data_1F62
# 
_entry.id   1F62 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.317 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F62         
RCSB  RCSB011287   
WWPDB D_1000011287 
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          2913 
_pdbx_database_related.details        'chemical shift list' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F62 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pascual, J.'         1 
'Martinez-Yamout, M.' 2 
'Dyson, H.J.'         3 
'Wright, P.E.'        4 
# 
_citation.id                        primary 
_citation.title                     'Structure of the PHD zinc finger from human Williams-Beuren syndrome transcription factor.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            304 
_citation.page_first                723 
_citation.page_last                 729 
_citation.year                      2000 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11124022 
_citation.pdbx_database_id_DOI      10.1006/jmbi.2000.4113 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pascual, J.'         1 ? 
primary 'Martinez-Yamout, M.' 2 ? 
primary 'Dyson, H.J.'         3 ? 
primary 'Wright, P.E.'        4 ? 
# 
_cell.entry_id           1F62 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1F62 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'TRANSCRIPTION FACTOR WSTF' 5822.804 1 ? ? 'PHD ZINC FINGER' ? 
2 non-polymer syn 'ZINC ION'                  65.409   2 ? ? ?                 ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_entity_poly.pdbx_seq_one_letter_code_can   ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  ARG n 
1 3  CYS n 
1 4  LYS n 
1 5  VAL n 
1 6  CYS n 
1 7  ARG n 
1 8  LYS n 
1 9  LYS n 
1 10 GLY n 
1 11 GLU n 
1 12 ASP n 
1 13 ASP n 
1 14 LYS n 
1 15 LEU n 
1 16 ILE n 
1 17 LEU n 
1 18 CYS n 
1 19 ASP n 
1 20 GLU n 
1 21 CYS n 
1 22 ASN n 
1 23 LYS n 
1 24 ALA n 
1 25 PHE n 
1 26 HIS n 
1 27 LEU n 
1 28 PHE n 
1 29 CYS n 
1 30 LEU n 
1 31 ARG n 
1 32 PRO n 
1 33 ALA n 
1 34 LEU n 
1 35 TYR n 
1 36 GLU n 
1 37 VAL n 
1 38 PRO n 
1 39 ASP n 
1 40 GLY n 
1 41 GLU n 
1 42 TRP n 
1 43 GLN n 
1 44 CYS n 
1 45 PRO n 
1 46 ALA n 
1 47 CYS n 
1 48 GLN n 
1 49 PRO n 
1 50 ALA n 
1 51 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BAZ1B_HUMAN 
_struct_ref.pdbx_db_accession          Q9UIG0 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ARCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPAT 
_struct_ref.pdbx_align_begin           1185 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1F62 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 51 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UIG0 
_struct_ref_seq.db_align_beg                  1185 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1235 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       51 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 2 2 3D_13C-separated_NOESY 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '50mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '1mM WSTF-PHD U-15N,13C;' 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker AMX 500 
2 ? Bruker DMX 750 
# 
_pdbx_nmr_refine.entry_id           1F62 
_pdbx_nmr_refine.method             
;Restrained molecular dynamics 
using AMBER-6 program
;
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1F62 
_pdbx_nmr_ensemble.conformers_calculated_total_number            20 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1F62 
_pdbx_nmr_representative.conformer_id         17 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
NMRPipe 1 processing           Delaglio 1 
DYANA   1 'structure solution' Guntert  2 
DYANA   1 refinement           Guntert  3 
# 
_exptl.entry_id          1F62 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1F62 
_struct.title                     WSTF-PHD 
_struct.pdbx_descriptor           WSTF-PHD 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F62 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'Zn-finger, TRANSCRIPTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       HIS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        26 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ARG 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        31 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        HIS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         26 
_struct_conf.end_auth_comp_id        ARG 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         31 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 6  SG  ? ? A ZN 52 A CYS 6  1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 3  SG  ? ? A ZN 52 A CYS 3  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A CYS 29 SG  ? ? A ZN 52 A CYS 29 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 26 ND1 ? ? A ZN 52 A HIS 26 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc5 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 21 SG  ? ? A ZN 53 A CYS 21 1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc6 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 47 SG  ? ? A ZN 53 A CYS 47 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc7 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 44 SG  ? ? A ZN 53 A CYS 44 1_555 ? ? ? ? ? ? ? 2.297 ? 
metalc8 metalc ? ? C ZN . ZN ? ? ? 1_555 A CYS 18 SG  ? ? A ZN 53 A CYS 18 1_555 ? ? ? ? ? ? ? 2.293 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 16 ? LEU A 17 ? ILE A 16 LEU A 17 
A 2 ALA A 24 ? PHE A 25 ? ALA A 24 PHE A 25 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   ILE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    16 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    ILE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     16 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    25 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     25 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 52' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 53' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 3  ? CYS A 3  . ? 1_555 ? 
2 AC1 4 CYS A 6  ? CYS A 6  . ? 1_555 ? 
3 AC1 4 HIS A 26 ? HIS A 26 . ? 1_555 ? 
4 AC1 4 CYS A 29 ? CYS A 29 . ? 1_555 ? 
5 AC2 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 
6 AC2 4 CYS A 21 ? CYS A 21 . ? 1_555 ? 
7 AC2 4 CYS A 44 ? CYS A 44 . ? 1_555 ? 
8 AC2 4 CYS A 47 ? CYS A 47 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F62 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F62 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . ALA A 1 1  ? 4.574  11.080  -4.391  1.00 0.00 ? 1  ALA A N    1  
ATOM   2     C  CA   . ALA A 1 1  ? 3.353  10.950  -5.206  1.00 0.00 ? 1  ALA A CA   1  
ATOM   3     C  C    . ALA A 1 1  ? 2.772  9.536   -5.099  1.00 0.00 ? 1  ALA A C    1  
ATOM   4     O  O    . ALA A 1 1  ? 1.773  9.330   -4.409  1.00 0.00 ? 1  ALA A O    1  
ATOM   5     C  CB   . ALA A 1 1  ? 3.617  11.354  -6.661  1.00 0.00 ? 1  ALA A CB   1  
ATOM   6     H  H1   . ALA A 1 1  ? 4.333  10.986  -3.409  1.00 0.00 ? 1  ALA A H1   1  
ATOM   7     H  H2   . ALA A 1 1  ? 5.243  10.370  -4.649  1.00 0.00 ? 1  ALA A H2   1  
ATOM   8     H  H3   . ALA A 1 1  ? 4.980  11.995  -4.531  1.00 0.00 ? 1  ALA A H3   1  
ATOM   9     H  HA   . ALA A 1 1  ? 2.618  11.650  -4.807  1.00 0.00 ? 1  ALA A HA   1  
ATOM   10    H  HB1  . ALA A 1 1  ? 4.415  10.749  -7.094  1.00 0.00 ? 1  ALA A HB1  1  
ATOM   11    H  HB2  . ALA A 1 1  ? 2.708  11.225  -7.250  1.00 0.00 ? 1  ALA A HB2  1  
ATOM   12    H  HB3  . ALA A 1 1  ? 3.915  12.403  -6.700  1.00 0.00 ? 1  ALA A HB3  1  
ATOM   13    N  N    . ARG A 1 2  ? 3.401  8.570   -5.782  1.00 0.00 ? 2  ARG A N    1  
ATOM   14    C  CA   . ARG A 1 2  ? 3.132  7.147   -5.634  1.00 0.00 ? 2  ARG A CA   1  
ATOM   15    C  C    . ARG A 1 2  ? 4.443  6.363   -5.615  1.00 0.00 ? 2  ARG A C    1  
ATOM   16    O  O    . ARG A 1 2  ? 5.476  6.837   -6.080  1.00 0.00 ? 2  ARG A O    1  
ATOM   17    C  CB   . ARG A 1 2  ? 2.216  6.646   -6.765  1.00 0.00 ? 2  ARG A CB   1  
ATOM   18    C  CG   . ARG A 1 2  ? 0.723  6.785   -6.443  1.00 0.00 ? 2  ARG A CG   1  
ATOM   19    C  CD   . ARG A 1 2  ? 0.287  5.759   -5.385  1.00 0.00 ? 2  ARG A CD   1  
ATOM   20    N  NE   . ARG A 1 2  ? -1.143 5.861   -5.066  1.00 0.00 ? 2  ARG A NE   1  
ATOM   21    C  CZ   . ARG A 1 2  ? -1.694 6.798   -4.274  1.00 0.00 ? 2  ARG A CZ   1  
ATOM   22    N  NH1  . ARG A 1 2  ? -0.956 7.811   -3.790  1.00 0.00 ? 2  ARG A NH1  1  
ATOM   23    N  NH2  . ARG A 1 2  ? -2.997 6.719   -3.967  1.00 0.00 ? 2  ARG A NH2  1  
ATOM   24    H  H    . ARG A 1 2  ? 4.201  8.810   -6.350  1.00 0.00 ? 2  ARG A H    1  
ATOM   25    H  HA   . ARG A 1 2  ? 2.672  6.979   -4.662  1.00 0.00 ? 2  ARG A HA   1  
ATOM   26    H  HB2  . ARG A 1 2  ? 2.441  7.202   -7.676  1.00 0.00 ? 2  ARG A HB2  1  
ATOM   27    H  HB3  . ARG A 1 2  ? 2.413  5.591   -6.964  1.00 0.00 ? 2  ARG A HB3  1  
ATOM   28    H  HG2  . ARG A 1 2  ? 0.512  7.802   -6.115  1.00 0.00 ? 2  ARG A HG2  1  
ATOM   29    H  HG3  . ARG A 1 2  ? 0.157  6.594   -7.356  1.00 0.00 ? 2  ARG A HG3  1  
ATOM   30    H  HD2  . ARG A 1 2  ? 0.474  4.755   -5.770  1.00 0.00 ? 2  ARG A HD2  1  
ATOM   31    H  HD3  . ARG A 1 2  ? 0.853  5.880   -4.464  1.00 0.00 ? 2  ARG A HD3  1  
ATOM   32    H  HE   . ARG A 1 2  ? -1.739 5.128   -5.428  1.00 0.00 ? 2  ARG A HE   1  
ATOM   33    H  HH11 . ARG A 1 2  ? 0.025  7.897   -4.028  1.00 0.00 ? 2  ARG A HH11 1  
ATOM   34    H  HH12 . ARG A 1 2  ? -1.380 8.511   -3.199  1.00 0.00 ? 2  ARG A HH12 1  
ATOM   35    H  HH21 . ARG A 1 2  ? -3.562 5.958   -4.322  1.00 0.00 ? 2  ARG A HH21 1  
ATOM   36    H  HH22 . ARG A 1 2  ? -3.426 7.415   -3.372  1.00 0.00 ? 2  ARG A HH22 1  
ATOM   37    N  N    . CYS A 1 3  ? 4.363  5.147   -5.071  1.00 0.00 ? 3  CYS A N    1  
ATOM   38    C  CA   . CYS A 1 3  ? 5.487  4.290   -4.735  1.00 0.00 ? 3  CYS A CA   1  
ATOM   39    C  C    . CYS A 1 3  ? 4.941  2.869   -4.655  1.00 0.00 ? 3  CYS A C    1  
ATOM   40    O  O    . CYS A 1 3  ? 3.912  2.657   -4.022  1.00 0.00 ? 3  CYS A O    1  
ATOM   41    C  CB   . CYS A 1 3  ? 6.025  4.726   -3.369  1.00 0.00 ? 3  CYS A CB   1  
ATOM   42    S  SG   . CYS A 1 3  ? 7.094  3.531   -2.530  1.00 0.00 ? 3  CYS A SG   1  
ATOM   43    H  H    . CYS A 1 3  ? 3.456  4.818   -4.773  1.00 0.00 ? 3  CYS A H    1  
ATOM   44    H  HA   . CYS A 1 3  ? 6.270  4.356   -5.492  1.00 0.00 ? 3  CYS A HA   1  
ATOM   45    H  HB2  . CYS A 1 3  ? 6.569  5.665   -3.484  1.00 0.00 ? 3  CYS A HB2  1  
ATOM   46    H  HB3  . CYS A 1 3  ? 5.168  4.895   -2.714  1.00 0.00 ? 3  CYS A HB3  1  
ATOM   47    N  N    . LYS A 1 4  ? 5.598  1.894   -5.290  1.00 0.00 ? 4  LYS A N    1  
ATOM   48    C  CA   . LYS A 1 4  ? 5.030  0.563   -5.442  1.00 0.00 ? 4  LYS A CA   1  
ATOM   49    C  C    . LYS A 1 4  ? 4.944  -0.187  -4.105  1.00 0.00 ? 4  LYS A C    1  
ATOM   50    O  O    . LYS A 1 4  ? 4.099  -1.069  -3.957  1.00 0.00 ? 4  LYS A O    1  
ATOM   51    C  CB   . LYS A 1 4  ? 5.815  -0.215  -6.502  1.00 0.00 ? 4  LYS A CB   1  
ATOM   52    C  CG   . LYS A 1 4  ? 5.671  0.450   -7.879  1.00 0.00 ? 4  LYS A CG   1  
ATOM   53    C  CD   . LYS A 1 4  ? 6.206  -0.457  -8.994  1.00 0.00 ? 4  LYS A CD   1  
ATOM   54    C  CE   . LYS A 1 4  ? 6.070  0.244   -10.354 1.00 0.00 ? 4  LYS A CE   1  
ATOM   55    N  NZ   . LYS A 1 4  ? 6.620  -0.564  -11.458 1.00 0.00 ? 4  LYS A NZ   1  
ATOM   56    H  H    . LYS A 1 4  ? 6.484  2.081   -5.741  1.00 0.00 ? 4  LYS A H    1  
ATOM   57    H  HA   . LYS A 1 4  ? 4.011  0.662   -5.812  1.00 0.00 ? 4  LYS A HA   1  
ATOM   58    H  HB2  . LYS A 1 4  ? 6.867  -0.266  -6.219  1.00 0.00 ? 4  LYS A HB2  1  
ATOM   59    H  HB3  . LYS A 1 4  ? 5.407  -1.222  -6.554  1.00 0.00 ? 4  LYS A HB3  1  
ATOM   60    H  HG2  . LYS A 1 4  ? 4.617  0.652   -8.075  1.00 0.00 ? 4  LYS A HG2  1  
ATOM   61    H  HG3  . LYS A 1 4  ? 6.217  1.394   -7.885  1.00 0.00 ? 4  LYS A HG3  1  
ATOM   62    H  HD2  . LYS A 1 4  ? 7.249  -0.690  -8.785  1.00 0.00 ? 4  LYS A HD2  1  
ATOM   63    H  HD3  . LYS A 1 4  ? 5.635  -1.388  -9.005  1.00 0.00 ? 4  LYS A HD3  1  
ATOM   64    H  HE2  . LYS A 1 4  ? 5.014  0.430   -10.556 1.00 0.00 ? 4  LYS A HE2  1  
ATOM   65    H  HE3  . LYS A 1 4  ? 6.598  1.197   -10.334 1.00 0.00 ? 4  LYS A HE3  1  
ATOM   66    H  HZ1  . LYS A 1 4  ? 6.148  -1.457  -11.482 1.00 0.00 ? 4  LYS A HZ1  1  
ATOM   67    H  HZ2  . LYS A 1 4  ? 6.470  -0.083  -12.335 1.00 0.00 ? 4  LYS A HZ2  1  
ATOM   68    H  HZ3  . LYS A 1 4  ? 7.613  -0.703  -11.332 1.00 0.00 ? 4  LYS A HZ3  1  
ATOM   69    N  N    . VAL A 1 5  ? 5.786  0.180   -3.129  1.00 0.00 ? 5  VAL A N    1  
ATOM   70    C  CA   . VAL A 1 5  ? 5.741  -0.347  -1.771  1.00 0.00 ? 5  VAL A CA   1  
ATOM   71    C  C    . VAL A 1 5  ? 4.449  0.079   -1.065  1.00 0.00 ? 5  VAL A C    1  
ATOM   72    O  O    . VAL A 1 5  ? 3.587  -0.759  -0.809  1.00 0.00 ? 5  VAL A O    1  
ATOM   73    C  CB   . VAL A 1 5  ? 6.998  0.083   -0.991  1.00 0.00 ? 5  VAL A CB   1  
ATOM   74    C  CG1  . VAL A 1 5  ? 7.010  -0.467  0.440   1.00 0.00 ? 5  VAL A CG1  1  
ATOM   75    C  CG2  . VAL A 1 5  ? 8.274  -0.382  -1.701  1.00 0.00 ? 5  VAL A CG2  1  
ATOM   76    H  H    . VAL A 1 5  ? 6.478  0.887   -3.329  1.00 0.00 ? 5  VAL A H    1  
ATOM   77    H  HA   . VAL A 1 5  ? 5.764  -1.435  -1.825  1.00 0.00 ? 5  VAL A HA   1  
ATOM   78    H  HB   . VAL A 1 5  ? 7.031  1.167   -0.927  1.00 0.00 ? 5  VAL A HB   1  
ATOM   79    H  HG11 . VAL A 1 5  ? 6.158  -0.090  1.005   1.00 0.00 ? 5  VAL A HG11 1  
ATOM   80    H  HG12 . VAL A 1 5  ? 6.974  -1.556  0.420   1.00 0.00 ? 5  VAL A HG12 1  
ATOM   81    H  HG13 . VAL A 1 5  ? 7.923  -0.147  0.947   1.00 0.00 ? 5  VAL A HG13 1  
ATOM   82    H  HG21 . VAL A 1 5  ? 8.250  -1.462  -1.843  1.00 0.00 ? 5  VAL A HG21 1  
ATOM   83    H  HG22 . VAL A 1 5  ? 8.375  0.105   -2.671  1.00 0.00 ? 5  VAL A HG22 1  
ATOM   84    H  HG23 . VAL A 1 5  ? 9.141  -0.124  -1.094  1.00 0.00 ? 5  VAL A HG23 1  
ATOM   85    N  N    . CYS A 1 6  ? 4.332  1.367   -0.716  1.00 0.00 ? 6  CYS A N    1  
ATOM   86    C  CA   . CYS A 1 6  ? 3.263  1.864   0.147   1.00 0.00 ? 6  CYS A CA   1  
ATOM   87    C  C    . CYS A 1 6  ? 2.007  2.235   -0.647  1.00 0.00 ? 6  CYS A C    1  
ATOM   88    O  O    . CYS A 1 6  ? 0.900  2.079   -0.135  1.00 0.00 ? 6  CYS A O    1  
ATOM   89    C  CB   . CYS A 1 6  ? 3.757  3.035   1.007   1.00 0.00 ? 6  CYS A CB   1  
ATOM   90    S  SG   . CYS A 1 6  ? 4.485  4.455   0.146   1.00 0.00 ? 6  CYS A SG   1  
ATOM   91    H  H    . CYS A 1 6  ? 5.054  2.011   -1.003  1.00 0.00 ? 6  CYS A H    1  
ATOM   92    H  HA   . CYS A 1 6  ? 2.981  1.072   0.845   1.00 0.00 ? 6  CYS A HA   1  
ATOM   93    H  HB2  . CYS A 1 6  ? 2.909  3.399   1.587   1.00 0.00 ? 6  CYS A HB2  1  
ATOM   94    H  HB3  . CYS A 1 6  ? 4.503  2.661   1.709   1.00 0.00 ? 6  CYS A HB3  1  
ATOM   95    N  N    . ARG A 1 7  ? 2.173  2.729   -1.881  1.00 0.00 ? 7  ARG A N    1  
ATOM   96    C  CA   . ARG A 1 7  ? 1.098  3.148   -2.776  1.00 0.00 ? 7  ARG A CA   1  
ATOM   97    C  C    . ARG A 1 7  ? 0.255  4.239   -2.116  1.00 0.00 ? 7  ARG A C    1  
ATOM   98    O  O    . ARG A 1 7  ? -0.970 4.149   -2.061  1.00 0.00 ? 7  ARG A O    1  
ATOM   99    C  CB   . ARG A 1 7  ? 0.277  1.940   -3.255  1.00 0.00 ? 7  ARG A CB   1  
ATOM   100   C  CG   . ARG A 1 7  ? 1.169  0.939   -4.006  1.00 0.00 ? 7  ARG A CG   1  
ATOM   101   C  CD   . ARG A 1 7  ? 0.378  -0.285  -4.480  1.00 0.00 ? 7  ARG A CD   1  
ATOM   102   N  NE   . ARG A 1 7  ? -0.218 -1.020  -3.356  1.00 0.00 ? 7  ARG A NE   1  
ATOM   103   C  CZ   . ARG A 1 7  ? 0.451  -1.806  -2.493  1.00 0.00 ? 7  ARG A CZ   1  
ATOM   104   N  NH1  . ARG A 1 7  ? 1.764  -2.037  -2.636  1.00 0.00 ? 7  ARG A NH1  1  
ATOM   105   N  NH2  . ARG A 1 7  ? -0.206 -2.364  -1.468  1.00 0.00 ? 7  ARG A NH2  1  
ATOM   106   H  H    . ARG A 1 7  ? 3.112  2.792   -2.250  1.00 0.00 ? 7  ARG A H    1  
ATOM   107   H  HA   . ARG A 1 7  ? 1.555  3.602   -3.654  1.00 0.00 ? 7  ARG A HA   1  
ATOM   108   H  HB2  . ARG A 1 7  ? -0.196 1.455   -2.400  1.00 0.00 ? 7  ARG A HB2  1  
ATOM   109   H  HB3  . ARG A 1 7  ? -0.504 2.288   -3.933  1.00 0.00 ? 7  ARG A HB3  1  
ATOM   110   H  HG2  . ARG A 1 7  ? 1.597  1.434   -4.879  1.00 0.00 ? 7  ARG A HG2  1  
ATOM   111   H  HG3  . ARG A 1 7  ? 1.985  0.611   -3.362  1.00 0.00 ? 7  ARG A HG3  1  
ATOM   112   H  HD2  . ARG A 1 7  ? -0.425 0.047   -5.140  1.00 0.00 ? 7  ARG A HD2  1  
ATOM   113   H  HD3  . ARG A 1 7  ? 1.036  -0.943  -5.050  1.00 0.00 ? 7  ARG A HD3  1  
ATOM   114   H  HE   . ARG A 1 7  ? -1.209 -0.889  -3.212  1.00 0.00 ? 7  ARG A HE   1  
ATOM   115   H  HH11 . ARG A 1 7  ? 2.293  -1.597  -3.379  1.00 0.00 ? 7  ARG A HH11 1  
ATOM   116   H  HH12 . ARG A 1 7  ? 2.263  -2.582  -1.947  1.00 0.00 ? 7  ARG A HH12 1  
ATOM   117   H  HH21 . ARG A 1 7  ? -1.193 -2.192  -1.343  1.00 0.00 ? 7  ARG A HH21 1  
ATOM   118   H  HH22 . ARG A 1 7  ? 0.284  -2.948  -0.805  1.00 0.00 ? 7  ARG A HH22 1  
ATOM   119   N  N    . LYS A 1 8  ? 0.941  5.279   -1.629  1.00 0.00 ? 8  LYS A N    1  
ATOM   120   C  CA   . LYS A 1 8  ? 0.381  6.319   -0.781  1.00 0.00 ? 8  LYS A CA   1  
ATOM   121   C  C    . LYS A 1 8  ? 1.062  7.644   -1.126  1.00 0.00 ? 8  LYS A C    1  
ATOM   122   O  O    . LYS A 1 8  ? 2.258  7.663   -1.416  1.00 0.00 ? 8  LYS A O    1  
ATOM   123   C  CB   . LYS A 1 8  ? 0.612  5.932   0.683   1.00 0.00 ? 8  LYS A CB   1  
ATOM   124   C  CG   . LYS A 1 8  ? -0.136 6.874   1.634   1.00 0.00 ? 8  LYS A CG   1  
ATOM   125   C  CD   . LYS A 1 8  ? 0.130  6.566   3.113   1.00 0.00 ? 8  LYS A CD   1  
ATOM   126   C  CE   . LYS A 1 8  ? 1.348  7.316   3.671   1.00 0.00 ? 8  LYS A CE   1  
ATOM   127   N  NZ   . LYS A 1 8  ? 2.625  6.848   3.105   1.00 0.00 ? 8  LYS A NZ   1  
ATOM   128   H  H    . LYS A 1 8  ? 1.942  5.303   -1.773  1.00 0.00 ? 8  LYS A H    1  
ATOM   129   H  HA   . LYS A 1 8  ? -0.691 6.413   -0.949  1.00 0.00 ? 8  LYS A HA   1  
ATOM   130   H  HB2  . LYS A 1 8  ? 0.233  4.920   0.843   1.00 0.00 ? 8  LYS A HB2  1  
ATOM   131   H  HB3  . LYS A 1 8  ? 1.684  5.943   0.872   1.00 0.00 ? 8  LYS A HB3  1  
ATOM   132   H  HG2  . LYS A 1 8  ? 0.126  7.911   1.439   1.00 0.00 ? 8  LYS A HG2  1  
ATOM   133   H  HG3  . LYS A 1 8  ? -1.204 6.756   1.447   1.00 0.00 ? 8  LYS A HG3  1  
ATOM   134   H  HD2  . LYS A 1 8  ? -0.739 6.905   3.679   1.00 0.00 ? 8  LYS A HD2  1  
ATOM   135   H  HD3  . LYS A 1 8  ? 0.231  5.491   3.265   1.00 0.00 ? 8  LYS A HD3  1  
ATOM   136   H  HE2  . LYS A 1 8  ? 1.229  8.383   3.475   1.00 0.00 ? 8  LYS A HE2  1  
ATOM   137   H  HE3  . LYS A 1 8  ? 1.380  7.160   4.749   1.00 0.00 ? 8  LYS A HE3  1  
ATOM   138   H  HZ1  . LYS A 1 8  ? 3.398  7.295   3.587   1.00 0.00 ? 8  LYS A HZ1  1  
ATOM   139   H  HZ2  . LYS A 1 8  ? 2.700  5.842   3.184   1.00 0.00 ? 8  LYS A HZ2  1  
ATOM   140   H  HZ3  . LYS A 1 8  ? 2.692  7.120   2.136   1.00 0.00 ? 8  LYS A HZ3  1  
ATOM   141   N  N    . LYS A 1 9  ? 0.289  8.736   -1.124  1.00 0.00 ? 9  LYS A N    1  
ATOM   142   C  CA   . LYS A 1 9  ? 0.792  10.097  -1.216  1.00 0.00 ? 9  LYS A CA   1  
ATOM   143   C  C    . LYS A 1 9  ? 0.942  10.637  0.207   1.00 0.00 ? 9  LYS A C    1  
ATOM   144   O  O    . LYS A 1 9  ? 0.022  10.500  1.013   1.00 0.00 ? 9  LYS A O    1  
ATOM   145   C  CB   . LYS A 1 9  ? -0.189 10.944  -2.040  1.00 0.00 ? 9  LYS A CB   1  
ATOM   146   C  CG   . LYS A 1 9  ? 0.397  12.337  -2.278  1.00 0.00 ? 9  LYS A CG   1  
ATOM   147   C  CD   . LYS A 1 9  ? -0.542 13.228  -3.094  1.00 0.00 ? 9  LYS A CD   1  
ATOM   148   C  CE   . LYS A 1 9  ? 0.163  14.521  -3.526  1.00 0.00 ? 9  LYS A CE   1  
ATOM   149   N  NZ   . LYS A 1 9  ? 0.738  15.260  -2.385  1.00 0.00 ? 9  LYS A NZ   1  
ATOM   150   H  H    . LYS A 1 9  ? -0.682 8.621   -0.876  1.00 0.00 ? 9  LYS A H    1  
ATOM   151   H  HA   . LYS A 1 9  ? 1.761  10.093  -1.722  1.00 0.00 ? 9  LYS A HA   1  
ATOM   152   H  HB2  . LYS A 1 9  ? -0.351 10.466  -3.007  1.00 0.00 ? 9  LYS A HB2  1  
ATOM   153   H  HB3  . LYS A 1 9  ? -1.142 11.026  -1.512  1.00 0.00 ? 9  LYS A HB3  1  
ATOM   154   H  HG2  . LYS A 1 9  ? 0.578  12.808  -1.312  1.00 0.00 ? 9  LYS A HG2  1  
ATOM   155   H  HG3  . LYS A 1 9  ? 1.339  12.224  -2.813  1.00 0.00 ? 9  LYS A HG3  1  
ATOM   156   H  HD2  . LYS A 1 9  ? -0.863 12.693  -3.989  1.00 0.00 ? 9  LYS A HD2  1  
ATOM   157   H  HD3  . LYS A 1 9  ? -1.423 13.467  -2.496  1.00 0.00 ? 9  LYS A HD3  1  
ATOM   158   H  HE2  . LYS A 1 9  ? 0.966  14.278  -4.223  1.00 0.00 ? 9  LYS A HE2  1  
ATOM   159   H  HE3  . LYS A 1 9  ? -0.557 15.161  -4.036  1.00 0.00 ? 9  LYS A HE3  1  
ATOM   160   H  HZ1  . LYS A 1 9  ? 1.465  14.701  -1.950  1.00 0.00 ? 9  LYS A HZ1  1  
ATOM   161   H  HZ2  . LYS A 1 9  ? 1.147  16.124  -2.713  1.00 0.00 ? 9  LYS A HZ2  1  
ATOM   162   H  HZ3  . LYS A 1 9  ? 0.018  15.464  -1.707  1.00 0.00 ? 9  LYS A HZ3  1  
ATOM   163   N  N    . GLY A 1 10 ? 2.096  11.234  0.522   1.00 0.00 ? 10 GLY A N    1  
ATOM   164   C  CA   . GLY A 1 10 ? 2.289  11.913  1.791   1.00 0.00 ? 10 GLY A CA   1  
ATOM   165   C  C    . GLY A 1 10 ? 3.728  12.392  1.931   1.00 0.00 ? 10 GLY A C    1  
ATOM   166   O  O    . GLY A 1 10 ? 3.982  13.595  1.927   1.00 0.00 ? 10 GLY A O    1  
ATOM   167   H  H    . GLY A 1 10 ? 2.818  11.324  -0.183  1.00 0.00 ? 10 GLY A H    1  
ATOM   168   H  HA2  . GLY A 1 10 ? 1.614  12.771  1.841   1.00 0.00 ? 10 GLY A HA2  1  
ATOM   169   H  HA3  . GLY A 1 10 ? 2.060  11.231  2.611   1.00 0.00 ? 10 GLY A HA3  1  
ATOM   170   N  N    . GLU A 1 11 ? 4.665  11.444  2.060   1.00 0.00 ? 11 GLU A N    1  
ATOM   171   C  CA   . GLU A 1 11 ? 6.093  11.710  2.206   1.00 0.00 ? 11 GLU A CA   1  
ATOM   172   C  C    . GLU A 1 11 ? 6.725  11.937  0.828   1.00 0.00 ? 11 GLU A C    1  
ATOM   173   O  O    . GLU A 1 11 ? 7.698  11.285  0.451   1.00 0.00 ? 11 GLU A O    1  
ATOM   174   C  CB   . GLU A 1 11 ? 6.776  10.599  3.027   1.00 0.00 ? 11 GLU A CB   1  
ATOM   175   C  CG   . GLU A 1 11 ? 6.694  9.166   2.467   1.00 0.00 ? 11 GLU A CG   1  
ATOM   176   C  CD   . GLU A 1 11 ? 5.326  8.517   2.649   1.00 0.00 ? 11 GLU A CD   1  
ATOM   177   O  OE1  . GLU A 1 11 ? 5.107  7.933   3.733   1.00 0.00 ? 11 GLU A OE1  1  
ATOM   178   O  OE2  . GLU A 1 11 ? 4.507  8.617   1.709   1.00 0.00 ? 11 GLU A OE2  1  
ATOM   179   H  H    . GLU A 1 11 ? 4.376  10.479  1.972   1.00 0.00 ? 11 GLU A H    1  
ATOM   180   H  HA   . GLU A 1 11 ? 6.218  12.632  2.777   1.00 0.00 ? 11 GLU A HA   1  
ATOM   181   H  HB2  . GLU A 1 11 ? 7.831  10.864  3.103   1.00 0.00 ? 11 GLU A HB2  1  
ATOM   182   H  HB3  . GLU A 1 11 ? 6.361  10.600  4.038   1.00 0.00 ? 11 GLU A HB3  1  
ATOM   183   H  HG2  . GLU A 1 11 ? 6.963  9.142   1.414   1.00 0.00 ? 11 GLU A HG2  1  
ATOM   184   H  HG3  . GLU A 1 11 ? 7.422  8.558   3.005   1.00 0.00 ? 11 GLU A HG3  1  
ATOM   185   N  N    . ASP A 1 12 ? 6.171  12.908  0.091   1.00 0.00 ? 12 ASP A N    1  
ATOM   186   C  CA   . ASP A 1 12 ? 6.447  13.156  -1.317  1.00 0.00 ? 12 ASP A CA   1  
ATOM   187   C  C    . ASP A 1 12 ? 7.708  14.008  -1.478  1.00 0.00 ? 12 ASP A C    1  
ATOM   188   O  O    . ASP A 1 12 ? 7.670  15.087  -2.067  1.00 0.00 ? 12 ASP A O    1  
ATOM   189   C  CB   . ASP A 1 12 ? 5.222  13.817  -1.969  1.00 0.00 ? 12 ASP A CB   1  
ATOM   190   C  CG   . ASP A 1 12 ? 3.917  13.074  -1.694  1.00 0.00 ? 12 ASP A CG   1  
ATOM   191   O  OD1  . ASP A 1 12 ? 3.919  11.826  -1.803  1.00 0.00 ? 12 ASP A OD1  1  
ATOM   192   O  OD2  . ASP A 1 12 ? 2.927  13.773  -1.389  1.00 0.00 ? 12 ASP A OD2  1  
ATOM   193   H  H    . ASP A 1 12 ? 5.436  13.454  0.518   1.00 0.00 ? 12 ASP A H    1  
ATOM   194   H  HA   . ASP A 1 12 ? 6.604  12.201  -1.811  1.00 0.00 ? 12 ASP A HA   1  
ATOM   195   H  HB2  . ASP A 1 12 ? 5.122  14.832  -1.580  1.00 0.00 ? 12 ASP A HB2  1  
ATOM   196   H  HB3  . ASP A 1 12 ? 5.374  13.869  -3.049  1.00 0.00 ? 12 ASP A HB3  1  
ATOM   197   N  N    . ASP A 1 13 ? 8.830  13.507  -0.952  1.00 0.00 ? 13 ASP A N    1  
ATOM   198   C  CA   . ASP A 1 13 ? 10.067 14.256  -0.817  1.00 0.00 ? 13 ASP A CA   1  
ATOM   199   C  C    . ASP A 1 13 ? 10.797 14.302  -2.160  1.00 0.00 ? 13 ASP A C    1  
ATOM   200   O  O    . ASP A 1 13 ? 10.709 15.296  -2.878  1.00 0.00 ? 13 ASP A O    1  
ATOM   201   C  CB   . ASP A 1 13 ? 10.897 13.627  0.311   1.00 0.00 ? 13 ASP A CB   1  
ATOM   202   C  CG   . ASP A 1 13 ? 12.299 14.217  0.397   1.00 0.00 ? 13 ASP A CG   1  
ATOM   203   O  OD1  . ASP A 1 13 ? 12.399 15.434  0.674   1.00 0.00 ? 13 ASP A OD1  1  
ATOM   204   O  OD2  . ASP A 1 13 ? 13.254 13.453  0.155   1.00 0.00 ? 13 ASP A OD2  1  
ATOM   205   H  H    . ASP A 1 13 ? 8.784  12.597  -0.515  1.00 0.00 ? 13 ASP A H    1  
ATOM   206   H  HA   . ASP A 1 13 ? 9.839  15.278  -0.520  1.00 0.00 ? 13 ASP A HA   1  
ATOM   207   H  HB2  . ASP A 1 13 ? 10.388 13.793  1.261   1.00 0.00 ? 13 ASP A HB2  1  
ATOM   208   H  HB3  . ASP A 1 13 ? 10.975 12.552  0.151   1.00 0.00 ? 13 ASP A HB3  1  
ATOM   209   N  N    . LYS A 1 14 ? 11.510 13.222  -2.496  1.00 0.00 ? 14 LYS A N    1  
ATOM   210   C  CA   . LYS A 1 14 ? 12.423 13.152  -3.628  1.00 0.00 ? 14 LYS A CA   1  
ATOM   211   C  C    . LYS A 1 14 ? 12.476 11.701  -4.105  1.00 0.00 ? 14 LYS A C    1  
ATOM   212   O  O    . LYS A 1 14 ? 13.445 10.992  -3.838  1.00 0.00 ? 14 LYS A O    1  
ATOM   213   C  CB   . LYS A 1 14 ? 13.820 13.657  -3.227  1.00 0.00 ? 14 LYS A CB   1  
ATOM   214   C  CG   . LYS A 1 14 ? 13.853 15.151  -2.877  1.00 0.00 ? 14 LYS A CG   1  
ATOM   215   C  CD   . LYS A 1 14 ? 15.285 15.678  -2.704  1.00 0.00 ? 14 LYS A CD   1  
ATOM   216   C  CE   . LYS A 1 14 ? 16.079 15.007  -1.573  1.00 0.00 ? 14 LYS A CE   1  
ATOM   217   N  NZ   . LYS A 1 14 ? 15.454 15.186  -0.250  1.00 0.00 ? 14 LYS A NZ   1  
ATOM   218   H  H    . LYS A 1 14 ? 11.517 12.450  -1.847  1.00 0.00 ? 14 LYS A H    1  
ATOM   219   H  HA   . LYS A 1 14 ? 12.061 13.766  -4.451  1.00 0.00 ? 14 LYS A HA   1  
ATOM   220   H  HB2  . LYS A 1 14 ? 14.161 13.081  -2.370  1.00 0.00 ? 14 LYS A HB2  1  
ATOM   221   H  HB3  . LYS A 1 14 ? 14.499 13.490  -4.066  1.00 0.00 ? 14 LYS A HB3  1  
ATOM   222   H  HG2  . LYS A 1 14 ? 13.385 15.711  -3.689  1.00 0.00 ? 14 LYS A HG2  1  
ATOM   223   H  HG3  . LYS A 1 14 ? 13.294 15.342  -1.963  1.00 0.00 ? 14 LYS A HG3  1  
ATOM   224   H  HD2  . LYS A 1 14 ? 15.827 15.532  -3.641  1.00 0.00 ? 14 LYS A HD2  1  
ATOM   225   H  HD3  . LYS A 1 14 ? 15.236 16.751  -2.508  1.00 0.00 ? 14 LYS A HD3  1  
ATOM   226   H  HE2  . LYS A 1 14 ? 16.191 13.942  -1.770  1.00 0.00 ? 14 LYS A HE2  1  
ATOM   227   H  HE3  . LYS A 1 14 ? 17.071 15.458  -1.547  1.00 0.00 ? 14 LYS A HE3  1  
ATOM   228   H  HZ1  . LYS A 1 14 ? 14.602 14.640  -0.188  1.00 0.00 ? 14 LYS A HZ1  1  
ATOM   229   H  HZ2  . LYS A 1 14 ? 16.095 14.865  0.469   1.00 0.00 ? 14 LYS A HZ2  1  
ATOM   230   H  HZ3  . LYS A 1 14 ? 15.245 16.160  -0.086  1.00 0.00 ? 14 LYS A HZ3  1  
ATOM   231   N  N    . LEU A 1 15 ? 11.425 11.249  -4.800  1.00 0.00 ? 15 LEU A N    1  
ATOM   232   C  CA   . LEU A 1 15 ? 11.251 9.840   -5.123  1.00 0.00 ? 15 LEU A CA   1  
ATOM   233   C  C    . LEU A 1 15 ? 12.288 9.387   -6.153  1.00 0.00 ? 15 LEU A C    1  
ATOM   234   O  O    . LEU A 1 15 ? 12.834 10.196  -6.903  1.00 0.00 ? 15 LEU A O    1  
ATOM   235   C  CB   . LEU A 1 15 ? 9.833  9.554   -5.640  1.00 0.00 ? 15 LEU A CB   1  
ATOM   236   C  CG   . LEU A 1 15 ? 8.764  9.545   -4.535  1.00 0.00 ? 15 LEU A CG   1  
ATOM   237   C  CD1  . LEU A 1 15 ? 8.393  10.949  -4.044  1.00 0.00 ? 15 LEU A CD1  1  
ATOM   238   C  CD2  . LEU A 1 15 ? 7.508  8.846   -5.062  1.00 0.00 ? 15 LEU A CD2  1  
ATOM   239   H  H    . LEU A 1 15 ? 10.683 11.890  -5.043  1.00 0.00 ? 15 LEU A H    1  
ATOM   240   H  HA   . LEU A 1 15 ? 11.409 9.256   -4.214  1.00 0.00 ? 15 LEU A HA   1  
ATOM   241   H  HB2  . LEU A 1 15 ? 9.563  10.262  -6.427  1.00 0.00 ? 15 LEU A HB2  1  
ATOM   242   H  HB3  . LEU A 1 15 ? 9.846  8.552   -6.075  1.00 0.00 ? 15 LEU A HB3  1  
ATOM   243   H  HG   . LEU A 1 15 ? 9.133  8.960   -3.695  1.00 0.00 ? 15 LEU A HG   1  
ATOM   244   H  HD11 . LEU A 1 15 ? 8.151  11.595  -4.888  1.00 0.00 ? 15 LEU A HD11 1  
ATOM   245   H  HD12 . LEU A 1 15 ? 7.523  10.878  -3.394  1.00 0.00 ? 15 LEU A HD12 1  
ATOM   246   H  HD13 . LEU A 1 15 ? 9.209  11.386  -3.470  1.00 0.00 ? 15 LEU A HD13 1  
ATOM   247   H  HD21 . LEU A 1 15 ? 7.763  7.830   -5.367  1.00 0.00 ? 15 LEU A HD21 1  
ATOM   248   H  HD22 . LEU A 1 15 ? 6.752  8.793   -4.278  1.00 0.00 ? 15 LEU A HD22 1  
ATOM   249   H  HD23 . LEU A 1 15 ? 7.105  9.389   -5.918  1.00 0.00 ? 15 LEU A HD23 1  
ATOM   250   N  N    . ILE A 1 16 ? 12.546 8.076   -6.168  1.00 0.00 ? 16 ILE A N    1  
ATOM   251   C  CA   . ILE A 1 16 ? 13.607 7.428   -6.916  1.00 0.00 ? 16 ILE A CA   1  
ATOM   252   C  C    . ILE A 1 16 ? 13.020 6.202   -7.618  1.00 0.00 ? 16 ILE A C    1  
ATOM   253   O  O    . ILE A 1 16 ? 12.357 5.380   -6.989  1.00 0.00 ? 16 ILE A O    1  
ATOM   254   C  CB   . ILE A 1 16 ? 14.783 7.089   -5.977  1.00 0.00 ? 16 ILE A CB   1  
ATOM   255   C  CG1  . ILE A 1 16 ? 15.884 6.346   -6.751  1.00 0.00 ? 16 ILE A CG1  1  
ATOM   256   C  CG2  . ILE A 1 16 ? 14.357 6.289   -4.733  1.00 0.00 ? 16 ILE A CG2  1  
ATOM   257   C  CD1  . ILE A 1 16 ? 17.239 6.424   -6.037  1.00 0.00 ? 16 ILE A CD1  1  
ATOM   258   H  H    . ILE A 1 16 ? 11.998 7.477   -5.564  1.00 0.00 ? 16 ILE A H    1  
ATOM   259   H  HA   . ILE A 1 16 ? 13.980 8.113   -7.680  1.00 0.00 ? 16 ILE A HA   1  
ATOM   260   H  HB   . ILE A 1 16 ? 15.193 8.040   -5.631  1.00 0.00 ? 16 ILE A HB   1  
ATOM   261   H  HG12 . ILE A 1 16 ? 15.603 5.298   -6.883  1.00 0.00 ? 16 ILE A HG12 1  
ATOM   262   H  HG13 . ILE A 1 16 ? 16.006 6.811   -7.732  1.00 0.00 ? 16 ILE A HG13 1  
ATOM   263   H  HG21 . ILE A 1 16 ? 13.922 5.331   -5.013  1.00 0.00 ? 16 ILE A HG21 1  
ATOM   264   H  HG22 . ILE A 1 16 ? 15.220 6.097   -4.101  1.00 0.00 ? 16 ILE A HG22 1  
ATOM   265   H  HG23 . ILE A 1 16 ? 13.637 6.855   -4.142  1.00 0.00 ? 16 ILE A HG23 1  
ATOM   266   H  HD11 . ILE A 1 16 ? 17.504 7.467   -5.862  1.00 0.00 ? 16 ILE A HD11 1  
ATOM   267   H  HD12 . ILE A 1 16 ? 17.215 5.888   -5.088  1.00 0.00 ? 16 ILE A HD12 1  
ATOM   268   H  HD13 . ILE A 1 16 ? 18.001 5.974   -6.670  1.00 0.00 ? 16 ILE A HD13 1  
ATOM   269   N  N    . LEU A 1 17 ? 13.231 6.103   -8.935  1.00 0.00 ? 17 LEU A N    1  
ATOM   270   C  CA   . LEU A 1 17 ? 12.931 4.908   -9.705  1.00 0.00 ? 17 LEU A CA   1  
ATOM   271   C  C    . LEU A 1 17 ? 14.188 4.045   -9.769  1.00 0.00 ? 17 LEU A C    1  
ATOM   272   O  O    . LEU A 1 17 ? 15.290 4.562   -9.953  1.00 0.00 ? 17 LEU A O    1  
ATOM   273   C  CB   . LEU A 1 17 ? 12.460 5.288   -11.116 1.00 0.00 ? 17 LEU A CB   1  
ATOM   274   C  CG   . LEU A 1 17 ? 10.952 5.586   -11.196 1.00 0.00 ? 17 LEU A CG   1  
ATOM   275   C  CD1  . LEU A 1 17 ? 10.537 6.792   -10.344 1.00 0.00 ? 17 LEU A CD1  1  
ATOM   276   C  CD2  . LEU A 1 17 ? 10.569 5.842   -12.658 1.00 0.00 ? 17 LEU A CD2  1  
ATOM   277   H  H    . LEU A 1 17 ? 13.753 6.825   -9.408  1.00 0.00 ? 17 LEU A H    1  
ATOM   278   H  HA   . LEU A 1 17 ? 12.140 4.334   -9.228  1.00 0.00 ? 17 LEU A HA   1  
ATOM   279   H  HB2  . LEU A 1 17 ? 13.033 6.143   -11.482 1.00 0.00 ? 17 LEU A HB2  1  
ATOM   280   H  HB3  . LEU A 1 17 ? 12.655 4.437   -11.771 1.00 0.00 ? 17 LEU A HB3  1  
ATOM   281   H  HG   . LEU A 1 17 ? 10.399 4.710   -10.855 1.00 0.00 ? 17 LEU A HG   1  
ATOM   282   H  HD11 . LEU A 1 17 ? 9.489  7.029   -10.530 1.00 0.00 ? 17 LEU A HD11 1  
ATOM   283   H  HD12 . LEU A 1 17 ? 10.649 6.568   -9.285  1.00 0.00 ? 17 LEU A HD12 1  
ATOM   284   H  HD13 . LEU A 1 17 ? 11.148 7.659   -10.599 1.00 0.00 ? 17 LEU A HD13 1  
