1 118 ? 56.090 95.132  58.514  1.00 39.16 ? 118 GLY B O   1 
ATOM   4566  N  N   . GLU B 1 119 ? 54.005 95.528  59.291  1.00 39.50 ? 119 GLU B N   1 
ATOM   4567  C  CA  . GLU B 1 119 ? 53.673 96.501  58.259  1.00 39.19 ? 119 GLU B CA  1 
ATOM   4568  C  C   . GLU B 1 119 ? 53.805 97.926  58.807  1.00 38.79 ? 119 GLU B C   1 
ATOM   4569  O  O   . GLU B 1 119 ? 54.125 98.126  59.981  1.00 38.43 ? 119 GLU B O   1 
ATOM   4570  C  CB  . GLU B 1 119 ? 52.267 96.242  57.709  1.00 39.63 ? 119 GLU B CB  1 
ATOM   4571  C  CG  . GLU B 1 119 ? 51.272 95.641  58.693  1.00 41.90 ? 119 GLU B CG  1 
ATOM   4572  C  CD  . GLU B 1 119 ? 51.284 94.119  58.725  1.00 42.56 ? 119 GLU B CD  1 
ATOM   4573  O  OE1 . GLU B 1 119 ? 51.146 93.492  57.653  1.00 43.01 ? 119 GLU B OE1 1 
ATOM   4574  O  OE2 . GLU B 1 119 ? 51.416 93.542  59.827  1.00 44.18 ? 119 GLU B OE2 1 
ATOM   4575  N  N   . SER B 1 120 ? 53.558 98.909  57.952  1.00 38.17 ? 120 SER B N   1 
ATOM   4576  C  CA  . SER B 1 120 ? 53.699 100.317 58.306  1.00 37.54 ? 120 SER B CA  1 
ATOM   4577  C  C   . SER B 1 120 ? 53.287 100.793 59.701  1.00 37.90 ? 120 SER B C   1 
ATOM   4578  O  O   . SER B 1 120 ? 53.906 101.710 60.248  1.00 38.84 ? 120 SER B O   1 
ATOM   4579  C  CB  . SER B 1 120 ? 53.006 101.184 57.255  1.00 37.14 ? 120 SER B CB  1 
ATOM   4580  O  OG  . SER B 1 120 ? 53.649 101.063 56.000  1.00 36.25 ? 120 SER B OG  1 
ATOM   4581  N  N   . GLY B 1 121 ? 52.266 100.205 60.297  1.00 37.13 ? 121 GLY B N   1 
ATOM   4582  C  CA  . GLY B 1 121 ? 51.898 100.699 61.610  1.00 36.85 ? 121 GLY B CA  1 
ATOM   4583  C  C   . GLY B 1 121 ? 52.507 99.981  62.806  1.00 36.22 ? 121 GLY B C   1 
ATOM   4584  O  O   . GLY B 1 121 ? 52.263 100.388 63.947  1.00 36.18 ? 121 GLY B O   1 
ATOM   4585  N  N   . SER B 1 122 ? 53.303 98.938  62.554  1.00 35.23 ? 122 SER B N   1 
ATOM   4586  C  CA  . SER B 1 122 ? 53.903 98.132  63.618  1.00 33.61 ? 122 SER B CA  1 
ATOM   4587  C  C   . SER B 1 122 ? 54.984 98.801  64.462  1.00 33.43 ? 122 SER B C   1 
ATOM   4588  O  O   . SER B 1 122 ? 55.510 99.853  64.108  1.00 33.13 ? 122 SER B O   1 
ATOM   4589  C  CB  . SER B 1 122 ? 54.441 96.832  63.032  1.00 32.73 ? 122 SER B CB  1 
ATOM   4590  O  OG  . SER B 1 122 ? 55.409 97.087  62.040  1.00 33.94 ? 122 SER B OG  1 
ATOM   4591  N  N   . ALA B 1 123 ? 55.299 98.180  65.595  1.00 33.26 ? 123 ALA B N   1 
ATOM   4592  C  CA  . ALA B 1 123 ? 56.311 98.709  66.506  1.00 33.77 ? 123 ALA B CA  1 
ATOM   4593  C  C   . ALA B 1 123 ? 57.720 98.394  66.016  1.00 33.71 ? 123 ALA B C   1 
ATOM   4594  O  O   . ALA B 1 123 ? 57.916 97.442  65.266  1.00 33.55 ? 123 ALA B O   1 
ATOM   4595  C  CB  . ALA B 1 123 ? 56.102 98.139  67.906  1.00 33.69 ? 123 ALA B CB  1 
ATOM   4596  N  N   . ASP B 1 124 ? 58.696 99.198  66.434  1.00 33.57 ? 124 ASP B N   1 
ATOM   4597  C  CA  . ASP B 1 124 ? 60.074 98.974  66.015  1.00 34.24 ? 124 ASP B CA  1 
ATOM   4598  C  C   . ASP B 1 124 ? 60.800 97.970  66.897  1.00 34.42 ? 124 ASP B C   1 
ATOM   4599  O  O   . ASP B 1 124 ? 61.532 97.129  66.391  1.00 36.27 ? 124 ASP B O   1 
ATOM   4600  C  CB  . ASP B 1 124 ? 60.900 100.265 66.045  1.00 33.97 ? 124 ASP B CB  1 
ATOM   4601  C  CG  . ASP B 1 124 ? 60.375 101.335 65.118  1.00 34.55 ? 124 ASP B CG  1 
ATOM   4602  O  OD1 . ASP B 1 124 ? 59.606 101.014 64.186  1.00 34.53 ? 124 ASP B OD1 1 
ATOM   4603  O  OD2 . ASP B 1 124 ? 60.756 102.511 65.321  1.00 34.18 ? 124 ASP B OD2 1 
ATOM   4604  N  N   . THR B 1 125 ? 60.604 98.075  68.208  1.00 33.34 ? 125 THR B N   1 
ATOM   4605  C  CA  . THR B 1 125 ? 61.286 97.222  69.169  1.00 32.85 ? 125 THR B CA  1 
ATOM   4606  C  C   . THR B 1 125 ? 60.667 95.854  69.380  1.00 33.53 ? 125 THR B C   1 
ATOM   4607  O  O   . THR B 1 125 ? 60.207 95.531  70.481  1.00 34.28 ? 125 THR B O   1 
ATOM   4608  C  CB  . THR B 1 125 ? 61.384 97.922  70.549  1.00 32.95 ? 125 THR B CB  1 
ATOM   4609  O  OG1 . THR B 1 125 ? 60.067 98.182  71.059  1.00 32.25 ? 125 THR B OG1 1 
ATOM   4610  C  CG2 . THR B 1 125 ? 62.141 99.228  70.429  1.00 31.33 ? 125 THR B CG2 1 
ATOM   4611  N  N   . VAL B 1 126 ? 60.658 95.046  68.330  1.00 33.03 ? 126 VAL B N   1 
ATOM   4612  C  CA  . VAL B 1 126 ? 60.113 93.695  68.405  1.00 32.54 ? 126 VAL B CA  1 
ATOM   4613  C  C   . VAL B 1 126 ? 61.214 92.767  67.898  1.00 32.74 ? 126 VAL B C   1 
ATOM   4614  O  O   . VAL B 1 126 ? 62.194 93.245  67.312  1.00 33.01 ? 126 VAL B O   1 
ATOM   4615  C  CB  . VAL B 1 126 ? 58.875 93.541  67.502  1.00 32.62 ? 126 VAL B CB  1 
ATOM   4616  C  CG1 . VAL B 1 126 ? 57.803 94.510  67.928  1.00 32.07 ? 126 VAL B CG1 1 
ATOM   4617  C  CG2 . VAL B 1 126 ? 59.255 93.778  66.047  1.00 31.77 ? 126 VAL B CG2 1 
ATOM   4618  N  N   . ARG B 1 127 ? 61.071 91.458  68.128  1.00 31.89 ? 127 ARG B N   1 
ATOM   4619  C  CA  . ARG B 1 127 ? 62.072 90.491  67.664  1.00 31.01 ? 127 ARG B CA  1 
ATOM   4620  C  C   . ARG B 1 127 ? 61.924 90.324  66.159  1.00 30.85 ? 127 ARG B C   1 
ATOM   4621  O  O   . ARG B 1 127 ? 60.832 90.052  65.658  1.00 31.54 ? 127 ARG B O   1 
ATOM   4622  C  CB  . ARG B 1 127 ? 61.882 89.133  68.337  1.00 30.40 ? 127 ARG B CB  1 
ATOM   4623  C  CG  . ARG B 1 127 ? 62.913 88.096  67.926  1.00 29.94 ? 127 ARG B CG  1 
ATOM   4624  C  CD  . ARG B 1 127 ? 62.644 86.793  68.622  1.00 31.18 ? 127 ARG B CD  1 
ATOM   4625  N  NE  . ARG B 1 127 ? 62.550 86.983  70.065  1.00 32.07 ? 127 ARG B NE  1 
ATOM   4626  C  CZ  . ARG B 1 127 ? 63.564 87.371  70.831  1.00 32.80 ? 127 ARG B CZ  1 
ATOM   4627  N  NH1 . ARG B 1 127 ? 64.757 87.602  70.296  1.00 31.18 ? 127 ARG B NH1 1 
ATOM   4628  N  NH2 . ARG B 1 127 ? 63.378 87.553  72.135  1.00 34.49 ? 127 ARG B NH2 1 
ATOM   4629  N  N   . ASP B 1 128 ? 63.023 90.465  65.435  1.00 30.06 ? 128 ASP B N   1 
ATOM   4630  C  CA  . ASP B 1 128 ? 62.954 90.356  63.994  1.00 29.61 ? 128 ASP B CA  1 
ATOM   4631  C  C   . ASP B 1 128 ? 64.327 90.691  63.494  1.00 28.98 ? 128 ASP B C   1 
ATOM   4632  O  O   . ASP B 1 128 ? 65.159 91.209  64.231  1.00 28.83 ? 128 ASP B O   1 
ATOM   4633  C  CB  . ASP B 1 128 ? 61.966 91.408  63.457  1.00 30.97 ? 128 ASP B CB  1 
ATOM   4634  C  CG  . ASP B 1 128 ? 61.120 90.904  62.297  1.00 31.22 ? 128 ASP B CG  1 
ATOM   4635  O  OD1 . ASP B 1 128 ? 61.037 89.669  62.117  1.00 32.89 ? 128 ASP B OD1 1 
ATOM   4636  O  OD2 . ASP B 1 128 ? 60.519 91.740  61.584  1.00 29.95 ? 128 ASP B OD2 1 
ATOM   4637  N  N   . PRO B 1 129 ? 64.608 90.360  62.243  1.00 28.28 ? 129 PRO B N   1 
ATOM   4638  C  CA  . PRO B 1 129 ? 65.945 90.737  61.805  1.00 28.22 ? 129 PRO B CA  1 
ATOM   4639  C  C   . PRO B 1 129 ? 65.811 92.246  61.552  1.00 28.77 ? 129 PRO B C   1 
ATOM   4640  O  O   . PRO B 1 129 ? 64.713 92.794  61.648  1.00 29.04 ? 129 PRO B O   1 
ATOM   4641  C  CB  . PRO B 1 129 ? 66.114 89.949  60.518  1.00 28.82 ? 129 PRO B CB  1 
ATOM   4642  C  CG  . PRO B 1 129 ? 65.241 88.736  60.746  1.00 27.83 ? 129 PRO B CG  1 
ATOM   4643  C  CD  . PRO B 1 129 ? 64.023 89.332  61.369  1.00 27.98 ? 129 PRO B CD  1 
ATOM   4644  N  N   . ARG B 1 130 ? 66.904 92.927  61.242  1.00 29.05 ? 130 ARG B N   1 
ATOM   4645  C  CA  . ARG B 1 130 ? 66.823 94.358  60.969  1.00 29.01 ? 130 ARG B CA  1 
ATOM   4646  C  C   . ARG B 1 130 ? 67.463 94.669  59.631  1.00 29.28 ? 130 ARG B C   1 
ATOM   4647  O  O   . ARG B 1 130 ? 68.572 94.225  59.352  1.00 29.75 ? 130 ARG B O   1 
ATOM   4648  C  CB  . ARG B 1 130 ? 67.533 95.161  62.057  1.00 28.04 ? 130 ARG B CB  1 
ATOM   4649  C  CG  . ARG B 1 130 ? 66.841 95.150  63.394  1.00 28.93 ? 130 ARG B CG  1 
ATOM   4650  C  CD  . ARG B 1 130 ? 65.670 96.095  63.429  1.00 28.07 ? 130 ARG B CD  1 
ATOM   4651  N  NE  . ARG B 1 130 ? 65.040 96.089  64.741  1.00 28.71 ? 130 ARG B NE  1 
ATOM   4652  C  CZ  . ARG B 1 130 ? 64.395 95.046  65.250  1.00 29.71 ? 130 ARG B CZ  1 
ATOM   4653  N  NH1 . ARG B 1 130 ? 64.294 93.923  64.546  1.00 30.48 ? 130 ARG B NH1 1 
ATOM   4654  N  NH2 . ARG B 1 130 ? 63.856 95.120  66.460  1.00 28.83 ? 130 ARG B NH2 1 
ATOM   4655  N  N   . GLY B 1 131 ? 66.759 95.419  58.795  1.00 29.75 ? 131 GLY B N   1 
ATOM   4656  C  CA  . GLY B 1 131 ? 67.325 95.782  57.511  1.00 30.43 ? 131 GLY B CA  1 
ATOM   4657  C  C   . GLY B 1 131 ? 68.310 96.913  57.739  1.00 31.06 ? 131 GLY B C   1 
ATOM   4658  O  O   . GLY B 1 131 ? 68.126 97.724  58.641  1.00 31.43 ? 131 GLY B O   1 
ATOM   4659  N  N   . PHE B 1 132 ? 69.358 96.960  56.929  1.00 31.41 ? 132 PHE B N   1 
ATOM   4660  C  CA  . PHE B 1 132 ? 70.383 97.991  57.025  1.00 31.70 ? 132 PHE B CA  1 
ATOM   4661  C  C   . PHE B 1 132 ? 70.895 98.211  55.591  1.00 31.19 ? 132 PHE B C   1 
ATOM   4662  O  O   . PHE B 1 132 ? 71.980 97.751  55.228  1.00 31.26 ? 132 PHE B O   1 
ATOM   4663  C  CB  . PHE B 1 132 ? 71.531 97.501  57.920  1.00 33.18 ? 132 PHE B CB  1 
ATOM   4664  C  CG  . PHE B 1 132 ? 72.455 98.596  58.399  1.00 35.83 ? 132 PHE B CG  1 
ATOM   4665  C  CD1 . PHE B 1 132 ? 72.739 99.704  57.596  1.00 36.54 ? 132 PHE B CD1 1 
ATOM   4666  C  CD2 . PHE B 1 132 ? 73.048 98.516  59.656  1.00 36.44 ? 132 PHE B CD2 1 
ATOM   4667  C  CE1 . PHE B 1 132 ? 73.593 100.712 58.038  1.00 36.70 ? 132 PHE B CE1 1 
ATOM   4668  C  CE2 . PHE B 1 132 ? 73.904 99.516  60.107  1.00 36.75 ? 132 PHE B CE2 1 
ATOM   4669  C  CZ  . PHE B 1 132 ? 74.176 100.619 59.295  1.00 37.69 ? 132 PHE B CZ  1 
ATOM   4670  N  N   . ALA B 1 133 ? 70.103 98.896  54.779  1.00 30.47 ? 133 ALA B N   1 
ATOM   4671  C  CA  . ALA B 1 133 ? 70.467 99.154  53.393  1.00 30.00 ? 133 ALA B CA  1 
ATOM   4672  C  C   . ALA B 1 133 ? 71.300 100.423 53.239  1.00 30.58 ? 133 ALA B C   1 
ATOM   4673  O  O   . ALA B 1 133 ? 71.028 101.454 53.875  1.00 30.76 ? 133 ALA B O   1 
ATOM   4674  C  CB  . ALA B 1 133 ? 69.210 99.249  52.542  1.00 29.11 ? 133 ALA B CB  1 
ATOM   4675  N  N   . VAL B 1 134 ? 72.320 100.343 52.390  1.00 30.34 ? 134 VAL B N   1 
ATOM   4676  C  CA  . VAL B 1 134 ? 73.189 101.482 52.150  1.00 30.17 ? 134 VAL B CA  1 
ATOM   4677  C  C   . VAL B 1 134 ? 73.341 101.790 50.655  1.00 30.12 ? 134 VAL B C   1 
ATOM   4678  O  O   . VAL B 1 134 ? 73.760 100.945 49.861  1.00 29.68 ? 134 VAL B O   1 
ATOM   4679  C  CB  . VAL B 1 134 ? 74.581 101.252 52.774  1.00 30.27 ? 134 VAL B CB  1 
ATOM   4680  C  CG1 . VAL B 1 134 ? 75.399 102.533 52.698  1.00 29.80 ? 134 VAL B CG1 1 
ATOM   4681  C  CG2 . VAL B 1 134 ? 74.433 100.800 54.222  1.00 29.89 ? 134 VAL B CG2 1 
ATOM   4682  N  N   . LYS B 1 135 ? 72.990 103.011 50.276  1.00 29.59 ? 135 LYS B N   1 
ATOM   4683  C  CA  . LYS B 1 135 ? 73.094 103.406 48.885  1.00 29.83 ? 135 LYS B CA  1 
ATOM   4684  C  C   . LYS B 1 135 ? 74.285 104.339 48.679  1.00 29.95 ? 135 LYS B C   1 
ATOM   4685  O  O   . LYS B 1 135 ? 74.338 105.413 49.275  1.00 30.83 ? 135 LYS B O   1 
ATOM   4686  C  CB  . LYS B 1 135 ? 71.803 104.102 48.448  1.00 29.77 ? 135 LYS B CB  1 
ATOM   4687  C  CG  . LYS B 1 135 ? 71.819 104.618 47.013  1.00 29.53 ? 135 LYS B CG  1 
ATOM   4688  C  CD  . LYS B 1 135 ? 70.512 105.309 46.658  1.00 28.89 ? 135 LYS B CD  1 
ATOM   4689  C  CE  . LYS B 1 135 ? 69.325 104.351 46.635  1.00 27.09 ? 135 LYS B CE  1 
ATOM   4690  N  NZ  . LYS B 1 135 ? 69.435 103.369 45.541  1.00 26.62 ? 135 LYS B NZ  1 
ATOM   4691  N  N   . PHE B 1 136 ? 75.240 103.917 47.847  1.00 29.20 ? 136 PHE B N   1 
ATOM   4692  C  CA  . PHE B 1 136 ? 76.427 104.718 47.535  1.00 28.42 ? 136 PHE B CA  1 
ATOM   4693  C  C   . PHE B 1 136 ? 76.265 105.387 46.175  1.00 27.76 ? 136 PHE B C   1 
ATOM   4694  O  O   . PHE B 1 136 ? 76.237 104.701 45.153  1.00 26.92 ? 136 PHE B O   1 
ATOM   4695  C  CB  . PHE B 1 136 ? 77.694 103.858 47.453  1.00 27.65 ? 136 PHE B CB  1 
ATOM   4696  C  CG  . PHE B 1 136 ? 78.032 103.116 48.716  1.00 28.23 ? 136 PHE B CG  1 
ATOM   4697  C  CD1 . PHE B 1 136 ? 77.303 101.990 49.102  1.00 28.33 ? 136 PHE B CD1 1 
ATOM   4698  C  CD2 . PHE B 1 136 ? 79.147 103.483 49.474  1.00 27.98 ? 136 PHE B CD2 1 
ATOM   4699  C  CE1 . PHE B 1 136 ? 77.684 101.237 50.212  1.00 27.22 ? 136 PHE B CE1 1 
ATOM   4700  C  CE2 . PHE B 1 136 ? 79.531 102.736 50.582  1.00 26.83 ? 136 PHE B CE2 1 
ATOM   4701  C  CZ  . PHE B 1 136 ? 78.799 101.611 50.948  1.00 27.19 ? 136 PHE B CZ  1 
ATOM   4702  N  N   . TYR B 1 137 ? 76.182 106.713 46.148  1.00 27.88 ? 137 TYR B N   1 
ATOM   4703  C  CA  . TYR B 1 137 ? 76.050 107.404 44.869  1.00 28.22 ? 137 TYR B CA  1 
ATOM   4704  C  C   . TYR B 1 137 ? 77.447 107.647 44.290  1.00 27.90 ? 137 TYR B C   1 
ATOM   4705  O  O   . TYR B 1 137 ? 78.032 108.688 44.517  1.00 27.74 ? 137 TYR B O   1 
ATOM   4706  C  CB  . TYR B 1 137 ? 75.329 108.744 45.038  1.00 28.49 ? 137 TYR B CB  1 
ATOM   4707  C  CG  . TYR B 1 137 ? 73.974 108.682 45.713  1.00 27.86 ? 137 TYR B CG  1 
ATOM   4708  C  CD1 . TYR B 1 137 ? 73.861 108.673 47.107  1.00 27.72 ? 137 TYR B CD1 1 
ATOM   4709  C  CD2 . TYR B 1 137 ? 72.803 108.706 44.960  1.00 27.95 ? 137 TYR B CD2 1 
ATOM   4710  C  CE1 . TYR B 1 137 ? 72.608 108.707 47.733  1.00 27.85 ? 137 TYR B CE1 1 
ATOM   4711  C  CE2 . TYR B 1 137 ? 71.542 108.732 45.574  1.00 27.67 ? 137 TYR B CE2 1 
ATOM   4712  C  CZ  . TYR B 1 137 ? 71.451 108.741 46.952  1.00 27.93 ? 137 TYR B CZ  1 
ATOM   4713  O  OH  . TYR B 1 137 ? 70.212 108.823 47.545  1.00 26.36 ? 137 TYR B OH  1 
ATOM   4714  N  N   . THR B 1 138 ? 77.975 106.679 43.544  1.00 28.40 ? 138 THR B N   1 
ATOM   4715  C  CA  . THR B 1 138 ? 79.312 106.800 42.976  1.00 28.60 ? 138 THR B CA  1 
ATOM   4716  C  C   . THR B 1 138 ? 79.247 107.299 41.550  1.00 29.36 ? 138 THR B C   1 
ATOM   4717  O  O   . THR B 1 138 ? 78.178 107.309 40.943  1.00 29.76 ? 138 THR B O   1 
ATOM   4718  C  CB  . THR B 1 138 ? 80.060 105.451 42.976  1.00 28.53 ? 138 THR B CB  1 
ATOM   4719  O  OG1 . THR B 1 138 ? 79.724 104.713 41.797  1.00 27.49 ? 138 THR B OG1 1 
ATOM   4720  C  CG2 . THR B 1 138 ? 79.686 104.635 44.200  1.00 27.42 ? 138 THR B CG2 1 
ATOM   4721  N  N   . GLU B 1 139 ? 80.393 107.707 41.019  1.00 29.92 ? 139 GLU B N   1 
ATOM   4722  C  CA  . GLU B 1 139 ? 80.453 108.223 39.662  1.00 32.32 ? 139 GLU B CA  1 
ATOM   4723  C  C   . GLU B 1 139 ? 80.305 107.099 38.663  1.00 32.02 ? 139 GLU B C   1 
ATOM   4724  O  O   . GLU B 1 139 ? 80.101 107.335 37.475  1.00 31.94 ? 139 GLU B O   1 
ATOM   4725  C  CB  . GLU B 1 139 ? 81.770 108.957 39.419  1.00 35.05 ? 139 GLU B CB  1 
ATOM   4726  C  CG  . GLU B 1 139 ? 82.183 109.880 40.554  1.00 38.98 ? 139 GLU B CG  1 
ATOM   4727  C  CD  . GLU B 1 139 ? 83.478 109.421 41.196  1.00 42.08 ? 139 GLU B CD  1 
ATOM   4728  O  OE1 . GLU B 1 139 ? 83.542 108.231 41.601  1.00 43.12 ? 139 GLU B OE1 1 
ATOM   4729  O  OE2 . GLU B 1 139 ? 84.427 110.244 41.292  1.00 43.54 ? 139 GLU B OE2 1 
ATOM   4730  N  N   . ASP B 1 140 ? 80.426 105.869 39.146  1.00 32.14 ? 140 ASP B N   1 
ATOM   4731  C  CA  . ASP B 1 140 ? 80.262 104.710 38.283  1.00 31.85 ? 140 ASP B CA  1 
ATOM   4732  C  C   . ASP B 1 140 ? 78.863 104.175 38.502  1.00 30.97 ? 140 ASP B C   1 
ATOM   4733  O  O   . ASP B 1 140 ? 78.614 102.991 38.348  1.00 31.86 ? 140 ASP B O   1 
ATOM   4734  C  CB  . ASP B 1 140 ? 81.289 103.622 38.609  1.00 32.53 ? 140 ASP B CB  1 
ATOM   4735  C  CG  . ASP B 1 140 ? 82.360 103.494 37.543  1.00 32.73 ? 140 ASP B CG  1 
ATOM   4736  O  OD1 . ASP B 1 140 ? 82.241 104.155 36.484  1.00 34.01 ? 140 ASP B OD1 1 
ATOM   4737  O  OD2 . ASP B 1 140 ? 83.320 102.726 37.757  1.00 33.02 ? 140 ASP B OD2 1 
ATOM   4738  N  N   . GLY B 1 141 ? 77.955 105.068 38.866  1.00 30.47 ? 141 GLY B N   1 
ATOM   4739  C  CA  . GLY B 1 141 ? 76.585 104.676 39.106  1.00 31.17 ? 141 GLY B CA  1 
ATOM   4740  C  C   . GLY B 1 141 ? 76.371 104.401 40.576  1.00 31.93 ? 141 GLY B C   1 
ATOM   4741  O  O   . GLY B 1 141 ? 77.307 104.452 41.366  1.00 32.23 ? 141 GLY B O   1 
ATOM   4742  N  N   . ASN B 1 142 ? 75.134 104.116 40.952  1.00 31.94 ? 142 ASN B N   1 
ATOM   4743  C  CA  . ASN B 1 142 ? 74.837 103.829 42.338  1.00 32.32 ? 142 ASN B CA  1 
ATOM   4744  C  C   . ASN B 1 142 ? 75.226 102.403 42.676  1.00 32.31 ? 142 ASN B C   1 
ATOM   4745  O  O   . ASN B 1 142 ? 75.185 101.524 41.813  1.00 32.59 ? 142 ASN B O   1 
ATOM   4746  C  CB  . ASN B 1 142 ? 73.346 104.023 42.607  1.00 33.24 ? 142 ASN B CB  1 
ATOM   4747  C  CG  . ASN B 1 142 ? 72.955 105.487 42.691  1.00 34.72 ? 142 ASN B CG  1 
ATOM   4748  O  OD1 . ASN B 1 142 ? 73.758 106.374 42.385  1.00 35.27 ? 142 ASN B OD1 1 
ATOM   4749  N  ND2 . ASN B 1 142 ? 71.714 105.751 43.104  1.00 34.48 ? 142 ASN B ND2 1 
ATOM   4750  N  N   . TRP B 1 143 ? 75.625 102.189 43.926  1.00 31.21 ? 143 TRP B N   1 
ATOM   4751  C  CA  . TRP B 1 143 ? 75.972 100.867 44.411  1.00 30.17 ? 143 TRP B CA  1 
ATOM   4752  C  C   . TRP B 1 143 ? 75.101 100.662 45.632  1.00 29.92 ? 143 TRP B C   1 
ATOM   4753  O  O   . TRP B 1 143 ? 75.291 101.308 46.656  1.00 28.54 ? 143 TRP B O   1 
ATOM   4754  C  CB  . TRP B 1 143 ? 77.444 100.785 44.803  1.00 30.72 ? 143 TRP B CB  1 
ATOM   4755  C  CG  . TRP B 1 143 ? 77.770 99.546  45.613  1.00 32.24 ? 143 TRP B CG  1 
ATOM   4756  C  CD1 . TRP B 1 143 ? 77.246 98.300  45.440  1.00 32.65 ? 143 TRP B CD1 1 
ATOM   4757  C  CD2 . TRP B 1 143 ? 78.707 99.434  46.701  1.00 32.49 ? 143 TRP B CD2 1 
ATOM   4758  N  NE1 . TRP B 1 143 ? 77.789 97.417  46.348  1.00 33.09 ? 143 TRP B NE1 1 
ATOM   4759  C  CE2 . TRP B 1 143 ? 78.690 98.084  47.132  1.00 33.21 ? 143 TRP B CE2 1 
ATOM   4760  C  CE3 . TRP B 1 143 ? 79.559 100.338 47.344  1.00 32.40 ? 143 TRP B CE3 1 
ATOM   4761  C  CZ2 . TRP B 1 143 ? 79.493 97.615  48.180  1.00 33.83 ? 143 TRP B CZ2 1 
ATOM   4762  C  CZ3 . TRP B 1 143 ? 80.358 99.876  48.383  1.00 33.85 ? 143 TRP B CZ3 1 
ATOM   4763  C  CH2 . TRP B 1 143 ? 80.319 98.522  48.793  1.00 34.74 ? 143 TRP B CH2 1 
ATOM   4764  N  N   . ASP B 1 144 ? 74.128 99.769  45.519  1.00 30.57 ? 144 ASP B N   1 
ATOM   4765  C  CA  . ASP B 1 144 ? 73.222 99.509  46.632  1.00 30.48 ? 144 ASP B CA  1 
ATOM   4766  C  C   . ASP B 1 144 ? 73.670 98.262  47.350  1.00 30.22 ? 144 ASP B C   1 
ATOM   4767  O  O   . ASP B 1 144 ? 73.721 97.190  46.751  1.00 30.68 ? 144 ASP B O   1 
ATOM   4768  C  CB  . ASP B 1 144 ? 71.780 99.298  46.139  1.00 31.39 ? 144 ASP B CB  1 
ATOM   4769  C  CG  . ASP B 1 144 ? 71.066 100.604 45.774  1.00 32.43 ? 144 ASP B CG  1 
ATOM   4770  O  OD1 . ASP B 1 144 ? 70.260 100.597 44.818  1.00 31.74 ? 144 ASP B OD1 1 
ATOM   4771  O  OD2 . ASP B 1 144 ? 71.296 101.631 46.447  1.00 33.40 ? 144 ASP B OD2 1 
ATOM   4772  N  N   . LEU B 1 145 ? 74.016 98.404  48.626  1.00 29.33 ? 145 LEU B N   1 
ATOM   4773  C  CA  . LEU B 1 145 ? 74.418 97.265  49.432  1.00 27.97 ? 145 LEU B CA  1 
ATOM   4774  C  C   . LEU B 1 145 ? 73.279 97.060  50.417  1.00 28.14 ? 145 LEU B C   1 
ATOM   4775  O  O   . LEU B 1 145 ? 73.256 97.658  51.499  1.00 28.71 ? 145 LEU B O   1 
ATOM   4776  C  CB  . LEU B 1 145 ? 75.710 97.558  50.178  1.00 27.97 ? 145 LEU B CB  1 
ATOM   4777  C  CG  . LEU B 1 145 ? 76.250 96.370  50.974  1.00 28.26 ? 145 LEU B CG  1 
ATOM   4778  C  CD1 . LEU B 1 145 ? 76.549 95.199  50.023  1.00 25.56 ? 145 LEU B CD1 1 
ATOM   4779  C  CD2 . LEU B 1 145 ? 77.496 96.802  51.747  1.00 26.39 ? 145 LEU B CD2 1 
ATOM   4780  N  N   . VAL B 1 146 ? 72.331 96.216  50.021  1.00 27.35 ? 146 VAL B N   1 
ATOM   4781  C  CA  . VAL B 1 146 ? 71.153 95.928  50.816  1.00 27.33 ? 146 VAL B CA  1 
ATOM   4782  C  C   . VAL B 1 146 ? 71.356 94.807  51.829  1.00 28.72 ? 146 VAL B C   1 
ATOM   4783  O  O   . VAL B 1 146 ? 71.022 93.649  51.561  1.00 29.48 ? 146 VAL B O   1 
ATOM   4784  C  CB  . VAL B 1 146 ? 69.981 95.535  49.912  1.00 26.66 ? 146 VAL B CB  1 
ATOM   4785  C  CG1 . VAL B 1 146 ? 68.697 95.616  50.708  1.00 26.76 ? 146 VAL B CG1 1 
ATOM   4786  C  CG2 . VAL B 1 146 ? 69.931 96.421  48.676  1.00 24.44 ? 146 VAL B CG2 1 
ATOM   4787  N  N   . GLY B 1 147 ? 71.876 95.134  53.002  1.00 28.78 ? 147 GLY B N   1 
ATOM   4788  C  CA  . GLY B 1 147 ? 72.106 94.083  53.965  1.00 30.46 ? 147 GLY B CA  1 
ATOM   4789  C  C   . GLY B 1 147 ? 71.284 94.227  55.211  1.00 32.14 ? 147 GLY B C   1 
ATOM   4790  O  O   . GLY B 1 147 ? 70.386 95.058  55.260  1.00 32.35 ? 147 GLY B O   1 
ATOM   4791  N  N   . ASN B 1 148 ? 71.565 93.388  56.205  1.00 34.24 ? 148 ASN B N   1 
ATOM   4792  C  CA  . ASN B 1 148 ? 70.866 93.463  57.482  1.00 36.44 ? 148 ASN B CA  1 
ATOM   4793  C  C   . ASN B 1 148 ? 71.810 93.306  58.652  1.00 35.84 ? 148 ASN B C   1 
ATOM   4794  O  O   . ASN B 1 148 ? 73.023 93.384  58.490  1.00 36.00 ? 148 ASN B O   1 
ATOM   4795  C  CB  . ASN B 1 148 ? 69.709 92.454  57.592  1.00 39.38 ? 148 ASN B CB  1 
ATOM   4796  C  CG  . ASN B 1 148 ? 69.955 91.182  56.836  1.00 41.93 ? 148 ASN B CG  1 
ATOM   4797  O  OD1 . ASN B 1 148 ? 71.099 90.756  56.667  1.00 44.60 ? 148 ASN B OD1 1 
ATOM   4798  N  ND2 . ASN B 1 148 ? 68.872 90.543  56.389  1.00 42.54 ? 148 ASN B ND2 1 
ATOM   4799  N  N   . ASN B 1 149 ? 71.257 93.090  59.837  1.00 35.85 ? 149 ASN B N   1 
ATOM   4800  C  CA  . ASN B 1 149 ? 72.082 92.994  61.031  1.00 35.55 ? 149 ASN B CA  1 
ATOM   4801  C  C   . ASN B 1 149 ? 72.599 91.603  61.369  1.00 35.43 ? 149 ASN B C   1 
ATOM   4802  O  O   . ASN B 1 149 ? 73.149 91.385  62.447  1.00 35.29 ? 149 ASN B O   1 
ATOM   4803  C  CB  . ASN B 1 149 ? 71.320 93.592  62.221  1.00 35.85 ? 149 ASN B CB  1 
ATOM   4804  C  CG  . ASN B 1 149 ? 70.145 92.753  62.643  1.00 35.32 ? 149 ASN B CG  1 
ATOM   4805  O  OD1 . ASN B 1 149 ? 69.647 91.940  61.880  1.00 36.74 ? 149 ASN B OD1 1 
ATOM   4806  N  ND2 . ASN B 1 149 ? 69.688 92.954  63.864  1.00 36.09 ? 149 ASN B ND2 1 
ATOM   4807  N  N   . THR B 1 150 ? 72.424 90.665  60.445  1.00 35.42 ? 150 THR B N   1 
ATOM   4808  C  CA  . THR B 1 150 ? 72.901 89.302  60.643  1.00 34.84 ? 150 THR B CA  1 
ATOM   4809  C  C   . THR B 1 150 ? 73.731 88.893  59.424  1.00 34.63 ? 150 THR B C   1 
ATOM   4810  O  O   . THR B 1 150 ? 73.398 89.251  58.293  1.00 35.28 ? 150 THR B O   1 
ATOM   4811  C  CB  . THR B 1 150 ? 71.725 88.331  60.841  1.00 34.84 ? 150 THR B CB  1 
ATOM   4812  O  OG1 . THR B 1 150 ? 72.202 86.979  60.767  1.00 35.56 ? 150 THR B OG1 1 
ATOM   4813  C  CG2 . THR B 1 150 ? 70.653 88.575  59.796  1.00 33.99 ? 150 THR B CG2 1 
ATOM   4814  N  N   . PRO B 1 151 ? 74.826 88.145  59.634  1.00 33.72 ? 151 PRO B N   1 
ATOM   4815  C  CA  . PRO B 1 151 ? 75.675 87.719  58.520  1.00 33.71 ? 151 PRO B CA  1 
ATOM   4816  C  C   . PRO B 1 151 ? 75.033 86.626  57.682  1.00 33.98 ? 151 PRO B C   1 
ATOM   4817  O  O   . PRO B 1 151 ? 75.409 86.419  56.522  1.00 34.34 ? 151 PRO B O   1 
ATOM   4818  C  CB  . PRO B 1 151 ? 76.930 87.212  59.223  1.00 33.38 ? 151 PRO B CB  1 
ATOM   4819  C  CG  . PRO B 1 151 ? 76.358 86.547  60.420  1.00 32.94 ? 151 PRO B CG  1 
ATOM   4820  C  CD  . PRO B 1 151 ? 75.290 87.541  60.896  1.00 33.84 ? 151 PRO B CD  1 
ATOM   4821  N  N   . ILE B 1 152 ? 74.067 85.934  58.283  1.00 32.97 ? 152 ILE B N   1 
ATOM   4822  C  CA  . ILE B 1 152 ? 73.378 84.823  57.630  1.00 32.71 ? 152 ILE B CA  1 
ATOM   4823  C  C   . ILE B 1 152 ? 71.886 85.063  57.474  1.00 32.76 ? 152 ILE B C   1 
ATOM   4824  O  O   . ILE B 1 152 ? 71.354 86.096  57.883  1.00 32.84 ? 152 ILE B O   1 
ATOM   4825  C  CB  . ILE B 1 152 ? 73.529 83.523  58.456  1.00 32.23 ? 152 ILE B CB  1 
ATOM   4826  C  CG1 . ILE B 1 152 ? 73.060 83.795  59.895  1.00 30.26 ? 152 ILE B CG1 1 
ATOM   4827  C  CG2 . ILE B 1 152 ? 74.963 83.030  58.403  1.00 30.57 ? 152 ILE B CG2 1 
ATOM   4828  C  CD1 . ILE B 1 152 ? 73.044 82.612  60.783  1.00 28.94 ? 152 ILE B CD1 1 
ATOM   4829  N  N   . PHE B 1 153 ? 71.212 84.086  56.878  1.00 32.20 ? 153 PHE B N   1 
ATOM   4830  C  CA  . PHE B 1 153 ? 69.774 84.170  56.718  1.00 32.15 ? 153 PHE B CA  1 
ATOM   4831  C  C   . PHE B 1 153 ? 69.127 82.813  57.039  1.00 32.28 ? 153 PHE B C   1 
ATOM   4832  O  O   . PHE B 1 153 ? 69.823 81.842  57.344  1.00 33.04 ? 153 PHE B O   1 
ATOM   4833  C  CB  . PHE B 1 153 ? 69.400 84.633  55.307  1.00 30.30 ? 153 PHE B CB  1 
ATOM   4834  C  CG  . PHE B 1 153 ? 67.994 85.132  55.213  1.00 30.03 ? 153 PHE B CG  1 
ATOM   4835  C  CD1 . PHE B 1 153 ? 67.603 86.258  55.931  1.00 30.24 ? 153 PHE B CD1 1 
ATOM   4836  C  CD2 . PHE B 1 153 ? 67.036 84.433  54.493  1.00 30.39 ? 153 PHE B CD2 1 
ATOM   4837  C  CE1 . PHE B 1 153 ? 66.280 86.681  55.944  1.00 31.06 ? 153 PHE B CE1 1 
ATOM   4838  C  CE2 . PHE B 1 153 ? 65.704 84.845  54.494  1.00 30.69 ? 153 PHE B CE2 1 
ATOM   4839  C  CZ  . PHE B 1 153 ? 65.325 85.970  55.222  1.00 31.65 ? 153 PHE B CZ  1 
ATOM   4840  N  N   . PHE B 1 154 ? 67.800 82.758  56.975  1.00 31.61 ? 154 PHE B N   1 
ATOM   4841  C  CA  . PHE B 1 154 ? 67.029 81.545  57.263  1.00 30.35 ? 154 PHE B CA  1 
ATOM   4842  C  C   . PHE B 1 154 ? 67.038 80.438  56.222  1.00 29.23 ? 154 PHE B C   1 
ATOM   4843  O  O   . PHE B 1 154 ? 66.921 79.273  56.581  1.00 29.41 ? 154 PHE B O   1 
ATOM   4844  C  CB  . PHE B 1 154 ? 65.565 81.908  57.498  1.00 30.91 ? 154 PHE B CB  1 
ATOM   4845  C  CG  . PHE B 1 154 ? 65.336 82.781  58.690  1.00 31.90 ? 154 PHE B CG  1 
ATOM   4846  C  CD1 . PHE B 1 154 ? 65.405 82.252  59.975  1.00 31.65 ? 154 PHE B CD1 1 
ATOM   4847  C  CD2 . PHE B 1 154 ? 65.025 84.128  58.526  1.00 31.58 ? 154 PHE B CD2 1 
ATOM   4848  C  CE1 . PHE B 1 154 ? 65.164 83.047  61.080  1.00 32.24 ? 154 PHE B CE1 1 
ATOM   4849  C  CE2 . PHE B 1 154 ? 64.784 84.934  59.625  1.00 32.09 ? 154 PHE B CE2 1 
ATOM   4850  C  CZ  . PHE B 1 154 ? 64.851 84.394  60.908  1.00 32.45 ? 154 PHE B CZ  1 
ATOM   4851  N  N   . ILE B 1 155 ? 67.138 80.794  54.945  1.00 28.29 ? 155 ILE B N   1 
ATOM   4852  C  CA  . ILE B 1 155 ? 67.091 79.804  53.865  1.00 27.79 ? 155 ILE B CA  1 
ATOM   4853  C  C   . ILE B 1 155 ? 68.182 80.060  52.839  1.00 28.22 ? 155 ILE B C   1 
ATOM   4854  O  O   . ILE B 1 155 ? 68.750 81.139  52.819  1.00 29.19 ? 155 ILE B O   1 
ATOM   4855  C  CB  . ILE B 1 155 ? 65.732 79.856  53.140  1.00 28.10 ? 155 ILE B CB  1 
ATOM   4856  C  CG1 . ILE B 1 155 ? 65.505 81.262  52.561  1.00 28.62 ? 155 ILE B CG1 1 
ATOM   4857  C  CG2 . ILE B 1 155 ? 64.608 79.525  54.108  1.00 27.35 ? 155 ILE B CG2 1 
ATOM   4858  C  CD1 . ILE B 1 155 ? 64.240 81.400  51.726  1.00 27.36 ? 155 ILE B CD1 1 
ATOM   4859  N  N   . ARG B 1 156 ? 68.466 79.080  51.982  1.00 28.37 ? 156 ARG B N   1 
ATOM   4860  C  CA  . ARG B 1 156 ? 69.512 79.240  50.977  1.00 28.27 ? 156 ARG B CA  1 
ATOM   4861  C  C   . ARG B 1 156 ? 69.094 79.137  49.520  1.00 29.11 ? 156 ARG B C   1 
ATOM   4862  O  O   . ARG B 1 156 ? 69.952 79.006  48.645  1.00 29.23 ? 156 ARG B O   1 
ATOM   4863  C  CB  . ARG B 1 156 ? 70.647 78.255  51.221  1.00 27.55 ? 156 ARG B CB  1 
ATOM   4864  C  CG  . ARG B 1 156 ? 70.223 76.825  51.384  1.00 28.11 ? 156 ARG B CG  1 
ATOM   4865  C  CD  . ARG B 1 156 ? 71.444 75.918  51.554  1.00 28.38 ? 156 ARG B CD  1 
ATOM   4866  N  NE  . ARG B 1 156 ? 71.123 74.756  52.374  1.00 29.59 ? 156 ARG B NE  1 
ATOM   4867  C  CZ  . ARG B 1 156 ? 71.428 74.640  53.663  1.00 28.47 ? 156 ARG B CZ  1 
ATOM   4868  N  NH1 . ARG B 1 156 ? 72.078 75.605  54.284  1.00 28.05 ? 156 ARG B NH1 1 
ATOM   4869  N  NH2 . ARG B 1 156 ? 71.056 73.567  54.333  1.00 27.99 ? 156 ARG B NH2 1 
ATOM   4870  N  N   . ASP B 1 157 ? 67.792 79.160  49.254  1.00 29.48 ? 157 ASP B N   1 
ATOM   4871  C  CA  . ASP B 1 157 ? 67.305 79.132  47.881  1.00 29.64 ? 157 ASP B CA  1 
ATOM   4872  C  C   . ASP B 1 157 ? 66.196 80.167  47.797  1.00 30.07 ? 157 ASP B C   1 
ATOM   4873  O  O   . ASP B 1 157 ? 65.204 80.113  48.537  1.00 30.03 ? 157 ASP B O   1 
ATOM   4874  C  CB  . ASP B 1 157 ? 66.780 77.754  47.467  1.00 30.71 ? 157 ASP B CB  1 
ATOM   4875  C  CG  . ASP B 1 157 ? 66.552 77.642  45.939  1.00 33.39 ? 157 ASP B CG  1 
ATOM   4876  O  OD1 . ASP B 1 157 ? 65.691 78.380  45.412  1.00 35.42 ? 157 ASP B OD1 1 
ATOM   4877  O  OD2 . ASP B 1 157 ? 67.226 76.828  45.258  1.00 31.85 ? 157 ASP B OD2 1 
ATOM   4878  N  N   . PRO B 1 158 ? 66.351 81.133  46.881  1.00 29.78 ? 158 PRO B N   1 
ATOM   4879  C  CA  . PRO B 1 158 ? 65.387 82.216  46.672  1.00 29.46 ? 158 PRO B CA  1 
ATOM   4880  C  C   . PRO B 1 158 ? 63.937 81.774  46.446  1.00 29.83 ? 158 PRO B C   1 
ATOM   4881  O  O   . PRO B 1 158 ? 63.002 82.503  46.785  1.00 29.66 ? 158 PRO B O   1 
ATOM   4882  C  CB  . PRO B 1 158 ? 65.966 82.945  45.468  1.00 29.85 ? 158 PRO B CB  1 
ATOM   4883  C  CG  . PRO B 1 158 ? 66.593 81.811  44.689  1.00 29.42 ? 158 PRO B CG  1 
ATOM   4884  C  CD  . PRO B 1 158 ? 67.317 81.073  45.770  1.00 29.21 ? 158 PRO B CD  1 
ATOM   4885  N  N   . ILE B 1 159 ? 63.750 80.582  45.891  1.00 29.36 ? 159 ILE B N   1 
ATOM   4886  C  CA  . ILE B 1 159 ? 62.412 80.095  45.604  1.00 29.41 ? 159 ILE B CA  1 
ATOM   4887  C  C   . ILE B 1 159 ? 61.538 79.803  46.837  1.00 29.90 ? 159 ILE B C   1 
ATOM   4888  O  O   . ILE B 1 159 ? 60.326 79.575  46.706  1.00 29.56 ? 159 ILE B O   1 
ATOM   4889  C  CB  . ILE B 1 159 ? 62.482 78.855  44.690  1.00 29.38 ? 159 ILE B CB  1 
ATOM   4890  C  CG1 . ILE B 1 159 ? 61.150 78.688  43.951  1.00 29.28 ? 159 ILE B CG1 1 
ATOM   4891  C  CG2 . ILE B 1 159 ? 62.818 77.611  45.506  1.00 29.05 ? 159 ILE B CG2 1 
ATOM   4892  C  CD1 . ILE B 1 159 ? 61.234 77.765  42.751  1.00 28.97 ? 159 ILE B CD1 1 
ATOM   4893  N  N   . LEU B 1 160 ? 62.143 79.820  48.027  1.00 29.36 ? 160 LEU B N   1 
ATOM   4894  C  CA  . LEU B 1 160 ? 61.394 79.580  49.261  1.00 28.97 ? 160 LEU B CA  1 
ATOM   4895  C  C   . LEU B 1 160 ? 61.132 80.891  49.994  1.00 29.79 ? 160 LEU B C   1 
ATOM   4896  O  O   . LEU B 1 160 ? 60.447 80.909  51.025  1.00 30.20 ? 160 LEU B O   1 
ATOM   4897  C  CB  . LEU B 1 160 ? 62.158 78.661  50.217  1.00 28.30 ? 160 LEU B CB  1 
ATOM   4898  C  CG  . LEU B 1 160 ? 62.192 77.139  50.081  1.00 27.64 ? 160 LEU B CG  1 
ATOM   4899  C  CD1 . LEU B 1 160 ? 63.419 76.674  49.318  1.00 25.97 ? 160 LEU B CD1 1 
ATOM   4900  C  CD2 . LEU B 1 160 ? 62.226 76.556  51.483  1.00 27.48 ? 160 LEU B CD2 1 
ATOM   4901  N  N   . PHE B 1 161 ? 61.670 81.990  49.471  1.00 29.47 ? 161 PHE B N   1 
ATOM   4902  C  CA  . PHE B 1 161 ? 61.499 83.277  50.133  1.00 29.11 ? 161 PHE B CA  1 
ATOM   4903  C  C   . PHE B 1 161 ? 60.059 83.758  50.241  1.00 29.52 ? 161 PHE B C   1 
ATOM   4904  O  O   . PHE B 1 161 ? 59.673 84.353  51.251  1.00 30.73 ? 161 PHE B O   1 
ATOM   4905  C  CB  . PHE B 1 161 ? 62.357 84.350  49.469  1.00 28.06 ? 161 PHE B CB  1 
ATOM   4906  C  CG  . PHE B 1 161 ? 62.383 85.638  50.224  1.00 26.69 ? 161 PHE B CG  1 
ATOM   4907  C  CD1 . PHE B 1 161 ? 61.584 86.699  49.839  1.00 26.54 ? 161 PHE B CD1 1 
ATOM   4908  C  CD2 . PHE B 1 161 ? 63.180 85.774  51.353  1.00 27.69 ? 161 PHE B CD2 1 
ATOM   4909  C  CE1 . PHE B 1 161 ? 61.571 87.886  50.568  1.00 27.12 ? 161 PHE B CE1 1 
ATOM   4910  C  CE2 . PHE B 1 161 ? 63.176 86.963  52.098  1.00 28.24 ? 161 PHE B CE2 1 
ATOM   4911  C  CZ  . PHE B 1 161 ? 62.370 88.021  51.703  1.00 27.48 ? 161 PHE B CZ  1 
ATOM   4912  N  N   . PRO B 1 162 ? 59.253 83.559  49.190  1.00 29.15 ? 162 PRO B N   1 
ATOM   4913  C  CA  . PRO B 1 162 ? 57.870 84.019  49.326  1.00 28.26 ? 162 PRO B CA  1 
ATOM   4914  C  C   . PRO B 1 162 ? 57.162 83.199  50.399  1.00 28.48 ? 162 PRO B C   1 
ATOM   4915  O  O   . PRO B 1 162 ? 56.455 83.741  51.245  1.00 28.89 ? 162 PRO B O   1 
ATOM   4916  C  CB  . PRO B 1 162 ? 57.296 83.780  47.941  1.00 28.04 ? 162 PRO B CB  1 
ATOM   4917  C  CG  . PRO B 1 162 ? 58.487 84.038  47.050  1.00 28.29 ? 162 PRO B CG  1 
ATOM   4918  C  CD  . PRO B 1 162 ? 59.592 83.315  47.774  1.00 28.54 ? 162 PRO B CD  1 
ATOM   4919  N  N   . SER B 1 163 ? 57.359 81.883  50.371  1.00 29.52 ? 163 SER B N   1 
ATOM   4920  C  CA  . SER B 1 163 ? 56.735 81.013  51.363  1.00 29.39 ? 163 SER B CA  1 
ATOM   4921  C  C   . SER B 1 163 ? 57.189 81.427  52.745  1.00 28.98 ? 163 SER B C   1 
ATOM   4922  O  O   . SER B 1 163 ? 56.362 81.634  53.623  1.00 29.63 ? 163 SER B O   1 
ATOM   4923  C  CB  . SER B 1 163 ? 57.097 79.547  51.121  1.00 29.65 ? 163 SER B CB  1 
ATOM   4924  O  OG  . SER B 1 163 ? 56.543 79.074  49.911  1.00 31.19 ? 163 SER B OG  1 
ATOM   4925  N  N   . PHE B 1 164 ? 58.500 81.562  52.937  1.00 28.61 ? 164 PHE B N   1 
ATOM   4926  C  CA  . PHE B 1 164 ? 59.015 81.962  54.236  1.00 28.91 ? 164 PHE B CA  1 
ATOM   4927  C  C   . PHE B 1 164 ? 58.330 83.238  54.718  1.00 29.29 ? 164 PHE B C   1 
ATOM   4928  O  O   . PHE B 1 164 ? 57.785 83.299  55.825  1.00 29.89 ? 164 PHE B O   1 
ATOM   4929  C  CB  . PHE B 1 164 ? 60.532 82.185  54.192  1.00 28.84 ? 164 PHE B CB  1 
ATOM   4930  C  CG  . PHE B 1 164 ? 61.067 82.864  55.432  1.00 29.29 ? 164 PHE B CG  1 
ATOM   4931  C  CD1 . PHE B 1 164 ? 60.788 82.347  56.697  1.00 29.45 ? 164 PHE B CD1 1 
ATOM   4932  C  CD2 . PHE B 1 164 ? 61.762 84.065  55.345  1.00 28.74 ? 164 PHE B CD2 1 
ATOM   4933  C  CE1 . PHE B 1 164 ? 61.183 83.021  57.847  1.00 28.54 ? 164 PHE B CE1 1 
ATOM   4934  C  CE2 . PHE B 1 164 ? 62.160 84.743  56.490  1.00 28.22 ? 164 PHE B CE2 1 
ATOM   4935  C  CZ  . PHE B 1 164 ? 61.867 84.222  57.741  1.00 28.42 ? 164 PHE B CZ  1 
ATOM   4936  N  N   . ILE B 1 165 ? 58.355 84.260  53.878  1.00 29.09 ? 165 ILE B N   1 
ATOM   4937  C  CA  . ILE B 1 165 ? 57.734 85.523  54.223  1.00 29.03 ? 165 ILE B CA  1 
ATOM   4938  C  C   . ILE B 1 165 ? 56.245 85.329  54.520  1.00 29.67 ? 165 ILE B C   1 
ATOM   4939  O  O   . ILE B 1 165 ? 55.720 85.897  55.474  1.00 30.32 ? 165 ILE B O   1 
ATOM   4940  C  CB  . ILE B 1 165 ? 57.960 86.569  53.089  1.00 28.07 ? 165 ILE B CB  1 
ATOM   4941  C  CG1 . ILE B 1 165 ? 59.457 86.869  52.974  1.00 25.90 ? 165 ILE B CG1 1 
ATOM   4942  C  CG2 . ILE B 1 165 ? 57.175 87.856  53.373  1.00 27.31 ? 165 ILE B CG2 1 
ATOM   4943  C  CD1 . ILE B 1 165 ? 60.099 87.275  54.285  1.00 23.13 ? 165 ILE B CD1 1 
ATOM   4944  N  N   . HIS B 1 166 ? 55.553 84.526  53.724  1.00 29.33 ? 166 HIS B N   1 
ATOM   4945  C  CA  . HIS B 1 166 ? 54.151 84.315  54.014  1.00 29.61 ? 166 HIS B CA  1 
ATOM   4946  C  C   . HIS B 1 166 ? 54.019 83.751  55.428  1.00 30.76 ? 166 HIS B C   1 
ATOM   4947  O  O   . HIS B 1 166 ? 53.211 84.231  56.222  1.00 31.09 ? 166 HIS B O   1 
ATOM   4948  C  CB  . HIS B 1 166 ? 53.520 83.353  53.009  1.00 28.29 ? 166 HIS B CB  1 
ATOM   4949  C  CG  . HIS B 1 166 ? 53.208 83.982  51.689  1.00 26.83 ? 166 HIS B CG  1 
ATOM   4950  N  ND1 . HIS B 1 166 ? 52.572 83.302  50.674  1.00 25.60 ? 166 HIS B ND1 1 
ATOM   4951  C  CD2 . HIS B 1 166 ? 53.440 85.229  51.218  1.00 25.58 ? 166 HIS B CD2 1 
ATOM   4952  C  CE1 . HIS B 1 166 ? 52.425 84.103  49.635  1.00 25.55 ? 166 HIS B CE1 1 
ATOM   4953  N  NE2 . HIS B 1 166 ? 52.942 85.279  49.940  1.00 25.38 ? 166 HIS B NE2 1 
ATOM   4954  N  N   . SER B 1 167 ? 54.831 82.749  55.749  1.00 31.25 ? 167 SER B N   1 
ATOM   4955  C  CA  . SER B 1 167 ? 54.760 82.118  57.066  1.00 31.69 ? 167 SER B CA  1 
ATOM   4956  C  C   . SER B 1 167 ? 55.075 83.074  58.217  1.00 31.23 ? 167 SER B C   1 
ATOM   4957  O  O   . SER B 1 167 ? 54.626 82.868  59.349  1.00 31.11 ? 167 SER B O   1 
ATOM   4958  C  CB  . SER B 1 167 ? 55.694 80.902  57.126  1.00 31.76 ? 167 SER B CB  1 
ATOM   4959  O  OG  . SER B 1 167 ? 57.042 81.293  56.996  1.00 32.08 ? 167 SER B OG  1 
ATOM   4960  N  N   . GLN B 1 168 ? 55.834 84.121  57.919  1.00 30.70 ? 168 GLN B N   1 
ATOM   4961  C  CA  . GLN B 1 168 ? 56.211 85.109  58.919  1.00 30.14 ? 168 GLN B CA  1 
ATOM   4962  C  C   . GLN B 1 168 ? 55.157 86.195  59.083  1.00 31.26 ? 168 GLN B C   1 
ATOM   4963  O  O   . GLN B 1 168 ? 55.146 86.914  60.090  1.00 31.84 ? 168 GLN B O   1 
ATOM   4964  C  CB  . GLN B 1 168 ? 57.531 85.752  58.523  1.00 29.16 ? 168 GLN B CB  1 
ATOM   4965  C  CG  . GLN B 1 168 ? 58.725 84.859  58.718  1.00 29.59 ? 168 GLN B CG  1 
ATOM   4966  C  CD  . GLN B 1 168 ? 58.995 84.586  60.182  1.00 29.31 ? 168 GLN B CD  1 
ATOM   4967  O  OE1 . GLN B 1 168 ? 59.185 85.508  60.969  1.00 30.03 ? 168 GLN B OE1 1 
ATOM   4968  N  NE2 . GLN B 1 168 ? 59.010 83.318  60.555  1.00 28.79 ? 168 GLN B NE2 1 
ATOM   4969  N  N   . LYS B 1 169 ? 54.278 86.302  58.087  1.00 31.25 ? 169 LYS B N   1 
ATOM   4970  C  CA  . LYS B 1 169 ? 53.216 87.297  58.065  1.00 30.90 ? 169 LYS B CA  1 
ATOM   4971  C  C   . LYS B 1 169 ? 51.921 86.796  58.704  1.00 31.65 ? 169 LYS B C   1 
ATOM   4972  O  O   . LYS B 1 169 ? 51.941 85.932  59.576  1.00 32.72 ? 169 LYS B O   1 
ATOM   4973  C  CB  . LYS B 1 169 ? 52.930 87.714  56.622  1.00 30.73 ? 169 LYS B CB  1 
ATOM   4974  C  CG  . LYS B 1 169 ? 54.068 88.424  55.908  1.00 28.60 ? 169 LYS B CG  1 
ATOM   4975  C  CD  . LYS B 1 169 ? 54.092 89.878  56.238  1.00 27.24 ? 169 LYS B CD  1 
ATOM   4976  C  CE  . LYS B 1 169 ? 55.076 90.617  55.375  1.00 25.99 ? 169 LYS B CE  1 
ATOM   4977  N  NZ  . LYS B 1 169 ? 54.953 92.068  55.642  1.00 26.22 ? 169 LYS B NZ  1 
ATOM   4978  N  N   . ARG B 1 170 ? 50.793 87.328  58.243  1.00 31.65 ? 170 ARG B N   1 
ATOM   4979  C  CA  . ARG B 1 170 ? 49.487 86.972  58.781  1.00 32.07 ? 170 ARG B CA  1 
ATOM   4980  C  C   . ARG B 1 170 ? 48.770 85.809  58.105  1.00 32.36 ? 170 ARG B C   1 
ATOM   4981  O  O   . ARG B 1 170 ? 48.888 85.601  56.901  1.00 32.81 ? 170 ARG B O   1 
ATOM   4982  C  CB  . ARG B 1 170 ? 48.570 88.192  58.732  1.00 32.29 ? 170 ARG B CB  1 
ATOM   4983  C  CG  . ARG B 1 170 ? 49.098 89.400  59.470  1.00 31.56 ? 170 ARG B CG  1 
ATOM   4984  C  CD  . ARG B 1 170 ? 48.303 90.640  59.113  1.00 31.13 ? 170 ARG B CD  1 
ATOM   4985  N  NE  . ARG B 1 170 ? 48.814 91.823  59.795  1.00 32.28 ? 170 ARG B NE  1 
ATOM   4986  C  CZ  . ARG B 1 170 ? 48.412 92.232  60.996  1.00 32.26 ? 170 ARG B CZ  1 
ATOM   4987  N  NH1 . ARG B 1 170 ? 47.481 91.553  61.656  1.00 31.69 ? 170 ARG B NH1 1 
ATOM   4988  N  NH2 . ARG B 1 170 ? 48.939 93.321  61.537  1.00 30.99 ? 170 ARG B NH2 1 
ATOM   4989  N  N   . ASN B 1 171 ? 48.015 85.063  58.901  1.00 32.34 ? 171 ASN B N   1 
ATOM   4990  C  CA  . ASN B 1 171 ? 47.229 83.943  58.407  1.00 32.82 ? 171 ASN B CA  1 
ATOM   4991  C  C   . ASN B 1 171 ? 46.274 84.507  57.337  1.00 32.81 ? 171 ASN B C   1 
ATOM   4992  O  O   . ASN B 1 171 ? 45.611 85.523  57.557  1.00 32.16 ? 171 ASN B O   1 
ATOM   4993  C  CB  . ASN B 1 171 ? 46.462 83.328  59.583  1.00 33.74 ? 171 ASN B CB  1 
ATOM   4994  C  CG  . ASN B 1 171 ? 45.541 82.205  59.164  1.00 34.72 ? 171 ASN B CG  1 
ATOM   4995  O  OD1 . ASN B 1 171 ? 44.525 82.437  58.508  1.00 35.98 ? 171 ASN B OD1 1 
ATOM   4996  N  ND2 . ASN B 1 171 ? 45.884 80.978  59.545  1.00 34.78 ? 171 ASN B ND2 1 
ATOM   4997  N  N   . PRO B 1 172 ? 46.190 83.854  56.166  1.00 33.25 ? 172 PRO B N   1 
ATOM   4998  C  CA  . PRO B 1 172 ? 45.315 84.333  55.084  1.00 33.71 ? 172 PRO B CA  1 
ATOM   4999  C  C   . PRO B 1 172 ? 43.816 84.502  55.380  1.00 34.69 ? 172 PRO B C   1 
ATOM   5000  O  O   . PRO B 1 172 ? 43.134 85.267  54.687  1.00 34.98 ? 172 PRO B O   1 
ATOM   5001  C  CB  . PRO B 1 172 ? 45.594 83.344  53.956  1.00 32.85 ? 172 PRO B CB  1 
ATOM   5002  C  CG  . PRO B 1 172 ? 45.918 82.101  54.686  1.00 33.21 ? 172 PRO B CG  1 
ATOM   5003  C  CD  . PRO B 1 172 ? 46.801 82.563  55.813  1.00 32.31 ? 172 PRO B CD  1 
ATOM   5004  N  N   . GLN B 1 173 ? 43.309 83.804  56.396  1.00 35.03 ? 173 GLN B N   1 
ATOM   5005  C  CA  . GLN B 1 173 ? 41.906 83.905  56.769  1.00 35.19 ? 173 GLN B CA  1 
ATOM   5006  C  C   . GLN B 1 173 ? 41.680 84.768  58.014  1.00 34.92 ? 173 GLN B C   1 
ATOM   5007  O  O   . GLN B 1 173 ? 40.870 85.681  57.995  1.00 35.44 ? 173 GLN B O   1 
ATOM   5008  C  CB  . GLN B 1 173 ? 41.311 82.522  57.016  1.00 37.21 ? 173 GLN B CB  1 
ATOM   5009  C  CG  . GLN B 1 173 ? 39.833 82.583  57.439  1.00 40.68 ? 173 GLN B CG  1 
ATOM   5010  C  CD  . GLN B 1 173 ? 39.220 81.214  57.726  1.00 42.08 ? 173 GLN B CD  1 
ATOM   5011  O  OE1 . GLN B 1 173 ? 39.261 80.728  58.859  1.00 41.98 ? 173 GLN B OE1 1 
ATOM   5012  N  NE2 . GLN B 1 173 ? 38.657 80.585  56.691  1.00 42.03 ? 173 GLN B NE2 1 
ATOM   5013  N  N   . THR B 1 174 ? 42.384 84.493  59.101  1.00 34.57 ? 174 THR B N   1 
ATOM   5014  C  CA  . THR B 1 174 ? 42.180 85.288  60.309  1.00 35.08 ? 174 THR B CA  1 
ATOM   5015  C  C   . THR B 1 174 ? 42.910 86.622  60.303  1.00 35.35 ? 174 THR B C   1 
ATOM   5016  O  O   . THR B 1 174 ? 42.533 87.546  61.018  1.00 35.08 ? 174 THR B O   1 
ATOM   5017  C  CB  . THR B 1 174 ? 42.600 84.520  61.575  1.00 35.04 ? 174 THR B CB  1 
ATOM   5018  O  OG1 . THR B 1 174 ? 43.975 84.121  61.477  1.00 36.49 ? 174 THR B OG1 1 
ATOM   5019  C  CG2 . THR B 1 174 ? 41.728 83.303  61.751  1.00 34.89 ? 174 THR B CG2 1 
ATOM   5020  N  N   . HIS B 1 175 ? 43.954 86.716  59.489  1.00 36.13 ? 175 HIS B N   1 
ATOM   5021  C  CA  . HIS B 1 175 ? 44.758 87.926  59.389  1.00 36.60 ? 175 HIS B CA  1 
ATOM   5022  C  C   . HIS B 1 175 ? 45.463 88.163  60.715  1.00 36.91 ? 175 HIS B C   1 
ATOM   5023  O  O   . HIS B 1 175 ? 45.703 89.299  61.102  1.00 37.37 ? 175 HIS B O   1 
ATOM   5024  C  CB  . HIS B 1 175 ? 43.881 89.134  59.061  1.00 36.51 ? 175 HIS B CB  1 
ATOM   5025  C  CG  . HIS B 1 175 ? 44.637 90.289  58.480  1.00 36.59 ? 175 HIS B CG  1 
ATOM   5026  N  ND1 . HIS B 1 175 ? 45.325 90.201  57.288  1.00 36.69 ? 175 HIS B ND1 1 
ATOM   5027  C  CD2 . HIS B 1 175 ? 44.768 91.571  58.895  1.00 36.38 ? 175 HIS B CD2 1 
ATOM   5028  C  CE1 . HIS B 1 175 ? 45.839 91.381  56.990  1.00 36.27 ? 175 HIS B CE1 1 
ATOM   5029  N  NE2 . HIS B 1 175 ? 45.516 92.231  57.949  1.00 36.18 ? 175 HIS B NE2 1 
ATOM   5030  N  N   . LEU B 1 176 ? 45.787 87.080  61.412  1.00 37.27 ? 176 LEU B N   1 
ATOM   5031  C  CA  . LEU B 1 176 ? 46.462 87.175  62.697  1.00 36.83 ? 176 LEU B CA  1 
ATOM   5032  C  C   . LEU B 1 176 ? 47.807 86.495  62.564  1.00 36.98 ? 176 LEU B C   1 
ATOM   5033  O  O   . LEU B 1 176 ? 47.992 85.707  61.636  1.00 36.96 ? 176 LEU B O   1 
ATOM   5034  C  CB  . LEU B 1 176 ? 45.637 86.470  63.761  1.00 36.78 ? 176 LEU B CB  1 
ATOM   5035  C  CG  . LEU B 1 176 ? 44.230 87.006  64.036  1.00 36.91 ? 176 LEU B CG  1 
ATOM   5036  C  CD1 . LEU B 1 176 ? 43.648 86.218  65.198  1.00 37.02 ? 176 LEU B CD1 1 
ATOM   5037  C  CD2 . LEU B 1 176 ? 44.268 88.487  64.379  1.00 35.08 ? 176 LEU B CD2 1 
ATOM   5038  N  N   . LYS B 1 177 ? 48.746 86.807  63.461  1.00 37.14 ? 177 LYS B N   1 
ATOM   5039  C  CA  . LYS B 1 177 ? 50.068 86.173  63.418  1.00 37.71 ? 177 LYS B CA  1 
ATOM   5040  C  C   . LYS B 1 177 ? 49.820 84.698  63.724  1.00 37.17 ? 177 LYS B C   1 
ATOM   5041  O  O   . LYS B 1 177 ? 48.933 84.373  64.510  1.00 37.48 ? 177 LYS B O   1 
ATOM   5042  C  CB  . LYS B 1 177 ? 51.018 86.782  64.456  1.00 38.87 ? 177 LYS B CB  1 
ATOM   5043  C  CG  . LYS B 1 177 ? 51.324 88.266  64.272  1.00 40.80 ? 177 LYS B CG  1 
ATOM   5044  C  CD  . LYS B 1 177 ? 51.979 88.603  62.917  1.00 44.06 ? 177 LYS B CD  1 
ATOM   5045  C  CE  . LYS B 1 177 ? 52.138 90.134  62.731  1.00 45.80 ? 177 LYS B CE  1 
ATOM   5046  N  NZ  . LYS B 1 177 ? 52.804 90.577  61.455  1.00 46.10 ? 177 LYS B NZ  1 
ATOM   5047  N  N   . ASP B 1 178 ? 50.592 83.803  63.122  1.00 36.64 ? 178 ASP B N   1 
ATOM   5048  C  CA  . ASP B 1 178 ? 50.340 82.387  63.328  1.00 36.77 ? 178 ASP B CA  1 
ATOM   5049  C  C   . ASP B 1 178 ? 51.564 81.522  63.645  1.00 36.80 ? 178 ASP B C   1 
ATOM   5050  O  O   . ASP B 1 178 ? 52.306 81.102  62.754  1.00 35.93 ? 178 ASP B O   1 
ATOM   5051  C  CB  . ASP B 1 178 ? 49.592 81.845  62.092  1.00 37.09 ? 178 ASP B CB  1 
ATOM   5052  C  CG  . ASP B 1 178 ? 48.985 80.463  62.315  1.00 37.99 ? 178 ASP B CG  1 
ATOM   5053  O  OD1 . ASP B 1 178 ? 48.185 80.027  61.455  1.00 37.08 ? 178 ASP B OD1 1 
ATOM   5054  O  OD2 . ASP B 1 178 ? 49.308 79.809  63.338  1.00 38.76 ? 178 ASP B OD2 1 
ATOM   5055  N  N   . PRO B 1 179 ? 51.775 81.228  64.935  1.00 36.77 ? 179 PRO B N   1 
ATOM   5056  C  CA  . PRO B 1 179 ? 52.904 80.406  65.366  1.00 36.59 ? 179 PRO B CA  1 
ATOM   5057  C  C   . PRO B 1 179 ? 52.946 79.117  64.575  1.00 36.72 ? 179 PRO B C   1 
ATOM   5058  O  O   . PRO B 1 179 ? 54.016 78.624  64.244  1.00 37.03 ? 179 PRO B O   1 
ATOM   5059  C  CB  . PRO B 1 179 ? 52.605 80.160  66.831  1.00 36.22 ? 179 PRO B CB  1 
ATOM   5060  C  CG  . PRO B 1 179 ? 51.964 81.438  67.236  1.00 37.09 ? 179 PRO B CG  1 
ATOM   5061  C  CD  . PRO B 1 179 ? 50.988 81.670  66.096  1.00 37.06 ? 179 PRO B CD  1 
ATOM   5062  N  N   . ASP B 1 180 ? 51.779 78.568  64.267  1.00 37.01 ? 180 ASP B N   1 
ATOM   5063  C  CA  . ASP B 1 180 ? 51.746 77.331  63.510  1.00 36.36 ? 180 ASP B CA  1 
ATOM   5064  C  C   . ASP B 1 180 ? 52.410 77.531  62.164  1.00 36.06 ? 180 ASP B C   1 
ATOM   5065  O  O   . ASP B 1 180 ? 53.187 76.686  61.739  1.00 37.74 ? 180 ASP B O   1 
ATOM   5066  C  CB  . ASP B 1 180 ? 50.314 76.821  63.330  1.00 36.92 ? 180 ASP B CB  1 
ATOM   5067  C  CG  . ASP B 1 180 ? 49.762 76.148  64.596  1.00 38.11 ? 180 ASP B CG  1 
ATOM   5068  O  OD1 . ASP B 1 180 ? 50.557 75.731  65.464  1.00 38.82 ? 180 ASP B OD1 1 
ATOM   5069  O  OD2 . ASP B 1 180 ? 48.527 76.016  64.722  1.00 39.22 ? 180 ASP B OD2 1 
ATOM   5070  N  N   . MET B 1 181 ? 52.137 78.649  61.500  1.00 34.59 ? 181 MET B N   1 
ATOM   5071  C  CA  . MET B 1 181 ? 52.749 78.907  60.193  1.00 33.84 ? 181 MET B CA  1 
ATOM   5072  C  C   . MET B 1 181 ? 54.264 79.069  60.312  1.00 33.57 ? 181 MET B C   1 
ATOM   5073  O  O   . MET B 1 181 ? 55.033 78.483  59.551  1.00 33.19 ? 181 MET B O   1 
ATOM   5074  C  CB  . MET B 1 181 ? 52.148 80.164  59.562  1.00 32.32 ? 181 MET B CB  1 
ATOM   5075  C  CG  . MET B 1 181 ? 50.788 79.943  58.966  1.00 31.51 ? 181 MET B CG  1 
ATOM   5076  S  SD  . MET B 1 181 ? 49.949 81.457  58.525  1.00 30.90 ? 181 MET B SD  1 
ATOM   5077  C  CE  . MET B 1 181 ? 50.974 82.055  57.206  1.00 30.10 ? 181 MET B CE  1 
ATOM   5078  N  N   . VAL B 1 182 ? 54.671 79.883  61.277  1.00 33.53 ? 182 VAL B N   1 
ATOM   5079  C  CA  . VAL B 1 182 ? 56.072 80.147  61.547  1.00 33.02 ? 182 VAL B CA  1 
ATOM   5080  C  C   . VAL B 1 182 ? 56.857 78.851  61.725  1.00 32.91 ? 182 VAL B C   1 
ATOM   5081  O  O   . VAL B 1 182 ? 57.753 78.549  60.942  1.00 33.51 ? 182 VAL B O   1 
ATOM   5082  C  CB  . VAL B 1 182 ? 56.230 81.003  62.839  1.00 33.40 ? 182 VAL B CB  1 
ATOM   5083  C  CG1 . VAL B 1 182 ? 57.687 81.119  63.226  1.00 32.82 ? 182 VAL B CG1 1 
ATOM   5084  C  CG2 . VAL B 1 182 ? 55.635 82.379  62.622  1.00 33.13 ? 182 VAL B CG2 1 
ATOM   5085  N  N   . TRP B 1 183 ? 56.501 78.072  62.741  1.00 32.09 ? 183 TRP B N   1 
ATOM   5086  C  CA  . TRP B 1 183 ? 57.220 76.843  63.031  1.00 31.40 ? 183 TRP B CA  1 
ATOM   5087  C  C   . TRP B 1 183 ? 56.993 75.630  62.125  1.00 30.62 ? 183 TRP B C   1 
ATOM   5088  O  O   . TRP B 1 183 ? 57.861 74.771  62.000  1.00 29.45 ? 183 TRP B O   1 
ATOM   5089  C  CB  . TRP B 1 183 ? 57.000 76.485  64.501  1.00 32.01 ? 183 TRP B CB  1 
ATOM   5090  C  CG  . TRP B 1 183 ? 57.534 77.560  65.407  1.00 31.80 ? 183 TRP B CG  1 
ATOM   5091  C  CD1 . TRP B 1 183 ? 56.831 78.595  65.958  1.00 32.94 ? 183 TRP B CD1 1 
ATOM   5092  C  CD2 . TRP B 1 183 ? 58.903 77.779  65.761  1.00 31.46 ? 183 TRP B CD2 1 
ATOM   5093  N  NE1 . TRP B 1 183 ? 57.677 79.454  66.625  1.00 31.97 ? 183 TRP B NE1 1 
ATOM   5094  C  CE2 . TRP B 1 183 ? 58.956 78.977  66.518  1.00 31.88 ? 183 TRP B CE2 1 
ATOM   5095  C  CE3 . TRP B 1 183 ? 60.092 77.082  65.512  1.00 31.82 ? 183 TRP B CE3 1 
ATOM   5096  C  CZ2 . TRP B 1 183 ? 60.155 79.495  67.023  1.00 31.61 ? 183 TRP B CZ2 1 
ATOM   5097  C  CZ3 . TRP B 1 183 ? 61.287 77.595  66.017  1.00 31.65 ? 183 TRP B CZ3 1 
ATOM   5098  C  CH2 . TRP B 1 183 ? 61.306 78.794  66.765  1.00 32.37 ? 183 TRP B CH2 1 
ATOM   5099  N  N   . ASP B 1 184 ? 55.845 75.536  61.481  1.00 30.71 ? 184 ASP B N   1 
ATOM   5100  C  CA  . ASP B 1 184 ? 55.659 74.401  60.600  1.00 31.27 ? 184 ASP B CA  1 
ATOM   5101  C  C   . ASP B 1 184 ? 56.710 74.580  59.510  1.00 30.82 ? 184 ASP B C   1 
ATOM   5102  O  O   . ASP B 1 184 ? 57.426 73.654  59.167  1.00 30.46 ? 184 ASP B O   1 
ATOM   5103  C  CB  . ASP B 1 184 ? 54.237 74.396  60.016  1.00 33.64 ? 184 ASP B CB  1 
ATOM   5104  C  CG  . ASP B 1 184 ? 53.993 73.232  59.054  1.00 36.37 ? 184 ASP B CG  1 
ATOM   5105  O  OD1 . ASP B 1 184 ? 54.429 72.103  59.366  1.00 38.70 ? 184 ASP B OD1 1 
ATOM   5106  O  OD2 . ASP B 1 184 ? 53.357 73.438  57.990  1.00 36.72 ? 184 ASP B OD2 1 
ATOM   5107  N  N   . PHE B 1 185 ? 56.829 75.796  58.990  1.00 31.10 ? 185 PHE B N   1 
ATOM   5108  C  CA  . PHE B 1 185 ? 57.803 76.072  57.935  1.00 31.15 ? 185 PHE B CA  1 
ATOM   5109  C  C   . PHE B 1 185 ? 59.248 75.862  58.405  1.00 31.82 ? 185 PHE B C   1 
ATOM   5110  O  O   . PHE B 1 185 ? 60.040 75.206  57.720  1.00 32.34 ? 185 PHE B O   1 
ATOM   5111  C  CB  . PHE B 1 185 ? 57.638 77.507  57.406  1.00 29.38 ? 185 PHE B CB  1 
ATOM   5112  C  CG  . PHE B 1 185 ? 58.584 77.852  56.280  1.00 27.52 ? 185 PHE B CG  1 
ATOM   5113  C  CD1 . PHE B 1 185 ? 58.364 77.356  54.990  1.00 26.61 ? 185 PHE B CD1 1 
ATOM   5114  C  CD2 . PHE B 1 185 ? 59.712 78.640  56.519  1.00 25.57 ? 185 PHE B CD2 1 
ATOM   5115  C  CE1 . PHE B 1 185 ? 59.253 77.637  53.959  1.00 25.81 ? 185 PHE B CE1 1 
ATOM   5116  C  CE2 . PHE B 1 185 ? 60.604 78.927  55.506  1.00 25.24 ? 185 PHE B CE2 1 
ATOM   5117  C  CZ  . PHE B 1 185 ? 60.381 78.424  54.216  1.00 26.08 ? 185 PHE B CZ  1 
ATOM   5118  N  N   . TRP B 1 186 ? 59.596 76.430  59.557  1.00 31.93 ? 186 TRP B N   1 
ATOM   5119  C  CA  . TRP B 1 186 ? 60.950 76.283  60.081  1.00 31.99 ? 186 TRP B CA  1 
ATOM   5120  C  C   . TRP B 1 186 ? 61.286 74.828  60.420  1.00 32.22 ? 186 TRP B C   1 
ATOM   5121  O  O   . TRP B 1 186 ? 62.370 74.343  60.103  1.00 32.59 ? 186 TRP B O   1 
ATOM   5122  C  CB  . TRP B 1 186 ? 61.160 77.173  61.321  1.00 31.15 ? 186 TRP B CB  1 
ATOM   5123  C  CG  . TRP B 1 186 ? 61.516 78.607  61.006  1.00 30.84 ? 186 TRP B CG  1 
ATOM   5124  C  CD1 . TRP B 1 186 ? 62.043 79.094  59.831  1.00 31.10 ? 186 TRP B CD1 1 
ATOM   5125  C  CD2 . TRP B 1 186 ? 61.455 79.723  61.903  1.00 31.16 ? 186 TRP B CD2 1 
ATOM   5126  N  NE1 . TRP B 1 186 ? 62.316 80.440  59.949  1.00 30.38 ? 186 TRP B NE1 1 
ATOM   5127  C  CE2 . TRP B 1 186 ? 61.965 80.852  61.209  1.00 30.53 ? 186 TRP B CE2 1 
ATOM   5128  C  CE3 . TRP B 1 186 ? 61.024 79.880  63.230  1.00 30.89 ? 186 TRP B CE3 1 
ATOM   5129  C  CZ2 . TRP B 1 186 ? 62.054 82.113  61.796  1.00 30.18 ? 186 TRP B CZ2 1 
ATOM   5130  C  CZ3 . TRP B 1 186 ? 61.115 81.135  63.813  1.00 30.91 ? 186 TRP B CZ3 1 
ATOM   5131  C  CH2 . TRP B 1 186 ? 61.628 82.238  63.092  1.00 31.44 ? 186 TRP B CH2 1 
ATOM   5132  N  N   . SER B 1 187 ? 60.362 74.123  61.057  1.00 33.18 ? 187 SER B N   1 
ATOM   5133  C  CA  . SER B 1 187 ? 60.627 72.732  61.408  1.00 33.72 ? 187 SER B CA  1 
ATOM   5134  C  C   . SER B 1 187 ? 60.785 71.885  60.143  1.00 33.99 ? 187 SER B C   1 
ATOM   5135  O  O   . SER B 1 187 ? 61.565 70.926  60.123  1.00 34.77 ? 187 SER B O   1 
ATOM   5136  C  CB  . SER B 1 187 ? 59.508 72.173  62.282  1.00 32.96 ? 187 SER B CB  1 
ATOM   5137  O  OG  . SER B 1 187 ? 58.302 72.064  61.557  1.00 35.21 ? 187 SER B OG  1 
ATOM   5138  N  N   . LEU B 1 188 ? 60.051 72.233  59.089  1.00 33.35 ? 188 LEU B N   1 
ATOM   5139  C  CA  . LEU B 1 188 ? 60.158 71.495  57.842  1.00 32.80 ? 188 LEU B CA  1 
ATOM   5140  C  C   . LEU B 1 188 ? 61.419 71.894  57.075  1.00 32.94 ? 188 LEU B C   1 
ATOM   5141  O  O   . LEU B 1 188 ? 61.900 71.136  56.246  1.00 33.52 ? 188 LEU B O   1 
ATOM   5142  C  CB  . LEU B 1 188 ? 58.922 71.724  56.979  1.00 33.29 ? 188 LEU B CB  1 
ATOM   5143  C  CG  . LEU B 1 188 ? 57.597 71.259  57.591  1.00 33.68 ? 188 LEU B CG  1 
ATOM   5144  C  CD1 . LEU B 1 188 ? 56.475 71.388  56.577  1.00 32.68 ? 188 LEU B CD1 1 
ATOM   5145  C  CD2 . LEU B 1 188 ? 57.730 69.818  58.041  1.00 34.18 ? 188 LEU B CD2 1 
ATOM   5146  N  N   . ARG B 1 189 ? 61.952 73.082  57.342  1.00 32.92 ? 189 ARG B N   1 
ATOM   5147  C  CA  . ARG B 1 189 ? 63.173 73.543  56.675  1.00 32.90 ? 189 ARG B CA  1 
ATOM   5148  C  C   . ARG B 1 189 ? 64.214 73.864  57.751  1.00 33.94 ? 189 ARG B C   1 
ATOM   5149  O  O   . ARG B 1 189 ? 64.465 75.036  58.066  1.00 33.91 ? 189 ARG B O   1 
ATOM   5150  C  CB  . ARG B 1 189 ? 62.896 74.793  55.828  1.00 31.12 ? 189 ARG B CB  1 
ATOM   5151  C  CG  . ARG B 1 189 ? 61.873 74.599  54.743  1.00 30.38 ? 189 ARG B CG  1 
ATOM   5152  C  CD  . ARG B 1 189 ? 62.288 73.511  53.776  1.00 30.23 ? 189 ARG B CD  1 
ATOM   5153  N  NE  . ARG B 1 189 ? 63.516 73.848  53.063  1.00 31.19 ? 189 ARG B NE  1 
ATOM   5154  C  CZ  . ARG B 1 189 ? 63.966 73.186  51.998  1.00 32.03 ? 189 ARG B CZ  1 
ATOM   5155  N  NH1 . ARG B 1 189 ? 63.285 72.150  51.524  1.00 31.85 ? 189 ARG B NH1 1 
ATOM   5156  N  NH2 . ARG B 1 189 ? 65.097 73.553  51.404  1.00 31.09 ? 189 ARG B NH2 1 
ATOM   5157  N  N   . PRO B 1 190 ? 64.857 72.819  58.307  1.00 34.60 ? 190 PRO B N   1 
ATOM   5158  C  CA  . PRO B 1 190 ? 65.871 72.946  59.360  1.00 34.75 ? 190 PRO B CA  1 
ATOM   5159  C  C   . PRO B 1 190 ? 67.101 73.774  59.014  1.00 35.03 ? 190 PRO B C   1 
ATOM   5160  O  O   . PRO B 1 190 ? 67.884 74.115  59.906  1.00 34.81 ? 190 PRO B O   1 
ATOM   5161  C  CB  . PRO B 1 190 ? 66.202 71.495  59.703  1.00 34.42 ? 190 PRO B CB  1 
ATOM   5162  C  CG  . PRO B 1 190 ? 66.079 70.818  58.378  1.00 35.35 ? 190 PRO B CG  1 
ATOM   5163  C  CD  . PRO B 1 190 ? 64.810 71.437  57.792  1.00 35.23 ? 190 PRO B CD  1 
ATOM   5164  N  N   . GLU B 1 191 ? 67.279 74.107  57.738  1.00 35.39 ? 191 GLU B N   1 
ATOM   5165  C  CA  . GLU B 1 191 ? 68.425 74.930  57.366  1.00 36.25 ? 191 GLU B CA  1 
ATOM   5166  C  C   . GLU B 1 191 ? 68.245 76.283  58.055  1.00 36.83 ? 191 GLU B C   1 
ATOM   5167  O  O   . GLU B 1 191 ? 69.185 77.070  58.161  1.00 37.97 ? 191 GLU B O   1 
ATOM   5168  C  CB  . GLU B 1 191 ? 68.514 75.139  55.850  1.00 36.56 ? 191 GLU B CB  1 
ATOM   5169  C  CG  . GLU B 1 191 ? 67.352 75.902  55.245  1.00 37.12 ? 191 GLU B CG  1 
ATOM   5170  C  CD  . GLU B 1 191 ? 66.204 74.998  54.877  1.00 38.08 ? 191 GLU B CD  1 
ATOM   5171  O  OE1 . GLU B 1 191 ? 66.036 73.953  55.542  1.00 38.98 ? 191 GLU B OE1 1 
ATOM   5172  O  OE2 . GLU B 1 191 ? 65.465 75.331  53.928  1.00 38.88 ? 191 GLU B OE2 1 
ATOM   5173  N  N   . SER B 1 192 ? 67.028 76.545  58.525  1.00 36.08 ? 192 SER B N   1 
ATOM   5174  C  CA  . SER B 1 192 ? 66.718 77.783  59.218  1.00 35.28 ? 192 SER B CA  1 
ATOM   5175  C  C   . SER B 1 192 ? 67.335 77.804  60.619  1.00 35.33 ? 192 SER B C   1 
ATOM   5176  O  O   . SER B 1 192 ? 67.268 78.815  61.311  1.00 35.97 ? 192 SER B O   1 
ATOM   5177  C  CB  . SER B 1 192 ? 65.208 77.920  59.355  1.00 36.25 ? 192 SER B CB  1 
ATOM   5178  O  OG  . SER B 1 192 ? 64.692 76.959  60.280  1.00 36.87 ? 192 SER B OG  1 
ATOM   5179  N  N   . LEU B 1 193 ? 67.928 76.693  61.042  1.00 34.65 ? 193 LEU B N   1 
ATOM   5180  C  CA  . LEU B 1 193 ? 68.519 76.597  62.377  1.00 34.08 ? 193 LEU B CA  1 
ATOM   5181  C  C   . LEU B 1 193 ? 69.539 77.669  62.752  1.00 34.32 ? 193 LEU B C   1 
ATOM   5182  O  O   . LEU B 1 193 ? 69.442 78.312  63.803  1.00 34.16 ? 193 LEU B O   1 
ATOM   5183  C  CB  . LEU B 1 193 ? 69.155 75.222  62.564  1.00 33.83 ? 193 LEU B CB  1 
ATOM   5184  C  CG  . LEU B 1 193 ? 68.201 74.062  62.846  1.00 32.90 ? 193 LEU B CG  1 
ATOM   5185  C  CD1 . LEU B 1 193 ? 68.962 72.763  62.722  1.00 32.17 ? 193 LEU B CD1 1 
ATOM   5186  C  CD2 . LEU B 1 193 ? 67.586 74.206  64.230  1.00 31.72 ? 193 LEU B CD2 1 
ATOM   5187  N  N   . HIS B 1 194 ? 70.530 77.862  61.902  1.00 33.81 ? 194 HIS B N   1 
ATOM   5188  C  CA  . HIS B 1 194 ? 71.546 78.854  62.193  1.00 33.98 ? 194 HIS B CA  1 
ATOM   5189  C  C   . HIS B 1 194 ? 70.975 80.258  62.469  1.00 34.90 ? 194 HIS B C   1 
ATOM   5190  O  O   . HIS B 1 194 ? 71.266 80.860  63.510  1.00 35.13 ? 194 HIS B O   1 
ATOM   5191  C  CB  . HIS B 1 194 ? 72.544 78.904  61.043  1.00 32.98 ? 194 HIS B CB  1 
ATOM   5192  C  CG  . HIS B 1 194 ? 73.879 79.440  61.434  1.00 32.40 ? 194 HIS B CG  1 
ATOM   5193  N  ND1 . HIS B 1 194 ? 74.945 79.482  60.564  1.00 31.69 ? 194 HIS B ND1 1 
ATOM   5194  C  CD2 . HIS B 1 194 ? 74.315 79.984  62.594  1.00 32.56 ? 194 HIS B CD2 1 
ATOM   5195  C  CE1 . HIS B 1 194 ? 75.981 80.032  61.170  1.00 32.55 ? 194 HIS B CE1 1 
ATOM   5196  N  NE2 . HIS B 1 194 ? 75.625 80.347  62.403  1.00 32.44 ? 194 HIS B NE2 1 
ATOM   5197  N  N   . GLN B 1 195 ? 70.157 80.772  61.551  1.00 34.17 ? 195 GLN B N   1 
ATOM   5198  C  CA  . GLN B 1 195 ? 69.581 82.104  61.716  1.00 34.14 ? 195 GLN B CA  1 
ATOM   5199  C  C   . GLN B 1 195 ? 68.498 82.181  62.783  1.00 33.55 ? 195 GLN B C   1 
ATOM   5200  O  O   . GLN B 1 195 ? 68.305 83.226  63.390  1.00 33.45 ? 195 GLN B O   1 
ATOM   5201  C  CB  . GLN B 1 195 ? 69.034 82.608  60.377  1.00 34.68 ? 195 GLN B CB  1 
ATOM   5202  C  CG  . GLN B 1 195 ? 68.342 83.960  60.416  1.00 34.72 ? 195 GLN B CG  1 
ATOM   5203  C  CD  . GLN B 1 195 ? 69.150 85.036  61.125  1.00 36.07 ? 195 GLN B CD  1 
ATOM   5204  O  OE1 . GLN B 1 195 ? 70.381 85.007  61.142  1.00 36.42 ? 195 GLN B OE1 1 
ATOM   5205  N  NE2 . GLN B 1 195 ? 68.452 86.011  61.697  1.00 36.62 ? 195 GLN B NE2 1 
ATOM   5206  N  N   . VAL B 1 196 ? 67.777 81.089  62.998  1.00 33.74 ? 196 VAL B N   1 
ATOM   5207  C  CA  . VAL B 1 196 ? 66.740 81.077  64.024  1.00 34.31 ? 196 VAL B CA  1 
ATOM   5208  C  C   . VAL B 1 196 ? 67.413 81.238  65.386  1.00 34.98 ? 196 VAL B C   1 
ATOM   5209  O  O   . VAL B 1 196 ? 66.831 81.786  66.319  1.00 35.21 ? 196 VAL B O   1 
ATOM   5210  C  CB  . VAL B 1 196 ? 65.923 79.754  64.014  1.00 33.73 ? 196 VAL B CB  1 
ATOM   5211  C  CG1 . VAL B 1 196 ? 65.168 79.604  65.320  1.00 33.41 ? 196 VAL B CG1 1 
ATOM   5212  C  CG2 . VAL B 1 196 ? 64.924 79.754  62.858  1.00 32.52 ? 196 VAL B CG2 1 
ATOM   5213  N  N   . SER B 1 197 ? 68.646 80.753  65.491  1.00 36.37 ? 197 SER B N   1 
ATOM   5214  C  CA  . SER B 1 197 ? 69.411 80.848  66.727  1.00 37.28 ? 197 SER B CA  1 
ATOM   5215  C  C   . SER B 1 197 ? 69.878 82.282  66.934  1.00 38.91 ? 197 SER B C   1 
ATOM   5216  O  O   . SER B 1 197 ? 69.781 82.828  68.038  1.00 40.37 ? 197 SER B O   1 
ATOM   5217  C  CB  . SER B 1 197 ? 70.623 79.918  66.678  1.00 36.68 ? 197 SER B CB  1 
ATOM   5218  O  OG  . SER B 1 197 ? 70.223 78.564  66.691  1.00 36.93 ? 197 SER B OG  1 
ATOM   5219  N  N   . PHE B 1 198 ? 70.389 82.898  65.875  1.00 39.17 ? 198 PHE B N   1 
ATOM   5220  C  CA  . PHE B 1 198 ? 70.853 84.263  65.987  1.00 40.05 ? 198 PHE B CA  1 
ATOM   5221  C  C   . PHE B 1 198 ? 69.678 85.183  66.304  1.00 40.26 ? 198 PHE B C   1 
ATOM   5222  O  O   . PHE B 1 198 ? 69.798 86.086  67.134  1.00 39.71 ? 198 PHE B O   1 
ATOM   5223  C  CB  . PHE B 1 198 ? 71.541 84.688  64.686  1.00 41.79 ? 198 PHE B CB  1 
ATOM   5224  C  CG  . PHE B 1 198 ? 72.138 86.064  64.737  1.00 43.20 ? 198 PHE B CG  1 
ATOM   5225  C  CD1 . PHE B 1 198 ? 71.350 87.194  64.488  1.00 44.06 ? 198 PHE B CD1 1 
ATOM   5226  C  CD2 . PHE B 1 198 ? 73.483 86.240  65.072  1.00 43.95 ? 198 PHE B CD2 1 
ATOM   5227  C  CE1 . PHE B 1 198 ? 71.891 88.485  64.571  1.00 43.95 ? 198 PHE B CE1 1 
ATOM   5228  C  CE2 . PHE B 1 198 ? 74.041 87.524  65.160  1.00 44.17 ? 198 PHE B CE2 1 
ATOM   5229  C  CZ  . PHE B 1 198 ? 73.241 88.650  64.909  1.00 44.63 ? 198 PHE B CZ  1 
ATOM   5230  N  N   . LEU B 1 199 ? 68.535 84.925  65.661  1.00 40.79 ? 199 LEU B N   1 
ATOM   5231  C  CA  . LEU B 1 199 ? 67.322 85.735  65.838  1.00 40.62 ? 199 LEU B CA  1 
ATOM   5232  C  C   . LEU B 1 199 ? 66.707 85.691  67.228  1.00 41.10 ? 199 LEU B C   1 
ATOM   5233  O  O   . LEU B 1 199 ? 66.058 86.651  67.650  1.00 41.22 ? 199 LEU B O   1 
ATOM   5234  C  CB  . LEU B 1 199 ? 66.251 85.334  64.818  1.00 40.25 ? 199 LEU B CB  1 
ATOM   5235  C  CG  . LEU B 1 199 ? 64.874 86.008  64.957  1.00 40.30 ? 199 LEU B CG  1 
ATOM   5236  C  CD1 . LEU B 1 199 ? 64.982 87.476  64.629  1.00 39.46 ? 199 LEU B CD1 1 
ATOM   5237  C  CD2 . LEU B 1 199 ? 63.863 85.339  64.031  1.00 40.05 ? 199 LEU B CD2 1 
ATOM   5238  N  N   . PHE B 1 200 ? 66.878 84.579  67.933  1.00 41.73 ? 200 PHE B N   1 
ATOM   5239  C  CA  . PHE B 1 200 ? 66.325 84.480  69.274  1.00 41.88 ? 200 PHE B CA  1 
ATOM   5240  C  C   . PHE B 1 200 ? 67.357 84.774  70.368  1.00 42.60 ? 200 PHE B C   1 
ATOM   5241  O  O   . PHE B 1 200 ? 67.037 84.749  71.555  1.00 42.40 ? 200 PHE B O   1 
ATOM   5242  C  CB  . PHE B 1 200 ? 65.677 83.113  69.490  1.00 41.20 ? 200 PHE B CB  1 
ATOM   5243  C  CG  . PHE B 1 200 ? 64.333 82.977  68.834  1.00 40.57 ? 200 PHE B CG  1 
ATOM   5244  C  CD1 . PHE B 1 200 ? 64.225 82.575  67.508  1.00 40.11 ? 200 PHE B CD1 1 
ATOM   5245  C  CD2 . PHE B 1 200 ? 63.169 83.306  69.529  1.00 39.74 ? 200 PHE B CD2 1 
ATOM   5246  C  CE1 . PHE B 1 200 ? 62.972 82.506  66.879  1.00 39.81 ? 200 PHE B CE1 1 
ATOM   5247  C  CE2 . PHE B 1 200 ? 61.921 83.241  68.913  1.00 38.66 ? 200 PHE B CE2 1 
ATOM   5248  C  CZ  . PHE B 1 200 ? 61.823 82.842  67.585  1.00 38.99 ? 200 PHE B CZ  1 
ATOM   5249  N  N   . SER B 1 201 ? 68.594 85.060  69.970  1.00 43.14 ? 201 SER B N   1 
ATOM   5250  C  CA  . SER B 1 201 ? 69.625 85.405  70.940  1.00 44.30 ? 201 SER B CA  1 
ATOM   5251  C  C   . SER B 1 201 ? 69.360 86.865  71.326  1.00 45.01 ? 201 SER B C   1 
ATOM   5252  O  O   . SER B 1 201 ? 68.433 87.482  70.810  1.00 45.17 ? 201 SER B O   1 
ATOM   5253  C  CB  . SER B 1 201 ? 71.016 85.296  70.320  1.00 44.40 ? 201 SER B CB  1 
ATOM   5254  O  OG  . SER B 1 201 ? 71.333 86.475  69.601  1.00 44.54 ? 201 SER B OG  1 
ATOM   5255  N  N   . ASP B 1 202 ? 70.174 87.430  72.210  1.00 45.54 ? 202 ASP B N   1 
ATOM   5256  C  CA  . ASP B 1 202 ? 69.953 88.804  72.624  1.00 46.12 ? 202 ASP B CA  1 
ATOM   5257  C  C   . ASP B 1 202 ? 69.877 89.763  71.439  1.00 46.50 ? 202 ASP B C   1 
ATOM   5258  O  O   . ASP B 1 202 ? 69.138 90.757  71.484  1.00 47.33 ? 202 ASP B O   1 
ATOM   5259  C  CB  . ASP B 1 202 ? 71.053 89.277  73.577  1.00 47.16 ? 202 ASP B CB  1 
ATOM   5260  C  CG  . ASP B 1 202 ? 71.043 88.541  74.902  1.00 48.08 ? 202 ASP B CG  1 
ATOM   5261  O  OD1 . ASP B 1 202 ? 69.951 88.304  75.460  1.00 49.49 ? 202 ASP B OD1 1 
ATOM   5262  O  OD2 . ASP B 1 202 ? 72.141 88.210  75.394  1.00 49.55 ? 202 ASP B OD2 1 
ATOM   5263  N  N   . ARG B 1 203 ? 70.626 89.473  70.379  1.00 45.28 ? 203 ARG B N   1 
ATOM   5264  C  CA  . ARG B 1 203 ? 70.624 90.349  69.215  1.00 44.23 ? 203 ARG B CA  1 
ATOM   5265  C  C   . ARG B 1 203 ? 69.335 90.384  68.397  1.00 43.24 ? 203 ARG B C   1 
ATOM   5266  O  O   . ARG B 1 203 ? 69.243 91.094  67.393  1.00 43.21 ? 203 ARG B O   1 
ATOM   5267  C  CB  . ARG B 1 203 ? 71.798 90.008  68.316  1.00 45.11 ? 203 ARG B CB  1 
ATOM   5268  C  CG  . ARG B 1 203 ? 73.130 90.373  68.942  1.00 47.22 ? 203 ARG B CG  1 
ATOM   5269  C  CD  . ARG B 1 203 ? 74.136 90.671  67.864  1.00 49.20 ? 203 ARG B CD  1 
ATOM   5270  N  NE  . ARG B 1 203 ? 75.496 90.786  68.373  1.00 51.67 ? 203 ARG B NE  1 
ATOM   5271  C  CZ  . ARG B 1 203 ? 76.553 91.044  67.603  1.00 53.01 ? 203 ARG B CZ  1 
ATOM   5272  N  NH1 . ARG B 1 203 ? 76.396 91.218  66.285  1.00 52.56 ? 203 ARG B NH1 1 
ATOM   5273  N  NH2 . ARG B 1 203 ? 77.768 91.113  68.146  1.00 53.18 ? 203 ARG B NH2 1 
ATOM   5274  N  N   . GLY B 1 204 ? 68.333 89.628  68.827  1.00 41.89 ? 204 GLY B N   1 
ATOM   5275  C  CA  . GLY B 1 204 ? 67.070 89.623  68.113  1.00 40.09 ? 204 GLY B CA  1 
ATOM   5276  C  C   . GLY B 1 204 ? 66.357 90.956  68.239  1.00 38.84 ? 204 GLY B C   1 
ATOM   5277  O  O   . GLY B 1 204 ? 65.509 91.296  67.418  1.00 37.83 ? 204 GLY B O   1 
ATOM   5278  N  N   . ILE B 1 205 ? 66.693 91.713  69.280  1.00 38.35 ? 205 ILE B N   1 
ATOM   5279  C  CA  . ILE B 1 205 ? 66.079 93.018  69.483  1.00 37.62 ? 205 ILE B CA  1 
ATOM   5280  C  C   . ILE B 1 205 ? 67.112 94.079  69.843  1.00 37.46 ? 205 ILE B C   1 
ATOM   5281  O  O   . ILE B 1 205 ? 67.356 94.339  71.023  1.00 37.53 ? 205 ILE B O   1 
ATOM   5282  C  CB  . ILE B 1 205 ? 65.047 92.989  70.611  1.00 37.36 ? 205 ILE B CB  1 
ATOM   5283  C  CG1 . ILE B 1 205 ? 64.239 91.688  70.563  1.00 36.42 ? 205 ILE B CG1 1 
ATOM   5284  C  CG2 . ILE B 1 205 ? 64.140 94.202  70.486  1.00 37.10 ? 205 ILE B CG2 1 
ATOM   5285  C  CD1 . ILE B 1 205 ? 63.280 91.530  71.737  1.00 35.49 ? 205 ILE B CD1 1 
ATOM   5286  N  N   . PRO B 1 206 ? 67.742 94.704  68.831  1.00 37.13 ? 206 PRO B N   1 
ATOM   5287  C  CA  . PRO B 1 206 ? 68.745 95.739  69.113  1.00 36.88 ? 206 PRO B CA  1 
ATOM   5288  C  C   . PRO B 1 206 ? 68.136 97.014  69.680  1.00 37.04 ? 206 PRO B C   1 
ATOM   5289  O  O   . PRO B 1 206 ? 66.987 97.335  69.416  1.00 37.38 ? 206 PRO B O   1 
ATOM   5290  C  CB  . PRO B 1 206 ? 69.416 95.956  67.758  1.00 36.93 ? 206 PRO B CB  1 
ATOM   5291  C  CG  . PRO B 1 206 ? 68.370 95.539  66.770  1.00 36.99 ? 206 PRO B CG  1 
ATOM   5292  C  CD  . PRO B 1 206 ? 67.748 94.335  67.404  1.00 36.57 ? 206 PRO B CD  1 
ATOM   5293  N  N   . ASP B 1 207 ? 68.900 97.737  70.485  1.00 37.74 ? 207 ASP B N   1 
ATOM   5294  C  CA  . ASP B 1 207 ? 68.387 98.968  71.065  1.00 37.38 ? 207 ASP B CA  1 
ATOM   5295  C  C   . ASP B 1 207 ? 68.553 100.071 70.033  1.00 37.13 ? 207 ASP B C   1 
ATOM   5296  O  O   . ASP B 1 207 ? 69.514 100.828 70.066  1.00 36.84 ? 207 ASP B O   1 
ATOM   5297  C  CB  . ASP B 1 207 ? 69.146 99.311  72.350  1.00 37.81 ? 207 ASP B CB  1 
ATOM   5298  C  CG  . ASP B 1 207 ? 68.527 100.469 73.106  1.00 38.89 ? 207 ASP B CG  1 
ATOM   5299  O  OD1 . ASP B 1 207 ? 68.906 100.695 74.279  1.00 39.95 ? 207 ASP B OD1 1 
ATOM   5300  O  OD2 . ASP B 1 207 ? 67.662 101.162 72.528  1.00 40.72 ? 207 ASP B OD2 1 
ATOM   5301  N  N   . GLY B 1 208 ? 67.606 100.150 69.107  1.00 36.91 ? 208 GLY B N   1 
ATOM   5302  C  CA  . GLY B 1 208 ? 67.676 101.169 68.084  1.00 36.58 ? 208 GLY B CA  1 
ATOM   5303  C  C   . GLY B 1 208 ? 68.522 100.683 66.930  1.00 36.60 ? 208 GLY B C   1 
ATOM   5304  O  O   . GLY B 1 208 ? 69.016 99.551  66.950  1.00 36.40 ? 208 GLY B O   1 
ATOM   5305  N  N   . HIS B 1 209 ? 68.704 101.545 65.934  1.00 35.74 ? 209 HIS B N   1 
ATOM   5306  C  CA  . HIS B 1 209 ? 69.470 101.184 64.755  1.00 35.34 ? 209 HIS B CA  1 
ATOM   5307  C  C   . HIS B 1 209 ? 70.952 101.437 64.877  1.00 35.50 ? 209 HIS B C   1 
ATOM   5308  O  O   . HIS B 1 209 ? 71.744 100.792 64.192  1.00 35.61 ? 209 HIS B O   1 
ATOM   5309  C  CB  . HIS B 1 209 ? 68.918 101.923 63.544  1.00 33.71 ? 209 HIS B CB  1 
ATOM   5310  C  CG  . HIS B 1 209 ? 67.453 101.716 63.357  1.00 34.36 ? 209 HIS B CG  1 
ATOM   5311  N  ND1 . HIS B 1 209 ? 66.888 100.461 63.285  1.00 35.49 ? 209 HIS B ND1 1 
ATOM   5312  C  CD2 . HIS B 1 209 ? 66.428 102.595 63.287  1.00 34.43 ? 209 HIS B CD2 1 
ATOM   5313  C  CE1 . HIS B 1 209 ? 65.576 100.575 63.181  1.00 35.25 ? 209 HIS B CE1 1 
ATOM   5314  N  NE2 . HIS B 1 209 ? 65.271 101.860 63.181  1.00 35.63 ? 209 HIS B NE2 1 
ATOM   5315  N  N   . ARG B 1 210 ? 71.328 102.364 65.753  1.00 35.41 ? 210 ARG B N   1 
ATOM   5316  C  CA  . ARG B 1 210 ? 72.728 102.714 65.939  1.00 35.52 ? 210 ARG B CA  1 
ATOM   5317  C  C   . ARG B 1 210 ? 73.530 101.701 66.771  1.00 36.30 ? 210 ARG B C   1 
ATOM   5318  O  O   . ARG B 1 210 ? 74.758 101.777 66.834  1.00 36.59 ? 210 ARG B O   1 
ATOM   5319  C  CB  . ARG B 1 210 ? 72.813 104.094 66.578  1.00 34.71 ? 210 ARG B CB  1 
ATOM   5320  C  CG  . ARG B 1 210 ? 71.952 105.125 65.894  1.00 34.28 ? 210 ARG B CG  1 
ATOM   5321  C  CD  . ARG B 1 210 ? 72.000 106.436 66.638  1.00 33.95 ? 210 ARG B CD  1 
ATOM   5322  N  NE  . ARG B 1 210 ? 71.320 106.334 67.924  1.00 34.17 ? 210 ARG B NE  1 
ATOM   5323  C  CZ  . ARG B 1 210 ? 71.872 106.647 69.089  1.00 33.76 ? 210 ARG B CZ  1 
ATOM   5324  N  NH1 . ARG B 1 210 ? 73.123 107.082 69.129  1.00 33.52 ? 210 ARG B NH1 1 
ATOM   5325  N  NH2 . ARG B 1 210 ? 71.171 106.532 70.212  1.00 32.60 ? 210 ARG B NH2 1 
ATOM   5326  N  N   . HIS B 1 211 ? 72.853 100.751 67.406  1.00 36.63 ? 211 HIS B N   1 
ATOM   5327  C  CA  . HIS B 1 211 ? 73.563 99.773  68.210  1.00 37.47 ? 211 HIS B CA  1 
ATOM   5328  C  C   . HIS B 1 211 ? 73.526 98.346  67.664  1.00 37.70 ? 211 HIS B C   1 
ATOM   5329  O  O   . HIS B 1 211 ? 73.307 97.393  68.411  1.00 38.88 ? 211 HIS B O   1 
ATOM   5330  C  CB  . HIS B 1 211 ? 73.054 99.824  69.654  1.00 37.95 ? 211 HIS B CB  1 
ATOM   5331  C  CG  . HIS B 1 211 ? 73.319 101.137 70.332  1.00 39.15 ? 211 HIS B CG  1 
ATOM   5332  N  ND1 . HIS B 1 211 ? 74.585 101.670 70.453  1.00 39.44 ? 211 HIS B ND1 1 
ATOM   5333  C  CD2 . HIS B 1 211 ? 72.482 102.029 70.916  1.00 39.79 ? 211 HIS B CD2 1 
ATOM   5334  C  CE1 . HIS B 1 211 ? 74.519 102.830 71.083  1.00 38.40 ? 211 HIS B CE1 1 
ATOM   5335  N  NE2 . HIS B 1 211 ? 73.254 103.070 71.375  1.00 39.88 ? 211 HIS B NE2 1 
ATOM   5336  N  N   . MET B 1 212 ? 73.756 98.214  66.356  1.00 37.45 ? 212 MET B N   1 
ATOM   5337  C  CA  . MET B 1 212 ? 73.794 96.916  65.674  1.00 36.64 ? 212 MET B CA  1 
ATOM   5338  C  C   . MET B 1 212 ? 74.822 96.979  64.550  1.00 36.52 ? 212 MET B C   1 
ATOM   5339  O  O   . MET B 1 212 ? 75.306 98.058  64.202  1.00 36.04 ? 212 MET B O   1 
ATOM   5340  C  CB  . MET B 1 212 ? 72.418 96.561  65.091  1.00 36.91 ? 212 MET B CB  1 
ATOM   5341  C  CG  . MET B 1 212 ? 71.820 97.622  64.160  1.00 36.73 ? 212 MET B CG  1 
ATOM   5342  S  SD  . MET B 1 212 ? 70.098 97.317  63.627  1.00 34.90 ? 212 MET B SD  1 
ATOM   5343  C  CE  . MET B 1 212 ? 70.235 97.691  61.870  1.00 35.00 ? 212 MET B CE  1 
ATOM   5344  N  N   . ASN B 1 213 ? 75.169 95.824  63.991  1.00 36.56 ? 213 ASN B N   1 
ATOM   5345  C  CA  . ASN B 1 213 ? 76.139 95.790  62.898  1.00 36.41 ? 213 ASN B CA  1 
ATOM   5346  C  C   . ASN B 1 213 ? 75.425 95.527  61.601  1.00 35.61 ? 213 ASN B C   1 
ATOM   5347  O  O   . ASN B 1 213 ? 74.262 95.145  61.598  1.00 35.76 ? 213 ASN B O   1 
ATOM   5348  C  CB  . ASN B 1 213 ? 77.180 94.694  63.103  1.00 37.41 ? 213 ASN B CB  1 
ATOM   5349  C  CG  . ASN B 1 213 ? 77.975 94.889  64.357  1.00 39.06 ? 213 ASN B CG  1 
ATOM   5350  O  OD1 . ASN B 1 213 ? 78.544 95.959  64.581  1.00 41.96 ? 213 ASN B OD1 1 
ATOM   5351  N  ND2 . ASN B 1 213 ? 78.025 93.861  65.191  1.00 39.73 ? 213 ASN B ND2 1 
ATOM   5352  N  N   . GLY B 1 214 ? 76.137 95.723  60.503  1.00 34.94 ? 214 GLY B N   1 
ATOM   5353  C  CA  . GLY B 1 214 ? 75.562 95.499  59.194  1.00 34.46 ? 214 GLY B CA  1 
ATOM   5354  C  C   . GLY B 1 214 ? 76.392 94.471  58.463  1.00 34.63 ? 214 GLY B C   1 
ATOM   5355  O  O   . GLY B 1 214 ? 77.592 94.336  58.700  1.00 34.50 ? 214 GLY B O   1 
ATOM   5356  N  N   . TYR B 1 215 ? 75.748 93.732  57.576  1.00 34.53 ? 215 TYR B N   1 
ATOM   5357  C  CA  . TYR B 1 215 ? 76.430 92.706  56.813  1.00 34.08 ? 215 TYR B CA  1 
ATOM   5358  C  C   . TYR B 1 215 ? 75.760 92.666  55.453  1.00 33.45 ? 215 TYR B C   1 
ATOM   5359  O  O   . TYR B 1 215 ? 74.562 92.881  55.364  1.00 33.36 ? 215 TYR B O   1 
ATOM   5360  C  CB  . TYR B 1 215 ? 76.246 91.336  57.477  1.00 34.18 ? 215 TYR B CB  1 
ATOM   5361  C  CG  . TYR B 1 215 ? 76.571 91.256  58.960  1.00 34.14 ? 215 TYR B CG  1 
ATOM   5362  C  CD1 . TYR B 1 215 ? 77.799 90.764  59.405  1.00 33.87 ? 215 TYR B CD1 1 
ATOM   5363  C  CD2 . TYR B 1 215 ? 75.633 91.637  59.918  1.00 34.21 ? 215 TYR B CD2 1 
ATOM   5364  C  CE1 . TYR B 1 215 ? 78.083 90.651  60.771  1.00 33.54 ? 215 TYR B CE1 1 
ATOM   5365  C  CE2 . TYR B 1 215 ? 75.904 91.530  61.281  1.00 33.74 ? 215 TYR B CE2 1 
ATOM   5366  C  CZ  . TYR B 1 215 ? 77.128 91.036  61.705  1.00 34.29 ? 215 TYR B CZ  1 
ATOM   5367  O  OH  . TYR B 1 215 ? 77.378 90.919  63.061  1.00 34.49 ? 215 TYR B OH  1 
ATOM   5368  N  N   . GLY B 1 216 ? 76.530 92.409  54.402  1.00 32.87 ? 216 GLY B N   1 
ATOM   5369  C  CA  . GLY B 1 216 ? 75.945 92.290  53.087  1.00 32.49 ? 216 GLY B CA  1 
ATOM   5370  C  C   . GLY B 1 216 ? 75.343 90.895  53.072  1.00 33.37 ? 216 GLY B C   1 
ATOM   5371  O  O   . GLY B 1 216 ? 74.475 90.567  52.253  1.00 33.83 ? 216 GLY B O   1 
ATOM   5372  N  N   . SER B 1 217 ? 75.808 90.075  54.016  1.00 33.50 ? 217 SER B N   1 
ATOM   5373  C  CA  . SER B 1 217 ? 75.369 88.687  54.173  1.00 32.18 ? 217 SER B CA  1 
ATOM   5374  C  C   . SER B 1 217 ? 75.866 87.783  53.037  1.00 32.02 ? 217 SER B C   1 
ATOM   5375  O  O   . SER B 1 217 ? 76.661 86.879  53.271  1.00 32.33 ? 217 SER B O   1 
ATOM   5376  C  CB  . SER B 1 217 ? 73.850 88.634  54.303  1.00 32.42 ? 217 SER B CB  1 
ATOM   5377  O  OG  . SER B 1 217 ? 73.427 89.325  55.472  1.00 31.36 ? 217 SER B OG  1 
ATOM   5378  N  N   . HIS B 1 218 ? 75.423 88.021  51.809  1.00 31.54 ? 218 HIS B N   1 
ATOM   5379  C  CA  . HIS B 1 218 ? 75.889 87.216  50.675  1.00 30.92 ? 218 HIS B CA  1 
ATOM   5380  C  C   . HIS B 1 218 ? 77.392 87.307  50.440  1.00 31.00 ? 218 HIS B C   1 
ATOM   5381  O  O   . HIS B 1 218 ? 78.080 88.194  50.943  1.00 31.77 ? 218 HIS B O   1 
ATOM   5382  C  CB  . HIS B 1 218 ? 75.269 87.701  49.377  1.00 30.82 ? 218 HIS B CB  1 
ATOM   5383  C  CG  . HIS B 1 218 ? 73.783 87.704  49.370  1.00 30.26 ? 218 HIS B CG  1 
ATOM   5384  N  ND1 . HIS B 1 218 ? 73.043 86.550  49.270  1.00 30.02 ? 218 HIS B ND1 1 
ATOM   5385  C  CD2 . HIS B 1 218 ? 72.899 88.724  49.399  1.00 30.80 ? 218 HIS B CD2 1 
ATOM   5386  C  CE1 . HIS B 1 218 ? 71.763 86.859  49.234  1.00 31.00 ? 218 HIS B CE1 1 
ATOM   5387  N  NE2 . HIS B 1 218 ? 71.648 88.172  49.309  1.00 31.63 ? 218 HIS B NE2 1 
ATOM   5388  N  N   . THR B 1 219 ? 77.893 86.387  49.637  1.00 30.47 ? 219 THR B N   1 
ATOM   5389  C  CA  . THR B 1 219 ? 79.283 86.427  49.247  1.00 30.46 ? 219 THR B CA  1 
ATOM   5390  C  C   . THR B 1 219 ? 79.200 87.211  47.942  1.00 30.76 ? 219 THR B C   1 
ATOM   5391  O  O   . THR B 1 219 ? 78.326 86.941  47.116  1.00 30.29 ? 219 THR B O   1 
ATOM   5392  C  CB  . THR B 1 219 ? 79.833 85.027  48.922  1.00 30.59 ? 219 THR B CB  1 
ATOM   5393  O  OG1 . THR B 1 219 ? 79.985 84.279  50.135  1.00 32.48 ? 219 THR B OG1 1 
ATOM   5394  C  CG2 . THR B 1 219 ? 81.167 85.126  48.195  1.00 28.38 ? 219 THR B CG2 1 
ATOM   5395  N  N   . PHE B 1 220 ? 80.072 88.200  47.764  1.00 30.94 ? 220 PHE B N   1 
ATOM   5396  C  CA  . PHE B 1 220 ? 80.086 88.968  46.522  1.00 29.69 ? 220 PHE B CA  1 