ATOM   285   H  HD21 . LEU A 1 17 ? 9.495  6.013   -12.735 1.00 0.00 ? 17 LEU A HD21 1  
ATOM   286   H  HD22 . LEU A 1 17 ? 11.099 6.717   -13.036 1.00 0.00 ? 17 LEU A HD22 1  
ATOM   287   H  HD23 . LEU A 1 17 ? 10.829 4.975   -13.267 1.00 0.00 ? 17 LEU A HD23 1  
ATOM   288   N  N    . CYS A 1 18 ? 14.016 2.727   -9.627  1.00 0.00 ? 18 CYS A N    1  
ATOM   289   C  CA   . CYS A 1 18 ? 15.078 1.770   -9.885  1.00 0.00 ? 18 CYS A CA   1  
ATOM   290   C  C    . CYS A 1 18 ? 15.351 1.736   -11.388 1.00 0.00 ? 18 CYS A C    1  
ATOM   291   O  O    . CYS A 1 18 ? 14.449 1.437   -12.166 1.00 0.00 ? 18 CYS A O    1  
ATOM   292   C  CB   . CYS A 1 18 ? 14.656 0.390   -9.374  1.00 0.00 ? 18 CYS A CB   1  
ATOM   293   S  SG   . CYS A 1 18 ? 15.802 -0.943  -9.802  1.00 0.00 ? 18 CYS A SG   1  
ATOM   294   H  H    . CYS A 1 18 ? 13.094 2.371   -9.410  1.00 0.00 ? 18 CYS A H    1  
ATOM   295   H  HA   . CYS A 1 18 ? 15.978 2.072   -9.348  1.00 0.00 ? 18 CYS A HA   1  
ATOM   296   H  HB2  . CYS A 1 18 ? 14.580 0.442   -8.290  1.00 0.00 ? 18 CYS A HB2  1  
ATOM   297   H  HB3  . CYS A 1 18 ? 13.676 0.127   -9.775  1.00 0.00 ? 18 CYS A HB3  1  
ATOM   298   N  N    . ASP A 1 19 ? 16.590 2.037   -11.794 1.00 0.00 ? 19 ASP A N    1  
ATOM   299   C  CA   . ASP A 1 19 ? 17.002 2.049   -13.193 1.00 0.00 ? 19 ASP A CA   1  
ATOM   300   C  C    . ASP A 1 19 ? 16.692 0.713   -13.873 1.00 0.00 ? 19 ASP A C    1  
ATOM   301   O  O    . ASP A 1 19 ? 16.146 0.686   -14.974 1.00 0.00 ? 19 ASP A O    1  
ATOM   302   C  CB   . ASP A 1 19 ? 18.495 2.383   -13.275 1.00 0.00 ? 19 ASP A CB   1  
ATOM   303   C  CG   . ASP A 1 19 ? 18.978 2.436   -14.721 1.00 0.00 ? 19 ASP A CG   1  
ATOM   304   O  OD1  . ASP A 1 19 ? 18.743 3.488   -15.360 1.00 0.00 ? 19 ASP A OD1  1  
ATOM   305   O  OD2  . ASP A 1 19 ? 19.567 1.429   -15.163 1.00 0.00 ? 19 ASP A OD2  1  
ATOM   306   H  H    . ASP A 1 19 ? 17.294 2.251   -11.101 1.00 0.00 ? 19 ASP A H    1  
ATOM   307   H  HA   . ASP A 1 19 ? 16.445 2.834   -13.704 1.00 0.00 ? 19 ASP A HA   1  
ATOM   308   H  HB2  . ASP A 1 19 ? 18.672 3.355   -12.814 1.00 0.00 ? 19 ASP A HB2  1  
ATOM   309   H  HB3  . ASP A 1 19 ? 19.073 1.632   -12.733 1.00 0.00 ? 19 ASP A HB3  1  
ATOM   310   N  N    . GLU A 1 20 ? 17.023 -0.385  -13.187 1.00 0.00 ? 20 GLU A N    1  
ATOM   311   C  CA   . GLU A 1 20 ? 16.982 -1.737  -13.721 1.00 0.00 ? 20 GLU A CA   1  
ATOM   312   C  C    . GLU A 1 20 ? 15.555 -2.131  -14.120 1.00 0.00 ? 20 GLU A C    1  
ATOM   313   O  O    . GLU A 1 20 ? 15.304 -2.425  -15.287 1.00 0.00 ? 20 GLU A O    1  
ATOM   314   C  CB   . GLU A 1 20 ? 17.568 -2.697  -12.674 1.00 0.00 ? 20 GLU A CB   1  
ATOM   315   C  CG   . GLU A 1 20 ? 17.707 -4.131  -13.195 1.00 0.00 ? 20 GLU A CG   1  
ATOM   316   C  CD   . GLU A 1 20 ? 18.174 -5.073  -12.088 1.00 0.00 ? 20 GLU A CD   1  
ATOM   317   O  OE1  . GLU A 1 20 ? 19.240 -4.781  -11.501 1.00 0.00 ? 20 GLU A OE1  1  
ATOM   318   O  OE2  . GLU A 1 20 ? 17.446 -6.060  -11.837 1.00 0.00 ? 20 GLU A OE2  1  
ATOM   319   H  H    . GLU A 1 20 ? 17.446 -0.251  -12.282 1.00 0.00 ? 20 GLU A H    1  
ATOM   320   H  HA   . GLU A 1 20 ? 17.619 -1.769  -14.607 1.00 0.00 ? 20 GLU A HA   1  
ATOM   321   H  HB2  . GLU A 1 20 ? 18.560 -2.338  -12.386 1.00 0.00 ? 20 GLU A HB2  1  
ATOM   322   H  HB3  . GLU A 1 20 ? 16.930 -2.713  -11.790 1.00 0.00 ? 20 GLU A HB3  1  
ATOM   323   H  HG2  . GLU A 1 20 ? 16.747 -4.485  -13.572 1.00 0.00 ? 20 GLU A HG2  1  
ATOM   324   H  HG3  . GLU A 1 20 ? 18.432 -4.153  -14.010 1.00 0.00 ? 20 GLU A HG3  1  
ATOM   325   N  N    . CYS A 1 21 ? 14.634 -2.146  -13.147 1.00 0.00 ? 21 CYS A N    1  
ATOM   326   C  CA   . CYS A 1 21 ? 13.291 -2.703  -13.290 1.00 0.00 ? 21 CYS A CA   1  
ATOM   327   C  C    . CYS A 1 21 ? 12.174 -1.678  -13.047 1.00 0.00 ? 21 CYS A C    1  
ATOM   328   O  O    . CYS A 1 21 ? 11.033 -2.076  -12.812 1.00 0.00 ? 21 CYS A O    1  
ATOM   329   C  CB   . CYS A 1 21 ? 13.163 -3.925  -12.371 1.00 0.00 ? 21 CYS A CB   1  
ATOM   330   S  SG   . CYS A 1 21 ? 13.427 -3.602  -10.608 1.00 0.00 ? 21 CYS A SG   1  
ATOM   331   H  H    . CYS A 1 21 ? 14.907 -1.818  -12.233 1.00 0.00 ? 21 CYS A H    1  
ATOM   332   H  HA   . CYS A 1 21 ? 13.146 -3.065  -14.309 1.00 0.00 ? 21 CYS A HA   1  
ATOM   333   H  HB2  . CYS A 1 21 ? 12.172 -4.366  -12.494 1.00 0.00 ? 21 CYS A HB2  1  
ATOM   334   H  HB3  . CYS A 1 21 ? 13.903 -4.667  -12.683 1.00 0.00 ? 21 CYS A HB3  1  
ATOM   335   N  N    . ASN A 1 22 ? 12.484 -0.374  -13.113 1.00 0.00 ? 22 ASN A N    1  
ATOM   336   C  CA   . ASN A 1 22 ? 11.526 0.732   -13.130 1.00 0.00 ? 22 ASN A CA   1  
ATOM   337   C  C    . ASN A 1 22 ? 10.445 0.641   -12.045 1.00 0.00 ? 22 ASN A C    1  
ATOM   338   O  O    . ASN A 1 22 ? 9.278  0.947   -12.293 1.00 0.00 ? 22 ASN A O    1  
ATOM   339   C  CB   . ASN A 1 22 ? 10.977 0.951   -14.553 1.00 0.00 ? 22 ASN A CB   1  
ATOM   340   C  CG   . ASN A 1 22 ? 10.204 -0.243  -15.119 1.00 0.00 ? 22 ASN A CG   1  
ATOM   341   O  OD1  . ASN A 1 22 ? 10.745 -1.021  -15.901 1.00 0.00 ? 22 ASN A OD1  1  
ATOM   342   N  ND2  . ASN A 1 22 ? 8.929  -0.376  -14.750 1.00 0.00 ? 22 ASN A ND2  1  
ATOM   343   H  H    . ASN A 1 22 ? 13.461 -0.111  -13.163 1.00 0.00 ? 22 ASN A H    1  
ATOM   344   H  HA   . ASN A 1 22 ? 12.083 1.639   -12.896 1.00 0.00 ? 22 ASN A HA   1  
ATOM   345   H  HB2  . ASN A 1 22 ? 10.331 1.832   -14.561 1.00 0.00 ? 22 ASN A HB2  1  
ATOM   346   H  HB3  . ASN A 1 22 ? 11.825 1.149   -15.214 1.00 0.00 ? 22 ASN A HB3  1  
ATOM   347   H  HD21 . ASN A 1 22 ? 8.549  0.263   -14.064 1.00 0.00 ? 22 ASN A HD21 1  
ATOM   348   H  HD22 . ASN A 1 22 ? 8.374  -1.127  -15.138 1.00 0.00 ? 22 ASN A HD22 1  
ATOM   349   N  N    . LYS A 1 23 ? 10.837 0.245   -10.827 1.00 0.00 ? 23 LYS A N    1  
ATOM   350   C  CA   . LYS A 1 23 ? 9.989  0.314   -9.655  1.00 0.00 ? 23 LYS A CA   1  
ATOM   351   C  C    . LYS A 1 23 ? 10.187 1.663   -8.965  1.00 0.00 ? 23 LYS A C    1  
ATOM   352   O  O    . LYS A 1 23 ? 11.299 1.986   -8.550  1.00 0.00 ? 23 LYS A O    1  
ATOM   353   C  CB   . LYS A 1 23 ? 10.290 -0.862  -8.720  1.00 0.00 ? 23 LYS A CB   1  
ATOM   354   C  CG   . LYS A 1 23 ? 9.893  -2.205  -9.356  1.00 0.00 ? 23 LYS A CG   1  
ATOM   355   C  CD   . LYS A 1 23 ? 9.495  -3.255  -8.307  1.00 0.00 ? 23 LYS A CD   1  
ATOM   356   C  CE   . LYS A 1 23 ? 10.647 -3.713  -7.404  1.00 0.00 ? 23 LYS A CE   1  
ATOM   357   N  NZ   . LYS A 1 23 ? 11.607 -4.571  -8.120  1.00 0.00 ? 23 LYS A NZ   1  
ATOM   358   H  H    . LYS A 1 23 ? 11.787 -0.056  -10.678 1.00 0.00 ? 23 LYS A H    1  
ATOM   359   H  HA   . LYS A 1 23 ? 8.947  0.238   -9.955  1.00 0.00 ? 23 LYS A HA   1  
ATOM   360   H  HB2  . LYS A 1 23 ? 11.348 -0.873  -8.448  1.00 0.00 ? 23 LYS A HB2  1  
ATOM   361   H  HB3  . LYS A 1 23 ? 9.696  -0.700  -7.825  1.00 0.00 ? 23 LYS A HB3  1  
ATOM   362   H  HG2  . LYS A 1 23 ? 9.022  -2.054  -9.993  1.00 0.00 ? 23 LYS A HG2  1  
ATOM   363   H  HG3  . LYS A 1 23 ? 10.703 -2.571  -9.985  1.00 0.00 ? 23 LYS A HG3  1  
ATOM   364   H  HD2  . LYS A 1 23 ? 8.707  -2.836  -7.678  1.00 0.00 ? 23 LYS A HD2  1  
ATOM   365   H  HD3  . LYS A 1 23 ? 9.081  -4.126  -8.818  1.00 0.00 ? 23 LYS A HD3  1  
ATOM   366   H  HE2  . LYS A 1 23 ? 11.168 -2.849  -6.995  1.00 0.00 ? 23 LYS A HE2  1  
ATOM   367   H  HE3  . LYS A 1 23 ? 10.231 -4.292  -6.578  1.00 0.00 ? 23 LYS A HE3  1  
ATOM   368   H  HZ1  . LYS A 1 23 ? 11.131 -5.386  -8.481  1.00 0.00 ? 23 LYS A HZ1  1  
ATOM   369   H  HZ2  . LYS A 1 23 ? 12.023 -4.059  -8.887  1.00 0.00 ? 23 LYS A HZ2  1  
ATOM   370   H  HZ3  . LYS A 1 23 ? 12.335 -4.867  -7.484  1.00 0.00 ? 23 LYS A HZ3  1  
ATOM   371   N  N    . ALA A 1 24 ? 9.101  2.442   -8.856  1.00 0.00 ? 24 ALA A N    1  
ATOM   372   C  CA   . ALA A 1 24 ? 9.072  3.706   -8.135  1.00 0.00 ? 24 ALA A CA   1  
ATOM   373   C  C    . ALA A 1 24 ? 9.085  3.458   -6.629  1.00 0.00 ? 24 ALA A C    1  
ATOM   374   O  O    . ALA A 1 24 ? 8.324  2.630   -6.126  1.00 0.00 ? 24 ALA A O    1  
ATOM   375   C  CB   . ALA A 1 24 ? 7.836  4.512   -8.541  1.00 0.00 ? 24 ALA A CB   1  
ATOM   376   H  H    . ALA A 1 24 ? 8.229  2.116   -9.244  1.00 0.00 ? 24 ALA A H    1  
ATOM   377   H  HA   . ALA A 1 24 ? 9.950  4.288   -8.415  1.00 0.00 ? 24 ALA A HA   1  
ATOM   378   H  HB1  . ALA A 1 24 ? 7.840  5.473   -8.023  1.00 0.00 ? 24 ALA A HB1  1  
ATOM   379   H  HB2  . ALA A 1 24 ? 7.849  4.691   -9.617  1.00 0.00 ? 24 ALA A HB2  1  
ATOM   380   H  HB3  . ALA A 1 24 ? 6.927  3.969   -8.278  1.00 0.00 ? 24 ALA A HB3  1  
ATOM   381   N  N    . PHE A 1 25 ? 9.960  4.182   -5.926  1.00 0.00 ? 25 PHE A N    1  
ATOM   382   C  CA   . PHE A 1 25 ? 10.294 3.974   -4.528  1.00 0.00 ? 25 PHE A CA   1  
ATOM   383   C  C    . PHE A 1 25 ? 10.525 5.333   -3.871  1.00 0.00 ? 25 PHE A C    1  
ATOM   384   O  O    . PHE A 1 25 ? 11.051 6.243   -4.508  1.00 0.00 ? 25 PHE A O    1  
ATOM   385   C  CB   . PHE A 1 25 ? 11.578 3.128   -4.422  1.00 0.00 ? 25 PHE A CB   1  
ATOM   386   C  CG   . PHE A 1 25 ? 11.348 1.663   -4.106  1.00 0.00 ? 25 PHE A CG   1  
ATOM   387   C  CD1  . PHE A 1 25 ? 10.863 0.786   -5.093  1.00 0.00 ? 25 PHE A CD1  1  
ATOM   388   C  CD2  . PHE A 1 25 ? 11.639 1.171   -2.820  1.00 0.00 ? 25 PHE A CD2  1  
ATOM   389   C  CE1  . PHE A 1 25 ? 10.647 -0.569  -4.786  1.00 0.00 ? 25 PHE A CE1  1  
ATOM   390   C  CE2  . PHE A 1 25 ? 11.478 -0.193  -2.531  1.00 0.00 ? 25 PHE A CE2  1  
ATOM   391   C  CZ   . PHE A 1 25 ? 10.972 -1.063  -3.511  1.00 0.00 ? 25 PHE A CZ   1  
ATOM   392   H  H    . PHE A 1 25 ? 10.533 4.856   -6.418  1.00 0.00 ? 25 PHE A H    1  
ATOM   393   H  HA   . PHE A 1 25 ? 9.483  3.466   -4.009  1.00 0.00 ? 25 PHE A HA   1  
ATOM   394   H  HB2  . PHE A 1 25 ? 12.155 3.197   -5.347  1.00 0.00 ? 25 PHE A HB2  1  
ATOM   395   H  HB3  . PHE A 1 25 ? 12.206 3.544   -3.628  1.00 0.00 ? 25 PHE A HB3  1  
ATOM   396   H  HD1  . PHE A 1 25 ? 10.650 1.149   -6.085  1.00 0.00 ? 25 PHE A HD1  1  
ATOM   397   H  HD2  . PHE A 1 25 ? 11.987 1.842   -2.052  1.00 0.00 ? 25 PHE A HD2  1  
ATOM   398   H  HE1  . PHE A 1 25 ? 10.229 -1.231  -5.528  1.00 0.00 ? 25 PHE A HE1  1  
ATOM   399   H  HE2  . PHE A 1 25 ? 11.717 -0.567  -1.545  1.00 0.00 ? 25 PHE A HE2  1  
ATOM   400   H  HZ   . PHE A 1 25 ? 10.819 -2.108  -3.280  1.00 0.00 ? 25 PHE A HZ   1  
ATOM   401   N  N    . HIS A 1 26 ? 10.107 5.486   -2.610  1.00 0.00 ? 26 HIS A N    1  
ATOM   402   C  CA   . HIS A 1 26 ? 10.505 6.634   -1.809  1.00 0.00 ? 26 HIS A CA   1  
ATOM   403   C  C    . HIS A 1 26 ? 11.911 6.330   -1.294  1.00 0.00 ? 26 HIS A C    1  
ATOM   404   O  O    . HIS A 1 26 ? 12.277 5.164   -1.152  1.00 0.00 ? 26 HIS A O    1  
ATOM   405   C  CB   . HIS A 1 26 ? 9.562  6.843   -0.622  1.00 0.00 ? 26 HIS A CB   1  
ATOM   406   C  CG   . HIS A 1 26 ? 8.195  7.373   -0.964  1.00 0.00 ? 26 HIS A CG   1  
ATOM   407   N  ND1  . HIS A 1 26 ? 7.011  6.636   -0.918  1.00 0.00 ? 26 HIS A ND1  1  
ATOM   408   C  CD2  . HIS A 1 26 ? 7.905  8.680   -1.231  1.00 0.00 ? 26 HIS A CD2  1  
ATOM   409   C  CE1  . HIS A 1 26 ? 6.032  7.522   -1.162  1.00 0.00 ? 26 HIS A CE1  1  
ATOM   410   N  NE2  . HIS A 1 26 ? 6.537  8.754   -1.354  1.00 0.00 ? 26 HIS A NE2  1  
ATOM   411   H  H    . HIS A 1 26 ? 9.652  4.717   -2.140  1.00 0.00 ? 26 HIS A H    1  
ATOM   412   H  HA   . HIS A 1 26 ? 10.528 7.545   -2.409  1.00 0.00 ? 26 HIS A HA   1  
ATOM   413   H  HB2  . HIS A 1 26 ? 9.457  5.907   -0.083  1.00 0.00 ? 26 HIS A HB2  1  
ATOM   414   H  HB3  . HIS A 1 26 ? 10.025 7.561   0.052   1.00 0.00 ? 26 HIS A HB3  1  
ATOM   415   H  HD2  . HIS A 1 26 ? 8.607  9.499   -1.277  1.00 0.00 ? 26 HIS A HD2  1  
ATOM   416   H  HE1  . HIS A 1 26 ? 4.980  7.282   -1.187  1.00 0.00 ? 26 HIS A HE1  1  
ATOM   417   H  HE2  . HIS A 1 26 ? 6.001  9.595   -1.512  1.00 0.00 ? 26 HIS A HE2  1  
ATOM   418   N  N    . LEU A 1 27 ? 12.692 7.368   -0.987  1.00 0.00 ? 27 LEU A N    1  
ATOM   419   C  CA   . LEU A 1 27 ? 13.958 7.202   -0.286  1.00 0.00 ? 27 LEU A CA   1  
ATOM   420   C  C    . LEU A 1 27 ? 13.735 6.514   1.064   1.00 0.00 ? 27 LEU A C    1  
ATOM   421   O  O    . LEU A 1 27 ? 14.471 5.591   1.403   1.00 0.00 ? 27 LEU A O    1  
ATOM   422   C  CB   . LEU A 1 27 ? 14.659 8.556   -0.130  1.00 0.00 ? 27 LEU A CB   1  
ATOM   423   C  CG   . LEU A 1 27 ? 15.006 9.207   -1.481  1.00 0.00 ? 27 LEU A CG   1  
ATOM   424   C  CD1  . LEU A 1 27 ? 15.426 10.659  -1.250  1.00 0.00 ? 27 LEU A CD1  1  
ATOM   425   C  CD2  . LEU A 1 27 ? 16.154 8.493   -2.204  1.00 0.00 ? 27 LEU A CD2  1  
ATOM   426   H  H    . LEU A 1 27 ? 12.361 8.307   -1.154  1.00 0.00 ? 27 LEU A H    1  
ATOM   427   H  HA   . LEU A 1 27 ? 14.596 6.549   -0.877  1.00 0.00 ? 27 LEU A HA   1  
ATOM   428   H  HB2  . LEU A 1 27 ? 13.992 9.215   0.427   1.00 0.00 ? 27 LEU A HB2  1  
ATOM   429   H  HB3  . LEU A 1 27 ? 15.578 8.420   0.441   1.00 0.00 ? 27 LEU A HB3  1  
ATOM   430   H  HG   . LEU A 1 27 ? 14.128 9.203   -2.125  1.00 0.00 ? 27 LEU A HG   1  
ATOM   431   H  HD11 . LEU A 1 27 ? 14.619 11.208  -0.766  1.00 0.00 ? 27 LEU A HD11 1  
ATOM   432   H  HD12 . LEU A 1 27 ? 16.309 10.676  -0.616  1.00 0.00 ? 27 LEU A HD12 1  
ATOM   433   H  HD13 . LEU A 1 27 ? 15.664 11.135  -2.201  1.00 0.00 ? 27 LEU A HD13 1  
ATOM   434   H  HD21 . LEU A 1 27 ? 15.920 7.445   -2.374  1.00 0.00 ? 27 LEU A HD21 1  
ATOM   435   H  HD22 . LEU A 1 27 ? 16.323 8.969   -3.170  1.00 0.00 ? 27 LEU A HD22 1  
ATOM   436   H  HD23 . LEU A 1 27 ? 17.064 8.562   -1.610  1.00 0.00 ? 27 LEU A HD23 1  
ATOM   437   N  N    . PHE A 1 28 ? 12.686 6.915   1.793   1.00 0.00 ? 28 PHE A N    1  
ATOM   438   C  CA   . PHE A 1 28 ? 12.205 6.238   2.993   1.00 0.00 ? 28 PHE A CA   1  
ATOM   439   C  C    . PHE A 1 28 ? 12.010 4.732   2.774   1.00 0.00 ? 28 PHE A C    1  
ATOM   440   O  O    . PHE A 1 28 ? 12.568 3.922   3.511   1.00 0.00 ? 28 PHE A O    1  
ATOM   441   C  CB   . PHE A 1 28 ? 10.895 6.888   3.454   1.00 0.00 ? 28 PHE A CB   1  
ATOM   442   C  CG   . PHE A 1 28 ? 10.985 8.382   3.703   1.00 0.00 ? 28 PHE A CG   1  
ATOM   443   C  CD1  . PHE A 1 28 ? 11.530 8.863   4.907   1.00 0.00 ? 28 PHE A CD1  1  
ATOM   444   C  CD2  . PHE A 1 28 ? 10.503 9.295   2.744   1.00 0.00 ? 28 PHE A CD2  1  
ATOM   445   C  CE1  . PHE A 1 28 ? 11.570 10.245  5.163   1.00 0.00 ? 28 PHE A CE1  1  
ATOM   446   C  CE2  . PHE A 1 28 ? 10.576 10.677  2.984   1.00 0.00 ? 28 PHE A CE2  1  
ATOM   447   C  CZ   . PHE A 1 28 ? 11.092 11.153  4.201   1.00 0.00 ? 28 PHE A CZ   1  
ATOM   448   H  H    . PHE A 1 28 ? 12.172 7.727   1.482   1.00 0.00 ? 28 PHE A H    1  
ATOM   449   H  HA   . PHE A 1 28 ? 12.946 6.380   3.781   1.00 0.00 ? 28 PHE A HA   1  
ATOM   450   H  HB2  . PHE A 1 28 ? 10.129 6.702   2.702   1.00 0.00 ? 28 PHE A HB2  1  
ATOM   451   H  HB3  . PHE A 1 28 ? 10.575 6.402   4.377   1.00 0.00 ? 28 PHE A HB3  1  
ATOM   452   H  HD1  . PHE A 1 28 ? 11.905 8.169   5.645   1.00 0.00 ? 28 PHE A HD1  1  
ATOM   453   H  HD2  . PHE A 1 28 ? 10.055 8.945   1.828   1.00 0.00 ? 28 PHE A HD2  1  
ATOM   454   H  HE1  . PHE A 1 28 ? 11.966 10.611  6.099   1.00 0.00 ? 28 PHE A HE1  1  
ATOM   455   H  HE2  . PHE A 1 28 ? 10.207 11.371  2.244   1.00 0.00 ? 28 PHE A HE2  1  
ATOM   456   H  HZ   . PHE A 1 28 ? 11.106 12.214  4.399   1.00 0.00 ? 28 PHE A HZ   1  
ATOM   457   N  N    . CYS A 1 29 ? 11.198 4.359   1.776   1.00 0.00 ? 29 CYS A N    1  
ATOM   458   C  CA   . CYS A 1 29 ? 10.784 2.979   1.535   1.00 0.00 ? 29 CYS A CA   1  
ATOM   459   C  C    . CYS A 1 29 ? 11.955 2.129   1.031   1.00 0.00 ? 29 CYS A C    1  
ATOM   460   O  O    . CYS A 1 29 ? 12.022 0.937   1.326   1.00 0.00 ? 29 CYS A O    1  
ATOM   461   C  CB   . CYS A 1 29 ? 9.623  2.949   0.533   1.00 0.00 ? 29 CYS A CB   1  
ATOM   462   S  SG   . CYS A 1 29 ? 8.116  3.801   1.077   1.00 0.00 ? 29 CYS A SG   1  
ATOM   463   H  H    . CYS A 1 29 ? 10.832 5.072   1.163   1.00 0.00 ? 29 CYS A H    1  
ATOM   464   H  HA   . CYS A 1 29 ? 10.428 2.550   2.474   1.00 0.00 ? 29 CYS A HA   1  
ATOM   465   H  HB2  . CYS A 1 29 ? 9.956  3.403   -0.401  1.00 0.00 ? 29 CYS A HB2  1  
ATOM   466   H  HB3  . CYS A 1 29 ? 9.359  1.910   0.331   1.00 0.00 ? 29 CYS A HB3  1  
ATOM   467   N  N    . LEU A 1 30 ? 12.875 2.743   0.277   1.00 0.00 ? 30 LEU A N    1  
ATOM   468   C  CA   . LEU A 1 30 ? 14.146 2.151   -0.114  1.00 0.00 ? 30 LEU A CA   1  
ATOM   469   C  C    . LEU A 1 30 ? 14.950 1.791   1.135   1.00 0.00 ? 30 LEU A C    1  
ATOM   470   O  O    . LEU A 1 30 ? 15.331 0.635   1.314   1.00 0.00 ? 30 LEU A O    1  
ATOM   471   C  CB   . LEU A 1 30 ? 14.867 3.125   -1.064  1.00 0.00 ? 30 LEU A CB   1  
ATOM   472   C  CG   . LEU A 1 30 ? 16.094 2.562   -1.797  1.00 0.00 ? 30 LEU A CG   1  
ATOM   473   C  CD1  . LEU A 1 30 ? 16.506 3.543   -2.902  1.00 0.00 ? 30 LEU A CD1  1  
ATOM   474   C  CD2  . LEU A 1 30 ? 17.291 2.347   -0.862  1.00 0.00 ? 30 LEU A CD2  1  
ATOM   475   H  H    . LEU A 1 30 ? 12.723 3.710   0.023   1.00 0.00 ? 30 LEU A H    1  
ATOM   476   H  HA   . LEU A 1 30 ? 13.940 1.235   -0.659  1.00 0.00 ? 30 LEU A HA   1  
ATOM   477   H  HB2  . LEU A 1 30 ? 14.146 3.408   -1.834  1.00 0.00 ? 30 LEU A HB2  1  
ATOM   478   H  HB3  . LEU A 1 30 ? 15.164 4.022   -0.525  1.00 0.00 ? 30 LEU A HB3  1  
ATOM   479   H  HG   . LEU A 1 30 ? 15.814 1.624   -2.273  1.00 0.00 ? 30 LEU A HG   1  
ATOM   480   H  HD11 . LEU A 1 30 ? 17.372 3.158   -3.441  1.00 0.00 ? 30 LEU A HD11 1  
ATOM   481   H  HD12 . LEU A 1 30 ? 15.687 3.669   -3.610  1.00 0.00 ? 30 LEU A HD12 1  
ATOM   482   H  HD13 . LEU A 1 30 ? 16.760 4.511   -2.468  1.00 0.00 ? 30 LEU A HD13 1  
ATOM   483   H  HD21 . LEU A 1 30 ? 17.383 3.186   -0.174  1.00 0.00 ? 30 LEU A HD21 1  
ATOM   484   H  HD22 . LEU A 1 30 ? 17.174 1.421   -0.303  1.00 0.00 ? 30 LEU A HD22 1  
ATOM   485   H  HD23 . LEU A 1 30 ? 18.213 2.273   -1.437  1.00 0.00 ? 30 LEU A HD23 1  
ATOM   486   N  N    . ARG A 1 31 ? 15.184 2.779   2.003   1.00 0.00 ? 31 ARG A N    1  
ATOM   487   C  CA   . ARG A 1 31 ? 15.997 2.638   3.203   1.00 0.00 ? 31 ARG A CA   1  
ATOM   488   C  C    . ARG A 1 31 ? 15.590 3.735   4.194   1.00 0.00 ? 31 ARG A C    1  
ATOM   489   O  O    . ARG A 1 31 ? 15.676 4.910   3.850   1.00 0.00 ? 31 ARG A O    1  
ATOM   490   C  CB   . ARG A 1 31 ? 17.478 2.731   2.804   1.00 0.00 ? 31 ARG A CB   1  
ATOM   491   C  CG   . ARG A 1 31 ? 18.435 2.520   3.983   1.00 0.00 ? 31 ARG A CG   1  
ATOM   492   C  CD   . ARG A 1 31 ? 19.901 2.637   3.549   1.00 0.00 ? 31 ARG A CD   1  
ATOM   493   N  NE   . ARG A 1 31 ? 20.276 1.595   2.577   1.00 0.00 ? 31 ARG A NE   1  
ATOM   494   C  CZ   . ARG A 1 31 ? 20.451 1.754   1.251   1.00 0.00 ? 31 ARG A CZ   1  
ATOM   495   N  NH1  . ARG A 1 31 ? 20.255 2.938   0.655   1.00 0.00 ? 31 ARG A NH1  1  
ATOM   496   N  NH2  . ARG A 1 31 ? 20.830 0.704   0.510   1.00 0.00 ? 31 ARG A NH2  1  
ATOM   497   H  H    . ARG A 1 31 ? 14.808 3.694   1.789   1.00 0.00 ? 31 ARG A H    1  
ATOM   498   H  HA   . ARG A 1 31 ? 15.814 1.651   3.626   1.00 0.00 ? 31 ARG A HA   1  
ATOM   499   H  HB2  . ARG A 1 31 ? 17.677 1.959   2.062   1.00 0.00 ? 31 ARG A HB2  1  
ATOM   500   H  HB3  . ARG A 1 31 ? 17.668 3.703   2.351   1.00 0.00 ? 31 ARG A HB3  1  
ATOM   501   H  HG2  . ARG A 1 31 ? 18.244 3.273   4.749   1.00 0.00 ? 31 ARG A HG2  1  
ATOM   502   H  HG3  . ARG A 1 31 ? 18.269 1.530   4.409   1.00 0.00 ? 31 ARG A HG3  1  
ATOM   503   H  HD2  . ARG A 1 31 ? 20.093 3.640   3.168   1.00 0.00 ? 31 ARG A HD2  1  
ATOM   504   H  HD3  . ARG A 1 31 ? 20.525 2.500   4.434   1.00 0.00 ? 31 ARG A HD3  1  
ATOM   505   H  HE   . ARG A 1 31 ? 20.432 0.674   2.963   1.00 0.00 ? 31 ARG A HE   1  
ATOM   506   H  HH11 . ARG A 1 31 ? 19.951 3.741   1.183   1.00 0.00 ? 31 ARG A HH11 1  
ATOM   507   H  HH12 . ARG A 1 31 ? 20.400 3.023   -0.346  1.00 0.00 ? 31 ARG A HH12 1  
ATOM   508   H  HH21 . ARG A 1 31 ? 20.968 -0.202  0.933   1.00 0.00 ? 31 ARG A HH21 1  
ATOM   509   H  HH22 . ARG A 1 31 ? 20.996 0.812   -0.487  1.00 0.00 ? 31 ARG A HH22 1  
ATOM   510   N  N    . PRO A 1 32 ? 15.165 3.392   5.423   1.00 0.00 ? 32 PRO A N    1  
ATOM   511   C  CA   . PRO A 1 32 ? 14.550 4.335   6.352   1.00 0.00 ? 32 PRO A CA   1  
ATOM   512   C  C    . PRO A 1 32 ? 15.480 5.489   6.748   1.00 0.00 ? 32 PRO A C    1  
ATOM   513   O  O    . PRO A 1 32 ? 14.998 6.575   7.059   1.00 0.00 ? 32 PRO A O    1  
ATOM   514   C  CB   . PRO A 1 32 ? 14.152 3.497   7.571   1.00 0.00 ? 32 PRO A CB   1  
ATOM   515   C  CG   . PRO A 1 32 ? 15.196 2.382   7.577   1.00 0.00 ? 32 PRO A CG   1  
ATOM   516   C  CD   . PRO A 1 32 ? 15.418 2.123   6.087   1.00 0.00 ? 32 PRO A CD   1  
ATOM   517   H  HA   . PRO A 1 32 ? 13.648 4.758   5.907   1.00 0.00 ? 32 PRO A HA   1  
ATOM   518   H  HB2  . PRO A 1 32 ? 14.152 4.071   8.499   1.00 0.00 ? 32 PRO A HB2  1  
ATOM   519   H  HB3  . PRO A 1 32 ? 13.167 3.060   7.399   1.00 0.00 ? 32 PRO A HB3  1  
ATOM   520   H  HG2  . PRO A 1 32 ? 16.119 2.749   8.028   1.00 0.00 ? 32 PRO A HG2  1  
ATOM   521   H  HG3  . PRO A 1 32 ? 14.848 1.492   8.104   1.00 0.00 ? 32 PRO A HG3  1  
ATOM   522   H  HD2  . PRO A 1 32 ? 16.432 1.761   5.922   1.00 0.00 ? 32 PRO A HD2  1  
ATOM   523   H  HD3  . PRO A 1 32 ? 14.693 1.387   5.735   1.00 0.00 ? 32 PRO A HD3  1  
ATOM   524   N  N    . ALA A 1 33 ? 16.800 5.260   6.740   1.00 0.00 ? 33 ALA A N    1  
ATOM   525   C  CA   . ALA A 1 33 ? 17.808 6.276   7.022   1.00 0.00 ? 33 ALA A CA   1  
ATOM   526   C  C    . ALA A 1 33 ? 18.003 7.264   5.863   1.00 0.00 ? 33 ALA A C    1  
ATOM   527   O  O    . ALA A 1 33 ? 18.513 8.360   6.081   1.00 0.00 ? 33 ALA A O    1  
ATOM   528   C  CB   . ALA A 1 33 ? 19.131 5.579   7.353   1.00 0.00 ? 33 ALA A CB   1  
ATOM   529   H  H    . ALA A 1 33 ? 17.128 4.336   6.502   1.00 0.00 ? 33 ALA A H    1  
ATOM   530   H  HA   . ALA A 1 33 ? 17.505 6.837   7.906   1.00 0.00 ? 33 ALA A HA   1  
ATOM   531   H  HB1  . ALA A 1 33 ? 19.884 6.323   7.617   1.00 0.00 ? 33 ALA A HB1  1  
ATOM   532   H  HB2  . ALA A 1 33 ? 18.992 4.903   8.198   1.00 0.00 ? 33 ALA A HB2  1  
ATOM   533   H  HB3  . ALA A 1 33 ? 19.480 5.009   6.491   1.00 0.00 ? 33 ALA A HB3  1  
ATOM   534   N  N    . LEU A 1 34 ? 17.639 6.876   4.635   1.00 0.00 ? 34 LEU A N    1  
ATOM   535   C  CA   . LEU A 1 34 ? 17.960 7.610   3.420   1.00 0.00 ? 34 LEU A CA   1  
ATOM   536   C  C    . LEU A 1 34 ? 16.917 8.706   3.185   1.00 0.00 ? 34 LEU A C    1  
ATOM   537   O  O    . LEU A 1 34 ? 15.720 8.427   3.124   1.00 0.00 ? 34 LEU A O    1  
ATOM   538   C  CB   . LEU A 1 34 ? 18.020 6.617   2.252   1.00 0.00 ? 34 LEU A CB   1  
ATOM   539   C  CG   . LEU A 1 34 ? 18.478 7.214   0.914   1.00 0.00 ? 34 LEU A CG   1  
ATOM   540   C  CD1  . LEU A 1 34 ? 19.970 7.570   0.933   1.00 0.00 ? 34 LEU A CD1  1  
ATOM   541   C  CD2  . LEU A 1 34 ? 18.205 6.177   -0.181  1.00 0.00 ? 34 LEU A CD2  1  
ATOM   542   H  H    . LEU A 1 34 ? 17.127 6.012   4.524   1.00 0.00 ? 34 LEU A H    1  
ATOM   543   H  HA   . LEU A 1 34 ? 18.948 8.054   3.541   1.00 0.00 ? 34 LEU A HA   1  
ATOM   544   H  HB2  . LEU A 1 34 ? 18.699 5.806   2.518   1.00 0.00 ? 34 LEU A HB2  1  
ATOM   545   H  HB3  . LEU A 1 34 ? 17.023 6.203   2.116   1.00 0.00 ? 34 LEU A HB3  1  
ATOM   546   H  HG   . LEU A 1 34 ? 17.903 8.111   0.689   1.00 0.00 ? 34 LEU A HG   1  
ATOM   547   H  HD11 . LEU A 1 34 ? 20.155 8.385   1.631   1.00 0.00 ? 34 LEU A HD11 1  
ATOM   548   H  HD12 . LEU A 1 34 ? 20.561 6.702   1.226   1.00 0.00 ? 34 LEU A HD12 1  
ATOM   549   H  HD13 . LEU A 1 34 ? 20.285 7.890   -0.060  1.00 0.00 ? 34 LEU A HD13 1  
ATOM   550   H  HD21 . LEU A 1 34 ? 17.144 5.925   -0.201  1.00 0.00 ? 34 LEU A HD21 1  
ATOM   551   H  HD22 . LEU A 1 34 ? 18.481 6.577   -1.153  1.00 0.00 ? 34 LEU A HD22 1  
ATOM   552   H  HD23 . LEU A 1 34 ? 18.784 5.274   0.006   1.00 0.00 ? 34 LEU A HD23 1  
ATOM   553   N  N    . TYR A 1 35 ? 17.388 9.951   3.035   1.00 0.00 ? 35 TYR A N    1  
ATOM   554   C  CA   . TYR A 1 35 ? 16.556 11.146  2.901   1.00 0.00 ? 35 TYR A CA   1  
ATOM   555   C  C    . TYR A 1 35 ? 16.959 11.986  1.687   1.00 0.00 ? 35 TYR A C    1  
ATOM   556   O  O    . TYR A 1 35 ? 16.116 12.690  1.136   1.00 0.00 ? 35 TYR A O    1  
ATOM   557   C  CB   . TYR A 1 35 ? 16.637 11.988  4.182   1.00 0.00 ? 35 TYR A CB   1  
ATOM   558   C  CG   . TYR A 1 35 ? 16.314 11.232  5.458   1.00 0.00 ? 35 TYR A CG   1  
ATOM   559   C  CD1  . TYR A 1 35 ? 15.142 10.457  5.541   1.00 0.00 ? 35 TYR A CD1  1  
ATOM   560   C  CD2  . TYR A 1 35 ? 17.210 11.258  6.544   1.00 0.00 ? 35 TYR A CD2  1  
ATOM   561   C  CE1  . TYR A 1 35 ? 14.913 9.647   6.664   1.00 0.00 ? 35 TYR A CE1  1  
ATOM   562   C  CE2  . TYR A 1 35 ? 16.959 10.476  7.685   1.00 0.00 ? 35 TYR A CE2  1  
ATOM   563   C  CZ   . TYR A 1 35 ? 15.837 9.631   7.722   1.00 0.00 ? 35 TYR A CZ   1  
ATOM   564   O  OH   . TYR A 1 35 ? 15.670 8.764   8.762   1.00 0.00 ? 35 TYR A OH   1  
ATOM   565   H  H    . TYR A 1 35 ? 18.384 10.093  3.114   1.00 0.00 ? 35 TYR A H    1  
ATOM   566   H  HA   . TYR A 1 35 ? 15.518 10.857  2.739   1.00 0.00 ? 35 TYR A HA   1  
ATOM   567   H  HB2  . TYR A 1 35 ? 17.647 12.398  4.254   1.00 0.00 ? 35 TYR A HB2  1  
ATOM   568   H  HB3  . TYR A 1 35 ? 15.933 12.819  4.092   1.00 0.00 ? 35 TYR A HB3  1  
ATOM   569   H  HD1  . TYR A 1 35 ? 14.428 10.457  4.732   1.00 0.00 ? 35 TYR A HD1  1  
ATOM   570   H  HD2  . TYR A 1 35 ? 18.106 11.861  6.500   1.00 0.00 ? 35 TYR A HD2  1  
ATOM   571   H  HE1  . TYR A 1 35 ? 14.033 9.022   6.702   1.00 0.00 ? 35 TYR A HE1  1  
ATOM   572   H  HE2  . TYR A 1 35 ? 17.671 10.466  8.497   1.00 0.00 ? 35 TYR A HE2  1  
ATOM   573   H  HH   . TYR A 1 35 ? 15.037 8.070   8.557   1.00 0.00 ? 35 TYR A HH   1  
ATOM   574   N  N    . GLU A 1 36 ? 18.230 11.910  1.270   1.00 0.00 ? 36 GLU A N    1  
ATOM   575   C  CA   . GLU A 1 36 ? 18.746 12.567  0.076   1.00 0.00 ? 36 GLU A CA   1  
ATOM   576   C  C    . GLU A 1 36 ? 19.038 11.531  -1.010  1.00 0.00 ? 36 GLU A C    1  
ATOM   577   O  O    . GLU A 1 36 ? 19.184 10.344  -0.719  1.00 0.00 ? 36 GLU A O    1  
ATOM   578   C  CB   . GLU A 1 36 ? 20.006 13.369  0.430   1.00 0.00 ? 36 GLU A CB   1  
ATOM   579   C  CG   . GLU A 1 36 ? 19.741 14.437  1.501   1.00 0.00 ? 36 GLU A CG   1  
ATOM   580   C  CD   . GLU A 1 36 ? 18.656 15.420  1.071   1.00 0.00 ? 36 GLU A CD   1  
ATOM   581   O  OE1  . GLU A 1 36 ? 18.950 16.236  0.170   1.00 0.00 ? 36 GLU A OE1  1  
ATOM   582   O  OE2  . GLU A 1 36 ? 17.540 15.324  1.627   1.00 0.00 ? 36 GLU A OE2  1  
ATOM   583   H  H    . GLU A 1 36 ? 18.867 11.303  1.764   1.00 0.00 ? 36 GLU A H    1  
ATOM   584   H  HA   . GLU A 1 36 ? 18.005 13.255  -0.329  1.00 0.00 ? 36 GLU A HA   1  
ATOM   585   H  HB2  . GLU A 1 36 ? 20.775 12.686  0.795   1.00 0.00 ? 36 GLU A HB2  1  
ATOM   586   H  HB3  . GLU A 1 36 ? 20.381 13.862  -0.468  1.00 0.00 ? 36 GLU A HB3  1  
ATOM   587   H  HG2  . GLU A 1 36 ? 19.450 13.961  2.439   1.00 0.00 ? 36 GLU A HG2  1  
ATOM   588   H  HG3  . GLU A 1 36 ? 20.662 14.993  1.677   1.00 0.00 ? 36 GLU A HG3  1  
ATOM   589   N  N    . VAL A 1 37 ? 19.099 11.987  -2.268  1.00 0.00 ? 37 VAL A N    1  
ATOM   590   C  CA   . VAL A 1 37 ? 19.154 11.119  -3.438  1.00 0.00 ? 37 VAL A CA   1  
ATOM   591   C  C    . VAL A 1 37 ? 20.546 10.478  -3.533  1.00 0.00 ? 37 VAL A C    1  
ATOM   592   O  O    . VAL A 1 37 ? 21.542 11.182  -3.369  1.00 0.00 ? 37 VAL A O    1  
ATOM   593   C  CB   . VAL A 1 37 ? 18.825 11.925  -4.708  1.00 0.00 ? 37 VAL A CB   1  
ATOM   594   C  CG1  . VAL A 1 37 ? 18.935 11.055  -5.970  1.00 0.00 ? 37 VAL A CG1  1  
ATOM   595   C  CG2  . VAL A 1 37 ? 17.406 12.507  -4.638  1.00 0.00 ? 37 VAL A CG2  1  
ATOM   596   H  H    . VAL A 1 37 ? 19.051 12.983  -2.427  1.00 0.00 ? 37 VAL A H    1  
ATOM   597   H  HA   . VAL A 1 37 ? 18.378 10.367  -3.322  1.00 0.00 ? 37 VAL A HA   1  
ATOM   598   H  HB   . VAL A 1 37 ? 19.535 12.748  -4.797  1.00 0.00 ? 37 VAL A HB   1  
ATOM   599   H  HG11 . VAL A 1 37 ? 19.965 10.732  -6.126  1.00 0.00 ? 37 VAL A HG11 1  
ATOM   600   H  HG12 . VAL A 1 37 ? 18.292 10.180  -5.879  1.00 0.00 ? 37 VAL A HG12 1  
ATOM   601   H  HG13 . VAL A 1 37 ? 18.628 11.633  -6.843  1.00 0.00 ? 37 VAL A HG13 1  
ATOM   602   H  HG21 . VAL A 1 37 ? 16.677 11.704  -4.527  1.00 0.00 ? 37 VAL A HG21 1  
ATOM   603   H  HG22 . VAL A 1 37 ? 17.317 13.193  -3.796  1.00 0.00 ? 37 VAL A HG22 1  
ATOM   604   H  HG23 . VAL A 1 37 ? 17.189 13.059  -5.553  1.00 0.00 ? 37 VAL A HG23 1  
ATOM   605   N  N    . PRO A 1 38 ? 20.635 9.161   -3.787  1.00 0.00 ? 38 PRO A N    1  
ATOM   606   C  CA   . PRO A 1 38 ? 21.892 8.512   -4.115  1.00 0.00 ? 38 PRO A CA   1  
ATOM   607   C  C    . PRO A 1 38 ? 22.085 8.545   -5.629  1.00 0.00 ? 38 PRO A C    1  
ATOM   608   O  O    . PRO A 1 38 ? 21.487 7.750   -6.355  1.00 0.00 ? 38 PRO A O    1  
ATOM   609   C  CB   . PRO A 1 38 ? 21.775 7.085   -3.581  1.00 0.00 ? 38 PRO A CB   1  
ATOM   610   C  CG   . PRO A 1 38 ? 20.277 6.799   -3.665  1.00 0.00 ? 38 PRO A CG   1  
ATOM   611   C  CD   . PRO A 1 38 ? 19.653 8.167   -3.380  1.00 0.00 ? 38 PRO A CD   1  
ATOM   612   H  HA   . PRO A 1 38 ? 22.742 8.989   -3.624  1.00 0.00 ? 38 PRO A HA   1  
ATOM   613   H  HB2  . PRO A 1 38 ? 22.376 6.379   -4.154  1.00 0.00 ? 38 PRO A HB2  1  
ATOM   614   H  HB3  . PRO A 1 38 ? 22.080 7.070   -2.534  1.00 0.00 ? 38 PRO A HB3  1  
ATOM   615   H  HG2  . PRO A 1 38 ? 20.016 6.485   -4.675  1.00 0.00 ? 38 PRO A HG2  1  
ATOM   616   H  HG3  . PRO A 1 38 ? 19.964 6.037   -2.951  1.00 0.00 ? 38 PRO A HG3  1  
ATOM   617   H  HD2  . PRO A 1 38 ? 18.721 8.261   -3.936  1.00 0.00 ? 38 PRO A HD2  1  
ATOM   618   H  HD3  . PRO A 1 38 ? 19.472 8.273   -2.312  1.00 0.00 ? 38 PRO A HD3  1  
ATOM   619   N  N    . ASP A 1 39 ? 22.943 9.456   -6.100  1.00 0.00 ? 39 ASP A N    1  
ATOM   620   C  CA   . ASP A 1 39 ? 23.375 9.508   -7.489  1.00 0.00 ? 39 ASP A CA   1  
ATOM   621   C  C    . ASP A 1 39 ? 24.386 8.392   -7.767  1.00 0.00 ? 39 ASP A C    1  
ATOM   622   O  O    . ASP A 1 39 ? 25.561 8.648   -8.025  1.00 0.00 ? 39 ASP A O    1  
ATOM   623   C  CB   . ASP A 1 39 ? 23.929 10.904  -7.800  1.00 0.00 ? 39 ASP A CB   1  
ATOM   624   C  CG   . ASP A 1 39 ? 22.841 11.964  -7.658  1.00 0.00 ? 39 ASP A CG   1  
ATOM   625   O  OD1  . ASP A 1 39 ? 22.026 12.070  -8.605  1.00 0.00 ? 39 ASP A OD1  1  
ATOM   626   O  OD2  . ASP A 1 39 ? 22.831 12.636  -6.604  1.00 0.00 ? 39 ASP A OD2  1  
ATOM   627   H  H    . ASP A 1 39 ? 23.338 10.133  -5.463  1.00 0.00 ? 39 ASP A H    1  
ATOM   628   H  HA   . ASP A 1 39 ? 22.509 9.355   -8.131  1.00 0.00 ? 39 ASP A HA   1  
ATOM   629   H  HB2  . ASP A 1 39 ? 24.756 11.134  -7.126  1.00 0.00 ? 39 ASP A HB2  1  
ATOM   630   H  HB3  . ASP A 1 39 ? 24.301 10.926  -8.825  1.00 0.00 ? 39 ASP A HB3  1  
ATOM   631   N  N    . GLY A 1 40 ? 23.911 7.143   -7.716  1.00 0.00 ? 40 GLY A N    1  
ATOM   632   C  CA   . GLY A 1 40 ? 24.736 5.953   -7.800  1.00 0.00 ? 40 GLY A CA   1  
ATOM   633   C  C    . GLY A 1 40 ? 23.863 4.716   -7.615  1.00 0.00 ? 40 GLY A C    1  
ATOM   634   O  O    . GLY A 1 40 ? 23.730 3.907   -8.532  1.00 0.00 ? 40 GLY A O    1  
ATOM   635   H  H    . GLY A 1 40 ? 22.932 7.020   -7.488  1.00 0.00 ? 40 GLY A H    1  
ATOM   636   H  HA2  . GLY A 1 40 ? 25.225 5.916   -8.774  1.00 0.00 ? 40 GLY A HA2  1  
ATOM   637   H  HA3  . GLY A 1 40 ? 25.498 5.977   -7.020  1.00 0.00 ? 40 GLY A HA3  1  
ATOM   638   N  N    . GLU A 1 41 ? 23.252 4.583   -6.429  1.00 0.00 ? 41 GLU A N    1  
ATOM   639   C  CA   . GLU A 1 41 ? 22.287 3.534   -6.126  1.00 0.00 ? 41 GLU A CA   1  
ATOM   640   C  C    . GLU A 1 41 ? 20.928 3.896   -6.735  1.00 0.00 ? 41 GLU A C    1  