ATOM   5397  C  C   . PHE B 1 220 ? 81.422 88.737  45.862  1.00 29.14 ? 220 PHE B C   1 
ATOM   5398  O  O   . PHE B 1 220 ? 82.291 88.099  46.438  1.00 28.90 ? 220 PHE B O   1 
ATOM   5399  C  CB  . PHE B 1 220 ? 79.906 90.457  46.779  1.00 29.54 ? 220 PHE B CB  1 
ATOM   5400  C  CG  . PHE B 1 220 ? 78.562 90.817  47.321  1.00 29.74 ? 220 PHE B CG  1 
ATOM   5401  C  CD1 . PHE B 1 220 ? 78.292 90.696  48.678  1.00 29.16 ? 220 PHE B CD1 1 
ATOM   5402  C  CD2 . PHE B 1 220 ? 77.555 91.261  46.466  1.00 29.71 ? 220 PHE B CD2 1 
ATOM   5403  C  CE1 . PHE B 1 220 ? 77.041 91.007  49.184  1.00 28.65 ? 220 PHE B CE1 1 
ATOM   5404  C  CE2 . PHE B 1 220 ? 76.296 91.575  46.961  1.00 29.79 ? 220 PHE B CE2 1 
ATOM   5405  C  CZ  . PHE B 1 220 ? 76.040 91.447  48.331  1.00 29.36 ? 220 PHE B CZ  1 
ATOM   5406  N  N   . LYS B 1 221 ? 81.582 89.263  44.656  1.00 29.00 ? 221 LYS B N   1 
ATOM   5407  C  CA  . LYS B 1 221 ? 82.824 89.113  43.914  1.00 28.99 ? 221 LYS B CA  1 
ATOM   5408  C  C   . LYS B 1 221 ? 83.527 90.459  43.685  1.00 29.58 ? 221 LYS B C   1 
ATOM   5409  O  O   . LYS B 1 221 ? 82.926 91.410  43.183  1.00 29.64 ? 221 LYS B O   1 
ATOM   5410  C  CB  . LYS B 1 221 ? 82.539 88.433  42.565  1.00 28.26 ? 221 LYS B CB  1 
ATOM   5411  C  CG  . LYS B 1 221 ? 83.781 88.021  41.789  1.00 27.96 ? 221 LYS B CG  1 
ATOM   5412  C  CD  . LYS B 1 221 ? 83.469 86.951  40.740  1.00 28.48 ? 221 LYS B CD  1 
ATOM   5413  C  CE  . LYS B 1 221 ? 82.854 87.507  39.467  1.00 28.67 ? 221 LYS B CE  1 
ATOM   5414  N  NZ  . LYS B 1 221 ? 82.509 86.404  38.520  1.00 30.12 ? 221 LYS B NZ  1 
ATOM   5415  N  N   . LEU B 1 222 ? 84.793 90.550  44.077  1.00 30.04 ? 222 LEU B N   1 
ATOM   5416  C  CA  . LEU B 1 222 ? 85.554 91.772  43.858  1.00 30.11 ? 222 LEU B CA  1 
ATOM   5417  C  C   . LEU B 1 222 ? 86.487 91.543  42.681  1.00 30.95 ? 222 LEU B C   1 
ATOM   5418  O  O   . LEU B 1 222 ? 87.092 90.467  42.547  1.00 29.47 ? 222 LEU B O   1 
ATOM   5419  C  CB  . LEU B 1 222 ? 86.383 92.132  45.080  1.00 29.23 ? 222 LEU B CB  1 
ATOM   5420  C  CG  . LEU B 1 222 ? 85.558 92.410  46.319  1.00 30.60 ? 222 LEU B CG  1 
ATOM   5421  C  CD1 . LEU B 1 222 ? 86.471 92.854  47.438  1.00 31.39 ? 222 LEU B CD1 1 
ATOM   5422  C  CD2 . LEU B 1 222 ? 84.541 93.482  46.007  1.00 30.89 ? 222 LEU B CD2 1 
ATOM   5423  N  N   . VAL B 1 223 ? 86.596 92.557  41.831  1.00 32.05 ? 223 VAL B N   1 
ATOM   5424  C  CA  . VAL B 1 223 ? 87.463 92.487  40.665  1.00 33.81 ? 223 VAL B CA  1 
ATOM   5425  C  C   . VAL B 1 223 ? 88.407 93.696  40.599  1.00 34.48 ? 223 VAL B C   1 
ATOM   5426  O  O   . VAL B 1 223 ? 87.960 94.853  40.655  1.00 34.13 ? 223 VAL B O   1 
ATOM   5427  C  CB  . VAL B 1 223 ? 86.621 92.407  39.383  1.00 34.00 ? 223 VAL B CB  1 
ATOM   5428  C  CG1 . VAL B 1 223 ? 87.512 92.577  38.164  1.00 34.72 ? 223 VAL B CG1 1 
ATOM   5429  C  CG2 . VAL B 1 223 ? 85.898 91.073  39.333  1.00 32.57 ? 223 VAL B CG2 1 
ATOM   5430  N  N   . ASN B 1 224 ? 89.709 93.422  40.483  1.00 35.24 ? 224 ASN B N   1 
ATOM   5431  C  CA  . ASN B 1 224 ? 90.711 94.487  40.420  1.00 36.51 ? 224 ASN B CA  1 
ATOM   5432  C  C   . ASN B 1 224 ? 91.043 94.912  38.994  1.00 37.24 ? 224 ASN B C   1 
ATOM   5433  O  O   . ASN B 1 224 ? 90.656 94.260  38.023  1.00 36.76 ? 224 ASN B O   1 
ATOM   5434  C  CB  . ASN B 1 224 ? 92.000 94.069  41.125  1.00 36.09 ? 224 ASN B CB  1 
ATOM   5435  C  CG  . ASN B 1 224 ? 92.671 92.904  40.450  1.00 37.07 ? 224 ASN B CG  1 
ATOM   5436  O  OD1 . ASN B 1 224 ? 92.711 92.832  39.217  1.00 38.37 ? 224 ASN B OD1 1 
ATOM   5437  N  ND2 . ASN B 1 224 ? 93.214 91.983  41.244  1.00 35.64 ? 224 ASN B ND2 1 
ATOM   5438  N  N   . ALA B 1 225 ? 91.770 96.017  38.889  1.00 38.56 ? 225 ALA B N   1 
ATOM   5439  C  CA  . ALA B 1 225 ? 92.165 96.579  37.604  1.00 39.81 ? 225 ALA B CA  1 
ATOM   5440  C  C   . ALA B 1 225 ? 92.800 95.547  36.686  1.00 40.52 ? 225 ALA B C   1 
ATOM   5441  O  O   . ALA B 1 225 ? 92.759 95.680  35.465  1.00 40.79 ? 225 ALA B O   1 
ATOM   5442  C  CB  . ALA B 1 225 ? 93.134 97.736  37.826  1.00 39.27 ? 225 ALA B CB  1 
ATOM   5443  N  N   . ASN B 1 226 ? 93.383 94.513  37.275  1.00 41.75 ? 226 ASN B N   1 
ATOM   5444  C  CA  . ASN B 1 226 ? 94.043 93.492  36.482  1.00 43.22 ? 226 ASN B CA  1 
ATOM   5445  C  C   . ASN B 1 226 ? 93.120 92.423  35.956  1.00 43.22 ? 226 ASN B C   1 
ATOM   5446  O  O   . ASN B 1 226 ? 93.532 91.589  35.141  1.00 44.17 ? 226 ASN B O   1 
ATOM   5447  C  CB  . ASN B 1 226 ? 95.174 92.845  37.281  1.00 44.25 ? 226 ASN B CB  1 
ATOM   5448  C  CG  . ASN B 1 226 ? 96.513 93.525  37.049  1.00 45.34 ? 226 ASN B CG  1 
ATOM   5449  O  OD1 . ASN B 1 226 ? 97.512 93.166  37.671  1.00 47.55 ? 226 ASN B OD1 1 
ATOM   5450  N  ND2 . ASN B 1 226 ? 96.543 94.503  36.144  1.00 45.22 ? 226 ASN B ND2 1 
ATOM   5451  N  N   . GLY B 1 227 ? 91.875 92.447  36.417  1.00 42.69 ? 227 GLY B N   1 
ATOM   5452  C  CA  . GLY B 1 227 ? 90.912 91.457  35.969  1.00 42.23 ? 227 GLY B CA  1 
ATOM   5453  C  C   . GLY B 1 227 ? 90.955 90.176  36.780  1.00 41.77 ? 227 GLY B C   1 
ATOM   5454  O  O   . GLY B 1 227 ? 90.416 89.151  36.374  1.00 42.47 ? 227 GLY B O   1 
ATOM   5455  N  N   . GLU B 1 228 ? 91.609 90.222  37.929  1.00 41.04 ? 228 GLU B N   1 
ATOM   5456  C  CA  . GLU B 1 228 ? 91.691 89.048  38.776  1.00 40.39 ? 228 GLU B CA  1 
ATOM   5457  C  C   . GLU B 1 228 ? 90.540 89.219  39.754  1.00 39.22 ? 228 GLU B C   1 
ATOM   5458  O  O   . GLU B 1 228 ? 90.163 90.350  40.068  1.00 39.92 ? 228 GLU B O   1 
ATOM   5459  C  CB  . GLU B 1 228 ? 93.049 89.030  39.473  1.00 41.57 ? 228 GLU B CB  1 
ATOM   5460  C  CG  . GLU B 1 228 ? 94.182 89.371  38.498  1.00 43.92 ? 228 GLU B CG  1 
ATOM   5461  C  CD  . GLU B 1 228 ? 95.563 89.489  39.148  1.00 46.23 ? 228 GLU B CD  1 
ATOM   5462  O  OE1 . GLU B 1 228 ? 95.765 90.350  40.053  1.00 46.55 ? 228 GLU B OE1 1 
ATOM   5463  O  OE2 . GLU B 1 228 ? 96.457 88.712  38.734  1.00 46.45 ? 228 GLU B OE2 1 
ATOM   5464  N  N   . ALA B 1 229 ? 89.962 88.115  40.217  1.00 37.91 ? 229 ALA B N   1 
ATOM   5465  C  CA  . ALA B 1 229 ? 88.824 88.194  41.135  1.00 36.33 ? 229 ALA B CA  1 
ATOM   5466  C  C   . ALA B 1 229 ? 88.975 87.439  42.452  1.00 35.51 ? 229 ALA B C   1 
ATOM   5467  O  O   . ALA B 1 229 ? 89.790 86.532  42.586  1.00 35.19 ? 229 ALA B O   1 
ATOM   5468  C  CB  . ALA B 1 229 ? 87.570 87.713  40.427  1.00 35.94 ? 229 ALA B CB  1 
ATOM   5469  N  N   . VAL B 1 230 ? 88.169 87.828  43.429  1.00 34.57 ? 230 VAL B N   1 
ATOM   5470  C  CA  . VAL B 1 230 ? 88.172 87.176  44.729  1.00 33.41 ? 230 VAL B CA  1 
ATOM   5471  C  C   . VAL B 1 230 ? 86.767 87.308  45.257  1.00 33.51 ? 230 VAL B C   1 
ATOM   5472  O  O   . VAL B 1 230 ? 86.007 88.153  44.798  1.00 34.55 ? 230 VAL B O   1 
ATOM   5473  C  CB  . VAL B 1 230 ? 89.122 87.866  45.753  1.00 33.28 ? 230 VAL B CB  1 
ATOM   5474  C  CG1 . VAL B 1 230 ? 90.566 87.751  45.304  1.00 32.22 ? 230 VAL B CG1 1 
ATOM   5475  C  CG2 . VAL B 1 230 ? 88.731 89.314  45.936  1.00 31.16 ? 230 VAL B CG2 1 
ATOM   5476  N  N   . TYR B 1 231 ? 86.415 86.476  46.221  1.00 33.11 ? 231 TYR B N   1 
ATOM   5477  C  CA  . TYR B 1 231 ? 85.099 86.556  46.819  1.00 32.78 ? 231 TYR B CA  1 
ATOM   5478  C  C   . TYR B 1 231 ? 85.234 87.301  48.142  1.00 32.32 ? 231 TYR B C   1 
ATOM   5479  O  O   . TYR B 1 231 ? 86.279 87.244  48.793  1.00 31.80 ? 231 TYR B O   1 
ATOM   5480  C  CB  . TYR B 1 231 ? 84.543 85.152  47.041  1.00 33.83 ? 231 TYR B CB  1 
ATOM   5481  C  CG  . TYR B 1 231 ? 84.180 84.446  45.755  1.00 33.86 ? 231 TYR B CG  1 
ATOM   5482  C  CD1 . TYR B 1 231 ? 83.285 85.018  44.865  1.00 33.06 ? 231 TYR B CD1 1 
ATOM   5483  C  CD2 . TYR B 1 231 ? 84.714 83.198  45.441  1.00 34.25 ? 231 TYR B CD2 1 
ATOM   5484  C  CE1 . TYR B 1 231 ? 82.928 84.372  43.698  1.00 33.84 ? 231 TYR B CE1 1 
ATOM   5485  C  CE2 . TYR B 1 231 ? 84.357 82.538  44.268  1.00 34.70 ? 231 TYR B CE2 1 
ATOM   5486  C  CZ  . TYR B 1 231 ? 83.459 83.134  43.401  1.00 33.95 ? 231 TYR B CZ  1 
ATOM   5487  O  OH  . TYR B 1 231 ? 83.063 82.494  42.246  1.00 34.44 ? 231 TYR B OH  1 
ATOM   5488  N  N   . CYS B 1 232 ? 84.187 88.016  48.535  1.00 32.50 ? 232 CYS B N   1 
ATOM   5489  C  CA  . CYS B 1 232 ? 84.231 88.766  49.787  1.00 32.38 ? 232 CYS B CA  1 
ATOM   5490  C  C   . CYS B 1 232 ? 82.905 88.787  50.524  1.00 31.65 ? 232 CYS B C   1 
ATOM   5491  O  O   . CYS B 1 232 ? 81.879 88.316  50.023  1.00 31.22 ? 232 CYS B O   1 
ATOM   5492  C  CB  . CYS B 1 232 ? 84.658 90.213  49.536  1.00 32.33 ? 232 CYS B CB  1 
ATOM   5493  S  SG  . CYS B 1 232 ? 83.374 91.246  48.773  1.00 34.47 ? 232 CYS B SG  1 
ATOM   5494  N  N   . LYS B 1 233 ? 82.966 89.328  51.732  1.00 31.00 ? 233 LYS B N   1 
ATOM   5495  C  CA  . LYS B 1 233 ? 81.816 89.498  52.602  1.00 31.35 ? 233 LYS B CA  1 
ATOM   5496  C  C   . LYS B 1 233 ? 81.963 90.950  53.007  1.00 32.01 ? 233 LYS B C   1 
ATOM   5497  O  O   . LYS B 1 233 ? 83.087 91.405  53.217  1.00 32.93 ? 233 LYS B O   1 
ATOM   5498  C  CB  . LYS B 1 233 ? 81.932 88.633  53.863  1.00 30.76 ? 233 LYS B CB  1 
ATOM   5499  C  CG  . LYS B 1 233 ? 81.790 87.142  53.659  1.00 29.01 ? 233 LYS B CG  1 
ATOM   5500  C  CD  . LYS B 1 233 ? 80.384 86.787  53.240  1.00 29.06 ? 233 LYS B CD  1 
ATOM   5501  C  CE  . LYS B 1 233 ? 80.153 85.296  53.335  1.00 28.15 ? 233 LYS B CE  1 
ATOM   5502  N  NZ  . LYS B 1 233 ? 78.791 84.915  52.906  1.00 27.55 ? 233 LYS B NZ  1 
ATOM   5503  N  N   . PHE B 1 234 ? 80.854 91.682  53.105  1.00 31.87 ? 234 PHE B N   1 
ATOM   5504  C  CA  . PHE B 1 234 ? 80.912 93.078  53.523  1.00 30.99 ? 234 PHE B CA  1 
ATOM   5505  C  C   . PHE B 1 234 ? 80.475 93.157  54.981  1.00 31.40 ? 234 PHE B C   1 
ATOM   5506  O  O   . PHE B 1 234 ? 79.524 92.499  55.381  1.00 32.17 ? 234 PHE B O   1 
ATOM   5507  C  CB  . PHE B 1 234 ? 80.007 93.935  52.640  1.00 29.67 ? 234 PHE B CB  1 
ATOM   5508  C  CG  . PHE B 1 234 ? 80.521 94.112  51.240  1.00 28.80 ? 234 PHE B CG  1 
ATOM   5509  C  CD1 . PHE B 1 234 ? 81.680 94.839  50.998  1.00 28.57 ? 234 PHE B CD1 1 
ATOM   5510  C  CD2 . PHE B 1 234 ? 79.849 93.549  50.159  1.00 28.98 ? 234 PHE B CD2 1 
ATOM   5511  C  CE1 . PHE B 1 234 ? 82.163 95.004  49.697  1.00 28.46 ? 234 PHE B CE1 1 
ATOM   5512  C  CE2 . PHE B 1 234 ? 80.328 93.706  48.847  1.00 28.90 ? 234 PHE B CE2 1 
ATOM   5513  C  CZ  . PHE B 1 234 ? 81.484 94.435  48.618  1.00 28.32 ? 234 PHE B CZ  1 
ATOM   5514  N  N   . HIS B 1 235 ? 81.186 93.940  55.783  1.00 32.20 ? 235 HIS B N   1 
ATOM   5515  C  CA  . HIS B 1 235 ? 80.854 94.083  57.196  1.00 32.92 ? 235 HIS B CA  1 
ATOM   5516  C  C   . HIS B 1 235 ? 81.006 95.526  57.593  1.00 32.94 ? 235 HIS B C   1 
ATOM   5517  O  O   . HIS B 1 235 ? 81.927 96.196  57.139  1.00 33.26 ? 235 HIS B O   1 
ATOM   5518  C  CB  . HIS B 1 235 ? 81.813 93.281  58.085  1.00 34.14 ? 235 HIS B CB  1 
ATOM   5519  C  CG  . HIS B 1 235 ? 81.800 91.804  57.842  1.00 35.89 ? 235 HIS B CG  1 
ATOM   5520  N  ND1 . HIS B 1 235 ? 81.281 90.906  58.753  1.00 36.77 ? 235 HIS B ND1 1 
ATOM   5521  C  CD2 . HIS B 1 235 ? 82.273 91.063  56.811  1.00 36.42 ? 235 HIS B CD2 1 
ATOM   5522  C  CE1 . HIS B 1 235 ? 81.436 89.677  58.293  1.00 36.51 ? 235 HIS B CE1 1 
ATOM   5523  N  NE2 . HIS B 1 235 ? 82.035 89.744  57.117  1.00 37.30 ? 235 HIS B NE2 1 
ATOM   5524  N  N   . TYR B 1 236 ? 80.090 96.010  58.423  1.00 33.44 ? 236 TYR B N   1 
ATOM   5525  C  CA  . TYR B 1 236 ? 80.177 97.365  58.955  1.00 34.25 ? 236 TYR B CA  1 
ATOM   5526  C  C   . TYR B 1 236 ? 79.724 97.317  60.408  1.00 34.91 ? 236 TYR B C   1 
ATOM   5527  O  O   . TYR B 1 236 ? 78.547 97.154  60.708  1.00 34.57 ? 236 TYR B O   1 
ATOM   5528  C  CB  . TYR B 1 236 ? 79.369 98.402  58.142  1.00 34.19 ? 236 TYR B CB  1 
ATOM   5529  C  CG  . TYR B 1 236 ? 78.129 97.942  57.391  1.00 33.59 ? 236 TYR B CG  1 
ATOM   5530  C  CD1 . TYR B 1 236 ? 78.223 97.082  56.292  1.00 32.87 ? 236 TYR B CD1 1 
ATOM   5531  C  CD2 . TYR B 1 236 ? 76.874 98.446  57.724  1.00 32.98 ? 236 TYR B CD2 1 
ATOM   5532  C  CE1 . TYR B 1 236 ? 77.104 96.746  55.544  1.00 32.21 ? 236 TYR B CE1 1 
ATOM   5533  C  CE2 . TYR B 1 236 ? 75.748 98.117  56.985  1.00 33.12 ? 236 TYR B CE2 1 
ATOM   5534  C  CZ  . TYR B 1 236 ? 75.867 97.267  55.892  1.00 33.41 ? 236 TYR B CZ  1 
ATOM   5535  O  OH  . TYR B 1 236 ? 74.740 96.953  55.149  1.00 32.64 ? 236 TYR B OH  1 
ATOM   5536  N  N   . LYS B 1 237 ? 80.695 97.432  61.307  1.00 36.51 ? 237 LYS B N   1 
ATOM   5537  C  CA  . LYS B 1 237 ? 80.451 97.370  62.744  1.00 37.55 ? 237 LYS B CA  1 
ATOM   5538  C  C   . LYS B 1 237 ? 80.103 98.725  63.367  1.00 37.31 ? 237 LYS B C   1 
ATOM   5539  O  O   . LYS B 1 237 ? 80.727 99.752  63.068  1.00 37.54 ? 237 LYS B O   1 
ATOM   5540  C  CB  . LYS B 1 237 ? 81.683 96.787  63.439  1.00 39.08 ? 237 LYS B CB  1 
ATOM   5541  C  CG  . LYS B 1 237 ? 82.196 95.480  62.835  1.00 41.80 ? 237 LYS B CG  1 
ATOM   5542  C  CD  . LYS B 1 237 ? 81.252 94.297  63.097  1.00 44.36 ? 237 LYS B CD  1 
ATOM   5543  C  CE  . LYS B 1 237 ? 81.783 92.989  62.471  1.00 45.10 ? 237 LYS B CE  1 
ATOM   5544  N  NZ  . LYS B 1 237 ? 81.008 91.770  62.886  1.00 45.69 ? 237 LYS B NZ  1 
ATOM   5545  N  N   . THR B 1 238 ? 79.111 98.716  64.250  1.00 36.55 ? 238 THR B N   1 
ATOM   5546  C  CA  . THR B 1 238 ? 78.678 99.939  64.915  1.00 36.18 ? 238 THR B CA  1 
ATOM   5547  C  C   . THR B 1 238 ? 79.772 100.582 65.751  1.00 36.11 ? 238 THR B C   1 
ATOM   5548  O  O   . THR B 1 238 ? 80.334 99.958  66.663  1.00 36.09 ? 238 THR B O   1 
ATOM   5549  C  CB  . THR B 1 238 ? 77.455 99.685  65.822  1.00 35.84 ? 238 THR B CB  1 
ATOM   5550  O  OG1 . THR B 1 238 ? 77.185 100.865 66.589  1.00 34.81 ? 238 THR B OG1 1 
ATOM   5551  C  CG2 . THR B 1 238 ? 77.704 98.503  66.755  1.00 35.09 ? 238 THR B CG2 1 
ATOM   5552  N  N   . ASP B 1 239 ? 80.076 101.835 65.434  1.00 35.70 ? 239 ASP B N   1 
ATOM   5553  C  CA  . ASP B 1 239 ? 81.099 102.558 66.169  1.00 34.92 ? 239 ASP B CA  1 
ATOM   5554  C  C   . ASP B 1 239 ? 80.536 102.966 67.518  1.00 35.15 ? 239 ASP B C   1 
ATOM   5555  O  O   . ASP B 1 239 ? 81.271 103.424 68.388  1.00 35.98 ? 239 ASP B O   1 
ATOM   5556  C  CB  . ASP B 1 239 ? 81.554 103.809 65.402  1.00 34.47 ? 239 ASP B CB  1 
ATOM   5557  C  CG  . ASP B 1 239 ? 82.503 103.491 64.245  1.00 34.51 ? 239 ASP B CG  1 
ATOM   5558  O  OD1 . ASP B 1 239 ? 83.076 102.375 64.214  1.00 33.95 ? 239 ASP B OD1 1 
ATOM   5559  O  OD2 . ASP B 1 239 ? 82.689 104.371 63.373  1.00 33.79 ? 239 ASP B OD2 1 
ATOM   5560  N  N   . GLN B 1 240 ? 79.226 102.812 67.687  1.00 34.86 ? 240 GLN B N   1 
ATOM   5561  C  CA  . GLN B 1 240 ? 78.573 103.171 68.938  1.00 34.62 ? 240 GLN B CA  1 
ATOM   5562  C  C   . GLN B 1 240 ? 78.443 101.966 69.859  1.00 35.86 ? 240 GLN B C   1 
ATOM   5563  O  O   . GLN B 1 240 ? 77.978 102.094 70.990  1.00 36.53 ? 240 GLN B O   1 
ATOM   5564  C  CB  . GLN B 1 240 ? 77.187 103.761 68.676  1.00 33.27 ? 240 GLN B CB  1 
ATOM   5565  C  CG  . GLN B 1 240 ? 77.201 105.060 67.902  1.00 31.82 ? 240 GLN B CG  1 
ATOM   5566  C  CD  . GLN B 1 240 ? 77.521 104.861 66.437  1.00 30.90 ? 240 GLN B CD  1 
ATOM   5567  O  OE1 . GLN B 1 240 ? 78.272 105.629 65.837  1.00 29.95 ? 240 GLN B OE1 1 
ATOM   5568  N  NE2 . GLN B 1 240 ? 76.937 103.832 65.848  1.00 31.83 ? 240 GLN B NE2 1 
ATOM   5569  N  N   . GLY B 1 241 ? 78.853 100.799 69.363  1.00 36.72 ? 241 GLY B N   1 
ATOM   5570  C  CA  . GLY B 1 241 ? 78.796 99.573  70.146  1.00 37.28 ? 241 GLY B CA  1 
ATOM   5571  C  C   . GLY B 1 241 ? 77.500 98.777  70.081  1.00 37.91 ? 241 GLY B C   1 
ATOM   5572  O  O   . GLY B 1 241 ? 76.436 99.314  69.770  1.00 38.73 ? 241 GLY B O   1 
ATOM   5573  N  N   . ILE B 1 242 ? 77.578 97.484  70.368  1.00 37.62 ? 242 ILE B N   1 
ATOM   5574  C  CA  . ILE B 1 242 ? 76.380 96.658  70.364  1.00 38.24 ? 242 ILE B CA  1 
ATOM   5575  C  C   . ILE B 1 242 ? 75.581 96.875  71.659  1.00 39.06 ? 242 ILE B C   1 
ATOM   5576  O  O   . ILE B 1 242 ? 76.133 96.879  72.758  1.00 39.68 ? 242 ILE B O   1 
ATOM   5577  C  CB  . ILE B 1 242 ? 76.734 95.164  70.244  1.00 37.59 ? 242 ILE B CB  1 
ATOM   5578  C  CG1 . ILE B 1 242 ? 77.270 94.862  68.844  1.00 37.79 ? 242 ILE B CG1 1 
ATOM   5579  C  CG2 . ILE B 1 242 ? 75.503 94.310  70.538  1.00 37.17 ? 242 ILE B CG2 1 
ATOM   5580  C  CD1 . ILE B 1 242 ? 76.198 94.791  67.752  1.00 38.15 ? 242 ILE B CD1 1 
ATOM   5581  N  N   . LYS B 1 243 ? 74.278 97.066  71.527  1.00 39.59 ? 243 LYS B N   1 
ATOM   5582  C  CA  . LYS B 1 243 ? 73.429 97.249  72.689  1.00 39.96 ? 243 LYS B CA  1 
ATOM   5583  C  C   . LYS B 1 243 ? 72.064 96.685  72.292  1.00 39.92 ? 243 LYS B C   1 
ATOM   5584  O  O   . LYS B 1 243 ? 71.578 96.953  71.192  1.00 39.73 ? 243 LYS B O   1 
ATOM   5585  C  CB  . LYS B 1 243 ? 73.355 98.740  73.058  1.00 40.93 ? 243 LYS B CB  1 
ATOM   5586  C  CG  . LYS B 1 243 ? 72.789 99.002  74.461  1.00 43.36 ? 243 LYS B CG  1 
ATOM   5587  C  CD  . LYS B 1 243 ? 73.164 100.379 75.032  1.00 44.64 ? 243 LYS B CD  1 
ATOM   5588  C  CE  . LYS B 1 243 ? 72.386 101.530 74.399  1.00 45.79 ? 243 LYS B CE  1 
ATOM   5589  N  NZ  . LYS B 1 243 ? 72.796 102.865 74.948  1.00 46.99 ? 243 LYS B NZ  1 
ATOM   5590  N  N   . ASN B 1 244 ? 71.476 95.866  73.161  1.00 39.77 ? 244 ASN B N   1 
ATOM   5591  C  CA  . ASN B 1 244 ? 70.175 95.255  72.880  1.00 40.82 ? 244 ASN B CA  1 
ATOM   5592  C  C   . ASN B 1 244 ? 69.136 95.527  73.990  1.00 40.91 ? 244 ASN B C   1 
ATOM   5593  O  O   . ASN B 1 244 ? 69.486 95.865  75.120  1.00 41.24 ? 244 ASN B O   1 
ATOM   5594  C  CB  . ASN B 1 244 ? 70.324 93.732  72.700  1.00 41.03 ? 244 ASN B CB  1 
ATOM   5595  C  CG  . ASN B 1 244 ? 71.431 93.346  71.718  1.00 41.53 ? 244 ASN B CG  1 
ATOM   5596  O  OD1 . ASN B 1 244 ? 71.455 93.782  70.556  1.00 41.65 ? 244 ASN B OD1 1 
ATOM   5597  N  ND2 . ASN B 1 244 ? 72.353 92.510  72.186  1.00 41.38 ? 244 ASN B ND2 1 
ATOM   5598  N  N   . LEU B 1 245 ? 67.859 95.370  73.655  1.00 40.65 ? 245 LEU B N   1 
ATOM   5599  C  CA  . LEU B 1 245 ? 66.774 95.587  74.606  1.00 40.49 ? 245 LEU B CA  1 
ATOM   5600  C  C   . LEU B 1 245 ? 66.312 94.242  75.107  1.00 40.68 ? 245 LEU B C   1 
ATOM   5601  O  O   . LEU B 1 245 ? 66.187 93.306  74.320  1.00 40.47 ? 245 LEU B O   1 
ATOM   5602  C  CB  . LEU B 1 245 ? 65.586 96.288  73.932  1.00 40.29 ? 245 LEU B CB  1 
ATOM   5603  C  CG  . LEU B 1 245 ? 65.784 97.694  73.355  1.00 40.43 ? 245 LEU B CG  1 
ATOM   5604  C  CD1 . LEU B 1 245 ? 64.721 97.971  72.322  1.00 39.87 ? 245 LEU B CD1 1 
ATOM   5605  C  CD2 . LEU B 1 245 ? 65.752 98.733  74.474  1.00 40.01 ? 245 LEU B CD2 1 
ATOM   5606  N  N   . SER B 1 246 ? 66.066 94.142  76.411  1.00 41.16 ? 246 SER B N   1 
ATOM   5607  C  CA  . SER B 1 246 ? 65.591 92.893  77.002  1.00 40.93 ? 246 SER B CA  1 
ATOM   5608  C  C   . SER B 1 246 ? 64.162 92.756  76.494  1.00 42.08 ? 246 SER B C   1 
ATOM   5609  O  O   . SER B 1 246 ? 63.592 93.738  76.021  1.00 42.56 ? 246 SER B O   1 
ATOM   5610  C  CB  . SER B 1 246 ? 65.594 92.982  78.532  1.00 39.54 ? 246 SER B CB  1 
ATOM   5611  O  OG  . SER B 1 246 ? 64.673 93.961  78.982  1.00 38.24 ? 246 SER B OG  1 
ATOM   5612  N  N   . VAL B 1 247 ? 63.580 91.560  76.587  1.00 43.17 ? 247 VAL B N   1 
ATOM   5613  C  CA  . VAL B 1 247 ? 62.216 91.355  76.113  1.00 43.92 ? 247 VAL B CA  1 
ATOM   5614  C  C   . VAL B 1 247 ? 61.210 92.168  76.914  1.00 45.00 ? 247 VAL B C   1 
ATOM   5615  O  O   . VAL B 1 247 ? 60.208 92.632  76.359  1.00 45.02 ? 247 VAL B O   1 
ATOM   5616  C  CB  . VAL B 1 247 ? 61.810 89.876  76.161  1.00 44.00 ? 247 VAL B CB  1 
ATOM   5617  C  CG1 . VAL B 1 247 ? 62.801 89.048  75.368  1.00 43.58 ? 247 VAL B CG1 1 
ATOM   5618  C  CG2 . VAL B 1 247 ? 61.735 89.404  77.592  1.00 45.27 ? 247 VAL B CG2 1 
ATOM   5619  N  N   . GLU B 1 248 ? 61.470 92.346  78.210  1.00 46.25 ? 248 GLU B N   1 
ATOM   5620  C  CA  . GLU B 1 248 ? 60.571 93.134  79.054  1.00 47.57 ? 248 GLU B CA  1 
ATOM   5621  C  C   . GLU B 1 248 ? 60.497 94.544  78.466  1.00 47.12 ? 248 GLU B C   1 
ATOM   5622  O  O   . GLU B 1 248 ? 59.420 95.041  78.120  1.00 47.21 ? 248 GLU B O   1 
ATOM   5623  C  CB  . GLU B 1 248 ? 61.089 93.240  80.498  1.00 49.90 ? 248 GLU B CB  1 
ATOM   5624  C  CG  . GLU B 1 248 ? 61.435 91.923  81.202  1.00 53.98 ? 248 GLU B CG  1 
ATOM   5625  C  CD  . GLU B 1 248 ? 62.877 91.428  80.926  1.00 56.36 ? 248 GLU B CD  1 
ATOM   5626  O  OE1 . GLU B 1 248 ? 63.055 90.548  80.038  1.00 55.86 ? 248 GLU B OE1 1 
ATOM   5627  O  OE2 . GLU B 1 248 ? 63.827 91.925  81.602  1.00 57.34 ? 248 GLU B OE2 1 
ATOM   5628  N  N   . ASP B 1 249 ? 61.655 95.181  78.347  1.00 46.36 ? 249 ASP B N   1 
ATOM   5629  C  CA  . ASP B 1 249 ? 61.728 96.533  77.811  1.00 46.19 ? 249 ASP B CA  1 
ATOM   5630  C  C   . ASP B 1 249 ? 61.154 96.636  76.402  1.00 45.38 ? 249 ASP B C   1 
ATOM   5631  O  O   . ASP B 1 249 ? 60.292 97.471  76.145  1.00 45.28 ? 249 ASP B O   1 
ATOM   5632  C  CB  . ASP B 1 249 ? 63.180 97.019  77.844  1.00 46.99 ? 249 ASP B CB  1 
ATOM   5633  C  CG  . ASP B 1 249 ? 63.647 97.356  79.260  1.00 48.17 ? 249 ASP B CG  1 
ATOM   5634  O  OD1 . ASP B 1 249 ? 64.850 97.200  79.552  1.00 48.30 ? 249 ASP B OD1 1 
ATOM   5635  O  OD2 . ASP B 1 249 ? 62.806 97.789  80.081  1.00 48.87 ? 249 ASP B OD2 1 
ATOM   5636  N  N   . ALA B 1 250 ? 61.619 95.781  75.497  1.00 44.39 ? 250 ALA B N   1 
ATOM   5637  C  CA  . ALA B 1 250 ? 61.130 95.789  74.122  1.00 44.35 ? 250 ALA B CA  1 
ATOM   5638  C  C   . ALA B 1 250 ? 59.605 95.821  74.096  1.00 44.20 ? 250 ALA B C   1 
ATOM   5639  O  O   . ALA B 1 250 ? 59.005 96.598  73.350  1.00 44.59 ? 250 ALA B O   1 
ATOM   5640  C  CB  . ALA B 1 250 ? 61.642 94.555  73.369  1.00 44.19 ? 250 ALA B CB  1 
ATOM   5641  N  N   . ALA B 1 251 ? 58.986 94.974  74.916  1.00 43.85 ? 251 ALA B N   1 
ATOM   5642  C  CA  . ALA B 1 251 ? 57.532 94.899  75.000  1.00 43.43 ? 251 ALA B CA  1 
ATOM   5643  C  C   . ALA B 1 251 ? 56.958 96.224  75.493  1.00 43.30 ? 251 ALA B C   1 
ATOM   5644  O  O   . ALA B 1 251 ? 56.042 96.775  74.885  1.00 43.52 ? 251 ALA B O   1 
ATOM   5645  C  CB  . ALA B 1 251 ? 57.125 93.775  75.935  1.00 43.34 ? 251 ALA B CB  1 
ATOM   5646  N  N   . ARG B 1 252 ? 57.494 96.734  76.598  1.00 42.65 ? 252 ARG B N   1 
ATOM   5647  C  CA  . ARG B 1 252 ? 57.022 98.002  77.141  1.00 41.93 ? 252 ARG B CA  1 
ATOM   5648  C  C   . ARG B 1 252 ? 57.130 99.094  76.081  1.00 40.62 ? 252 ARG B C   1 
ATOM   5649  O  O   . ARG B 1 252 ? 56.211 99.892  75.890  1.00 40.46 ? 252 ARG B O   1 
ATOM   5650  C  CB  . ARG B 1 252 ? 57.844 98.394  78.377  1.00 42.28 ? 252 ARG B CB  1 
ATOM   5651  C  CG  . ARG B 1 252 ? 57.548 99.793  78.921  1.00 43.23 ? 252 ARG B CG  1 
ATOM   5652  C  CD  . ARG B 1 252 ? 58.244 100.047 80.262  1.00 45.26 ? 252 ARG B CD  1 
ATOM   5653  N  NE  . ARG B 1 252 ? 59.703 99.928  80.188  1.00 47.20 ? 252 ARG B NE  1 
ATOM   5654  C  CZ  . ARG B 1 252 ? 60.508 100.804 79.581  1.00 48.08 ? 252 ARG B CZ  1 
ATOM   5655  N  NH1 . ARG B 1 252 ? 60.002 101.883 78.980  1.00 47.71 ? 252 ARG B NH1 1 
ATOM   5656  N  NH2 . ARG B 1 252 ? 61.824 100.604 79.578  1.00 47.79 ? 252 ARG B NH2 1 
ATOM   5657  N  N   . LEU B 1 253 ? 58.260 99.120  75.392  1.00 39.78 ? 253 LEU B N   1 
ATOM   5658  C  CA  . LEU B 1 253 ? 58.492 100.118 74.355  1.00 39.94 ? 253 LEU B CA  1 
ATOM   5659  C  C   . LEU B 1 253 ? 57.586 99.933  73.131  1.00 39.68 ? 253 LEU B C   1 
ATOM   5660  O  O   . LEU B 1 253 ? 57.196 100.911 72.488  1.00 39.28 ? 253 LEU B O   1 
ATOM   5661  C  CB  . LEU B 1 253 ? 59.969 100.104 73.913  1.00 38.95 ? 253 LEU B CB  1 
ATOM   5662  C  CG  . LEU B 1 253 ? 61.027 100.616 74.895  1.00 37.97 ? 253 LEU B CG  1 
ATOM   5663  C  CD1 . LEU B 1 253 ? 62.359 100.725 74.186  1.00 36.05 ? 253 LEU B CD1 1 
ATOM   5664  C  CD2 . LEU B 1 253 ? 60.617 101.973 75.436  1.00 36.70 ? 253 LEU B CD2 1 
ATOM   5665  N  N   . SER B 1 254 ? 57.252 98.685  72.812  1.00 39.50 ? 254 SER B N   1 
ATOM   5666  C  CA  . SER B 1 254 ? 56.410 98.426  71.654  1.00 39.84 ? 254 SER B CA  1 
ATOM   5667  C  C   . SER B 1 254 ? 55.062 99.082  71.858  1.00 40.68 ? 254 SER B C   1 
ATOM   5668  O  O   . SER B 1 254 ? 54.289 99.242  70.917  1.00 40.94 ? 254 SER B O   1 
ATOM   5669  C  CB  . SER B 1 254 ? 56.230 96.921  71.431  1.00 38.77 ? 254 SER B CB  1 
ATOM   5670  O  OG  . SER B 1 254 ? 55.362 96.340  72.386  1.00 39.32 ? 254 SER B OG  1 
ATOM   5671  N  N   . GLN B 1 255 ? 54.791 99.484  73.094  1.00 41.30 ? 255 GLN B N   1 
ATOM   5672  C  CA  . GLN B 1 255 ? 53.521 100.102 73.411  1.00 42.31 ? 255 GLN B CA  1 
ATOM   5673  C  C   . GLN B 1 255 ? 53.625 101.572 73.774  1.00 42.01 ? 255 GLN B C   1 
ATOM   5674  O  O   . GLN B 1 255 ? 52.718 102.350 73.494  1.00 41.88 ? 255 GLN B O   1 
ATOM   5675  C  CB  . GLN B 1 255 ? 52.846 99.310  74.530  1.00 44.52 ? 255 GLN B CB  1 
ATOM   5676  C  CG  . GLN B 1 255 ? 51.671 100.000 75.191  1.00 47.18 ? 255 GLN B CG  1 
ATOM   5677  C  CD  . GLN B 1 255 ? 52.122 100.878 76.341  1.00 48.58 ? 255 GLN B CD  1 
ATOM   5678  O  OE1 . GLN B 1 255 ? 52.118 102.115 76.247  1.00 49.02 ? 255 GLN B OE1 1 
ATOM   5679  N  NE2 . GLN B 1 255 ? 52.534 100.239 77.435  1.00 48.09 ? 255 GLN B NE2 1 
ATOM   5680  N  N   . GLU B 1 256 ? 54.730 101.966 74.390  1.00 42.19 ? 256 GLU B N   1 
ATOM   5681  C  CA  . GLU B 1 256 ? 54.902 103.366 74.762  1.00 42.34 ? 256 GLU B CA  1 
ATOM   5682  C  C   . GLU B 1 256 ? 55.319 104.213 73.573  1.00 41.41 ? 256 GLU B C   1 
ATOM   5683  O  O   . GLU B 1 256 ? 54.863 105.344 73.403  1.00 40.81 ? 256 GLU B O   1 
ATOM   5684  C  CB  . GLU B 1 256 ? 55.940 103.483 75.864  1.00 43.39 ? 256 GLU B CB  1 
ATOM   5685  C  CG  . GLU B 1 256 ? 55.455 102.912 77.165  1.00 45.83 ? 256 GLU B CG  1 
ATOM   5686  C  CD  . GLU B 1 256 ? 56.476 103.045 78.262  1.00 47.69 ? 256 GLU B CD  1 
ATOM   5687  O  OE1 . GLU B 1 256 ? 56.108 102.784 79.433  1.00 48.33 ? 256 GLU B OE1 1 
ATOM   5688  O  OE2 . GLU B 1 256 ? 57.642 103.404 77.949  1.00 48.31 ? 256 GLU B OE2 1 
ATOM   5689  N  N   . ASP B 1 257 ? 56.187 103.646 72.748  1.00 40.73 ? 257 ASP B N   1 
ATOM   5690  C  CA  . ASP B 1 257 ? 56.681 104.333 71.574  1.00 40.28 ? 257 ASP B CA  1 
ATOM   5691  C  C   . ASP B 1 257 ? 56.944 103.313 70.482  1.00 39.19 ? 257 ASP B C   1 
ATOM   5692  O  O   . ASP B 1 257 ? 58.022 102.715 70.403  1.00 38.13 ? 257 ASP B O   1 
ATOM   5693  C  CB  . ASP B 1 257 ? 57.969 105.087 71.907  1.00 41.90 ? 257 ASP B CB  1 
ATOM   5694  C  CG  . ASP B 1 257 ? 58.492 105.893 70.730  1.00 43.72 ? 257 ASP B CG  1 
ATOM   5695  O  OD1 . ASP B 1 257 ? 59.556 106.551 70.872  1.00 43.83 ? 257 ASP B OD1 1 
ATOM   5696  O  OD2 . ASP B 1 257 ? 57.833 105.867 69.663  1.00 44.26 ? 257 ASP B OD2 1 
ATOM   5697  N  N   . PRO B 1 258 ? 55.945 103.082 69.627  1.00 38.32 ? 258 PRO B N   1 
ATOM   5698  C  CA  . PRO B 1 258 ? 56.143 102.112 68.552  1.00 37.81 ? 258 PRO B CA  1 
ATOM   5699  C  C   . PRO B 1 258 ? 57.204 102.568 67.549  1.00 37.00 ? 258 PRO B C   1 
ATOM   5700  O  O   . PRO B 1 258 ? 57.827 101.743 66.886  1.00 36.70 ? 258 PRO B O   1 
ATOM   5701  C  CB  . PRO B 1 258 ? 54.751 102.001 67.938  1.00 36.87 ? 258 PRO B CB  1 
ATOM   5702  C  CG  . PRO B 1 258 ? 53.867 102.248 69.089  1.00 36.82 ? 258 PRO B CG  1 
ATOM   5703  C  CD  . PRO B 1 258 ? 54.523 103.432 69.749  1.00 37.70 ? 258 PRO B CD  1 
ATOM   5704  N  N   . ASP B 1 259 ? 57.417 103.878 67.459  1.00 36.50 ? 259 ASP B N   1 
ATOM   5705  C  CA  . ASP B 1 259 ? 58.399 104.429 66.526  1.00 36.59 ? 259 ASP B CA  1 
ATOM   5706  C  C   . ASP B 1 259 ? 59.735 104.772 67.189  1.00 36.16 ? 259 ASP B C   1 
ATOM   5707  O  O   . ASP B 1 259 ? 60.481 105.640 66.725  1.00 35.75 ? 259 ASP B O   1 
ATOM   5708  C  CB  . ASP B 1 259 ? 57.811 105.659 65.828  1.00 36.86 ? 259 ASP B CB  1 
ATOM   5709  C  CG  . ASP B 1 259 ? 56.527 105.336 65.076  1.00 38.04 ? 259 ASP B CG  1 
ATOM   5710  O  OD1 . ASP B 1 259 ? 56.519 104.331 64.335  1.00 38.77 ? 259 ASP B OD1 1 
ATOM   5711  O  OD2 . ASP B 1 259 ? 55.526 106.077 65.215  1.00 38.29 ? 259 ASP B OD2 1 
ATOM   5712  N  N   . TYR B 1 260 ? 60.026 104.066 68.276  1.00 35.37 ? 260 TYR B N   1 
ATOM   5713  C  CA  . TYR B 1 260 ? 61.254 104.242 69.036  1.00 35.16 ? 260 TYR B CA  1 
ATOM   5714  C  C   . TYR B 1 260 ? 62.513 104.303 68.149  1.00 34.77 ? 260 TYR B C   1 
ATOM   5715  O  O   . TYR B 1 260 ? 63.367 105.178 68.319  1.00 34.15 ? 260 TYR B O   1 
ATOM   5716  C  CB  . TYR B 1 260 ? 61.353 103.102 70.053  1.00 35.70 ? 260 TYR B CB  1 
ATOM   5717  C  CG  . TYR B 1 260 ? 62.603 103.066 70.900  1.00 36.74 ? 260 TYR B CG  1 
ATOM   5718  C  CD1 . TYR B 1 260 ? 63.748 102.400 70.466  1.00 37.21 ? 260 TYR B CD1 1 
ATOM   5719  C  CD2 . TYR B 1 260 ? 62.621 103.646 72.162  1.00 37.74 ? 260 TYR B CD2 1 
ATOM   5720  C  CE1 . TYR B 1 260 ? 64.886 102.301 71.278  1.00 37.97 ? 260 TYR B CE1 1 
ATOM   5721  C  CE2 . TYR B 1 260 ? 63.749 103.558 72.982  1.00 38.59 ? 260 TYR B CE2 1 
ATOM   5722  C  CZ  . TYR B 1 260 ? 64.878 102.880 72.539  1.00 38.48 ? 260 TYR B CZ  1 
ATOM   5723  O  OH  . TYR B 1 260 ? 65.970 102.759 73.374  1.00 37.51 ? 260 TYR B OH  1 
ATOM   5724  N  N   . GLY B 1 261 ? 62.625 103.374 67.207  1.00 34.30 ? 261 GLY B N   1 
ATOM   5725  C  CA  . GLY B 1 261 ? 63.781 103.358 66.327  1.00 33.91 ? 261 GLY B CA  1 
ATOM   5726  C  C   . GLY B 1 261 ? 63.932 104.616 65.492  1.00 33.69 ? 261 GLY B C   1 
ATOM   5727  O  O   . GLY B 1 261 ? 65.037 105.127 65.284  1.00 33.52 ? 261 GLY B O   1 
ATOM   5728  N  N   . ILE B 1 262 ? 62.810 105.120 65.002  1.00 33.52 ? 262 ILE B N   1 
ATOM   5729  C  CA  . ILE B 1 262 ? 62.830 106.320 64.191  1.00 32.63 ? 262 ILE B CA  1 
ATOM   5730  C  C   . ILE B 1 262 ? 63.250 107.470 65.077  1.00 32.65 ? 262 ILE B C   1 
ATOM   5731  O  O   . ILE B 1 262 ? 64.185 108.190 64.759  1.00 33.00 ? 262 ILE B O   1 
ATOM   5732  C  CB  . ILE B 1 262 ? 61.435 106.608 63.602  1.00 31.94 ? 262 ILE B CB  1 
ATOM   5733  C  CG1 . ILE B 1 262 ? 61.024 105.454 62.690  1.00 31.93 ? 262 ILE B CG1 1 
ATOM   5734  C  CG2 . ILE B 1 262 ? 61.436 107.940 62.853  1.00 31.88 ? 262 ILE B CG2 1 
ATOM   5735  C  CD1 . ILE B 1 262 ? 59.578 105.477 62.270  1.00 32.15 ? 262 ILE B CD1 1 
ATOM   5736  N  N   . ARG B 1 263 ? 62.565 107.629 66.201  1.00 32.83 ? 263 ARG B N   1 
ATOM   5737  C  CA  . ARG B 1 263 ? 62.866 108.722 67.113  1.00 33.39 ? 263 ARG B CA  1 
ATOM   5738  C  C   . ARG B 1 263 ? 64.338 108.734 67.481  1.00 33.38 ? 263 ARG B C   1 
ATOM   5739  O  O   . ARG B 1 263 ? 65.023 109.741 67.294  1.00 34.23 ? 263 ARG B O   1 
ATOM   5740  C  CB  . ARG B 1 263 ? 62.011 108.615 68.382  1.00 33.69 ? 263 ARG B CB  1 
ATOM   5741  C  CG  . ARG B 1 263 ? 61.879 109.915 69.156  1.00 33.66 ? 263 ARG B CG  1 
ATOM   5742  C  CD  . ARG B 1 263 ? 61.012 109.730 70.394  1.00 33.53 ? 263 ARG B CD  1 
ATOM   5743  N  NE  . ARG B 1 263 ? 59.730 109.093 70.100  1.00 34.30 ? 263 ARG B NE  1 
ATOM   5744  C  CZ  . ARG B 1 263 ? 58.651 109.729 69.652  1.00 34.21 ? 263 ARG B CZ  1 
ATOM   5745  N  NH1 . ARG B 1 263 ? 58.679 111.036 69.442  1.00 35.03 ? 263 ARG B NH1 1 
ATOM   5746  N  NH2 . ARG B 1 263 ? 57.539 109.055 69.400  1.00 34.92 ? 263 ARG B NH2 1 
ATOM   5747  N  N   . ASP B 1 264 ? 64.827 107.606 67.978  1.00 32.94 ? 264 ASP B N   1 
ATOM   5748  C  CA  . ASP B 1 264 ? 66.218 107.497 68.391  1.00 33.16 ? 264 ASP B CA  1 
ATOM   5749  C  C   . ASP B 1 264 ? 67.201 107.930 67.315  1.00 32.71 ? 264 ASP B C   1 
ATOM   5750  O  O   . ASP B 1 264 ? 68.140 108.677 67.584  1.00 32.33 ? 264 ASP B O   1 
ATOM   5751  C  CB  . ASP B 1 264 ? 66.521 106.062 68.839  1.00 33.68 ? 264 ASP B CB  1 
ATOM   5752  C  CG  . ASP B 1 264 ? 68.009 105.807 69.029  1.00 36.07 ? 264 ASP B CG  1 
ATOM   5753  O  OD1 . ASP B 1 264 ? 68.672 105.333 68.077  1.00 36.11 ? 264 ASP B OD1 1 
ATOM   5754  O  OD2 . ASP B 1 264 ? 68.525 106.087 70.134  1.00 38.21 ? 264 ASP B OD2 1 
ATOM   5755  N  N   . LEU B 1 265 ? 66.980 107.474 66.091  1.00 33.00 ? 265 LEU B N   1 
ATOM   5756  C  CA  . LEU B 1 265 ? 67.881 107.822 65.013  1.00 33.46 ? 265 LEU B CA  1 
ATOM   5757  C  C   . LEU B 1 265 ? 67.828 109.301 64.697  1.00 33.88 ? 265 LEU B C   1 
ATOM   5758  O  O   . LEU B 1 265 ? 68.854 109.974 64.642  1.00 34.41 ? 265 LEU B O   1 
ATOM   5759  C  CB  . LEU B 1 265 ? 67.552 107.016 63.756  1.00 33.74 ? 265 LEU B CB  1 
ATOM   5760  C  CG  . LEU B 1 265 ? 68.407 107.391 62.540  1.00 34.75 ? 265 LEU B CG  1 
ATOM   5761  C  CD1 . LEU B 1 265 ? 69.859 107.135 62.852  1.00 35.83 ? 265 LEU B CD1 1 
ATOM   5762  C  CD2 . LEU B 1 265 ? 67.990 106.590 61.322  1.00 35.91 ? 265 LEU B CD2 1 
ATOM   5763  N  N   . PHE B 1 266 ? 66.622 109.812 64.495  1.00 34.58 ? 266 PHE B N   1 
ATOM   5764  C  CA  . PHE B 1 266 ? 66.447 111.209 64.155  1.00 33.98 ? 266 PHE B CA  1 
ATOM   5765  C  C   . PHE B 1 266 ? 66.952 112.132 65.251  1.00 34.83 ? 266 PHE B C   1 
ATOM   5766  O  O   . PHE B 1 266 ? 67.547 113.158 64.948  1.00 34.95 ? 266 PHE B O   1 
ATOM   5767  C  CB  . PHE B 1 266 ? 64.972 111.498 63.839  1.00 33.21 ? 266 PHE B CB  1 
ATOM   5768  C  CG  . PHE B 1 266 ? 64.725 112.874 63.249  1.00 32.77 ? 266 PHE B CG  1 
ATOM   5769  C  CD1 . PHE B 1 266 ? 64.765 114.019 64.056  1.00 31.95 ? 266 PHE B CD1 1 
ATOM   5770  C  CD2 . PHE B 1 266 ? 64.499 113.027 61.876  1.00 31.62 ? 266 PHE B CD2 1 
ATOM   5771  C  CE1 . PHE B 1 266 ? 64.593 115.284 63.505  1.00 31.32 ? 266 PHE B CE1 1 
ATOM   5772  C  CE2 . PHE B 1 266 ? 64.329 114.281 61.321  1.00 30.35 ? 266 PHE B CE2 1 
ATOM   5773  C  CZ  . PHE B 1 266 ? 64.376 115.416 62.135  1.00 30.95 ? 266 PHE B CZ  1 
ATOM   5774  N  N   . ASN B 1 267 ? 66.734 111.792 66.518  1.00 35.57 ? 267 ASN B N   1 
ATOM   5775  C  CA  . ASN B 1 267 ? 67.208 112.689 67.567  1.00 36.79 ? 267 ASN B CA  1 
ATOM   5776  C  C   . ASN B 1 267 ? 68.721 112.705 67.699  1.00 36.64 ? 267 ASN B C   1 
ATOM   5777  O  O   . ASN B 1 267 ? 69.306 113.737 68.036  1.00 37.29 ? 267 ASN B O   1 
ATOM   5778  C  CB  . ASN B 1 267 ? 66.581 112.360 68.921  1.00 38.49 ? 267 ASN B CB  1 
ATOM   5779  C  CG  . ASN B 1 267 ? 65.094 112.660 68.958  1.00 41.73 ? 267 ASN B CG  1 
ATOM   5780  O  OD1 . ASN B 1 267 ? 64.600 113.574 68.267  1.00 42.78 ? 267 ASN B OD1 1 
ATOM   5781  N  ND2 . ASN B 1 267 ? 64.362 111.898 69.777  1.00 42.80 ? 267 ASN B ND2 1 
ATOM   5782  N  N   . ALA B 1 268 ? 69.364 111.574 67.429  1.00 35.96 ? 268 ALA B N   1 
ATOM   5783  C  CA  . ALA B 1 268 ? 70.823 111.520 67.517  1.00 35.04 ? 268 ALA B CA  1 
ATOM   5784  C  C   . ALA B 1 268 ? 71.392 112.504 66.511  1.00 34.52 ? 268 ALA B C   1 
ATOM   5785  O  O   . ALA B 1 268 ? 72.060 113.472 66.877  1.00 34.56 ? 268 ALA B O   1 
ATOM   5786  C  CB  . ALA B 1 268 ? 71.330 110.115 67.218  1.00 34.31 ? 268 ALA B CB  1 
ATOM   5787  N  N   . ILE B 1 269 ? 71.109 112.262 65.239  1.00 33.45 ? 269 ILE B N   1 
ATOM   5788  C  CA  . ILE B 1 269 ? 71.600 113.134 64.197  1.00 33.09 ? 269 ILE B CA  1 
ATOM   5789  C  C   . ILE B 1 269 ? 71.208 114.587 64.470  1.00 33.20 ? 269 ILE B C   1 
ATOM   5790  O  O   . ILE B 1 269 ? 72.002 115.500 64.270  1.00 33.76 ? 269 ILE B O   1 
ATOM   5791  C  CB  . ILE B 1 269 ? 71.050 112.694 62.833  1.00 33.92 ? 269 ILE B CB  1 
ATOM   5792  C  CG1 . ILE B 1 269 ? 71.626 111.326 62.473  1.00 32.85 ? 269 ILE B CG1 1 
ATOM   5793  C  CG2 . ILE B 1 269 ? 71.372 113.737 61.761  1.00 33.76 ? 269 ILE B CG2 1 
ATOM   5794  C  CD1 . ILE B 1 269 ? 71.051 110.742 61.214  1.00 33.10 ? 269 ILE B CD1 1 
ATOM   5795  N  N   . ALA B 1 270 ? 69.992 114.801 64.947  1.00 32.79 ? 270 ALA B N   1 
ATOM   5796  C  CA  . ALA B 1 270 ? 69.525 116.149 65.213  1.00 32.88 ? 270 ALA B CA  1 
ATOM   5797  C  C   . ALA B 1 270 ? 70.356 116.855 66.260  1.00 33.44 ? 270 ALA B C   1 
ATOM   5798  O  O   . ALA B 1 270 ? 70.567 118.059 66.183  1.00 33.42 ? 270 ALA B O   1 
ATOM   5799  C  CB  . ALA B 1 270 ? 68.072 116.119 65.643  1.00 33.14 ? 270 ALA B CB  1 
ATOM   5800  N  N   . THR B 1 271 ? 70.832 116.106 67.243  1.00 34.68 ? 271 THR B N   1 
ATOM   5801  C  CA  . THR B 1 271 ? 71.635 116.694 68.312  1.00 35.60 ? 271 THR B CA  1 
ATOM   5802  C  C   . THR B 1 271 ? 73.145 116.614 68.062  1.00 36.34 ? 271 THR B C   1 
ATOM   5803  O  O   . THR B 1 271 ? 73.952 116.872 68.956  1.00 36.88 ? 271 THR B O   1 
ATOM   5804  C  CB  . THR B 1 271 ? 71.303 116.038 69.666  1.00 35.18 ? 271 THR B CB  1 
ATOM   5805  O  OG1 . THR B 1 271 ? 71.642 114.648 69.634  1.00 34.48 ? 271 THR B OG1 1 
ATOM   5806  C  CG2 . THR B 1 271 ? 69.826 116.167 69.947  1.00 35.66 ? 271 THR B CG2 1 
ATOM   5807  N  N   . GLY B 1 272 ? 73.524 116.251 66.840  1.00 37.17 ? 272 GLY B N   1 
ATOM   5808  C  CA  . GLY B 1 272 ? 74.936 116.180 66.501  1.00 37.31 ? 272 GLY B CA  1 
ATOM   5809  C  C   . GLY B 1 272 ? 75.668 114.906 66.854  1.00 37.56 ? 272 GLY B C   1 
ATOM   5810  O  O   . GLY B 1 272 ? 76.864 114.803 66.602  1.00 37.59 ? 272 GLY B O   1 
ATOM   5811  N  N   . LYS B 1 273 ? 74.969 113.944 67.447  1.00 38.03 ? 273 LYS B N   1 
ATOM   5812  C  CA  . LYS B 1 273 ? 75.582 112.674 67.800  1.00 37.96 ? 273 LYS B CA  1 
ATOM   5813  C  C   . LYS B 1 273 ? 75.536 111.768 66.573  1.00 38.07 ? 273 LYS B C   1 
ATOM   5814  O  O   . LYS B 1 273 ? 74.916 110.704 66.614  1.00 39.00 ? 273 LYS B O   1 
ATOM   5815  C  CB  . LYS B 1 273 ? 74.804 112.005 68.923  1.00 38.79 ? 273 LYS B CB  1 
ATOM   5816  C  CG  . LYS B 1 273 ? 74.454 112.898 70.074  1.00 40.03 ? 273 LYS B CG  1 
ATOM   5817  C  CD  . LYS B 1 273 ? 73.736 112.084 71.152  1.00 42.52 ? 273 LYS B CD  1 
ATOM   5818  C  CE  . LYS B 1 273 ? 73.144 112.997 72.231  1.00 44.33 ? 273 LYS B CE  1 
ATOM   5819  N  NZ  . LYS B 1 273 ? 74.166 113.943 72.810  1.00 45.42 ? 273 LYS B NZ  1 
ATOM   5820  N  N   . TYR B 1 274 ? 76.180 112.183 65.485  1.00 37.02 ? 274 TYR B N   1 
ATOM   5821  C  CA  . TYR B 1 274 ? 76.179 111.397 64.250  1.00 36.46 ? 274 TYR B CA  1 
ATOM   5822  C  C   . TYR B 1 274 ? 76.746 109.990 64.421  1.00 36.29 ? 274 TYR B C   1 
ATOM   5823  O  O   . TYR B 1 274 ? 77.926 109.828 64.729  1.00 36.57 ? 274 TYR B O   1 
ATOM   5824  C  CB  . TYR B 1 274 ? 76.982 112.113 63.162  1.00 36.48 ? 274 TYR B CB  1 
ATOM   5825  C  CG  . TYR B 1 274 ? 76.649 113.581 62.992  1.00 36.50 ? 274 TYR B CG  1 
ATOM   5826  C  CD1 . TYR B 1 274 ? 75.366 114.062 63.231  1.00 36.30 ? 274 TYR B CD1 1 
ATOM   5827  C  CD2 . TYR B 1 274 ? 77.610 114.481 62.547  1.00 36.42 ? 274 TYR B CD2 1 
ATOM   5828  C  CE1 . TYR B 1 274 ? 75.052 115.399 63.028  1.00 36.45 ? 274 TYR B CE1 1 
ATOM   5829  C  CE2 . TYR B 1 274 ? 77.306 115.821 62.341  1.00 35.83 ? 274 TYR B CE2 1 
ATOM   5830  C  CZ  . TYR B 1 274 ? 76.028 116.273 62.584  1.00 36.18 ? 274 TYR B CZ  1 
ATOM   5831  O  OH  . TYR B 1 274 ? 75.728 117.605 62.401  1.00 35.54 ? 274 TYR B OH  1 
ATOM   5832  N  N   . PRO B 1 275 ? 75.913 108.950 64.214  1.00 36.03 ? 275 PRO B N   1 
ATOM   5833  C  CA  . PRO B 1 275 ? 76.377 107.564 64.352  1.00 34.81 ? 275 PRO B CA  1 
ATOM   5834  C  C   . PRO B 1 275 ? 77.215 107.141 63.145  1.00 34.57 ? 275 PRO B C   1 
ATOM   5835  O  O   . PRO B 1 275 ? 77.017 107.650 62.033  1.00 33.72 ? 275 PRO B O   1 
ATOM   5836  C  CB  . PRO B 1 275 ? 75.074 106.777 64.452  1.00 34.27 ? 275 PRO B CB  1 
ATOM   5837  C  CG  . PRO B 1 275 ? 74.171 107.551 63.540  1.00 34.90 ? 275 PRO B CG  1 
ATOM   5838  C  CD  . PRO B 1 275 ? 74.464 108.987 63.927  1.00 35.34 ? 275 PRO B CD  1 
ATOM   5839  N  N   . SER B 1 276 ? 78.155 106.223 63.377  1.00 34.19 ? 276 SER B N   1 
ATOM   5840  C  CA  . SER B 1 276 ? 79.021 105.716 62.316  1.00 33.65 ? 276 SER B CA  1 
ATOM   5841  C  C   . SER B 1 276 ? 79.309 104.234 62.493  1.00 33.11 ? 276 SER B C   1 
ATOM   5842  O  O   . SER B 1 276 ? 79.093 103.664 63.564  1.00 32.64 ? 276 SER B O   1 
ATOM   5843  C  CB  . SER B 1 276 ? 80.348 106.489 62.269  1.00 34.23 ? 276 SER B CB  1 
ATOM   5844  O  OG  . SER B 1 276 ? 81.116 106.268 63.437  1.00 33.21 ? 276 SER B OG  1 
ATOM   5845  N  N   . TRP B 1 277 ? 79.789 103.613 61.420  1.00 32.42 ? 277 TRP B N   1 
ATOM   5846  C  CA  . TRP B 1 277 ? 80.119 102.195 61.428  1.00 31.68 ? 277 TRP B CA  1 
ATOM   5847  C  C   . TRP B 1 277 ? 81.471 102.071 60.764  1.00 31.83 ? 277 TRP B C   1 
ATOM   5848  O  O   . TRP B 1 277 ? 81.789 102.858 59.869  1.00 31.80 ? 277 TRP B O   1 
ATOM   5849  C  CB  . TRP B 1 277 ? 79.087 101.389 60.618  1.00 31.12 ? 277 TRP B CB  1 
ATOM   5850  C  CG  . TRP B 1 277 ? 77.774 101.238 61.304  1.00 30.35 ? 277 TRP B CG  1 
ATOM   5851  C  CD1 . TRP B 1 277 ? 77.339 100.158 62.010  1.00 30.00 ? 277 TRP B CD1 1 
ATOM   5852  C  CD2 . TRP B 1 277 ? 76.767 102.244 61.447  1.00 30.83 ? 277 TRP B CD2 1 
ATOM   5853  N  NE1 . TRP B 1 277 ? 76.124 100.427 62.597  1.00 29.98 ? 277 TRP B NE1 1 
ATOM   5854  C  CE2 . TRP B 1 277 ? 75.752 101.704 62.268  1.00 31.18 ? 277 TRP B CE2 1 
ATOM   5855  C  CE3 . TRP B 1 277 ? 76.627 103.559 60.968  1.00 30.86 ? 277 TRP B CE3 1 
ATOM   5856  C  CZ2 . TRP B 1 277 ? 74.616 102.430 62.621  1.00 31.15 ? 277 TRP B CZ2 1 
ATOM   5857  C  CZ3 . TRP B 1 277 ? 75.503 104.280 61.318  1.00 30.29 ? 277 TRP B CZ3 1 
ATOM   5858  C  CH2 . TRP B 1 277 ? 74.510 103.714 62.138  1.00 32.13 ? 277 TRP B CH2 1 
ATOM   5859  N  N   . THR B 1 278 ? 82.272 101.103 61.207  1.00 31.90 ? 278 THR B N   1 
ATOM   5860  C  CA  . THR B 1 278 ? 83.570 100.878 60.588  1.00 32.00 ? 278 THR B CA  1 
ATOM   5861  C  C   . THR B 1 278 ? 83.323 99.767  59.563  1.00 31.74 ? 278 THR B C   1 
ATOM   5862  O  O   . THR B 1 278 ? 82.780 98.707  59.886  1.00 30.98 ? 278 THR B O   1 
ATOM   5863  C  CB  . THR B 1 278 ? 84.646 100.446 61.614  1.00 32.64 ? 278 THR B CB  1 
ATOM   5864  O  OG1 . THR B 1 278 ? 84.733 101.418 62.663  1.00 33.26 ? 278 THR B OG1 1 
ATOM   5865  C  CG2 . THR B 1 278 ? 86.007 100.352 60.931  1.00 32.02 ? 278 THR B CG2 1 
ATOM   5866  N  N   . PHE B 1 279 ? 83.723 100.034 58.327  1.00 31.49 ? 279 PHE B N   1 
ATOM   5867  C  CA  . PHE B 1 279 ? 83.512 99.131  57.202  1.00 31.47 ? 279 PHE B CA  1 
ATOM   5868  C  C   . PHE B 1 279 ? 84.717 98.240  56.856  1.00 31.14 ? 279 PHE B C   1 
ATOM   5869  O  O   . PHE B 1 279 ? 85.793 98.740  56.523  1.00 30.14 ? 279 PHE B O   1 
ATOM   5870  C  CB  . PHE B 1 279 ? 83.110 100.013 56.008  1.00 31.80 ? 279 PHE B CB  1 
ATOM   5871  C  CG  . PHE B 1 279 ? 82.474 99.282  54.855  1.00 32.92 ? 279 PHE B CG  1 
ATOM   5872  C  CD1 . PHE B 1 279 ? 83.248 98.635  53.904  1.00 33.11 ? 279 PHE B CD1 1 
ATOM   5873  C  CD2 . PHE B 1 279 ? 81.095 99.337  54.663  1.00 33.67 ? 279 PHE B CD2 1 
ATOM   5874  C  CE1 . PHE B 1 279 ? 82.654 98.062  52.769  1.00 34.11 ? 279 PHE B CE1 1 
ATOM   5875  C  CE2 . PHE B 1 279 ? 80.497 98.771  53.536  1.00 33.55 ? 279 PHE B CE2 1 
ATOM   5876  C  CZ  . PHE B 1 279 ? 81.277 98.135  52.585  1.00 33.27 ? 279 PHE B CZ  1 
ATOM   5877  N  N   . TYR B 1 280 ? 84.523 96.921  56.940  1.00 31.52 ? 280 TYR B N   1 
ATOM   5878  C  CA  . TYR B 1 280 ? 85.569 95.939  56.599  1.00 32.61 ? 280 TYR B CA  1 
ATOM   5879  C  C   . TYR B 1 280 ? 85.073 94.954  55.542  1.00 33.24 ? 280 TYR B C   1 
ATOM   5880  O  O   . TYR B 1 280 ? 83.930 95.008  55.090  1.00 34.30 ? 280 TYR B O   1 
ATOM   5881  C  CB  . TYR B 1 280 ? 85.979 95.061  57.788  1.00 31.91 ? 280 TYR B CB  1 
ATOM   5882  C  CG  . TYR B 1 280 ? 86.168 95.742  59.110  1.00 33.63 ? 280 TYR B CG  1 
ATOM   5883  C  CD1 . TYR B 1 280 ? 85.068 96.174  59.853  1.00 34.16 ? 280 TYR B CD1 1 
ATOM   5884  C  CD2 . TYR B 1 280 ? 87.444 95.906  59.656  1.00 33.43 ? 280 TYR B CD2 1 
ATOM   5885  C  CE1 . TYR B 1 280 ? 85.231 96.743  61.106  1.00 34.93 ? 280 TYR B CE1 1 
ATOM   5886  C  CE2 . TYR B 1 280 ? 87.616 96.479  60.913  1.00 34.58 ? 280 TYR B CE2 1 
ATOM   5887  C  CZ  . TYR B 1 280 ? 86.503 96.894  61.630  1.00 35.04 ? 280 TYR B CZ  1 
ATOM   5888  O  OH  . TYR B 1 280 ? 86.648 97.471  62.866  1.00 37.02 ? 280 TYR B OH  1 
ATOM   5889  N  N   . ILE B 1 281 ? 85.953 94.036  55.162  1.00 33.58 ? 281 ILE B N   1 
ATOM   5890  C  CA  . ILE B 1 281 ? 85.595 92.975  54.230  1.00 32.47 ? 281 ILE B CA  1 
ATOM   5891  C  C   . ILE B 1 281 ? 86.400 91.757  54.622  1.00 32.22 ? 281 ILE B C   1 
ATOM   5892  O  O   . ILE B 1 281 ? 87.362 91.853  55.383  1.00 31.13 ? 281 ILE B O   1 
ATOM   5893  C  CB  . ILE B 1 281 ? 85.937 93.277  52.753  1.00 31.80 ? 281 ILE B CB  1 
ATOM   5894  C  CG1 . ILE B 1 281 ? 87.441 93.518  52.602  1.00 30.82 ? 281 ILE B CG1 1 
ATOM   5895  C  CG2 . ILE B 1 281 ? 85.071 94.396  52.250  1.00 31.52 ? 281 ILE B CG2 1 
ATOM   5896  C  CD1 . ILE B 1 281 ? 87.908 93.575  51.157  1.00 30.18 ? 281 ILE B CD1 1 
ATOM   5897  N  N   . GLN B 1 282 ? 85.961 90.615  54.106  1.00 32.52 ? 282 GLN B N   1 
ATOM   5898  C  CA  . GLN B 1 282 ? 86.605 89.332  54.305  1.00 31.94 ? 282 GLN B CA  1 
ATOM   5899  C  C   . GLN B 1 282 ? 86.911 88.927  52.882  1.00 32.56 ? 282 GLN B C   1 
ATOM   5900  O  O   . GLN B 1 282 ? 86.081 89.131  51.989  1.00 32.07 ? 282 GLN B O   1 
ATOM   5901  C  CB  . GLN B 1 282 ? 85.648 88.322  54.940  1.00 30.69 ? 282 GLN B CB  1 
ATOM   5902  C  CG  . GLN B 1 282 ? 85.500 88.475  56.432  1.00 30.50 ? 282 GLN B CG  1 
ATOM   5903  C  CD  . GLN B 1 282 ? 84.573 87.440  57.026  1.00 32.02 ? 282 GLN B CD  1 
ATOM   5904  O  OE1 . GLN B 1 282 ? 83.384 87.396  56.701  1.00 31.98 ? 282 GLN B OE1 1 
ATOM   5905  N  NE2 . GLN B 1 282 ? 85.113 86.591  57.902  1.00 30.81 ? 282 GLN B NE2 1 
ATOM   5906  N  N   . VAL B 1 283 ? 88.105 88.391  52.662  1.00 33.22 ? 283 VAL B N   1 
ATOM   5907  C  CA  . VAL B 1 283 ? 88.497 87.964  51.330  1.00 34.26 ? 283 VAL B CA  1 
ATOM   5908  C  C   . VAL B 1 283 ? 88.740 86.476  51.290  1.00 34.74 ? 283 VAL B C   1 
ATOM   5909  O  O   . VAL B 1 283 ? 89.390 85.918  52.175  1.00 36.87 ? 283 VAL B O   1 
ATOM   5910  C  CB  . VAL B 1 283 ? 89.777 88.680  50.849  1.00 33.93 ? 283 VAL B CB  1 
ATOM   5911  C  CG1 . VAL B 1 283 ? 90.265 88.055  49.551  1.00 34.16 ? 283 VAL B CG1 1 
ATOM   5912  C  CG2 . VAL B 1 283 ? 89.494 90.161  50.628  1.00 33.84 ? 283 VAL B CG2 1 
ATOM   5913  N  N   . MET B 1 284 ? 88.210 85.838  50.257  1.00 34.39 ? 284 MET B N   1 
ATOM   5914  C  CA  . MET B 1 284 ? 88.377 84.410  50.074  1.00 34.13 ? 284 MET B CA  1 
ATOM   5915  C  C   . MET B 1 284 ? 88.790 84.229  48.617  1.00 34.50 ? 284 MET B C   1 
ATOM   5916  O  O   . MET B 1 284 ? 88.074 84.651  47.719  1.00 35.38 ? 284 MET B O   1 
ATOM   5917  C  CB  . MET B 1 284 ? 87.052 83.695  50.353  1.00 33.21 ? 284 MET B CB  1 
ATOM   5918  C  CG  . MET B 1 284 ? 87.156 82.192  50.438  1.00 32.46 ? 284 MET B CG  1 
ATOM   5919  S  SD  . MET B 1 284 ? 85.575 81.347  50.637  1.00 35.16 ? 284 MET B SD  1 
ATOM   5920  C  CE  . MET B 1 284 ? 85.381 81.276  52.470  1.00 31.79 ? 284 MET B CE  1 
ATOM   5921  N  N   . THR B 1 285 ? 89.954 83.644  48.373  1.00 34.94 ? 285 THR B N   1 
ATOM   5922  C  CA  . THR B 1 285 ? 90.392 83.431  46.998  1.00 35.58 ? 285 THR B CA  1 
ATOM   5923  C  C   . THR B 1 285 ? 89.556 82.291  46.457  1.00 36.35 ? 285 THR B C   1 
ATOM   5924  O  O   . THR B 1 285 ? 88.973 81.517  47.230  1.00 35.62 ? 285 THR B O   1 
ATOM   5925  C  CB  . THR B 1 285 ? 91.858 82.987  46.907  1.00 35.72 ? 285 THR B CB  1 
ATOM   5926  O  OG1 . THR B 1 285 ? 91.981 81.660  47.440  1.00 36.53 ? 285 THR B OG1 1 
ATOM   5927  C  CG2 . THR B 1 285 ? 92.754 83.924  47.678  1.00 35.17 ? 285 THR B CG2 1 
ATOM   5928  N  N   . PHE B 1 286 ? 89.505 82.163  45.138  1.00 37.19 ? 286 PHE B N   1 
ATOM   5929  C  CA  . PHE B 1 286 ? 88.725 81.083  44.553  1.00 38.50 ? 286 PHE B CA  1 
ATOM   5930  C  C   . PHE B 1 286 ? 89.152 79.734  45.096  1.00 39.08 ? 286 PHE B C   1 
ATOM   5931  O  O   . PHE B 1 286 ? 88.307 78.885  45.360  1.00 39.30 ? 286 PHE B O   1 
ATOM   5932  C  CB  . PHE B 1 286 ? 88.805 81.138  43.034  1.00 38.52 ? 286 PHE B CB  1 
ATOM   5933  C  CG  . PHE B 1 286 ? 87.888 82.164  42.436  1.00 39.55 ? 286 PHE B CG  1 
ATOM   5934  C  CD1 . PHE B 1 286 ? 87.690 83.390  43.071  1.00 40.57 ? 286 PHE B CD1 1 
ATOM   5935  C  CD2 . PHE B 1 286 ? 87.219 81.917  41.246  1.00 40.21 ? 286 PHE B CD2 1 
ATOM   5936  C  CE1 . PHE B 1 286 ? 86.832 84.365  42.525  1.00 40.77 ? 286 PHE B CE1 1 
ATOM   5937  C  CE2 . PHE B 1 286 ? 86.358 82.884  40.690  1.00 40.86 ? 286 PHE B CE2 1 
ATOM   5938  C  CZ  . PHE B 1 286 ? 86.167 84.109  41.333  1.00 40.55 ? 286 PHE B CZ  1 
ATOM   5939  N  N   . ASN B 1 287 ? 90.454 79.539  45.294  1.00 40.66 ? 287 ASN B N   1 
ATOM   5940  C  CA  . ASN B 1 287 ? 90.940 78.280  45.865  1.00 40.73 ? 287 ASN B CA  1 
ATOM   5941  C  C   . ASN B 1 287 ? 90.339 78.073  47.239  1.00 39.98 ? 287 ASN B C   1 
ATOM   5942  O  O   . ASN B 1 287 ? 89.809 77.009  47.529  1.00 39.89 ? 287 ASN B O   1 
ATOM   5943  C  CB  . ASN B 1 287 ? 92.462 78.271  45.999  1.00 42.58 ? 287 ASN B CB  1 
ATOM   5944  C  CG  . ASN B 1 287 ? 93.152 77.978  44.685  1.00 45.51 ? 287 ASN B CG  1 
ATOM   5945  O  OD1 . ASN B 1 287 ? 92.602 77.270  43.835  1.00 47.05 ? 287 ASN B OD1 1 
ATOM   5946  N  ND2 . ASN B 1 287 ? 94.368 78.507  44.509  1.00 47.23 ? 287 ASN B ND2 1 
ATOM   5947  N  N   . GLN B 1 288 ? 90.424 79.093  48.085  1.00 39.69 ? 288 GLN B N   1 
ATOM   5948  C  CA  . GLN B 1 288 ? 89.883 79.000  49.436  1.00 39.84 ? 288 GLN B CA  1 
ATOM   5949  C  C   . GLN B 1 288 ? 88.393 78.676  49.429  1.00 40.15 ? 288 GLN B C   1 
ATOM   5950  O  O   . GLN B 1 288 ? 87.889 77.975  50.323  1.00 39.89 ? 288 GLN B O   1 
ATOM   5951  C  CB  . GLN B 1 288 ? 90.117 80.305  50.195  1.00 39.80 ? 288 GLN B CB  1 
ATOM   5952  C  CG  . GLN B 1 288 ? 91.578 80.627  50.433  1.00 38.69 ? 288 GLN B CG  1 
ATOM   5953  C  CD  . GLN B 1 288 ? 91.766 81.961  51.113  1.00 39.18 ? 288 GLN B CD  1 
ATOM   5954  O  OE1 . GLN B 1 288 ? 91.495 83.018  50.541  1.00 39.04 ? 288 GLN B OE1 1 
ATOM   5955  N  NE2 . GLN B 1 288 ? 92.223 81.920  52.352  1.00 40.05 ? 288 GLN B NE2 1 
ATOM   5956  N  N   . ALA B 1 289 ? 87.689 79.195  48.426  1.00 39.94 ? 289 ALA B N   1 
ATOM   5957  C  CA  . ALA B 1 289 ? 86.259 78.944  48.306  1.00 40.08 ? 289 ALA B CA  1 
ATOM   5958  C  C   . ALA B 1 289 ? 86.056 77.433  48.184  1.00 40.61 ? 289 ALA B C   1 
ATOM   5959  O  O   . ALA B 1 289 ? 85.051 76.883  48.635  1.00 40.71 ? 289 ALA B O   1 
ATOM   5960  C  CB  . ALA B 1 289 ? 85.705 79.656  47.085  1.00 39.69 ? 289 ALA B CB  1 
ATOM   5961  N  N   . GLU B 1 290 ? 87.038 76.770  47.582  1.00 41.11 ? 290 GLU B N   1 
ATOM   5962  C  CA  . GLU B 1 290 ? 87.013 75.327  47.391  1.00 41.20 ? 290 GLU B CA  1 
ATOM   5963  C  C   . GLU B 1 290 ? 87.380 74.564  48.666  1.00 40.59 ? 290 GLU B C   1 
ATOM   5964  O  O   . GLU B 1 290 ? 86.649 73.668  49.095  1.00 40.48 ? 290 GLU B O   1 
ATOM   5965  C  CB  . GLU B 1 290 ? 87.963 74.944  46.251  1.00 41.95 ? 290 GLU B CB  1 
ATOM   5966  C  CG  . GLU B 1 290 ? 87.256 74.676  44.929  1.00 44.04 ? 290 GLU B CG  1 
ATOM   5967  C  CD  . GLU B 1 290 ? 88.204 74.605  43.733  1.00 45.72 ? 290 GLU B CD  1 
ATOM   5968  O  OE1 . GLU B 1 290 ? 89.262 73.929  43.824  1.00 46.17 ? 290 GLU B OE1 1 
ATOM   5969  O  OE2 . GLU B 1 290 ? 87.872 75.223  42.694  1.00 46.56 ? 290 GLU B OE2 1 
ATOM   5970  N  N   . THR B 1 291 ? 88.506 74.915  49.275  1.00 40.19 ? 291 THR B N   1 
ATOM   5971  C  CA  . THR B 1 291 ? 88.924 74.236  50.494  1.00 40.20 ? 291 THR B CA  1 
ATOM   5972  C  C   . THR B 1 291 ? 87.981 74.529  51.647  1.00 40.69 ? 291 THR B C   1 
ATOM   5973  O  O   . THR B 1 291 ? 88.037 73.861  52.672  1.00 41.92 ? 291 THR B O   1 
ATOM   5974  C  CB  . THR B 1 291 ? 90.330 74.637  50.916  1.00 39.55 ? 291 THR B CB  1 
ATOM   5975  O  OG1 . THR B 1 291 ? 90.388 76.058  51.107  1.00 39.34 ? 291 THR B OG1 1 
ATOM   5976  C  CG2 . THR B 1 291 ? 91.329 74.205  49.864  1.00 38.17 ? 291 THR B CG2 1 
ATOM   5977  N  N   . PHE B 1 292 ? 87.124 75.532  51.487  1.00 40.85 ? 292 PHE B N   1 
ATOM   5978  C  CA  . PHE B 1 292 ? 86.154 75.867  52.524  1.00 40.29 ? 292 PHE B CA  1 
ATOM   5979  C  C   . PHE B 1 292 ? 85.240 74.634  52.733  1.00 39.65 ? 292 PHE B C   1 
ATOM   5980  O  O   . PHE B 1 292 ? 84.644 74.108  51.783  1.00 39.39 ? 292 PHE B O   1 
ATOM   5981  C  CB  . PHE B 1 292 ? 85.336 77.085  52.084  1.00 40.78 ? 292 PHE B CB  1 
ATOM   5982  C  CG  . PHE B 1 292 ? 84.348 77.572  53.119  1.00 42.10 ? 292 PHE B CG  1 
ATOM   5983  C  CD1 . PHE B 1 292 ? 84.787 78.162  54.299  1.00 42.01 ? 292 PHE B CD1 1 
ATOM   5984  C  CD2 . PHE B 1 292 ? 82.971 77.426  52.916  1.00 42.21 ? 292 PHE B CD2 1 
ATOM   5985  C  CE1 . PHE B 1 292 ? 83.868 78.599  55.262  1.00 41.64 ? 292 PHE B CE1 1 
ATOM   5986  C  CE2 . PHE B 1 292 ? 82.051 77.857  53.872  1.00 41.61 ? 292 PHE B CE2 1 
ATOM   5987  C  CZ  . PHE B 1 292 ? 82.505 78.444  55.047  1.00 41.30 ? 292 PHE B CZ  1 
ATOM   5988  N  N   . PRO B 1 293 ? 85.113 74.172  53.987  1.00 38.55 ? 293 PRO B N   1 
ATOM   5989  C  CA  . PRO B 1 293 ? 84.304 73.014  54.387  1.00 37.48 ? 293 PRO B CA  1 
ATOM   5990  C  C   . PRO B 1 293 ? 82.962 72.906  53.675  1.00 37.49 ? 293 PRO B C   1 
ATOM   5991  O  O   . PRO B 1 293 ? 82.627 71.864  53.100  1.00 38.07 ? 293 PRO B O   1 
ATOM   5992  C  CB  . PRO B 1 293 ? 84.112 73.224  55.884  1.00 37.39 ? 293 PRO B CB  1 
ATOM   5993  C  CG  . PRO B 1 293 ? 85.326 73.974  56.283  1.00 38.21 ? 293 PRO B CG  1 
ATOM   5994  C  CD  . PRO B 1 293 ? 85.523 74.954  55.166  1.00 38.09 ? 293 PRO B CD  1 
ATOM   5995  N  N   . PHE B 1 294 ? 82.202 73.998  53.731  1.00 36.46 ? 294 PHE B N   1 
ATOM   5996  C  CA  . PHE B 1 294 ? 80.869 74.084  53.145  1.00 34.52 ? 294 PHE B CA  1 
ATOM   5997  C  C   . PHE B 1 294 ? 80.825 74.834  51.830  1.00 34.03 ? 294 PHE B C   1 
ATOM   5998  O  O   . PHE B 1 294 ? 81.863 75.175  51.245  1.00 33.32 ? 294 PHE B O   1 
ATOM   5999  C  CB  . PHE B 1 294 ? 79.955 74.804  54.119  1.00 32.85 ? 294 PHE B CB  1 
ATOM   6000  C  CG  . PHE B 1 294 ? 80.103 74.334  55.514  1.00 32.45 ? 294 PHE B CG  1 
ATOM   6001  C  CD1 . PHE B 1 294 ? 79.715 73.044  55.867  1.00 30.78 ? 294 PHE B CD1 1 
ATOM   6002  C  CD2 . PHE B 1 294 ? 80.658 75.162  56.478  1.00 31.61 ? 294 PHE B CD2 1 
ATOM   6003  C  CE1 . PHE B 1 294 ? 79.876 72.585  57.162  1.00 30.42 ? 294 PHE B CE1 1 
ATOM   6004  C  CE2 . PHE B 1 294 ? 80.825 74.709  57.780  1.00 31.72 ? 294 PHE B CE2 1 
ATOM   6005  C  CZ  . PHE B 1 294 ? 80.432 73.416  58.124  1.00 30.08 ? 294 PHE B CZ  1 
ATOM   6006  N  N   . ASN B 1 295 ? 79.600 75.091  51.377  1.00 33.21 ? 295 ASN B N   1 
ATOM   6007  C  CA  . ASN B 1 295 ? 79.390 75.848  50.158  1.00 32.50 ? 295 ASN B CA  1 
ATOM   6008  C  C   . ASN B 1 295 ? 79.623 77.298  50.580  1.00 32.30 ? 295 ASN B C   1 
ATOM   6009  O  O   . ASN B 1 295 ? 78.868 77.853  51.387  1.00 33.04 ? 295 ASN B O   1 
ATOM   6010  C  CB  . ASN B 1 295 ? 77.962 75.659  49.637  1.00 31.24 ? 295 ASN B CB  1 
ATOM   6011  C  CG  . ASN B 1 295 ? 77.606 76.651  48.545  1.00 30.51 ? 295 ASN B CG  1 
ATOM   6012  O  OD1 . ASN B 1 295 ? 78.425 77.476  48.147  1.00 30.85 ? 295 ASN B OD1 1 
ATOM   6013  N  ND2 . ASN B 1 295 ? 76.379 76.580  48.060  1.00 30.20 ? 295 ASN B ND2 1 
ATOM   6014  N  N   . PRO B 1 296 ? 80.685 77.925  50.053  1.00 31.19 ? 296 PRO B N   1 
ATOM   6015  C  CA  . PRO B 1 296 ? 81.000 79.311  50.396  1.00 31.18 ? 296 PRO B CA  1 
ATOM   6016  C  C   . PRO B 1 296 ? 79.867 80.265  50.056  1.00 31.30 ? 296 PRO B C   1 
ATOM   6017  O  O   . PRO B 1 296 ? 79.761 81.354  50.619  1.00 31.78 ? 296 PRO B O   1 
ATOM   6018  C  CB  . PRO B 1 296 ? 82.251 79.584  49.577  1.00 30.19 ? 296 PRO B CB  1 
ATOM   6019  C  CG  . PRO B 1 296 ? 82.026 78.746  48.356  1.00 30.13 ? 296 PRO B CG  1 
ATOM   6020  C  CD  . PRO B 1 296 ? 81.542 77.453  48.953  1.00 30.33 ? 296 PRO B CD  1 
ATOM   6021  N  N   . PHE B 1 297 ? 79.012 79.834  49.141  1.00 31.58 ? 297 PHE B N   1 
ATOM   6022  C  CA  . PHE B 1 297 ? 77.902 80.656  48.698  1.00 31.69 ? 297 PHE B CA  1 
ATOM   6023  C  C   . PHE B 1 297 ? 76.581 80.330  49.382  1.00 31.67 ? 297 PHE B C   1 
ATOM   6024  O  O   . PHE B 1 297 ? 75.542 80.794  48.951  1.00 32.64 ? 297 PHE B O   1 
ATOM   6025  C  CB  . PHE B 1 297 ? 77.751 80.532  47.178  1.00 31.67 ? 297 PHE B CB  1 
ATOM   6026  C  CG  . PHE B 1 297 ? 79.056 80.613  46.429  1.00 32.55 ? 297 PHE B CG  1 
ATOM   6027  C  CD1 . PHE B 1 297 ? 79.987 81.606  46.723  1.00 32.59 ? 297 PHE B CD1 1 
ATOM   6028  C  CD2 . PHE B 1 297 ? 79.362 79.695  45.435  1.00 33.10 ? 297 PHE B CD2 1 
ATOM   6029  C  CE1 . PHE B 1 297 ? 81.204 81.679  46.042  1.00 33.05 ? 297 PHE B CE1 1 
ATOM   6030  C  CE2 . PHE B 1 297 ? 80.585 79.764  44.747  1.00 33.74 ? 297 PHE B CE2 1 
ATOM   6031  C  CZ  . PHE B 1 297 ? 81.503 80.758  45.055  1.00 33.37 ? 297 PHE B CZ  1 
ATOM   6032  N  N   . ASP B 1 298 ? 76.605 79.529  50.440  1.00 31.95 ? 298 ASP B N   1 
ATOM   6033  C  CA  . ASP B 1 298 ? 75.366 79.208  51.141  1.00 31.92 ? 298 ASP B CA  1 
ATOM   6034  C  C   . ASP B 1 298 ? 75.075 80.277  52.221  1.00 31.61 ? 298 ASP B C   1 
ATOM   6035  O  O   . ASP B 1 298 ? 75.789 80.404  53.217  1.00 31.18 ? 298 ASP B O   1 
ATOM   6036  C  CB  . ASP B 1 298 ? 75.458 77.797  51.729  1.00 31.93 ? 298 ASP B CB  1 
ATOM   6037  C  CG  . ASP B 1 298 ? 74.410 77.527  52.797  1.00 33.33 ? 298 ASP B CG  1 
ATOM   6038  O  OD1 . ASP B 1 298 ? 73.438 78.297  52.928  1.00 33.59 ? 298 ASP B OD1 1 
ATOM   6039  O  OD2 . ASP B 1 298 ? 74.559 76.523  53.517  1.00 34.90 ? 298 ASP B OD2 1 
ATOM   6040  N  N   . LEU B 1 299 ? 74.011 81.042  52.005  1.00 31.17 ? 299 LEU B N   1 
ATOM   6041  C  CA  . LEU B 1 299 ? 73.634 82.124  52.903  1.00 31.95 ? 299 LEU B CA  1 
ATOM   6042  C  C   . LEU B 1 299 ? 73.449 81.752  54.377  1.00 31.56 ? 299 LEU B C   1 
ATOM   6043  O  O   . LEU B 1 299 ? 73.421 82.631  55.235  1.00 31.14 ? 299 LEU B O   1 
ATOM   6044  C  CB  . LEU B 1 299 ? 72.374 82.806  52.370  1.00 32.52 ? 299 LEU B CB  1 
ATOM   6045  C  CG  . LEU B 1 299 ? 71.970 84.166  52.951  1.00 33.58 ? 299 LEU B CG  1 
ATOM   6046  C  CD1 . LEU B 1 299 ? 73.116 85.165  52.802  1.00 33.96 ? 299 LEU B CD1 1 
ATOM   6047  C  CD2 . LEU B 1 299 ? 70.737 84.674  52.211  1.00 33.47 ? 299 LEU B CD2 1 
ATOM   6048  N  N   . THR B 1 300 ? 73.331 80.463  54.677  1.00 31.64 ? 300 THR B N   1 
ATOM   6049  C  CA  . THR B 1 300 ? 73.157 80.025  56.066  1.00 31.35 ? 300 THR B CA  1 
ATOM   6050  C  C   . THR B 1 300 ? 74.495 79.794  56.763  1.00 31.67 ? 300 THR B C   1 
ATOM   6051  O  O   . THR B 1 300 ? 74.517 79.352  57.914  1.00 31.49 ? 300 THR B O   1 
ATOM   6052  C  CB  . THR B 1 300 ? 72.389 78.701  56.164  1.00 31.26 ? 300 THR B CB  1 
ATOM   6053  O  OG1 . THR B 1 300 ? 73.162 77.658  55.549  1.00 30.27 ? 300 THR B OG1 1 
ATOM   6054  C  CG2 . THR B 1 300 ? 71.041 78.814  55.492  1.00 30.45 ? 300 THR B CG2 1 
ATOM   6055  N  N   . LYS B 1 301 ? 75.595 80.093  56.067  1.00 31.21 ? 301 LYS B N   1 
ATOM   6056  C  CA  . LYS B 1 301 ? 76.945 79.899  56.604  1.00 31.35 ? 301 LYS B CA  1 
ATOM   6057  C  C   . LYS B 1 301 ? 77.738 81.207  56.742  1.00 32.48 ? 301 LYS B C   1 
ATOM   6058  O  O   . LYS B 1 301 ? 77.483 82.185  56.030  1.00 32.91 ? 301 LYS B O   1 
ATOM   6059  C  CB  . LYS B 1 301 ? 77.740 78.958  55.685  1.00 30.52 ? 301 LYS B CB  1 
ATOM   6060  C  CG  . LYS B 1 301 ? 77.064 77.644  55.356  1.00 29.49 ? 301 LYS B CG  1 
ATOM   6061  C  CD  . LYS B 1 301 ? 77.339 76.599  56.423  1.00 30.57 ? 301 LYS B CD  1 
ATOM   6062  C  CE  . LYS B 1 301 ? 76.095 75.790  56.775  1.00 31.16 ? 301 LYS B CE  1 
ATOM   6063  N  NZ  . LYS B 1 301 ? 75.452 75.144  55.597  1.00 30.51 ? 301 LYS B NZ  1 
ATOM   6064  N  N   . VAL B 1 302 ? 78.701 81.228  57.662  1.00 32.46 ? 302 VAL B N   1 
ATOM   6065  C  CA  . VAL B 1 302 ? 79.544 82.406  57.823  1.00 32.55 ? 302 VAL B CA  1 
ATOM   6066  C  C   . VAL B 1 302 ? 80.964 82.001  57.510  1.00 33.17 ? 302 VAL B C   1 
ATOM   6067  O  O   . VAL B 1 302 ? 81.269 80.817  57.406  1.00 33.79 ? 302 VAL B O   1 
ATOM   6068  C  CB  . VAL B 1 302 ? 79.553 82.945  59.259  1.00 32.25 ? 302 VAL B CB  1 
ATOM   6069  C  CG1 . VAL B 1 302 ? 78.177 83.371  59.653  1.00 33.11 ? 302 VAL B CG1 1 
ATOM   6070  C  CG2 . VAL B 1 302 ? 80.090 81.894  60.211  1.00 30.52 ? 302 VAL B CG2 1 
ATOM   6071  N  N   . TRP B 1 303 ? 81.830 82.985  57.338  1.00 33.62 ? 303 TRP B N   1 
ATOM   6072  C  CA  . TRP B 1 303 ? 83.235 82.706  57.111  1.00 34.86 ? 303 TRP B CA  1 
ATOM   6073  C  C   . TRP B 1 303 ? 83.845 83.031  58.466  1.00 36.66 ? 303 TRP B C   1 
ATOM   6074  O  O   . TRP B 1 303 ? 83.931 84.201  58.851  1.00 37.10 ? 303 TRP B O   1 
ATOM   6075  C  CB  . TRP B 1 303 ? 83.820 83.626  56.042  1.00 33.34 ? 303 TRP B CB  1 
ATOM   6076  C  CG  . TRP B 1 303 ? 83.335 83.339  54.669  1.00 32.05 ? 303 TRP B CG  1 
ATOM   6077  C  CD1 . TRP B 1 303 ? 82.513 82.326  54.284  1.00 31.92 ? 303 TRP B CD1 1 
ATOM   6078  C  CD2 . TRP B 1 303 ? 83.641 84.080  53.491  1.00 30.82 ? 303 TRP B CD2 1 
ATOM   6079  N  NE1 . TRP B 1 303 ? 82.283 82.390  52.930  1.00 32.06 ? 303 TRP B NE1 1 
ATOM   6080  C  CE2 . TRP B 1 303 ? 82.966 83.460  52.420  1.00 31.05 ? 303 TRP B CE2 1 
ATOM   6081  C  CE3 . TRP B 1 303 ? 84.421 85.212  53.235  1.00 30.22 ? 303 TRP B CE3 1 
ATOM   6082  C  CZ2 . TRP B 1 303 ? 83.044 83.934  51.112  1.00 30.10 ? 303 TRP B CZ2 1 
ATOM   6083  C  CZ3 . TRP B 1 303 ? 84.499 85.683  51.935  1.00 29.84 ? 303 TRP B CZ3 1 
ATOM   6084  C  CH2 . TRP B 1 303 ? 83.812 85.044  50.888  1.00 29.43 ? 303 TRP B CH2 1 
ATOM   6085  N  N   . PRO B 1 304 ? 84.252 82.002  59.221  1.00 38.12 ? 304 PRO B N   1 
ATOM   6086  C  CA  . PRO B 1 304 ? 84.839 82.259  60.538  1.00 39.88 ? 304 PRO B CA  1 
ATOM   6087  C  C   . PRO B 1 304 ? 85.954 83.297  60.485  1.00 42.13 ? 304 PRO B C   1 
ATOM   6088  O  O   . PRO B 1 304 ? 86.903 83.146  59.719  1.00 42.81 ? 304 PRO B O   1 
ATOM   6089  C  CB  . PRO B 1 304 ? 85.323 80.880  60.965  1.00 39.27 ? 304 PRO B CB  1 
ATOM   6090  C  CG  . PRO B 1 304 ? 84.304 79.972  60.334  1.00 37.92 ? 304 PRO B CG  1 
ATOM   6091  C  CD  . PRO B 1 304 ? 84.161 80.556  58.953  1.00 37.37 ? 304 PRO B CD  1 
ATOM   6092  N  N   . HIS B 1 305 ? 85.824 84.351  61.293  1.00 45.09 ? 305 HIS B N   1 
ATOM   6093  C  CA  . HIS B 1 305 ? 86.814 85.430  61.350  1.00 47.82 ? 305 HIS B CA  1 
ATOM   6094  C  C   . HIS B 1 305 ? 88.222 84.881  61.520  1.00 47.88 ? 305 HIS B C   1 
ATOM   6095  O  O   . HIS B 1 305 ? 89.152 85.291  60.828  1.00 47.84 ? 305 HIS B O   1 
ATOM   6096  C  CB  . HIS B 1 305 ? 86.506 86.384  62.514  1.00 51.34 ? 305 HIS B CB  1 
ATOM   6097  C  CG  . HIS B 1 305 ? 85.238 87.166  62.342  1.00 56.59 ? 305 HIS B CG  1 
ATOM   6098  N  ND1 . HIS B 1 305 ? 84.822 88.121  63.248  1.00 59.16 ? 305 HIS B ND1 1 
ATOM   6099  C  CD2 . HIS B 1 305 ? 84.288 87.133  61.372  1.00 58.76 ? 305 HIS B CD2 1 
ATOM   6100  C  CE1 . HIS B 1 305 ? 83.673 88.641  62.846  1.00 59.83 ? 305 HIS B CE1 1 
ATOM   6101  N  NE2 . HIS B 1 305 ? 83.326 88.059  61.709  1.00 60.00 ? 305 HIS B NE2 1 
ATOM   6102  N  N   . LYS B 1 306 ? 88.366 83.961  62.464  1.00 48.15 ? 306 LYS B N   1 
ATOM   6103  C  CA  . LYS B 1 306 ? 89.644 83.328  62.759  1.00 48.54 ? 306 LYS B CA  1 
ATOM   6104  C  C   . LYS B 1 306 ? 90.314 82.933  61.459  1.00 47.64 ? 306 LYS B C   1 
ATOM   6105  O  O   . LYS B 1 306 ? 91.480 83.237  61.215  1.00 48.39 ? 306 LYS B O   1 
ATOM   6106  C  CB  . LYS B 1 306 ? 89.417 82.075  63.598  1.00 50.35 ? 306 LYS B CB  1 
ATOM   6107  C  CG  . LYS B 1 306 ? 88.172 82.148  64.510  1.00 54.27 ? 306 LYS B CG  1 
ATOM   6108  C  CD  . LYS B 1 306 ? 86.842 82.114  63.713  1.00 55.25 ? 306 LYS B CD  1 
ATOM   6109  C  CE  . LYS B 1 306 ? 85.598 82.240  64.603  1.00 55.85 ? 306 LYS B CE  1 
ATOM   6110  N  NZ  . LYS B 1 306 ? 84.324 82.389  63.812  1.00 56.78 ? 306 LYS B NZ  1 
ATOM   6111  N  N   . ASP B 1 307 ? 89.546 82.273  60.608  1.00 46.35 ? 307 ASP B N   1 
ATOM   6112  C  CA  . ASP B 1 307 ? 90.049 81.790  59.337  1.00 44.64 ? 307 ASP B CA  1 
ATOM   6113  C  C   . ASP B 1 307 ? 90.141 82.828  58.220  1.00 43.34 ? 307 ASP B C   1 
ATOM   6114  O  O   . ASP B 1 307 ? 91.081 82.808  57.429  1.00 42.01 ? 307 ASP B O   1 
ATOM   6115  C  CB  . ASP B 1 307 ? 89.202 80.591  58.921  1.00 45.39 ? 307 ASP B CB  1 
ATOM   6116  C  CG  . ASP B 1 307 ? 89.208 79.496  59.978  1.00 44.95 ? 307 ASP B CG  1 
ATOM   6117  O  OD1 . ASP B 1 307 ? 90.316 79.106  60.408  1.00 45.49 ? 307 ASP B OD1 1 
ATOM   6118  O  OD2 . ASP B 1 307 ? 88.120 79.028  60.380  1.00 45.30 ? 307 ASP B OD2 1 
ATOM   6119  N  N   . TYR B 1 308 ? 89.170 83.733  58.156  1.00 42.80 ? 308 TYR B N   1 
ATOM   6120  C  CA  . TYR B 1 308 ? 89.162 84.798  57.146  1.00 41.81 ? 308 TYR B CA  1 
ATOM   6121  C  C   . TYR B 1 308 ? 88.899 86.072  57.942  1.00 41.89 ? 308 TYR B C   1 
ATOM   6122  O  O   . TYR B 1 308 ? 87.751 86.473  58.143  1.00 41.96 ? 308 TYR B O   1 
ATOM   6123  C  CB  . TYR B 1 308 ? 88.052 84.549  56.125  1.00 40.48 ? 308 TYR B CB  1 
ATOM   6124  C  CG  . TYR B 1 308 ? 87.988 83.109  55.679  1.00 39.42 ? 308 TYR B CG  1 
ATOM   6125  C  CD1 . TYR B 1 308 ? 88.526 82.706  54.457  1.00 39.07 ? 308 TYR B CD1 1 
ATOM   6126  C  CD2 . TYR B 1 308 ? 87.464 82.129  56.525  1.00 39.44 ? 308 TYR B CD2 1 
ATOM   6127  C  CE1 . TYR B 1 308 ? 88.550 81.353  54.091  1.00 39.27 ? 308 TYR B CE1 1 
ATOM   6128  C  CE2 . TYR B 1 308 ? 87.484 80.785  56.174  1.00 39.52 ? 308 TYR B CE2 1 
ATOM   6129  C  CZ  . TYR B 1 308 ? 88.029 80.401  54.961  1.00 39.41 ? 308 TYR B CZ  1 
ATOM   6130  O  OH  . TYR B 1 308 ? 88.066 79.063  54.641  1.00 40.21 ? 308 TYR B OH  1 
ATOM   6131  N  N   . PRO B 1 309 ? 89.974 86.716  58.423  1.00 42.05 ? 309 PRO B N   1 
ATOM   6132  C  CA  . PRO B 1 309 ? 89.925 87.947  59.220  1.00 42.16 ? 309 PRO B CA  1 
ATOM   6133  C  C   . PRO B 1 309 ? 89.394 89.163  58.468  1.00 42.16 ? 309 PRO B C   1 
ATOM   6134  O  O   . PRO B 1 309 ? 89.526 89.254  57.246  1.00 42.20 ? 309 PRO B O   1 
ATOM   6135  C  CB  . PRO B 1 309 ? 91.377 88.126  59.649  1.00 41.94 ? 309 PRO B CB  1 
ATOM   6136  C  CG  . PRO B 1 309 ? 92.114 87.660  58.423  1.00 42.07 ? 309 PRO B CG  1 
ATOM   6137  C  CD  . PRO B 1 309 ? 91.367 86.384  58.065  1.00 41.50 ? 309 PRO B CD  1 
ATOM   6138  N  N   . LEU B 1 310 ? 88.811 90.101  59.209  1.00 41.79 ? 310 LEU B N   1 
ATOM   6139  C  CA  . LEU B 1 310 ? 88.259 91.315  58.621  1.00 42.09 ? 310 LEU B CA  1 
ATOM   6140  C  C   . LEU B 1 310 ? 89.366 92.251  58.101  1.00 41.89 ? 310 LEU B C   1 
ATOM   6141  O  O   . LEU B 1 310 ? 90.429 92.356  58.705  1.00 42.48 ? 310 LEU B O   1 
ATOM   6142  C  CB  . LEU B 1 310 ? 87.409 92.046  59.669  1.00 42.62 ? 310 LEU B CB  1 
ATOM   6143  C  CG  . LEU B 1 310 ? 86.260 91.281  60.351  1.00 43.35 ? 310 LEU B CG  1 
ATOM   6144  C  CD1 . LEU B 1 310 ? 85.624 92.154  61.432  1.00 43.56 ? 310 LEU B CD1 1 
ATOM   6145  C  CD2 . LEU B 1 310 ? 85.212 90.877  59.328  1.00 43.07 ? 310 LEU B CD2 1 
ATOM   6146  N  N   . ILE B 1 311 ? 89.117 92.925  56.980  1.00 41.18 ? 311 ILE B N   1 
ATOM   6147  C  CA  . ILE B 1 311 ? 90.088 93.857  56.401  1.00 40.47 ? 311 ILE B CA  1 
ATOM   6148  C  C   . ILE B 1 311 ? 89.451 95.238  56.451  1.00 40.15 ? 311 ILE B C   1 
ATOM   6149  O  O   . ILE B 1 311 ? 88.366 95.428  55.914  1.00 40.58 ? 311 ILE B O   1 
ATOM   6150  C  CB  . ILE B 1 311 ? 90.375 93.542  54.913  1.00 40.85 ? 311 ILE B CB  1 
ATOM   6151  C  CG1 . ILE B 1 311 ? 90.620 92.045  54.719  1.00 41.32 ? 311 ILE B CG1 1 
ATOM   6152  C  CG2 . ILE B 1 311 ? 91.560 94.346  54.426  1.00 40.43 ? 311 ILE B CG2 1 
ATOM   6153  C  CD1 . ILE B 1 311 ? 91.614 91.448  55.670  1.00 42.46 ? 311 ILE B CD1 1 
ATOM   6154  N  N   . PRO B 1 312 ? 90.115 96.220  57.084  1.00 39.59 ? 312 PRO B N   1 
ATOM   6155  C  CA  . PRO B 1 312 ? 89.554 97.577  57.172  1.00 38.54 ? 312 PRO B CA  1 
ATOM   6156  C  C   . PRO B 1 312 ? 89.442 98.216  55.789  1.00 37.55 ? 312 PRO B C   1 
ATOM   6157  O  O   . PRO B 1 312 ? 90.338 98.056  54.963  1.00 37.16 ? 312 PRO B O   1 
ATOM   6158  C  CB  . PRO B 1 312 ? 90.562 98.324  58.056  1.00 38.70 ? 312 PRO B CB  1 
ATOM   6159  C  CG  . PRO B 1 312 ? 91.284 97.229  58.799  1.00 39.20 ? 312 PRO B CG  1 
ATOM   6160  C  CD  . PRO B 1 312 ? 91.424 96.154  57.754  1.00 39.78 ? 312 PRO B CD  1 
ATOM   6161  N  N   . VAL B 1 313 ? 88.348 98.934  55.540  1.00 36.24 ? 313 VAL B N   1 
ATOM   6162  C  CA  . VAL B 1 313 ? 88.157 99.592  54.258  1.00 34.74 ? 313 VAL B CA  1 
ATOM   6163  C  C   . VAL B 1 313 ? 87.769 101.049 54.429  1.00 34.58 ? 313 VAL B C   1 
ATOM   6164  O  O   . VAL B 1 313 ? 88.300 101.922 53.739  1.00 34.83 ? 313 VAL B O   1 
ATOM   6165  C  CB  . VAL B 1 313 ? 87.084 98.887  53.400  1.00 34.13 ? 313 VAL B CB  1 
ATOM   6166  C  CG1 . VAL B 1 313 ? 86.901 99.634  52.081  1.00 32.90 ? 313 VAL B CG1 1 
ATOM   6167  C  CG2 . VAL B 1 313 ? 87.499 97.457  53.119  1.00 33.80 ? 313 VAL B CG2 1 
ATOM   6168  N  N   . GLY B 1 314 ? 86.848 101.327 55.345  1.00 34.17 ? 314 GLY B N   1 
ATOM   6169  C  CA  . GLY B 1 314 ? 86.446 102.708 55.537  1.00 33.47 ? 314 GLY B CA  1 
ATOM   6170  C  C   . GLY B 1 314 ? 85.390 102.929 56.590  1.00 32.95 ? 314 GLY B C   1 
ATOM   6171  O  O   . GLY B 1 314 ? 85.162 102.073 57.437  1.00 32.80 ? 314 GLY B O   1 
ATOM   6172  N  N   . LYS B 1 315 ? 84.744 104.088 56.531  1.00 33.76 ? 315 LYS B N   1 
ATOM   6173  C  CA  . LYS B 1 315 ? 83.696 104.441 57.489  1.00 34.16 ? 315 LYS B CA  1 
ATOM   6174  C  C   . LYS B 1 315 ? 82.388 104.853 56.829  1.00 33.32 ? 315 LYS B C   1 
ATOM   6175  O  O   . LYS B 1 315 ? 82.356 105.352 55.702  1.00 32.40 ? 315 LYS B O   1 
ATOM   6176  C  CB  . LYS B 1 315 ? 84.152 105.607 58.383  1.00 35.96 ? 315 LYS B CB  1 
ATOM   6177  C  CG  . LYS B 1 315 ? 85.159 105.259 59.473  1.00 38.32 ? 315 LYS B CG  1 
ATOM   6178  C  CD  . LYS B 1 315 ? 84.480 104.610 60.684  1.00 40.05 ? 315 LYS B CD  1 
ATOM   6179  C  CE  . LYS B 1 315 ? 85.220 104.928 61.989  1.00 39.78 ? 315 LYS B CE  1 
ATOM   6180  N  NZ  . LYS B 1 315 ? 86.641 104.472 61.970  1.00 41.44 ? 315 LYS B NZ  1 
ATOM   6181  N  N   . LEU B 1 316 ? 81.305 104.637 57.562  1.00 33.22 ? 316 LEU B N   1 
ATOM   6182  C  CA  . LEU B 1 316 ? 79.973 105.032 57.128  1.00 32.27 ? 316 LEU B CA  1 
ATOM   6183  C  C   . LEU B 1 316 ? 79.525 105.977 58.233  1.00 32.17 ? 316 LEU B C   1 
ATOM   6184  O  O   . LEU B 1 316 ? 79.485 105.592 59.414  1.00 31.61 ? 316 LEU B O   1 
ATOM   6185  C  CB  . LEU B 1 316 ? 79.035 103.826 57.051  1.00 32.21 ? 316 LEU B CB  1 
ATOM   6186  C  CG  . LEU B 1 316 ? 79.315 102.793 55.955  1.00 32.14 ? 316 LEU B CG  1 
ATOM   6187  C  CD1 . LEU B 1 316 ? 78.336 101.638 56.094  1.00 32.13 ? 316 LEU B CD1 1 
ATOM   6188  C  CD2 . LEU B 1 316 ? 79.201 103.433 54.579  1.00 31.98 ? 316 LEU B CD2 1 
ATOM   6189  N  N   . VAL B 1 317 ? 79.219 107.217 57.851  1.00 32.28 ? 317 VAL B N   1 
ATOM   6190  C  CA  . VAL B 1 317 ? 78.790 108.245 58.798  1.00 31.70 ? 317 VAL B CA  1 
ATOM   6191  C  C   . VAL B 1 317 ? 77.430 108.839 58.427  1.00 32.46 ? 317 VAL B C   1 
ATOM   6192  O  O   . VAL B 1 317 ? 77.248 109.331 57.312  1.00 33.46 ? 317 VAL B O   1 
ATOM   6193  C  CB  . VAL B 1 317 ? 79.828 109.410 58.842  1.00 31.77 ? 317 VAL B CB  1 
ATOM   6194  C  CG1 . VAL B 1 317 ? 79.357 110.511 59.765  1.00 30.03 ? 317 VAL B CG1 1 
ATOM   6195  C  CG2 . VAL B 1 317 ? 81.189 108.893 59.295  1.00 31.02 ? 317 VAL B CG2 1 
ATOM   6196  N  N   . LEU B 1 318 ? 76.478 108.798 59.353  1.00 32.48 ? 318 LEU B N   1 
ATOM   6197  C  CA  . LEU B 1 318 ? 75.159 109.393 59.114  1.00 32.43 ? 318 LEU B CA  1 
ATOM   6198  C  C   . LEU B 1 318 ? 75.122 110.759 59.795  1.00 31.98 ? 318 LEU B C   1 
ATOM   6199  O  O   . LEU B 1 318 ? 75.069 110.841 61.016  1.00 32.06 ? 318 LEU B O   1 
ATOM   6200  C  CB  . LEU B 1 318 ? 74.051 108.497 59.679  1.00 32.52 ? 318 LEU B CB  1 
ATOM   6201  C  CG  . LEU B 1 318 ? 73.842 107.170 58.940  1.00 31.41 ? 318 LEU B CG  1 
ATOM   6202  C  CD1 . LEU B 1 318 ? 72.707 106.385 59.587  1.00 31.32 ? 318 LEU B CD1 1 
ATOM   6203  C  CD2 . LEU B 1 318 ? 73.545 107.450 57.480  1.00 29.84 ? 318 LEU B CD2 1 
ATOM   6204  N  N   . ASN B 1 319 ? 75.138 111.821 58.998  1.00 32.35 ? 319 ASN B N   1 
ATOM   6205  C  CA  . ASN B 1 319 ? 75.165 113.197 59.512  1.00 32.87 ? 319 ASN B CA  1 
ATOM   6206  C  C   . ASN B 1 319 ? 74.058 114.136 59.007  1.00 33.70 ? 319 ASN B C   1 
ATOM   6207  O  O   . ASN B 1 319 ? 74.192 115.357 59.102  1.00 34.25 ? 319 ASN B O   1 
ATOM   6208  C  CB  . ASN B 1 319 ? 76.489 113.832 59.131  1.00 31.94 ? 319 ASN B CB  1 
ATOM   6209  C  CG  . ASN B 1 319 ? 76.639 113.964 57.624  1.00 31.22 ? 319 ASN B CG  1 
ATOM   6210  O  OD1 . ASN B 1 319 ? 75.734 113.605 56.880  1.00 32.09 ? 319 ASN B OD1 1 
ATOM   6211  N  ND2 . ASN B 1 319 ? 77.771 114.476 57.171  1.00 30.64 ? 319 ASN B ND2 1 
ATOM   6212  N  N   . ARG B 1 320 ? 72.983 113.591 58.458  1.00 34.08 ? 320 ARG B N   1 
ATOM   6213  C  CA  . ARG B 1 320 ? 71.905 114.422 57.946  1.00 33.96 ? 320 ARG B CA  1 
ATOM   6214  C  C   . ARG B 1 320 ? 70.563 113.718 58.077  1.00 35.01 ? 320 ARG B C   1 
ATOM   6215  O  O   . ARG B 1 320 ? 70.419 112.546 57.715  1.00 35.95 ? 320 ARG B O   1 
ATOM   6216  C  CB  . ARG B 1 320 ? 72.168 114.773 56.478  1.00 33.36 ? 320 ARG B CB  1 
ATOM   6217  C  CG  . ARG B 1 320 ? 70.989 115.421 55.783  1.00 34.27 ? 320 ARG B CG  1 
ATOM   6218  C  CD  . ARG B 1 320 ? 71.401 116.139 54.529  1.00 34.51 ? 320 ARG B CD  1 
ATOM   6219  N  NE  . ARG B 1 320 ? 72.048 115.247 53.569  1.00 37.48 ? 320 ARG B NE  1 
ATOM   6220  C  CZ  . ARG B 1 320 ? 71.408 114.575 52.618  1.00 37.73 ? 320 ARG B CZ  1 
ATOM   6221  N  NH1 . ARG B 1 320 ? 70.093 114.691 52.491  1.00 38.79 ? 320 ARG B NH1 1 
ATOM   6222  N  NH2 . ARG B 1 320 ? 72.085 113.792 51.790  1.00 37.60 ? 320 ARG B NH2 1 
ATOM   6223  N  N   . ASN B 1 321 ? 69.575 114.428 58.604  1.00 35.21 ? 321 ASN B N   1 
ATOM   6224  C  CA  . ASN B 1 321 ? 68.245 113.855 58.750  1.00 34.99 ? 321 ASN B CA  1 
ATOM   6225  C  C   . ASN B 1 321 ? 67.424 114.118 57.505  1.00 34.44 ? 321 ASN B C   1 
ATOM   6226  O  O   . ASN B 1 321 ? 67.703 115.048 56.752  1.00 34.19 ? 321 ASN B O   1 
ATOM   6227  C  CB  . ASN B 1 321 ? 67.538 114.476 59.945  1.00 35.55 ? 321 ASN B CB  1 
ATOM   6228  C  CG  . ASN B 1 321 ? 67.950 113.847 61.238  1.00 37.24 ? 321 ASN B CG  1 
ATOM   6229  O  OD1 . ASN B 1 321 ? 67.894 114.478 62.291  1.00 39.12 ? 321 ASN B OD1 1 
ATOM   6230  N  ND2 . ASN B 1 321 ? 68.354 112.585 61.178  1.00 37.12 ? 321 ASN B ND2 1 
ATOM   6231  N  N   . PRO B 1 322 ? 66.412 113.286 57.251  1.00 34.22 ? 322 PRO B N   1 
ATOM   6232  C  CA  . PRO B 1 322 ? 65.621 113.567 56.050  1.00 34.06 ? 322 PRO B CA  1 
ATOM   6233  C  C   . PRO B 1 322 ? 64.794 114.822 56.317  1.00 34.22 ? 322 PRO B C   1 
ATOM   6234  O  O   . PRO B 1 322 ? 64.541 115.166 57.473  1.00 34.69 ? 322 PRO B O   1 
ATOM   6235  C  CB  . PRO B 1 322 ? 64.751 112.327 55.915  1.00 33.48 ? 322 PRO B CB  1 
ATOM   6236  C  CG  . PRO B 1 322 ? 64.577 111.885 57.357  1.00 33.68 ? 322 PRO B CG  1 
ATOM   6237  C  CD  . PRO B 1 322 ? 65.980 112.036 57.900  1.00 33.53 ? 322 PRO B CD  1 
ATOM   6238  N  N   . VAL B 1 323 ? 64.389 115.516 55.261  1.00 33.82 ? 323 VAL B N   1 
ATOM   6239  C  CA  . VAL B 1 323 ? 63.570 116.707 55.425  1.00 33.29 ? 323 VAL B CA  1 
ATOM   6240  C  C   . VAL B 1 323 ? 62.109 116.309 55.283  1.00 32.99 ? 323 VAL B C   1 
ATOM   6241  O  O   . VAL B 1 323 ? 61.265 116.763 56.055  1.00 33.07 ? 323 VAL B O   1 
ATOM   6242  C  CB  . VAL B 1 323 ? 63.921 117.784 54.384  1.00 33.39 ? 323 VAL B CB  1 
ATOM   6243  C  CG1 . VAL B 1 323 ? 62.864 118.867 54.380  1.00 33.71 ? 323 VAL B CG1 1 
ATOM   6244  C  CG2 . VAL B 1 323 ? 65.265 118.389 54.717  1.00 32.25 ? 323 VAL B CG2 1 
ATOM   6245  N  N   . ASN B 1 324 ? 61.830 115.454 54.299  1.00 31.95 ? 324 ASN B N   1 
ATOM   6246  C  CA  . ASN B 1 324 ? 60.486 114.949 54.038  1.00 31.34 ? 324 ASN B CA  1 
ATOM   6247  C  C   . ASN B 1 324 ? 60.565 113.431 54.037  1.00 31.16 ? 324 ASN B C   1 
ATOM   6248  O  O   . ASN B 1 324 ? 61.125 112.842 53.114  1.00 31.06 ? 324 ASN B O   1 
ATOM   6249  C  CB  . ASN B 1 324 ? 59.983 115.427 52.679  1.00 31.44 ? 324 ASN B CB  1 
ATOM   6250  C  CG  . ASN B 1 324 ? 58.567 114.971 52.393  1.00 32.22 ? 324 ASN B CG  1 
ATOM   6251  O  OD1 . ASN B 1 324 ? 58.309 113.789 52.155  1.00 32.01 ? 324 ASN B OD1 1 
ATOM   6252  N  ND2 . ASN B 1 324 ? 57.634 115.909 52.435  1.00 32.56 ? 324 ASN B ND2 1 
ATOM   6253  N  N   . TYR B 1 325 ? 59.992 112.793 55.053  1.00 30.16 ? 325 TYR B N   1 
ATOM   6254  C  CA  . TYR B 1 325 ? 60.062 111.339 55.152  1.00 29.96 ? 325 TYR B CA  1 
ATOM   6255  C  C   . TYR B 1 325 ? 59.554 110.550 53.951  1.00 30.47 ? 325 TYR B C   1 
ATOM   6256  O  O   . TYR B 1 325 ? 60.196 109.589 53.527  1.00 30.74 ? 325 TYR B O   1 
ATOM   6257  C  CB  . TYR B 1 325 ? 59.330 110.850 56.393  1.00 28.95 ? 325 TYR B CB  1 
ATOM   6258  C  CG  . TYR B 1 325 ? 59.461 109.358 56.626  1.00 28.94 ? 325 TYR B CG  1 
ATOM   6259  C  CD1 . TYR B 1 325 ? 60.365 108.851 57.567  1.00 29.73 ? 325 TYR B CD1 1 
ATOM   6260  C  CD2 . TYR B 1 325 ? 58.653 108.454 55.942  1.00 28.61 ? 325 TYR B CD2 1 
ATOM   6261  C  CE1 . TYR B 1 325 ? 60.450 107.473 57.827  1.00 28.16 ? 325 TYR B CE1 1 
ATOM   6262  C  CE2 . TYR B 1 325 ? 58.732 107.090 56.188  1.00 28.56 ? 325 TYR B CE2 1 
ATOM   6263  C  CZ  . TYR B 1 325 ? 59.630 106.605 57.133  1.00 28.90 ? 325 TYR B CZ  1 
ATOM   6264  O  OH  . TYR B 1 325 ? 59.689 105.248 57.372  1.00 29.38 ? 325 TYR B OH  1 
ATOM   6265  N  N   . PHE B 1 326 ? 58.398 110.931 53.418  1.00 30.58 ? 326 PHE B N   1 
ATOM   6266  C  CA  . PHE B 1 326 ? 57.833 110.206 52.292  1.00 30.99 ? 326 PHE B CA  1 
ATOM   6267  C  C   . PHE B 1 326 ? 58.749 110.296 51.084  1.00 31.26 ? 326 PHE B C   1 
ATOM   6268  O  O   . PHE B 1 326 ? 59.012 109.298 50.411  1.00 31.08 ? 326 PHE B O   1 
ATOM   6269  C  CB  . PHE B 1 326 ? 56.443 110.761 51.920  1.00 30.32 ? 326 PHE B CB  1 
ATOM   6270  C  CG  . PHE B 1 326 ? 55.760 110.014 50.784  1.00 28.89 ? 326 PHE B CG  1 
ATOM   6271  C  CD1 . PHE B 1 326 ? 55.050 108.849 51.024  1.00 29.17 ? 326 PHE B CD1 1 
ATOM   6272  C  CD2 . PHE B 1 326 ? 55.850 110.471 49.471  1.00 28.91 ? 326 PHE B CD2 1 
ATOM   6273  C  CE1 . PHE B 1 326 ? 54.436 108.147 49.969  1.00 28.93 ? 326 PHE B CE1 1 
ATOM   6274  C  CE2 . PHE B 1 326 ? 55.239 109.773 48.412  1.00 28.12 ? 326 PHE B CE2 1 
ATOM   6275  C  CZ  . PHE B 1 326 ? 54.534 108.614 48.669  1.00 27.35 ? 326 PHE B CZ  1 
ATOM   6276  N  N   . ALA B 1 327 ? 59.245 111.494 50.817  1.00 31.13 ? 327 ALA B N   1 
ATOM   6277  C  CA  . ALA B 1 327 ? 60.086 111.687 49.657  1.00 31.77 ? 327 ALA B CA  1 
ATOM   6278  C  C   . ALA B 1 327 ? 61.455 111.053 49.769  1.00 32.27 ? 327 ALA B C   1 
ATOM   6279  O  O   . ALA B 1 327 ? 61.974 110.540 48.779  1.00 32.95 ? 327 ALA B O   1 
ATOM   6280  C  CB  . ALA B 1 327 ? 60.231 113.163 49.371  1.00 31.89 ? 327 ALA B CB  1 
ATOM   6281  N  N   . GLU B 1 328 ? 62.036 111.082 50.965  1.00 32.19 ? 328 GLU B N   1 
ATOM   6282  C  CA  . GLU B 1 328 ? 63.382 110.546 51.167  1.00 32.11 ? 328 GLU B CA  1 
ATOM   6283  C  C   . GLU B 1 328 ? 63.491 109.169 51.784  1.00 31.19 ? 328 GLU B C   1 
ATOM   6284  O  O   . GLU B 1 328 ? 64.522 108.520 51.639  1.00 31.88 ? 328 GLU B O   1 
ATOM   6285  C  CB  . GLU B 1 328 ? 64.223 111.510 52.008  1.00 33.08 ? 328 GLU B CB  1 
ATOM   6286  C  CG  . GLU B 1 328 ? 64.376 112.893 51.419  1.00 33.53 ? 328 GLU B CG  1 
ATOM   6287  C  CD  . GLU B 1 328 ? 65.151 113.810 52.333  1.00 33.99 ? 328 GLU B CD  1 
ATOM   6288  O  OE1 . GLU B 1 328 ? 66.403 113.722 52.344  1.00 36.55 ? 328 GLU B OE1 1 
ATOM   6289  O  OE2 . GLU B 1 328 ? 64.510 114.605 53.049  1.00 32.48 ? 328 GLU B OE2 1 
ATOM   6290  N  N   . VAL B 1 329 ? 62.458 108.711 52.475  1.00 30.17 ? 329 VAL B N   1 
ATOM   6291  C  CA  . VAL B 1 329 ? 62.541 107.388 53.079  1.00 29.96 ? 329 VAL B CA  1 
ATOM   6292  C  C   . VAL B 1 329 ? 61.578 106.366 52.475  1.00 29.72 ? 329 VAL B C   1 
ATOM   6293  O  O   . VAL B 1 329 ? 61.997 105.305 52.038  1.00 29.66 ? 329 VAL B O   1 
ATOM   6294  C  CB  . VAL B 1 329 ? 62.317 107.469 54.606  1.00 29.73 ? 329 VAL B CB  1 
ATOM   6295  C  CG1 . VAL B 1 329 ? 62.598 106.123 55.254  1.00 27.70 ? 329 VAL B CG1 1 
ATOM   6296  C  CG2 . VAL B 1 329 ? 63.224 108.534 55.195  1.00 29.85 ? 329 VAL B CG2 1 
ATOM   6297  N  N   . GLU B 1 330 ? 60.291 106.683 52.445  1.00 30.27 ? 330 GLU B N   1 
ATOM   6298  C  CA  . GLU B 1 330 ? 59.316 105.753 51.902  1.00 30.76 ? 330 GLU B CA  1 
ATOM   6299  C  C   . GLU B 1 330 ? 59.612 105.418 50.442  1.00 30.62 ? 330 GLU B C   1 
ATOM   6300  O  O   . GLU B 1 330 ? 59.567 104.251 50.051  1.00 30.25 ? 330 GLU B O   1 
ATOM   6301  C  CB  . GLU B 1 330 ? 57.903 106.329 52.028  1.00 31.47 ? 330 GLU B CB  1 
ATOM   6302  C  CG  . GLU B 1 330 ? 56.781 105.321 51.756  1.00 32.11 ? 330 GLU B CG  1 
ATOM   6303  C  CD  . GLU B 1 330 ? 56.814 104.110 52.697  1.00 33.53 ? 330 GLU B CD  1 
ATOM   6304  O  OE1 . GLU B 1 330 ? 56.995 104.302 53.921  1.00 33.64 ? 330 GLU B OE1 1 
ATOM   6305  O  OE2 . GLU B 1 330 ? 56.644 102.961 52.218  1.00 32.87 ? 330 GLU B OE2 1 
ATOM   6306  N  N   . GLN B 1 331 ? 59.939 106.437 49.650  1.00 29.47 ? 331 GLN B N   1 
ATOM   6307  C  CA  . GLN B 1 331 ? 60.212 106.237 48.235  1.00 29.58 ? 331 GLN B CA  1 
ATOM   6308  C  C   . GLN B 1 331 ? 61.607 105.763 47.848  1.00 29.63 ? 331 GLN B C   1 
ATOM   6309  O  O   . GLN B 1 331 ? 61.866 105.537 46.661  1.00 30.52 ? 331 GLN B O   1 
ATOM   6310  C  CB  . GLN B 1 331 ? 59.906 107.512 47.450  1.00 29.19 ? 331 GLN B CB  1 
ATOM   6311  C  CG  . GLN B 1 331 ? 58.457 107.945 47.490  1.00 30.27 ? 331 GLN B CG  1 
ATOM   6312  C  CD  . GLN B 1 331 ? 58.160 109.031 46.473  1.00 31.52 ? 331 GLN B CD  1 
ATOM   6313  O  OE1 . GLN B 1 331 ? 57.505 108.794 45.459  1.00 30.66 ? 331 GLN B OE1 1 
ATOM   6314  N  NE2 . GLN B 1 331 ? 58.660 110.236 46.736  1.00 33.05 ? 331 GLN B NE2 1 
ATOM   6315  N  N   . ILE B 1 332 ? 62.514 105.609 48.808  1.00 28.66 ? 332 ILE B N   1 
ATOM   6316  C  CA  . ILE B 1 332 ? 63.861 105.178 48.442  1.00 27.58 ? 332 ILE B CA  1 
ATOM   6317  C  C   . ILE B 1 332 ? 63.802 103.728 47.989  1.00 26.68 ? 332 ILE B C   1 
ATOM   6318  O  O   . ILE B 1 332 ? 62.971 102.961 48.459  1.00 26.80 ? 332 ILE B O   1 
ATOM   6319  C  CB  . ILE B 1 332 ? 64.894 105.373 49.620  1.00 27.29 ? 332 ILE B CB  1 
ATOM   6320  C  CG1 . ILE B 1 332 ? 66.311 105.162 49.085  1.00 27.49 ? 332 ILE B CG1 1 
ATOM   6321  C  CG2 . ILE B 1 332 ? 64.639 104.407 50.766  1.00 25.70 ? 332 ILE B CG2 1 
ATOM   6322  C  CD1 . ILE B 1 332 ? 67.392 105.616 50.027  1.00 27.15 ? 332 ILE B CD1 1 
ATOM   6323  N  N   . ALA B 1 333 ? 64.668 103.360 47.056  1.00 26.62 ? 333 ALA B N   1 
ATOM   6324  C  CA  . ALA B 1 333 ? 64.676 101.996 46.534  1.00 26.76 ? 333 ALA B CA  1 
ATOM   6325  C  C   . ALA B 1 333 ? 66.075 101.447 46.357  1.00 26.46 ? 333 ALA B C   1 
ATOM   6326  O  O   . ALA B 1 333 ? 66.882 102.033 45.644  1.00 26.61 ? 333 ALA B O   1 
ATOM   6327  C  CB  . ALA B 1 333 ? 63.940 101.946 45.200  1.00 26.40 ? 333 ALA B CB  1 
ATOM   6328  N  N   . PHE B 1 334 ? 66.356 100.317 47.003  1.00 26.81 ? 334 PHE B N   1 
ATOM   6329  C  CA  . PHE B 1 334 ? 67.668 99.687  46.890  1.00 26.35 ? 334 PHE B CA  1 
ATOM   6330  C  C   . PHE B 1 334 ? 67.588 98.407  46.059  1.00 25.94 ? 334 PHE B C   1 
ATOM   6331  O  O   . PHE B 1 334 ? 66.739 97.558  46.296  1.00 25.22 ? 334 PHE B O   1 
ATOM   6332  C  CB  . PHE B 1 334 ? 68.225 99.339  48.268  1.00 26.49 ? 334 PHE B CB  1 
ATOM   6333  C  CG  . PHE B 1 334 ? 68.270 100.494 49.228  1.00 27.48 ? 334 PHE B CG  1 
ATOM   6334  C  CD1 . PHE B 1 334 ? 67.182 100.781 50.046  1.00 28.04 ? 334 PHE B CD1 1 
ATOM   6335  C  CD2 . PHE B 1 334 ? 69.426 101.254 49.367  1.00 28.30 ? 334 PHE B CD2 1 
ATOM   6336  C  CE1 . PHE B 1 334 ? 67.245 101.798 50.999  1.00 28.67 ? 334 PHE B CE1 1 
ATOM   6337  C  CE2 . PHE B 1 334 ? 69.504 102.274 50.313  1.00 28.89 ? 334 PHE B CE2 1 
ATOM   6338  C  CZ  . PHE B 1 334 ? 68.409 102.546 51.135  1.00 28.93 ? 334 PHE B CZ  1 
ATOM   6339  N  N   . ASP B 1 335 ? 68.481 98.274  45.087  1.00 26.32 ? 335 ASP B N   1 
ATOM   6340  C  CA  . ASP B 1 335 ? 68.515 97.097  44.233  1.00 26.37 ? 335 ASP B CA  1 
ATOM   6341  C  C   . ASP B 1 335 ? 69.884 96.433  44.352  1.00 26.71 ? 335 ASP B C   1 
ATOM   6342  O  O   . ASP B 1 335 ? 70.894 97.004  43.946  1.00 26.96 ? 335 ASP B O   1 
ATOM   6343  C  CB  . ASP B 1 335 ? 68.289 97.473  42.763  1.00 26.65 ? 335 ASP B CB  1 
ATOM   6344  C  CG  . ASP B 1 335 ? 66.992 98.254  42.529  1.00 28.86 ? 335 ASP B CG  1 
ATOM   6345  O  OD1 . ASP B 1 335 ? 65.912 97.801  42.966  1.00 28.66 ? 335 ASP B OD1 1 
ATOM   6346  O  OD2 . ASP B 1 335 ? 67.052 99.324  41.881  1.00 30.01 ? 335 ASP B OD2 1 
ATOM   6347  N  N   . PRO B 1 336 ? 69.942 95.219  44.918  1.00 26.81 ? 336 PRO B N   1 
ATOM   6348  C  CA  . PRO B 1 336 ? 71.225 94.534  45.052  1.00 26.30 ? 336 PRO B CA  1 
ATOM   6349  C  C   . PRO B 1 336 ? 71.950 94.480  43.722  1.00 27.16 ? 336 PRO B C   1 
ATOM   6350  O  O   . PRO B 1 336 ? 73.168 94.427  43.683  1.00 28.40 ? 336 PRO B O   1 
ATOM   6351  C  CB  . PRO B 1 336 ? 70.824 93.148  45.527  1.00 25.59 ? 336 PRO B CB  1 
ATOM   6352  C  CG  . PRO B 1 336 ? 69.641 93.425  46.358  1.00 26.79 ? 336 PRO B CG  1 
ATOM   6353  C  CD  . PRO B 1 336 ? 68.866 94.444  45.557  1.00 26.56 ? 336 PRO B CD  1 
ATOM   6354  N  N   . SER B 1 337 ? 71.196 94.493  42.631  1.00 28.12 ? 337 SER B N   1 
ATOM   6355  C  CA  . SER B 1 337 ? 71.791 94.428  41.302  1.00 28.96 ? 337 SER B CA  1 
ATOM   6356  C  C   . SER B 1 337 ? 72.537 95.689  40.903  1.00 29.89 ? 337 SER B C   1 
ATOM   6357  O  O   . SER B 1 337 ? 73.208 95.721  39.863  1.00 30.44 ? 337 SER B O   1 
ATOM   6358  C  CB  . SER B 1 337 ? 70.727 94.105  40.258  1.00 27.90 ? 337 SER B CB  1 
ATOM   6359  O  OG  . SER B 1 337 ? 69.548 94.833  40.522  1.00 29.99 ? 337 SER B OG  1 
ATOM   6360  N  N   . ASN B 1 338 ? 72.404 96.739  41.709  1.00 30.83 ? 338 ASN B N   1 
ATOM   6361  C  CA  . ASN B 1 338 ? 73.127 97.978  41.439  1.00 31.45 ? 338 ASN B CA  1 
ATOM   6362  C  C   . ASN B 1 338 ? 74.558 97.791  41.934  1.00 31.71 ? 338 ASN B C   1 
ATOM   6363  O  O   . ASN B 1 338 ? 74.868 98.009  43.119  1.00 31.96 ? 338 ASN B O   1 
ATOM   6364  C  CB  . ASN B 1 338 ? 72.480 99.167  42.150  1.00 32.07 ? 338 ASN B CB  1 
ATOM   6365  C  CG  . ASN B 1 338 ? 71.223 99.628  41.464  1.00 32.90 ? 338 ASN B CG  1 
ATOM   6366  O  OD1 . ASN B 1 338 ? 71.015 99.349  40.278  1.00 33.01 ? 338 ASN B OD1 1 
ATOM   6367  N  ND2 . ASN B 1 338 ? 70.378 100.350 42.195  1.00 32.41 ? 338 ASN B ND2 1 
ATOM   6368  N  N   . MET B 1 339 ? 75.414 97.365  41.011  1.00 31.11 ? 339 MET B N   1 
ATOM   6369  C  CA  . MET B 1 339 ? 76.811 97.111  41.294  1.00 30.60 ? 339 MET B CA  1 
ATOM   6370  C  C   . MET B 1 339 ? 77.673 97.666  40.182  1.00 31.17 ? 339 MET B C   1 
ATOM   6371  O  O   . MET B 1 339 ? 77.495 97.332  39.001  1.00 31.05 ? 339 MET B O   1 
ATOM   6372  C  CB  . MET B 1 339 ? 77.056 95.608  41.449  1.00 30.41 ? 339 MET B CB  1 
ATOM   6373  C  CG  . MET B 1 339 ? 76.522 95.046  42.767  1.00 30.82 ? 339 MET B CG  1 
ATOM   6374  S  SD  . MET B 1 339 ? 76.769 93.266  42.957  1.00 31.33 ? 339 MET B SD  1 
ATOM   6375  C  CE  . MET B 1 339 ? 75.469 92.674  41.864  1.00 29.41 ? 339 MET B CE  1 
ATOM   6376  N  N   . PRO B 1 340 ? 78.622 98.540  40.550  1.00 30.66 ? 340 PRO B N   1 
ATOM   6377  C  CA  . PRO B 1 340 ? 79.550 99.183  39.621  1.00 29.93 ? 340 PRO B CA  1 
ATOM   6378  C  C   . PRO B 1 340 ? 80.770 98.324  39.348  1.00 29.80 ? 340 PRO B C   1 
ATOM   6379  O  O   . PRO B 1 340 ? 81.007 97.341  40.035  1.00 30.03 ? 340 PRO B O   1 
ATOM   6380  C  CB  . PRO B 1 340 ? 79.898 100.474 40.345  1.00 29.58 ? 340 PRO B CB  1 
ATOM   6381  C  CG  . PRO B 1 340 ? 79.930 100.032 41.766  1.00 29.57 ? 340 PRO B CG  1 
ATOM   6382  C  CD  . PRO B 1 340 ? 78.723 99.137  41.894  1.00 29.75 ? 340 PRO B CD  1 
ATOM   6383  N  N   . PRO B 1 341 ? 81.549 98.668  38.318  1.00 30.31 ? 341 PRO B N   1 
ATOM   6384  C  CA  . PRO B 1 341 ? 82.745 97.884  38.012  1.00 31.07 ? 341 PRO B CA  1 
ATOM   6385  C  C   . PRO B 1 341 ? 83.615 97.702  39.261  1.00 32.47 ? 341 PRO B C   1 
ATOM   6386  O  O   . PRO B 1 341 ? 83.881 98.667  39.998  1.00 32.55 ? 341 PRO B O   1 
ATOM   6387  C  CB  . PRO B 1 341 ? 83.430 98.724  36.948  1.00 30.25 ? 341 PRO B CB  1 
ATOM   6388  C  CG  . PRO B 1 341 ? 82.279 99.246  36.183  1.00 30.42 ? 341 PRO B CG  1 
ATOM   6389  C  CD  . PRO B 1 341 ? 81.327 99.692  37.287  1.00 30.18 ? 341 PRO B CD  1 
ATOM   6390  N  N   . GLY B 1 342 ? 84.053 96.465  39.488  1.00 32.43 ? 342 GLY B N   1 
ATOM   6391  C  CA  . GLY B 1 342 ? 84.868 96.170  40.649  1.00 33.07 ? 342 GLY B CA  1 
ATOM   6392  C  C   . GLY B 1 342 ? 84.086 95.352  41.663  1.00 33.12 ? 342 GLY B C   1 
ATOM   6393  O  O   . GLY B 1 342 ? 84.664 94.688  42.517  1.00 33.43 ? 342 GLY B O   1 
ATOM   6394  N  N   . ILE B 1 343 ? 82.763 95.403  41.568  1.00 33.04 ? 343 ILE B N   1 
ATOM   6395  C  CA  . ILE B 1 343 ? 81.896 94.653  42.469  1.00 33.17 ? 343 ILE B CA  1 
ATOM   6396  C  C   . ILE B 1 343 ? 80.885 93.871  41.630  1.00 33.16 ? 343 ILE B C   1 
ATOM   6397  O  O   . ILE B 1 343 ? 80.211 94.440  40.774  1.00 33.84 ? 343 ILE B O   1 
ATOM   6398  C  CB  . ILE B 1 343 ? 81.143 95.597  43.436  1.00 32.96 ? 343 ILE B CB  1 
ATOM   6399  C  CG1 . ILE B 1 343 ? 82.144 96.504  44.165  1.00 32.34 ? 343 ILE B CG1 1 
ATOM   6400  C  CG2 . ILE B 1 343 ? 80.350 94.777  44.434  1.00 31.84 ? 343 ILE B CG2 1 
ATOM   6401  C  CD1 . ILE B 1 343 ? 81.519 97.593  44.992  1.00 30.67 ? 343 ILE B CD1 1 
ATOM   6402  N  N   . GLU B 1 344 ? 80.800 92.566  41.858  1.00 33.02 ? 344 GLU B N   1 
ATOM   6403  C  CA  . GLU B 1 344 ? 79.874 91.712  41.110  1.00 33.38 ? 344 GLU B CA  1 
ATOM   6404  C  C   . GLU B 1 344 ? 79.230 90.686  42.033  1.00 32.95 ? 344 GLU B C   1 
ATOM   6405  O  O   . GLU B 1 344 ? 79.615 90.547  43.195  1.00 34.02 ? 344 GLU B O   1 
ATOM   6406  C  CB  . GLU B 1 344 ? 80.600 90.995  39.966  1.00 32.81 ? 344 GLU B CB  1 
ATOM   6407  C  CG  . GLU B 1 344 ? 81.203 91.940  38.943  1.00 34.01 ? 344 GLU B CG  1 
ATOM   6408  C  CD  . GLU B 1 344 ? 81.881 91.215  37.791  1.00 35.22 ? 344 GLU B CD  1 
ATOM   6409  O  OE1 . GLU B 1 344 ? 82.623 91.860  37.014  1.00 35.95 ? 344 GLU B OE1 1 
ATOM   6410  O  OE2 . GLU B 1 344 ? 81.665 89.997  37.651  1.00 36.84 ? 344 GLU B OE2 1 
ATOM   6411  N  N   . ALA B 1 345 ? 78.248 89.965  41.523  1.00 32.23 ? 345 ALA B N   1 
ATOM   6412  C  CA  . ALA B 1 345 ? 77.562 88.980  42.338  1.00 31.30 ? 345 ALA B CA  1 
ATOM   6413  C  C   . ALA B 1 345 ? 78.265 87.629  42.308  1.00 31.23 ? 345 ALA B C   1 
ATOM   6414  O  O   . ALA B 1 345 ? 79.007 87.330  41.372  1.00 31.38 ? 345 ALA B O   1 
ATOM   6415  C  CB  . ALA B 1 345 ? 76.131 88.834  41.860  1.00 30.93 ? 345 ALA B CB  1 
ATOM   6416  N  N   . SER B 1 346 ? 78.032 86.823  43.342  1.00 30.51 ? 346 SER B N   1 
ATOM   6417  C  CA  . SER B 1 346 ? 78.607 85.484  43.424  1.00 30.40 ? 346 SER B CA  1 
ATOM   6418  C  C   . SER B 1 346 ? 77.514 84.501  43.000  1.00 29.97 ? 346 SER B C   1 
ATOM   6419  O  O   . SER B 1 346 ? 76.404 84.907  42.675  1.00 30.55 ? 346 SER B O   1 
ATOM   6420  C  CB  . SER B 1 346 ? 79.005 85.176  44.857  1.00 30.17 ? 346 SER B CB  1 
ATOM   6421  O  OG  . SER B 1 346 ? 77.844 85.097  45.657  1.00 30.33 ? 346 SER B OG  1 
ATOM   6422  N  N   . PRO B 1 347 ? 77.819 83.196  42.978  1.00 29.34 ? 347 PRO B N   1 
ATOM   6423  C  CA  . PRO B 1 347 ? 76.775 82.249  42.586  1.00 28.49 ? 347 PRO B CA  1 
ATOM   6424  C  C   . PRO B 1 347 ? 75.711 82.046  43.649  1.00 28.30 ? 347 PRO B C   1 
ATOM   6425  O  O   . PRO B 1 347 ? 74.786 81.267  43.441  1.00 30.07 ? 347 PRO B O   1 
ATOM   6426  C  CB  . PRO B 1 347 ? 77.551 80.967  42.314  1.00 27.86 ? 347 PRO B CB  1 
ATOM   6427  C  CG  . PRO B 1 347 ? 78.832 81.474  41.801  1.00 28.48 ? 347 PRO B CG  1 
ATOM   6428  C  CD  . PRO B 1 347 ? 79.148 82.594  42.777  1.00 29.15 ? 347 PRO B CD  1 
ATOM   6429  N  N   . ASP B 1 348 ? 75.822 82.728  44.783  1.00 27.46 ? 348 ASP B N   1 
ATOM   6430  C  CA  . ASP B 1 348 ? 74.820 82.558  45.837  1.00 27.31 ? 348 ASP B CA  1 
ATOM   6431  C  C   . ASP B 1 348 ? 73.383 82.645  45.279  1.00 27.76 ? 348 ASP B C   1 
ATOM   6432  O  O   . ASP B 1 348 ? 72.915 83.703  44.841  1.00 26.89 ? 348 ASP B O   1 
ATOM   6433  C  CB  . ASP B 1 348 ? 75.015 83.607  46.932  1.00 27.53 ? 348 ASP B CB  1 
ATOM   6434  C  CG  . ASP B 1 348 ? 73.970 83.508  48.034  1.00 28.13 ? 348 ASP B CG  1 
ATOM   6435  O  OD1 . ASP B 1 348 ? 72.895 82.923  47.793  1.00 27.53 ? 348 ASP B OD1 1 
ATOM   6436  O  OD2 . ASP B 1 348 ? 74.219 84.031  49.143  1.00 29.58 ? 348 ASP B OD2 1 
ATOM   6437  N  N   . LYS B 1 349 ? 72.684 81.516  45.312  1.00 28.13 ? 349 LYS B N   1 
ATOM   6438  C  CA  . LYS B 1 349 ? 71.322 81.442  44.808  1.00 27.95 ? 349 LYS B CA  1 
ATOM   6439  C  C   . LYS B 1 349 ? 70.419 82.531  45.372  1.00 28.34 ? 349 LYS B C   1 
ATOM   6440  O  O   . LYS B 1 349 ? 69.697 83.182  44.613  1.00 28.92 ? 349 LYS B O   1 
ATOM   6441  C  CB  . LYS B 1 349 ? 70.745 80.058  45.091  1.00 26.77 ? 349 LYS B CB  1 
ATOM   6442  C  CG  . LYS B 1 349 ? 71.514 78.956  44.388  1.00 26.97 ? 349 LYS B CG  1 
ATOM   6443  C  CD  . LYS B 1 349 ? 70.960 77.593  44.730  1.00 27.73 ? 349 LYS B CD  1 
ATOM   6444  C  CE  . LYS B 1 349 ? 71.616 76.515  43.920  1.00 27.60 ? 349 LYS B CE  1 
ATOM   6445  N  NZ  . LYS B 1 349 ? 70.983 75.214  44.253  1.00 28.23 ? 349 LYS B NZ  1 
ATOM   6446  N  N   . MET B 1 350 ? 70.455 82.737  46.691  1.00 27.35 ? 350 MET B N   1 
ATOM   6447  C  CA  . MET B 1 350 ? 69.632 83.768  47.293  1.00 26.82 ? 350 MET B CA  1 
ATOM   6448  C  C   . MET B 1 350 ? 69.872 85.120  46.603  1.00 27.58 ? 350 MET B C   1 
ATOM   6449  O  O   . MET B 1 350 ? 68.935 85.782  46.165  1.00 28.33 ? 350 MET B O   1 
ATOM   6450  C  CB  . MET B 1 350 ? 69.935 83.894  48.781  1.00 26.40 ? 350 MET B CB  1 
ATOM   6451  C  CG  . MET B 1 350 ? 69.481 82.725  49.618  1.00 26.78 ? 350 MET B CG  1 
ATOM   6452  S  SD  . MET B 1 350 ? 67.692 82.551  49.753  1.00 27.76 ? 350 MET B SD  1 
ATOM   6453  C  CE  . MET B 1 350 ? 67.343 83.576  51.185  1.00 27.89 ? 350 MET B CE  1 
ATOM   6454  N  N   . LEU B 1 351 ? 71.130 85.523  46.504  1.00 27.65 ? 351 LEU B N   1 
ATOM   6455  C  CA  . LEU B 1 351 ? 71.470 86.788  45.882  1.00 27.71 ? 351 LEU B CA  1 
ATOM   6456  C  C   . LEU B 1 351 ? 71.048 86.809  44.416  1.00 28.50 ? 351 LEU B C   1 
ATOM   6457  O  O   . LEU B 1 351 ? 70.578 87.825  43.902  1.00 28.88 ? 351 LEU B O   1 
ATOM   6458  C  CB  . LEU B 1 351 ? 72.975 87.025  45.992  1.00 26.41 ? 351 LEU B CB  1 
ATOM   6459  C  CG  . LEU B 1 351 ? 73.491 88.353  45.434  1.00 26.57 ? 351 LEU B CG  1 
ATOM   6460  C  CD1 . LEU B 1 351 ? 72.927 89.500  46.272  1.00 24.25 ? 351 LEU B CD1 1 
ATOM   6461  C  CD2 . LEU B 1 351 ? 75.036 88.368  45.441  1.00 25.56 ? 351 LEU B CD2 1 
ATOM   6462  N  N   . GLN B 1 352 ? 71.229 85.682  43.741  1.00 29.24 ? 352 GLN B N   1 
ATOM   6463  C  CA  . GLN B 1 352 ? 70.868 85.583  42.331  1.00 29.22 ? 352 GLN B CA  1 
ATOM   6464  C  C   . GLN B 1 352 ? 69.397 85.927  42.152  1.00 28.87 ? 352 GLN B C   1 
ATOM   6465  O  O   . GLN B 1 352 ? 69.013 86.600  41.194  1.00 27.94 ? 352 GLN B O   1 
ATOM   6466  C  CB  . GLN B 1 352 ? 71.157 84.173  41.810  1.00 28.85 ? 352 GLN B CB  1 
ATOM   6467  C  CG  . GLN B 1 352 ? 72.637 83.870  41.613  1.00 27.82 ? 352 GLN B CG  1 
ATOM   6468  C  CD  . GLN B 1 352 ? 73.226 84.514  40.350  1.00 29.14 ? 352 GLN B CD  1 
ATOM   6469  O  OE1 . GLN B 1 352 ? 72.774 84.265  39.224  1.00 27.44 ? 352 GLN B OE1 1 
ATOM   6470  N  NE2 . GLN B 1 352 ? 74.252 85.329  40.538  1.00 28.95 ? 352 GLN B NE2 1 
ATOM   6471  N  N   . GLY B 1 353 ? 68.578 85.477  43.092  1.00 28.71 ? 353 GLY B N   1 
ATOM   6472  C  CA  . GLY B 1 353 ? 67.159 85.767  43.012  1.00 29.50 ? 353 GLY B CA  1 
ATOM   6473  C  C   . GLY B 1 353 ? 66.840 87.215  43.344  1.00 30.31 ? 353 GLY B C   1 
ATOM   6474  O  O   . GLY B 1 353 ? 65.866 87.778  42.833  1.00 30.42 ? 353 GLY B O   1 
ATOM   6475  N  N   . ARG B 1 354 ? 67.658 87.817  44.207  1.00 30.54 ? 354 ARG B N   1 
ATOM   6476  C  CA  . ARG B 1 354 ? 67.464 89.205  44.608  1.00 29.70 ? 354 ARG B CA  1 
ATOM   6477  C  C   . ARG B 1 354 ? 67.851 90.148  43.485  1.00 28.22 ? 354 ARG B C   1 
ATOM   6478  O  O   . ARG B 1 354 ? 67.497 91.314  43.499  1.00 28.53 ? 354 ARG B O   1 
ATOM   6479  C  CB  . ARG B 1 354 ? 68.294 89.525  45.851  1.00 30.63 ? 354 ARG B CB  1 
ATOM   6480  C  CG  . ARG B 1 354 ? 67.969 88.650  47.043  1.00 31.87 ? 354 ARG B CG  1 
ATOM   6481  C  CD  . ARG B 1 354 ? 68.800 89.060  48.233  1.00 32.77 ? 354 ARG B CD  1 
ATOM   6482  N  NE  . ARG B 1 354 ? 68.446 90.395  48.683  1.00 35.13 ? 354 ARG B NE  1 
ATOM   6483  C  CZ  . ARG B 1 354 ? 69.248 91.177  49.401  1.00 37.10 ? 354 ARG B CZ  1 
ATOM   6484  N  NH1 . ARG B 1 354 ? 70.458 90.753  49.748  1.00 37.50 ? 354 ARG B NH1 1 
ATOM   6485  N  NH2 . ARG B 1 354 ? 68.839 92.385  49.776  1.00 37.66 ? 354 ARG B NH2 1 
ATOM   6486  N  N   . LEU B 1 355 ? 68.583 89.644  42.505  1.00 27.07 ? 355 LEU B N   1 
ATOM   6487  C  CA  . LEU B 1 355 ? 68.988 90.492  41.394  1.00 26.21 ? 355 LEU B CA  1 
ATOM   6488  C  C   . LEU B 1 355 ? 67.775 90.856  40.549  1.00 25.91 ? 355 LEU B C   1 
ATOM   6489  O  O   . LEU B 1 355 ? 67.743 91.891  39.896  1.00 25.82 ? 355 LEU B O   1 
ATOM   6490  C  CB  . LEU B 1 355 ? 70.044 89.781  40.541  1.00 24.54 ? 355 LEU B CB  1 
ATOM   6491  C  CG  . LEU B 1 355 ? 71.391 89.575  41.233  1.00 23.33 ? 355 LEU B CG  1 
ATOM   6492  C  CD1 . LEU B 1 355 ? 72.307 88.687  40.412  1.00 22.61 ? 355 LEU B CD1 1 
ATOM   6493  C  CD2 . LEU B 1 355 ? 72.014 90.911  41.436  1.00 22.38 ? 355 LEU B CD2 1 
ATOM   6494  N  N   . PHE B 1 356 ? 66.766 90.003  40.589  1.00 26.52 ? 356 PHE B N   1 
ATOM   6495  C  CA  . PHE B 1 356 ? 65.560 90.226  39.827  1.00 26.81 ? 356 PHE B CA  1 
ATOM   6496  C  C   . PHE B 1 356 ? 64.437 90.854  40.656  1.00 27.54 ? 356 PHE B C   1 
ATOM   6497  O  O   . PHE B 1 356 ? 63.756 91.781  40.215  1.00 28.62 ? 356 PHE B O   1 
ATOM   6498  C  CB  . PHE B 1 356 ? 65.065 88.900  39.254  1.00 27.01 ? 356 PHE B CB  1 
ATOM   6499  C  CG  . PHE B 1 356 ? 63.614 88.922  38.895  1.00 28.37 ? 356 PHE B CG  1 
ATOM   6500  C  CD1 . PHE B 1 356 ? 63.173 89.635  37.780  1.00 28.97 ? 356 PHE B CD1 1 
ATOM   6501  C  CD2 . PHE B 1 356 ? 62.668 88.346  39.747  1.00 27.93 ? 356 PHE B CD2 1 
ATOM   6502  C  CE1 . PHE B 1 356 ? 61.814 89.782  37.529  1.00 29.39 ? 356 PHE B CE1 1 
ATOM   6503  C  CE2 . PHE B 1 356 ? 61.312 88.484  39.510  1.00 26.85 ? 356 PHE B CE2 1 
ATOM   6504  C  CZ  . PHE B 1 356 ? 60.878 89.203  38.405  1.00 29.28 ? 356 PHE B CZ  1 
ATOM   6505  N  N   . ALA B 1 357 ? 64.240 90.336  41.856  1.00 27.01 ? 357 ALA B N   1 
ATOM   6506  C  CA  . ALA B 1 357 ? 63.167 90.795  42.725  1.00 27.07 ? 357 ALA B CA  1 
ATOM   6507  C  C   . ALA B 1 357 ? 63.054 92.297  43.017  1.00 27.83 ? 357 ALA B C   1 
ATOM   6508  O  O   . ALA B 1 357 ? 61.962 92.874  42.892  1.00 28.48 ? 357 ALA B O   1 
ATOM   6509  C  CB  . ALA B 1 357 ? 63.211 90.008  44.043  1.00 26.21 ? 357 ALA B CB  1 
ATOM   6510  N  N   . TYR B 1 358 ? 64.159 92.943  43.384  1.00 26.82 ? 358 TYR B N   1 
ATOM   6511  C  CA  . TYR B 1 358 ? 64.085 94.354  43.731  1.00 25.79 ? 358 TYR B CA  1 
ATOM   6512  C  C   . TYR B 1 358 ? 63.674 95.306  42.603  1.00 25.38 ? 358 TYR B C   1 
ATOM   6513  O  O   . TYR B 1 358 ? 62.733 96.089  42.773  1.00 25.57 ? 358 TYR B O   1 
ATOM   6514  C  CB  . TYR B 1 358 ? 65.387 94.780  44.423  1.00 25.87 ? 358 TYR B CB  1 
ATOM   6515  C  CG  . TYR B 1 358 ? 65.585 94.104  45.785  1.00 26.51 ? 358 TYR B CG  1 
ATOM   6516  C  CD1 . TYR B 1 358 ? 65.709 92.716  45.894  1.00 26.19 ? 358 TYR B CD1 1 
ATOM   6517  C  CD2 . TYR B 1 358 ? 65.665 94.856  46.962  1.00 26.51 ? 358 TYR B CD2 1 
ATOM   6518  C  CE1 . TYR B 1 358 ? 65.914 92.098  47.137  1.00 26.86 ? 358 TYR B CE1 1 
ATOM   6519  C  CE2 . TYR B 1 358 ? 65.867 94.245  48.213  1.00 26.49 ? 358 TYR B CE2 1 
ATOM   6520  C  CZ  . TYR B 1 358 ? 65.992 92.867  48.291  1.00 26.93 ? 358 TYR B CZ  1 
ATOM   6521  O  OH  . TYR B 1 358 ? 66.201 92.263  49.514  1.00 28.44 ? 358 TYR B OH  1 
ATOM   6522  N  N   . PRO B 1 359 ? 64.368 95.289  41.451  1.00 24.70 ? 359 PRO B N   1 
ATOM   6523  C  CA  . PRO B 1 359 ? 63.884 96.228  40.424  1.00 24.83 ? 359 PRO B CA  1 
ATOM   6524  C  C   . PRO B 1 359 ? 62.424 95.910  40.070  1.00 25.35 ? 359 PRO B C   1 
ATOM   6525  O  O   . PRO B 1 359 ? 61.586 96.803  39.896  1.00 26.15 ? 359 PRO B O   1 
ATOM   6526  C  CB  . PRO B 1 359 ? 64.837 95.985  39.260  1.00 23.45 ? 359 PRO B CB  1 
ATOM   6527  C  CG  . PRO B 1 359 ? 66.111 95.710  39.949  1.00 22.86 ? 359 PRO B CG  1 
ATOM   6528  C  CD  . PRO B 1 359 ? 65.710 94.789  41.105  1.00 24.09 ? 359 PRO B CD  1 
ATOM   6529  N  N   . ASP B 1 360 ? 62.125 94.619  40.000  1.00 26.21 ? 360 ASP B N   1 
ATOM   6530  C  CA  . ASP B 1 360 ? 60.785 94.144  39.688  1.00 27.05 ? 360 ASP B CA  1 
ATOM   6531  C  C   . ASP B 1 360 ? 59.752 94.752  40.632  1.00 27.18 ? 360 ASP B C   1 
ATOM   6532  O  O   . ASP B 1 360 ? 58.804 95.404  40.190  1.00 27.91 ? 360 ASP B O   1 
ATOM   6533  C  CB  . ASP B 1 360 ? 60.738 92.617  39.788  1.00 27.07 ? 360 ASP B CB  1 
ATOM   6534  C  CG  . ASP B 1 360 ? 59.384 92.052  39.413  1.00 28.28 ? 360 ASP B CG  1 
ATOM   6535  O  OD1 . ASP B 1 360 ? 58.932 92.272  38.268  1.00 28.31 ? 360 ASP B OD1 1 
ATOM   6536  O  OD2 . ASP B 1 360 ? 58.769 91.386  40.268  1.00 28.61 ? 360 ASP B OD2 1 
ATOM   6537  N  N   . THR B 1 361 ? 59.938 94.544  41.931  1.00 26.12 ? 361 THR B N   1 
ATOM   6538  C  CA  . THR B 1 361 ? 59.010 95.074  42.914  1.00 25.35 ? 361 THR B CA  1 
ATOM   6539  C  C   . THR B 1 361 ? 59.014 96.618  42.955  1.00 25.33 ? 361 THR B C   1 
ATOM   6540  O  O   . THR B 1 361 ? 58.004 97.242  43.303  1.00 25.40 ? 361 THR B O   1 
ATOM   6541  C  CB  . THR B 1 361 ? 59.339 94.508  44.318  1.00 25.51 ? 361 THR B CB  1 
ATOM   6542  O  OG1 . THR B 1 361 ? 58.219 94.709  45.189  1.00 26.52 ? 361 THR B OG1 1 
ATOM   6543  C  CG2 . THR B 1 361 ? 60.565 95.216  44.914  1.00 25.79 ? 361 THR B CG2 1 
ATOM   6544  N  N   . HIS B 1 362 ? 60.139 97.237  42.603  1.00 24.90 ? 362 HIS B N   1 
ATOM   6545  C  CA  . HIS B 1 362 ? 60.214 98.694  42.617  1.00 25.94 ? 362 HIS B CA  1 
ATOM   6546  C  C   . HIS B 1 362 ? 59.393 99.300  41.488  1.00 26.34 ? 362 HIS B C   1 
ATOM   6547  O  O   . HIS B 1 362 ? 58.755 100.341 41.661  1.00 26.65 ? 362 HIS B O   1 
ATOM   6548  C  CB  . HIS B 1 362 ? 61.672 99.168  42.547  1.00 25.87 ? 362 HIS B CB  1 
ATOM   6549  C  CG  . HIS B 1 362 ? 62.417 98.991  43.835  1.00 26.47 ? 362 HIS B CG  1 
ATOM   6550  N  ND1 . HIS B 1 362 ? 63.735 98.590  43.886  1.00 26.02 ? 362 HIS B ND1 1 
ATOM   6551  C  CD2 . HIS B 1 362 ? 62.006 99.095  45.122  1.00 25.53 ? 362 HIS B CD2 1 
ATOM   6552  C  CE1 . HIS B 1 362 ? 64.100 98.445  45.148  1.00 25.35 ? 362 HIS B CE1 1 
ATOM   6553  N  NE2 . HIS B 1 362 ? 63.070 98.744  45.919  1.00 24.81 ? 362 HIS B NE2 1 
ATOM   6554  N  N   . ARG B 1 363 ? 59.393 98.656  40.329  1.00 26.18 ? 363 ARG B N   1 
ATOM   6555  C  CA  . ARG B 1 363 ? 58.594 99.177  39.236  1.00 25.96 ? 363 ARG B CA  1 
ATOM   6556  C  C   . ARG B 1 363 ? 57.127 99.038  39.618  1.00 26.49 ? 363 ARG B C   1 
ATOM   6557  O  O   . ARG B 1 363 ? 56.261 99.670  39.014  1.00 27.19 ? 363 ARG B O   1 
ATOM   6558  C  CB  . ARG B 1 363 ? 58.875 98.402  37.956  1.00 25.37 ? 363 ARG B CB  1 
ATOM   6559  C  CG  . ARG B 1 363 ? 60.287 98.576  37.469  1.00 24.22 ? 363 ARG B CG  1 
ATOM   6560  C  CD  . ARG B 1 363 ? 60.807 97.308  36.868  1.00 23.35 ? 363 ARG B CD  1 
ATOM   6561  N  NE  . ARG B 1 363 ? 62.194 97.476  36.477  1.00 24.26 ? 363 ARG B NE  1 
ATOM   6562  C  CZ  . ARG B 1 363 ? 63.085 96.495  36.430  1.00 25.01 ? 363 ARG B CZ  1 
ATOM   6563  N  NH1 . ARG B 1 363 ? 62.737 95.257  36.755  1.00 25.21 ? 363 ARG B NH1 1 
ATOM   6564  N  NH2 . ARG B 1 363 ? 64.326 96.754  36.052  1.00 26.48 ? 363 ARG B NH2 1 
ATOM   6565  N  N   . HIS B 1 364 ? 56.842 98.208  40.620  1.00 26.12 ? 364 HIS B N   1 
ATOM   6566  C  CA  . HIS B 1 364 ? 55.457 98.018  41.060  1.00 26.11 ? 364 HIS B CA  1 
ATOM   6567  C  C   . HIS B 1 364 ? 55.091 98.978  42.184  1.00 26.35 ? 364 HIS B C   1 
ATOM   6568  O  O   . HIS B 1 364 ? 54.145 99.758  42.069  1.00 25.77 ? 364 HIS B O   1 
ATOM   6569  C  CB  . HIS B 1 364 ? 55.224 96.582  41.529  1.00 24.95 ? 364 HIS B CB  1 
ATOM   6570  C  CG  . HIS B 1 364 ? 53.969 96.405  42.327  1.00 25.18 ? 364 HIS B CG  1 
ATOM   6571  N  ND1 . HIS B 1 364 ? 52.710 96.482  41.768  1.00 24.81 ? 364 HIS B ND1 1 
ATOM   6572  C  CD2 . HIS B 1 364 ? 53.779 96.189  43.652  1.00 24.25 ? 364 HIS B CD2 1 
ATOM   6573  C  CE1 . HIS B 1 364 ? 51.802 96.322  42.715  1.00 23.88 ? 364 HIS B CE1 1 
ATOM   6574  N  NE2 . HIS B 1 364 ? 52.425 96.143  43.867  1.00 23.50 ? 364 HIS B NE2 1 
ATOM   6575  N  N   . ARG B 1 365 ? 55.844 98.910  43.273  1.00 26.47 ? 365 ARG B N   1 
ATOM   6576  C  CA  . ARG B 1 365 ? 55.593 99.765  44.414  1.00 26.29 ? 365 ARG B CA  1 
ATOM   6577  C  C   . ARG B 1 365 ? 55.704 101.237 44.076  1.00 26.49 ? 365 ARG B C   1 
ATOM   6578  O  O   . ARG B 1 365 ? 54.854 102.035 44.479  1.00 26.93 ? 365 ARG B O   1 
ATOM   6579  C  CB  . ARG B 1 365 ? 56.580 99.452  45.542  1.00 26.81 ? 365 ARG B CB  1 
ATOM   6580  C  CG  . ARG B 1 365 ? 56.531 100.449 46.691  1.00 27.29 ? 365 ARG B CG  1 
ATOM   6581  C  CD  . ARG B 1 365 ? 57.208 99.910  47.932  1.00 28.01 ? 365 ARG B CD  1 
ATOM   6582  N  NE  . ARG B 1 365 ? 58.662 99.945  47.848  1.00 30.30 ? 365 ARG B NE  1 
ATOM   6583  C  CZ  . ARG B 1 365 ? 59.401 101.043 48.004  1.00 31.41 ? 365 ARG B CZ  1 
ATOM   6584  N  NH1 . ARG B 1 365 ? 58.816 102.212 48.249  1.00 32.19 ? 365 ARG B NH1 1 
ATOM   6585  N  NH2 . ARG B 1 365 ? 60.726 100.973 47.936  1.00 29.19 ? 365 ARG B NH2 1 
ATOM   6586  N  N   . LEU B 1 366 ? 56.762 101.598 43.351  1.00 26.43 ? 366 LEU B N   1 
ATOM   6587  C  CA  . LEU B 1 366 ? 57.009 102.993 43.013  1.00 26.98 ? 366 LEU B CA  1 
ATOM   6588  C  C   . LEU B 1 366 ? 56.653 103.410 41.599  1.00 27.38 ? 366 LEU B C   1 
ATOM   6589  O  O   . LEU B 1 366 ? 56.043 104.443 41.398  1.00 28.68 ? 366 LEU B O   1 
ATOM   6590  C  CB  . LEU B 1 366 ? 58.464 103.334 43.291  1.00 26.11 ? 366 LEU B CB  1 
ATOM   6591  C  CG  . LEU B 1 366 ? 58.922 103.088 44.726  1.00 26.34 ? 366 LEU B CG  1 
ATOM   6592  C  CD1 . LEU B 1 366 ? 60.440 103.199 44.788  1.00 26.33 ? 366 LEU B CD1 1 
ATOM   6593  C  CD2 . LEU B 1 366 ? 58.261 104.077 45.673  1.00 25.36 ? 366 LEU B CD2 1 
ATOM   6594  N  N   . GLY B 1 367 ? 57.042 102.628 40.609  1.00 27.57 ? 367 GLY B N   1 
ATOM   6595  C  CA  . GLY B 1 367 ? 56.698 103.008 39.257  1.00 27.44 ? 367 GLY B CA  1 
ATOM   6596  C  C   . GLY B 1 367 ? 57.800 102.724 38.275  1.00 27.73 ? 367 GLY B C   1 
ATOM   6597  O  O   . GLY B 1 367 ? 58.977 102.727 38.625  1.00 28.09 ? 367 GLY B O   1 
ATOM   6598  N  N   . PRO B 1 368 ? 57.440 102.475 37.016  1.00 28.19 ? 368 PRO B N   1 
ATOM   6599  C  CA  . PRO B 1 368 ? 58.412 102.183 35.954  1.00 28.23 ? 368 PRO B CA  1 
ATOM   6600  C  C   . PRO B 1 368 ? 59.664 103.071 35.996  1.00 28.00 ? 368 PRO B C   1 
ATOM   6601  O  O   . PRO B 1 368 ? 60.777 102.596 35.784  1.00 28.46 ? 368 PRO B O   1 
ATOM   6602  C  CB  . PRO B 1 368 ? 57.590 102.387 34.689  1.00 28.09 ? 368 PRO B CB  1 
ATOM   6603  C  CG  . PRO B 1 368 ? 56.234 101.888 35.112  1.00 28.52 ? 368 PRO B CG  1 
ATOM   6604  C  CD  . PRO B 1 368 ? 56.063 102.487 36.493  1.00 27.45 ? 368 PRO B CD  1 
ATOM   6605  N  N   . ASN B 1 369 ? 59.476 104.355 36.284  1.00 27.66 ? 369 ASN B N   1 
ATOM   6606  C  CA  . ASN B 1 369 ? 60.591 105.290 36.340  1.00 26.65 ? 369 ASN B CA  1 
ATOM   6607  C  C   . ASN B 1 369 ? 61.033 105.658 37.753  1.00 26.51 ? 369 ASN B C   1 
ATOM   6608  O  O   . ASN B 1 369 ? 61.529 106.757 37.973  1.00 26.96 ? 369 ASN B O   1 
ATOM   6609  C  CB  . ASN B 1 369 ? 60.245 106.566 35.570  1.00 25.39 ? 369 ASN B CB  1 
ATOM   6610  C  CG  . ASN B 1 369 ? 60.178 106.343 34.063  1.00 26.43 ? 369 ASN B CG  1 
ATOM   6611  O  OD1 . ASN B 1 369 ? 61.144 105.899 33.454  1.00 26.76 ? 369 ASN B OD1 1 
ATOM   6612  N  ND2 . ASN B 1 369 ? 59.042 106.661 33.460  1.00 25.41 ? 369 ASN B ND2 1 
ATOM   6613  N  N   . TYR B 1 370 ? 60.901 104.746 38.706  1.00 26.06 ? 370 TYR B N   1 
ATOM   6614  C  CA  . TYR B 1 370 ? 61.292 105.075 40.078  1.00 26.98 ? 370 TYR B CA  1 
ATOM   6615  C  C   . TYR B 1 370 ? 62.721 105.604 40.227  1.00 27.36 ? 370 TYR B C   1 
ATOM   6616  O  O   . TYR B 1 370 ? 63.029 106.285 41.207  1.00 28.04 ? 370 TYR B O   1 
ATOM   6617  C  CB  . TYR B 1 370 ? 61.124 103.863 40.990  1.00 26.88 ? 370 TYR B CB  1 
ATOM   6618  C  CG  . TYR B 1 370 ? 62.154 102.780 40.748  1.00 28.74 ? 370 TYR B CG  1 
ATOM   6619  C  CD1 . TYR B 1 370 ? 63.258 102.644 41.583  1.00 28.17 ? 370 TYR B CD1 1 
ATOM   6620  C  CD2 . TYR B 1 370 ? 62.006 101.873 39.691  1.00 29.10 ? 370 TYR B CD2 1 
ATOM   6621  C  CE1 . TYR B 1 370 ? 64.181 101.630 41.381  1.00 29.93 ? 370 TYR B CE1 1 
ATOM   6622  C  CE2 . TYR B 1 370 ? 62.925 100.854 39.483  1.00 29.56 ? 370 TYR B CE2 1 
ATOM   6623  C  CZ  . TYR B 1 370 ? 64.005 100.732 40.333  1.00 29.75 ? 370 TYR B CZ  1 
ATOM   6624  O  OH  . TYR B 1 370 ? 64.873 99.680  40.179  1.00 30.45 ? 370 TYR B OH  1 
ATOM   6625  N  N   . LEU B 1 371 ? 63.597 105.288 39.280  1.00 27.14 ? 371 LEU B N   1 
ATOM   6626  C  CA  . LEU B 1 371 ? 64.970 105.760 39.367  1.00 27.40 ? 371 LEU B CA  1 
ATOM   6627  C  C   . LEU B 1 371 ? 65.097 107.264 39.133  1.00 28.73 ? 371 LEU B C   1 
ATOM   6628  O  O   . LEU B 1 371 ? 66.171 107.827 39.350  1.00 28.90 ? 371 LEU B O   1 
ATOM   6629  C  CB  . LEU B 1 371 ? 65.867 105.005 38.386  1.00 26.50 ? 371 LEU B CB  1 
ATOM   6630  C  CG  . LEU B 1 371 ? 66.161 103.543 38.726  1.00 26.18 ? 371 LEU B CG  1 
ATOM   6631  C  CD1 . LEU B 1 371 ? 66.945 102.903 37.600  1.00 25.07 ? 371 LEU B CD1 1 
ATOM   6632  C  CD2 . LEU B 1 371 ? 66.932 103.461 40.021  1.00 26.43 ? 371 LEU B CD2 1 
ATOM   6633  N  N   . HIS B 1 372 ? 64.013 107.906 38.685  1.00 30.08 ? 372 HIS B N   1 
ATOM   6634  C  CA  . HIS B 1 372 ? 63.996 109.358 38.462  1.00 31.56 ? 372 HIS B CA  1 
ATOM   6635  C  C   . HIS B 1 372 ? 63.647 110.091 39.759  1.00 31.07 ? 372 HIS B C   1 
ATOM   6636  O  O   . HIS B 1 372 ? 63.736 111.312 39.844  1.00 30.65 ? 372 HIS B O   1 
ATOM   6637  C  CB  . HIS B 1 372 ? 62.954 109.754 37.424  1.00 33.98 ? 372 HIS B CB  1 
ATOM   6638  C  CG  . HIS B 1 372 ? 63.251 109.259 36.049  1.00 38.44 ? 372 HIS B CG  1 
ATOM   6639  N  ND1 . HIS B 1 372 ? 64.499 108.814 35.671  1.00 39.79 ? 372 HIS B ND1 1 
ATOM   6640  C  CD2 . HIS B 1 372 ? 62.467 109.171 34.947  1.00 40.31 ? 372 HIS B CD2 1 
ATOM   6641  C  CE1 . HIS B 1 372 ? 64.473 108.470 34.395  1.00 41.02 ? 372 HIS B CE1 1 
ATOM   6642  N  NE2 . HIS B 1 372 ? 63.252 108.678 33.931  1.00 41.78 ? 372 HIS B NE2 1 
ATOM   6643  N  N   . ILE B 1 373 ? 63.204 109.340 40.757  1.00 30.66 ? 373 ILE B N   1 
ATOM   6644  C  CA  . ILE B 1 373 ? 62.863 109.933 42.030  1.00 30.15 ? 373 ILE B CA  1 
ATOM   6645  C  C   . ILE B 1 373 ? 64.164 110.433 42.646  1.00 30.54 ? 373 ILE B C   1 
ATOM   6646  O  O   . ILE B 1 373 ? 65.135 109.683 42.775  1.00 31.77 ? 373 ILE B O   1 
ATOM   6647  C  CB  . ILE B 1 373 ? 62.212 108.903 42.941  1.00 29.50 ? 373 ILE B CB  1 
ATOM   6648  C  CG1 . ILE B 1 373 ? 60.952 108.367 42.267  1.00 29.50 ? 373 ILE B CG1 1 
ATOM   6649  C  CG2 . ILE B 1 373 ? 61.936 109.514 44.304  1.00 28.40 ? 373 ILE B CG2 1 
ATOM   6650  C  CD1 . ILE B 1 373 ? 60.143 107.425 43.126  1.00 30.03 ? 373 ILE B CD1 1 
ATOM   6651  N  N   . PRO B 1 374 ? 64.209 111.714 43.025  1.00 30.63 ? 374 PRO B N   1 
ATOM   6652  C  CA  . PRO B 1 374 ? 65.423 112.273 43.620  1.00 30.05 ? 374 PRO B CA  1 
ATOM   6653  C  C   . PRO B 1 374 ? 66.309 111.324 44.437  1.00 30.55 ? 374 PRO B C   1 
ATOM   6654  O  O   . PRO B 1 374 ? 67.475 111.166 44.100  1.00 31.87 ? 374 PRO B O   1 
ATOM   6655  C  CB  . PRO B 1 374 ? 64.888 113.444 44.430  1.00 30.38 ? 374 PRO B CB  1 
ATOM   6656  C  CG  . PRO B 1 374 ? 63.798 113.961 43.518  1.00 29.85 ? 374 PRO B CG  1 
ATOM   6657  C  CD  . PRO B 1 374 ? 63.107 112.697 43.042  1.00 30.00 ? 374 PRO B CD  1 
ATOM   6658  N  N   . VAL B 1 375 ? 65.802 110.676 45.486  1.00 29.72 ? 375 VAL B N   1 
ATOM   6659  C  CA  . VAL B 1 375 ? 66.699 109.810 46.248  1.00 29.92 ? 375 VAL B CA  1 
ATOM   6660  C  C   . VAL B 1 375 ? 67.214 108.592 45.517  1.00 30.40 ? 375 VAL B C   1 
ATOM   6661  O  O   . VAL B 1 375 ? 68.250 108.048 45.887  1.00 31.37 ? 375 VAL B O   1 
ATOM   6662  C  CB  . VAL B 1 375 ? 66.099 109.294 47.572  1.00 30.04 ? 375 VAL B CB  1 
ATOM   6663  C  CG1 . VAL B 1 375 ? 66.070 110.397 48.593  1.00 30.02 ? 375 VAL B CG1 1 
ATOM   6664  C  CG2 . VAL B 1 375 ? 64.722 108.702 47.331  1.00 30.27 ? 375 VAL B CG2 1 
ATOM   6665  N  N   . ASN B 1 376 ? 66.520 108.141 44.486  1.00 30.23 ? 376 ASN B N   1 
ATOM   6666  C  CA  . ASN B 1 376 ? 67.003 106.961 43.792  1.00 29.88 ? 376 ASN B CA  1 
ATOM   6667  C  C   . ASN B 1 376 ? 67.825 107.304 42.575  1.00 30.09 ? 376 ASN B C   1 
ATOM   6668  O  O   . ASN B 1 376 ? 68.409 106.427 41.961  1.00 30.67 ? 376 ASN B O   1 
ATOM   6669  C  CB  . ASN B 1 376 ? 65.837 106.051 43.395  1.00 29.82 ? 376 ASN B CB  1 
ATOM   6670  C  CG  . ASN B 1 376 ? 64.960 105.680 44.582  1.00 29.93 ? 376 ASN B CG  1 
ATOM   6671  O  OD1 . ASN B 1 376 ? 65.466 105.375 45.670  1.00 30.04 ? 376 ASN B OD1 1 
ATOM   6672  N  ND2 . ASN B 1 376 ? 63.635 105.702 44.379  1.00 28.72 ? 376 ASN B ND2 1 
ATOM   6673  N  N   . CYS B 1 377 ? 67.889 108.583 42.237  1.00 31.45 ? 377 CYS B N   1 
ATOM   6674  C  CA  . CYS B 1 377 ? 68.641 109.025 41.070  1.00 33.53 ? 377 CYS B CA  1 
ATOM   6675  C  C   . CYS B 1 377 ? 70.153 108.851 41.253  1.00 33.90 ? 377 CYS B C   1 
ATOM   6676  O  O   . CYS B 1 377 ? 70.696 109.091 42.330  1.00 34.16 ? 377 CYS B O   1 
ATOM   6677  C  CB  . CYS B 1 377 ? 68.318 110.495 40.784  1.00 34.60 ? 377 CYS B CB  1 
ATOM   6678  S  SG  . CYS B 1 377 ? 68.561 111.035 39.057  1.00 42.58 ? 377 CYS B SG  1 
ATOM   6679  N  N   . PRO B 1 378 ? 70.850 108.387 40.208  1.00 33.93 ? 378 PRO B N   1 
ATOM   6680  C  CA  . PRO B 1 378 ? 72.303 108.216 40.325  1.00 34.72 ? 378 PRO B CA  1 
ATOM   6681  C  C   . PRO B 1 378 ? 72.952 109.560 39.927  1.00 35.67 ? 378 PRO B C   1 
ATOM   6682  O  O   . PRO B 1 378 ? 73.572 109.701 38.861  1.00 35.63 ? 378 PRO B O   1 
ATOM   6683  C  CB  . PRO B 1 378 ? 72.583 107.073 39.350  1.00 33.72 ? 378 PRO B CB  1 
ATOM   6684  C  CG  . PRO B 1 378 ? 71.578 107.312 38.270  1.00 33.24 ? 378 PRO B CG  1 
ATOM   6685  C  CD  . PRO B 1 378 ? 70.325 107.685 39.024  1.00 33.47 ? 378 PRO B CD  1 
ATOM   6686  N  N   . TYR B 1 379 ? 72.814 110.541 40.820  1.00 36.46 ? 379 TYR B N   1 
ATOM   6687  C  CA  . TYR B 1 379 ? 73.288 111.894 40.558  1.00 36.74 ? 379 TYR B CA  1 
ATOM   6688  C  C   . TYR B 1 379 ? 74.775 112.171 40.408  1.00 37.21 ? 379 TYR B C   1 
ATOM   6689  O  O   . TYR B 1 379 ? 75.141 113.145 39.751  1.00 38.17 ? 379 TYR B O   1 
ATOM   6690  C  CB  . TYR B 1 379 ? 72.655 112.871 41.566  1.00 35.63 ? 379 TYR B CB  1 
ATOM   6691  C  CG  . TYR B 1 379 ? 73.184 112.816 42.970  1.00 35.55 ? 379 TYR B CG  1 
ATOM   6692  C  CD1 . TYR B 1 379 ? 74.343 113.506 43.320  1.00 35.65 ? 379 TYR B CD1 1 
ATOM   6693  C  CD2 . TYR B 1 379 ? 72.517 112.097 43.961  1.00 35.45 ? 379 TYR B CD2 1 
ATOM   6694  C  CE1 . TYR B 1 379 ? 74.829 113.484 44.630  1.00 35.46 ? 379 TYR B CE1 1 
ATOM   6695  C  CE2 . TYR B 1 379 ? 72.993 112.068 45.275  1.00 35.29 ? 379 TYR B CE2 1 
ATOM   6696  C  CZ  . TYR B 1 379 ? 74.150 112.766 45.602  1.00 35.71 ? 379 TYR B CZ  1 
ATOM   6697  O  OH  . TYR B 1 379 ? 74.625 112.769 46.895  1.00 35.38 ? 379 TYR B OH  1 
ATOM   6698  N  N   . ARG B 1 380 ? 75.642 111.350 40.988  1.00 37.38 ? 380 ARG B N   1 
ATOM   6699  C  CA  . ARG B 1 380 ? 77.072 111.596 40.813  1.00 37.92 ? 380 ARG B CA  1 
ATOM   6700  C  C   . ARG B 1 380 ? 77.491 111.000 39.460  1.00 37.66 ? 380 ARG B C   1 
ATOM   6701  O  O   . ARG B 1 380 ? 78.651 111.119 39.049  1.00 37.22 ? 380 ARG B O   1 
ATOM   6702  C  CB  . ARG B 1 380 ? 77.897 110.940 41.929  1.00 39.19 ? 380 ARG B CB  1 
ATOM   6703  C  CG  . ARG B 1 380 ? 77.730 111.507 43.325  1.00 41.43 ? 380 ARG B CG  1 
ATOM   6704  C  CD  . ARG B 1 380 ? 78.334 112.890 43.459  1.00 46.37 ? 380 ARG B CD  1 
ATOM   6705  N  NE  . ARG B 1 380 ? 79.782 112.939 43.233  1.00 49.42 ? 380 ARG B NE  1 
ATOM   6706  C  CZ  . ARG B 1 380 ? 80.671 112.275 43.961  1.00 51.31 ? 380 ARG B CZ  1 
ATOM   6707  N  NH1 . ARG B 1 380 ? 80.256 111.506 44.957  1.00 53.50 ? 380 ARG B NH1 1 
ATOM   6708  N  NH2 . ARG B 1 380 ? 81.970 112.382 43.702  1.00 52.36 ? 380 ARG B NH2 1 
ATOM   6709  N  N   . ALA B 1 381 ? 76.543 110.363 38.770  1.00 37.33 ? 381 ALA B N   1 
ATOM   6710  C  CA  . ALA B 1 381 ? 76.830 109.729 37.488  1.00 37.43 ? 381 ALA B CA  1 
ATOM   6711  C  C   . ALA B 1 381 ? 76.087 110.325 36.301  1.00 37.87 ? 381 ALA B C   1 
ATOM   6712  O  O   . ALA B 1 381 ? 75.052 110.967 36.453  1.00 38.93 ? 381 ALA B O   1 
ATOM   6713  C  CB  . ALA B 1 381 ? 76.539 108.244 37.579  1.00 36.87 ? 381 ALA B CB  1 
ATOM   6714  N  N   . ARG B 1 382 ? 76.630 110.099 35.114  1.00 38.86 ? 382 ARG B N   1 
ATOM   6715  C  CA  . ARG B 1 382 ? 76.038 110.596 33.878  1.00 40.65 ? 382 ARG B CA  1 
ATOM   6716  C  C   . ARG B 1 382 ? 75.235 109.446 33.262  1.00 40.70 ? 382 ARG B C   1 
ATOM   6717  O  O   . ARG B 1 382 ? 75.812 108.504 32.699  1.00 41.28 ? 382 ARG B O   1 
ATOM   6718  C  CB  . ARG B 1 382 ? 77.152 111.045 32.920  1.00 43.40 ? 382 ARG B CB  1 
ATOM   6719  C  CG  . ARG B 1 382 ? 76.692 111.485 31.513  1.00 47.27 ? 382 ARG B CG  1 
ATOM   6720  C  CD  . ARG B 1 382 ? 76.564 113.009 31.348  1.00 50.57 ? 382 ARG B CD  1 
ATOM   6721  N  NE  . ARG B 1 382 ? 77.773 113.696 30.865  1.00 53.24 ? 382 ARG B NE  1 
ATOM   6722  C  CZ  . ARG B 1 382 ? 78.884 113.913 31.576  1.00 55.27 ? 382 ARG B CZ  1 
ATOM   6723  N  NH1 . ARG B 1 382 ? 78.983 113.494 32.838  1.00 56.27 ? 382 ARG B NH1 1 
ATOM   6724  N  NH2 . ARG B 1 382 ? 79.899 114.584 31.031  1.00 55.92 ? 382 ARG B NH2 1 
ATOM   6725  N  N   . VAL B 1 383 ? 73.910 109.514 33.375  1.00 39.41 ? 383 VAL B N   1 
ATOM   6726  C  CA  . VAL B 1 383 ? 73.057 108.465 32.844  1.00 38.12 ? 383 VAL B CA  1 
ATOM   6727  C  C   . VAL B 1 383 ? 72.737 108.659 31.374  1.00 37.14 ? 383 VAL B C   1 
ATOM   6728  O  O   . VAL B 1 383 ? 71.982 109.547 31.004  1.00 37.00 ? 383 VAL B O   1 
ATOM   6729  C  CB  . VAL B 1 383 ? 71.739 108.364 33.650  1.00 38.57 ? 383 VAL B CB  1 
ATOM   6730  C  CG1 . VAL B 1 383 ? 70.790 107.359 33.001  1.00 37.71 ? 383 VAL B CG1 1 
ATOM   6731  C  CG2 . VAL B 1 383 ? 72.044 107.932 35.083  1.00 38.56 ? 383 VAL B CG2 1 
ATOM   6732  N  N   . ALA B 1 384 ? 73.315 107.811 30.534  1.00 36.64 ? 384 ALA B N   1 
ATOM   6733  C  CA  . ALA B 1 384 ? 73.085 107.888 29.094  1.00 35.73 ? 384 ALA B CA  1 
ATOM   6734  C  C   . ALA B 1 384 ? 72.887 106.494 28.544  1.00 35.11 ? 384 ALA B C   1 
ATOM   6735  O  O   . ALA B 1 384 ? 73.710 105.615 28.773  1.00 35.70 ? 384 ALA B O   1 
ATOM   6736  C  CB  . ALA B 1 384 ? 74.264 108.546 28.412  1.00 35.94 ? 384 ALA B CB  1 
ATOM   6737  N  N   . ASN B 1 385 ? 71.789 106.292 27.823  1.00 34.58 ? 385 ASN B N   1 
ATOM   6738  C  CA  . ASN B 1 385 ? 71.477 104.994 27.234  1.00 32.62 ? 385 ASN B CA  1 
ATOM   6739  C  C   . ASN B 1 385 ? 70.418 105.136 26.145  1.00 32.24 ? 385 ASN B C   1 
ATOM   6740  O  O   . ASN B 1 385 ? 70.257 106.205 25.560  1.00 31.65 ? 385 ASN B O   1 
ATOM   6741  C  CB  . ASN B 1 385 ? 71.001 104.013 28.307  1.00 31.14 ? 385 ASN B CB  1 
ATOM   6742  C  CG  . ASN B 1 385 ? 69.836 104.550 29.115  1.00 31.68 ? 385 ASN B CG  1 
ATOM   6743  O  OD1 . ASN B 1 385 ? 68.861 105.059 28.559  1.00 31.38 ? 385 ASN B OD1 1 
ATOM   6744  N  ND2 . ASN B 1 385 ? 69.924 104.425 30.438  1.00 30.15 ? 385 ASN B ND2 1 
ATOM   6745  N  N   . TYR B 1 386 ? 69.693 104.058 25.876  1.00 32.14 ? 386 TYR B N   1 
ATOM   6746  C  CA  . TYR B 1 386 ? 68.691 104.085 24.826  1.00 31.49 ? 386 TYR B CA  1 
ATOM   6747  C  C   . TYR B 1 386 ? 67.316 103.755 25.338  1.00 31.70 ? 386 TYR B C   1 
ATOM   6748  O  O   . TYR B 1 386 ? 66.463 103.247 24.613  1.00 31.64 ? 386 TYR B O   1 
ATOM   6749  C  CB  . TYR B 1 386 ? 69.106 103.135 23.698  1.00 31.46 ? 386 TYR B CB  1 
ATOM   6750  C  CG  . TYR B 1 386 ? 70.414 103.567 23.058  1.00 31.20 ? 386 TYR B CG  1 
ATOM   6751  C  CD1 . TYR B 1 386 ? 71.636 103.265 23.654  1.00 30.51 ? 386 TYR B CD1 1 
ATOM   6752  C  CD2 . TYR B 1 386 ? 70.419 104.379 21.921  1.00 31.55 ? 386 TYR B CD2 1 
ATOM   6753  C  CE1 . TYR B 1 386 ? 72.826 103.769 23.144  1.00 31.15 ? 386 TYR B CE1 1 
ATOM   6754  C  CE2 . TYR B 1 386 ? 71.603 104.887 21.401  1.00 30.80 ? 386 TYR B CE2 1 
ATOM   6755  C  CZ  . TYR B 1 386 ? 72.798 104.581 22.019  1.00 31.05 ? 386 TYR B CZ  1 
ATOM   6756  O  OH  . TYR B 1 386 ? 73.965 105.087 21.516  1.00 30.78 ? 386 TYR B OH  1 
ATOM   6757  N  N   . GLN B 1 387 ? 67.107 104.067 26.606  1.00 31.12 ? 387 GLN B N   1 
ATOM   6758  C  CA  . GLN B 1 387 ? 65.834 103.841 27.245  1.00 30.82 ? 387 GLN B CA  1 
ATOM   6759  C  C   . GLN B 1 387 ? 65.014 105.131 27.107  1.00 30.95 ? 387 GLN B C   1 
ATOM   6760  O  O   . GLN B 1 387 ? 65.570 106.228 27.169  1.00 31.87 ? 387 GLN B O   1 
ATOM   6761  C  CB  . GLN B 1 387 ? 66.081 103.470 28.705  1.00 31.36 ? 387 GLN B CB  1 
ATOM   6762  C  CG  . GLN B 1 387 ? 66.799 102.147 28.841  1.00 30.47 ? 387 GLN B CG  1 
ATOM   6763  C  CD  . GLN B 1 387 ? 67.064 101.763 30.289  1.00 31.51 ? 387 GLN B CD  1 
ATOM   6764  O  OE1 . GLN B 1 387 ? 66.232 101.995 31.160  1.00 29.92 ? 387 GLN B OE1 1 
ATOM   6765  N  NE2 . GLN B 1 387 ? 68.226 101.151 30.546  1.00 31.33 ? 387 GLN B NE2 1 
ATOM   6766  N  N   . ARG B 1 388 ? 63.704 105.003 26.917  1.00 30.38 ? 388 ARG B N   1 
ATOM   6767  C  CA  . ARG B 1 388 ? 62.846 106.167 26.732  1.00 30.42 ? 388 ARG B CA  1 
ATOM   6768  C  C   . ARG B 1 388 ? 61.427 105.957 27.234  1.00 30.60 ? 388 ARG B C   1 
ATOM   6769  O  O   . ARG B 1 388 ? 60.961 104.830 27.351  1.00 31.25 ? 388 ARG B O   1 
ATOM   6770  C  CB  . ARG B 1 388 ? 62.742 106.534 25.238  1.00 30.26 ? 388 ARG B CB  1 
ATOM   6771  C  CG  . ARG B 1 388 ? 64.056 106.794 24.505  1.00 30.06 ? 388 ARG B CG  1 
ATOM   6772  C  CD  . ARG B 1 388 ? 64.718 108.057 24.981  1.00 30.44 ? 388 ARG B CD  1 
ATOM   6773  N  NE  . ARG B 1 388 ? 66.148 107.857 25.195  1.00 32.86 ? 388 ARG B NE  1 
ATOM   6774  C  CZ  . ARG B 1 388 ? 67.080 108.024 24.263  1.00 34.56 ? 388 ARG B CZ  1 
ATOM   6775  N  NH1 . ARG B 1 388 ? 66.748 108.403 23.035  1.00 36.62 ? 388 ARG B NH1 1 
ATOM   6776  N  NH2 . ARG B 1 388 ? 68.351 107.814 24.559  1.00 36.82 ? 388 ARG B NH2 1 
ATOM   6777  N  N   . ASP B 1 389 ? 60.755 107.066 27.531  1.00 30.42 ? 389 ASP B N   1 
ATOM   6778  C  CA  . ASP B 1 389 ? 59.364 107.057 27.945  1.00 30.15 ? 389 ASP B CA  1 
ATOM   6779  C  C   . ASP B 1 389 ? 59.010 106.414 29.277  1.00 30.41 ? 389 ASP B C   1 
ATOM   6780  O  O   . ASP B 1 389 ? 59.780 106.470 30.228  1.00 30.28 ? 389 ASP B O   1 
ATOM   6781  C  CB  . ASP B 1 389 ? 58.532 106.435 26.820  1.00 31.41 ? 389 ASP B CB  1 
ATOM   6782  C  CG  . ASP B 1 389 ? 58.717 107.163 25.495  1.00 31.83 ? 389 ASP B CG  1 
ATOM   6783  O  OD1 . ASP B 1 389 ? 58.322 106.635 24.444  1.00 33.00 ? 389 ASP B OD1 1 
ATOM   6784  O  OD2 . ASP B 1 389 ? 59.261 108.279 25.500  1.00 33.70 ? 389 ASP B OD2 1 
ATOM   6785  N  N   . GLY B 1 390 ? 57.819 105.825 29.334  1.00 30.36 ? 390 GLY B N   1 
ATOM   6786  C  CA  . GLY B 1 390 ? 57.339 105.202 30.549  1.00 30.45 ? 390 GLY B CA  1 
ATOM   6787  C  C   . GLY B 1 390 ? 56.514 106.211 31.324  1.00 31.35 ? 390 GLY B C   1 
ATOM   6788  O  O   . GLY B 1 390 ? 56.718 107.409 31.162  1.00 30.69 ? 390 GLY B O   1 
ATOM   6789  N  N   . PRO B 1 391 ? 55.565 105.769 32.169  1.00 32.20 ? 391 PRO B N   1 
ATOM   6790  C  CA  . PRO B 1 391 ? 54.755 106.722 32.935  1.00 32.79 ? 391 PRO B CA  1 
ATOM   6791  C  C   . PRO B 1 391 ? 55.582 107.645 33.824  1.00 33.60 ? 391 PRO B C   1 
ATOM   6792  O  O   . PRO B 1 391 ? 56.635 107.256 34.338  1.00 33.16 ? 391 PRO B O   1 
ATOM   6793  C  CB  . PRO B 1 391 ? 53.807 105.816 33.737  1.00 33.42 ? 391 PRO B CB  1 
ATOM   6794  C  CG  . PRO B 1 391 ? 54.521 104.506 33.797  1.00 31.96 ? 391 PRO B CG  1 
ATOM   6795  C  CD  . PRO B 1 391 ? 55.146 104.382 32.443  1.00 31.75 ? 391 PRO B CD  1 
ATOM   6796  N  N   . MET B 1 392 ? 55.095 108.871 33.995  1.00 34.87 ? 392 MET B N   1 
ATOM   6797  C  CA  . MET B 1 392 ? 55.770 109.870 34.810  1.00 35.86 ? 392 MET B CA  1 
ATOM   6798  C  C   . MET B 1 392 ? 57.226 110.068 34.412  1.00 37.73 ? 392 MET B C   1 
ATOM   6799  O  O   . MET B 1 392 ? 58.114 110.012 35.266  1.00 38.35 ? 392 MET B O   1 
ATOM   6800  C  CB  . MET B 1 392 ? 55.706 109.495 36.295  1.00 34.83 ? 392 MET B CB  1 
ATOM   6801  C  CG  . MET B 1 392 ? 54.317 109.469 36.888  1.00 34.01 ? 392 MET B CG  1 
ATOM   6802  S  SD  . MET B 1 392 ? 53.466 111.075 36.860  1.00 36.13 ? 392 MET B SD  1 
ATOM   6803  C  CE  . MET B 1 392 ? 54.319 111.933 38.194  1.00 35.01 ? 392 MET B CE  1 
ATOM   6804  N  N   . CYS B 1 393 ? 57.476 110.283 33.122  1.00 39.29 ? 393 CYS B N   1 
ATOM   6805  C  CA  . CYS B 1 393 ? 58.835 110.530 32.645  1.00 41.39 ? 393 CYS B CA  1 
ATOM   6806  C  C   . CYS B 1 393 ? 59.146 111.970 33.041  1.00 43.75 ? 393 CYS B C   1 
ATOM   6807  O  O   . CYS B 1 393 ? 58.573 112.903 32.483  1.00 44.67 ? 393 CYS B O   1 
ATOM   6808  C  CB  . CYS B 1 393 ? 58.906 110.389 31.130  1.00 40.07 ? 393 CYS B CB  1 
ATOM   6809  S  SG  . CYS B 1 393 ? 60.535 110.694 30.483  1.00 39.07 ? 393 CYS B SG  1 
ATOM   6810  N  N   . MET B 1 394 ? 60.051 112.160 33.994  1.00 46.52 ? 394 MET B N   1 
ATOM   6811  C  CA  . MET B 1 394 ? 60.347 113.505 34.468  1.00 49.02 ? 394 MET B CA  1 
ATOM   6812  C  C   . MET B 1 394 ? 61.428 114.305 33.792  1.00 50.54 ? 394 MET B C   1 
ATOM   6813  O  O   . MET B 1 394 ? 61.275 115.507 33.623  1.00 51.32 ? 394 MET B O   1 
ATOM   6814  C  CB  . MET B 1 394 ? 60.631 113.490 35.967  1.00 49.45 ? 394 MET B CB  1 
ATOM   6815  C  CG  . MET B 1 394 ? 59.487 114.038 36.785  1.00 50.34 ? 394 MET B CG  1 
ATOM   6816  S  SD  . MET B 1 394 ? 57.992 113.066 36.568  1.00 52.33 ? 394 MET B SD  1 
ATOM   6817  C  CE  . MET B 1 394 ? 56.771 114.167 37.252  1.00 52.52 ? 394 MET B CE  1 
ATOM   6818  N  N   . GLN B 1 395 ? 62.534 113.680 33.424  1.00 52.56 ? 395 GLN B N   1 
ATOM   6819  C  CA  . GLN B 1 395 ? 63.582 114.462 32.788  1.00 54.47 ? 395 GLN B CA  1 
ATOM   6820  C  C   . GLN B 1 395 ? 63.155 114.852 31.397  1.00 53.98 ? 395 GLN B C   1 
ATOM   6821  O  O   . GLN B 1 395 ? 61.982 114.756 31.038  1.00 54.30 ? 395 GLN B O   1 
ATOM   6822  C  CB  . GLN B 1 395 ? 64.909 113.691 32.707  1.00 56.81 ? 395 GLN B CB  1 
ATOM   6823  C  CG  . GLN B 1 395 ? 65.678 113.562 34.028  1.00 59.59 ? 395 GLN B CG  1 
ATOM   6824  C  CD  . GLN B 1 395 ? 65.189 112.409 34.889  1.00 60.92 ? 395 GLN B CD  1 
ATOM   6825  O  OE1 . GLN B 1 395 ? 65.179 111.250 34.451  1.00 61.33 ? 395 GLN B OE1 1 
ATOM   6826  N  NE2 . GLN B 1 395 ? 64.788 112.718 36.126  1.00 61.85 ? 395 GLN B NE2 1 
ATOM   6827  N  N   . ASP B 1 396 ? 64.129 115.299 30.624  1.00 53.54 ? 396 ASP B N   1 
ATOM   6828  C  CA  . ASP B 1 396 ? 63.912 115.698 29.251  1.00 53.44 ? 396 ASP B CA  1 
ATOM   6829  C  C   . ASP B 1 396 ? 63.689 114.447 28.382  1.00 52.73 ? 396 ASP B C   1 
ATOM   6830  O  O   . ASP B 1 396 ? 63.445 114.559 27.175  1.00 53.09 ? 396 ASP B O   1 
ATOM   6831  C  CB  . ASP B 1 396 ? 65.146 116.470 28.769  1.00 55.06 ? 396 ASP B CB  1 
ATOM   6832  C  CG  . ASP B 1 396 ? 66.445 115.674 28.954  1.00 56.49 ? 396 ASP B CG  1 
ATOM   6833  O  OD1 . ASP B 1 396 ? 66.621 115.049 30.029  1.00 56.64 ? 396 ASP B OD1 1 
ATOM   6834  O  OD2 . ASP B 1 396 ? 67.291 115.678 28.027  1.00 57.28 ? 396 ASP B OD2 1 
ATOM   6835  N  N   . ASN B 1 397 ? 63.769 113.265 29.004  1.00 50.72 ? 397 ASN B N   1 
ATOM   6836  C  CA  . ASN B 1 397 ? 63.609 111.992 28.299  1.00 48.74 ? 397 ASN B CA  1 
ATOM   6837  C  C   . ASN B 1 397 ? 64.773 111.875 27.306  1.00 47.86 ? 397 ASN B C   1 
ATOM   6838  O  O   . ASN B 1 397 ? 64.660 111.250 26.245  1.00 47.07 ? 397 ASN B O   1 
ATOM   6839  C  CB  . ASN B 1 397 ? 62.247 111.948 27.578  1.00 48.93 ? 397 ASN B CB  1 
ATOM   6840  C  CG  . ASN B 1 397 ? 61.866 110.545 27.088  1.00 48.40 ? 397 ASN B CG  1 
ATOM   6841  O  OD1 . ASN B 1 397 ? 62.239 109.532 27.684  1.00 47.91 ? 397 ASN B OD1 1 
ATOM   6842  N  ND2 . ASN B 1 397 ? 61.096 110.491 26.010  1.00 47.86 ? 397 ASN B ND2 1 
ATOM   6843  N  N   . GLN B 1 398 ? 65.893 112.496 27.676  1.00 46.57 ? 398 GLN B N   1 
ATOM   6844  C  CA  . GLN B 1 398 ? 67.108 112.503 26.870  1.00 45.81 ? 398 GLN B CA  1 
ATOM   6845  C  C   . GLN B 1 398 ? 66.935 113.184 25.513  1.00 45.29 ? 398 GLN B C   1 
ATOM   6846  O  O   . GLN B 1 398 ? 67.549 112.788 24.517  1.00 45.11 ? 398 GLN B O   1 
ATOM   6847  C  CB  . GLN B 1 398 ? 67.629 111.078 26.680  1.00 45.29 ? 398 GLN B CB  1 
ATOM   6848  C  CG  . GLN B 1 398 ? 68.003 110.389 27.982  1.00 45.39 ? 398 GLN B CG  1 
ATOM   6849  C  CD  . GLN B 1 398 ? 68.619 109.017 27.762  1.00 45.96 ? 398 GLN B CD  1 
ATOM   6850  O  OE1 . GLN B 1 398 ? 69.808 108.895 27.455  1.00 45.61 ? 398 GLN B OE1 1 
ATOM   6851  N  NE2 . GLN B 1 398 ? 67.803 107.974 27.905  1.00 46.59 ? 398 GLN B NE2 1 
ATOM   6852  N  N   . GLY B 1 399 ? 66.103 114.220 25.496  1.00 44.89 ? 399 GLY B N   1 
ATOM   6853  C  CA  . GLY B 1 399 ? 65.855 114.976 24.281  1.00 44.25 ? 399 GLY B CA  1 
ATOM   6854  C  C   . GLY B 1 399 ? 65.640 114.171 23.015  1.00 43.56 ? 399 GLY B C   1 
ATOM   6855  O  O   . GLY B 1 399 ? 64.953 113.153 23.028  1.00 43.67 ? 399 GLY B O   1 
ATOM   6856  N  N   . GLY B 1 400 ? 66.228 114.640 21.916  1.00 43.07 ? 400 GLY B N   1 
ATOM   6857  C  CA  . GLY B 1 400 ? 66.075 113.965 20.636  1.00 41.46 ? 400 GLY B CA  1 
ATOM   6858  C  C   . GLY B 1 400 ? 67.260 113.086 20.286  1.00 40.70 ? 400 GLY B C   1 
ATOM   6859  O  O   . GLY B 1 400 ? 67.435 112.691 19.129  1.00 40.77 ? 400 GLY B O   1 
ATOM   6860  N  N   . ALA B 1 401 ? 68.079 112.782 21.286  1.00 39.22 ? 401 ALA B N   1 
ATOM   6861  C  CA  . ALA B 1 401 ? 69.241 111.933 21.078  1.00 38.79 ? 401 ALA B CA  1 
ATOM   6862  C  C   . ALA B 1 401 ? 68.783 110.643 20.398  1.00 38.87 ? 401 ALA B C   1 
ATOM   6863  O  O   . ALA B 1 401 ? 67.732 110.085 20.750  1.00 40.42 ? 401 ALA B O   1 
ATOM   6864  C  CB  . ALA B 1 401 ? 69.896 111.617 22.422  1.00 36.82 ? 401 ALA B CB  1 
ATOM   6865  N  N   . PRO B 1 402 ? 69.545 110.155 19.402  1.00 38.17 ? 402 PRO B N   1 
ATOM   6866  C  CA  . PRO B 1 402 ? 69.133 108.911 18.733  1.00 37.44 ? 402 PRO B CA  1 
ATOM   6867  C  C   . PRO B 1 402 ? 68.829 107.813 19.770  1.00 37.03 ? 402 PRO B C   1 
ATOM   6868  O  O   . PRO B 1 402 ? 69.593 107.620 20.726  1.00 36.82 ? 402 PRO B O   1 
ATOM   6869  C  CB  . PRO B 1 402 ? 70.324 108.597 17.812  1.00 36.78 ? 402 PRO B CB  1 
ATOM   6870  C  CG  . PRO B 1 402 ? 71.463 109.382 18.410  1.00 37.22 ? 402 PRO B CG  1 
ATOM   6871  C  CD  . PRO B 1 402 ? 70.824 110.647 18.870  1.00 37.36 ? 402 PRO B CD  1 
ATOM   6872  N  N   . ASN B 1 403 ? 67.715 107.104 19.576  1.00 36.01 ? 403 ASN B N   1 
ATOM   6873  C  CA  . ASN B 1 403 ? 67.277 106.081 20.527  1.00 35.03 ? 403 ASN B CA  1 
ATOM   6874  C  C   . ASN B 1 403 ? 67.542 104.609 20.229  1.00 34.74 ? 403 ASN B C   1 
ATOM   6875  O  O   . ASN B 1 403 ? 67.038 103.738 20.933  1.00 34.00 ? 403 ASN B O   1 
ATOM   6876  C  CB  . ASN B 1 403 ? 65.783 106.255 20.804  1.00 34.01 ? 403 ASN B CB  1 
ATOM   6877  C  CG  . ASN B 1 403 ? 64.914 105.892 19.610  1.00 33.87 ? 403 ASN B CG  1 
ATOM   6878  O  OD1 . ASN B 1 403 ? 63.694 106.086 19.645  1.00 32.88 ? 403 ASN B OD1 1 
ATOM   6879  N  ND2 . ASN B 1 403 ? 65.532 105.357 18.554  1.00 32.09 ? 403 ASN B ND2 1 
ATOM   6880  N  N   . TYR B 1 404 ? 68.309 104.316 19.192  1.00 34.42 ? 404 TYR B N   1 
ATOM   6881  C  CA  . TYR B 1 404 ? 68.606 102.925 18.878  1.00 34.64 ? 404 TYR B CA  1 
ATOM   6882  C  C   . TYR B 1 404 ? 70.115 102.707 18.917  1.00 34.54 ? 404 TYR B C   1 
ATOM   6883  O  O   . TYR B 1 404 ? 70.878 103.615 18.627  1.00 35.76 ? 404 TYR B O   1 
ATOM   6884  C  CB  . TYR B 1 404 ? 68.074 102.576 17.497  1.00 34.80 ? 404 TYR B CB  1 
ATOM   6885  C  CG  . TYR B 1 404 ? 68.594 103.489 16.429  1.00 35.51 ? 404 TYR B CG  1 
ATOM   6886  C  CD1 . TYR B 1 404 ? 68.203 104.825 16.378  1.00 35.84 ? 404 TYR B CD1 1 
ATOM   6887  C  CD2 . TYR B 1 404 ? 69.506 103.028 15.482  1.00 36.25 ? 404 TYR B CD2 1 
ATOM   6888  C  CE1 . TYR B 1 404 ? 68.712 105.685 15.407  1.00 36.52 ? 404 TYR B CE1 1 
ATOM   6889  C  CE2 . TYR B 1 404 ? 70.018 103.876 14.507  1.00 36.44 ? 404 TYR B CE2 1 
ATOM   6890  C  CZ  . TYR B 1 404 ? 69.619 105.202 14.476  1.00 36.46 ? 404 TYR B CZ  1 
ATOM   6891  O  OH  . TYR B 1 404 ? 70.139 106.044 13.521  1.00 36.93 ? 404 TYR B OH  1 
ATOM   6892  N  N   . TYR B 1 405 ? 70.546 101.506 19.278  1.00 33.68 ? 405 TYR B N   1 
ATOM   6893  C  CA  . TYR B 1 405 ? 71.969 101.201 19.344  1.00 32.37 ? 405 TYR B CA  1 
ATOM   6894  C  C   . TYR B 1 405 ? 72.199 99.911  18.546  1.00 32.43 ? 405 TYR B C   1 
ATOM   6895  O  O   . TYR B 1 405 ? 71.450 98.943  18.693  1.00 31.90 ? 405 TYR B O   1 
ATOM   6896  C  CB  . TYR B 1 405 ? 72.366 101.013 20.812  1.00 31.87 ? 405 TYR B CB  1 
ATOM   6897  C  CG  . TYR B 1 405 ? 73.852 100.908 21.069  1.00 31.00 ? 405 TYR B CG  1 
ATOM   6898  C  CD1 . TYR B 1 405 ? 74.711 101.939 20.709  1.00 30.77 ? 405 TYR B CD1 1 
ATOM   6899  C  CD2 . TYR B 1 405 ? 74.399 99.779  21.694  1.00 31.04 ? 405 TYR B CD2 1 
ATOM   6900  C  CE1 . TYR B 1 405 ? 76.082 101.859 20.962  1.00 30.29 ? 405 TYR B CE1 1 
ATOM   6901  C  CE2 . TYR B 1 405 ? 75.776 99.688  21.955  1.00 30.30 ? 405 TYR B CE2 1 
ATOM   6902  C  CZ  . TYR B 1 405 ? 76.609 100.738 21.583  1.00 29.75 ? 405 TYR B CZ  1 
ATOM   6903  O  OH  . TYR B 1 405 ? 77.964 100.678 21.812  1.00 28.89 ? 405 TYR B OH  1 
ATOM   6904  N  N   . PRO B 1 406 ? 73.226 99.878  17.687  1.00 32.24 ? 406 PRO B N   1 
ATOM   6905  C  CA  . PRO B 1 406 ? 74.210 100.916 17.370  1.00 33.15 ? 406 PRO B CA  1 
ATOM   6906  C  C   . PRO B 1 406 ? 73.666 101.946 16.389  1.00 33.92 ? 406 PRO B C   1 
ATOM   6907  O  O   . PRO B 1 406 ? 72.675 101.701 15.694  1.00 34.11 ? 406 PRO B O   1 
ATOM   6908  C  CB  . PRO B 1 406 ? 75.351 100.120 16.767  1.00 32.61 ? 406 PRO B CB  1 
ATOM   6909  C  CG  . PRO B 1 406 ? 74.612 99.088  15.985  1.00 32.95 ? 406 PRO B CG  1 
ATOM   6910  C  CD  . PRO B 1 406 ? 73.550 98.632  16.972  1.00 32.30 ? 406 PRO B CD  1 
ATOM   6911  N  N   . ASN B 1 407 ? 74.329 103.094 16.327  1.00 33.92 ? 407 ASN B N   1 
ATOM   6912  C  CA  . ASN B 1 407 ? 73.902 104.161 15.444  1.00 34.45 ? 407 ASN B CA  1 
ATOM   6913  C  C   . ASN B 1 407 ? 75.093 104.947 14.963  1.00 34.14 ? 407 ASN B C   1 
ATOM   6914  O  O   . ASN B 1 407 ? 76.141 104.954 15.588  1.00 33.33 ? 407 ASN B O   1 
ATOM   6915  C  CB  . ASN B 1 407 ? 72.944 105.104 16.174  1.00 35.30 ? 407 ASN B CB  1 
ATOM   6916  C  CG  . ASN B 1 407 ? 73.609 105.826 17.323  1.00 35.56 ? 407 ASN B CG  1 
ATOM   6917  O  OD1 . ASN B 1 407 ? 74.393 106.751 17.123  1.00 36.65 ? 407 ASN B OD1 1 
ATOM   6918  N  ND2 . ASN B 1 407 ? 73.313 105.395 18.537  1.00 35.61 ? 407 ASN B ND2 1 
ATOM   6919  N  N   . SER B 1 408 ? 74.899 105.642 13.858  1.00 35.19 ? 408 SER B N   1 
ATOM   6920  C  CA  . SER B 1 408 ? 75.946 106.435 13.254  1.00 36.30 ? 408 SER B CA  1 
ATOM   6921  C  C   . SER B 1 408 ? 75.797 107.905 13.592  1.00 37.32 ? 408 SER B C   1 
ATOM   6922  O  O   . SER B 1 408 ? 76.170 108.754 12.791  1.00 38.37 ? 408 SER B O   1 
ATOM   6923  C  CB  . SER B 1 408 ? 75.895 106.266 11.741  1.00 35.90 ? 408 SER B CB  1 
ATOM   6924  O  OG  . SER B 1 408 ? 75.865 104.893 11.400  1.00 37.94 ? 408 SER B OG  1 
ATOM   6925  N  N   . PHE B 1 409 ? 75.261 108.217 14.768  1.00 38.36 ? 409 PHE B N   1 
ATOM   6926  C  CA  . PHE B 1 409 ? 75.071 109.610 15.142  1.00 38.81 ? 409 PHE B CA  1 
ATOM   6927  C  C   . PHE B 1 409 ? 75.633 109.977 16.500  1.00 40.09 ? 409 PHE B C   1 
ATOM   6928  O  O   . PHE B 1 409 ? 75.060 110.794 17.228  1.00 41.11 ? 409 PHE B O   1 
ATOM   6929  C  CB  . PHE B 1 409 ? 73.593 109.958 15.059  1.00 38.00 ? 409 PHE B CB  1 
ATOM   6930  C  CG  . PHE B 1 409 ? 73.029 109.798 13.684  1.00 37.57 ? 409 PHE B CG  1 
ATOM   6931  C  CD1 . PHE B 1 409 ? 73.199 110.796 12.730  1.00 37.39 ? 409 PHE B CD1 1 
ATOM   6932  C  CD2 . PHE B 1 409 ? 72.369 108.633 13.323  1.00 37.42 ? 409 PHE B CD2 1 
ATOM   6933  C  CE1 . PHE B 1 409 ? 72.718 110.637 11.436  1.00 37.45 ? 409 PHE B CE1 1 
ATOM   6934  C  CE2 . PHE B 1 409 ? 71.883 108.462 12.029  1.00 37.95 ? 409 PHE B CE2 1 
ATOM   6935  C  CZ  . PHE B 1 409 ? 72.059 109.470 11.083  1.00 37.40 ? 409 PHE B CZ  1 
ATOM   6936  N  N   . GLY B 1 410 ? 76.764 109.365 16.827  1.00 40.69 ? 410 GLY B N   1 
ATOM   6937  C  CA  . GLY B 1 410 ? 77.446 109.646 18.075  1.00 41.81 ? 410 GLY B CA  1 
ATOM   6938  C  C   . GLY B 1 410 ? 76.708 109.499 19.391  1.00 42.47 ? 410 GLY B C   1 
ATOM   6939  O  O   . GLY B 1 410 ? 77.049 110.177 20.362  1.00 42.80 ? 410 GLY B O   1 
ATOM   6940  N  N   . ALA B 1 411 ? 75.713 108.626 19.462  1.00 42.49 ? 411 ALA B N   1 
ATOM   6941  C  CA  . ALA B 1 411 ? 75.005 108.461 20.730  1.00 42.81 ? 411 ALA B CA  1 
ATOM   6942  C  C   . ALA B 1 411 ? 75.917 107.697 21.702  1.00 42.60 ? 411 ALA B C   1 
ATOM   6943  O  O   . ALA B 1 411 ? 76.987 107.221 21.311  1.00 41.70 ? 411 ALA B O   1 
ATOM   6944  C  CB  . ALA B 1 411 ? 73.681 107.714 20.511  1.00 42.80 ? 411 ALA B CB  1 
ATOM   6945  N  N   . PRO B 1 412 ? 75.506 107.569 22.976  1.00 42.76 ? 412 PRO B N   1 
ATOM   6946  C  CA  . PRO B 1 412 ? 76.333 106.857 23.955  1.00 43.76 ? 412 PRO B CA  1 
ATOM   6947  C  C   . PRO B 1 412 ? 76.845 105.497 23.461  1.00 44.90 ? 412 PRO B C   1 
ATOM   6948  O  O   . PRO B 1 412 ? 76.092 104.716 22.880  1.00 45.31 ? 412 PRO B O   1 
ATOM   6949  C  CB  . PRO B 1 412 ? 75.403 106.726 25.165  1.00 43.04 ? 412 PRO B CB  1 
ATOM   6950  C  CG  . PRO B 1 412 ? 74.543 107.942 25.057  1.00 42.80 ? 412 PRO B CG  1 
ATOM   6951  C  CD  . PRO B 1 412 ? 74.226 107.982 23.580  1.00 42.39 ? 412 PRO B CD  1 
ATOM   6952  N  N   . GLU B 1 413 ? 78.131 105.228 23.687  1.00 45.69 ? 413 GLU B N   1 
ATOM   6953  C  CA  . GLU B 1 413 ? 78.749 103.962 23.288  1.00 46.31 ? 413 GLU B CA  1 
ATOM   6954  C  C   . GLU B 1 413 ? 79.103 103.135 24.531  1.00 46.35 ? 413 GLU B C   1 
ATOM   6955  O  O   . GLU B 1 413 ? 79.296 103.680 25.623  1.00 46.65 ? 413 GLU B O   1 
ATOM   6956  C  CB  . GLU B 1 413 ? 80.010 104.226 22.461  1.00 46.69 ? 413 GLU B CB  1 
ATOM   6957  C  CG  . GLU B 1 413 ? 79.757 104.522 20.995  1.00 48.20 ? 413 GLU B CG  1 
ATOM   6958  C  CD  . GLU B 1 413 ? 79.473 103.268 20.171  1.00 50.44 ? 413 GLU B CD  1 
ATOM   6959  O  OE1 . GLU B 1 413 ? 80.355 102.383 20.059  1.00 51.38 ? 413 GLU B OE1 1 
ATOM   6960  O  OE2 . GLU B 1 413 ? 78.357 103.160 19.623  1.00 52.91 ? 413 GLU B OE2 1 
ATOM   6961  N  N   . GLN B 1 414 ? 79.174 101.821 24.369  1.00 45.96 ? 414 GLN B N   1 
ATOM   6962  C  CA  . GLN B 1 414 ? 79.512 100.946 25.481  1.00 46.47 ? 414 GLN B CA  1 
ATOM   6963  C  C   . GLN B 1 414 ? 81.009 101.032 25.751  1.00 47.21 ? 414 GLN B C   1 
ATOM   6964  O  O   . GLN B 1 414 ? 81.792 101.371 24.854  1.00 47.21 ? 414 GLN B O   1 
ATOM   6965  C  CB  . GLN B 1 414 ? 79.142 99.511  25.134  1.00 46.72 ? 414 GLN B CB  1 
ATOM   6966  C  CG  . GLN B 1 414 ? 80.035 98.891  24.077  1.00 46.59 ? 414 GLN B CG  1 
ATOM   6967  C  CD  . GLN B 1 414 ? 79.273 97.996  23.125  1.00 47.09 ? 414 GLN B CD  1 
ATOM   6968  O  OE1 . GLN B 1 414 ? 78.601 97.053  23.537  1.00 47.21 ? 414 GLN B OE1 1 
ATOM   6969  N  NE2 . GLN B 1 414 ? 79.371 98.293  21.839  1.00 48.14 ? 414 GLN B NE2 1 
ATOM   6970  N  N   . GLN B 1 415 ? 81.423 100.727 26.976  1.00 47.51 ? 415 GLN B N   1 
ATOM   6971  C  CA  . GLN B 1 415 ? 82.843 100.786 27.271  1.00 48.82 ? 415 GLN B CA  1 
ATOM   6972  C  C   . GLN B 1 415 ? 83.375 99.483  27.852  1.00 48.24 ? 415 GLN B C   1 
ATOM   6973  O  O   . GLN B 1 415 ? 83.060 99.104  28.979  1.00 47.93 ? 415 GLN B O   1 
ATOM   6974  C  CB  . GLN B 1 415 ? 83.162 101.987 28.183  1.00 51.49 ? 415 GLN B CB  1 
ATOM   6975  C  CG  . GLN B 1 415 ? 83.075 101.781 29.697  1.00 53.43 ? 415 GLN B CG  1 
ATOM   6976  C  CD  . GLN B 1 415 ? 83.739 102.937 30.458  1.00 55.06 ? 415 GLN B CD  1 
ATOM   6977  O  OE1 . GLN B 1 415 ? 84.795 103.430 30.045  1.00 55.93 ? 415 GLN B OE1 1 
ATOM   6978  N  NE2 . GLN B 1 415 ? 83.129 103.368 31.568  1.00 55.18 ? 415 GLN B NE2 1 
ATOM   6979  N  N   . PRO B 1 416 ? 84.197 98.774  27.063  1.00 48.08 ? 416 PRO B N   1 
ATOM   6980  C  CA  . PRO B 1 416 ? 84.838 97.491  27.376  1.00 47.77 ? 416 PRO B CA  1 
ATOM   6981  C  C   . PRO B 1 416 ? 85.331 97.352  28.810  1.00 47.31 ? 416 PRO B C   1 
ATOM   6982  O  O   . PRO B 1 416 ? 85.129 96.325  29.445  1.00 47.42 ? 416 PRO B O   1 
ATOM   6983  C  CB  . PRO B 1 416 ? 85.978 97.432  26.366  1.00 47.58 ? 416 PRO B CB  1 
ATOM   6984  C  CG  . PRO B 1 416 ? 85.378 98.096  25.180  1.00 47.57 ? 416 PRO B CG  1 
ATOM   6985  C  CD  . PRO B 1 416 ? 84.696 99.302  25.778  1.00 47.88 ? 416 PRO B CD  1 
ATOM   6986  N  N   . SER B 1 417 ? 85.989 98.391  29.303  1.00 47.74 ? 417 SER B N   1 
ATOM   6987  C  CA  . SER B 1 417 ? 86.533 98.411  30.656  1.00 48.26 ? 417 SER B CA  1 
ATOM   6988  C  C   . SER B 1 417 ? 85.551 97.856  31.690  1.00 48.59 ? 417 SER B C   1 
ATOM   6989  O  O   . SER B 1 417 ? 85.959 97.197  32.652  1.00 49.37 ? 417 SER B O   1 
ATOM   6990  C  CB  . SER B 1 417 ? 86.907 99.850  31.039  1.00 48.12 ? 417 SER B CB  1 
ATOM   6991  O  OG  . SER B 1 417 ? 87.025 100.672 29.880  1.00 49.50 ? 417 SER B OG  1 
ATOM   6992  N  N   . ALA B 1 418 ? 84.259 98.112  31.486  1.00 47.90 ? 418 ALA B N   1 
ATOM   6993  C  CA  . ALA B 1 418 ? 83.227 97.666  32.420  1.00 47.47 ? 418 ALA B CA  1 
ATOM   6994  C  C   . ALA B 1 418 ? 82.597 96.308  32.101  1.00 47.16 ? 418 ALA B C   1 
ATOM   6995  O  O   . ALA B 1 418 ? 81.464 96.030  32.501  1.00 47.13 ? 418 ALA B O   1 
ATOM   6996  C  CB  . ALA B 1 418 ? 82.136 98.732  32.521  1.00 47.76 ? 418 ALA B CB  1 
ATOM   6997  N  N   . LEU B 1 419 ? 83.328 95.465  31.384  1.00 46.82 ? 419 LEU B N   1 
ATOM   6998  C  CA  . LEU B 1 419 ? 82.834 94.139  31.033  1.00 46.56 ? 419 LEU B CA  1 
ATOM   6999  C  C   . LEU B 1 419 ? 82.895 93.260  32.291  1.00 46.71 ? 419 LEU B C   1 
ATOM   7000  O  O   . LEU B 1 419 ? 83.779 93.434  33.127  1.00 46.54 ? 419 LEU B O   1 
ATOM   7001  C  CB  . LEU B 1 419 ? 83.715 93.567  29.929  1.00 45.89 ? 419 LEU B CB  1 
ATOM   7002  C  CG  . LEU B 1 419 ? 83.098 92.762  28.792  1.00 46.13 ? 419 LEU B CG  1 
ATOM   7003  C  CD1 . LEU B 1 419 ? 81.980 93.562  28.142  1.00 45.34 ? 419 LEU B CD1 1 
ATOM   7004  C  CD2 . LEU B 1 419 ? 84.195 92.421  27.772  1.00 44.82 ? 419 LEU B CD2 1 
ATOM   7005  N  N   . GLU B 1 420 ? 81.957 92.327  32.438  1.00 47.37 ? 420 GLU B N   1 
ATOM   7006  C  CA  . GLU B 1 420 ? 81.939 91.446  33.617  1.00 47.36 ? 420 GLU B CA  1 
ATOM   7007  C  C   . GLU B 1 420 ? 83.024 90.364  33.583  1.00 47.14 ? 420 GLU B C   1 
ATOM   7008  O  O   . GLU B 1 420 ? 83.394 89.866  32.512  1.00 46.67 ? 420 GLU B O   1 
ATOM   7009  C  CB  . GLU B 1 420 ? 80.587 90.736  33.761  1.00 47.24 ? 420 GLU B CB  1 
ATOM   7010  C  CG  . GLU B 1 420 ? 79.366 91.637  33.779  1.00 48.59 ? 420 GLU B CG  1 
ATOM   7011  C  CD  . GLU B 1 420 ? 78.850 91.970  32.385  1.00 49.19 ? 420 GLU B CD  1 
ATOM   7012  O  OE1 . GLU B 1 420 ? 79.326 91.349  31.400  1.00 49.68 ? 420 GLU B OE1 1 
ATOM   7013  O  OE2 . GLU B 1 420 ? 77.958 92.846  32.289  1.00 48.79 ? 420 GLU B OE2 1 
ATOM   7014  N  N   . HIS B 1 421 ? 83.508 90.000  34.769  1.00 46.56 ? 421 HIS B N   1 
ATOM   7015  C  CA  . HIS B 1 421 ? 84.523 88.968  34.927  1.00 46.47 ? 421 HIS B CA  1 
ATOM   7016  C  C   . HIS B 1 421 ? 83.877 87.622  34.602  1.00 46.94 ? 421 HIS B C   1 
ATOM   7017  O  O   . HIS B 1 421 ? 82.891 87.245  35.231  1.00 47.57 ? 421 HIS B O   1 
ATOM   7018  C  CB  . HIS B 1 421 ? 85.040 89.000  36.370  1.00 45.98 ? 421 HIS B CB  1 
ATOM   7019  C  CG  . HIS B 1 421 ? 85.805 87.777  36.784  1.00 45.60 ? 421 HIS B CG  1 
ATOM   7020  N  ND1 . HIS B 1 421 ? 85.190 86.643  37.274  1.00 45.01 ? 421 HIS B ND1 1 
ATOM   7021  C  CD2 . HIS B 1 421 ? 87.137 87.523  36.805  1.00 44.65 ? 421 HIS B CD2 1 
ATOM   7022  C  CE1 . HIS B 1 421 ? 86.111 85.745  37.581  1.00 44.98 ? 421 HIS B CE1 1 
ATOM   7023  N  NE2 . HIS B 1 421 ? 87.299 86.254  37.307  1.00 45.00 ? 421 HIS B NE2 1 
ATOM   7024  N  N   . SER B 1 422 ? 84.417 86.902  33.620  1.00 47.07 ? 422 SER B N   1 
ATOM   7025  C  CA  . SER B 1 422 ? 83.830 85.618  33.243  1.00 47.92 ? 422 SER B CA  1 
ATOM   7026  C  C   . SER B 1 422 ? 84.460 84.399  33.919  1.00 48.21 ? 422 SER B C   1 
ATOM   7027  O  O   . SER B 1 422 ? 85.672 84.336  34.136  1.00 48.43 ? 422 SER B O   1 
ATOM   7028  C  CB  . SER B 1 422 ? 83.860 85.442  31.723  1.00 47.74 ? 422 SER B CB  1 
ATOM   7029  O  OG  . SER B 1 422 ? 85.173 85.241  31.252  1.00 48.93 ? 422 SER B OG  1 
ATOM   7030  N  N   . ILE B 1 423 ? 83.612 83.428  34.244  1.00 48.30 ? 423 ILE B N   1 
ATOM   7031  C  CA  . ILE B 1 423 ? 84.030 82.205  34.920  1.00 48.73 ? 423 ILE B CA  1 
ATOM   7032  C  C   . ILE B 1 423 ? 83.500 81.003  34.167  1.00 48.88 ? 423 ILE B C   1 
ATOM   7033  O  O   . ILE B 1 423 ? 82.497 81.106  33.466  1.00 49.15 ? 423 ILE B O   1 
ATOM   7034  C  CB  . ILE B 1 423 ? 83.436 82.137  36.348  1.00 49.01 ? 423 ILE B CB  1 
ATOM   7035  C  CG1 . ILE B 1 423 ? 84.157 83.110  37.273  1.00 49.61 ? 423 ILE B CG1 1 
ATOM   7036  C  CG2 . ILE B 1 423 ? 83.510 80.716  36.891  1.00 49.36 ? 423 ILE B CG2 1 
ATOM   7037  C  CD1 . ILE B 1 423 ? 83.566 83.150  38.682  1.00 50.23 ? 423 ILE B CD1 1 
ATOM   7038  N  N   . GLN B 1 424 ? 84.166 79.861  34.298  1.00 48.76 ? 424 GLN B N   1 
ATOM   7039  C  CA  . GLN B 1 424 ? 83.652 78.662  33.650  1.00 48.83 ? 424 GLN B CA  1 
ATOM   7040  C  C   . GLN B 1 424 ? 83.065 77.732  34.706  1.00 47.11 ? 424 GLN B C   1 
ATOM   7041  O  O   . GLN B 1 424 ? 83.763 77.311  35.624  1.00 46.58 ? 424 GLN B O   1 
ATOM   7042  C  CB  . GLN B 1 424 ? 84.733 77.921  32.875  1.00 50.28 ? 424 GLN B CB  1 
ATOM   7043  C  CG  . GLN B 1 424 ? 84.170 76.662  32.225  1.00 53.72 ? 424 GLN B CG  1 
ATOM   7044  C  CD  . GLN B 1 424 ? 84.896 76.270  30.947  1.00 56.24 ? 424 GLN B CD  1 
ATOM   7045  O  OE1 . GLN B 1 424 ? 84.393 75.446  30.161  1.00 57.43 ? 424 GLN B OE1 1 
ATOM   7046  N  NE2 . GLN B 1 424 ? 86.087 76.854  30.728  1.00 56.37 ? 424 GLN B NE2 1 
ATOM   7047  N  N   . TYR B 1 425 ? 81.780 77.422  34.587  1.00 45.56 ? 425 TYR B N   1 
ATOM   7048  C  CA  . TYR B 1 425 ? 81.158 76.540  35.558  1.00 44.77 ? 425 TYR B CA  1 
ATOM   7049  C  C   . TYR B 1 425 ? 80.905 75.216  34.894  1.00 45.33 ? 425 TYR B C   1 
ATOM   7050  O  O   . TYR B 1 425 ? 80.726 75.139  33.672  1.00 44.99 ? 425 TYR B O   1 
ATOM   7051  C  CB  . TYR B 1 425 ? 79.833 77.103  36.089  1.00 43.12 ? 425 TYR B CB  1 
ATOM   7052  C  CG  . TYR B 1 425 ? 79.923 78.487  36.702  1.00 41.50 ? 425 TYR B CG  1 
ATOM   7053  C  CD1 . TYR B 1 425 ? 79.944 79.620  35.892  1.00 40.86 ? 425 TYR B CD1 1 
ATOM   7054  C  CD2 . TYR B 1 425 ? 79.945 78.664  38.091  1.00 40.95 ? 425 TYR B CD2 1 
ATOM   7055  C  CE1 . TYR B 1 425 ? 79.975 80.892  36.435  1.00 41.58 ? 425 TYR B CE1 1 
ATOM   7056  C  CE2 . TYR B 1 425 ? 79.976 79.946  38.660  1.00 40.67 ? 425 TYR B CE2 1 
ATOM   7057  C  CZ  . TYR B 1 425 ? 79.986 81.059  37.821  1.00 41.52 ? 425 TYR B CZ  1 
ATOM   7058  O  OH  . TYR B 1 425 ? 79.959 82.342  38.334  1.00 41.03 ? 425 TYR B OH  1 
ATOM   7059  N  N   . SER B 1 426 ? 80.901 74.173  35.714  1.00 46.20 ? 426 SER B N   1 