ATOM   641   O  O    . GLU A 1 41 ? 19.964 4.166   -6.021  1.00 0.00 ? 41 GLU A O    1  
ATOM   642   C  CB   . GLU A 1 41 ? 22.219 3.323   -4.605  1.00 0.00 ? 41 GLU A CB   1  
ATOM   643   C  CG   . GLU A 1 41 ? 21.425 2.068   -4.217  1.00 0.00 ? 41 GLU A CG   1  
ATOM   644   C  CD   . GLU A 1 41 ? 21.289 1.948   -2.703  1.00 0.00 ? 41 GLU A CD   1  
ATOM   645   O  OE1  . GLU A 1 41 ? 20.729 2.890   -2.101  1.00 0.00 ? 41 GLU A OE1  1  
ATOM   646   O  OE2  . GLU A 1 41 ? 21.736 0.914   -2.161  1.00 0.00 ? 41 GLU A OE2  1  
ATOM   647   H  H    . GLU A 1 41 ? 23.415 5.286   -5.723  1.00 0.00 ? 41 GLU A H    1  
ATOM   648   H  HA   . GLU A 1 41 ? 22.631 2.598   -6.570  1.00 0.00 ? 41 GLU A HA   1  
ATOM   649   H  HB2  . GLU A 1 41 ? 23.231 3.215   -4.214  1.00 0.00 ? 41 GLU A HB2  1  
ATOM   650   H  HB3  . GLU A 1 41 ? 21.760 4.193   -4.136  1.00 0.00 ? 41 GLU A HB3  1  
ATOM   651   H  HG2  . GLU A 1 41 ? 20.420 2.106   -4.635  1.00 0.00 ? 41 GLU A HG2  1  
ATOM   652   H  HG3  . GLU A 1 41 ? 21.934 1.188   -4.612  1.00 0.00 ? 41 GLU A HG3  1  
ATOM   653   N  N    . TRP A 1 42 ? 20.850 3.881   -8.070  1.00 0.00 ? 42 TRP A N    1  
ATOM   654   C  CA   . TRP A 1 42 ? 19.598 3.982   -8.804  1.00 0.00 ? 42 TRP A CA   1  
ATOM   655   C  C    . TRP A 1 42 ? 18.949 2.602   -8.848  1.00 0.00 ? 42 TRP A C    1  
ATOM   656   O  O    . TRP A 1 42 ? 18.809 1.999   -9.910  1.00 0.00 ? 42 TRP A O    1  
ATOM   657   C  CB   . TRP A 1 42 ? 19.872 4.557   -10.195 1.00 0.00 ? 42 TRP A CB   1  
ATOM   658   C  CG   . TRP A 1 42 ? 20.508 5.912   -10.185 1.00 0.00 ? 42 TRP A CG   1  
ATOM   659   C  CD1  . TRP A 1 42 ? 19.932 7.035   -9.704  1.00 0.00 ? 42 TRP A CD1  1  
ATOM   660   C  CD2  . TRP A 1 42 ? 21.838 6.307   -10.641 1.00 0.00 ? 42 TRP A CD2  1  
ATOM   661   N  NE1  . TRP A 1 42 ? 20.793 8.100   -9.862  1.00 0.00 ? 42 TRP A NE1  1  
ATOM   662   C  CE2  . TRP A 1 42 ? 21.983 7.711   -10.442 1.00 0.00 ? 42 TRP A CE2  1  
ATOM   663   C  CE3  . TRP A 1 42 ? 22.939 5.624   -11.204 1.00 0.00 ? 42 TRP A CE3  1  
ATOM   664   C  CZ2  . TRP A 1 42 ? 23.148 8.405   -10.803 1.00 0.00 ? 42 TRP A CZ2  1  
ATOM   665   C  CZ3  . TRP A 1 42 ? 24.121 6.306   -11.546 1.00 0.00 ? 42 TRP A CZ3  1  
ATOM   666   C  CH2  . TRP A 1 42 ? 24.227 7.694   -11.350 1.00 0.00 ? 42 TRP A CH2  1  
ATOM   667   H  H    . TRP A 1 42 ? 21.696 3.712   -8.599  1.00 0.00 ? 42 TRP A H    1  
ATOM   668   H  HA   . TRP A 1 42 ? 18.916 4.663   -8.297  1.00 0.00 ? 42 TRP A HA   1  
ATOM   669   H  HB2  . TRP A 1 42 ? 20.524 3.873   -10.744 1.00 0.00 ? 42 TRP A HB2  1  
ATOM   670   H  HB3  . TRP A 1 42 ? 18.923 4.639   -10.728 1.00 0.00 ? 42 TRP A HB3  1  
ATOM   671   H  HD1  . TRP A 1 42 ? 18.943 7.089   -9.273  1.00 0.00 ? 42 TRP A HD1  1  
ATOM   672   H  HE1  . TRP A 1 42 ? 20.557 9.040   -9.577  1.00 0.00 ? 42 TRP A HE1  1  
ATOM   673   H  HE3  . TRP A 1 42 ? 22.877 4.558   -11.365 1.00 0.00 ? 42 TRP A HE3  1  
ATOM   674   H  HZ2  . TRP A 1 42 ? 23.218 9.472   -10.650 1.00 0.00 ? 42 TRP A HZ2  1  
ATOM   675   H  HZ3  . TRP A 1 42 ? 24.954 5.758   -11.963 1.00 0.00 ? 42 TRP A HZ3  1  
ATOM   676   H  HH2  . TRP A 1 42 ? 25.137 8.211   -11.617 1.00 0.00 ? 42 TRP A HH2  1  
ATOM   677   N  N    . GLN A 1 43 ? 18.576 2.102   -7.665  1.00 0.00 ? 43 GLN A N    1  
ATOM   678   C  CA   . GLN A 1 43 ? 18.147 0.730   -7.455  1.00 0.00 ? 43 GLN A CA   1  
ATOM   679   C  C    . GLN A 1 43 ? 17.024 0.673   -6.418  1.00 0.00 ? 43 GLN A C    1  
ATOM   680   O  O    . GLN A 1 43 ? 16.693 1.677   -5.790  1.00 0.00 ? 43 GLN A O    1  
ATOM   681   C  CB   . GLN A 1 43 ? 19.333 -0.122  -6.983  1.00 0.00 ? 43 GLN A CB   1  
ATOM   682   C  CG   . GLN A 1 43 ? 20.513 -0.148  -7.958  1.00 0.00 ? 43 GLN A CG   1  
ATOM   683   C  CD   . GLN A 1 43 ? 21.551 -1.167  -7.495  1.00 0.00 ? 43 GLN A CD   1  
ATOM   684   O  OE1  . GLN A 1 43 ? 22.499 -0.819  -6.793  1.00 0.00 ? 43 GLN A OE1  1  
ATOM   685   N  NE2  . GLN A 1 43 ? 21.355 -2.436  -7.860  1.00 0.00 ? 43 GLN A NE2  1  
ATOM   686   H  H    . GLN A 1 43 ? 18.656 2.698   -6.850  1.00 0.00 ? 43 GLN A H    1  
ATOM   687   H  HA   . GLN A 1 43 ? 17.777 0.312   -8.388  1.00 0.00 ? 43 GLN A HA   1  
ATOM   688   H  HB2  . GLN A 1 43 ? 19.685 0.255   -6.023  1.00 0.00 ? 43 GLN A HB2  1  
ATOM   689   H  HB3  . GLN A 1 43 ? 18.989 -1.148  -6.853  1.00 0.00 ? 43 GLN A HB3  1  
ATOM   690   H  HG2  . GLN A 1 43 ? 20.161 -0.415  -8.956  1.00 0.00 ? 43 GLN A HG2  1  
ATOM   691   H  HG3  . GLN A 1 43 ? 20.983 0.835   -8.000  1.00 0.00 ? 43 GLN A HG3  1  
ATOM   692   H  HE21 . GLN A 1 43 ? 20.581 -2.672  -8.468  1.00 0.00 ? 43 GLN A HE21 1  
ATOM   693   H  HE22 . GLN A 1 43 ? 21.973 -3.160  -7.515  1.00 0.00 ? 43 GLN A HE22 1  
ATOM   694   N  N    . CYS A 1 44 ? 16.458 -0.527  -6.240  1.00 0.00 ? 44 CYS A N    1  
ATOM   695   C  CA   . CYS A 1 44 ? 15.535 -0.876  -5.168  1.00 0.00 ? 44 CYS A CA   1  
ATOM   696   C  C    . CYS A 1 44 ? 16.119 -2.078  -4.405  1.00 0.00 ? 44 CYS A C    1  
ATOM   697   O  O    . CYS A 1 44 ? 16.971 -2.774  -4.958  1.00 0.00 ? 44 CYS A O    1  
ATOM   698   C  CB   . CYS A 1 44 ? 14.155 -1.173  -5.771  1.00 0.00 ? 44 CYS A CB   1  
ATOM   699   S  SG   . CYS A 1 44 ? 14.105 -2.520  -6.980  1.00 0.00 ? 44 CYS A SG   1  
ATOM   700   H  H    . CYS A 1 44 ? 16.784 -1.292  -6.812  1.00 0.00 ? 44 CYS A H    1  
ATOM   701   H  HA   . CYS A 1 44 ? 15.444 -0.029  -4.489  1.00 0.00 ? 44 CYS A HA   1  
ATOM   702   H  HB2  . CYS A 1 44 ? 13.457 -1.427  -4.978  1.00 0.00 ? 44 CYS A HB2  1  
ATOM   703   H  HB3  . CYS A 1 44 ? 13.789 -0.267  -6.259  1.00 0.00 ? 44 CYS A HB3  1  
ATOM   704   N  N    . PRO A 1 45 ? 15.684 -2.346  -3.158  1.00 0.00 ? 45 PRO A N    1  
ATOM   705   C  CA   . PRO A 1 45 ? 16.305 -3.310  -2.249  1.00 0.00 ? 45 PRO A CA   1  
ATOM   706   C  C    . PRO A 1 45 ? 16.603 -4.693  -2.841  1.00 0.00 ? 45 PRO A C    1  
ATOM   707   O  O    . PRO A 1 45 ? 17.585 -5.321  -2.451  1.00 0.00 ? 45 PRO A O    1  
ATOM   708   C  CB   . PRO A 1 45 ? 15.361 -3.417  -1.049  1.00 0.00 ? 45 PRO A CB   1  
ATOM   709   C  CG   . PRO A 1 45 ? 14.718 -2.035  -1.010  1.00 0.00 ? 45 PRO A CG   1  
ATOM   710   C  CD   . PRO A 1 45 ? 14.548 -1.722  -2.495  1.00 0.00 ? 45 PRO A CD   1  
ATOM   711   H  HA   . PRO A 1 45 ? 17.239 -2.873  -1.897  1.00 0.00 ? 45 PRO A HA   1  
ATOM   712   H  HB2  . PRO A 1 45 ? 14.591 -4.165  -1.245  1.00 0.00 ? 45 PRO A HB2  1  
ATOM   713   H  HB3  . PRO A 1 45 ? 15.892 -3.653  -0.124  1.00 0.00 ? 45 PRO A HB3  1  
ATOM   714   H  HG2  . PRO A 1 45 ? 13.770 -2.030  -0.469  1.00 0.00 ? 45 PRO A HG2  1  
ATOM   715   H  HG3  . PRO A 1 45 ? 15.417 -1.323  -0.565  1.00 0.00 ? 45 PRO A HG3  1  
ATOM   716   H  HD2  . PRO A 1 45 ? 13.632 -2.198  -2.847  1.00 0.00 ? 45 PRO A HD2  1  
ATOM   717   H  HD3  . PRO A 1 45 ? 14.497 -0.642  -2.631  1.00 0.00 ? 45 PRO A HD3  1  
ATOM   718   N  N    . ALA A 1 46 ? 15.755 -5.182  -3.756  1.00 0.00 ? 46 ALA A N    1  
ATOM   719   C  CA   . ALA A 1 46 ? 15.915 -6.487  -4.379  1.00 0.00 ? 46 ALA A CA   1  
ATOM   720   C  C    . ALA A 1 46 ? 17.159 -6.500  -5.266  1.00 0.00 ? 46 ALA A C    1  
ATOM   721   O  O    . ALA A 1 46 ? 17.906 -7.477  -5.279  1.00 0.00 ? 46 ALA A O    1  
ATOM   722   C  CB   . ALA A 1 46 ? 14.664 -6.815  -5.198  1.00 0.00 ? 46 ALA A CB   1  
ATOM   723   H  H    . ALA A 1 46 ? 15.064 -4.570  -4.159  1.00 0.00 ? 46 ALA A H    1  
ATOM   724   H  HA   . ALA A 1 46 ? 16.023 -7.245  -3.601  1.00 0.00 ? 46 ALA A HA   1  
ATOM   725   H  HB1  . ALA A 1 46 ? 13.789 -6.824  -4.546  1.00 0.00 ? 46 ALA A HB1  1  
ATOM   726   H  HB2  . ALA A 1 46 ? 14.520 -6.070  -5.981  1.00 0.00 ? 46 ALA A HB2  1  
ATOM   727   H  HB3  . ALA A 1 46 ? 14.773 -7.798  -5.657  1.00 0.00 ? 46 ALA A HB3  1  
ATOM   728   N  N    . CYS A 1 47 ? 17.364 -5.410  -6.014  1.00 0.00 ? 47 CYS A N    1  
ATOM   729   C  CA   . CYS A 1 47 ? 18.459 -5.257  -6.951  1.00 0.00 ? 47 CYS A CA   1  
ATOM   730   C  C    . CYS A 1 47 ? 19.767 -4.904  -6.237  1.00 0.00 ? 47 CYS A C    1  
ATOM   731   O  O    . CYS A 1 47 ? 20.843 -5.228  -6.736  1.00 0.00 ? 47 CYS A O    1  
ATOM   732   C  CB   . CYS A 1 47 ? 18.078 -4.191  -7.977  1.00 0.00 ? 47 CYS A CB   1  
ATOM   733   S  SG   . CYS A 1 47 ? 16.591 -4.594  -8.923  1.00 0.00 ? 47 CYS A SG   1  
ATOM   734   H  H    . CYS A 1 47 ? 16.761 -4.609  -5.897  1.00 0.00 ? 47 CYS A H    1  
ATOM   735   H  HA   . CYS A 1 47 ? 18.579 -6.199  -7.478  1.00 0.00 ? 47 CYS A HA   1  
ATOM   736   H  HB2  . CYS A 1 47 ? 17.906 -3.247  -7.460  1.00 0.00 ? 47 CYS A HB2  1  
ATOM   737   H  HB3  . CYS A 1 47 ? 18.897 -4.067  -8.683  1.00 0.00 ? 47 CYS A HB3  1  
ATOM   738   N  N    . GLN A 1 48 ? 19.678 -4.250  -5.072  1.00 0.00 ? 48 GLN A N    1  
ATOM   739   C  CA   . GLN A 1 48 ? 20.835 -3.815  -4.305  1.00 0.00 ? 48 GLN A CA   1  
ATOM   740   C  C    . GLN A 1 48 ? 21.558 -5.036  -3.722  1.00 0.00 ? 48 GLN A C    1  
ATOM   741   O  O    . GLN A 1 48 ? 20.902 -5.943  -3.210  1.00 0.00 ? 48 GLN A O    1  
ATOM   742   C  CB   . GLN A 1 48 ? 20.367 -2.882  -3.183  1.00 0.00 ? 48 GLN A CB   1  
ATOM   743   C  CG   . GLN A 1 48 ? 19.901 -1.540  -3.757  1.00 0.00 ? 48 GLN A CG   1  
ATOM   744   C  CD   . GLN A 1 48 ? 19.093 -0.714  -2.760  1.00 0.00 ? 48 GLN A CD   1  
ATOM   745   O  OE1  . GLN A 1 48 ? 19.166 -0.923  -1.551  1.00 0.00 ? 48 GLN A OE1  1  
ATOM   746   N  NE2  . GLN A 1 48 ? 18.279 0.210   -3.274  1.00 0.00 ? 48 GLN A NE2  1  
ATOM   747   H  H    . GLN A 1 48 ? 18.767 -4.004  -4.710  1.00 0.00 ? 48 GLN A H    1  
ATOM   748   H  HA   . GLN A 1 48 ? 21.486 -3.250  -4.969  1.00 0.00 ? 48 GLN A HA   1  
ATOM   749   H  HB2  . GLN A 1 48 ? 19.550 -3.367  -2.647  1.00 0.00 ? 48 GLN A HB2  1  
ATOM   750   H  HB3  . GLN A 1 48 ? 21.188 -2.701  -2.489  1.00 0.00 ? 48 GLN A HB3  1  
ATOM   751   H  HG2  . GLN A 1 48 ? 20.772 -0.968  -4.079  1.00 0.00 ? 48 GLN A HG2  1  
ATOM   752   H  HG3  . GLN A 1 48 ? 19.271 -1.725  -4.622  1.00 0.00 ? 48 GLN A HG3  1  
ATOM   753   H  HE21 . GLN A 1 48 ? 18.291 0.408   -4.266  1.00 0.00 ? 48 GLN A HE21 1  
ATOM   754   H  HE22 . GLN A 1 48 ? 17.678 0.734   -2.655  1.00 0.00 ? 48 GLN A HE22 1  
ATOM   755   N  N    . PRO A 1 49 ? 22.899 -5.079  -3.800  1.00 0.00 ? 49 PRO A N    1  
ATOM   756   C  CA   . PRO A 1 49 ? 23.686 -6.262  -3.482  1.00 0.00 ? 49 PRO A CA   1  
ATOM   757   C  C    . PRO A 1 49 ? 23.656 -6.558  -1.980  1.00 0.00 ? 49 PRO A C    1  
ATOM   758   O  O    . PRO A 1 49 ? 23.492 -5.653  -1.163  1.00 0.00 ? 49 PRO A O    1  
ATOM   759   C  CB   . PRO A 1 49 ? 25.106 -5.932  -3.950  1.00 0.00 ? 49 PRO A CB   1  
ATOM   760   C  CG   . PRO A 1 49 ? 25.180 -4.417  -3.764  1.00 0.00 ? 49 PRO A CG   1  
ATOM   761   C  CD   . PRO A 1 49 ? 23.770 -3.965  -4.139  1.00 0.00 ? 49 PRO A CD   1  
ATOM   762   H  HA   . PRO A 1 49 ? 23.308 -7.123  -4.036  1.00 0.00 ? 49 PRO A HA   1  
ATOM   763   H  HB2  . PRO A 1 49 ? 25.875 -6.457  -3.379  1.00 0.00 ? 49 PRO A HB2  1  
ATOM   764   H  HB3  . PRO A 1 49 ? 25.200 -6.166  -5.012  1.00 0.00 ? 49 PRO A HB3  1  
ATOM   765   H  HG2  . PRO A 1 49 ? 25.366 -4.186  -2.715  1.00 0.00 ? 49 PRO A HG2  1  
ATOM   766   H  HG3  . PRO A 1 49 ? 25.945 -3.958  -4.392  1.00 0.00 ? 49 PRO A HG3  1  
ATOM   767   H  HD2  . PRO A 1 49 ? 23.507 -3.057  -3.594  1.00 0.00 ? 49 PRO A HD2  1  
ATOM   768   H  HD3  . PRO A 1 49 ? 23.726 -3.787  -5.214  1.00 0.00 ? 49 PRO A HD3  1  
ATOM   769   N  N    . ALA A 1 50 ? 23.838 -7.836  -1.623  1.00 0.00 ? 50 ALA A N    1  
ATOM   770   C  CA   . ALA A 1 50 ? 23.975 -8.281  -0.243  1.00 0.00 ? 50 ALA A CA   1  
ATOM   771   C  C    . ALA A 1 50 ? 25.397 -8.011  0.256   1.00 0.00 ? 50 ALA A C    1  
ATOM   772   O  O    . ALA A 1 50 ? 26.167 -8.943  0.487   1.00 0.00 ? 50 ALA A O    1  
ATOM   773   C  CB   . ALA A 1 50 ? 23.603 -9.765  -0.153  1.00 0.00 ? 50 ALA A CB   1  
ATOM   774   H  H    . ALA A 1 50 ? 23.950 -8.530  -2.347  1.00 0.00 ? 50 ALA A H    1  
ATOM   775   H  HA   . ALA A 1 50 ? 23.275 -7.731  0.390   1.00 0.00 ? 50 ALA A HA   1  
ATOM   776   H  HB1  . ALA A 1 50 ? 24.265 -10.360 -0.784  1.00 0.00 ? 50 ALA A HB1  1  
ATOM   777   H  HB2  . ALA A 1 50 ? 23.688 -10.105 0.880   1.00 0.00 ? 50 ALA A HB2  1  
ATOM   778   H  HB3  . ALA A 1 50 ? 22.574 -9.905  -0.486  1.00 0.00 ? 50 ALA A HB3  1  
ATOM   779   N  N    . THR A 1 51 ? 25.736 -6.726  0.415   1.00 0.00 ? 51 THR A N    1  
ATOM   780   C  CA   . THR A 1 51 ? 26.999 -6.261  0.970   1.00 0.00 ? 51 THR A CA   1  
ATOM   781   C  C    . THR A 1 51 ? 26.711 -5.125  1.952   1.00 0.00 ? 51 THR A C    1  
ATOM   782   O  O    . THR A 1 51 ? 26.224 -4.073  1.476   1.00 0.00 ? 51 THR A O    1  
ATOM   783   C  CB   . THR A 1 51 ? 27.936 -5.796  -0.157  1.00 0.00 ? 51 THR A CB   1  
ATOM   784   O  OG1  . THR A 1 51 ? 27.294 -4.826  -0.960  1.00 0.00 ? 51 THR A OG1  1  
ATOM   785   C  CG2  . THR A 1 51 ? 28.391 -6.958  -1.045  1.00 0.00 ? 51 THR A CG2  1  
ATOM   786   O  OXT  . THR A 1 51 ? 26.978 -5.327  3.157   1.00 0.00 ? 51 THR A OXT  1  
ATOM   787   H  H    . THR A 1 51 ? 25.063 -6.016  0.156   1.00 0.00 ? 51 THR A H    1  
ATOM   788   H  HA   . THR A 1 51 ? 27.493 -7.063  1.521   1.00 0.00 ? 51 THR A HA   1  
ATOM   789   H  HB   . THR A 1 51 ? 28.820 -5.343  0.295   1.00 0.00 ? 51 THR A HB   1  
ATOM   790   H  HG1  . THR A 1 51 ? 26.866 -4.196  -0.370  1.00 0.00 ? 51 THR A HG1  1  
ATOM   791   H  HG21 . THR A 1 51 ? 29.109 -6.593  -1.780  1.00 0.00 ? 51 THR A HG21 1  
ATOM   792   H  HG22 . THR A 1 51 ? 28.868 -7.725  -0.434  1.00 0.00 ? 51 THR A HG22 1  
ATOM   793   H  HG23 . THR A 1 51 ? 27.541 -7.393  -1.570  1.00 0.00 ? 51 THR A HG23 1  
HETATM 794   ZN ZN   . ZN  B 2 .  ? 6.680  4.598   -0.536  1.00 0.00 ? 52 ZN  A ZN   1  
HETATM 795   ZN ZN   . ZN  C 2 .  ? 14.992 -2.953  -9.054  1.00 0.00 ? 53 ZN  A ZN   1  
ATOM   796   N  N    . ALA A 1 1  ? 5.146  11.012  -6.681  1.00 0.00 ? 1  ALA A N    2  
ATOM   797   C  CA   . ALA A 1 1  ? 3.795  10.760  -7.210  1.00 0.00 ? 1  ALA A CA   2  
ATOM   798   C  C    . ALA A 1 1  ? 3.215  9.455   -6.660  1.00 0.00 ? 1  ALA A C    2  
ATOM   799   O  O    . ALA A 1 1  ? 2.155  9.474   -6.035  1.00 0.00 ? 1  ALA A O    2  
ATOM   800   C  CB   . ALA A 1 1  ? 3.798  10.758  -8.743  1.00 0.00 ? 1  ALA A CB   2  
ATOM   801   H  H1   . ALA A 1 1  ? 5.779  10.290  -6.987  1.00 0.00 ? 1  ALA A H1   2  
ATOM   802   H  H2   . ALA A 1 1  ? 5.477  11.910  -7.001  1.00 0.00 ? 1  ALA A H2   2  
ATOM   803   H  H3   . ALA A 1 1  ? 5.112  11.014  -5.667  1.00 0.00 ? 1  ALA A H3   2  
ATOM   804   H  HA   . ALA A 1 1  ? 3.157  11.579  -6.881  1.00 0.00 ? 1  ALA A HA   2  
ATOM   805   H  HB1  . ALA A 1 1  ? 2.787  10.586  -9.111  1.00 0.00 ? 1  ALA A HB1  2  
ATOM   806   H  HB2  . ALA A 1 1  ? 4.148  11.725  -9.110  1.00 0.00 ? 1  ALA A HB2  2  
ATOM   807   H  HB3  . ALA A 1 1  ? 4.456  9.976   -9.121  1.00 0.00 ? 1  ALA A HB3  2  
ATOM   808   N  N    . ARG A 1 2  ? 3.897  8.328   -6.909  1.00 0.00 ? 2  ARG A N    2  
ATOM   809   C  CA   . ARG A 1 2  ? 3.384  6.989   -6.646  1.00 0.00 ? 2  ARG A CA   2  
ATOM   810   C  C    . ARG A 1 2  ? 4.545  6.061   -6.289  1.00 0.00 ? 2  ARG A C    2  
ATOM   811   O  O    . ARG A 1 2  ? 5.684  6.317   -6.674  1.00 0.00 ? 2  ARG A O    2  
ATOM   812   C  CB   . ARG A 1 2  ? 2.617  6.482   -7.882  1.00 0.00 ? 2  ARG A CB   2  
ATOM   813   C  CG   . ARG A 1 2  ? 1.460  5.531   -7.537  1.00 0.00 ? 2  ARG A CG   2  
ATOM   814   C  CD   . ARG A 1 2  ? 0.137  6.280   -7.329  1.00 0.00 ? 2  ARG A CD   2  
ATOM   815   N  NE   . ARG A 1 2  ? 0.261  7.339   -6.317  1.00 0.00 ? 2  ARG A NE   2  
ATOM   816   C  CZ   . ARG A 1 2  ? -0.207 7.331   -5.058  1.00 0.00 ? 2  ARG A CZ   2  
ATOM   817   N  NH1  . ARG A 1 2  ? -0.984 6.338   -4.602  1.00 0.00 ? 2  ARG A NH1  2  
ATOM   818   N  NH2  . ARG A 1 2  ? 0.124  8.341   -4.246  1.00 0.00 ? 2  ARG A NH2  2  
ATOM   819   H  H    . ARG A 1 2  ? 4.794  8.380   -7.371  1.00 0.00 ? 2  ARG A H    2  
ATOM   820   H  HA   . ARG A 1 2  ? 2.730  7.031   -5.777  1.00 0.00 ? 2  ARG A HA   2  
ATOM   821   H  HB2  . ARG A 1 2  ? 2.211  7.322   -8.447  1.00 0.00 ? 2  ARG A HB2  2  
ATOM   822   H  HB3  . ARG A 1 2  ? 3.321  5.962   -8.534  1.00 0.00 ? 2  ARG A HB3  2  
ATOM   823   H  HG2  . ARG A 1 2  ? 1.320  4.845   -8.375  1.00 0.00 ? 2  ARG A HG2  2  
ATOM   824   H  HG3  . ARG A 1 2  ? 1.699  4.941   -6.653  1.00 0.00 ? 2  ARG A HG3  2  
ATOM   825   H  HD2  . ARG A 1 2  ? -0.145 6.753   -8.271  1.00 0.00 ? 2  ARG A HD2  2  
ATOM   826   H  HD3  . ARG A 1 2  ? -0.643 5.561   -7.080  1.00 0.00 ? 2  ARG A HD3  2  
ATOM   827   H  HE   . ARG A 1 2  ? 0.833  8.132   -6.582  1.00 0.00 ? 2  ARG A HE   2  
ATOM   828   H  HH11 . ARG A 1 2  ? -1.259 5.585   -5.214  1.00 0.00 ? 2  ARG A HH11 2  
ATOM   829   H  HH12 . ARG A 1 2  ? -1.279 6.316   -3.634  1.00 0.00 ? 2  ARG A HH12 2  
ATOM   830   H  HH21 . ARG A 1 2  ? 0.752  9.062   -4.582  1.00 0.00 ? 2  ARG A HH21 2  
ATOM   831   H  HH22 . ARG A 1 2  ? -0.235 8.387   -3.305  1.00 0.00 ? 2  ARG A HH22 2  
ATOM   832   N  N    . CYS A 1 3  ? 4.249  4.985   -5.551  1.00 0.00 ? 3  CYS A N    2  
ATOM   833   C  CA   . CYS A 1 3  ? 5.237  4.113   -4.935  1.00 0.00 ? 3  CYS A CA   2  
ATOM   834   C  C    . CYS A 1 3  ? 4.664  2.699   -4.841  1.00 0.00 ? 3  CYS A C    2  
ATOM   835   O  O    . CYS A 1 3  ? 3.460  2.532   -4.656  1.00 0.00 ? 3  CYS A O    2  
ATOM   836   C  CB   . CYS A 1 3  ? 5.572  4.680   -3.552  1.00 0.00 ? 3  CYS A CB   2  
ATOM   837   S  SG   . CYS A 1 3  ? 6.665  3.683   -2.511  1.00 0.00 ? 3  CYS A SG   2  
ATOM   838   H  H    . CYS A 1 3  ? 3.284  4.800   -5.321  1.00 0.00 ? 3  CYS A H    2  
ATOM   839   H  HA   . CYS A 1 3  ? 6.145  4.086   -5.538  1.00 0.00 ? 3  CYS A HA   2  
ATOM   840   H  HB2  . CYS A 1 3  ? 6.055  5.644   -3.704  1.00 0.00 ? 3  CYS A HB2  2  
ATOM   841   H  HB3  . CYS A 1 3  ? 4.641  4.830   -3.001  1.00 0.00 ? 3  CYS A HB3  2  
ATOM   842   N  N    . LYS A 1 4  ? 5.525  1.685   -4.975  1.00 0.00 ? 4  LYS A N    2  
ATOM   843   C  CA   . LYS A 1 4  ? 5.141  0.287   -4.821  1.00 0.00 ? 4  LYS A CA   2  
ATOM   844   C  C    . LYS A 1 4  ? 4.726  -0.008  -3.377  1.00 0.00 ? 4  LYS A C    2  
ATOM   845   O  O    . LYS A 1 4  ? 3.674  -0.598  -3.140  1.00 0.00 ? 4  LYS A O    2  
ATOM   846   C  CB   . LYS A 1 4  ? 6.302  -0.609  -5.276  1.00 0.00 ? 4  LYS A CB   2  
ATOM   847   C  CG   . LYS A 1 4  ? 6.047  -2.112  -5.079  1.00 0.00 ? 4  LYS A CG   2  
ATOM   848   C  CD   . LYS A 1 4  ? 4.817  -2.611  -5.848  1.00 0.00 ? 4  LYS A CD   2  
ATOM   849   C  CE   . LYS A 1 4  ? 4.680  -4.131  -5.709  1.00 0.00 ? 4  LYS A CE   2  
ATOM   850   N  NZ   . LYS A 1 4  ? 3.474  -4.631  -6.396  1.00 0.00 ? 4  LYS A NZ   2  
ATOM   851   H  H    . LYS A 1 4  ? 6.501  1.889   -5.155  1.00 0.00 ? 4  LYS A H    2  
ATOM   852   H  HA   . LYS A 1 4  ? 4.292  0.104   -5.474  1.00 0.00 ? 4  LYS A HA   2  
ATOM   853   H  HB2  . LYS A 1 4  ? 6.497  -0.420  -6.334  1.00 0.00 ? 4  LYS A HB2  2  
ATOM   854   H  HB3  . LYS A 1 4  ? 7.192  -0.340  -4.705  1.00 0.00 ? 4  LYS A HB3  2  
ATOM   855   H  HG2  . LYS A 1 4  ? 6.928  -2.646  -5.436  1.00 0.00 ? 4  LYS A HG2  2  
ATOM   856   H  HG3  . LYS A 1 4  ? 5.928  -2.331  -4.017  1.00 0.00 ? 4  LYS A HG3  2  
ATOM   857   H  HD2  . LYS A 1 4  ? 3.917  -2.144  -5.445  1.00 0.00 ? 4  LYS A HD2  2  
ATOM   858   H  HD3  . LYS A 1 4  ? 4.915  -2.345  -6.901  1.00 0.00 ? 4  LYS A HD3  2  
ATOM   859   H  HE2  . LYS A 1 4  ? 5.556  -4.617  -6.138  1.00 0.00 ? 4  LYS A HE2  2  
ATOM   860   H  HE3  . LYS A 1 4  ? 4.612  -4.393  -4.653  1.00 0.00 ? 4  LYS A HE3  2  
ATOM   861   H  HZ1  . LYS A 1 4  ? 3.415  -5.634  -6.287  1.00 0.00 ? 4  LYS A HZ1  2  
ATOM   862   H  HZ2  . LYS A 1 4  ? 2.652  -4.205  -5.991  1.00 0.00 ? 4  LYS A HZ2  2  
ATOM   863   H  HZ3  . LYS A 1 4  ? 3.521  -4.404  -7.379  1.00 0.00 ? 4  LYS A HZ3  2  
ATOM   864   N  N    . VAL A 1 5  ? 5.573  0.402   -2.429  1.00 0.00 ? 5  VAL A N    2  
ATOM   865   C  CA   . VAL A 1 5  ? 5.497  0.048   -1.018  1.00 0.00 ? 5  VAL A CA   2  
ATOM   866   C  C    . VAL A 1 5  ? 4.230  0.632   -0.390  1.00 0.00 ? 5  VAL A C    2  
ATOM   867   O  O    . VAL A 1 5  ? 3.276  -0.102  -0.142  1.00 0.00 ? 5  VAL A O    2  
ATOM   868   C  CB   . VAL A 1 5  ? 6.784  0.524   -0.321  1.00 0.00 ? 5  VAL A CB   2  
ATOM   869   C  CG1  . VAL A 1 5  ? 6.784  0.321   1.198   1.00 0.00 ? 5  VAL A CG1  2  
ATOM   870   C  CG2  . VAL A 1 5  ? 7.999  -0.208  -0.904  1.00 0.00 ? 5  VAL A CG2  2  
ATOM   871   H  H    . VAL A 1 5  ? 6.383  0.917   -2.736  1.00 0.00 ? 5  VAL A H    2  
ATOM   872   H  HA   . VAL A 1 5  ? 5.450  -1.037  -0.934  1.00 0.00 ? 5  VAL A HA   2  
ATOM   873   H  HB   . VAL A 1 5  ? 6.896  1.588   -0.512  1.00 0.00 ? 5  VAL A HB   2  
ATOM   874   H  HG11 . VAL A 1 5  ? 6.679  -0.737  1.436   1.00 0.00 ? 5  VAL A HG11 2  
ATOM   875   H  HG12 . VAL A 1 5  ? 7.729  0.692   1.599   1.00 0.00 ? 5  VAL A HG12 2  
ATOM   876   H  HG13 . VAL A 1 5  ? 5.976  0.881   1.667   1.00 0.00 ? 5  VAL A HG13 2  
ATOM   877   H  HG21 . VAL A 1 5  ? 8.906  0.118   -0.396  1.00 0.00 ? 5  VAL A HG21 2  
ATOM   878   H  HG22 . VAL A 1 5  ? 7.888  -1.284  -0.773  1.00 0.00 ? 5  VAL A HG22 2  
ATOM   879   H  HG23 . VAL A 1 5  ? 8.098  0.015   -1.966  1.00 0.00 ? 5  VAL A HG23 2  
ATOM   880   N  N    . CYS A 1 6  ? 4.222  1.944   -0.124  1.00 0.00 ? 6  CYS A N    2  
ATOM   881   C  CA   . CYS A 1 6  ? 3.102  2.602   0.533   1.00 0.00 ? 6  CYS A CA   2  
ATOM   882   C  C    . CYS A 1 6  ? 1.950  2.813   -0.448  1.00 0.00 ? 6  CYS A C    2  
ATOM   883   O  O    . CYS A 1 6  ? 0.799  2.566   -0.094  1.00 0.00 ? 6  CYS A O    2  
ATOM   884   C  CB   . CYS A 1 6  ? 3.545  3.910   1.203   1.00 0.00 ? 6  CYS A CB   2  
ATOM   885   S  SG   . CYS A 1 6  ? 4.395  5.131   0.168   1.00 0.00 ? 6  CYS A SG   2  
ATOM   886   H  H    . CYS A 1 6  ? 5.031  2.499   -0.362  1.00 0.00 ? 6  CYS A H    2  
ATOM   887   H  HA   . CYS A 1 6  ? 2.740  1.955   1.335   1.00 0.00 ? 6  CYS A HA   2  
ATOM   888   H  HB2  . CYS A 1 6  ? 2.659  4.390   1.623   1.00 0.00 ? 6  CYS A HB2  2  
ATOM   889   H  HB3  . CYS A 1 6  ? 4.213  3.665   2.029   1.00 0.00 ? 6  CYS A HB3  2  
ATOM   890   N  N    . ARG A 1 7  ? 2.258  3.268   -1.670  1.00 0.00 ? 7  ARG A N    2  
ATOM   891   C  CA   . ARG A 1 7  ? 1.277  3.721   -2.649  1.00 0.00 ? 7  ARG A CA   2  
ATOM   892   C  C    . ARG A 1 7  ? 0.413  4.841   -2.057  1.00 0.00 ? 7  ARG A C    2  
ATOM   893   O  O    . ARG A 1 7  ? -0.816 4.794   -2.107  1.00 0.00 ? 7  ARG A O    2  
ATOM   894   C  CB   . ARG A 1 7  ? 0.480  2.515   -3.177  1.00 0.00 ? 7  ARG A CB   2  
ATOM   895   C  CG   . ARG A 1 7  ? -0.255 2.819   -4.491  1.00 0.00 ? 7  ARG A CG   2  
ATOM   896   C  CD   . ARG A 1 7  ? -0.915 1.558   -5.060  1.00 0.00 ? 7  ARG A CD   2  
ATOM   897   N  NE   . ARG A 1 7  ? -1.950 1.035   -4.158  1.00 0.00 ? 7  ARG A NE   2  
ATOM   898   C  CZ   . ARG A 1 7  ? -2.672 -0.078  -4.378  1.00 0.00 ? 7  ARG A CZ   2  
ATOM   899   N  NH1  . ARG A 1 7  ? -2.494 -0.798  -5.495  1.00 0.00 ? 7  ARG A NH1  2  
ATOM   900   N  NH2  . ARG A 1 7  ? -3.578 -0.470  -3.472  1.00 0.00 ? 7  ARG A NH2  2  
ATOM   901   H  H    . ARG A 1 7  ? 3.232  3.373   -1.912  1.00 0.00 ? 7  ARG A H    2  
ATOM   902   H  HA   . ARG A 1 7  ? 1.833  4.153   -3.481  1.00 0.00 ? 7  ARG A HA   2  
ATOM   903   H  HB2  . ARG A 1 7  ? 1.178  1.698   -3.367  1.00 0.00 ? 7  ARG A HB2  2  
ATOM   904   H  HB3  . ARG A 1 7  ? -0.234 2.183   -2.422  1.00 0.00 ? 7  ARG A HB3  2  
ATOM   905   H  HG2  . ARG A 1 7  ? -1.024 3.572   -4.329  1.00 0.00 ? 7  ARG A HG2  2  
ATOM   906   H  HG3  . ARG A 1 7  ? 0.462  3.193   -5.221  1.00 0.00 ? 7  ARG A HG3  2  
ATOM   907   H  HD2  . ARG A 1 7  ? -1.371 1.810   -6.019  1.00 0.00 ? 7  ARG A HD2  2  
ATOM   908   H  HD3  . ARG A 1 7  ? -0.149 0.797   -5.222  1.00 0.00 ? 7  ARG A HD3  2  
ATOM   909   H  HE   . ARG A 1 7  ? -2.118 1.557   -3.309  1.00 0.00 ? 7  ARG A HE   2  
ATOM   910   H  HH11 . ARG A 1 7  ? -1.816 -0.504  -6.183  1.00 0.00 ? 7  ARG A HH11 2  
ATOM   911   H  HH12 . ARG A 1 7  ? -3.039 -1.632  -5.658  1.00 0.00 ? 7  ARG A HH12 2  
ATOM   912   H  HH21 . ARG A 1 7  ? -3.715 0.066   -2.628  1.00 0.00 ? 7  ARG A HH21 2  
ATOM   913   H  HH22 . ARG A 1 7  ? -4.127 -1.304  -3.626  1.00 0.00 ? 7  ARG A HH22 2  
ATOM   914   N  N    . LYS A 1 8  ? 1.079  5.852   -1.487  1.00 0.00 ? 8  LYS A N    2  
ATOM   915   C  CA   . LYS A 1 8  ? 0.472  7.026   -0.876  1.00 0.00 ? 8  LYS A CA   2  
ATOM   916   C  C    . LYS A 1 8  ? 1.324  8.248   -1.220  1.00 0.00 ? 8  LYS A C    2  
ATOM   917   O  O    . LYS A 1 8  ? 2.487  8.108   -1.592  1.00 0.00 ? 8  LYS A O    2  
ATOM   918   C  CB   . LYS A 1 8  ? 0.394  6.858   0.647   1.00 0.00 ? 8  LYS A CB   2  
ATOM   919   C  CG   . LYS A 1 8  ? -0.549 5.724   1.065   1.00 0.00 ? 8  LYS A CG   2  
ATOM   920   C  CD   . LYS A 1 8  ? -0.590 5.602   2.592   1.00 0.00 ? 8  LYS A CD   2  
ATOM   921   C  CE   . LYS A 1 8  ? -1.471 4.417   3.006   1.00 0.00 ? 8  LYS A CE   2  
ATOM   922   N  NZ   . LYS A 1 8  ? -1.510 4.260   4.470   1.00 0.00 ? 8  LYS A NZ   2  
ATOM   923   H  H    . LYS A 1 8  ? 2.088  5.834   -1.509  1.00 0.00 ? 8  LYS A H    2  
ATOM   924   H  HA   . LYS A 1 8  ? -0.533 7.182   -1.264  1.00 0.00 ? 8  LYS A HA   2  
ATOM   925   H  HB2  . LYS A 1 8  ? 1.396  6.656   1.026   1.00 0.00 ? 8  LYS A HB2  2  
ATOM   926   H  HB3  . LYS A 1 8  ? 0.028  7.787   1.087   1.00 0.00 ? 8  LYS A HB3  2  
ATOM   927   H  HG2  . LYS A 1 8  ? -1.552 5.925   0.685   1.00 0.00 ? 8  LYS A HG2  2  
ATOM   928   H  HG3  . LYS A 1 8  ? -0.196 4.783   0.653   1.00 0.00 ? 8  LYS A HG3  2  
ATOM   929   H  HD2  . LYS A 1 8  ? 0.424  5.446   2.965   1.00 0.00 ? 8  LYS A HD2  2  
ATOM   930   H  HD3  . LYS A 1 8  ? -0.988 6.524   3.018   1.00 0.00 ? 8  LYS A HD3  2  
ATOM   931   H  HE2  . LYS A 1 8  ? -2.486 4.574   2.639   1.00 0.00 ? 8  LYS A HE2  2  
ATOM   932   H  HE3  . LYS A 1 8  ? -1.074 3.501   2.567   1.00 0.00 ? 8  LYS A HE3  2  
ATOM   933   H  HZ1  . LYS A 1 8  ? -2.095 3.471   4.710   1.00 0.00 ? 8  LYS A HZ1  2  
ATOM   934   H  HZ2  . LYS A 1 8  ? -0.576 4.101   4.820   1.00 0.00 ? 8  LYS A HZ2  2  
ATOM   935   H  HZ3  . LYS A 1 8  ? -1.888 5.096   4.892   1.00 0.00 ? 8  LYS A HZ3  2  
ATOM   936   N  N    . LYS A 1 9  ? 0.727  9.440   -1.121  1.00 0.00 ? 9  LYS A N    2  
ATOM   937   C  CA   . LYS A 1 9  ? 1.451  10.699  -1.199  1.00 0.00 ? 9  LYS A CA   2  
ATOM   938   C  C    . LYS A 1 9  ? 1.991  11.037  0.193   1.00 0.00 ? 9  LYS A C    2  
ATOM   939   O  O    . LYS A 1 9  ? 1.284  10.868  1.186   1.00 0.00 ? 9  LYS A O    2  
ATOM   940   C  CB   . LYS A 1 9  ? 0.514  11.794  -1.727  1.00 0.00 ? 9  LYS A CB   2  
ATOM   941   C  CG   . LYS A 1 9  ? 1.279  13.087  -2.032  1.00 0.00 ? 9  LYS A CG   2  
ATOM   942   C  CD   . LYS A 1 9  ? 0.330  14.174  -2.546  1.00 0.00 ? 9  LYS A CD   2  
ATOM   943   C  CE   . LYS A 1 9  ? 1.116  15.454  -2.852  1.00 0.00 ? 9  LYS A CE   2  
ATOM   944   N  NZ   . LYS A 1 9  ? 0.235  16.528  -3.343  1.00 0.00 ? 9  LYS A NZ   2  
ATOM   945   H  H    . LYS A 1 9  ? -0.230 9.481   -0.800  1.00 0.00 ? 9  LYS A H    2  
ATOM   946   H  HA   . LYS A 1 9  ? 2.277  10.595  -1.905  1.00 0.00 ? 9  LYS A HA   2  
ATOM   947   H  HB2  . LYS A 1 9  ? 0.047  11.443  -2.649  1.00 0.00 ? 9  LYS A HB2  2  
ATOM   948   H  HB3  . LYS A 1 9  ? -0.265 11.993  -0.986  1.00 0.00 ? 9  LYS A HB3  2  
ATOM   949   H  HG2  . LYS A 1 9  ? 1.775  13.449  -1.130  1.00 0.00 ? 9  LYS A HG2  2  
ATOM   950   H  HG3  . LYS A 1 9  ? 2.031  12.883  -2.794  1.00 0.00 ? 9  LYS A HG3  2  
ATOM   951   H  HD2  . LYS A 1 9  ? -0.164 13.823  -3.452  1.00 0.00 ? 9  LYS A HD2  2  
ATOM   952   H  HD3  . LYS A 1 9  ? -0.424 14.381  -1.785  1.00 0.00 ? 9  LYS A HD3  2  
ATOM   953   H  HE2  . LYS A 1 9  ? 1.616  15.798  -1.945  1.00 0.00 ? 9  LYS A HE2  2  
ATOM   954   H  HE3  . LYS A 1 9  ? 1.871  15.244  -3.611  1.00 0.00 ? 9  LYS A HE3  2  
ATOM   955   H  HZ1  . LYS A 1 9  ? -0.226 16.230  -4.192  1.00 0.00 ? 9  LYS A HZ1  2  
ATOM   956   H  HZ2  . LYS A 1 9  ? -0.461 16.745  -2.644  1.00 0.00 ? 9  LYS A HZ2  2  
ATOM   957   H  HZ3  . LYS A 1 9  ? 0.784  17.354  -3.535  1.00 0.00 ? 9  LYS A HZ3  2  
ATOM   958   N  N    . GLY A 1 10 ? 3.238  11.511  0.264   1.00 0.00 ? 10 GLY A N    2  
ATOM   959   C  CA   . GLY A 1 10 ? 3.813  12.072  1.471   1.00 0.00 ? 10 GLY A CA   2  
ATOM   960   C  C    . GLY A 1 10 ? 5.101  12.820  1.139   1.00 0.00 ? 10 GLY A C    2  
ATOM   961   O  O    . GLY A 1 10 ? 5.091  14.044  1.007   1.00 0.00 ? 10 GLY A O    2  
ATOM   962   H  H    . GLY A 1 10 ? 3.774  11.598  -0.591  1.00 0.00 ? 10 GLY A H    2  
ATOM   963   H  HA2  . GLY A 1 10 ? 3.105  12.770  1.922   1.00 0.00 ? 10 GLY A HA2  2  
ATOM   964   H  HA3  . GLY A 1 10 ? 4.028  11.269  2.179   1.00 0.00 ? 10 GLY A HA3  2  
ATOM   965   N  N    . GLU A 1 11 ? 6.206  12.078  1.003   1.00 0.00 ? 11 GLU A N    2  
ATOM   966   C  CA   . GLU A 1 11 ? 7.558  12.615  0.906   1.00 0.00 ? 11 GLU A CA   2  
ATOM   967   C  C    . GLU A 1 11 ? 8.015  12.719  -0.554  1.00 0.00 ? 11 GLU A C    2  
ATOM   968   O  O    . GLU A 1 11 ? 9.134  12.331  -0.893  1.00 0.00 ? 11 GLU A O    2  
ATOM   969   C  CB   . GLU A 1 11 ? 8.513  11.788  1.788   1.00 0.00 ? 11 GLU A CB   2  
ATOM   970   C  CG   . GLU A 1 11 ? 8.610  10.297  1.419   1.00 0.00 ? 11 GLU A CG   2  
ATOM   971   C  CD   . GLU A 1 11 ? 7.455  9.461   1.964   1.00 0.00 ? 11 GLU A CD   2  
ATOM   972   O  OE1  . GLU A 1 11 ? 7.557  9.042   3.137   1.00 0.00 ? 11 GLU A OE1  2  
ATOM   973   O  OE2  . GLU A 1 11 ? 6.486  9.263   1.199   1.00 0.00 ? 11 GLU A OE2  2  
ATOM   974   H  H    . GLU A 1 11 ? 6.106  11.071  1.007   1.00 0.00 ? 11 GLU A H    2  
ATOM   975   H  HA   . GLU A 1 11 ? 7.570  13.628  1.311   1.00 0.00 ? 11 GLU A HA   2  
ATOM   976   H  HB2  . GLU A 1 11 ? 9.512  12.223  1.700   1.00 0.00 ? 11 GLU A HB2  2  
ATOM   977   H  HB3  . GLU A 1 11 ? 8.198  11.869  2.832   1.00 0.00 ? 11 GLU A HB3  2  
ATOM   978   H  HG2  . GLU A 1 11 ? 8.649  10.190  0.340   1.00 0.00 ? 11 GLU A HG2  2  
ATOM   979   H  HG3  . GLU A 1 11 ? 9.537  9.899   1.831   1.00 0.00 ? 11 GLU A HG3  2  
ATOM   980   N  N    . ASP A 1 12 ? 7.160  13.277  -1.421  1.00 0.00 ? 12 ASP A N    2  
ATOM   981   C  CA   . ASP A 1 12 ? 7.354  13.257  -2.867  1.00 0.00 ? 12 ASP A CA   2  
ATOM   982   C  C    . ASP A 1 12 ? 8.230  14.435  -3.310  1.00 0.00 ? 12 ASP A C    2  
ATOM   983   O  O    . ASP A 1 12 ? 7.813  15.252  -4.129  1.00 0.00 ? 12 ASP A O    2  
ATOM   984   C  CB   . ASP A 1 12 ? 5.991  13.257  -3.577  1.00 0.00 ? 12 ASP A CB   2  
ATOM   985   C  CG   . ASP A 1 12 ? 5.131  12.068  -3.167  1.00 0.00 ? 12 ASP A CG   2  
ATOM   986   O  OD1  . ASP A 1 12 ? 4.454  12.195  -2.127  1.00 0.00 ? 12 ASP A OD1  2  
ATOM   987   O  OD2  . ASP A 1 12 ? 5.155  11.052  -3.896  1.00 0.00 ? 12 ASP A OD2  2  
ATOM   988   H  H    . ASP A 1 12 ? 6.268  13.606  -1.075  1.00 0.00 ? 12 ASP A H    2  
ATOM   989   H  HA   . ASP A 1 12 ? 7.862  12.334  -3.141  1.00 0.00 ? 12 ASP A HA   2  
ATOM   990   H  HB2  . ASP A 1 12 ? 5.461  14.176  -3.323  1.00 0.00 ? 12 ASP A HB2  2  
ATOM   991   H  HB3  . ASP A 1 12 ? 6.148  13.226  -4.657  1.00 0.00 ? 12 ASP A HB3  2  
ATOM   992   N  N    . ASP A 1 13 ? 9.454  14.508  -2.774  1.00 0.00 ? 13 ASP A N    2  
ATOM   993   C  CA   . ASP A 1 13 ? 10.465 15.478  -3.172  1.00 0.00 ? 13 ASP A CA   2  
ATOM   994   C  C    . ASP A 1 13 ? 11.026 15.116  -4.546  1.00 0.00 ? 13 ASP A C    2  
ATOM   995   O  O    . ASP A 1 13 ? 10.897 15.878  -5.503  1.00 0.00 ? 13 ASP A O    2  
ATOM   996   C  CB   . ASP A 1 13 ? 11.563 15.533  -2.104  1.00 0.00 ? 13 ASP A CB   2  
ATOM   997   C  CG   . ASP A 1 13 ? 12.697 16.471  -2.510  1.00 0.00 ? 13 ASP A CG   2  