ATOM   7060  C  CA  . SER B 1 426 ? 80.680 72.816  35.237  1.00 46.86 ? 426 SER B CA  1 
ATOM   7061  C  C   . SER B 1 426 ? 79.412 72.235  35.847  1.00 46.18 ? 426 SER B C   1 
ATOM   7062  O  O   . SER B 1 426 ? 79.023 72.584  36.965  1.00 46.09 ? 426 SER B O   1 
ATOM   7063  C  CB  . SER B 1 426 ? 81.880 71.925  35.598  1.00 48.24 ? 426 SER B CB  1 
ATOM   7064  O  OG  . SER B 1 426 ? 82.067 71.849  37.010  1.00 49.15 ? 426 SER B OG  1 
ATOM   7065  N  N   . GLY B 1 427 ? 78.780 71.336  35.102  1.00 45.62 ? 427 GLY B N   1 
ATOM   7066  C  CA  . GLY B 1 427 ? 77.566 70.709  35.573  1.00 44.18 ? 427 GLY B CA  1 
ATOM   7067  C  C   . GLY B 1 427 ? 76.443 70.940  34.592  1.00 43.69 ? 427 GLY B C   1 
ATOM   7068  O  O   . GLY B 1 427 ? 76.584 71.698  33.633  1.00 43.74 ? 427 GLY B O   1 
ATOM   7069  N  N   . GLU B 1 428 ? 75.325 70.267  34.829  1.00 43.75 ? 428 GLU B N   1 
ATOM   7070  C  CA  . GLU B 1 428 ? 74.158 70.402  33.984  1.00 43.31 ? 428 GLU B CA  1 
ATOM   7071  C  C   . GLU B 1 428 ? 73.360 71.595  34.476  1.00 41.93 ? 428 GLU B C   1 
ATOM   7072  O  O   . GLU B 1 428 ? 73.491 72.005  35.630  1.00 42.38 ? 428 GLU B O   1 
ATOM   7073  C  CB  . GLU B 1 428 ? 73.276 69.165  34.098  1.00 45.22 ? 428 GLU B CB  1 
ATOM   7074  C  CG  . GLU B 1 428 ? 73.954 67.831  33.841  1.00 48.35 ? 428 GLU B CG  1 
ATOM   7075  C  CD  . GLU B 1 428 ? 72.964 66.671  33.949  1.00 50.60 ? 428 GLU B CD  1 
ATOM   7076  O  OE1 . GLU B 1 428 ? 72.507 66.168  32.893  1.00 51.94 ? 428 GLU B OE1 1 
ATOM   7077  O  OE2 . GLU B 1 428 ? 72.626 66.278  35.096  1.00 51.68 ? 428 GLU B OE2 1 
ATOM   7078  N  N   . VAL B 1 429 ? 72.531 72.146  33.598  1.00 40.27 ? 429 VAL B N   1 
ATOM   7079  C  CA  . VAL B 1 429 ? 71.665 73.261  33.961  1.00 38.07 ? 429 VAL B CA  1 
ATOM   7080  C  C   . VAL B 1 429 ? 70.368 72.636  34.478  1.00 37.61 ? 429 VAL B C   1 
ATOM   7081  O  O   . VAL B 1 429 ? 69.462 72.317  33.705  1.00 37.25 ? 429 VAL B O   1 
ATOM   7082  C  CB  . VAL B 1 429 ? 71.367 74.151  32.741  1.00 37.47 ? 429 VAL B CB  1 
ATOM   7083  C  CG1 . VAL B 1 429 ? 70.225 75.096  33.042  1.00 37.79 ? 429 VAL B CG1 1 
ATOM   7084  C  CG2 . VAL B 1 429 ? 72.599 74.943  32.381  1.00 36.93 ? 429 VAL B CG2 1 
ATOM   7085  N  N   . ARG B 1 430 ? 70.302 72.426  35.788  1.00 36.80 ? 430 ARG B N   1 
ATOM   7086  C  CA  . ARG B 1 430 ? 69.120 71.840  36.404  1.00 36.41 ? 430 ARG B CA  1 
ATOM   7087  C  C   . ARG B 1 430 ? 68.942 72.314  37.826  1.00 35.93 ? 430 ARG B C   1 
ATOM   7088  O  O   . ARG B 1 430 ? 69.676 73.183  38.292  1.00 36.17 ? 430 ARG B O   1 
ATOM   7089  C  CB  . ARG B 1 430 ? 69.191 70.316  36.398  1.00 37.36 ? 430 ARG B CB  1 
ATOM   7090  C  CG  . ARG B 1 430 ? 70.509 69.740  36.819  1.00 38.97 ? 430 ARG B CG  1 
ATOM   7091  C  CD  . ARG B 1 430 ? 70.394 68.247  37.040  1.00 40.42 ? 430 ARG B CD  1 
ATOM   7092  N  NE  . ARG B 1 430 ? 70.194 67.991  38.458  1.00 43.43 ? 430 ARG B NE  1 
ATOM   7093  C  CZ  . ARG B 1 430 ? 71.063 67.342  39.229  1.00 44.62 ? 430 ARG B CZ  1 
ATOM   7094  N  NH1 . ARG B 1 430 ? 72.195 66.866  38.701  1.00 44.00 ? 430 ARG B NH1 1 
ATOM   7095  N  NH2 . ARG B 1 430 ? 70.817 67.209  40.536  1.00 44.10 ? 430 ARG B NH2 1 
ATOM   7096  N  N   . ARG B 1 431 ? 67.963 71.740  38.515  1.00 34.86 ? 431 ARG B N   1 
ATOM   7097  C  CA  . ARG B 1 431 ? 67.688 72.122  39.889  1.00 33.63 ? 431 ARG B CA  1 
ATOM   7098  C  C   . ARG B 1 431 ? 68.435 71.214  40.855  1.00 32.63 ? 431 ARG B C   1 
ATOM   7099  O  O   . ARG B 1 431 ? 68.171 70.032  40.930  1.00 33.31 ? 431 ARG B O   1 
ATOM   7100  C  CB  . ARG B 1 431 ? 66.176 72.072  40.149  1.00 33.63 ? 431 ARG B CB  1 
ATOM   7101  C  CG  . ARG B 1 431 ? 65.379 73.024  39.254  1.00 33.59 ? 431 ARG B CG  1 
ATOM   7102  C  CD  . ARG B 1 431 ? 63.879 72.978  39.530  1.00 33.05 ? 431 ARG B CD  1 
ATOM   7103  N  NE  . ARG B 1 431 ? 63.119 73.730  38.529  1.00 33.26 ? 431 ARG B NE  1 
ATOM   7104  C  CZ  . ARG B 1 431 ? 62.789 75.019  38.621  1.00 33.62 ? 431 ARG B CZ  1 
ATOM   7105  N  NH1 . ARG B 1 431 ? 63.139 75.738  39.684  1.00 32.80 ? 431 ARG B NH1 1 
ATOM   7106  N  NH2 . ARG B 1 431 ? 62.109 75.597  37.639  1.00 31.83 ? 431 ARG B NH2 1 
ATOM   7107  N  N   . PHE B 1 432 ? 69.386 71.775  41.583  1.00 31.51 ? 432 PHE B N   1 
ATOM   7108  C  CA  . PHE B 1 432 ? 70.164 71.004  42.534  1.00 30.63 ? 432 PHE B CA  1 
ATOM   7109  C  C   . PHE B 1 432 ? 69.614 71.279  43.920  1.00 30.85 ? 432 PHE B C   1 
ATOM   7110  O  O   . PHE B 1 432 ? 69.517 72.434  44.339  1.00 30.95 ? 432 PHE B O   1 
ATOM   7111  C  CB  . PHE B 1 432 ? 71.636 71.408  42.450  1.00 30.25 ? 432 PHE B CB  1 
ATOM   7112  C  CG  . PHE B 1 432 ? 72.268 71.126  41.113  1.00 29.77 ? 432 PHE B CG  1 
ATOM   7113  C  CD1 . PHE B 1 432 ? 72.906 69.917  40.874  1.00 29.14 ? 432 PHE B CD1 1 
ATOM   7114  C  CD2 . PHE B 1 432 ? 72.206 72.073  40.080  1.00 28.98 ? 432 PHE B CD2 1 
ATOM   7115  C  CE1 . PHE B 1 432 ? 73.481 69.651  39.613  1.00 30.25 ? 432 PHE B CE1 1 
ATOM   7116  C  CE2 . PHE B 1 432 ? 72.771 71.820  38.826  1.00 28.45 ? 432 PHE B CE2 1 
ATOM   7117  C  CZ  . PHE B 1 432 ? 73.410 70.610  38.589  1.00 29.20 ? 432 PHE B CZ  1 
ATOM   7118  N  N   . ASN B 1 433 ? 69.239 70.219  44.626  1.00 31.40 ? 433 ASN B N   1 
ATOM   7119  C  CA  . ASN B 1 433 ? 68.676 70.365  45.966  1.00 31.79 ? 433 ASN B CA  1 
ATOM   7120  C  C   . ASN B 1 433 ? 69.752 70.710  46.988  1.00 31.29 ? 433 ASN B C   1 
ATOM   7121  O  O   . ASN B 1 433 ? 70.797 70.065  47.037  1.00 32.78 ? 433 ASN B O   1 
ATOM   7122  C  CB  . ASN B 1 433 ? 67.962 69.074  46.381  1.00 32.13 ? 433 ASN B CB  1 
ATOM   7123  C  CG  . ASN B 1 433 ? 67.243 69.203  47.718  1.00 33.13 ? 433 ASN B CG  1 
ATOM   7124  O  OD1 . ASN B 1 433 ? 66.916 68.204  48.346  1.00 33.63 ? 433 ASN B OD1 1 
ATOM   7125  N  ND2 . ASN B 1 433 ? 66.988 70.432  48.150  1.00 33.15 ? 433 ASN B ND2 1 
ATOM   7126  N  N   . THR B 1 434 ? 69.506 71.734  47.791  1.00 30.56 ? 434 THR B N   1 
ATOM   7127  C  CA  . THR B 1 434 ? 70.468 72.119  48.809  1.00 31.03 ? 434 THR B CA  1 
ATOM   7128  C  C   . THR B 1 434 ? 69.826 72.017  50.189  1.00 31.70 ? 434 THR B C   1 
ATOM   7129  O  O   . THR B 1 434 ? 70.332 72.556  51.176  1.00 32.00 ? 434 THR B O   1 
ATOM   7130  C  CB  . THR B 1 434 ? 70.964 73.554  48.597  1.00 30.51 ? 434 THR B CB  1 
ATOM   7131  O  OG1 . THR B 1 434 ? 69.859 74.455  48.693  1.00 29.79 ? 434 THR B OG1 1 
ATOM   7132  C  CG2 . THR B 1 434 ? 71.623 73.693  47.239  1.00 29.85 ? 434 THR B CG2 1 
ATOM   7133  N  N   . ALA B 1 435 ? 68.700 71.322  50.252  1.00 32.55 ? 435 ALA B N   1 
ATOM   7134  C  CA  . ALA B 1 435 ? 67.992 71.154  51.509  1.00 33.28 ? 435 ALA B CA  1 
ATOM   7135  C  C   . ALA B 1 435 ? 68.847 70.380  52.499  1.00 34.21 ? 435 ALA B C   1 
ATOM   7136  O  O   . ALA B 1 435 ? 68.733 70.571  53.704  1.00 33.96 ? 435 ALA B O   1 
ATOM   7137  C  CB  . ALA B 1 435 ? 66.683 70.422  51.273  1.00 31.94 ? 435 ALA B CB  1 
ATOM   7138  N  N   . ASN B 1 436 ? 69.720 69.520  51.981  1.00 35.49 ? 436 ASN B N   1 
ATOM   7139  C  CA  . ASN B 1 436 ? 70.561 68.694  52.838  1.00 36.38 ? 436 ASN B CA  1 
ATOM   7140  C  C   . ASN B 1 436 ? 72.010 69.115  52.997  1.00 36.52 ? 436 ASN B C   1 
ATOM   7141  O  O   . ASN B 1 436 ? 72.839 68.312  53.410  1.00 37.02 ? 436 ASN B O   1 
ATOM   7142  C  CB  . ASN B 1 436 ? 70.499 67.242  52.373  1.00 36.91 ? 436 ASN B CB  1 
ATOM   7143  C  CG  . ASN B 1 436 ? 69.074 66.754  52.211  1.00 37.97 ? 436 ASN B CG  1 
ATOM   7144  O  OD1 . ASN B 1 436 ? 68.251 66.874  53.127  1.00 37.74 ? 436 ASN B OD1 1 
ATOM   7145  N  ND2 . ASN B 1 436 ? 68.769 66.204  51.038  1.00 39.37 ? 436 ASN B ND2 1 
ATOM   7146  N  N   . ASP B 1 437 ? 72.327 70.360  52.656  1.00 36.94 ? 437 ASP B N   1 
ATOM   7147  C  CA  . ASP B 1 437 ? 73.680 70.848  52.853  1.00 37.49 ? 437 ASP B CA  1 
ATOM   7148  C  C   . ASP B 1 437 ? 73.773 70.921  54.375  1.00 38.32 ? 437 ASP B C   1 
ATOM   7149  O  O   . ASP B 1 437 ? 72.758 70.804  55.056  1.00 39.20 ? 437 ASP B O   1 
ATOM   7150  C  CB  . ASP B 1 437 ? 73.856 72.210  52.189  1.00 37.55 ? 437 ASP B CB  1 
ATOM   7151  C  CG  . ASP B 1 437 ? 74.153 72.089  50.692  1.00 38.76 ? 437 ASP B CG  1 
ATOM   7152  O  OD1 . ASP B 1 437 ? 73.803 71.046  50.091  1.00 40.41 ? 437 ASP B OD1 1 
ATOM   7153  O  OD2 . ASP B 1 437 ? 74.731 73.029  50.106  1.00 39.52 ? 437 ASP B OD2 1 
ATOM   7154  N  N   . ASP B 1 438 ? 74.958 71.092  54.934  1.00 38.91 ? 438 ASP B N   1 
ATOM   7155  C  CA  . ASP B 1 438 ? 75.044 71.091  56.386  1.00 39.54 ? 438 ASP B CA  1 
ATOM   7156  C  C   . ASP B 1 438 ? 74.041 72.035  57.040  1.00 39.08 ? 438 ASP B C   1 
ATOM   7157  O  O   . ASP B 1 438 ? 74.013 73.222  56.750  1.00 40.06 ? 438 ASP B O   1 
ATOM   7158  C  CB  . ASP B 1 438 ? 76.466 71.431  56.827  1.00 40.70 ? 438 ASP B CB  1 
ATOM   7159  C  CG  . ASP B 1 438 ? 76.734 71.033  58.262  1.00 42.50 ? 438 ASP B CG  1 
ATOM   7160  O  OD1 . ASP B 1 438 ? 76.301 71.769  59.181  1.00 43.37 ? 438 ASP B OD1 1 
ATOM   7161  O  OD2 . ASP B 1 438 ? 77.365 69.970  58.465  1.00 42.96 ? 438 ASP B OD2 1 
ATOM   7162  N  N   . ASN B 1 439 ? 73.195 71.505  57.914  1.00 38.67 ? 439 ASN B N   1 
ATOM   7163  C  CA  . ASN B 1 439 ? 72.214 72.352  58.581  1.00 37.63 ? 439 ASN B CA  1 
ATOM   7164  C  C   . ASN B 1 439 ? 72.496 72.549  60.051  1.00 37.80 ? 439 ASN B C   1 
ATOM   7165  O  O   . ASN B 1 439 ? 71.800 73.335  60.696  1.00 39.14 ? 439 ASN B O   1 
ATOM   7166  C  CB  . ASN B 1 439 ? 70.796 71.785  58.466  1.00 36.72 ? 439 ASN B CB  1 
ATOM   7167  C  CG  . ASN B 1 439 ? 70.239 71.880  57.073  1.00 35.82 ? 439 ASN B CG  1 
ATOM   7168  O  OD1 . ASN B 1 439 ? 70.480 72.845  56.365  1.00 36.75 ? 439 ASN B OD1 1 
ATOM   7169  N  ND2 . ASN B 1 439 ? 69.472 70.883  56.680  1.00 35.68 ? 439 ASN B ND2 1 
ATOM   7170  N  N   . VAL B 1 440 ? 73.493 71.863  60.604  1.00 37.07 ? 440 VAL B N   1 
ATOM   7171  C  CA  . VAL B 1 440 ? 73.729 72.032  62.031  1.00 37.06 ? 440 VAL B CA  1 
ATOM   7172  C  C   . VAL B 1 440 ? 75.130 72.310  62.533  1.00 37.08 ? 440 VAL B C   1 
ATOM   7173  O  O   . VAL B 1 440 ? 75.287 72.796  63.648  1.00 37.84 ? 440 VAL B O   1 
ATOM   7174  C  CB  . VAL B 1 440 ? 73.226 70.817  62.838  1.00 36.70 ? 440 VAL B CB  1 
ATOM   7175  C  CG1 . VAL B 1 440 ? 71.826 70.429  62.397  1.00 36.27 ? 440 VAL B CG1 1 
ATOM   7176  C  CG2 . VAL B 1 440 ? 74.193 69.668  62.681  1.00 36.36 ? 440 VAL B CG2 1 
ATOM   7177  N  N   . THR B 1 441 ? 76.154 72.031  61.744  1.00 36.76 ? 441 THR B N   1 
ATOM   7178  C  CA  . THR B 1 441 ? 77.496 72.237  62.270  1.00 36.61 ? 441 THR B CA  1 
ATOM   7179  C  C   . THR B 1 441 ? 77.775 73.622  62.844  1.00 36.51 ? 441 THR B C   1 
ATOM   7180  O  O   . THR B 1 441 ? 77.997 73.758  64.052  1.00 36.79 ? 441 THR B O   1 
ATOM   7181  C  CB  . THR B 1 441 ? 78.588 71.876  61.237  1.00 35.80 ? 441 THR B CB  1 
ATOM   7182  O  OG1 . THR B 1 441 ? 78.386 70.534  60.779  1.00 36.08 ? 441 THR B OG1 1 
ATOM   7183  C  CG2 . THR B 1 441 ? 79.948 71.931  61.888  1.00 34.78 ? 441 THR B CG2 1 
ATOM   7184  N  N   . GLN B 1 442 ? 77.764 74.644  61.995  1.00 35.95 ? 442 GLN B N   1 
ATOM   7185  C  CA  . GLN B 1 442 ? 78.041 75.989  62.460  1.00 35.29 ? 442 GLN B CA  1 
ATOM   7186  C  C   . GLN B 1 442 ? 77.098 76.385  63.579  1.00 35.27 ? 442 GLN B C   1 
ATOM   7187  O  O   . GLN B 1 442 ? 77.461 77.158  64.468  1.00 34.94 ? 442 GLN B O   1 
ATOM   7188  C  CB  . GLN B 1 442 ? 77.951 76.983  61.305  1.00 35.47 ? 442 GLN B CB  1 
ATOM   7189  C  CG  . GLN B 1 442 ? 79.126 76.890  60.336  1.00 36.20 ? 442 GLN B CG  1 
ATOM   7190  C  CD  . GLN B 1 442 ? 79.264 78.119  59.437  1.00 36.52 ? 442 GLN B CD  1 
ATOM   7191  O  OE1 . GLN B 1 442 ? 80.295 78.316  58.801  1.00 36.89 ? 442 GLN B OE1 1 
ATOM   7192  N  NE2 . GLN B 1 442 ? 78.225 78.942  59.383  1.00 36.84 ? 442 GLN B NE2 1 
ATOM   7193  N  N   . VAL B 1 443 ? 75.889 75.837  63.547  1.00 35.38 ? 443 VAL B N   1 
ATOM   7194  C  CA  . VAL B 1 443 ? 74.901 76.146  64.568  1.00 35.13 ? 443 VAL B CA  1 
ATOM   7195  C  C   . VAL B 1 443 ? 75.410 75.653  65.917  1.00 35.61 ? 443 VAL B C   1 
ATOM   7196  O  O   . VAL B 1 443 ? 75.205 76.297  66.948  1.00 35.21 ? 443 VAL B O   1 
ATOM   7197  C  CB  . VAL B 1 443 ? 73.552 75.479  64.251  1.00 35.13 ? 443 VAL B CB  1 
ATOM   7198  C  CG1 . VAL B 1 443 ? 72.458 76.040  65.169  1.00 34.56 ? 443 VAL B CG1 1 
ATOM   7199  C  CG2 . VAL B 1 443 ? 73.202 75.695  62.789  1.00 33.92 ? 443 VAL B CG2 1 
ATOM   7200  N  N   . ARG B 1 444 ? 76.092 74.513  65.899  1.00 36.64 ? 444 ARG B N   1 
ATOM   7201  C  CA  . ARG B 1 444 ? 76.640 73.931  67.113  1.00 37.34 ? 444 ARG B CA  1 
ATOM   7202  C  C   . ARG B 1 444 ? 77.717 74.865  67.658  1.00 37.49 ? 444 ARG B C   1 
ATOM   7203  O  O   . ARG B 1 444 ? 77.658 75.289  68.812  1.00 37.30 ? 444 ARG B O   1 
ATOM   7204  C  CB  . ARG B 1 444 ? 77.229 72.551  66.807  1.00 38.53 ? 444 ARG B CB  1 
ATOM   7205  C  CG  . ARG B 1 444 ? 77.418 71.647  68.029  1.00 40.56 ? 444 ARG B CG  1 
ATOM   7206  C  CD  . ARG B 1 444 ? 77.893 70.255  67.632  1.00 42.61 ? 444 ARG B CD  1 
ATOM   7207  N  NE  . ARG B 1 444 ? 76.866 69.507  66.898  1.00 45.52 ? 444 ARG B NE  1 
ATOM   7208  C  CZ  . ARG B 1 444 ? 77.046 68.941  65.700  1.00 45.73 ? 444 ARG B CZ  1 
ATOM   7209  N  NH1 . ARG B 1 444 ? 78.217 69.032  65.079  1.00 45.40 ? 444 ARG B NH1 1 
ATOM   7210  N  NH2 . ARG B 1 444 ? 76.050 68.278  65.123  1.00 45.66 ? 444 ARG B NH2 1 
ATOM   7211  N  N   . ALA B 1 445 ? 78.684 75.201  66.808  1.00 37.89 ? 445 ALA B N   1 
ATOM   7212  C  CA  . ALA B 1 445 ? 79.781 76.087  67.186  1.00 38.24 ? 445 ALA B CA  1 
ATOM   7213  C  C   . ALA B 1 445 ? 79.280 77.421  67.755  1.00 39.20 ? 445 ALA B C   1 
ATOM   7214  O  O   . ALA B 1 445 ? 79.916 78.017  68.633  1.00 40.18 ? 445 ALA B O   1 
ATOM   7215  C  CB  . ALA B 1 445 ? 80.691 76.333  65.984  1.00 37.29 ? 445 ALA B CB  1 
ATOM   7216  N  N   . PHE B 1 446 ? 78.148 77.900  67.256  1.00 39.38 ? 446 PHE B N   1 
ATOM   7217  C  CA  . PHE B 1 446 ? 77.596 79.153  67.750  1.00 40.02 ? 446 PHE B CA  1 
ATOM   7218  C  C   . PHE B 1 446 ? 76.918 78.907  69.097  1.00 40.93 ? 446 PHE B C   1 
ATOM   7219  O  O   . PHE B 1 446 ? 77.006 79.721  70.014  1.00 41.05 ? 446 PHE B O   1 
ATOM   7220  C  CB  . PHE B 1 446 ? 76.576 79.709  66.751  1.00 39.23 ? 446 PHE B CB  1 
ATOM   7221  C  CG  . PHE B 1 446 ? 75.758 80.840  67.289  1.00 38.00 ? 446 PHE B CG  1 
ATOM   7222  C  CD1 . PHE B 1 446 ? 76.263 82.123  67.325  1.00 38.16 ? 446 PHE B CD1 1 
ATOM   7223  C  CD2 . PHE B 1 446 ? 74.478 80.614  67.778  1.00 37.96 ? 446 PHE B CD2 1 
ATOM   7224  C  CE1 . PHE B 1 446 ? 75.498 83.173  67.843  1.00 38.87 ? 446 PHE B CE1 1 
ATOM   7225  C  CE2 . PHE B 1 446 ? 73.706 81.653  68.297  1.00 37.45 ? 446 PHE B CE2 1 
ATOM   7226  C  CZ  . PHE B 1 446 ? 74.213 82.930  68.330  1.00 37.95 ? 446 PHE B CZ  1 
ATOM   7227  N  N   . TYR B 1 447 ? 76.239 77.774  69.209  1.00 41.86 ? 447 TYR B N   1 
ATOM   7228  C  CA  . TYR B 1 447 ? 75.546 77.453  70.436  1.00 42.82 ? 447 TYR B CA  1 
ATOM   7229  C  C   . TYR B 1 447 ? 76.476 77.185  71.597  1.00 43.73 ? 447 TYR B C   1 
ATOM   7230  O  O   . TYR B 1 447 ? 76.310 77.771  72.662  1.00 44.42 ? 447 TYR B O   1 
ATOM   7231  C  CB  . TYR B 1 447 ? 74.633 76.247  70.242  1.00 42.09 ? 447 TYR B CB  1 
ATOM   7232  C  CG  . TYR B 1 447 ? 73.846 75.888  71.485  1.00 42.32 ? 447 TYR B CG  1 
ATOM   7233  C  CD1 . TYR B 1 447 ? 74.250 74.836  72.306  1.00 42.30 ? 447 TYR B CD1 1 
ATOM   7234  C  CD2 . TYR B 1 447 ? 72.681 76.586  71.832  1.00 41.74 ? 447 TYR B CD2 1 
ATOM   7235  C  CE1 . TYR B 1 447 ? 73.513 74.476  73.441  1.00 42.31 ? 447 TYR B CE1 1 
ATOM   7236  C  CE2 . TYR B 1 447 ? 71.937 76.236  72.968  1.00 41.46 ? 447 TYR B CE2 1 
ATOM   7237  C  CZ  . TYR B 1 447 ? 72.360 75.175  73.766  1.00 42.34 ? 447 TYR B CZ  1 
ATOM   7238  O  OH  . TYR B 1 447 ? 71.636 74.793  74.880  1.00 42.54 ? 447 TYR B OH  1 
ATOM   7239  N  N   . VAL B 1 448 ? 77.457 76.314  71.402  1.00 44.54 ? 448 VAL B N   1 
ATOM   7240  C  CA  . VAL B 1 448 ? 78.355 75.989  72.499  1.00 46.37 ? 448 VAL B CA  1 
ATOM   7241  C  C   . VAL B 1 448 ? 79.620 76.842  72.635  1.00 46.83 ? 448 VAL B C   1 
ATOM   7242  O  O   . VAL B 1 448 ? 80.189 76.944  73.725  1.00 47.62 ? 448 VAL B O   1 
ATOM   7243  C  CB  . VAL B 1 448 ? 78.740 74.486  72.465  1.00 47.06 ? 448 VAL B CB  1 
ATOM   7244  C  CG1 . VAL B 1 448 ? 79.324 74.115  71.113  1.00 47.51 ? 448 VAL B CG1 1 
ATOM   7245  C  CG2 . VAL B 1 448 ? 79.725 74.180  73.584  1.00 47.57 ? 448 VAL B CG2 1 
ATOM   7246  N  N   . ASN B 1 449 ? 80.060 77.476  71.559  1.00 46.86 ? 449 ASN B N   1 
ATOM   7247  C  CA  . ASN B 1 449 ? 81.261 78.287  71.662  1.00 47.71 ? 449 ASN B CA  1 
ATOM   7248  C  C   . ASN B 1 449 ? 80.963 79.785  71.773  1.00 48.22 ? 449 ASN B C   1 
ATOM   7249  O  O   . ASN B 1 449 ? 81.261 80.418  72.799  1.00 48.89 ? 449 ASN B O   1 
ATOM   7250  C  CB  . ASN B 1 449 ? 82.176 78.020  70.459  1.00 48.11 ? 449 ASN B CB  1 
ATOM   7251  C  CG  . ASN B 1 449 ? 82.603 76.552  70.353  1.00 48.36 ? 449 ASN B CG  1 
ATOM   7252  O  OD1 . ASN B 1 449 ? 83.166 76.130  69.338  1.00 48.82 ? 449 ASN B OD1 1 
ATOM   7253  N  ND2 . ASN B 1 449 ? 82.341 75.775  71.402  1.00 48.03 ? 449 ASN B ND2 1 
ATOM   7254  N  N   . VAL B 1 450 ? 80.369 80.341  70.719  1.00 48.06 ? 450 VAL B N   1 
ATOM   7255  C  CA  . VAL B 1 450 ? 80.043 81.765  70.647  1.00 47.21 ? 450 VAL B CA  1 
ATOM   7256  C  C   . VAL B 1 450 ? 79.200 82.312  71.800  1.00 48.76 ? 450 VAL B C   1 
ATOM   7257  O  O   . VAL B 1 450 ? 79.445 83.423  72.280  1.00 49.43 ? 450 VAL B O   1 
ATOM   7258  C  CB  . VAL B 1 450 ? 79.331 82.082  69.325  1.00 45.52 ? 450 VAL B CB  1 
ATOM   7259  C  CG1 . VAL B 1 450 ? 78.982 83.558  69.253  1.00 43.63 ? 450 VAL B CG1 1 
ATOM   7260  C  CG2 . VAL B 1 450 ? 80.215 81.670  68.166  1.00 44.18 ? 450 VAL B CG2 1 
ATOM   7261  N  N   . LEU B 1 451 ? 78.198 81.554  72.235  1.00 49.71 ? 451 LEU B N   1 
ATOM   7262  C  CA  . LEU B 1 451 ? 77.342 81.993  73.336  1.00 50.50 ? 451 LEU B CA  1 
ATOM   7263  C  C   . LEU B 1 451 ? 77.894 81.483  74.665  1.00 51.71 ? 451 LEU B C   1 
ATOM   7264  O  O   . LEU B 1 451 ? 78.796 80.642  74.692  1.00 52.03 ? 451 LEU B O   1 
ATOM   7265  C  CB  . LEU B 1 451 ? 75.919 81.459  73.154  1.00 49.48 ? 451 LEU B CB  1 
ATOM   7266  C  CG  . LEU B 1 451 ? 75.094 81.857  71.928  1.00 49.06 ? 451 LEU B CG  1 
ATOM   7267  C  CD1 . LEU B 1 451 ? 73.686 81.314  72.081  1.00 49.46 ? 451 LEU B CD1 1 
ATOM   7268  C  CD2 . LEU B 1 451 ? 75.028 83.358  71.800  1.00 48.94 ? 451 LEU B CD2 1 
ATOM   7269  N  N   . ASN B 1 452 ? 77.364 82.004  75.766  1.00 52.86 ? 452 ASN B N   1 
ATOM   7270  C  CA  . ASN B 1 452 ? 77.779 81.556  77.094  1.00 53.69 ? 452 ASN B CA  1 
ATOM   7271  C  C   . ASN B 1 452 ? 76.520 80.954  77.704  1.00 54.22 ? 452 ASN B C   1 
ATOM   7272  O  O   . ASN B 1 452 ? 75.498 80.863  77.020  1.00 54.04 ? 452 ASN B O   1 
ATOM   7273  C  CB  . ASN B 1 452 ? 78.262 82.729  77.938  1.00 53.55 ? 452 ASN B CB  1 
ATOM   7274  C  CG  . ASN B 1 452 ? 77.161 83.708  78.232  1.00 54.25 ? 452 ASN B CG  1 
ATOM   7275  O  OD1 . ASN B 1 452 ? 76.087 83.320  78.688  1.00 54.49 ? 452 ASN B OD1 1 
ATOM   7276  N  ND2 . ASN B 1 452 ? 77.416 84.992  77.975  1.00 54.26 ? 452 ASN B ND2 1 
ATOM   7277  N  N   . GLU B 1 453 ? 76.568 80.558  78.976  1.00 55.03 ? 453 GLU B N   1 
ATOM   7278  C  CA  . GLU B 1 453 ? 75.388 79.960  79.595  1.00 55.47 ? 453 GLU B CA  1 
ATOM   7279  C  C   . GLU B 1 453 ? 74.168 80.870  79.683  1.00 55.14 ? 453 GLU B C   1 
ATOM   7280  O  O   . GLU B 1 453 ? 73.067 80.426  79.383  1.00 55.48 ? 453 GLU B O   1 
ATOM   7281  C  CB  . GLU B 1 453 ? 75.717 79.395  80.983  1.00 56.87 ? 453 GLU B CB  1 
ATOM   7282  C  CG  . GLU B 1 453 ? 76.112 77.909  80.971  1.00 59.47 ? 453 GLU B CG  1 
ATOM   7283  C  CD  . GLU B 1 453 ? 74.976 76.964  80.518  1.00 61.32 ? 453 GLU B CD  1 
ATOM   7284  O  OE1 . GLU B 1 453 ? 75.277 75.815  80.103  1.00 61.53 ? 453 GLU B OE1 1 
ATOM   7285  O  OE2 . GLU B 1 453 ? 73.784 77.355  80.586  1.00 62.30 ? 453 GLU B OE2 1 
ATOM   7286  N  N   . GLU B 1 454 ? 74.340 82.128  80.083  1.00 55.11 ? 454 GLU B N   1 
ATOM   7287  C  CA  . GLU B 1 454 ? 73.195 83.043  80.181  1.00 55.15 ? 454 GLU B CA  1 
ATOM   7288  C  C   . GLU B 1 454 ? 72.492 83.139  78.835  1.00 54.62 ? 454 GLU B C   1 
ATOM   7289  O  O   . GLU B 1 454 ? 71.288 82.883  78.719  1.00 54.67 ? 454 GLU B O   1 
ATOM   7290  C  CB  . GLU B 1 454 ? 73.620 84.464  80.526  1.00 56.02 ? 454 GLU B CB  1 
ATOM   7291  C  CG  . GLU B 1 454 ? 74.441 84.688  81.760  1.00 57.46 ? 454 GLU B CG  1 
ATOM   7292  C  CD  . GLU B 1 454 ? 75.074 86.076  81.707  1.00 58.91 ? 454 GLU B CD  1 
ATOM   7293  O  OE1 . GLU B 1 454 ? 74.319 87.077  81.639  1.00 58.87 ? 454 GLU B OE1 1 
ATOM   7294  O  OE2 . GLU B 1 454 ? 76.325 86.166  81.707  1.00 59.81 ? 454 GLU B OE2 1 
ATOM   7295  N  N   . GLN B 1 455 ? 73.266 83.555  77.835  1.00 53.82 ? 455 GLN B N   1 
ATOM   7296  C  CA  . GLN B 1 455 ? 72.793 83.733  76.469  1.00 52.88 ? 455 GLN B CA  1 
ATOM   7297  C  C   . GLN B 1 455 ? 72.138 82.444  75.996  1.00 52.43 ? 455 GLN B C   1 
ATOM   7298  O  O   . GLN B 1 455 ? 71.075 82.452  75.376  1.00 51.94 ? 455 GLN B O   1 
ATOM   7299  C  CB  . GLN B 1 455 ? 73.979 84.114  75.576  1.00 52.43 ? 455 GLN B CB  1 
ATOM   7300  C  CG  . GLN B 1 455 ? 74.755 85.308  76.122  1.00 51.63 ? 455 GLN B CG  1 
ATOM   7301  C  CD  . GLN B 1 455 ? 75.960 85.701  75.280  1.00 51.42 ? 455 GLN B CD  1 
ATOM   7302  O  OE1 . GLN B 1 455 ? 76.842 84.881  74.992  1.00 51.38 ? 455 GLN B OE1 1 
ATOM   7303  N  NE2 . GLN B 1 455 ? 76.012 86.968  74.894  1.00 51.07 ? 455 GLN B NE2 1 
ATOM   7304  N  N   . ARG B 1 456 ? 72.784 81.334  76.317  1.00 52.09 ? 456 ARG B N   1 
ATOM   7305  C  CA  . ARG B 1 456 ? 72.281 80.025  75.964  1.00 51.70 ? 456 ARG B CA  1 
ATOM   7306  C  C   . ARG B 1 456 ? 70.938 79.778  76.648  1.00 50.96 ? 456 ARG B C   1 
ATOM   7307  O  O   . ARG B 1 456 ? 70.003 79.302  76.016  1.00 51.80 ? 456 ARG B O   1 
ATOM   7308  C  CB  . ARG B 1 456 ? 73.299 78.972  76.378  1.00 52.65 ? 456 ARG B CB  1 
ATOM   7309  C  CG  . ARG B 1 456 ? 72.871 77.547  76.155  1.00 54.53 ? 456 ARG B CG  1 
ATOM   7310  C  CD  . ARG B 1 456 ? 74.018 76.592  76.506  1.00 56.15 ? 456 ARG B CD  1 
ATOM   7311  N  NE  . ARG B 1 456 ? 75.252 76.957  75.809  1.00 56.36 ? 456 ARG B NE  1 
ATOM   7312  C  CZ  . ARG B 1 456 ? 76.271 77.594  76.379  1.00 56.83 ? 456 ARG B CZ  1 
ATOM   7313  N  NH1 . ARG B 1 456 ? 76.206 77.936  77.661  1.00 56.18 ? 456 ARG B NH1 1 
ATOM   7314  N  NH2 . ARG B 1 456 ? 77.352 77.892  75.666  1.00 56.66 ? 456 ARG B NH2 1 
ATOM   7315  N  N   . LYS B 1 457 ? 70.829 80.104  77.933  1.00 50.09 ? 457 LYS B N   1 
ATOM   7316  C  CA  . LYS B 1 457 ? 69.565 79.900  78.646  1.00 49.34 ? 457 LYS B CA  1 
ATOM   7317  C  C   . LYS B 1 457 ? 68.464 80.773  78.045  1.00 48.04 ? 457 LYS B C   1 
ATOM   7318  O  O   . LYS B 1 457 ? 67.354 80.307  77.774  1.00 47.69 ? 457 LYS B O   1 
ATOM   7319  C  CB  . LYS B 1 457 ? 69.703 80.236  80.137  1.00 50.11 ? 457 LYS B CB  1 
ATOM   7320  C  CG  . LYS B 1 457 ? 68.398 80.020  80.922  1.00 52.17 ? 457 LYS B CG  1 
ATOM   7321  C  CD  . LYS B 1 457 ? 68.363 80.732  82.287  1.00 53.97 ? 457 LYS B CD  1 
ATOM   7322  C  CE  . LYS B 1 457 ? 68.274 82.270  82.164  1.00 55.38 ? 457 LYS B CE  1 
ATOM   7323  N  NZ  . LYS B 1 457 ? 69.527 82.919  81.616  1.00 56.05 ? 457 LYS B NZ  1 
ATOM   7324  N  N   . ARG B 1 458 ? 68.774 82.050  77.855  1.00 46.98 ? 458 ARG B N   1 
ATOM   7325  C  CA  . ARG B 1 458 ? 67.815 82.982  77.282  1.00 46.07 ? 458 ARG B CA  1 
ATOM   7326  C  C   . ARG B 1 458 ? 67.409 82.502  75.896  1.00 45.34 ? 458 ARG B C   1 
ATOM   7327  O  O   . ARG B 1 458 ? 66.230 82.427  75.578  1.00 45.11 ? 458 ARG B O   1 
ATOM   7328  C  CB  . ARG B 1 458 ? 68.423 84.381  77.203  1.00 45.89 ? 458 ARG B CB  1 
ATOM   7329  C  CG  . ARG B 1 458 ? 67.817 85.364  78.196  1.00 45.66 ? 458 ARG B CG  1 
ATOM   7330  C  CD  . ARG B 1 458 ? 68.888 86.069  78.975  1.00 44.72 ? 458 ARG B CD  1 
ATOM   7331  N  NE  . ARG B 1 458 ? 69.807 86.794  78.109  1.00 45.26 ? 458 ARG B NE  1 
ATOM   7332  C  CZ  . ARG B 1 458 ? 71.031 87.159  78.479  1.00 46.48 ? 458 ARG B CZ  1 
ATOM   7333  N  NH1 . ARG B 1 458 ? 71.477 86.863  79.697  1.00 46.76 ? 458 ARG B NH1 1 
ATOM   7334  N  NH2 . ARG B 1 458 ? 71.815 87.813  77.638  1.00 46.17 ? 458 ARG B NH2 1 
ATOM   7335  N  N   . LEU B 1 459 ? 68.392 82.162  75.076  1.00 44.58 ? 459 LEU B N   1 
ATOM   7336  C  CA  . LEU B 1 459 ? 68.092 81.677  73.752  1.00 44.26 ? 459 LEU B CA  1 
ATOM   7337  C  C   . LEU B 1 459 ? 66.977 80.650  73.850  1.00 44.98 ? 459 LEU B C   1 
ATOM   7338  O  O   . LEU B 1 459 ? 65.976 80.753  73.144  1.00 45.96 ? 459 LEU B O   1 
ATOM   7339  C  CB  . LEU B 1 459 ? 69.331 81.048  73.121  1.00 43.36 ? 459 LEU B CB  1 
ATOM   7340  C  CG  . LEU B 1 459 ? 69.106 80.241  71.838  1.00 42.88 ? 459 LEU B CG  1 
ATOM   7341  C  CD1 . LEU B 1 459 ? 68.285 81.044  70.834  1.00 41.47 ? 459 LEU B CD1 1 
ATOM   7342  C  CD2 . LEU B 1 459 ? 70.456 79.845  71.263  1.00 41.82 ? 459 LEU B CD2 1 
ATOM   7343  N  N   . CYS B 1 460 ? 67.134 79.673  74.740  1.00 45.32 ? 460 CYS B N   1 
ATOM   7344  C  CA  . CYS B 1 460 ? 66.126 78.629  74.906  1.00 45.47 ? 460 CYS B CA  1 
ATOM   7345  C  C   . CYS B 1 460 ? 64.773 79.158  75.361  1.00 45.51 ? 460 CYS B C   1 
ATOM   7346  O  O   . CYS B 1 460 ? 63.736 78.712  74.871  1.00 46.05 ? 460 CYS B O   1 
ATOM   7347  C  CB  . CYS B 1 460 ? 66.616 77.565  75.886  1.00 45.50 ? 460 CYS B CB  1 
ATOM   7348  S  SG  . CYS B 1 460 ? 68.003 76.588  75.248  1.00 49.90 ? 460 CYS B SG  1 
ATOM   7349  N  N   . GLU B 1 461 ? 64.774 80.116  76.284  1.00 45.35 ? 461 GLU B N   1 
ATOM   7350  C  CA  . GLU B 1 461 ? 63.520 80.679  76.787  1.00 44.99 ? 461 GLU B CA  1 
ATOM   7351  C  C   . GLU B 1 461 ? 62.752 81.486  75.750  1.00 43.80 ? 461 GLU B C   1 
ATOM   7352  O  O   . GLU B 1 461 ? 61.529 81.403  75.681  1.00 43.27 ? 461 GLU B O   1 
ATOM   7353  C  CB  . GLU B 1 461 ? 63.795 81.540  78.010  1.00 46.43 ? 461 GLU B CB  1 
ATOM   7354  C  CG  . GLU B 1 461 ? 64.456 80.757  79.124  1.00 49.31 ? 461 GLU B CG  1 
ATOM   7355  C  CD  . GLU B 1 461 ? 64.770 81.610  80.327  1.00 50.88 ? 461 GLU B CD  1 
ATOM   7356  O  OE1 . GLU B 1 461 ? 65.697 82.454  80.251  1.00 51.30 ? 461 GLU B OE1 1 
ATOM   7357  O  OE2 . GLU B 1 461 ? 64.073 81.435  81.349  1.00 52.53 ? 461 GLU B OE2 1 
ATOM   7358  N  N   . ASN B 1 462 ? 63.467 82.268  74.947  1.00 43.28 ? 462 ASN B N   1 
ATOM   7359  C  CA  . ASN B 1 462 ? 62.833 83.073  73.901  1.00 42.80 ? 462 ASN B CA  1 
ATOM   7360  C  C   . ASN B 1 462 ? 62.196 82.179  72.845  1.00 42.22 ? 462 ASN B C   1 
ATOM   7361  O  O   . ASN B 1 462 ? 61.106 82.474  72.360  1.00 41.54 ? 462 ASN B O   1 
ATOM   7362  C  CB  . ASN B 1 462 ? 63.847 84.000  73.229  1.00 41.99 ? 462 ASN B CB  1 
ATOM   7363  C  CG  . ASN B 1 462 ? 64.482 84.959  74.201  1.00 42.17 ? 462 ASN B CG  1 
ATOM   7364  O  OD1 . ASN B 1 462 ? 63.905 85.284  75.239  1.00 42.30 ? 462 ASN B OD1 1 
ATOM   7365  N  ND2 . ASN B 1 462 ? 65.672 85.435  73.867  1.00 43.21 ? 462 ASN B ND2 1 
ATOM   7366  N  N   . ILE B 1 463 ? 62.879 81.091  72.489  1.00 41.92 ? 463 ILE B N   1 
ATOM   7367  C  CA  . ILE B 1 463 ? 62.342 80.161  71.506  1.00 41.96 ? 463 ILE B CA  1 
ATOM   7368  C  C   . ILE B 1 463 ? 61.140 79.464  72.118  1.00 42.29 ? 463 ILE B C   1 
ATOM   7369  O  O   . ILE B 1 463 ? 60.059 79.430  71.532  1.00 42.49 ? 463 ILE B O   1 
ATOM   7370  C  CB  . ILE B 1 463 ? 63.374 79.092  71.098  1.00 41.91 ? 463 ILE B CB  1 
ATOM   7371  C  CG1 . ILE B 1 463 ? 64.536 79.746  70.352  1.00 41.88 ? 463 ILE B CG1 1 
ATOM   7372  C  CG2 . ILE B 1 463 ? 62.713 78.044  70.206  1.00 42.11 ? 463 ILE B CG2 1 
ATOM   7373  C  CD1 . ILE B 1 463 ? 65.572 78.763  69.852  1.00 42.02 ? 463 ILE B CD1 1 
ATOM   7374  N  N   . ALA B 1 464 ? 61.333 78.914  73.309  1.00 42.32 ? 464 ALA B N   1 
ATOM   7375  C  CA  . ALA B 1 464 ? 60.265 78.217  74.002  1.00 42.34 ? 464 ALA B CA  1 
ATOM   7376  C  C   . ALA B 1 464 ? 59.013 79.080  74.144  1.00 42.63 ? 464 ALA B C   1 
ATOM   7377  O  O   . ALA B 1 464 ? 57.896 78.617  73.900  1.00 43.67 ? 464 ALA B O   1 
ATOM   7378  C  CB  . ALA B 1 464 ? 60.746 77.780  75.368  1.00 43.11 ? 464 ALA B CB  1 
ATOM   7379  N  N   . GLY B 1 465 ? 59.192 80.334  74.537  1.00 41.81 ? 465 GLY B N   1 
ATOM   7380  C  CA  . GLY B 1 465 ? 58.046 81.205  74.718  1.00 40.97 ? 465 GLY B CA  1 
ATOM   7381  C  C   . GLY B 1 465 ? 57.246 81.482  73.461  1.00 40.63 ? 465 GLY B C   1 
ATOM   7382  O  O   . GLY B 1 465 ? 56.090 81.885  73.534  1.00 41.21 ? 465 GLY B O   1 
ATOM   7383  N  N   . HIS B 1 466 ? 57.848 81.274  72.302  1.00 40.33 ? 466 HIS B N   1 
ATOM   7384  C  CA  . HIS B 1 466 ? 57.155 81.535  71.050  1.00 40.14 ? 466 HIS B CA  1 
ATOM   7385  C  C   . HIS B 1 466 ? 56.667 80.252  70.399  1.00 39.58 ? 466 HIS B C   1 
ATOM   7386  O  O   . HIS B 1 466 ? 55.587 80.219  69.820  1.00 39.14 ? 466 HIS B O   1 
ATOM   7387  C  CB  . HIS B 1 466 ? 58.078 82.282  70.092  1.00 41.28 ? 466 HIS B CB  1 
ATOM   7388  C  CG  . HIS B 1 466 ? 57.449 82.591  68.773  1.00 43.15 ? 466 HIS B CG  1 
ATOM   7389  N  ND1 . HIS B 1 466 ? 56.309 83.357  68.655  1.00 44.84 ? 466 HIS B ND1 1 
ATOM   7390  C  CD2 . HIS B 1 466 ? 57.796 82.237  67.514  1.00 43.89 ? 466 HIS B CD2 1 
ATOM   7391  C  CE1 . HIS B 1 466 ? 55.983 83.461  67.378  1.00 44.51 ? 466 HIS B CE1 1 
ATOM   7392  N  NE2 . HIS B 1 466 ? 56.870 82.791  66.665  1.00 44.27 ? 466 HIS B NE2 1 
ATOM   7393  N  N   . LEU B 1 467 ? 57.475 79.200  70.496  1.00 39.10 ? 467 LEU B N   1 
ATOM   7394  C  CA  . LEU B 1 467 ? 57.135 77.902  69.927  1.00 38.49 ? 467 LEU B CA  1 
ATOM   7395  C  C   . LEU B 1 467 ? 55.974 77.252  70.675  1.00 38.50 ? 467 LEU B C   1 
ATOM   7396  O  O   . LEU B 1 467 ? 55.183 76.516  70.079  1.00 38.09 ? 467 LEU B O   1 
ATOM   7397  C  CB  . LEU B 1 467 ? 58.355 76.977  69.972  1.00 37.38 ? 467 LEU B CB  1 
ATOM   7398  C  CG  . LEU B 1 467 ? 58.157 75.512  69.574  1.00 36.59 ? 467 LEU B CG  1 
ATOM   7399  C  CD1 . LEU B 1 467 ? 57.745 75.424  68.125  1.00 34.99 ? 467 LEU B CD1 1 
ATOM   7400  C  CD2 . LEU B 1 467 ? 59.446 74.738  69.807  1.00 35.53 ? 467 LEU B CD2 1 
ATOM   7401  N  N   . LYS B 1 468 ? 55.863 77.538  71.972  1.00 38.69 ? 468 LYS B N   1 
ATOM   7402  C  CA  . LYS B 1 468 ? 54.800 76.952  72.785  1.00 39.37 ? 468 LYS B CA  1 
ATOM   7403  C  C   . LYS B 1 468 ? 53.392 77.197  72.278  1.00 39.30 ? 468 LYS B C   1 
ATOM   7404  O  O   . LYS B 1 468 ? 52.476 76.464  72.636  1.00 39.17 ? 468 LYS B O   1 
ATOM   7405  C  CB  . LYS B 1 468 ? 54.919 77.386  74.259  1.00 39.75 ? 468 LYS B CB  1 
ATOM   7406  C  CG  . LYS B 1 468 ? 54.920 78.864  74.535  1.00 39.45 ? 468 LYS B CG  1 
ATOM   7407  C  CD  . LYS B 1 468 ? 53.524 79.432  74.621  1.00 40.25 ? 468 LYS B CD  1 
ATOM   7408  C  CE  . LYS B 1 468 ? 53.581 80.925  74.947  1.00 39.45 ? 468 LYS B CE  1 
ATOM   7409  N  NZ  . LYS B 1 468 ? 52.244 81.554  74.814  1.00 39.75 ? 468 LYS B NZ  1 
ATOM   7410  N  N   . ASP B 1 469 ? 53.219 78.201  71.428  1.00 39.62 ? 469 ASP B N   1 
ATOM   7411  C  CA  . ASP B 1 469 ? 51.901 78.486  70.879  1.00 40.12 ? 469 ASP B CA  1 
ATOM   7412  C  C   . ASP B 1 469 ? 51.614 77.642  69.650  1.00 40.16 ? 469 ASP B C   1 
ATOM   7413  O  O   . ASP B 1 469 ? 50.500 77.649  69.143  1.00 39.44 ? 469 ASP B O   1 
ATOM   7414  C  CB  . ASP B 1 469 ? 51.768 79.958  70.499  1.00 41.36 ? 469 ASP B CB  1 
ATOM   7415  C  CG  . ASP B 1 469 ? 51.750 80.875  71.704  1.00 42.63 ? 469 ASP B CG  1 
ATOM   7416  O  OD1 . ASP B 1 469 ? 51.137 80.494  72.729  1.00 44.22 ? 469 ASP B OD1 1 
ATOM   7417  O  OD2 . ASP B 1 469 ? 52.330 81.982  71.621  1.00 42.67 ? 469 ASP B OD2 1 
ATOM   7418  N  N   . ALA B 1 470 ? 52.620 76.921  69.166  1.00 40.83 ? 470 ALA B N   1 
ATOM   7419  C  CA  . ALA B 1 470 ? 52.444 76.078  67.984  1.00 41.31 ? 470 ALA B CA  1 
ATOM   7420  C  C   . ALA B 1 470 ? 51.823 74.753  68.379  1.00 42.10 ? 470 ALA B C   1 
ATOM   7421  O  O   . ALA B 1 470 ? 51.834 74.376  69.554  1.00 42.94 ? 470 ALA B O   1 
ATOM   7422  C  CB  . ALA B 1 470 ? 53.779 75.832  67.305  1.00 40.23 ? 470 ALA B CB  1 
ATOM   7423  N  N   . GLN B 1 471 ? 51.272 74.044  67.402  1.00 42.03 ? 471 GLN B N   1 
ATOM   7424  C  CA  . GLN B 1 471 ? 50.675 72.758  67.689  1.00 41.61 ? 471 GLN B CA  1 
ATOM   7425  C  C   . GLN B 1 471 ? 51.791 71.814  68.096  1.00 41.54 ? 471 GLN B C   1 
ATOM   7426  O  O   . GLN B 1 471 ? 52.923 71.927  67.627  1.00 41.71 ? 471 GLN B O   1 
ATOM   7427  C  CB  . GLN B 1 471 ? 49.957 72.214  66.465  1.00 42.06 ? 471 GLN B CB  1 
ATOM   7428  C  CG  . GLN B 1 471 ? 48.679 72.934  66.139  1.00 42.67 ? 471 GLN B CG  1 
ATOM   7429  C  CD  . GLN B 1 471 ? 48.056 72.403  64.874  1.00 43.25 ? 471 GLN B CD  1 
ATOM   7430  O  OE1 . GLN B 1 471 ? 47.883 73.134  63.893  1.00 44.02 ? 471 GLN B OE1 1 
ATOM   7431  N  NE2 . GLN B 1 471 ? 47.721 71.119  64.879  1.00 43.93 ? 471 GLN B NE2 1 
ATOM   7432  N  N   . ILE B 1 472 ? 51.462 70.866  68.955  1.00 41.37 ? 472 ILE B N   1 
ATOM   7433  C  CA  . ILE B 1 472 ? 52.457 69.932  69.437  1.00 41.23 ? 472 ILE B CA  1 
ATOM   7434  C  C   . ILE B 1 472 ? 53.227 69.149  68.374  1.00 40.44 ? 472 ILE B C   1 
ATOM   7435  O  O   . ILE B 1 472 ? 54.447 69.030  68.467  1.00 39.87 ? 472 ILE B O   1 
ATOM   7436  C  CB  . ILE B 1 472 ? 51.823 68.985  70.470  1.00 41.70 ? 472 ILE B CB  1 
ATOM   7437  C  CG1 . ILE B 1 472 ? 51.319 69.822  71.657  1.00 42.52 ? 472 ILE B CG1 1 
ATOM   7438  C  CG2 . ILE B 1 472 ? 52.842 67.964  70.945  1.00 41.25 ? 472 ILE B CG2 1 
ATOM   7439  C  CD1 . ILE B 1 472 ? 50.575 69.040  72.715  1.00 43.75 ? 472 ILE B CD1 1 
ATOM   7440  N  N   . PHE B 1 473 ? 52.553 68.629  67.356  1.00 40.53 ? 473 PHE B N   1 
ATOM   7441  C  CA  . PHE B 1 473 ? 53.282 67.866  66.337  1.00 40.37 ? 473 PHE B CA  1 
ATOM   7442  C  C   . PHE B 1 473 ? 54.339 68.759  65.695  1.00 40.24 ? 473 PHE B C   1 
ATOM   7443  O  O   . PHE B 1 473 ? 55.380 68.286  65.241  1.00 40.25 ? 473 PHE B O   1 
ATOM   7444  C  CB  . PHE B 1 473 ? 52.319 67.289  65.288  1.00 39.70 ? 473 PHE B CB  1 
ATOM   7445  C  CG  . PHE B 1 473 ? 51.860 68.277  64.265  1.00 39.67 ? 473 PHE B CG  1 
ATOM   7446  C  CD1 . PHE B 1 473 ? 52.496 68.362  63.036  1.00 38.83 ? 473 PHE B CD1 1 
ATOM   7447  C  CD2 . PHE B 1 473 ? 50.774 69.107  64.518  1.00 39.59 ? 473 PHE B CD2 1 
ATOM   7448  C  CE1 . PHE B 1 473 ? 52.056 69.250  62.071  1.00 39.00 ? 473 PHE B CE1 1 
ATOM   7449  C  CE2 . PHE B 1 473 ? 50.325 70.004  63.557  1.00 39.75 ? 473 PHE B CE2 1 
ATOM   7450  C  CZ  . PHE B 1 473 ? 50.969 70.074  62.328  1.00 39.74 ? 473 PHE B CZ  1 
ATOM   7451  N  N   . ILE B 1 474 ? 54.072 70.059  65.676  1.00 40.46 ? 474 ILE B N   1 
ATOM   7452  C  CA  . ILE B 1 474 ? 55.027 71.008  65.132  1.00 40.30 ? 474 ILE B CA  1 
ATOM   7453  C  C   . ILE B 1 474 ? 56.125 71.187  66.182  1.00 41.36 ? 474 ILE B C   1 
ATOM   7454  O  O   . ILE B 1 474 ? 57.315 71.205  65.850  1.00 41.76 ? 474 ILE B O   1 
ATOM   7455  C  CB  . ILE B 1 474 ? 54.357 72.354  64.832  1.00 39.13 ? 474 ILE B CB  1 
ATOM   7456  C  CG1 . ILE B 1 474 ? 53.295 72.145  63.745  1.00 38.56 ? 474 ILE B CG1 1 
ATOM   7457  C  CG2 . ILE B 1 474 ? 55.417 73.394  64.435  1.00 37.83 ? 474 ILE B CG2 1 
ATOM   7458  C  CD1 . ILE B 1 474 ? 52.532 73.385  63.343  1.00 37.55 ? 474 ILE B CD1 1 
ATOM   7459  N  N   . GLN B 1 475 ? 55.719 71.314  67.446  1.00 41.83 ? 475 GLN B N   1 
ATOM   7460  C  CA  . GLN B 1 475 ? 56.665 71.452  68.549  1.00 41.93 ? 475 GLN B CA  1 
ATOM   7461  C  C   . GLN B 1 475 ? 57.657 70.283  68.527  1.00 42.09 ? 475 GLN B C   1 
ATOM   7462  O  O   . GLN B 1 475 ? 58.856 70.472  68.742  1.00 42.58 ? 475 GLN B O   1 
ATOM   7463  C  CB  . GLN B 1 475 ? 55.930 71.468  69.894  1.00 41.79 ? 475 GLN B CB  1 
ATOM   7464  C  CG  . GLN B 1 475 ? 55.307 72.805  70.272  1.00 43.66 ? 475 GLN B CG  1 
ATOM   7465  C  CD  . GLN B 1 475 ? 54.615 72.795  71.649  1.00 45.03 ? 475 GLN B CD  1 
ATOM   7466  O  OE1 . GLN B 1 475 ? 54.974 72.017  72.538  1.00 45.93 ? 475 GLN B OE1 1 
ATOM   7467  N  NE2 . GLN B 1 475 ? 53.633 73.680  71.829  1.00 45.11 ? 475 GLN B NE2 1 
ATOM   7468  N  N   . LYS B 1 476 ? 57.167 69.080  68.241  1.00 41.96 ? 476 LYS B N   1 
ATOM   7469  C  CA  . LYS B 1 476 ? 58.038 67.907  68.214  1.00 42.48 ? 476 LYS B CA  1 
ATOM   7470  C  C   . LYS B 1 476 ? 59.104 67.947  67.134  1.00 42.27 ? 476 LYS B C   1 
ATOM   7471  O  O   . LYS B 1 476 ? 60.272 67.698  67.414  1.00 41.87 ? 476 LYS B O   1 
ATOM   7472  C  CB  . LYS B 1 476 ? 57.224 66.617  68.061  1.00 43.56 ? 476 LYS B CB  1 
ATOM   7473  C  CG  . LYS B 1 476 ? 56.422 66.230  69.300  1.00 45.57 ? 476 LYS B CG  1 
ATOM   7474  C  CD  . LYS B 1 476 ? 55.605 64.953  69.069  1.00 47.48 ? 476 LYS B CD  1 
ATOM   7475  C  CE  . LYS B 1 476 ? 54.760 64.558  70.295  1.00 47.93 ? 476 LYS B CE  1 
ATOM   7476  N  NZ  . LYS B 1 476 ? 54.012 63.276  70.075  1.00 48.31 ? 476 LYS B NZ  1 
ATOM   7477  N  N   . LYS B 1 477 ? 58.726 68.253  65.896  1.00 42.78 ? 477 LYS B N   1 
ATOM   7478  C  CA  . LYS B 1 477 ? 59.739 68.281  64.847  1.00 42.82 ? 477 LYS B CA  1 
ATOM   7479  C  C   . LYS B 1 477 ? 60.726 69.419  65.083  1.00 41.83 ? 477 LYS B C   1 
ATOM   7480  O  O   . LYS B 1 477 ? 61.913 69.302  64.768  1.00 41.02 ? 477 LYS B O   1 
ATOM   7481  C  CB  . LYS B 1 477 ? 59.113 68.404  63.452  1.00 43.25 ? 477 LYS B CB  1 
ATOM   7482  C  CG  . LYS B 1 477 ? 60.121 68.016  62.353  1.00 45.47 ? 477 LYS B CG  1 
ATOM   7483  C  CD  . LYS B 1 477 ? 59.510 67.858  60.952  1.00 46.27 ? 477 LYS B CD  1 
ATOM   7484  C  CE  . LYS B 1 477 ? 58.439 66.786  60.909  1.00 47.15 ? 477 LYS B CE  1 
ATOM   7485  N  NZ  . LYS B 1 477 ? 57.186 67.235  61.611  1.00 48.73 ? 477 LYS B NZ  1 
ATOM   7486  N  N   . ALA B 1 478 ? 60.230 70.511  65.654  1.00 41.10 ? 478 ALA B N   1 
ATOM   7487  C  CA  . ALA B 1 478 ? 61.073 71.655  65.943  1.00 40.52 ? 478 ALA B CA  1 
ATOM   7488  C  C   . ALA B 1 478 ? 62.178 71.179  66.861  1.00 40.66 ? 478 ALA B C   1 
ATOM   7489  O  O   . ALA B 1 478 ? 63.362 71.328  66.560  1.00 40.12 ? 478 ALA B O   1 
ATOM   7490  C  CB  . ALA B 1 478 ? 60.265 72.744  66.620  1.00 39.98 ? 478 ALA B CB  1 
ATOM   7491  N  N   . VAL B 1 479 ? 61.780 70.585  67.980  1.00 40.80 ? 479 VAL B N   1 
ATOM   7492  C  CA  . VAL B 1 479 ? 62.747 70.095  68.946  1.00 41.18 ? 479 VAL B CA  1 
ATOM   7493  C  C   . VAL B 1 479 ? 63.706 69.050  68.376  1.00 41.02 ? 479 VAL B C   1 
ATOM   7494  O  O   . VAL B 1 479 ? 64.887 69.062  68.702  1.00 41.00 ? 479 VAL B O   1 
ATOM   7495  C  CB  . VAL B 1 479 ? 62.041 69.530  70.188  1.00 41.76 ? 479 VAL B CB  1 
ATOM   7496  C  CG1 . VAL B 1 479 ? 63.065 68.998  71.179  1.00 41.80 ? 479 VAL B CG1 1 
ATOM   7497  C  CG2 . VAL B 1 479 ? 61.210 70.627  70.830  1.00 41.93 ? 479 VAL B CG2 1 
ATOM   7498  N  N   . LYS B 1 480 ? 63.228 68.143  67.536  1.00 40.73 ? 480 LYS B N   1 
ATOM   7499  C  CA  . LYS B 1 480 ? 64.149 67.173  66.978  1.00 40.98 ? 480 LYS B CA  1 
ATOM   7500  C  C   . LYS B 1 480 ? 65.297 67.903  66.303  1.00 41.10 ? 480 LYS B C   1 
ATOM   7501  O  O   . LYS B 1 480 ? 66.465 67.544  66.490  1.00 41.29 ? 480 LYS B O   1 
ATOM   7502  C  CB  . LYS B 1 480 ? 63.453 66.269  65.977  1.00 42.32 ? 480 LYS B CB  1 
ATOM   7503  C  CG  . LYS B 1 480 ? 62.694 65.156  66.649  1.00 45.91 ? 480 LYS B CG  1 
ATOM   7504  C  CD  . LYS B 1 480 ? 62.230 64.092  65.667  1.00 48.65 ? 480 LYS B CD  1 
ATOM   7505  C  CE  . LYS B 1 480 ? 61.582 62.931  66.418  1.00 50.57 ? 480 LYS B CE  1 
ATOM   7506  N  NZ  . LYS B 1 480 ? 60.489 63.421  67.330  1.00 51.73 ? 480 LYS B NZ  1 
ATOM   7507  N  N   . ASN B 1 481 ? 64.963 68.941  65.535  1.00 40.90 ? 481 ASN B N   1 
ATOM   7508  C  CA  . ASN B 1 481 ? 65.963 69.740  64.829  1.00 39.73 ? 481 ASN B CA  1 
ATOM   7509  C  C   . ASN B 1 481 ? 66.997 70.349  65.779  1.00 39.41 ? 481 ASN B C   1 
ATOM   7510  O  O   . ASN B 1 481 ? 68.207 70.265  65.533  1.00 40.10 ? 481 ASN B O   1 
ATOM   7511  C  CB  . ASN B 1 481 ? 65.296 70.876  64.049  1.00 40.00 ? 481 ASN B CB  1 
ATOM   7512  C  CG  . ASN B 1 481 ? 64.462 70.388  62.892  1.00 40.82 ? 481 ASN B CG  1 
ATOM   7513  O  OD1 . ASN B 1 481 ? 64.836 69.452  62.182  1.00 40.99 ? 481 ASN B OD1 1 
ATOM   7514  N  ND2 . ASN B 1 481 ? 63.329 71.041  62.675  1.00 41.53 ? 481 ASN B ND2 1 
ATOM   7515  N  N   . PHE B 1 482 ? 66.519 70.982  66.850  1.00 37.91 ? 482 PHE B N   1 
ATOM   7516  C  CA  . PHE B 1 482 ? 67.407 71.606  67.822  1.00 36.85 ? 482 PHE B CA  1 
ATOM   7517  C  C   . PHE B 1 482 ? 68.304 70.564  68.489  1.00 36.86 ? 482 PHE B C   1 
ATOM   7518  O  O   . PHE B 1 482 ? 69.434 70.856  68.869  1.00 36.74 ? 482 PHE B O   1 
ATOM   7519  C  CB  . PHE B 1 482 ? 66.593 72.345  68.894  1.00 35.94 ? 482 PHE B CB  1 
ATOM   7520  C  CG  . PHE B 1 482 ? 65.939 73.611  68.408  1.00 34.10 ? 482 PHE B CG  1 
ATOM   7521  C  CD1 . PHE B 1 482 ? 66.701 74.650  67.883  1.00 33.76 ? 482 PHE B CD1 1 
ATOM   7522  C  CD2 . PHE B 1 482 ? 64.558 73.772  68.491  1.00 34.24 ? 482 PHE B CD2 1 
ATOM   7523  C  CE1 . PHE B 1 482 ? 66.096 75.841  67.442  1.00 33.49 ? 482 PHE B CE1 1 
ATOM   7524  C  CE2 . PHE B 1 482 ? 63.941 74.960  68.053  1.00 34.57 ? 482 PHE B CE2 1 
ATOM   7525  C  CZ  . PHE B 1 482 ? 64.718 75.996  67.527  1.00 33.45 ? 482 PHE B CZ  1 
ATOM   7526  N  N   . THR B 1 483 ? 67.782 69.349  68.626  1.00 37.39 ? 483 THR B N   1 
ATOM   7527  C  CA  . THR B 1 483 ? 68.506 68.241  69.240  1.00 37.69 ? 483 THR B CA  1 
ATOM   7528  C  C   . THR B 1 483 ? 69.661 67.832  68.345  1.00 37.93 ? 483 THR B C   1 
ATOM   7529  O  O   . THR B 1 483 ? 70.687 67.355  68.828  1.00 37.72 ? 483 THR B O   1 
ATOM   7530  C  CB  . THR B 1 483 ? 67.597 67.015  69.438  1.00 37.57 ? 483 THR B CB  1 
ATOM   7531  O  OG1 . THR B 1 483 ? 66.455 67.387  70.211  1.00 38.19 ? 483 THR B OG1 1 
ATOM   7532  C  CG2 . THR B 1 483 ? 68.333 65.919  70.164  1.00 37.88 ? 483 THR B CG2 1 
ATOM   7533  N  N   . GLU B 1 484 ? 69.481 68.006  67.038  1.00 38.35 ? 484 GLU B N   1 
ATOM   7534  C  CA  . GLU B 1 484 ? 70.529 67.667  66.089  1.00 39.28 ? 484 GLU B CA  1 
ATOM   7535  C  C   . GLU B 1 484 ? 71.677 68.653  66.217  1.00 39.74 ? 484 GLU B C   1 
ATOM   7536  O  O   . GLU B 1 484 ? 72.823 68.329  65.913  1.00 40.06 ? 484 GLU B O   1 
ATOM   7537  C  CB  . GLU B 1 484 ? 69.992 67.661  64.660  1.00 39.58 ? 484 GLU B CB  1 
ATOM   7538  C  CG  . GLU B 1 484 ? 69.229 66.407  64.316  1.00 41.35 ? 484 GLU B CG  1 
ATOM   7539  C  CD  . GLU B 1 484 ? 70.059 65.153  64.538  1.00 43.25 ? 484 GLU B CD  1 
ATOM   7540  O  OE1 . GLU B 1 484 ? 71.117 65.006  63.878  1.00 43.09 ? 484 GLU B OE1 1 
ATOM   7541  O  OE2 . GLU B 1 484 ? 69.653 64.319  65.383  1.00 44.45 ? 484 GLU B OE2 1 
ATOM   7542  N  N   . VAL B 1 485 ? 71.387 69.868  66.654  1.00 40.15 ? 485 VAL B N   1 
ATOM   7543  C  CA  . VAL B 1 485 ? 72.474 70.815  66.831  1.00 41.09 ? 485 VAL B CA  1 
ATOM   7544  C  C   . VAL B 1 485 ? 73.216 70.394  68.098  1.00 41.92 ? 485 VAL B C   1 
ATOM   7545  O  O   . VAL B 1 485 ? 74.443 70.265  68.092  1.00 41.81 ? 485 VAL B O   1 
ATOM   7546  C  CB  . VAL B 1 485 ? 71.965 72.257  66.984  1.00 40.90 ? 485 VAL B CB  1 
ATOM   7547  C  CG1 . VAL B 1 485 ? 73.109 73.173  67.397  1.00 39.93 ? 485 VAL B CG1 1 
ATOM   7548  C  CG2 . VAL B 1 485 ? 71.378 72.725  65.672  1.00 40.67 ? 485 VAL B CG2 1 
ATOM   7549  N  N   . HIS B 1 486 ? 72.457 70.156  69.167  1.00 42.43 ? 486 HIS B N   1 
ATOM   7550  C  CA  . HIS B 1 486 ? 73.016 69.742  70.450  1.00 43.43 ? 486 HIS B CA  1 
ATOM   7551  C  C   . HIS B 1 486 ? 71.901 69.243  71.369  1.00 43.98 ? 486 HIS B C   1 
ATOM   7552  O  O   . HIS B 1 486 ? 70.960 69.970  71.673  1.00 44.78 ? 486 HIS B O   1 
ATOM   7553  C  CB  . HIS B 1 486 ? 73.733 70.913  71.104  1.00 44.13 ? 486 HIS B CB  1 
ATOM   7554  C  CG  . HIS B 1 486 ? 74.597 70.519  72.259  1.00 45.83 ? 486 HIS B CG  1 
ATOM   7555  N  ND1 . HIS B 1 486 ? 74.104 69.872  73.372  1.00 46.56 ? 486 HIS B ND1 1 
ATOM   7556  C  CD2 . HIS B 1 486 ? 75.922 70.701  72.484  1.00 46.20 ? 486 HIS B CD2 1 
ATOM   7557  C  CE1 . HIS B 1 486 ? 75.088 69.675  74.233  1.00 47.01 ? 486 HIS B CE1 1 
ATOM   7558  N  NE2 . HIS B 1 486 ? 76.200 70.170  73.719  1.00 46.85 ? 486 HIS B NE2 1 
ATOM   7559  N  N   . PRO B 1 487 ? 71.998 67.994  71.837  1.00 44.39 ? 487 PRO B N   1 
ATOM   7560  C  CA  . PRO B 1 487 ? 70.952 67.460  72.714  1.00 44.12 ? 487 PRO B CA  1 
ATOM   7561  C  C   . PRO B 1 487 ? 70.500 68.369  73.853  1.00 43.62 ? 487 PRO B C   1 
ATOM   7562  O  O   . PRO B 1 487 ? 69.353 68.287  74.290  1.00 43.53 ? 487 PRO B O   1 
ATOM   7563  C  CB  . PRO B 1 487 ? 71.544 66.123  73.194  1.00 43.89 ? 487 PRO B CB  1 
ATOM   7564  C  CG  . PRO B 1 487 ? 73.017 66.263  72.967  1.00 44.12 ? 487 PRO B CG  1 
ATOM   7565  C  CD  . PRO B 1 487 ? 73.094 67.023  71.678  1.00 44.70 ? 487 PRO B CD  1 
ATOM   7566  N  N   . ASP B 1 488 ? 71.387 69.242  74.317  1.00 43.44 ? 488 ASP B N   1 
ATOM   7567  C  CA  . ASP B 1 488 ? 71.052 70.163  75.399  1.00 43.72 ? 488 ASP B CA  1 
ATOM   7568  C  C   . ASP B 1 488 ? 70.139 71.265  74.884  1.00 43.91 ? 488 ASP B C   1 
ATOM   7569  O  O   . ASP B 1 488 ? 69.234 71.733  75.591  1.00 43.89 ? 488 ASP B O   1 
ATOM   7570  C  CB  . ASP B 1 488 ? 72.317 70.801  75.965  1.00 45.31 ? 488 ASP B CB  1 
ATOM   7571  C  CG  . ASP B 1 488 ? 73.170 69.821  76.754  1.00 47.13 ? 488 ASP B CG  1 
ATOM   7572  O  OD1 . ASP B 1 488 ? 74.333 70.183  77.055  1.00 48.62 ? 488 ASP B OD1 1 
ATOM   7573  O  OD2 . ASP B 1 488 ? 72.689 68.703  77.077  1.00 47.30 ? 488 ASP B OD2 1 
ATOM   7574  N  N   . TYR B 1 489 ? 70.401 71.686  73.649  1.00 43.56 ? 489 TYR B N   1 
ATOM   7575  C  CA  . TYR B 1 489 ? 69.626 72.733  72.997  1.00 42.75 ? 489 TYR B CA  1 
ATOM   7576  C  C   . TYR B 1 489 ? 68.172 72.278  73.000  1.00 43.51 ? 489 TYR B C   1 
ATOM   7577  O  O   . TYR B 1 489 ? 67.304 72.918  73.593  1.00 43.01 ? 489 TYR B O   1 
ATOM   7578  C  CB  . TYR B 1 489 ? 70.113 72.904  71.561  1.00 40.91 ? 489 TYR B CB  1 
ATOM   7579  C  CG  . TYR B 1 489 ? 69.799 74.232  70.908  1.00 39.88 ? 489 TYR B CG  1 
ATOM   7580  C  CD1 . TYR B 1 489 ? 68.821 75.081  71.416  1.00 39.38 ? 489 TYR B CD1 1 
ATOM   7581  C  CD2 . TYR B 1 489 ? 70.462 74.617  69.739  1.00 39.70 ? 489 TYR B CD2 1 
ATOM   7582  C  CE1 . TYR B 1 489 ? 68.507 76.281  70.772  1.00 38.62 ? 489 TYR B CE1 1 
ATOM   7583  C  CE2 . TYR B 1 489 ? 70.159 75.807  69.090  1.00 38.36 ? 489 TYR B CE2 1 
ATOM   7584  C  CZ  . TYR B 1 489 ? 69.182 76.635  69.608  1.00 38.75 ? 489 TYR B CZ  1 
ATOM   7585  O  OH  . TYR B 1 489 ? 68.889 77.814  68.956  1.00 37.81 ? 489 TYR B OH  1 
ATOM   7586  N  N   . GLY B 1 490 ? 67.928 71.147  72.347  1.00 44.53 ? 490 GLY B N   1 
ATOM   7587  C  CA  . GLY B 1 490 ? 66.586 70.609  72.270  1.00 45.58 ? 490 GLY B CA  1 
ATOM   7588  C  C   . GLY B 1 490 ? 65.964 70.273  73.611  1.00 46.54 ? 490 GLY B C   1 
ATOM   7589  O  O   . GLY B 1 490 ? 64.873 70.756  73.933  1.00 46.61 ? 490 GLY B O   1 
ATOM   7590  N  N   . SER B 1 491 ? 66.650 69.456  74.405  1.00 47.40 ? 491 SER B N   1 
ATOM   7591  C  CA  . SER B 1 491 ? 66.106 69.043  75.700  1.00 48.09 ? 491 SER B CA  1 
ATOM   7592  C  C   . SER B 1 491 ? 65.730 70.189  76.628  1.00 48.32 ? 491 SER B C   1 
ATOM   7593  O  O   . SER B 1 491 ? 64.696 70.129  77.295  1.00 47.81 ? 491 SER B O   1 
ATOM   7594  C  CB  . SER B 1 491 ? 67.070 68.097  76.414  1.00 47.74 ? 491 SER B CB  1 
ATOM   7595  O  OG  . SER B 1 491 ? 68.332 68.702  76.593  1.00 48.75 ? 491 SER B OG  1 
ATOM   7596  N  N   . HIS B 1 492 ? 66.549 71.233  76.684  1.00 49.18 ? 492 HIS B N   1 
ATOM   7597  C  CA  . HIS B 1 492 ? 66.208 72.346  77.558  1.00 50.62 ? 492 HIS B CA  1 
ATOM   7598  C  C   . HIS B 1 492 ? 64.958 73.062  77.018  1.00 49.54 ? 492 HIS B C   1 
ATOM   7599  O  O   . HIS B 1 492 ? 64.056 73.433  77.782  1.00 49.41 ? 492 HIS B O   1 
ATOM   7600  C  CB  . HIS B 1 492 ? 67.381 73.320  77.688  1.00 53.85 ? 492 HIS B CB  1 
ATOM   7601  C  CG  . HIS B 1 492 ? 67.120 74.445  78.645  1.00 58.67 ? 492 HIS B CG  1 
ATOM   7602  N  ND1 . HIS B 1 492 ? 67.996 75.501  78.816  1.00 60.67 ? 492 HIS B ND1 1 
ATOM   7603  C  CD2 . HIS B 1 492 ? 66.065 74.697  79.462  1.00 60.06 ? 492 HIS B CD2 1 
ATOM   7604  C  CE1 . HIS B 1 492 ? 67.489 76.354  79.692  1.00 61.56 ? 492 HIS B CE1 1 
ATOM   7605  N  NE2 . HIS B 1 492 ? 66.318 75.890  80.100  1.00 61.69 ? 492 HIS B NE2 1 
ATOM   7606  N  N   . ILE B 1 493 ? 64.898 73.250  75.703  1.00 47.67 ? 493 ILE B N   1 
ATOM   7607  C  CA  . ILE B 1 493 ? 63.736 73.888  75.097  1.00 45.87 ? 493 ILE B CA  1 
ATOM   7608  C  C   . ILE B 1 493 ? 62.523 73.012  75.392  1.00 45.34 ? 493 ILE B C   1 
ATOM   7609  O  O   . ILE B 1 493 ? 61.464 73.503  75.780  1.00 45.18 ? 493 ILE B O   1 
ATOM   7610  C  CB  . ILE B 1 493 ? 63.890 74.020  73.562  1.00 44.95 ? 493 ILE B CB  1 
ATOM   7611  C  CG1 . ILE B 1 493 ? 64.878 75.144  73.225  1.00 43.54 ? 493 ILE B CG1 1 
ATOM   7612  C  CG2 . ILE B 1 493 ? 62.531 74.238  72.921  1.00 43.89 ? 493 ILE B CG2 1 
ATOM   7613  C  CD1 . ILE B 1 493 ? 65.216 75.252  71.742  1.00 42.24 ? 493 ILE B CD1 1 
ATOM   7614  N  N   . GLN B 1 494 ? 62.684 71.707  75.214  1.00 44.60 ? 494 GLN B N   1 
ATOM   7615  C  CA  . GLN B 1 494 ? 61.590 70.778  75.461  1.00 44.55 ? 494 GLN B CA  1 
ATOM   7616  C  C   . GLN B 1 494 ? 61.075 70.899  76.887  1.00 43.94 ? 494 GLN B C   1 
ATOM   7617  O  O   . GLN B 1 494 ? 59.881 70.760  77.130  1.00 44.10 ? 494 GLN B O   1 
ATOM   7618  C  CB  . GLN B 1 494 ? 62.042 69.337  75.202  1.00 45.42 ? 494 GLN B CB  1 
ATOM   7619  C  CG  . GLN B 1 494 ? 60.948 68.301  75.402  1.00 45.75 ? 494 GLN B CG  1 
ATOM   7620  C  CD  . GLN B 1 494 ? 59.703 68.620  74.601  1.00 47.20 ? 494 GLN B CD  1 
ATOM   7621  O  OE1 . GLN B 1 494 ? 59.746 68.710  73.372  1.00 47.87 ? 494 GLN B OE1 1 
ATOM   7622  N  NE2 . GLN B 1 494 ? 58.583 68.795  75.292  1.00 47.87 ? 494 GLN B NE2 1 
ATOM   7623  N  N   . ALA B 1 495 ? 61.982 71.155  77.824  1.00 43.64 ? 495 ALA B N   1 
ATOM   7624  C  CA  . ALA B 1 495 ? 61.624 71.299  79.230  1.00 43.40 ? 495 ALA B CA  1 
ATOM   7625  C  C   . ALA B 1 495 ? 60.663 72.471  79.397  1.00 43.84 ? 495 ALA B C   1 
ATOM   7626  O  O   . ALA B 1 495 ? 59.563 72.318  79.936  1.00 43.59 ? 495 ALA B O   1 
ATOM   7627  C  CB  . ALA B 1 495 ? 62.875 71.521  80.064  1.00 43.00 ? 495 ALA B CB  1 
ATOM   7628  N  N   . LEU B 1 496 ? 61.083 73.644  78.930  1.00 43.97 ? 496 LEU B N   1 
ATOM   7629  C  CA  . LEU B 1 496 ? 60.242 74.823  79.018  1.00 44.46 ? 496 LEU B CA  1 
ATOM   7630  C  C   . LEU B 1 496 ? 58.920 74.566  78.305  1.00 45.00 ? 496 LEU B C   1 
ATOM   7631  O  O   . LEU B 1 496 ? 57.855 74.895  78.839  1.00 45.82 ? 496 LEU B O   1 
ATOM   7632  C  CB  . LEU B 1 496 ? 60.948 76.030  78.405  1.00 44.84 ? 496 LEU B CB  1 
ATOM   7633  C  CG  . LEU B 1 496 ? 62.369 76.214  78.948  1.00 46.46 ? 496 LEU B CG  1 
ATOM   7634  C  CD1 . LEU B 1 496 ? 62.974 77.474  78.373  1.00 46.71 ? 496 LEU B CD1 1 
ATOM   7635  C  CD2 . LEU B 1 496 ? 62.345 76.279  80.478  1.00 46.99 ? 496 LEU B CD2 1 
ATOM   7636  N  N   . LEU B 1 497 ? 58.969 73.973  77.111  1.00 44.76 ? 497 LEU B N   1 
ATOM   7637  C  CA  . LEU B 1 497 ? 57.726 73.695  76.398  1.00 45.38 ? 497 LEU B CA  1 
ATOM   7638  C  C   . LEU B 1 497 ? 56.780 72.891  77.293  1.00 45.89 ? 497 LEU B C   1 
ATOM   7639  O  O   . LEU B 1 497 ? 55.596 73.224  77.410  1.00 46.00 ? 497 LEU B O   1 
ATOM   7640  C  CB  . LEU B 1 497 ? 57.984 72.934  75.091  1.00 45.32 ? 497 LEU B CB  1 
ATOM   7641  C  CG  . LEU B 1 497 ? 58.591 73.692  73.901  1.00 45.33 ? 497 LEU B CG  1 
ATOM   7642  C  CD1 . LEU B 1 497 ? 58.689 72.762  72.708  1.00 44.78 ? 497 LEU B CD1 1 
ATOM   7643  C  CD2 . LEU B 1 497 ? 57.733 74.888  73.541  1.00 45.58 ? 497 LEU B CD2 1 
ATOM   7644  N  N   . ASP B 1 498 ? 57.298 71.844  77.935  1.00 46.28 ? 498 ASP B N   1 
ATOM   7645  C  CA  . ASP B 1 498 ? 56.469 71.023  78.817  1.00 46.96 ? 498 ASP B CA  1 
ATOM   7646  C  C   . ASP B 1 498 ? 55.813 71.905  79.865  1.00 47.94 ? 498 ASP B C   1 
ATOM   7647  O  O   . ASP B 1 498 ? 54.623 71.790  80.151  1.00 47.89 ? 498 ASP B O   1 
ATOM   7648  C  CB  . ASP B 1 498 ? 57.303 69.961  79.527  1.00 46.38 ? 498 ASP B CB  1 
ATOM   7649  C  CG  . ASP B 1 498 ? 57.829 68.911  78.587  1.00 46.16 ? 498 ASP B CG  1 
ATOM   7650  O  OD1 . ASP B 1 498 ? 57.152 68.638  77.571  1.00 46.94 ? 498 ASP B OD1 1 
ATOM   7651  O  OD2 . ASP B 1 498 ? 58.906 68.344  78.871  1.00 45.58 ? 498 ASP B OD2 1 
ATOM   7652  N  N   . LYS B 1 499 ? 56.605 72.792  80.443  1.00 49.25 ? 499 LYS B N   1 
ATOM   7653  C  CA  . LYS B 1 499 ? 56.090 73.688  81.454  1.00 50.88 ? 499 LYS B CA  1 
ATOM   7654  C  C   . LYS B 1 499 ? 54.916 74.439  80.837  1.00 51.14 ? 499 LYS B C   1 
ATOM   7655  O  O   . LYS B 1 499 ? 53.827 74.456  81.394  1.00 51.99 ? 499 LYS B O   1 
ATOM   7656  C  CB  . LYS B 1 499 ? 57.194 74.653  81.894  1.00 52.07 ? 499 LYS B CB  1 
ATOM   7657  C  CG  . LYS B 1 499 ? 57.004 75.270  83.274  1.00 53.26 ? 499 LYS B CG  1 
ATOM   7658  C  CD  . LYS B 1 499 ? 58.348 75.775  83.814  1.00 54.25 ? 499 LYS B CD  1 
ATOM   7659  C  CE  . LYS B 1 499 ? 59.359 74.615  83.987  1.00 55.05 ? 499 LYS B CE  1 
ATOM   7660  N  NZ  . LYS B 1 499 ? 60.731 75.034  84.449  1.00 54.20 ? 499 LYS B NZ  1 
ATOM   7661  N  N   . TYR B 1 500 ? 55.131 75.028  79.667  1.00 51.42 ? 500 TYR B N   1 
ATOM   7662  C  CA  . TYR B 1 500 ? 54.075 75.778  78.987  1.00 51.84 ? 500 TYR B CA  1 
ATOM   7663  C  C   . TYR B 1 500 ? 52.822 74.970  78.671  1.00 52.42 ? 500 TYR B C   1 
ATOM   7664  O  O   . TYR B 1 500 ? 51.705 75.395  78.958  1.00 52.31 ? 500 TYR B O   1 
ATOM   7665  C  CB  . TYR B 1 500 ? 54.614 76.375  77.689  1.00 51.18 ? 500 TYR B CB  1 
ATOM   7666  C  CG  . TYR B 1 500 ? 55.411 77.648  77.873  1.00 49.86 ? 500 TYR B CG  1 
ATOM   7667  C  CD1 . TYR B 1 500 ? 54.793 78.819  78.305  1.00 48.89 ? 500 TYR B CD1 1 
ATOM   7668  C  CD2 . TYR B 1 500 ? 56.776 77.690  77.573  1.00 49.40 ? 500 TYR B CD2 1 
ATOM   7669  C  CE1 . TYR B 1 500 ? 55.508 79.997  78.429  1.00 48.80 ? 500 TYR B CE1 1 
ATOM   7670  C  CE2 . TYR B 1 500 ? 57.502 78.865  77.693  1.00 48.78 ? 500 TYR B CE2 1 
ATOM   7671  C  CZ  . TYR B 1 500 ? 56.859 80.014  78.121  1.00 48.80 ? 500 TYR B CZ  1 
ATOM   7672  O  OH  . TYR B 1 500 ? 57.564 81.183  78.234  1.00 48.99 ? 500 TYR B OH  1 
ATOM   7673  N  N   . ASN B 1 501 ? 53.004 73.809  78.061  1.00 53.89 ? 501 ASN B N   1 
ATOM   7674  C  CA  . ASN B 1 501 ? 51.864 72.977  77.716  1.00 55.51 ? 501 ASN B CA  1 
ATOM   7675  C  C   . ASN B 1 501 ? 51.198 72.386  78.958  1.00 57.03 ? 501 ASN B C   1 
ATOM   7676  O  O   . ASN B 1 501 ? 50.087 71.863  78.880  1.00 57.56 ? 501 ASN B O   1 
ATOM   7677  C  CB  . ASN B 1 501 ? 52.298 71.855  76.767  1.00 54.97 ? 501 ASN B CB  1 
ATOM   7678  C  CG  . ASN B 1 501 ? 52.952 72.382  75.505  1.00 55.13 ? 501 ASN B CG  1 
ATOM   7679  O  OD1 . ASN B 1 501 ? 52.492 73.373  74.920  1.00 55.42 ? 501 ASN B OD1 1 
ATOM   7680  N  ND2 . ASN B 1 501 ? 54.026 71.722  75.071  1.00 54.41 ? 501 ASN B ND2 1 
ATOM   7681  N  N   . ALA B 1 502 ? 51.873 72.465  80.103  1.00 58.55 ? 502 ALA B N   1 
ATOM   7682  C  CA  . ALA B 1 502 ? 51.317 71.940  81.349  1.00 59.82 ? 502 ALA B CA  1 
ATOM   7683  C  C   . ALA B 1 502 ? 50.101 72.773  81.739  1.00 61.17 ? 502 ALA B C   1 
ATOM   7684  O  O   . ALA B 1 502 ? 49.240 72.321  82.504  1.00 61.18 ? 502 ALA B O   1 
ATOM   7685  C  CB  . ALA B 1 502 ? 52.362 71.989  82.456  1.00 59.70 ? 502 ALA B CB  1 
ATOM   7686  N  N   . GLU B 1 503 ? 50.039 73.989  81.198  1.00 62.41 ? 503 GLU B N   1 
ATOM   7687  C  CA  . GLU B 1 503 ? 48.936 74.905  81.467  1.00 64.33 ? 503 GLU B CA  1 
ATOM   7688  C  C   . GLU B 1 503 ? 47.927 74.965  80.304  1.00 65.09 ? 503 GLU B C   1 
ATOM   7689  O  O   . GLU B 1 503 ? 48.351 74.877  79.121  1.00 65.05 ? 503 GLU B O   1 
ATOM   7690  C  CB  . GLU B 1 503 ? 49.494 76.298  81.720  1.00 65.38 ? 503 GLU B CB  1 
ATOM   7691  C  CG  . GLU B 1 503 ? 50.617 76.328  82.731  1.00 67.62 ? 503 GLU B CG  1 
ATOM   7692  C  CD  . GLU B 1 503 ? 51.665 77.363  82.372  1.00 69.43 ? 503 GLU B CD  1 
ATOM   7693  O  OE1 . GLU B 1 503 ? 51.294 78.377  81.735  1.00 70.35 ? 503 GLU B OE1 1 
ATOM   7694  O  OE2 . GLU B 1 503 ? 52.854 77.171  82.730  1.00 70.42 ? 503 GLU B OE2 1 
ATOM   7695  N  N   . ALA C 1 24  ? 46.151 65.414  47.586  1.00 44.79 ? 24  ALA C N   1 
ATOM   7696  C  CA  . ALA C 1 24  ? 46.833 66.743  47.441  1.00 45.19 ? 24  ALA C CA  1 
ATOM   7697  C  C   . ALA C 1 24  ? 46.868 67.182  45.979  1.00 44.90 ? 24  ALA C C   1 
ATOM   7698  O  O   . ALA C 1 24  ? 47.341 66.437  45.110  1.00 45.34 ? 24  ALA C O   1 
ATOM   7699  C  CB  . ALA C 1 24  ? 48.258 66.673  47.989  1.00 44.79 ? 24  ALA C CB  1 
ATOM   7700  N  N   . ASP C 1 25  ? 46.377 68.389  45.706  1.00 43.62 ? 25  ASP C N   1 
ATOM   7701  C  CA  . ASP C 1 25  ? 46.372 68.884  44.341  1.00 42.87 ? 25  ASP C CA  1 
ATOM   7702  C  C   . ASP C 1 25  ? 47.790 69.076  43.826  1.00 41.51 ? 25  ASP C C   1 
ATOM   7703  O  O   . ASP C 1 25  ? 48.737 69.183  44.609  1.00 40.94 ? 25  ASP C O   1 
ATOM   7704  C  CB  . ASP C 1 25  ? 45.645 70.222  44.242  1.00 45.01 ? 25  ASP C CB  1 
ATOM   7705  C  CG  . ASP C 1 25  ? 44.185 70.130  44.623  1.00 46.21 ? 25  ASP C CG  1 
ATOM   7706  O  OD1 . ASP C 1 25  ? 43.521 69.147  44.222  1.00 47.22 ? 25  ASP C OD1 1 
ATOM   7707  O  OD2 . ASP C 1 25  ? 43.704 71.059  45.312  1.00 46.67 ? 25  ASP C OD2 1 
ATOM   7708  N  N   . VAL C 1 26  ? 47.920 69.127  42.501  1.00 40.16 ? 26  VAL C N   1 
ATOM   7709  C  CA  . VAL C 1 26  ? 49.210 69.330  41.853  1.00 38.50 ? 26  VAL C CA  1 
ATOM   7710  C  C   . VAL C 1 26  ? 49.566 70.806  41.889  1.00 37.49 ? 26  VAL C C   1 
ATOM   7711  O  O   . VAL C 1 26  ? 48.752 71.653  41.518  1.00 37.91 ? 26  VAL C O   1 
ATOM   7712  C  CB  . VAL C 1 26  ? 49.175 68.849  40.398  1.00 38.30 ? 26  VAL C CB  1 
ATOM   7713  C  CG1 . VAL C 1 26  ? 50.348 69.415  39.618  1.00 37.15 ? 26  VAL C CG1 1 
ATOM   7714  C  CG2 . VAL C 1 26  ? 49.240 67.341  40.380  1.00 38.27 ? 26  VAL C CG2 1 
ATOM   7715  N  N   . LEU C 1 27  ? 50.780 71.102  42.351  1.00 36.27 ? 27  LEU C N   1 
ATOM   7716  C  CA  . LEU C 1 27  ? 51.271 72.470  42.468  1.00 34.36 ? 27  LEU C CA  1 
ATOM   7717  C  C   . LEU C 1 27  ? 51.644 73.014  41.098  1.00 33.93 ? 27  LEU C C   1 
ATOM   7718  O  O   . LEU C 1 27  ? 52.389 72.369  40.361  1.00 33.37 ? 27  LEU C O   1 
ATOM   7719  C  CB  . LEU C 1 27  ? 52.479 72.487  43.403  1.00 33.74 ? 27  LEU C CB  1 
ATOM   7720  C  CG  . LEU C 1 27  ? 53.299 73.766  43.567  1.00 32.79 ? 27  LEU C CG  1 
ATOM   7721  C  CD1 . LEU C 1 27  ? 52.412 74.910  43.990  1.00 32.45 ? 27  LEU C CD1 1 
ATOM   7722  C  CD2 . LEU C 1 27  ? 54.374 73.524  44.603  1.00 32.93 ? 27  LEU C CD2 1 
ATOM   7723  N  N   . THR C 1 28  ? 51.124 74.198  40.756  1.00 33.57 ? 28  THR C N   1 
ATOM   7724  C  CA  . THR C 1 28  ? 51.397 74.800  39.443  1.00 33.12 ? 28  THR C CA  1 
ATOM   7725  C  C   . THR C 1 28  ? 51.801 76.270  39.453  1.00 32.72 ? 28  THR C C   1 
ATOM   7726  O  O   . THR C 1 28  ? 51.746 76.954  40.479  1.00 32.45 ? 28  THR C O   1 
ATOM   7727  C  CB  . THR C 1 28  ? 50.160 74.720  38.479  1.00 33.30 ? 28  THR C CB  1 
ATOM   7728  O  OG1 . THR C 1 28  ? 49.103 75.548  38.982  1.00 33.24 ? 28  THR C OG1 1 
ATOM   7729  C  CG2 . THR C 1 28  ? 49.650 73.310  38.351  1.00 32.67 ? 28  THR C CG2 1 
ATOM   7730  N  N   . THR C 1 29  ? 52.206 76.731  38.273  1.00 32.08 ? 29  THR C N   1 
ATOM   7731  C  CA  . THR C 1 29  ? 52.572 78.114  38.040  1.00 31.84 ? 29  THR C CA  1 
ATOM   7732  C  C   . THR C 1 29  ? 51.224 78.818  37.891  1.00 32.18 ? 29  THR C C   1 
ATOM   7733  O  O   . THR C 1 29  ? 50.177 78.177  37.994  1.00 32.85 ? 29  THR C O   1 
ATOM   7734  C  CB  . THR C 1 29  ? 53.378 78.273  36.720  1.00 32.42 ? 29  THR C CB  1 
ATOM   7735  O  OG1 . THR C 1 29  ? 52.591 77.818  35.606  1.00 32.77 ? 29  THR C OG1 1 
ATOM   7736  C  CG2 . THR C 1 29  ? 54.681 77.466  36.781  1.00 31.95 ? 29  THR C CG2 1 
ATOM   7737  N  N   . GLY C 1 30  ? 51.236 80.124  37.647  1.00 32.23 ? 30  GLY C N   1 
ATOM   7738  C  CA  . GLY C 1 30  ? 49.988 80.851  37.492  1.00 31.75 ? 30  GLY C CA  1 
ATOM   7739  C  C   . GLY C 1 30  ? 49.249 80.498  36.211  1.00 31.99 ? 30  GLY C C   1 
ATOM   7740  O  O   . GLY C 1 30  ? 48.058 80.768  36.083  1.00 32.91 ? 30  GLY C O   1 
ATOM   7741  N  N   . ALA C 1 31  ? 49.953 79.887  35.266  1.00 31.70 ? 31  ALA C N   1 
ATOM   7742  C  CA  . ALA C 1 31  ? 49.372 79.506  33.991  1.00 31.34 ? 31  ALA C CA  1 
ATOM   7743  C  C   . ALA C 1 31  ? 48.896 78.063  34.045  1.00 31.67 ? 31  ALA C C   1 
ATOM   7744  O  O   . ALA C 1 31  ? 48.492 77.492  33.034  1.00 31.33 ? 31  ALA C O   1 
ATOM   7745  C  CB  . ALA C 1 31  ? 50.403 79.689  32.877  1.00 31.25 ? 31  ALA C CB  1 
ATOM   7746  N  N   . GLY C 1 32  ? 48.968 77.472  35.233  1.00 31.99 ? 32  GLY C N   1 
ATOM   7747  C  CA  . GLY C 1 32  ? 48.506 76.107  35.420  1.00 32.04 ? 32  GLY C CA  1 
ATOM   7748  C  C   . GLY C 1 32  ? 49.456 75.003  35.023  1.00 32.66 ? 32  GLY C C   1 
ATOM   7749  O  O   . GLY C 1 32  ? 49.075 73.831  34.969  1.00 33.45 ? 32  GLY C O   1 
ATOM   7750  N  N   . ASN C 1 33  ? 50.697 75.359  34.741  1.00 33.02 ? 33  ASN C N   1 
ATOM   7751  C  CA  . ASN C 1 33  ? 51.670 74.360  34.344  1.00 33.51 ? 33  ASN C CA  1 
ATOM   7752  C  C   . ASN C 1 33  ? 52.219 73.698  35.595  1.00 34.13 ? 33  ASN C C   1 
ATOM   7753  O  O   . ASN C 1 33  ? 52.617 74.375  36.545  1.00 35.00 ? 33  ASN C O   1 
ATOM   7754  C  CB  . ASN C 1 33  ? 52.801 75.013  33.554  1.00 33.89 ? 33  ASN C CB  1 
ATOM   7755  C  CG  . ASN C 1 33  ? 52.319 75.658  32.260  1.00 34.80 ? 33  ASN C CG  1 
ATOM   7756  O  OD1 . ASN C 1 33  ? 52.907 76.625  31.771  1.00 35.30 ? 33  ASN C OD1 1 
ATOM   7757  N  ND2 . ASN C 1 33  ? 51.253 75.115  31.695  1.00 35.01 ? 33  ASN C ND2 1 
ATOM   7758  N  N   . PRO C 1 34  ? 52.221 72.361  35.623  1.00 33.85 ? 34  PRO C N   1 
ATOM   7759  C  CA  . PRO C 1 34  ? 52.718 71.563  36.745  1.00 33.50 ? 34  PRO C CA  1 
ATOM   7760  C  C   . PRO C 1 34  ? 54.178 71.895  37.083  1.00 33.48 ? 34  PRO C C   1 
ATOM   7761  O  O   . PRO C 1 34  ? 55.004 72.085  36.185  1.00 32.08 ? 34  PRO C O   1 
ATOM   7762  C  CB  . PRO C 1 34  ? 52.546 70.137  36.232  1.00 33.78 ? 34  PRO C CB  1 
ATOM   7763  C  CG  . PRO C 1 34  ? 51.324 70.243  35.419  1.00 33.99 ? 34  PRO C CG  1 
ATOM   7764  C  CD  . PRO C 1 34  ? 51.568 71.496  34.629  1.00 33.75 ? 34  PRO C CD  1 
ATOM   7765  N  N   . VAL C 1 35  ? 54.482 71.960  38.379  1.00 33.54 ? 35  VAL C N   1 
ATOM   7766  C  CA  . VAL C 1 35  ? 55.834 72.277  38.852  1.00 34.17 ? 35  VAL C CA  1 
ATOM   7767  C  C   . VAL C 1 35  ? 56.548 71.031  39.370  1.00 34.76 ? 35  VAL C C   1 
ATOM   7768  O  O   . VAL C 1 35  ? 56.109 70.422  40.342  1.00 35.71 ? 35  VAL C O   1 
ATOM   7769  C  CB  . VAL C 1 35  ? 55.797 73.325  40.002  1.00 34.15 ? 35  VAL C CB  1 
ATOM   7770  C  CG1 . VAL C 1 35  ? 57.201 73.564  40.539  1.00 33.48 ? 35  VAL C CG1 1 
ATOM   7771  C  CG2 . VAL C 1 35  ? 55.187 74.632  39.510  1.00 32.84 ? 35  VAL C CG2 1 
ATOM   7772  N  N   . GLY C 1 36  ? 57.644 70.653  38.728  1.00 35.10 ? 36  GLY C N   1 
ATOM   7773  C  CA  . GLY C 1 36  ? 58.374 69.486  39.183  1.00 36.28 ? 36  GLY C CA  1 
ATOM   7774  C  C   . GLY C 1 36  ? 59.032 69.700  40.546  1.00 37.86 ? 36  GLY C C   1 
ATOM   7775  O  O   . GLY C 1 36  ? 58.882 68.877  41.460  1.00 38.18 ? 36  GLY C O   1 
ATOM   7776  N  N   . ASP C 1 37  ? 59.764 70.809  40.688  1.00 38.11 ? 37  ASP C N   1 
ATOM   7777  C  CA  . ASP C 1 37  ? 60.457 71.139  41.937  1.00 37.07 ? 37  ASP C CA  1 
ATOM   7778  C  C   . ASP C 1 37  ? 60.318 72.634  42.194  1.00 35.89 ? 37  ASP C C   1 
ATOM   7779  O  O   . ASP C 1 37  ? 60.734 73.445  41.368  1.00 35.18 ? 37  ASP C O   1 
ATOM   7780  C  CB  . ASP C 1 37  ? 61.949 70.762  41.827  1.00 38.15 ? 37  ASP C CB  1 
ATOM   7781  C  CG  . ASP C 1 37  ? 62.699 70.862  43.162  1.00 38.86 ? 37  ASP C CG  1 
ATOM   7782  O  OD1 . ASP C 1 37  ? 63.879 70.444  43.216  1.00 39.93 ? 37  ASP C OD1 1 
ATOM   7783  O  OD2 . ASP C 1 37  ? 62.125 71.355  44.151  1.00 39.30 ? 37  ASP C OD2 1 
ATOM   7784  N  N   . LYS C 1 38  ? 59.721 72.987  43.331  1.00 34.24 ? 38  LYS C N   1 
ATOM   7785  C  CA  . LYS C 1 38  ? 59.535 74.385  43.696  1.00 32.90 ? 38  LYS C CA  1 
ATOM   7786  C  C   . LYS C 1 38  ? 60.270 74.668  45.003  1.00 32.57 ? 38  LYS C C   1 
ATOM   7787  O  O   . LYS C 1 38  ? 59.869 75.535  45.781  1.00 31.84 ? 38  LYS C O   1 
ATOM   7788  C  CB  . LYS C 1 38  ? 58.042 74.724  43.856  1.00 32.22 ? 38  LYS C CB  1 
ATOM   7789  C  CG  . LYS C 1 38  ? 57.711 76.161  43.446  1.00 31.07 ? 38  LYS C CG  1 
ATOM   7790  C  CD  . LYS C 1 38  ? 56.588 76.791  44.274  1.00 31.03 ? 38  LYS C CD  1 
ATOM   7791  C  CE  . LYS C 1 38  ? 56.964 76.939  45.750  1.00 29.17 ? 38  LYS C CE  1 
ATOM   7792  N  NZ  . LYS C 1 38  ? 58.232 77.695  45.943  1.00 28.31 ? 38  LYS C NZ  1 
ATOM   7793  N  N   . LEU C 1 39  ? 61.349 73.922  45.234  1.00 32.57 ? 39  LEU C N   1 
ATOM   7794  C  CA  . LEU C 1 39  ? 62.178 74.084  46.432  1.00 31.55 ? 39  LEU C CA  1 
ATOM   7795  C  C   . LEU C 1 39  ? 63.628 74.365  46.029  1.00 30.90 ? 39  LEU C C   1 
ATOM   7796  O  O   . LEU C 1 39  ? 64.483 74.648  46.867  1.00 30.20 ? 39  LEU C O   1 
ATOM   7797  C  CB  . LEU C 1 39  ? 62.084 72.827  47.309  1.00 30.82 ? 39  LEU C CB  1 
ATOM   7798  C  CG  . LEU C 1 39  ? 60.671 72.639  47.872  1.00 31.15 ? 39  LEU C CG  1 
ATOM   7799  C  CD1 . LEU C 1 39  ? 60.535 71.343  48.648  1.00 31.16 ? 39  LEU C CD1 1 
ATOM   7800  C  CD2 . LEU C 1 39  ? 60.363 73.826  48.765  1.00 31.44 ? 39  LEU C CD2 1 
ATOM   7801  N  N   . ASN C 1 40  ? 63.890 74.300  44.729  1.00 30.20 ? 40  ASN C N   1 
ATOM   7802  C  CA  . ASN C 1 40  ? 65.224 74.550  44.209  1.00 30.81 ? 40  ASN C CA  1 
ATOM   7803  C  C   . ASN C 1 40  ? 65.150 75.265  42.864  1.00 30.64 ? 40  ASN C C   1 
ATOM   7804  O  O   . ASN C 1 40  ? 64.310 74.957  42.027  1.00 31.17 ? 40  ASN C O   1 
ATOM   7805  C  CB  . ASN C 1 40  ? 65.989 73.224  44.059  1.00 31.15 ? 40  ASN C CB  1 
ATOM   7806  C  CG  . ASN C 1 40  ? 66.110 72.467  45.377  1.00 31.18 ? 40  ASN C CG  1 
ATOM   7807  O  OD1 . ASN C 1 40  ? 66.751 72.935  46.322  1.00 29.70 ? 40  ASN C OD1 1 
ATOM   7808  N  ND2 . ASN C 1 40  ? 65.482 71.295  45.447  1.00 30.32 ? 40  ASN C ND2 1 
ATOM   7809  N  N   . VAL C 1 41  ? 66.046 76.217  42.668  1.00 30.16 ? 41  VAL C N   1 
ATOM   7810  C  CA  . VAL C 1 41  ? 66.104 76.998  41.448  1.00 30.29 ? 41  VAL C CA  1 
ATOM   7811  C  C   . VAL C 1 41  ? 67.067 76.389  40.416  1.00 29.94 ? 41  VAL C C   1 
ATOM   7812  O  O   . VAL C 1 41  ? 67.945 75.607  40.773  1.00 30.57 ? 41  VAL C O   1 
ATOM   7813  C  CB  . VAL C 1 41  ? 66.535 78.424  41.814  1.00 31.32 ? 41  VAL C CB  1 
ATOM   7814  C  CG1 . VAL C 1 41  ? 66.965 79.181  40.591  1.00 32.25 ? 41  VAL C CG1 1 
ATOM   7815  C  CG2 . VAL C 1 41  ? 65.381 79.133  42.495  1.00 30.36 ? 41  VAL C CG2 1 
ATOM   7816  N  N   . ILE C 1 42  ? 66.905 76.735  39.139  1.00 29.36 ? 42  ILE C N   1 
ATOM   7817  C  CA  . ILE C 1 42  ? 67.792 76.207  38.093  1.00 28.87 ? 42  ILE C CA  1 
ATOM   7818  C  C   . ILE C 1 42  ? 69.088 77.014  37.982  1.00 29.34 ? 42  ILE C C   1 
ATOM   7819  O  O   . ILE C 1 42  ? 69.080 78.224  37.731  1.00 29.76 ? 42  ILE C O   1 
ATOM   7820  C  CB  . ILE C 1 42  ? 67.141 76.218  36.692  1.00 28.42 ? 42  ILE C CB  1 
ATOM   7821  C  CG1 . ILE C 1 42  ? 65.786 75.514  36.718  1.00 28.06 ? 42  ILE C CG1 1 
ATOM   7822  C  CG2 . ILE C 1 42  ? 68.080 75.538  35.690  1.00 27.32 ? 42  ILE C CG2 1 
ATOM   7823  C  CD1 . ILE C 1 42  ? 65.035 75.581  35.377  1.00 27.02 ? 42  ILE C CD1 1 
ATOM   7824  N  N   . THR C 1 43  ? 70.209 76.329  38.140  1.00 29.80 ? 43  THR C N   1 
ATOM   7825  C  CA  . THR C 1 43  ? 71.505 76.983  38.066  1.00 29.91 ? 43  THR C CA  1 
ATOM   7826  C  C   . THR C 1 43  ? 72.412 76.230  37.113  1.00 30.81 ? 43  THR C C   1 
ATOM   7827  O  O   . THR C 1 43  ? 72.176 75.058  36.821  1.00 31.32 ? 43  THR C O   1 
ATOM   7828  C  CB  . THR C 1 43  ? 72.162 76.990  39.433  1.00 28.55 ? 43  THR C CB  1 
ATOM   7829  O  OG1 . THR C 1 43  ? 72.371 75.638  39.848  1.00 27.57 ? 43  THR C OG1 1 
ATOM   7830  C  CG2 . THR C 1 43  ? 71.256 77.680  40.453  1.00 27.62 ? 43  THR C CG2 1 
ATOM   7831  N  N   . VAL C 1 44  ? 73.441 76.906  36.614  1.00 31.62 ? 44  VAL C N   1 
ATOM   7832  C  CA  . VAL C 1 44  ? 74.393 76.248  35.732  1.00 31.83 ? 44  VAL C CA  1 
ATOM   7833  C  C   . VAL C 1 44  ? 75.399 75.554  36.664  1.00 31.33 ? 44  VAL C C   1 
ATOM   7834  O  O   . VAL C 1 44  ? 76.385 76.137  37.124  1.00 30.44 ? 44  VAL C O   1 
ATOM   7835  C  CB  . VAL C 1 44  ? 75.055 77.271  34.723  1.00 32.14 ? 44  VAL C CB  1 
ATOM   7836  C  CG1 . VAL C 1 44  ? 75.174 78.624  35.356  1.00 33.54 ? 44  VAL C CG1 1 
ATOM   7837  C  CG2 . VAL C 1 44  ? 76.423 76.779  34.253  1.00 31.51 ? 44  VAL C CG2 1 
ATOM   7838  N  N   . GLY C 1 45  ? 75.080 74.296  36.964  1.00 31.50 ? 45  GLY C N   1 
ATOM   7839  C  CA  . GLY C 1 45  ? 75.896 73.485  37.847  1.00 32.63 ? 45  GLY C CA  1 
ATOM   7840  C  C   . GLY C 1 45  ? 75.429 73.672  39.276  1.00 32.64 ? 45  GLY C C   1 
ATOM   7841  O  O   . GLY C 1 45  ? 74.622 74.555  39.538  1.00 32.74 ? 45  GLY C O   1 
ATOM   7842  N  N   . PRO C 1 46  ? 75.917 72.870  40.224  1.00 32.75 ? 46  PRO C N   1 
ATOM   7843  C  CA  . PRO C 1 46  ? 75.498 73.009  41.620  1.00 32.97 ? 46  PRO C CA  1 
ATOM   7844  C  C   . PRO C 1 46  ? 75.965 74.308  42.272  1.00 33.48 ? 46  PRO C C   1 
ATOM   7845  O  O   . PRO C 1 46  ? 75.380 74.751  43.259  1.00 33.53 ? 46  PRO C O   1 
ATOM   7846  C  CB  . PRO C 1 46  ? 76.105 71.777  42.281  1.00 33.30 ? 46  PRO C CB  1 
ATOM   7847  C  CG  . PRO C 1 46  ? 77.347 71.550  41.480  1.00 32.92 ? 46  PRO C CG  1 
ATOM   7848  C  CD  . PRO C 1 46  ? 76.864 71.755  40.067  1.00 32.85 ? 46  PRO C CD  1 
ATOM   7849  N  N   . ARG C 1 47  ? 77.020 74.909  41.719  1.00 33.68 ? 47  ARG C N   1 
ATOM   7850  C  CA  . ARG C 1 47  ? 77.566 76.157  42.245  1.00 33.41 ? 47  ARG C CA  1 
ATOM   7851  C  C   . ARG C 1 47  ? 77.593 77.247  41.184  1.00 33.15 ? 47  ARG C C   1 
ATOM   7852  O  O   . ARG C 1 47  ? 78.478 78.101  41.204  1.00 33.36 ? 47  ARG C O   1 
ATOM   7853  C  CB  . ARG C 1 47  ? 78.998 75.953  42.753  1.00 34.61 ? 47  ARG C CB  1 
ATOM   7854  C  CG  . ARG C 1 47  ? 79.158 74.934  43.869  1.00 35.89 ? 47  ARG C CG  1 
ATOM   7855  C  CD  . ARG C 1 47  ? 78.371 75.309  45.107  1.00 36.34 ? 47  ARG C CD  1 
ATOM   7856  N  NE  . ARG C 1 47  ? 78.543 74.331  46.171  1.00 37.73 ? 47  ARG C NE  1 
ATOM   7857  C  CZ  . ARG C 1 47  ? 79.715 74.041  46.729  1.00 39.12 ? 47  ARG C CZ  1 
ATOM   7858  N  NH1 . ARG C 1 47  ? 80.820 74.658  46.316  1.00 40.19 ? 47  ARG C NH1 1 
ATOM   7859  N  NH2 . ARG C 1 47  ? 79.787 73.142  47.702  1.00 39.06 ? 47  ARG C NH2 1 
ATOM   7860  N  N   . GLY C 1 48  ? 76.636 77.217  40.259  1.00 32.85 ? 48  GLY C N   1 
ATOM   7861  C  CA  . GLY C 1 48  ? 76.590 78.219  39.206  1.00 31.69 ? 48  GLY C CA  1 
ATOM   7862  C  C   . GLY C 1 48  ? 75.484 79.245  39.374  1.00 31.41 ? 48  GLY C C   1 
ATOM   7863  O  O   . GLY C 1 48  ? 74.652 79.123  40.267  1.00 32.49 ? 48  GLY C O   1 
ATOM   7864  N  N   . PRO C 1 49  ? 75.455 80.285  38.535  1.00 30.62 ? 49  PRO C N   1 
ATOM   7865  C  CA  . PRO C 1 49  ? 74.425 81.329  38.611  1.00 30.23 ? 49  PRO C CA  1 
ATOM   7866  C  C   . PRO C 1 49  ? 73.030 80.863  38.190  1.00 29.70 ? 49  PRO C C   1 
ATOM   7867  O  O   . PRO C 1 49  ? 72.875 79.784  37.609  1.00 29.15 ? 49  PRO C O   1 
ATOM   7868  C  CB  . PRO C 1 49  ? 74.976 82.418  37.702  1.00 30.20 ? 49  PRO C CB  1 
ATOM   7869  C  CG  . PRO C 1 49  ? 75.771 81.622  36.703  1.00 30.41 ? 49  PRO C CG  1 
ATOM   7870  C  CD  . PRO C 1 49  ? 76.488 80.638  37.551  1.00 29.83 ? 49  PRO C CD  1 
ATOM   7871  N  N   . LEU C 1 50  ? 72.037 81.701  38.485  1.00 28.88 ? 50  LEU C N   1 
ATOM   7872  C  CA  . LEU C 1 50  ? 70.620 81.452  38.202  1.00 28.30 ? 50  LEU C CA  1 
ATOM   7873  C  C   . LEU C 1 50  ? 70.192 81.702  36.766  1.00 28.61 ? 50  LEU C C   1 
ATOM   7874  O  O   . LEU C 1 50  ? 70.605 82.678  36.144  1.00 28.49 ? 50  LEU C O   1 
ATOM   7875  C  CB  . LEU C 1 50  ? 69.766 82.322  39.125  1.00 27.59 ? 50  LEU C CB  1 
ATOM   7876  C  CG  . LEU C 1 50  ? 68.320 82.636  38.725  1.00 27.93 ? 50  LEU C CG  1 
ATOM   7877  C  CD1 . LEU C 1 50  ? 67.558 81.355  38.469  1.00 27.46 ? 50  LEU C CD1 1 
ATOM   7878  C  CD2 . LEU C 1 50  ? 67.650 83.445  39.824  1.00 26.45 ? 50  LEU C CD2 1 
ATOM   7879  N  N   . LEU C 1 51  ? 69.327 80.836  36.253  1.00 29.43 ? 51  LEU C N   1 
ATOM   7880  C  CA  . LEU C 1 51  ? 68.855 80.973  34.880  1.00 29.96 ? 51  LEU C CA  1 
ATOM   7881  C  C   . LEU C 1 51  ? 67.510 81.649  34.674  1.00 30.32 ? 51  LEU C C   1 
ATOM   7882  O  O   . LEU C 1 51  ? 66.576 81.505  35.460  1.00 30.50 ? 51  LEU C O   1 
ATOM   7883  C  CB  . LEU C 1 51  ? 68.835 79.614  34.208  1.00 30.07 ? 51  LEU C CB  1 
ATOM   7884  C  CG  . LEU C 1 51  ? 70.272 79.135  34.109  1.00 30.89 ? 51  LEU C CG  1 
ATOM   7885  C  CD1 . LEU C 1 51  ? 70.492 77.999  35.097  1.00 31.00 ? 51  LEU C CD1 1 
ATOM   7886  C  CD2 . LEU C 1 51  ? 70.569 78.723  32.667  1.00 31.10 ? 51  LEU C CD2 1 
ATOM   7887  N  N   . VAL C 1 52  ? 67.423 82.394  33.585  1.00 30.75 ? 52  VAL C N   1 
ATOM   7888  C  CA  . VAL C 1 52  ? 66.201 83.096  33.255  1.00 30.59 ? 52  VAL C CA  1 
ATOM   7889  C  C   . VAL C 1 52  ? 65.108 82.109  32.876  1.00 30.07 ? 52  VAL C C   1 
ATOM   7890  O  O   . VAL C 1 52  ? 63.930 82.382  33.092  1.00 30.34 ? 52  VAL C O   1 
ATOM   7891  C  CB  . VAL C 1 52  ? 66.441 84.087  32.091  1.00 30.97 ? 52  VAL C CB  1 
ATOM   7892  C  CG1 . VAL C 1 52  ? 65.118 84.478  31.429  1.00 30.51 ? 52  VAL C CG1 1 
ATOM   7893  C  CG2 . VAL C 1 52  ? 67.159 85.319  32.620  1.00 30.16 ? 52  VAL C CG2 1 
ATOM   7894  N  N   . GLN C 1 53  ? 65.494 80.963  32.324  1.00 29.80 ? 53  GLN C N   1 
ATOM   7895  C  CA  . GLN C 1 53  ? 64.504 79.966  31.920  1.00 30.41 ? 53  GLN C CA  1 
ATOM   7896  C  C   . GLN C 1 53  ? 63.813 79.263  33.079  1.00 29.99 ? 53  GLN C C   1 
ATOM   7897  O  O   . GLN C 1 53  ? 62.899 78.478  32.869  1.00 30.09 ? 53  GLN C O   1 
ATOM   7898  C  CB  . GLN C 1 53  ? 65.106 78.931  30.969  1.00 30.51 ? 53  GLN C CB  1 
ATOM   7899  C  CG  . GLN C 1 53  ? 66.286 78.202  31.498  1.00 31.30 ? 53  GLN C CG  1 
ATOM   7900  C  CD  . GLN C 1 53  ? 66.811 77.202  30.502  1.00 31.40 ? 53  GLN C CD  1 
ATOM   7901  O  OE1 . GLN C 1 53  ? 66.961 77.507  29.319  1.00 30.69 ? 53  GLN C OE1 1 
ATOM   7902  N  NE2 . GLN C 1 53  ? 67.106 75.998  30.977  1.00 31.58 ? 53  GLN C NE2 1 
ATOM   7903  N  N   . ASP C 1 54  ? 64.251 79.534  34.301  1.00 29.58 ? 54  ASP C N   1 
ATOM   7904  C  CA  . ASP C 1 54  ? 63.576 78.969  35.455  1.00 29.60 ? 54  ASP C CA  1 
ATOM   7905  C  C   . ASP C 1 54  ? 62.401 79.943  35.629  1.00 30.29 ? 54  ASP C C   1 
ATOM   7906  O  O   . ASP C 1 54  ? 62.459 80.865  36.463  1.00 31.05 ? 54  ASP C O   1 
ATOM   7907  C  CB  . ASP C 1 54  ? 64.480 79.015  36.689  1.00 29.67 ? 54  ASP C CB  1 
ATOM   7908  C  CG  . ASP C 1 54  ? 63.783 78.517  37.941  1.00 30.10 ? 54  ASP C CG  1 
ATOM   7909  O  OD1 . ASP C 1 54  ? 62.549 78.330  37.886  1.00 29.65 ? 54  ASP C OD1 1 
ATOM   7910  O  OD2 . ASP C 1 54  ? 64.463 78.321  38.978  1.00 29.84 ? 54  ASP C OD2 1 
ATOM   7911  N  N   . VAL C 1 55  ? 61.352 79.767  34.823  1.00 29.09 ? 55  VAL C N   1 
ATOM   7912  C  CA  . VAL C 1 55  ? 60.203 80.665  34.908  1.00 27.79 ? 55  VAL C CA  1 
ATOM   7913  C  C   . VAL C 1 55  ? 59.258 80.280  36.040  1.00 27.05 ? 55  VAL C C   1 
ATOM   7914  O  O   . VAL C 1 55  ? 58.386 81.058  36.426  1.00 27.29 ? 55  VAL C O   1 
ATOM   7915  C  CB  . VAL C 1 55  ? 59.431 80.753  33.563  1.00 26.40 ? 55  VAL C CB  1 
ATOM   7916  C  CG1 . VAL C 1 55  ? 60.414 80.952  32.421  1.00 25.62 ? 55  VAL C CG1 1 
ATOM   7917  C  CG2 . VAL C 1 55  ? 58.587 79.528  33.359  1.00 27.66 ? 55  VAL C CG2 1 
ATOM   7918  N  N   . VAL C 1 56  ? 59.424 79.076  36.572  1.00 26.98 ? 56  VAL C N   1 
ATOM   7919  C  CA  . VAL C 1 56  ? 58.611 78.676  37.703  1.00 26.47 ? 56  VAL C CA  1 
ATOM   7920  C  C   . VAL C 1 56  ? 58.925 79.714  38.787  1.00 27.50 ? 56  VAL C C   1 
ATOM   7921  O  O   . VAL C 1 56  ? 58.017 80.331  39.354  1.00 28.62 ? 56  VAL C O   1 
ATOM   7922  C  CB  . VAL C 1 56  ? 58.994 77.276  38.203  1.00 25.34 ? 56  VAL C CB  1 
ATOM   7923  C  CG1 . VAL C 1 56  ? 58.543 77.092  39.648  1.00 24.63 ? 56  VAL C CG1 1 
ATOM   7924  C  CG2 . VAL C 1 56  ? 58.354 76.225  37.321  1.00 23.59 ? 56  VAL C CG2 1 
ATOM   7925  N  N   . PHE C 1 57  ? 60.222 79.919  39.026  1.00 27.59 ? 57  PHE C N   1 
ATOM   7926  C  CA  . PHE C 1 57  ? 60.724 80.865  40.015  1.00 27.43 ? 57  PHE C CA  1 
ATOM   7927  C  C   . PHE C 1 57  ? 60.272 82.283  39.756  1.00 28.76 ? 57  PHE C C   1 
ATOM   7928  O  O   . PHE C 1 57  ? 59.749 82.947  40.656  1.00 29.72 ? 57  PHE C O   1 
ATOM   7929  C  CB  . PHE C 1 57  ? 62.249 80.871  40.025  1.00 27.11 ? 57  PHE C CB  1 
ATOM   7930  C  CG  . PHE C 1 57  ? 62.842 82.003  40.831  1.00 25.95 ? 57  PHE C CG  1 
ATOM   7931  C  CD1 . PHE C 1 57  ? 62.762 82.002  42.231  1.00 25.62 ? 57  PHE C CD1 1 
ATOM   7932  C  CD2 . PHE C 1 57  ? 63.453 83.075  40.195  1.00 24.96 ? 57  PHE C CD2 1 
ATOM   7933  C  CE1 . PHE C 1 57  ? 63.283 83.055  42.986  1.00 24.64 ? 57  PHE C CE1 1 
ATOM   7934  C  CE2 . PHE C 1 57  ? 63.976 84.137  40.935  1.00 25.60 ? 57  PHE C CE2 1 
ATOM   7935  C  CZ  . PHE C 1 57  ? 63.891 84.126  42.339  1.00 25.99 ? 57  PHE C CZ  1 
ATOM   7936  N  N   . THR C 1 58  ? 60.496 82.763  38.532  1.00 29.02 ? 58  THR C N   1 
ATOM   7937  C  CA  . THR C 1 58  ? 60.112 84.131  38.184  1.00 28.33 ? 58  THR C CA  1 
ATOM   7938  C  C   . THR C 1 58  ? 58.624 84.351  38.298  1.00 28.04 ? 58  THR C C   1 
ATOM   7939  O  O   . THR C 1 58  ? 58.183 85.391  38.779  1.00 27.54 ? 58  THR C O   1 
ATOM   7940  C  CB  . THR C 1 58  ? 60.512 84.497  36.764  1.00 28.31 ? 58  THR C CB  1 
ATOM   7941  O  OG1 . THR C 1 58  ? 61.917 84.302  36.602  1.00 29.57 ? 58  THR C OG1 1 
ATOM   7942  C  CG2 . THR C 1 58  ? 60.185 85.964  36.493  1.00 28.42 ? 58  THR C CG2 1 
ATOM   7943  N  N   . ASP C 1 59  ? 57.850 83.372  37.840  1.00 28.00 ? 59  ASP C N   1 
ATOM   7944  C  CA  . ASP C 1 59  ? 56.407 83.482  37.908  1.00 28.01 ? 59  ASP C CA  1 
ATOM   7945  C  C   . ASP C 1 59  ? 55.932 83.644  39.358  1.00 28.01 ? 59  ASP C C   1 
ATOM   7946  O  O   . ASP C 1 59  ? 55.054 84.444  39.628  1.00 27.95 ? 59  ASP C O   1 
ATOM   7947  C  CB  . ASP C 1 59  ? 55.744 82.256  37.280  1.00 27.77 ? 59  ASP C CB  1 
ATOM   7948  C  CG  . ASP C 1 59  ? 54.236 82.289  37.416  1.00 28.87 ? 59  ASP C CG  1 
ATOM   7949  O  OD1 . ASP C 1 59  ? 53.615 83.195  36.820  1.00 29.95 ? 59  ASP C OD1 1 
ATOM   7950  O  OD2 . ASP C 1 59  ? 53.673 81.427  38.130  1.00 28.48 ? 59  ASP C OD2 1 
ATOM   7951  N  N   . GLU C 1 60  ? 56.495 82.885  40.294  1.00 28.10 ? 60  GLU C N   1 
ATOM   7952  C  CA  . GLU C 1 60  ? 56.058 83.021  41.679  1.00 28.46 ? 60  GLU C CA  1 
ATOM   7953  C  C   . GLU C 1 60  ? 56.677 84.249  42.332  1.00 28.18 ? 60  GLU C C   1 
ATOM   7954  O  O   . GLU C 1 60  ? 56.036 84.934  43.132  1.00 28.38 ? 60  GLU C O   1 
ATOM   7955  C  CB  . GLU C 1 60  ? 56.410 81.776  42.512  1.00 29.05 ? 60  GLU C CB  1 
ATOM   7956  C  CG  . GLU C 1 60  ? 56.203 82.004  44.016  1.00 30.13 ? 60  GLU C CG  1 
ATOM   7957  C  CD  . GLU C 1 60  ? 56.505 80.793  44.878  1.00 31.11 ? 60  GLU C CD  1 
ATOM   7958  O  OE1 . GLU C 1 60  ? 57.421 80.015  44.525  1.00 29.78 ? 60  GLU C OE1 1 
ATOM   7959  O  OE2 . GLU C 1 60  ? 55.829 80.641  45.926  1.00 31.86 ? 60  GLU C OE2 1 
ATOM   7960  N  N   . MET C 1 61  ? 57.929 84.526  41.994  1.00 27.37 ? 61  MET C N   1 
ATOM   7961  C  CA  . MET C 1 61  ? 58.606 85.672  42.568  1.00 27.01 ? 61  MET C CA  1 
ATOM   7962  C  C   . MET C 1 61  ? 57.938 86.960  42.089  1.00 27.35 ? 61  MET C C   1 
ATOM   7963  O  O   . MET C 1 61  ? 57.666 87.863  42.891  1.00 28.39 ? 61  MET C O   1 
ATOM   7964  C  CB  . MET C 1 61  ? 60.090 85.655  42.188  1.00 25.50 ? 61  MET C CB  1 
ATOM   7965  C  CG  . MET C 1 61  ? 60.950 86.661  42.939  1.00 26.20 ? 61  MET C CG  1 
ATOM   7966  S  SD  . MET C 1 61  ? 60.914 86.522  44.780  1.00 25.60 ? 61  MET C SD  1 
ATOM   7967  C  CE  . MET C 1 61  ? 60.082 87.908  45.090  1.00 24.76 ? 61  MET C CE  1 
ATOM   7968  N  N   . ALA C 1 62  ? 57.653 87.036  40.792  1.00 26.17 ? 62  ALA C N   1 
ATOM   7969  C  CA  . ALA C 1 62  ? 57.026 88.224  40.239  1.00 26.19 ? 62  ALA C CA  1 
ATOM   7970  C  C   . ALA C 1 62  ? 55.717 88.560  40.945  1.00 26.02 ? 62  ALA C C   1 
ATOM   7971  O  O   . ALA C 1 62  ? 55.426 89.726  41.195  1.00 27.09 ? 62  ALA C O   1 
ATOM   7972  C  CB  . ALA C 1 62  ? 56.790 88.053  38.737  1.00 25.31 ? 62  ALA C CB  1 
ATOM   7973  N  N   . HIS C 1 63  ? 54.933 87.545  41.278  1.00 25.70 ? 63  HIS C N   1 
ATOM   7974  C  CA  . HIS C 1 63  ? 53.662 87.780  41.937  1.00 26.01 ? 63  HIS C CA  1 
ATOM   7975  C  C   . HIS C 1 63  ? 53.884 88.223  43.379  1.00 26.19 ? 63  HIS C C   1 
ATOM   7976  O  O   . HIS C 1 63  ? 53.221 89.127  43.863  1.00 25.82 ? 63  HIS C O   1 
ATOM   7977  C  CB  . HIS C 1 63  ? 52.793 86.514  41.875  1.00 26.08 ? 63  HIS C CB  1 
ATOM   7978  C  CG  . HIS C 1 63  ? 51.333 86.783  42.068  1.00 27.39 ? 63  HIS C CG  1 
ATOM   7979  N  ND1 . HIS C 1 63  ? 50.754 86.895  43.314  1.00 28.01 ? 63  HIS C ND1 1 
ATOM   7980  C  CD2 . HIS C 1 63  ? 50.357 87.069  41.173  1.00 28.43 ? 63  HIS C CD2 1 
ATOM   7981  C  CE1 . HIS C 1 63  ? 49.486 87.244  43.180  1.00 27.77 ? 63  HIS C CE1 1 
ATOM   7982  N  NE2 . HIS C 1 63  ? 49.220 87.358  41.890  1.00 28.85 ? 63  HIS C NE2 1 
ATOM   7983  N  N   . PHE C 1 64  ? 54.823 87.579  44.063  1.00 27.52 ? 64  PHE C N   1 
ATOM   7984  C  CA  . PHE C 1 64  ? 55.145 87.928  45.450  1.00 27.59 ? 64  PHE C CA  1 
ATOM   7985  C  C   . PHE C 1 64  ? 55.442 89.411  45.506  1.00 27.46 ? 64  PHE C C   1 
ATOM   7986  O  O   . PHE C 1 64  ? 54.980 90.122  46.398  1.00 27.22 ? 64  PHE C O   1 
ATOM   7987  C  CB  . PHE C 1 64  ? 56.384 87.171  45.923  1.00 26.88 ? 64  PHE C CB  1 
ATOM   7988  C  CG  . PHE C 1 64  ? 56.903 87.634  47.259  1.00 27.77 ? 64  PHE C CG  1 
ATOM   7989  C  CD1 . PHE C 1 64  ? 56.178 87.385  48.429  1.00 26.81 ? 64  PHE C CD1 1 
ATOM   7990  C  CD2 . PHE C 1 64  ? 58.122 88.321  47.350  1.00 26.74 ? 64  PHE C CD2 1 
ATOM   7991  C  CE1 . PHE C 1 64  ? 56.657 87.808  49.660  1.00 26.03 ? 64  PHE C CE1 1 
ATOM   7992  C  CE2 . PHE C 1 64  ? 58.612 88.751  48.566  1.00 25.29 ? 64  PHE C CE2 1 
ATOM   7993  C  CZ  . PHE C 1 64  ? 57.882 88.496  49.730  1.00 27.41 ? 64  PHE C CZ  1 
ATOM   7994  N  N   . ASP C 1 65  ? 56.229 89.857  44.532  1.00 27.10 ? 65  ASP C N   1 
ATOM   7995  C  CA  . ASP C 1 65  ? 56.629 91.247  44.412  1.00 26.88 ? 65  ASP C CA  1 
ATOM   7996  C  C   . ASP C 1 65  ? 55.469 92.210  44.188  1.00 27.13 ? 65  ASP C C   1 
ATOM   7997  O  O   . ASP C 1 65  ? 55.684 93.416  44.118  1.00 27.88 ? 65  ASP C O   1 
ATOM   7998  C  CB  . ASP C 1 65  ? 57.603 91.422  43.243  1.00 26.98 ? 65  ASP C CB  1 
ATOM   7999  C  CG  . ASP C 1 65  ? 58.918 90.702  43.453  1.00 27.83 ? 65  ASP C CG  1 
ATOM   8000  O  OD1 . ASP C 1 65  ? 59.281 90.459  44.624  1.00 28.42 ? 65  ASP C OD1 1 
ATOM   8001  O  OD2 . ASP C 1 65  ? 59.598 90.405  42.445  1.00 26.61 ? 65  ASP C OD2 1 
ATOM   8002  N  N   . ARG C 1 66  ? 54.247 91.709  44.079  1.00 27.04 ? 66  ARG C N   1 
ATOM   8003  C  CA  . ARG C 1 66  ? 53.140 92.601  43.810  1.00 27.93 ? 66  ARG C CA  1 
ATOM   8004  C  C   . ARG C 1 66  ? 51.930 92.443  44.702  1.00 29.91 ? 66  ARG C C   1 
ATOM   8005  O  O   . ARG C 1 66  ? 50.919 93.115  44.497  1.00 30.43 ? 66  ARG C O   1 
ATOM   8006  C  CB  . ARG C 1 66  ? 52.724 92.452  42.341  1.00 26.78 ? 66  ARG C CB  1 
ATOM   8007  C  CG  . ARG C 1 66  ? 53.802 92.913  41.377  1.00 27.42 ? 66  ARG C CG  1 
ATOM   8008  C  CD  . ARG C 1 66  ? 53.454 92.697  39.917  1.00 27.24 ? 66  ARG C CD  1 
ATOM   8009  N  NE  . ARG C 1 66  ? 54.461 93.296  39.039  1.00 28.17 ? 66  ARG C NE  1 
ATOM   8010  C  CZ  . ARG C 1 66  ? 55.647 92.758  38.750  1.00 29.64 ? 66  ARG C CZ  1 
ATOM   8011  N  NH1 . ARG C 1 66  ? 56.008 91.583  39.258  1.00 30.89 ? 66  ARG C NH1 1 
ATOM   8012  N  NH2 . ARG C 1 66  ? 56.480 93.395  37.941  1.00 28.75 ? 66  ARG C NH2 1 
ATOM   8013  N  N   . GLU C 1 67  ? 52.023 91.608  45.726  1.00 31.55 ? 67  GLU C N   1 
ATOM   8014  C  CA  . GLU C 1 67  ? 50.843 91.402  46.541  1.00 33.21 ? 67  GLU C CA  1 
ATOM   8015  C  C   . GLU C 1 67  ? 50.352 92.529  47.432  1.00 33.49 ? 67  GLU C C   1 
ATOM   8016  O  O   . GLU C 1 67  ? 49.388 92.356  48.187  1.00 35.13 ? 67  GLU C O   1 
ATOM   8017  C  CB  . GLU C 1 67  ? 50.973 90.102  47.337  1.00 34.42 ? 67  GLU C CB  1 
ATOM   8018  C  CG  . GLU C 1 67  ? 52.150 89.961  48.234  1.00 34.78 ? 67  GLU C CG  1 
ATOM   8019  C  CD  . GLU C 1 67  ? 52.229 88.547  48.794  1.00 35.46 ? 67  GLU C CD  1 
ATOM   8020  O  OE1 . GLU C 1 67  ? 52.458 87.603  48.006  1.00 35.95 ? 67  GLU C OE1 1 
ATOM   8021  O  OE2 . GLU C 1 67  ? 52.049 88.376  50.018  1.00 35.89 ? 67  GLU C OE2 1 
ATOM   8022  N  N   . ARG C 1 68  ? 50.976 93.692  47.325  1.00 32.68 ? 68  ARG C N   1 
ATOM   8023  C  CA  . ARG C 1 68  ? 50.574 94.829  48.140  1.00 31.04 ? 68  ARG C CA  1 
ATOM   8024  C  C   . ARG C 1 68  ? 49.918 95.907  47.293  1.00 30.38 ? 68  ARG C C   1 
ATOM   8025  O  O   . ARG C 1 68  ? 50.412 96.242  46.211  1.00 30.64 ? 68  ARG C O   1 
ATOM   8026  C  CB  . ARG C 1 68  ? 51.788 95.432  48.844  1.00 30.69 ? 68  ARG C CB  1 
ATOM   8027  C  CG  . ARG C 1 68  ? 52.532 94.472  49.720  1.00 30.68 ? 68  ARG C CG  1 
ATOM   8028  C  CD  . ARG C 1 68  ? 51.803 94.212  51.022  1.00 31.63 ? 68  ARG C CD  1 
ATOM   8029  N  NE  . ARG C 1 68  ? 52.545 93.246  51.829  1.00 32.21 ? 68  ARG C NE  1 
ATOM   8030  C  CZ  . ARG C 1 68  ? 52.449 91.929  51.698  1.00 32.11 ? 68  ARG C CZ  1 
ATOM   8031  N  NH1 . ARG C 1 68  ? 51.622 91.415  50.796  1.00 32.75 ? 68  ARG C NH1 1 
ATOM   8032  N  NH2 . ARG C 1 68  ? 53.204 91.128  52.447  1.00 31.91 ? 68  ARG C NH2 1 
ATOM   8033  N  N   . ILE C 1 69  ? 48.800 96.435  47.788  1.00 28.44 ? 69  ILE C N   1 
ATOM   8034  C  CA  . ILE C 1 69  ? 48.084 97.513  47.123  1.00 27.58 ? 69  ILE C CA  1 
ATOM   8035  C  C   . ILE C 1 69  ? 48.170 98.643  48.132  1.00 27.14 ? 69  ILE C C   1 
ATOM   8036  O  O   . ILE C 1 69  ? 48.702 98.444  49.220  1.00 27.45 ? 69  ILE C O   1 
ATOM   8037  C  CB  . ILE C 1 69  ? 46.587 97.161  46.858  1.00 26.68 ? 69  ILE C CB  1 
ATOM   8038  C  CG1 . ILE C 1 69  ? 45.879 96.837  48.165  1.00 24.52 ? 69  ILE C CG1 1 
ATOM   8039  C  CG2 . ILE C 1 69  ? 46.490 95.980  45.903  1.00 26.37 ? 69  ILE C CG2 1 
ATOM   8040  C  CD1 . ILE C 1 69  ? 44.412 96.627  48.014  1.00 23.43 ? 69  ILE C CD1 1 
ATOM   8041  N  N   . PRO C 1 70  ? 47.687 99.848  47.782  1.00 26.65 ? 70  PRO C N   1 
ATOM   8042  C  CA  . PRO C 1 70  ? 47.767 100.932 48.769  1.00 26.41 ? 70  PRO C CA  1 
ATOM   8043  C  C   . PRO C 1 70  ? 46.742 100.682 49.869  1.00 26.41 ? 70  PRO C C   1 
ATOM   8044  O  O   . PRO C 1 70  ? 45.672 100.161 49.580  1.00 27.07 ? 70  PRO C O   1 
ATOM   8045  C  CB  . PRO C 1 70  ? 47.425 102.183 47.954  1.00 24.66 ? 70  PRO C CB  1 
ATOM   8046  C  CG  . PRO C 1 70  ? 47.885 101.840 46.587  1.00 25.63 ? 70  PRO C CG  1 
ATOM   8047  C  CD  . PRO C 1 70  ? 47.435 100.388 46.434  1.00 25.90 ? 70  PRO C CD  1 
ATOM   8048  N  N   . GLU C 1 71  ? 47.067 101.020 51.118  1.00 26.16 ? 71  GLU C N   1 
ATOM   8049  C  CA  . GLU C 1 71  ? 46.105 100.849 52.202  1.00 26.49 ? 71  GLU C CA  1 
ATOM   8050  C  C   . GLU C 1 71  ? 45.184 102.050 52.139  1.00 27.03 ? 71  GLU C C   1 
ATOM   8051  O  O   . GLU C 1 71  ? 45.511 103.043 51.505  1.00 27.06 ? 71  GLU C O   1 
ATOM   8052  C  CB  . GLU C 1 71  ? 46.787 100.813 53.573  1.00 26.47 ? 71  GLU C CB  1 
ATOM   8053  C  CG  . GLU C 1 71  ? 47.577 102.056 53.923  1.00 25.54 ? 71  GLU C CG  1 
ATOM   8054  C  CD  . GLU C 1 71  ? 48.058 102.064 55.365  1.00 25.88 ? 71  GLU C CD  1 
ATOM   8055  O  OE1 . GLU C 1 71  ? 48.448 101.007 55.885  1.00 26.41 ? 71  GLU C OE1 1 
ATOM   8056  O  OE2 . GLU C 1 71  ? 48.063 103.142 55.984  1.00 28.21 ? 71  GLU C OE2 1 
ATOM   8057  N  N   . ARG C 1 72  ? 44.029 101.958 52.782  1.00 28.42 ? 72  ARG C N   1 
ATOM   8058  C  CA  . ARG C 1 72  ? 43.088 103.067 52.781  1.00 29.66 ? 72  ARG C CA  1 
ATOM   8059  C  C   . ARG C 1 72  ? 43.815 104.280 53.355  1.00 29.64 ? 72  ARG C C   1 
ATOM   8060  O  O   . ARG C 1 72  ? 44.676 104.131 54.223  1.00 30.30 ? 72  ARG C O   1 
ATOM   8061  C  CB  . ARG C 1 72  ? 41.867 102.714 53.636  1.00 31.11 ? 72  ARG C CB  1 
ATOM   8062  C  CG  . ARG C 1 72  ? 41.068 101.509 53.136  1.00 32.48 ? 72  ARG C CG  1 
ATOM   8063  C  CD  . ARG C 1 72  ? 40.199 100.931 54.263  1.00 34.52 ? 72  ARG C CD  1 
ATOM   8064  N  NE  . ARG C 1 72  ? 39.287 99.887  53.797  1.00 35.98 ? 72  ARG C NE  1 
ATOM   8065  C  CZ  . ARG C 1 72  ? 39.672 98.694  53.352  1.00 36.38 ? 72  ARG C CZ  1 
ATOM   8066  N  NH1 . ARG C 1 72  ? 40.960 98.384  53.314  1.00 36.36 ? 72  ARG C NH1 1 
ATOM   8067  N  NH2 . ARG C 1 72  ? 38.770 97.812  52.938  1.00 36.63 ? 72  ARG C NH2 1 
ATOM   8068  N  N   . VAL C 1 73  ? 43.489 105.476 52.870  1.00 29.35 ? 73  VAL C N   1 
ATOM   8069  C  CA  . VAL C 1 73  ? 44.147 106.684 53.362  1.00 29.39 ? 73  VAL C CA  1 
ATOM   8070  C  C   . VAL C 1 73  ? 43.824 106.956 54.832  1.00 29.79 ? 73  VAL C C   1 
ATOM   8071  O  O   . VAL C 1 73  ? 44.579 107.634 55.523  1.00 30.12 ? 73  VAL C O   1 
ATOM   8072  C  CB  . VAL C 1 73  ? 43.796 107.909 52.493  1.00 28.55 ? 73  VAL C CB  1 
ATOM   8073  C  CG1 . VAL C 1 73  ? 42.332 108.250 52.621  1.00 29.64 ? 73  VAL C CG1 1 
ATOM   8074  C  CG2 . VAL C 1 73  ? 44.673 109.076 52.881  1.00 28.47 ? 73  VAL C CG2 1 
ATOM   8075  N  N   . VAL C 1 74  ? 42.692 106.429 55.293  1.00 30.70 ? 74  VAL C N   1 
ATOM   8076  C  CA  . VAL C 1 74  ? 42.263 106.521 56.696  1.00 31.03 ? 74  VAL C CA  1 
ATOM   8077  C  C   . VAL C 1 74  ? 41.513 105.221 56.956  1.00 31.31 ? 74  VAL C C   1 
ATOM   8078  O  O   . VAL C 1 74  ? 41.151 104.531 56.004  1.00 31.08 ? 74  VAL C O   1 
ATOM   8079  C  CB  . VAL C 1 74  ? 41.320 107.724 56.994  1.00 30.64 ? 74  VAL C CB  1 
ATOM   8080  C  CG1 . VAL C 1 74  ? 42.097 109.009 56.988  1.00 30.96 ? 74  VAL C CG1 1 
ATOM   8081  C  CG2 . VAL C 1 74  ? 40.213 107.785 55.985  1.00 31.55 ? 74  VAL C CG2 1 
ATOM   8082  N  N   . HIS C 1 75  ? 41.301 104.876 58.229  1.00 32.06 ? 75  HIS C N   1 
ATOM   8083  C  CA  . HIS C 1 75  ? 40.603 103.639 58.587  1.00 31.89 ? 75  HIS C CA  1 
ATOM   8084  C  C   . HIS C 1 75  ? 41.349 102.422 58.025  1.00 31.56 ? 75  HIS C C   1 
ATOM   8085  O  O   . HIS C 1 75  ? 40.766 101.386 57.717  1.00 33.10 ? 75  HIS C O   1 
ATOM   8086  C  CB  . HIS C 1 75  ? 39.166 103.689 58.051  1.00 32.93 ? 75  HIS C CB  1 
ATOM   8087  C  CG  . HIS C 1 75  ? 38.302 104.699 58.740  1.00 33.77 ? 75  HIS C CG  1 
ATOM   8088  N  ND1 . HIS C 1 75  ? 37.424 104.362 59.747  1.00 33.76 ? 75  HIS C ND1 1 
ATOM   8089  C  CD2 . HIS C 1 75  ? 38.210 106.043 58.593  1.00 34.07 ? 75  HIS C CD2 1 
ATOM   8090  C  CE1 . HIS C 1 75  ? 36.830 105.456 60.194  1.00 34.06 ? 75  HIS C CE1 1 
ATOM   8091  N  NE2 . HIS C 1 75  ? 37.289 106.490 59.510  1.00 33.86 ? 75  HIS C NE2 1 
ATOM   8092  N  N   . ALA C 1 76  ? 42.658 102.558 57.905  1.00 31.37 ? 76  ALA C N   1 
ATOM   8093  C  CA  . ALA C 1 76  ? 43.500 101.505 57.368  1.00 30.90 ? 76  ALA C CA  1 
ATOM   8094  C  C   . ALA C 1 76  ? 43.405 100.158 58.081  1.00 30.91 ? 76  ALA C C   1 
ATOM   8095  O  O   . ALA C 1 76  ? 43.229 99.138  57.433  1.00 30.94 ? 76  ALA C O   1 
ATOM   8096  C  CB  . ALA C 1 76  ? 44.943 101.980 57.356  1.00 30.79 ? 76  ALA C CB  1 
ATOM   8097  N  N   . LYS C 1 77  ? 43.532 100.156 59.406  1.00 31.16 ? 77  LYS C N   1 
ATOM   8098  C  CA  . LYS C 1 77  ? 43.490 98.928  60.195  1.00 30.99 ? 77  LYS C CA  1 
ATOM   8099  C  C   . LYS C 1 77  ? 42.055 98.428  60.371  1.00 32.19 ? 77  LYS C C   1 
ATOM   8100  O  O   . LYS C 1 77  ? 41.228 99.116  60.966  1.00 33.10 ? 77  LYS C O   1 
ATOM   8101  C  CB  . LYS C 1 77  ? 44.126 99.190  61.558  1.00 31.16 ? 77  LYS C CB  1 
ATOM   8102  C  CG  . LYS C 1 77  ? 44.305 97.958  62.427  1.00 30.94 ? 77  LYS C CG  1 
ATOM   8103  C  CD  . LYS C 1 77  ? 45.375 97.035  61.875  1.00 29.91 ? 77  LYS C CD  1 
ATOM   8104  C  CE  . LYS C 1 77  ? 45.404 95.730  62.645  1.00 30.51 ? 77  LYS C CE  1 
ATOM   8105  N  NZ  . LYS C 1 77  ? 45.649 95.911  64.104  1.00 30.66 ? 77  LYS C NZ  1 
ATOM   8106  N  N   . GLY C 1 78  ? 41.757 97.222  59.886  1.00 32.69 ? 78  GLY C N   1 
ATOM   8107  C  CA  . GLY C 1 78  ? 40.391 96.730  59.998  1.00 32.51 ? 78  GLY C CA  1 
ATOM   8108  C  C   . GLY C 1 78  ? 40.086 95.265  60.270  1.00 32.20 ? 78  GLY C C   1 
ATOM   8109  O  O   . GLY C 1 78  ? 40.967 94.400  60.299  1.00 32.39 ? 78  GLY C O   1 
ATOM   8110  N  N   . ALA C 1 79  ? 38.795 95.007  60.467  1.00 31.71 ? 79  ALA C N   1 
ATOM   8111  C  CA  . ALA C 1 79  ? 38.272 93.676  60.747  1.00 31.23 ? 79  ALA C CA  1 
ATOM   8112  C  C   . ALA C 1 79  ? 36.960 93.515  59.994  1.00 31.22 ? 79  ALA C C   1 
ATOM   8113  O  O   . ALA C 1 79  ? 36.118 94.416  60.004  1.00 30.01 ? 79  ALA C O   1 
ATOM   8114  C  CB  . ALA C 1 79  ? 38.038 93.514  62.235  1.00 30.61 ? 79  ALA C CB  1 
ATOM   8115  N  N   . GLY C 1 80  ? 36.787 92.365  59.346  1.00 31.93 ? 80  GLY C N   1 
ATOM   8116  C  CA  . GLY C 1 80  ? 35.574 92.123  58.584  1.00 32.51 ? 80  GLY C CA  1 
ATOM   8117  C  C   . GLY C 1 80  ? 34.723 90.930  58.996  1.00 33.27 ? 80  GLY C C   1 
ATOM   8118  O  O   . GLY C 1 80  ? 35.191 89.978  59.638  1.00 33.32 ? 80  GLY C O   1 
ATOM   8119  N  N   . ALA C 1 81  ? 33.451 90.994  58.614  1.00 33.40 ? 81  ALA C N   1 
ATOM   8120  C  CA  . ALA C 1 81  ? 32.491 89.944  58.912  1.00 34.50 ? 81  ALA C CA  1 
ATOM   8121  C  C   . ALA C 1 81  ? 31.277 90.144  58.011  1.00 34.83 ? 81  ALA C C   1 
ATOM   8122  O  O   . ALA C 1 81  ? 31.072 91.229  57.465  1.00 34.15 ? 81  ALA C O   1 
ATOM   8123  C  CB  . ALA C 1 81  ? 32.083 89.998  60.391  1.00 34.94 ? 81  ALA C CB  1 
ATOM   8124  N  N   . PHE C 1 82  ? 30.482 89.090  57.851  1.00 35.41 ? 82  PHE C N   1 
ATOM   8125  C  CA  . PHE C 1 82  ? 29.301 89.146  56.999  1.00 35.70 ? 82  PHE C CA  1 
ATOM   8126  C  C   . PHE C 1 82  ? 28.075 88.547  57.661  1.00 35.79 ? 82  PHE C C   1 
ATOM   8127  O  O   . PHE C 1 82  ? 28.177 87.763  58.610  1.00 36.34 ? 82  PHE C O   1 
ATOM   8128  C  CB  . PHE C 1 82  ? 29.573 88.421  55.687  1.00 35.43 ? 82  PHE C CB  1 
ATOM   8129  C  CG  . PHE C 1 82  ? 30.872 88.795  55.071  1.00 36.44 ? 82  PHE C CG  1 
ATOM   8130  C  CD1 . PHE C 1 82  ? 32.063 88.289  55.582  1.00 36.80 ? 82  PHE C CD1 1 
ATOM   8131  C  CD2 . PHE C 1 82  ? 30.917 89.677  54.005  1.00 36.84 ? 82  PHE C CD2 1 
ATOM   8132  C  CE1 . PHE C 1 82  ? 33.281 88.654  55.042  1.00 37.48 ? 82  PHE C CE1 1 
ATOM   8133  C  CE2 . PHE C 1 82  ? 32.126 90.050  53.453  1.00 37.43 ? 82  PHE C CE2 1 
ATOM   8134  C  CZ  . PHE C 1 82  ? 33.316 89.536  53.973  1.00 38.30 ? 82  PHE C CZ  1 
ATOM   8135  N  N   . GLY C 1 83  ? 26.912 88.921  57.148  1.00 35.40 ? 83  GLY C N   1 
ATOM   8136  C  CA  . GLY C 1 83  ? 25.680 88.421  57.711  1.00 35.53 ? 83  GLY C CA  1 
ATOM   8137  C  C   . GLY C 1 83  ? 24.473 88.957  56.984  1.00 35.94 ? 83  GLY C C   1 
ATOM   8138  O  O   . GLY C 1 83  ? 24.445 89.011  55.754  1.00 36.10 ? 83  GLY C O   1 
ATOM   8139  N  N   . TYR C 1 84  ? 23.470 89.368  57.743  1.00 36.30 ? 84  TYR C N   1 
ATOM   8140  C  CA  . TYR C 1 84  ? 22.273 89.873  57.123  1.00 36.66 ? 84  TYR C CA  1 
ATOM   8141  C  C   . TYR C 1 84  ? 21.598 90.970  57.912  1.00 36.56 ? 84  TYR C C   1 
ATOM   8142  O  O   . TYR C 1 84  ? 21.878 91.186  59.096  1.00 35.98 ? 84  TYR C O   1 
ATOM   8143  C  CB  . TYR C 1 84  ? 21.288 88.722  56.932  1.00 37.89 ? 84  TYR C CB  1 
ATOM   8144  C  CG  . TYR C 1 84  ? 20.778 88.136  58.236  1.00 39.63 ? 84  TYR C CG  1 
ATOM   8145  C  CD1 . TYR C 1 84  ? 19.560 88.542  58.785  1.00 40.45 ? 84  TYR C CD1 1 
ATOM   8146  C  CD2 . TYR C 1 84  ? 21.514 87.174  58.923  1.00 40.72 ? 84  TYR C CD2 1 
ATOM   8147  C  CE1 . TYR C 1 84  ? 19.093 88.001  59.984  1.00 40.67 ? 84  TYR C CE1 1 
ATOM   8148  C  CE2 . TYR C 1 84  ? 21.057 86.628  60.117  1.00 40.49 ? 84  TYR C CE2 1 
ATOM   8149  C  CZ  . TYR C 1 84  ? 19.849 87.041  60.644  1.00 41.07 ? 84  TYR C CZ  1 
ATOM   8150  O  OH  . TYR C 1 84  ? 19.402 86.488  61.832  1.00 41.21 ? 84  TYR C OH  1 
ATOM   8151  N  N   . PHE C 1 85  ? 20.706 91.663  57.215  1.00 36.61 ? 85  PHE C N   1 
ATOM   8152  C  CA  . PHE C 1 85  ? 19.886 92.701  57.795  1.00 36.58 ? 85  PHE C CA  1 
ATOM   8153  C  C   . PHE C 1 85  ? 18.457 92.178  57.653  1.00 37.48 ? 85  PHE C C   1 
ATOM   8154  O  O   . PHE C 1 85  ? 18.062 91.721  56.570  1.00 37.24 ? 85  PHE C O   1 
ATOM   8155  C  CB  . PHE C 1 85  ? 20.006 94.003  57.016  1.00 35.52 ? 85  PHE C CB  1 
ATOM   8156  C  CG  . PHE C 1 85  ? 18.884 94.963  57.289  1.00 35.12 ? 85  PHE C CG  1 
ATOM   8157  C  CD1 . PHE C 1 85  ? 18.777 95.597  58.525  1.00 33.94 ? 85  PHE C CD1 1 
ATOM   8158  C  CD2 . PHE C 1 85  ? 17.900 95.195  56.325  1.00 34.63 ? 85  PHE C CD2 1 
ATOM   8159  C  CE1 . PHE C 1 85  ? 17.707 96.449  58.801  1.00 34.04 ? 85  PHE C CE1 1 
ATOM   8160  C  CE2 . PHE C 1 85  ? 16.822 96.046  56.593  1.00 34.10 ? 85  PHE C CE2 1 
ATOM   8161  C  CZ  . PHE C 1 85  ? 16.728 96.676  57.839  1.00 33.53 ? 85  PHE C CZ  1 
ATOM   8162  N  N   . GLU C 1 86  ? 17.690 92.236  58.737  1.00 38.31 ? 86  GLU C N   1 
ATOM   8163  C  CA  . GLU C 1 86  ? 16.304 91.785  58.708  1.00 39.21 ? 86  GLU C CA  1 
ATOM   8164  C  C   . GLU C 1 86  ? 15.351 92.875  59.173  1.00 39.55 ? 86  GLU C C   1 
ATOM   8165  O  O   . GLU C 1 86  ? 15.573 93.501  60.215  1.00 39.20 ? 86  GLU C O   1 
ATOM   8166  C  CB  . GLU C 1 86  ? 16.124 90.562  59.591  1.00 40.42 ? 86  GLU C CB  1 
ATOM   8167  C  CG  . GLU C 1 86  ? 14.696 90.065  59.643  1.00 43.08 ? 86  GLU C CG  1 
ATOM   8168  C  CD  . GLU C 1 86  ? 14.587 88.720  60.328  1.00 44.43 ? 86  GLU C CD  1 
ATOM   8169  O  OE1 . GLU C 1 86  ? 13.464 88.178  60.418  1.00 45.80 ? 86  GLU C OE1 1 
ATOM   8170  O  OE2 . GLU C 1 86  ? 15.634 88.202  60.773  1.00 45.82 ? 86  GLU C OE2 1 
ATOM   8171  N  N   . VAL C 1 87  ? 14.295 93.103  58.397  1.00 39.90 ? 87  VAL C N   1 
ATOM   8172  C  CA  . VAL C 1 87  ? 13.303 94.116  58.746  1.00 40.89 ? 87  VAL C CA  1 
ATOM   8173  C  C   . VAL C 1 87  ? 12.400 93.596  59.864  1.00 41.77 ? 87  VAL C C   1 
ATOM   8174  O  O   . VAL C 1 87  ? 11.892 92.480  59.790  1.00 41.49 ? 87  VAL C O   1 
ATOM   8175  C  CB  . VAL C 1 87  ? 12.407 94.488  57.544  1.00 40.74 ? 87  VAL C CB  1 
ATOM   8176  C  CG1 . VAL C 1 87  ? 11.383 95.538  57.977  1.00 40.46 ? 87  VAL C CG1 1 
ATOM   8177  C  CG2 . VAL C 1 87  ? 13.250 95.001  56.399  1.00 39.47 ? 87  VAL C CG2 1 
ATOM   8178  N  N   . THR C 1 88  ? 12.200 94.410  60.896  1.00 42.64 ? 88  THR C N   1 
ATOM   8179  C  CA  . THR C 1 88  ? 11.367 94.008  62.016  1.00 43.21 ? 88  THR C CA  1 
ATOM   8180  C  C   . THR C 1 88  ? 10.140 94.893  62.183  1.00 44.53 ? 88  THR C C   1 
ATOM   8181  O  O   . THR C 1 88  ? 9.140  94.461  62.758  1.00 45.13 ? 88  THR C O   1 
ATOM   8182  C  CB  . THR C 1 88  ? 12.169 93.997  63.328  1.00 42.93 ? 88  THR C CB  1 
ATOM   8183  O  OG1 . THR C 1 88  ? 12.703 95.302  63.599  1.00 42.17 ? 88  THR C OG1 1 
ATOM   8184  C  CG2 . THR C 1 88  ? 13.300 93.002  63.222  1.00 42.50 ? 88  THR C CG2 1 
ATOM   8185  N  N   . HIS C 1 89  ? 10.210 96.128  61.693  1.00 45.14 ? 89  HIS C N   1 
ATOM   8186  C  CA  . HIS C 1 89  ? 9.069  97.035  61.783  1.00 45.90 ? 89  HIS C CA  1 
ATOM   8187  C  C   . HIS C 1 89  ? 8.831  97.685  60.438  1.00 46.26 ? 89  HIS C C   1 
ATOM   8188  O  O   . HIS C 1 89  ? 9.728  97.733  59.598  1.00 47.02 ? 89  HIS C O   1 
ATOM   8189  C  CB  . HIS C 1 89  ? 9.308  98.086  62.853  1.00 45.79 ? 89  HIS C CB  1 
ATOM   8190  C  CG  . HIS C 1 89  ? 9.540  97.501  64.208  1.00 46.81 ? 89  HIS C CG  1 
ATOM   8191  N  ND1 . HIS C 1 89  ? 10.487 96.527  64.440  1.00 47.17 ? 89  HIS C ND1 1 
ATOM   8192  C  CD2 . HIS C 1 89  ? 8.959  97.754  65.404  1.00 47.15 ? 89  HIS C CD2 1 
ATOM   8193  C  CE1 . HIS C 1 89  ? 10.481 96.207  65.723  1.00 47.56 ? 89  HIS C CE1 1 
ATOM   8194  N  NE2 . HIS C 1 89  ? 9.564  96.938  66.330  1.00 47.37 ? 89  HIS C NE2 1 
ATOM   8195  N  N   . ASP C 1 90  ? 7.618  98.177  60.228  1.00 46.59 ? 90  ASP C N   1 
ATOM   8196  C  CA  . ASP C 1 90  ? 7.264  98.791  58.958  1.00 46.57 ? 90  ASP C CA  1 
ATOM   8197  C  C   . ASP C 1 90  ? 7.507  100.293 58.933  1.00 46.61 ? 90  ASP C C   1 
ATOM   8198  O  O   . ASP C 1 90  ? 6.869  101.041 59.681  1.00 46.88 ? 90  ASP C O   1 
ATOM   8199  C  CB  . ASP C 1 90  ? 5.796  98.517  58.648  1.00 47.15 ? 90  ASP C CB  1 
ATOM   8200  C  CG  . ASP C 1 90  ? 5.364  99.092  57.311  1.00 48.64 ? 90  ASP C CG  1 
ATOM   8201  O  OD1 . ASP C 1 90  ? 6.126  99.902  56.727  1.00 48.69 ? 90  ASP C OD1 1 
ATOM   8202  O  OD2 . ASP C 1 90  ? 4.255  98.739  56.849  1.00 49.33 ? 90  ASP C OD2 1 
ATOM   8203  N  N   . ILE C 1 91  ? 8.424  100.732 58.070  1.00 45.86 ? 91  ILE C N   1 
ATOM   8204  C  CA  . ILE C 1 91  ? 8.722  102.158 57.935  1.00 44.88 ? 91  ILE C CA  1 
ATOM   8205  C  C   . ILE C 1 91  ? 8.504  102.624 56.489  1.00 45.32 ? 91  ILE C C   1 
ATOM   8206  O  O   . ILE C 1 91  ? 9.051  103.650 56.051  1.00 45.07 ? 91  ILE C O   1 
ATOM   8207  C  CB  . ILE C 1 91  ? 10.171 102.488 58.372  1.00 43.22 ? 91  ILE C CB  1 
ATOM   8208  C  CG1 . ILE C 1 91  ? 11.177 101.656 57.576  1.00 42.31 ? 91  ILE C CG1 1 
ATOM   8209  C  CG2 . ILE C 1 91  ? 10.322 102.244 59.860  1.00 42.54 ? 91  ILE C CG2 1 
ATOM   8210  C  CD1 . ILE C 1 91  ? 12.626 102.126 57.727  1.00 39.89 ? 91  ILE C CD1 1 
ATOM   8211  N  N   . THR C 1 92  ? 7.680  101.868 55.764  1.00 45.15 ? 92  THR C N   1 
ATOM   8212  C  CA  . THR C 1 92  ? 7.377  102.160 54.367  1.00 45.32 ? 92  THR C CA  1 
ATOM   8213  C  C   . THR C 1 92  ? 6.742  103.534 54.135  1.00 44.92 ? 92  THR C C   1 
ATOM   8214  O  O   . THR C 1 92  ? 6.773  104.057 53.012  1.00 44.22 ? 92  THR C O   1 
ATOM   8215  C  CB  . THR C 1 92  ? 6.453  101.063 53.756  1.00 45.94 ? 92  THR C CB  1 
ATOM   8216  O  OG1 . THR C 1 92  ? 5.348  100.815 54.634  1.00 46.87 ? 92  THR C OG1 1 
ATOM   8217  C  CG2 . THR C 1 92  ? 7.224  99.764  53.537  1.00 45.32 ? 92  THR C CG2 1 
ATOM   8218  N  N   . LYS C 1 93  ? 6.169  104.121 55.185  1.00 44.47 ? 93  LYS C N   1 
ATOM   8219  C  CA  . LYS C 1 93  ? 5.545  105.437 55.043  1.00 44.30 ? 93  LYS C CA  1 
ATOM   8220  C  C   . LYS C 1 93  ? 6.615  106.500 54.897  1.00 43.69 ? 93  LYS C C   1 
ATOM   8221  O  O   . LYS C 1 93  ? 6.340  107.618 54.452  1.00 43.83 ? 93  LYS C O   1 
ATOM   8222  C  CB  . LYS C 1 93  ? 4.642  105.766 56.239  1.00 44.47 ? 93  LYS C CB  1 
ATOM   8223  C  CG  . LYS C 1 93  ? 5.313  105.853 57.609  1.00 45.23 ? 93  LYS C CG  1 
ATOM   8224  C  CD  . LYS C 1 93  ? 4.287  106.327 58.657  1.00 46.02 ? 93  LYS C CD  1 
ATOM   8225  C  CE  . LYS C 1 93  ? 4.817  106.274 60.093  1.00 46.94 ? 93  LYS C CE  1 
ATOM   8226  N  NZ  . LYS C 1 93  ? 5.079  104.880 60.581  1.00 46.79 ? 93  LYS C NZ  1 
ATOM   8227  N  N   . TYR C 1 94  ? 7.842  106.134 55.260  1.00 43.25 ? 94  TYR C N   1 
ATOM   8228  C  CA  . TYR C 1 94  ? 8.982  107.046 55.174  1.00 42.13 ? 94  TYR C CA  1 
ATOM   8229  C  C   . TYR C 1 94  ? 9.904  106.740 53.976  1.00 41.19 ? 94  TYR C C   1 
ATOM   8230  O  O   . TYR C 1 94  ? 10.441 107.651 53.344  1.00 40.93 ? 94  TYR C O   1 
ATOM   8231  C  CB  . TYR C 1 94  ? 9.805  106.972 56.454  1.00 41.56 ? 94  TYR C CB  1 
ATOM   8232  C  CG  . TYR C 1 94  ? 9.085  107.350 57.726  1.00 41.39 ? 94  TYR C CG  1 
ATOM   8233  C  CD1 . TYR C 1 94  ? 8.625  108.641 57.934  1.00 42.28 ? 94  TYR C CD1 1 
ATOM   8234  C  CD2 . TYR C 1 94  ? 8.964  106.437 58.771  1.00 41.79 ? 94  TYR C CD2 1 
ATOM   8235  C  CE1 . TYR C 1 94  ? 8.075  109.018 59.160  1.00 42.19 ? 94  TYR C CE1 1 
ATOM   8236  C  CE2 . TYR C 1 94  ? 8.421  106.800 59.989  1.00 41.44 ? 94  TYR C CE2 1 
ATOM   8237  C  CZ  . TYR C 1 94  ? 7.984  108.088 60.177  1.00 42.22 ? 94  TYR C CZ  1 
ATOM   8238  O  OH  . TYR C 1 94  ? 7.480  108.451 61.399  1.00 44.59 ? 94  TYR C OH  1 
ATOM   8239  N  N   . SER C 1 95  ? 10.091 105.463 53.660  1.00 39.81 ? 95  SER C N   1 
ATOM   8240  C  CA  . SER C 1 95  ? 10.967 105.114 52.556  1.00 38.94 ? 95  SER C CA  1 
ATOM   8241  C  C   . SER C 1 95  ? 10.460 103.966 51.695  1.00 38.45 ? 95  SER C C   1 
ATOM   8242  O  O   . SER C 1 95  ? 10.020 102.943 52.206  1.00 38.51 ? 95  SER C O   1 
ATOM   8243  C  CB  . SER C 1 95  ? 12.358 104.781 53.104  1.00 39.22 ? 95  SER C CB  1 
ATOM   8244  O  OG  . SER C 1 95  ? 13.196 104.215 52.112  1.00 39.71 ? 95  SER C OG  1 
ATOM   8245  N  N   . LYS C 1 96  ? 10.534 104.142 50.381  1.00 37.87 ? 96  LYS C N   1 
ATOM   8246  C  CA  . LYS C 1 96  ? 10.100 103.117 49.442  1.00 37.78 ? 96  LYS C CA  1 
ATOM   8247  C  C   . LYS C 1 96  ? 11.222 102.135 49.131  1.00 38.46 ? 96  LYS C C   1 
ATOM   8248  O  O   . LYS C 1 96  ? 11.068 101.252 48.289  1.00 39.12 ? 96  LYS C O   1 
ATOM   8249  C  CB  . LYS C 1 96  ? 9.633  103.766 48.142  1.00 37.19 ? 96  LYS C CB  1 
ATOM   8250  C  CG  . LYS C 1 96  ? 10.684 104.620 47.459  1.00 37.03 ? 96  LYS C CG  1 
ATOM   8251  C  CD  . LYS C 1 96  ? 10.159 105.144 46.141  1.00 37.37 ? 96  LYS C CD  1 
ATOM   8252  C  CE  . LYS C 1 96  ? 11.272 105.665 45.258  1.00 37.40 ? 96  LYS C CE  1 
ATOM   8253  N  NZ  . LYS C 1 96  ? 10.743 106.010 43.913  1.00 38.19 ? 96  LYS C NZ  1 
ATOM   8254  N  N   . ALA C 1 97  ? 12.351 102.289 49.811  1.00 39.23 ? 97  ALA C N   1 
ATOM   8255  C  CA  . ALA C 1 97  ? 13.505 101.427 49.583  1.00 40.16 ? 97  ALA C CA  1 
ATOM   8256  C  C   . ALA C 1 97  ? 13.190 99.952  49.768  1.00 40.95 ? 97  ALA C C   1 
ATOM   8257  O  O   . ALA C 1 97  ? 12.740 99.532  50.840  1.00 40.73 ? 97  ALA C O   1 
ATOM   8258  C  CB  . ALA C 1 97  ? 14.638 101.830 50.509  1.00 40.09 ? 97  ALA C CB  1 
ATOM   8259  N  N   . LYS C 1 98  ? 13.440 99.166  48.724  1.00 41.52 ? 98  LYS C N   1 
ATOM   8260  C  CA  . LYS C 1 98  ? 13.187 97.733  48.779  1.00 42.11 ? 98  LYS C CA  1 
ATOM   8261  C  C   . LYS C 1 98  ? 13.805 97.069  50.009  1.00 42.06 ? 98  LYS C C   1 
ATOM   8262  O  O   . LYS C 1 98  ? 13.187 96.191  50.609  1.00 41.70 ? 98  LYS C O   1 
ATOM   8263  C  CB  . LYS C 1 98  ? 13.697 97.050  47.510  1.00 43.08 ? 98  LYS C CB  1 
ATOM   8264  C  CG  . LYS C 1 98  ? 13.006 97.527  46.245  1.00 45.24 ? 98  LYS C CG  1 
ATOM   8265  C  CD  . LYS C 1 98  ? 13.279 96.583  45.083  1.00 48.06 ? 98  LYS C CD  1 
ATOM   8266  C  CE  . LYS C 1 98  ? 12.724 97.141  43.766  1.00 49.93 ? 98  LYS C CE  1 
ATOM   8267  N  NZ  . LYS C 1 98  ? 13.096 96.308  42.568  1.00 50.72 ? 98  LYS C NZ  1 
ATOM   8268  N  N   . VAL C 1 99  ? 15.013 97.480  50.393  1.00 41.81 ? 99  VAL C N   1 
ATOM   8269  C  CA  . VAL C 1 99  ? 15.657 96.890  51.566  1.00 41.56 ? 99  VAL C CA  1 
ATOM   8270  C  C   . VAL C 1 99  ? 14.705 96.903  52.771  1.00 42.33 ? 99  VAL C C   1 
ATOM   8271  O  O   . VAL C 1 99  ? 14.878 96.129  53.717  1.00 42.24 ? 99  VAL C O   1 
ATOM   8272  C  CB  . VAL C 1 99  ? 16.954 97.648  51.949  1.00 41.11 ? 99  VAL C CB  1 
ATOM   8273  C  CG1 . VAL C 1 99  ? 16.625 99.083  52.366  1.00 40.23 ? 99  VAL C CG1 1 
ATOM   8274  C  CG2 . VAL C 1 99  ? 17.679 96.908  53.067  1.00 39.51 ? 99  VAL C CG2 1 
ATOM   8275  N  N   . PHE C 1 100 ? 13.701 97.781  52.721  1.00 42.84 ? 100 PHE C N   1 
ATOM   8276  C  CA  . PHE C 1 100 ? 12.705 97.912  53.792  1.00 43.85 ? 100 PHE C CA  1 
ATOM   8277  C  C   . PHE C 1 100 ? 11.334 97.377  53.350  1.00 44.33 ? 100 PHE C C   1 
ATOM   8278  O  O   . PHE C 1 100 ? 10.433 97.200  54.160  1.00 43.59 ? 100 PHE C O   1 
ATOM   8279  C  CB  . PHE C 1 100 ? 12.557 99.387  54.210  1.00 43.65 ? 100 PHE C CB  1 
ATOM   8280  C  CG  . PHE C 1 100 ? 13.845 100.035 54.674  1.00 43.61 ? 100 PHE C CG  1 
ATOM   8281  C  CD1 . PHE C 1 100 ? 14.645 99.428  55.639  1.00 43.41 ? 100 PHE C CD1 1 
ATOM   8282  C  CD2 . PHE C 1 100 ? 14.251 101.262 54.149  1.00 43.21 ? 100 PHE C CD2 1 
ATOM   8283  C  CE1 . PHE C 1 100 ? 15.826 100.033 56.068  1.00 43.01 ? 100 PHE C CE1 1 
ATOM   8284  C  CE2 . PHE C 1 100 ? 15.431 101.871 54.573  1.00 42.17 ? 100 PHE C CE2 1 
ATOM   8285  C  CZ  . PHE C 1 100 ? 16.216 101.257 55.530  1.00 42.55 ? 100 PHE C CZ  1 
ATOM   8286  N  N   . GLU C 1 101 ? 11.207 97.143  52.049  1.00 46.14 ? 101 GLU C N   1 
ATOM   8287  C  CA  . GLU C 1 101 ? 10.003 96.635  51.394  1.00 47.17 ? 101 GLU C CA  1 
ATOM   8288  C  C   . GLU C 1 101 ? 8.930  96.023  52.287  1.00 47.73 ? 101 GLU C C   1 
ATOM   8289  O  O   . GLU C 1 101 ? 7.744  96.336  52.116  1.00 47.94 ? 101 GLU C O   1 
ATOM   8290  C  CB  . GLU C 1 101 ? 10.411 95.609  50.351  1.00 48.24 ? 101 GLU C CB  1 
ATOM   8291  C  CG  . GLU C 1 101 ? 9.573  95.604  49.105  1.00 50.31 ? 101 GLU C CG  1 
ATOM   8292  C  CD  . GLU C 1 101 ? 10.211 94.746  48.026  1.00 52.45 ? 101 GLU C CD  1 
ATOM   8293  O  OE1 . GLU C 1 101 ? 10.471 93.546  48.298  1.00 53.55 ? 101 GLU C OE1 1 
ATOM   8294  O  OE2 . GLU C 1 101 ? 10.461 95.270  46.911  1.00 54.20 ? 101 GLU C OE2 1 
ATOM   8295  N  N   . HIS C 1 102 ? 9.331  95.143  53.212  1.00 47.58 ? 102 HIS C N   1 
ATOM   8296  C  CA  . HIS C 1 102 ? 8.379  94.496  54.124  1.00 46.81 ? 102 HIS C CA  1 
ATOM   8297  C  C   . HIS C 1 102 ? 8.986  93.779  55.334  1.00 45.96 ? 102 HIS C C   1 
ATOM   8298  O  O   . HIS C 1 102 ? 10.140 93.350  55.322  1.00 46.09 ? 102 HIS C O   1 
ATOM   8299  C  CB  . HIS C 1 102 ? 7.511  93.508  53.356  1.00 47.64 ? 102 HIS C CB  1 
ATOM   8300  C  CG  . HIS C 1 102 ? 8.267  92.337  52.823  1.00 48.40 ? 102 HIS C CG  1 
ATOM   8301  N  ND1 . HIS C 1 102 ? 8.748  91.334  53.636  1.00 49.41 ? 102 HIS C ND1 1 
ATOM   8302  C  CD2 . HIS C 1 102 ? 8.633  92.010  51.559  1.00 49.35 ? 102 HIS C CD2 1 
ATOM   8303  C  CE1 . HIS C 1 102 ? 9.379  90.437  52.895  1.00 50.20 ? 102 HIS C CE1 1 
ATOM   8304  N  NE2 . HIS C 1 102 ? 9.323  90.823  51.631  1.00 50.34 ? 102 HIS C NE2 1 
ATOM   8305  N  N   . ILE C 1 103 ? 8.174  93.642  56.376  1.00 44.76 ? 103 ILE C N   1 
ATOM   8306  C  CA  . ILE C 1 103 ? 8.605  93.003  57.606  1.00 43.24 ? 103 ILE C CA  1 
ATOM   8307  C  C   . ILE C 1 103 ? 9.039  91.571  57.362  1.00 42.68 ? 103 ILE C C   1 
ATOM   8308  O  O   . ILE C 1 103 ? 8.346  90.803  56.697  1.00 42.85 ? 103 ILE C O   1 
ATOM   8309  C  CB  . ILE C 1 103 ? 7.479  93.023  58.664  1.00 42.91 ? 103 ILE C CB  1 
ATOM   8310  C  CG1 . ILE C 1 103 ? 6.940  94.446  58.803  1.00 42.52 ? 103 ILE C CG1 1 
ATOM   8311  C  CG2 . ILE C 1 103 ? 8.003  92.528  60.004  1.00 41.26 ? 103 ILE C CG2 1 
ATOM   8312  C  CD1 . ILE C 1 103 ? 6.016  94.657  59.973  1.00 42.64 ? 103 ILE C CD1 1 
ATOM   8313  N  N   . GLY C 1 104 ? 10.205 91.229  57.898  1.00 42.25 ? 104 GLY C N   1 
ATOM   8314  C  CA  . GLY C 1 104 ? 10.733 89.888  57.748  1.00 41.47 ? 104 GLY C CA  1 
ATOM   8315  C  C   . GLY C 1 104 ? 11.733 89.759  56.618  1.00 41.26 ? 104 GLY C C   1 
ATOM   8316  O  O   . GLY C 1 104 ? 12.473 88.776  56.553  1.00 41.28 ? 104 GLY C O   1 
ATOM   8317  N  N   . LYS C 1 105 ? 11.760 90.751  55.731  1.00 40.69 ? 105 LYS C N   1 
ATOM   8318  C  CA  . LYS C 1 105 ? 12.673 90.734  54.593  1.00 40.27 ? 105 LYS C CA  1 
ATOM   8319  C  C   . LYS C 1 105 ? 14.142 90.763  55.048  1.00 40.21 ? 105 LYS C C   1 
ATOM   8320  O  O   . LYS C 1 105 ? 14.547 91.626  55.838  1.00 39.74 ? 105 LYS C O   1 
ATOM   8321  C  CB  . LYS C 1 105 ? 12.365 91.928  53.675  1.00 39.86 ? 105 LYS C CB  1 
ATOM   8322  C  CG  . LYS C 1 105 ? 13.084 91.913  52.326  1.00 39.49 ? 105 LYS C CG  1 
ATOM   8323  C  CD  . LYS C 1 105 ? 12.444 92.900  51.369  1.00 39.19 ? 105 LYS C CD  1 
ATOM   8324  C  CE  . LYS C 1 105 ? 13.319 93.187  50.148  1.00 39.88 ? 105 LYS C CE  1 
ATOM   8325  N  NZ  . LYS C 1 105 ? 13.460 92.069  49.183  1.00 39.12 ? 105 LYS C NZ  1 
ATOM   8326  N  N   . LYS C 1 106 ? 14.930 89.803  54.564  1.00 39.73 ? 106 LYS C N   1 
ATOM   8327  C  CA  . LYS C 1 106 ? 16.350 89.733  54.909  1.00 39.00 ? 106 LYS C CA  1 
ATOM   8328  C  C   . LYS C 1 106 ? 17.217 90.148  53.724  1.00 37.63 ? 106 LYS C C   1 
ATOM   8329  O  O   . LYS C 1 106 ? 16.934 89.788  52.583  1.00 37.97 ? 106 LYS C O   1 
ATOM   8330  C  CB  . LYS C 1 106 ? 16.748 88.312  55.334  1.00 39.84 ? 106 LYS C CB  1 
ATOM   8331  C  CG  . LYS C 1 106 ? 16.238 87.861  56.702  1.00 40.77 ? 106 LYS C CG  1 
ATOM   8332  C  CD  . LYS C 1 106 ? 16.747 86.460  57.031  1.00 41.27 ? 106 LYS C CD  1 
ATOM   8333  C  CE  . LYS C 1 106 ? 16.209 85.951  58.376  1.00 43.25 ? 106 LYS C CE  1 
ATOM   8334  N  NZ  . LYS C 1 106 ? 16.655 84.544  58.709  1.00 43.36 ? 106 LYS C NZ  1 
ATOM   8335  N  N   . THR C 1 107 ? 18.261 90.921  54.001  1.00 35.84 ? 107 THR C N   1 
ATOM   8336  C  CA  . THR C 1 107 ? 19.190 91.351  52.967  1.00 34.85 ? 107 THR C CA  1 
ATOM   8337  C  C   . THR C 1 107 ? 20.611 91.040  53.426  1.00 34.30 ? 107 THR C C   1 
ATOM   8338  O  O   . THR C 1 107 ? 21.034 91.467  54.509  1.00 34.87 ? 107 THR C O   1 
ATOM   8339  C  CB  . THR C 1 107 ? 19.097 92.848  52.708  1.00 35.15 ? 107 THR C CB  1 
ATOM   8340  O  OG1 . THR C 1 107 ? 17.745 93.189  52.386  1.00 36.60 ? 107 THR C OG1 1 
ATOM   8341  C  CG2 . THR C 1 107 ? 20.006 93.237  51.545  1.00 34.81 ? 107 THR C CG2 1 
ATOM   8342  N  N   . PRO C 1 108 ? 21.368 90.282  52.618  1.00 33.08 ? 108 PRO C N   1 
ATOM   8343  C  CA  . PRO C 1 108 ? 22.729 89.980  53.052  1.00 32.82 ? 108 PRO C CA  1 
ATOM   8344  C  C   . PRO C 1 108 ? 23.565 91.243  53.221  1.00 32.86 ? 108 PRO C C   1 
ATOM   8345  O  O   . PRO C 1 108 ? 23.361 92.225  52.515  1.00 32.98 ? 108 PRO C O   1 
ATOM   8346  C  CB  . PRO C 1 108 ? 23.244 89.058  51.946  1.00 32.39 ? 108 PRO C CB  1 
ATOM   8347  C  CG  . PRO C 1 108 ? 22.416 89.431  50.752  1.00 31.58 ? 108 PRO C CG  1 
ATOM   8348  C  CD  . PRO C 1 108 ? 21.063 89.618  51.339  1.00 32.38 ? 108 PRO C CD  1 
ATOM   8349  N  N   . ILE C 1 109 ? 24.492 91.223  54.174  1.00 33.45 ? 109 ILE C N   1 
ATOM   8350  C  CA  . ILE C 1 109 ? 25.355 92.373  54.409  1.00 33.17 ? 109 ILE C CA  1 
ATOM   8351  C  C   . ILE C 1 109 ? 26.828 92.010  54.634  1.00 33.27 ? 109 ILE C C   1 
ATOM   8352  O  O   . ILE C 1 109 ? 27.176 90.868  54.930  1.00 33.32 ? 109 ILE C O   1 
ATOM   8353  C  CB  . ILE C 1 109 ? 24.884 93.177  55.625  1.00 33.08 ? 109 ILE C CB  1 
ATOM   8354  C  CG1 . ILE C 1 109 ? 25.066 92.344  56.890  1.00 33.69 ? 109 ILE C CG1 1 
ATOM   8355  C  CG2 . ILE C 1 109 ? 23.437 93.574  55.453  1.00 32.95 ? 109 ILE C CG2 1 
ATOM   8356  C  CD1 . ILE C 1 109 ? 24.703 93.085  58.154  1.00 33.95 ? 109 ILE C CD1 1 
ATOM   8357  N  N   . ALA C 1 110 ? 27.679 93.016  54.478  1.00 33.36 ? 110 ALA C N   1 
ATOM   8358  C  CA  . ALA C 1 110 ? 29.118 92.905  54.678  1.00 32.66 ? 110 ALA C CA  1 
ATOM   8359  C  C   . ALA C 1 110 ? 29.472 94.059  55.620  1.00 32.49 ? 110 ALA C C   1 
ATOM   8360  O  O   . ALA C 1 110 ? 28.965 95.173  55.458  1.00 32.37 ? 110 ALA C O   1 
ATOM   8361  C  CB  . ALA C 1 110 ? 29.838 93.075  53.362  1.00 31.19 ? 110 ALA C CB  1 
ATOM   8362  N  N   . VAL C 1 111 ? 30.325 93.804  56.605  1.00 32.27 ? 111 VAL C N   1 
ATOM   8363  C  CA  . VAL C 1 111 ? 30.719 94.857  57.543  1.00 31.55 ? 111 VAL C CA  1 
ATOM   8364  C  C   . VAL C 1 111 ? 32.221 94.897  57.734  1.00 31.89 ? 111 VAL C C   1 
ATOM   8365  O  O   . VAL C 1 111 ? 32.895 93.870  57.690  1.00 32.82 ? 111 VAL C O   1 
ATOM   8366  C  CB  . VAL C 1 111 ? 30.057 94.649  58.935  1.00 30.98 ? 111 VAL C CB  1 
ATOM   8367  C  CG1 . VAL C 1 111 ? 30.521 95.724  59.931  1.00 28.90 ? 111 VAL C CG1 1 
ATOM   8368  C  CG2 . VAL C 1 111 ? 28.549 94.655  58.783  1.00 29.84 ? 111 VAL C CG2 1 
ATOM   8369  N  N   . ARG C 1 112 ? 32.748 96.096  57.923  1.00 32.38 ? 112 ARG C N   1 
ATOM   8370  C  CA  . ARG C 1 112 ? 34.168 96.270  58.186  1.00 32.40 ? 112 ARG C CA  1 
ATOM   8371  C  C   . ARG C 1 112 ? 34.314 97.294  59.310  1.00 32.60 ? 112 ARG C C   1 
ATOM   8372  O  O   . ARG C 1 112 ? 33.835 98.428  59.204  1.00 32.61 ? 112 ARG C O   1 
ATOM   8373  C  CB  . ARG C 1 112 ? 34.922 96.751  56.943  1.00 32.89 ? 112 ARG C CB  1 
ATOM   8374  C  CG  . ARG C 1 112 ? 36.416 96.992  57.207  1.00 34.31 ? 112 ARG C CG  1 
ATOM   8375  C  CD  . ARG C 1 112 ? 37.227 97.288  55.944  1.00 35.30 ? 112 ARG C CD  1 
ATOM   8376  N  NE  . ARG C 1 112 ? 38.654 97.413  56.250  1.00 36.34 ? 112 ARG C NE  1 
ATOM   8377  C  CZ  . ARG C 1 112 ? 39.221 98.492  56.779  1.00 36.51 ? 112 ARG C CZ  1 
ATOM   8378  N  NH1 . ARG C 1 112 ? 38.496 99.559  57.056  1.00 37.12 ? 112 ARG C NH1 1 
ATOM   8379  N  NH2 . ARG C 1 112 ? 40.514 98.497  57.054  1.00 36.84 ? 112 ARG C NH2 1 
ATOM   8380  N  N   . PHE C 1 113 ? 34.948 96.879  60.402  1.00 32.67 ? 113 PHE C N   1 
ATOM   8381  C  CA  . PHE C 1 113 ? 35.182 97.766  61.535  1.00 32.61 ? 113 PHE C CA  1 
ATOM   8382  C  C   . PHE C 1 113 ? 36.588 98.288  61.362  1.00 33.07 ? 113 PHE C C   1 
ATOM   8383  O  O   . PHE C 1 113 ? 37.377 97.712  60.611  1.00 33.28 ? 113 PHE C O   1 
ATOM   8384  C  CB  . PHE C 1 113 ? 35.091 96.994  62.843  1.00 32.12 ? 113 PHE C CB  1 
ATOM   8385  C  CG  . PHE C 1 113 ? 33.729 96.442  63.123  1.00 32.41 ? 113 PHE C CG  1 
ATOM   8386  C  CD1 . PHE C 1 113 ? 32.682 97.289  63.484  1.00 32.14 ? 113 PHE C CD1 1 
ATOM   8387  C  CD2 . PHE C 1 113 ? 33.486 95.073  63.025  1.00 31.55 ? 113 PHE C CD2 1 
ATOM   8388  C  CE1 . PHE C 1 113 ? 31.415 96.779  63.744  1.00 31.76 ? 113 PHE C CE1 1 
ATOM   8389  C  CE2 . PHE C 1 113 ? 32.223 94.557  63.281  1.00 31.65 ? 113 PHE C CE2 1 
ATOM   8390  C  CZ  . PHE C 1 113 ? 31.187 95.407  63.641  1.00 31.87 ? 113 PHE C CZ  1 
ATOM   8391  N  N   . SER C 1 114 ? 36.919 99.364  62.060  1.00 33.33 ? 114 SER C N   1 
ATOM   8392  C  CA  . SER C 1 114 ? 38.255 99.914  61.926  1.00 33.73 ? 114 SER C CA  1 
ATOM   8393  C  C   . SER C 1 114 ? 38.536 101.050 62.888  1.00 33.69 ? 114 SER C C   1 
ATOM   8394  O  O   . SER C 1 114 ? 37.658 101.506 63.622  1.00 33.81 ? 114 SER C O   1 
ATOM   8395  C  CB  . SER C 1 114 ? 38.446 100.427 60.496  1.00 34.63 ? 114 SER C CB  1 
ATOM   8396  O  OG  . SER C 1 114 ? 37.427 101.364 60.151  1.00 36.36 ? 114 SER C OG  1 
ATOM   8397  N  N   . THR C 1 115 ? 39.791 101.483 62.876  1.00 33.92 ? 115 THR C N   1 
ATOM   8398  C  CA  . THR C 1 115 ? 40.253 102.615 63.661  1.00 33.39 ? 115 THR C CA  1 
ATOM   8399  C  C   . THR C 1 115 ? 40.449 103.701 62.602  1.00 33.60 ? 115 THR C C   1 
ATOM   8400  O  O   . THR C 1 115 ? 40.119 103.488 61.435  1.00 33.51 ? 115 THR C O   1 
ATOM   8401  C  CB  . THR C 1 115 ? 41.569 102.312 64.354  1.00 32.96 ? 115 THR C CB  1 
ATOM   8402  O  OG1 . THR C 1 115 ? 42.422 101.603 63.451  1.00 33.07 ? 115 THR C OG1 1 
ATOM   8403  C  CG2 . THR C 1 115 ? 41.330 101.473 65.600  1.00 33.17 ? 115 THR C CG2 1 
ATOM   8404  N  N   . VAL C 1 116 ? 40.997 104.848 62.975  1.00 33.81 ? 116 VAL C N   1 
ATOM   8405  C  CA  . VAL C 1 116 ? 41.131 105.916 61.998  1.00 33.53 ? 116 VAL C CA  1 
ATOM   8406  C  C   . VAL C 1 116 ? 42.522 106.290 61.524  1.00 33.65 ? 116 VAL C C   1 
ATOM   8407  O  O   . VAL C 1 116 ? 42.837 106.167 60.337  1.00 32.11 ? 116 VAL C O   1 
ATOM   8408  C  CB  . VAL C 1 116 ? 40.460 107.192 62.521  1.00 33.55 ? 116 VAL C CB  1 
ATOM   8409  C  CG1 . VAL C 1 116 ? 40.394 108.244 61.424  1.00 33.74 ? 116 VAL C CG1 1 
ATOM   8410  C  CG2 . VAL C 1 116 ? 39.071 106.863 63.034  1.00 34.59 ? 116 VAL C CG2 1 
ATOM   8411  N  N   . ALA C 1 117 ? 43.340 106.750 62.465  1.00 34.28 ? 117 ALA C N   1 
ATOM   8412  C  CA  . ALA C 1 117 ? 44.693 107.237 62.192  1.00 34.62 ? 117 ALA C CA  1 
ATOM   8413  C  C   . ALA C 1 117 ? 45.768 106.206 61.862  1.00 35.35 ? 117 ALA C C   1 
ATOM   8414  O  O   . ALA C 1 117 ? 46.457 106.316 60.838  1.00 34.84 ? 117 ALA C O   1 
ATOM   8415  C  CB  . ALA C 1 117 ? 45.153 108.096 63.365  1.00 34.02 ? 117 ALA C CB  1 
ATOM   8416  N  N   . GLY C 1 118 ? 45.917 105.218 62.739  1.00 36.05 ? 118 GLY C N   1 
ATOM   8417  C  CA  . GLY C 1 118 ? 46.929 104.196 62.549  1.00 36.42 ? 118 GLY C CA  1 
ATOM   8418  C  C   . GLY C 1 118 ? 46.855 103.470 61.226  1.00 37.12 ? 118 GLY C C   1 
ATOM   8419  O  O   . GLY C 1 118 ? 45.767 103.256 60.686  1.00 37.45 ? 118 GLY C O   1 
ATOM   8420  N  N   . GLU C 1 119 ? 48.018 103.100 60.691  1.00 37.46 ? 119 GLU C N   1 
ATOM   8421  C  CA  . GLU C 1 119 ? 48.058 102.372 59.430  1.00 37.27 ? 119 GLU C CA  1 
ATOM   8422  C  C   . GLU C 1 119 ? 47.976 100.857 59.651  1.00 35.94 ? 119 GLU C C   1 
ATOM   8423  O  O   . GLU C 1 119 ? 47.797 100.391 60.773  1.00 35.40 ? 119 GLU C O   1 
ATOM   8424  C  CB  . GLU C 1 119 ? 49.288 102.772 58.570  1.00 37.28 ? 119 GLU C CB  1 
ATOM   8425  C  CG  . GLU C 1 119 ? 50.602 103.028 59.280  1.00 37.94 ? 119 GLU C CG  1 
ATOM   8426  C  CD  . GLU C 1 119 ? 50.619 104.319 60.078  1.00 38.22 ? 119 GLU C CD  1 
ATOM   8427  O  OE1 . GLU C 1 119 ? 50.403 105.398 59.502  1.00 38.53 ? 119 GLU C OE1 1 
ATOM   8428  O  OE2 . GLU C 1 119 ? 50.860 104.254 61.298  1.00 39.92 ? 119 GLU C OE2 1 
ATOM   8429  N  N   . SER C 1 120 ? 48.094 100.102 58.573  1.00 35.05 ? 120 SER C N   1 
ATOM   8430  C  CA  . SER C 1 120 ? 47.964 98.653  58.617  1.00 35.52 ? 120 SER C CA  1 
ATOM   8431  C  C   . SER C 1 120 ? 48.599 97.802  59.729  1.00 36.85 ? 120 SER C C   1 
ATOM   8432  O  O   . SER C 1 120 ? 48.151 96.679  59.972  1.00 37.98 ? 120 SER C O   1 
ATOM   8433  C  CB  . SER C 1 120 ? 48.362 98.082  57.260  1.00 34.03 ? 120 SER C CB  1 
ATOM   8434  O  OG  . SER C 1 120 ? 47.398 98.435  56.291  1.00 32.69 ? 120 SER C OG  1 
ATOM   8435  N  N   . GLY C 1 121 ? 49.621 98.287  60.414  1.00 37.23 ? 121 GLY C N   1 
ATOM   8436  C  CA  . GLY C 1 121 ? 50.188 97.444  61.452  1.00 36.75 ? 121 GLY C CA  1 
ATOM   8437  C  C   . GLY C 1 121 ? 49.913 97.942  62.855  1.00 37.11 ? 121 GLY C C   1 
ATOM   8438  O  O   . GLY C 1 121 ? 50.341 97.321  63.824  1.00 37.61 ? 121 GLY C O   1 
ATOM   8439  N  N   . SER C 1 122 ? 49.196 99.059  62.962  1.00 36.79 ? 122 SER C N   1 
ATOM   8440  C  CA  . SER C 1 122 ? 48.879 99.679  64.248  1.00 36.15 ? 122 SER C CA  1 
ATOM   8441  C  C   . SER C 1 122 ? 48.058 98.790  65.165  1.00 36.01 ? 122 SER C C   1 
ATOM   8442  O  O   . SER C 1 122 ? 47.487 97.792  64.728  1.00 36.24 ? 122 SER C O   1 
ATOM   8443  C  CB  . SER C 1 122 ? 48.131 100.987 64.012  1.00 35.69 ? 122 SER C CB  1 
ATOM   8444  O  OG  . SER C 1 122 ? 46.963 100.761 63.240  1.00 36.64 ? 122 SER C OG  1 
ATOM   8445  N  N   . ALA C 1 123 ? 47.985 99.169  66.437  1.00 35.67 ? 123 ALA C N   1 
ATOM   8446  C  CA  . ALA C 1 123 ? 47.233 98.402  67.428  1.00 35.40 ? 123 ALA C CA  1 
ATOM   8447  C  C   . ALA C 1 123 ? 45.745 98.733  67.397  1.00 35.62 ? 123 ALA C C   1 
ATOM   8448  O  O   . ALA C 1 123 ? 45.364 99.870  67.130  1.00 36.15 ? 123 ALA C O   1 
ATOM   8449  C  CB  . ALA C 1 123 ? 47.792 98.665  68.813  1.00 35.31 ? 123 ALA C CB  1 
ATOM   8450  N  N   . ASP C 1 124 ? 44.910 97.736  67.686  1.00 35.61 ? 124 ASP C N   1 
ATOM   8451  C  CA  . ASP C 1 124 ? 43.465 97.910  67.679  1.00 34.74 ? 124 ASP C CA  1 
ATOM   8452  C  C   . ASP C 1 124 ? 42.945 98.693  68.856  1.00 35.50 ? 124 ASP C C   1 
ATOM   8453  O  O   . ASP C 1 124 ? 42.036 99.501  68.708  1.00 36.15 ? 124 ASP C O   1 
ATOM   8454  C  CB  . ASP C 1 124 ? 42.769 96.555  67.654  1.00 34.05 ? 124 ASP C CB  1 
ATOM   8455  C  CG  . ASP C 1 124 ? 42.729 95.951  66.272  1.00 33.91 ? 124 ASP C CG  1 
ATOM   8456  O  OD1 . ASP C 1 124 ? 43.623 96.284  65.472  1.00 34.32 ? 124 ASP C OD1 1 
ATOM   8457  O  OD2 . ASP C 1 124 ? 41.820 95.141  65.980  1.00 33.80 ? 124 ASP C OD2 1 
ATOM   8458  N  N   . THR C 1 125 ? 43.521 98.459  70.027  1.00 36.39 ? 125 THR C N   1 
ATOM   8459  C  CA  . THR C 1 125 ? 43.065 99.122  71.246  1.00 36.74 ? 125 THR C CA  1 
ATOM   8460  C  C   . THR C 1 125 ? 43.718 100.469 71.562  1.00 36.44 ? 125 THR C C   1 
ATOM   8461  O  O   . THR C 1 125 ? 44.579 100.575 72.440  1.00 36.38 ? 125 THR C O   1 
ATOM   8462  C  CB  . THR C 1 125 ? 43.234 98.177  72.467  1.00 37.29 ? 125 THR C CB  1 
ATOM   8463  O  OG1 . THR C 1 125 ? 44.615 97.800  72.606  1.00 37.75 ? 125 THR C OG1 1 
ATOM   8464  C  CG2 . THR C 1 125 ? 42.389 96.921  72.280  1.00 36.46 ? 125 THR C CG2 1 
ATOM   8465  N  N   . VAL C 1 126 ? 43.286 101.505 70.859  1.00 36.02 ? 126 VAL C N   1 
ATOM   8466  C  CA  . VAL C 1 126 ? 43.834 102.833 71.080  1.00 36.77 ? 126 VAL C CA  1 
ATOM   8467  C  C   . VAL C 1 126 ? 42.713 103.851 70.966  1.00 37.45 ? 126 VAL C C   1 
ATOM   8468  O  O   . VAL C 1 126 ? 41.732 103.596 70.265  1.00 38.27 ? 126 VAL C O   1 
ATOM   8469  C  CB  . VAL C 1 126 ? 44.925 103.149 70.044  1.00 36.95 ? 126 VAL C CB  1 
ATOM   8470  C  CG1 . VAL C 1 126 ? 46.100 102.168 70.209  1.00 35.10 ? 126 VAL C CG1 1 
ATOM   8471  C  CG2 . VAL C 1 126 ? 44.336 103.069 68.627  1.00 36.33 ? 126 VAL C CG2 1 
ATOM   8472  N  N   . ARG C 1 127 ? 42.834 104.983 71.661  1.00 37.34 ? 127 ARG C N   1 
ATOM   8473  C  CA  . ARG C 1 127 ? 41.789 106.012 71.599  1.00 37.22 ? 127 ARG C CA  1 
ATOM   8474  C  C   . ARG C 1 127 ? 41.682 106.469 70.153  1.00 37.34 ? 127 ARG C C   1 
ATOM   8475  O  O   . ARG C 1 127 ? 42.691 106.826 69.548  1.00 38.09 ? 127 ARG C O   1 
ATOM   8476  C  CB  . ARG C 1 127 ? 42.133 107.210 72.491  1.00 36.59 ? 127 ARG C CB  1 
ATOM   8477  C  CG  . ARG C 1 127 ? 40.990 108.226 72.612  1.00 37.45 ? 127 ARG C CG  1 
ATOM   8478  C  CD  . ARG C 1 127 ? 41.249 109.250 73.717  1.00 38.19 ? 127 ARG C CD  1 
ATOM   8479  N  NE  . ARG C 1 127 ? 41.535 108.599 74.997  1.00 39.53 ? 127 ARG C NE  1 
ATOM   8480  C  CZ  . ARG C 1 127 ? 40.622 107.998 75.754  1.00 39.63 ? 127 ARG C CZ  1 
ATOM   8481  N  NH1 . ARG C 1 127 ? 39.353 107.975 75.369  1.00 39.79 ? 127 ARG C NH1 1 
ATOM   8482  N  NH2 . ARG C 1 127 ? 40.984 107.387 76.879  1.00 39.72 ? 127 ARG C NH2 1 
ATOM   8483  N  N   . ASP C 1 128 ? 40.470 106.471 69.606  1.00 36.89 ? 128 ASP C N   1 
ATOM   8484  C  CA  . ASP C 1 128 ? 40.268 106.852 68.210  1.00 37.17 ? 128 ASP C CA  1 
ATOM   8485  C  C   . ASP C 1 128 ? 38.841 106.430 67.843  1.00 36.75 ? 128 ASP C C   1 
ATOM   8486  O  O   . ASP C 1 128 ? 38.290 105.482 68.422  1.00 37.49 ? 128 ASP C O   1 
ATOM   8487  C  CB  . ASP C 1 128 ? 41.277 106.078 67.337  1.00 38.25 ? 128 ASP C CB  1 
ATOM   8488  C  CG  . ASP C 1 128 ? 41.719 106.837 66.078  1.00 38.66 ? 128 ASP C CG  1 
ATOM   8489  O  OD1 . ASP C 1 128 ? 41.935 108.066 66.136  1.00 39.36 ? 128 ASP C OD1 1 
ATOM   8490  O  OD2 . ASP C 1 128 ? 41.889 106.180 65.025  1.00 39.71 ? 128 ASP C OD2 1 
ATOM   8491  N  N   . PRO C 1 129 ? 38.207 107.136 66.898  1.00 35.16 ? 129 PRO C N   1 
ATOM   8492  C  CA  . PRO C 1 129 ? 36.853 106.716 66.546  1.00 34.31 ? 129 PRO C CA  1 
ATOM   8493  C  C   . PRO C 1 129 ? 36.925 105.303 65.966  1.00 34.33 ? 129 PRO C C   1 
ATOM   8494  O  O   . PRO C 1 129 ? 38.006 104.736 65.836  1.00 34.09 ? 129 PRO C O   1 
ATOM   8495  C  CB  . PRO C 1 129 ? 36.451 107.744 65.500  1.00 33.57 ? 129 PRO C CB  1 
ATOM   8496  C  CG  . PRO C 1 129 ? 37.146 108.958 65.960  1.00 32.91 ? 129 PRO C CG  1 
ATOM   8497  C  CD  . PRO C 1 129 ? 38.515 108.444 66.303  1.00 34.24 ? 129 PRO C CD  1 
ATOM   8498  N  N   . ARG C 1 130 ? 35.782 104.721 65.634  1.00 34.30 ? 130 ARG C N   1 
ATOM   8499  C  CA  . ARG C 1 130 ? 35.791 103.396 65.029  1.00 34.47 ? 130 ARG C CA  1 
ATOM   8500  C  C   . ARG C 1 130 ? 34.872 103.389 63.818  1.00 33.99 ? 130 ARG C C   1 
ATOM   8501  O  O   . ARG C 1 130 ? 33.723 103.792 63.908  1.00 33.82 ? 130 ARG C O   1 
ATOM   8502  C  CB  . ARG C 1 130 ? 35.340 102.338 66.032  1.00 35.62 ? 130 ARG C CB  1 
ATOM   8503  C  CG  . ARG C 1 130 ? 36.304 102.114 67.188  1.00 36.50 ? 130 ARG C CG  1 
ATOM   8504  C  CD  . ARG C 1 130 ? 37.478 101.224 66.805  1.00 36.79 ? 130 ARG C CD  1 
ATOM   8505  N  NE  . ARG C 1 130 ? 38.220 100.808 67.996  1.00 38.28 ? 130 ARG C NE  1 
ATOM   8506  C  CZ  . ARG C 1 130 ? 39.020 101.604 68.706  1.00 39.95 ? 130 ARG C CZ  1 
ATOM   8507  N  NH1 . ARG C 1 130 ? 39.200 102.869 68.345  1.00 39.91 ? 130 ARG C NH1 1 
ATOM   8508  N  NH2 . ARG C 1 130 ? 39.631 101.144 69.794  1.00 41.17 ? 130 ARG C NH2 1 
ATOM   8509  N  N   . GLY C 1 131 ? 35.395 102.963 62.678  1.00 34.18 ? 131 GLY C N   1 
ATOM   8510  C  CA  . GLY C 1 131 ? 34.581 102.897 61.483  1.00 35.03 ? 131 GLY C CA  1 
ATOM   8511  C  C   . GLY C 1 131 ? 33.615 101.740 61.645  1.00 35.65 ? 131 GLY C C   1 
ATOM   8512  O  O   . GLY C 1 131 ? 33.911 100.771 62.334  1.00 36.94 ? 131 GLY C O   1 
ATOM   8513  N  N   . PHE C 1 132 ? 32.454 101.830 61.015  1.00 35.68 ? 132 PHE C N   1 
ATOM   8514  C  CA  . PHE C 1 132 ? 31.447 100.782 61.115  1.00 35.02 ? 132 PHE C CA  1 
ATOM   8515  C  C   . PHE C 1 132 ? 30.673 100.811 59.784  1.00 34.48 ? 132 PHE C C   1 
ATOM   8516  O  O   . PHE C 1 132 ? 29.559 101.340 59.703  1.00 34.35 ? 132 PHE C O   1 
ATOM   8517  C  CB  . PHE C 1 132 ? 30.529 101.091 62.305  1.00 34.98 ? 132 PHE C CB  1 
ATOM   8518  C  CG  . PHE C 1 132 ? 29.712 99.917  62.789  1.00 36.32 ? 132 PHE C CG  1 
ATOM   8519  C  CD1 . PHE C 1 132 ? 29.289 98.919  61.910  1.00 36.08 ? 132 PHE C CD1 1 
ATOM   8520  C  CD2 . PHE C 1 132 ? 29.304 99.851  64.119  1.00 36.19 ? 132 PHE C CD2 1 
ATOM   8521  C  CE1 . PHE C 1 132 ? 28.470 97.882  62.341  1.00 36.89 ? 132 PHE C CE1 1 
ATOM   8522  C  CE2 . PHE C 1 132 ? 28.481 98.814  64.566  1.00 36.87 ? 132 PHE C CE2 1 
ATOM   8523  C  CZ  . PHE C 1 132 ? 28.061 97.827  63.677  1.00 37.02 ? 132 PHE C CZ  1 
ATOM   8524  N  N   . ALA C 1 133 ? 31.286 100.251 58.743  1.00 33.52 ? 133 ALA C N   1 
ATOM   8525  C  CA  . ALA C 1 133 ? 30.688 100.221 57.411  1.00 33.18 ? 133 ALA C CA  1 
ATOM   8526  C  C   . ALA C 1 133 ? 29.773 99.019  57.170  1.00 32.71 ? 133 ALA C C   1 
ATOM   8527  O  O   . ALA C 1 133 ? 30.088 97.889  57.533  1.00 32.77 ? 133 ALA C O   1 
ATOM   8528  C  CB  . ALA C 1 133 ? 31.785 100.266 56.344  1.00 32.30 ? 133 ALA C CB  1 
ATOM   8529  N  N   . VAL C 1 134 ? 28.631 99.282  56.551  1.00 32.48 ? 134 VAL C N   1 
ATOM   8530  C  CA  . VAL C 1 134 ? 27.668 98.241  56.252  1.00 32.18 ? 134 VAL C CA  1 
ATOM   8531  C  C   . VAL C 1 134 ? 27.247 98.302  54.788  1.00 32.29 ? 134 VAL C C   1 
ATOM   8532  O  O   . VAL C 1 134 ? 26.746 99.317  54.307  1.00 32.03 ? 134 VAL C O   1 
ATOM   8533  C  CB  . VAL C 1 134 ? 26.396 98.380  57.119  1.00 32.62 ? 134 VAL C CB  1 
ATOM   8534  C  CG1 . VAL C 1 134 ? 25.519 97.149  56.939  1.00 32.10 ? 134 VAL C CG1 1 
ATOM   8535  C  CG2 . VAL C 1 134 ? 26.770 98.580  58.592  1.00 32.42 ? 134 VAL C CG2 1 
ATOM   8536  N  N   . LYS C 1 135 ? 27.462 97.206  54.077  1.00 32.79 ? 135 LYS C N   1 
ATOM   8537  C  CA  . LYS C 1 135 ? 27.070 97.128  52.683  1.00 33.14 ? 135 LYS C CA  1 
ATOM   8538  C  C   . LYS C 1 135 ? 25.870 96.200  52.578  1.00 34.58 ? 135 LYS C C   1 
ATOM   8539  O  O   . LYS C 1 135 ? 25.991 95.001  52.831  1.00 35.75 ? 135 LYS C O   1 
ATOM   8540  C  CB  . LYS C 1 135 ? 28.208 96.570  51.831  1.00 31.67 ? 135 LYS C CB  1 
ATOM   8541  C  CG  . LYS C 1 135 ? 27.837 96.397  50.368  1.00 29.68 ? 135 LYS C CG  1 
ATOM   8542  C  CD  . LYS C 1 135 ? 28.982 95.799  49.594  1.00 28.41 ? 135 LYS C CD  1 
ATOM   8543  C  CE  . LYS C 1 135 ? 30.242 96.643  49.742  1.00 27.30 ? 135 LYS C CE  1 
ATOM   8544  N  NZ  . LYS C 1 135 ? 30.082 97.973  49.110  1.00 28.13 ? 135 LYS C NZ  1 
ATOM   8545  N  N   . PHE C 1 136 ? 24.707 96.748  52.234  1.00 35.41 ? 136 PHE C N   1 
ATOM   8546  C  CA  . PHE C 1 136 ? 23.506 95.930  52.068  1.00 35.28 ? 136 PHE C CA  1 
ATOM   8547  C  C   . PHE C 1 136 ? 23.395 95.637  50.576  1.00 35.88 ? 136 PHE C C   1 
ATOM   8548  O  O   . PHE C 1 136 ? 23.247 96.563  49.773  1.00 36.29 ? 136 PHE C O   1 
ATOM   8549  C  CB  . PHE C 1 136 ? 22.243 96.683  52.479  1.00 35.12 ? 136 PHE C CB  1 
ATOM   8550  C  CG  . PHE C 1 136 ? 22.302 97.308  53.839  1.00 36.09 ? 136 PHE C CG  1 
ATOM   8551  C  CD1 . PHE C 1 136 ? 23.157 98.375  54.095  1.00 35.77 ? 136 PHE C CD1 1 
ATOM   8552  C  CD2 . PHE C 1 136 ? 21.440 96.879  54.847  1.00 35.83 ? 136 PHE C CD2 1 
ATOM   8553  C  CE1 . PHE C 1 136 ? 23.146 99.013  55.334  1.00 36.65 ? 136 PHE C CE1 1 
ATOM   8554  C  CE2 . PHE C 1 136 ? 21.418 97.507  56.091  1.00 36.31 ? 136 PHE C CE2 1 
ATOM   8555  C  CZ  . PHE C 1 136 ? 22.270 98.578  56.338  1.00 36.48 ? 136 PHE C CZ  1 
ATOM   8556  N  N   . TYR C 1 137 ? 23.471 94.371  50.192  1.00 35.74 ? 137 TYR C N   1 
ATOM   8557  C  CA  . TYR C 1 137 ? 23.354 94.035  48.781  1.00 35.84 ? 137 TYR C CA  1 
ATOM   8558  C  C   . TYR C 1 137 ? 21.870 93.949  48.478  1.00 35.88 ? 137 TYR C C   1 
ATOM   8559  O  O   . TYR C 1 137 ? 21.274 92.884  48.587  1.00 36.92 ? 137 TYR C O   1 
ATOM   8560  C  CB  . TYR C 1 137 ? 24.021 92.688  48.489  1.00 36.03 ? 137 TYR C CB  1 
ATOM   8561  C  CG  . TYR C 1 137 ? 25.461 92.572  48.962  1.00 35.45 ? 137 TYR C CG  1 
ATOM   8562  C  CD1 . TYR C 1 137 ? 25.760 92.258  50.294  1.00 34.87 ? 137 TYR C CD1 1 
ATOM   8563  C  CD2 . TYR C 1 137 ? 26.524 92.748  48.067  1.00 34.74 ? 137 TYR C CD2 1 
ATOM   8564  C  CE1 . TYR C 1 137 ? 27.079 92.115  50.718  1.00 34.17 ? 137 TYR C CE1 1 
ATOM   8565  C  CE2 . TYR C 1 137 ? 27.842 92.610  48.479  1.00 34.23 ? 137 TYR C CE2 1 
ATOM   8566  C  CZ  . TYR C 1 137 ? 28.118 92.291  49.804  1.00 34.61 ? 137 TYR C CZ  1 
ATOM   8567  O  OH  . TYR C 1 137 ? 29.431 92.134  50.200  1.00 33.89 ? 137 TYR C OH  1 
ATOM   8568  N  N   . THR C 1 138 ? 21.269 95.073  48.108  1.00 35.95 ? 138 THR C N   1 
ATOM   8569  C  CA  . THR C 1 138 ? 19.842 95.103  47.829  1.00 35.63 ? 138 THR C CA  1 
ATOM   8570  C  C   . THR C 1 138 ? 19.543 94.802  46.368  1.00 36.22 ? 138 THR C C   1 
ATOM   8571  O  O   . THR C 1 138 ? 20.449 94.733  45.549  1.00 36.13 ? 138 THR C O   1 
ATOM   8572  C  CB  . THR C 1 138 ? 19.229 96.475  48.206  1.00 34.97 ? 138 THR C CB  1 
ATOM   8573  O  OG1 . THR C 1 138 ? 19.434 97.405  47.143  1.00 35.67 ? 138 THR C OG1 1 
ATOM   8574  C  CG2 . THR C 1 138 ? 19.879 97.025  49.457  1.00 33.28 ? 138 THR C CG2 1 
ATOM   8575  N  N   . GLU C 1 139 ? 18.267 94.601  46.055  1.00 37.19 ? 139 GLU C N   1 
ATOM   8576  C  CA  . GLU C 1 139 ? 17.840 94.315  44.687  1.00 38.93 ? 139 GLU C CA  1 
ATOM   8577  C  C   . GLU C 1 139 ? 17.970 95.562  43.821  1.00 38.16 ? 139 GLU C C   1 
ATOM   8578  O  O   . GLU C 1 139 ? 18.067 95.479  42.587  1.00 37.27 ? 139 GLU C O   1 
ATOM   8579  C  CB  . GLU C 1 139 ? 16.388 93.845  44.671  1.00 41.17 ? 139 GLU C CB  1 
ATOM   8580  C  CG  . GLU C 1 139 ? 16.172 92.496  45.301  1.00 45.38 ? 139 GLU C CG  1 
ATOM   8581  C  CD  . GLU C 1 139 ? 14.791 92.376  45.921  1.00 48.87 ? 139 GLU C CD  1 
ATOM   8582  O  OE1 . GLU C 1 139 ? 14.477 91.282  46.444  1.00 51.09 ? 139 GLU C OE1 1 
ATOM   8583  O  OE2 . GLU C 1 139 ? 14.025 93.376  45.892  1.00 50.13 ? 139 GLU C OE2 1 
ATOM   8584  N  N   . ASP C 1 140 ? 17.950 96.715  44.484  1.00 37.05 ? 140 ASP C N   1 
ATOM   8585  C  CA  . ASP C 1 140 ? 18.085 97.987  43.803  1.00 36.61 ? 140 ASP C CA  1 
ATOM   8586  C  C   . ASP C 1 140 ? 19.530 98.460  43.888  1.00 35.64 ? 140 ASP C C   1 
ATOM   8587  O  O   . ASP C 1 140 ? 19.809 99.660  43.884  1.00 35.54 ? 140 ASP C O   1 
ATOM   8588  C  CB  . ASP C 1 140 ? 17.159 99.028  44.428  1.00 37.39 ? 140 ASP C CB  1 
ATOM   8589  C  CG  . ASP C 1 140 ? 15.816 99.095  43.746  1.00 37.35 ? 140 ASP C CG  1 
ATOM   8590  O  OD1 . ASP C 1 140 ? 15.629 98.417  42.713  1.00 38.54 ? 140 ASP C OD1 1 
ATOM   8591  O  OD2 . ASP C 1 140 ? 14.948 99.837  44.242  1.00 38.28 ? 140 ASP C OD2 1 
ATOM   8592  N  N   . GLY C 1 141 ? 20.446 97.505  43.970  1.00 34.43 ? 141 GLY C N   1 
ATOM   8593  C  CA  . GLY C 1 141 ? 21.846 97.855  44.056  1.00 33.95 ? 141 GLY C CA  1 
ATOM   8594  C  C   . GLY C 1 141 ? 22.337 97.864  45.489  1.00 33.82 ? 141 GLY C C   1 
ATOM   8595  O  O   . GLY C 1 141 ? 21.558 97.703  46.435  1.00 32.00 ? 141 GLY C O   1 
ATOM   8596  N  N   . ASN C 1 142 ? 23.638 98.060  45.660  1.00 33.08 ? 142 ASN C N   1 
ATOM   8597  C  CA  . ASN C 1 142 ? 24.176 98.054  46.993  1.00 32.50 ? 142 ASN C CA  1 
ATOM   8598  C  C   . ASN C 1 142 ? 23.884 99.369  47.672  1.00 32.74 ? 142 ASN C C   1 
ATOM   8599  O  O   . ASN C 1 142 ? 23.737 100.397 47.015  1.00 32.09 ? 142 ASN C O   1 
ATOM   8600  C  CB  . ASN C 1 142 ? 25.676 97.785  46.953  1.00 32.99 ? 142 ASN C CB  1 
ATOM   8601  C  CG  . ASN C 1 142 ? 25.997 96.348  46.566  1.00 33.87 ? 142 ASN C CG  1 
ATOM   8602  O  OD1 . ASN C 1 142 ? 25.091 95.531  46.424  1.00 33.65 ? 142 ASN C OD1 1 
ATOM   8603  N  ND2 . ASN C 1 142 ? 27.288 96.031  46.404  1.00 33.75 ? 142 ASN C ND2 1 
ATOM   8604  N  N   . TRP C 1 143 ? 23.757 99.317  48.992  1.00 31.91 ? 143 TRP C N   1 
ATOM   8605  C  CA  . TRP C 1 143 ? 23.518 100.507 49.780  1.00 31.74 ? 143 TRP C CA  1 
ATOM   8606  C  C   . TRP C 1 143 ? 24.568 100.480 50.876  1.00 32.50 ? 143 TRP C C   1 
ATOM   8607  O  O   . TRP C 1 143 ? 24.536 99.622  51.761  1.00 33.17 ? 143 TRP C O   1 
ATOM   8608  C  CB  . TRP C 1 143 ? 22.101 100.513 50.373  1.00 30.88 ? 143 TRP C CB  1 
ATOM   8609  C  CG  . TRP C 1 143 ? 21.925 101.512 51.481  1.00 30.67 ? 143 TRP C CG  1 
ATOM   8610  C  CD1 . TRP C 1 143 ? 22.429 102.790 51.528  1.00 30.87 ? 143 TRP C CD1 1 
ATOM   8611  C  CD2 . TRP C 1 143 ? 21.237 101.309 52.720  1.00 30.37 ? 143 TRP C CD2 1 
ATOM   8612  N  NE1 . TRP C 1 143 ? 22.103 103.384 52.723  1.00 30.17 ? 143 TRP C NE1 1 
ATOM   8613  C  CE2 . TRP C 1 143 ? 21.370 102.501 53.473  1.00 30.39 ? 143 TRP C CE2 1 
ATOM   8614  C  CE3 . TRP C 1 143 ? 20.515 100.239 53.268  1.00 29.90 ? 143 TRP C CE3 1 
ATOM   8615  C  CZ2 . TRP C 1 143 ? 20.808 102.650 54.749  1.00 30.25 ? 143 TRP C CZ2 1 
ATOM   8616  C  CZ3 . TRP C 1 143 ? 19.954 100.388 54.538  1.00 29.64 ? 143 TRP C CZ3 1 
ATOM   8617  C  CH2 . TRP C 1 143 ? 20.105 101.585 55.263  1.00 30.12 ? 143 TRP C CH2 1 
ATOM   8618  N  N   . ASP C 1 144 ? 25.514 101.410 50.800  1.00 32.83 ? 144 ASP C N   1 
ATOM   8619  C  CA  . ASP C 1 144 ? 26.578 101.478 51.780  1.00 33.08 ? 144 ASP C CA  1 
ATOM   8620  C  C   . ASP C 1 144 ? 26.259 102.509 52.838  1.00 33.32 ? 144 ASP C C   1 
ATOM   8621  O  O   . ASP C 1 144 ? 26.001 103.662 52.525  1.00 33.74 ? 144 ASP C O   1 
ATOM   8622  C  CB  . ASP C 1 144 ? 27.904 101.853 51.104  1.00 33.96 ? 144 ASP C CB  1 
ATOM   8623  C  CG  . ASP C 1 144 ? 28.449 100.746 50.204  1.00 35.32 ? 144 ASP C CG  1 
ATOM   8624  O  OD1 . ASP C 1 144 ? 28.824 101.032 49.046  1.00 35.93 ? 144 ASP C OD1 1 
ATOM   8625  O  OD2 . ASP C 1 144 ? 28.523 99.587  50.656  1.00 36.12 ? 144 ASP C OD2 1 
ATOM   8626  N  N   . LEU C 1 145 ? 26.255 102.086 54.094  1.00 33.80 ? 145 LEU C N   1 
ATOM   8627  C  CA  . LEU C 1 145 ? 26.026 102.994 55.214  1.00 34.42 ? 145 LEU C CA  1 
ATOM   8628  C  C   . LEU C 1 145 ? 27.358 103.004 55.962  1.00 34.83 ? 145 LEU C C   1 
ATOM   8629  O  O   . LEU C 1 145 ? 27.577 102.224 56.886  1.00 35.76 ? 145 LEU C O   1 
ATOM   8630  C  CB  . LEU C 1 145 ? 24.919 102.461 56.114  1.00 34.71 ? 145 LEU C CB  1 
ATOM   8631  C  CG  . LEU C 1 145 ? 24.495 103.394 57.239  1.00 35.44 ? 145 LEU C CG  1 
ATOM   8632  C  CD1 . LEU C 1 145 ? 24.055 104.736 56.658  1.00 36.50 ? 145 LEU C CD1 1 
ATOM   8633  C  CD2 . LEU C 1 145 ? 23.363 102.757 58.014  1.00 35.56 ? 145 LEU C CD2 1 
ATOM   8634  N  N   . VAL C 1 146 ? 28.253 103.881 55.530  1.00 35.01 ? 146 VAL C N   1 
ATOM   8635  C  CA  . VAL C 1 146 ? 29.591 103.992 56.089  1.00 34.65 ? 146 VAL C CA  1 
ATOM   8636  C  C   . VAL C 1 146 ? 29.612 104.869 57.343  1.00 35.16 ? 146 VAL C C   1 
ATOM   8637  O  O   . VAL C 1 146 ? 29.940 106.048 57.267  1.00 35.22 ? 146 VAL C O   1 
ATOM   8638  C  CB  . VAL C 1 146 ? 30.530 104.598 55.019  1.00 34.61 ? 146 VAL C CB  1 
ATOM   8639  C  CG1 . VAL C 1 146 ? 31.976 104.248 55.315  1.00 35.43 ? 146 VAL C CG1 1 
ATOM   8640  C  CG2 . VAL C 1 146 ? 30.126 104.105 53.637  1.00 33.82 ? 146 VAL C CG2 1 
ATOM   8641  N  N   . GLY C 1 147 ? 29.289 104.302 58.500  1.00 35.30 ? 147 GLY C N   1 
ATOM   8642  C  CA  . GLY C 1 147 ? 29.268 105.119 59.704  1.00 36.85 ? 147 GLY C CA  1 
ATOM   8643  C  C   . GLY C 1 147 ? 30.285 104.782 60.773  1.00 37.24 ? 147 GLY C C   1 
ATOM   8644  O  O   . GLY C 1 147 ? 31.034 103.835 60.616  1.00 37.56 ? 147 GLY C O   1 
ATOM   8645  N  N   . ASN C 1 148 ? 30.339 105.569 61.845  1.00 38.44 ? 148 ASN C N   1 
ATOM   8646  C  CA  . ASN C 1 148 ? 31.279 105.278 62.924  1.00 39.57 ? 148 ASN C CA  1 
ATOM   8647  C  C   . ASN C 1 148 ? 30.502 104.929 64.164  1.00 39.11 ? 148 ASN C C   1 
ATOM   8648  O  O   . ASN C 1 148 ? 29.281 104.779 64.132  1.00 38.29 ? 148 ASN C O   1 
ATOM   8649  C  CB  . ASN C 1 148 ? 32.189 106.460 63.298  1.00 42.04 ? 148 ASN C CB  1 
ATOM   8650  C  CG  . ASN C 1 148 ? 32.444 107.409 62.159  1.00 44.17 ? 148 ASN C CG  1 
ATOM   8651  O  OD1 . ASN C 1 148 ? 31.608 108.270 61.870  1.00 46.10 ? 148 ASN C OD1 1 
ATOM   8652  N  ND2 . ASN C 1 148 ? 33.610 107.275 61.508  1.00 44.56 ? 148 ASN C ND2 1 
ATOM   8653  N  N   . ASN C 1 149 ? 31.234 104.835 65.268  1.00 39.18 ? 149 ASN C N   1 
ATOM   8654  C  CA  . ASN C 1 149 ? 30.652 104.507 66.555  1.00 39.44 ? 149 ASN C CA  1 
ATOM   8655  C  C   . ASN C 1 149 ? 30.356 105.796 67.313  1.00 39.76 ? 149 ASN C C   1 
ATOM   8656  O  O   . ASN C 1 149 ? 30.407 105.847 68.540  1.00 41.11 ? 149 ASN C O   1 
ATOM   8657  C  CB  . ASN C 1 149 ? 31.610 103.620 67.346  1.00 38.56 ? 149 ASN C CB  1 
ATOM   8658  C  CG  . ASN C 1 149 ? 32.840 104.361 67.798  1.00 38.72 ? 149 ASN C CG  1 
ATOM   8659  O  OD1 . ASN C 1 149 ? 33.438 105.130 67.038  1.00 38.13 ? 149 ASN C OD1 1 
ATOM   8660  N  ND2 . ASN C 1 149 ? 33.233 104.132 69.043  1.00 38.26 ? 149 ASN C ND2 1 
ATOM   8661  N  N   . THR C 1 150 ? 30.071 106.852 66.566  1.00 39.86 ? 150 THR C N   1 
ATOM   8662  C  CA  . THR C 1 150 ? 29.722 108.134 67.163  1.00 39.20 ? 150 THR C CA  1 
ATOM   8663  C  C   . THR C 1 150 ? 28.736 108.815 66.231  1.00 39.50 ? 150 THR C C   1 
ATOM   8664  O  O   . THR C 1 150 ? 28.791 108.645 65.017  1.00 39.22 ? 150 THR C O   1 
ATOM   8665  C  CB  . THR C 1 150 ? 30.946 109.053 67.350  1.00 39.27 ? 150 THR C CB  1 
ATOM   8666  O  OG1 . THR C 1 150 ? 30.509 110.338 67.816  1.00 38.22 ? 150 THR C OG1 1 
ATOM   8667  C  CG2 . THR C 1 150 ? 31.712 109.209 66.035  1.00 39.33 ? 150 THR C CG2 1 
ATOM   8668  N  N   . PRO C 1 151 ? 27.797 109.573 66.796  1.00 39.75 ? 151 PRO C N   1 
ATOM   8669  C  CA  . PRO C 1 151 ? 26.791 110.283 66.011  1.00 39.30 ? 151 PRO C CA  1 
ATOM   8670  C  C   . PRO C 1 151 ? 27.335 111.564 65.389  1.00 39.50 ? 151 PRO C C   1 
ATOM   8671  O  O   . PRO C 1 151 ? 26.709 112.136 64.491  1.00 40.22 ? 151 PRO C O   1 
ATOM   8672  C  CB  . PRO C 1 151 ? 25.731 110.590 67.046  1.00 39.66 ? 151 PRO C CB  1 
ATOM   8673  C  CG  . PRO C 1 151 ? 26.566 110.865 68.270  1.00 39.14 ? 151 PRO C CG  1 
ATOM   8674  C  CD  . PRO C 1 151 ? 27.522 109.707 68.239  1.00 39.60 ? 151 PRO C CD  1 
ATOM   8675  N  N   . ILE C 1 152 ? 28.496 112.011 65.863  1.00 38.52 ? 152 ILE C N   1 
ATOM   8676  C  CA  . ILE C 1 152 ? 29.079 113.250 65.368  1.00 37.97 ? 152 ILE C CA  1 
ATOM   8677  C  C   . ILE C 1 152 ? 30.556 113.194 64.962  1.00 37.40 ? 152 ILE C C   1 
ATOM   8678  O  O   . ILE C 1 152 ? 31.220 112.166 65.130  1.00 36.01 ? 152 ILE C O   1 
ATOM   8679  C  CB  . ILE C 1 152 ? 28.913 114.326 66.423  1.00 38.33 ? 152 ILE C CB  1 
ATOM   8680  C  CG1 . ILE C 1 152 ? 29.622 113.894 67.706  1.00 38.28 ? 152 ILE C CG1 1 
ATOM   8681  C  CG2 . ILE C 1 152 ? 27.447 114.518 66.713  1.00 38.03 ? 152 ILE C CG2 1 
ATOM   8682  C  CD1 . ILE C 1 152 ? 29.735 114.984 68.738  1.00 38.01 ? 152 ILE C CD1 1 
ATOM   8683  N  N   . PHE C 1 153 ? 31.062 114.310 64.431  1.00 36.89 ? 153 PHE C N   1 
ATOM   8684  C  CA  . PHE C 1 153 ? 32.457 114.378 64.004  1.00 37.26 ? 153 PHE C CA  1 
ATOM   8685  C  C   . PHE C 1 153 ? 33.175 115.678 64.400  1.00 37.09 ? 153 PHE C C   1 
ATOM   8686  O  O   . PHE C 1 153 ? 32.571 116.603 64.935  1.00 38.01 ? 153 PHE C O   1 
ATOM   8687  C  CB  . PHE C 1 153 ? 32.547 114.161 62.492  1.00 38.01 ? 153 PHE C CB  1 
ATOM   8688  C  CG  . PHE C 1 153 ? 33.923 113.761 62.014  1.00 38.74 ? 153 PHE C CG  1 
ATOM   8689  C  CD1 . PHE C 1 153 ? 34.543 112.621 62.512  1.00 39.00 ? 153 PHE C CD1 1 
ATOM   8690  C  CD2 . PHE C 1 153 ? 34.603 114.525 61.075  1.00 39.00 ? 153 PHE C CD2 1 
ATOM   8691  C  CE1 . PHE C 1 153 ? 35.825 112.250 62.081  1.00 39.22 ? 153 PHE C CE1 1 
ATOM   8692  C  CE2 . PHE C 1 153 ? 35.877 114.156 60.643  1.00 39.16 ? 153 PHE C CE2 1 
ATOM   8693  C  CZ  . PHE C 1 153 ? 36.485 113.018 61.150  1.00 38.62 ? 153 PHE C CZ  1 
ATOM   8694  N  N   . PHE C 1 154 ? 34.468 115.743 64.118  1.00 36.07 ? 154 PHE C N   1 
ATOM   8695  C  CA  . PHE C 1 154 ? 35.297 116.886 64.475  1.00 35.51 ? 154 PHE C CA  1 
ATOM   8696  C  C   . PHE C 1 154 ? 35.095 118.179 63.687  1.00 35.75 ? 154 PHE C C   1 
ATOM   8697  O  O   . PHE C 1 154 ? 35.269 119.276 64.225  1.00 35.65 ? 154 PHE C O   1 
ATOM   8698  C  CB  . PHE C 1 154 ? 36.769 116.472 64.384  1.00 35.31 ? 154 PHE C CB  1 
ATOM   8699  C  CG  . PHE C 1 154 ? 37.102 115.248 65.189  1.00 35.69 ? 154 PHE C CG  1 
ATOM   8700  C  CD1 . PHE C 1 154 ? 37.328 115.335 66.561  1.00 35.22 ? 154 PHE C CD1 1 
ATOM   8701  C  CD2 . PHE C 1 154 ? 37.162 113.995 64.580  1.00 35.92 ? 154 PHE C CD2 1 
ATOM   8702  C  CE1 . PHE C 1 154 ? 37.610 114.194 67.318  1.00 35.79 ? 154 PHE C CE1 1 
ATOM   8703  C  CE2 . PHE C 1 154 ? 37.443 112.847 65.329  1.00 35.97 ? 154 PHE C CE2 1 
ATOM   8704  C  CZ  . PHE C 1 154 ? 37.668 112.948 66.702  1.00 35.71 ? 154 PHE C CZ  1 
ATOM   8705  N  N   . ILE C 1 155 ? 34.745 118.061 62.414  1.00 35.41 ? 155 ILE C N   1 
ATOM   8706  C  CA  . ILE C 1 155 ? 34.557 119.238 61.587  1.00 35.45 ? 155 ILE C CA  1 
ATOM   8707  C  C   . ILE C 1 155 ? 33.265 119.156 60.794  1.00 36.31 ? 155 ILE C C   1 
ATOM   8708  O  O   . ILE C 1 155 ? 32.694 118.073 60.646  1.00 35.86 ? 155 ILE C O   1 
ATOM   8709  C  CB  . ILE C 1 155 ? 35.724 119.393 60.620  1.00 35.86 ? 155 ILE C CB  1 
ATOM   8710  C  CG1 . ILE C 1 155 ? 35.878 118.113 59.789  1.00 36.34 ? 155 ILE C CG1 1 
ATOM   8711  C  CG2 . ILE C 1 155 ? 36.987 119.706 61.391  1.00 34.71 ? 155 ILE C CG2 1 
ATOM   8712  C  CD1 . ILE C 1 155 ? 37.040 118.142 58.804  1.00 35.28 ? 155 ILE C CD1 1 
ATOM   8713  N  N   . ARG C 1 156 ? 32.803 120.297 60.278  1.00 36.60 ? 156 ARG C N   1 
ATOM   8714  C  CA  . ARG C 1 156 ? 31.560 120.306 59.516  1.00 36.50 ? 156 ARG C CA  1 
ATOM   8715  C  C   . ARG C 1 156 ? 31.648 120.763 58.071  1.00 36.65 ? 156 ARG C C   1 
ATOM   8716  O  O   . ARG C 1 156 ? 30.637 121.095 57.463  1.00 37.60 ? 156 ARG C O   1 
ATOM   8717  C  CB  . ARG C 1 156 ? 30.495 121.126 60.239  1.00 36.51 ? 156 ARG C CB  1 
ATOM   8718  C  CG  . ARG C 1 156 ? 30.924 122.516 60.633  1.00 37.02 ? 156 ARG C CG  1 
ATOM   8719  C  CD  . ARG C 1 156 ? 29.798 123.202 61.382  1.00 36.85 ? 156 ARG C CD  1 
ATOM   8720  N  NE  . ARG C 1 156 ? 30.286 124.325 62.165  1.00 37.42 ? 156 ARG C NE  1 
ATOM   8721  C  CZ  . ARG C 1 156 ? 30.331 124.345 63.490  1.00 36.42 ? 156 ARG C CZ  1 
ATOM   8722  N  NH1 . ARG C 1 156 ? 29.908 123.302 64.186  1.00 35.31 ? 156 ARG C NH1 1 
ATOM   8723  N  NH2 . ARG C 1 156 ? 30.820 125.406 64.113  1.00 35.93 ? 156 ARG C NH2 1 