ATOM   998   O  OD1  . ASP A 1 13 ? 12.529 17.692  -2.298  1.00 0.00 ? 13 ASP A OD1  2  
ATOM   999   O  OD2  . ASP A 1 13 ? 13.708 15.952  -3.030  1.00 0.00 ? 13 ASP A OD2  2  
ATOM   1000  H  H    . ASP A 1 13 ? 9.715  13.813  -2.087  1.00 0.00 ? 13 ASP A H    2  
ATOM   1001  H  HA   . ASP A 1 13 ? 10.013 16.464  -3.231  1.00 0.00 ? 13 ASP A HA   2  
ATOM   1002  H  HB2  . ASP A 1 13 ? 11.133 15.884  -1.166  1.00 0.00 ? 13 ASP A HB2  2  
ATOM   1003  H  HB3  . ASP A 1 13 ? 11.967 14.535  -1.942  1.00 0.00 ? 13 ASP A HB3  2  
ATOM   1004  N  N    . LYS A 1 14 ? 11.652 13.939  -4.623  1.00 0.00 ? 14 LYS A N    2  
ATOM   1005  C  CA   . LYS A 1 14 ? 12.303 13.413  -5.808  1.00 0.00 ? 14 LYS A CA   2  
ATOM   1006  C  C    . LYS A 1 14 ? 12.402 11.902  -5.621  1.00 0.00 ? 14 LYS A C    2  
ATOM   1007  O  O    . LYS A 1 14 ? 13.308 11.417  -4.942  1.00 0.00 ? 14 LYS A O    2  
ATOM   1008  C  CB   . LYS A 1 14 ? 13.683 14.058  -5.999  1.00 0.00 ? 14 LYS A CB   2  
ATOM   1009  C  CG   . LYS A 1 14 ? 14.315 13.603  -7.324  1.00 0.00 ? 14 LYS A CG   2  
ATOM   1010  C  CD   . LYS A 1 14 ? 15.738 14.143  -7.522  1.00 0.00 ? 14 LYS A CD   2  
ATOM   1011  C  CE   . LYS A 1 14 ? 16.751 13.428  -6.619  1.00 0.00 ? 14 LYS A CE   2  
ATOM   1012  N  NZ   . LYS A 1 14 ? 18.136 13.823  -6.930  1.00 0.00 ? 14 LYS A NZ   2  
ATOM   1013  H  H    . LYS A 1 14 ? 11.664 13.364  -3.794  1.00 0.00 ? 14 LYS A H    2  
ATOM   1014  H  HA   . LYS A 1 14 ? 11.695 13.636  -6.684  1.00 0.00 ? 14 LYS A HA   2  
ATOM   1015  H  HB2  . LYS A 1 14 ? 13.576 15.144  -6.022  1.00 0.00 ? 14 LYS A HB2  2  
ATOM   1016  H  HB3  . LYS A 1 14 ? 14.317 13.786  -5.157  1.00 0.00 ? 14 LYS A HB3  2  
ATOM   1017  H  HG2  . LYS A 1 14 ? 14.342 12.515  -7.382  1.00 0.00 ? 14 LYS A HG2  2  
ATOM   1018  H  HG3  . LYS A 1 14 ? 13.691 13.972  -8.139  1.00 0.00 ? 14 LYS A HG3  2  
ATOM   1019  H  HD2  . LYS A 1 14 ? 16.018 13.971  -8.562  1.00 0.00 ? 14 LYS A HD2  2  
ATOM   1020  H  HD3  . LYS A 1 14 ? 15.754 15.217  -7.329  1.00 0.00 ? 14 LYS A HD3  2  
ATOM   1021  H  HE2  . LYS A 1 14 ? 16.550 13.666  -5.575  1.00 0.00 ? 14 LYS A HE2  2  
ATOM   1022  H  HE3  . LYS A 1 14 ? 16.665 12.349  -6.758  1.00 0.00 ? 14 LYS A HE3  2  
ATOM   1023  H  HZ1  . LYS A 1 14 ? 18.338 13.634  -7.901  1.00 0.00 ? 14 LYS A HZ1  2  
ATOM   1024  H  HZ2  . LYS A 1 14 ? 18.264 14.806  -6.743  1.00 0.00 ? 14 LYS A HZ2  2  
ATOM   1025  H  HZ3  . LYS A 1 14 ? 18.770 13.283  -6.353  1.00 0.00 ? 14 LYS A HZ3  2  
ATOM   1026  N  N    . LEU A 1 15 ? 11.461 11.161  -6.214  1.00 0.00 ? 15 LEU A N    2  
ATOM   1027  C  CA   . LEU A 1 15 ? 11.315 9.740   -5.943  1.00 0.00 ? 15 LEU A CA   2  
ATOM   1028  C  C    . LEU A 1 15 ? 12.500 8.975   -6.526  1.00 0.00 ? 15 LEU A C    2  
ATOM   1029  O  O    . LEU A 1 15 ? 13.053 9.339   -7.565  1.00 0.00 ? 15 LEU A O    2  
ATOM   1030  C  CB   . LEU A 1 15 ? 9.996  9.186   -6.500  1.00 0.00 ? 15 LEU A CB   2  
ATOM   1031  C  CG   . LEU A 1 15 ? 8.793  9.485   -5.594  1.00 0.00 ? 15 LEU A CG   2  
ATOM   1032  C  CD1  . LEU A 1 15 ? 8.394  10.962  -5.628  1.00 0.00 ? 15 LEU A CD1  2  
ATOM   1033  C  CD2  . LEU A 1 15 ? 7.611  8.616   -6.031  1.00 0.00 ? 15 LEU A CD2  2  
ATOM   1034  H  H    . LEU A 1 15 ? 10.743 11.626  -6.749  1.00 0.00 ? 15 LEU A H    2  
ATOM   1035  H  HA   . LEU A 1 15 ? 11.317 9.595   -4.861  1.00 0.00 ? 15 LEU A HA   2  
ATOM   1036  H  HB2  . LEU A 1 15 ? 9.820  9.561   -7.511  1.00 0.00 ? 15 LEU A HB2  2  
ATOM   1037  H  HB3  . LEU A 1 15 ? 10.093 8.100   -6.550  1.00 0.00 ? 15 LEU A HB3  2  
ATOM   1038  H  HG   . LEU A 1 15 ? 9.040  9.209   -4.569  1.00 0.00 ? 15 LEU A HG   2  
ATOM   1039  H  HD11 . LEU A 1 15 ? 9.153  11.574  -5.144  1.00 0.00 ? 15 LEU A HD11 2  
ATOM   1040  H  HD12 . LEU A 1 15 ? 8.255  11.294  -6.656  1.00 0.00 ? 15 LEU A HD12 2  
ATOM   1041  H  HD13 . LEU A 1 15 ? 7.462  11.088  -5.083  1.00 0.00 ? 15 LEU A HD13 2  
ATOM   1042  H  HD21 . LEU A 1 15 ? 7.353  8.824   -7.069  1.00 0.00 ? 15 LEU A HD21 2  
ATOM   1043  H  HD22 . LEU A 1 15 ? 7.884  7.564   -5.934  1.00 0.00 ? 15 LEU A HD22 2  
ATOM   1044  H  HD23 . LEU A 1 15 ? 6.748  8.809   -5.393  1.00 0.00 ? 15 LEU A HD23 2  
ATOM   1045  N  N    . ILE A 1 16 ? 12.886 7.918   -5.813  1.00 0.00 ? 16 ILE A N    2  
ATOM   1046  C  CA   . ILE A 1 16 ? 14.099 7.155   -6.027  1.00 0.00 ? 16 ILE A CA   2  
ATOM   1047  C  C    . ILE A 1 16 ? 13.710 5.894   -6.803  1.00 0.00 ? 16 ILE A C    2  
ATOM   1048  O  O    . ILE A 1 16 ? 13.638 4.796   -6.258  1.00 0.00 ? 16 ILE A O    2  
ATOM   1049  C  CB   . ILE A 1 16 ? 14.808 6.939   -4.671  1.00 0.00 ? 16 ILE A CB   2  
ATOM   1050  C  CG1  . ILE A 1 16 ? 16.102 6.133   -4.838  1.00 0.00 ? 16 ILE A CG1  2  
ATOM   1051  C  CG2  . ILE A 1 16 ? 13.904 6.342   -3.583  1.00 0.00 ? 16 ILE A CG2  2  
ATOM   1052  C  CD1  . ILE A 1 16 ? 16.897 6.041   -3.530  1.00 0.00 ? 16 ILE A CD1  2  
ATOM   1053  H  H    . ILE A 1 16 ? 12.260 7.593   -5.089  1.00 0.00 ? 16 ILE A H    2  
ATOM   1054  H  HA   . ILE A 1 16 ? 14.788 7.726   -6.651  1.00 0.00 ? 16 ILE A HA   2  
ATOM   1055  H  HB   . ILE A 1 16 ? 15.096 7.930   -4.317  1.00 0.00 ? 16 ILE A HB   2  
ATOM   1056  H  HG12 . ILE A 1 16 ? 15.872 5.127   -5.185  1.00 0.00 ? 16 ILE A HG12 2  
ATOM   1057  H  HG13 . ILE A 1 16 ? 16.729 6.633   -5.579  1.00 0.00 ? 16 ILE A HG13 2  
ATOM   1058  H  HG21 . ILE A 1 16 ? 14.435 6.296   -2.635  1.00 0.00 ? 16 ILE A HG21 2  
ATOM   1059  H  HG22 . ILE A 1 16 ? 13.043 6.985   -3.427  1.00 0.00 ? 16 ILE A HG22 2  
ATOM   1060  H  HG23 . ILE A 1 16 ? 13.571 5.339   -3.842  1.00 0.00 ? 16 ILE A HG23 2  
ATOM   1061  H  HD11 . ILE A 1 16 ? 16.402 5.387   -2.814  1.00 0.00 ? 16 ILE A HD11 2  
ATOM   1062  H  HD12 . ILE A 1 16 ? 17.879 5.623   -3.745  1.00 0.00 ? 16 ILE A HD12 2  
ATOM   1063  H  HD13 . ILE A 1 16 ? 17.010 7.030   -3.090  1.00 0.00 ? 16 ILE A HD13 2  
ATOM   1064  N  N    . LEU A 1 17 ? 13.438 6.072   -8.101  1.00 0.00 ? 17 LEU A N    2  
ATOM   1065  C  CA   . LEU A 1 17 ? 13.110 4.976   -8.998  1.00 0.00 ? 17 LEU A CA   2  
ATOM   1066  C  C    . LEU A 1 17 ? 14.370 4.137   -9.199  1.00 0.00 ? 17 LEU A C    2  
ATOM   1067  O  O    . LEU A 1 17 ? 15.458 4.686   -9.367  1.00 0.00 ? 17 LEU A O    2  
ATOM   1068  C  CB   . LEU A 1 17 ? 12.598 5.520   -10.340 1.00 0.00 ? 17 LEU A CB   2  
ATOM   1069  C  CG   . LEU A 1 17 ? 11.101 5.869   -10.334 1.00 0.00 ? 17 LEU A CG   2  
ATOM   1070  C  CD1  . LEU A 1 17 ? 10.729 6.902   -9.263  1.00 0.00 ? 17 LEU A CD1  2  
ATOM   1071  C  CD2  . LEU A 1 17 ? 10.703 6.401   -11.714 1.00 0.00 ? 17 LEU A CD2  2  
ATOM   1072  H  H    . LEU A 1 17 ? 13.503 6.999   -8.495  1.00 0.00 ? 17 LEU A H    2  
ATOM   1073  H  HA   . LEU A 1 17 ? 12.332 4.361   -8.547  1.00 0.00 ? 17 LEU A HA   2  
ATOM   1074  H  HB2  . LEU A 1 17 ? 13.188 6.394   -10.629 1.00 0.00 ? 17 LEU A HB2  2  
ATOM   1075  H  HB3  . LEU A 1 17 ? 12.743 4.743   -11.092 1.00 0.00 ? 17 LEU A HB3  2  
ATOM   1076  H  HG   . LEU A 1 17 ? 10.530 4.957   -10.151 1.00 0.00 ? 17 LEU A HG   2  
ATOM   1077  H  HD11 . LEU A 1 17 ? 9.683  7.190   -9.376  1.00 0.00 ? 17 LEU A HD11 2  
ATOM   1078  H  HD12 . LEU A 1 17 ? 10.855 6.475   -8.269  1.00 0.00 ? 17 LEU A HD12 2  
ATOM   1079  H  HD13 . LEU A 1 17 ? 11.354 7.789   -9.364  1.00 0.00 ? 17 LEU A HD13 2  
ATOM   1080  H  HD21 . LEU A 1 17 ? 9.633  6.613   -11.736 1.00 0.00 ? 17 LEU A HD21 2  
ATOM   1081  H  HD22 . LEU A 1 17 ? 11.253 7.315   -11.937 1.00 0.00 ? 17 LEU A HD22 2  
ATOM   1082  H  HD23 . LEU A 1 17 ? 10.926 5.654   -12.476 1.00 0.00 ? 17 LEU A HD23 2  
ATOM   1083  N  N    . CYS A 1 18 ? 14.223 2.807   -9.174  1.00 0.00 ? 18 CYS A N    2  
ATOM   1084  C  CA   . CYS A 1 18 ? 15.368 1.913   -9.126  1.00 0.00 ? 18 CYS A CA   2  
ATOM   1085  C  C    . CYS A 1 18 ? 16.143 1.938   -10.445 1.00 0.00 ? 18 CYS A C    2  
ATOM   1086  O  O    . CYS A 1 18 ? 15.549 1.949   -11.520 1.00 0.00 ? 18 CYS A O    2  
ATOM   1087  C  CB   . CYS A 1 18 ? 14.916 0.497   -8.757  1.00 0.00 ? 18 CYS A CB   2  
ATOM   1088  S  SG   . CYS A 1 18 ? 16.240 -0.739  -8.754  1.00 0.00 ? 18 CYS A SG   2  
ATOM   1089  H  H    . CYS A 1 18 ? 13.296 2.414   -9.053  1.00 0.00 ? 18 CYS A H    2  
ATOM   1090  H  HA   . CYS A 1 18 ? 16.016 2.268   -8.327  1.00 0.00 ? 18 CYS A HA   2  
ATOM   1091  H  HB2  . CYS A 1 18 ? 14.463 0.535   -7.765  1.00 0.00 ? 18 CYS A HB2  2  
ATOM   1092  H  HB3  . CYS A 1 18 ? 14.162 0.155   -9.459  1.00 0.00 ? 18 CYS A HB3  2  
ATOM   1093  N  N    . ASP A 1 19 ? 17.477 1.955   -10.358 1.00 0.00 ? 19 ASP A N    2  
ATOM   1094  C  CA   . ASP A 1 19 ? 18.351 2.009   -11.523 1.00 0.00 ? 19 ASP A CA   2  
ATOM   1095  C  C    . ASP A 1 19 ? 18.134 0.818   -12.460 1.00 0.00 ? 19 ASP A C    2  
ATOM   1096  O  O    . ASP A 1 19 ? 17.951 0.986   -13.664 1.00 0.00 ? 19 ASP A O    2  
ATOM   1097  C  CB   . ASP A 1 19 ? 19.822 2.149   -11.092 1.00 0.00 ? 19 ASP A CB   2  
ATOM   1098  C  CG   . ASP A 1 19 ? 20.336 1.159   -10.041 1.00 0.00 ? 19 ASP A CG   2  
ATOM   1099  O  OD1  . ASP A 1 19 ? 19.608 0.201   -9.702  1.00 0.00 ? 19 ASP A OD1  2  
ATOM   1100  O  OD2  . ASP A 1 19 ? 21.466 1.399   -9.563  1.00 0.00 ? 19 ASP A OD2  2  
ATOM   1101  H  H    . ASP A 1 19 ? 17.909 1.861   -9.448  1.00 0.00 ? 19 ASP A H    2  
ATOM   1102  H  HA   . ASP A 1 19 ? 18.095 2.908   -12.084 1.00 0.00 ? 19 ASP A HA   2  
ATOM   1103  H  HB2  . ASP A 1 19 ? 20.457 2.084   -11.975 1.00 0.00 ? 19 ASP A HB2  2  
ATOM   1104  H  HB3  . ASP A 1 19 ? 19.935 3.142   -10.671 1.00 0.00 ? 19 ASP A HB3  2  
ATOM   1105  N  N    . GLU A 1 20 ? 18.116 -0.382  -11.881 1.00 0.00 ? 20 GLU A N    2  
ATOM   1106  C  CA   . GLU A 1 20 ? 18.143 -1.648  -12.586 1.00 0.00 ? 20 GLU A CA   2  
ATOM   1107  C  C    . GLU A 1 20 ? 16.785 -1.959  -13.220 1.00 0.00 ? 20 GLU A C    2  
ATOM   1108  O  O    . GLU A 1 20 ? 16.713 -2.212  -14.422 1.00 0.00 ? 20 GLU A O    2  
ATOM   1109  C  CB   . GLU A 1 20 ? 18.568 -2.718  -11.575 1.00 0.00 ? 20 GLU A CB   2  
ATOM   1110  C  CG   . GLU A 1 20 ? 18.870 -4.077  -12.215 1.00 0.00 ? 20 GLU A CG   2  
ATOM   1111  C  CD   . GLU A 1 20 ? 19.332 -5.082  -11.161 1.00 0.00 ? 20 GLU A CD   2  
ATOM   1112  O  OE1  . GLU A 1 20 ? 20.313 -4.758  -10.454 1.00 0.00 ? 20 GLU A OE1  2  
ATOM   1113  O  OE2  . GLU A 1 20 ? 18.687 -6.148  -11.067 1.00 0.00 ? 20 GLU A OE2  2  
ATOM   1114  H  H    . GLU A 1 20 ? 18.316 -0.400  -10.889 1.00 0.00 ? 20 GLU A H    2  
ATOM   1115  H  HA   . GLU A 1 20 ? 18.901 -1.593  -13.369 1.00 0.00 ? 20 GLU A HA   2  
ATOM   1116  H  HB2  . GLU A 1 20 ? 19.474 -2.372  -11.070 1.00 0.00 ? 20 GLU A HB2  2  
ATOM   1117  H  HB3  . GLU A 1 20 ? 17.778 -2.840  -10.835 1.00 0.00 ? 20 GLU A HB3  2  
ATOM   1118  H  HG2  . GLU A 1 20 ? 17.975 -4.457  -12.710 1.00 0.00 ? 20 GLU A HG2  2  
ATOM   1119  H  HG3  . GLU A 1 20 ? 19.661 -3.961  -12.956 1.00 0.00 ? 20 GLU A HG3  2  
ATOM   1120  N  N    . CYS A 1 21 ? 15.720 -1.947  -12.407 1.00 0.00 ? 21 CYS A N    2  
ATOM   1121  C  CA   . CYS A 1 21 ? 14.394 -2.436  -12.778 1.00 0.00 ? 21 CYS A CA   2  
ATOM   1122  C  C    . CYS A 1 21 ? 13.285 -1.375  -12.692 1.00 0.00 ? 21 CYS A C    2  
ATOM   1123  O  O    . CYS A 1 21 ? 12.127 -1.703  -12.942 1.00 0.00 ? 21 CYS A O    2  
ATOM   1124  C  CB   . CYS A 1 21 ? 14.076 -3.676  -11.932 1.00 0.00 ? 21 CYS A CB   2  
ATOM   1125  S  SG   . CYS A 1 21 ? 14.211 -3.450  -10.139 1.00 0.00 ? 21 CYS A SG   2  
ATOM   1126  H  H    . CYS A 1 21 ? 15.859 -1.643  -11.454 1.00 0.00 ? 21 CYS A H    2  
ATOM   1127  H  HA   . CYS A 1 21 ? 14.400 -2.767  -13.818 1.00 0.00 ? 21 CYS A HA   2  
ATOM   1128  H  HB2  . CYS A 1 21 ? 13.066 -4.024  -12.158 1.00 0.00 ? 21 CYS A HB2  2  
ATOM   1129  H  HB3  . CYS A 1 21 ? 14.780 -4.464  -12.214 1.00 0.00 ? 21 CYS A HB3  2  
ATOM   1130  N  N    . ASN A 1 22 ? 13.613 -0.120  -12.350 1.00 0.00 ? 22 ASN A N    2  
ATOM   1131  C  CA   . ASN A 1 22 ? 12.704 1.025   -12.438 1.00 0.00 ? 22 ASN A CA   2  
ATOM   1132  C  C    . ASN A 1 22 ? 11.422 0.853   -11.614 1.00 0.00 ? 22 ASN A C    2  
ATOM   1133  O  O    . ASN A 1 22 ? 10.369 1.380   -11.967 1.00 0.00 ? 22 ASN A O    2  
ATOM   1134  C  CB   . ASN A 1 22 ? 12.442 1.376   -13.911 1.00 0.00 ? 22 ASN A CB   2  
ATOM   1135  C  CG   . ASN A 1 22 ? 11.946 2.811   -14.085 1.00 0.00 ? 22 ASN A CG   2  
ATOM   1136  O  OD1  . ASN A 1 22 ? 10.802 3.037   -14.471 1.00 0.00 ? 22 ASN A OD1  2  
ATOM   1137  N  ND2  . ASN A 1 22 ? 12.815 3.789   -13.818 1.00 0.00 ? 22 ASN A ND2  2  
ATOM   1138  H  H    . ASN A 1 22 ? 14.574 0.092   -12.117 1.00 0.00 ? 22 ASN A H    2  
ATOM   1139  H  HA   . ASN A 1 22 ? 13.211 1.873   -11.989 1.00 0.00 ? 22 ASN A HA   2  
ATOM   1140  H  HB2  . ASN A 1 22 ? 13.376 1.280   -14.471 1.00 0.00 ? 22 ASN A HB2  2  
ATOM   1141  H  HB3  . ASN A 1 22 ? 11.712 0.680   -14.325 1.00 0.00 ? 22 ASN A HB3  2  
ATOM   1142  H  HD21 . ASN A 1 22 ? 13.749 3.561   -13.503 1.00 0.00 ? 22 ASN A HD21 2  
ATOM   1143  H  HD22 . ASN A 1 22 ? 12.532 4.752   -13.939 1.00 0.00 ? 22 ASN A HD22 2  
ATOM   1144  N  N    . LYS A 1 23 ? 11.519 0.132   -10.492 1.00 0.00 ? 23 LYS A N    2  
ATOM   1145  C  CA   . LYS A 1 23 ? 10.472 0.050   -9.491  1.00 0.00 ? 23 LYS A CA   2  
ATOM   1146  C  C    . LYS A 1 23 ? 10.433 1.363   -8.706  1.00 0.00 ? 23 LYS A C    2  
ATOM   1147  O  O    . LYS A 1 23 ? 11.482 1.920   -8.386  1.00 0.00 ? 23 LYS A O    2  
ATOM   1148  C  CB   . LYS A 1 23 ? 10.761 -1.135  -8.563  1.00 0.00 ? 23 LYS A CB   2  
ATOM   1149  C  CG   . LYS A 1 23 ? 10.604 -2.476  -9.293  1.00 0.00 ? 23 LYS A CG   2  
ATOM   1150  C  CD   . LYS A 1 23 ? 11.026 -3.664  -8.414  1.00 0.00 ? 23 LYS A CD   2  
ATOM   1151  C  CE   . LYS A 1 23 ? 10.166 -3.866  -7.161  1.00 0.00 ? 23 LYS A CE   2  
ATOM   1152  N  NZ   . LYS A 1 23 ? 8.750  -4.097  -7.493  1.00 0.00 ? 23 LYS A NZ   2  
ATOM   1153  H  H    . LYS A 1 23 ? 12.390 -0.329  -10.280 1.00 0.00 ? 23 LYS A H    2  
ATOM   1154  H  HA   . LYS A 1 23 ? 9.510  -0.114  -9.978  1.00 0.00 ? 23 LYS A HA   2  
ATOM   1155  H  HB2  . LYS A 1 23 ? 11.783 -1.049  -8.194  1.00 0.00 ? 23 LYS A HB2  2  
ATOM   1156  H  HB3  . LYS A 1 23 ? 10.064 -1.090  -7.728  1.00 0.00 ? 23 LYS A HB3  2  
ATOM   1157  H  HG2  . LYS A 1 23 ? 9.574  -2.595  -9.627  1.00 0.00 ? 23 LYS A HG2  2  
ATOM   1158  H  HG3  . LYS A 1 23 ? 11.243 -2.478  -10.176 1.00 0.00 ? 23 LYS A HG3  2  
ATOM   1159  H  HD2  . LYS A 1 23 ? 10.985 -4.571  -9.019  1.00 0.00 ? 23 LYS A HD2  2  
ATOM   1160  H  HD3  . LYS A 1 23 ? 12.059 -3.517  -8.099  1.00 0.00 ? 23 LYS A HD3  2  
ATOM   1161  H  HE2  . LYS A 1 23 ? 10.541 -4.739  -6.625  1.00 0.00 ? 23 LYS A HE2  2  
ATOM   1162  H  HE3  . LYS A 1 23 ? 10.249 -3.003  -6.501  1.00 0.00 ? 23 LYS A HE3  2  
ATOM   1163  H  HZ1  . LYS A 1 23 ? 8.369  -3.279  -7.948  1.00 0.00 ? 23 LYS A HZ1  2  
ATOM   1164  H  HZ2  . LYS A 1 23 ? 8.672  -4.893  -8.109  1.00 0.00 ? 23 LYS A HZ2  2  
ATOM   1165  H  HZ3  . LYS A 1 23 ? 8.232  -4.279  -6.644  1.00 0.00 ? 23 LYS A HZ3  2  
ATOM   1166  N  N    . ALA A 1 24 ? 9.223  1.855   -8.419  1.00 0.00 ? 24 ALA A N    2  
ATOM   1167  C  CA   . ALA A 1 24 ? 8.997  3.185   -7.870  1.00 0.00 ? 24 ALA A CA   2  
ATOM   1168  C  C    . ALA A 1 24 ? 9.008  3.143   -6.343  1.00 0.00 ? 24 ALA A C    2  
ATOM   1169  O  O    . ALA A 1 24 ? 8.376  2.275   -5.738  1.00 0.00 ? 24 ALA A O    2  
ATOM   1170  C  CB   . ALA A 1 24 ? 7.667  3.739   -8.388  1.00 0.00 ? 24 ALA A CB   2  
ATOM   1171  H  H    . ALA A 1 24 ? 8.410  1.316   -8.674  1.00 0.00 ? 24 ALA A H    2  
ATOM   1172  H  HA   . ALA A 1 24 ? 9.786  3.853   -8.215  1.00 0.00 ? 24 ALA A HA   2  
ATOM   1173  H  HB1  . ALA A 1 24 ? 7.525  4.752   -8.011  1.00 0.00 ? 24 ALA A HB1  2  
ATOM   1174  H  HB2  . ALA A 1 24 ? 7.678  3.766   -9.478  1.00 0.00 ? 24 ALA A HB2  2  
ATOM   1175  H  HB3  . ALA A 1 24 ? 6.841  3.111   -8.052  1.00 0.00 ? 24 ALA A HB3  2  
ATOM   1176  N  N    . PHE A 1 25 ? 9.725  4.092   -5.732  1.00 0.00 ? 25 PHE A N    2  
ATOM   1177  C  CA   . PHE A 1 25 ? 10.013 4.112   -4.307  1.00 0.00 ? 25 PHE A CA   2  
ATOM   1178  C  C    . PHE A 1 25 ? 10.291 5.538   -3.844  1.00 0.00 ? 25 PHE A C    2  
ATOM   1179  O  O    . PHE A 1 25 ? 10.781 6.361   -4.616  1.00 0.00 ? 25 PHE A O    2  
ATOM   1180  C  CB   . PHE A 1 25 ? 11.281 3.301   -4.013  1.00 0.00 ? 25 PHE A CB   2  
ATOM   1181  C  CG   . PHE A 1 25 ? 11.165 1.794   -4.097  1.00 0.00 ? 25 PHE A CG   2  
ATOM   1182  C  CD1  . PHE A 1 25 ? 10.646 1.074   -3.005  1.00 0.00 ? 25 PHE A CD1  2  
ATOM   1183  C  CD2  . PHE A 1 25 ? 11.769 1.102   -5.162  1.00 0.00 ? 25 PHE A CD2  2  
ATOM   1184  C  CE1  . PHE A 1 25 ? 10.710 -0.331  -2.994  1.00 0.00 ? 25 PHE A CE1  2  
ATOM   1185  C  CE2  . PHE A 1 25 ? 11.767 -0.302  -5.182  1.00 0.00 ? 25 PHE A CE2  2  
ATOM   1186  C  CZ   . PHE A 1 25 ? 11.241 -1.021  -4.096  1.00 0.00 ? 25 PHE A CZ   2  
ATOM   1187  H  H    . PHE A 1 25 ? 10.173 4.803   -6.291  1.00 0.00 ? 25 PHE A H    2  
ATOM   1188  H  HA   . PHE A 1 25 ? 9.180  3.700   -3.743  1.00 0.00 ? 25 PHE A HA   2  
ATOM   1189  H  HB2  . PHE A 1 25 ? 12.067 3.632   -4.692  1.00 0.00 ? 25 PHE A HB2  2  
ATOM   1190  H  HB3  . PHE A 1 25 ? 11.599 3.542   -2.998  1.00 0.00 ? 25 PHE A HB3  2  
ATOM   1191  H  HD1  . PHE A 1 25 ? 10.243 1.602   -2.152  1.00 0.00 ? 25 PHE A HD1  2  
ATOM   1192  H  HD2  . PHE A 1 25 ? 12.275 1.643   -5.947  1.00 0.00 ? 25 PHE A HD2  2  
ATOM   1193  H  HE1  . PHE A 1 25 ? 10.370 -0.886  -2.132  1.00 0.00 ? 25 PHE A HE1  2  
ATOM   1194  H  HE2  . PHE A 1 25 ? 12.223 -0.830  -6.003  1.00 0.00 ? 25 PHE A HE2  2  
ATOM   1195  H  HZ   . PHE A 1 25 ? 11.277 -2.100  -4.091  1.00 0.00 ? 25 PHE A HZ   2  
ATOM   1196  N  N    . HIS A 1 26 ? 9.978  5.811   -2.574  1.00 0.00 ? 26 HIS A N    2  
ATOM   1197  C  CA   . HIS A 1 26 ? 10.405 7.011   -1.872  1.00 0.00 ? 26 HIS A CA   2  
ATOM   1198  C  C    . HIS A 1 26 ? 11.707 6.670   -1.143  1.00 0.00 ? 26 HIS A C    2  
ATOM   1199  O  O    . HIS A 1 26 ? 12.131 5.513   -1.117  1.00 0.00 ? 26 HIS A O    2  
ATOM   1200  C  CB   . HIS A 1 26 ? 9.354  7.461   -0.854  1.00 0.00 ? 26 HIS A CB   2  
ATOM   1201  C  CG   . HIS A 1 26 ? 8.021  7.820   -1.448  1.00 0.00 ? 26 HIS A CG   2  
ATOM   1202  N  ND1  . HIS A 1 26 ? 6.891  7.005   -1.418  1.00 0.00 ? 26 HIS A ND1  2  
ATOM   1203  C  CD2  . HIS A 1 26 ? 7.713  9.013   -2.039  1.00 0.00 ? 26 HIS A CD2  2  
ATOM   1204  C  CE1  . HIS A 1 26 ? 5.921  7.736   -1.990  1.00 0.00 ? 26 HIS A CE1  2  
ATOM   1205  N  NE2  . HIS A 1 26 ? 6.384  8.938   -2.377  1.00 0.00 ? 26 HIS A NE2  2  
ATOM   1206  H  H    . HIS A 1 26 ? 9.456  5.129   -2.047  1.00 0.00 ? 26 HIS A H    2  
ATOM   1207  H  HA   . HIS A 1 26 ? 10.585 7.828   -2.574  1.00 0.00 ? 26 HIS A HA   2  
ATOM   1208  H  HB2  . HIS A 1 26 ? 9.214  6.676   -0.115  1.00 0.00 ? 26 HIS A HB2  2  
ATOM   1209  H  HB3  . HIS A 1 26 ? 9.735  8.336   -0.333  1.00 0.00 ? 26 HIS A HB3  2  
ATOM   1210  H  HD2  . HIS A 1 26 ? 8.372  9.855   -2.187  1.00 0.00 ? 26 HIS A HD2  2  
ATOM   1211  H  HE1  . HIS A 1 26 ? 4.906  7.398   -2.130  1.00 0.00 ? 26 HIS A HE1  2  
ATOM   1212  H  HE2  . HIS A 1 26 ? 5.844  9.666   -2.831  1.00 0.00 ? 26 HIS A HE2  2  
ATOM   1213  N  N    . LEU A 1 27 ? 12.333 7.690   -0.546  1.00 0.00 ? 27 LEU A N    2  
ATOM   1214  C  CA   . LEU A 1 27 ? 13.646 7.624   0.083   1.00 0.00 ? 27 LEU A CA   2  
ATOM   1215  C  C    . LEU A 1 27 ? 13.688 6.456   1.070   1.00 0.00 ? 27 LEU A C    2  
ATOM   1216  O  O    . LEU A 1 27 ? 14.499 5.542   0.932   1.00 0.00 ? 27 LEU A O    2  
ATOM   1217  C  CB   . LEU A 1 27 ? 13.933 8.946   0.806   1.00 0.00 ? 27 LEU A CB   2  
ATOM   1218  C  CG   . LEU A 1 27 ? 14.267 10.133  -0.115  1.00 0.00 ? 27 LEU A CG   2  
ATOM   1219  C  CD1  . LEU A 1 27 ? 13.144 10.521  -1.086  1.00 0.00 ? 27 LEU A CD1  2  
ATOM   1220  C  CD2  . LEU A 1 27 ? 14.575 11.330  0.787   1.00 0.00 ? 27 LEU A CD2  2  
ATOM   1221  H  H    . LEU A 1 27 ? 11.872 8.588   -0.552  1.00 0.00 ? 27 LEU A H    2  
ATOM   1222  H  HA   . LEU A 1 27 ? 14.413 7.478   -0.674  1.00 0.00 ? 27 LEU A HA   2  
ATOM   1223  H  HB2  . LEU A 1 27 ? 13.076 9.204   1.429   1.00 0.00 ? 27 LEU A HB2  2  
ATOM   1224  H  HB3  . LEU A 1 27 ? 14.797 8.788   1.454   1.00 0.00 ? 27 LEU A HB3  2  
ATOM   1225  H  HG   . LEU A 1 27 ? 15.163 9.899   -0.692  1.00 0.00 ? 27 LEU A HG   2  
ATOM   1226  H  HD11 . LEU A 1 27 ? 12.200 10.620  -0.551  1.00 0.00 ? 27 LEU A HD11 2  
ATOM   1227  H  HD12 . LEU A 1 27 ? 13.374 11.473  -1.562  1.00 0.00 ? 27 LEU A HD12 2  
ATOM   1228  H  HD13 . LEU A 1 27 ? 13.053 9.773   -1.874  1.00 0.00 ? 27 LEU A HD13 2  
ATOM   1229  H  HD21 . LEU A 1 27 ? 13.709 11.567  1.407   1.00 0.00 ? 27 LEU A HD21 2  
ATOM   1230  H  HD22 . LEU A 1 27 ? 15.417 11.084  1.426   1.00 0.00 ? 27 LEU A HD22 2  
ATOM   1231  H  HD23 . LEU A 1 27 ? 14.831 12.201  0.189   1.00 0.00 ? 27 LEU A HD23 2  
ATOM   1232  N  N    . PHE A 1 28 ? 12.763 6.483   2.034   1.00 0.00 ? 28 PHE A N    2  
ATOM   1233  C  CA   . PHE A 1 28 ? 12.652 5.494   3.092   1.00 0.00 ? 28 PHE A CA   2  
ATOM   1234  C  C    . PHE A 1 28 ? 12.206 4.144   2.530   1.00 0.00 ? 28 PHE A C    2  
ATOM   1235  O  O    . PHE A 1 28 ? 12.732 3.106   2.928   1.00 0.00 ? 28 PHE A O    2  
ATOM   1236  C  CB   . PHE A 1 28 ? 11.654 5.981   4.148   1.00 0.00 ? 28 PHE A CB   2  
ATOM   1237  C  CG   . PHE A 1 28 ? 11.808 7.441   4.537   1.00 0.00 ? 28 PHE A CG   2  
ATOM   1238  C  CD1  . PHE A 1 28 ? 12.983 7.888   5.171   1.00 0.00 ? 28 PHE A CD1  2  
ATOM   1239  C  CD2  . PHE A 1 28 ? 10.809 8.369   4.184   1.00 0.00 ? 28 PHE A CD2  2  
ATOM   1240  C  CE1  . PHE A 1 28 ? 13.146 9.254   5.467   1.00 0.00 ? 28 PHE A CE1  2  
ATOM   1241  C  CE2  . PHE A 1 28 ? 10.978 9.733   4.473   1.00 0.00 ? 28 PHE A CE2  2  
ATOM   1242  C  CZ   . PHE A 1 28 ? 12.148 10.177  5.111   1.00 0.00 ? 28 PHE A CZ   2  
ATOM   1243  H  H    . PHE A 1 28 ? 12.130 7.270   2.066   1.00 0.00 ? 28 PHE A H    2  
ATOM   1244  H  HA   . PHE A 1 28 ? 13.631 5.388   3.560   1.00 0.00 ? 28 PHE A HA   2  
ATOM   1245  H  HB2  . PHE A 1 28 ? 10.650 5.824   3.752   1.00 0.00 ? 28 PHE A HB2  2  
ATOM   1246  H  HB3  . PHE A 1 28 ? 11.760 5.365   5.041   1.00 0.00 ? 28 PHE A HB3  2  
ATOM   1247  H  HD1  . PHE A 1 28 ? 13.765 7.188   5.427   1.00 0.00 ? 28 PHE A HD1  2  
ATOM   1248  H  HD2  . PHE A 1 28 ? 9.910  8.039   3.686   1.00 0.00 ? 28 PHE A HD2  2  
ATOM   1249  H  HE1  . PHE A 1 28 ? 14.036 9.601   5.970   1.00 0.00 ? 28 PHE A HE1  2  
ATOM   1250  H  HE2  . PHE A 1 28 ? 10.203 10.439  4.209   1.00 0.00 ? 28 PHE A HE2  2  
ATOM   1251  H  HZ   . PHE A 1 28 ? 12.280 11.226  5.330   1.00 0.00 ? 28 PHE A HZ   2  
ATOM   1252  N  N    . CYS A 1 29 ? 11.214 4.163   1.627   1.00 0.00 ? 29 CYS A N    2  
ATOM   1253  C  CA   . CYS A 1 29 ? 10.533 2.966   1.157   1.00 0.00 ? 29 CYS A CA   2  
ATOM   1254  C  C    . CYS A 1 29 ? 11.497 2.029   0.427   1.00 0.00 ? 29 CYS A C    2  
ATOM   1255  O  O    . CYS A 1 29 ? 11.367 0.813   0.556   1.00 0.00 ? 29 CYS A O    2  
ATOM   1256  C  CB   . CYS A 1 29 ? 9.368  3.327   0.229   1.00 0.00 ? 29 CYS A CB   2  
ATOM   1257  S  SG   . CYS A 1 29 ? 8.061  4.386   0.908   1.00 0.00 ? 29 CYS A SG   2  
ATOM   1258  H  H    . CYS A 1 29 ? 10.879 5.055   1.294   1.00 0.00 ? 29 CYS A H    2  
ATOM   1259  H  HA   . CYS A 1 29 ? 10.124 2.441   2.022   1.00 0.00 ? 29 CYS A HA   2  
ATOM   1260  H  HB2  . CYS A 1 29 ? 9.772  3.802   -0.658  1.00 0.00 ? 29 CYS A HB2  2  
ATOM   1261  H  HB3  . CYS A 1 29 ? 8.898  2.398   -0.079  1.00 0.00 ? 29 CYS A HB3  2  
ATOM   1262  N  N    . LEU A 1 30 ? 12.452 2.581   -0.339  1.00 0.00 ? 30 LEU A N    2  
ATOM   1263  C  CA   . LEU A 1 30 ? 13.522 1.784   -0.922  1.00 0.00 ? 30 LEU A CA   2  
ATOM   1264  C  C    . LEU A 1 30 ? 14.334 1.125   0.187   1.00 0.00 ? 30 LEU A C    2  
ATOM   1265  O  O    . LEU A 1 30 ? 14.351 -0.099  0.289   1.00 0.00 ? 30 LEU A O    2  
ATOM   1266  C  CB   . LEU A 1 30 ? 14.374 2.620   -1.890  1.00 0.00 ? 30 LEU A CB   2  
ATOM   1267  C  CG   . LEU A 1 30 ? 15.283 1.736   -2.763  1.00 0.00 ? 30 LEU A CG   2  
ATOM   1268  C  CD1  . LEU A 1 30 ? 15.586 2.418   -4.098  1.00 0.00 ? 30 LEU A CD1  2  
ATOM   1269  C  CD2  . LEU A 1 30 ? 16.610 1.429   -2.061  1.00 0.00 ? 30 LEU A CD2  2  
ATOM   1270  H  H    . LEU A 1 30 ? 12.484 3.587   -0.450  1.00 0.00 ? 30 LEU A H    2  
ATOM   1271  H  HA   . LEU A 1 30 ? 13.053 0.992   -1.499  1.00 0.00 ? 30 LEU A HA   2  
ATOM   1272  H  HB2  . LEU A 1 30 ? 13.696 3.151   -2.554  1.00 0.00 ? 30 LEU A HB2  2  
ATOM   1273  H  HB3  . LEU A 1 30 ? 14.968 3.357   -1.349  1.00 0.00 ? 30 LEU A HB3  2  
ATOM   1274  H  HG   . LEU A 1 30 ? 14.763 0.809   -2.992  1.00 0.00 ? 30 LEU A HG   2  
ATOM   1275  H  HD11 . LEU A 1 30 ? 16.182 1.758   -4.730  1.00 0.00 ? 30 LEU A HD11 2  
ATOM   1276  H  HD12 . LEU A 1 30 ? 14.659 2.657   -4.622  1.00 0.00 ? 30 LEU A HD12 2  
ATOM   1277  H  HD13 . LEU A 1 30 ? 16.145 3.330   -3.914  1.00 0.00 ? 30 LEU A HD13 2  
ATOM   1278  H  HD21 . LEU A 1 30 ? 17.309 0.982   -2.763  1.00 0.00 ? 30 LEU A HD21 2  
ATOM   1279  H  HD22 . LEU A 1 30 ? 17.045 2.352   -1.682  1.00 0.00 ? 30 LEU A HD22 2  
ATOM   1280  H  HD23 . LEU A 1 30 ? 16.463 0.731   -1.241  1.00 0.00 ? 30 LEU A HD23 2  
ATOM   1281  N  N    . ARG A 1 31 ? 14.998 1.932   1.017   1.00 0.00 ? 31 ARG A N    2  
ATOM   1282  C  CA   . ARG A 1 31 ? 15.629 1.457   2.240   1.00 0.00 ? 31 ARG A CA   2  
ATOM   1283  C  C    . ARG A 1 31 ? 15.803 2.618   3.225   1.00 0.00 ? 31 ARG A C    2  
ATOM   1284  O  O    . ARG A 1 31 ? 16.208 3.703   2.810   1.00 0.00 ? 31 ARG A O    2  
ATOM   1285  C  CB   . ARG A 1 31 ? 16.952 0.731   1.933   1.00 0.00 ? 31 ARG A CB   2  
ATOM   1286  C  CG   . ARG A 1 31 ? 18.047 1.627   1.338   1.00 0.00 ? 31 ARG A CG   2  
ATOM   1287  C  CD   . ARG A 1 31 ? 19.273 0.816   0.889   1.00 0.00 ? 31 ARG A CD   2  
ATOM   1288  N  NE   . ARG A 1 31 ? 19.012 0.007   -0.316  1.00 0.00 ? 31 ARG A NE   2  
ATOM   1289  C  CZ   . ARG A 1 31 ? 18.728 -1.305  -0.377  1.00 0.00 ? 31 ARG A CZ   2  
ATOM   1290  N  NH1  . ARG A 1 31 ? 18.626 -2.055  0.727   1.00 0.00 ? 31 ARG A NH1  2  
ATOM   1291  N  NH2  . ARG A 1 31 ? 18.539 -1.872  -1.576  1.00 0.00 ? 31 ARG A NH2  2  
ATOM   1292  H  H    . ARG A 1 31 ? 14.932 2.928   0.866   1.00 0.00 ? 31 ARG A H    2  
ATOM   1293  H  HA   . ARG A 1 31 ? 14.946 0.725   2.674   1.00 0.00 ? 31 ARG A HA   2  
ATOM   1294  H  HB2  . ARG A 1 31 ? 17.337 0.303   2.856   1.00 0.00 ? 31 ARG A HB2  2  
ATOM   1295  H  HB3  . ARG A 1 31 ? 16.743 -0.088  1.247   1.00 0.00 ? 31 ARG A HB3  2  
ATOM   1296  H  HG2  . ARG A 1 31 ? 17.658 2.194   0.494   1.00 0.00 ? 31 ARG A HG2  2  
ATOM   1297  H  HG3  . ARG A 1 31 ? 18.372 2.335   2.100   1.00 0.00 ? 31 ARG A HG3  2  
ATOM   1298  H  HD2  . ARG A 1 31 ? 20.067 1.523   0.642   1.00 0.00 ? 31 ARG A HD2  2  
ATOM   1299  H  HD3  . ARG A 1 31 ? 19.635 0.205   1.716   1.00 0.00 ? 31 ARG A HD3  2  
ATOM   1300  H  HE   . ARG A 1 31 ? 19.055 0.495   -1.197  1.00 0.00 ? 31 ARG A HE   2  
ATOM   1301  H  HH11 . ARG A 1 31 ? 18.827 -1.665  1.642   1.00 0.00 ? 31 ARG A HH11 2  
ATOM   1302  H  HH12 . ARG A 1 31 ? 18.336 -3.022  0.668   1.00 0.00 ? 31 ARG A HH12 2  
ATOM   1303  H  HH21 . ARG A 1 31 ? 18.649 -1.326  -2.423  1.00 0.00 ? 31 ARG A HH21 2  
ATOM   1304  H  HH22 . ARG A 1 31 ? 18.336 -2.859  -1.646  1.00 0.00 ? 31 ARG A HH22 2  
ATOM   1305  N  N    . PRO A 1 32 ? 15.496 2.413   4.518   1.00 0.00 ? 32 PRO A N    2  
ATOM   1306  C  CA   . PRO A 1 32 ? 15.439 3.469   5.519   1.00 0.00 ? 32 PRO A CA   2  
ATOM   1307  C  C    . PRO A 1 32 ? 16.795 4.155   5.700   1.00 0.00 ? 32 PRO A C    2  
ATOM   1308  O  O    . PRO A 1 32 ? 16.835 5.352   5.971   1.00 0.00 ? 32 PRO A O    2  
ATOM   1309  C  CB   . PRO A 1 32 ? 14.979 2.786   6.811   1.00 0.00 ? 32 PRO A CB   2  
ATOM   1310  C  CG   . PRO A 1 32 ? 15.480 1.353   6.647   1.00 0.00 ? 32 PRO A CG   2  
ATOM   1311  C  CD   . PRO A 1 32 ? 15.310 1.116   5.147   1.00 0.00 ? 32 PRO A CD   2  
ATOM   1312  H  HA   . PRO A 1 32 ? 14.700 4.219   5.236   1.00 0.00 ? 32 PRO A HA   2  
ATOM   1313  H  HB2  . PRO A 1 32 ? 15.377 3.265   7.708   1.00 0.00 ? 32 PRO A HB2  2  
ATOM   1314  H  HB3  . PRO A 1 32 ? 13.888 2.778   6.843   1.00 0.00 ? 32 PRO A HB3  2  
ATOM   1315  H  HG2  . PRO A 1 32 ? 16.537 1.298   6.910   1.00 0.00 ? 32 PRO A HG2  2  
ATOM   1316  H  HG3  . PRO A 1 32 ? 14.908 0.642   7.244   1.00 0.00 ? 32 PRO A HG3  2  
ATOM   1317  H  HD2  . PRO A 1 32 ? 16.033 0.380   4.799   1.00 0.00 ? 32 PRO A HD2  2  
ATOM   1318  H  HD3  . PRO A 1 32 ? 14.296 0.765   4.951   1.00 0.00 ? 32 PRO A HD3  2  
ATOM   1319  N  N    . ALA A 1 33 ? 17.892 3.402   5.524   1.00 0.00 ? 33 ALA A N    2  
ATOM   1320  C  CA   . ALA A 1 33 ? 19.259 3.904   5.482   1.00 0.00 ? 33 ALA A CA   2  
ATOM   1321  C  C    . ALA A 1 33 ? 19.403 5.173   4.640   1.00 0.00 ? 33 ALA A C    2  
ATOM   1322  O  O    . ALA A 1 33 ? 20.150 6.073   5.018   1.00 0.00 ? 33 ALA A O    2  
ATOM   1323  C  CB   . ALA A 1 33 ? 20.192 2.801   4.974   1.00 0.00 ? 33 ALA A CB   2  
ATOM   1324  H  H    . ALA A 1 33 ? 17.767 2.413   5.354   1.00 0.00 ? 33 ALA A H    2  
ATOM   1325  H  HA   . ALA A 1 33 ? 19.548 4.147   6.502   1.00 0.00 ? 33 ALA A HA   2  
ATOM   1326  H  HB1  . ALA A 1 33 ? 20.107 1.922   5.614   1.00 0.00 ? 33 ALA A HB1  2  
ATOM   1327  H  HB2  . ALA A 1 33 ? 19.928 2.525   3.953   1.00 0.00 ? 33 ALA A HB2  2  
ATOM   1328  H  HB3  . ALA A 1 33 ? 21.223 3.155   4.993   1.00 0.00 ? 33 ALA A HB3  2  
ATOM   1329  N  N    . LEU A 1 34 ? 18.702 5.239   3.501   1.00 0.00 ? 34 LEU A N    2  
ATOM   1330  C  CA   . LEU A 1 34 ? 18.570 6.465   2.732   1.00 0.00 ? 34 LEU A CA   2  
ATOM   1331  C  C    . LEU A 1 34 ? 17.456 7.311   3.344   1.00 0.00 ? 34 LEU A C    2  
ATOM   1332  O  O    . LEU A 1 34 ? 16.284 7.162   3.000   1.00 0.00 ? 34 LEU A O    2  
ATOM   1333  C  CB   . LEU A 1 34 ? 18.309 6.165   1.251   1.00 0.00 ? 34 LEU A CB   2  
ATOM   1334  C  CG   . LEU A 1 34 ? 19.490 5.474   0.548   1.00 0.00 ? 34 LEU A CG   2  
ATOM   1335  C  CD1  . LEU A 1 34 ? 19.142 5.324   -0.934  1.00 0.00 ? 34 LEU A CD1  2  
ATOM   1336  C  CD2  . LEU A 1 34 ? 20.801 6.263   0.663   1.00 0.00 ? 34 LEU A CD2  2  
ATOM   1337  H  H    . LEU A 1 34 ? 18.078 4.475   3.280   1.00 0.00 ? 34 LEU A H    2  
ATOM   1338  H  HA   . LEU A 1 34 ? 19.486 7.049   2.795   1.00 0.00 ? 34 LEU A HA   2  
ATOM   1339  H  HB2  . LEU A 1 34 ? 17.423 5.536   1.158   1.00 0.00 ? 34 LEU A HB2  2  
ATOM   1340  H  HB3  . LEU A 1 34 ? 18.111 7.111   0.746   1.00 0.00 ? 34 LEU A HB3  2  
ATOM   1341  H  HG   . LEU A 1 34 ? 19.640 4.480   0.974   1.00 0.00 ? 34 LEU A HG   2  
ATOM   1342  H  HD11 . LEU A 1 34 ? 18.942 6.302   -1.371  1.00 0.00 ? 34 LEU A HD11 2  
ATOM   1343  H  HD12 . LEU A 1 34 ? 19.982 4.872   -1.459  1.00 0.00 ? 34 LEU A HD12 2  
ATOM   1344  H  HD13 . LEU A 1 34 ? 18.262 4.690   -1.045  1.00 0.00 ? 34 LEU A HD13 2  
ATOM   1345  H  HD21 . LEU A 1 34 ? 20.640 7.302   0.372   1.00 0.00 ? 34 LEU A HD21 2  
ATOM   1346  H  HD22 . LEU A 1 34 ? 21.184 6.225   1.682   1.00 0.00 ? 34 LEU A HD22 2  
ATOM   1347  H  HD23 . LEU A 1 34 ? 21.555 5.824   0.010   1.00 0.00 ? 34 LEU A HD23 2  
ATOM   1348  N  N    . TYR A 1 35 ? 17.844 8.194   4.268   1.00 0.00 ? 35 TYR A N    2  
ATOM   1349  C  CA   . TYR A 1 35 ? 16.988 9.238   4.812   1.00 0.00 ? 35 TYR A CA   2  
ATOM   1350  C  C    . TYR A 1 35 ? 16.925 10.444  3.867   1.00 0.00 ? 35 TYR A C    2  
ATOM   1351  O  O    . TYR A 1 35 ? 16.004 11.252  3.970   1.00 0.00 ? 35 TYR A O    2  
ATOM   1352  C  CB   . TYR A 1 35 ? 17.510 9.650   6.194   1.00 0.00 ? 35 TYR A CB   2  
ATOM   1353  C  CG   . TYR A 1 35 ? 17.597 8.497   7.175   1.00 0.00 ? 35 TYR A CG   2  
ATOM   1354  C  CD1  . TYR A 1 35 ? 16.439 8.048   7.837   1.00 0.00 ? 35 TYR A CD1  2  
ATOM   1355  C  CD2  . TYR A 1 35 ? 18.812 7.808   7.350   1.00 0.00 ? 35 TYR A CD2  2  
ATOM   1356  C  CE1  . TYR A 1 35 ? 16.494 6.913   8.666   1.00 0.00 ? 35 TYR A CE1  2  
ATOM   1357  C  CE2  . TYR A 1 35 ? 18.866 6.669   8.171   1.00 0.00 ? 35 TYR A CE2  2  
ATOM   1358  C  CZ   . TYR A 1 35 ? 17.705 6.212   8.816   1.00 0.00 ? 35 TYR A CZ   2  
ATOM   1359  O  OH   . TYR A 1 35 ? 17.749 5.076   9.572   1.00 0.00 ? 35 TYR A OH   2  
ATOM   1360  H  H    . TYR A 1 35 ? 18.831 8.250   4.487   1.00 0.00 ? 35 TYR A H    2  
ATOM   1361  H  HA   . TYR A 1 35 ? 15.982 8.840   4.934   1.00 0.00 ? 35 TYR A HA   2  
ATOM   1362  H  HB2  . TYR A 1 35 ? 18.500 10.096  6.076   1.00 0.00 ? 35 TYR A HB2  2  
ATOM   1363  H  HB3  . TYR A 1 35 ? 16.841 10.408  6.607   1.00 0.00 ? 35 TYR A HB3  2  
ATOM   1364  H  HD1  . TYR A 1 35 ? 15.501 8.564   7.702   1.00 0.00 ? 35 TYR A HD1  2  
ATOM   1365  H  HD2  . TYR A 1 35 ? 19.704 8.140   6.837   1.00 0.00 ? 35 TYR A HD2  2  
ATOM   1366  H  HE1  . TYR A 1 35 ? 15.598 6.564   9.155   1.00 0.00 ? 35 TYR A HE1  2  
ATOM   1367  H  HE2  . TYR A 1 35 ? 19.795 6.129   8.280   1.00 0.00 ? 35 TYR A HE2  2  
ATOM   1368  H  HH   . TYR A 1 35 ? 16.898 4.839   9.947   1.00 0.00 ? 35 TYR A HH   2  
ATOM   1369  N  N    . GLU A 1 36 ? 17.903 10.556  2.957   1.00 0.00 ? 36 GLU A N    2  
ATOM   1370  C  CA   . GLU A 1 36 ? 18.151 11.687  2.077   1.00 0.00 ? 36 GLU A CA   2  
ATOM   1371  C  C    . GLU A 1 36 ? 18.257 11.194  0.629   1.00 0.00 ? 36 GLU A C    2  
ATOM   1372  O  O    . GLU A 1 36 ? 18.465 10.004  0.386   1.00 0.00 ? 36 GLU A O    2  
ATOM   1373  C  CB   . GLU A 1 36 ? 19.425 12.427  2.524   1.00 0.00 ? 36 GLU A CB   2  
ATOM   1374  C  CG   . GLU A 1 36 ? 20.698 11.562  2.563   1.00 0.00 ? 36 GLU A CG   2  
ATOM   1375  C  CD   . GLU A 1 36 ? 20.733 10.607  3.756   1.00 0.00 ? 36 GLU A CD   2  
ATOM   1376  O  OE1  . GLU A 1 36 ? 21.039 11.093  4.866   1.00 0.00 ? 36 GLU A OE1  2  
ATOM   1377  O  OE2  . GLU A 1 36 ? 20.436 9.410   3.541   1.00 0.00 ? 36 GLU A OE2  2  
ATOM   1378  H  H    . GLU A 1 36 ? 18.611 9.834   2.929   1.00 0.00 ? 36 GLU A H    2  
ATOM   1379  H  HA   . GLU A 1 36 ? 17.321 12.393  2.134   1.00 0.00 ? 36 GLU A HA   2  
ATOM   1380  H  HB2  . GLU A 1 36 ? 19.598 13.252  1.831   1.00 0.00 ? 36 GLU A HB2  2  
ATOM   1381  H  HB3  . GLU A 1 36 ? 19.261 12.853  3.515   1.00 0.00 ? 36 GLU A HB3  2  
ATOM   1382  H  HG2  . GLU A 1 36 ? 20.803 11.000  1.635   1.00 0.00 ? 36 GLU A HG2  2  
ATOM   1383  H  HG3  . GLU A 1 36 ? 21.556 12.227  2.650   1.00 0.00 ? 36 GLU A HG3  2  
ATOM   1384  N  N    . VAL A 1 37 ? 18.099 12.108  -0.336  1.00 0.00 ? 37 VAL A N    2  
ATOM   1385  C  CA   . VAL A 1 37 ? 18.047 11.773  -1.749  1.00 0.00 ? 37 VAL A CA   2  
ATOM   1386  C  C    . VAL A 1 37 ? 19.442 11.440  -2.296  1.00 0.00 ? 37 VAL A C    2  
ATOM   1387  O  O    . VAL A 1 37 ? 20.435 11.974  -1.803  1.00 0.00 ? 37 VAL A O    2  
ATOM   1388  C  CB   . VAL A 1 37 ? 17.449 12.939  -2.559  1.00 0.00 ? 37 VAL A CB   2  
ATOM   1389  C  CG1  . VAL A 1 37 ? 16.007 13.245  -2.149  1.00 0.00 ? 37 VAL A CG1  2  
ATOM   1390  C  CG2  . VAL A 1 37 ? 18.279 14.231  -2.494  1.00 0.00 ? 37 VAL A CG2  2  
ATOM   1391  H  H    . VAL A 1 37 ? 17.941 13.073  -0.090  1.00 0.00 ? 37 VAL A H    2  
ATOM   1392  H  HA   . VAL A 1 37 ? 17.378 10.918  -1.858  1.00 0.00 ? 37 VAL A HA   2  
ATOM   1393  H  HB   . VAL A 1 37 ? 17.424 12.618  -3.597  1.00 0.00 ? 37 VAL A HB   2  
ATOM   1394  H  HG11 . VAL A 1 37 ? 15.979 13.664  -1.144  1.00 0.00 ? 37 VAL A HG11 2  
ATOM   1395  H  HG12 . VAL A 1 37 ? 15.578 13.968  -2.842  1.00 0.00 ? 37 VAL A HG12 2  
ATOM   1396  H  HG13 . VAL A 1 37 ? 15.418 12.331  -2.191  1.00 0.00 ? 37 VAL A HG13 2  
ATOM   1397  H  HG21 . VAL A 1 37 ? 17.786 15.006  -3.082  1.00 0.00 ? 37 VAL A HG21 2  
ATOM   1398  H  HG22 . VAL A 1 37 ? 18.371 14.580  -1.467  1.00 0.00 ? 37 VAL A HG22 2  
ATOM   1399  H  HG23 . VAL A 1 37 ? 19.272 14.072  -2.912  1.00 0.00 ? 37 VAL A HG23 2  
ATOM   1400  N  N    . PRO A 1 38 ? 19.523 10.544  -3.293  1.00 0.00 ? 38 PRO A N    2  
ATOM   1401  C  CA   . PRO A 1 38 ? 20.736 10.334  -4.074  1.00 0.00 ? 38 PRO A CA   2  
ATOM   1402  C  C    . PRO A 1 38 ? 20.534 11.040  -5.420  1.00 0.00 ? 38 PRO A C    2  
ATOM   1403  O  O    . PRO A 1 38 ? 19.565 11.782  -5.591  1.00 0.00 ? 38 PRO A O    2  
ATOM   1404  C  CB   . PRO A 1 38 ? 20.860 8.817   -4.224  1.00 0.00 ? 38 PRO A CB   2  
ATOM   1405  C  CG   . PRO A 1 38 ? 19.401 8.386   -4.318  1.00 0.00 ? 38 PRO A CG   2  
ATOM   1406  C  CD   . PRO A 1 38 ? 18.695 9.347   -3.360  1.00 0.00 ? 38 PRO A CD   2  
ATOM   1407  H  HA   . PRO A 1 38 ? 21.633 10.727  -3.591  1.00 0.00 ? 38 PRO A HA   2  
ATOM   1408  H  HB2  . PRO A 1 38 ? 21.440 8.499   -5.091  1.00 0.00 ? 38 PRO A HB2  2  
ATOM   1409  H  HB3  . PRO A 1 38 ? 21.294 8.403   -3.312  1.00 0.00 ? 38 PRO A HB3  2  
ATOM   1410  H  HG2  . PRO A 1 38 ? 19.036 8.539   -5.334  1.00 0.00 ? 38 PRO A HG2  2  
ATOM   1411  H  HG3  . PRO A 1 38 ? 19.286 7.344   -4.030  1.00 0.00 ? 38 PRO A HG3  2  
ATOM   1412  H  HD2  . PRO A 1 38 ? 17.696 9.574   -3.736  1.00 0.00 ? 38 PRO A HD2  2  
ATOM   1413  H  HD3  . PRO A 1 38 ? 18.627 8.893   -2.369  1.00 0.00 ? 38 PRO A HD3  2  
ATOM   1414  N  N    . ASP A 1 39 ? 21.414 10.791  -6.398  1.00 0.00 ? 39 ASP A N    2  
ATOM   1415  C  CA   . ASP A 1 39 ? 21.205 11.228  -7.774  1.00 0.00 ? 39 ASP A CA   2  
ATOM   1416  C  C    . ASP A 1 39 ? 20.375 10.187  -8.540  1.00 0.00 ? 39 ASP A C    2  
ATOM   1417  O  O    . ASP A 1 39 ? 20.775 9.725   -9.608  1.00 0.00 ? 39 ASP A O    2  
ATOM   1418  C  CB   . ASP A 1 39 ? 22.566 11.518  -8.425  1.00 0.00 ? 39 ASP A CB   2  
ATOM   1419  C  CG   . ASP A 1 39 ? 22.431 12.192  -9.790  1.00 0.00 ? 39 ASP A CG   2  
ATOM   1420  O  OD1  . ASP A 1 39 ? 21.601 13.123  -9.888  1.00 0.00 ? 39 ASP A OD1  2  
ATOM   1421  O  OD2  . ASP A 1 39 ? 23.170 11.775  -10.707 1.00 0.00 ? 39 ASP A OD2  2  
ATOM   1422  H  H    . ASP A 1 39 ? 22.215 10.207  -6.207  1.00 0.00 ? 39 ASP A H    2  
ATOM   1423  H  HA   . ASP A 1 39 ? 20.645 12.163  -7.767  1.00 0.00 ? 39 ASP A HA   2  
ATOM   1424  H  HB2  . ASP A 1 39 ? 23.132 12.191  -7.779  1.00 0.00 ? 39 ASP A HB2  2  
ATOM   1425  H  HB3  . ASP A 1 39 ? 23.127 10.586  -8.528  1.00 0.00 ? 39 ASP A HB3  2  
ATOM   1426  N  N    . GLY A 1 40 ? 19.209 9.823   -7.988  1.00 0.00 ? 40 GLY A N    2  
ATOM   1427  C  CA   . GLY A 1 40 ? 18.193 9.019   -8.654  1.00 0.00 ? 40 GLY A CA   2  
ATOM   1428  C  C    . GLY A 1 40 ? 18.542 7.529   -8.658  1.00 0.00 ? 40 GLY A C    2  
ATOM   1429  O  O    . GLY A 1 40 ? 17.882 6.732   -7.994  1.00 0.00 ? 40 GLY A O    2  
ATOM   1430  H  H    . GLY A 1 40 ? 18.967 10.216  -7.089  1.00 0.00 ? 40 GLY A H    2  
ATOM   1431  H  HA2  . GLY A 1 40 ? 17.249 9.159   -8.126  1.00 0.00 ? 40 GLY A HA2  2  
ATOM   1432  H  HA3  . GLY A 1 40 ? 18.065 9.362   -9.681  1.00 0.00 ? 40 GLY A HA3  2  
ATOM   1433  N  N    . GLU A 1 41 ? 19.575 7.166   -9.426  1.00 0.00 ? 41 GLU A N    2  
ATOM   1434  C  CA   . GLU A 1 41 ? 19.944 5.796   -9.747  1.00 0.00 ? 41 GLU A CA   2  
ATOM   1435  C  C    . GLU A 1 41 ? 20.459 5.069   -8.501  1.00 0.00 ? 41 GLU A C    2  
ATOM   1436  O  O    . GLU A 1 41 ? 21.492 5.454   -7.953  1.00 0.00 ? 41 GLU A O    2  
ATOM   1437  C  CB   . GLU A 1 41 ? 21.024 5.826   -10.843 1.00 0.00 ? 41 GLU A CB   2  
ATOM   1438  C  CG   . GLU A 1 41 ? 20.526 6.445   -12.158 1.00 0.00 ? 41 GLU A CG   2  
ATOM   1439  C  CD   . GLU A 1 41 ? 19.396 5.635   -12.786 1.00 0.00 ? 41 GLU A CD   2  
ATOM   1440  O  OE1  . GLU A 1 41 ? 19.722 4.628   -13.451 1.00 0.00 ? 41 GLU A OE1  2  
ATOM   1441  O  OE2  . GLU A 1 41 ? 18.228 6.036   -12.590 1.00 0.00 ? 41 GLU A OE2  2  
ATOM   1442  H  H    . GLU A 1 41 ? 20.107 7.901   -9.872  1.00 0.00 ? 41 GLU A H    2  
ATOM   1443  H  HA   . GLU A 1 41 ? 19.061 5.279   -10.121 1.00 0.00 ? 41 GLU A HA   2  
ATOM   1444  H  HB2  . GLU A 1 41 ? 21.874 6.411   -10.489 1.00 0.00 ? 41 GLU A HB2  2  
ATOM   1445  H  HB3  . GLU A 1 41 ? 21.376 4.815   -11.046 1.00 0.00 ? 41 GLU A HB3  2  
ATOM   1446  H  HG2  . GLU A 1 41 ? 20.192 7.470   -11.992 1.00 0.00 ? 41 GLU A HG2  2  
ATOM   1447  H  HG3  . GLU A 1 41 ? 21.360 6.474   -12.861 1.00 0.00 ? 41 GLU A HG3  2  
ATOM   1448  N  N    . TRP A 1 42 ? 19.748 4.019   -8.063  1.00 0.00 ? 42 TRP A N    2  
ATOM   1449  C  CA   . TRP A 1 42 ? 20.172 3.163   -6.963  1.00 0.00 ? 42 TRP A CA   2  
ATOM   1450  C  C    . TRP A 1 42 ? 19.405 1.836   -6.972  1.00 0.00 ? 42 TRP A C    2  
ATOM   1451  O  O    . TRP A 1 42 ? 18.268 1.777   -7.436  1.00 0.00 ? 42 TRP A O    2  
ATOM   1452  C  CB   . TRP A 1 42 ? 19.964 3.906   -5.638  1.00 0.00 ? 42 TRP A CB   2  
ATOM   1453  C  CG   . TRP A 1 42 ? 20.276 3.144   -4.388  1.00 0.00 ? 42 TRP A CG   2  
ATOM   1454  C  CD1  . TRP A 1 42 ? 19.423 2.990   -3.354  1.00 0.00 ? 42 TRP A CD1  2  
ATOM   1455  C  CD2  . TRP A 1 42 ? 21.497 2.436   -4.002  1.00 0.00 ? 42 TRP A CD2  2  
ATOM   1456  N  NE1  . TRP A 1 42 ? 20.033 2.280   -2.346  1.00 0.00 ? 42 TRP A NE1  2  
ATOM   1457  C  CE2  . TRP A 1 42 ? 21.307 1.890   -2.697  1.00 0.00 ? 42 TRP A CE2  2  
ATOM   1458  C  CE3  . TRP A 1 42 ? 22.749 2.202   -4.613  1.00 0.00 ? 42 TRP A CE3  2  
ATOM   1459  C  CZ2  . TRP A 1 42 ? 22.300 1.158   -2.033  1.00 0.00 ? 42 TRP A CZ2  2  
ATOM   1460  C  CZ3  . TRP A 1 42 ? 23.751 1.459   -3.960  1.00 0.00 ? 42 TRP A CZ3  2  
ATOM   1461  C  CH2  . TRP A 1 42 ? 23.531 0.942   -2.670  1.00 0.00 ? 42 TRP A CH2  2  
ATOM   1462  H  H    . TRP A 1 42 ? 18.890 3.774   -8.533  1.00 0.00 ? 42 TRP A H    2  
ATOM   1463  H  HA   . TRP A 1 42 ? 21.232 2.944   -7.094  1.00 0.00 ? 42 TRP A HA   2  
ATOM   1464  H  HB2  . TRP A 1 42 ? 20.584 4.803   -5.631  1.00 0.00 ? 42 TRP A HB2  2  
ATOM   1465  H  HB3  . TRP A 1 42 ? 18.917 4.216   -5.597  1.00 0.00 ? 42 TRP A HB3  2  
ATOM   1466  H  HD1  . TRP A 1 42 ? 18.427 3.397   -3.307  1.00 0.00 ? 42 TRP A HD1  2  
ATOM   1467  H  HE1  . TRP A 1 42 ? 19.583 2.109   -1.460  1.00 0.00 ? 42 TRP A HE1  2  
ATOM   1468  H  HE3  . TRP A 1 42 ? 22.951 2.605   -5.594  1.00 0.00 ? 42 TRP A HE3  2  
ATOM   1469  H  HZ2  . TRP A 1 42 ? 22.121 0.765   -1.043  1.00 0.00 ? 42 TRP A HZ2  2  
ATOM   1470  H  HZ3  . TRP A 1 42 ? 24.697 1.289   -4.450  1.00 0.00 ? 42 TRP A HZ3  2  
ATOM   1471  H  HH2  . TRP A 1 42 ? 24.308 0.381   -2.173  1.00 0.00 ? 42 TRP A HH2  2  
ATOM   1472  N  N    . GLN A 1 43 ? 20.035 0.777   -6.446  1.00 0.00 ? 43 GLN A N    2  
ATOM   1473  C  CA   . GLN A 1 43 ? 19.518 -0.585  -6.437  1.00 0.00 ? 43 GLN A CA   2  
ATOM   1474  C  C    . GLN A 1 43 ? 18.588 -0.818  -5.241  1.00 0.00 ? 43 GLN A C    2  
ATOM   1475  O  O    . GLN A 1 43 ? 18.922 -0.469  -4.108  1.00 0.00 ? 43 GLN A O    2  
ATOM   1476  C  CB   . GLN A 1 43 ? 20.692 -1.571  -6.389  1.00 0.00 ? 43 GLN A CB   2  
ATOM   1477  C  CG   . GLN A 1 43 ? 21.355 -1.752  -7.757  1.00 0.00 ? 43 GLN A CG   2  
ATOM   1478  C  CD   . GLN A 1 43 ? 22.414 -2.852  -7.713  1.00 0.00 ? 43 GLN A CD   2  
ATOM   1479  O  OE1  . GLN A 1 43 ? 23.376 -2.756  -6.954  1.00 0.00 ? 43 GLN A OE1  2  
ATOM   1480  N  NE2  . GLN A 1 43 ? 22.242 -3.912  -8.507  1.00 0.00 ? 43 GLN A NE2  2  
ATOM   1481  H  H    . GLN A 1 43 ? 20.965 0.914   -6.080  1.00 0.00 ? 43 GLN A H    2  
ATOM   1482  H  HA   . GLN A 1 43 ? 18.954 -0.761  -7.354  1.00 0.00 ? 43 GLN A HA   2  
ATOM   1483  H  HB2  . GLN A 1 43 ? 21.426 -1.217  -5.665  1.00 0.00 ? 43 GLN A HB2  2  
ATOM   1484  H  HB3  . GLN A 1 43 ? 20.330 -2.540  -6.058  1.00 0.00 ? 43 GLN A HB3  2  
ATOM   1485  H  HG2  . GLN A 1 43 ? 20.594 -2.016  -8.495  1.00 0.00 ? 43 GLN A HG2  2  
ATOM   1486  H  HG3  . GLN A 1 43 ? 21.828 -0.819  -8.059  1.00 0.00 ? 43 GLN A HG3  2  
ATOM   1487  H  HE21 . GLN A 1 43 ? 21.445 -3.971  -9.138  1.00 0.00 ? 43 GLN A HE21 2  
ATOM   1488  H  HE22 . GLN A 1 43 ? 22.921 -4.660  -8.483  1.00 0.00 ? 43 GLN A HE22 2  
ATOM   1489  N  N    . CYS A 1 44 ? 17.431 -1.444  -5.502  1.00 0.00 ? 44 CYS A N    2  
ATOM   1490  C  CA   . CYS A 1 44 ? 16.333 -1.603  -4.553  1.00 0.00 ? 44 CYS A CA   2  
ATOM   1491  C  C    . CYS A 1 44 ? 16.486 -2.910  -3.753  1.00 0.00 ? 44 CYS A C    2  
ATOM   1492  O  O    . CYS A 1 44 ? 17.455 -3.636  -3.972  1.00 0.00 ? 44 CYS A O    2  
ATOM   1493  C  CB   . CYS A 1 44 ? 15.005 -1.496  -5.312  1.00 0.00 ? 44 CYS A CB   2  
ATOM   1494  S  SG   . CYS A 1 44 ? 14.537 -2.900  -6.351  1.00 0.00 ? 44 CYS A SG   2  
ATOM   1495  H  H    . CYS A 1 44 ? 17.279 -1.785  -6.439  1.00 0.00 ? 44 CYS A H    2  
ATOM   1496  H  HA   . CYS A 1 44 ? 16.362 -0.763  -3.863  1.00 0.00 ? 44 CYS A HA   2  
ATOM   1497  H  HB2  . CYS A 1 44 ? 14.199 -1.346  -4.602  1.00 0.00 ? 44 CYS A HB2  2  
ATOM   1498  H  HB3  . CYS A 1 44 ? 15.045 -0.605  -5.939  1.00 0.00 ? 44 CYS A HB3  2  
ATOM   1499  N  N    . PRO A 1 45 ? 15.572 -3.231  -2.816  1.00 0.00 ? 45 PRO A N    2  
ATOM   1500  C  CA   . PRO A 1 45 ? 15.642 -4.458  -2.026  1.00 0.00 ? 45 PRO A CA   2  
ATOM   1501  C  C    . PRO A 1 45 ? 15.616 -5.763  -2.828  1.00 0.00 ? 45 PRO A C    2  
ATOM   1502  O  O    . PRO A 1 45 ? 16.127 -6.775  -2.354  1.00 0.00 ? 45 PRO A O    2  
ATOM   1503  C  CB   . PRO A 1 45 ? 14.481 -4.387  -1.039  1.00 0.00 ? 45 PRO A CB   2  
ATOM   1504  C  CG   . PRO A 1 45 ? 14.433 -2.893  -0.745  1.00 0.00 ? 45 PRO A CG   2  
ATOM   1505  C  CD   . PRO A 1 45 ? 14.717 -2.281  -2.117  1.00 0.00 ? 45 PRO A CD   2  
ATOM   1506  H  HA   . PRO A 1 45 ? 16.557 -4.415  -1.439  1.00 0.00 ? 45 PRO A HA   2  
ATOM   1507  H  HB2  . PRO A 1 45 ? 13.555 -4.696  -1.524  1.00 0.00 ? 45 PRO A HB2  2  
ATOM   1508  H  HB3  . PRO A 1 45 ? 14.664 -4.980  -0.141  1.00 0.00 ? 45 PRO A HB3  2  
ATOM   1509  H  HG2  . PRO A 1 45 ? 13.467 -2.584  -0.343  1.00 0.00 ? 45 PRO A HG2  2  
ATOM   1510  H  HG3  . PRO A 1 45 ? 15.237 -2.637  -0.052  1.00 0.00 ? 45 PRO A HG3  2  
ATOM   1511  H  HD2  . PRO A 1 45 ? 13.768 -2.184  -2.643  1.00 0.00 ? 45 PRO A HD2  2  
ATOM   1512  H  HD3  . PRO A 1 45 ? 15.190 -1.307  -1.992  1.00 0.00 ? 45 PRO A HD3  2  
ATOM   1513  N  N    . ALA A 1 46 ? 15.011 -5.760  -4.023  1.00 0.00 ? 46 ALA A N    2  
ATOM   1514  C  CA   . ALA A 1 46 ? 15.040 -6.907  -4.916  1.00 0.00 ? 46 ALA A CA   2  
ATOM   1515  C  C    . ALA A 1 46 ? 16.462 -7.124  -5.428  1.00 0.00 ? 46 ALA A C    2  
ATOM   1516  O  O    . ALA A 1 46 ? 16.952 -8.252  -5.445  1.00 0.00 ? 46 ALA A O    2  
ATOM   1517  C  CB   . ALA A 1 46 ? 14.064 -6.692  -6.076  1.00 0.00 ? 46 ALA A CB   2  
ATOM   1518  H  H    . ALA A 1 46 ? 14.668 -4.891  -4.402  1.00 0.00 ? 46 ALA A H    2  
ATOM   1519  H  HA   . ALA A 1 46 ? 14.719 -7.794  -4.367  1.00 0.00 ? 46 ALA A HA   2  
ATOM   1520  H  HB1  . ALA A 1 46 ? 13.059 -6.520  -5.686  1.00 0.00 ? 46 ALA A HB1  2  
ATOM   1521  H  HB2  . ALA A 1 46 ? 14.369 -5.837  -6.676  1.00 0.00 ? 46 ALA A HB2  2  
ATOM   1522  H  HB3  . ALA A 1 46 ? 14.050 -7.581  -6.708  1.00 0.00 ? 46 ALA A HB3  2  
ATOM   1523  N  N    . CYS A 1 47 ? 17.118 -6.035  -5.846  1.00 0.00 ? 47 CYS A N    2  
ATOM   1524  C  CA   . CYS A 1 47 ? 18.414 -6.079  -6.492  1.00 0.00 ? 47 CYS A CA   2  
ATOM   1525  C  C    . CYS A 1 47 ? 19.513 -6.390  -5.476  1.00 0.00 ? 47 CYS A C    2  
ATOM   1526  O  O    . CYS A 1 47 ? 20.354 -7.256  -5.713  1.00 0.00 ? 47 CYS A O    2  
ATOM   1527  C  CB   . CYS A 1 47 ? 18.686 -4.741  -7.175  1.00 0.00 ? 47 CYS A CB   2  
ATOM   1528  S  SG   . CYS A 1 47 ? 17.482 -4.221  -8.413  1.00 0.00 ? 47 CYS A SG   2  
ATOM   1529  H  H    . CYS A 1 47 ? 16.691 -5.127  -5.740  1.00 0.00 ? 47 CYS A H    2  
ATOM   1530  H  HA   . CYS A 1 47 ? 18.384 -6.850  -7.256  1.00 0.00 ? 47 CYS A HA   2  
ATOM   1531  H  HB2  . CYS A 1 47 ? 18.718 -3.962  -6.418  1.00 0.00 ? 47 CYS A HB2  2  
ATOM   1532  H  HB3  . CYS A 1 47 ? 19.655 -4.809  -7.664  1.00 0.00 ? 47 CYS A HB3  2  
ATOM   1533  N  N    . GLN A 1 48 ? 19.495 -5.673  -4.346  1.00 0.00 ? 48 GLN A N    2  
ATOM   1534  C  CA   . GLN A 1 48 ? 20.307 -5.911  -3.169  1.00 0.00 ? 48 GLN A CA   2  
ATOM   1535  C  C    . GLN A 1 48 ? 19.400 -6.438  -2.054  1.00 0.00 ? 48 GLN A C    2  
ATOM   1536  O  O    . GLN A 1 48 ? 18.685 -5.638  -1.453  1.00 0.00 ? 48 GLN A O    2  
ATOM   1537  C  CB   . GLN A 1 48 ? 20.921 -4.574  -2.743  1.00 0.00 ? 48 GLN A CB   2  
ATOM   1538  C  CG   . GLN A 1 48 ? 21.993 -4.074  -3.717  1.00 0.00 ? 48 GLN A CG   2  
ATOM   1539  C  CD   . GLN A 1 48 ? 22.506 -2.685  -3.333  1.00 0.00 ? 48 GLN A CD   2  
ATOM   1540  O  OE1  . GLN A 1 48 ? 22.077 -2.104  -2.338  1.00 0.00 ? 48 GLN A OE1  2  
ATOM   1541  N  NE2  . GLN A 1 48 ? 23.439 -2.151  -4.121  1.00 0.00 ? 48 GLN A NE2  2  
ATOM   1542  H  H    . GLN A 1 48 ? 18.808 -4.939  -4.252  1.00 0.00 ? 48 GLN A H    2  
ATOM   1543  H  HA   . GLN A 1 48 ? 21.117 -6.612  -3.366  1.00 0.00 ? 48 GLN A HA   2  
ATOM   1544  H  HB2  . GLN A 1 48 ? 20.125 -3.831  -2.686  1.00 0.00 ? 48 GLN A HB2  2  
ATOM   1545  H  HB3  . GLN A 1 48 ? 21.365 -4.697  -1.757  1.00 0.00 ? 48 GLN A HB3  2  
ATOM   1546  H  HG2  . GLN A 1 48 ? 22.829 -4.774  -3.714  1.00 0.00 ? 48 GLN A HG2  2  
ATOM   1547  H  HG3  . GLN A 1 48 ? 21.583 -4.028  -4.724  1.00 0.00 ? 48 GLN A HG3  2  
ATOM   1548  H  HE21 . GLN A 1 48 ? 23.700 -2.619  -4.983  1.00 0.00 ? 48 GLN A HE21 2  
ATOM   1549  H  HE22 . GLN A 1 48 ? 23.822 -1.245  -3.893  1.00 0.00 ? 48 GLN A HE22 2  
ATOM   1550  N  N    . PRO A 1 49 ? 19.411 -7.753  -1.776  1.00 0.00 ? 49 PRO A N    2  
ATOM   1551  C  CA   . PRO A 1 49 ? 18.771 -8.341  -0.605  1.00 0.00 ? 49 PRO A CA   2  
ATOM   1552  C  C    . PRO A 1 49 ? 19.305 -7.764  0.710   1.00 0.00 ? 49 PRO A C    2  
ATOM   1553  O  O    . PRO A 1 49 ? 20.197 -8.332  1.338   1.00 0.00 ? 49 PRO A O    2  
ATOM   1554  C  CB   . PRO A 1 49 ? 18.989 -9.850  -0.739  1.00 0.00 ? 49 PRO A CB   2  
ATOM   1555  C  CG   . PRO A 1 49 ? 18.927 -10.042 -2.251  1.00 0.00 ? 49 PRO A CG   2  
ATOM   1556  C  CD   . PRO A 1 49 ? 19.629 -8.789  -2.776  1.00 0.00 ? 49 PRO A CD   2  
ATOM   1557  H  HA   . PRO A 1 49 ? 17.697 -8.162  -0.667  1.00 0.00 ? 49 PRO A HA   2  
ATOM   1558  H  HB2  . PRO A 1 49 ? 19.986 -10.127 -0.396  1.00 0.00 ? 49 PRO A HB2  2  
ATOM   1559  H  HB3  . PRO A 1 49 ? 18.228 -10.430 -0.213  1.00 0.00 ? 49 PRO A HB3  2  
ATOM   1560  H  HG2  . PRO A 1 49 ? 19.421 -10.959 -2.575  1.00 0.00 ? 49 PRO A HG2  2  
ATOM   1561  H  HG3  . PRO A 1 49 ? 17.885 -10.038 -2.574  1.00 0.00 ? 49 PRO A HG3  2  
ATOM   1562  H  HD2  . PRO A 1 49 ? 20.699 -8.977  -2.873  1.00 0.00 ? 49 PRO A HD2  2  
ATOM   1563  H  HD3  . PRO A 1 49 ? 19.204 -8.522  -3.742  1.00 0.00 ? 49 PRO A HD3  2  
ATOM   1564  N  N    . ALA A 1 50 ? 18.734 -6.629  1.124   1.00 0.00 ? 50 ALA A N    2  
ATOM   1565  C  CA   . ALA A 1 50 ? 19.218 -5.801  2.216   1.00 0.00 ? 50 ALA A CA   2  
ATOM   1566  C  C    . ALA A 1 50 ? 18.177 -4.727  2.526   1.00 0.00 ? 50 ALA A C    2  
ATOM   1567  O  O    . ALA A 1 50 ? 17.338 -4.416  1.679   1.00 0.00 ? 50 ALA A O    2  
ATOM   1568  C  CB   . ALA A 1 50 ? 20.547 -5.146  1.823   1.00 0.00 ? 50 ALA A CB   2  
ATOM   1569  H  H    . ALA A 1 50 ? 18.011 -6.222  0.544   1.00 0.00 ? 50 ALA A H    2  
ATOM   1570  H  HA   . ALA A 1 50 ? 19.367 -6.422  3.101   1.00 0.00 ? 50 ALA A HA   2  
ATOM   1571  H  HB1  . ALA A 1 50 ? 20.890 -4.494  2.627   1.00 0.00 ? 50 ALA A HB1  2  
ATOM   1572  H  HB2  . ALA A 1 50 ? 21.307 -5.906  1.643   1.00 0.00 ? 50 ALA A HB2  2  
ATOM   1573  H  HB3  . ALA A 1 50 ? 20.414 -4.552  0.917   1.00 0.00 ? 50 ALA A HB3  2  
ATOM   1574  N  N    . THR A 1 51 ? 18.254 -4.160  3.735   1.00 0.00 ? 51 THR A N    2  
ATOM   1575  C  CA   . THR A 1 51 ? 17.507 -2.979  4.156   1.00 0.00 ? 51 THR A CA   2  
ATOM   1576  C  C    . THR A 1 51 ? 18.465 -1.784  4.254   1.00 0.00 ? 51 THR A C    2  
ATOM   1577  O  O    . THR A 1 51 ? 18.265 -0.935  5.152   1.00 0.00 ? 51 THR A O    2  
ATOM   1578  C  CB   . THR A 1 51 ? 16.747 -3.294  5.459   1.00 0.00 ? 51 THR A CB   2  
ATOM   1579  O  OG1  . THR A 1 51 ? 15.977 -2.179  5.855   1.00 0.00 ? 51 THR A OG1  2  
ATOM   1580  C  CG2  . THR A 1 51 ? 17.664 -3.712  6.616   1.00 0.00 ? 51 THR A CG2  2  
ATOM   1581  O  OXT  . THR A 1 51 ? 19.377 -1.718  3.400   1.00 0.00 ? 51 THR A OXT  2  
ATOM   1582  H  H    . THR A 1 51 ? 18.977 -4.480  4.362   1.00 0.00 ? 51 THR A H    2  
ATOM   1583  H  HA   . THR A 1 51 ? 16.759 -2.722  3.404   1.00 0.00 ? 51 THR A HA   2  
ATOM   1584  H  HB   . THR A 1 51 ? 16.057 -4.116  5.263   1.00 0.00 ? 51 THR A HB   2  
ATOM   1585  H  HG1  . THR A 1 51 ? 16.576 -1.426  5.918   1.00 0.00 ? 51 THR A HG1  2  
ATOM   1586  H  HG21 . THR A 1 51 ? 18.195 -4.630  6.369   1.00 0.00 ? 51 THR A HG21 2  
ATOM   1587  H  HG22 . THR A 1 51 ? 18.386 -2.928  6.841   1.00 0.00 ? 51 THR A HG22 2  
ATOM   1588  H  HG23 . THR A 1 51 ? 17.057 -3.893  7.505   1.00 0.00 ? 51 THR A HG23 2  
HETATM 1589  ZN ZN   . ZN  B 2 .  ? 6.532  5.069   -0.681  1.00 0.00 ? 52 ZN  A ZN   2  
HETATM 1590  ZN ZN   . ZN  C 2 .  ? 15.597 -2.914  -8.385  1.00 0.00 ? 53 ZN  A ZN   2  
ATOM   1591  N  N    . ALA A 1 1  ? 2.796  12.453  -7.675  1.00 0.00 ? 1  ALA A N    3  
ATOM   1592  C  CA   . ALA A 1 1  ? 3.318  11.081  -7.808  1.00 0.00 ? 1  ALA A CA   3  
ATOM   1593  C  C    . ALA A 1 1  ? 2.724  10.173  -6.728  1.00 0.00 ? 1  ALA A C    3  
ATOM   1594  O  O    . ALA A 1 1  ? 1.973  10.638  -5.872  1.00 0.00 ? 1  ALA A O    3  
ATOM   1595  C  CB   . ALA A 1 1  ? 4.849  11.087  -7.745  1.00 0.00 ? 1  ALA A CB   3  
ATOM   1596  H  H1   . ALA A 1 1  ? 3.020  12.797  -6.746  1.00 0.00 ? 1  ALA A H1   3  
ATOM   1597  H  H2   . ALA A 1 1  ? 3.213  13.053  -8.371  1.00 0.00 ? 1  ALA A H2   3  
ATOM   1598  H  H3   . ALA A 1 1  ? 1.794  12.439  -7.786  1.00 0.00 ? 1  ALA A H3   3  
ATOM   1599  H  HA   . ALA A 1 1  ? 3.016  10.702  -8.784  1.00 0.00 ? 1  ALA A HA   3  
ATOM   1600  H  HB1  . ALA A 1 1  ? 5.237  10.088  -7.945  1.00 0.00 ? 1  ALA A HB1  3  
ATOM   1601  H  HB2  . ALA A 1 1  ? 5.246  11.770  -8.495  1.00 0.00 ? 1  ALA A HB2  3  
ATOM   1602  H  HB3  . ALA A 1 1  ? 5.179  11.411  -6.757  1.00 0.00 ? 1  ALA A HB3  3  
ATOM   1603  N  N    . ARG A 1 2  ? 3.044  8.876   -6.783  1.00 0.00 ? 2  ARG A N    3  
ATOM   1604  C  CA   . ARG A 1 2  ? 2.749  7.930   -5.718  1.00 0.00 ? 2  ARG A CA   3  
ATOM   1605  C  C    . ARG A 1 2  ? 3.802  6.825   -5.720  1.00 0.00 ? 2  ARG A C    3  
ATOM   1606  O  O    . ARG A 1 2  ? 4.410  6.546   -6.754  1.00 0.00 ? 2  ARG A O    3  
ATOM   1607  C  CB   . ARG A 1 2  ? 1.327  7.362   -5.846  1.00 0.00 ? 2  ARG A CB   3  
ATOM   1608  C  CG   . ARG A 1 2  ? 1.128  6.460   -7.070  1.00 0.00 ? 2  ARG A CG   3  
ATOM   1609  C  CD   . ARG A 1 2  ? -0.296 5.895   -7.067  1.00 0.00 ? 2  ARG A CD   3  
ATOM   1610  N  NE   . ARG A 1 2  ? -0.521 5.016   -8.221  1.00 0.00 ? 2  ARG A NE   3  
ATOM   1611  C  CZ   . ARG A 1 2  ? -1.621 4.267   -8.410  1.00 0.00 ? 2  ARG A CZ   3  
ATOM   1612  N  NH1  . ARG A 1 2  ? -2.619 4.277   -7.516  1.00 0.00 ? 2  ARG A NH1  3  
ATOM   1613  N  NH2  . ARG A 1 2  ? -1.722 3.504   -9.507  1.00 0.00 ? 2  ARG A NH2  3  
ATOM   1614  H  H    . ARG A 1 2  ? 3.640  8.543   -7.528  1.00 0.00 ? 2  ARG A H    3  
ATOM   1615  H  HA   . ARG A 1 2  ? 2.819  8.456   -4.764  1.00 0.00 ? 2  ARG A HA   3  
ATOM   1616  H  HB2  . ARG A 1 2  ? 1.110  6.781   -4.948  1.00 0.00 ? 2  ARG A HB2  3  
ATOM   1617  H  HB3  . ARG A 1 2  ? 0.617  8.187   -5.900  1.00 0.00 ? 2  ARG A HB3  3  
ATOM   1618  H  HG2  . ARG A 1 2  ? 1.295  7.034   -7.983  1.00 0.00 ? 2  ARG A HG2  3  
ATOM   1619  H  HG3  . ARG A 1 2  ? 1.827  5.623   -7.039  1.00 0.00 ? 2  ARG A HG3  3  
ATOM   1620  H  HD2  . ARG A 1 2  ? -0.442 5.329   -6.146  1.00 0.00 ? 2  ARG A HD2  3  
ATOM   1621  H  HD3  . ARG A 1 2  ? -1.009 6.720   -7.099  1.00 0.00 ? 2  ARG A HD3  3  
ATOM   1622  H  HE   . ARG A 1 2  ? 0.212  4.983   -8.915  1.00 0.00 ? 2  ARG A HE   3  
ATOM   1623  H  HH11 . ARG A 1 2  ? -2.550 4.851   -6.688  1.00 0.00 ? 2  ARG A HH11 3  
ATOM   1624  H  HH12 . ARG A 1 2  ? -3.445 3.713   -7.662  1.00 0.00 ? 2  ARG A HH12 3  
ATOM   1625  H  HH21 . ARG A 1 2  ? -0.976 3.493   -10.188 1.00 0.00 ? 2  ARG A HH21 3  
ATOM   1626  H  HH22 . ARG A 1 2  ? -2.545 2.939   -9.662  1.00 0.00 ? 2  ARG A HH22 3  
ATOM   1627  N  N    . CYS A 1 3  ? 4.017  6.209   -4.556  1.00 0.00 ? 3  CYS A N    3  
ATOM   1628  C  CA   . CYS A 1 3  ? 4.947  5.102   -4.397  1.00 0.00 ? 3  CYS A CA   3  
ATOM   1629  C  C    . CYS A 1 3  ? 4.279  3.794   -4.809  1.00 0.00 ? 3  CYS A C    3  
ATOM   1630  O  O    . CYS A 1 3  ? 3.057  3.669   -4.747  1.00 0.00 ? 3  CYS A O    3  
ATOM   1631  C  CB   . CYS A 1 3  ? 5.424  5.073   -2.947  1.00 0.00 ? 3  CYS A CB   3  
ATOM   1632  S  SG   . CYS A 1 3  ? 6.734  3.887   -2.556  1.00 0.00 ? 3  CYS A SG   3  
ATOM   1633  H  H    . CYS A 1 3  ? 3.476  6.491   -3.747  1.00 0.00 ? 3  CYS A H    3  
ATOM   1634  H  HA   . CYS A 1 3  ? 5.820  5.273   -5.030  1.00 0.00 ? 3  CYS A HA   3  
ATOM   1635  H  HB2  . CYS A 1 3  ? 5.824  6.064   -2.746  1.00 0.00 ? 3  CYS A HB2  3  
ATOM   1636  H  HB3  . CYS A 1 3  ? 4.573  4.889   -2.289  1.00 0.00 ? 3  CYS A HB3  3  
ATOM   1637  N  N    . LYS A 1 4  ? 5.092  2.828   -5.245  1.00 0.00 ? 4  LYS A N    3  
ATOM   1638  C  CA   . LYS A 1 4  ? 4.677  1.467   -5.542  1.00 0.00 ? 4  LYS A CA   3  
ATOM   1639  C  C    . LYS A 1 4  ? 4.669  0.624   -4.265  1.00 0.00 ? 4  LYS A C    3  
ATOM   1640  O  O    . LYS A 1 4  ? 3.722  -0.123  -4.025  1.00 0.00 ? 4  LYS A O    3  
ATOM   1641  C  CB   . LYS A 1 4  ? 5.600  0.897   -6.628  1.00 0.00 ? 4  LYS A CB   3  
ATOM   1642  C  CG   . LYS A 1 4  ? 5.109  -0.454  -7.164  1.00 0.00 ? 4  LYS A CG   3  
ATOM   1643  C  CD   . LYS A 1 4  ? 5.959  -0.959  -8.341  1.00 0.00 ? 4  LYS A CD   3  
ATOM   1644  C  CE   . LYS A 1 4  ? 5.765  -0.122  -9.615  1.00 0.00 ? 4  LYS A CE   3  
ATOM   1645  N  NZ   . LYS A 1 4  ? 6.417  -0.736  -10.787 1.00 0.00 ? 4  LYS A NZ   3  
ATOM   1646  H  H    . LYS A 1 4  ? 6.082  3.027   -5.301  1.00 0.00 ? 4  LYS A H    3  
ATOM   1647  H  HA   . LYS A 1 4  ? 3.669  1.487   -5.947  1.00 0.00 ? 4  LYS A HA   3  
ATOM   1648  H  HB2  . LYS A 1 4  ? 5.623  1.616   -7.447  1.00 0.00 ? 4  LYS A HB2  3  
ATOM   1649  H  HB3  . LYS A 1 4  ? 6.607  0.780   -6.225  1.00 0.00 ? 4  LYS A HB3  3  
ATOM   1650  H  HG2  . LYS A 1 4  ? 5.162  -1.189  -6.360  1.00 0.00 ? 4  LYS A HG2  3  
ATOM   1651  H  HG3  . LYS A 1 4  ? 4.068  -0.367  -7.483  1.00 0.00 ? 4  LYS A HG3  3  
ATOM   1652  H  HD2  . LYS A 1 4  ? 7.009  -0.960  -8.049  1.00 0.00 ? 4  LYS A HD2  3  
ATOM   1653  H  HD3  . LYS A 1 4  ? 5.655  -1.986  -8.551  1.00 0.00 ? 4  LYS A HD3  3  
ATOM   1654  H  HE2  . LYS A 1 4  ? 4.700  -0.030  -9.828  1.00 0.00 ? 4  LYS A HE2  3  
ATOM   1655  H  HE3  . LYS A 1 4  ? 6.182  0.876   -9.478  1.00 0.00 ? 4  LYS A HE3  3  
ATOM   1656  H  HZ1  . LYS A 1 4  ? 6.035  -1.656  -10.950 1.00 0.00 ? 4  LYS A HZ1  3  
ATOM   1657  H  HZ2  . LYS A 1 4  ? 6.253  -0.162  -11.602 1.00 0.00 ? 4  LYS A HZ2  3  
ATOM   1658  H  HZ3  . LYS A 1 4  ? 7.415  -0.805  -10.641 1.00 0.00 ? 4  LYS A HZ3  3  
ATOM   1659  N  N    . VAL A 1 5  ? 5.721  0.758   -3.447  1.00 0.00 ? 5  VAL A N    3  
ATOM   1660  C  CA   . VAL A 1 5  ? 5.991  -0.107  -2.307  1.00 0.00 ? 5  VAL A CA   3  
ATOM   1661  C  C    . VAL A 1 5  ? 4.946  0.109   -1.211  1.00 0.00 ? 5  VAL A C    3  
ATOM   1662  O  O    . VAL A 1 5  ? 4.091  -0.750  -1.002  1.00 0.00 ? 5  VAL A O    3  
ATOM   1663  C  CB   . VAL A 1 5  ? 7.420  0.130   -1.794  1.00 0.00 ? 5  VAL A CB   3  
ATOM   1664  C  CG1  . VAL A 1 5  ? 7.756  -0.813  -0.630  1.00 0.00 ? 5  VAL A CG1  3  
ATOM   1665  C  CG2  . VAL A 1 5  ? 8.449  -0.083  -2.907  1.00 0.00 ? 5  VAL A CG2  3  
ATOM   1666  H  H    . VAL A 1 5  ? 6.430  1.428   -3.700  1.00 0.00 ? 5  VAL A H    3  
ATOM   1667  H  HA   . VAL A 1 5  ? 5.930  -1.141  -2.644  1.00 0.00 ? 5  VAL A HA   3  
ATOM   1668  H  HB   . VAL A 1 5  ? 7.519  1.156   -1.448  1.00 0.00 ? 5  VAL A HB   3  
ATOM   1669  H  HG11 . VAL A 1 5  ? 7.110  -0.614  0.224   1.00 0.00 ? 5  VAL A HG11 3  
ATOM   1670  H  HG12 . VAL A 1 5  ? 7.628  -1.851  -0.941  1.00 0.00 ? 5  VAL A HG12 3  
ATOM   1671  H  HG13 . VAL A 1 5  ? 8.791  -0.662  -0.319  1.00 0.00 ? 5  VAL A HG13 3  
ATOM   1672  H  HG21 . VAL A 1 5  ? 8.403  -1.107  -3.279  1.00 0.00 ? 5  VAL A HG21 3  
ATOM   1673  H  HG22 . VAL A 1 5  ? 8.298  0.612   -3.733  1.00 0.00 ? 5  VAL A HG22 3  
ATOM   1674  H  HG23 . VAL A 1 5  ? 9.429  0.108   -2.484  1.00 0.00 ? 5  VAL A HG23 3  
ATOM   1675  N  N    . CYS A 1 6  ? 5.009  1.252   -0.514  1.00 0.00 ? 6  CYS A N    3  
ATOM   1676  C  CA   . CYS A 1 6  ? 4.037  1.596   0.516   1.00 0.00 ? 6  CYS A CA   3  
ATOM   1677  C  C    . CYS A 1 6  ? 2.673  1.969   -0.075  1.00 0.00 ? 6  CYS A C    3  
ATOM   1678  O  O    . CYS A 1 6  ? 1.702  2.043   0.676   1.00 0.00 ? 6  CYS A O    3  
ATOM   1679  C  CB   . CYS A 1 6  ? 4.578  2.694   1.440   1.00 0.00 ? 6  CYS A CB   3  
ATOM   1680  S  SG   . CYS A 1 6  ? 4.953  4.296   0.682   1.00 0.00 ? 6  CYS A SG   3  
ATOM   1681  H  H    . CYS A 1 6  ? 5.737  1.919   -0.721  1.00 0.00 ? 6  CYS A H    3  
ATOM   1682  H  HA   . CYS A 1 6  ? 3.887  0.715   1.143   1.00 0.00 ? 6  CYS A HA   3  
ATOM   1683  H  HB2  . CYS A 1 6  ? 3.833  2.873   2.217   1.00 0.00 ? 6  CYS A HB2  3  
ATOM   1684  H  HB3  . CYS A 1 6  ? 5.485  2.334   1.926   1.00 0.00 ? 6  CYS A HB3  3  
ATOM   1685  N  N    . ARG A 1 7  ? 2.590  2.188   -1.399  1.00 0.00 ? 7  ARG A N    3  
ATOM   1686  C  CA   . ARG A 1 7  ? 1.336  2.337   -2.126  1.00 0.00 ? 7  ARG A CA   3  
ATOM   1687  C  C    . ARG A 1 7  ? 0.571  3.537   -1.564  1.00 0.00 ? 7  ARG A C    3  
ATOM   1688  O  O    . ARG A 1 7  ? -0.507 3.384   -0.991  1.00 0.00 ? 7  ARG A O    3  
ATOM   1689  C  CB   . ARG A 1 7  ? 0.553  1.015   -2.083  1.00 0.00 ? 7  ARG A CB   3  
ATOM   1690  C  CG   . ARG A 1 7  ? -0.619 1.001   -3.074  1.00 0.00 ? 7  ARG A CG   3  
ATOM   1691  C  CD   . ARG A 1 7  ? -1.344 -0.348  -3.023  1.00 0.00 ? 7  ARG A CD   3  
ATOM   1692  N  NE   . ARG A 1 7  ? -1.935 -0.582  -1.698  1.00 0.00 ? 7  ARG A NE   3  
ATOM   1693  C  CZ   . ARG A 1 7  ? -2.267 -1.782  -1.190  1.00 0.00 ? 7  ARG A CZ   3  
ATOM   1694  N  NH1  . ARG A 1 7  ? -2.122 -2.901  -1.914  1.00 0.00 ? 7  ARG A NH1  3  
ATOM   1695  N  NH2  . ARG A 1 7  ? -2.748 -1.858  0.058   1.00 0.00 ? 7  ARG A NH2  3  
ATOM   1696  H  H    . ARG A 1 7  ? 3.436  2.168   -1.949  1.00 0.00 ? 7  ARG A H    3  
ATOM   1697  H  HA   . ARG A 1 7  ? 1.573  2.537   -3.168  1.00 0.00 ? 7  ARG A HA   3  
ATOM   1698  H  HB2  . ARG A 1 7  ? 1.233  0.205   -2.353  1.00 0.00 ? 7  ARG A HB2  3  
ATOM   1699  H  HB3  . ARG A 1 7  ? 0.191  0.833   -1.071  1.00 0.00 ? 7  ARG A HB3  3  
ATOM   1700  H  HG2  . ARG A 1 7  ? -1.328 1.797   -2.843  1.00 0.00 ? 7  ARG A HG2  3  
ATOM   1701  H  HG3  . ARG A 1 7  ? -0.236 1.156   -4.083  1.00 0.00 ? 7  ARG A HG3  3  
ATOM   1702  H  HD2  . ARG A 1 7  ? -2.138 -0.351  -3.771  1.00 0.00 ? 7  ARG A HD2  3  
ATOM   1703  H  HD3  . ARG A 1 7  ? -0.625 -1.130  -3.267  1.00 0.00 ? 7  ARG A HD3  3  
ATOM   1704  H  HE   . ARG A 1 7  ? -2.073 0.236   -1.121  1.00 0.00 ? 7  ARG A HE   3  
ATOM   1705  H  HH11 . ARG A 1 7  ? -1.768 -2.851  -2.858  1.00 0.00 ? 7  ARG A HH11 3  
ATOM   1706  H  HH12 . ARG A 1 7  ? -2.364 -3.799  -1.521  1.00 0.00 ? 7  ARG A HH12 3  
ATOM   1707  H  HH21 . ARG A 1 7  ? -2.857 -1.021  0.611   1.00 0.00 ? 7  ARG A HH21 3  
ATOM   1708  H  HH22 . ARG A 1 7  ? -2.998 -2.752  0.456   1.00 0.00 ? 7  ARG A HH22 3  
ATOM   1709  N  N    . LYS A 1 8  ? 1.154  4.733   -1.715  1.00 0.00 ? 8  LYS A N    3  
ATOM   1710  C  CA   . LYS A 1 8  ? 0.681  5.930   -1.039  1.00 0.00 ? 8  LYS A CA   3  