ATOM   8724  N  N   . ASP C 1 157 ? 32.851 120.802 57.521  1.00 36.27 ? 157 ASP C N   1 
ATOM   8725  C  CA  . ASP C 1 157 ? 33.017 121.168 56.121  1.00 35.27 ? 157 ASP C CA  1 
ATOM   8726  C  C   . ASP C 1 157 ? 34.119 120.278 55.576  1.00 34.90 ? 157 ASP C C   1 
ATOM   8727  O  O   . ASP C 1 157 ? 35.234 120.277 56.090  1.00 35.52 ? 157 ASP C O   1 
ATOM   8728  C  CB  . ASP C 1 157 ? 33.394 122.633 55.953  1.00 34.59 ? 157 ASP C CB  1 
ATOM   8729  C  CG  . ASP C 1 157 ? 33.537 123.017 54.493  1.00 35.07 ? 157 ASP C CG  1 
ATOM   8730  O  OD1 . ASP C 1 157 ? 34.366 122.380 53.809  1.00 35.81 ? 157 ASP C OD1 1 
ATOM   8731  O  OD2 . ASP C 1 157 ? 32.829 123.939 54.026  1.00 33.18 ? 157 ASP C OD2 1 
ATOM   8732  N  N   . PRO C 1 158 ? 33.818 119.507 54.523  1.00 34.28 ? 158 PRO C N   1 
ATOM   8733  C  CA  . PRO C 1 158 ? 34.760 118.584 53.885  1.00 33.62 ? 158 PRO C CA  1 
ATOM   8734  C  C   . PRO C 1 158 ? 36.122 119.150 53.473  1.00 33.20 ? 158 PRO C C   1 
ATOM   8735  O  O   . PRO C 1 158 ? 37.095 118.405 53.380  1.00 33.64 ? 158 PRO C O   1 
ATOM   8736  C  CB  . PRO C 1 158 ? 33.965 118.058 52.693  1.00 34.47 ? 158 PRO C CB  1 
ATOM   8737  C  CG  . PRO C 1 158 ? 33.095 119.237 52.335  1.00 33.96 ? 158 PRO C CG  1 
ATOM   8738  C  CD  . PRO C 1 158 ? 32.611 119.676 53.694  1.00 34.16 ? 158 PRO C CD  1 
ATOM   8739  N  N   . ILE C 1 159 ? 36.215 120.453 53.245  1.00 32.39 ? 159 ILE C N   1 
ATOM   8740  C  CA  . ILE C 1 159 ? 37.496 121.023 52.827  1.00 32.64 ? 159 ILE C CA  1 
ATOM   8741  C  C   . ILE C 1 159 ? 38.567 121.015 53.936  1.00 31.94 ? 159 ILE C C   1 
ATOM   8742  O  O   . ILE C 1 159 ? 39.737 121.308 53.684  1.00 30.98 ? 159 ILE C O   1 
ATOM   8743  C  CB  . ILE C 1 159 ? 37.305 122.467 52.262  1.00 32.76 ? 159 ILE C CB  1 
ATOM   8744  C  CG1 . ILE C 1 159 ? 38.377 122.754 51.205  1.00 32.79 ? 159 ILE C CG1 1 
ATOM   8745  C  CG2 . ILE C 1 159 ? 37.372 123.490 53.384  1.00 32.11 ? 159 ILE C CG2 1 
ATOM   8746  C  CD1 . ILE C 1 159 ? 38.088 123.955 50.333  1.00 31.88 ? 159 ILE C CD1 1 
ATOM   8747  N  N   . LEU C 1 160 ? 38.164 120.678 55.160  1.00 31.69 ? 160 LEU C N   1 
ATOM   8748  C  CA  . LEU C 1 160 ? 39.108 120.608 56.274  1.00 31.82 ? 160 LEU C CA  1 
ATOM   8749  C  C   . LEU C 1 160 ? 39.482 119.171 56.598  1.00 31.38 ? 160 LEU C C   1 
ATOM   8750  O  O   . LEU C 1 160 ? 40.356 118.936 57.431  1.00 31.54 ? 160 LEU C O   1 
ATOM   8751  C  CB  . LEU C 1 160 ? 38.527 121.206 57.551  1.00 32.13 ? 160 LEU C CB  1 
ATOM   8752  C  CG  . LEU C 1 160 ? 38.025 122.637 57.570  1.00 32.98 ? 160 LEU C CG  1 
ATOM   8753  C  CD1 . LEU C 1 160 ? 38.066 123.145 59.015  1.00 33.08 ? 160 LEU C CD1 1 
ATOM   8754  C  CD2 . LEU C 1 160 ? 38.902 123.488 56.683  1.00 33.73 ? 160 LEU C CD2 1 
ATOM   8755  N  N   . PHE C 1 161 ? 38.821 118.214 55.953  1.00 30.51 ? 161 PHE C N   1 
ATOM   8756  C  CA  . PHE C 1 161 ? 39.087 116.821 56.247  1.00 30.38 ? 161 PHE C CA  1 
ATOM   8757  C  C   . PHE C 1 161 ? 40.522 116.396 55.945  1.00 31.25 ? 161 PHE C C   1 
ATOM   8758  O  O   . PHE C 1 161 ? 41.136 115.659 56.732  1.00 33.00 ? 161 PHE C O   1 
ATOM   8759  C  CB  . PHE C 1 161 ? 38.075 115.908 55.530  1.00 29.63 ? 161 PHE C CB  1 
ATOM   8760  C  CG  . PHE C 1 161 ? 38.131 114.478 55.984  1.00 27.76 ? 161 PHE C CG  1 
ATOM   8761  C  CD1 . PHE C 1 161 ? 38.858 113.533 55.272  1.00 27.81 ? 161 PHE C CD1 1 
ATOM   8762  C  CD2 . PHE C 1 161 ? 37.509 114.089 57.166  1.00 28.37 ? 161 PHE C CD2 1 
ATOM   8763  C  CE1 . PHE C 1 161 ? 38.970 112.219 55.732  1.00 27.23 ? 161 PHE C CE1 1 
ATOM   8764  C  CE2 . PHE C 1 161 ? 37.615 112.779 57.636  1.00 27.74 ? 161 PHE C CE2 1 
ATOM   8765  C  CZ  . PHE C 1 161 ? 38.348 111.844 56.913  1.00 27.50 ? 161 PHE C CZ  1 
ATOM   8766  N  N   . PRO C 1 162 ? 41.089 116.838 54.811  1.00 30.94 ? 162 PRO C N   1 
ATOM   8767  C  CA  . PRO C 1 162 ? 42.465 116.378 54.620  1.00 30.97 ? 162 PRO C CA  1 
ATOM   8768  C  C   . PRO C 1 162 ? 43.368 116.960 55.704  1.00 30.56 ? 162 PRO C C   1 
ATOM   8769  O  O   . PRO C 1 162 ? 44.225 116.271 56.244  1.00 30.94 ? 162 PRO C O   1 
ATOM   8770  C  CB  . PRO C 1 162 ? 42.811 116.894 53.228  1.00 30.14 ? 162 PRO C CB  1 
ATOM   8771  C  CG  . PRO C 1 162 ? 41.492 116.861 52.539  1.00 30.55 ? 162 PRO C CG  1 
ATOM   8772  C  CD  . PRO C 1 162 ? 40.569 117.449 53.578  1.00 30.39 ? 162 PRO C CD  1 
ATOM   8773  N  N   . SER C 1 163 ? 43.165 118.233 56.022  1.00 30.78 ? 163 SER C N   1 
ATOM   8774  C  CA  . SER C 1 163 ? 43.972 118.885 57.040  1.00 30.73 ? 163 SER C CA  1 
ATOM   8775  C  C   . SER C 1 163 ? 43.838 118.144 58.351  1.00 30.61 ? 163 SER C C   1 
ATOM   8776  O  O   . SER C 1 163 ? 44.831 117.770 58.971  1.00 30.28 ? 163 SER C O   1 
ATOM   8777  C  CB  . SER C 1 163 ? 43.539 120.335 57.208  1.00 30.79 ? 163 SER C CB  1 
ATOM   8778  O  OG  . SER C 1 163 ? 44.073 121.132 56.169  1.00 31.09 ? 163 SER C OG  1 
ATOM   8779  N  N   . PHE C 1 164 ? 42.602 117.923 58.766  1.00 30.90 ? 164 PHE C N   1 
ATOM   8780  C  CA  . PHE C 1 164 ? 42.354 117.214 60.007  1.00 32.04 ? 164 PHE C CA  1 
ATOM   8781  C  C   . PHE C 1 164 ? 43.046 115.855 60.027  1.00 32.78 ? 164 PHE C C   1 
ATOM   8782  O  O   . PHE C 1 164 ? 43.619 115.435 61.038  1.00 33.53 ? 164 PHE C O   1 
ATOM   8783  C  CB  . PHE C 1 164 ? 40.856 117.010 60.216  1.00 31.66 ? 164 PHE C CB  1 
ATOM   8784  C  CG  . PHE C 1 164 ? 40.541 116.076 61.336  1.00 31.49 ? 164 PHE C CG  1 
ATOM   8785  C  CD1 . PHE C 1 164 ? 41.000 116.343 62.622  1.00 31.56 ? 164 PHE C CD1 1 
ATOM   8786  C  CD2 . PHE C 1 164 ? 39.862 114.890 61.099  1.00 30.60 ? 164 PHE C CD2 1 
ATOM   8787  C  CE1 . PHE C 1 164 ? 40.793 115.428 63.655  1.00 31.46 ? 164 PHE C CE1 1 
ATOM   8788  C  CE2 . PHE C 1 164 ? 39.652 113.978 62.120  1.00 30.23 ? 164 PHE C CE2 1 
ATOM   8789  C  CZ  . PHE C 1 164 ? 40.119 114.243 63.400  1.00 30.05 ? 164 PHE C CZ  1 
ATOM   8790  N  N   . ILE C 1 165 ? 42.986 115.156 58.908  1.00 32.70 ? 165 ILE C N   1 
ATOM   8791  C  CA  . ILE C 1 165 ? 43.601 113.854 58.863  1.00 32.65 ? 165 ILE C CA  1 
ATOM   8792  C  C   . ILE C 1 165 ? 45.107 113.974 58.975  1.00 33.30 ? 165 ILE C C   1 
ATOM   8793  O  O   . ILE C 1 165 ? 45.731 113.234 59.735  1.00 34.69 ? 165 ILE C O   1 
ATOM   8794  C  CB  . ILE C 1 165 ? 43.190 113.095 57.586  1.00 32.07 ? 165 ILE C CB  1 
ATOM   8795  C  CG1 . ILE C 1 165 ? 41.693 112.795 57.662  1.00 29.65 ? 165 ILE C CG1 1 
ATOM   8796  C  CG2 . ILE C 1 165 ? 44.000 111.784 57.447  1.00 30.59 ? 165 ILE C CG2 1 
ATOM   8797  C  CD1 . ILE C 1 165 ? 41.311 111.976 58.893  1.00 27.98 ? 165 ILE C CD1 1 
ATOM   8798  N  N   . HIS C 1 166 ? 45.696 114.905 58.238  1.00 33.00 ? 166 HIS C N   1 
ATOM   8799  C  CA  . HIS C 1 166 ? 47.135 115.090 58.317  1.00 32.78 ? 166 HIS C CA  1 
ATOM   8800  C  C   . HIS C 1 166 ? 47.552 115.344 59.770  1.00 33.39 ? 166 HIS C C   1 
ATOM   8801  O  O   . HIS C 1 166 ? 48.518 114.762 60.252  1.00 34.14 ? 166 HIS C O   1 
ATOM   8802  C  CB  . HIS C 1 166 ? 47.577 116.271 57.447  1.00 31.36 ? 166 HIS C CB  1 
ATOM   8803  C  CG  . HIS C 1 166 ? 47.539 115.992 55.977  1.00 31.14 ? 166 HIS C CG  1 
ATOM   8804  N  ND1 . HIS C 1 166 ? 48.022 116.880 55.040  1.00 29.96 ? 166 HIS C ND1 1 
ATOM   8805  C  CD2 . HIS C 1 166 ? 47.075 114.925 55.280  1.00 30.82 ? 166 HIS C CD2 1 
ATOM   8806  C  CE1 . HIS C 1 166 ? 47.857 116.373 53.830  1.00 29.86 ? 166 HIS C CE1 1 
ATOM   8807  N  NE2 . HIS C 1 166 ? 47.286 115.188 53.948  1.00 29.55 ? 166 HIS C NE2 1 
ATOM   8808  N  N   . SER C 1 167 ? 46.816 116.202 60.468  1.00 33.35 ? 167 SER C N   1 
ATOM   8809  C  CA  . SER C 1 167 ? 47.146 116.534 61.848  1.00 33.78 ? 167 SER C CA  1 
ATOM   8810  C  C   . SER C 1 167 ? 47.045 115.355 62.822  1.00 35.08 ? 167 SER C C   1 
ATOM   8811  O  O   . SER C 1 167 ? 47.706 115.344 63.870  1.00 34.90 ? 167 SER C O   1 
ATOM   8812  C  CB  . SER C 1 167 ? 46.260 117.681 62.328  1.00 33.09 ? 167 SER C CB  1 
ATOM   8813  O  OG  . SER C 1 167 ? 44.901 117.317 62.286  1.00 32.07 ? 167 SER C OG  1 
ATOM   8814  N  N   . GLN C 1 168 ? 46.227 114.365 62.471  1.00 35.70 ? 168 GLN C N   1 
ATOM   8815  C  CA  . GLN C 1 168 ? 46.043 113.191 63.310  1.00 36.09 ? 168 GLN C CA  1 
ATOM   8816  C  C   . GLN C 1 168 ? 47.105 112.128 63.055  1.00 36.50 ? 168 GLN C C   1 
ATOM   8817  O  O   . GLN C 1 168 ? 47.294 111.211 63.874  1.00 37.65 ? 168 GLN C O   1 
ATOM   8818  C  CB  . GLN C 1 168 ? 44.662 112.585 63.068  1.00 36.41 ? 168 GLN C CB  1 
ATOM   8819  C  CG  . GLN C 1 168 ? 43.508 113.344 63.706  1.00 38.18 ? 168 GLN C CG  1 
ATOM   8820  C  CD  . GLN C 1 168 ? 43.563 113.349 65.231  1.00 38.59 ? 168 GLN C CD  1 
ATOM   8821  O  OE1 . GLN C 1 168 ? 43.774 112.313 65.865  1.00 39.24 ? 168 GLN C OE1 1 
ATOM   8822  N  NE2 . GLN C 1 168 ? 43.357 114.521 65.826  1.00 39.39 ? 168 GLN C NE2 1 
ATOM   8823  N  N   . LYS C 1 169 ? 47.794 112.248 61.924  1.00 35.05 ? 169 LYS C N   1 
ATOM   8824  C  CA  . LYS C 1 169 ? 48.832 111.290 61.555  1.00 34.42 ? 169 LYS C CA  1 
ATOM   8825  C  C   . LYS C 1 169 ? 50.252 111.773 61.846  1.00 33.42 ? 169 LYS C C   1 
ATOM   8826  O  O   . LYS C 1 169 ? 50.456 112.700 62.617  1.00 33.33 ? 169 LYS C O   1 
ATOM   8827  C  CB  . LYS C 1 169 ? 48.693 110.905 60.070  1.00 34.76 ? 169 LYS C CB  1 
ATOM   8828  C  CG  . LYS C 1 169 ? 47.545 109.924 59.803  1.00 34.28 ? 169 LYS C CG  1 
ATOM   8829  C  CD  . LYS C 1 169 ? 47.197 109.809 58.323  1.00 33.30 ? 169 LYS C CD  1 
ATOM   8830  C  CE  . LYS C 1 169 ? 46.129 108.739 58.067  1.00 32.88 ? 169 LYS C CE  1 
ATOM   8831  N  NZ  . LYS C 1 169 ? 46.574 107.361 58.441  1.00 32.55 ? 169 LYS C NZ  1 
ATOM   8832  N  N   . ARG C 1 170 ? 51.221 111.140 61.200  1.00 32.74 ? 170 ARG C N   1 
ATOM   8833  C  CA  . ARG C 1 170 ? 52.637 111.427 61.382  1.00 32.15 ? 170 ARG C CA  1 
ATOM   8834  C  C   . ARG C 1 170 ? 53.189 112.761 60.869  1.00 32.57 ? 170 ARG C C   1 
ATOM   8835  O  O   . ARG C 1 170 ? 52.739 113.287 59.856  1.00 33.80 ? 170 ARG C O   1 
ATOM   8836  C  CB  . ARG C 1 170 ? 53.426 110.293 60.748  1.00 31.52 ? 170 ARG C CB  1 
ATOM   8837  C  CG  . ARG C 1 170 ? 53.056 108.934 61.297  1.00 31.36 ? 170 ARG C CG  1 
ATOM   8838  C  CD  . ARG C 1 170 ? 53.552 107.798 60.428  1.00 29.66 ? 170 ARG C CD  1 
ATOM   8839  N  NE  . ARG C 1 170 ? 53.261 106.502 61.033  1.00 29.68 ? 170 ARG C NE  1 
ATOM   8840  C  CZ  . ARG C 1 170 ? 53.989 105.940 61.994  1.00 30.00 ? 170 ARG C CZ  1 
ATOM   8841  N  NH1 . ARG C 1 170 ? 55.067 106.547 62.476  1.00 29.19 ? 170 ARG C NH1 1 
ATOM   8842  N  NH2 . ARG C 1 170 ? 53.641 104.757 62.473  1.00 31.44 ? 170 ARG C NH2 1 
ATOM   8843  N  N   . ASN C 1 171 ? 54.174 113.299 61.585  1.00 31.84 ? 171 ASN C N   1 
ATOM   8844  C  CA  . ASN C 1 171 ? 54.842 114.533 61.196  1.00 31.64 ? 171 ASN C CA  1 
ATOM   8845  C  C   . ASN C 1 171 ? 55.412 114.263 59.792  1.00 31.64 ? 171 ASN C C   1 
ATOM   8846  O  O   . ASN C 1 171 ? 55.951 113.186 59.526  1.00 31.82 ? 171 ASN C O   1 
ATOM   8847  C  CB  . ASN C 1 171 ? 55.972 114.819 62.191  1.00 32.24 ? 171 ASN C CB  1 
ATOM   8848  C  CG  . ASN C 1 171 ? 56.699 116.113 61.905  1.00 33.09 ? 171 ASN C CG  1 
ATOM   8849  O  OD1 . ASN C 1 171 ? 57.436 116.232 60.918  1.00 32.86 ? 171 ASN C OD1 1 
ATOM   8850  N  ND2 . ASN C 1 171 ? 56.497 117.097 62.772  1.00 32.39 ? 171 ASN C ND2 1 
ATOM   8851  N  N   . PRO C 1 172 ? 55.312 115.233 58.876  1.00 31.12 ? 172 PRO C N   1 
ATOM   8852  C  CA  . PRO C 1 172 ? 55.840 114.985 57.528  1.00 31.21 ? 172 PRO C CA  1 
ATOM   8853  C  C   . PRO C 1 172 ? 57.347 114.831 57.414  1.00 31.72 ? 172 PRO C C   1 
ATOM   8854  O  O   . PRO C 1 172 ? 57.854 114.365 56.388  1.00 32.10 ? 172 PRO C O   1 
ATOM   8855  C  CB  . PRO C 1 172 ? 55.309 116.174 56.726  1.00 30.86 ? 172 PRO C CB  1 
ATOM   8856  C  CG  . PRO C 1 172 ? 55.247 117.261 57.740  1.00 30.98 ? 172 PRO C CG  1 
ATOM   8857  C  CD  . PRO C 1 172 ? 54.697 116.565 58.973  1.00 30.51 ? 172 PRO C CD  1 
ATOM   8858  N  N   . GLN C 1 173 ? 58.067 115.222 58.463  1.00 32.19 ? 173 GLN C N   1 
ATOM   8859  C  CA  . GLN C 1 173 ? 59.518 115.126 58.456  1.00 31.74 ? 173 GLN C CA  1 
ATOM   8860  C  C   . GLN C 1 173 ? 60.102 114.040 59.365  1.00 31.28 ? 173 GLN C C   1 
ATOM   8861  O  O   . GLN C 1 173 ? 60.952 113.256 58.933  1.00 30.40 ? 173 GLN C O   1 
ATOM   8862  C  CB  . GLN C 1 173 ? 60.130 116.470 58.819  1.00 33.00 ? 173 GLN C CB  1 
ATOM   8863  C  CG  . GLN C 1 173 ? 61.589 116.367 59.206  1.00 34.23 ? 173 GLN C CG  1 
ATOM   8864  C  CD  . GLN C 1 173 ? 62.219 117.707 59.363  1.00 35.37 ? 173 GLN C CD  1 
ATOM   8865  O  OE1 . GLN C 1 173 ? 61.647 118.596 59.985  1.00 36.61 ? 173 GLN C OE1 1 
ATOM   8866  N  NE2 . GLN C 1 173 ? 63.411 117.873 58.800  1.00 36.94 ? 173 GLN C NE2 1 
ATOM   8867  N  N   . THR C 1 174 ? 59.652 113.996 60.615  1.00 30.81 ? 174 THR C N   1 
ATOM   8868  C  CA  . THR C 1 174 ? 60.149 113.001 61.569  1.00 30.89 ? 174 THR C CA  1 
ATOM   8869  C  C   . THR C 1 174 ? 59.429 111.667 61.436  1.00 30.64 ? 174 THR C C   1 
ATOM   8870  O  O   . THR C 1 174 ? 59.968 110.618 61.792  1.00 30.69 ? 174 THR C O   1 
ATOM   8871  C  CB  . THR C 1 174 ? 59.980 113.483 63.023  1.00 31.40 ? 174 THR C CB  1 
ATOM   8872  O  OG1 . THR C 1 174 ? 58.583 113.665 63.319  1.00 32.88 ? 174 THR C OG1 1 
ATOM   8873  C  CG2 . THR C 1 174 ? 60.730 114.792 63.234  1.00 30.41 ? 174 THR C CG2 1 
ATOM   8874  N  N   . HIS C 1 175 ? 58.206 111.729 60.920  1.00 30.96 ? 175 HIS C N   1 
ATOM   8875  C  CA  . HIS C 1 175 ? 57.360 110.557 60.721  1.00 30.28 ? 175 HIS C CA  1 
ATOM   8876  C  C   . HIS C 1 175 ? 56.890 110.049 62.077  1.00 29.83 ? 175 HIS C C   1 
ATOM   8877  O  O   . HIS C 1 175 ? 56.578 108.881 62.232  1.00 28.85 ? 175 HIS C O   1 
ATOM   8878  C  CB  . HIS C 1 175 ? 58.141 109.463 59.980  1.00 29.96 ? 175 HIS C CB  1 
ATOM   8879  C  CG  . HIS C 1 175 ? 57.273 108.443 59.309  1.00 30.12 ? 175 HIS C CG  1 
ATOM   8880  N  ND1 . HIS C 1 175 ? 56.339 108.773 58.350  1.00 29.48 ? 175 HIS C ND1 1 
ATOM   8881  C  CD2 . HIS C 1 175 ? 57.226 107.094 59.429  1.00 29.48 ? 175 HIS C CD2 1 
ATOM   8882  C  CE1 . HIS C 1 175 ? 55.757 107.673 57.908  1.00 28.47 ? 175 HIS C CE1 1 
ATOM   8883  N  NE2 . HIS C 1 175 ? 56.276 106.640 58.546  1.00 27.96 ? 175 HIS C NE2 1 
ATOM   8884  N  N   . LEU C 1 176 ? 56.843 110.945 63.058  1.00 30.87 ? 176 LEU C N   1 
ATOM   8885  C  CA  . LEU C 1 176 ? 56.409 110.595 64.412  1.00 31.72 ? 176 LEU C CA  1 
ATOM   8886  C  C   . LEU C 1 176 ? 55.054 111.224 64.714  1.00 32.25 ? 176 LEU C C   1 
ATOM   8887  O  O   . LEU C 1 176 ? 54.669 112.204 64.084  1.00 31.60 ? 176 LEU C O   1 
ATOM   8888  C  CB  . LEU C 1 176 ? 57.424 111.106 65.438  1.00 31.73 ? 176 LEU C CB  1 
ATOM   8889  C  CG  . LEU C 1 176 ? 58.908 110.825 65.187  1.00 33.03 ? 176 LEU C CG  1 
ATOM   8890  C  CD1 . LEU C 1 176 ? 59.713 111.393 66.331  1.00 32.15 ? 176 LEU C CD1 1 
ATOM   8891  C  CD2 . LEU C 1 176 ? 59.157 109.324 65.063  1.00 32.47 ? 176 LEU C CD2 1 
ATOM   8892  N  N   . LYS C 1 177 ? 54.317 110.655 65.666  1.00 33.69 ? 177 LYS C N   1 
ATOM   8893  C  CA  . LYS C 1 177 ? 53.038 111.243 66.035  1.00 34.88 ? 177 LYS C CA  1 
ATOM   8894  C  C   . LYS C 1 177 ? 53.392 112.625 66.569  1.00 35.23 ? 177 LYS C C   1 
ATOM   8895  O  O   . LYS C 1 177 ? 54.457 112.814 67.149  1.00 34.18 ? 177 LYS C O   1 
ATOM   8896  C  CB  . LYS C 1 177 ? 52.331 110.417 67.105  1.00 36.32 ? 177 LYS C CB  1 
ATOM   8897  C  CG  . LYS C 1 177 ? 51.778 109.083 66.600  1.00 39.52 ? 177 LYS C CG  1 
ATOM   8898  C  CD  . LYS C 1 177 ? 51.134 109.226 65.209  1.00 40.85 ? 177 LYS C CD  1 
ATOM   8899  C  CE  . LYS C 1 177 ? 50.341 107.984 64.808  1.00 41.58 ? 177 LYS C CE  1 
ATOM   8900  N  NZ  . LYS C 1 177 ? 48.959 108.001 65.388  1.00 42.56 ? 177 LYS C NZ  1 
ATOM   8901  N  N   . ASP C 1 178 ? 52.501 113.590 66.375  1.00 36.52 ? 178 ASP C N   1 
ATOM   8902  C  CA  . ASP C 1 178 ? 52.789 114.952 66.786  1.00 37.14 ? 178 ASP C CA  1 
ATOM   8903  C  C   . ASP C 1 178 ? 51.631 115.700 67.468  1.00 37.66 ? 178 ASP C C   1 
ATOM   8904  O  O   . ASP C 1 178 ? 50.712 116.192 66.810  1.00 37.75 ? 178 ASP C O   1 
ATOM   8905  C  CB  . ASP C 1 178 ? 53.285 115.710 65.551  1.00 36.86 ? 178 ASP C CB  1 
ATOM   8906  C  CG  . ASP C 1 178 ? 53.831 117.070 65.886  1.00 38.36 ? 178 ASP C CG  1 
ATOM   8907  O  OD1 . ASP C 1 178 ? 54.541 117.637 65.027  1.00 38.15 ? 178 ASP C OD1 1 
ATOM   8908  O  OD2 . ASP C 1 178 ? 53.541 117.579 66.995  1.00 38.68 ? 178 ASP C OD2 1 
ATOM   8909  N  N   . PRO C 1 179 ? 51.674 115.794 68.808  1.00 38.13 ? 179 PRO C N   1 
ATOM   8910  C  CA  . PRO C 1 179 ? 50.673 116.465 69.642  1.00 38.45 ? 179 PRO C CA  1 
ATOM   8911  C  C   . PRO C 1 179 ? 50.457 117.936 69.268  1.00 38.84 ? 179 PRO C C   1 
ATOM   8912  O  O   . PRO C 1 179 ? 49.340 118.452 69.359  1.00 38.01 ? 179 PRO C O   1 
ATOM   8913  C  CB  . PRO C 1 179 ? 51.243 116.307 71.047  1.00 38.07 ? 179 PRO C CB  1 
ATOM   8914  C  CG  . PRO C 1 179 ? 51.908 114.998 70.968  1.00 38.56 ? 179 PRO C CG  1 
ATOM   8915  C  CD  . PRO C 1 179 ? 52.656 115.106 69.659  1.00 38.34 ? 179 PRO C CD  1 
ATOM   8916  N  N   . ASP C 1 180 ? 51.525 118.617 68.863  1.00 38.85 ? 180 ASP C N   1 
ATOM   8917  C  CA  . ASP C 1 180 ? 51.379 120.010 68.476  1.00 39.27 ? 180 ASP C CA  1 
ATOM   8918  C  C   . ASP C 1 180 ? 50.481 120.042 67.244  1.00 38.70 ? 180 ASP C C   1 
ATOM   8919  O  O   . ASP C 1 180 ? 49.642 120.928 67.097  1.00 38.42 ? 180 ASP C O   1 
ATOM   8920  C  CB  . ASP C 1 180 ? 52.751 120.644 68.192  1.00 40.44 ? 180 ASP C CB  1 
ATOM   8921  C  CG  . ASP C 1 180 ? 53.504 121.039 69.485  1.00 42.82 ? 180 ASP C CG  1 
ATOM   8922  O  OD1 . ASP C 1 180 ? 53.006 120.731 70.600  1.00 43.69 ? 180 ASP C OD1 1 
ATOM   8923  O  OD2 . ASP C 1 180 ? 54.597 121.656 69.387  1.00 42.59 ? 180 ASP C OD2 1 
ATOM   8924  N  N   . MET C 1 181 ? 50.641 119.058 66.366  1.00 38.31 ? 181 MET C N   1 
ATOM   8925  C  CA  . MET C 1 181 ? 49.805 118.993 65.170  1.00 38.46 ? 181 MET C CA  1 
ATOM   8926  C  C   . MET C 1 181 ? 48.358 118.683 65.546  1.00 37.68 ? 181 MET C C   1 
ATOM   8927  O  O   . MET C 1 181 ? 47.420 119.302 65.044  1.00 36.31 ? 181 MET C O   1 
ATOM   8928  C  CB  . MET C 1 181 ? 50.310 117.915 64.217  1.00 38.88 ? 181 MET C CB  1 
ATOM   8929  C  CG  . MET C 1 181 ? 51.620 118.246 63.550  1.00 40.12 ? 181 MET C CG  1 
ATOM   8930  S  SD  . MET C 1 181 ? 52.049 117.005 62.333  1.00 41.70 ? 181 MET C SD  1 
ATOM   8931  C  CE  . MET C 1 181 ? 51.877 117.979 60.837  1.00 42.84 ? 181 MET C CE  1 
ATOM   8932  N  N   . VAL C 1 182 ? 48.188 117.706 66.428  1.00 37.36 ? 182 VAL C N   1 
ATOM   8933  C  CA  . VAL C 1 182 ? 46.862 117.313 66.875  1.00 36.97 ? 182 VAL C CA  1 
ATOM   8934  C  C   . VAL C 1 182 ? 46.092 118.499 67.449  1.00 36.98 ? 182 VAL C C   1 
ATOM   8935  O  O   . VAL C 1 182 ? 45.030 118.878 66.940  1.00 37.82 ? 182 VAL C O   1 
ATOM   8936  C  CB  . VAL C 1 182 ? 46.955 116.191 67.943  1.00 36.60 ? 182 VAL C CB  1 
ATOM   8937  C  CG1 . VAL C 1 182 ? 45.619 116.005 68.655  1.00 36.16 ? 182 VAL C CG1 1 
ATOM   8938  C  CG2 . VAL C 1 182 ? 47.371 114.896 67.275  1.00 35.79 ? 182 VAL C CG2 1 
ATOM   8939  N  N   . TRP C 1 183 ? 46.650 119.099 68.494  1.00 36.31 ? 183 TRP C N   1 
ATOM   8940  C  CA  . TRP C 1 183 ? 46.011 120.217 69.168  1.00 34.85 ? 183 TRP C CA  1 
ATOM   8941  C  C   . TRP C 1 183 ? 46.044 121.570 68.490  1.00 34.01 ? 183 TRP C C   1 
ATOM   8942  O  O   . TRP C 1 183 ? 45.144 122.368 68.700  1.00 35.11 ? 183 TRP C O   1 
ATOM   8943  C  CB  . TRP C 1 183 ? 46.547 120.307 70.587  1.00 33.96 ? 183 TRP C CB  1 
ATOM   8944  C  CG  . TRP C 1 183 ? 46.221 119.060 71.321  1.00 33.38 ? 183 TRP C CG  1 
ATOM   8945  C  CD1 . TRP C 1 183 ? 47.005 117.952 71.455  1.00 32.52 ? 183 TRP C CD1 1 
ATOM   8946  C  CD2 . TRP C 1 183 ? 44.973 118.746 71.940  1.00 33.71 ? 183 TRP C CD2 1 
ATOM   8947  N  NE1 . TRP C 1 183 ? 46.321 116.965 72.117  1.00 32.02 ? 183 TRP C NE1 1 
ATOM   8948  C  CE2 . TRP C 1 183 ? 45.068 117.427 72.425  1.00 33.42 ? 183 TRP C CE2 1 
ATOM   8949  C  CE3 . TRP C 1 183 ? 43.777 119.454 72.130  1.00 33.75 ? 183 TRP C CE3 1 
ATOM   8950  C  CZ2 . TRP C 1 183 ? 44.011 116.796 73.092  1.00 34.77 ? 183 TRP C CZ2 1 
ATOM   8951  C  CZ3 . TRP C 1 183 ? 42.731 118.829 72.793  1.00 34.27 ? 183 TRP C CZ3 1 
ATOM   8952  C  CH2 . TRP C 1 183 ? 42.854 117.512 73.267  1.00 34.14 ? 183 TRP C CH2 1 
ATOM   8953  N  N   . ASP C 1 184 ? 47.055 121.858 67.687  1.00 33.72 ? 184 ASP C N   1 
ATOM   8954  C  CA  . ASP C 1 184 ? 47.044 123.138 66.998  1.00 34.45 ? 184 ASP C CA  1 
ATOM   8955  C  C   . ASP C 1 184 ? 45.754 123.148 66.162  1.00 34.99 ? 184 ASP C C   1 
ATOM   8956  O  O   . ASP C 1 184 ? 44.981 124.102 66.190  1.00 35.08 ? 184 ASP C O   1 
ATOM   8957  C  CB  . ASP C 1 184 ? 48.265 123.290 66.085  1.00 33.87 ? 184 ASP C CB  1 
ATOM   8958  C  CG  . ASP C 1 184 ? 48.357 124.679 65.467  1.00 33.95 ? 184 ASP C CG  1 
ATOM   8959  O  OD1 . ASP C 1 184 ? 47.982 125.644 66.162  1.00 33.25 ? 184 ASP C OD1 1 
ATOM   8960  O  OD2 . ASP C 1 184 ? 48.808 124.815 64.304  1.00 33.27 ? 184 ASP C OD2 1 
ATOM   8961  N  N   . PHE C 1 185 ? 45.507 122.064 65.439  1.00 35.85 ? 185 PHE C N   1 
ATOM   8962  C  CA  . PHE C 1 185 ? 44.313 121.983 64.620  1.00 36.53 ? 185 PHE C CA  1 
ATOM   8963  C  C   . PHE C 1 185 ? 43.032 122.098 65.462  1.00 37.18 ? 185 PHE C C   1 
ATOM   8964  O  O   . PHE C 1 185 ? 42.174 122.951 65.195  1.00 37.27 ? 185 PHE C O   1 
ATOM   8965  C  CB  . PHE C 1 185 ? 44.277 120.669 63.830  1.00 35.38 ? 185 PHE C CB  1 
ATOM   8966  C  CG  . PHE C 1 185 ? 43.192 120.639 62.786  1.00 34.69 ? 185 PHE C CG  1 
ATOM   8967  C  CD1 . PHE C 1 185 ? 43.360 121.302 61.573  1.00 33.67 ? 185 PHE C CD1 1 
ATOM   8968  C  CD2 . PHE C 1 185 ? 41.970 120.030 63.049  1.00 33.65 ? 185 PHE C CD2 1 
ATOM   8969  C  CE1 . PHE C 1 185 ? 42.331 121.361 60.645  1.00 33.27 ? 185 PHE C CE1 1 
ATOM   8970  C  CE2 . PHE C 1 185 ? 40.930 120.087 62.121  1.00 33.81 ? 185 PHE C CE2 1 
ATOM   8971  C  CZ  . PHE C 1 185 ? 41.109 120.753 60.920  1.00 33.06 ? 185 PHE C CZ  1 
ATOM   8972  N  N   . TRP C 1 186 ? 42.895 121.238 66.469  1.00 36.82 ? 186 TRP C N   1 
ATOM   8973  C  CA  . TRP C 1 186 ? 41.705 121.265 67.314  1.00 36.54 ? 186 TRP C CA  1 
ATOM   8974  C  C   . TRP C 1 186 ? 41.485 122.564 68.092  1.00 37.09 ? 186 TRP C C   1 
ATOM   8975  O  O   . TRP C 1 186 ? 40.358 122.881 68.464  1.00 38.36 ? 186 TRP C O   1 
ATOM   8976  C  CB  . TRP C 1 186 ? 41.720 120.096 68.297  1.00 36.11 ? 186 TRP C CB  1 
ATOM   8977  C  CG  . TRP C 1 186 ? 41.325 118.777 67.708  1.00 35.79 ? 186 TRP C CG  1 
ATOM   8978  C  CD1 . TRP C 1 186 ? 40.596 118.564 66.565  1.00 35.27 ? 186 TRP C CD1 1 
ATOM   8979  C  CD2 . TRP C 1 186 ? 41.571 117.485 68.274  1.00 35.59 ? 186 TRP C CD2 1 
ATOM   8980  N  NE1 . TRP C 1 186 ? 40.372 117.216 66.391  1.00 35.31 ? 186 TRP C NE1 1 
ATOM   8981  C  CE2 . TRP C 1 186 ? 40.959 116.531 67.425  1.00 36.29 ? 186 TRP C CE2 1 
ATOM   8982  C  CE3 . TRP C 1 186 ? 42.247 117.039 69.417  1.00 35.95 ? 186 TRP C CE3 1 
ATOM   8983  C  CZ2 . TRP C 1 186 ? 41.006 115.150 67.688  1.00 36.74 ? 186 TRP C CZ2 1 
ATOM   8984  C  CZ3 . TRP C 1 186 ? 42.291 115.664 69.680  1.00 36.61 ? 186 TRP C CZ3 1 
ATOM   8985  C  CH2 . TRP C 1 186 ? 41.674 114.739 68.818  1.00 36.54 ? 186 TRP C CH2 1 
ATOM   8986  N  N   . SER C 1 187 ? 42.548 123.315 68.354  1.00 37.71 ? 187 SER C N   1 
ATOM   8987  C  CA  . SER C 1 187 ? 42.403 124.566 69.093  1.00 37.38 ? 187 SER C CA  1 
ATOM   8988  C  C   . SER C 1 187 ? 42.057 125.718 68.148  1.00 37.29 ? 187 SER C C   1 
ATOM   8989  O  O   . SER C 1 187 ? 41.439 126.703 68.564  1.00 37.29 ? 187 SER C O   1 
ATOM   8990  C  CB  . SER C 1 187 ? 43.683 124.885 69.868  1.00 36.44 ? 187 SER C CB  1 
ATOM   8991  O  OG  . SER C 1 187 ? 44.748 125.179 68.985  1.00 36.28 ? 187 SER C OG  1 
ATOM   8992  N  N   . LEU C 1 188 ? 42.458 125.604 66.882  1.00 37.35 ? 188 LEU C N   1 
ATOM   8993  C  CA  . LEU C 1 188 ? 42.147 126.648 65.901  1.00 37.22 ? 188 LEU C CA  1 
ATOM   8994  C  C   . LEU C 1 188 ? 40.777 126.350 65.307  1.00 37.42 ? 188 LEU C C   1 
ATOM   8995  O  O   . LEU C 1 188 ? 40.179 127.202 64.660  1.00 38.41 ? 188 LEU C O   1 
ATOM   8996  C  CB  . LEU C 1 188 ? 43.196 126.706 64.778  1.00 36.43 ? 188 LEU C CB  1 
ATOM   8997  C  CG  . LEU C 1 188 ? 44.616 127.162 65.149  1.00 36.31 ? 188 LEU C CG  1 
ATOM   8998  C  CD1 . LEU C 1 188 ? 45.567 127.043 63.950  1.00 35.53 ? 188 LEU C CD1 1 
ATOM   8999  C  CD2 . LEU C 1 188 ? 44.555 128.592 65.643  1.00 35.48 ? 188 LEU C CD2 1 
ATOM   9000  N  N   . ARG C 1 189 ? 40.288 125.132 65.529  1.00 37.43 ? 189 ARG C N   1 
ATOM   9001  C  CA  . ARG C 1 189 ? 38.983 124.723 65.028  1.00 37.37 ? 189 ARG C CA  1 
ATOM   9002  C  C   . ARG C 1 189 ? 38.198 124.126 66.186  1.00 37.59 ? 189 ARG C C   1 
ATOM   9003  O  O   . ARG C 1 189 ? 38.058 122.905 66.291  1.00 37.92 ? 189 ARG C O   1 
ATOM   9004  C  CB  . ARG C 1 189 ? 39.141 123.695 63.906  1.00 37.46 ? 189 ARG C CB  1 
ATOM   9005  C  CG  . ARG C 1 189 ? 39.953 124.200 62.716  1.00 37.82 ? 189 ARG C CG  1 
ATOM   9006  C  CD  . ARG C 1 189 ? 39.389 125.505 62.136  1.00 37.92 ? 189 ARG C CD  1 
ATOM   9007  N  NE  . ARG C 1 189 ? 38.012 125.339 61.672  1.00 39.10 ? 189 ARG C NE  1 
ATOM   9008  C  CZ  . ARG C 1 189 ? 37.418 126.107 60.760  1.00 39.12 ? 189 ARG C CZ  1 
ATOM   9009  N  NH1 . ARG C 1 189 ? 38.076 127.113 60.194  1.00 38.30 ? 189 ARG C NH1 1 
ATOM   9010  N  NH2 . ARG C 1 189 ? 36.157 125.866 60.418  1.00 38.92 ? 189 ARG C NH2 1 
ATOM   9011  N  N   . PRO C 1 190 ? 37.662 124.990 67.066  1.00 37.32 ? 190 PRO C N   1 
ATOM   9012  C  CA  . PRO C 1 190 ? 36.876 124.658 68.260  1.00 37.57 ? 190 PRO C CA  1 
ATOM   9013  C  C   . PRO C 1 190 ? 35.573 123.924 68.014  1.00 37.63 ? 190 PRO C C   1 
ATOM   9014  O  O   . PRO C 1 190 ? 35.000 123.359 68.950  1.00 37.27 ? 190 PRO C O   1 
ATOM   9015  C  CB  . PRO C 1 190 ? 36.638 126.017 68.905  1.00 37.25 ? 190 PRO C CB  1 
ATOM   9016  C  CG  . PRO C 1 190 ? 36.502 126.896 67.728  1.00 37.77 ? 190 PRO C CG  1 
ATOM   9017  C  CD  . PRO C 1 190 ? 37.650 126.445 66.843  1.00 37.36 ? 190 PRO C CD  1 
ATOM   9018  N  N   . GLU C 1 191 ? 35.100 123.938 66.769  1.00 37.62 ? 191 GLU C N   1 
ATOM   9019  C  CA  . GLU C 1 191 ? 33.851 123.258 66.441  1.00 38.04 ? 191 GLU C CA  1 
ATOM   9020  C  C   . GLU C 1 191 ? 33.989 121.798 66.840  1.00 38.38 ? 191 GLU C C   1 
ATOM   9021  O  O   . GLU C 1 191 ? 32.999 121.104 67.090  1.00 39.38 ? 191 GLU C O   1 
ATOM   9022  C  CB  . GLU C 1 191 ? 33.554 123.359 64.941  1.00 38.15 ? 191 GLU C CB  1 
ATOM   9023  C  CG  . GLU C 1 191 ? 34.544 122.630 64.061  1.00 39.11 ? 191 GLU C CG  1 
ATOM   9024  C  CD  . GLU C 1 191 ? 35.423 123.568 63.272  1.00 40.34 ? 191 GLU C CD  1 
ATOM   9025  O  OE1 . GLU C 1 191 ? 36.079 124.441 63.892  1.00 40.57 ? 191 GLU C OE1 1 
ATOM   9026  O  OE2 . GLU C 1 191 ? 35.453 123.422 62.028  1.00 41.13 ? 191 GLU C OE2 1 
ATOM   9027  N  N   . SER C 1 192 ? 35.241 121.353 66.905  1.00 38.21 ? 192 SER C N   1 
ATOM   9028  C  CA  . SER C 1 192 ? 35.593 119.987 67.260  1.00 38.27 ? 192 SER C CA  1 
ATOM   9029  C  C   . SER C 1 192 ? 35.241 119.587 68.700  1.00 38.61 ? 192 SER C C   1 
ATOM   9030  O  O   . SER C 1 192 ? 35.123 118.397 69.002  1.00 39.46 ? 192 SER C O   1 
ATOM   9031  C  CB  . SER C 1 192 ? 37.094 119.786 67.037  1.00 38.19 ? 192 SER C CB  1 
ATOM   9032  O  OG  . SER C 1 192 ? 37.866 120.703 67.805  1.00 37.50 ? 192 SER C OG  1 
ATOM   9033  N  N   . LEU C 1 193 ? 35.076 120.573 69.578  1.00 38.15 ? 193 LEU C N   1 
ATOM   9034  C  CA  . LEU C 1 193 ? 34.770 120.333 70.992  1.00 38.17 ? 193 LEU C CA  1 
ATOM   9035  C  C   . LEU C 1 193 ? 33.802 119.191 71.292  1.00 38.22 ? 193 LEU C C   1 
ATOM   9036  O  O   . LEU C 1 193 ? 34.020 118.388 72.196  1.00 37.48 ? 193 LEU C O   1 
ATOM   9037  C  CB  . LEU C 1 193 ? 34.240 121.622 71.626  1.00 38.23 ? 193 LEU C CB  1 
ATOM   9038  C  CG  . LEU C 1 193 ? 35.238 122.770 71.793  1.00 37.19 ? 193 LEU C CG  1 
ATOM   9039  C  CD1 . LEU C 1 193 ? 34.486 124.022 72.112  1.00 38.02 ? 193 LEU C CD1 1 
ATOM   9040  C  CD2 . LEU C 1 193 ? 36.237 122.456 72.892  1.00 37.24 ? 193 LEU C CD2 1 
ATOM   9041  N  N   . HIS C 1 194 ? 32.731 119.110 70.521  1.00 39.20 ? 194 HIS C N   1 
ATOM   9042  C  CA  . HIS C 1 194 ? 31.740 118.072 70.741  1.00 39.15 ? 194 HIS C CA  1 
ATOM   9043  C  C   . HIS C 1 194 ? 32.307 116.657 70.597  1.00 39.21 ? 194 HIS C C   1 
ATOM   9044  O  O   . HIS C 1 194 ? 32.346 115.888 71.560  1.00 39.32 ? 194 HIS C O   1 
ATOM   9045  C  CB  . HIS C 1 194 ? 30.582 118.279 69.774  1.00 38.88 ? 194 HIS C CB  1 
ATOM   9046  C  CG  . HIS C 1 194 ? 29.293 117.694 70.246  1.00 39.50 ? 194 HIS C CG  1 
ATOM   9047  N  ND1 . HIS C 1 194 ? 28.121 117.805 69.531  1.00 39.71 ? 194 HIS C ND1 1 
ATOM   9048  C  CD2 . HIS C 1 194 ? 28.990 116.982 71.358  1.00 40.33 ? 194 HIS C CD2 1 
ATOM   9049  C  CE1 . HIS C 1 194 ? 27.152 117.186 70.183  1.00 40.81 ? 194 HIS C CE1 1 
ATOM   9050  N  NE2 . HIS C 1 194 ? 27.653 116.677 71.295  1.00 40.32 ? 194 HIS C NE2 1 
ATOM   9051  N  N   . GLN C 1 195 ? 32.755 116.321 69.393  1.00 39.36 ? 195 GLN C N   1 
ATOM   9052  C  CA  . GLN C 1 195 ? 33.300 114.993 69.118  1.00 39.17 ? 195 GLN C CA  1 
ATOM   9053  C  C   . GLN C 1 195 ? 34.586 114.716 69.877  1.00 38.79 ? 195 GLN C C   1 
ATOM   9054  O  O   . GLN C 1 195 ? 34.938 113.561 70.103  1.00 38.72 ? 195 GLN C O   1 
ATOM   9055  C  CB  . GLN C 1 195 ? 33.522 114.821 67.606  1.00 39.01 ? 195 GLN C CB  1 
ATOM   9056  C  CG  . GLN C 1 195 ? 34.204 113.530 67.180  1.00 38.78 ? 195 GLN C CG  1 
ATOM   9057  C  CD  . GLN C 1 195 ? 33.655 112.291 67.873  1.00 38.69 ? 195 GLN C CD  1 
ATOM   9058  O  OE1 . GLN C 1 195 ? 32.457 112.174 68.114  1.00 38.58 ? 195 GLN C OE1 1 
ATOM   9059  N  NE2 . GLN C 1 195 ? 34.541 111.349 68.178  1.00 38.81 ? 195 GLN C NE2 1 
ATOM   9060  N  N   . VAL C 1 196 ? 35.298 115.769 70.259  1.00 39.04 ? 196 VAL C N   1 
ATOM   9061  C  CA  . VAL C 1 196 ? 36.530 115.586 71.019  1.00 39.58 ? 196 VAL C CA  1 
ATOM   9062  C  C   . VAL C 1 196 ? 36.163 115.141 72.427  1.00 40.71 ? 196 VAL C C   1 
ATOM   9063  O  O   . VAL C 1 196 ? 36.824 114.270 73.005  1.00 40.97 ? 196 VAL C O   1 
ATOM   9064  C  CB  . VAL C 1 196 ? 37.341 116.883 71.114  1.00 38.63 ? 196 VAL C CB  1 
ATOM   9065  C  CG1 . VAL C 1 196 ? 38.498 116.706 72.088  1.00 37.82 ? 196 VAL C CG1 1 
ATOM   9066  C  CG2 . VAL C 1 196 ? 37.861 117.255 69.742  1.00 38.55 ? 196 VAL C CG2 1 
ATOM   9067  N  N   . SER C 1 197 ? 35.100 115.742 72.965  1.00 41.28 ? 197 SER C N   1 
ATOM   9068  C  CA  . SER C 1 197 ? 34.620 115.422 74.306  1.00 41.94 ? 197 SER C CA  1 
ATOM   9069  C  C   . SER C 1 197 ? 34.148 113.981 74.341  1.00 42.29 ? 197 SER C C   1 
ATOM   9070  O  O   . SER C 1 197 ? 34.152 113.336 75.391  1.00 42.57 ? 197 SER C O   1 
ATOM   9071  C  CB  . SER C 1 197 ? 33.466 116.346 74.692  1.00 41.80 ? 197 SER C CB  1 
ATOM   9072  O  OG  . SER C 1 197 ? 33.901 117.692 74.727  1.00 43.07 ? 197 SER C OG  1 
ATOM   9073  N  N   . PHE C 1 198 ? 33.731 113.482 73.185  1.00 42.38 ? 198 PHE C N   1 
ATOM   9074  C  CA  . PHE C 1 198 ? 33.265 112.111 73.079  1.00 42.79 ? 198 PHE C CA  1 
ATOM   9075  C  C   . PHE C 1 198 ? 34.465 111.177 72.910  1.00 42.42 ? 198 PHE C C   1 
ATOM   9076  O  O   . PHE C 1 198 ? 34.528 110.138 73.558  1.00 42.13 ? 198 PHE C O   1 
ATOM   9077  C  CB  . PHE C 1 198 ? 32.296 111.993 71.894  1.00 44.02 ? 198 PHE C CB  1 
ATOM   9078  C  CG  . PHE C 1 198 ? 31.770 110.598 71.658  1.00 45.57 ? 198 PHE C CG  1 
ATOM   9079  C  CD1 . PHE C 1 198 ? 32.471 109.697 70.844  1.00 45.86 ? 198 PHE C CD1 1 
ATOM   9080  C  CD2 . PHE C 1 198 ? 30.564 110.189 72.232  1.00 45.36 ? 198 PHE C CD2 1 
ATOM   9081  C  CE1 . PHE C 1 198 ? 31.976 108.409 70.601  1.00 45.74 ? 198 PHE C CE1 1 
ATOM   9082  C  CE2 . PHE C 1 198 ? 30.057 108.904 72.000  1.00 45.77 ? 198 PHE C CE2 1 
ATOM   9083  C  CZ  . PHE C 1 198 ? 30.764 108.012 71.181  1.00 46.47 ? 198 PHE C CZ  1 
ATOM   9084  N  N   . LEU C 1 199 ? 35.421 111.572 72.060  1.00 42.73 ? 199 LEU C N   1 
ATOM   9085  C  CA  . LEU C 1 199 ? 36.624 110.779 71.773  1.00 41.97 ? 199 LEU C CA  1 
ATOM   9086  C  C   . LEU C 1 199 ? 37.470 110.531 72.999  1.00 42.85 ? 199 LEU C C   1 
ATOM   9087  O  O   . LEU C 1 199 ? 38.180 109.526 73.079  1.00 42.74 ? 199 LEU C O   1 
ATOM   9088  C  CB  . LEU C 1 199 ? 37.495 111.467 70.721  1.00 41.58 ? 199 LEU C CB  1 
ATOM   9089  C  CG  . LEU C 1 199 ? 38.849 110.795 70.409  1.00 40.68 ? 199 LEU C CG  1 
ATOM   9090  C  CD1 . LEU C 1 199 ? 38.609 109.445 69.749  1.00 39.99 ? 199 LEU C CD1 1 
ATOM   9091  C  CD2 . LEU C 1 199 ? 39.691 111.682 69.496  1.00 39.51 ? 199 LEU C CD2 1 
ATOM   9092  N  N   . PHE C 1 200 ? 37.415 111.458 73.948  1.00 43.60 ? 200 PHE C N   1 
ATOM   9093  C  CA  . PHE C 1 200 ? 38.185 111.306 75.168  1.00 44.53 ? 200 PHE C CA  1 
ATOM   9094  C  C   . PHE C 1 200 ? 37.379 110.786 76.348  1.00 44.80 ? 200 PHE C C   1 
ATOM   9095  O  O   . PHE C 1 200 ? 37.871 110.756 77.474  1.00 45.30 ? 200 PHE C O   1 
ATOM   9096  C  CB  . PHE C 1 200 ? 38.871 112.619 75.528  1.00 45.16 ? 200 PHE C CB  1 
ATOM   9097  C  CG  . PHE C 1 200 ? 40.061 112.908 74.682  1.00 45.88 ? 200 PHE C CG  1 
ATOM   9098  C  CD1 . PHE C 1 200 ? 39.915 113.488 73.431  1.00 46.58 ? 200 PHE C CD1 1 
ATOM   9099  C  CD2 . PHE C 1 200 ? 41.327 112.526 75.099  1.00 46.29 ? 200 PHE C CD2 1 
ATOM   9100  C  CE1 . PHE C 1 200 ? 41.016 113.678 72.598  1.00 46.62 ? 200 PHE C CE1 1 
ATOM   9101  C  CE2 . PHE C 1 200 ? 42.432 112.710 74.276  1.00 46.74 ? 200 PHE C CE2 1 
ATOM   9102  C  CZ  . PHE C 1 200 ? 42.275 113.287 73.021  1.00 46.87 ? 200 PHE C CZ  1 
ATOM   9103  N  N   . SER C 1 201 ? 36.145 110.370 76.092  1.00 45.20 ? 201 SER C N   1 
ATOM   9104  C  CA  . SER C 1 201 ? 35.302 109.831 77.148  1.00 45.79 ? 201 SER C CA  1 
ATOM   9105  C  C   . SER C 1 201 ? 35.576 108.333 77.199  1.00 45.74 ? 201 SER C C   1 
ATOM   9106  O  O   . SER C 1 201 ? 36.399 107.834 76.444  1.00 45.11 ? 201 SER C O   1 
ATOM   9107  C  CB  . SER C 1 201 ? 33.822 110.104 76.844  1.00 46.45 ? 201 SER C CB  1 
ATOM   9108  O  OG  . SER C 1 201 ? 33.347 109.315 75.764  1.00 47.94 ? 201 SER C OG  1 
ATOM   9109  N  N   . ASP C 1 202 ? 34.905 107.613 78.086  1.00 46.74 ? 202 ASP C N   1 
ATOM   9110  C  CA  . ASP C 1 202 ? 35.137 106.177 78.168  1.00 48.38 ? 202 ASP C CA  1 
ATOM   9111  C  C   . ASP C 1 202 ? 34.930 105.498 76.826  1.00 48.61 ? 202 ASP C C   1 
ATOM   9112  O  O   . ASP C 1 202 ? 35.554 104.478 76.537  1.00 48.58 ? 202 ASP C O   1 
ATOM   9113  C  CB  . ASP C 1 202 ? 34.198 105.522 79.176  1.00 49.73 ? 202 ASP C CB  1 
ATOM   9114  C  CG  . ASP C 1 202 ? 34.472 105.961 80.589  1.00 51.11 ? 202 ASP C CG  1 
ATOM   9115  O  OD1 . ASP C 1 202 ? 35.586 105.693 81.092  1.00 51.73 ? 202 ASP C OD1 1 
ATOM   9116  O  OD2 . ASP C 1 202 ? 33.565 106.578 81.189  1.00 52.13 ? 202 ASP C OD2 1 
ATOM   9117  N  N   . ARG C 1 203 ? 34.051 106.065 76.008  1.00 48.57 ? 203 ARG C N   1 
ATOM   9118  C  CA  . ARG C 1 203 ? 33.749 105.471 74.716  1.00 48.37 ? 203 ARG C CA  1 
ATOM   9119  C  C   . ARG C 1 203 ? 34.831 105.655 73.645  1.00 47.43 ? 203 ARG C C   1 
ATOM   9120  O  O   . ARG C 1 203 ? 34.648 105.248 72.487  1.00 47.29 ? 203 ARG C O   1 
ATOM   9121  C  CB  . ARG C 1 203 ? 32.392 105.983 74.220  1.00 49.77 ? 203 ARG C CB  1 
ATOM   9122  C  CG  . ARG C 1 203 ? 31.178 105.451 75.012  1.00 51.07 ? 203 ARG C CG  1 
ATOM   9123  C  CD  . ARG C 1 203 ? 29.933 105.527 74.138  1.00 53.39 ? 203 ARG C CD  1 
ATOM   9124  N  NE  . ARG C 1 203 ? 28.691 105.138 74.803  1.00 54.79 ? 203 ARG C NE  1 
ATOM   9125  C  CZ  . ARG C 1 203 ? 27.496 105.145 74.205  1.00 56.00 ? 203 ARG C CZ  1 
ATOM   9126  N  NH1 . ARG C 1 203 ? 27.389 105.520 72.926  1.00 55.49 ? 203 ARG C NH1 1 
ATOM   9127  N  NH2 . ARG C 1 203 ? 26.405 104.783 74.881  1.00 55.74 ? 203 ARG C NH2 1 
ATOM   9128  N  N   . GLY C 1 204 ? 35.957 106.252 74.037  1.00 45.72 ? 204 GLY C N   1 
ATOM   9129  C  CA  . GLY C 1 204 ? 37.057 106.452 73.111  1.00 43.58 ? 204 GLY C CA  1 
ATOM   9130  C  C   . GLY C 1 204 ? 37.759 105.138 72.797  1.00 42.78 ? 204 GLY C C   1 
ATOM   9131  O  O   . GLY C 1 204 ? 38.340 104.969 71.724  1.00 42.87 ? 204 GLY C O   1 
ATOM   9132  N  N   . ILE C 1 205 ? 37.719 104.200 73.735  1.00 41.37 ? 205 ILE C N   1 
ATOM   9133  C  CA  . ILE C 1 205 ? 38.341 102.902 73.519  1.00 40.49 ? 205 ILE C CA  1 
ATOM   9134  C  C   . ILE C 1 205 ? 37.369 101.750 73.797  1.00 39.74 ? 205 ILE C C   1 
ATOM   9135  O  O   . ILE C 1 205 ? 37.372 101.160 74.879  1.00 38.94 ? 205 ILE C O   1 
ATOM   9136  C  CB  . ILE C 1 205 ? 39.576 102.707 74.409  1.00 40.46 ? 205 ILE C CB  1 
ATOM   9137  C  CG1 . ILE C 1 205 ? 40.504 103.909 74.297  1.00 40.48 ? 205 ILE C CG1 1 
ATOM   9138  C  CG2 . ILE C 1 205 ? 40.333 101.467 73.968  1.00 40.59 ? 205 ILE C CG2 1 
ATOM   9139  C  CD1 . ILE C 1 205 ? 41.762 103.752 75.115  1.00 40.47 ? 205 ILE C CD1 1 
ATOM   9140  N  N   . PRO C 1 206 ? 36.520 101.416 72.814  1.00 39.52 ? 206 PRO C N   1 
ATOM   9141  C  CA  . PRO C 1 206 ? 35.563 100.322 73.001  1.00 39.67 ? 206 PRO C CA  1 
ATOM   9142  C  C   . PRO C 1 206 ? 36.254 98.968  73.173  1.00 40.38 ? 206 PRO C C   1 
ATOM   9143  O  O   . PRO C 1 206 ? 37.351 98.755  72.652  1.00 40.78 ? 206 PRO C O   1 
ATOM   9144  C  CB  . PRO C 1 206 ? 34.708 100.393 71.737  1.00 39.33 ? 206 PRO C CB  1 
ATOM   9145  C  CG  . PRO C 1 206 ? 35.623 101.019 70.725  1.00 38.40 ? 206 PRO C CG  1 
ATOM   9146  C  CD  . PRO C 1 206 ? 36.340 102.070 71.506  1.00 38.25 ? 206 PRO C CD  1 
ATOM   9147  N  N   . ASP C 1 207 ? 35.630 98.059  73.923  1.00 40.86 ? 207 ASP C N   1 
ATOM   9148  C  CA  . ASP C 1 207 ? 36.205 96.727  74.126  1.00 40.91 ? 207 ASP C CA  1 
ATOM   9149  C  C   . ASP C 1 207 ? 35.755 95.826  72.970  1.00 40.64 ? 207 ASP C C   1 
ATOM   9150  O  O   . ASP C 1 207 ? 34.758 95.103  73.070  1.00 40.63 ? 207 ASP C O   1 
ATOM   9151  C  CB  . ASP C 1 207 ? 35.749 96.135  75.467  1.00 41.34 ? 207 ASP C CB  1 
ATOM   9152  C  CG  . ASP C 1 207 ? 36.470 94.836  75.812  1.00 42.35 ? 207 ASP C CG  1 
ATOM   9153  O  OD1 . ASP C 1 207 ? 36.194 94.247  76.877  1.00 42.97 ? 207 ASP C OD1 1 
ATOM   9154  O  OD2 . ASP C 1 207 ? 37.325 94.399  75.018  1.00 43.34 ? 207 ASP C OD2 1 
ATOM   9155  N  N   . GLY C 1 208 ? 36.498 95.872  71.871  1.00 39.93 ? 208 GLY C N   1 
ATOM   9156  C  CA  . GLY C 1 208 ? 36.143 95.071  70.718  1.00 39.90 ? 208 GLY C CA  1 
ATOM   9157  C  C   . GLY C 1 208 ? 35.115 95.820  69.893  1.00 40.57 ? 208 GLY C C   1 
ATOM   9158  O  O   . GLY C 1 208 ? 34.599 96.856  70.324  1.00 41.39 ? 208 GLY C O   1 
ATOM   9159  N  N   . HIS C 1 209 ? 34.808 95.307  68.707  1.00 40.04 ? 209 HIS C N   1 
ATOM   9160  C  CA  . HIS C 1 209 ? 33.842 95.950  67.837  1.00 39.53 ? 209 HIS C CA  1 
ATOM   9161  C  C   . HIS C 1 209 ? 32.425 95.545  68.169  1.00 39.67 ? 209 HIS C C   1 
ATOM   9162  O  O   . HIS C 1 209 ? 31.470 96.201  67.754  1.00 39.59 ? 209 HIS C O   1 
ATOM   9163  C  CB  . HIS C 1 209 ? 34.121 95.583  66.397  1.00 39.18 ? 209 HIS C CB  1 
ATOM   9164  C  CG  . HIS C 1 209 ? 35.535 95.808  65.994  1.00 40.32 ? 209 HIS C CG  1 
ATOM   9165  N  ND1 . HIS C 1 209 ? 36.245 96.922  66.385  1.00 40.92 ? 209 HIS C ND1 1 
ATOM   9166  C  CD2 . HIS C 1 209 ? 36.369 95.079  65.217  1.00 41.03 ? 209 HIS C CD2 1 
ATOM   9167  C  CE1 . HIS C 1 209 ? 37.459 96.870  65.865  1.00 41.73 ? 209 HIS C CE1 1 
ATOM   9168  N  NE2 . HIS C 1 209 ? 37.561 95.762  65.151  1.00 42.43 ? 209 HIS C NE2 1 
ATOM   9169  N  N   . ARG C 1 210 ? 32.284 94.461  68.920  1.00 40.08 ? 210 ARG C N   1 
ATOM   9170  C  CA  . ARG C 1 210 ? 30.960 93.960  69.268  1.00 39.95 ? 210 ARG C CA  1 
ATOM   9171  C  C   . ARG C 1 210 ? 30.262 94.700  70.406  1.00 39.65 ? 210 ARG C C   1 
ATOM   9172  O  O   . ARG C 1 210 ? 29.084 94.458  70.662  1.00 40.27 ? 210 ARG C O   1 
ATOM   9173  C  CB  . ARG C 1 210 ? 31.044 92.469  69.606  1.00 39.56 ? 210 ARG C CB  1 
ATOM   9174  C  CG  . ARG C 1 210 ? 31.602 91.612  68.494  1.00 39.23 ? 210 ARG C CG  1 
ATOM   9175  C  CD  . ARG C 1 210 ? 31.660 90.159  68.917  1.00 39.92 ? 210 ARG C CD  1 
ATOM   9176  N  NE  . ARG C 1 210 ? 32.434 90.003  70.145  1.00 40.59 ? 210 ARG C NE  1 
ATOM   9177  C  CZ  . ARG C 1 210 ? 31.947 89.540  71.292  1.00 40.48 ? 210 ARG C CZ  1 
ATOM   9178  N  NH1 . ARG C 1 210 ? 30.671 89.177  71.378  1.00 39.30 ? 210 ARG C NH1 1 
ATOM   9179  N  NH2 . ARG C 1 210 ? 32.740 89.453  72.358  1.00 40.12 ? 210 ARG C NH2 1 
ATOM   9180  N  N   . HIS C 1 211 ? 30.964 95.607  71.077  1.00 39.11 ? 211 HIS C N   1 
ATOM   9181  C  CA  . HIS C 1 211 ? 30.351 96.320  72.187  1.00 39.16 ? 211 HIS C CA  1 
ATOM   9182  C  C   . HIS C 1 211 ? 30.276 97.824  72.016  1.00 39.19 ? 211 HIS C C   1 
ATOM   9183  O  O   . HIS C 1 211 ? 30.390 98.563  72.995  1.00 39.11 ? 211 HIS C O   1 
ATOM   9184  C  CB  . HIS C 1 211 ? 31.083 96.004  73.486  1.00 40.12 ? 211 HIS C CB  1 
ATOM   9185  C  CG  . HIS C 1 211 ? 30.984 94.568  73.905  1.00 41.19 ? 211 HIS C CG  1 
ATOM   9186  N  ND1 . HIS C 1 211 ? 29.799 93.989  74.301  1.00 41.48 ? 211 HIS C ND1 1 
ATOM   9187  C  CD2 . HIS C 1 211 ? 31.931 93.608  74.027  1.00 41.91 ? 211 HIS C CD2 1 
ATOM   9188  C  CE1 . HIS C 1 211 ? 30.021 92.735  74.656  1.00 42.24 ? 211 HIS C CE1 1 
ATOM   9189  N  NE2 . HIS C 1 211 ? 31.307 92.479  74.500  1.00 42.41 ? 211 HIS C NE2 1 
ATOM   9190  N  N   . MET C 1 212 ? 30.079 98.273  70.777  1.00 38.78 ? 212 MET C N   1 
ATOM   9191  C  CA  . MET C 1 212 ? 29.953 99.703  70.482  1.00 37.81 ? 212 MET C CA  1 
ATOM   9192  C  C   . MET C 1 212 ? 28.736 99.886  69.596  1.00 37.88 ? 212 MET C C   1 
ATOM   9193  O  O   . MET C 1 212 ? 28.295 98.933  68.957  1.00 37.83 ? 212 MET C O   1 
ATOM   9194  C  CB  . MET C 1 212 ? 31.198 100.220 69.751  1.00 37.16 ? 212 MET C CB  1 
ATOM   9195  C  CG  . MET C 1 212 ? 31.415 99.617  68.365  1.00 35.46 ? 212 MET C CG  1 
ATOM   9196  S  SD  . MET C 1 212 ? 33.029 100.028 67.718  1.00 33.96 ? 212 MET C SD  1 
ATOM   9197  C  CE  . MET C 1 212 ? 32.975 99.350  66.102  1.00 34.00 ? 212 MET C CE  1 
ATOM   9198  N  N   . ASN C 1 213 ? 28.184 101.100 69.573  1.00 38.59 ? 213 ASN C N   1 
ATOM   9199  C  CA  . ASN C 1 213 ? 27.024 101.406 68.724  1.00 38.44 ? 213 ASN C CA  1 
ATOM   9200  C  C   . ASN C 1 213 ? 27.470 101.809 67.323  1.00 38.32 ? 213 ASN C C   1 
ATOM   9201  O  O   . ASN C 1 213 ? 28.647 102.048 67.080  1.00 38.16 ? 213 ASN C O   1 
ATOM   9202  C  CB  . ASN C 1 213 ? 26.188 102.545 69.316  1.00 37.63 ? 213 ASN C CB  1 
ATOM   9203  C  CG  . ASN C 1 213 ? 25.458 102.134 70.566  1.00 36.83 ? 213 ASN C CG  1 
ATOM   9204  O  OD1 . ASN C 1 213 ? 25.075 100.980 70.707  1.00 37.04 ? 213 ASN C OD1 1 
ATOM   9205  N  ND2 . ASN C 1 213 ? 25.242 103.079 71.475  1.00 36.76 ? 213 ASN C ND2 1 
ATOM   9206  N  N   . GLY C 1 214 ? 26.519 101.887 66.403  1.00 39.16 ? 214 GLY C N   1 
ATOM   9207  C  CA  . GLY C 1 214 ? 26.842 102.278 65.039  1.00 39.28 ? 214 GLY C CA  1 
ATOM   9208  C  C   . GLY C 1 214 ? 25.966 103.449 64.649  1.00 39.33 ? 214 GLY C C   1 
ATOM   9209  O  O   . GLY C 1 214 ? 24.783 103.457 64.972  1.00 39.95 ? 214 GLY C O   1 
ATOM   9210  N  N   . TYR C 1 215 ? 26.535 104.439 63.969  1.00 39.24 ? 215 TYR C N   1 
ATOM   9211  C  CA  . TYR C 1 215 ? 25.774 105.615 63.557  1.00 38.95 ? 215 TYR C CA  1 
ATOM   9212  C  C   . TYR C 1 215 ? 26.079 106.001 62.118  1.00 38.66 ? 215 TYR C C   1 
ATOM   9213  O  O   . TYR C 1 215 ? 27.240 105.954 61.687  1.00 38.80 ? 215 TYR C O   1 
ATOM   9214  C  CB  . TYR C 1 215 ? 26.135 106.816 64.426  1.00 39.47 ? 215 TYR C CB  1 
ATOM   9215  C  CG  . TYR C 1 215 ? 25.944 106.636 65.902  1.00 40.08 ? 215 TYR C CG  1 
ATOM   9216  C  CD1 . TYR C 1 215 ? 24.718 106.908 66.501  1.00 40.59 ? 215 TYR C CD1 1 
ATOM   9217  C  CD2 . TYR C 1 215 ? 27.004 106.248 66.712  1.00 40.05 ? 215 TYR C CD2 1 
ATOM   9218  C  CE1 . TYR C 1 215 ? 24.555 106.809 67.879  1.00 41.21 ? 215 TYR C CE1 1 
ATOM   9219  C  CE2 . TYR C 1 215 ? 26.857 106.145 68.087  1.00 40.88 ? 215 TYR C CE2 1 
ATOM   9220  C  CZ  . TYR C 1 215 ? 25.632 106.433 68.668  1.00 41.22 ? 215 TYR C CZ  1 
ATOM   9221  O  OH  . TYR C 1 215 ? 25.494 106.389 70.039  1.00 41.97 ? 215 TYR C OH  1 
ATOM   9222  N  N   . GLY C 1 216 ? 25.047 106.387 61.377  1.00 37.38 ? 216 GLY C N   1 
ATOM   9223  C  CA  . GLY C 1 216 ? 25.275 106.836 60.017  1.00 36.58 ? 216 GLY C CA  1 
ATOM   9224  C  C   . GLY C 1 216 ? 25.822 108.248 60.177  1.00 36.25 ? 216 GLY C C   1 
ATOM   9225  O  O   . GLY C 1 216 ? 26.448 108.804 59.275  1.00 34.93 ? 216 GLY C O   1 
ATOM   9226  N  N   . SER C 1 217 ? 25.568 108.809 61.363  1.00 36.61 ? 217 SER C N   1 
ATOM   9227  C  CA  . SER C 1 217 ? 25.991 110.157 61.759  1.00 36.35 ? 217 SER C CA  1 
ATOM   9228  C  C   . SER C 1 217 ? 25.353 111.296 60.957  1.00 35.76 ? 217 SER C C   1 
ATOM   9229  O  O   . SER C 1 217 ? 24.726 112.196 61.525  1.00 34.95 ? 217 SER C O   1 
ATOM   9230  C  CB  . SER C 1 217 ? 27.514 110.274 61.682  1.00 37.12 ? 217 SER C CB  1 
ATOM   9231  O  OG  . SER C 1 217 ? 28.123 109.353 62.557  1.00 37.96 ? 217 SER C OG  1 
ATOM   9232  N  N   . HIS C 1 218 ? 25.541 111.264 59.642  1.00 34.79 ? 218 HIS C N   1 
ATOM   9233  C  CA  . HIS C 1 218 ? 24.983 112.285 58.777  1.00 34.71 ? 218 HIS C CA  1 
ATOM   9234  C  C   . HIS C 1 218 ? 23.471 112.244 58.791  1.00 35.70 ? 218 HIS C C   1 
ATOM   9235  O  O   . HIS C 1 218 ? 22.843 111.261 59.217  1.00 34.52 ? 218 HIS C O   1 
ATOM   9236  C  CB  . HIS C 1 218 ? 25.403 112.069 57.330  1.00 34.05 ? 218 HIS C CB  1 
ATOM   9237  C  CG  . HIS C 1 218 ? 26.857 112.268 57.077  1.00 34.04 ? 218 HIS C CG  1 
ATOM   9238  N  ND1 . HIS C 1 218 ? 27.458 113.504 57.144  1.00 33.48 ? 218 HIS C ND1 1 
ATOM   9239  C  CD2 . HIS C 1 218 ? 27.823 111.394 56.708  1.00 33.80 ? 218 HIS C CD2 1 
ATOM   9240  C  CE1 . HIS C 1 218 ? 28.734 113.385 56.824  1.00 34.42 ? 218 HIS C CE1 1 
ATOM   9241  N  NE2 . HIS C 1 218 ? 28.981 112.115 56.555  1.00 34.77 ? 218 HIS C NE2 1 
ATOM   9242  N  N   . THR C 1 219 ? 22.891 113.329 58.298  1.00 36.20 ? 219 THR C N   1 
ATOM   9243  C  CA  . THR C 1 219 ? 21.459 113.405 58.170  1.00 36.98 ? 219 THR C CA  1 
ATOM   9244  C  C   . THR C 1 219 ? 21.213 113.009 56.725  1.00 37.78 ? 219 THR C C   1 
ATOM   9245  O  O   . THR C 1 219 ? 21.799 113.594 55.815  1.00 38.19 ? 219 THR C O   1 
ATOM   9246  C  CB  . THR C 1 219 ? 20.963 114.823 58.412  1.00 37.20 ? 219 THR C CB  1 
ATOM   9247  O  OG1 . THR C 1 219 ? 20.945 115.066 59.825  1.00 37.75 ? 219 THR C OG1 1 
ATOM   9248  C  CG2 . THR C 1 219 ? 19.572 115.025 57.817  1.00 35.76 ? 219 THR C CG2 1 
ATOM   9249  N  N   . PHE C 1 220 ? 20.395 111.983 56.514  1.00 37.80 ? 220 PHE C N   1 
ATOM   9250  C  CA  . PHE C 1 220 ? 20.077 111.556 55.159  1.00 38.36 ? 220 PHE C CA  1 
ATOM   9251  C  C   . PHE C 1 220 ? 18.616 111.895 54.877  1.00 38.55 ? 220 PHE C C   1 
ATOM   9252  O  O   . PHE C 1 220 ? 17.921 112.431 55.738  1.00 38.00 ? 220 PHE C O   1 
ATOM   9253  C  CB  . PHE C 1 220 ? 20.309 110.044 54.982  1.00 39.17 ? 220 PHE C CB  1 
ATOM   9254  C  CG  . PHE C 1 220 ? 21.733 109.619 55.173  1.00 38.77 ? 220 PHE C CG  1 
ATOM   9255  C  CD1 . PHE C 1 220 ? 22.273 109.507 56.451  1.00 38.60 ? 220 PHE C CD1 1 
ATOM   9256  C  CD2 . PHE C 1 220 ? 22.552 109.380 54.072  1.00 38.67 ? 220 PHE C CD2 1 
ATOM   9257  C  CE1 . PHE C 1 220 ? 23.607 109.169 56.629  1.00 37.98 ? 220 PHE C CE1 1 
ATOM   9258  C  CE2 . PHE C 1 220 ? 23.891 109.040 54.238  1.00 38.03 ? 220 PHE C CE2 1 
ATOM   9259  C  CZ  . PHE C 1 220 ? 24.419 108.936 55.515  1.00 38.48 ? 220 PHE C CZ  1 
ATOM   9260  N  N   . LYS C 1 221 ? 18.156 111.590 53.669  1.00 39.39 ? 221 LYS C N   1 
ATOM   9261  C  CA  . LYS C 1 221 ? 16.775 111.859 53.306  1.00 40.15 ? 221 LYS C CA  1 
ATOM   9262  C  C   . LYS C 1 221 ? 16.060 110.565 52.918  1.00 40.37 ? 221 LYS C C   1 
ATOM   9263  O  O   . LYS C 1 221 ? 16.605 109.742 52.171  1.00 41.16 ? 221 LYS C O   1 
ATOM   9264  C  CB  . LYS C 1 221 ? 16.721 112.863 52.151  1.00 41.14 ? 221 LYS C CB  1 
ATOM   9265  C  CG  . LYS C 1 221 ? 15.307 113.242 51.722  1.00 42.21 ? 221 LYS C CG  1 
ATOM   9266  C  CD  . LYS C 1 221 ? 15.300 114.456 50.802  1.00 43.18 ? 221 LYS C CD  1 
ATOM   9267  C  CE  . LYS C 1 221 ? 16.047 114.187 49.500  1.00 44.26 ? 221 LYS C CE  1 
ATOM   9268  N  NZ  . LYS C 1 221 ? 16.222 115.439 48.682  1.00 44.54 ? 221 LYS C NZ  1 
ATOM   9269  N  N   . LEU C 1 222 ? 14.856 110.371 53.457  1.00 40.13 ? 222 LEU C N   1 
ATOM   9270  C  CA  . LEU C 1 222 ? 14.053 109.191 53.145  1.00 39.41 ? 222 LEU C CA  1 
ATOM   9271  C  C   . LEU C 1 222 ? 12.921 109.653 52.241  1.00 39.49 ? 222 LEU C C   1 
ATOM   9272  O  O   . LEU C 1 222 ? 12.414 110.760 52.398  1.00 40.17 ? 222 LEU C O   1 
ATOM   9273  C  CB  . LEU C 1 222 ? 13.504 108.563 54.421  1.00 38.41 ? 222 LEU C CB  1 
ATOM   9274  C  CG  . LEU C 1 222 ? 14.565 107.905 55.308  1.00 38.46 ? 222 LEU C CG  1 
ATOM   9275  C  CD1 . LEU C 1 222 ? 13.927 107.395 56.581  1.00 38.04 ? 222 LEU C CD1 1 
ATOM   9276  C  CD2 . LEU C 1 222 ? 15.229 106.763 54.558  1.00 37.73 ? 222 LEU C CD2 1 
ATOM   9277  N  N   . VAL C 1 223 ? 12.538 108.815 51.285  1.00 40.06 ? 223 VAL C N   1 
ATOM   9278  C  CA  . VAL C 1 223 ? 11.478 109.153 50.325  1.00 39.98 ? 223 VAL C CA  1 
ATOM   9279  C  C   . VAL C 1 223 ? 10.497 107.985 50.197  1.00 40.95 ? 223 VAL C C   1 
ATOM   9280  O  O   . VAL C 1 223 ? 10.928 106.838 50.056  1.00 41.77 ? 223 VAL C O   1 
ATOM   9281  C  CB  . VAL C 1 223 ? 12.104 109.466 48.931  1.00 38.86 ? 223 VAL C CB  1 
ATOM   9282  C  CG1 . VAL C 1 223 ? 11.024 109.658 47.871  1.00 37.54 ? 223 VAL C CG1 1 
ATOM   9283  C  CG2 . VAL C 1 223 ? 12.979 110.706 49.037  1.00 37.09 ? 223 VAL C CG2 1 
ATOM   9284  N  N   . ASN C 1 224 ? 9.190  108.263 50.257  1.00 41.53 ? 224 ASN C N   1 
ATOM   9285  C  CA  . ASN C 1 224 ? 8.194  107.196 50.132  1.00 41.65 ? 224 ASN C CA  1 
ATOM   9286  C  C   . ASN C 1 224 ? 7.607  107.073 48.730  1.00 41.27 ? 224 ASN C C   1 
ATOM   9287  O  O   . ASN C 1 224 ? 7.916  107.861 47.843  1.00 40.82 ? 224 ASN C O   1 
ATOM   9288  C  CB  . ASN C 1 224 ? 7.063  107.359 51.158  1.00 42.08 ? 224 ASN C CB  1 
ATOM   9289  C  CG  . ASN C 1 224 ? 6.279  108.642 50.979  1.00 43.57 ? 224 ASN C CG  1 
ATOM   9290  O  OD1 . ASN C 1 224 ? 5.984  109.069 49.853  1.00 44.32 ? 224 ASN C OD1 1 
ATOM   9291  N  ND2 . ASN C 1 224 ? 5.913  109.259 52.096  1.00 43.47 ? 224 ASN C ND2 1 
ATOM   9292  N  N   . ALA C 1 225 ? 6.767  106.065 48.538  1.00 41.66 ? 225 ALA C N   1 
ATOM   9293  C  CA  . ALA C 1 225 ? 6.146  105.815 47.246  1.00 42.96 ? 225 ALA C CA  1 
ATOM   9294  C  C   . ALA C 1 225 ? 5.358  107.008 46.707  1.00 44.44 ? 225 ALA C C   1 
ATOM   9295  O  O   . ALA C 1 225 ? 5.020  107.056 45.521  1.00 44.05 ? 225 ALA C O   1 
ATOM   9296  C  CB  . ALA C 1 225 ? 5.248  104.613 47.347  1.00 42.24 ? 225 ALA C CB  1 
ATOM   9297  N  N   . ASN C 1 226 ? 5.074  107.969 47.580  1.00 46.40 ? 226 ASN C N   1 
ATOM   9298  C  CA  . ASN C 1 226 ? 4.324  109.164 47.200  1.00 48.31 ? 226 ASN C CA  1 
ATOM   9299  C  C   . ASN C 1 226 ? 5.204  110.319 46.734  1.00 48.85 ? 226 ASN C C   1 
ATOM   9300  O  O   . ASN C 1 226 ? 4.713  111.280 46.132  1.00 48.89 ? 226 ASN C O   1 
ATOM   9301  C  CB  . ASN C 1 226 ? 3.475  109.625 48.377  1.00 49.51 ? 226 ASN C CB  1 
ATOM   9302  C  CG  . ASN C 1 226 ? 2.393  108.634 48.720  1.00 51.39 ? 226 ASN C CG  1 
ATOM   9303  O  OD1 . ASN C 1 226 ? 1.988  108.516 49.883  1.00 52.83 ? 226 ASN C OD1 1 
ATOM   9304  N  ND2 . ASN C 1 226 ? 1.905  107.913 47.707  1.00 51.44 ? 226 ASN C ND2 1 
ATOM   9305  N  N   . GLY C 1 227 ? 6.502  110.222 47.005  1.00 48.96 ? 227 GLY C N   1 
ATOM   9306  C  CA  . GLY C 1 227 ? 7.415  111.281 46.618  1.00 48.57 ? 227 GLY C CA  1 
ATOM   9307  C  C   . GLY C 1 227 ? 7.643  112.196 47.806  1.00 48.47 ? 227 GLY C C   1 
ATOM   9308  O  O   . GLY C 1 227 ? 8.398  113.172 47.729  1.00 48.78 ? 227 GLY C O   1 
ATOM   9309  N  N   . GLU C 1 228 ? 6.969  111.882 48.910  1.00 48.05 ? 228 GLU C N   1 
ATOM   9310  C  CA  . GLU C 1 228 ? 7.101  112.654 50.137  1.00 47.56 ? 228 GLU C CA  1 
ATOM   9311  C  C   . GLU C 1 228 ? 8.460  112.314 50.747  1.00 46.11 ? 228 GLU C C   1 
ATOM   9312  O  O   . GLU C 1 228 ? 8.872  111.148 50.756  1.00 45.84 ? 228 GLU C O   1 
ATOM   9313  C  CB  . GLU C 1 228 ? 5.974  112.286 51.103  1.00 49.81 ? 228 GLU C CB  1 
ATOM   9314  C  CG  . GLU C 1 228 ? 4.579  112.547 50.551  1.00 53.36 ? 228 GLU C CG  1 
ATOM   9315  C  CD  . GLU C 1 228 ? 3.478  111.948 51.423  1.00 56.04 ? 228 GLU C CD  1 
ATOM   9316  O  OE1 . GLU C 1 228 ? 3.251  110.711 51.352  1.00 56.40 ? 228 GLU C OE1 1 
ATOM   9317  O  OE2 . GLU C 1 228 ? 2.846  112.718 52.189  1.00 57.72 ? 228 GLU C OE2 1 
ATOM   9318  N  N   . ALA C 1 229 ? 9.159  113.324 51.250  1.00 44.13 ? 229 ALA C N   1 
ATOM   9319  C  CA  . ALA C 1 229 ? 10.472 113.098 51.835  1.00 42.11 ? 229 ALA C CA  1 
ATOM   9320  C  C   . ALA C 1 229 ? 10.596 113.559 53.276  1.00 41.43 ? 229 ALA C C   1 
ATOM   9321  O  O   . ALA C 1 229 ? 9.888  114.459 53.724  1.00 40.77 ? 229 ALA C O   1 
ATOM   9322  C  CB  . ALA C 1 229 ? 11.530 113.788 50.992  1.00 40.99 ? 229 ALA C CB  1 
ATOM   9323  N  N   . VAL C 1 230 ? 11.508 112.924 54.000  1.00 41.12 ? 230 VAL C N   1 
ATOM   9324  C  CA  . VAL C 1 230 ? 11.788 113.290 55.379  1.00 40.84 ? 230 VAL C CA  1 
ATOM   9325  C  C   . VAL C 1 230 ? 13.286 113.162 55.580  1.00 40.53 ? 230 VAL C C   1 
ATOM   9326  O  O   . VAL C 1 230 ? 13.979 112.549 54.771  1.00 39.92 ? 230 VAL C O   1 
ATOM   9327  C  CB  . VAL C 1 230 ? 11.064 112.380 56.409  1.00 41.00 ? 230 VAL C CB  1 
ATOM   9328  C  CG1 . VAL C 1 230 ? 9.568  112.495 56.234  1.00 41.14 ? 230 VAL C CG1 1 
ATOM   9329  C  CG2 . VAL C 1 230 ? 11.521 110.937 56.268  1.00 41.06 ? 230 VAL C CG2 1 
ATOM   9330  N  N   . TYR C 1 231 ? 13.785 113.766 56.648  1.00 40.66 ? 231 TYR C N   1 
ATOM   9331  C  CA  . TYR C 1 231 ? 15.201 113.703 56.962  1.00 40.80 ? 231 TYR C CA  1 
ATOM   9332  C  C   . TYR C 1 231 ? 15.355 112.696 58.080  1.00 40.76 ? 231 TYR C C   1 
ATOM   9333  O  O   . TYR C 1 231 ? 14.422 112.472 58.847  1.00 40.44 ? 231 TYR C O   1 
ATOM   9334  C  CB  . TYR C 1 231 ? 15.724 115.079 57.390  1.00 40.75 ? 231 TYR C CB  1 
ATOM   9335  C  CG  . TYR C 1 231 ? 15.875 116.063 56.239  1.00 40.72 ? 231 TYR C CG  1 
ATOM   9336  C  CD1 . TYR C 1 231 ? 16.571 115.715 55.086  1.00 40.62 ? 231 TYR C CD1 1 
ATOM   9337  C  CD2 . TYR C 1 231 ? 15.344 117.349 56.320  1.00 41.41 ? 231 TYR C CD2 1 
ATOM   9338  C  CE1 . TYR C 1 231 ? 16.737 116.628 54.042  1.00 41.67 ? 231 TYR C CE1 1 
ATOM   9339  C  CE2 . TYR C 1 231 ? 15.503 118.270 55.284  1.00 41.23 ? 231 TYR C CE2 1 
ATOM   9340  C  CZ  . TYR C 1 231 ? 16.201 117.907 54.148  1.00 41.73 ? 231 TYR C CZ  1 
ATOM   9341  O  OH  . TYR C 1 231 ? 16.383 118.826 53.133  1.00 41.72 ? 231 TYR C OH  1 
ATOM   9342  N  N   . CYS C 1 232 ? 16.523 112.076 58.176  1.00 41.14 ? 232 CYS C N   1 
ATOM   9343  C  CA  . CYS C 1 232 ? 16.707 111.082 59.215  1.00 41.33 ? 232 CYS C CA  1 
ATOM   9344  C  C   . CYS C 1 232 ? 18.137 110.862 59.644  1.00 40.93 ? 232 CYS C C   1 
ATOM   9345  O  O   . CYS C 1 232 ? 19.076 111.425 59.088  1.00 41.08 ? 232 CYS C O   1 
ATOM   9346  C  CB  . CYS C 1 232 ? 16.136 109.738 58.764  1.00 41.67 ? 232 CYS C CB  1 
ATOM   9347  S  SG  . CYS C 1 232 ? 17.218 108.856 57.628  1.00 41.85 ? 232 CYS C SG  1 
ATOM   9348  N  N   . LYS C 1 233 ? 18.262 110.009 60.652  1.00 40.59 ? 233 LYS C N   1 
ATOM   9349  C  CA  . LYS C 1 233 ? 19.531 109.624 61.235  1.00 40.48 ? 233 LYS C CA  1 
ATOM   9350  C  C   . LYS C 1 233 ? 19.421 108.123 61.409  1.00 40.16 ? 233 LYS C C   1 
ATOM   9351  O  O   . LYS C 1 233 ? 18.405 107.645 61.897  1.00 39.97 ? 233 LYS C O   1 
ATOM   9352  C  CB  . LYS C 1 233 ? 19.711 110.266 62.620  1.00 41.01 ? 233 LYS C CB  1 
ATOM   9353  C  CG  . LYS C 1 233 ? 19.913 111.774 62.637  1.00 41.10 ? 233 LYS C CG  1 
ATOM   9354  C  CD  . LYS C 1 233 ? 21.329 112.140 62.258  1.00 41.79 ? 233 LYS C CD  1 
ATOM   9355  C  CE  . LYS C 1 233 ? 21.578 113.621 62.437  1.00 41.92 ? 233 LYS C CE  1 
ATOM   9356  N  NZ  . LYS C 1 233 ? 23.013 113.975 62.230  1.00 42.78 ? 233 LYS C NZ  1 
ATOM   9357  N  N   . PHE C 1 234 ? 20.449 107.381 61.002  1.00 40.25 ? 234 PHE C N   1 
ATOM   9358  C  CA  . PHE C 1 234 ? 20.447 105.934 61.161  1.00 39.92 ? 234 PHE C CA  1 
ATOM   9359  C  C   . PHE C 1 234 ? 21.251 105.605 62.407  1.00 40.66 ? 234 PHE C C   1 
ATOM   9360  O  O   . PHE C 1 234 ? 22.272 106.234 62.672  1.00 40.90 ? 234 PHE C O   1 
ATOM   9361  C  CB  . PHE C 1 234 ? 21.104 105.264 59.966  1.00 39.19 ? 234 PHE C CB  1 
ATOM   9362  C  CG  . PHE C 1 234 ? 20.366 105.454 58.682  1.00 38.92 ? 234 PHE C CG  1 
ATOM   9363  C  CD1 . PHE C 1 234 ? 19.195 104.768 58.435  1.00 38.12 ? 234 PHE C CD1 1 
ATOM   9364  C  CD2 . PHE C 1 234 ? 20.863 106.301 57.701  1.00 38.87 ? 234 PHE C CD2 1 
ATOM   9365  C  CE1 . PHE C 1 234 ? 18.531 104.918 57.232  1.00 38.39 ? 234 PHE C CE1 1 
ATOM   9366  C  CE2 . PHE C 1 234 ? 20.200 106.457 56.486  1.00 38.70 ? 234 PHE C CE2 1 
ATOM   9367  C  CZ  . PHE C 1 234 ? 19.036 105.766 56.252  1.00 38.07 ? 234 PHE C CZ  1 
ATOM   9368  N  N   . HIS C 1 235 ? 20.782 104.635 63.182  1.00 41.72 ? 235 HIS C N   1 
ATOM   9369  C  CA  . HIS C 1 235 ? 21.493 104.212 64.387  1.00 42.48 ? 235 HIS C CA  1 
ATOM   9370  C  C   . HIS C 1 235 ? 21.356 102.709 64.499  1.00 42.46 ? 235 HIS C C   1 
ATOM   9371  O  O   . HIS C 1 235 ? 20.308 102.145 64.190  1.00 42.80 ? 235 HIS C O   1 
ATOM   9372  C  CB  . HIS C 1 235 ? 20.889 104.801 65.674  1.00 43.19 ? 235 HIS C CB  1 
ATOM   9373  C  CG  . HIS C 1 235 ? 20.754 106.294 65.680  1.00 45.14 ? 235 HIS C CG  1 
ATOM   9374  N  ND1 . HIS C 1 235 ? 21.335 107.087 66.649  1.00 45.51 ? 235 HIS C ND1 1 
ATOM   9375  C  CD2 . HIS C 1 235 ? 20.043 107.132 64.886  1.00 45.01 ? 235 HIS C CD2 1 
ATOM   9376  C  CE1 . HIS C 1 235 ? 20.985 108.346 66.455  1.00 44.85 ? 235 HIS C CE1 1 
ATOM   9377  N  NE2 . HIS C 1 235 ? 20.201 108.401 65.392  1.00 45.09 ? 235 HIS C NE2 1 
ATOM   9378  N  N   . TYR C 1 236 ? 22.419 102.055 64.928  1.00 42.53 ? 236 TYR C N   1 
ATOM   9379  C  CA  . TYR C 1 236 ? 22.364 100.626 65.150  1.00 42.85 ? 236 TYR C CA  1 
ATOM   9380  C  C   . TYR C 1 236 ? 23.013 100.404 66.505  1.00 43.06 ? 236 TYR C C   1 
ATOM   9381  O  O   . TYR C 1 236 ? 24.230 100.482 66.639  1.00 42.37 ? 236 TYR C O   1 
ATOM   9382  C  CB  . TYR C 1 236 ? 23.073 99.821  64.039  1.00 42.67 ? 236 TYR C CB  1 
ATOM   9383  C  CG  . TYR C 1 236 ? 24.084 100.539 63.161  1.00 42.36 ? 236 TYR C CG  1 
ATOM   9384  C  CD1 . TYR C 1 236 ? 23.732 101.664 62.409  1.00 41.86 ? 236 TYR C CD1 1 
ATOM   9385  C  CD2 . TYR C 1 236 ? 25.378 100.030 63.009  1.00 42.36 ? 236 TYR C CD2 1 
ATOM   9386  C  CE1 . TYR C 1 236 ? 24.644 102.255 61.524  1.00 40.85 ? 236 TYR C CE1 1 
ATOM   9387  C  CE2 . TYR C 1 236 ? 26.292 100.612 62.130  1.00 40.81 ? 236 TYR C CE2 1 
ATOM   9388  C  CZ  . TYR C 1 236 ? 25.920 101.717 61.394  1.00 40.72 ? 236 TYR C CZ  1 
ATOM   9389  O  OH  . TYR C 1 236 ? 26.824 102.270 60.523  1.00 40.21 ? 236 TYR C OH  1 
ATOM   9390  N  N   . LYS C 1 237 ? 22.180 100.167 67.516  1.00 44.24 ? 237 LYS C N   1 
ATOM   9391  C  CA  . LYS C 1 237 ? 22.658 99.957  68.881  1.00 45.12 ? 237 LYS C CA  1 
ATOM   9392  C  C   . LYS C 1 237 ? 23.130 98.525  69.115  1.00 45.00 ? 237 LYS C C   1 
ATOM   9393  O  O   . LYS C 1 237 ? 22.508 97.566  68.654  1.00 44.89 ? 237 LYS C O   1 
ATOM   9394  C  CB  . LYS C 1 237 ? 21.561 100.324 69.886  1.00 46.87 ? 237 LYS C CB  1 
ATOM   9395  C  CG  . LYS C 1 237 ? 21.085 101.784 69.799  1.00 48.89 ? 237 LYS C CG  1 
ATOM   9396  C  CD  . LYS C 1 237 ? 22.266 102.761 69.890  1.00 51.51 ? 237 LYS C CD  1 
ATOM   9397  C  CE  . LYS C 1 237 ? 21.853 104.236 69.710  1.00 53.02 ? 237 LYS C CE  1 
ATOM   9398  N  NZ  . LYS C 1 237 ? 20.984 104.754 70.812  1.00 54.16 ? 237 LYS C NZ  1 
ATOM   9399  N  N   . THR C 1 238 ? 24.240 98.388  69.834  1.00 44.72 ? 238 THR C N   1 
ATOM   9400  C  CA  . THR C 1 238 ? 24.817 97.076  70.110  1.00 44.44 ? 238 THR C CA  1 
ATOM   9401  C  C   . THR C 1 238 ? 23.990 96.213  71.041  1.00 44.18 ? 238 THR C C   1 
ATOM   9402  O  O   . THR C 1 238 ? 23.790 96.545  72.206  1.00 44.21 ? 238 THR C O   1 
ATOM   9403  C  CB  . THR C 1 238 ? 26.236 97.177  70.720  1.00 44.36 ? 238 THR C CB  1 
ATOM   9404  O  OG1 . THR C 1 238 ? 26.675 95.865  71.097  1.00 44.76 ? 238 THR C OG1 1 
ATOM   9405  C  CG2 . THR C 1 238 ? 26.242 98.083  71.951  1.00 43.78 ? 238 THR C CG2 1 
ATOM   9406  N  N   . ASP C 1 239 ? 23.514 95.091  70.527  1.00 43.73 ? 239 ASP C N   1 
ATOM   9407  C  CA  . ASP C 1 239 ? 22.738 94.203  71.354  1.00 42.88 ? 239 ASP C CA  1 
ATOM   9408  C  C   . ASP C 1 239 ? 23.659 93.567  72.390  1.00 42.63 ? 239 ASP C C   1 
ATOM   9409  O  O   . ASP C 1 239 ? 23.225 93.190  73.468  1.00 42.73 ? 239 ASP C O   1 
ATOM   9410  C  CB  . ASP C 1 239 ? 22.064 93.144  70.488  1.00 42.99 ? 239 ASP C CB  1 
ATOM   9411  C  CG  . ASP C 1 239 ? 20.996 93.734  69.573  1.00 43.10 ? 239 ASP C CG  1 
ATOM   9412  O  OD1 . ASP C 1 239 ? 20.395 94.768  69.940  1.00 42.67 ? 239 ASP C OD1 1 
ATOM   9413  O  OD2 . ASP C 1 239 ? 20.744 93.151  68.496  1.00 42.95 ? 239 ASP C OD2 1 
ATOM   9414  N  N   . GLN C 1 240 ? 24.941 93.466  72.067  1.00 42.62 ? 240 GLN C N   1 
ATOM   9415  C  CA  . GLN C 1 240 ? 25.910 92.888  72.994  1.00 42.42 ? 240 GLN C CA  1 
ATOM   9416  C  C   . GLN C 1 240 ? 26.200 93.878  74.128  1.00 42.36 ? 240 GLN C C   1 
ATOM   9417  O  O   . GLN C 1 240 ? 26.994 93.604  75.023  1.00 42.72 ? 240 GLN C O   1 
ATOM   9418  C  CB  . GLN C 1 240 ? 27.211 92.532  72.248  1.00 42.69 ? 240 GLN C CB  1 
ATOM   9419  C  CG  . GLN C 1 240 ? 27.096 91.367  71.238  1.00 42.89 ? 240 GLN C CG  1 
ATOM   9420  C  CD  . GLN C 1 240 ? 26.133 91.649  70.075  1.00 43.74 ? 240 GLN C CD  1 
ATOM   9421  O  OE1 . GLN C 1 240 ? 25.252 90.836  69.772  1.00 43.82 ? 240 GLN C OE1 1 
ATOM   9422  N  NE2 . GLN C 1 240 ? 26.304 92.796  69.419  1.00 44.17 ? 240 GLN C NE2 1 
ATOM   9423  N  N   . GLY C 1 241 ? 25.548 95.033  74.081  1.00 42.76 ? 241 GLY C N   1 
ATOM   9424  C  CA  . GLY C 1 241 ? 25.742 96.048  75.099  1.00 42.78 ? 241 GLY C CA  1 
ATOM   9425  C  C   . GLY C 1 241 ? 27.024 96.862  74.990  1.00 43.37 ? 241 GLY C C   1 
ATOM   9426  O  O   . GLY C 1 241 ? 28.040 96.392  74.469  1.00 44.24 ? 241 GLY C O   1 
ATOM   9427  N  N   . ILE C 1 242 ? 26.977 98.098  75.484  1.00 42.97 ? 242 ILE C N   1 
ATOM   9428  C  CA  . ILE C 1 242 ? 28.137 98.975  75.473  1.00 42.04 ? 242 ILE C CA  1 
ATOM   9429  C  C   . ILE C 1 242 ? 29.150 98.391  76.443  1.00 42.58 ? 242 ILE C C   1 
ATOM   9430  O  O   . ILE C 1 242 ? 28.778 97.759  77.427  1.00 42.45 ? 242 ILE C O   1 
ATOM   9431  C  CB  . ILE C 1 242 ? 27.755 100.417 75.916  1.00 40.64 ? 242 ILE C CB  1 
ATOM   9432  C  CG1 . ILE C 1 242 ? 26.956 101.108 74.810  1.00 40.58 ? 242 ILE C CG1 1 
ATOM   9433  C  CG2 . ILE C 1 242 ? 28.997 101.241 76.196  1.00 40.15 ? 242 ILE C CG2 1 
ATOM   9434  C  CD1 . ILE C 1 242 ? 27.743 101.353 73.521  1.00 38.62 ? 242 ILE C CD1 1 
ATOM   9435  N  N   . LYS C 1 243 ? 30.429 98.608  76.157  1.00 43.46 ? 243 LYS C N   1 
ATOM   9436  C  CA  . LYS C 1 243 ? 31.516 98.105  76.992  1.00 43.99 ? 243 LYS C CA  1 
ATOM   9437  C  C   . LYS C 1 243 ? 32.832 98.741  76.506  1.00 43.66 ? 243 LYS C C   1 
ATOM   9438  O  O   . LYS C 1 243 ? 33.136 98.691  75.310  1.00 43.38 ? 243 LYS C O   1 
ATOM   9439  C  CB  . LYS C 1 243 ? 31.564 96.578  76.856  1.00 45.25 ? 243 LYS C CB  1 
ATOM   9440  C  CG  . LYS C 1 243 ? 32.434 95.832  77.859  1.00 46.63 ? 243 LYS C CG  1 
ATOM   9441  C  CD  . LYS C 1 243 ? 32.277 94.325  77.668  1.00 47.86 ? 243 LYS C CD  1 
ATOM   9442  C  CE  . LYS C 1 243 ? 33.025 93.527  78.738  1.00 48.83 ? 243 LYS C CE  1 
ATOM   9443  N  NZ  . LYS C 1 243 ? 32.943 92.053  78.472  1.00 49.49 ? 243 LYS C NZ  1 
ATOM   9444  N  N   . ASN C 1 244 ? 33.601 99.343  77.413  1.00 42.96 ? 244 ASN C N   1 
ATOM   9445  C  CA  . ASN C 1 244 ? 34.868 99.972  77.030  1.00 43.16 ? 244 ASN C CA  1 
ATOM   9446  C  C   . ASN C 1 244 ? 36.070 99.450  77.807  1.00 43.21 ? 244 ASN C C   1 
ATOM   9447  O  O   . ASN C 1 244 ? 35.934 98.885  78.885  1.00 43.37 ? 244 ASN C O   1 
ATOM   9448  C  CB  . ASN C 1 244 ? 34.825 101.485 77.248  1.00 43.97 ? 244 ASN C CB  1 
ATOM   9449  C  CG  . ASN C 1 244 ? 33.560 102.124 76.734  1.00 45.02 ? 244 ASN C CG  1 
ATOM   9450  O  OD1 . ASN C 1 244 ? 33.232 102.040 75.541  1.00 46.00 ? 244 ASN C OD1 1 
ATOM   9451  N  ND2 . ASN C 1 244 ? 32.839 102.783 77.634  1.00 44.46 ? 244 ASN C ND2 1 
ATOM   9452  N  N   . LEU C 1 245 ? 37.256 99.684  77.254  1.00 43.52 ? 245 LEU C N   1 
ATOM   9453  C  CA  . LEU C 1 245 ? 38.516 99.277  77.873  1.00 43.49 ? 245 LEU C CA  1 
ATOM   9454  C  C   . LEU C 1 245 ? 39.119 100.450 78.647  1.00 43.62 ? 245 LEU C C   1 
ATOM   9455  O  O   . LEU C 1 245 ? 39.112 101.580 78.155  1.00 43.56 ? 245 LEU C O   1 
ATOM   9456  C  CB  . LEU C 1 245 ? 39.515 98.850  76.794  1.00 43.01 ? 245 LEU C CB  1 
ATOM   9457  C  CG  . LEU C 1 245 ? 39.263 97.543  76.051  1.00 43.30 ? 245 LEU C CG  1 
ATOM   9458  C  CD1 . LEU C 1 245 ? 40.129 97.484  74.799  1.00 42.81 ? 245 LEU C CD1 1 
ATOM   9459  C  CD2 . LEU C 1 245 ? 39.556 96.369  76.987  1.00 42.98 ? 245 LEU C CD2 1 
ATOM   9460  N  N   . SER C 1 246 ? 39.637 100.193 79.848  1.00 43.38 ? 246 SER C N   1 
ATOM   9461  C  CA  . SER C 1 246 ? 40.265 101.262 80.632  1.00 43.39 ? 246 SER C CA  1 
ATOM   9462  C  C   . SER C 1 246 ? 41.567 101.630 79.915  1.00 43.74 ? 246 SER C C   1 
ATOM   9463  O  O   . SER C 1 246 ? 42.111 100.820 79.153  1.00 43.88 ? 246 SER C O   1 
ATOM   9464  C  CB  . SER C 1 246 ? 40.593 100.782 82.046  1.00 42.89 ? 246 SER C CB  1 
ATOM   9465  O  OG  . SER C 1 246 ? 41.672 99.861  82.033  1.00 41.96 ? 246 SER C OG  1 
ATOM   9466  N  N   . VAL C 1 247 ? 42.079 102.831 80.155  1.00 43.60 ? 247 VAL C N   1 
ATOM   9467  C  CA  . VAL C 1 247 ? 43.310 103.243 79.492  1.00 44.54 ? 247 VAL C CA  1 
ATOM   9468  C  C   . VAL C 1 247 ? 44.434 102.216 79.671  1.00 46.21 ? 247 VAL C C   1 
ATOM   9469  O  O   . VAL C 1 247 ? 45.166 101.898 78.729  1.00 46.18 ? 247 VAL C O   1 
ATOM   9470  C  CB  . VAL C 1 247 ? 43.800 104.587 80.023  1.00 43.52 ? 247 VAL C CB  1 
ATOM   9471  C  CG1 . VAL C 1 247 ? 44.965 105.077 79.187  1.00 43.55 ? 247 VAL C CG1 1 
ATOM   9472  C  CG2 . VAL C 1 247 ? 42.677 105.585 79.999  1.00 44.06 ? 247 VAL C CG2 1 
ATOM   9473  N  N   . GLU C 1 248 ? 44.553 101.684 80.881  1.00 47.71 ? 248 GLU C N   1 
ATOM   9474  C  CA  . GLU C 1 248 ? 45.592 100.720 81.189  1.00 49.58 ? 248 GLU C CA  1 
ATOM   9475  C  C   . GLU C 1 248 ? 45.468 99.428  80.399  1.00 49.70 ? 248 GLU C C   1 
ATOM   9476  O  O   . GLU C 1 248 ? 46.444 98.978  79.796  1.00 49.66 ? 248 GLU C O   1 
ATOM   9477  C  CB  . GLU C 1 248 ? 45.606 100.430 82.693  1.00 52.05 ? 248 GLU C CB  1 
ATOM   9478  C  CG  . GLU C 1 248 ? 46.013 101.647 83.544  1.00 56.14 ? 248 GLU C CG  1 
ATOM   9479  C  CD  . GLU C 1 248 ? 45.018 102.824 83.449  1.00 58.47 ? 248 GLU C CD  1 
ATOM   9480  O  OE1 . GLU C 1 248 ? 45.424 103.980 83.755  1.00 58.96 ? 248 GLU C OE1 1 
ATOM   9481  O  OE2 . GLU C 1 248 ? 43.835 102.592 83.080  1.00 59.19 ? 248 GLU C OE2 1 
ATOM   9482  N  N   . ASP C 1 249 ? 44.282 98.826  80.391  1.00 49.73 ? 249 ASP C N   1 
ATOM   9483  C  CA  . ASP C 1 249 ? 44.107 97.582  79.649  1.00 49.80 ? 249 ASP C CA  1 
ATOM   9484  C  C   . ASP C 1 249 ? 44.338 97.841  78.174  1.00 49.00 ? 249 ASP C C   1 
ATOM   9485  O  O   . ASP C 1 249 ? 44.950 97.037  77.473  1.00 48.52 ? 249 ASP C O   1 
ATOM   9486  C  CB  . ASP C 1 249 ? 42.702 97.017  79.837  1.00 51.23 ? 249 ASP C CB  1 
ATOM   9487  C  CG  . ASP C 1 249 ? 42.396 96.687  81.275  1.00 52.35 ? 249 ASP C CG  1 
ATOM   9488  O  OD1 . ASP C 1 249 ? 43.285 96.135  81.963  1.00 53.67 ? 249 ASP C OD1 1 
ATOM   9489  O  OD2 . ASP C 1 249 ? 41.260 96.967  81.711  1.00 53.39 ? 249 ASP C OD2 1 
ATOM   9490  N  N   . ALA C 1 250 ? 43.839 98.982  77.716  1.00 48.16 ? 250 ALA C N   1 
ATOM   9491  C  CA  . ALA C 1 250 ? 43.972 99.370  76.327  1.00 47.60 ? 250 ALA C CA  1 
ATOM   9492  C  C   . ALA C 1 250 ? 45.447 99.400  75.902  1.00 47.12 ? 250 ALA C C   1 
ATOM   9493  O  O   . ALA C 1 250 ? 45.795 99.052  74.773  1.00 46.55 ? 250 ALA C O   1 
ATOM   9494  C  CB  . ALA C 1 250 ? 43.325 100.733 76.126  1.00 47.52 ? 250 ALA C CB  1 
ATOM   9495  N  N   . ALA C 1 251 ? 46.312 99.811  76.819  1.00 46.60 ? 251 ALA C N   1 
ATOM   9496  C  CA  . ALA C 1 251 ? 47.732 99.883  76.529  1.00 46.52 ? 251 ALA C CA  1 
ATOM   9497  C  C   . ALA C 1 251 ? 48.388 98.511  76.677  1.00 46.96 ? 251 ALA C C   1 
ATOM   9498  O  O   . ALA C 1 251 ? 49.145 98.075  75.806  1.00 47.37 ? 251 ALA C O   1 
ATOM   9499  C  CB  . ALA C 1 251 ? 48.389 100.889 77.453  1.00 45.99 ? 251 ALA C CB  1 
ATOM   9500  N  N   . ARG C 1 252 ? 48.105 97.827  77.782  1.00 47.20 ? 252 ARG C N   1 
ATOM   9501  C  CA  . ARG C 1 252 ? 48.672 96.502  78.002  1.00 46.89 ? 252 ARG C CA  1 
ATOM   9502  C  C   . ARG C 1 252 ? 48.293 95.655  76.797  1.00 46.61 ? 252 ARG C C   1 
ATOM   9503  O  O   . ARG C 1 252 ? 49.063 94.803  76.355  1.00 47.31 ? 252 ARG C O   1 
ATOM   9504  C  CB  . ARG C 1 252 ? 48.108 95.875  79.287  1.00 47.62 ? 252 ARG C CB  1 
ATOM   9505  C  CG  . ARG C 1 252 ? 48.370 94.369  79.428  1.00 48.55 ? 252 ARG C CG  1 
ATOM   9506  C  CD  . ARG C 1 252 ? 47.689 93.758  80.665  1.00 48.91 ? 252 ARG C CD  1 
ATOM   9507  N  NE  . ARG C 1 252 ? 46.222 93.792  80.630  1.00 49.84 ? 252 ARG C NE  1 
ATOM   9508  C  CZ  . ARG C 1 252 ? 45.451 92.960  79.925  1.00 50.41 ? 252 ARG C CZ  1 
ATOM   9509  N  NH1 . ARG C 1 252 ? 45.990 92.003  79.174  1.00 49.72 ? 252 ARG C NH1 1 
ATOM   9510  N  NH2 . ARG C 1 252 ? 44.127 93.079  79.983  1.00 51.14 ? 252 ARG C NH2 1 
ATOM   9511  N  N   . LEU C 1 253 ? 47.104 95.906  76.261  1.00 46.06 ? 253 LEU C N   1 
ATOM   9512  C  CA  . LEU C 1 253 ? 46.626 95.164  75.109  1.00 45.86 ? 253 LEU C CA  1 
ATOM   9513  C  C   . LEU C 1 253 ? 47.281 95.573  73.802  1.00 46.07 ? 253 LEU C C   1 
ATOM   9514  O  O   . LEU C 1 253 ? 47.581 94.714  72.968  1.00 46.44 ? 253 LEU C O   1 
ATOM   9515  C  CB  . LEU C 1 253 ? 45.113 95.299  74.978  1.00 45.43 ? 253 LEU C CB  1 
ATOM   9516  C  CG  . LEU C 1 253 ? 44.309 94.461  75.970  1.00 45.00 ? 253 LEU C CG  1 
ATOM   9517  C  CD1 . LEU C 1 253 ? 42.845 94.729  75.747  1.00 45.32 ? 253 LEU C CD1 1 
ATOM   9518  C  CD2 . LEU C 1 253 ? 44.612 92.979  75.795  1.00 44.70 ? 253 LEU C CD2 1 
ATOM   9519  N  N   . SER C 1 254 ? 47.502 96.872  73.612  1.00 46.14 ? 254 SER C N   1 
ATOM   9520  C  CA  . SER C 1 254 ? 48.124 97.348  72.374  1.00 45.85 ? 254 SER C CA  1 
ATOM   9521  C  C   . SER C 1 254 ? 49.484 96.690  72.210  1.00 46.13 ? 254 SER C C   1 
ATOM   9522  O  O   . SER C 1 254 ? 50.045 96.673  71.113  1.00 46.51 ? 254 SER C O   1 
ATOM   9523  C  CB  . SER C 1 254 ? 48.294 98.872  72.386  1.00 45.22 ? 254 SER C CB  1 
ATOM   9524  O  OG  . SER C 1 254 ? 49.370 99.272  73.217  1.00 45.65 ? 254 SER C OG  1 
ATOM   9525  N  N   . GLN C 1 255 ? 50.008 96.146  73.307  1.00 46.04 ? 255 GLN C N   1 
ATOM   9526  C  CA  . GLN C 1 255 ? 51.299 95.477  73.281  1.00 46.19 ? 255 GLN C CA  1 
ATOM   9527  C  C   . GLN C 1 255 ? 51.186 93.953  73.255  1.00 46.07 ? 255 GLN C C   1 
ATOM   9528  O  O   . GLN C 1 255 ? 51.959 93.280  72.576  1.00 45.82 ? 255 GLN C O   1 
ATOM   9529  C  CB  . GLN C 1 255 ? 52.140 95.911  74.482  1.00 47.49 ? 255 GLN C CB  1 
ATOM   9530  C  CG  . GLN C 1 255 ? 53.365 95.042  74.723  1.00 48.81 ? 255 GLN C CG  1 
ATOM   9531  C  CD  . GLN C 1 255 ? 53.092 93.928  75.723  1.00 49.99 ? 255 GLN C CD  1 
ATOM   9532  O  OE1 . GLN C 1 255 ? 53.415 92.757  75.477  1.00 50.06 ? 255 GLN C OE1 1 
ATOM   9533  N  NE2 . GLN C 1 255 ? 52.504 94.289  76.865  1.00 50.06 ? 255 GLN C NE2 1 
ATOM   9534  N  N   . GLU C 1 256 ? 50.227 93.406  73.993  1.00 46.00 ? 256 GLU C N   1 
ATOM   9535  C  CA  . GLU C 1 256 ? 50.049 91.957  74.031  1.00 46.10 ? 256 GLU C CA  1 
ATOM   9536  C  C   . GLU C 1 256 ? 49.371 91.427  72.786  1.00 45.01 ? 256 GLU C C   1 
ATOM   9537  O  O   . GLU C 1 256 ? 49.700 90.350  72.297  1.00 44.65 ? 256 GLU C O   1 
ATOM   9538  C  CB  . GLU C 1 256 ? 49.234 91.552  75.254  1.00 47.37 ? 256 GLU C CB  1 
ATOM   9539  C  CG  . GLU C 1 256 ? 49.977 91.761  76.556  1.00 50.14 ? 256 GLU C CG  1 
ATOM   9540  C  CD  . GLU C 1 256 ? 49.178 91.302  77.752  1.00 51.92 ? 256 GLU C CD  1 
ATOM   9541  O  OE1 . GLU C 1 256 ? 49.734 91.336  78.880  1.00 52.60 ? 256 GLU C OE1 1 
ATOM   9542  O  OE2 . GLU C 1 256 ? 47.997 90.912  77.557  1.00 52.42 ? 256 GLU C OE2 1 
ATOM   9543  N  N   . ASP C 1 257 ? 48.418 92.189  72.271  1.00 44.05 ? 257 ASP C N   1 
ATOM   9544  C  CA  . ASP C 1 257 ? 47.704 91.763  71.083  1.00 43.12 ? 257 ASP C CA  1 
ATOM   9545  C  C   . ASP C 1 257 ? 47.212 92.961  70.284  1.00 42.64 ? 257 ASP C C   1 
ATOM   9546  O  O   . ASP C 1 257 ? 46.096 93.439  70.470  1.00 43.22 ? 257 ASP C O   1 
ATOM   9547  C  CB  . ASP C 1 257 ? 46.527 90.876  71.474  1.00 41.48 ? 257 ASP C CB  1 
ATOM   9548  C  CG  . ASP C 1 257 ? 45.801 90.323  70.280  1.00 40.88 ? 257 ASP C CG  1 
ATOM   9549  O  OD1 . ASP C 1 257 ? 44.762 89.668  70.475  1.00 40.04 ? 257 ASP C OD1 1 
ATOM   9550  O  OD2 . ASP C 1 257 ? 46.269 90.537  69.147  1.00 41.73 ? 257 ASP C OD2 1 
ATOM   9551  N  N   . PRO C 1 258 ? 48.060 93.478  69.395  1.00 42.03 ? 258 PRO C N   1 
ATOM   9552  C  CA  . PRO C 1 258 ? 47.668 94.625  68.582  1.00 41.13 ? 258 PRO C CA  1 
ATOM   9553  C  C   . PRO C 1 258 ? 46.522 94.315  67.623  1.00 40.22 ? 258 PRO C C   1 
ATOM   9554  O  O   . PRO C 1 258 ? 45.966 95.218  67.010  1.00 40.82 ? 258 PRO C O   1 
ATOM   9555  C  CB  . PRO C 1 258 ? 48.970 94.998  67.865  1.00 41.82 ? 258 PRO C CB  1 