ATOM   1711  C  C    . LYS A 1 8  ? 1.138  7.191   -1.775  1.00 0.00 ? 8  LYS A C    3  
ATOM   1712  O  O    . LYS A 1 8  ? 2.210  7.214   -2.380  1.00 0.00 ? 8  LYS A O    3  
ATOM   1713  C  CB   . LYS A 1 8  ? 1.209  5.899   0.403   1.00 0.00 ? 8  LYS A CB   3  
ATOM   1714  C  CG   . LYS A 1 8  ? 0.794  7.112   1.247   1.00 0.00 ? 8  LYS A CG   3  
ATOM   1715  C  CD   . LYS A 1 8  ? 1.352  7.041   2.677   1.00 0.00 ? 8  LYS A CD   3  
ATOM   1716  C  CE   . LYS A 1 8  ? 0.857  5.848   3.504   1.00 0.00 ? 8  LYS A CE   3  
ATOM   1717  N  NZ   . LYS A 1 8  ? -0.612 5.806   3.596   1.00 0.00 ? 8  LYS A NZ   3  
ATOM   1718  H  H    . LYS A 1 8  ? 2.009  4.804   -2.247  1.00 0.00 ? 8  LYS A H    3  
ATOM   1719  H  HA   . LYS A 1 8  ? -0.409 5.921   -1.008  1.00 0.00 ? 8  LYS A HA   3  
ATOM   1720  H  HB2  . LYS A 1 8  ? 0.830  4.992   0.877   1.00 0.00 ? 8  LYS A HB2  3  
ATOM   1721  H  HB3  . LYS A 1 8  ? 2.297  5.855   0.370   1.00 0.00 ? 8  LYS A HB3  3  
ATOM   1722  H  HG2  . LYS A 1 8  ? 1.208  8.017   0.802   1.00 0.00 ? 8  LYS A HG2  3  
ATOM   1723  H  HG3  . LYS A 1 8  ? -0.293 7.203   1.264   1.00 0.00 ? 8  LYS A HG3  3  
ATOM   1724  H  HD2  . LYS A 1 8  ? 2.440  6.994   2.622   1.00 0.00 ? 8  LYS A HD2  3  
ATOM   1725  H  HD3  . LYS A 1 8  ? 1.083  7.963   3.194   1.00 0.00 ? 8  LYS A HD3  3  
ATOM   1726  H  HE2  . LYS A 1 8  ? 1.221  4.913   3.076   1.00 0.00 ? 8  LYS A HE2  3  
ATOM   1727  H  HE3  . LYS A 1 8  ? 1.265  5.937   4.512   1.00 0.00 ? 8  LYS A HE3  3  
ATOM   1728  H  HZ1  . LYS A 1 8  ? -0.951 6.668   3.998   1.00 0.00 ? 8  LYS A HZ1  3  
ATOM   1729  H  HZ2  . LYS A 1 8  ? -1.007 5.685   2.674   1.00 0.00 ? 8  LYS A HZ2  3  
ATOM   1730  H  HZ3  . LYS A 1 8  ? -0.892 5.031   4.182   1.00 0.00 ? 8  LYS A HZ3  3  
ATOM   1731  N  N    . LYS A 1 9  ? 0.285  8.220   -1.720  1.00 0.00 ? 9  LYS A N    3  
ATOM   1732  C  CA   . LYS A 1 9  ? 0.559  9.590   -2.127  1.00 0.00 ? 9  LYS A CA   3  
ATOM   1733  C  C    . LYS A 1 9  ? 0.408  10.471  -0.883  1.00 0.00 ? 9  LYS A C    3  
ATOM   1734  O  O    . LYS A 1 9  ? -0.383 10.155  0.006   1.00 0.00 ? 9  LYS A O    3  
ATOM   1735  C  CB   . LYS A 1 9  ? -0.421 10.013  -3.232  1.00 0.00 ? 9  LYS A CB   3  
ATOM   1736  C  CG   . LYS A 1 9  ? -0.268 11.503  -3.556  1.00 0.00 ? 9  LYS A CG   3  
ATOM   1737  C  CD   . LYS A 1 9  ? -1.039 11.923  -4.810  1.00 0.00 ? 9  LYS A CD   3  
ATOM   1738  C  CE   . LYS A 1 9  ? -1.102 13.453  -4.917  1.00 0.00 ? 9  LYS A CE   3  
ATOM   1739  N  NZ   . LYS A 1 9  ? 0.227  14.084  -4.813  1.00 0.00 ? 9  LYS A NZ   3  
ATOM   1740  H  H    . LYS A 1 9  ? -0.578 8.086   -1.212  1.00 0.00 ? 9  LYS A H    3  
ATOM   1741  H  HA   . LYS A 1 9  ? 1.579  9.677   -2.504  1.00 0.00 ? 9  LYS A HA   3  
ATOM   1742  H  HB2  . LYS A 1 9  ? -0.213 9.428   -4.127  1.00 0.00 ? 9  LYS A HB2  3  
ATOM   1743  H  HB3  . LYS A 1 9  ? -1.448 9.824   -2.910  1.00 0.00 ? 9  LYS A HB3  3  
ATOM   1744  H  HG2  . LYS A 1 9  ? -0.642 12.094  -2.719  1.00 0.00 ? 9  LYS A HG2  3  
ATOM   1745  H  HG3  . LYS A 1 9  ? 0.791  11.711  -3.705  1.00 0.00 ? 9  LYS A HG3  3  
ATOM   1746  H  HD2  . LYS A 1 9  ? -0.552 11.506  -5.693  1.00 0.00 ? 9  LYS A HD2  3  
ATOM   1747  H  HD3  . LYS A 1 9  ? -2.057 11.536  -4.756  1.00 0.00 ? 9  LYS A HD3  3  
ATOM   1748  H  HE2  . LYS A 1 9  ? -1.553 13.724  -5.872  1.00 0.00 ? 9  LYS A HE2  3  
ATOM   1749  H  HE3  . LYS A 1 9  ? -1.732 13.842  -4.114  1.00 0.00 ? 9  LYS A HE3  3  
ATOM   1750  H  HZ1  . LYS A 1 9  ? 0.844  13.728  -5.529  1.00 0.00 ? 9  LYS A HZ1  3  
ATOM   1751  H  HZ2  . LYS A 1 9  ? 0.141  15.086  -4.914  1.00 0.00 ? 9  LYS A HZ2  3  
ATOM   1752  H  HZ3  . LYS A 1 9  ? 0.648  13.882  -3.913  1.00 0.00 ? 9  LYS A HZ3  3  
ATOM   1753  N  N    . GLY A 1 10 ? 1.159  11.576  -0.830  1.00 0.00 ? 10 GLY A N    3  
ATOM   1754  C  CA   . GLY A 1 10 ? 1.128  12.527  0.268   1.00 0.00 ? 10 GLY A CA   3  
ATOM   1755  C  C    . GLY A 1 10 ? 2.534  13.068  0.480   1.00 0.00 ? 10 GLY A C    3  
ATOM   1756  O  O    . GLY A 1 10 ? 2.769  14.269  0.345   1.00 0.00 ? 10 GLY A O    3  
ATOM   1757  H  H    . GLY A 1 10 ? 1.772  11.795  -1.607  1.00 0.00 ? 10 GLY A H    3  
ATOM   1758  H  HA2  . GLY A 1 10 ? 0.452  13.344  0.014   1.00 0.00 ? 10 GLY A HA2  3  
ATOM   1759  H  HA3  . GLY A 1 10 ? 0.796  12.054  1.195   1.00 0.00 ? 10 GLY A HA3  3  
ATOM   1760  N  N    . GLU A 1 11 ? 3.474  12.160  0.763   1.00 0.00 ? 11 GLU A N    3  
ATOM   1761  C  CA   . GLU A 1 11 ? 4.899  12.436  0.799   1.00 0.00 ? 11 GLU A CA   3  
ATOM   1762  C  C    . GLU A 1 11 ? 5.446  12.534  -0.630  1.00 0.00 ? 11 GLU A C    3  
ATOM   1763  O  O    . GLU A 1 11 ? 6.308  11.750  -1.025  1.00 0.00 ? 11 GLU A O    3  
ATOM   1764  C  CB   . GLU A 1 11 ? 5.635  11.366  1.626   1.00 0.00 ? 11 GLU A CB   3  
ATOM   1765  C  CG   . GLU A 1 11 ? 4.928  10.980  2.935   1.00 0.00 ? 11 GLU A CG   3  
ATOM   1766  C  CD   . GLU A 1 11 ? 4.006  9.773   2.746   1.00 0.00 ? 11 GLU A CD   3  
ATOM   1767  O  OE1  . GLU A 1 11 ? 2.827  9.996   2.394   1.00 0.00 ? 11 GLU A OE1  3  
ATOM   1768  O  OE2  . GLU A 1 11 ? 4.505  8.643   2.935   1.00 0.00 ? 11 GLU A OE2  3  
ATOM   1769  H  H    . GLU A 1 11 ? 3.176  11.216  0.978   1.00 0.00 ? 11 GLU A H    3  
ATOM   1770  H  HA   . GLU A 1 11 ? 5.059  13.391  1.299   1.00 0.00 ? 11 GLU A HA   3  
ATOM   1771  H  HB2  . GLU A 1 11 ? 5.761  10.456  1.041   1.00 0.00 ? 11 GLU A HB2  3  
ATOM   1772  H  HB3  . GLU A 1 11 ? 6.623  11.764  1.869   1.00 0.00 ? 11 GLU A HB3  3  
ATOM   1773  H  HG2  . GLU A 1 11 ? 5.690  10.701  3.664   1.00 0.00 ? 11 GLU A HG2  3  
ATOM   1774  H  HG3  . GLU A 1 11 ? 4.372  11.829  3.335   1.00 0.00 ? 11 GLU A HG3  3  
ATOM   1775  N  N    . ASP A 1 12 ? 4.958  13.512  -1.405  1.00 0.00 ? 12 ASP A N    3  
ATOM   1776  C  CA   . ASP A 1 12 ? 5.485  13.857  -2.719  1.00 0.00 ? 12 ASP A CA   3  
ATOM   1777  C  C    . ASP A 1 12 ? 6.773  14.673  -2.554  1.00 0.00 ? 12 ASP A C    3  
ATOM   1778  O  O    . ASP A 1 12 ? 6.861  15.814  -3.003  1.00 0.00 ? 12 ASP A O    3  
ATOM   1779  C  CB   . ASP A 1 12 ? 4.419  14.617  -3.525  1.00 0.00 ? 12 ASP A CB   3  
ATOM   1780  C  CG   . ASP A 1 12 ? 3.199  13.758  -3.850  1.00 0.00 ? 12 ASP A CG   3  
ATOM   1781  O  OD1  . ASP A 1 12 ? 2.358  13.573  -2.943  1.00 0.00 ? 12 ASP A OD1  3  
ATOM   1782  O  OD2  . ASP A 1 12 ? 3.097  13.330  -5.022  1.00 0.00 ? 12 ASP A OD2  3  
ATOM   1783  H  H    . ASP A 1 12 ? 4.213  14.089  -1.035  1.00 0.00 ? 12 ASP A H    3  
ATOM   1784  H  HA   . ASP A 1 12 ? 5.722  12.950  -3.272  1.00 0.00 ? 12 ASP A HA   3  
ATOM   1785  H  HB2  . ASP A 1 12 ? 4.099  15.492  -2.958  1.00 0.00 ? 12 ASP A HB2  3  
ATOM   1786  H  HB3  . ASP A 1 12 ? 4.860  14.950  -4.467  1.00 0.00 ? 12 ASP A HB3  3  
ATOM   1787  N  N    . ASP A 1 13 ? 7.770  14.069  -1.897  1.00 0.00 ? 13 ASP A N    3  
ATOM   1788  C  CA   . ASP A 1 13 ? 9.022  14.703  -1.520  1.00 0.00 ? 13 ASP A CA   3  
ATOM   1789  C  C    . ASP A 1 13 ? 9.991  14.605  -2.695  1.00 0.00 ? 13 ASP A C    3  
ATOM   1790  O  O    . ASP A 1 13 ? 10.222 15.584  -3.403  1.00 0.00 ? 13 ASP A O    3  
ATOM   1791  C  CB   . ASP A 1 13 ? 9.555  14.029  -0.247  1.00 0.00 ? 13 ASP A CB   3  
ATOM   1792  C  CG   . ASP A 1 13 ? 10.987 14.446  0.073   1.00 0.00 ? 13 ASP A CG   3  
ATOM   1793  O  OD1  . ASP A 1 13 ? 11.173 15.636  0.407   1.00 0.00 ? 13 ASP A OD1  3  
ATOM   1794  O  OD2  . ASP A 1 13 ? 11.871 13.567  -0.031  1.00 0.00 ? 13 ASP A OD2  3  
ATOM   1795  H  H    . ASP A 1 13 ? 7.627  13.115  -1.595  1.00 0.00 ? 13 ASP A H    3  
ATOM   1796  H  HA   . ASP A 1 13 ? 8.857  15.754  -1.292  1.00 0.00 ? 13 ASP A HA   3  
ATOM   1797  H  HB2  . ASP A 1 13 ? 8.914  14.300  0.592   1.00 0.00 ? 13 ASP A HB2  3  
ATOM   1798  H  HB3  . ASP A 1 13 ? 9.517  12.946  -0.360  1.00 0.00 ? 13 ASP A HB3  3  
ATOM   1799  N  N    . LYS A 1 14 ? 10.533 13.403  -2.905  1.00 0.00 ? 14 LYS A N    3  
ATOM   1800  C  CA   . LYS A 1 14 ? 11.431 13.075  -3.996  1.00 0.00 ? 14 LYS A CA   3  
ATOM   1801  C  C    . LYS A 1 14 ? 11.406 11.558  -4.162  1.00 0.00 ? 14 LYS A C    3  
ATOM   1802  O  O    . LYS A 1 14 ? 12.265 10.852  -3.635  1.00 0.00 ? 14 LYS A O    3  
ATOM   1803  C  CB   . LYS A 1 14 ? 12.834 13.621  -3.696  1.00 0.00 ? 14 LYS A CB   3  
ATOM   1804  C  CG   . LYS A 1 14 ? 13.819 13.350  -4.840  1.00 0.00 ? 14 LYS A CG   3  
ATOM   1805  C  CD   . LYS A 1 14 ? 15.196 13.931  -4.492  1.00 0.00 ? 14 LYS A CD   3  
ATOM   1806  C  CE   . LYS A 1 14 ? 16.251 13.567  -5.542  1.00 0.00 ? 14 LYS A CE   3  
ATOM   1807  N  NZ   . LYS A 1 14 ? 15.968 14.179  -6.852  1.00 0.00 ? 14 LYS A NZ   3  
ATOM   1808  H  H    . LYS A 1 14 ? 10.320 12.674  -2.241  1.00 0.00 ? 14 LYS A H    3  
ATOM   1809  H  HA   . LYS A 1 14 ? 11.074 13.539  -4.915  1.00 0.00 ? 14 LYS A HA   3  
ATOM   1810  H  HB2  . LYS A 1 14 ? 12.771 14.702  -3.551  1.00 0.00 ? 14 LYS A HB2  3  
ATOM   1811  H  HB3  . LYS A 1 14 ? 13.200 13.166  -2.776  1.00 0.00 ? 14 LYS A HB3  3  
ATOM   1812  H  HG2  . LYS A 1 14 ? 13.921 12.276  -4.999  1.00 0.00 ? 14 LYS A HG2  3  
ATOM   1813  H  HG3  . LYS A 1 14 ? 13.437 13.810  -5.752  1.00 0.00 ? 14 LYS A HG3  3  
ATOM   1814  H  HD2  . LYS A 1 14 ? 15.124 15.016  -4.398  1.00 0.00 ? 14 LYS A HD2  3  
ATOM   1815  H  HD3  . LYS A 1 14 ? 15.516 13.522  -3.533  1.00 0.00 ? 14 LYS A HD3  3  
ATOM   1816  H  HE2  . LYS A 1 14 ? 17.223 13.920  -5.197  1.00 0.00 ? 14 LYS A HE2  3  
ATOM   1817  H  HE3  . LYS A 1 14 ? 16.293 12.482  -5.655  1.00 0.00 ? 14 LYS A HE3  3  
ATOM   1818  H  HZ1  . LYS A 1 14 ? 15.081 13.844  -7.201  1.00 0.00 ? 14 LYS A HZ1  3  
ATOM   1819  H  HZ2  . LYS A 1 14 ? 15.934 15.184  -6.756  1.00 0.00 ? 14 LYS A HZ2  3  
ATOM   1820  H  HZ3  . LYS A 1 14 ? 16.698 13.931  -7.505  1.00 0.00 ? 14 LYS A HZ3  3  
ATOM   1821  N  N    . LEU A 1 15 ? 10.397 11.052  -4.880  1.00 0.00 ? 15 LEU A N    3  
ATOM   1822  C  CA   . LEU A 1 15 ? 10.303 9.637   -5.195  1.00 0.00 ? 15 LEU A CA   3  
ATOM   1823  C  C    . LEU A 1 15 ? 11.385 9.268   -6.211  1.00 0.00 ? 15 LEU A C    3  
ATOM   1824  O  O    . LEU A 1 15 ? 11.733 10.063  -7.084  1.00 0.00 ? 15 LEU A O    3  
ATOM   1825  C  CB   . LEU A 1 15 ? 8.900  9.271   -5.701  1.00 0.00 ? 15 LEU A CB   3  
ATOM   1826  C  CG   . LEU A 1 15 ? 7.850  9.205   -4.576  1.00 0.00 ? 15 LEU A CG   3  
ATOM   1827  C  CD1  . LEU A 1 15 ? 7.477  10.585  -4.018  1.00 0.00 ? 15 LEU A CD1  3  
ATOM   1828  C  CD2  . LEU A 1 15 ? 6.583  8.527   -5.103  1.00 0.00 ? 15 LEU A CD2  3  
ATOM   1829  H  H    . LEU A 1 15 ? 9.711  11.676  -5.277  1.00 0.00 ? 15 LEU A H    3  
ATOM   1830  H  HA   . LEU A 1 15 ? 10.485 9.067   -4.282  1.00 0.00 ? 15 LEU A HA   3  
ATOM   1831  H  HB2  . LEU A 1 15 ? 8.584  9.972   -6.475  1.00 0.00 ? 15 LEU A HB2  3  
ATOM   1832  H  HB3  . LEU A 1 15 ? 8.966  8.273   -6.142  1.00 0.00 ? 15 LEU A HB3  3  
ATOM   1833  H  HG   . LEU A 1 15 ? 8.235  8.586   -3.764  1.00 0.00 ? 15 LEU A HG   3  
ATOM   1834  H  HD11 . LEU A 1 15 ? 7.250  11.272  -4.833  1.00 0.00 ? 15 LEU A HD11 3  
ATOM   1835  H  HD12 . LEU A 1 15 ? 6.598  10.494  -3.381  1.00 0.00 ? 15 LEU A HD12 3  
ATOM   1836  H  HD13 . LEU A 1 15 ? 8.289  10.989  -3.415  1.00 0.00 ? 15 LEU A HD13 3  
ATOM   1837  H  HD21 . LEU A 1 15 ? 6.822  7.527   -5.463  1.00 0.00 ? 15 LEU A HD21 3  
ATOM   1838  H  HD22 . LEU A 1 15 ? 5.850  8.445   -4.299  1.00 0.00 ? 15 LEU A HD22 3  
ATOM   1839  H  HD23 . LEU A 1 15 ? 6.158  9.110   -5.918  1.00 0.00 ? 15 LEU A HD23 3  
ATOM   1840  N  N    . ILE A 1 16 ? 11.919 8.054   -6.064  1.00 0.00 ? 16 ILE A N    3  
ATOM   1841  C  CA   . ILE A 1 16 ? 13.092 7.537   -6.744  1.00 0.00 ? 16 ILE A CA   3  
ATOM   1842  C  C    . ILE A 1 16 ? 12.705 6.215   -7.411  1.00 0.00 ? 16 ILE A C    3  
ATOM   1843  O  O    . ILE A 1 16 ? 12.502 5.200   -6.746  1.00 0.00 ? 16 ILE A O    3  
ATOM   1844  C  CB   . ILE A 1 16 ? 14.270 7.430   -5.752  1.00 0.00 ? 16 ILE A CB   3  
ATOM   1845  C  CG1  . ILE A 1 16 ? 15.444 6.653   -6.369  1.00 0.00 ? 16 ILE A CG1  3  
ATOM   1846  C  CG2  . ILE A 1 16 ? 13.884 6.817   -4.395  1.00 0.00 ? 16 ILE A CG2  3  
ATOM   1847  C  CD1  . ILE A 1 16 ? 16.783 7.052   -5.741  1.00 0.00 ? 16 ILE A CD1  3  
ATOM   1848  H  H    . ILE A 1 16 ? 11.512 7.449   -5.366  1.00 0.00 ? 16 ILE A H    3  
ATOM   1849  H  HA   . ILE A 1 16 ? 13.402 8.231   -7.527  1.00 0.00 ? 16 ILE A HA   3  
ATOM   1850  H  HB   . ILE A 1 16 ? 14.604 8.452   -5.559  1.00 0.00 ? 16 ILE A HB   3  
ATOM   1851  H  HG12 . ILE A 1 16 ? 15.278 5.581   -6.232  1.00 0.00 ? 16 ILE A HG12 3  
ATOM   1852  H  HG13 . ILE A 1 16 ? 15.503 6.869   -7.438  1.00 0.00 ? 16 ILE A HG13 3  
ATOM   1853  H  HG21 . ILE A 1 16 ? 14.746 6.797   -3.736  1.00 0.00 ? 16 ILE A HG21 3  
ATOM   1854  H  HG22 . ILE A 1 16 ? 13.120 7.417   -3.904  1.00 0.00 ? 16 ILE A HG22 3  
ATOM   1855  H  HG23 . ILE A 1 16 ? 13.530 5.795   -4.515  1.00 0.00 ? 16 ILE A HG23 3  
ATOM   1856  H  HD11 . ILE A 1 16 ? 17.019 8.084   -6.004  1.00 0.00 ? 16 ILE A HD11 3  
ATOM   1857  H  HD12 . ILE A 1 16 ? 16.759 6.962   -4.658  1.00 0.00 ? 16 ILE A HD12 3  
ATOM   1858  H  HD13 . ILE A 1 16 ? 17.566 6.398   -6.122  1.00 0.00 ? 16 ILE A HD13 3  
ATOM   1859  N  N    . LEU A 1 17 ? 12.575 6.241   -8.742  1.00 0.00 ? 17 LEU A N    3  
ATOM   1860  C  CA   . LEU A 1 17 ? 12.394 5.043   -9.541  1.00 0.00 ? 17 LEU A CA   3  
ATOM   1861  C  C    . LEU A 1 17 ? 13.710 4.268   -9.587  1.00 0.00 ? 17 LEU A C    3  
ATOM   1862  O  O    . LEU A 1 17 ? 14.768 4.853   -9.818  1.00 0.00 ? 17 LEU A O    3  
ATOM   1863  C  CB   . LEU A 1 17 ? 11.915 5.403   -10.954 1.00 0.00 ? 17 LEU A CB   3  
ATOM   1864  C  CG   . LEU A 1 17 ? 10.395 5.625   -11.040 1.00 0.00 ? 17 LEU A CG   3  
ATOM   1865  C  CD1  . LEU A 1 17 ? 9.916  6.822   -10.211 1.00 0.00 ? 17 LEU A CD1  3  
ATOM   1866  C  CD2  . LEU A 1 17 ? 10.003 5.838   -12.507 1.00 0.00 ? 17 LEU A CD2  3  
ATOM   1867  H  H    . LEU A 1 17 ? 12.724 7.108   -9.237  1.00 0.00 ? 17 LEU A H    3  
ATOM   1868  H  HA   . LEU A 1 17 ? 11.630 4.425   -9.078  1.00 0.00 ? 17 LEU A HA   3  
ATOM   1869  H  HB2  . LEU A 1 17 ? 12.449 6.286   -11.316 1.00 0.00 ? 17 LEU A HB2  3  
ATOM   1870  H  HB3  . LEU A 1 17 ? 12.157 4.563   -11.608 1.00 0.00 ? 17 LEU A HB3  3  
ATOM   1871  H  HG   . LEU A 1 17 ? 9.886  4.727   -10.685 1.00 0.00 ? 17 LEU A HG   3  
ATOM   1872  H  HD11 . LEU A 1 17 ? 10.033 6.621   -9.146  1.00 0.00 ? 17 LEU A HD11 3  
ATOM   1873  H  HD12 . LEU A 1 17 ? 10.481 7.714   -10.478 1.00 0.00 ? 17 LEU A HD12 3  
ATOM   1874  H  HD13 . LEU A 1 17 ? 8.857  7.001   -10.405 1.00 0.00 ? 17 LEU A HD13 3  
ATOM   1875  H  HD21 . LEU A 1 17 ? 10.322 4.983   -13.103 1.00 0.00 ? 17 LEU A HD21 3  
ATOM   1876  H  HD22 . LEU A 1 17 ? 8.921  5.938   -12.590 1.00 0.00 ? 17 LEU A HD22 3  
ATOM   1877  H  HD23 . LEU A 1 17 ? 10.477 6.740   -12.893 1.00 0.00 ? 17 LEU A HD23 3  
ATOM   1878  N  N    . CYS A 1 18 ? 13.636 2.949   -9.378  1.00 0.00 ? 18 CYS A N    3  
ATOM   1879  C  CA   . CYS A 1 18 ? 14.759 2.053   -9.602  1.00 0.00 ? 18 CYS A CA   3  
ATOM   1880  C  C    . CYS A 1 18 ? 15.039 1.946   -11.100 1.00 0.00 ? 18 CYS A C    3  
ATOM   1881  O  O    . CYS A 1 18 ? 14.119 1.726   -11.884 1.00 0.00 ? 18 CYS A O    3  
ATOM   1882  C  CB   . CYS A 1 18 ? 14.461 0.680   -8.997  1.00 0.00 ? 18 CYS A CB   3  
ATOM   1883  S  SG   . CYS A 1 18 ? 15.653 -0.595  -9.472  1.00 0.00 ? 18 CYS A SG   3  
ATOM   1884  H  H    . CYS A 1 18 ? 12.747 2.544   -9.113  1.00 0.00 ? 18 CYS A H    3  
ATOM   1885  H  HA   . CYS A 1 18 ? 15.639 2.448   -9.098  1.00 0.00 ? 18 CYS A HA   3  
ATOM   1886  H  HB2  . CYS A 1 18 ? 14.470 0.778   -7.912  1.00 0.00 ? 18 CYS A HB2  3  
ATOM   1887  H  HB3  . CYS A 1 18 ? 13.472 0.338   -9.303  1.00 0.00 ? 18 CYS A HB3  3  
ATOM   1888  N  N    . ASP A 1 19 ? 16.310 2.096   -11.490 1.00 0.00 ? 19 ASP A N    3  
ATOM   1889  C  CA   . ASP A 1 19 ? 16.729 2.104   -12.884 1.00 0.00 ? 19 ASP A CA   3  
ATOM   1890  C  C    . ASP A 1 19 ? 16.368 0.783   -13.564 1.00 0.00 ? 19 ASP A C    3  
ATOM   1891  O  O    . ASP A 1 19 ? 15.699 0.773   -14.595 1.00 0.00 ? 19 ASP A O    3  
ATOM   1892  C  CB   . ASP A 1 19 ? 18.235 2.386   -12.959 1.00 0.00 ? 19 ASP A CB   3  
ATOM   1893  C  CG   . ASP A 1 19 ? 18.720 2.417   -14.405 1.00 0.00 ? 19 ASP A CG   3  
ATOM   1894  O  OD1  . ASP A 1 19 ? 18.518 3.468   -15.049 1.00 0.00 ? 19 ASP A OD1  3  
ATOM   1895  O  OD2  . ASP A 1 19 ? 19.281 1.388   -14.840 1.00 0.00 ? 19 ASP A OD2  3  
ATOM   1896  H  H    . ASP A 1 19 ? 17.024 2.223   -10.784 1.00 0.00 ? 19 ASP A H    3  
ATOM   1897  H  HA   . ASP A 1 19 ? 16.204 2.909   -13.394 1.00 0.00 ? 19 ASP A HA   3  
ATOM   1898  H  HB2  . ASP A 1 19 ? 18.443 3.351   -12.497 1.00 0.00 ? 19 ASP A HB2  3  
ATOM   1899  H  HB3  . ASP A 1 19 ? 18.784 1.618   -12.412 1.00 0.00 ? 19 ASP A HB3  3  
ATOM   1900  N  N    . GLU A 1 20 ? 16.799 -0.324  -12.954 1.00 0.00 ? 20 GLU A N    3  
ATOM   1901  C  CA   . GLU A 1 20 ? 16.745 -1.656  -13.537 1.00 0.00 ? 20 GLU A CA   3  
ATOM   1902  C  C    . GLU A 1 20 ? 15.307 -2.090  -13.833 1.00 0.00 ? 20 GLU A C    3  
ATOM   1903  O  O    . GLU A 1 20 ? 15.009 -2.476  -14.962 1.00 0.00 ? 20 GLU A O    3  
ATOM   1904  C  CB   . GLU A 1 20 ? 17.435 -2.633  -12.578 1.00 0.00 ? 20 GLU A CB   3  
ATOM   1905  C  CG   . GLU A 1 20 ? 17.451 -4.083  -13.076 1.00 0.00 ? 20 GLU A CG   3  
ATOM   1906  C  CD   . GLU A 1 20 ? 18.026 -5.015  -12.013 1.00 0.00 ? 20 GLU A CD   3  
ATOM   1907  O  OE1  . GLU A 1 20 ? 19.128 -4.700  -11.516 1.00 0.00 ? 20 GLU A OE1  3  
ATOM   1908  O  OE2  . GLU A 1 20 ? 17.343 -6.014  -11.699 1.00 0.00 ? 20 GLU A OE2  3  
ATOM   1909  H  H    . GLU A 1 20 ? 17.336 -0.206  -12.105 1.00 0.00 ? 20 GLU A H    3  
ATOM   1910  H  HA   . GLU A 1 20 ? 17.307 -1.644  -14.472 1.00 0.00 ? 20 GLU A HA   3  
ATOM   1911  H  HB2  . GLU A 1 20 ? 18.470 -2.310  -12.459 1.00 0.00 ? 20 GLU A HB2  3  
ATOM   1912  H  HB3  . GLU A 1 20 ? 16.933 -2.601  -11.609 1.00 0.00 ? 20 GLU A HB3  3  
ATOM   1913  H  HG2  . GLU A 1 20 ? 16.440 -4.415  -13.312 1.00 0.00 ? 20 GLU A HG2  3  
ATOM   1914  H  HG3  . GLU A 1 20 ? 18.062 -4.150  -13.977 1.00 0.00 ? 20 GLU A HG3  3  
ATOM   1915  N  N    . CYS A 1 21 ? 14.428 -2.037  -12.822 1.00 0.00 ? 21 CYS A N    3  
ATOM   1916  C  CA   . CYS A 1 21 ? 13.094 -2.633  -12.883 1.00 0.00 ? 21 CYS A CA   3  
ATOM   1917  C  C    . CYS A 1 21 ? 11.948 -1.627  -12.712 1.00 0.00 ? 21 CYS A C    3  
ATOM   1918  O  O    . CYS A 1 21 ? 10.795 -2.051  -12.625 1.00 0.00 ? 21 CYS A O    3  
ATOM   1919  C  CB   . CYS A 1 21 ? 13.016 -3.792  -11.879 1.00 0.00 ? 21 CYS A CB   3  
ATOM   1920  S  SG   . CYS A 1 21 ? 13.405 -3.388  -10.156 1.00 0.00 ? 21 CYS A SG   3  
ATOM   1921  H  H    . CYS A 1 21 ? 14.719 -1.609  -11.953 1.00 0.00 ? 21 CYS A H    3  
ATOM   1922  H  HA   . CYS A 1 21 ? 12.934 -3.081  -13.865 1.00 0.00 ? 21 CYS A HA   3  
ATOM   1923  H  HB2  . CYS A 1 21 ? 12.014 -4.225  -11.910 1.00 0.00 ? 21 CYS A HB2  3  
ATOM   1924  H  HB3  . CYS A 1 21 ? 13.727 -4.558  -12.194 1.00 0.00 ? 21 CYS A HB3  3  
ATOM   1925  N  N    . ASN A 1 22 ? 12.235 -0.317  -12.688 1.00 0.00 ? 22 ASN A N    3  
ATOM   1926  C  CA   . ASN A 1 22 ? 11.234 0.746   -12.752 1.00 0.00 ? 22 ASN A CA   3  
ATOM   1927  C  C    . ASN A 1 22 ? 10.155 0.568   -11.678 1.00 0.00 ? 22 ASN A C    3  
ATOM   1928  O  O    . ASN A 1 22 ? 8.965  0.462   -11.972 1.00 0.00 ? 22 ASN A O    3  
ATOM   1929  C  CB   . ASN A 1 22 ? 10.685 0.857   -14.183 1.00 0.00 ? 22 ASN A CB   3  
ATOM   1930  C  CG   . ASN A 1 22 ? 10.054 2.222   -14.460 1.00 0.00 ? 22 ASN A CG   3  
ATOM   1931  O  OD1  . ASN A 1 22 ? 10.651 3.057   -15.134 1.00 0.00 ? 22 ASN A OD1  3  
ATOM   1932  N  ND2  . ASN A 1 22 ? 8.840  2.453   -13.958 1.00 0.00 ? 22 ASN A ND2  3  
ATOM   1933  H  H    . ASN A 1 22 ? 13.203 -0.023  -12.689 1.00 0.00 ? 22 ASN A H    3  
ATOM   1934  H  HA   . ASN A 1 22 ? 11.740 1.687   -12.543 1.00 0.00 ? 22 ASN A HA   3  
ATOM   1935  H  HB2  . ASN A 1 22 ? 11.519 0.738   -14.880 1.00 0.00 ? 22 ASN A HB2  3  
ATOM   1936  H  HB3  . ASN A 1 22 ? 9.962  0.062   -14.373 1.00 0.00 ? 22 ASN A HB3  3  
ATOM   1937  H  HD21 . ASN A 1 22 ? 8.404  1.749   -13.376 1.00 0.00 ? 22 ASN A HD21 3  
ATOM   1938  H  HD22 . ASN A 1 22 ? 8.383  3.336   -14.144 1.00 0.00 ? 22 ASN A HD22 3  
ATOM   1939  N  N    . LYS A 1 23 ? 10.595 0.517   -10.416 1.00 0.00 ? 23 LYS A N    3  
ATOM   1940  C  CA   . LYS A 1 23 ? 9.747  0.507   -9.243  1.00 0.00 ? 23 LYS A CA   3  
ATOM   1941  C  C    . LYS A 1 23 ? 9.896  1.850   -8.533  1.00 0.00 ? 23 LYS A C    3  
ATOM   1942  O  O    . LYS A 1 23 ? 11.009 2.226   -8.172  1.00 0.00 ? 23 LYS A O    3  
ATOM   1943  C  CB   . LYS A 1 23 ? 10.182 -0.645  -8.336  1.00 0.00 ? 23 LYS A CB   3  
ATOM   1944  C  CG   . LYS A 1 23 ? 9.927  -2.016  -8.977  1.00 0.00 ? 23 LYS A CG   3  
ATOM   1945  C  CD   . LYS A 1 23 ? 10.337 -3.138  -8.017  1.00 0.00 ? 23 LYS A CD   3  
ATOM   1946  C  CE   . LYS A 1 23 ? 10.086 -4.511  -8.650  1.00 0.00 ? 23 LYS A CE   3  
ATOM   1947  N  NZ   . LYS A 1 23 ? 10.558 -5.603  -7.780  1.00 0.00 ? 23 LYS A NZ   3  
ATOM   1948  H  H    . LYS A 1 23 ? 11.585 0.533   -10.235 1.00 0.00 ? 23 LYS A H    3  
ATOM   1949  H  HA   . LYS A 1 23 ? 8.701  0.359   -9.509  1.00 0.00 ? 23 LYS A HA   3  
ATOM   1950  H  HB2  . LYS A 1 23 ? 11.246 -0.547  -8.106  1.00 0.00 ? 23 LYS A HB2  3  
ATOM   1951  H  HB3  . LYS A 1 23 ? 9.608  -0.566  -7.419  1.00 0.00 ? 23 LYS A HB3  3  
ATOM   1952  H  HG2  . LYS A 1 23 ? 8.869  -2.117  -9.217  1.00 0.00 ? 23 LYS A HG2  3  
ATOM   1953  H  HG3  . LYS A 1 23 ? 10.507 -2.105  -9.895  1.00 0.00 ? 23 LYS A HG3  3  
ATOM   1954  H  HD2  . LYS A 1 23 ? 11.398 -3.035  -7.782  1.00 0.00 ? 23 LYS A HD2  3  
ATOM   1955  H  HD3  . LYS A 1 23 ? 9.760  -3.056  -7.095  1.00 0.00 ? 23 LYS A HD3  3  
ATOM   1956  H  HE2  . LYS A 1 23 ? 9.017  -4.638  -8.826  1.00 0.00 ? 23 LYS A HE2  3  
ATOM   1957  H  HE3  . LYS A 1 23 ? 10.610 -4.576  -9.604  1.00 0.00 ? 23 LYS A HE3  3  
ATOM   1958  H  HZ1  . LYS A 1 23 ? 11.552 -5.507  -7.621  1.00 0.00 ? 23 LYS A HZ1  3  
ATOM   1959  H  HZ2  . LYS A 1 23 ? 10.073 -5.571  -6.894  1.00 0.00 ? 23 LYS A HZ2  3  
ATOM   1960  H  HZ3  . LYS A 1 23 ? 10.378 -6.492  -8.225  1.00 0.00 ? 23 LYS A HZ3  3  
ATOM   1961  N  N    . ALA A 1 24 ? 8.779  2.563   -8.341  1.00 0.00 ? 24 ALA A N    3  
ATOM   1962  C  CA   . ALA A 1 24 ? 8.732  3.788   -7.557  1.00 0.00 ? 24 ALA A CA   3  
ATOM   1963  C  C    . ALA A 1 24 ? 8.898  3.459   -6.075  1.00 0.00 ? 24 ALA A C    3  
ATOM   1964  O  O    . ALA A 1 24 ? 7.967  2.975   -5.435  1.00 0.00 ? 24 ALA A O    3  
ATOM   1965  C  CB   . ALA A 1 24 ? 7.419  4.529   -7.828  1.00 0.00 ? 24 ALA A CB   3  
ATOM   1966  H  H    . ALA A 1 24 ? 7.902  2.202   -8.685  1.00 0.00 ? 24 ALA A H    3  
ATOM   1967  H  HA   . ALA A 1 24 ? 9.542  4.447   -7.874  1.00 0.00 ? 24 ALA A HA   3  
ATOM   1968  H  HB1  . ALA A 1 24 ? 6.565  3.909   -7.555  1.00 0.00 ? 24 ALA A HB1  3  
ATOM   1969  H  HB2  . ALA A 1 24 ? 7.392  5.450   -7.244  1.00 0.00 ? 24 ALA A HB2  3  
ATOM   1970  H  HB3  . ALA A 1 24 ? 7.352  4.781   -8.887  1.00 0.00 ? 24 ALA A HB3  3  
ATOM   1971  N  N    . PHE A 1 25 ? 10.097 3.707   -5.544  1.00 0.00 ? 25 PHE A N    3  
ATOM   1972  C  CA   . PHE A 1 25 ? 10.403 3.667   -4.122  1.00 0.00 ? 25 PHE A CA   3  
ATOM   1973  C  C    . PHE A 1 25 ? 10.575 5.102   -3.618  1.00 0.00 ? 25 PHE A C    3  
ATOM   1974  O  O    . PHE A 1 25 ? 10.931 5.981   -4.396  1.00 0.00 ? 25 PHE A O    3  
ATOM   1975  C  CB   . PHE A 1 25 ? 11.733 2.915   -3.926  1.00 0.00 ? 25 PHE A CB   3  
ATOM   1976  C  CG   . PHE A 1 25 ? 11.649 1.399   -3.842  1.00 0.00 ? 25 PHE A CG   3  
ATOM   1977  C  CD1  . PHE A 1 25 ? 11.314 0.630   -4.971  1.00 0.00 ? 25 PHE A CD1  3  
ATOM   1978  C  CD2  . PHE A 1 25 ? 12.003 0.745   -2.648  1.00 0.00 ? 25 PHE A CD2  3  
ATOM   1979  C  CE1  . PHE A 1 25 ? 11.284 -0.774  -4.888  1.00 0.00 ? 25 PHE A CE1  3  
ATOM   1980  C  CE2  . PHE A 1 25 ? 11.971 -0.657  -2.560  1.00 0.00 ? 25 PHE A CE2  3  
ATOM   1981  C  CZ   . PHE A 1 25 ? 11.594 -1.419  -3.678  1.00 0.00 ? 25 PHE A CZ   3  
ATOM   1982  H  H    . PHE A 1 25 ? 10.819 4.085   -6.145  1.00 0.00 ? 25 PHE A H    3  
ATOM   1983  H  HA   . PHE A 1 25 ? 9.618  3.172   -3.547  1.00 0.00 ? 25 PHE A HA   3  
ATOM   1984  H  HB2  . PHE A 1 25 ? 12.417 3.179   -4.737  1.00 0.00 ? 25 PHE A HB2  3  
ATOM   1985  H  HB3  . PHE A 1 25 ? 12.183 3.273   -2.998  1.00 0.00 ? 25 PHE A HB3  3  
ATOM   1986  H  HD1  . PHE A 1 25 ? 11.086 1.115   -5.906  1.00 0.00 ? 25 PHE A HD1  3  
ATOM   1987  H  HD2  . PHE A 1 25 ? 12.287 1.318   -1.786  1.00 0.00 ? 25 PHE A HD2  3  
ATOM   1988  H  HE1  . PHE A 1 25 ? 11.039 -1.367  -5.753  1.00 0.00 ? 25 PHE A HE1  3  
ATOM   1989  H  HE2  . PHE A 1 25 ? 12.221 -1.146  -1.629  1.00 0.00 ? 25 PHE A HE2  3  
ATOM   1990  H  HZ   . PHE A 1 25 ? 11.562 -2.496  -3.613  1.00 0.00 ? 25 PHE A HZ   3  
ATOM   1991  N  N    . HIS A 1 26 ? 10.283 5.362   -2.339  1.00 0.00 ? 26 HIS A N    3  
ATOM   1992  C  CA   . HIS A 1 26 ? 10.680 6.613   -1.703  1.00 0.00 ? 26 HIS A CA   3  
ATOM   1993  C  C    . HIS A 1 26 ? 12.124 6.420   -1.237  1.00 0.00 ? 26 HIS A C    3  
ATOM   1994  O  O    . HIS A 1 26 ? 12.615 5.294   -1.145  1.00 0.00 ? 26 HIS A O    3  
ATOM   1995  C  CB   . HIS A 1 26 ? 9.830  6.938   -0.467  1.00 0.00 ? 26 HIS A CB   3  
ATOM   1996  C  CG   . HIS A 1 26 ? 8.455  7.488   -0.725  1.00 0.00 ? 26 HIS A CG   3  
ATOM   1997  N  ND1  . HIS A 1 26 ? 7.265  6.765   -0.639  1.00 0.00 ? 26 HIS A ND1  3  
ATOM   1998  C  CD2  . HIS A 1 26 ? 8.172  8.813   -0.897  1.00 0.00 ? 26 HIS A CD2  3  
ATOM   1999  C  CE1  . HIS A 1 26 ? 6.288  7.679   -0.756  1.00 0.00 ? 26 HIS A CE1  3  
ATOM   2000  N  NE2  . HIS A 1 26 ? 6.803  8.910   -0.927  1.00 0.00 ? 26 HIS A NE2  3  
ATOM   2001  H  H    . HIS A 1 26 ? 9.862  4.646   -1.768  1.00 0.00 ? 26 HIS A H    3  
ATOM   2002  H  HA   . HIS A 1 26 ? 10.627 7.452   -2.399  1.00 0.00 ? 26 HIS A HA   3  
ATOM   2003  H  HB2  . HIS A 1 26 ? 9.757  6.066   0.174   1.00 0.00 ? 26 HIS A HB2  3  
ATOM   2004  H  HB3  . HIS A 1 26 ? 10.349 7.708   0.103   1.00 0.00 ? 26 HIS A HB3  3  
ATOM   2005  H  HD2  . HIS A 1 26 ? 8.879  9.629   -0.942  1.00 0.00 ? 26 HIS A HD2  3  
ATOM   2006  H  HE1  . HIS A 1 26 ? 5.232  7.457   -0.732  1.00 0.00 ? 26 HIS A HE1  3  
ATOM   2007  H  HE2  . HIS A 1 26 ? 6.278  9.770   -1.030  1.00 0.00 ? 26 HIS A HE2  3  
ATOM   2008  N  N    . LEU A 1 27 ? 12.789 7.524   -0.892  1.00 0.00 ? 27 LEU A N    3  
ATOM   2009  C  CA   . LEU A 1 27 ? 14.076 7.501   -0.212  1.00 0.00 ? 27 LEU A CA   3  
ATOM   2010  C  C    . LEU A 1 27 ? 13.962 6.682   1.083   1.00 0.00 ? 27 LEU A C    3  
ATOM   2011  O  O    . LEU A 1 27 ? 14.850 5.898   1.411   1.00 0.00 ? 27 LEU A O    3  
ATOM   2012  C  CB   . LEU A 1 27 ? 14.515 8.946   0.065   1.00 0.00 ? 27 LEU A CB   3  
ATOM   2013  C  CG   . LEU A 1 27 ? 14.729 9.757   -1.226  1.00 0.00 ? 27 LEU A CG   3  
ATOM   2014  C  CD1  . LEU A 1 27 ? 14.914 11.241  -0.897  1.00 0.00 ? 27 LEU A CD1  3  
ATOM   2015  C  CD2  . LEU A 1 27 ? 15.965 9.267   -1.986  1.00 0.00 ? 27 LEU A CD2  3  
ATOM   2016  H  H    . LEU A 1 27 ? 12.346 8.422   -1.025  1.00 0.00 ? 27 LEU A H    3  
ATOM   2017  H  HA   . LEU A 1 27 ? 14.814 7.016   -0.848  1.00 0.00 ? 27 LEU A HA   3  
ATOM   2018  H  HB2  . LEU A 1 27 ? 13.735 9.423   0.660   1.00 0.00 ? 27 LEU A HB2  3  
ATOM   2019  H  HB3  . LEU A 1 27 ? 15.442 8.945   0.641   1.00 0.00 ? 27 LEU A HB3  3  
ATOM   2020  H  HG   . LEU A 1 27 ? 13.859 9.672   -1.874  1.00 0.00 ? 27 LEU A HG   3  
ATOM   2021  H  HD11 . LEU A 1 27 ? 14.062 11.606  -0.321  1.00 0.00 ? 27 LEU A HD11 3  
ATOM   2022  H  HD12 . LEU A 1 27 ? 15.829 11.386  -0.326  1.00 0.00 ? 27 LEU A HD12 3  
ATOM   2023  H  HD13 . LEU A 1 27 ? 14.984 11.812  -1.821  1.00 0.00 ? 27 LEU A HD13 3  
ATOM   2024  H  HD21 . LEU A 1 27 ? 16.179 9.939   -2.818  1.00 0.00 ? 27 LEU A HD21 3  
ATOM   2025  H  HD22 . LEU A 1 27 ? 16.816 9.239   -1.308  1.00 0.00 ? 27 LEU A HD22 3  
ATOM   2026  H  HD23 . LEU A 1 27 ? 15.804 8.269   -2.386  1.00 0.00 ? 27 LEU A HD23 3  
ATOM   2027  N  N    . PHE A 1 28 ? 12.823 6.824   1.773   1.00 0.00 ? 28 PHE A N    3  
ATOM   2028  C  CA   . PHE A 1 28 ? 12.439 6.032   2.934   1.00 0.00 ? 28 PHE A CA   3  
ATOM   2029  C  C    . PHE A 1 28 ? 12.398 4.537   2.596   1.00 0.00 ? 28 PHE A C    3  
ATOM   2030  O  O    . PHE A 1 28 ? 13.017 3.730   3.287   1.00 0.00 ? 28 PHE A O    3  
ATOM   2031  C  CB   . PHE A 1 28 ? 11.077 6.510   3.475   1.00 0.00 ? 28 PHE A CB   3  
ATOM   2032  C  CG   . PHE A 1 28 ? 10.805 8.002   3.360   1.00 0.00 ? 28 PHE A CG   3  
ATOM   2033  C  CD1  . PHE A 1 28 ? 11.772 8.937   3.780   1.00 0.00 ? 28 PHE A CD1  3  
ATOM   2034  C  CD2  . PHE A 1 28 ? 9.639  8.454   2.708   1.00 0.00 ? 28 PHE A CD2  3  
ATOM   2035  C  CE1  . PHE A 1 28 ? 11.604 10.303  3.495   1.00 0.00 ? 28 PHE A CE1  3  
ATOM   2036  C  CE2  . PHE A 1 28 ? 9.470  9.820   2.426   1.00 0.00 ? 28 PHE A CE2  3  
ATOM   2037  C  CZ   . PHE A 1 28 ? 10.459 10.744  2.806   1.00 0.00 ? 28 PHE A CZ   3  
ATOM   2038  H  H    . PHE A 1 28 ? 12.169 7.526   1.458   1.00 0.00 ? 28 PHE A H    3  
ATOM   2039  H  HA   . PHE A 1 28 ? 13.188 6.201   3.708   1.00 0.00 ? 28 PHE A HA   3  
ATOM   2040  H  HB2  . PHE A 1 28 ? 10.288 5.985   2.936   1.00 0.00 ? 28 PHE A HB2  3  
ATOM   2041  H  HB3  . PHE A 1 28 ? 11.000 6.220   4.524   1.00 0.00 ? 28 PHE A HB3  3  
ATOM   2042  H  HD1  . PHE A 1 28 ? 12.663 8.605   4.291   1.00 0.00 ? 28 PHE A HD1  3  
ATOM   2043  H  HD2  . PHE A 1 28 ? 8.876  7.755   2.399   1.00 0.00 ? 28 PHE A HD2  3  
ATOM   2044  H  HE1  . PHE A 1 28 ? 12.359 11.015  3.794   1.00 0.00 ? 28 PHE A HE1  3  
ATOM   2045  H  HE2  . PHE A 1 28 ? 8.585  10.158  1.908   1.00 0.00 ? 28 PHE A HE2  3  
ATOM   2046  H  HZ   . PHE A 1 28 ? 10.336 11.792  2.572   1.00 0.00 ? 28 PHE A HZ   3  
ATOM   2047  N  N    . CYS A 1 29 ? 11.655 4.174   1.539   1.00 0.00 ? 29 CYS A N    3  
ATOM   2048  C  CA   . CYS A 1 29 ? 11.328 2.792   1.201   1.00 0.00 ? 29 CYS A CA   3  
ATOM   2049  C  C    . CYS A 1 29 ? 12.566 2.030   0.729   1.00 0.00 ? 29 CYS A C    3  
ATOM   2050  O  O    . CYS A 1 29 ? 12.650 0.824   0.956   1.00 0.00 ? 29 CYS A O    3  
ATOM   2051  C  CB   . CYS A 1 29 ? 10.225 2.743   0.133   1.00 0.00 ? 29 CYS A CB   3  
ATOM   2052  S  SG   . CYS A 1 29 ? 8.695  3.608   0.580   1.00 0.00 ? 29 CYS A SG   3  
ATOM   2053  H  H    . CYS A 1 29 ? 11.269 4.900   0.953   1.00 0.00 ? 29 CYS A H    3  
ATOM   2054  H  HA   . CYS A 1 29 ? 10.944 2.302   2.098   1.00 0.00 ? 29 CYS A HA   3  
ATOM   2055  H  HB2  . CYS A 1 29 ? 10.625 3.184   -0.778  1.00 0.00 ? 29 CYS A HB2  3  
ATOM   2056  H  HB3  . CYS A 1 29 ? 9.959  1.706   -0.087  1.00 0.00 ? 29 CYS A HB3  3  
ATOM   2057  N  N    . LEU A 1 30 ? 13.512 2.710   0.060   1.00 0.00 ? 30 LEU A N    3  
ATOM   2058  C  CA   . LEU A 1 30 ? 14.818 2.137   -0.244  1.00 0.00 ? 30 LEU A CA   3  
ATOM   2059  C  C    . LEU A 1 30 ? 15.473 1.650   1.046   1.00 0.00 ? 30 LEU A C    3  
ATOM   2060  O  O    . LEU A 1 30 ? 15.668 0.452   1.236   1.00 0.00 ? 30 LEU A O    3  
ATOM   2061  C  CB   . LEU A 1 30 ? 15.732 3.155   -0.945  1.00 0.00 ? 30 LEU A CB   3  
ATOM   2062  C  CG   . LEU A 1 30 ? 15.364 3.494   -2.397  1.00 0.00 ? 30 LEU A CG   3  
ATOM   2063  C  CD1  . LEU A 1 30 ? 16.336 4.564   -2.902  1.00 0.00 ? 30 LEU A CD1  3  
ATOM   2064  C  CD2  . LEU A 1 30 ? 15.467 2.282   -3.327  1.00 0.00 ? 30 LEU A CD2  3  
ATOM   2065  H  H    . LEU A 1 30 ? 13.354 3.685   -0.169  1.00 0.00 ? 30 LEU A H    3  
ATOM   2066  H  HA   . LEU A 1 30 ? 14.689 1.272   -0.883  1.00 0.00 ? 30 LEU A HA   3  
ATOM   2067  H  HB2  . LEU A 1 30 ? 15.727 4.079   -0.368  1.00 0.00 ? 30 LEU A HB2  3  