ATOM   9556  C  CG  . PRO C 1 258 ? 49.752 93.706  67.841  1.00 41.76 ? 258 PRO C CG  1 
ATOM   9557  C  CD  . PRO C 1 258 ? 49.491 93.174  69.222  1.00 42.36 ? 258 PRO C CD  1 
ATOM   9558  N  N   . ASP C 1 259 ? 46.156 93.046  67.498  1.00 39.22 ? 259 ASP C N   1 
ATOM   9559  C  CA  . ASP C 1 259 ? 45.069 92.683  66.601  1.00 38.87 ? 259 ASP C CA  1 
ATOM   9560  C  C   . ASP C 1 259 ? 43.849 92.193  67.366  1.00 38.93 ? 259 ASP C C   1 
ATOM   9561  O  O   . ASP C 1 259 ? 42.969 91.532  66.815  1.00 39.09 ? 259 ASP C O   1 
ATOM   9562  C  CB  . ASP C 1 259 ? 45.543 91.623  65.609  1.00 38.60 ? 259 ASP C CB  1 
ATOM   9563  C  CG  . ASP C 1 259 ? 46.707 92.108  64.761  1.00 39.11 ? 259 ASP C CG  1 
ATOM   9564  O  OD1 . ASP C 1 259 ? 46.643 93.264  64.280  1.00 38.62 ? 259 ASP C OD1 1 
ATOM   9565  O  OD2 . ASP C 1 259 ? 47.686 91.344  64.578  1.00 38.77 ? 259 ASP C OD2 1 
ATOM   9566  N  N   . TYR C 1 260 ? 43.806 92.548  68.643  1.00 38.69 ? 260 TYR C N   1 
ATOM   9567  C  CA  . TYR C 1 260 ? 42.726 92.188  69.555  1.00 38.70 ? 260 TYR C CA  1 
ATOM   9568  C  C   . TYR C 1 260 ? 41.338 92.260  68.942  1.00 38.19 ? 260 TYR C C   1 
ATOM   9569  O  O   . TYR C 1 260 ? 40.579 91.293  69.005  1.00 38.96 ? 260 TYR C O   1 
ATOM   9570  C  CB  . TYR C 1 260 ? 42.798 93.095  70.775  1.00 39.57 ? 260 TYR C CB  1 
ATOM   9571  C  CG  . TYR C 1 260 ? 41.712 92.918  71.790  1.00 40.28 ? 260 TYR C CG  1 
ATOM   9572  C  CD1 . TYR C 1 260 ? 40.520 93.640  71.704  1.00 41.96 ? 260 TYR C CD1 1 
ATOM   9573  C  CD2 . TYR C 1 260 ? 41.900 92.086  72.881  1.00 41.19 ? 260 TYR C CD2 1 
ATOM   9574  C  CE1 . TYR C 1 260 ? 39.536 93.543  72.700  1.00 42.48 ? 260 TYR C CE1 1 
ATOM   9575  C  CE2 . TYR C 1 260 ? 40.930 91.976  73.880  1.00 42.66 ? 260 TYR C CE2 1 
ATOM   9576  C  CZ  . TYR C 1 260 ? 39.755 92.709  73.787  1.00 42.98 ? 260 TYR C CZ  1 
ATOM   9577  O  OH  . TYR C 1 260 ? 38.833 92.615  74.803  1.00 43.55 ? 260 TYR C OH  1 
ATOM   9578  N  N   . GLY C 1 261 ? 41.005 93.405  68.356  1.00 37.54 ? 261 GLY C N   1 
ATOM   9579  C  CA  . GLY C 1 261 ? 39.699 93.569  67.743  1.00 36.19 ? 261 GLY C CA  1 
ATOM   9580  C  C   . GLY C 1 261 ? 39.371 92.523  66.692  1.00 35.86 ? 261 GLY C C   1 
ATOM   9581  O  O   . GLY C 1 261 ? 38.251 92.020  66.623  1.00 35.72 ? 261 GLY C O   1 
ATOM   9582  N  N   . ILE C 1 262 ? 40.344 92.185  65.863  1.00 35.47 ? 262 ILE C N   1 
ATOM   9583  C  CA  . ILE C 1 262 ? 40.115 91.189  64.827  1.00 35.84 ? 262 ILE C CA  1 
ATOM   9584  C  C   . ILE C 1 262 ? 39.876 89.805  65.430  1.00 35.95 ? 262 ILE C C   1 
ATOM   9585  O  O   . ILE C 1 262 ? 38.958 89.086  65.037  1.00 35.42 ? 262 ILE C O   1 
ATOM   9586  C  CB  . ILE C 1 262 ? 41.318 91.100  63.883  1.00 34.82 ? 262 ILE C CB  1 
ATOM   9587  C  CG1 . ILE C 1 262 ? 41.561 92.455  63.230  1.00 33.54 ? 262 ILE C CG1 1 
ATOM   9588  C  CG2 . ILE C 1 262 ? 41.073 90.030  62.835  1.00 34.99 ? 262 ILE C CG2 1 
ATOM   9589  C  CD1 . ILE C 1 262 ? 42.955 92.603  62.719  1.00 32.74 ? 262 ILE C CD1 1 
ATOM   9590  N  N   . ARG C 1 263 ? 40.715 89.446  66.390  1.00 36.63 ? 263 ARG C N   1 
ATOM   9591  C  CA  . ARG C 1 263 ? 40.631 88.152  67.045  1.00 37.40 ? 263 ARG C CA  1 
ATOM   9592  C  C   . ARG C 1 263 ? 39.308 87.974  67.781  1.00 37.91 ? 263 ARG C C   1 
ATOM   9593  O  O   . ARG C 1 263 ? 38.683 86.913  67.704  1.00 38.43 ? 263 ARG C O   1 
ATOM   9594  C  CB  . ARG C 1 263 ? 41.798 88.001  68.025  1.00 37.51 ? 263 ARG C CB  1 
ATOM   9595  C  CG  . ARG C 1 263 ? 42.108 86.576  68.410  1.00 37.70 ? 263 ARG C CG  1 
ATOM   9596  C  CD  . ARG C 1 263 ? 43.100 86.525  69.551  1.00 38.45 ? 263 ARG C CD  1 
ATOM   9597  N  NE  . ARG C 1 263 ? 44.351 87.227  69.261  1.00 40.42 ? 263 ARG C NE  1 
ATOM   9598  C  CZ  . ARG C 1 263 ? 45.404 86.706  68.628  1.00 40.44 ? 263 ARG C CZ  1 
ATOM   9599  N  NH1 . ARG C 1 263 ? 45.390 85.449  68.198  1.00 39.98 ? 263 ARG C NH1 1 
ATOM   9600  N  NH2 . ARG C 1 263 ? 46.478 87.457  68.425  1.00 39.98 ? 263 ARG C NH2 1 
ATOM   9601  N  N   . ASP C 1 264 ? 38.880 89.010  68.495  1.00 38.03 ? 264 ASP C N   1 
ATOM   9602  C  CA  . ASP C 1 264 ? 37.633 88.934  69.245  1.00 38.66 ? 264 ASP C CA  1 
ATOM   9603  C  C   . ASP C 1 264 ? 36.463 88.661  68.313  1.00 38.80 ? 264 ASP C C   1 
ATOM   9604  O  O   . ASP C 1 264 ? 35.741 87.674  68.471  1.00 39.18 ? 264 ASP C O   1 
ATOM   9605  C  CB  . ASP C 1 264 ? 37.408 90.231  70.026  1.00 40.00 ? 264 ASP C CB  1 
ATOM   9606  C  CG  . ASP C 1 264 ? 36.001 90.343  70.595  1.00 41.58 ? 264 ASP C CG  1 
ATOM   9607  O  OD1 . ASP C 1 264 ? 35.071 90.666  69.825  1.00 42.45 ? 264 ASP C OD1 1 
ATOM   9608  O  OD2 . ASP C 1 264 ? 35.821 90.108  71.811  1.00 42.18 ? 264 ASP C OD2 1 
ATOM   9609  N  N   . LEU C 1 265 ? 36.289 89.525  67.325  1.00 38.62 ? 265 LEU C N   1 
ATOM   9610  C  CA  . LEU C 1 265 ? 35.204 89.362  66.378  1.00 38.51 ? 265 LEU C CA  1 
ATOM   9611  C  C   . LEU C 1 265 ? 35.253 87.991  65.694  1.00 38.27 ? 265 LEU C C   1 
ATOM   9612  O  O   . LEU C 1 265 ? 34.223 87.340  65.547  1.00 38.74 ? 265 LEU C O   1 
ATOM   9613  C  CB  . LEU C 1 265 ? 35.254 90.480  65.333  1.00 38.87 ? 265 LEU C CB  1 
ATOM   9614  C  CG  . LEU C 1 265 ? 34.169 90.433  64.257  1.00 39.17 ? 265 LEU C CG  1 
ATOM   9615  C  CD1 . LEU C 1 265 ? 32.827 90.716  64.888  1.00 38.53 ? 265 LEU C CD1 1 
ATOM   9616  C  CD2 . LEU C 1 265 ? 34.470 91.443  63.162  1.00 39.63 ? 265 LEU C CD2 1 
ATOM   9617  N  N   . PHE C 1 266 ? 36.439 87.541  65.295  1.00 37.91 ? 266 PHE C N   1 
ATOM   9618  C  CA  . PHE C 1 266 ? 36.562 86.251  64.617  1.00 38.21 ? 266 PHE C CA  1 
ATOM   9619  C  C   . PHE C 1 266 ? 36.200 85.063  65.495  1.00 39.25 ? 266 PHE C C   1 
ATOM   9620  O  O   . PHE C 1 266 ? 35.415 84.196  65.086  1.00 38.38 ? 266 PHE C O   1 
ATOM   9621  C  CB  . PHE C 1 266 ? 37.980 86.061  64.074  1.00 37.54 ? 266 PHE C CB  1 
ATOM   9622  C  CG  . PHE C 1 266 ? 38.124 84.884  63.136  1.00 36.68 ? 266 PHE C CG  1 
ATOM   9623  C  CD1 . PHE C 1 266 ? 38.345 83.596  63.630  1.00 36.41 ? 266 PHE C CD1 1 
ATOM   9624  C  CD2 . PHE C 1 266 ? 38.039 85.066  61.756  1.00 35.63 ? 266 PHE C CD2 1 
ATOM   9625  C  CE1 . PHE C 1 266 ? 38.483 82.502  62.762  1.00 35.53 ? 266 PHE C CE1 1 
ATOM   9626  C  CE2 . PHE C 1 266 ? 38.173 83.980  60.879  1.00 35.76 ? 266 PHE C CE2 1 
ATOM   9627  C  CZ  . PHE C 1 266 ? 38.395 82.697  61.383  1.00 35.13 ? 266 PHE C CZ  1 
ATOM   9628  N  N   . ASN C 1 267 ? 36.768 85.002  66.697  1.00 40.27 ? 267 ASN C N   1 
ATOM   9629  C  CA  . ASN C 1 267 ? 36.447 83.883  67.576  1.00 41.79 ? 267 ASN C CA  1 
ATOM   9630  C  C   . ASN C 1 267 ? 34.971 83.914  67.941  1.00 41.12 ? 267 ASN C C   1 
ATOM   9631  O  O   . ASN C 1 267 ? 34.292 82.886  67.894  1.00 41.54 ? 267 ASN C O   1 
ATOM   9632  C  CB  . ASN C 1 267 ? 37.324 83.893  68.834  1.00 43.62 ? 267 ASN C CB  1 
ATOM   9633  C  CG  . ASN C 1 267 ? 38.780 83.569  68.526  1.00 46.11 ? 267 ASN C CG  1 
ATOM   9634  O  OD1 . ASN C 1 267 ? 39.087 82.874  67.544  1.00 47.30 ? 267 ASN C OD1 1 
ATOM   9635  N  ND2 . ASN C 1 267 ? 39.686 84.059  69.368  1.00 47.65 ? 267 ASN C ND2 1 
ATOM   9636  N  N   . ALA C 1 268 ? 34.468 85.095  68.282  1.00 40.30 ? 268 ALA C N   1 
ATOM   9637  C  CA  . ALA C 1 268 ? 33.060 85.234  68.623  1.00 39.77 ? 268 ALA C CA  1 
ATOM   9638  C  C   . ALA C 1 268 ? 32.209 84.510  67.582  1.00 39.52 ? 268 ALA C C   1 
ATOM   9639  O  O   . ALA C 1 268 ? 31.461 83.590  67.913  1.00 39.65 ? 268 ALA C O   1 
ATOM   9640  C  CB  . ALA C 1 268 ? 32.678 86.702  68.679  1.00 38.96 ? 268 ALA C CB  1 
ATOM   9641  N  N   . ILE C 1 269 ? 32.344 84.911  66.321  1.00 38.89 ? 269 ILE C N   1 
ATOM   9642  C  CA  . ILE C 1 269 ? 31.577 84.302  65.243  1.00 38.23 ? 269 ILE C CA  1 
ATOM   9643  C  C   . ILE C 1 269 ? 31.904 82.835  65.059  1.00 38.95 ? 269 ILE C C   1 
ATOM   9644  O  O   . ILE C 1 269 ? 31.016 82.024  64.834  1.00 39.76 ? 269 ILE C O   1 
ATOM   9645  C  CB  . ILE C 1 269 ? 31.819 85.019  63.895  1.00 37.49 ? 269 ILE C CB  1 
ATOM   9646  C  CG1 . ILE C 1 269 ? 31.151 86.390  63.903  1.00 36.34 ? 269 ILE C CG1 1 
ATOM   9647  C  CG2 . ILE C 1 269 ? 31.276 84.177  62.745  1.00 37.29 ? 269 ILE C CG2 1 
ATOM   9648  C  CD1 . ILE C 1 269 ? 31.486 87.238  62.703  1.00 37.03 ? 269 ILE C CD1 1 
ATOM   9649  N  N   . ALA C 1 270 ? 33.178 82.487  65.141  1.00 40.05 ? 270 ALA C N   1 
ATOM   9650  C  CA  . ALA C 1 270 ? 33.561 81.096  64.955  1.00 40.73 ? 270 ALA C CA  1 
ATOM   9651  C  C   . ALA C 1 270 ? 33.033 80.211  66.073  1.00 41.54 ? 270 ALA C C   1 
ATOM   9652  O  O   . ALA C 1 270 ? 32.942 78.994  65.905  1.00 42.25 ? 270 ALA C O   1 
ATOM   9653  C  CB  . ALA C 1 270 ? 35.063 80.975  64.864  1.00 40.57 ? 270 ALA C CB  1 
ATOM   9654  N  N   . THR C 1 271 ? 32.685 80.801  67.216  1.00 41.62 ? 271 THR C N   1 
ATOM   9655  C  CA  . THR C 1 271 ? 32.160 79.992  68.316  1.00 42.01 ? 271 THR C CA  1 
ATOM   9656  C  C   . THR C 1 271 ? 30.656 80.203  68.561  1.00 42.96 ? 271 THR C C   1 
ATOM   9657  O  O   . THR C 1 271 ? 30.154 79.955  69.663  1.00 43.46 ? 271 THR C O   1 
ATOM   9658  C  CB  . THR C 1 271 ? 32.932 80.242  69.638  1.00 41.04 ? 271 THR C CB  1 
ATOM   9659  O  OG1 . THR C 1 271 ? 32.649 81.554  70.128  1.00 41.96 ? 271 THR C OG1 1 
ATOM   9660  C  CG2 . THR C 1 271 ? 34.421 80.115  69.414  1.00 40.50 ? 271 THR C CG2 1 
ATOM   9661  N  N   . GLY C 1 272 ? 29.944 80.663  67.532  1.00 42.84 ? 272 GLY C N   1 
ATOM   9662  C  CA  . GLY C 1 272 ? 28.512 80.871  67.650  1.00 43.05 ? 272 GLY C CA  1 
ATOM   9663  C  C   . GLY C 1 272 ? 28.022 82.141  68.323  1.00 43.45 ? 272 GLY C C   1 
ATOM   9664  O  O   . GLY C 1 272 ? 26.816 82.376  68.389  1.00 43.78 ? 272 GLY C O   1 
ATOM   9665  N  N   . LYS C 1 273 ? 28.932 82.967  68.825  1.00 43.73 ? 273 LYS C N   1 
ATOM   9666  C  CA  . LYS C 1 273 ? 28.525 84.205  69.480  1.00 43.50 ? 273 LYS C CA  1 
ATOM   9667  C  C   . LYS C 1 273 ? 28.263 85.317  68.479  1.00 42.42 ? 273 LYS C C   1 
ATOM   9668  O  O   . LYS C 1 273 ? 28.738 86.450  68.629  1.00 41.92 ? 273 LYS C O   1 
ATOM   9669  C  CB  . LYS C 1 273 ? 29.582 84.655  70.483  1.00 45.19 ? 273 LYS C CB  1 
ATOM   9670  C  CG  . LYS C 1 273 ? 29.400 84.069  71.857  1.00 47.68 ? 273 LYS C CG  1 
ATOM   9671  C  CD  . LYS C 1 273 ? 29.403 82.553  71.819  1.00 51.01 ? 273 LYS C CD  1 
ATOM   9672  C  CE  . LYS C 1 273 ? 29.436 81.985  73.236  1.00 53.43 ? 273 LYS C CE  1 
ATOM   9673  N  NZ  . LYS C 1 273 ? 30.624 82.529  73.987  1.00 54.30 ? 273 LYS C NZ  1 
ATOM   9674  N  N   . TYR C 1 274 ? 27.496 84.987  67.453  1.00 41.22 ? 274 TYR C N   1 
ATOM   9675  C  CA  . TYR C 1 274 ? 27.159 85.959  66.437  1.00 40.51 ? 274 TYR C CA  1 
ATOM   9676  C  C   . TYR C 1 274 ? 26.662 87.255  67.069  1.00 40.06 ? 274 TYR C C   1 
ATOM   9677  O  O   . TYR C 1 274 ? 25.650 87.259  67.764  1.00 40.72 ? 274 TYR C O   1 
ATOM   9678  C  CB  . TYR C 1 274 ? 26.067 85.405  65.551  1.00 40.30 ? 274 TYR C CB  1 
ATOM   9679  C  CG  . TYR C 1 274 ? 26.318 84.010  65.053  1.00 41.29 ? 274 TYR C CG  1 
ATOM   9680  C  CD1 . TYR C 1 274 ? 27.559 83.642  64.551  1.00 41.10 ? 274 TYR C CD1 1 
ATOM   9681  C  CD2 . TYR C 1 274 ? 25.279 83.088  64.986  1.00 41.73 ? 274 TYR C CD2 1 
ATOM   9682  C  CE1 . TYR C 1 274 ? 27.758 82.398  63.983  1.00 42.37 ? 274 TYR C CE1 1 
ATOM   9683  C  CE2 . TYR C 1 274 ? 25.463 81.843  64.421  1.00 42.94 ? 274 TYR C CE2 1 
ATOM   9684  C  CZ  . TYR C 1 274 ? 26.705 81.500  63.914  1.00 43.00 ? 274 TYR C CZ  1 
ATOM   9685  O  OH  . TYR C 1 274 ? 26.873 80.274  63.304  1.00 43.53 ? 274 TYR C OH  1 
ATOM   9686  N  N   . PRO C 1 275 ? 27.365 88.372  66.835  1.00 39.39 ? 275 PRO C N   1 
ATOM   9687  C  CA  . PRO C 1 275 ? 26.970 89.670  67.391  1.00 39.02 ? 275 PRO C CA  1 
ATOM   9688  C  C   . PRO C 1 275 ? 25.861 90.324  66.570  1.00 39.24 ? 275 PRO C C   1 
ATOM   9689  O  O   . PRO C 1 275 ? 25.786 90.135  65.348  1.00 39.39 ? 275 PRO C O   1 
ATOM   9690  C  CB  . PRO C 1 275 ? 28.258 90.475  67.323  1.00 39.04 ? 275 PRO C CB  1 
ATOM   9691  C  CG  . PRO C 1 275 ? 28.847 89.981  66.028  1.00 39.33 ? 275 PRO C CG  1 
ATOM   9692  C  CD  . PRO C 1 275 ? 28.666 88.472  66.153  1.00 38.96 ? 275 PRO C CD  1 
ATOM   9693  N  N   . SER C 1 276 ? 25.017 91.110  67.237  1.00 38.73 ? 276 SER C N   1 
ATOM   9694  C  CA  . SER C 1 276 ? 23.921 91.775  66.558  1.00 38.51 ? 276 SER C CA  1 
ATOM   9695  C  C   . SER C 1 276 ? 23.704 93.205  67.020  1.00 37.83 ? 276 SER C C   1 
ATOM   9696  O  O   . SER C 1 276 ? 24.119 93.599  68.108  1.00 38.05 ? 276 SER C O   1 
ATOM   9697  C  CB  . SER C 1 276 ? 22.622 90.982  66.741  1.00 39.58 ? 276 SER C CB  1 
ATOM   9698  O  OG  . SER C 1 276 ? 22.226 90.953  68.103  1.00 41.00 ? 276 SER C OG  1 
ATOM   9699  N  N   . TRP C 1 277 ? 23.052 93.977  66.162  1.00 36.95 ? 277 TRP C N   1 
ATOM   9700  C  CA  . TRP C 1 277 ? 22.744 95.367  66.445  1.00 37.19 ? 277 TRP C CA  1 
ATOM   9701  C  C   . TRP C 1 277 ? 21.285 95.541  66.042  1.00 37.84 ? 277 TRP C C   1 
ATOM   9702  O  O   . TRP C 1 277 ? 20.798 94.831  65.146  1.00 36.68 ? 277 TRP C O   1 
ATOM   9703  C  CB  . TRP C 1 277 ? 23.615 96.311  65.593  1.00 36.82 ? 277 TRP C CB  1 
ATOM   9704  C  CG  . TRP C 1 277 ? 25.048 96.442  66.033  1.00 35.97 ? 277 TRP C CG  1 
ATOM   9705  C  CD1 . TRP C 1 277 ? 25.595 97.465  66.759  1.00 35.25 ? 277 TRP C CD1 1 
ATOM   9706  C  CD2 . TRP C 1 277 ? 26.095 95.481  65.845  1.00 35.66 ? 277 TRP C CD2 1 
ATOM   9707  N  NE1 . TRP C 1 277 ? 26.910 97.195  67.041  1.00 35.22 ? 277 TRP C NE1 1 
ATOM   9708  C  CE2 . TRP C 1 277 ? 27.243 95.983  66.493  1.00 35.44 ? 277 TRP C CE2 1 
ATOM   9709  C  CE3 . TRP C 1 277 ? 26.172 94.239  65.194  1.00 35.88 ? 277 TRP C CE3 1 
ATOM   9710  C  CZ2 . TRP C 1 277 ? 28.454 95.288  66.513  1.00 35.34 ? 277 TRP C CZ2 1 
ATOM   9711  C  CZ3 . TRP C 1 277 ? 27.382 93.544  65.215  1.00 35.89 ? 277 TRP C CZ3 1 
ATOM   9712  C  CH2 . TRP C 1 277 ? 28.505 94.074  65.872  1.00 35.69 ? 277 TRP C CH2 1 
ATOM   9713  N  N   . THR C 1 278 ? 20.595 96.465  66.718  1.00 38.64 ? 278 THR C N   1 
ATOM   9714  C  CA  . THR C 1 278 ? 19.195 96.782  66.413  1.00 39.20 ? 278 THR C CA  1 
ATOM   9715  C  C   . THR C 1 278 ? 19.177 98.097  65.610  1.00 39.32 ? 278 THR C C   1 
ATOM   9716  O  O   . THR C 1 278 ? 19.723 99.124  66.039  1.00 38.75 ? 278 THR C O   1 
ATOM   9717  C  CB  . THR C 1 278 ? 18.354 96.919  67.701  1.00 39.35 ? 278 THR C CB  1 
ATOM   9718  O  OG1 . THR C 1 278 ? 18.355 95.670  68.405  1.00 39.09 ? 278 THR C OG1 1 
ATOM   9719  C  CG2 . THR C 1 278 ? 16.918 97.291  67.358  1.00 38.65 ? 278 THR C CG2 1 
ATOM   9720  N  N   . PHE C 1 279 ? 18.551 98.053  64.441  1.00 39.12 ? 279 PHE C N   1 
ATOM   9721  C  CA  . PHE C 1 279 ? 18.523 99.202  63.551  1.00 39.92 ? 279 PHE C CA  1 
ATOM   9722  C  C   . PHE C 1 279 ? 17.350 100.179 63.731  1.00 40.45 ? 279 PHE C C   1 
ATOM   9723  O  O   . PHE C 1 279 ? 16.190 99.821  63.517  1.00 40.28 ? 279 PHE C O   1 
ATOM   9724  C  CB  . PHE C 1 279 ? 18.573 98.673  62.113  1.00 40.59 ? 279 PHE C CB  1 
ATOM   9725  C  CG  . PHE C 1 279 ? 19.128 99.645  61.114  1.00 41.62 ? 279 PHE C CG  1 
ATOM   9726  C  CD1 . PHE C 1 279 ? 18.284 100.482 60.387  1.00 42.35 ? 279 PHE C CD1 1 
ATOM   9727  C  CD2 . PHE C 1 279 ? 20.497 99.708  60.877  1.00 41.83 ? 279 PHE C CD2 1 
ATOM   9728  C  CE1 . PHE C 1 279 ? 18.799 101.369 59.430  1.00 42.61 ? 279 PHE C CE1 1 
ATOM   9729  C  CE2 . PHE C 1 279 ? 21.022 100.587 59.926  1.00 42.20 ? 279 PHE C CE2 1 
ATOM   9730  C  CZ  . PHE C 1 279 ? 20.168 101.420 59.199  1.00 42.15 ? 279 PHE C CZ  1 
ATOM   9731  N  N   . TYR C 1 280 ? 17.665 101.414 64.127  1.00 40.69 ? 280 TYR C N   1 
ATOM   9732  C  CA  . TYR C 1 280 ? 16.652 102.458 64.301  1.00 41.29 ? 280 TYR C CA  1 
ATOM   9733  C  C   . TYR C 1 280 ? 16.891 103.601 63.316  1.00 41.29 ? 280 TYR C C   1 
ATOM   9734  O  O   . TYR C 1 280 ? 17.857 103.595 62.547  1.00 41.70 ? 280 TYR C O   1 
ATOM   9735  C  CB  . TYR C 1 280 ? 16.694 103.081 65.702  1.00 41.59 ? 280 TYR C CB  1 
ATOM   9736  C  CG  . TYR C 1 280 ? 16.607 102.128 66.859  1.00 42.90 ? 280 TYR C CG  1 
ATOM   9737  C  CD1 . TYR C 1 280 ? 17.755 101.574 67.404  1.00 43.39 ? 280 TYR C CD1 1 
ATOM   9738  C  CD2 . TYR C 1 280 ? 15.377 101.808 67.439  1.00 43.25 ? 280 TYR C CD2 1 
ATOM   9739  C  CE1 . TYR C 1 280 ? 17.692 100.724 68.509  1.00 44.79 ? 280 TYR C CE1 1 
ATOM   9740  C  CE2 . TYR C 1 280 ? 15.299 100.959 68.546  1.00 43.76 ? 280 TYR C CE2 1 
ATOM   9741  C  CZ  . TYR C 1 280 ? 16.465 100.420 69.076  1.00 44.32 ? 280 TYR C CZ  1 
ATOM   9742  O  OH  . TYR C 1 280 ? 16.429 99.586  70.171  1.00 44.08 ? 280 TYR C OH  1 
ATOM   9743  N  N   . ILE C 1 281 ? 15.992 104.581 63.359  1.00 40.90 ? 281 ILE C N   1 
ATOM   9744  C  CA  . ILE C 1 281 ? 16.091 105.787 62.547  1.00 40.64 ? 281 ILE C CA  1 
ATOM   9745  C  C   . ILE C 1 281 ? 15.400 106.860 63.344  1.00 41.16 ? 281 ILE C C   1 
ATOM   9746  O  O   . ILE C 1 281 ? 14.559 106.561 64.183  1.00 41.45 ? 281 ILE C O   1 
ATOM   9747  C  CB  . ILE C 1 281 ? 15.341 105.710 61.210  1.00 39.32 ? 281 ILE C CB  1 
ATOM   9748  C  CG1 . ILE C 1 281 ? 13.848 105.527 61.457  1.00 40.05 ? 281 ILE C CG1 1 
ATOM   9749  C  CG2 . ILE C 1 281 ? 15.888 104.608 60.377  1.00 40.21 ? 281 ILE C CG2 1 
ATOM   9750  C  CD1 . ILE C 1 281 ? 13.001 105.544 60.189  1.00 40.23 ? 281 ILE C CD1 1 
ATOM   9751  N  N   . GLN C 1 282 ? 15.785 108.103 63.097  1.00 41.59 ? 282 GLN C N   1 
ATOM   9752  C  CA  . GLN C 1 282 ? 15.155 109.246 63.729  1.00 41.72 ? 282 GLN C CA  1 
ATOM   9753  C  C   . GLN C 1 282 ? 14.608 110.002 62.530  1.00 41.84 ? 282 GLN C C   1 
ATOM   9754  O  O   . GLN C 1 282 ? 15.262 110.085 61.489  1.00 41.67 ? 282 GLN C O   1 
ATOM   9755  C  CB  . GLN C 1 282 ? 16.164 110.116 64.472  1.00 42.27 ? 282 GLN C CB  1 
ATOM   9756  C  CG  . GLN C 1 282 ? 16.630 109.556 65.794  1.00 43.47 ? 282 GLN C CG  1 
ATOM   9757  C  CD  . GLN C 1 282 ? 17.563 110.512 66.519  1.00 44.92 ? 282 GLN C CD  1 
ATOM   9758  O  OE1 . GLN C 1 282 ? 18.628 110.871 66.005  1.00 45.93 ? 282 GLN C OE1 1 
ATOM   9759  N  NE2 . GLN C 1 282 ? 17.166 110.938 67.717  1.00 45.54 ? 282 GLN C NE2 1 
ATOM   9760  N  N   . VAL C 1 283 ? 13.402 110.531 62.659  1.00 41.76 ? 283 VAL C N   1 
ATOM   9761  C  CA  . VAL C 1 283 ? 12.810 111.253 61.556  1.00 41.37 ? 283 VAL C CA  1 
ATOM   9762  C  C   . VAL C 1 283 ? 12.535 112.684 61.960  1.00 41.45 ? 283 VAL C C   1 
ATOM   9763  O  O   . VAL C 1 283 ? 12.062 112.950 63.063  1.00 41.48 ? 283 VAL C O   1 
ATOM   9764  C  CB  . VAL C 1 283 ? 11.492 110.568 61.084  1.00 41.38 ? 283 VAL C CB  1 
ATOM   9765  C  CG1 . VAL C 1 283 ? 10.870 111.337 59.900  1.00 40.76 ? 283 VAL C CG1 1 
ATOM   9766  C  CG2 . VAL C 1 283 ? 11.783 109.125 60.684  1.00 40.18 ? 283 VAL C CG2 1 
ATOM   9767  N  N   . MET C 1 284 ? 12.884 113.596 61.060  1.00 41.49 ? 284 MET C N   1 
ATOM   9768  C  CA  . MET C 1 284 ? 12.670 115.018 61.238  1.00 41.95 ? 284 MET C CA  1 
ATOM   9769  C  C   . MET C 1 284 ? 11.984 115.439 59.943  1.00 42.97 ? 284 MET C C   1 
ATOM   9770  O  O   . MET C 1 284 ? 12.508 115.204 58.858  1.00 42.91 ? 284 MET C O   1 
ATOM   9771  C  CB  . MET C 1 284 ? 14.007 115.754 61.389  1.00 41.62 ? 284 MET C CB  1 
ATOM   9772  C  CG  . MET C 1 284 ? 13.878 117.267 61.580  1.00 40.83 ? 284 MET C CG  1 
ATOM   9773  S  SD  . MET C 1 284 ? 15.456 118.165 61.708  1.00 41.42 ? 284 MET C SD  1 
ATOM   9774  C  CE  . MET C 1 284 ? 15.934 117.732 63.382  1.00 39.85 ? 284 MET C CE  1 
ATOM   9775  N  N   . THR C 1 285 ? 10.802 116.034 60.048  1.00 44.03 ? 285 THR C N   1 
ATOM   9776  C  CA  . THR C 1 285 ? 10.091 116.461 58.856  1.00 45.24 ? 285 THR C CA  1 
ATOM   9777  C  C   . THR C 1 285 ? 10.737 117.731 58.346  1.00 45.55 ? 285 THR C C   1 
ATOM   9778  O  O   . THR C 1 285 ? 11.563 118.328 59.032  1.00 45.03 ? 285 THR C O   1 
ATOM   9779  C  CB  . THR C 1 285 ? 8.614  116.731 59.159  1.00 45.97 ? 285 THR C CB  1 
ATOM   9780  O  OG1 . THR C 1 285 ? 8.511  117.673 60.236  1.00 47.69 ? 285 THR C OG1 1 
ATOM   9781  C  CG2 . THR C 1 285 ? 7.913  115.439 59.547  1.00 46.10 ? 285 THR C CG2 1 
ATOM   9782  N  N   . PHE C 1 286 ? 10.373 118.140 57.139  1.00 46.23 ? 286 PHE C N   1 
ATOM   9783  C  CA  . PHE C 1 286 ? 10.941 119.352 56.584  1.00 47.94 ? 286 PHE C CA  1 
ATOM   9784  C  C   . PHE C 1 286 ? 10.523 120.555 57.414  1.00 49.54 ? 286 PHE C C   1 
ATOM   9785  O  O   . PHE C 1 286 ? 11.297 121.511 57.594  1.00 49.84 ? 286 PHE C O   1 
ATOM   9786  C  CB  . PHE C 1 286 ? 10.497 119.531 55.138  1.00 47.58 ? 286 PHE C CB  1 
ATOM   9787  C  CG  . PHE C 1 286 ? 11.347 118.793 54.154  1.00 47.44 ? 286 PHE C CG  1 
ATOM   9788  C  CD1 . PHE C 1 286 ? 11.716 117.466 54.388  1.00 48.00 ? 286 PHE C CD1 1 
ATOM   9789  C  CD2 . PHE C 1 286 ? 11.766 119.411 52.982  1.00 47.21 ? 286 PHE C CD2 1 
ATOM   9790  C  CE1 . PHE C 1 286 ? 12.493 116.762 53.463  1.00 47.49 ? 286 PHE C CE1 1 
ATOM   9791  C  CE2 . PHE C 1 286 ? 12.541 118.719 52.050  1.00 47.97 ? 286 PHE C CE2 1 
ATOM   9792  C  CZ  . PHE C 1 286 ? 12.906 117.387 52.291  1.00 47.68 ? 286 PHE C CZ  1 
ATOM   9793  N  N   . ASN C 1 287 ? 9.300  120.512 57.928  1.00 51.19 ? 287 ASN C N   1 
ATOM   9794  C  CA  . ASN C 1 287 ? 8.825  121.614 58.751  1.00 52.89 ? 287 ASN C CA  1 
ATOM   9795  C  C   . ASN C 1 287 ? 9.676  121.702 60.010  1.00 53.29 ? 287 ASN C C   1 
ATOM   9796  O  O   . ASN C 1 287 ? 10.195 122.771 60.347  1.00 53.63 ? 287 ASN C O   1 
ATOM   9797  C  CB  . ASN C 1 287 ? 7.352  121.422 59.110  1.00 53.72 ? 287 ASN C CB  1 
ATOM   9798  C  CG  . ASN C 1 287 ? 6.424  121.877 57.997  1.00 55.35 ? 287 ASN C CG  1 
ATOM   9799  O  OD1 . ASN C 1 287 ? 5.208  121.691 58.073  1.00 56.46 ? 287 ASN C OD1 1 
ATOM   9800  N  ND2 . ASN C 1 287 ? 6.996  122.485 56.955  1.00 55.07 ? 287 ASN C ND2 1 
ATOM   9801  N  N   . GLN C 1 288 ? 9.832  120.574 60.696  1.00 53.19 ? 288 GLN C N   1 
ATOM   9802  C  CA  . GLN C 1 288 ? 10.635 120.546 61.911  1.00 53.12 ? 288 GLN C CA  1 
ATOM   9803  C  C   . GLN C 1 288 ? 12.044 121.045 61.622  1.00 53.21 ? 288 GLN C C   1 
ATOM   9804  O  O   . GLN C 1 288 ? 12.651 121.755 62.429  1.00 52.93 ? 288 GLN C O   1 
ATOM   9805  C  CB  . GLN C 1 288 ? 10.700 119.124 62.460  1.00 52.59 ? 288 GLN C CB  1 
ATOM   9806  C  CG  . GLN C 1 288 ? 9.368  118.587 62.912  1.00 52.36 ? 288 GLN C CG  1 
ATOM   9807  C  CD  . GLN C 1 288 ? 9.452  117.140 63.329  1.00 52.91 ? 288 GLN C CD  1 
ATOM   9808  O  OE1 . GLN C 1 288 ? 9.493  116.239 62.488  1.00 52.83 ? 288 GLN C OE1 1 
ATOM   9809  N  NE2 . GLN C 1 288 ? 9.497  116.905 64.639  1.00 53.29 ? 288 GLN C NE2 1 
ATOM   9810  N  N   . ALA C 1 289 ? 12.550 120.680 60.450  1.00 53.57 ? 289 ALA C N   1 
ATOM   9811  C  CA  . ALA C 1 289 ? 13.895 121.062 60.057  1.00 53.99 ? 289 ALA C CA  1 
ATOM   9812  C  C   . ALA C 1 289 ? 14.122 122.567 60.040  1.00 54.28 ? 289 ALA C C   1 
ATOM   9813  O  O   . ALA C 1 289 ? 15.195 123.030 60.434  1.00 54.15 ? 289 ALA C O   1 
ATOM   9814  C  CB  . ALA C 1 289 ? 14.228 120.465 58.697  1.00 54.04 ? 289 ALA C CB  1 
ATOM   9815  N  N   . GLU C 1 290 ? 13.133 123.335 59.589  1.00 54.45 ? 290 GLU C N   1 
ATOM   9816  C  CA  . GLU C 1 290 ? 13.298 124.789 59.547  1.00 54.92 ? 290 GLU C CA  1 
ATOM   9817  C  C   . GLU C 1 290 ? 13.270 125.437 60.923  1.00 53.89 ? 290 GLU C C   1 
ATOM   9818  O  O   . GLU C 1 290 ? 13.588 126.619 61.064  1.00 53.84 ? 290 GLU C O   1 
ATOM   9819  C  CB  . GLU C 1 290 ? 12.229 125.432 58.672  1.00 56.55 ? 290 GLU C CB  1 
ATOM   9820  C  CG  . GLU C 1 290 ? 12.463 125.233 57.200  1.00 59.91 ? 290 GLU C CG  1 
ATOM   9821  C  CD  . GLU C 1 290 ? 11.200 125.447 56.391  1.00 62.44 ? 290 GLU C CD  1 
ATOM   9822  O  OE1 . GLU C 1 290 ? 10.196 124.733 56.645  1.00 63.91 ? 290 GLU C OE1 1 
ATOM   9823  O  OE2 . GLU C 1 290 ? 11.208 126.326 55.499  1.00 63.75 ? 290 GLU C OE2 1 
ATOM   9824  N  N   . THR C 1 291 ? 12.904 124.665 61.939  1.00 52.58 ? 291 THR C N   1 
ATOM   9825  C  CA  . THR C 1 291 ? 12.846 125.203 63.288  1.00 51.36 ? 291 THR C CA  1 
ATOM   9826  C  C   . THR C 1 291 ? 13.835 124.581 64.263  1.00 50.44 ? 291 THR C C   1 
ATOM   9827  O  O   . THR C 1 291 ? 13.779 124.851 65.462  1.00 50.17 ? 291 THR C O   1 
ATOM   9828  C  CB  . THR C 1 291 ? 11.436 125.071 63.868  1.00 51.54 ? 291 THR C CB  1 
ATOM   9829  O  OG1 . THR C 1 291 ? 10.882 123.812 63.472  1.00 52.01 ? 291 THR C OG1 1 
ATOM   9830  C  CG2 . THR C 1 291 ? 10.550 126.219 63.387  1.00 50.97 ? 291 THR C CG2 1 
ATOM   9831  N  N   . PHE C 1 292 ? 14.735 123.746 63.760  1.00 49.25 ? 292 PHE C N   1 
ATOM   9832  C  CA  . PHE C 1 292 ? 15.738 123.132 64.620  1.00 48.08 ? 292 PHE C CA  1 
ATOM   9833  C  C   . PHE C 1 292 ? 16.626 124.291 65.104  1.00 47.74 ? 292 PHE C C   1 
ATOM   9834  O  O   . PHE C 1 292 ? 17.020 125.163 64.323  1.00 47.47 ? 292 PHE C O   1 
ATOM   9835  C  CB  . PHE C 1 292 ? 16.549 122.112 63.821  1.00 47.80 ? 292 PHE C CB  1 
ATOM   9836  C  CG  . PHE C 1 292 ? 17.376 121.181 64.667  1.00 47.45 ? 292 PHE C CG  1 
ATOM   9837  C  CD1 . PHE C 1 292 ? 16.802 120.483 65.721  1.00 46.71 ? 292 PHE C CD1 1 
ATOM   9838  C  CD2 . PHE C 1 292 ? 18.719 120.957 64.368  1.00 47.66 ? 292 PHE C CD2 1 
ATOM   9839  C  CE1 . PHE C 1 292 ? 17.547 119.572 66.465  1.00 46.69 ? 292 PHE C CE1 1 
ATOM   9840  C  CE2 . PHE C 1 292 ? 19.474 120.045 65.107  1.00 47.61 ? 292 PHE C CE2 1 
ATOM   9841  C  CZ  . PHE C 1 292 ? 18.885 119.351 66.155  1.00 47.25 ? 292 PHE C CZ  1 
ATOM   9842  N  N   . PRO C 1 293 ? 16.935 124.326 66.404  1.00 47.10 ? 293 PRO C N   1 
ATOM   9843  C  CA  . PRO C 1 293 ? 17.766 125.396 66.960  1.00 46.81 ? 293 PRO C CA  1 
ATOM   9844  C  C   . PRO C 1 293 ? 19.147 125.488 66.342  1.00 46.58 ? 293 PRO C C   1 
ATOM   9845  O  O   . PRO C 1 293 ? 19.857 126.470 66.555  1.00 47.28 ? 293 PRO C O   1 
ATOM   9846  C  CB  . PRO C 1 293 ? 17.829 125.053 68.444  1.00 46.89 ? 293 PRO C CB  1 
ATOM   9847  C  CG  . PRO C 1 293 ? 16.537 124.342 68.679  1.00 47.69 ? 293 PRO C CG  1 
ATOM   9848  C  CD  . PRO C 1 293 ? 16.422 123.449 67.467  1.00 47.27 ? 293 PRO C CD  1 
ATOM   9849  N  N   . PHE C 1 294 ? 19.531 124.459 65.588  1.00 45.90 ? 294 PHE C N   1 
ATOM   9850  C  CA  . PHE C 1 294 ? 20.843 124.423 64.941  1.00 43.92 ? 294 PHE C CA  1 
ATOM   9851  C  C   . PHE C 1 294 ? 20.650 124.040 63.482  1.00 43.36 ? 294 PHE C C   1 
ATOM   9852  O  O   . PHE C 1 294 ? 19.531 123.839 63.024  1.00 43.24 ? 294 PHE C O   1 
ATOM   9853  C  CB  . PHE C 1 294 ? 21.726 123.358 65.584  1.00 43.45 ? 294 PHE C CB  1 
ATOM   9854  C  CG  . PHE C 1 294 ? 21.801 123.428 67.090  1.00 43.72 ? 294 PHE C CG  1 
ATOM   9855  C  CD1 . PHE C 1 294 ? 22.551 124.425 67.727  1.00 43.59 ? 294 PHE C CD1 1 
ATOM   9856  C  CD2 . PHE C 1 294 ? 21.181 122.449 67.873  1.00 42.92 ? 294 PHE C CD2 1 
ATOM   9857  C  CE1 . PHE C 1 294 ? 22.693 124.442 69.132  1.00 42.79 ? 294 PHE C CE1 1 
ATOM   9858  C  CE2 . PHE C 1 294 ? 21.315 122.455 69.274  1.00 43.07 ? 294 PHE C CE2 1 
ATOM   9859  C  CZ  . PHE C 1 294 ? 22.074 123.453 69.903  1.00 42.99 ? 294 PHE C CZ  1 
ATOM   9860  N  N   . ASN C 1 295 ? 21.749 123.942 62.749  1.00 42.77 ? 295 ASN C N   1 
ATOM   9861  C  CA  . ASN C 1 295 ? 21.673 123.513 61.360  1.00 41.84 ? 295 ASN C CA  1 
ATOM   9862  C  C   . ASN C 1 295 ? 21.507 121.997 61.454  1.00 40.59 ? 295 ASN C C   1 
ATOM   9863  O  O   . ASN C 1 295 ? 22.434 121.287 61.824  1.00 40.64 ? 295 ASN C O   1 
ATOM   9864  C  CB  . ASN C 1 295 ? 22.969 123.870 60.621  1.00 42.47 ? 295 ASN C CB  1 
ATOM   9865  C  CG  . ASN C 1 295 ? 23.030 123.281 59.210  1.00 43.59 ? 295 ASN C CG  1 
ATOM   9866  O  OD1 . ASN C 1 295 ? 22.000 122.933 58.619  1.00 44.43 ? 295 ASN C OD1 1 
ATOM   9867  N  ND2 . ASN C 1 295 ? 24.241 123.183 58.659  1.00 43.91 ? 295 ASN C ND2 1 
ATOM   9868  N  N   . PRO C 1 296 ? 20.321 121.477 61.129  1.00 39.66 ? 296 PRO C N   1 
ATOM   9869  C  CA  . PRO C 1 296 ? 20.150 120.021 61.225  1.00 39.30 ? 296 PRO C CA  1 
ATOM   9870  C  C   . PRO C 1 296 ? 21.187 119.205 60.436  1.00 39.09 ? 296 PRO C C   1 
ATOM   9871  O  O   . PRO C 1 296 ? 21.424 118.033 60.724  1.00 39.50 ? 296 PRO C O   1 
ATOM   9872  C  CB  . PRO C 1 296 ? 18.728 119.812 60.716  1.00 38.73 ? 296 PRO C CB  1 
ATOM   9873  C  CG  . PRO C 1 296 ? 18.578 120.921 59.708  1.00 39.30 ? 296 PRO C CG  1 
ATOM   9874  C  CD  . PRO C 1 296 ? 19.189 122.099 60.425  1.00 39.16 ? 296 PRO C CD  1 
ATOM   9875  N  N   . PHE C 1 297 ? 21.816 119.835 59.453  1.00 38.43 ? 297 PHE C N   1 
ATOM   9876  C  CA  . PHE C 1 297 ? 22.799 119.160 58.629  1.00 37.69 ? 297 PHE C CA  1 
ATOM   9877  C  C   . PHE C 1 297 ? 24.214 119.445 59.102  1.00 37.76 ? 297 PHE C C   1 
ATOM   9878  O  O   . PHE C 1 297 ? 25.165 119.372 58.330  1.00 38.91 ? 297 PHE C O   1 
ATOM   9879  C  CB  . PHE C 1 297 ? 22.624 119.595 57.180  1.00 37.50 ? 297 PHE C CB  1 
ATOM   9880  C  CG  . PHE C 1 297 ? 21.197 119.576 56.722  1.00 37.63 ? 297 PHE C CG  1 
ATOM   9881  C  CD1 . PHE C 1 297 ? 20.444 118.415 56.802  1.00 38.37 ? 297 PHE C CD1 1 
ATOM   9882  C  CD2 . PHE C 1 297 ? 20.600 120.723 56.224  1.00 38.84 ? 297 PHE C CD2 1 
ATOM   9883  C  CE1 . PHE C 1 297 ? 19.114 118.393 56.389  1.00 38.85 ? 297 PHE C CE1 1 
ATOM   9884  C  CE2 . PHE C 1 297 ? 19.271 120.719 55.809  1.00 38.92 ? 297 PHE C CE2 1 
ATOM   9885  C  CZ  . PHE C 1 297 ? 18.527 119.549 55.892  1.00 39.22 ? 297 PHE C CZ  1 
ATOM   9886  N  N   . ASP C 1 298 ? 24.346 119.780 60.377  1.00 36.99 ? 298 ASP C N   1 
ATOM   9887  C  CA  . ASP C 1 298 ? 25.648 120.047 60.966  1.00 36.17 ? 298 ASP C CA  1 
ATOM   9888  C  C   . ASP C 1 298 ? 26.110 118.739 61.571  1.00 35.75 ? 298 ASP C C   1 
ATOM   9889  O  O   . ASP C 1 298 ? 25.479 118.229 62.500  1.00 35.28 ? 298 ASP C O   1 
ATOM   9890  C  CB  . ASP C 1 298 ? 25.535 121.094 62.072  1.00 36.29 ? 298 ASP C CB  1 
ATOM   9891  C  CG  . ASP C 1 298 ? 26.866 121.398 62.723  1.00 36.37 ? 298 ASP C CG  1 
ATOM   9892  O  OD1 . ASP C 1 298 ? 27.877 120.765 62.344  1.00 36.50 ? 298 ASP C OD1 1 
ATOM   9893  O  OD2 . ASP C 1 298 ? 26.904 122.275 63.615  1.00 36.34 ? 298 ASP C OD2 1 
ATOM   9894  N  N   . LEU C 1 299 ? 27.216 118.208 61.052  1.00 35.91 ? 299 LEU C N   1 
ATOM   9895  C  CA  . LEU C 1 299 ? 27.768 116.941 61.526  1.00 35.34 ? 299 LEU C CA  1 
ATOM   9896  C  C   . LEU C 1 299 ? 28.279 116.999 62.969  1.00 35.00 ? 299 LEU C C   1 
ATOM   9897  O  O   . LEU C 1 299 ? 28.605 115.965 63.552  1.00 33.91 ? 299 LEU C O   1 
ATOM   9898  C  CB  . LEU C 1 299 ? 28.881 116.470 60.582  1.00 35.24 ? 299 LEU C CB  1 
ATOM   9899  C  CG  . LEU C 1 299 ? 29.379 115.022 60.742  1.00 36.60 ? 299 LEU C CG  1 
ATOM   9900  C  CD1 . LEU C 1 299 ? 28.218 114.059 60.617  1.00 35.51 ? 299 LEU C CD1 1 
ATOM   9901  C  CD2 . LEU C 1 299 ? 30.436 114.702 59.683  1.00 36.54 ? 299 LEU C CD2 1 
ATOM   9902  N  N   . THR C 1 300 ? 28.337 118.200 63.543  1.00 35.67 ? 300 THR C N   1 
ATOM   9903  C  CA  . THR C 1 300 ? 28.791 118.362 64.926  1.00 37.33 ? 300 THR C CA  1 
ATOM   9904  C  C   . THR C 1 300 ? 27.622 118.418 65.916  1.00 38.48 ? 300 THR C C   1 
ATOM   9905  O  O   . THR C 1 300 ? 27.834 118.591 67.125  1.00 38.19 ? 300 THR C O   1 
ATOM   9906  C  CB  . THR C 1 300 ? 29.642 119.647 65.129  1.00 37.71 ? 300 THR C CB  1 
ATOM   9907  O  OG1 . THR C 1 300 ? 28.839 120.804 64.875  1.00 38.91 ? 300 THR C OG1 1 
ATOM   9908  C  CG2 . THR C 1 300 ? 30.855 119.647 64.207  1.00 37.73 ? 300 THR C CG2 1 
ATOM   9909  N  N   . LYS C 1 301 ? 26.398 118.287 65.397  1.00 39.21 ? 301 LYS C N   1 
ATOM   9910  C  CA  . LYS C 1 301 ? 25.190 118.296 66.222  1.00 39.66 ? 301 LYS C CA  1 
ATOM   9911  C  C   . LYS C 1 301 ? 24.483 116.951 66.200  1.00 40.00 ? 301 LYS C C   1 
ATOM   9912  O  O   . LYS C 1 301 ? 24.709 116.122 65.315  1.00 39.69 ? 301 LYS C O   1 
ATOM   9913  C  CB  . LYS C 1 301 ? 24.187 119.355 65.743  1.00 40.24 ? 301 LYS C CB  1 
ATOM   9914  C  CG  . LYS C 1 301 ? 24.322 120.711 66.409  1.00 40.72 ? 301 LYS C CG  1 
ATOM   9915  C  CD  . LYS C 1 301 ? 25.630 121.350 66.037  1.00 40.54 ? 301 LYS C CD  1 
ATOM   9916  C  CE  . LYS C 1 301 ? 25.810 122.681 66.702  1.00 39.40 ? 301 LYS C CE  1 
ATOM   9917  N  NZ  . LYS C 1 301 ? 26.975 123.318 66.058  1.00 38.87 ? 301 LYS C NZ  1 
ATOM   9918  N  N   . VAL C 1 302 ? 23.622 116.742 67.187  1.00 39.90 ? 302 VAL C N   1 
ATOM   9919  C  CA  . VAL C 1 302 ? 22.844 115.519 67.267  1.00 40.62 ? 302 VAL C CA  1 
ATOM   9920  C  C   . VAL C 1 302 ? 21.379 115.928 67.387  1.00 40.93 ? 302 VAL C C   1 
ATOM   9921  O  O   . VAL C 1 302 ? 21.081 117.083 67.703  1.00 41.37 ? 302 VAL C O   1 
ATOM   9922  C  CB  . VAL C 1 302 ? 23.224 114.671 68.509  1.00 40.78 ? 302 VAL C CB  1 
ATOM   9923  C  CG1 . VAL C 1 302 ? 24.681 114.272 68.439  1.00 40.61 ? 302 VAL C CG1 1 
ATOM   9924  C  CG2 . VAL C 1 302 ? 22.940 115.449 69.795  1.00 40.70 ? 302 VAL C CG2 1 
ATOM   9925  N  N   . TRP C 1 303 ? 20.470 115.002 67.098  1.00 41.09 ? 303 TRP C N   1 
ATOM   9926  C  CA  . TRP C 1 303 ? 19.052 115.289 67.245  1.00 41.15 ? 303 TRP C CA  1 
ATOM   9927  C  C   . TRP C 1 303 ? 18.699 114.629 68.571  1.00 42.85 ? 303 TRP C C   1 
ATOM   9928  O  O   . TRP C 1 303 ? 18.727 113.397 68.690  1.00 43.22 ? 303 TRP C O   1 
ATOM   9929  C  CB  . TRP C 1 303 ? 18.222 114.660 66.121  1.00 38.95 ? 303 TRP C CB  1 
ATOM   9930  C  CG  . TRP C 1 303 ? 18.444 115.252 64.747  1.00 37.33 ? 303 TRP C CG  1 
ATOM   9931  C  CD1 . TRP C 1 303 ? 19.174 116.363 64.428  1.00 36.20 ? 303 TRP C CD1 1 
ATOM   9932  C  CD2 . TRP C 1 303 ? 17.896 114.767 63.510  1.00 36.51 ? 303 TRP C CD2 1 
ATOM   9933  N  NE1 . TRP C 1 303 ? 19.112 116.600 63.073  1.00 34.72 ? 303 TRP C NE1 1 
ATOM   9934  C  CE2 . TRP C 1 303 ? 18.337 115.636 62.487  1.00 35.19 ? 303 TRP C CE2 1 
ATOM   9935  C  CE3 . TRP C 1 303 ? 17.072 113.682 63.169  1.00 35.23 ? 303 TRP C CE3 1 
ATOM   9936  C  CZ2 . TRP C 1 303 ? 17.983 115.452 61.146  1.00 35.18 ? 303 TRP C CZ2 1 
ATOM   9937  C  CZ3 . TRP C 1 303 ? 16.718 113.503 61.831  1.00 34.93 ? 303 TRP C CZ3 1 
ATOM   9938  C  CH2 . TRP C 1 303 ? 17.174 114.382 60.839  1.00 34.87 ? 303 TRP C CH2 1 
ATOM   9939  N  N   . PRO C 1 304 ? 18.403 115.437 69.600  1.00 44.14 ? 304 PRO C N   1 
ATOM   9940  C  CA  . PRO C 1 304 ? 18.053 114.873 70.909  1.00 45.65 ? 304 PRO C CA  1 
ATOM   9941  C  C   . PRO C 1 304 ? 16.917 113.851 70.845  1.00 47.19 ? 304 PRO C C   1 
ATOM   9942  O  O   . PRO C 1 304 ? 15.832 114.137 70.323  1.00 47.22 ? 304 PRO C O   1 
ATOM   9943  C  CB  . PRO C 1 304 ? 17.709 116.112 71.742  1.00 45.30 ? 304 PRO C CB  1 
ATOM   9944  C  CG  . PRO C 1 304 ? 17.395 117.169 70.712  1.00 45.26 ? 304 PRO C CG  1 
ATOM   9945  C  CD  . PRO C 1 304 ? 18.392 116.908 69.635  1.00 43.64 ? 304 PRO C CD  1 
ATOM   9946  N  N   . HIS C 1 305 ? 17.180 112.658 71.372  1.00 49.43 ? 305 HIS C N   1 
ATOM   9947  C  CA  . HIS C 1 305 ? 16.198 111.570 71.363  1.00 52.26 ? 305 HIS C CA  1 
ATOM   9948  C  C   . HIS C 1 305 ? 14.845 111.970 71.954  1.00 52.80 ? 305 HIS C C   1 
ATOM   9949  O  O   . HIS C 1 305 ? 13.799 111.424 71.591  1.00 52.62 ? 305 HIS C O   1 
ATOM   9950  C  CB  . HIS C 1 305 ? 16.754 110.350 72.106  1.00 54.56 ? 305 HIS C CB  1 
ATOM   9951  C  CG  . HIS C 1 305 ? 17.935 109.716 71.431  1.00 58.42 ? 305 HIS C CG  1 
ATOM   9952  N  ND1 . HIS C 1 305 ? 18.453 108.499 71.825  1.00 60.14 ? 305 HIS C ND1 1 
ATOM   9953  C  CD2 . HIS C 1 305 ? 18.698 110.128 70.387  1.00 60.01 ? 305 HIS C CD2 1 
ATOM   9954  C  CE1 . HIS C 1 305 ? 19.483 108.187 71.053  1.00 60.73 ? 305 HIS C CE1 1 
ATOM   9955  N  NE2 . HIS C 1 305 ? 19.653 109.159 70.172  1.00 61.08 ? 305 HIS C NE2 1 
ATOM   9956  N  N   . LYS C 1 306 ? 14.877 112.945 72.853  1.00 53.39 ? 306 LYS C N   1 
ATOM   9957  C  CA  . LYS C 1 306 ? 13.682 113.440 73.513  1.00 53.45 ? 306 LYS C CA  1 
ATOM   9958  C  C   . LYS C 1 306 ? 12.749 114.063 72.490  1.00 52.93 ? 306 LYS C C   1 
ATOM   9959  O  O   . LYS C 1 306 ? 11.559 113.754 72.458  1.00 52.45 ? 306 LYS C O   1 
ATOM   9960  C  CB  . LYS C 1 306 ? 14.066 114.481 74.563  1.00 54.82 ? 306 LYS C CB  1 
ATOM   9961  C  CG  . LYS C 1 306 ? 15.205 114.043 75.507  1.00 58.26 ? 306 LYS C CG  1 
ATOM   9962  C  CD  . LYS C 1 306 ? 16.590 113.884 74.795  1.00 59.62 ? 306 LYS C CD  1 
ATOM   9963  C  CE  . LYS C 1 306 ? 17.033 112.405 74.655  1.00 60.36 ? 306 LYS C CE  1 
ATOM   9964  N  NZ  . LYS C 1 306 ? 18.351 112.218 73.942  1.00 60.74 ? 306 LYS C NZ  1 
ATOM   9965  N  N   . ASP C 1 307 ? 13.299 114.935 71.648  1.00 52.90 ? 307 ASP C N   1 
ATOM   9966  C  CA  . ASP C 1 307 ? 12.516 115.616 70.617  1.00 52.70 ? 307 ASP C CA  1 
ATOM   9967  C  C   . ASP C 1 307 ? 12.360 114.787 69.345  1.00 52.22 ? 307 ASP C C   1 
ATOM   9968  O  O   . ASP C 1 307 ? 11.462 115.032 68.534  1.00 52.13 ? 307 ASP C O   1 
ATOM   9969  C  CB  . ASP C 1 307 ? 13.160 116.955 70.282  1.00 53.55 ? 307 ASP C CB  1 
ATOM   9970  C  CG  . ASP C 1 307 ? 13.214 117.889 71.480  1.00 55.10 ? 307 ASP C CG  1 
ATOM   9971  O  OD1 . ASP C 1 307 ? 12.144 118.378 71.911  1.00 55.80 ? 307 ASP C OD1 1 
ATOM   9972  O  OD2 . ASP C 1 307 ? 14.329 118.132 71.994  1.00 55.85 ? 307 ASP C OD2 1 
ATOM   9973  N  N   . TYR C 1 308 ? 13.235 113.806 69.168  1.00 51.26 ? 308 TYR C N   1 
ATOM   9974  C  CA  . TYR C 1 308 ? 13.167 112.953 67.994  1.00 50.89 ? 308 TYR C CA  1 
ATOM   9975  C  C   . TYR C 1 308 ? 13.466 111.548 68.453  1.00 50.56 ? 308 TYR C C   1 
ATOM   9976  O  O   . TYR C 1 308 ? 14.605 111.106 68.415  1.00 51.16 ? 308 TYR C O   1 
ATOM   9977  C  CB  . TYR C 1 308 ? 14.194 113.404 66.966  1.00 51.16 ? 308 TYR C CB  1 
ATOM   9978  C  CG  . TYR C 1 308 ? 14.000 114.839 66.552  1.00 51.51 ? 308 TYR C CG  1 
ATOM   9979  C  CD1 . TYR C 1 308 ? 13.174 115.168 65.474  1.00 51.46 ? 308 TYR C CD1 1 
ATOM   9980  C  CD2 . TYR C 1 308 ? 14.594 115.880 67.279  1.00 51.05 ? 308 TYR C CD2 1 
ATOM   9981  C  CE1 . TYR C 1 308 ? 12.938 116.500 65.129  1.00 51.88 ? 308 TYR C CE1 1 
ATOM   9982  C  CE2 . TYR C 1 308 ? 14.363 117.214 66.946  1.00 51.08 ? 308 TYR C CE2 1 
ATOM   9983  C  CZ  . TYR C 1 308 ? 13.534 117.516 65.871  1.00 51.36 ? 308 TYR C CZ  1 
ATOM   9984  O  OH  . TYR C 1 308 ? 13.290 118.828 65.544  1.00 51.94 ? 308 TYR C OH  1 
ATOM   9985  N  N   . PRO C 1 309 ? 12.432 110.822 68.892  1.00 50.24 ? 309 PRO C N   1 
ATOM   9986  C  CA  . PRO C 1 309 ? 12.557 109.446 69.379  1.00 49.19 ? 309 PRO C CA  1 
ATOM   9987  C  C   . PRO C 1 309 ? 13.053 108.475 68.318  1.00 48.33 ? 309 PRO C C   1 
ATOM   9988  O  O   . PRO C 1 309 ? 12.701 108.582 67.143  1.00 47.45 ? 309 PRO C O   1 
ATOM   9989  C  CB  . PRO C 1 309 ? 11.141 109.127 69.832  1.00 49.60 ? 309 PRO C CB  1 
ATOM   9990  C  CG  . PRO C 1 309 ? 10.313 109.854 68.795  1.00 50.23 ? 309 PRO C CG  1 
ATOM   9991  C  CD  . PRO C 1 309 ? 11.011 111.193 68.728  1.00 50.41 ? 309 PRO C CD  1 
ATOM   9992  N  N   . LEU C 1 310 ? 13.879 107.527 68.741  1.00 47.83 ? 310 LEU C N   1 
ATOM   9993  C  CA  . LEU C 1 310 ? 14.400 106.534 67.824  1.00 47.27 ? 310 LEU C CA  1 
ATOM   9994  C  C   . LEU C 1 310 ? 13.264 105.601 67.419  1.00 46.69 ? 310 LEU C C   1 
ATOM   9995  O  O   . LEU C 1 310 ? 12.562 105.063 68.272  1.00 46.13 ? 310 LEU C O   1 
ATOM   9996  C  CB  . LEU C 1 310 ? 15.522 105.727 68.487  1.00 47.97 ? 310 LEU C CB  1 
ATOM   9997  C  CG  . LEU C 1 310 ? 16.800 106.463 68.917  1.00 48.43 ? 310 LEU C CG  1 
ATOM   9998  C  CD1 . LEU C 1 310 ? 17.787 105.468 69.536  1.00 47.87 ? 310 LEU C CD1 1 
ATOM   9999  C  CD2 . LEU C 1 310 ? 17.427 107.155 67.723  1.00 48.14 ? 310 LEU C CD2 1 
ATOM   10000 N  N   . ILE C 1 311 ? 13.095 105.428 66.110  1.00 46.45 ? 311 ILE C N   1 
ATOM   10001 C  CA  . ILE C 1 311 ? 12.063 104.564 65.535  1.00 46.03 ? 311 ILE C CA  1 
ATOM   10002 C  C   . ILE C 1 311 ? 12.720 103.235 65.156  1.00 45.62 ? 311 ILE C C   1 
ATOM   10003 O  O   . ILE C 1 311 ? 13.605 103.210 64.302  1.00 45.77 ? 311 ILE C O   1 
ATOM   10004 C  CB  . ILE C 1 311 ? 11.480 105.172 64.230  1.00 46.26 ? 311 ILE C CB  1 
ATOM   10005 C  CG1 . ILE C 1 311 ? 10.954 106.586 64.476  1.00 45.49 ? 311 ILE C CG1 1 
ATOM   10006 C  CG2 . ILE C 1 311 ? 10.391 104.279 63.688  1.00 46.16 ? 311 ILE C CG2 1 
ATOM   10007 C  CD1 . ILE C 1 311 ? 9.899  106.667 65.531  1.00 46.82 ? 311 ILE C CD1 1 
ATOM   10008 N  N   . PRO C 1 312 ? 12.291 102.113 65.770  1.00 44.82 ? 312 PRO C N   1 
ATOM   10009 C  CA  . PRO C 1 312 ? 12.889 100.812 65.443  1.00 43.20 ? 312 PRO C CA  1 
ATOM   10010 C  C   . PRO C 1 312 ? 12.575 100.411 64.002  1.00 42.36 ? 312 PRO C C   1 
ATOM   10011 O  O   . PRO C 1 312 ? 11.465 100.640 63.517  1.00 42.10 ? 312 PRO C O   1 
ATOM   10012 C  CB  . PRO C 1 312 ? 12.253 99.880  66.466  1.00 42.46 ? 312 PRO C CB  1 
ATOM   10013 C  CG  . PRO C 1 312 ? 10.894 100.443 66.590  1.00 43.07 ? 312 PRO C CG  1 
ATOM   10014 C  CD  . PRO C 1 312 ? 11.136 101.940 66.669  1.00 43.47 ? 312 PRO C CD  1 
ATOM   10015 N  N   . VAL C 1 313 ? 13.557 99.823  63.322  1.00 41.57 ? 313 VAL C N   1 
ATOM   10016 C  CA  . VAL C 1 313 ? 13.383 99.412  61.934  1.00 40.63 ? 313 VAL C CA  1 
ATOM   10017 C  C   . VAL C 1 313 ? 13.720 97.954  61.693  1.00 40.99 ? 313 VAL C C   1 
ATOM   10018 O  O   . VAL C 1 313 ? 12.907 97.195  61.159  1.00 41.56 ? 313 VAL C O   1 
ATOM   10019 C  CB  . VAL C 1 313 ? 14.266 100.230 60.982  1.00 39.15 ? 313 VAL C CB  1 
ATOM   10020 C  CG1 . VAL C 1 313 ? 14.020 99.789  59.556  1.00 38.53 ? 313 VAL C CG1 1 
ATOM   10021 C  CG2 . VAL C 1 313 ? 13.981 101.692 61.139  1.00 38.25 ? 313 VAL C CG2 1 
ATOM   10022 N  N   . GLY C 1 314 ? 14.928 97.561  62.071  1.00 41.18 ? 314 GLY C N   1 
ATOM   10023 C  CA  . GLY C 1 314 ? 15.328 96.190  61.845  1.00 41.11 ? 314 GLY C CA  1 
ATOM   10024 C  C   . GLY C 1 314 ? 16.412 95.675  62.761  1.00 41.11 ? 314 GLY C C   1 
ATOM   10025 O  O   . GLY C 1 314 ? 16.521 96.071  63.921  1.00 41.61 ? 314 GLY C O   1 
ATOM   10026 N  N   . LYS C 1 315 ? 17.237 94.794  62.215  1.00 40.81 ? 315 LYS C N   1 
ATOM   10027 C  CA  . LYS C 1 315 ? 18.289 94.176  62.983  1.00 40.01 ? 315 LYS C CA  1 
ATOM   10028 C  C   . LYS C 1 315 ? 19.448 93.791  62.075  1.00 39.84 ? 315 LYS C C   1 
ATOM   10029 O  O   . LYS C 1 315 ? 19.253 93.447  60.903  1.00 39.67 ? 315 LYS C O   1 
ATOM   10030 C  CB  . LYS C 1 315 ? 17.700 92.950  63.668  1.00 40.48 ? 315 LYS C CB  1 
ATOM   10031 C  CG  . LYS C 1 315 ? 18.665 92.119  64.449  1.00 42.73 ? 315 LYS C CG  1 
ATOM   10032 C  CD  . LYS C 1 315 ? 17.904 91.157  65.354  1.00 44.45 ? 315 LYS C CD  1 
ATOM   10033 C  CE  . LYS C 1 315 ? 17.141 91.932  66.442  1.00 45.77 ? 315 LYS C CE  1 
ATOM   10034 N  NZ  . LYS C 1 315 ? 18.015 92.865  67.243  1.00 44.53 ? 315 LYS C NZ  1 
ATOM   10035 N  N   . LEU C 1 316 ? 20.657 93.869  62.621  1.00 39.35 ? 316 LEU C N   1 
ATOM   10036 C  CA  . LEU C 1 316 ? 21.868 93.522  61.883  1.00 38.83 ? 316 LEU C CA  1 
ATOM   10037 C  C   . LEU C 1 316 ? 22.500 92.338  62.588  1.00 38.81 ? 316 LEU C C   1 
ATOM   10038 O  O   . LEU C 1 316 ? 22.690 92.359  63.805  1.00 38.91 ? 316 LEU C O   1 
ATOM   10039 C  CB  . LEU C 1 316 ? 22.855 94.691  61.879  1.00 38.17 ? 316 LEU C CB  1 
ATOM   10040 C  CG  . LEU C 1 316 ? 22.467 95.963  61.132  1.00 36.78 ? 316 LEU C CG  1 
ATOM   10041 C  CD1 . LEU C 1 316 ? 23.382 97.091  61.547  1.00 36.85 ? 316 LEU C CD1 1 
ATOM   10042 C  CD2 . LEU C 1 316 ? 22.550 95.718  59.645  1.00 37.12 ? 316 LEU C CD2 1 
ATOM   10043 N  N   . VAL C 1 317 ? 22.830 91.309  61.820  1.00 38.58 ? 317 VAL C N   1 
ATOM   10044 C  CA  . VAL C 1 317 ? 23.423 90.109  62.382  1.00 38.11 ? 317 VAL C CA  1 
ATOM   10045 C  C   . VAL C 1 317 ? 24.685 89.689  61.640  1.00 37.68 ? 317 VAL C C   1 
ATOM   10046 O  O   . VAL C 1 317 ? 24.675 89.568  60.418  1.00 37.71 ? 317 VAL C O   1 
ATOM   10047 C  CB  . VAL C 1 317 ? 22.427 88.960  62.316  1.00 37.99 ? 317 VAL C CB  1 
ATOM   10048 C  CG1 . VAL C 1 317 ? 23.063 87.707  62.849  1.00 38.56 ? 317 VAL C CG1 1 
ATOM   10049 C  CG2 . VAL C 1 317 ? 21.188 89.314  63.100  1.00 38.14 ? 317 VAL C CG2 1 
ATOM   10050 N  N   . LEU C 1 318 ? 25.774 89.472  62.370  1.00 37.25 ? 318 LEU C N   1 
ATOM   10051 C  CA  . LEU C 1 318 ? 27.017 89.037  61.734  1.00 37.15 ? 318 LEU C CA  1 
ATOM   10052 C  C   . LEU C 1 318 ? 27.241 87.597  62.142  1.00 37.49 ? 318 LEU C C   1 
ATOM   10053 O  O   . LEU C 1 318 ? 27.591 87.315  63.281  1.00 37.47 ? 318 LEU C O   1 
ATOM   10054 C  CB  . LEU C 1 318 ? 28.196 89.924  62.164  1.00 35.90 ? 318 LEU C CB  1 
ATOM   10055 C  CG  . LEU C 1 318 ? 28.157 91.363  61.614  1.00 34.66 ? 318 LEU C CG  1 
ATOM   10056 C  CD1 . LEU C 1 318 ? 29.328 92.174  62.107  1.00 34.06 ? 318 LEU C CD1 1 
ATOM   10057 C  CD2 . LEU C 1 318 ? 28.178 91.315  60.102  1.00 34.37 ? 318 LEU C CD2 1 
ATOM   10058 N  N   . ASN C 1 319 ? 27.022 86.680  61.208  1.00 38.14 ? 319 ASN C N   1 
ATOM   10059 C  CA  . ASN C 1 319 ? 27.169 85.263  61.503  1.00 38.72 ? 319 ASN C CA  1 
ATOM   10060 C  C   . ASN C 1 319 ? 28.216 84.520  60.680  1.00 38.91 ? 319 ASN C C   1 
ATOM   10061 O  O   . ASN C 1 319 ? 28.329 83.300  60.791  1.00 38.97 ? 319 ASN C O   1 
ATOM   10062 C  CB  . ASN C 1 319 ? 25.815 84.569  61.348  1.00 38.86 ? 319 ASN C CB  1 
ATOM   10063 C  CG  . ASN C 1 319 ? 25.201 84.794  59.977  1.00 39.40 ? 319 ASN C CG  1 
ATOM   10064 O  OD1 . ASN C 1 319 ? 24.035 84.467  59.742  1.00 40.41 ? 319 ASN C OD1 1 
ATOM   10065 N  ND2 . ASN C 1 319 ? 25.981 85.351  59.065  1.00 39.09 ? 319 ASN C ND2 1 
ATOM   10066 N  N   . ARG C 1 320 ? 28.978 85.233  59.858  1.00 38.92 ? 320 ARG C N   1 
ATOM   10067 C  CA  . ARG C 1 320 ? 30.009 84.574  59.052  1.00 39.51 ? 320 ARG C CA  1 
ATOM   10068 C  C   . ARG C 1 320 ? 31.308 85.358  58.961  1.00 38.80 ? 320 ARG C C   1 
ATOM   10069 O  O   . ARG C 1 320 ? 31.312 86.567  58.727  1.00 39.13 ? 320 ARG C O   1 
ATOM   10070 C  CB  . ARG C 1 320 ? 29.501 84.277  57.631  1.00 40.04 ? 320 ARG C CB  1 
ATOM   10071 C  CG  . ARG C 1 320 ? 30.618 83.945  56.637  1.00 42.15 ? 320 ARG C CG  1 
ATOM   10072 C  CD  . ARG C 1 320 ? 30.076 83.441  55.300  1.00 44.57 ? 320 ARG C CD  1 
ATOM   10073 N  NE  . ARG C 1 320 ? 29.085 84.345  54.718  1.00 46.98 ? 320 ARG C NE  1 
ATOM   10074 C  CZ  . ARG C 1 320 ? 29.363 85.368  53.913  1.00 48.46 ? 320 ARG C CZ  1 
ATOM   10075 N  NH1 . ARG C 1 320 ? 30.616 85.644  53.562  1.00 49.51 ? 320 ARG C NH1 1 
ATOM   10076 N  NH2 . ARG C 1 320 ? 28.377 86.135  53.470  1.00 49.60 ? 320 ARG C NH2 1 
ATOM   10077 N  N   . ASN C 1 321 ? 32.409 84.643  59.146  1.00 38.21 ? 321 ASN C N   1 
ATOM   10078 C  CA  . ASN C 1 321 ? 33.743 85.218  59.078  1.00 37.02 ? 321 ASN C CA  1 
ATOM   10079 C  C   . ASN C 1 321 ? 34.240 85.166  57.652  1.00 36.10 ? 321 ASN C C   1 
ATOM   10080 O  O   . ASN C 1 321 ? 33.704 84.426  56.833  1.00 36.13 ? 321 ASN C O   1 
ATOM   10081 C  CB  . ASN C 1 321 ? 34.695 84.419  59.950  1.00 36.97 ? 321 ASN C CB  1 
ATOM   10082 C  CG  . ASN C 1 321 ? 34.646 84.849  61.384  1.00 37.89 ? 321 ASN C CG  1 
ATOM   10083 O  OD1 . ASN C 1 321 ? 34.945 84.066  62.288  1.00 39.54 ? 321 ASN C OD1 1 
ATOM   10084 N  ND2 . ASN C 1 321 ? 34.282 86.107  61.613  1.00 37.93 ? 321 ASN C ND2 1 
ATOM   10085 N  N   . PRO C 1 322 ? 35.260 85.969  57.327  1.00 34.97 ? 322 PRO C N   1 
ATOM   10086 C  CA  . PRO C 1 322 ? 35.763 85.920  55.951  1.00 34.37 ? 322 PRO C CA  1 
ATOM   10087 C  C   . PRO C 1 322 ? 36.554 84.623  55.735  1.00 34.05 ? 322 PRO C C   1 
ATOM   10088 O  O   . PRO C 1 322 ? 37.030 84.004  56.697  1.00 33.99 ? 322 PRO C O   1 
ATOM   10089 C  CB  . PRO C 1 322 ? 36.627 87.174  55.854  1.00 34.64 ? 322 PRO C CB  1 
ATOM   10090 C  CG  . PRO C 1 322 ? 37.048 87.427  57.271  1.00 34.68 ? 322 PRO C CG  1 
ATOM   10091 C  CD  . PRO C 1 322 ? 35.818 87.115  58.065  1.00 33.91 ? 322 PRO C CD  1 
ATOM   10092 N  N   . VAL C 1 323 ? 36.674 84.188  54.488  1.00 33.30 ? 323 VAL C N   1 
ATOM   10093 C  CA  . VAL C 1 323 ? 37.419 82.962  54.204  1.00 33.56 ? 323 VAL C CA  1 
ATOM   10094 C  C   . VAL C 1 323 ? 38.869 83.330  53.905  1.00 33.44 ? 323 VAL C C   1 
ATOM   10095 O  O   . VAL C 1 323 ? 39.805 82.598  54.247  1.00 33.25 ? 323 VAL C O   1 
ATOM   10096 C  CB  . VAL C 1 323 ? 36.835 82.215  52.988  1.00 32.75 ? 323 VAL C CB  1 
ATOM   10097 C  CG1 . VAL C 1 323 ? 37.510 80.879  52.831  1.00 32.58 ? 323 VAL C CG1 1 
ATOM   10098 C  CG2 . VAL C 1 323 ? 35.356 82.028  53.167  1.00 33.71 ? 323 VAL C CG2 1 
ATOM   10099 N  N   . ASN C 1 324 ? 39.023 84.471  53.237  1.00 33.47 ? 324 ASN C N   1 
ATOM   10100 C  CA  . ASN C 1 324 ? 40.315 85.026  52.870  1.00 33.51 ? 324 ASN C CA  1 
ATOM   10101 C  C   . ASN C 1 324 ? 40.158 86.503  53.178  1.00 33.79 ? 324 ASN C C   1 
ATOM   10102 O  O   . ASN C 1 324 ? 39.258 87.162  52.649  1.00 33.60 ? 324 ASN C O   1 
ATOM   10103 C  CB  . ASN C 1 324 ? 40.618 84.815  51.381  1.00 32.71 ? 324 ASN C CB  1 
ATOM   10104 C  CG  . ASN C 1 324 ? 41.938 85.447  50.963  1.00 33.09 ? 324 ASN C CG  1 
ATOM   10105 O  OD1 . ASN C 1 324 ? 42.005 86.649  50.706  1.00 33.94 ? 324 ASN C OD1 1 
ATOM   10106 N  ND2 . ASN C 1 324 ? 43.002 84.644  50.920  1.00 32.36 ? 324 ASN C ND2 1 
ATOM   10107 N  N   . TYR C 1 325 ? 41.029 87.015  54.043  1.00 33.55 ? 325 TYR C N   1 
ATOM   10108 C  CA  . TYR C 1 325 ? 40.947 88.404  54.461  1.00 33.25 ? 325 TYR C CA  1 
ATOM   10109 C  C   . TYR C 1 325 ? 41.203 89.388  53.339  1.00 33.09 ? 325 TYR C C   1 
ATOM   10110 O  O   . TYR C 1 325 ? 40.460 90.348  53.170  1.00 33.80 ? 325 TYR C O   1 
ATOM   10111 C  CB  . TYR C 1 325 ? 41.923 88.663  55.604  1.00 32.39 ? 325 TYR C CB  1 
ATOM   10112 C  CG  . TYR C 1 325 ? 41.875 90.065  56.174  1.00 32.57 ? 325 TYR C CG  1 
ATOM   10113 C  CD1 . TYR C 1 325 ? 41.079 90.363  57.275  1.00 32.64 ? 325 TYR C CD1 1 
ATOM   10114 C  CD2 . TYR C 1 325 ? 42.697 91.076  55.665  1.00 32.46 ? 325 TYR C CD2 1 
ATOM   10115 C  CE1 . TYR C 1 325 ? 41.116 91.628  57.869  1.00 32.11 ? 325 TYR C CE1 1 
ATOM   10116 C  CE2 . TYR C 1 325 ? 42.735 92.338  56.248  1.00 31.65 ? 325 TYR C CE2 1 
ATOM   10117 C  CZ  . TYR C 1 325 ? 41.948 92.605  57.352  1.00 31.63 ? 325 TYR C CZ  1 
ATOM   10118 O  OH  . TYR C 1 325 ? 42.015 93.840  57.957  1.00 32.06 ? 325 TYR C OH  1 
ATOM   10119 N  N   . PHE C 1 326 ? 42.248 89.153  52.566  1.00 32.67 ? 326 PHE C N   1 
ATOM   10120 C  CA  . PHE C 1 326 ? 42.569 90.075  51.493  1.00 32.80 ? 326 PHE C CA  1 
ATOM   10121 C  C   . PHE C 1 326 ? 41.428 90.276  50.505  1.00 32.52 ? 326 PHE C C   1 
ATOM   10122 O  O   . PHE C 1 326 ? 41.093 91.411  50.140  1.00 31.89 ? 326 PHE C O   1 
ATOM   10123 C  CB  . PHE C 1 326 ? 43.803 89.604  50.721  1.00 32.28 ? 326 PHE C CB  1 
ATOM   10124 C  CG  . PHE C 1 326 ? 44.308 90.620  49.740  1.00 31.46 ? 326 PHE C CG  1 
ATOM   10125 C  CD1 . PHE C 1 326 ? 44.992 91.745  50.182  1.00 30.93 ? 326 PHE C CD1 1 
ATOM   10126 C  CD2 . PHE C 1 326 ? 44.052 90.485  48.384  1.00 30.88 ? 326 PHE C CD2 1 
ATOM   10127 C  CE1 . PHE C 1 326 ? 45.410 92.718  49.290  1.00 30.33 ? 326 PHE C CE1 1 
ATOM   10128 C  CE2 . PHE C 1 326 ? 44.469 91.456  47.485  1.00 30.75 ? 326 PHE C CE2 1 
ATOM   10129 C  CZ  . PHE C 1 326 ? 45.148 92.572  47.939  1.00 29.68 ? 326 PHE C CZ  1 
ATOM   10130 N  N   . ALA C 1 327 ? 40.846 89.164  50.075  1.00 32.59 ? 327 ALA C N   1 
ATOM   10131 C  CA  . ALA C 1 327 ? 39.770 89.183  49.096  1.00 32.77 ? 327 ALA C CA  1 
ATOM   10132 C  C   . ALA C 1 327 ? 38.488 89.810  49.598  1.00 32.52 ? 327 ALA C C   1 
ATOM   10133 O  O   . ALA C 1 327 ? 37.860 90.604  48.900  1.00 32.80 ? 327 ALA C O   1 
ATOM   10134 C  CB  . ALA C 1 327 ? 39.487 87.772  48.622  1.00 33.09 ? 327 ALA C CB  1 
ATOM   10135 N  N   . GLU C 1 328 ? 38.111 89.459  50.818  1.00 32.43 ? 328 GLU C N   1 
ATOM   10136 C  CA  . GLU C 1 328 ? 36.875 89.938  51.398  1.00 31.78 ? 328 GLU C CA  1 
ATOM   10137 C  C   . GLU C 1 328 ? 36.946 91.147  52.312  1.00 31.18 ? 328 GLU C C   1 
ATOM   10138 O  O   . GLU C 1 328 ? 35.939 91.808  52.524  1.00 31.22 ? 328 GLU C O   1 
ATOM   10139 C  CB  . GLU C 1 328 ? 36.214 88.784  52.141  1.00 33.07 ? 328 GLU C CB  1 
ATOM   10140 C  CG  . GLU C 1 328 ? 35.800 87.647  51.236  1.00 34.31 ? 328 GLU C CG  1 
ATOM   10141 C  CD  . GLU C 1 328 ? 35.573 86.355  51.988  1.00 35.83 ? 328 GLU C CD  1 
ATOM   10142 O  OE1 . GLU C 1 328 ? 34.906 86.387  53.041  1.00 37.44 ? 328 GLU C OE1 1 
ATOM   10143 O  OE2 . GLU C 1 328 ? 36.061 85.302  51.519  1.00 37.35 ? 328 GLU C OE2 1 
ATOM   10144 N  N   . VAL C 1 329 ? 38.116 91.459  52.854  1.00 30.72 ? 329 VAL C N   1 
ATOM   10145 C  CA  . VAL C 1 329 ? 38.201 92.590  53.765  1.00 29.23 ? 329 VAL C CA  1 
ATOM   10146 C  C   . VAL C 1 329 ? 39.062 93.750  53.287  1.00 29.35 ? 329 VAL C C   1 
ATOM   10147 O  O   . VAL C 1 329 ? 38.584 94.880  53.179  1.00 30.28 ? 329 VAL C O   1 
ATOM   10148 C  CB  . VAL C 1 329 ? 38.696 92.136  55.161  1.00 28.61 ? 329 VAL C CB  1 
ATOM   10149 C  CG1 . VAL C 1 329 ? 38.554 93.274  56.165  1.00 26.64 ? 329 VAL C CG1 1 
ATOM   10150 C  CG2 . VAL C 1 329 ? 37.899 90.937  55.623  1.00 27.70 ? 329 VAL C CG2 1 
ATOM   10151 N  N   . GLU C 1 330 ? 40.332 93.492  53.011  1.00 29.56 ? 330 GLU C N   1 
ATOM   10152 C  CA  . GLU C 1 330 ? 41.220 94.562  52.564  1.00 29.57 ? 330 GLU C CA  1 
ATOM   10153 C  C   . GLU C 1 330 ? 40.727 95.140  51.241  1.00 29.41 ? 330 GLU C C   1 
ATOM   10154 O  O   . GLU C 1 330 ? 40.833 96.340  51.010  1.00 29.38 ? 330 GLU C O   1 
ATOM   10155 C  CB  . GLU C 1 330 ? 42.647 94.036  52.415  1.00 30.24 ? 330 GLU C CB  1 
ATOM   10156 C  CG  . GLU C 1 330 ? 43.706 95.089  52.078  1.00 32.62 ? 330 GLU C CG  1 
ATOM   10157 C  CD  . GLU C 1 330 ? 43.833 96.187  53.131  1.00 33.96 ? 330 GLU C CD  1 
ATOM   10158 O  OE1 . GLU C 1 330 ? 43.781 95.872  54.338  1.00 33.93 ? 330 GLU C OE1 1 
ATOM   10159 O  OE2 . GLU C 1 330 ? 44.001 97.368  52.747  1.00 35.84 ? 330 GLU C OE2 1 
ATOM   10160 N  N   . GLN C 1 331 ? 40.178 94.291  50.379  1.00 28.07 ? 331 GLN C N   1 
ATOM   10161 C  CA  . GLN C 1 331 ? 39.679 94.755  49.099  1.00 27.85 ? 331 GLN C CA  1 
ATOM   10162 C  C   . GLN C 1 331 ? 38.252 95.281  49.129  1.00 28.12 ? 331 GLN C C   1 
ATOM   10163 O  O   . GLN C 1 331 ? 37.757 95.752  48.112  1.00 27.89 ? 331 GLN C O   1 
ATOM   10164 C  CB  . GLN C 1 331 ? 39.768 93.645  48.051  1.00 27.68 ? 331 GLN C CB  1 
ATOM   10165 C  CG  . GLN C 1 331 ? 41.125 93.527  47.386  1.00 27.42 ? 331 GLN C CG  1 
ATOM   10166 C  CD  . GLN C 1 331 ? 41.122 92.592  46.192  1.00 27.29 ? 331 GLN C CD  1 
ATOM   10167 O  OE1 . GLN C 1 331 ? 41.822 92.829  45.219  1.00 27.36 ? 331 GLN C OE1 1 
ATOM   10168 N  NE2 . GLN C 1 331 ? 40.343 91.519  46.268  1.00 28.01 ? 331 GLN C NE2 1 
ATOM   10169 N  N   . ILE C 1 332 ? 37.582 95.227  50.275  1.00 28.08 ? 332 ILE C N   1 
ATOM   10170 C  CA  . ILE C 1 332 ? 36.205 95.699  50.308  1.00 28.43 ? 332 ILE C CA  1 
ATOM   10171 C  C   . ILE C 1 332 ? 36.169 97.213  50.219  1.00 28.87 ? 332 ILE C C   1 
ATOM   10172 O  O   . ILE C 1 332 ? 37.018 97.894  50.782  1.00 29.29 ? 332 ILE C O   1 
ATOM   10173 C  CB  . ILE C 1 332 ? 35.422 95.198  51.572  1.00 28.19 ? 332 ILE C CB  1 
ATOM   10174 C  CG1 . ILE C 1 332 ? 33.930 95.486  51.381  1.00 27.83 ? 332 ILE C CG1 1 
ATOM   10175 C  CG2 . ILE C 1 332 ? 35.901 95.894  52.834  1.00 27.91 ? 332 ILE C CG2 1 
ATOM   10176 C  CD1 . ILE C 1 332 ? 33.029 94.683  52.256  1.00 25.43 ? 332 ILE C CD1 1 
ATOM   10177 N  N   . ALA C 1 333 ? 35.184 97.730  49.495  1.00 29.23 ? 333 ALA C N   1 
ATOM   10178 C  CA  . ALA C 1 333 ? 35.042 99.161  49.288  1.00 29.85 ? 333 ALA C CA  1 
ATOM   10179 C  C   . ALA C 1 333 ? 33.621 99.660  49.554  1.00 30.67 ? 333 ALA C C   1 
ATOM   10180 O  O   . ALA C 1 333 ? 32.655 99.146  48.999  1.00 31.10 ? 333 ALA C O   1 
ATOM   10181 C  CB  . ALA C 1 333 ? 35.439 99.490  47.862  1.00 29.40 ? 333 ALA C CB  1 
ATOM   10182 N  N   . PHE C 1 334 ? 33.490 100.666 50.404  1.00 31.77 ? 334 PHE C N   1 
ATOM   10183 C  CA  . PHE C 1 334 ? 32.169 101.212 50.684  1.00 32.73 ? 334 PHE C CA  1 
ATOM   10184 C  C   . PHE C 1 334 ? 32.061 102.650 50.153  1.00 32.70 ? 334 PHE C C   1 
ATOM   10185 O  O   . PHE C 1 334 ? 32.932 103.477 50.421  1.00 33.47 ? 334 PHE C O   1 
ATOM   10186 C  CB  . PHE C 1 334 ? 31.885 101.231 52.195  1.00 32.85 ? 334 PHE C CB  1 
ATOM   10187 C  CG  . PHE C 1 334 ? 32.044 99.896  52.882  1.00 33.98 ? 334 PHE C CG  1 
ATOM   10188 C  CD1 . PHE C 1 334 ? 33.292 99.450  53.291  1.00 34.49 ? 334 PHE C CD1 1 
ATOM   10189 C  CD2 . PHE C 1 334 ? 30.933 99.122  53.191  1.00 34.79 ? 334 PHE C CD2 1 
ATOM   10190 C  CE1 . PHE C 1 334 ? 33.429 98.259  54.008  1.00 35.04 ? 334 PHE C CE1 1 
ATOM   10191 C  CE2 . PHE C 1 334 ? 31.060 97.925  53.908  1.00 34.34 ? 334 PHE C CE2 1 
ATOM   10192 C  CZ  . PHE C 1 334 ? 32.307 97.497  54.317  1.00 33.90 ? 334 PHE C CZ  1 
ATOM   10193 N  N   . ASP C 1 335 ? 31.000 102.951 49.405  1.00 32.09 ? 335 ASP C N   1 
ATOM   10194 C  CA  . ASP C 1 335 ? 30.800 104.306 48.897  1.00 30.62 ? 335 ASP C CA  1 
ATOM   10195 C  C   . ASP C 1 335 ? 29.498 104.877 49.434  1.00 30.06 ? 335 ASP C C   1 
ATOM   10196 O  O   . ASP C 1 335 ? 28.425 104.399 49.096  1.00 29.47 ? 335 ASP C O   1 
ATOM   10197 C  CB  . ASP C 1 335 ? 30.722 104.327 47.372  1.00 31.12 ? 335 ASP C CB  1 
ATOM   10198 C  CG  . ASP C 1 335 ? 31.920 103.707 46.721  1.00 32.22 ? 335 ASP C CG  1 
ATOM   10199 O  OD1 . ASP C 1 335 ? 33.044 104.201 46.955  1.00 32.37 ? 335 ASP C OD1 1 
ATOM   10200 O  OD2 . ASP C 1 335 ? 31.732 102.724 45.974  1.00 33.00 ? 335 ASP C OD2 1 
ATOM   10201 N  N   . PRO C 1 336 ? 29.574 105.912 50.280  1.00 29.93 ? 336 PRO C N   1 
ATOM   10202 C  CA  . PRO C 1 336 ? 28.363 106.523 50.830  1.00 30.42 ? 336 PRO C CA  1 
ATOM   10203 C  C   . PRO C 1 336 ? 27.367 106.880 49.716  1.00 31.50 ? 336 PRO C C   1 
ATOM   10204 O  O   . PRO C 1 336 ? 26.156 106.856 49.920  1.00 31.52 ? 336 PRO C O   1 
ATOM   10205 C  CB  . PRO C 1 336 ? 28.908 107.756 51.534  1.00 29.33 ? 336 PRO C CB  1 
ATOM   10206 C  CG  . PRO C 1 336 ? 30.215 107.276 52.039  1.00 28.87 ? 336 PRO C CG  1 
ATOM   10207 C  CD  . PRO C 1 336 ? 30.778 106.515 50.874  1.00 29.00 ? 336 PRO C CD  1 
ATOM   10208 N  N   . SER C 1 337 ? 27.895 107.209 48.539  1.00 32.28 ? 337 SER C N   1 
ATOM   10209 C  CA  . SER C 1 337 ? 27.083 107.575 47.385  1.00 33.01 ? 337 SER C CA  1 
ATOM   10210 C  C   . SER C 1 337 ? 26.268 106.411 46.835  1.00 33.65 ? 337 SER C C   1 
ATOM   10211 O  O   . SER C 1 337 ? 25.458 106.585 45.922  1.00 33.59 ? 337 SER C O   1 
ATOM   10212 C  CB  . SER C 1 337 ? 27.973 108.118 46.280  1.00 32.75 ? 337 SER C CB  1 
ATOM   10213 O  OG  . SER C 1 337 ? 28.938 107.151 45.923  1.00 33.43 ? 337 SER C OG  1 
ATOM   10214 N  N   . ASN C 1 338 ? 26.498 105.220 47.367  1.00 34.72 ? 338 ASN C N   1 
ATOM   10215 C  CA  . ASN C 1 338 ? 25.736 104.057 46.929  1.00 36.13 ? 338 ASN C CA  1 
ATOM   10216 C  C   . ASN C 1 338 ? 24.445 104.019 47.722  1.00 36.48 ? 338 ASN C C   1 
ATOM   10217 O  O   . ASN C 1 338 ? 24.401 103.458 48.818  1.00 37.25 ? 338 ASN C O   1 
ATOM   10218 C  CB  . ASN C 1 338 ? 26.506 102.762 47.179  1.00 37.06 ? 338 ASN C CB  1 
ATOM   10219 C  CG  . ASN C 1 338 ? 27.536 102.492 46.122  1.00 37.20 ? 338 ASN C CG  1 
ATOM   10220 O  OD1 . ASN C 1 338 ? 27.588 103.177 45.098  1.00 40.59 ? 338 ASN C OD1 1 
ATOM   10221 N  ND2 . ASN C 1 338 ? 28.359 101.488 46.350  1.00 36.85 ? 338 ASN C ND2 1 
ATOM   10222 N  N   . MET C 1 339 ? 23.407 104.636 47.173  1.00 36.79 ? 339 MET C N   1 
ATOM   10223 C  CA  . MET C 1 339 ? 22.104 104.681 47.817  1.00 37.15 ? 339 MET C CA  1 
ATOM   10224 C  C   . MET C 1 339 ? 21.018 104.333 46.808  1.00 37.63 ? 339 MET C C   1 
ATOM   10225 O  O   . MET C 1 339 ? 20.981 104.870 45.696  1.00 38.10 ? 339 MET C O   1 
ATOM   10226 C  CB  . MET C 1 339 ? 21.849 106.073 48.407  1.00 37.31 ? 339 MET C CB  1 
ATOM   10227 C  CG  . MET C 1 339 ? 22.729 106.412 49.605  1.00 37.42 ? 339 MET C CG  1 
ATOM   10228 S  SD  . MET C 1 339 ? 22.468 108.100 50.176  1.00 38.64 ? 339 MET C SD  1 
ATOM   10229 C  CE  . MET C 1 339 ? 23.180 109.019 48.802  1.00 36.89 ? 339 MET C CE  1 
ATOM   10230 N  N   . PRO C 1 340 ? 20.132 103.399 47.172  1.00 37.75 ? 340 PRO C N   1 
ATOM   10231 C  CA  . PRO C 1 340 ? 19.054 103.002 46.270  1.00 37.59 ? 340 PRO C CA  1 
ATOM   10232 C  C   . PRO C 1 340 ? 17.845 103.887 46.512  1.00 37.33 ? 340 PRO C C   1 
ATOM   10233 O  O   . PRO C 1 340 ? 17.765 104.569 47.532  1.00 37.98 ? 340 PRO C O   1 
ATOM   10234 C  CB  . PRO C 1 340 ? 18.808 101.555 46.662  1.00 37.53 ? 340 PRO C CB  1 
ATOM   10235 C  CG  . PRO C 1 340 ? 18.977 101.619 48.137  1.00 37.84 ? 340 PRO C CG  1 
ATOM   10236 C  CD  . PRO C 1 340 ? 20.222 102.472 48.315  1.00 37.72 ? 340 PRO C CD  1 
ATOM   10237 N  N   . PRO C 1 341 ? 16.892 103.894 45.572  1.00 36.95 ? 341 PRO C N   1 
ATOM   10238 C  CA  . PRO C 1 341 ? 15.680 104.704 45.691  1.00 36.17 ? 341 PRO C CA  1 
ATOM   10239 C  C   . PRO C 1 341 ? 15.054 104.571 47.075  1.00 36.19 ? 341 PRO C C   1 
ATOM   10240 O  O   . PRO C 1 341 ? 14.948 103.471 47.611  1.00 35.66 ? 341 PRO C O   1 
ATOM   10241 C  CB  . PRO C 1 341 ? 14.797 104.141 44.595  1.00 35.33 ? 341 PRO C CB  1 
ATOM   10242 C  CG  . PRO C 1 341 ? 15.792 103.790 43.541  1.00 35.75 ? 341 PRO C CG  1 
ATOM   10243 C  CD  . PRO C 1 341 ? 16.869 103.103 44.331  1.00 36.06 ? 341 PRO C CD  1 
ATOM   10244 N  N   . GLY C 1 342 ? 14.647 105.699 47.644  1.00 36.33 ? 342 GLY C N   1 
ATOM   10245 C  CA  . GLY C 1 342 ? 14.054 105.694 48.967  1.00 36.36 ? 342 GLY C CA  1 
ATOM   10246 C  C   . GLY C 1 342 ? 15.017 106.332 49.944  1.00 36.63 ? 342 GLY C C   1 
ATOM   10247 O  O   . GLY C 1 342 ? 14.621 106.937 50.942  1.00 36.63 ? 342 GLY C O   1 
ATOM   10248 N  N   . ILE C 1 343 ? 16.301 106.193 49.639  1.00 37.27 ? 343 ILE C N   1 
ATOM   10249 C  CA  . ILE C 1 343 ? 17.360 106.752 50.464  1.00 38.05 ? 343 ILE C CA  1 
ATOM   10250 C  C   . ILE C 1 343 ? 18.176 107.721 49.636  1.00 38.34 ? 343 ILE C C   1 
ATOM   10251 O  O   . ILE C 1 343 ? 18.614 107.388 48.529  1.00 38.12 ? 343 ILE C O   1 
ATOM   10252 C  CB  . ILE C 1 343 ? 18.308 105.664 50.968  1.00 38.48 ? 343 ILE C CB  1 
ATOM   10253 C  CG1 . ILE C 1 343 ? 17.500 104.578 51.682  1.00 39.27 ? 343 ILE C CG1 1 
ATOM   10254 C  CG2 . ILE C 1 343 ? 19.360 106.288 51.875  1.00 37.25 ? 343 ILE C CG2 1 
ATOM   10255 C  CD1 . ILE C 1 343 ? 18.313 103.392 52.128  1.00 40.08 ? 343 ILE C CD1 1 
ATOM   10256 N  N   . GLU C 1 344 ? 18.383 108.918 50.174  1.00 38.39 ? 344 GLU C N   1 
ATOM   10257 C  CA  . GLU C 1 344 ? 19.156 109.931 49.476  1.00 38.62 ? 344 GLU C CA  1 
ATOM   10258 C  C   . GLU C 1 344 ? 19.961 110.769 50.461  1.00 37.68 ? 344 GLU C C   1 
ATOM   10259 O  O   . GLU C 1 344 ? 19.779 110.678 51.678  1.00 37.86 ? 344 GLU C O   1 
ATOM   10260 C  CB  . GLU C 1 344 ? 18.226 110.829 48.660  1.00 41.00 ? 344 GLU C CB  1 
ATOM   10261 C  CG  . GLU C 1 344 ? 17.295 110.065 47.704  1.00 43.29 ? 344 GLU C CG  1 
ATOM   10262 C  CD  . GLU C 1 344 ? 16.482 110.994 46.805  1.00 45.00 ? 344 GLU C CD  1 
ATOM   10263 O  OE1 . GLU C 1 344 ? 15.571 110.509 46.087  1.00 45.62 ? 344 GLU C OE1 1 
ATOM   10264 O  OE2 . GLU C 1 344 ? 16.762 112.215 46.816  1.00 46.24 ? 344 GLU C OE2 1 
ATOM   10265 N  N   . ALA C 1 345 ? 20.854 111.587 49.928  1.00 36.12 ? 345 ALA C N   1 
ATOM   10266 C  CA  . ALA C 1 345 ? 21.696 112.434 50.752  1.00 34.98 ? 345 ALA C CA  1 
ATOM   10267 C  C   . ALA C 1 345 ? 21.020 113.740 51.126  1.00 34.72 ? 345 ALA C C   1 
ATOM   10268 O  O   . ALA C 1 345 ? 20.086 114.177 50.463  1.00 34.90 ? 345 ALA C O   1 
ATOM   10269 C  CB  . ALA C 1 345 ? 22.996 112.731 50.018  1.00 33.82 ? 345 ALA C CB  1 
ATOM   10270 N  N   . SER C 1 346 ? 21.497 114.357 52.201  1.00 34.69 ? 346 SER C N   1 
ATOM   10271 C  CA  . SER C 1 346 ? 20.985 115.651 52.625  1.00 35.38 ? 346 SER C CA  1 
ATOM   10272 C  C   . SER C 1 346 ? 22.068 116.643 52.216  1.00 36.42 ? 346 SER C C   1 
ATOM   10273 O  O   . SER C 1 346 ? 23.164 116.249 51.822  1.00 35.99 ? 346 SER C O   1 
ATOM   10274 C  CB  . SER C 1 346 ? 20.788 115.714 54.141  1.00 34.67 ? 346 SER C CB  1 
ATOM   10275 O  OG  . SER C 1 346 ? 22.035 115.775 54.806  1.00 34.22 ? 346 SER C OG  1 
ATOM   10276 N  N   . PRO C 1 347 ? 21.783 117.944 52.308  1.00 37.90 ? 347 PRO C N   1 
ATOM   10277 C  CA  . PRO C 1 347 ? 22.797 118.933 51.924  1.00 38.66 ? 347 PRO C CA  1 
ATOM   10278 C  C   . PRO C 1 347 ? 23.953 119.092 52.924  1.00 38.88 ? 347 PRO C C   1 
ATOM   10279 O  O   . PRO C 1 347 ? 24.711 120.059 52.843  1.00 39.56 ? 347 PRO C O   1 
ATOM   10280 C  CB  . PRO C 1 347 ? 21.979 120.209 51.765  1.00 39.48 ? 347 PRO C CB  1 
ATOM   10281 C  CG  . PRO C 1 347 ? 20.896 120.035 52.814  1.00 39.22 ? 347 PRO C CG  1 
ATOM   10282 C  CD  . PRO C 1 347 ? 20.499 118.591 52.640  1.00 38.66 ? 347 PRO C CD  1 
ATOM   10283 N  N   . ASP C 1 348 ? 24.074 118.145 53.857  1.00 38.22 ? 348 ASP C N   1 
ATOM   10284 C  CA  . ASP C 1 348 ? 25.137 118.159 54.858  1.00 37.27 ? 348 ASP C CA  1 
ATOM   10285 C  C   . ASP C 1 348 ? 26.451 118.271 54.111  1.00 36.73 ? 348 ASP C C   1 
ATOM   10286 O  O   . ASP C 1 348 ? 26.848 117.344 53.396  1.00 36.30 ? 348 ASP C O   1 
ATOM   10287 C  CB  . ASP C 1 348 ? 25.117 116.854 55.660  1.00 38.65 ? 348 ASP C CB  1 
ATOM   10288 C  CG  . ASP C 1 348 ? 26.240 116.769 56.687  1.00 38.94 ? 348 ASP C CG  1 
ATOM   10289 O  OD1 . ASP C 1 348 ? 27.248 117.497 56.566  1.00 40.56 ? 348 ASP C OD1 1 
ATOM   10290 O  OD2 . ASP C 1 348 ? 26.120 115.949 57.617  1.00 39.52 ? 348 ASP C OD2 1 
ATOM   10291 N  N   . LYS C 1 349 ? 27.130 119.402 54.295  1.00 36.28 ? 349 LYS C N   1 
ATOM   10292 C  CA  . LYS C 1 349 ? 28.399 119.673 53.620  1.00 34.89 ? 349 LYS C CA  1 
ATOM   10293 C  C   . LYS C 1 349 ? 29.389 118.509 53.657  1.00 34.59 ? 349 LYS C C   1 
ATOM   10294 O  O   . LYS C 1 349 ? 29.946 118.128 52.624  1.00 33.22 ? 349 LYS C O   1 
ATOM   10295 C  CB  . LYS C 1 349 ? 29.023 120.935 54.209  1.00 34.46 ? 349 LYS C CB  1 
ATOM   10296 C  CG  . LYS C 1 349 ? 28.188 122.175 53.956  1.00 33.71 ? 349 LYS C CG  1 
ATOM   10297 C  CD  . LYS C 1 349 ? 28.931 123.456 54.313  1.00 33.47 ? 349 LYS C CD  1 
ATOM   10298 C  CE  . LYS C 1 349 ? 28.256 124.656 53.659  1.00 33.67 ? 349 LYS C CE  1 
ATOM   10299 N  NZ  . LYS C 1 349 ? 28.929 125.981 53.883  1.00 33.47 ? 349 LYS C NZ  1 
ATOM   10300 N  N   . MET C 1 350 ? 29.584 117.937 54.845  1.00 34.69 ? 350 MET C N   1 
ATOM   10301 C  CA  . MET C 1 350 ? 30.492 116.806 55.029  1.00 34.17 ? 350 MET C CA  1 
ATOM   10302 C  C   . MET C 1 350 ? 30.111 115.596 54.167  1.00 34.03 ? 350 MET C C   1 
ATOM   10303 O  O   . MET C 1 350 ? 30.960 115.028 53.472  1.00 33.70 ? 350 MET C O   1 
ATOM   10304 C  CB  . MET C 1 350 ? 30.516 116.386 56.500  1.00 34.94 ? 350 MET C CB  1 
ATOM   10305 C  CG  . MET C 1 350 ? 31.240 117.347 57.426  1.00 35.78 ? 350 MET C CG  1 
ATOM   10306 S  SD  . MET C 1 350 ? 33.002 117.414 57.128  1.00 36.58 ? 350 MET C SD  1 
ATOM   10307 C  CE  . MET C 1 350 ? 33.533 115.938 57.987  1.00 36.73 ? 350 MET C CE  1 
ATOM   10308 N  N   . LEU C 1 351 ? 28.840 115.195 54.229  1.00 33.52 ? 351 LEU C N   1 
ATOM   10309 C  CA  . LEU C 1 351 ? 28.348 114.063 53.446  1.00 32.50 ? 351 LEU C CA  1 
ATOM   10310 C  C   . LEU C 1 351 ? 28.466 114.361 51.945  1.00 32.43 ? 351 LEU C C   1 
ATOM   10311 O  O   . LEU C 1 351 ? 28.865 113.502 51.158  1.00 31.34 ? 351 LEU C O   1 
ATOM   10312 C  CB  . LEU C 1 351 ? 26.891 113.777 53.804  1.00 31.66 ? 351 LEU C CB  1 
ATOM   10313 C  CG  . LEU C 1 351 ? 26.192 112.689 52.982  1.00 31.26 ? 351 LEU C CG  1 
ATOM   10314 C  CD1 . LEU C 1 351 ? 26.760 111.314 53.318  1.00 29.74 ? 351 LEU C CD1 1 
ATOM   10315 C  CD2 . LEU C 1 351 ? 24.706 112.742 53.262  1.00 30.23 ? 351 LEU C CD2 1 
ATOM   10316 N  N   . GLN C 1 352 ? 28.120 115.584 51.555  1.00 32.77 ? 352 GLN C N   1 
ATOM   10317 C  CA  . GLN C 1 352 ? 28.213 115.975 50.156  1.00 34.17 ? 352 GLN C CA  1 
ATOM   10318 C  C   . GLN C 1 352 ? 29.645 115.741 49.647  1.00 34.64 ? 352 GLN C C   1 
ATOM   10319 O  O   . GLN C 1 352 ? 29.852 115.332 48.494  1.00 34.52 ? 352 GLN C O   1 
ATOM   10320 C  CB  . GLN C 1 352 ? 27.834 117.451 49.984  1.00 35.25 ? 352 GLN C CB  1 
ATOM   10321 C  CG  . GLN C 1 352 ? 26.345 117.817 50.193  1.00 36.51 ? 352 GLN C CG  1 
ATOM   10322 C  CD  . GLN C 1 352 ? 25.437 117.502 48.988  1.00 36.88 ? 352 GLN C CD  1 
ATOM   10323 O  OE1 . GLN C 1 352 ? 25.713 117.884 47.845  1.00 36.39 ? 352 GLN C OE1 1 
ATOM   10324 N  NE2 . GLN C 1 352 ? 24.337 116.818 49.257  1.00 37.15 ? 352 GLN C NE2 1 
ATOM   10325 N  N   . GLY C 1 353 ? 30.628 116.006 50.506  1.00 34.07 ? 353 GLY C N   1 
ATOM   10326 C  CA  . GLY C 1 353 ? 32.019 115.801 50.130  1.00 34.03 ? 353 GLY C CA  1 
ATOM   10327 C  C   . GLY C 1 353 ? 32.358 114.325 49.926  1.00 34.09 ? 353 GLY C C   1 
ATOM   10328 O  O   . GLY C 1 353 ? 32.999 113.948 48.928  1.00 34.30 ? 353 GLY C O   1 
ATOM   10329 N  N   . ARG C 1 354 ? 31.934 113.487 50.875  1.00 32.75 ? 354 ARG C N   1 
ATOM   10330 C  CA  . ARG C 1 354 ? 32.163 112.045 50.803  1.00 31.25 ? 354 ARG C CA  1 
ATOM   10331 C  C   . ARG C 1 354 ? 31.493 111.427 49.572  1.00 30.78 ? 354 ARG C C   1 
ATOM   10332 O  O   . ARG C 1 354 ? 31.900 110.373 49.112  1.00 30.69 ? 354 ARG C O   1 
ATOM   10333 C  CB  . ARG C 1 354 ? 31.630 111.359 52.061  1.00 30.83 ? 354 ARG C CB  1 
ATOM   10334 C  CG  . ARG C 1 354 ? 32.217 111.898 53.350  1.00 30.17 ? 354 ARG C CG  1 
ATOM   10335 C  CD  . ARG C 1 354 ? 31.533 111.270 54.538  1.00 30.00 ? 354 ARG C CD  1 
ATOM   10336 N  NE  . ARG C 1 354 ? 31.955 109.889 54.751  1.00 30.07 ? 354 ARG C NE  1 
ATOM   10337 C  CZ  . ARG C 1 354 ? 31.202 108.974 55.348  1.00 29.02 ? 354 ARG C CZ  1 
ATOM   10338 N  NH1 . ARG C 1 354 ? 29.996 109.300 55.777  1.00 30.43 ? 354 ARG C NH1 1 
ATOM   10339 N  NH2 . ARG C 1 354 ? 31.652 107.744 55.532  1.00 29.05 ? 354 ARG C NH2 1 
ATOM   10340 N  N   . LEU C 1 355 ? 30.452 112.070 49.048  1.00 31.09 ? 355 LEU C N   1 
ATOM   10341 C  CA  . LEU C 1 355 ? 29.789 111.540 47.860  1.00 30.48 ? 355 LEU C CA  1 
ATOM   10342 C  C   . LEU C 1 355 ? 30.829 111.420 46.768  1.00 30.32 ? 355 LEU C C   1 
ATOM   10343 O  O   . LEU C 1 355 ? 30.687 110.627 45.855  1.00 30.86 ? 355 LEU C O   1 
ATOM   10344 C  CB  . LEU C 1 355 ? 28.660 112.455 47.376  1.00 29.96 ? 355 LEU C CB  1 
ATOM   10345 C  CG  . LEU C 1 355 ? 27.401 112.564 48.235  1.00 29.70 ? 355 LEU C CG  1 
ATOM   10346 C  CD1 . LEU C 1 355 ? 26.346 113.350 47.478  1.00 28.48 ? 355 LEU C CD1 1 
ATOM   10347 C  CD2 . LEU C 1 355 ? 26.881 111.179 48.571  1.00 28.72 ? 355 LEU C CD2 1 
ATOM   10348 N  N   . PHE C 1 356 ? 31.893 112.200 46.880  1.00 30.49 ? 356 PHE C N   1 
ATOM   10349 C  CA  . PHE C 1 356 ? 32.942 112.164 45.886  1.00 30.54 ? 356 PHE C CA  1 
ATOM   10350 C  C   . PHE C 1 356 ? 34.212 111.417 46.309  1.00 31.01 ? 356 PHE C C   1 
ATOM   10351 O  O   . PHE C 1 356 ? 34.791 110.657 45.531  1.00 31.44 ? 356 PHE C O   1 
ATOM   10352 C  CB  . PHE C 1 356 ? 33.326 113.583 45.498  1.00 29.54 ? 356 PHE C CB  1 
ATOM   10353 C  CG  . PHE C 1 356 ? 34.609 113.659 44.736  1.00 29.58 ? 356 PHE C CG  1 
ATOM   10354 C  CD1 . PHE C 1 356 ? 34.694 113.142 43.449  1.00 29.52 ? 356 PHE C CD1 1 
ATOM   10355 C  CD2 . PHE C 1 356 ? 35.746 114.196 45.323  1.00 29.46 ? 356 PHE C CD2 1 
ATOM   10356 C  CE1 . PHE C 1 356 ? 35.893 113.154 42.753  1.00 30.68 ? 356 PHE C CE1 1 
ATOM   10357 C  CE2 . PHE C 1 356 ? 36.961 114.214 44.643  1.00 29.98 ? 356 PHE C CE2 1 
ATOM   10358 C  CZ  . PHE C 1 356 ? 37.041 113.693 43.355  1.00 30.71 ? 356 PHE C CZ  1 
ATOM   10359 N  N   . ALA C 1 357 ? 34.647 111.637 47.540  1.00 30.86 ? 357 ALA C N   1 
ATOM   10360 C  CA  . ALA C 1 357 ? 35.881 111.028 48.004  1.00 31.21 ? 357 ALA C CA  1 
ATOM   10361 C  C   . ALA C 1 357 ? 36.033 109.519 47.826  1.00 31.71 ? 357 ALA C C   1 
ATOM   10362 O  O   . ALA C 1 357 ? 37.028 109.071 47.252  1.00 31.97 ? 357 ALA C O   1 
ATOM   10363 C  CB  . ALA C 1 357 ? 36.139 111.404 49.467  1.00 30.02 ? 357 ALA C CB  1 
ATOM   10364 N  N   . TYR C 1 358 ? 35.062 108.737 48.291  1.00 30.69 ? 358 TYR C N   1 
ATOM   10365 C  CA  . TYR C 1 358 ? 35.181 107.294 48.215  1.00 29.88 ? 358 TYR C CA  1 
ATOM   10366 C  C   . TYR C 1 358 ? 35.323 106.675 46.813  1.00 29.81 ? 358 TYR C C   1 
ATOM   10367 O  O   . TYR C 1 358 ? 36.331 106.013 46.513  1.00 30.58 ? 358 TYR C O   1 
ATOM   10368 C  CB  . TYR C 1 358 ? 34.038 106.660 49.007  1.00 30.33 ? 358 TYR C CB  1 
ATOM   10369 C  CG  . TYR C 1 358 ? 34.061 107.063 50.473  1.00 31.04 ? 358 TYR C CG  1 
ATOM   10370 C  CD1 . TYR C 1 358 ? 33.748 108.367 50.868  1.00 31.19 ? 358 TYR C CD1 1 
ATOM   10371 C  CD2 . TYR C 1 358 ? 34.400 106.144 51.472  1.00 31.97 ? 358 TYR C CD2 1 
ATOM   10372 C  CE1 . TYR C 1 358 ? 33.770 108.752 52.223  1.00 31.50 ? 358 TYR C CE1 1 
ATOM   10373 C  CE2 . TYR C 1 358 ? 34.425 106.521 52.837  1.00 32.08 ? 358 TYR C CE2 1 
ATOM   10374 C  CZ  . TYR C 1 358 ? 34.112 107.826 53.197  1.00 31.64 ? 358 TYR C CZ  1 
ATOM   10375 O  OH  . TYR C 1 358 ? 34.182 108.216 54.518  1.00 33.87 ? 358 TYR C OH  1 
ATOM   10376 N  N   . PRO C 1 359 ? 34.337 106.863 45.931  1.00 28.51 ? 359 PRO C N   1 
ATOM   10377 C  CA  . PRO C 1 359 ? 34.574 106.234 44.625  1.00 28.06 ? 359 PRO C CA  1 
ATOM   10378 C  C   . PRO C 1 359 ? 35.913 106.683 44.030  1.00 26.75 ? 359 PRO C C   1 
ATOM   10379 O  O   . PRO C 1 359 ? 36.604 105.904 43.371  1.00 27.33 ? 359 PRO C O   1 
ATOM   10380 C  CB  . PRO C 1 359 ? 33.380 106.700 43.791  1.00 27.83 ? 359 PRO C CB  1 
ATOM   10381 C  CG  . PRO C 1 359 ? 32.302 106.844 44.824  1.00 27.95 ? 359 PRO C CG  1 
ATOM   10382 C  CD  . PRO C 1 359 ? 33.009 107.493 45.991  1.00 27.83 ? 359 PRO C CD  1 
ATOM   10383 N  N   . ASP C 1 360 ? 36.276 107.936 44.281  1.00 25.85 ? 360 ASP C N   1 
ATOM   10384 C  CA  . ASP C 1 360 ? 37.518 108.494 43.768  1.00 25.52 ? 360 ASP C CA  1 
ATOM   10385 C  C   . ASP C 1 360 ? 38.723 107.747 44.332  1.00 25.72 ? 360 ASP C C   1 
ATOM   10386 O  O   . ASP C 1 360 ? 39.576 107.253 43.585  1.00 24.54 ? 360 ASP C O   1 