ATOM   2068  H  HB3  . LEU A 1 30 ? 16.747 2.755   -0.953  1.00 0.00 ? 30 LEU A HB3  3  
ATOM   2069  H  HG   . LEU A 1 30 ? 14.354 3.893   -2.433  1.00 0.00 ? 30 LEU A HG   3  
ATOM   2070  H  HD11 . LEU A 1 30 ? 16.247 5.467   -2.298  1.00 0.00 ? 30 LEU A HD11 3  
ATOM   2071  H  HD12 . LEU A 1 30 ? 17.363 4.198   -2.844  1.00 0.00 ? 30 LEU A HD12 3  
ATOM   2072  H  HD13 . LEU A 1 30 ? 16.107 4.801   -3.939  1.00 0.00 ? 30 LEU A HD13 3  
ATOM   2073  H  HD21 . LEU A 1 30 ? 16.470 1.861   -3.255  1.00 0.00 ? 30 LEU A HD21 3  
ATOM   2074  H  HD22 . LEU A 1 30 ? 14.731 1.526   -3.068  1.00 0.00 ? 30 LEU A HD22 3  
ATOM   2075  H  HD23 . LEU A 1 30 ? 15.286 2.592   -4.358  1.00 0.00 ? 30 LEU A HD23 3  
ATOM   2076  N  N    . ARG A 1 31 ? 15.815 2.600   1.918   1.00 0.00 ? 31 ARG A N    3  
ATOM   2077  C  CA   . ARG A 1 31 ? 16.520 2.352   3.161   1.00 0.00 ? 31 ARG A CA   3  
ATOM   2078  C  C    . ARG A 1 31 ? 16.485 3.660   3.953   1.00 0.00 ? 31 ARG A C    3  
ATOM   2079  O  O    . ARG A 1 31 ? 16.966 4.668   3.442   1.00 0.00 ? 31 ARG A O    3  
ATOM   2080  C  CB   . ARG A 1 31 ? 17.960 1.903   2.854   1.00 0.00 ? 31 ARG A CB   3  
ATOM   2081  C  CG   . ARG A 1 31 ? 18.704 1.429   4.108   1.00 0.00 ? 31 ARG A CG   3  
ATOM   2082  C  CD   . ARG A 1 31 ? 20.030 0.754   3.733   1.00 0.00 ? 31 ARG A CD   3  
ATOM   2083  N  NE   . ARG A 1 31 ? 19.800 -0.519  3.031   1.00 0.00 ? 31 ARG A NE   3  
ATOM   2084  C  CZ   . ARG A 1 31 ? 20.756 -1.294  2.489   1.00 0.00 ? 31 ARG A CZ   3  
ATOM   2085  N  NH1  . ARG A 1 31 ? 22.046 -0.940  2.561   1.00 0.00 ? 31 ARG A NH1  3  
ATOM   2086  N  NH2  . ARG A 1 31 ? 20.412 -2.434  1.873   1.00 0.00 ? 31 ARG A NH2  3  
ATOM   2087  H  H    . ARG A 1 31 ? 15.580 3.556   1.693   1.00 0.00 ? 31 ARG A H    3  
ATOM   2088  H  HA   . ARG A 1 31 ? 15.998 1.552   3.686   1.00 0.00 ? 31 ARG A HA   3  
ATOM   2089  H  HB2  . ARG A 1 31 ? 17.930 1.076   2.147   1.00 0.00 ? 31 ARG A HB2  3  
ATOM   2090  H  HB3  . ARG A 1 31 ? 18.514 2.721   2.390   1.00 0.00 ? 31 ARG A HB3  3  
ATOM   2091  H  HG2  . ARG A 1 31 ? 18.900 2.284   4.754   1.00 0.00 ? 31 ARG A HG2  3  
ATOM   2092  H  HG3  . ARG A 1 31 ? 18.092 0.708   4.650   1.00 0.00 ? 31 ARG A HG3  3  
ATOM   2093  H  HD2  . ARG A 1 31 ? 20.610 1.432   3.106   1.00 0.00 ? 31 ARG A HD2  3  
ATOM   2094  H  HD3  . ARG A 1 31 ? 20.588 0.554   4.650   1.00 0.00 ? 31 ARG A HD3  3  
ATOM   2095  H  HE   . ARG A 1 31 ? 18.840 -0.823  2.957   1.00 0.00 ? 31 ARG A HE   3  
ATOM   2096  H  HH11 . ARG A 1 31 ? 22.310 -0.083  3.027   1.00 0.00 ? 31 ARG A HH11 3  
ATOM   2097  H  HH12 . ARG A 1 31 ? 22.760 -1.524  2.151   1.00 0.00 ? 31 ARG A HH12 3  
ATOM   2098  H  HH21 . ARG A 1 31 ? 19.443 -2.714  1.820   1.00 0.00 ? 31 ARG A HH21 3  
ATOM   2099  H  HH22 . ARG A 1 31 ? 21.115 -3.035  1.467   1.00 0.00 ? 31 ARG A HH22 3  
ATOM   2100  N  N    . PRO A 1 32 ? 15.921 3.679   5.173   1.00 0.00 ? 32 PRO A N    3  
ATOM   2101  C  CA   . PRO A 1 32 ? 15.649 4.911   5.900   1.00 0.00 ? 32 PRO A CA   3  
ATOM   2102  C  C    . PRO A 1 32 ? 16.924 5.722   6.154   1.00 0.00 ? 32 PRO A C    3  
ATOM   2103  O  O    . PRO A 1 32 ? 16.877 6.948   6.104   1.00 0.00 ? 32 PRO A O    3  
ATOM   2104  C  CB   . PRO A 1 32 ? 14.975 4.479   7.206   1.00 0.00 ? 32 PRO A CB   3  
ATOM   2105  C  CG   . PRO A 1 32 ? 15.540 3.079   7.444   1.00 0.00 ? 32 PRO A CG   3  
ATOM   2106  C  CD   . PRO A 1 32 ? 15.689 2.526   6.027   1.00 0.00 ? 32 PRO A CD   3  
ATOM   2107  H  HA   . PRO A 1 32 ? 14.953 5.529   5.331   1.00 0.00 ? 32 PRO A HA   3  
ATOM   2108  H  HB2  . PRO A 1 32 ? 15.183 5.159   8.034   1.00 0.00 ? 32 PRO A HB2  3  
ATOM   2109  H  HB3  . PRO A 1 32 ? 13.899 4.403   7.043   1.00 0.00 ? 32 PRO A HB3  3  
ATOM   2110  H  HG2  . PRO A 1 32 ? 16.521 3.158   7.914   1.00 0.00 ? 32 PRO A HG2  3  
ATOM   2111  H  HG3  . PRO A 1 32 ? 14.879 2.467   8.059   1.00 0.00 ? 32 PRO A HG3  3  
ATOM   2112  H  HD2  . PRO A 1 32 ? 16.511 1.811   5.996   1.00 0.00 ? 32 PRO A HD2  3  
ATOM   2113  H  HD3  . PRO A 1 32 ? 14.758 2.043   5.724   1.00 0.00 ? 32 PRO A HD3  3  
ATOM   2114  N  N    . ALA A 1 33 ? 18.056 5.043   6.385   1.00 0.00 ? 33 ALA A N    3  
ATOM   2115  C  CA   . ALA A 1 33 ? 19.382 5.648   6.474   1.00 0.00 ? 33 ALA A CA   3  
ATOM   2116  C  C    . ALA A 1 33 ? 19.669 6.611   5.320   1.00 0.00 ? 33 ALA A C    3  
ATOM   2117  O  O    . ALA A 1 33 ? 20.218 7.689   5.541   1.00 0.00 ? 33 ALA A O    3  
ATOM   2118  C  CB   . ALA A 1 33 ? 20.444 4.547   6.533   1.00 0.00 ? 33 ALA A CB   3  
ATOM   2119  H  H    . ALA A 1 33 ? 18.006 4.037   6.450   1.00 0.00 ? 33 ALA A H    3  
ATOM   2120  H  HA   . ALA A 1 33 ? 19.424 6.212   7.403   1.00 0.00 ? 33 ALA A HA   3  
ATOM   2121  H  HB1  . ALA A 1 33 ? 20.242 3.880   7.371   1.00 0.00 ? 33 ALA A HB1  3  
ATOM   2122  H  HB2  . ALA A 1 33 ? 20.441 3.972   5.607   1.00 0.00 ? 33 ALA A HB2  3  
ATOM   2123  H  HB3  . ALA A 1 33 ? 21.428 4.997   6.667   1.00 0.00 ? 33 ALA A HB3  3  
ATOM   2124  N  N    . LEU A 1 34 ? 19.296 6.222   4.096   1.00 0.00 ? 34 LEU A N    3  
ATOM   2125  C  CA   . LEU A 1 34 ? 19.305 7.109   2.941   1.00 0.00 ? 34 LEU A CA   3  
ATOM   2126  C  C    . LEU A 1 34 ? 18.091 8.038   3.010   1.00 0.00 ? 34 LEU A C    3  
ATOM   2127  O  O    . LEU A 1 34 ? 17.132 7.881   2.256   1.00 0.00 ? 34 LEU A O    3  
ATOM   2128  C  CB   . LEU A 1 34 ? 19.359 6.314   1.629   1.00 0.00 ? 34 LEU A CB   3  
ATOM   2129  C  CG   . LEU A 1 34 ? 20.772 5.857   1.232   1.00 0.00 ? 34 LEU A CG   3  
ATOM   2130  C  CD1  . LEU A 1 34 ? 21.689 7.020   0.827   1.00 0.00 ? 34 LEU A CD1  3  
ATOM   2131  C  CD2  . LEU A 1 34 ? 21.447 4.979   2.293   1.00 0.00 ? 34 LEU A CD2  3  
ATOM   2132  H  H    . LEU A 1 34 ? 18.797 5.348   4.009   1.00 0.00 ? 34 LEU A H    3  
ATOM   2133  H  HA   . LEU A 1 34 ? 20.198 7.726   2.954   1.00 0.00 ? 34 LEU A HA   3  
ATOM   2134  H  HB2  . LEU A 1 34 ? 18.701 5.447   1.693   1.00 0.00 ? 34 LEU A HB2  3  
ATOM   2135  H  HB3  . LEU A 1 34 ? 18.998 6.944   0.813   1.00 0.00 ? 34 LEU A HB3  3  
ATOM   2136  H  HG   . LEU A 1 34 ? 20.636 5.249   0.344   1.00 0.00 ? 34 LEU A HG   3  
ATOM   2137  H  HD11 . LEU A 1 34 ? 21.985 7.613   1.693   1.00 0.00 ? 34 LEU A HD11 3  
ATOM   2138  H  HD12 . LEU A 1 34 ? 22.591 6.622   0.361   1.00 0.00 ? 34 LEU A HD12 3  
ATOM   2139  H  HD13 . LEU A 1 34 ? 21.182 7.663   0.108   1.00 0.00 ? 34 LEU A HD13 3  
ATOM   2140  H  HD21 . LEU A 1 34 ? 21.716 5.572   3.166   1.00 0.00 ? 34 LEU A HD21 3  
ATOM   2141  H  HD22 . LEU A 1 34 ? 20.775 4.174   2.590   1.00 0.00 ? 34 LEU A HD22 3  
ATOM   2142  H  HD23 . LEU A 1 34 ? 22.355 4.543   1.876   1.00 0.00 ? 34 LEU A HD23 3  
ATOM   2143  N  N    . TYR A 1 35 ? 18.143 9.006   3.931   1.00 0.00 ? 35 TYR A N    3  
ATOM   2144  C  CA   . TYR A 1 35 ? 17.198 10.112  3.980   1.00 0.00 ? 35 TYR A CA   3  
ATOM   2145  C  C    . TYR A 1 35 ? 17.471 11.019  2.780   1.00 0.00 ? 35 TYR A C    3  
ATOM   2146  O  O    . TYR A 1 35 ? 16.546 11.451  2.097   1.00 0.00 ? 35 TYR A O    3  
ATOM   2147  C  CB   . TYR A 1 35 ? 17.359 10.891  5.292   1.00 0.00 ? 35 TYR A CB   3  
ATOM   2148  C  CG   . TYR A 1 35 ? 17.061 10.083  6.539   1.00 0.00 ? 35 TYR A CG   3  
ATOM   2149  C  CD1  . TYR A 1 35 ? 15.727 9.812   6.896   1.00 0.00 ? 35 TYR A CD1  3  
ATOM   2150  C  CD2  . TYR A 1 35 ? 18.112 9.590   7.335   1.00 0.00 ? 35 TYR A CD2  3  
ATOM   2151  C  CE1  . TYR A 1 35 ? 15.444 9.049   8.043   1.00 0.00 ? 35 TYR A CE1  3  
ATOM   2152  C  CE2  . TYR A 1 35 ? 17.829 8.824   8.479   1.00 0.00 ? 35 TYR A CE2  3  
ATOM   2153  C  CZ   . TYR A 1 35 ? 16.496 8.546   8.828   1.00 0.00 ? 35 TYR A CZ   3  
ATOM   2154  O  OH   . TYR A 1 35 ? 16.226 7.787   9.930   1.00 0.00 ? 35 TYR A OH   3  
ATOM   2155  H  H    . TYR A 1 35 ? 18.916 9.010   4.582   1.00 0.00 ? 35 TYR A H    3  
ATOM   2156  H  HA   . TYR A 1 35 ? 16.180 9.729   3.915   1.00 0.00 ? 35 TYR A HA   3  
ATOM   2157  H  HB2  . TYR A 1 35 ? 18.380 11.278  5.352   1.00 0.00 ? 35 TYR A HB2  3  
ATOM   2158  H  HB3  . TYR A 1 35 ? 16.674 11.742  5.269   1.00 0.00 ? 35 TYR A HB3  3  
ATOM   2159  H  HD1  . TYR A 1 35 ? 14.916 10.184  6.286   1.00 0.00 ? 35 TYR A HD1  3  
ATOM   2160  H  HD2  . TYR A 1 35 ? 19.139 9.792   7.068   1.00 0.00 ? 35 TYR A HD2  3  
ATOM   2161  H  HE1  . TYR A 1 35 ? 14.418 8.839   8.307   1.00 0.00 ? 35 TYR A HE1  3  
ATOM   2162  H  HE2  . TYR A 1 35 ? 18.638 8.439   9.082   1.00 0.00 ? 35 TYR A HE2  3  
ATOM   2163  H  HH   . TYR A 1 35 ? 15.287 7.667   10.084  1.00 0.00 ? 35 TYR A HH   3  
ATOM   2164  N  N    . GLU A 1 36 ? 18.759 11.289  2.544   1.00 0.00 ? 36 GLU A N    3  
ATOM   2165  C  CA   . GLU A 1 36 ? 19.277 11.939  1.351   1.00 0.00 ? 36 GLU A CA   3  
ATOM   2166  C  C    . GLU A 1 36 ? 19.236 10.991  0.146   1.00 0.00 ? 36 GLU A C    3  
ATOM   2167  O  O    . GLU A 1 36 ? 19.076 9.781   0.299   1.00 0.00 ? 36 GLU A O    3  
ATOM   2168  C  CB   . GLU A 1 36 ? 20.704 12.435  1.630   1.00 0.00 ? 36 GLU A CB   3  
ATOM   2169  C  CG   . GLU A 1 36 ? 21.700 11.293  1.889   1.00 0.00 ? 36 GLU A CG   3  
ATOM   2170  C  CD   . GLU A 1 36 ? 23.059 11.838  2.317   1.00 0.00 ? 36 GLU A CD   3  
ATOM   2171  O  OE1  . GLU A 1 36 ? 23.686 12.522  1.480   1.00 0.00 ? 36 GLU A OE1  3  
ATOM   2172  O  OE2  . GLU A 1 36 ? 23.443 11.567  3.476   1.00 0.00 ? 36 GLU A OE2  3  
ATOM   2173  H  H    . GLU A 1 36 ? 19.432 10.922  3.197   1.00 0.00 ? 36 GLU A H    3  
ATOM   2174  H  HA   . GLU A 1 36 ? 18.654 12.808  1.134   1.00 0.00 ? 36 GLU A HA   3  
ATOM   2175  H  HB2  . GLU A 1 36 ? 21.056 13.019  0.778   1.00 0.00 ? 36 GLU A HB2  3  
ATOM   2176  H  HB3  . GLU A 1 36 ? 20.682 13.087  2.505   1.00 0.00 ? 36 GLU A HB3  3  
ATOM   2177  H  HG2  . GLU A 1 36 ? 21.332 10.633  2.673   1.00 0.00 ? 36 GLU A HG2  3  
ATOM   2178  H  HG3  . GLU A 1 36 ? 21.836 10.706  0.980   1.00 0.00 ? 36 GLU A HG3  3  
ATOM   2179  N  N    . VAL A 1 37 ? 19.391 11.556  -1.057  1.00 0.00 ? 37 VAL A N    3  
ATOM   2180  C  CA   . VAL A 1 37 ? 19.444 10.803  -2.304  1.00 0.00 ? 37 VAL A CA   3  
ATOM   2181  C  C    . VAL A 1 37 ? 20.784 10.062  -2.426  1.00 0.00 ? 37 VAL A C    3  
ATOM   2182  O  O    . VAL A 1 37 ? 21.809 10.601  -2.009  1.00 0.00 ? 37 VAL A O    3  
ATOM   2183  C  CB   . VAL A 1 37 ? 19.171 11.748  -3.492  1.00 0.00 ? 37 VAL A CB   3  
ATOM   2184  C  CG1  . VAL A 1 37 ? 20.292 12.774  -3.712  1.00 0.00 ? 37 VAL A CG1  3  
ATOM   2185  C  CG2  . VAL A 1 37 ? 18.935 10.968  -4.791  1.00 0.00 ? 37 VAL A CG2  3  
ATOM   2186  H  H    . VAL A 1 37 ? 19.534 12.553  -1.104  1.00 0.00 ? 37 VAL A H    3  
ATOM   2187  H  HA   . VAL A 1 37 ? 18.627 10.091  -2.269  1.00 0.00 ? 37 VAL A HA   3  
ATOM   2188  H  HB   . VAL A 1 37 ? 18.253 12.297  -3.272  1.00 0.00 ? 37 VAL A HB   3  
ATOM   2189  H  HG11 . VAL A 1 37 ? 19.989 13.477  -4.488  1.00 0.00 ? 37 VAL A HG11 3  
ATOM   2190  H  HG12 . VAL A 1 37 ? 20.486 13.333  -2.797  1.00 0.00 ? 37 VAL A HG12 3  
ATOM   2191  H  HG13 . VAL A 1 37 ? 21.209 12.279  -4.031  1.00 0.00 ? 37 VAL A HG13 3  
ATOM   2192  H  HG21 . VAL A 1 37 ? 19.825 10.405  -5.069  1.00 0.00 ? 37 VAL A HG21 3  
ATOM   2193  H  HG22 . VAL A 1 37 ? 18.097 10.282  -4.666  1.00 0.00 ? 37 VAL A HG22 3  
ATOM   2194  H  HG23 . VAL A 1 37 ? 18.699 11.663  -5.595  1.00 0.00 ? 37 VAL A HG23 3  
ATOM   2195  N  N    . PRO A 1 38 ? 20.801 8.833   -2.974  1.00 0.00 ? 38 PRO A N    3  
ATOM   2196  C  CA   . PRO A 1 38 ? 22.039 8.156   -3.336  1.00 0.00 ? 38 PRO A CA   3  
ATOM   2197  C  C    . PRO A 1 38 ? 22.509 8.676   -4.694  1.00 0.00 ? 38 PRO A C    3  
ATOM   2198  O  O    . PRO A 1 38 ? 21.785 8.574   -5.684  1.00 0.00 ? 38 PRO A O    3  
ATOM   2199  C  CB   . PRO A 1 38 ? 21.704 6.663   -3.376  1.00 0.00 ? 38 PRO A CB   3  
ATOM   2200  C  CG   . PRO A 1 38 ? 20.209 6.636   -3.681  1.00 0.00 ? 38 PRO A CG   3  
ATOM   2201  C  CD   . PRO A 1 38 ? 19.689 7.893   -2.985  1.00 0.00 ? 38 PRO A CD   3  
ATOM   2202  H  HA   . PRO A 1 38 ? 22.813 8.319   -2.585  1.00 0.00 ? 38 PRO A HA   3  
ATOM   2203  H  HB2  . PRO A 1 38 ? 22.289 6.118   -4.119  1.00 0.00 ? 38 PRO A HB2  3  
ATOM   2204  H  HB3  . PRO A 1 38 ? 21.870 6.236   -2.385  1.00 0.00 ? 38 PRO A HB3  3  
ATOM   2205  H  HG2  . PRO A 1 38 ? 20.055 6.726   -4.756  1.00 0.00 ? 38 PRO A HG2  3  
ATOM   2206  H  HG3  . PRO A 1 38 ? 19.726 5.730   -3.310  1.00 0.00 ? 38 PRO A HG3  3  
ATOM   2207  H  HD2  . PRO A 1 38 ? 18.829 8.273   -3.535  1.00 0.00 ? 38 PRO A HD2  3  
ATOM   2208  H  HD3  . PRO A 1 38 ? 19.408 7.658   -1.957  1.00 0.00 ? 38 PRO A HD3  3  
ATOM   2209  N  N    . ASP A 1 39 ? 23.718 9.243   -4.744  1.00 0.00 ? 39 ASP A N    3  
ATOM   2210  C  CA   . ASP A 1 39 ? 24.232 9.974   -5.895  1.00 0.00 ? 39 ASP A CA   3  
ATOM   2211  C  C    . ASP A 1 39 ? 24.895 9.024   -6.901  1.00 0.00 ? 39 ASP A C    3  
ATOM   2212  O  O    . ASP A 1 39 ? 26.036 9.236   -7.309  1.00 0.00 ? 39 ASP A O    3  
ATOM   2213  C  CB   . ASP A 1 39 ? 25.168 11.098  -5.412  1.00 0.00 ? 39 ASP A CB   3  
ATOM   2214  C  CG   . ASP A 1 39 ? 26.405 10.594  -4.664  1.00 0.00 ? 39 ASP A CG   3  
ATOM   2215  O  OD1  . ASP A 1 39 ? 26.218 9.832   -3.689  1.00 0.00 ? 39 ASP A OD1  3  
ATOM   2216  O  OD2  . ASP A 1 39 ? 27.517 10.997  -5.068  1.00 0.00 ? 39 ASP A OD2  3  
ATOM   2217  H  H    . ASP A 1 39 ? 24.307 9.237   -3.920  1.00 0.00 ? 39 ASP A H    3  
ATOM   2218  H  HA   . ASP A 1 39 ? 23.399 10.461  -6.405  1.00 0.00 ? 39 ASP A HA   3  
ATOM   2219  H  HB2  . ASP A 1 39 ? 25.487 11.684  -6.275  1.00 0.00 ? 39 ASP A HB2  3  
ATOM   2220  H  HB3  . ASP A 1 39 ? 24.612 11.756  -4.744  1.00 0.00 ? 39 ASP A HB3  3  
ATOM   2221  N  N    . GLY A 1 40 ? 24.163 7.989   -7.330  1.00 0.00 ? 40 GLY A N    3  
ATOM   2222  C  CA   . GLY A 1 40 ? 24.584 7.141   -8.434  1.00 0.00 ? 40 GLY A CA   3  
ATOM   2223  C  C    . GLY A 1 40 ? 23.594 6.002   -8.657  1.00 0.00 ? 40 GLY A C    3  
ATOM   2224  O  O    . GLY A 1 40 ? 22.638 6.151   -9.416  1.00 0.00 ? 40 GLY A O    3  
ATOM   2225  H  H    . GLY A 1 40 ? 23.244 7.843   -6.934  1.00 0.00 ? 40 GLY A H    3  
ATOM   2226  H  HA2  . GLY A 1 40 ? 24.640 7.743   -9.342  1.00 0.00 ? 40 GLY A HA2  3  
ATOM   2227  H  HA3  . GLY A 1 40 ? 25.572 6.728   -8.228  1.00 0.00 ? 40 GLY A HA3  3  
ATOM   2228  N  N    . GLU A 1 41 ? 23.831 4.867   -7.990  1.00 0.00 ? 41 GLU A N    3  
ATOM   2229  C  CA   . GLU A 1 41 ? 23.135 3.613   -8.238  1.00 0.00 ? 41 GLU A CA   3  
ATOM   2230  C  C    . GLU A 1 41 ? 21.739 3.662   -7.618  1.00 0.00 ? 41 GLU A C    3  
ATOM   2231  O  O    . GLU A 1 41 ? 21.537 3.227   -6.485  1.00 0.00 ? 41 GLU A O    3  
ATOM   2232  C  CB   . GLU A 1 41 ? 23.955 2.431   -7.693  1.00 0.00 ? 41 GLU A CB   3  
ATOM   2233  C  CG   . GLU A 1 41 ? 25.259 2.183   -8.470  1.00 0.00 ? 41 GLU A CG   3  
ATOM   2234  C  CD   . GLU A 1 41 ? 26.289 3.302   -8.325  1.00 0.00 ? 41 GLU A CD   3  
ATOM   2235  O  OE1  . GLU A 1 41 ? 26.416 3.822   -7.195  1.00 0.00 ? 41 GLU A OE1  3  
ATOM   2236  O  OE2  . GLU A 1 41 ? 26.920 3.631   -9.353  1.00 0.00 ? 41 GLU A OE2  3  
ATOM   2237  H  H    . GLU A 1 41 ? 24.636 4.827   -7.377  1.00 0.00 ? 41 GLU A H    3  
ATOM   2238  H  HA   . GLU A 1 41 ? 23.030 3.468   -9.316  1.00 0.00 ? 41 GLU A HA   3  
ATOM   2239  H  HB2  . GLU A 1 41 ? 24.177 2.585   -6.635  1.00 0.00 ? 41 GLU A HB2  3  
ATOM   2240  H  HB3  . GLU A 1 41 ? 23.348 1.528   -7.783  1.00 0.00 ? 41 GLU A HB3  3  
ATOM   2241  H  HG2  . GLU A 1 41 ? 25.713 1.263   -8.098  1.00 0.00 ? 41 GLU A HG2  3  
ATOM   2242  H  HG3  . GLU A 1 41 ? 25.022 2.043   -9.525  1.00 0.00 ? 41 GLU A HG3  3  
ATOM   2243  N  N    . TRP A 1 42 ? 20.770 4.174   -8.385  1.00 0.00 ? 42 TRP A N    3  
ATOM   2244  C  CA   . TRP A 1 42 ? 19.355 4.119   -8.053  1.00 0.00 ? 42 TRP A CA   3  
ATOM   2245  C  C    . TRP A 1 42 ? 18.846 2.695   -8.279  1.00 0.00 ? 42 TRP A C    3  
ATOM   2246  O  O    . TRP A 1 42 ? 18.222 2.401   -9.297  1.00 0.00 ? 42 TRP A O    3  
ATOM   2247  C  CB   . TRP A 1 42 ? 18.588 5.162   -8.881  1.00 0.00 ? 42 TRP A CB   3  
ATOM   2248  C  CG   . TRP A 1 42 ? 18.854 6.607   -8.565  1.00 0.00 ? 42 TRP A CG   3  
ATOM   2249  C  CD1  . TRP A 1 42 ? 19.848 7.090   -7.783  1.00 0.00 ? 42 TRP A CD1  3  
ATOM   2250  C  CD2  . TRP A 1 42 ? 18.085 7.777   -8.983  1.00 0.00 ? 42 TRP A CD2  3  
ATOM   2251  N  NE1  . TRP A 1 42 ? 19.747 8.459   -7.688  1.00 0.00 ? 42 TRP A NE1  3  
ATOM   2252  C  CE2  . TRP A 1 42 ? 18.675 8.941   -8.407  1.00 0.00 ? 42 TRP A CE2  3  
ATOM   2253  C  CE3  . TRP A 1 42 ? 16.938 7.973   -9.784  1.00 0.00 ? 42 TRP A CE3  3  
ATOM   2254  C  CZ2  . TRP A 1 42 ? 18.159 10.229  -8.614  1.00 0.00 ? 42 TRP A CZ2  3  
ATOM   2255  C  CZ3  . TRP A 1 42 ? 16.410 9.260   -9.997  1.00 0.00 ? 42 TRP A CZ3  3  
ATOM   2256  C  CH2  . TRP A 1 42 ? 17.018 10.386  -9.416  1.00 0.00 ? 42 TRP A CH2  3  
ATOM   2257  H  H    . TRP A 1 42 ? 21.033 4.610   -9.258  1.00 0.00 ? 42 TRP A H    3  
ATOM   2258  H  HA   . TRP A 1 42 ? 19.213 4.367   -6.999  1.00 0.00 ? 42 TRP A HA   3  
ATOM   2259  H  HB2  . TRP A 1 42 ? 18.799 5.001   -9.941  1.00 0.00 ? 42 TRP A HB2  3  
ATOM   2260  H  HB3  . TRP A 1 42 ? 17.520 4.998   -8.714  1.00 0.00 ? 42 TRP A HB3  3  
ATOM   2261  H  HD1  . TRP A 1 42 ? 20.604 6.509   -7.277  1.00 0.00 ? 42 TRP A HD1  3  
ATOM   2262  H  HE1  . TRP A 1 42 ? 20.396 9.004   -7.134  1.00 0.00 ? 42 TRP A HE1  3  
ATOM   2263  H  HE3  . TRP A 1 42 ? 16.458 7.119   -10.240 1.00 0.00 ? 42 TRP A HE3  3  
ATOM   2264  H  HZ2  . TRP A 1 42 ? 18.636 11.087  -8.164  1.00 0.00 ? 42 TRP A HZ2  3  
ATOM   2265  H  HZ3  . TRP A 1 42 ? 15.533 9.383   -10.616 1.00 0.00 ? 42 TRP A HZ3  3  
ATOM   2266  H  HH2  . TRP A 1 42 ? 16.610 11.372  -9.590  1.00 0.00 ? 42 TRP A HH2  3  
ATOM   2267  N  N    . GLN A 1 43 ? 19.141 1.816   -7.315  1.00 0.00 ? 43 GLN A N    3  
ATOM   2268  C  CA   . GLN A 1 43 ? 18.818 0.400   -7.332  1.00 0.00 ? 43 GLN A CA   3  
ATOM   2269  C  C    . GLN A 1 43 ? 18.159 0.037   -6.004  1.00 0.00 ? 43 GLN A C    3  
ATOM   2270  O  O    . GLN A 1 43 ? 18.619 0.467   -4.946  1.00 0.00 ? 43 GLN A O    3  
ATOM   2271  C  CB   . GLN A 1 43 ? 20.101 -0.416  -7.542  1.00 0.00 ? 43 GLN A CB   3  
ATOM   2272  C  CG   . GLN A 1 43 ? 20.607 -0.323  -8.988  1.00 0.00 ? 43 GLN A CG   3  
ATOM   2273  C  CD   . GLN A 1 43 ? 19.704 -1.099  -9.945  1.00 0.00 ? 43 GLN A CD   3  
ATOM   2274  O  OE1  . GLN A 1 43 ? 18.870 -0.516  -10.636 1.00 0.00 ? 43 GLN A OE1  3  
ATOM   2275  N  NE2  . GLN A 1 43 ? 19.879 -2.422  -9.976  1.00 0.00 ? 43 GLN A NE2  3  
ATOM   2276  H  H    . GLN A 1 43 ? 19.684 2.147   -6.529  1.00 0.00 ? 43 GLN A H    3  
ATOM   2277  H  HA   . GLN A 1 43 ? 18.115 0.184   -8.134  1.00 0.00 ? 43 GLN A HA   3  
ATOM   2278  H  HB2  . GLN A 1 43 ? 20.876 -0.046  -6.868  1.00 0.00 ? 43 GLN A HB2  3  
ATOM   2279  H  HB3  . GLN A 1 43 ? 19.913 -1.464  -7.303  1.00 0.00 ? 43 GLN A HB3  3  
ATOM   2280  H  HG2  . GLN A 1 43 ? 20.669 0.720   -9.301  1.00 0.00 ? 43 GLN A HG2  3  
ATOM   2281  H  HG3  . GLN A 1 43 ? 21.610 -0.749  -9.034  1.00 0.00 ? 43 GLN A HG3  3  
ATOM   2282  H  HE21 . GLN A 1 43 ? 20.574 -2.846  -9.378  1.00 0.00 ? 43 GLN A HE21 3  
ATOM   2283  H  HE22 . GLN A 1 43 ? 19.347 -3.004  -10.619 1.00 0.00 ? 43 GLN A HE22 3  
ATOM   2284  N  N    . CYS A 1 44 ? 17.074 -0.742  -6.068  1.00 0.00 ? 44 CYS A N    3  
ATOM   2285  C  CA   . CYS A 1 44 ? 16.211 -1.008  -4.926  1.00 0.00 ? 44 CYS A CA   3  
ATOM   2286  C  C    . CYS A 1 44 ? 16.646 -2.283  -4.191  1.00 0.00 ? 44 CYS A C    3  
ATOM   2287  O  O    . CYS A 1 44 ? 17.418 -3.070  -4.737  1.00 0.00 ? 44 CYS A O    3  
ATOM   2288  C  CB   . CYS A 1 44 ? 14.752 -1.057  -5.387  1.00 0.00 ? 44 CYS A CB   3  
ATOM   2289  S  SG   . CYS A 1 44 ? 14.325 -2.357  -6.571  1.00 0.00 ? 44 CYS A SG   3  
ATOM   2290  H  H    . CYS A 1 44 ? 16.812 -1.138  -6.958  1.00 0.00 ? 44 CYS A H    3  
ATOM   2291  H  HA   . CYS A 1 44 ? 16.293 -0.168  -4.241  1.00 0.00 ? 44 CYS A HA   3  
ATOM   2292  H  HB2  . CYS A 1 44 ? 14.116 -1.200  -4.520  1.00 0.00 ? 44 CYS A HB2  3  
ATOM   2293  H  HB3  . CYS A 1 44 ? 14.499 -0.094  -5.830  1.00 0.00 ? 44 CYS A HB3  3  
ATOM   2294  N  N    . PRO A 1 45 ? 16.152 -2.504  -2.961  1.00 0.00 ? 45 PRO A N    3  
ATOM   2295  C  CA   . PRO A 1 45 ? 16.301 -3.754  -2.226  1.00 0.00 ? 45 PRO A CA   3  
ATOM   2296  C  C    . PRO A 1 45 ? 15.943 -5.031  -2.987  1.00 0.00 ? 45 PRO A C    3  
ATOM   2297  O  O    . PRO A 1 45 ? 16.474 -6.089  -2.660  1.00 0.00 ? 45 PRO A O    3  
ATOM   2298  C  CB   . PRO A 1 45 ? 15.445 -3.586  -0.974  1.00 0.00 ? 45 PRO A CB   3  
ATOM   2299  C  CG   . PRO A 1 45 ? 15.636 -2.106  -0.660  1.00 0.00 ? 45 PRO A CG   3  
ATOM   2300  C  CD   . PRO A 1 45 ? 15.720 -1.457  -2.044  1.00 0.00 ? 45 PRO A CD   3  
ATOM   2301  H  HA   . PRO A 1 45 ? 17.340 -3.820  -1.908  1.00 0.00 ? 45 PRO A HA   3  
ATOM   2302  H  HB2  . PRO A 1 45 ? 14.398 -3.775  -1.216  1.00 0.00 ? 45 PRO A HB2  3  
ATOM   2303  H  HB3  . PRO A 1 45 ? 15.772 -4.231  -0.158  1.00 0.00 ? 45 PRO A HB3  3  
ATOM   2304  H  HG2  . PRO A 1 45 ? 14.811 -1.707  -0.066  1.00 0.00 ? 45 PRO A HG2  3  
ATOM   2305  H  HG3  . PRO A 1 45 ? 16.583 -1.970  -0.135  1.00 0.00 ? 45 PRO A HG3  3  
ATOM   2306  H  HD2  . PRO A 1 45 ? 14.732 -1.100  -2.330  1.00 0.00 ? 45 PRO A HD2  3  
ATOM   2307  H  HD3  . PRO A 1 45 ? 16.429 -0.628  -2.010  1.00 0.00 ? 45 PRO A HD3  3  
ATOM   2308  N  N    . ALA A 1 46 ? 15.044 -4.967  -3.978  1.00 0.00 ? 46 ALA A N    3  
ATOM   2309  C  CA   . ALA A 1 46 ? 14.705 -6.134  -4.780  1.00 0.00 ? 46 ALA A CA   3  
ATOM   2310  C  C    . ALA A 1 46 ? 15.903 -6.549  -5.632  1.00 0.00 ? 46 ALA A C    3  
ATOM   2311  O  O    . ALA A 1 46 ? 16.149 -7.742  -5.804  1.00 0.00 ? 46 ALA A O    3  
ATOM   2312  C  CB   . ALA A 1 46 ? 13.478 -5.850  -5.650  1.00 0.00 ? 46 ALA A CB   3  
ATOM   2313  H  H    . ALA A 1 46 ? 14.725 -4.071  -4.307  1.00 0.00 ? 46 ALA A H    3  
ATOM   2314  H  HA   . ALA A 1 46 ? 14.447 -6.956  -4.109  1.00 0.00 ? 46 ALA A HA   3  
ATOM   2315  H  HB1  . ALA A 1 46 ? 12.655 -5.499  -5.027  1.00 0.00 ? 46 ALA A HB1  3  
ATOM   2316  H  HB2  . ALA A 1 46 ? 13.712 -5.100  -6.403  1.00 0.00 ? 46 ALA A HB2  3  
ATOM   2317  H  HB3  . ALA A 1 46 ? 13.176 -6.769  -6.155  1.00 0.00 ? 46 ALA A HB3  3  
ATOM   2318  N  N    . CYS A 1 47 ? 16.652 -5.566  -6.152  1.00 0.00 ? 47 CYS A N    3  
ATOM   2319  C  CA   . CYS A 1 47 ? 17.877 -5.812  -6.882  1.00 0.00 ? 47 CYS A CA   3  
ATOM   2320  C  C    . CYS A 1 47 ? 19.011 -6.186  -5.926  1.00 0.00 ? 47 CYS A C    3  
ATOM   2321  O  O    . CYS A 1 47 ? 19.661 -7.214  -6.108  1.00 0.00 ? 47 CYS A O    3  
ATOM   2322  C  CB   . CYS A 1 47 ? 18.251 -4.582  -7.710  1.00 0.00 ? 47 CYS A CB   3  
ATOM   2323  S  SG   . CYS A 1 47 ? 16.963 -3.946  -8.812  1.00 0.00 ? 47 CYS A SG   3  
ATOM   2324  H  H    . CYS A 1 47 ? 16.431 -4.600  -5.961  1.00 0.00 ? 47 CYS A H    3  
ATOM   2325  H  HA   . CYS A 1 47 ? 17.690 -6.630  -7.572  1.00 0.00 ? 47 CYS A HA   3  
ATOM   2326  H  HB2  . CYS A 1 47 ? 18.550 -3.769  -7.051  1.00 0.00 ? 47 CYS A HB2  3  
ATOM   2327  H  HB3  . CYS A 1 47 ? 19.101 -4.858  -8.329  1.00 0.00 ? 47 CYS A HB3  3  
ATOM   2328  N  N    . GLN A 1 48 ? 19.238 -5.342  -4.911  1.00 0.00 ? 48 GLN A N    3  
ATOM   2329  C  CA   . GLN A 1 48 ? 20.391 -5.391  -4.025  1.00 0.00 ? 48 GLN A CA   3  
ATOM   2330  C  C    . GLN A 1 48 ? 19.910 -5.345  -2.567  1.00 0.00 ? 48 GLN A C    3  
ATOM   2331  O  O    . GLN A 1 48 ? 19.936 -4.279  -1.951  1.00 0.00 ? 48 GLN A O    3  
ATOM   2332  C  CB   . GLN A 1 48 ? 21.313 -4.214  -4.378  1.00 0.00 ? 48 GLN A CB   3  
ATOM   2333  C  CG   . GLN A 1 48 ? 22.660 -4.292  -3.648  1.00 0.00 ? 48 GLN A CG   3  
ATOM   2334  C  CD   . GLN A 1 48 ? 23.568 -3.106  -3.973  1.00 0.00 ? 48 GLN A CD   3  
ATOM   2335  O  OE1  . GLN A 1 48 ? 23.173 -2.172  -4.667  1.00 0.00 ? 48 GLN A OE1  3  
ATOM   2336  N  NE2  . GLN A 1 48 ? 24.799 -3.138  -3.460  1.00 0.00 ? 48 GLN A NE2  3  
ATOM   2337  H  H    . GLN A 1 48 ? 18.615 -4.553  -4.802  1.00 0.00 ? 48 GLN A H    3  
ATOM   2338  H  HA   . GLN A 1 48 ? 20.973 -6.296  -4.192  1.00 0.00 ? 48 GLN A HA   3  
ATOM   2339  H  HB2  . GLN A 1 48 ? 21.510 -4.240  -5.454  1.00 0.00 ? 48 GLN A HB2  3  
ATOM   2340  H  HB3  . GLN A 1 48 ? 20.809 -3.275  -4.138  1.00 0.00 ? 48 GLN A HB3  3  
ATOM   2341  H  HG2  . GLN A 1 48 ? 22.503 -4.317  -2.570  1.00 0.00 ? 48 GLN A HG2  3  
ATOM   2342  H  HG3  . GLN A 1 48 ? 23.168 -5.209  -3.948  1.00 0.00 ? 48 GLN A HG3  3  
ATOM   2343  H  HE21 . GLN A 1 48 ? 25.087 -3.943  -2.908  1.00 0.00 ? 48 GLN A HE21 3  
ATOM   2344  H  HE22 . GLN A 1 48 ? 25.439 -2.377  -3.639  1.00 0.00 ? 48 GLN A HE22 3  
ATOM   2345  N  N    . PRO A 1 49 ? 19.464 -6.478  -1.997  1.00 0.00 ? 49 PRO A N    3  
ATOM   2346  C  CA   . PRO A 1 49 ? 18.923 -6.521  -0.646  1.00 0.00 ? 49 PRO A CA   3  
ATOM   2347  C  C    . PRO A 1 49 ? 20.038 -6.331  0.384   1.00 0.00 ? 49 PRO A C    3  
ATOM   2348  O  O    . PRO A 1 49 ? 19.973 -5.424  1.213   1.00 0.00 ? 49 PRO A O    3  
ATOM   2349  C  CB   . PRO A 1 49 ? 18.226 -7.880  -0.517  1.00 0.00 ? 49 PRO A CB   3  
ATOM   2350  C  CG   . PRO A 1 49 ? 18.903 -8.757  -1.571  1.00 0.00 ? 49 PRO A CG   3  
ATOM   2351  C  CD   . PRO A 1 49 ? 19.324 -7.767  -2.657  1.00 0.00 ? 49 PRO A CD   3  
ATOM   2352  H  HA   . PRO A 1 49 ? 18.181 -5.733  -0.508  1.00 0.00 ? 49 PRO A HA   3  
ATOM   2353  H  HB2  . PRO A 1 49 ? 18.313 -8.304  0.485   1.00 0.00 ? 49 PRO A HB2  3  
ATOM   2354  H  HB3  . PRO A 1 49 ? 17.173 -7.770  -0.779  1.00 0.00 ? 49 PRO A HB3  3  
ATOM   2355  H  HG2  . PRO A 1 49 ? 19.786 -9.234  -1.145  1.00 0.00 ? 49 PRO A HG2  3  
ATOM   2356  H  HG3  . PRO A 1 49 ? 18.228 -9.522  -1.958  1.00 0.00 ? 49 PRO A HG3  3  
ATOM   2357  H  HD2  . PRO A 1 49 ? 20.256 -8.105  -3.111  1.00 0.00 ? 49 PRO A HD2  3  
ATOM   2358  H  HD3  . PRO A 1 49 ? 18.542 -7.706  -3.414  1.00 0.00 ? 49 PRO A HD3  3  
ATOM   2359  N  N    . ALA A 1 50 ? 21.056 -7.195  0.323   1.00 0.00 ? 50 ALA A N    3  
ATOM   2360  C  CA   . ALA A 1 50 ? 22.178 -7.231  1.245   1.00 0.00 ? 50 ALA A CA   3  
ATOM   2361  C  C    . ALA A 1 50 ? 23.334 -7.917  0.522   1.00 0.00 ? 50 ALA A C    3  
ATOM   2362  O  O    . ALA A 1 50 ? 23.719 -9.036  0.862   1.00 0.00 ? 50 ALA A O    3  
ATOM   2363  C  CB   . ALA A 1 50 ? 21.771 -7.963  2.529   1.00 0.00 ? 50 ALA A CB   3  
ATOM   2364  H  H    . ALA A 1 50 ? 21.063 -7.872  -0.425  1.00 0.00 ? 50 ALA A H    3  
ATOM   2365  H  HA   . ALA A 1 50 ? 22.484 -6.215  1.503   1.00 0.00 ? 50 ALA A HA   3  
ATOM   2366  H  HB1  . ALA A 1 50 ? 20.964 -7.421  3.024   1.00 0.00 ? 50 ALA A HB1  3  
ATOM   2367  H  HB2  . ALA A 1 50 ? 21.428 -8.973  2.295   1.00 0.00 ? 50 ALA A HB2  3  
ATOM   2368  H  HB3  . ALA A 1 50 ? 22.623 -8.021  3.206   1.00 0.00 ? 50 ALA A HB3  3  
ATOM   2369  N  N    . THR A 1 51 ? 23.852 -7.242  -0.509  1.00 0.00 ? 51 THR A N    3  
ATOM   2370  C  CA   . THR A 1 51 ? 24.801 -7.788  -1.466  1.00 0.00 ? 51 THR A CA   3  
ATOM   2371  C  C    . THR A 1 51 ? 25.755 -6.670  -1.885  1.00 0.00 ? 51 THR A C    3  
ATOM   2372  O  O    . THR A 1 51 ? 26.962 -6.965  -2.020  1.00 0.00 ? 51 THR A O    3  
ATOM   2373  C  CB   . THR A 1 51 ? 24.033 -8.357  -2.671  1.00 0.00 ? 51 THR A CB   3  
ATOM   2374  O  OG1  . THR A 1 51 ? 23.059 -9.284  -2.234  1.00 0.00 ? 51 THR A OG1  3  
ATOM   2375  C  CG2  . THR A 1 51 ? 24.968 -9.057  -3.663  1.00 0.00 ? 51 THR A CG2  3  
ATOM   2376  O  OXT  . THR A 1 51 ? 25.259 -5.535  -2.061  1.00 0.00 ? 51 THR A OXT  3  
ATOM   2377  H  H    . THR A 1 51 ? 23.534 -6.300  -0.686  1.00 0.00 ? 51 THR A H    3  
ATOM   2378  H  HA   . THR A 1 51 ? 25.384 -8.586  -1.002  1.00 0.00 ? 51 THR A HA   3  
ATOM   2379  H  HB   . THR A 1 51 ? 23.520 -7.545  -3.189  1.00 0.00 ? 51 THR A HB   3  
ATOM   2380  H  HG1  . THR A 1 51 ? 23.490 -9.938  -1.678  1.00 0.00 ? 51 THR A HG1  3  
ATOM   2381  H  HG21 . THR A 1 51 ? 25.678 -8.343  -4.081  1.00 0.00 ? 51 THR A HG21 3  
ATOM   2382  H  HG22 . THR A 1 51 ? 25.515 -9.855  -3.161  1.00 0.00 ? 51 THR A HG22 3  
ATOM   2383  H  HG23 . THR A 1 51 ? 24.382 -9.484  -4.477  1.00 0.00 ? 51 THR A HG23 3  
HETATM 2384  ZN ZN   . ZN  B 2 .  ? 6.931  4.700   -0.418  1.00 0.00 ? 52 ZN  A ZN   3  
HETATM 2385  ZN ZN   . ZN  C 2 .  ? 15.053 -2.676  -8.721  1.00 0.00 ? 53 ZN  A ZN   3  
ATOM   2386  N  N    . ALA A 1 1  ? 4.601  10.720  -5.820  1.00 0.00 ? 1  ALA A N    4  
ATOM   2387  C  CA   . ALA A 1 1  ? 3.502  10.035  -6.524  1.00 0.00 ? 1  ALA A CA   4  
ATOM   2388  C  C    . ALA A 1 1  ? 3.149  8.719   -5.827  1.00 0.00 ? 1  ALA A C    4  
ATOM   2389  O  O    . ALA A 1 1  ? 3.736  8.392   -4.797  1.00 0.00 ? 1  ALA A O    4  
ATOM   2390  C  CB   . ALA A 1 1  ? 3.865  9.819   -7.997  1.00 0.00 ? 1  ALA A CB   4  
ATOM   2391  H  H1   . ALA A 1 1  ? 5.443  10.172  -5.912  1.00 0.00 ? 1  ALA A H1   4  
ATOM   2392  H  H2   . ALA A 1 1  ? 4.752  11.638  -6.210  1.00 0.00 ? 1  ALA A H2   4  
ATOM   2393  H  H3   . ALA A 1 1  ? 4.388  10.805  -4.832  1.00 0.00 ? 1  ALA A H3   4  
ATOM   2394  H  HA   . ALA A 1 1  ? 2.625  10.681  -6.485  1.00 0.00 ? 1  ALA A HA   4  
ATOM   2395  H  HB1  . ALA A 1 1  ? 4.153  10.769  -8.447  1.00 0.00 ? 1  ALA A HB1  4  
ATOM   2396  H  HB2  . ALA A 1 1  ? 4.698  9.119   -8.077  1.00 0.00 ? 1  ALA A HB2  4  
ATOM   2397  H  HB3  . ALA A 1 1  ? 3.011  9.421   -8.546  1.00 0.00 ? 1  ALA A HB3  4  
ATOM   2398  N  N    . ARG A 1 2  ? 2.190  7.973   -6.392  1.00 0.00 ? 2  ARG A N    4  
ATOM   2399  C  CA   . ARG A 1 2  ? 1.749  6.683   -5.878  1.00 0.00 ? 2  ARG A CA   4  
ATOM   2400  C  C    . ARG A 1 2  ? 2.847  5.635   -6.083  1.00 0.00 ? 2  ARG A C    4  
ATOM   2401  O  O    . ARG A 1 2  ? 2.896  4.960   -7.109  1.00 0.00 ? 2  ARG A O    4  
ATOM   2402  C  CB   . ARG A 1 2  ? 0.439  6.263   -6.557  1.00 0.00 ? 2  ARG A CB   4  
ATOM   2403  C  CG   . ARG A 1 2  ? -0.715 7.202   -6.175  1.00 0.00 ? 2  ARG A CG   4  
ATOM   2404  C  CD   . ARG A 1 2  ? -2.047 6.701   -6.743  1.00 0.00 ? 2  ARG A CD   4  
ATOM   2405  N  NE   . ARG A 1 2  ? -2.057 6.733   -8.213  1.00 0.00 ? 2  ARG A NE   4  
ATOM   2406  C  CZ   . ARG A 1 2  ? -3.045 6.249   -8.984  1.00 0.00 ? 2  ARG A CZ   4  
ATOM   2407  N  NH1  . ARG A 1 2  ? -4.123 5.670   -8.435  1.00 0.00 ? 2  ARG A NH1  4  
ATOM   2408  N  NH2  . ARG A 1 2  ? -2.953 6.348   -10.317 1.00 0.00 ? 2  ARG A NH2  4  
ATOM   2409  H  H    . ARG A 1 2  ? 1.752  8.304   -7.238  1.00 0.00 ? 2  ARG A H    4  
ATOM   2410  H  HA   . ARG A 1 2  ? 1.551  6.773   -4.809  1.00 0.00 ? 2  ARG A HA   4  
ATOM   2411  H  HB2  . ARG A 1 2  ? 0.574  6.256   -7.640  1.00 0.00 ? 2  ARG A HB2  4  
ATOM   2412  H  HB3  . ARG A 1 2  ? 0.188  5.253   -6.229  1.00 0.00 ? 2  ARG A HB3  4  
ATOM   2413  H  HG2  . ARG A 1 2  ? -0.797 7.236   -5.088  1.00 0.00 ? 2  ARG A HG2  4  
ATOM   2414  H  HG3  . ARG A 1 2  ? -0.520 8.209   -6.543  1.00 0.00 ? 2  ARG A HG3  4  
ATOM   2415  H  HD2  . ARG A 1 2  ? -2.220 5.682   -6.392  1.00 0.00 ? 2  ARG A HD2  4  
ATOM   2416  H  HD3  . ARG A 1 2  ? -2.846 7.343   -6.370  1.00 0.00 ? 2  ARG A HD3  4  
ATOM   2417  H  HE   . ARG A 1 2  ? -1.262 7.162   -8.662  1.00 0.00 ? 2  ARG A HE   4  
ATOM   2418  H  HH11 . ARG A 1 2  ? -4.199 5.595   -7.431  1.00 0.00 ? 2  ARG A HH11 4  
ATOM   2419  H  HH12 . ARG A 1 2  ? -4.862 5.306   -9.019  1.00 0.00 ? 2  ARG A HH12 4  
ATOM   2420  H  HH21 . ARG A 1 2  ? -2.146 6.783   -10.740 1.00 0.00 ? 2  ARG A HH21 4  
ATOM   2421  H  HH22 . ARG A 1 2  ? -3.689 5.990   -10.908 1.00 0.00 ? 2  ARG A HH22 4  
ATOM   2422  N  N    . CYS A 1 3  ? 3.715  5.506   -5.078  1.00 0.00 ? 3  CYS A N    4  
ATOM   2423  C  CA   . CYS A 1 3  ? 4.814  4.555   -5.031  1.00 0.00 ? 3  CYS A CA   4  
ATOM   2424  C  C    . CYS A 1 3  ? 4.291  3.126   -4.881  1.00 0.00 ? 3  CYS A C    4  