ATOM   10387 C  CB  . ASP C 1 360 ? 37.609 109.969 44.142  1.00 26.47 ? 360 ASP C CB  1 
ATOM   10388 C  CG  . ASP C 1 360 ? 38.846 110.639 43.578  1.00 29.23 ? 360 ASP C CG  1 
ATOM   10389 O  OD1 . ASP C 1 360 ? 38.987 110.639 42.330  1.00 31.13 ? 360 ASP C OD1 1 
ATOM   10390 O  OD2 . ASP C 1 360 ? 39.672 111.164 44.370  1.00 27.93 ? 360 ASP C OD2 1 
ATOM   10391 N  N   . THR C 1 361 ? 38.777 107.647 45.658  1.00 24.97 ? 361 THR C N   1 
ATOM   10392 C  CA  . THR C 1 361 ? 39.885 106.978 46.307  1.00 24.31 ? 361 THR C CA  1 
ATOM   10393 C  C   . THR C 1 361 ? 39.884 105.497 45.934  1.00 24.18 ? 361 THR C C   1 
ATOM   10394 O  O   . THR C 1 361 ? 40.940 104.906 45.703  1.00 24.73 ? 361 THR C O   1 
ATOM   10395 C  CB  . THR C 1 361 ? 39.839 107.164 47.865  1.00 23.88 ? 361 THR C CB  1 
ATOM   10396 O  OG1 . THR C 1 361 ? 41.151 106.981 48.395  1.00 24.56 ? 361 THR C OG1 1 
ATOM   10397 C  CG2 . THR C 1 361 ? 38.931 106.151 48.524  1.00 22.41 ? 361 THR C CG2 1 
ATOM   10398 N  N   . HIS C 1 362 ? 38.707 104.896 45.852  1.00 23.42 ? 362 HIS C N   1 
ATOM   10399 C  CA  . HIS C 1 362 ? 38.645 103.484 45.501  1.00 24.54 ? 362 HIS C CA  1 
ATOM   10400 C  C   . HIS C 1 362 ? 39.262 103.208 44.134  1.00 25.03 ? 362 HIS C C   1 
ATOM   10401 O  O   . HIS C 1 362 ? 39.931 102.194 43.934  1.00 24.07 ? 362 HIS C O   1 
ATOM   10402 C  CB  . HIS C 1 362 ? 37.199 103.006 45.542  1.00 23.75 ? 362 HIS C CB  1 
ATOM   10403 C  CG  . HIS C 1 362 ? 36.658 102.904 46.924  1.00 25.46 ? 362 HIS C CG  1 
ATOM   10404 N  ND1 . HIS C 1 362 ? 35.338 103.151 47.230  1.00 27.12 ? 362 HIS C ND1 1 
ATOM   10405 C  CD2 . HIS C 1 362 ? 37.257 102.559 48.088  1.00 25.31 ? 362 HIS C CD2 1 
ATOM   10406 C  CE1 . HIS C 1 362 ? 35.147 102.964 48.524  1.00 27.06 ? 362 HIS C CE1 1 
ATOM   10407 N  NE2 . HIS C 1 362 ? 36.295 102.602 49.067  1.00 27.26 ? 362 HIS C NE2 1 
ATOM   10408 N  N   . ARG C 1 363 ? 39.047 104.125 43.199  1.00 25.79 ? 363 ARG C N   1 
ATOM   10409 C  CA  . ARG C 1 363 ? 39.582 103.958 41.865  1.00 27.27 ? 363 ARG C CA  1 
ATOM   10410 C  C   . ARG C 1 363 ? 41.097 103.913 41.956  1.00 28.42 ? 363 ARG C C   1 
ATOM   10411 O  O   . ARG C 1 363 ? 41.762 103.233 41.174  1.00 28.27 ? 363 ARG C O   1 
ATOM   10412 C  CB  . ARG C 1 363 ? 39.088 105.107 40.978  1.00 27.04 ? 363 ARG C CB  1 
ATOM   10413 C  CG  . ARG C 1 363 ? 37.589 105.010 40.742  1.00 25.82 ? 363 ARG C CG  1 
ATOM   10414 C  CD  . ARG C 1 363 ? 36.944 106.293 40.285  1.00 25.13 ? 363 ARG C CD  1 
ATOM   10415 N  NE  . ARG C 1 363 ? 35.495 106.104 40.279  1.00 25.17 ? 363 ARG C NE  1 
ATOM   10416 C  CZ  . ARG C 1 363 ? 34.607 107.029 40.626  1.00 24.04 ? 363 ARG C CZ  1 
ATOM   10417 N  NH1 . ARG C 1 363 ? 35.005 108.227 41.002  1.00 24.24 ? 363 ARG C NH1 1 
ATOM   10418 N  NH2 . ARG C 1 363 ? 33.319 106.742 40.638  1.00 24.31 ? 363 ARG C NH2 1 
ATOM   10419 N  N   . HIS C 1 364 ? 41.632 104.627 42.939  1.00 29.79 ? 364 HIS C N   1 
ATOM   10420 C  CA  . HIS C 1 364 ? 43.066 104.671 43.164  1.00 30.58 ? 364 HIS C CA  1 
ATOM   10421 C  C   . HIS C 1 364 ? 43.531 103.420 43.893  1.00 30.49 ? 364 HIS C C   1 
ATOM   10422 O  O   . HIS C 1 364 ? 44.386 102.684 43.402  1.00 30.32 ? 364 HIS C O   1 
ATOM   10423 C  CB  . HIS C 1 364 ? 43.433 105.907 43.990  1.00 31.51 ? 364 HIS C CB  1 
ATOM   10424 C  CG  . HIS C 1 364 ? 44.852 105.918 44.479  1.00 31.83 ? 364 HIS C CG  1 
ATOM   10425 N  ND1 . HIS C 1 364 ? 45.930 106.074 43.635  1.00 30.54 ? 364 HIS C ND1 1 
ATOM   10426 C  CD2 . HIS C 1 364 ? 45.364 105.768 45.725  1.00 31.01 ? 364 HIS C CD2 1 
ATOM   10427 C  CE1 . HIS C 1 364 ? 47.046 106.016 44.340  1.00 31.73 ? 364 HIS C CE1 1 
ATOM   10428 N  NE2 . HIS C 1 364 ? 46.730 105.831 45.611  1.00 31.64 ? 364 HIS C NE2 1 
ATOM   10429 N  N   . ARG C 1 365 ? 42.949 103.183 45.064  1.00 30.81 ? 365 ARG C N   1 
ATOM   10430 C  CA  . ARG C 1 365 ? 43.310 102.035 45.893  1.00 30.93 ? 365 ARG C CA  1 
ATOM   10431 C  C   . ARG C 1 365 ? 43.094 100.683 45.237  1.00 31.05 ? 365 ARG C C   1 
ATOM   10432 O  O   . ARG C 1 365 ? 43.977 99.829  45.261  1.00 31.67 ? 365 ARG C O   1 
ATOM   10433 C  CB  . ARG C 1 365 ? 42.534 102.068 47.217  1.00 31.00 ? 365 ARG C CB  1 
ATOM   10434 C  CG  . ARG C 1 365 ? 42.994 101.019 48.214  1.00 31.54 ? 365 ARG C CG  1 
ATOM   10435 C  CD  . ARG C 1 365 ? 42.514 101.334 49.617  1.00 31.30 ? 365 ARG C CD  1 
ATOM   10436 N  NE  . ARG C 1 365 ? 41.075 101.154 49.756  1.00 32.80 ? 365 ARG C NE  1 
ATOM   10437 C  CZ  . ARG C 1 365 ? 40.470 99.968  49.795  1.00 33.04 ? 365 ARG C CZ  1 
ATOM   10438 N  NH1 . ARG C 1 365 ? 41.196 98.859  49.705  1.00 33.87 ? 365 ARG C NH1 1 
ATOM   10439 N  NH2 . ARG C 1 365 ? 39.148 99.889  49.929  1.00 30.33 ? 365 ARG C NH2 1 
ATOM   10440 N  N   . LEU C 1 366 ? 41.922 100.475 44.654  1.00 30.62 ? 366 LEU C N   1 
ATOM   10441 C  CA  . LEU C 1 366 ? 41.642 99.188  44.046  1.00 30.33 ? 366 LEU C CA  1 
ATOM   10442 C  C   . LEU C 1 366 ? 41.802 99.210  42.545  1.00 30.06 ? 366 LEU C C   1 
ATOM   10443 O  O   . LEU C 1 366 ? 42.542 98.413  41.990  1.00 31.01 ? 366 LEU C O   1 
ATOM   10444 C  CB  . LEU C 1 366 ? 40.241 98.727  44.440  1.00 30.69 ? 366 LEU C CB  1 
ATOM   10445 C  CG  . LEU C 1 366 ? 40.050 98.747  45.964  1.00 31.18 ? 366 LEU C CG  1 
ATOM   10446 C  CD1 . LEU C 1 366 ? 38.603 98.492  46.287  1.00 31.42 ? 366 LEU C CD1 1 
ATOM   10447 C  CD2 . LEU C 1 366 ? 40.959 97.718  46.637  1.00 30.75 ? 366 LEU C CD2 1 
ATOM   10448 N  N   . GLY C 1 367 ? 41.122 100.125 41.875  1.00 29.62 ? 367 GLY C N   1 
ATOM   10449 C  CA  . GLY C 1 367 ? 41.265 100.186 40.438  1.00 28.67 ? 367 GLY C CA  1 
ATOM   10450 C  C   . GLY C 1 367 ? 39.996 100.640 39.786  1.00 29.08 ? 367 GLY C C   1 
ATOM   10451 O  O   . GLY C 1 367 ? 38.931 100.581 40.391  1.00 29.92 ? 367 GLY C O   1 
ATOM   10452 N  N   . PRO C 1 368 ? 40.077 101.119 38.546  1.00 28.71 ? 368 PRO C N   1 
ATOM   10453 C  CA  . PRO C 1 368 ? 38.890 101.578 37.838  1.00 28.09 ? 368 PRO C CA  1 
ATOM   10454 C  C   . PRO C 1 368 ? 37.712 100.637 38.056  1.00 28.08 ? 368 PRO C C   1 
ATOM   10455 O  O   . PRO C 1 368 ? 36.654 101.056 38.514  1.00 28.25 ? 368 PRO C O   1 
ATOM   10456 C  CB  . PRO C 1 368 ? 39.362 101.606 36.400  1.00 28.28 ? 368 PRO C CB  1 
ATOM   10457 C  CG  . PRO C 1 368 ? 40.767 102.104 36.565  1.00 28.92 ? 368 PRO C CG  1 
ATOM   10458 C  CD  . PRO C 1 368 ? 41.278 101.265 37.710  1.00 28.85 ? 368 PRO C CD  1 
ATOM   10459 N  N   . ASN C 1 369 ? 37.916 99.358  37.762  1.00 27.72 ? 369 ASN C N   1 
ATOM   10460 C  CA  . ASN C 1 369 ? 36.864 98.362  37.906  1.00 27.81 ? 369 ASN C CA  1 
ATOM   10461 C  C   . ASN C 1 369 ? 36.798 97.670  39.276  1.00 28.63 ? 369 ASN C C   1 
ATOM   10462 O  O   . ASN C 1 369 ? 36.500 96.477  39.361  1.00 29.26 ? 369 ASN C O   1 
ATOM   10463 C  CB  . ASN C 1 369 ? 37.009 97.325  36.790  1.00 26.34 ? 369 ASN C CB  1 
ATOM   10464 C  CG  . ASN C 1 369 ? 36.742 97.922  35.410  1.00 27.28 ? 369 ASN C CG  1 
ATOM   10465 O  OD1 . ASN C 1 369 ? 35.694 98.526  35.184  1.00 26.71 ? 369 ASN C OD1 1 
ATOM   10466 N  ND2 . ASN C 1 369 ? 37.685 97.759  34.487  1.00 25.22 ? 369 ASN C ND2 1 
ATOM   10467 N  N   . TYR C 1 370 ? 37.043 98.418  40.349  1.00 28.35 ? 370 TYR C N   1 
ATOM   10468 C  CA  . TYR C 1 370 ? 37.008 97.843  41.693  1.00 28.75 ? 370 TYR C CA  1 
ATOM   10469 C  C   . TYR C 1 370 ? 35.640 97.286  42.054  1.00 30.08 ? 370 TYR C C   1 
ATOM   10470 O  O   . TYR C 1 370 ? 35.494 96.545  43.024  1.00 31.06 ? 370 TYR C O   1 
ATOM   10471 C  CB  . TYR C 1 370 ? 37.423 98.891  42.733  1.00 27.46 ? 370 TYR C CB  1 
ATOM   10472 C  CG  . TYR C 1 370 ? 36.376 99.937  43.054  1.00 26.06 ? 370 TYR C CG  1 
ATOM   10473 C  CD1 . TYR C 1 370 ? 35.593 99.831  44.198  1.00 25.04 ? 370 TYR C CD1 1 
ATOM   10474 C  CD2 . TYR C 1 370 ? 36.190 101.049 42.230  1.00 25.30 ? 370 TYR C CD2 1 
ATOM   10475 C  CE1 . TYR C 1 370 ? 34.661 100.799 44.522  1.00 24.44 ? 370 TYR C CE1 1 
ATOM   10476 C  CE2 . TYR C 1 370 ? 35.255 102.025 42.543  1.00 24.37 ? 370 TYR C CE2 1 
ATOM   10477 C  CZ  . TYR C 1 370 ? 34.493 101.894 43.696  1.00 24.05 ? 370 TYR C CZ  1 
ATOM   10478 O  OH  . TYR C 1 370 ? 33.562 102.854 44.030  1.00 23.27 ? 370 TYR C OH  1 
ATOM   10479 N  N   . LEU C 1 371 ? 34.631 97.638  41.271  1.00 31.39 ? 371 LEU C N   1 
ATOM   10480 C  CA  . LEU C 1 371 ? 33.291 97.153  41.544  1.00 32.86 ? 371 LEU C CA  1 
ATOM   10481 C  C   . LEU C 1 371 ? 33.082 95.716  41.101  1.00 34.59 ? 371 LEU C C   1 
ATOM   10482 O  O   . LEU C 1 371 ? 32.064 95.119  41.438  1.00 35.51 ? 371 LEU C O   1 
ATOM   10483 C  CB  . LEU C 1 371 ? 32.248 98.055  40.890  1.00 31.34 ? 371 LEU C CB  1 
ATOM   10484 C  CG  . LEU C 1 371 ? 31.937 99.333  41.663  1.00 30.22 ? 371 LEU C CG  1 
ATOM   10485 C  CD1 . LEU C 1 371 ? 30.868 100.107 40.915  1.00 27.63 ? 371 LEU C CD1 1 
ATOM   10486 C  CD2 . LEU C 1 371 ? 31.484 98.990  43.094  1.00 28.03 ? 371 LEU C CD2 1 
ATOM   10487 N  N   . HIS C 1 372 ? 34.044 95.165  40.358  1.00 36.09 ? 372 HIS C N   1 
ATOM   10488 C  CA  . HIS C 1 372 ? 33.980 93.776  39.887  1.00 37.04 ? 372 HIS C CA  1 
ATOM   10489 C  C   . HIS C 1 372 ? 34.512 92.828  40.964  1.00 36.98 ? 372 HIS C C   1 
ATOM   10490 O  O   . HIS C 1 372 ? 34.224 91.633  40.966  1.00 37.42 ? 372 HIS C O   1 
ATOM   10491 C  CB  . HIS C 1 372 ? 34.821 93.579  38.620  1.00 38.90 ? 372 HIS C CB  1 
ATOM   10492 C  CG  . HIS C 1 372 ? 34.313 94.322  37.422  1.00 41.96 ? 372 HIS C CG  1 
ATOM   10493 N  ND1 . HIS C 1 372 ? 33.117 95.012  37.419  1.00 42.36 ? 372 HIS C ND1 1 
ATOM   10494 C  CD2 . HIS C 1 372 ? 34.842 94.474  36.181  1.00 43.22 ? 372 HIS C CD2 1 
ATOM   10495 C  CE1 . HIS C 1 372 ? 32.933 95.559  36.228  1.00 43.27 ? 372 HIS C CE1 1 
ATOM   10496 N  NE2 . HIS C 1 372 ? 33.964 95.247  35.458  1.00 44.17 ? 372 HIS C NE2 1 
ATOM   10497 N  N   . ILE C 1 373 ? 35.328 93.348  41.865  1.00 37.08 ? 373 ILE C N   1 
ATOM   10498 C  CA  . ILE C 1 373 ? 35.843 92.511  42.926  1.00 36.50 ? 373 ILE C CA  1 
ATOM   10499 C  C   . ILE C 1 373 ? 34.586 91.938  43.597  1.00 36.53 ? 373 ILE C C   1 
ATOM   10500 O  O   . ILE C 1 373 ? 33.677 92.674  43.979  1.00 35.76 ? 373 ILE C O   1 
ATOM   10501 C  CB  . ILE C 1 373 ? 36.659 93.343  43.926  1.00 36.35 ? 373 ILE C CB  1 
ATOM   10502 C  CG1 . ILE C 1 373 ? 37.830 94.021  43.210  1.00 36.13 ? 373 ILE C CG1 1 
ATOM   10503 C  CG2 . ILE C 1 373 ? 37.156 92.461  45.047  1.00 36.08 ? 373 ILE C CG2 1 
ATOM   10504 C  CD1 . ILE C 1 373 ? 38.659 94.937  44.101  1.00 34.44 ? 373 ILE C CD1 1 
ATOM   10505 N  N   . PRO C 1 374 ? 34.512 90.608  43.721  1.00 36.45 ? 374 PRO C N   1 
ATOM   10506 C  CA  . PRO C 1 374 ? 33.376 89.908  44.333  1.00 36.26 ? 374 PRO C CA  1 
ATOM   10507 C  C   . PRO C 1 374 ? 32.606 90.582  45.490  1.00 36.54 ? 374 PRO C C   1 
ATOM   10508 O  O   . PRO C 1 374 ? 31.392 90.741  45.385  1.00 36.60 ? 374 PRO C O   1 
ATOM   10509 C  CB  . PRO C 1 374 ? 33.987 88.575  44.737  1.00 35.56 ? 374 PRO C CB  1 
ATOM   10510 C  CG  . PRO C 1 374 ? 34.933 88.318  43.582  1.00 35.99 ? 374 PRO C CG  1 
ATOM   10511 C  CD  . PRO C 1 374 ? 35.581 89.664  43.342  1.00 35.45 ? 374 PRO C CD  1 
ATOM   10512 N  N   . VAL C 1 375 ? 33.282 90.968  46.580  1.00 36.40 ? 375 VAL C N   1 
ATOM   10513 C  CA  . VAL C 1 375 ? 32.595 91.587  47.726  1.00 35.91 ? 375 VAL C CA  1 
ATOM   10514 C  C   . VAL C 1 375 ? 32.054 92.978  47.480  1.00 36.04 ? 375 VAL C C   1 
ATOM   10515 O  O   . VAL C 1 375 ? 31.326 93.522  48.312  1.00 35.19 ? 375 VAL C O   1 
ATOM   10516 C  CB  . VAL C 1 375 ? 33.489 91.688  48.985  1.00 36.52 ? 375 VAL C CB  1 
ATOM   10517 C  CG1 . VAL C 1 375 ? 33.807 90.311  49.502  1.00 37.53 ? 375 VAL C CG1 1 
ATOM   10518 C  CG2 . VAL C 1 375 ? 34.762 92.468  48.676  1.00 36.68 ? 375 VAL C CG2 1 
ATOM   10519 N  N   . ASN C 1 376 ? 32.422 93.565  46.350  1.00 36.24 ? 376 ASN C N   1 
ATOM   10520 C  CA  . ASN C 1 376 ? 31.952 94.899  46.014  1.00 36.14 ? 376 ASN C CA  1 
ATOM   10521 C  C   . ASN C 1 376 ? 30.824 94.819  44.986  1.00 36.62 ? 376 ASN C C   1 
ATOM   10522 O  O   . ASN C 1 376 ? 29.975 95.709  44.904  1.00 36.85 ? 376 ASN C O   1 
ATOM   10523 C  CB  . ASN C 1 376 ? 33.114 95.745  45.486  1.00 35.36 ? 376 ASN C CB  1 
ATOM   10524 C  CG  . ASN C 1 376 ? 34.156 96.034  46.559  1.00 34.73 ? 376 ASN C CG  1 
ATOM   10525 O  OD1 . ASN C 1 376 ? 33.836 96.063  47.751  1.00 35.14 ? 376 ASN C OD1 1 
ATOM   10526 N  ND2 . ASN C 1 376 ? 35.401 96.270  46.142  1.00 33.63 ? 376 ASN C ND2 1 
ATOM   10527 N  N   . CYS C 1 377 ? 30.811 93.727  44.230  1.00 37.19 ? 377 CYS C N   1 
ATOM   10528 C  CA  . CYS C 1 377 ? 29.812 93.477  43.197  1.00 37.98 ? 377 CYS C CA  1 
ATOM   10529 C  C   . CYS C 1 377 ? 28.403 93.469  43.786  1.00 37.84 ? 377 CYS C C   1 
ATOM   10530 O  O   . CYS C 1 377 ? 28.166 92.886  44.840  1.00 37.73 ? 377 CYS C O   1 
ATOM   10531 C  CB  . CYS C 1 377 ? 30.099 92.125  42.527  1.00 38.42 ? 377 CYS C CB  1 
ATOM   10532 S  SG  . CYS C 1 377 ? 29.420 91.898  40.859  1.00 44.08 ? 377 CYS C SG  1 
ATOM   10533 N  N   . PRO C 1 378 ? 27.459 94.169  43.139  1.00 37.84 ? 378 PRO C N   1 
ATOM   10534 C  CA  . PRO C 1 378 ? 26.076 94.199  43.628  1.00 37.91 ? 378 PRO C CA  1 
ATOM   10535 C  C   . PRO C 1 378 ? 25.416 92.953  43.028  1.00 38.58 ? 378 PRO C C   1 
ATOM   10536 O  O   . PRO C 1 378 ? 24.619 93.021  42.089  1.00 37.85 ? 378 PRO C O   1 
ATOM   10537 C  CB  . PRO C 1 378 ? 25.545 95.503  43.048  1.00 37.85 ? 378 PRO C CB  1 
ATOM   10538 C  CG  . PRO C 1 378 ? 26.273 95.603  41.749  1.00 36.64 ? 378 PRO C CG  1 
ATOM   10539 C  CD  . PRO C 1 378 ? 27.678 95.204  42.111  1.00 36.55 ? 378 PRO C CD  1 
ATOM   10540 N  N   . TYR C 1 379 ? 25.788 91.806  43.585  1.00 39.56 ? 379 TYR C N   1 
ATOM   10541 C  CA  . TYR C 1 379 ? 25.328 90.512  43.106  1.00 39.83 ? 379 TYR C CA  1 
ATOM   10542 C  C   . TYR C 1 379 ? 23.842 90.207  43.255  1.00 41.02 ? 379 TYR C C   1 
ATOM   10543 O  O   . TYR C 1 379 ? 23.344 89.283  42.620  1.00 41.30 ? 379 TYR C O   1 
ATOM   10544 C  CB  . TYR C 1 379 ? 26.165 89.408  43.760  1.00 38.43 ? 379 TYR C CB  1 
ATOM   10545 C  CG  . TYR C 1 379 ? 25.810 89.092  45.197  1.00 37.74 ? 379 TYR C CG  1 
ATOM   10546 C  CD1 . TYR C 1 379 ? 24.749 88.245  45.502  1.00 36.93 ? 379 TYR C CD1 1 
ATOM   10547 C  CD2 . TYR C 1 379 ? 26.554 89.618  46.251  1.00 37.74 ? 379 TYR C CD2 1 
ATOM   10548 C  CE1 . TYR C 1 379 ? 24.439 87.926  46.817  1.00 37.42 ? 379 TYR C CE1 1 
ATOM   10549 C  CE2 . TYR C 1 379 ? 26.253 89.306  47.575  1.00 37.09 ? 379 TYR C CE2 1 
ATOM   10550 C  CZ  . TYR C 1 379 ? 25.197 88.458  47.851  1.00 37.59 ? 379 TYR C CZ  1 
ATOM   10551 O  OH  . TYR C 1 379 ? 24.910 88.118  49.155  1.00 38.33 ? 379 TYR C OH  1 
ATOM   10552 N  N   . ARG C 1 380 ? 23.136 90.959  44.092  1.00 41.83 ? 380 ARG C N   1 
ATOM   10553 C  CA  . ARG C 1 380 ? 21.705 90.736  44.265  1.00 42.78 ? 380 ARG C CA  1 
ATOM   10554 C  C   . ARG C 1 380 ? 20.966 91.656  43.304  1.00 42.63 ? 380 ARG C C   1 
ATOM   10555 O  O   . ARG C 1 380 ? 19.749 91.621  43.212  1.00 42.93 ? 380 ARG C O   1 
ATOM   10556 C  CB  . ARG C 1 380 ? 21.269 91.043  45.698  1.00 44.88 ? 380 ARG C CB  1 
ATOM   10557 C  CG  . ARG C 1 380 ? 21.802 90.085  46.770  1.00 48.03 ? 380 ARG C CG  1 
ATOM   10558 C  CD  . ARG C 1 380 ? 21.065 88.741  46.800  1.00 50.94 ? 380 ARG C CD  1 
ATOM   10559 N  NE  . ARG C 1 380 ? 19.612 88.894  46.899  1.00 54.22 ? 380 ARG C NE  1 
ATOM   10560 C  CZ  . ARG C 1 380 ? 18.991 89.739  47.726  1.00 55.53 ? 380 ARG C CZ  1 
ATOM   10561 N  NH1 . ARG C 1 380 ? 19.690 90.522  48.543  1.00 55.43 ? 380 ARG C NH1 1 
ATOM   10562 N  NH2 . ARG C 1 380 ? 17.660 89.820  47.722  1.00 56.04 ? 380 ARG C NH2 1 
ATOM   10563 N  N   . ALA C 1 381 ? 21.714 92.487  42.592  1.00 42.58 ? 381 ALA C N   1 
ATOM   10564 C  CA  . ALA C 1 381 ? 21.123 93.411  41.640  1.00 42.61 ? 381 ALA C CA  1 
ATOM   10565 C  C   . ALA C 1 381 ? 21.516 93.007  40.224  1.00 43.09 ? 381 ALA C C   1 
ATOM   10566 O  O   . ALA C 1 381 ? 22.327 92.102  40.028  1.00 43.25 ? 381 ALA C O   1 
ATOM   10567 C  CB  . ALA C 1 381 ? 21.587 94.823  41.934  1.00 42.26 ? 381 ALA C CB  1 
ATOM   10568 N  N   . ARG C 1 382 ? 20.935 93.678  39.238  1.00 44.01 ? 382 ARG C N   1 
ATOM   10569 C  CA  . ARG C 1 382 ? 21.217 93.381  37.838  1.00 45.29 ? 382 ARG C CA  1 
ATOM   10570 C  C   . ARG C 1 382 ? 21.842 94.607  37.166  1.00 44.20 ? 382 ARG C C   1 
ATOM   10571 O  O   . ARG C 1 382 ? 21.132 95.497  36.686  1.00 44.58 ? 382 ARG C O   1 
ATOM   10572 C  CB  . ARG C 1 382 ? 19.913 92.975  37.149  1.00 48.26 ? 382 ARG C CB  1 
ATOM   10573 C  CG  . ARG C 1 382 ? 19.938 92.960  35.622  1.00 53.32 ? 382 ARG C CG  1 
ATOM   10574 C  CD  . ARG C 1 382 ? 20.999 92.032  35.042  1.00 56.81 ? 382 ARG C CD  1 
ATOM   10575 N  NE  . ARG C 1 382 ? 20.571 91.490  33.749  1.00 60.74 ? 382 ARG C NE  1 
ATOM   10576 C  CZ  . ARG C 1 382 ? 19.585 90.599  33.595  1.00 62.31 ? 382 ARG C CZ  1 
ATOM   10577 N  NH1 . ARG C 1 382 ? 18.916 90.139  34.655  1.00 62.38 ? 382 ARG C NH1 1 
ATOM   10578 N  NH2 . ARG C 1 382 ? 19.266 90.161  32.376  1.00 62.78 ? 382 ARG C NH2 1 
ATOM   10579 N  N   . VAL C 1 383 ? 23.172 94.645  37.143  1.00 42.21 ? 383 VAL C N   1 
ATOM   10580 C  CA  . VAL C 1 383 ? 23.907 95.763  36.567  1.00 40.66 ? 383 VAL C CA  1 
ATOM   10581 C  C   . VAL C 1 383 ? 23.876 95.806  35.050  1.00 40.22 ? 383 VAL C C   1 
ATOM   10582 O  O   . VAL C 1 383 ? 24.336 94.879  34.378  1.00 39.88 ? 383 VAL C O   1 
ATOM   10583 C  CB  . VAL C 1 383 ? 25.383 95.748  37.019  1.00 40.28 ? 383 VAL C CB  1 
ATOM   10584 C  CG1 . VAL C 1 383 ? 26.141 96.884  36.375  1.00 39.23 ? 383 VAL C CG1 1 
ATOM   10585 C  CG2 . VAL C 1 383 ? 25.454 95.885  38.530  1.00 40.86 ? 383 VAL C CG2 1 
ATOM   10586 N  N   . ALA C 1 384 ? 23.347 96.903  34.518  1.00 38.93 ? 384 ALA C N   1 
ATOM   10587 C  CA  . ALA C 1 384 ? 23.261 97.091  33.075  1.00 37.53 ? 384 ALA C CA  1 
ATOM   10588 C  C   . ALA C 1 384 ? 23.383 98.578  32.754  1.00 36.36 ? 384 ALA C C   1 
ATOM   10589 O  O   . ALA C 1 384 ? 22.644 99.403  33.292  1.00 36.47 ? 384 ALA C O   1 
ATOM   10590 C  CB  . ALA C 1 384 ? 21.934 96.549  32.562  1.00 38.21 ? 384 ALA C CB  1 
ATOM   10591 N  N   . ASN C 1 385 ? 24.323 98.926  31.885  1.00 34.77 ? 385 ASN C N   1 
ATOM   10592 C  CA  . ASN C 1 385 ? 24.502 100.319 31.529  1.00 33.51 ? 385 ASN C CA  1 
ATOM   10593 C  C   . ASN C 1 385 ? 25.345 100.524 30.279  1.00 33.30 ? 385 ASN C C   1 
ATOM   10594 O  O   . ASN C 1 385 ? 25.441 99.629  29.440  1.00 33.47 ? 385 ASN C O   1 
ATOM   10595 C  CB  . ASN C 1 385 ? 25.092 101.092 32.708  1.00 32.32 ? 385 ASN C CB  1 
ATOM   10596 C  CG  . ASN C 1 385 ? 26.347 100.466 33.246  1.00 31.54 ? 385 ASN C CG  1 
ATOM   10597 O  OD1 . ASN C 1 385 ? 27.265 100.151 32.500  1.00 30.70 ? 385 ASN C OD1 1 
ATOM   10598 N  ND2 . ASN C 1 385 ? 26.398 100.289 34.557  1.00 32.17 ? 385 ASN C ND2 1 
ATOM   10599 N  N   . TYR C 1 386 ? 25.937 101.709 30.148  1.00 33.42 ? 386 TYR C N   1 
ATOM   10600 C  CA  . TYR C 1 386 ? 26.747 102.034 28.979  1.00 33.28 ? 386 TYR C CA  1 
ATOM   10601 C  C   . TYR C 1 386 ? 28.223 102.259 29.262  1.00 32.76 ? 386 TYR C C   1 
ATOM   10602 O  O   . TYR C 1 386 ? 28.962 102.796 28.428  1.00 33.38 ? 386 TYR C O   1 
ATOM   10603 C  CB  . TYR C 1 386 ? 26.147 103.242 28.268  1.00 33.71 ? 386 TYR C CB  1 
ATOM   10604 C  CG  . TYR C 1 386 ? 24.762 102.939 27.776  1.00 34.64 ? 386 TYR C CG  1 
ATOM   10605 C  CD1 . TYR C 1 386 ? 23.657 103.072 28.616  1.00 34.49 ? 386 TYR C CD1 1 
ATOM   10606 C  CD2 . TYR C 1 386 ? 24.566 102.395 26.506  1.00 35.46 ? 386 TYR C CD2 1 
ATOM   10607 C  CE1 . TYR C 1 386 ? 22.393 102.658 28.203  1.00 35.11 ? 386 TYR C CE1 1 
ATOM   10608 C  CE2 . TYR C 1 386 ? 23.310 101.978 26.085  1.00 35.07 ? 386 TYR C CE2 1 
ATOM   10609 C  CZ  . TYR C 1 386 ? 22.230 102.107 26.936  1.00 35.09 ? 386 TYR C CZ  1 
ATOM   10610 O  OH  . TYR C 1 386 ? 20.996 101.649 26.525  1.00 36.99 ? 386 TYR C OH  1 
ATOM   10611 N  N   . GLN C 1 387 ? 28.643 101.838 30.448  1.00 31.66 ? 387 GLN C N   1 
ATOM   10612 C  CA  . GLN C 1 387 ? 30.033 101.938 30.869  1.00 30.48 ? 387 GLN C CA  1 
ATOM   10613 C  C   . GLN C 1 387 ? 30.741 100.705 30.293  1.00 30.22 ? 387 GLN C C   1 
ATOM   10614 O  O   . GLN C 1 387 ? 30.159 99.614  30.265  1.00 29.31 ? 387 GLN C O   1 
ATOM   10615 C  CB  . GLN C 1 387 ? 30.105 101.948 32.408  1.00 29.22 ? 387 GLN C CB  1 
ATOM   10616 C  CG  . GLN C 1 387 ? 29.408 103.158 33.031  1.00 28.19 ? 387 GLN C CG  1 
ATOM   10617 C  CD  . GLN C 1 387 ? 29.438 103.184 34.557  1.00 28.25 ? 387 GLN C CD  1 
ATOM   10618 O  OE1 . GLN C 1 387 ? 30.362 102.666 35.191  1.00 29.17 ? 387 GLN C OE1 1 
ATOM   10619 N  NE2 . GLN C 1 387 ? 28.432 103.815 35.153  1.00 27.85 ? 387 GLN C NE2 1 
ATOM   10620 N  N   . ARG C 1 388 ? 31.972 100.885 29.815  1.00 30.77 ? 388 ARG C N   1 
ATOM   10621 C  CA  . ARG C 1 388 ? 32.749 99.782  29.240  1.00 31.15 ? 388 ARG C CA  1 
ATOM   10622 C  C   . ARG C 1 388 ? 34.244 99.869  29.541  1.00 31.11 ? 388 ARG C C   1 
ATOM   10623 O  O   . ARG C 1 388 ? 34.735 100.837 30.126  1.00 31.47 ? 388 ARG C O   1 
ATOM   10624 C  CB  . ARG C 1 388 ? 32.576 99.720  27.705  1.00 31.76 ? 388 ARG C CB  1 
ATOM   10625 C  CG  . ARG C 1 388 ? 31.143 99.544  27.192  1.00 32.93 ? 388 ARG C CG  1 
ATOM   10626 C  CD  . ARG C 1 388 ? 30.429 98.351  27.846  1.00 35.52 ? 388 ARG C CD  1 
ATOM   10627 N  NE  . ARG C 1 388 ? 28.972 98.513  27.839  1.00 36.26 ? 388 ARG C NE  1 
ATOM   10628 C  CZ  . ARG C 1 388 ? 28.206 98.148  26.819  1.00 37.77 ? 388 ARG C CZ  1 
ATOM   10629 N  NH1 . ARG C 1 388 ? 28.762 97.599  25.751  1.00 38.36 ? 388 ARG C NH1 1 
ATOM   10630 N  NH2 . ARG C 1 388 ? 26.897 98.346  26.849  1.00 39.02 ? 388 ARG C NH2 1 
ATOM   10631 N  N   . ASP C 1 389 ? 34.950 98.823  29.137  1.00 31.37 ? 389 ASP C N   1 
ATOM   10632 C  CA  . ASP C 1 389 ? 36.397 98.709  29.265  1.00 31.29 ? 389 ASP C CA  1 
ATOM   10633 C  C   . ASP C 1 389 ? 37.042 99.043  30.600  1.00 31.90 ? 389 ASP C C   1 
ATOM   10634 O  O   . ASP C 1 389 ? 36.494 98.736  31.662  1.00 32.50 ? 389 ASP C O   1 
ATOM   10635 C  CB  . ASP C 1 389 ? 37.042 99.503  28.132  1.00 31.19 ? 389 ASP C CB  1 
ATOM   10636 C  CG  . ASP C 1 389 ? 36.476 99.109  26.759  1.00 33.75 ? 389 ASP C CG  1 
ATOM   10637 O  OD1 . ASP C 1 389 ? 36.749 99.811  25.753  1.00 33.88 ? 389 ASP C OD1 1 
ATOM   10638 O  OD2 . ASP C 1 389 ? 35.749 98.082  26.684  1.00 33.25 ? 389 ASP C OD2 1 
ATOM   10639 N  N   . GLY C 1 390 ? 38.227 99.648  30.538  1.00 32.63 ? 390 GLY C N   1 
ATOM   10640 C  CA  . GLY C 1 390 ? 38.983 99.975  31.740  1.00 32.68 ? 390 GLY C CA  1 
ATOM   10641 C  C   . GLY C 1 390 ? 39.929 98.831  32.095  1.00 33.15 ? 390 GLY C C   1 
ATOM   10642 O  O   . GLY C 1 390 ? 39.713 97.709  31.646  1.00 32.53 ? 390 GLY C O   1 
ATOM   10643 N  N   . PRO C 1 391 ? 40.985 99.062  32.894  1.00 34.36 ? 391 PRO C N   1 
ATOM   10644 C  CA  . PRO C 1 391 ? 41.887 97.950  33.228  1.00 35.19 ? 391 PRO C CA  1 
ATOM   10645 C  C   . PRO C 1 391 ? 41.224 96.836  34.027  1.00 35.98 ? 391 PRO C C   1 
ATOM   10646 O  O   . PRO C 1 391 ? 40.240 97.060  34.738  1.00 35.73 ? 391 PRO C O   1 
ATOM   10647 C  CB  . PRO C 1 391 ? 43.008 98.633  34.005  1.00 34.57 ? 391 PRO C CB  1 
ATOM   10648 C  CG  . PRO C 1 391 ? 42.300 99.769  34.668  1.00 34.69 ? 391 PRO C CG  1 
ATOM   10649 C  CD  . PRO C 1 391 ? 41.413 100.300 33.566  1.00 34.23 ? 391 PRO C CD  1 
ATOM   10650 N  N   . MET C 1 392 ? 41.775 95.633  33.899  1.00 38.01 ? 392 MET C N   1 
ATOM   10651 C  CA  . MET C 1 392 ? 41.258 94.457  34.595  1.00 39.76 ? 392 MET C CA  1 
ATOM   10652 C  C   . MET C 1 392 ? 39.748 94.289  34.462  1.00 41.50 ? 392 MET C C   1 
ATOM   10653 O  O   . MET C 1 392 ? 39.061 94.100  35.472  1.00 41.58 ? 392 MET C O   1 
ATOM   10654 C  CB  . MET C 1 392 ? 41.612 94.511  36.086  1.00 39.58 ? 392 MET C CB  1 
ATOM   10655 C  CG  . MET C 1 392 ? 43.095 94.457  36.391  1.00 39.07 ? 392 MET C CG  1 
ATOM   10656 S  SD  . MET C 1 392 ? 43.891 92.985  35.707  1.00 39.95 ? 392 MET C SD  1 
ATOM   10657 C  CE  . MET C 1 392 ? 43.230 91.687  36.752  1.00 38.87 ? 392 MET C CE  1 
ATOM   10658 N  N   . CYS C 1 393 ? 39.230 94.369  33.233  1.00 43.52 ? 393 CYS C N   1 
ATOM   10659 C  CA  . CYS C 1 393 ? 37.795 94.188  33.006  1.00 45.14 ? 393 CYS C CA  1 
ATOM   10660 C  C   . CYS C 1 393 ? 37.598 92.693  33.163  1.00 47.13 ? 393 CYS C C   1 
ATOM   10661 O  O   . CYS C 1 393 ? 38.071 91.911  32.336  1.00 47.08 ? 393 CYS C O   1 
ATOM   10662 C  CB  . CYS C 1 393 ? 37.386 94.616  31.590  1.00 44.72 ? 393 CYS C CB  1 
ATOM   10663 S  SG  . CYS C 1 393 ? 35.585 94.610  31.313  1.00 43.17 ? 393 CYS C SG  1 
ATOM   10664 N  N   . MET C 1 394 ? 36.901 92.302  34.226  1.00 49.71 ? 394 MET C N   1 
ATOM   10665 C  CA  . MET C 1 394 ? 36.688 90.888  34.527  1.00 51.64 ? 394 MET C CA  1 
ATOM   10666 C  C   . MET C 1 394 ? 35.507 90.201  33.868  1.00 52.72 ? 394 MET C C   1 
ATOM   10667 O  O   . MET C 1 394 ? 35.625 89.064  33.411  1.00 53.71 ? 394 MET C O   1 
ATOM   10668 C  CB  . MET C 1 394 ? 36.584 90.698  36.039  1.00 52.10 ? 394 MET C CB  1 
ATOM   10669 C  CG  . MET C 1 394 ? 37.840 91.085  36.778  1.00 52.49 ? 394 MET C CG  1 
ATOM   10670 S  SD  . MET C 1 394 ? 39.242 90.155  36.141  1.00 54.72 ? 394 MET C SD  1 
ATOM   10671 C  CE  . MET C 1 394 ? 40.334 91.448  35.637  1.00 53.54 ? 394 MET C CE  1 
ATOM   10672 N  N   . GLN C 1 395 ? 34.365 90.865  33.824  1.00 53.21 ? 395 GLN C N   1 
ATOM   10673 C  CA  . GLN C 1 395 ? 33.209 90.228  33.225  1.00 54.47 ? 395 GLN C CA  1 
ATOM   10674 C  C   . GLN C 1 395 ? 33.324 90.112  31.706  1.00 53.42 ? 395 GLN C C   1 
ATOM   10675 O  O   . GLN C 1 395 ? 34.417 90.208  31.144  1.00 53.05 ? 395 GLN C O   1 
ATOM   10676 C  CB  . GLN C 1 395 ? 31.933 90.989  33.608  1.00 57.14 ? 395 GLN C CB  1 
ATOM   10677 C  CG  . GLN C 1 395 ? 31.328 90.572  34.962  1.00 60.03 ? 395 GLN C CG  1 
ATOM   10678 C  CD  . GLN C 1 395 ? 31.700 91.507  36.109  1.00 61.32 ? 395 GLN C CD  1 
ATOM   10679 O  OE1 . GLN C 1 395 ? 31.483 92.722  36.033  1.00 61.74 ? 395 GLN C OE1 1 
ATOM   10680 N  NE2 . GLN C 1 395 ? 32.249 90.939  37.187  1.00 61.83 ? 395 GLN C NE2 1 
ATOM   10681 N  N   . ASP C 1 396 ? 32.185 89.881  31.061  1.00 52.02 ? 396 ASP C N   1 
ATOM   10682 C  CA  . ASP C 1 396 ? 32.099 89.772  29.607  1.00 50.66 ? 396 ASP C CA  1 
ATOM   10683 C  C   . ASP C 1 396 ? 32.096 91.186  28.993  1.00 49.32 ? 396 ASP C C   1 
ATOM   10684 O  O   . ASP C 1 396 ? 32.013 91.343  27.772  1.00 49.04 ? 396 ASP C O   1 
ATOM   10685 C  CB  . ASP C 1 396 ? 30.807 89.030  29.233  1.00 51.56 ? 396 ASP C CB  1 
ATOM   10686 C  CG  . ASP C 1 396 ? 29.544 89.766  29.702  1.00 52.46 ? 396 ASP C CG  1 
ATOM   10687 O  OD1 . ASP C 1 396 ? 29.559 90.376  30.801  1.00 52.53 ? 396 ASP C OD1 1 
ATOM   10688 O  OD2 . ASP C 1 396 ? 28.525 89.721  28.971  1.00 53.32 ? 396 ASP C OD2 1 
ATOM   10689 N  N   . ASN C 1 397 ? 32.189 92.203  29.855  1.00 47.30 ? 397 ASN C N   1 
ATOM   10690 C  CA  . ASN C 1 397 ? 32.192 93.608  29.445  1.00 45.11 ? 397 ASN C CA  1 
ATOM   10691 C  C   . ASN C 1 397 ? 30.870 93.935  28.759  1.00 44.62 ? 397 ASN C C   1 
ATOM   10692 O  O   . ASN C 1 397 ? 30.807 94.784  27.866  1.00 44.60 ? 397 ASN C O   1 
ATOM   10693 C  CB  . ASN C 1 397 ? 33.376 93.891  28.505  1.00 44.31 ? 397 ASN C CB  1 
ATOM   10694 C  CG  . ASN C 1 397 ? 33.769 95.369  28.470  1.00 43.06 ? 397 ASN C CG  1 
ATOM   10695 O  OD1 . ASN C 1 397 ? 33.525 96.115  29.424  1.00 42.09 ? 397 ASN C OD1 1 
ATOM   10696 N  ND2 . ASN C 1 397 ? 34.402 95.791  27.374  1.00 41.90 ? 397 ASN C ND2 1 
ATOM   10697 N  N   . GLN C 1 398 ? 29.816 93.249  29.198  1.00 43.45 ? 398 GLN C N   1 
ATOM   10698 C  CA  . GLN C 1 398 ? 28.474 93.425  28.661  1.00 42.03 ? 398 GLN C CA  1 
ATOM   10699 C  C   . GLN C 1 398 ? 28.411 93.130  27.159  1.00 41.32 ? 398 GLN C C   1 
ATOM   10700 O  O   . GLN C 1 398 ? 27.658 93.753  26.411  1.00 41.25 ? 398 GLN C O   1 
ATOM   10701 C  CB  . GLN C 1 398 ? 27.951 94.833  29.003  1.00 41.49 ? 398 GLN C CB  1 
ATOM   10702 C  CG  . GLN C 1 398 ? 27.928 95.066  30.526  1.00 42.33 ? 398 GLN C CG  1 
ATOM   10703 C  CD  . GLN C 1 398 ? 27.289 96.380  30.972  1.00 42.10 ? 398 GLN C CD  1 
ATOM   10704 O  OE1 . GLN C 1 398 ? 26.070 96.549  30.912  1.00 41.70 ? 398 GLN C OE1 1 
ATOM   10705 N  NE2 . GLN C 1 398 ? 28.119 97.313  31.437  1.00 42.58 ? 398 GLN C NE2 1 
ATOM   10706 N  N   . GLY C 1 399 ? 29.223 92.159  26.749  1.00 40.45 ? 399 GLY C N   1 
ATOM   10707 C  CA  . GLY C 1 399 ? 29.284 91.687  25.374  1.00 39.58 ? 399 GLY C CA  1 
ATOM   10708 C  C   . GLY C 1 399 ? 29.222 92.651  24.209  1.00 38.89 ? 399 GLY C C   1 
ATOM   10709 O  O   . GLY C 1 399 ? 30.004 93.590  24.126  1.00 39.93 ? 399 GLY C O   1 
ATOM   10710 N  N   . GLY C 1 400 ? 28.302 92.400  23.286  1.00 38.27 ? 400 GLY C N   1 
ATOM   10711 C  CA  . GLY C 1 400 ? 28.170 93.265  22.129  1.00 37.45 ? 400 GLY C CA  1 
ATOM   10712 C  C   . GLY C 1 400 ? 27.022 94.258  22.223  1.00 37.04 ? 400 GLY C C   1 
ATOM   10713 O  O   . GLY C 1 400 ? 26.740 94.981  21.264  1.00 37.31 ? 400 GLY C O   1 
ATOM   10714 N  N   . ALA C 1 401 ? 26.358 94.300  23.374  1.00 36.19 ? 401 ALA C N   1 
ATOM   10715 C  CA  . ALA C 1 401 ? 25.245 95.215  23.580  1.00 35.94 ? 401 ALA C CA  1 
ATOM   10716 C  C   . ALA C 1 401 ? 25.635 96.630  23.128  1.00 35.74 ? 401 ALA C C   1 
ATOM   10717 O  O   . ALA C 1 401 ? 26.795 97.025  23.255  1.00 35.65 ? 401 ALA C O   1 
ATOM   10718 C  CB  . ALA C 1 401 ? 24.857 95.216  25.050  1.00 35.11 ? 401 ALA C CB  1 
ATOM   10719 N  N   . PRO C 1 402 ? 24.669 97.410  22.600  1.00 35.73 ? 402 PRO C N   1 
ATOM   10720 C  CA  . PRO C 1 402 ? 24.939 98.784  22.135  1.00 35.41 ? 402 PRO C CA  1 
ATOM   10721 C  C   . PRO C 1 402 ? 25.496 99.597  23.291  1.00 34.79 ? 402 PRO C C   1 
ATOM   10722 O  O   . PRO C 1 402 ? 24.895 99.644  24.362  1.00 34.71 ? 402 PRO C O   1 
ATOM   10723 C  CB  . PRO C 1 402 ? 23.567 99.282  21.688  1.00 35.41 ? 402 PRO C CB  1 
ATOM   10724 C  CG  . PRO C 1 402 ? 22.813 98.012  21.366  1.00 35.92 ? 402 PRO C CG  1 
ATOM   10725 C  CD  . PRO C 1 402 ? 23.237 97.088  22.475  1.00 35.56 ? 402 PRO C CD  1 
ATOM   10726 N  N   . ASN C 1 403 ? 26.634 100.245 23.073  1.00 34.73 ? 403 ASN C N   1 
ATOM   10727 C  CA  . ASN C 1 403 ? 27.279 100.996 24.143  1.00 35.06 ? 403 ASN C CA  1 
ATOM   10728 C  C   . ASN C 1 403 ? 26.987 102.489 24.228  1.00 36.15 ? 403 ASN C C   1 
ATOM   10729 O  O   . ASN C 1 403 ? 27.645 103.207 24.989  1.00 36.77 ? 403 ASN C O   1 
ATOM   10730 C  CB  . ASN C 1 403 ? 28.792 100.773 24.079  1.00 33.00 ? 403 ASN C CB  1 
ATOM   10731 C  CG  . ASN C 1 403 ? 29.408 101.290 22.794  1.00 32.49 ? 403 ASN C CG  1 
ATOM   10732 O  OD1 . ASN C 1 403 ? 30.570 100.998 22.492  1.00 32.28 ? 403 ASN C OD1 1 
ATOM   10733 N  ND2 . ASN C 1 403 ? 28.643 102.066 22.035  1.00 30.33 ? 403 ASN C ND2 1 
ATOM   10734 N  N   . TYR C 1 404 ? 26.002 102.961 23.469  1.00 36.30 ? 404 TYR C N   1 
ATOM   10735 C  CA  . TYR C 1 404 ? 25.665 104.378 23.492  1.00 36.14 ? 404 TYR C CA  1 
ATOM   10736 C  C   . TYR C 1 404 ? 24.191 104.586 23.783  1.00 36.11 ? 404 TYR C C   1 
ATOM   10737 O  O   . TYR C 1 404 ? 23.345 103.807 23.349  1.00 35.56 ? 404 TYR C O   1 
ATOM   10738 C  CB  . TYR C 1 404 ? 26.022 105.023 22.166  1.00 36.17 ? 404 TYR C CB  1 
ATOM   10739 C  CG  . TYR C 1 404 ? 25.277 104.433 21.011  1.00 35.77 ? 404 TYR C CG  1 
ATOM   10740 C  CD1 . TYR C 1 404 ? 25.616 103.187 20.501  1.00 34.76 ? 404 TYR C CD1 1 
ATOM   10741 C  CD2 . TYR C 1 404 ? 24.215 105.116 20.439  1.00 35.77 ? 404 TYR C CD2 1 
ATOM   10742 C  CE1 . TYR C 1 404 ? 24.914 102.640 19.451  1.00 35.24 ? 404 TYR C CE1 1 
ATOM   10743 C  CE2 . TYR C 1 404 ? 23.505 104.579 19.391  1.00 36.04 ? 404 TYR C CE2 1 
ATOM   10744 C  CZ  . TYR C 1 404 ? 23.855 103.343 18.901  1.00 35.69 ? 404 TYR C CZ  1 
ATOM   10745 O  OH  . TYR C 1 404 ? 23.125 102.817 17.864  1.00 36.49 ? 404 TYR C OH  1 
ATOM   10746 N  N   . TYR C 1 405 ? 23.895 105.659 24.507  1.00 36.19 ? 405 TYR C N   1 
ATOM   10747 C  CA  . TYR C 1 405 ? 22.533 105.964 24.914  1.00 36.53 ? 405 TYR C CA  1 
ATOM   10748 C  C   . TYR C 1 405 ? 22.171 107.388 24.543  1.00 37.03 ? 405 TYR C C   1 
ATOM   10749 O  O   . TYR C 1 405 ? 22.930 108.316 24.816  1.00 37.63 ? 405 TYR C O   1 
ATOM   10750 C  CB  . TYR C 1 405 ? 22.434 105.792 26.418  1.00 36.14 ? 405 TYR C CB  1 
ATOM   10751 C  CG  . TYR C 1 405 ? 21.045 105.771 26.983  1.00 36.13 ? 405 TYR C CG  1 
ATOM   10752 C  CD1 . TYR C 1 405 ? 20.137 104.785 26.615  1.00 36.50 ? 405 TYR C CD1 1 
ATOM   10753 C  CD2 . TYR C 1 405 ? 20.662 106.690 27.962  1.00 36.26 ? 405 TYR C CD2 1 
ATOM   10754 C  CE1 . TYR C 1 405 ? 18.875 104.707 27.217  1.00 36.70 ? 405 TYR C CE1 1 
ATOM   10755 C  CE2 . TYR C 1 405 ? 19.411 106.621 28.568  1.00 36.16 ? 405 TYR C CE2 1 
ATOM   10756 C  CZ  . TYR C 1 405 ? 18.524 105.629 28.192  1.00 36.43 ? 405 TYR C CZ  1 
ATOM   10757 O  OH  . TYR C 1 405 ? 17.287 105.566 28.788  1.00 36.98 ? 405 TYR C OH  1 
ATOM   10758 N  N   . PRO C 1 406 ? 20.994 107.586 23.928  1.00 37.30 ? 406 PRO C N   1 
ATOM   10759 C  CA  . PRO C 1 406 ? 20.027 106.539 23.584  1.00 36.65 ? 406 PRO C CA  1 
ATOM   10760 C  C   . PRO C 1 406 ? 20.399 105.795 22.312  1.00 36.30 ? 406 PRO C C   1 
ATOM   10761 O  O   . PRO C 1 406 ? 21.336 106.169 21.612  1.00 34.86 ? 406 PRO C O   1 
ATOM   10762 C  CB  . PRO C 1 406 ? 18.738 107.321 23.426  1.00 36.51 ? 406 PRO C CB  1 
ATOM   10763 C  CG  . PRO C 1 406 ? 19.227 108.582 22.779  1.00 36.85 ? 406 PRO C CG  1 
ATOM   10764 C  CD  . PRO C 1 406 ? 20.460 108.918 23.590  1.00 36.83 ? 406 PRO C CD  1 
ATOM   10765 N  N   . ASN C 1 407 ? 19.651 104.739 22.026  1.00 36.87 ? 407 ASN C N   1 
ATOM   10766 C  CA  . ASN C 1 407 ? 19.874 103.928 20.839  1.00 38.58 ? 407 ASN C CA  1 
ATOM   10767 C  C   . ASN C 1 407 ? 18.558 103.262 20.453  1.00 39.18 ? 407 ASN C C   1 
ATOM   10768 O  O   . ASN C 1 407 ? 17.671 103.067 21.298  1.00 39.09 ? 407 ASN C O   1 
ATOM   10769 C  CB  . ASN C 1 407 ? 20.923 102.847 21.121  1.00 38.63 ? 407 ASN C CB  1 
ATOM   10770 C  CG  . ASN C 1 407 ? 20.466 101.864 22.184  1.00 39.63 ? 407 ASN C CG  1 
ATOM   10771 O  OD1 . ASN C 1 407 ? 19.673 100.950 21.910  1.00 39.67 ? 407 ASN C OD1 1 
ATOM   10772 N  ND2 . ASN C 1 407 ? 20.942 102.062 23.418  1.00 39.10 ? 407 ASN C ND2 1 
ATOM   10773 N  N   . SER C 1 408 ? 18.434 102.907 19.181  1.00 39.37 ? 408 SER C N   1 
ATOM   10774 C  CA  . SER C 1 408 ? 17.227 102.257 18.708  1.00 40.64 ? 408 SER C CA  1 
ATOM   10775 C  C   . SER C 1 408 ? 17.434 100.749 18.692  1.00 41.25 ? 408 SER C C   1 
ATOM   10776 O  O   . SER C 1 408 ? 16.927 100.066 17.807  1.00 41.62 ? 408 SER C O   1 
ATOM   10777 C  CB  . SER C 1 408 ? 16.892 102.738 17.299  1.00 41.13 ? 408 SER C CB  1 
ATOM   10778 O  OG  . SER C 1 408 ? 16.846 104.151 17.250  1.00 42.62 ? 408 SER C OG  1 
ATOM   10779 N  N   . PHE C 1 409 ? 18.163 100.226 19.673  1.00 41.76 ? 409 PHE C N   1 
ATOM   10780 C  CA  . PHE C 1 409 ? 18.430 98.799  19.697  1.00 42.27 ? 409 PHE C CA  1 
ATOM   10781 C  C   . PHE C 1 409 ? 18.125 98.048  20.978  1.00 43.83 ? 409 PHE C C   1 
ATOM   10782 O  O   . PHE C 1 409 ? 18.675 96.969  21.203  1.00 45.03 ? 409 PHE C O   1 
ATOM   10783 C  CB  . PHE C 1 409 ? 19.873 98.544  19.275  1.00 41.27 ? 409 PHE C CB  1 
ATOM   10784 C  CG  . PHE C 1 409 ? 20.164 98.974  17.869  1.00 40.73 ? 409 PHE C CG  1 
ATOM   10785 C  CD1 . PHE C 1 409 ? 19.597 98.301  16.794  1.00 40.04 ? 409 PHE C CD1 1 
ATOM   10786 C  CD2 . PHE C 1 409 ? 20.968 100.075 17.617  1.00 40.47 ? 409 PHE C CD2 1 
ATOM   10787 C  CE1 . PHE C 1 409 ? 19.828 98.722  15.480  1.00 40.53 ? 409 PHE C CE1 1 
ATOM   10788 C  CE2 . PHE C 1 409 ? 21.203 100.505 16.304  1.00 40.66 ? 409 PHE C CE2 1 
ATOM   10789 C  CZ  . PHE C 1 409 ? 20.633 99.827  15.237  1.00 39.86 ? 409 PHE C CZ  1 
ATOM   10790 N  N   . GLY C 1 410 ? 17.266 98.612  21.823  1.00 45.22 ? 410 GLY C N   1 
ATOM   10791 C  CA  . GLY C 1 410 ? 16.863 97.914  23.037  1.00 47.21 ? 410 GLY C CA  1 
ATOM   10792 C  C   . GLY C 1 410 ? 17.680 97.951  24.319  1.00 48.46 ? 410 GLY C C   1 
ATOM   10793 O  O   . GLY C 1 410 ? 17.128 97.724  25.399  1.00 49.11 ? 410 GLY C O   1 
ATOM   10794 N  N   . ALA C 1 411 ? 18.979 98.213  24.219  1.00 49.33 ? 411 ALA C N   1 
ATOM   10795 C  CA  . ALA C 1 411 ? 19.847 98.279  25.395  1.00 49.93 ? 411 ALA C CA  1 
ATOM   10796 C  C   . ALA C 1 411 ? 19.141 98.917  26.609  1.00 50.20 ? 411 ALA C C   1 
ATOM   10797 O  O   . ALA C 1 411 ? 18.159 99.653  26.457  1.00 50.47 ? 411 ALA C O   1 
ATOM   10798 C  CB  . ALA C 1 411 ? 21.113 99.060  25.046  1.00 50.72 ? 411 ALA C CB  1 
ATOM   10799 N  N   . PRO C 1 412 ? 19.651 98.658  27.827  1.00 49.83 ? 412 PRO C N   1 
ATOM   10800 C  CA  . PRO C 1 412 ? 19.109 99.172  29.091  1.00 49.74 ? 412 PRO C CA  1 
ATOM   10801 C  C   . PRO C 1 412 ? 18.452 100.556 29.030  1.00 50.26 ? 412 PRO C C   1 
ATOM   10802 O  O   . PRO C 1 412 ? 18.900 101.445 28.299  1.00 49.89 ? 412 PRO C O   1 
ATOM   10803 C  CB  . PRO C 1 412 ? 20.320 99.154  30.005  1.00 49.43 ? 412 PRO C CB  1 
ATOM   10804 C  CG  . PRO C 1 412 ? 21.045 97.949  29.534  1.00 49.51 ? 412 PRO C CG  1 
ATOM   10805 C  CD  . PRO C 1 412 ? 20.984 98.067  28.041  1.00 49.09 ? 412 PRO C CD  1 
ATOM   10806 N  N   . GLU C 1 413 ? 17.397 100.735 29.821  1.00 50.63 ? 413 GLU C N   1 
ATOM   10807 C  CA  . GLU C 1 413 ? 16.665 102.000 29.855  1.00 51.06 ? 413 GLU C CA  1 
ATOM   10808 C  C   . GLU C 1 413 ? 16.432 102.546 31.249  1.00 50.77 ? 413 GLU C C   1 
ATOM   10809 O  O   . GLU C 1 413 ? 16.299 101.794 32.203  1.00 51.25 ? 413 GLU C O   1 
ATOM   10810 C  CB  . GLU C 1 413 ? 15.316 101.824 29.185  1.00 51.88 ? 413 GLU C CB  1 
ATOM   10811 C  CG  . GLU C 1 413 ? 15.428 101.552 27.727  1.00 53.72 ? 413 GLU C CG  1 
ATOM   10812 C  CD  . GLU C 1 413 ? 14.827 102.663 26.922  1.00 54.88 ? 413 GLU C CD  1 
ATOM   10813 O  OE1 . GLU C 1 413 ? 15.053 103.847 27.281  1.00 54.59 ? 413 GLU C OE1 1 
ATOM   10814 O  OE2 . GLU C 1 413 ? 14.132 102.345 25.932  1.00 56.75 ? 413 GLU C OE2 1 
ATOM   10815 N  N   . GLN C 1 414 ? 16.360 103.863 31.358  1.00 50.56 ? 414 GLN C N   1 
ATOM   10816 C  CA  . GLN C 1 414 ? 16.122 104.511 32.644  1.00 51.13 ? 414 GLN C CA  1 
ATOM   10817 C  C   . GLN C 1 414 ? 14.677 104.293 33.109  1.00 51.19 ? 414 GLN C C   1 
ATOM   10818 O  O   . GLN C 1 414 ? 13.754 104.336 32.299  1.00 51.29 ? 414 GLN C O   1 
ATOM   10819 C  CB  . GLN C 1 414 ? 16.397 106.015 32.510  1.00 51.30 ? 414 GLN C CB  1 
ATOM   10820 C  CG  . GLN C 1 414 ? 15.870 106.596 31.187  1.00 51.54 ? 414 GLN C CG  1 
ATOM   10821 C  CD  . GLN C 1 414 ? 16.037 108.096 31.060  1.00 50.81 ? 414 GLN C CD  1 
ATOM   10822 O  OE1 . GLN C 1 414 ? 15.235 108.865 31.585  1.00 51.38 ? 414 GLN C OE1 1 
ATOM   10823 N  NE2 . GLN C 1 414 ? 17.084 108.520 30.357  1.00 51.11 ? 414 GLN C NE2 1 
ATOM   10824 N  N   . GLN C 1 415 ? 14.480 104.033 34.400  1.00 51.44 ? 415 GLN C N   1 
ATOM   10825 C  CA  . GLN C 1 415 ? 13.124 103.869 34.923  1.00 52.20 ? 415 GLN C CA  1 
ATOM   10826 C  C   . GLN C 1 415 ? 12.850 105.129 35.740  1.00 51.23 ? 415 GLN C C   1 
ATOM   10827 O  O   . GLN C 1 415 ? 13.485 105.374 36.760  1.00 50.96 ? 415 GLN C O   1 
ATOM   10828 C  CB  . GLN C 1 415 ? 12.978 102.592 35.785  1.00 54.12 ? 415 GLN C CB  1 
ATOM   10829 C  CG  . GLN C 1 415 ? 13.825 102.545 37.058  1.00 57.44 ? 415 GLN C CG  1 
ATOM   10830 C  CD  . GLN C 1 415 ? 13.375 101.470 38.066  1.00 59.05 ? 415 GLN C CD  1 
ATOM   10831 O  OE1 . GLN C 1 415 ? 13.385 100.267 37.772  1.00 59.42 ? 415 GLN C OE1 1 
ATOM   10832 N  NE2 . GLN C 1 415 ? 12.984 101.912 39.266  1.00 59.87 ? 415 GLN C NE2 1 
ATOM   10833 N  N   . PRO C 1 416 ? 11.914 105.967 35.273  1.00 50.79 ? 416 PRO C N   1 
ATOM   10834 C  CA  . PRO C 1 416 ? 11.546 107.220 35.936  1.00 50.34 ? 416 PRO C CA  1 
ATOM   10835 C  C   . PRO C 1 416 ? 11.264 107.136 37.428  1.00 50.45 ? 416 PRO C C   1 
ATOM   10836 O  O   . PRO C 1 416 ? 11.508 108.094 38.163  1.00 50.45 ? 416 PRO C O   1 
ATOM   10837 C  CB  . PRO C 1 416 ? 10.345 107.680 35.133  1.00 50.30 ? 416 PRO C CB  1 
ATOM   10838 C  CG  . PRO C 1 416 ? 10.715 107.230 33.747  1.00 50.91 ? 416 PRO C CG  1 
ATOM   10839 C  CD  . PRO C 1 416 ? 11.178 105.818 34.006  1.00 50.69 ? 416 PRO C CD  1 
ATOM   10840 N  N   . SER C 1 417 ? 10.752 106.001 37.886  1.00 50.63 ? 417 SER C N   1 
ATOM   10841 C  CA  . SER C 1 417 ? 10.464 105.836 39.310  1.00 50.83 ? 417 SER C CA  1 
ATOM   10842 C  C   . SER C 1 417 ? 11.703 106.044 40.197  1.00 51.16 ? 417 SER C C   1 
ATOM   10843 O  O   . SER C 1 417 ? 11.578 106.348 41.383  1.00 51.46 ? 417 SER C O   1 
ATOM   10844 C  CB  . SER C 1 417 ? 9.891  104.442 39.557  1.00 50.25 ? 417 SER C CB  1 
ATOM   10845 O  OG  . SER C 1 417 ? 10.681 103.459 38.911  1.00 50.43 ? 417 SER C OG  1 
ATOM   10846 N  N   . ALA C 1 418 ? 12.890 105.891 39.609  1.00 51.24 ? 418 ALA C N   1 
ATOM   10847 C  CA  . ALA C 1 418 ? 14.159 106.020 40.332  1.00 51.12 ? 418 ALA C CA  1 
ATOM   10848 C  C   . ALA C 1 418 ? 14.677 107.444 40.457  1.00 50.96 ? 418 ALA C C   1 
ATOM   10849 O  O   . ALA C 1 418 ? 15.701 107.684 41.099  1.00 50.92 ? 418 ALA C O   1 
ATOM   10850 C  CB  . ALA C 1 418 ? 15.226 105.155 39.660  1.00 51.32 ? 418 ALA C CB  1 
ATOM   10851 N  N   . LEU C 1 419 ? 13.973 108.379 39.834  1.00 50.76 ? 419 LEU C N   1 
ATOM   10852 C  CA  . LEU C 1 419 ? 14.348 109.790 39.855  1.00 50.93 ? 419 LEU C CA  1 
ATOM   10853 C  C   . LEU C 1 419 ? 14.492 110.339 41.292  1.00 50.73 ? 419 LEU C C   1 
ATOM   10854 O  O   . LEU C 1 419 ? 13.707 110.000 42.180  1.00 50.95 ? 419 LEU C O   1 
ATOM   10855 C  CB  . LEU C 1 419 ? 13.302 110.581 39.067  1.00 50.73 ? 419 LEU C CB  1 
ATOM   10856 C  CG  . LEU C 1 419 ? 13.623 112.001 38.619  1.00 51.19 ? 419 LEU C CG  1 
ATOM   10857 C  CD1 . LEU C 1 419 ? 14.942 112.035 37.844  1.00 50.81 ? 419 LEU C CD1 1 
ATOM   10858 C  CD2 . LEU C 1 419 ? 12.469 112.491 37.757  1.00 50.84 ? 419 LEU C CD2 1 
ATOM   10859 N  N   . GLU C 1 420 ? 15.492 111.187 41.513  1.00 50.26 ? 420 GLU C N   1 
ATOM   10860 C  CA  . GLU C 1 420 ? 15.741 111.747 42.843  1.00 50.22 ? 420 GLU C CA  1 
ATOM   10861 C  C   . GLU C 1 420 ? 14.673 112.751 43.268  1.00 49.94 ? 420 GLU C C   1 
ATOM   10862 O  O   . GLU C 1 420 ? 14.019 113.375 42.425  1.00 50.27 ? 420 GLU C O   1 
ATOM   10863 C  CB  . GLU C 1 420 ? 17.102 112.468 42.900  1.00 50.38 ? 420 GLU C CB  1 
ATOM   10864 C  CG  . GLU C 1 420 ? 18.265 111.835 42.133  1.00 50.69 ? 420 GLU C CG  1 
ATOM   10865 C  CD  . GLU C 1 420 ? 18.113 111.916 40.616  1.00 51.35 ? 420 GLU C CD  1 
ATOM   10866 O  OE1 . GLU C 1 420 ? 17.697 112.975 40.088  1.00 50.37 ? 420 GLU C OE1 1 
ATOM   10867 O  OE2 . GLU C 1 420 ? 18.428 110.909 39.950  1.00 52.63 ? 420 GLU C OE2 1 
ATOM   10868 N  N   . HIS C 1 421 ? 14.527 112.917 44.582  1.00 49.23 ? 421 HIS C N   1 
ATOM   10869 C  CA  . HIS C 1 421 ? 13.581 113.870 45.160  1.00 48.40 ? 421 HIS C CA  1 
ATOM   10870 C  C   . HIS C 1 421 ? 14.113 115.296 44.995  1.00 48.15 ? 421 HIS C C   1 
ATOM   10871 O  O   . HIS C 1 421 ? 15.260 115.567 45.337  1.00 48.28 ? 421 HIS C O   1 
ATOM   10872 C  CB  . HIS C 1 421 ? 13.385 113.575 46.644  1.00 47.93 ? 421 HIS C CB  1 
ATOM   10873 C  CG  . HIS C 1 421 ? 12.560 114.599 47.353  1.00 47.84 ? 421 HIS C CG  1 
ATOM   10874 N  ND1 . HIS C 1 421 ? 13.050 115.839 47.695  1.00 47.66 ? 421 HIS C ND1 1 
ATOM   10875 C  CD2 . HIS C 1 421 ? 11.262 114.586 47.741  1.00 48.25 ? 421 HIS C CD2 1 
ATOM   10876 C  CE1 . HIS C 1 421 ? 12.090 116.548 48.265  1.00 48.42 ? 421 HIS C CE1 1 
ATOM   10877 N  NE2 . HIS C 1 421 ? 10.994 115.810 48.304  1.00 48.51 ? 421 HIS C NE2 1 
ATOM   10878 N  N   . SER C 1 422 ? 13.288 116.213 44.491  1.00 48.22 ? 422 SER C N   1 
ATOM   10879 C  CA  . SER C 1 422 ? 13.755 117.583 44.285  1.00 48.74 ? 422 SER C CA  1 
ATOM   10880 C  C   . SER C 1 422 ? 13.233 118.653 45.252  1.00 48.91 ? 422 SER C C   1 
ATOM   10881 O  O   . SER C 1 422 ? 12.051 118.709 45.580  1.00 49.31 ? 422 SER C O   1 
ATOM   10882 C  CB  . SER C 1 422 ? 13.501 118.022 42.835  1.00 47.56 ? 422 SER C CB  1 
ATOM   10883 O  OG  . SER C 1 422 ? 12.140 117.895 42.499  1.00 47.87 ? 422 SER C OG  1 
ATOM   10884 N  N   . ILE C 1 423 ? 14.161 119.489 45.707  1.00 49.23 ? 423 ILE C N   1 
ATOM   10885 C  CA  . ILE C 1 423 ? 13.892 120.582 46.624  1.00 49.40 ? 423 ILE C CA  1 
ATOM   10886 C  C   . ILE C 1 423 ? 14.466 121.842 45.987  1.00 49.64 ? 423 ILE C C   1 
ATOM   10887 O  O   . ILE C 1 423 ? 15.187 121.779 44.994  1.00 50.00 ? 423 ILE C O   1 
ATOM   10888 C  CB  . ILE C 1 423 ? 14.614 120.380 47.974  1.00 49.94 ? 423 ILE C CB  1 
ATOM   10889 C  CG1 . ILE C 1 423 ? 14.498 118.919 48.422  1.00 50.22 ? 423 ILE C CG1 1 
ATOM   10890 C  CG2 . ILE C 1 423 ? 14.011 121.318 49.030  1.00 50.00 ? 423 ILE C CG2 1 
ATOM   10891 C  CD1 . ILE C 1 423 ? 15.232 118.605 49.722  1.00 50.05 ? 423 ILE C CD1 1 
ATOM   10892 N  N   . GLN C 1 424 ? 14.153 122.993 46.552  1.00 49.95 ? 424 GLN C N   1 
ATOM   10893 C  CA  . GLN C 1 424 ? 14.680 124.230 46.010  1.00 50.89 ? 424 GLN C CA  1 
ATOM   10894 C  C   . GLN C 1 424 ? 15.339 124.954 47.158  1.00 50.62 ? 424 GLN C C   1 
ATOM   10895 O  O   . GLN C 1 424 ? 14.802 124.983 48.263  1.00 50.98 ? 424 GLN C O   1 
ATOM   10896 C  CB  . GLN C 1 424 ? 13.565 125.081 45.427  1.00 51.90 ? 424 GLN C CB  1 
ATOM   10897 C  CG  . GLN C 1 424 ? 14.047 126.432 44.970  1.00 54.16 ? 424 GLN C CG  1 
ATOM   10898 C  CD  . GLN C 1 424 ? 12.921 127.288 44.452  1.00 55.54 ? 424 GLN C CD  1 
ATOM   10899 O  OE1 . GLN C 1 424 ? 13.129 128.448 44.075  1.00 56.95 ? 424 GLN C OE1 1 
ATOM   10900 N  NE2 . GLN C 1 424 ? 11.712 126.725 44.427  1.00 54.97 ? 424 GLN C NE2 1 
ATOM   10901 N  N   . TYR C 1 425 ? 16.498 125.545 46.904  1.00 50.35 ? 425 TYR C N   1 
ATOM   10902 C  CA  . TYR C 1 425 ? 17.209 126.217 47.973  1.00 50.37 ? 425 TYR C CA  1 
ATOM   10903 C  C   . TYR C 1 425 ? 17.317 127.714 47.761  1.00 51.28 ? 425 TYR C C   1 
ATOM   10904 O  O   . TYR C 1 425 ? 17.311 128.190 46.623  1.00 51.75 ? 425 TYR C O   1 
ATOM   10905 C  CB  . TYR C 1 425 ? 18.600 125.593 48.122  1.00 49.48 ? 425 TYR C CB  1 
ATOM   10906 C  CG  . TYR C 1 425 ? 18.572 124.087 48.314  1.00 47.92 ? 425 TYR C CG  1 
ATOM   10907 C  CD1 . TYR C 1 425 ? 18.414 123.226 47.229  1.00 47.15 ? 425 TYR C CD1 1 
ATOM   10908 C  CD2 . TYR C 1 425 ? 18.666 123.528 49.590  1.00 47.14 ? 425 TYR C CD2 1 
ATOM   10909 C  CE1 . TYR C 1 425 ? 18.346 121.848 47.410  1.00 46.91 ? 425 TYR C CE1 1 
ATOM   10910 C  CE2 . TYR C 1 425 ? 18.602 122.152 49.784  1.00 46.70 ? 425 TYR C CE2 1 
ATOM   10911 C  CZ  . TYR C 1 425 ? 18.442 121.317 48.694  1.00 47.04 ? 425 TYR C CZ  1 
ATOM   10912 O  OH  . TYR C 1 425 ? 18.379 119.954 48.888  1.00 47.04 ? 425 TYR C OH  1 
ATOM   10913 N  N   . SER C 1 426 ? 17.401 128.458 48.862  1.00 51.84 ? 426 SER C N   1 
ATOM   10914 C  CA  . SER C 1 426 ? 17.515 129.913 48.783  1.00 52.76 ? 426 SER C CA  1 
ATOM   10915 C  C   . SER C 1 426 ? 18.946 130.324 49.062  1.00 52.65 ? 426 SER C C   1 
ATOM   10916 O  O   . SER C 1 426 ? 19.654 129.647 49.805  1.00 53.47 ? 426 SER C O   1 
ATOM   10917 C  CB  . SER C 1 426 ? 16.590 130.589 49.801  1.00 53.43 ? 426 SER C CB  1 
ATOM   10918 O  OG  . SER C 1 426 ? 15.223 130.359 49.494  1.00 55.14 ? 426 SER C OG  1 
ATOM   10919 N  N   . GLY C 1 427 ? 19.369 131.436 48.471  1.00 52.59 ? 427 GLY C N   1 
ATOM   10920 C  CA  . GLY C 1 427 ? 20.728 131.917 48.678  1.00 51.45 ? 427 GLY C CA  1 
ATOM   10921 C  C   . GLY C 1 427 ? 21.562 131.837 47.416  1.00 50.24 ? 427 GLY C C   1 
ATOM   10922 O  O   . GLY C 1 427 ? 21.168 131.189 46.444  1.00 50.94 ? 427 GLY C O   1 
ATOM   10923 N  N   . GLU C 1 428 ? 22.711 132.499 47.417  1.00 49.03 ? 428 GLU C N   1 
ATOM   10924 C  CA  . GLU C 1 428 ? 23.574 132.467 46.245  1.00 48.09 ? 428 GLU C CA  1 
ATOM   10925 C  C   . GLU C 1 428 ? 24.576 131.310 46.306  1.00 46.43 ? 428 GLU C C   1 
ATOM   10926 O  O   . GLU C 1 428 ? 24.753 130.680 47.349  1.00 46.37 ? 428 GLU C O   1 
ATOM   10927 C  CB  . GLU C 1 428 ? 24.300 133.816 46.078  1.00 48.76 ? 428 GLU C CB  1 
ATOM   10928 C  CG  . GLU C 1 428 ? 24.494 134.621 47.369  1.00 49.85 ? 428 GLU C CG  1 
ATOM   10929 C  CD  . GLU C 1 428 ? 25.156 135.984 47.133  1.00 50.42 ? 428 GLU C CD  1 
ATOM   10930 O  OE1 . GLU C 1 428 ? 24.778 136.667 46.153  1.00 50.67 ? 428 GLU C OE1 1 
ATOM   10931 O  OE2 . GLU C 1 428 ? 26.042 136.375 47.931  1.00 50.01 ? 428 GLU C OE2 1 
ATOM   10932 N  N   . VAL C 1 429 ? 25.200 131.015 45.171  1.00 44.57 ? 429 VAL C N   1 
ATOM   10933 C  CA  . VAL C 1 429 ? 26.193 129.953 45.087  1.00 42.95 ? 429 VAL C CA  1 
ATOM   10934 C  C   . VAL C 1 429 ? 27.551 130.546 45.452  1.00 42.17 ? 429 VAL C C   1 
ATOM   10935 O  O   . VAL C 1 429 ? 28.126 131.331 44.699  1.00 40.85 ? 429 VAL C O   1 
ATOM   10936 C  CB  . VAL C 1 429 ? 26.242 129.359 43.665  1.00 42.82 ? 429 VAL C CB  1 
ATOM   10937 C  CG1 . VAL C 1 429 ? 27.382 128.352 43.546  1.00 42.45 ? 429 VAL C CG1 1 
ATOM   10938 C  CG2 . VAL C 1 429 ? 24.914 128.696 43.349  1.00 42.16 ? 429 VAL C CG2 1 
ATOM   10939 N  N   . ARG C 1 430 ? 28.046 130.167 46.625  1.00 41.63 ? 430 ARG C N   1 
ATOM   10940 C  CA  . ARG C 1 430 ? 29.321 130.658 47.131  1.00 42.06 ? 430 ARG C CA  1 
ATOM   10941 C  C   . ARG C 1 430 ? 29.734 129.871 48.370  1.00 41.68 ? 430 ARG C C   1 
ATOM   10942 O  O   . ARG C 1 430 ? 29.075 128.915 48.769  1.00 42.32 ? 430 ARG C O   1 
ATOM   10943 C  CB  . ARG C 1 430 ? 29.198 132.138 47.509  1.00 42.62 ? 430 ARG C CB  1 
ATOM   10944 C  CG  . ARG C 1 430 ? 27.918 132.448 48.293  1.00 43.92 ? 430 ARG C CG  1 
ATOM   10945 C  CD  . ARG C 1 430 ? 27.933 133.804 49.031  1.00 43.32 ? 430 ARG C CD  1 
ATOM   10946 N  NE  . ARG C 1 430 ? 28.603 133.699 50.325  1.00 42.93 ? 430 ARG C NE  1 
ATOM   10947 C  CZ  . ARG C 1 430 ? 28.288 134.416 51.402  1.00 42.56 ? 430 ARG C CZ  1 
ATOM   10948 N  NH1 . ARG C 1 430 ? 27.305 135.303 51.353  1.00 41.19 ? 430 ARG C NH1 1 
ATOM   10949 N  NH2 . ARG C 1 430 ? 28.956 134.234 52.536  1.00 42.57 ? 430 ARG C NH2 1 
ATOM   10950 N  N   . ARG C 1 431 ? 30.831 130.286 48.982  1.00 41.26 ? 431 ARG C N   1 
ATOM   10951 C  CA  . ARG C 1 431 ? 31.317 129.635 50.187  1.00 40.87 ? 431 ARG C CA  1 
ATOM   10952 C  C   . ARG C 1 431 ? 30.715 130.380 51.359  1.00 40.63 ? 431 ARG C C   1 
ATOM   10953 O  O   . ARG C 1 431 ? 30.832 131.597 51.449  1.00 41.58 ? 431 ARG C O   1 
ATOM   10954 C  CB  . ARG C 1 431 ? 32.848 129.705 50.245  1.00 40.82 ? 431 ARG C CB  1 
ATOM   10955 C  CG  . ARG C 1 431 ? 33.504 129.001 49.074  1.00 40.60 ? 431 ARG C CG  1 
ATOM   10956 C  CD  . ARG C 1 431 ? 34.961 129.323 48.953  1.00 39.89 ? 431 ARG C CD  1 
ATOM   10957 N  NE  . ARG C 1 431 ? 35.504 128.768 47.720  1.00 39.30 ? 431 ARG C NE  1 
ATOM   10958 C  CZ  . ARG C 1 431 ? 35.664 127.470 47.496  1.00 39.36 ? 431 ARG C CZ  1 
ATOM   10959 N  NH1 . ARG C 1 431 ? 35.319 126.593 48.437  1.00 39.08 ? 431 ARG C NH1 1 
ATOM   10960 N  NH2 . ARG C 1 431 ? 36.166 127.053 46.334  1.00 38.23 ? 431 ARG C NH2 1 
ATOM   10961 N  N   . PHE C 1 432 ? 30.051 129.654 52.245  1.00 40.24 ? 432 PHE C N   1 
ATOM   10962 C  CA  . PHE C 1 432 ? 29.434 130.266 53.410  1.00 40.05 ? 432 PHE C CA  1 
ATOM   10963 C  C   . PHE C 1 432 ? 30.206 129.797 54.633  1.00 40.59 ? 432 PHE C C   1 
ATOM   10964 O  O   . PHE C 1 432 ? 30.221 128.609 54.933  1.00 41.58 ? 432 PHE C O   1 
ATOM   10965 C  CB  . PHE C 1 432 ? 27.969 129.823 53.522  1.00 39.19 ? 432 PHE C CB  1 
ATOM   10966 C  CG  . PHE C 1 432 ? 27.061 130.438 52.500  1.00 38.16 ? 432 PHE C CG  1 
ATOM   10967 C  CD1 . PHE C 1 432 ? 26.409 131.639 52.764  1.00 38.13 ? 432 PHE C CD1 1 
ATOM   10968 C  CD2 . PHE C 1 432 ? 26.867 129.828 51.262  1.00 37.95 ? 432 PHE C CD2 1 
ATOM   10969 C  CE1 . PHE C 1 432 ? 25.578 132.224 51.805  1.00 38.00 ? 432 PHE C CE1 1 
ATOM   10970 C  CE2 . PHE C 1 432 ? 26.038 130.406 50.298  1.00 37.46 ? 432 PHE C CE2 1 
ATOM   10971 C  CZ  . PHE C 1 432 ? 25.394 131.603 50.567  1.00 37.38 ? 432 PHE C CZ  1 
ATOM   10972 N  N   . ASN C 1 433 ? 30.850 130.708 55.345  1.00 41.22 ? 433 ASN C N   1 
ATOM   10973 C  CA  . ASN C 1 433 ? 31.600 130.299 56.529  1.00 42.10 ? 433 ASN C CA  1 
ATOM   10974 C  C   . ASN C 1 433 ? 30.664 129.686 57.566  1.00 42.48 ? 433 ASN C C   1 
ATOM   10975 O  O   . ASN C 1 433 ? 29.538 130.159 57.744  1.00 43.07 ? 433 ASN C O   1 
ATOM   10976 C  CB  . ASN C 1 433 ? 32.318 131.496 57.153  1.00 42.40 ? 433 ASN C CB  1 
ATOM   10977 C  CG  . ASN C 1 433 ? 33.346 131.081 58.190  1.00 43.44 ? 433 ASN C CG  1 
ATOM   10978 O  OD1 . ASN C 1 433 ? 33.998 131.919 58.801  1.00 45.36 ? 433 ASN C OD1 1 
ATOM   10979 N  ND2 . ASN C 1 433 ? 33.504 129.779 58.385  1.00 44.09 ? 433 ASN C ND2 1 
ATOM   10980 N  N   . THR C 1 434 ? 31.126 128.628 58.233  1.00 42.92 ? 434 THR C N   1 
ATOM   10981 C  CA  . THR C 1 434 ? 30.348 127.965 59.285  1.00 42.68 ? 434 THR C CA  1 
ATOM   10982 C  C   . THR C 1 434 ? 31.244 127.746 60.494  1.00 43.37 ? 434 THR C C   1 
ATOM   10983 O  O   . THR C 1 434 ? 30.854 127.092 61.458  1.00 43.43 ? 434 THR C O   1 
ATOM   10984 C  CB  . THR C 1 434 ? 29.801 126.570 58.859  1.00 41.88 ? 434 THR C CB  1 
ATOM   10985 O  OG1 . THR C 1 434 ? 30.896 125.659 58.658  1.00 40.32 ? 434 THR C OG1 1 
ATOM   10986 C  CG2 . THR C 1 434 ? 28.950 126.685 57.594  1.00 40.69 ? 434 THR C CG2 1 
ATOM   10987 N  N   . ALA C 1 435 ? 32.452 128.290 60.433  1.00 44.43 ? 435 ALA C N   1 
ATOM   10988 C  CA  . ALA C 1 435 ? 33.402 128.143 61.520  1.00 46.04 ? 435 ALA C CA  1 
ATOM   10989 C  C   . ALA C 1 435 ? 32.799 128.699 62.800  1.00 47.68 ? 435 ALA C C   1 
ATOM   10990 O  O   . ALA C 1 435 ? 33.176 128.290 63.906  1.00 47.85 ? 435 ALA C O   1 
ATOM   10991 C  CB  . ALA C 1 435 ? 34.686 128.883 61.192  1.00 45.43 ? 435 ALA C CB  1 
ATOM   10992 N  N   . ASN C 1 436 ? 31.839 129.610 62.640  1.00 48.84 ? 436 ASN C N   1 
ATOM   10993 C  CA  . ASN C 1 436 ? 31.210 130.261 63.780  1.00 50.05 ? 436 ASN C CA  1 
ATOM   10994 C  C   . ASN C 1 436 ? 29.808 129.841 64.177  1.00 50.26 ? 436 ASN C C   1 
ATOM   10995 O  O   . ASN C 1 436 ? 29.132 130.560 64.917  1.00 50.58 ? 436 ASN C O   1 
ATOM   10996 C  CB  . ASN C 1 436 ? 31.255 131.772 63.581  1.00 51.23 ? 436 ASN C CB  1 
ATOM   10997 C  CG  . ASN C 1 436 ? 32.677 132.287 63.474  1.00 52.80 ? 436 ASN C CG  1 
ATOM   10998 O  OD1 . ASN C 1 436 ? 33.530 131.960 64.312  1.00 53.58 ? 436 ASN C OD1 1 
ATOM   10999 N  ND2 . ASN C 1 436 ? 32.949 133.088 62.444  1.00 53.07 ? 436 ASN C ND2 1 
ATOM   11000 N  N   . ASP C 1 437 ? 29.358 128.688 63.699  1.00 50.09 ? 437 ASP C N   1 
ATOM   11001 C  CA  . ASP C 1 437 ? 28.047 128.218 64.107  1.00 50.39 ? 437 ASP C CA  1 
ATOM   11002 C  C   . ASP C 1 437 ? 28.251 127.815 65.563  1.00 50.13 ? 437 ASP C C   1 
ATOM   11003 O  O   . ASP C 1 437 ? 29.382 127.865 66.056  1.00 50.46 ? 437 ASP C O   1 
ATOM   11004 C  CB  . ASP C 1 437 ? 27.601 127.030 63.254  1.00 50.84 ? 437 ASP C CB  1 
ATOM   11005 C  CG  . ASP C 1 437 ? 27.333 127.430 61.814  1.00 51.43 ? 437 ASP C CG  1 
ATOM   11006 O  OD1 . ASP C 1 437 ? 27.164 128.646 61.566  1.00 51.15 ? 437 ASP C OD1 1 
ATOM   11007 O  OD2 . ASP C 1 437 ? 27.282 126.538 60.936  1.00 52.23 ? 437 ASP C OD2 1 
ATOM   11008 N  N   . ASP C 1 438 ? 27.184 127.433 66.258  1.00 49.18 ? 438 ASP C N   1 
ATOM   11009 C  CA  . ASP C 1 438 ? 27.315 127.061 67.664  1.00 48.98 ? 438 ASP C CA  1 
ATOM   11010 C  C   . ASP C 1 438 ? 28.378 125.967 67.897  1.00 48.52 ? 438 ASP C C   1 
ATOM   11011 O  O   . ASP C 1 438 ? 28.332 124.912 67.268  1.00 49.13 ? 438 ASP C O   1 
ATOM   11012 C  CB  . ASP C 1 438 ? 25.966 126.590 68.200  1.00 49.03 ? 438 ASP C CB  1 
ATOM   11013 C  CG  . ASP C 1 438 ? 25.861 126.728 69.702  1.00 49.52 ? 438 ASP C CG  1 
ATOM   11014 O  OD1 . ASP C 1 438 ? 26.789 126.282 70.424  1.00 49.43 ? 438 ASP C OD1 1 
ATOM   11015 O  OD2 . ASP C 1 438 ? 24.839 127.287 70.153  1.00 50.41 ? 438 ASP C OD2 1 
ATOM   11016 N  N   . ASN C 1 439 ? 29.330 126.208 68.797  1.00 47.06 ? 439 ASN C N   1 
ATOM   11017 C  CA  . ASN C 1 439 ? 30.361 125.208 69.056  1.00 46.01 ? 439 ASN C CA  1 
ATOM   11018 C  C   . ASN C 1 439 ? 30.331 124.672 70.473  1.00 46.38 ? 439 ASN C C   1 
ATOM   11019 O  O   . ASN C 1 439 ? 30.986 123.666 70.761  1.00 46.77 ? 439 ASN C O   1 
ATOM   11020 C  CB  . ASN C 1 439 ? 31.766 125.767 68.819  1.00 44.16 ? 439 ASN C CB  1 
ATOM   11021 C  CG  . ASN C 1 439 ? 31.966 126.266 67.420  1.00 43.09 ? 439 ASN C CG  1 
ATOM   11022 O  OD1 . ASN C 1 439 ? 31.484 125.674 66.469  1.00 43.19 ? 439 ASN C OD1 1 
ATOM   11023 N  ND2 . ASN C 1 439 ? 32.701 127.355 67.282  1.00 43.04 ? 439 ASN C ND2 1 
ATOM   11024 N  N   . VAL C 1 440 ? 29.580 125.318 71.361  1.00 45.99 ? 440 VAL C N   1 
ATOM   11025 C  CA  . VAL C 1 440 ? 29.578 124.875 72.750  1.00 45.82 ? 440 VAL C CA  1 
ATOM   11026 C  C   . VAL C 1 440 ? 28.271 124.350 73.326  1.00 45.96 ? 440 VAL C C   1 
ATOM   11027 O  O   . VAL C 1 440 ? 28.278 123.457 74.180  1.00 45.46 ? 440 VAL C O   1 
ATOM   11028 C  CB  . VAL C 1 440 ? 30.080 126.013 73.688  1.00 45.80 ? 440 VAL C CB  1 
ATOM   11029 C  CG1 . VAL C 1 440 ? 31.444 126.510 73.229  1.00 44.97 ? 440 VAL C CG1 1 
ATOM   11030 C  CG2 . VAL C 1 440 ? 29.075 127.159 73.711  1.00 45.59 ? 440 VAL C CG2 1 
ATOM   11031 N  N   . THR C 1 441 ? 27.156 124.899 72.862  1.00 46.25 ? 441 THR C N   1 
ATOM   11032 C  CA  . THR C 1 441 ? 25.860 124.520 73.388  1.00 46.44 ? 441 THR C CA  1 
ATOM   11033 C  C   . THR C 1 441 ? 25.653 123.024 73.578  1.00 47.25 ? 441 THR C C   1 
ATOM   11034 O  O   . THR C 1 441 ? 25.608 122.549 74.714  1.00 47.89 ? 441 THR C O   1 
ATOM   11035 C  CB  . THR C 1 441 ? 24.746 125.109 72.535  1.00 46.19 ? 441 THR C CB  1 
ATOM   11036 O  OG1 . THR C 1 441 ? 24.983 126.509 72.376  1.00 45.62 ? 441 THR C OG1 1 
ATOM   11037 C  CG2 . THR C 1 441 ? 23.399 124.939 73.226  1.00 46.32 ? 441 THR C CG2 1 
ATOM   11038 N  N   . GLN C 1 442 ? 25.537 122.272 72.490  1.00 48.00 ? 442 GLN C N   1 
ATOM   11039 C  CA  . GLN C 1 442 ? 25.332 120.834 72.619  1.00 48.31 ? 442 GLN C CA  1 
ATOM   11040 C  C   . GLN C 1 442 ? 26.413 120.166 73.476  1.00 48.64 ? 442 GLN C C   1 
ATOM   11041 O  O   . GLN C 1 442 ? 26.140 119.189 74.180  1.00 48.62 ? 442 GLN C O   1 
ATOM   11042 C  CB  . GLN C 1 442 ? 25.270 120.168 71.237  1.00 48.40 ? 442 GLN C CB  1 
ATOM   11043 C  CG  . GLN C 1 442 ? 24.028 120.530 70.421  1.00 47.98 ? 442 GLN C CG  1 
ATOM   11044 C  CD  . GLN C 1 442 ? 23.481 119.353 69.627  1.00 47.62 ? 442 GLN C CD  1 
ATOM   11045 O  OE1 . GLN C 1 442 ? 22.319 119.353 69.208  1.00 47.88 ? 442 GLN C OE1 1 
ATOM   11046 N  NE2 . GLN C 1 442 ? 24.313 118.345 69.419  1.00 46.69 ? 442 GLN C NE2 1 
ATOM   11047 N  N   . VAL C 1 443 ? 27.631 120.705 73.430  1.00 49.17 ? 443 VAL C N   1 
ATOM   11048 C  CA  . VAL C 1 443 ? 28.749 120.149 74.196  1.00 49.41 ? 443 VAL C CA  1 
ATOM   11049 C  C   . VAL C 1 443 ? 28.522 120.295 75.696  1.00 49.87 ? 443 VAL C C   1 
ATOM   11050 O  O   . VAL C 1 443 ? 28.792 119.362 76.465  1.00 49.58 ? 443 VAL C O   1 
ATOM   11051 C  CB  . VAL C 1 443 ? 30.099 120.830 73.825  1.00 49.19 ? 443 VAL C CB  1 
ATOM   11052 C  CG1 . VAL C 1 443 ? 31.258 120.099 74.497  1.00 48.47 ? 443 VAL C CG1 1 
ATOM   11053 C  CG2 . VAL C 1 443 ? 30.289 120.833 72.310  1.00 49.13 ? 443 VAL C CG2 1 
ATOM   11054 N  N   . ARG C 1 444 ? 28.025 121.459 76.112  1.00 50.21 ? 444 ARG C N   1 
ATOM   11055 C  CA  . ARG C 1 444 ? 27.769 121.694 77.527  1.00 50.85 ? 444 ARG C CA  1 
ATOM   11056 C  C   . ARG C 1 444 ? 26.788 120.638 78.029  1.00 50.37 ? 444 ARG C C   1 
ATOM   11057 O  O   . ARG C 1 444 ? 26.956 120.082 79.119  1.00 49.89 ? 444 ARG C O   1 
ATOM   11058 C  CB  . ARG C 1 444 ? 27.193 123.098 77.752  1.00 52.80 ? 444 ARG C CB  1 
ATOM   11059 C  CG  . ARG C 1 444 ? 26.997 123.443 79.237  1.00 55.16 ? 444 ARG C CG  1 
ATOM   11060 C  CD  . ARG C 1 444 ? 26.520 124.880 79.486  1.00 57.53 ? 444 ARG C CD  1 
ATOM   11061 N  NE  . ARG C 1 444 ? 27.492 125.895 79.073  1.00 59.86 ? 444 ARG C NE  1 
ATOM   11062 C  CZ  . ARG C 1 444 ? 27.580 126.397 77.840  1.00 61.07 ? 444 ARG C CZ  1 
ATOM   11063 N  NH1 . ARG C 1 444 ? 26.750 125.981 76.893  1.00 62.11 ? 444 ARG C NH1 1 
ATOM   11064 N  NH2 . ARG C 1 444 ? 28.501 127.312 77.546  1.00 61.57 ? 444 ARG C NH2 1 
ATOM   11065 N  N   . ALA C 1 445 ? 25.771 120.355 77.220  1.00 49.95 ? 445 ALA C N   1 
ATOM   11066 C  CA  . ALA C 1 445 ? 24.771 119.349 77.571  1.00 50.04 ? 445 ALA C CA  1 
ATOM   11067 C  C   . ALA C 1 445 ? 25.472 118.035 77.892  1.00 50.22 ? 445 ALA C C   1 
ATOM   11068 O  O   . ALA C 1 445 ? 25.304 117.472 78.976  1.00 50.43 ? 445 ALA C O   1 
ATOM   11069 C  CB  . ALA C 1 445 ? 23.798 119.153 76.419  1.00 49.50 ? 445 ALA C CB  1 
ATOM   11070 N  N   . PHE C 1 446 ? 26.265 117.553 76.942  1.00 50.10 ? 446 PHE C N   1 
ATOM   11071 C  CA  . PHE C 1 446 ? 27.004 116.313 77.130  1.00 50.14 ? 446 PHE C CA  1 
ATOM   11072 C  C   . PHE C 1 446 ? 27.832 116.344 78.419  1.00 50.47 ? 446 PHE C C   1 
ATOM   11073 O  O   . PHE C 1 446 ? 27.761 115.419 79.227  1.00 50.56 ? 446 PHE C O   1 
ATOM   11074 C  CB  . PHE C 1 446 ? 27.932 116.079 75.935  1.00 49.30 ? 446 PHE C CB  1 
ATOM   11075 C  CG  . PHE C 1 446 ? 28.773 114.829 76.041  1.00 47.61 ? 446 PHE C CG  1 
ATOM   11076 C  CD1 . PHE C 1 446 ? 28.199 113.571 75.902  1.00 46.88 ? 446 PHE C CD1 1 
ATOM   11077 C  CD2 . PHE C 1 446 ? 30.148 114.917 76.246  1.00 46.35 ? 446 PHE C CD2 1 
ATOM   11078 C  CE1 . PHE C 1 446 ? 28.983 112.422 75.961  1.00 46.54 ? 446 PHE C CE1 1 
ATOM   11079 C  CE2 . PHE C 1 446 ? 30.941 113.778 76.308  1.00 45.50 ? 446 PHE C CE2 1 
ATOM   11080 C  CZ  . PHE C 1 446 ? 30.361 112.527 76.165  1.00 46.16 ? 446 PHE C CZ  1 
ATOM   11081 N  N   . TYR C 1 447 ? 28.600 117.414 78.614  1.00 51.20 ? 447 TYR C N   1 
ATOM   11082 C  CA  . TYR C 1 447 ? 29.469 117.536 79.790  1.00 52.10 ? 447 TYR C CA  1 
ATOM   11083 C  C   . TYR C 1 447 ? 28.763 117.531 81.139  1.00 52.64 ? 447 TYR C C   1 
ATOM   11084 O  O   . TYR C 1 447 ? 29.196 116.863 82.075  1.00 52.16 ? 447 TYR C O   1 
ATOM   11085 C  CB  . TYR C 1 447 ? 30.324 118.802 79.702  1.00 51.65 ? 447 TYR C CB  1 
ATOM   11086 C  CG  . TYR C 1 447 ? 31.383 118.901 80.787  1.00 51.49 ? 447 TYR C CG  1 
ATOM   11087 C  CD1 . TYR C 1 447 ? 31.486 120.039 81.588  1.00 51.56 ? 447 TYR C CD1 1 
ATOM   11088 C  CD2 . TYR C 1 447 ? 32.289 117.866 81.002  1.00 51.25 ? 447 TYR C CD2 1 
ATOM   11089 C  CE1 . TYR C 1 447 ? 32.466 120.147 82.580  1.00 51.71 ? 447 TYR C CE1 1 
ATOM   11090 C  CE2 . TYR C 1 447 ? 33.276 117.962 81.988  1.00 52.23 ? 447 TYR C CE2 1 
ATOM   11091 C  CZ  . TYR C 1 447 ? 33.359 119.106 82.776  1.00 52.16 ? 447 TYR C CZ  1 
ATOM   11092 O  OH  . TYR C 1 447 ? 34.329 119.208 83.757  1.00 52.12 ? 447 TYR C OH  1 
ATOM   11093 N  N   . VAL C 1 448 ? 27.677 118.282 81.242  1.00 53.69 ? 448 VAL C N   1 
ATOM   11094 C  CA  . VAL C 1 448 ? 26.962 118.354 82.500  1.00 54.61 ? 448 VAL C CA  1 
ATOM   11095 C  C   . VAL C 1 448 ? 25.827 117.333 82.636  1.00 55.03 ? 448 VAL C C   1 
ATOM   11096 O  O   . VAL C 1 448 ? 25.806 116.545 83.582  1.00 55.56 ? 448 VAL C O   1 
ATOM   11097 C  CB  . VAL C 1 448 ? 26.420 119.777 82.725  1.00 54.64 ? 448 VAL C CB  1 
ATOM   11098 C  CG1 . VAL C 1 448 ? 25.565 120.196 81.550  1.00 54.63 ? 448 VAL C CG1 1 
ATOM   11099 C  CG2 . VAL C 1 448 ? 25.626 119.826 84.025  1.00 54.73 ? 448 VAL C CG2 1 
ATOM   11100 N  N   . ASN C 1 449 ? 24.894 117.330 81.694  1.00 55.08 ? 449 ASN C N   1 
ATOM   11101 C  CA  . ASN C 1 449 ? 23.774 116.400 81.759  1.00 55.44 ? 449 ASN C CA  1 
ATOM   11102 C  C   . ASN C 1 449 ? 24.174 114.932 81.582  1.00 55.55 ? 449 ASN C C   1 
ATOM   11103 O  O   . ASN C 1 449 ? 24.101 114.139 82.530  1.00 55.94 ? 449 ASN C O   1 
ATOM   11104 C  CB  . ASN C 1 449 ? 22.724 116.780 80.709  1.00 55.77 ? 449 ASN C CB  1 
ATOM   11105 C  CG  . ASN C 1 449 ? 22.181 118.188 80.909  1.00 56.59 ? 449 ASN C CG  1 
ATOM   11106 O  OD1 . ASN C 1 449 ? 21.430 118.709 80.071  1.00 56.55 ? 449 ASN C OD1 1 
ATOM   11107 N  ND2 . ASN C 1 449 ? 22.557 118.815 82.027  1.00 56.76 ? 449 ASN C ND2 1 
ATOM   11108 N  N   . VAL C 1 450 ? 24.595 114.586 80.367  1.00 55.48 ? 450 VAL C N   1 
ATOM   11109 C  CA  . VAL C 1 450 ? 24.991 113.220 80.002  1.00 55.57 ? 450 VAL C CA  1 
ATOM   11110 C  C   . VAL C 1 450 ? 26.000 112.483 80.888  1.00 56.18 ? 450 VAL C C   1 
ATOM   11111 O  O   . VAL C 1 450 ? 25.780 111.318 81.260  1.00 56.08 ? 450 VAL C O   1 
ATOM   11112 C  CB  . VAL C 1 450 ? 25.560 113.177 78.571  1.00 55.01 ? 450 VAL C CB  1 
ATOM   11113 C  CG1 . VAL C 1 450 ? 26.000 111.755 78.229  1.00 53.38 ? 450 VAL C CG1 1 
ATOM   11114 C  CG2 . VAL C 1 450 ? 24.521 113.697 77.588  1.00 54.07 ? 450 VAL C CG2 1 
ATOM   11115 N  N   . LEU C 1 451 ? 27.110 113.142 81.203  1.00 56.15 ? 451 LEU C N   1 
ATOM   11116 C  CA  . LEU C 1 451 ? 28.146 112.514 82.018  1.00 56.71 ? 451 LEU C CA  1 
ATOM   11117 C  C   . LEU C 1 451 ? 27.979 112.710 83.520  1.00 57.23 ? 451 LEU C C   1 
ATOM   11118 O  O   . LEU C 1 451 ? 27.537 113.766 83.976  1.00 57.74 ? 451 LEU C O   1 
ATOM   11119 C  CB  . LEU C 1 451 ? 29.520 113.037 81.599  1.00 55.77 ? 451 LEU C CB  1 
ATOM   11120 C  CG  . LEU C 1 451 ? 29.859 112.876 80.116  1.00 55.39 ? 451 LEU C CG  1 
ATOM   11121 C  CD1 . LEU C 1 451 ? 31.202 113.517 79.834  1.00 54.91 ? 451 LEU C CD1 1 
ATOM   11122 C  CD2 . LEU C 1 451 ? 29.876 111.403 79.742  1.00 55.09 ? 451 LEU C CD2 1 
ATOM   11123 N  N   . ASN C 1 452 ? 28.323 111.682 84.287  1.00 57.58 ? 452 ASN C N   1 
ATOM   11124 C  CA  . ASN C 1 452 ? 28.253 111.783 85.735  1.00 58.60 ? 452 ASN C CA  1 
ATOM   11125 C  C   . ASN C 1 452 ? 29.599 112.360 86.161  1.00 59.83 ? 452 ASN C C   1 
ATOM   11126 O  O   . ASN C 1 452 ? 30.505 112.501 85.331  1.00 59.95 ? 452 ASN C O   1 
ATOM   11127 C  CB  . ASN C 1 452 ? 28.049 110.406 86.367  1.00 58.39 ? 452 ASN C CB  1 
ATOM   11128 C  CG  . ASN C 1 452 ? 29.080 109.393 85.907  1.00 58.34 ? 452 ASN C CG  1 
ATOM   11129 O  OD1 . ASN C 1 452 ? 30.269 109.709 85.782  1.00 58.40 ? 452 ASN C OD1 1 
ATOM   11130 N  ND2 . ASN C 1 452 ? 28.635 108.160 85.665  1.00 57.43 ? 452 ASN C ND2 1 
ATOM   11131 N  N   . GLU C 1 453 ? 29.744 112.687 87.442  1.00 60.93 ? 453 GLU C N   1 
ATOM   11132 C  CA  . GLU C 1 453 ? 31.000 113.255 87.931  1.00 61.78 ? 453 GLU C CA  1 
ATOM   11133 C  C   . GLU C 1 453 ? 32.208 112.379 87.577  1.00 61.48 ? 453 GLU C C   1 
ATOM   11134 O  O   . GLU C 1 453 ? 33.238 112.882 87.114  1.00 61.48 ? 453 GLU C O   1 
ATOM   11135 C  CB  . GLU C 1 453 ? 30.935 113.462 89.451  1.00 63.14 ? 453 GLU C CB  1 
ATOM   11136 C  CG  . GLU C 1 453 ? 32.057 114.342 90.000  1.00 65.02 ? 453 GLU C CG  1 
ATOM   11137 C  CD  . GLU C 1 453 ? 31.968 115.782 89.499  1.00 66.45 ? 453 GLU C CD  1 
ATOM   11138 O  OE1 . GLU C 1 453 ? 31.093 116.531 89.991  1.00 67.14 ? 453 GLU C OE1 1 
ATOM   11139 O  OE2 . GLU C 1 453 ? 32.764 116.165 88.606  1.00 67.03 ? 453 GLU C OE2 1 
ATOM   11140 N  N   . GLU C 1 454 ? 32.077 111.073 87.802  1.00 60.90 ? 454 GLU C N   1 
ATOM   11141 C  CA  . GLU C 1 454 ? 33.150 110.123 87.505  1.00 60.33 ? 454 GLU C CA  1 
ATOM   11142 C  C   . GLU C 1 454 ? 33.684 110.341 86.097  1.00 58.84 ? 454 GLU C C   1 
ATOM   11143 O  O   . GLU C 1 454 ? 34.883 110.542 85.891  1.00 58.32 ? 454 GLU C O   1 
ATOM   11144 C  CB  . GLU C 1 454 ? 32.634 108.682 87.630  1.00 61.75 ? 454 GLU C CB  1 
ATOM   11145 C  CG  . GLU C 1 454 ? 32.661 108.129 89.033  1.00 63.42 ? 454 GLU C CG  1 
ATOM   11146 C  CD  . GLU C 1 454 ? 34.084 107.995 89.559  1.00 65.65 ? 454 GLU C CD  1 
ATOM   11147 O  OE1 . GLU C 1 454 ? 34.772 109.044 89.707  1.00 65.40 ? 454 GLU C OE1 1 
ATOM   11148 O  OE2 . GLU C 1 454 ? 34.514 106.839 89.816  1.00 66.21 ? 454 GLU C OE2 1 
ATOM   11149 N  N   . GLN C 1 455 ? 32.769 110.297 85.136  1.00 57.32 ? 455 GLN C N   1 
ATOM   11150 C  CA  . GLN C 1 455 ? 33.090 110.482 83.734  1.00 55.83 ? 455 GLN C CA  1 
ATOM   11151 C  C   . GLN C 1 455 ? 33.859 111.770 83.437  1.00 55.81 ? 455 GLN C C   1 
ATOM   11152 O  O   . GLN C 1 455 ? 34.926 111.726 82.823  1.00 55.64 ? 455 GLN C O   1 
ATOM   11153 C  CB  . GLN C 1 455 ? 31.806 110.440 82.914  1.00 54.52 ? 455 GLN C CB  1 
ATOM   11154 C  CG  . GLN C 1 455 ? 31.510 109.077 82.343  1.00 53.28 ? 455 GLN C CG  1 
ATOM   11155 C  CD  . GLN C 1 455 ? 30.169 108.533 82.769  1.00 52.47 ? 455 GLN C CD  1 
ATOM   11156 O  OE1 . GLN C 1 455 ? 29.157 109.242 82.749  1.00 52.35 ? 455 GLN C OE1 1 
ATOM   11157 N  NE2 . GLN C 1 455 ? 30.145 107.254 83.139  1.00 52.03 ? 455 GLN C NE2 1 
ATOM   11158 N  N   . ARG C 1 456 ? 33.326 112.912 83.866  1.00 55.33 ? 456 ARG C N   1 
ATOM   11159 C  CA  . ARG C 1 456 ? 33.995 114.187 83.613  1.00 55.39 ? 456 ARG C CA  1 
ATOM   11160 C  C   . ARG C 1 456 ? 35.463 114.172 84.043  1.00 55.23 ? 456 ARG C C   1 
ATOM   11161 O  O   . ARG C 1 456 ? 36.334 114.633 83.305  1.00 55.16 ? 456 ARG C O   1 
ATOM   11162 C  CB  . ARG C 1 456 ? 33.282 115.342 84.334  1.00 55.55 ? 456 ARG C CB  1 
ATOM   11163 C  CG  . ARG C 1 456 ? 31.800 115.448 84.052  1.00 55.81 ? 456 ARG C CG  1 
ATOM   11164 C  CD  . ARG C 1 456 ? 31.213 116.758 84.560  1.00 56.11 ? 456 ARG C CD  1 
ATOM   11165 N  NE  . ARG C 1 456 ? 29.783 116.619 84.829  1.00 56.65 ? 456 ARG C NE  1 
ATOM   11166 C  CZ  . ARG C 1 456 ? 29.285 116.089 85.944  1.00 57.16 ? 456 ARG C CZ  1 
ATOM   11167 N  NH1 . ARG C 1 456 ? 30.106 115.661 86.897  1.00 56.75 ? 456 ARG C NH1 1 
ATOM   11168 N  NH2 . ARG C 1 456 ? 27.969 115.962 86.096  1.00 57.52 ? 456 ARG C NH2 1 
ATOM   11169 N  N   . LYS C 1 457 ? 35.730 113.654 85.240  1.00 55.02 ? 457 LYS C N   1 
ATOM   11170 C  CA  . LYS C 1 457 ? 37.090 113.599 85.763  1.00 54.89 ? 457 LYS C CA  1 
ATOM   11171 C  C   . LYS C 1 457 ? 37.995 112.785 84.846  1.00 54.12 ? 457 LYS C C   1 
ATOM   11172 O  O   . LYS C 1 457 ? 39.128 113.176 84.552  1.00 54.40 ? 457 LYS C O   1 
ATOM   11173 C  CB  . LYS C 1 457 ? 37.090 112.977 87.161  1.00 56.31 ? 457 LYS C CB  1 
ATOM   11174 C  CG  . LYS C 1 457 ? 38.481 112.814 87.787  1.00 58.34 ? 457 LYS C CG  1 
ATOM   11175 C  CD  . LYS C 1 457 ? 38.401 112.087 89.142  1.00 60.07 ? 457 LYS C CD  1 
ATOM   11176 C  CE  . LYS C 1 457 ? 39.761 112.024 89.856  1.00 60.76 ? 457 LYS C CE  1 
ATOM   11177 N  NZ  . LYS C 1 457 ? 40.765 111.167 89.157  1.00 61.07 ? 457 LYS C NZ  1 
ATOM   11178 N  N   . ARG C 1 458 ? 37.486 111.643 84.403  1.00 52.83 ? 458 ARG C N   1 
ATOM   11179 C  CA  . ARG C 1 458 ? 38.235 110.756 83.526  1.00 51.49 ? 458 ARG C CA  1 
ATOM   11180 C  C   . ARG C 1 458 ? 38.450 111.499 82.205  1.00 50.79 ? 458 ARG C C   1 
ATOM   11181 O  O   . ARG C 1 458 ? 39.512 111.420 81.597  1.00 50.72 ? 458 ARG C O   1 
ATOM   11182 C  CB  . ARG C 1 458 ? 37.432 109.460 83.322  1.00 51.29 ? 458 ARG C CB  1 
ATOM   11183 C  CG  . ARG C 1 458 ? 38.263 108.172 83.236  1.00 51.12 ? 458 ARG C CG  1 
ATOM   11184 C  CD  . ARG C 1 458 ? 37.580 107.017 83.967  1.00 50.86 ? 458 ARG C CD  1 
ATOM   11185 N  NE  . ARG C 1 458 ? 36.174 106.877 83.596  1.00 51.65 ? 458 ARG C NE  1 
ATOM   11186 C  CZ  . ARG C 1 458 ? 35.222 106.430 84.413  1.00 51.79 ? 458 ARG C CZ  1 
ATOM   11187 N  NH1 . ARG C 1 458 ? 35.519 106.073 85.660  1.00 52.51 ? 458 ARG C NH1 1 
ATOM   11188 N  NH2 . ARG C 1 458 ? 33.964 106.356 83.993  1.00 51.35 ? 458 ARG C NH2 1 
ATOM   11189 N  N   . LEU C 1 459 ? 37.438 112.244 81.781  1.00 50.24 ? 459 LEU C N   1 
ATOM   11190 C  CA  . LEU C 1 459 ? 37.522 113.005 80.546  1.00 49.75 ? 459 LEU C CA  1 
ATOM   11191 C  C   . LEU C 1 459 ? 38.646 114.032 80.639  1.00 50.42 ? 459 LEU C C   1 
ATOM   11192 O  O   . LEU C 1 459 ? 39.552 114.064 79.805  1.00 50.46 ? 459 LEU C O   1 
ATOM   11193 C  CB  . LEU C 1 459 ? 36.192 113.709 80.276  1.00 48.70 ? 459 LEU C CB  1 
ATOM   11194 C  CG  . LEU C 1 459 ? 36.106 114.603 79.040  1.00 48.26 ? 459 LEU C CG  1 
ATOM   11195 C  CD1 . LEU C 1 459 ? 36.609 113.855 77.821  1.00 47.72 ? 459 LEU C CD1 1 
ATOM   11196 C  CD2 . LEU C 1 459 ? 34.668 115.046 78.836  1.00 47.95 ? 459 LEU C CD2 1 
ATOM   11197 N  N   . CYS C 1 460 ? 38.591 114.876 81.663  1.00 51.07 ? 460 CYS C N   1 
ATOM   11198 C  CA  . CYS C 1 460 ? 39.612 115.900 81.838  1.00 50.83 ? 460 CYS C CA  1 
ATOM   11199 C  C   . CYS C 1 460 ? 40.993 115.253 81.858  1.00 50.46 ? 460 CYS C C   1 
ATOM   11200 O  O   . CYS C 1 460 ? 41.916 115.749 81.216  1.00 50.46 ? 460 CYS C O   1 
ATOM   11201 C  CB  . CYS C 1 460 ? 39.349 116.697 83.126  1.00 50.94 ? 460 CYS C CB  1 
ATOM   11202 S  SG  . CYS C 1 460 ? 37.789 117.674 83.096  1.00 52.83 ? 460 CYS C SG  1 
ATOM   11203 N  N   . GLU C 1 461 ? 41.117 114.130 82.567  1.00 50.21 ? 461 GLU C N   1 
ATOM   11204 C  CA  . GLU C 1 461 ? 42.385 113.404 82.673  1.00 50.35 ? 461 GLU C CA  1 
ATOM   11205 C  C   . GLU C 1 461 ? 42.909 112.892 81.336  1.00 49.11 ? 461 GLU C C   1 
ATOM   11206 O  O   . GLU C 1 461 ? 44.077 113.074 81.012  1.00 49.28 ? 461 GLU C O   1 
ATOM   11207 C  CB  . GLU C 1 461 ? 42.243 112.216 83.624  1.00 52.12 ? 461 GLU C CB  1 
ATOM   11208 C  CG  . GLU C 1 461 ? 42.026 112.596 85.071  1.00 55.30 ? 461 GLU C CG  1 
ATOM   11209 C  CD  . GLU C 1 461 ? 41.720 111.388 85.947  1.00 57.20 ? 461 GLU C CD  1 
ATOM   11210 O  OE1 . GLU C 1 461 ? 40.665 110.737 85.731  1.00 57.34 ? 461 GLU C OE1 1 
ATOM   11211 O  OE2 . GLU C 1 461 ? 42.540 111.091 86.849  1.00 58.26 ? 461 GLU C OE2 1 
ATOM   11212 N  N   . ASN C 1 462 ? 42.051 112.237 80.565  1.00 48.04 ? 462 ASN C N   1 
ATOM   11213 C  CA  . ASN C 1 462 ? 42.468 111.717 79.274  1.00 47.03 ? 462 ASN C CA  1 
ATOM   11214 C  C   . ASN C 1 462 ? 42.829 112.853 78.318  1.00 46.85 ? 462 ASN C C   1 
ATOM   11215 O  O   . ASN C 1 462 ? 43.629 112.671 77.403  1.00 47.00 ? 462 ASN C O   1 
ATOM   11216 C  CB  . ASN C 1 462 ? 41.372 110.843 78.659  1.00 46.69 ? 462 ASN C CB  1 
ATOM   11217 C  CG  . ASN C 1 462 ? 41.007 109.650 79.534  1.00 46.11 ? 462 ASN C CG  1 
ATOM   11218 O  OD1 . ASN C 1 462 ? 41.755 109.259 80.433  1.00 45.57 ? 462 ASN C OD1 1 
ATOM