ATOM   2425  O  O    . CYS A 1 3  ? 3.309  2.893   -4.179  1.00 0.00 ? 3  CYS A O    4  
ATOM   2426  C  CB   . CYS A 1 3  ? 5.682  4.938   -3.835  1.00 0.00 ? 3  CYS A CB   4  
ATOM   2427  S  SG   . CYS A 1 3  ? 6.958  3.755   -3.351  1.00 0.00 ? 3  CYS A SG   4  
ATOM   2428  H  H    . CYS A 1 3  ? 3.623  6.145   -4.299  1.00 0.00 ? 3  CYS A H    4  
ATOM   2429  H  HA   . CYS A 1 3  ? 5.414  4.638   -5.940  1.00 0.00 ? 3  CYS A HA   4  
ATOM   2430  H  HB2  . CYS A 1 3  ? 6.166  5.887   -4.062  1.00 0.00 ? 3  CYS A HB2  4  
ATOM   2431  H  HB3  . CYS A 1 3  ? 5.015  5.065   -2.984  1.00 0.00 ? 3  CYS A HB3  4  
ATOM   2432  N  N    . LYS A 1 4  ? 4.975  2.168   -5.523  1.00 0.00 ? 4  LYS A N    4  
ATOM   2433  C  CA   . LYS A 1 4  ? 4.633  0.752   -5.492  1.00 0.00 ? 4  LYS A CA   4  
ATOM   2434  C  C    . LYS A 1 4  ? 4.580  0.222   -4.058  1.00 0.00 ? 4  LYS A C    4  
ATOM   2435  O  O    . LYS A 1 4  ? 3.614  -0.433  -3.672  1.00 0.00 ? 4  LYS A O    4  
ATOM   2436  C  CB   . LYS A 1 4  ? 5.661  -0.027  -6.323  1.00 0.00 ? 4  LYS A CB   4  
ATOM   2437  C  CG   . LYS A 1 4  ? 5.292  -1.515  -6.431  1.00 0.00 ? 4  LYS A CG   4  
ATOM   2438  C  CD   . LYS A 1 4  ? 6.359  -2.330  -7.174  1.00 0.00 ? 4  LYS A CD   4  
ATOM   2439  C  CE   . LYS A 1 4  ? 7.736  -2.337  -6.491  1.00 0.00 ? 4  LYS A CE   4  
ATOM   2440  N  NZ   . LYS A 1 4  ? 7.663  -2.766  -5.083  1.00 0.00 ? 4  LYS A NZ   4  
ATOM   2441  H  H    . LYS A 1 4  ? 5.782  2.438   -6.066  1.00 0.00 ? 4  LYS A H    4  
ATOM   2442  H  HA   . LYS A 1 4  ? 3.655  0.628   -5.949  1.00 0.00 ? 4  LYS A HA   4  
ATOM   2443  H  HB2  . LYS A 1 4  ? 5.706  0.396   -7.328  1.00 0.00 ? 4  LYS A HB2  4  
ATOM   2444  H  HB3  . LYS A 1 4  ? 6.632  0.087   -5.844  1.00 0.00 ? 4  LYS A HB3  4  
ATOM   2445  H  HG2  . LYS A 1 4  ? 5.136  -1.950  -5.444  1.00 0.00 ? 4  LYS A HG2  4  
ATOM   2446  H  HG3  . LYS A 1 4  ? 4.353  -1.596  -6.980  1.00 0.00 ? 4  LYS A HG3  4  
ATOM   2447  H  HD2  . LYS A 1 4  ? 6.004  -3.359  -7.257  1.00 0.00 ? 4  LYS A HD2  4  
ATOM   2448  H  HD3  . LYS A 1 4  ? 6.467  -1.928  -8.182  1.00 0.00 ? 4  LYS A HD3  4  
ATOM   2449  H  HE2  . LYS A 1 4  ? 8.387  -3.026  -7.029  1.00 0.00 ? 4  LYS A HE2  4  
ATOM   2450  H  HE3  . LYS A 1 4  ? 8.184  -1.345  -6.533  1.00 0.00 ? 4  LYS A HE3  4  
ATOM   2451  H  HZ1  . LYS A 1 4  ? 8.593  -2.788  -4.689  1.00 0.00 ? 4  LYS A HZ1  4  
ATOM   2452  H  HZ2  . LYS A 1 4  ? 7.099  -2.113  -4.558  1.00 0.00 ? 4  LYS A HZ2  4  
ATOM   2453  H  HZ3  . LYS A 1 4  ? 7.252  -3.687  -5.027  1.00 0.00 ? 4  LYS A HZ3  4  
ATOM   2454  N  N    . VAL A 1 5  ? 5.644  0.477   -3.292  1.00 0.00 ? 5  VAL A N    4  
ATOM   2455  C  CA   . VAL A 1 5  ? 5.865  -0.120  -1.984  1.00 0.00 ? 5  VAL A CA   4  
ATOM   2456  C  C    . VAL A 1 5  ? 4.785  0.360   -1.017  1.00 0.00 ? 5  VAL A C    4  
ATOM   2457  O  O    . VAL A 1 5  ? 3.923  -0.419  -0.611  1.00 0.00 ? 5  VAL A O    4  
ATOM   2458  C  CB   . VAL A 1 5  ? 7.278  0.215   -1.476  1.00 0.00 ? 5  VAL A CB   4  
ATOM   2459  C  CG1  . VAL A 1 5  ? 7.531  -0.390  -0.088  1.00 0.00 ? 5  VAL A CG1  4  
ATOM   2460  C  CG2  . VAL A 1 5  ? 8.351  -0.309  -2.436  1.00 0.00 ? 5  VAL A CG2  4  
ATOM   2461  H  H    . VAL A 1 5  ? 6.368  1.060   -3.683  1.00 0.00 ? 5  VAL A H    4  
ATOM   2462  H  HA   . VAL A 1 5  ? 5.792  -1.203  -2.079  1.00 0.00 ? 5  VAL A HA   4  
ATOM   2463  H  HB   . VAL A 1 5  ? 7.390  1.295   -1.410  1.00 0.00 ? 5  VAL A HB   4  
ATOM   2464  H  HG11 . VAL A 1 5  ? 7.392  -1.471  -0.122  1.00 0.00 ? 5  VAL A HG11 4  
ATOM   2465  H  HG12 . VAL A 1 5  ? 8.552  -0.173  0.228   1.00 0.00 ? 5  VAL A HG12 4  
ATOM   2466  H  HG13 . VAL A 1 5  ? 6.850  0.036   0.648   1.00 0.00 ? 5  VAL A HG13 4  
ATOM   2467  H  HG21 . VAL A 1 5  ? 8.274  0.171   -3.411  1.00 0.00 ? 5  VAL A HG21 4  
ATOM   2468  H  HG22 . VAL A 1 5  ? 9.324  -0.076  -2.011  1.00 0.00 ? 5  VAL A HG22 4  
ATOM   2469  H  HG23 . VAL A 1 5  ? 8.259  -1.389  -2.551  1.00 0.00 ? 5  VAL A HG23 4  
ATOM   2470  N  N    . CYS A 1 6  ? 4.838  1.643   -0.645  1.00 0.00 ? 6  CYS A N    4  
ATOM   2471  C  CA   . CYS A 1 6  ? 4.013  2.185   0.422   1.00 0.00 ? 6  CYS A CA   4  
ATOM   2472  C  C    . CYS A 1 6  ? 2.564  2.382   -0.029  1.00 0.00 ? 6  CYS A C    4  
ATOM   2473  O  O    . CYS A 1 6  ? 1.667  2.288   0.809   1.00 0.00 ? 6  CYS A O    4  
ATOM   2474  C  CB   . CYS A 1 6  ? 4.625  3.472   0.988   1.00 0.00 ? 6  CYS A CB   4  
ATOM   2475  S  SG   . CYS A 1 6  ? 5.012  4.793   -0.188  1.00 0.00 ? 6  CYS A SG   4  
ATOM   2476  H  H    . CYS A 1 6  ? 5.538  2.242   -1.058  1.00 0.00 ? 6  CYS A H    4  
ATOM   2477  H  HA   . CYS A 1 6  ? 4.000  1.462   1.241   1.00 0.00 ? 6  CYS A HA   4  
ATOM   2478  H  HB2  . CYS A 1 6  ? 3.930  3.879   1.722   1.00 0.00 ? 6  CYS A HB2  4  
ATOM   2479  H  HB3  . CYS A 1 6  ? 5.549  3.220   1.509   1.00 0.00 ? 6  CYS A HB3  4  
ATOM   2480  N  N    . ARG A 1 7  ? 2.335  2.647   -1.326  1.00 0.00 ? 7  ARG A N    4  
ATOM   2481  C  CA   . ARG A 1 7  ? 1.042  3.066   -1.863  1.00 0.00 ? 7  ARG A CA   4  
ATOM   2482  C  C    . ARG A 1 7  ? 0.522  4.272   -1.083  1.00 0.00 ? 7  ARG A C    4  
ATOM   2483  O  O    . ARG A 1 7  ? -0.557 4.234   -0.495  1.00 0.00 ? 7  ARG A O    4  
ATOM   2484  C  CB   . ARG A 1 7  ? 0.067  1.879   -1.912  1.00 0.00 ? 7  ARG A CB   4  
ATOM   2485  C  CG   . ARG A 1 7  ? 0.448  0.926   -3.054  1.00 0.00 ? 7  ARG A CG   4  
ATOM   2486  C  CD   . ARG A 1 7  ? 0.173  -0.535  -2.691  1.00 0.00 ? 7  ARG A CD   4  
ATOM   2487  N  NE   . ARG A 1 7  ? 1.172  -1.034  -1.735  1.00 0.00 ? 7  ARG A NE   4  
ATOM   2488  C  CZ   . ARG A 1 7  ? 1.157  -2.253  -1.170  1.00 0.00 ? 7  ARG A CZ   4  
ATOM   2489  N  NH1  . ARG A 1 7  ? 0.156  -3.110  -1.415  1.00 0.00 ? 7  ARG A NH1  4  
ATOM   2490  N  NH2  . ARG A 1 7  ? 2.160  -2.610  -0.358  1.00 0.00 ? 7  ARG A NH2  4  
ATOM   2491  H  H    . ARG A 1 7  ? 3.114  2.658   -1.971  1.00 0.00 ? 7  ARG A H    4  
ATOM   2492  H  HA   . ARG A 1 7  ? 1.185  3.414   -2.887  1.00 0.00 ? 7  ARG A HA   4  
ATOM   2493  H  HB2  . ARG A 1 7  ? 0.067  1.356   -0.956  1.00 0.00 ? 7  ARG A HB2  4  
ATOM   2494  H  HB3  . ARG A 1 7  ? -0.946 2.236   -2.103  1.00 0.00 ? 7  ARG A HB3  4  
ATOM   2495  H  HG2  . ARG A 1 7  ? -0.131 1.194   -3.939  1.00 0.00 ? 7  ARG A HG2  4  
ATOM   2496  H  HG3  . ARG A 1 7  ? 1.504  1.024   -3.301  1.00 0.00 ? 7  ARG A HG3  4  
ATOM   2497  H  HD2  . ARG A 1 7  ? -0.834 -0.621  -2.278  1.00 0.00 ? 7  ARG A HD2  4  
ATOM   2498  H  HD3  . ARG A 1 7  ? 0.237  -1.134  -3.601  1.00 0.00 ? 7  ARG A HD3  4  
ATOM   2499  H  HE   . ARG A 1 7  ? 1.956  -0.426  -1.535  1.00 0.00 ? 7  ARG A HE   4  
ATOM   2500  H  HH11 . ARG A 1 7  ? -0.598 -2.843  -2.030  1.00 0.00 ? 7  ARG A HH11 4  
ATOM   2501  H  HH12 . ARG A 1 7  ? 0.151  -4.026  -0.988  1.00 0.00 ? 7  ARG A HH12 4  
ATOM   2502  H  HH21 . ARG A 1 7  ? 2.922  -1.960  -0.202  1.00 0.00 ? 7  ARG A HH21 4  
ATOM   2503  H  HH22 . ARG A 1 7  ? 2.173  -3.519  0.081   1.00 0.00 ? 7  ARG A HH22 4  
ATOM   2504  N  N    . LYS A 1 8  ? 1.332  5.336   -1.076  1.00 0.00 ? 8  LYS A N    4  
ATOM   2505  C  CA   . LYS A 1 8  ? 1.018  6.625   -0.485  1.00 0.00 ? 8  LYS A CA   4  
ATOM   2506  C  C    . LYS A 1 8  ? 1.517  7.723   -1.418  1.00 0.00 ? 8  LYS A C    4  
ATOM   2507  O  O    . LYS A 1 8  ? 2.389  7.487   -2.256  1.00 0.00 ? 8  LYS A O    4  
ATOM   2508  C  CB   . LYS A 1 8  ? 1.695  6.762   0.886   1.00 0.00 ? 8  LYS A CB   4  
ATOM   2509  C  CG   . LYS A 1 8  ? 1.196  5.713   1.882   1.00 0.00 ? 8  LYS A CG   4  
ATOM   2510  C  CD   . LYS A 1 8  ? 1.915  5.854   3.227   1.00 0.00 ? 8  LYS A CD   4  
ATOM   2511  C  CE   . LYS A 1 8  ? 1.457  4.777   4.219   1.00 0.00 ? 8  LYS A CE   4  
ATOM   2512  N  NZ   . LYS A 1 8  ? 1.812  3.417   3.771   1.00 0.00 ? 8  LYS A NZ   4  
ATOM   2513  H  H    . LYS A 1 8  ? 2.202  5.281   -1.589  1.00 0.00 ? 8  LYS A H    4  
ATOM   2514  H  HA   . LYS A 1 8  ? -0.058 6.733   -0.358  1.00 0.00 ? 8  LYS A HA   4  
ATOM   2515  H  HB2  . LYS A 1 8  ? 2.771  6.650   0.753   1.00 0.00 ? 8  LYS A HB2  4  
ATOM   2516  H  HB3  . LYS A 1 8  ? 1.488  7.755   1.290   1.00 0.00 ? 8  LYS A HB3  4  
ATOM   2517  H  HG2  . LYS A 1 8  ? 0.120  5.829   2.024   1.00 0.00 ? 8  LYS A HG2  4  
ATOM   2518  H  HG3  . LYS A 1 8  ? 1.397  4.725   1.479   1.00 0.00 ? 8  LYS A HG3  4  
ATOM   2519  H  HD2  . LYS A 1 8  ? 2.994  5.782   3.079   1.00 0.00 ? 8  LYS A HD2  4  
ATOM   2520  H  HD3  . LYS A 1 8  ? 1.693  6.838   3.645   1.00 0.00 ? 8  LYS A HD3  4  
ATOM   2521  H  HE2  . LYS A 1 8  ? 1.938  4.961   5.181   1.00 0.00 ? 8  LYS A HE2  4  
ATOM   2522  H  HE3  . LYS A 1 8  ? 0.377  4.842   4.351   1.00 0.00 ? 8  LYS A HE3  4  
ATOM   2523  H  HZ1  . LYS A 1 8  ? 1.498  2.745   4.457   1.00 0.00 ? 8  LYS A HZ1  4  
ATOM   2524  H  HZ2  . LYS A 1 8  ? 1.372  3.213   2.883   1.00 0.00 ? 8  LYS A HZ2  4  
ATOM   2525  H  HZ3  . LYS A 1 8  ? 2.813  3.346   3.668   1.00 0.00 ? 8  LYS A HZ3  4  
ATOM   2526  N  N    . LYS A 1 9  ? 0.937  8.917   -1.269  1.00 0.00 ? 9  LYS A N    4  
ATOM   2527  C  CA   . LYS A 1 9  ? 1.412  10.139  -1.890  1.00 0.00 ? 9  LYS A CA   4  
ATOM   2528  C  C    . LYS A 1 9  ? 1.397  11.224  -0.814  1.00 0.00 ? 9  LYS A C    4  
ATOM   2529  O  O    . LYS A 1 9  ? 0.370  11.861  -0.584  1.00 0.00 ? 9  LYS A O    4  
ATOM   2530  C  CB   . LYS A 1 9  ? 0.537  10.506  -3.098  1.00 0.00 ? 9  LYS A CB   4  
ATOM   2531  C  CG   . LYS A 1 9  ? 1.166  11.710  -3.805  1.00 0.00 ? 9  LYS A CG   4  
ATOM   2532  C  CD   . LYS A 1 9  ? 0.257  12.322  -4.873  1.00 0.00 ? 9  LYS A CD   4  
ATOM   2533  C  CE   . LYS A 1 9  ? 0.987  13.428  -5.649  1.00 0.00 ? 9  LYS A CE   4  
ATOM   2534  N  NZ   . LYS A 1 9  ? 1.627  14.419  -4.761  1.00 0.00 ? 9  LYS A NZ   4  
ATOM   2535  H  H    . LYS A 1 9  ? 0.200  9.011   -0.586  1.00 0.00 ? 9  LYS A H    4  
ATOM   2536  H  HA   . LYS A 1 9  ? 2.438  10.007  -2.239  1.00 0.00 ? 9  LYS A HA   4  
ATOM   2537  H  HB2  . LYS A 1 9  ? 0.500  9.664   -3.795  1.00 0.00 ? 9  LYS A HB2  4  
ATOM   2538  H  HB3  . LYS A 1 9  ? -0.476 10.745  -2.770  1.00 0.00 ? 9  LYS A HB3  4  
ATOM   2539  H  HG2  . LYS A 1 9  ? 1.376  12.479  -3.063  1.00 0.00 ? 9  LYS A HG2  4  
ATOM   2540  H  HG3  . LYS A 1 9  ? 2.101  11.387  -4.257  1.00 0.00 ? 9  LYS A HG3  4  
ATOM   2541  H  HD2  . LYS A 1 9  ? -0.061 11.546  -5.572  1.00 0.00 ? 9  LYS A HD2  4  
ATOM   2542  H  HD3  . LYS A 1 9  ? -0.628 12.739  -4.389  1.00 0.00 ? 9  LYS A HD3  4  
ATOM   2543  H  HE2  . LYS A 1 9  ? 1.759  12.983  -6.276  1.00 0.00 ? 9  LYS A HE2  4  
ATOM   2544  H  HE3  . LYS A 1 9  ? 0.268  13.938  -6.293  1.00 0.00 ? 9  LYS A HE3  4  
ATOM   2545  H  HZ1  . LYS A 1 9  ? 2.367  13.973  -4.229  1.00 0.00 ? 9  LYS A HZ1  4  
ATOM   2546  H  HZ2  . LYS A 1 9  ? 2.027  15.164  -5.313  1.00 0.00 ? 9  LYS A HZ2  4  
ATOM   2547  H  HZ3  . LYS A 1 9  ? 0.943  14.805  -4.124  1.00 0.00 ? 9  LYS A HZ3  4  
ATOM   2548  N  N    . GLY A 1 10 ? 2.541  11.426  -0.157  1.00 0.00 ? 10 GLY A N    4  
ATOM   2549  C  CA   . GLY A 1 10 ? 2.703  12.451  0.862   1.00 0.00 ? 10 GLY A CA   4  
ATOM   2550  C  C    . GLY A 1 10 ? 4.183  12.723  1.092   1.00 0.00 ? 10 GLY A C    4  
ATOM   2551  O  O    . GLY A 1 10 ? 4.614  13.875  1.088   1.00 0.00 ? 10 GLY A O    4  
ATOM   2552  H  H    . GLY A 1 10 ? 3.332  10.832  -0.363  1.00 0.00 ? 10 GLY A H    4  
ATOM   2553  H  HA2  . GLY A 1 10 ? 2.216  13.375  0.544   1.00 0.00 ? 10 GLY A HA2  4  
ATOM   2554  H  HA3  . GLY A 1 10 ? 2.253  12.104  1.794   1.00 0.00 ? 10 GLY A HA3  4  
ATOM   2555  N  N    . GLU A 1 11 ? 4.962  11.650  1.263   1.00 0.00 ? 11 GLU A N    4  
ATOM   2556  C  CA   . GLU A 1 11 ? 6.400  11.687  1.468   1.00 0.00 ? 11 GLU A CA   4  
ATOM   2557  C  C    . GLU A 1 11 ? 7.158  11.862  0.144   1.00 0.00 ? 11 GLU A C    4  
ATOM   2558  O  O    . GLU A 1 11 ? 8.198  11.239  -0.062  1.00 0.00 ? 11 GLU A O    4  
ATOM   2559  C  CB   . GLU A 1 11 ? 6.847  10.444  2.264   1.00 0.00 ? 11 GLU A CB   4  
ATOM   2560  C  CG   . GLU A 1 11 ? 6.681  9.072   1.577   1.00 0.00 ? 11 GLU A CG   4  
ATOM   2561  C  CD   . GLU A 1 11 ? 5.234  8.587   1.460   1.00 0.00 ? 11 GLU A CD   4  
ATOM   2562  O  OE1  . GLU A 1 11 ? 4.564  9.002   0.488   1.00 0.00 ? 11 GLU A OE1  4  
ATOM   2563  O  OE2  . GLU A 1 11 ? 4.821  7.808   2.346   1.00 0.00 ? 11 GLU A OE2  4  
ATOM   2564  H  H    . GLU A 1 11 ? 4.534  10.738  1.185   1.00 0.00 ? 11 GLU A H    4  
ATOM   2565  H  HA   . GLU A 1 11 ? 6.635  12.555  2.087   1.00 0.00 ? 11 GLU A HA   4  
ATOM   2566  H  HB2  . GLU A 1 11 ? 7.907  10.577  2.476   1.00 0.00 ? 11 GLU A HB2  4  
ATOM   2567  H  HB3  . GLU A 1 11 ? 6.323  10.426  3.221   1.00 0.00 ? 11 GLU A HB3  4  
ATOM   2568  H  HG2  . GLU A 1 11 ? 7.131  9.085   0.587   1.00 0.00 ? 11 GLU A HG2  4  
ATOM   2569  H  HG3  . GLU A 1 11 ? 7.231  8.343   2.172   1.00 0.00 ? 11 GLU A HG3  4  
ATOM   2570  N  N    . ASP A 1 12 ? 6.664  12.738  -0.743  1.00 0.00 ? 12 ASP A N    4  
ATOM   2571  C  CA   . ASP A 1 12 ? 7.215  12.952  -2.077  1.00 0.00 ? 12 ASP A CA   4  
ATOM   2572  C  C    . ASP A 1 12 ? 8.409  13.909  -1.999  1.00 0.00 ? 12 ASP A C    4  
ATOM   2573  O  O    . ASP A 1 12 ? 8.403  14.974  -2.615  1.00 0.00 ? 12 ASP A O    4  
ATOM   2574  C  CB   . ASP A 1 12 ? 6.126  13.494  -3.014  1.00 0.00 ? 12 ASP A CB   4  
ATOM   2575  C  CG   . ASP A 1 12 ? 4.937  12.559  -3.212  1.00 0.00 ? 12 ASP A CG   4  
ATOM   2576  O  OD1  . ASP A 1 12 ? 5.126  11.325  -3.111  1.00 0.00 ? 12 ASP A OD1  4  
ATOM   2577  O  OD2  . ASP A 1 12 ? 3.853  13.097  -3.528  1.00 0.00 ? 12 ASP A OD2  4  
ATOM   2578  H  H    . ASP A 1 12 ? 5.860  13.289  -0.479  1.00 0.00 ? 12 ASP A H    4  
ATOM   2579  H  HA   . ASP A 1 12 ? 7.568  12.007  -2.488  1.00 0.00 ? 12 ASP A HA   4  
ATOM   2580  H  HB2  . ASP A 1 12 ? 5.761  14.440  -2.610  1.00 0.00 ? 12 ASP A HB2  4  
ATOM   2581  H  HB3  . ASP A 1 12 ? 6.564  13.675  -3.997  1.00 0.00 ? 12 ASP A HB3  4  
ATOM   2582  N  N    . ASP A 1 13 ? 9.441  13.517  -1.245  1.00 0.00 ? 13 ASP A N    4  
ATOM   2583  C  CA   . ASP A 1 13 ? 10.731 14.188  -1.220  1.00 0.00 ? 13 ASP A CA   4  
ATOM   2584  C  C    . ASP A 1 13 ? 11.421 14.025  -2.573  1.00 0.00 ? 13 ASP A C    4  
ATOM   2585  O  O    . ASP A 1 13 ? 11.722 15.007  -3.247  1.00 0.00 ? 13 ASP A O    4  
ATOM   2586  C  CB   . ASP A 1 13 ? 11.568 13.626  -0.067  1.00 0.00 ? 13 ASP A CB   4  
ATOM   2587  C  CG   . ASP A 1 13 ? 12.939 14.293  0.009   1.00 0.00 ? 13 ASP A CG   4  
ATOM   2588  O  OD1  . ASP A 1 13 ? 13.830 13.858  -0.751  1.00 0.00 ? 13 ASP A OD1  4  
ATOM   2589  O  OD2  . ASP A 1 13 ? 13.068 15.234  0.822   1.00 0.00 ? 13 ASP A OD2  4  
ATOM   2590  H  H    . ASP A 1 13 ? 9.359  12.648  -0.733  1.00 0.00 ? 13 ASP A H    4  
ATOM   2591  H  HA   . ASP A 1 13 ? 10.576 15.247  -1.033  1.00 0.00 ? 13 ASP A HA   4  
ATOM   2592  H  HB2  . ASP A 1 13 ? 11.040 13.802  0.871   1.00 0.00 ? 13 ASP A HB2  4  
ATOM   2593  H  HB3  . ASP A 1 13 ? 11.691 12.550  -0.187  1.00 0.00 ? 13 ASP A HB3  4  
ATOM   2594  N  N    . LYS A 1 14 ? 11.651 12.768  -2.958  1.00 0.00 ? 14 LYS A N    4  
ATOM   2595  C  CA   . LYS A 1 14 ? 12.334 12.382  -4.178  1.00 0.00 ? 14 LYS A CA   4  
ATOM   2596  C  C    . LYS A 1 14 ? 12.111 10.887  -4.383  1.00 0.00 ? 14 LYS A C    4  
ATOM   2597  O  O    . LYS A 1 14 ? 12.698 10.062  -3.684  1.00 0.00 ? 14 LYS A O    4  
ATOM   2598  C  CB   . LYS A 1 14 ? 13.827 12.734  -4.100  1.00 0.00 ? 14 LYS A CB   4  
ATOM   2599  C  CG   . LYS A 1 14 ? 14.653 12.181  -5.273  1.00 0.00 ? 14 LYS A CG   4  
ATOM   2600  C  CD   . LYS A 1 14 ? 14.097 12.608  -6.640  1.00 0.00 ? 14 LYS A CD   4  
ATOM   2601  C  CE   . LYS A 1 14 ? 15.044 12.215  -7.778  1.00 0.00 ? 14 LYS A CE   4  
ATOM   2602  N  NZ   . LYS A 1 14 ? 15.224 10.755  -7.878  1.00 0.00 ? 14 LYS A NZ   4  
ATOM   2603  H  H    . LYS A 1 14 ? 11.311 12.027  -2.366  1.00 0.00 ? 14 LYS A H    4  
ATOM   2604  H  HA   . LYS A 1 14 ? 11.893 12.937  -5.005  1.00 0.00 ? 14 LYS A HA   4  
ATOM   2605  H  HB2  . LYS A 1 14 ? 13.940 13.821  -4.082  1.00 0.00 ? 14 LYS A HB2  4  
ATOM   2606  H  HB3  . LYS A 1 14 ? 14.235 12.326  -3.176  1.00 0.00 ? 14 LYS A HB3  4  
ATOM   2607  H  HG2  . LYS A 1 14 ? 15.668 12.564  -5.172  1.00 0.00 ? 14 LYS A HG2  4  
ATOM   2608  H  HG3  . LYS A 1 14 ? 14.691 11.094  -5.206  1.00 0.00 ? 14 LYS A HG3  4  
ATOM   2609  H  HD2  . LYS A 1 14 ? 13.126 12.147  -6.820  1.00 0.00 ? 14 LYS A HD2  4  
ATOM   2610  H  HD3  . LYS A 1 14 ? 13.978 13.693  -6.650  1.00 0.00 ? 14 LYS A HD3  4  
ATOM   2611  H  HE2  . LYS A 1 14 ? 14.637 12.579  -8.723  1.00 0.00 ? 14 LYS A HE2  4  
ATOM   2612  H  HE3  . LYS A 1 14 ? 16.013 12.686  -7.617  1.00 0.00 ? 14 LYS A HE3  4  
ATOM   2613  H  HZ1  . LYS A 1 14 ? 15.606 10.399  -7.015  1.00 0.00 ? 14 LYS A HZ1  4  
ATOM   2614  H  HZ2  . LYS A 1 14 ? 14.337 10.303  -8.067  1.00 0.00 ? 14 LYS A HZ2  4  
ATOM   2615  H  HZ3  . LYS A 1 14 ? 15.882 10.561  -8.625  1.00 0.00 ? 14 LYS A HZ3  4  
ATOM   2616  N  N    . LEU A 1 15 ? 11.260 10.545  -5.352  1.00 0.00 ? 15 LEU A N    4  
ATOM   2617  C  CA   . LEU A 1 15 ? 11.108 9.178   -5.819  1.00 0.00 ? 15 LEU A CA   4  
ATOM   2618  C  C    . LEU A 1 15 ? 12.382 8.791   -6.574  1.00 0.00 ? 15 LEU A C    4  
ATOM   2619  O  O    . LEU A 1 15 ? 12.663 9.322   -7.649  1.00 0.00 ? 15 LEU A O    4  
ATOM   2620  C  CB   . LEU A 1 15 ? 9.851  9.022   -6.686  1.00 0.00 ? 15 LEU A CB   4  
ATOM   2621  C  CG   . LEU A 1 15 ? 8.553  8.972   -5.859  1.00 0.00 ? 15 LEU A CG   4  
ATOM   2622  C  CD1  . LEU A 1 15 ? 8.170  10.334  -5.264  1.00 0.00 ? 15 LEU A CD1  4  
ATOM   2623  C  CD2  . LEU A 1 15 ? 7.407  8.475   -6.747  1.00 0.00 ? 15 LEU A CD2  4  
ATOM   2624  H  H    . LEU A 1 15 ? 10.728 11.273  -5.803  1.00 0.00 ? 15 LEU A H    4  
ATOM   2625  H  HA   . LEU A 1 15 ? 10.994 8.518   -4.960  1.00 0.00 ? 15 LEU A HA   4  
ATOM   2626  H  HB2  . LEU A 1 15 ? 9.801  9.820   -7.429  1.00 0.00 ? 15 LEU A HB2  4  
ATOM   2627  H  HB3  . LEU A 1 15 ? 9.942  8.066   -7.205  1.00 0.00 ? 15 LEU A HB3  4  
ATOM   2628  H  HG   . LEU A 1 15 ? 8.672  8.252   -5.046  1.00 0.00 ? 15 LEU A HG   4  
ATOM   2629  H  HD11 . LEU A 1 15 ? 7.194  10.264  -4.790  1.00 0.00 ? 15 LEU A HD11 4  
ATOM   2630  H  HD12 . LEU A 1 15 ? 8.885  10.639  -4.502  1.00 0.00 ? 15 LEU A HD12 4  
ATOM   2631  H  HD13 . LEU A 1 15 ? 8.132  11.090  -6.048  1.00 0.00 ? 15 LEU A HD13 4  
ATOM   2632  H  HD21 . LEU A 1 15 ? 7.660  7.505   -7.175  1.00 0.00 ? 15 LEU A HD21 4  
ATOM   2633  H  HD22 . LEU A 1 15 ? 6.500  8.362   -6.151  1.00 0.00 ? 15 LEU A HD22 4  
ATOM   2634  H  HD23 . LEU A 1 15 ? 7.227  9.186   -7.555  1.00 0.00 ? 15 LEU A HD23 4  
ATOM   2635  N  N    . ILE A 1 16 ? 13.172 7.903   -5.965  1.00 0.00 ? 16 ILE A N    4  
ATOM   2636  C  CA   . ILE A 1 16 ? 14.334 7.268   -6.558  1.00 0.00 ? 16 ILE A CA   4  
ATOM   2637  C  C    . ILE A 1 16 ? 13.902 5.920   -7.139  1.00 0.00 ? 16 ILE A C    4  
ATOM   2638  O  O    . ILE A 1 16 ? 13.848 4.916   -6.436  1.00 0.00 ? 16 ILE A O    4  
ATOM   2639  C  CB   . ILE A 1 16 ? 15.479 7.185   -5.526  1.00 0.00 ? 16 ILE A CB   4  
ATOM   2640  C  CG1  . ILE A 1 16 ? 16.628 6.315   -6.064  1.00 0.00 ? 16 ILE A CG1  4  
ATOM   2641  C  CG2  . ILE A 1 16 ? 15.041 6.720   -4.129  1.00 0.00 ? 16 ILE A CG2  4  
ATOM   2642  C  CD1  . ILE A 1 16 ? 17.921 6.533   -5.276  1.00 0.00 ? 16 ILE A CD1  4  
ATOM   2643  H  H    . ILE A 1 16 ? 12.833 7.490   -5.106  1.00 0.00 ? 16 ILE A H    4  
ATOM   2644  H  HA   . ILE A 1 16 ? 14.711 7.879   -7.382  1.00 0.00 ? 16 ILE A HA   4  
ATOM   2645  H  HB   . ILE A 1 16 ? 15.857 8.202   -5.410  1.00 0.00 ? 16 ILE A HB   4  
ATOM   2646  H  HG12 . ILE A 1 16 ? 16.361 5.257   -6.018  1.00 0.00 ? 16 ILE A HG12 4  
ATOM   2647  H  HG13 . ILE A 1 16 ? 16.819 6.595   -7.102  1.00 0.00 ? 16 ILE A HG13 4  
ATOM   2648  H  HG21 . ILE A 1 16 ? 14.558 5.745   -4.166  1.00 0.00 ? 16 ILE A HG21 4  
ATOM   2649  H  HG22 . ILE A 1 16 ? 15.913 6.652   -3.481  1.00 0.00 ? 16 ILE A HG22 4  
ATOM   2650  H  HG23 . ILE A 1 16 ? 14.360 7.443   -3.684  1.00 0.00 ? 16 ILE A HG23 4  
ATOM   2651  H  HD11 . ILE A 1 16 ? 18.089 7.600   -5.131  1.00 0.00 ? 16 ILE A HD11 4  
ATOM   2652  H  HD12 . ILE A 1 16 ? 17.873 6.042   -4.306  1.00 0.00 ? 16 ILE A HD12 4  
ATOM   2653  H  HD13 . ILE A 1 16 ? 18.755 6.110   -5.835  1.00 0.00 ? 16 ILE A HD13 4  
ATOM   2654  N  N    . LEU A 1 17 ? 13.594 5.906   -8.439  1.00 0.00 ? 17 LEU A N    4  
ATOM   2655  C  CA   . LEU A 1 17 ? 13.207 4.697   -9.149  1.00 0.00 ? 17 LEU A CA   4  
ATOM   2656  C  C    . LEU A 1 17 ? 14.423 3.778   -9.262  1.00 0.00 ? 17 LEU A C    4  
ATOM   2657  O  O    . LEU A 1 17 ? 15.556 4.254   -9.309  1.00 0.00 ? 17 LEU A O    4  
ATOM   2658  C  CB   . LEU A 1 17 ? 12.706 5.061   -10.556 1.00 0.00 ? 17 LEU A CB   4  
ATOM   2659  C  CG   . LEU A 1 17 ? 11.238 5.511   -10.629 1.00 0.00 ? 17 LEU A CG   4  
ATOM   2660  C  CD1  . LEU A 1 17 ? 10.904 6.652   -9.660  1.00 0.00 ? 17 LEU A CD1  4  
ATOM   2661  C  CD2  . LEU A 1 17 ? 10.928 5.953   -12.064 1.00 0.00 ? 17 LEU A CD2  4  
ATOM   2662  H  H    . LEU A 1 17 ? 13.662 6.761   -8.972  1.00 0.00 ? 17 LEU A H    4  
ATOM   2663  H  HA   . LEU A 1 17 ? 12.417 4.186   -8.596  1.00 0.00 ? 17 LEU A HA   4  
ATOM   2664  H  HB2  . LEU A 1 17 ? 13.343 5.848   -10.958 1.00 0.00 ? 17 LEU A HB2  4  
ATOM   2665  H  HB3  . LEU A 1 17 ? 12.800 4.180   -11.195 1.00 0.00 ? 17 LEU A HB3  4  
ATOM   2666  H  HG   . LEU A 1 17 ? 10.600 4.658   -10.403 1.00 0.00 ? 17 LEU A HG   4  
ATOM   2667  H  HD11 . LEU A 1 17 ? 11.579 7.493   -9.822  1.00 0.00 ? 17 LEU A HD11 4  
ATOM   2668  H  HD12 . LEU A 1 17 ? 9.878  6.982   -9.823  1.00 0.00 ? 17 LEU A HD12 4  
ATOM   2669  H  HD13 . LEU A 1 17 ? 10.989 6.309   -8.630  1.00 0.00 ? 17 LEU A HD13 4  
ATOM   2670  H  HD21 . LEU A 1 17 ? 9.874  6.218   -12.149 1.00 0.00 ? 17 LEU A HD21 4  
ATOM   2671  H  HD22 . LEU A 1 17 ? 11.536 6.818   -12.330 1.00 0.00 ? 17 LEU A HD22 4  
ATOM   2672  H  HD23 . LEU A 1 17 ? 11.142 5.139   -12.756 1.00 0.00 ? 17 LEU A HD23 4  
ATOM   2673  N  N    . CYS A 1 18 ? 14.189 2.461   -9.289  1.00 0.00 ? 18 CYS A N    4  
ATOM   2674  C  CA   . CYS A 1 18 ? 15.237 1.509   -9.622  1.00 0.00 ? 18 CYS A CA   4  
ATOM   2675  C  C    . CYS A 1 18 ? 15.408 1.485   -11.135 1.00 0.00 ? 18 CYS A C    4  
ATOM   2676  O  O    . CYS A 1 18 ? 14.440 1.239   -11.847 1.00 0.00 ? 18 CYS A O    4  
ATOM   2677  C  CB   . CYS A 1 18 ? 14.890 0.116   -9.102  1.00 0.00 ? 18 CYS A CB   4  
ATOM   2678  S  SG   . CYS A 1 18 ? 16.093 -1.141  -9.609  1.00 0.00 ? 18 CYS A SG   4  
ATOM   2679  H  H    . CYS A 1 18 ? 13.230 2.132   -9.238  1.00 0.00 ? 18 CYS A H    4  
ATOM   2680  H  HA   . CYS A 1 18 ? 16.175 1.801   -9.150  1.00 0.00 ? 18 CYS A HA   4  
ATOM   2681  H  HB2  . CYS A 1 18 ? 14.863 0.151   -8.014  1.00 0.00 ? 18 CYS A HB2  4  
ATOM   2682  H  HB3  . CYS A 1 18 ? 13.905 -0.177  -9.468  1.00 0.00 ? 18 CYS A HB3  4  
ATOM   2683  N  N    . ASP A 1 19 ? 16.629 1.723   -11.627 1.00 0.00 ? 19 ASP A N    4  
ATOM   2684  C  CA   . ASP A 1 19 ? 16.926 1.739   -13.052 1.00 0.00 ? 19 ASP A CA   4  
ATOM   2685  C  C    . ASP A 1 19 ? 16.621 0.377   -13.676 1.00 0.00 ? 19 ASP A C    4  
ATOM   2686  O  O    . ASP A 1 19 ? 15.901 0.295   -14.670 1.00 0.00 ? 19 ASP A O    4  
ATOM   2687  C  CB   . ASP A 1 19 ? 18.391 2.133   -13.265 1.00 0.00 ? 19 ASP A CB   4  
ATOM   2688  C  CG   . ASP A 1 19 ? 18.762 2.116   -14.744 1.00 0.00 ? 19 ASP A CG   4  
ATOM   2689  O  OD1  . ASP A 1 19 ? 18.392 3.092   -15.433 1.00 0.00 ? 19 ASP A OD1  4  
ATOM   2690  O  OD2  . ASP A 1 19 ? 19.401 1.126   -15.160 1.00 0.00 ? 19 ASP A OD2  4  
ATOM   2691  H  H    . ASP A 1 19 ? 17.397 1.870   -10.986 1.00 0.00 ? 19 ASP A H    4  
ATOM   2692  H  HA   . ASP A 1 19 ? 16.295 2.487   -13.530 1.00 0.00 ? 19 ASP A HA   4  
ATOM   2693  H  HB2  . ASP A 1 19 ? 18.552 3.140   -12.881 1.00 0.00 ? 19 ASP A HB2  4  
ATOM   2694  H  HB3  . ASP A 1 19 ? 19.044 1.447   -12.724 1.00 0.00 ? 19 ASP A HB3  4  
ATOM   2695  N  N    . GLU A 1 20 ? 17.160 -0.680  -13.057 1.00 0.00 ? 20 GLU A N    4  
ATOM   2696  C  CA   . GLU A 1 20 ? 17.181 -2.036  -13.582 1.00 0.00 ? 20 GLU A CA   4  
ATOM   2697  C  C    . GLU A 1 20 ? 15.772 -2.512  -13.944 1.00 0.00 ? 20 GLU A C    4  
ATOM   2698  O  O    . GLU A 1 20 ? 15.520 -2.857  -15.097 1.00 0.00 ? 20 GLU A O    4  
ATOM   2699  C  CB   . GLU A 1 20 ? 17.856 -2.954  -12.553 1.00 0.00 ? 20 GLU A CB   4  
ATOM   2700  C  CG   . GLU A 1 20 ? 18.040 -4.384  -13.072 1.00 0.00 ? 20 GLU A CG   4  
ATOM   2701  C  CD   . GLU A 1 20 ? 18.703 -5.270  -12.021 1.00 0.00 ? 20 GLU A CD   4  
ATOM   2702  O  OE1  . GLU A 1 20 ? 19.804 -4.889  -11.569 1.00 0.00 ? 20 GLU A OE1  4  
ATOM   2703  O  OE2  . GLU A 1 20 ? 18.093 -6.307  -11.681 1.00 0.00 ? 20 GLU A OE2  4  
ATOM   2704  H  H    . GLU A 1 20 ? 17.704 -0.493  -12.228 1.00 0.00 ? 20 GLU A H    4  
ATOM   2705  H  HA   . GLU A 1 20 ? 17.792 -2.032  -14.487 1.00 0.00 ? 20 GLU A HA   4  
ATOM   2706  H  HB2  . GLU A 1 20 ? 18.843 -2.544  -12.325 1.00 0.00 ? 20 GLU A HB2  4  
ATOM   2707  H  HB3  . GLU A 1 20 ? 17.265 -2.986  -11.638 1.00 0.00 ? 20 GLU A HB3  4  
ATOM   2708  H  HG2  . GLU A 1 20 ? 17.071 -4.812  -13.332 1.00 0.00 ? 20 GLU A HG2  4  
ATOM   2709  H  HG3  . GLU A 1 20 ? 18.666 -4.369  -13.965 1.00 0.00 ? 20 GLU A HG3  4  
ATOM   2710  N  N    . CYS A 1 21 ? 14.861 -2.529  -12.962 1.00 0.00 ? 21 CYS A N    4  
ATOM   2711  C  CA   . CYS A 1 21 ? 13.512 -3.058  -13.136 1.00 0.00 ? 21 CYS A CA   4  
ATOM   2712  C  C    . CYS A 1 21 ? 12.489 -1.969  -13.483 1.00 0.00 ? 21 CYS A C    4  
ATOM   2713  O  O    . CYS A 1 21 ? 11.410 -2.303  -13.973 1.00 0.00 ? 21 CYS A O    4  
ATOM   2714  C  CB   . CYS A 1 21 ? 13.090 -3.881  -11.912 1.00 0.00 ? 21 CYS A CB   4  
ATOM   2715  S  SG   . CYS A 1 21 ? 13.045 -3.021  -10.317 1.00 0.00 ? 21 CYS A SG   4  
ATOM   2716  H  H    . CYS A 1 21 ? 15.123 -2.173  -12.054 1.00 0.00 ? 21 CYS A H    4  
ATOM   2717  H  HA   . CYS A 1 21 ? 13.513 -3.762  -13.971 1.00 0.00 ? 21 CYS A HA   4  
ATOM   2718  H  HB2  . CYS A 1 21 ? 12.090 -4.273  -12.102 1.00 0.00 ? 21 CYS A HB2  4  
ATOM   2719  H  HB3  . CYS A 1 21 ? 13.773 -4.727  -11.808 1.00 0.00 ? 21 CYS A HB3  4  
ATOM   2720  N  N    . ASN A 1 22 ? 12.806 -0.689  -13.232 1.00 0.00 ? 22 ASN A N    4  
ATOM   2721  C  CA   . ASN A 1 22 ? 11.954 0.462   -13.531 1.00 0.00 ? 22 ASN A CA   4  
ATOM   2722  C  C    . ASN A 1 22 ? 10.687 0.466   -12.668 1.00 0.00 ? 22 ASN A C    4  
ATOM   2723  O  O    . ASN A 1 22 ? 9.591  0.711   -13.169 1.00 0.00 ? 22 ASN A O    4  
ATOM   2724  C  CB   . ASN A 1 22 ? 11.685 0.563   -15.042 1.00 0.00 ? 22 ASN A CB   4  
ATOM   2725  C  CG   . ASN A 1 22 ? 11.159 1.942   -15.441 1.00 0.00 ? 22 ASN A CG   4  
ATOM   2726  O  OD1  . ASN A 1 22 ? 10.009 2.079   -15.851 1.00 0.00 ? 22 ASN A OD1  4  
ATOM   2727  N  ND2  . ASN A 1 22 ? 12.004 2.970   -15.333 1.00 0.00 ? 22 ASN A ND2  4  
ATOM   2728  H  H    . ASN A 1 22 ? 13.707 -0.478  -12.824 1.00 0.00 ? 22 ASN A H    4  
ATOM   2729  H  HA   . ASN A 1 22 ? 12.510 1.354   -13.260 1.00 0.00 ? 22 ASN A HA   4  
ATOM   2730  H  HB2  . ASN A 1 22 ? 12.620 0.393   -15.581 1.00 0.00 ? 22 ASN A HB2  4  
ATOM   2731  H  HB3  . ASN A 1 22 ? 10.962 -0.194  -15.345 1.00 0.00 ? 22 ASN A HB3  4  
ATOM   2732  H  HD21 . ASN A 1 22 ? 12.949 2.813   -15.006 1.00 0.00 ? 22 ASN A HD21 4  
ATOM   2733  H  HD22 . ASN A 1 22 ? 11.695 3.895   -15.596 1.00 0.00 ? 22 ASN A HD22 4  
ATOM   2734  N  N    . LYS A 1 23 ? 10.844 0.189   -11.366 1.00 0.00 ? 23 LYS A N    4  
ATOM   2735  C  CA   . LYS A 1 23 ? 9.816  0.330   -10.342 1.00 0.00 ? 23 LYS A CA   4  
ATOM   2736  C  C    . LYS A 1 23 ? 10.130 1.534   -9.450  1.00 0.00 ? 23 LYS A C    4  
ATOM   2737  O  O    . LYS A 1 23 ? 11.279 1.966   -9.356  1.00 0.00 ? 23 LYS A O    4  
ATOM   2738  C  CB   . LYS A 1 23 ? 9.734  -0.959  -9.511  1.00 0.00 ? 23 LYS A CB   4  
ATOM   2739  C  CG   . LYS A 1 23 ? 8.920  -2.094  -10.157 1.00 0.00 ? 23 LYS A CG   4  
ATOM   2740  C  CD   . LYS A 1 23 ? 9.366  -2.438  -11.579 1.00 0.00 ? 23 LYS A CD   4  
ATOM   2741  C  CE   . LYS A 1 23 ? 8.779  -3.761  -12.073 1.00 0.00 ? 23 LYS A CE   4  
ATOM   2742  N  NZ   . LYS A 1 23 ? 9.109  -3.981  -13.493 1.00 0.00 ? 23 LYS A NZ   4  
ATOM   2743  H  H    . LYS A 1 23 ? 11.767 -0.035  -11.025 1.00 0.00 ? 23 LYS A H    4  
ATOM   2744  H  HA   . LYS A 1 23 ? 8.841  0.502   -10.801 1.00 0.00 ? 23 LYS A HA   4  
ATOM   2745  H  HB2  . LYS A 1 23 ? 10.745 -1.314  -9.305  1.00 0.00 ? 23 LYS A HB2  4  
ATOM   2746  H  HB3  . LYS A 1 23 ? 9.261  -0.717  -8.562  1.00 0.00 ? 23 LYS A HB3  4  
ATOM   2747  H  HG2  . LYS A 1 23 ? 9.022  -2.980  -9.529  1.00 0.00 ? 23 LYS A HG2  4  
ATOM   2748  H  HG3  . LYS A 1 23 ? 7.868  -1.808  -10.186 1.00 0.00 ? 23 LYS A HG3  4  
ATOM   2749  H  HD2  . LYS A 1 23 ? 9.036  -1.649  -12.252 1.00 0.00 ? 23 LYS A HD2  4  
ATOM   2750  H  HD3  . LYS A 1 23 ? 10.450 -2.508  -11.594 1.00 0.00 ? 23 LYS A HD3  4  
ATOM   2751  H  HE2  . LYS A 1 23 ? 9.187  -4.580  -11.479 1.00 0.00 ? 23 LYS A HE2  4  
ATOM   2752  H  HE3  . LYS A 1 23 ? 7.693  -3.748  -11.962 1.00 0.00 ? 23 LYS A HE3  4  
ATOM   2753  H  HZ1  . LYS A 1 23 ? 8.811  -4.902  -13.780 1.00 0.00 ? 23 LYS A HZ1  4  
ATOM   2754  H  HZ2  . LYS A 1 23 ? 8.643  -3.286  -14.059 1.00 0.00 ? 23 LYS A HZ2  4  
ATOM   2755  H  HZ3  . LYS A 1 23 ? 10.108 -3.885  -13.629 1.00 0.00 ? 23 LYS A HZ3  4  
ATOM   2756  N  N    . ALA A 1 24 ? 9.088  2.054   -8.791  1.00 0.00 ? 24 ALA A N    4  
ATOM   2757  C  CA   . ALA A 1 24 ? 9.093  3.313   -8.060  1.00 0.00 ? 24 ALA A CA   4  
ATOM   2758  C  C    . ALA A 1 24 ? 9.256  3.080   -6.559  1.00 0.00 ? 24 ALA A C    4  
ATOM   2759  O  O    . ALA A 1 24 ? 8.615  2.199   -5.986  1.00 0.00 ? 24 ALA A O    4  
ATOM   2760  C  CB   . ALA A 1 24 ? 7.796  4.074   -8.347  1.00 0.00 ? 24 ALA A CB   4  
ATOM   2761  H  H    . ALA A 1 24 ? 8.206  1.576   -8.866  1.00 0.00 ? 24 ALA A H    4  
ATOM   2762  H  HA   . ALA A 1 24 ? 9.920  3.930   -8.407  1.00 0.00 ? 24 ALA A HA   4  
ATOM   2763  H  HB1  . ALA A 1 24 ? 6.937  3.488   -8.019  1.00 0.00 ? 24 ALA A HB1  4  
ATOM   2764  H  HB2  . ALA A 1 24 ? 7.804  5.025   -7.815  1.00 0.00 ? 24 ALA A HB2  4  
ATOM   2765  H  HB3  . ALA A 1 24 ? 7.712  4.267   -9.418  1.00 0.00 ? 24 ALA A HB3  4  
ATOM   2766  N  N    . PHE A 1 25 ? 10.119 3.894   -5.940  1.00 0.00 ? 25 PHE A N    4  
ATOM   2767  C  CA   . PHE A 1 25 ? 10.592 3.744   -4.574  1.00 0.00 ? 25 PHE A CA   4  
ATOM   2768  C  C    . PHE A 1 25 ? 10.950 5.130   -4.043  1.00 0.00 ? 25 PHE A C    4  
ATOM   2769  O  O    . PHE A 1 25 ? 11.738 5.834   -4.670  1.00 0.00 ? 25 PHE A O    4  
ATOM   2770  C  CB   . PHE A 1 25 ? 11.856 2.865   -4.555  1.00 0.00 ? 25 PHE A CB   4  
ATOM   2771  C  CG   . PHE A 1 25 ? 11.610 1.370   -4.555  1.00 0.00 ? 25 PHE A CG   4  
ATOM   2772  C  CD1  . PHE A 1 25 ? 11.441 0.679   -5.771  1.00 0.00 ? 25 PHE A CD1  4  
ATOM   2773  C  CD2  . PHE A 1 25 ? 11.653 0.653   -3.345  1.00 0.00 ? 25 PHE A CD2  4  
ATOM   2774  C  CE1  . PHE A 1 25 ? 11.255 -0.713  -5.772  1.00 0.00 ? 25 PHE A CE1  4  
ATOM   2775  C  CE2  . PHE A 1 25 ? 11.521 -0.748  -3.353  1.00 0.00 ? 25 PHE A CE2  4  
ATOM   2776  C  CZ   . PHE A 1 25 ? 11.290 -1.427  -4.562  1.00 0.00 ? 25 PHE A CZ   4  
ATOM   2777  H  H    . PHE A 1 25 ? 10.559 4.624   -6.482  1.00 0.00 ? 25 PHE A H    4  
ATOM   2778  H  HA   . PHE A 1 25 ? 9.823  3.300   -3.942  1.00 0.00 ? 25 PHE A HA   4  
ATOM   2779  H  HB2  . PHE A 1 25 ? 12.470 3.107   -5.424  1.00 0.00 ? 25 PHE A HB2  4  
ATOM   2780  H  HB3  . PHE A 1 25 ? 12.444 3.114   -3.667  1.00 0.00 ? 25 PHE A HB3  4  
ATOM   2781  H  HD1  . PHE A 1 25 ? 11.463 1.217   -6.707  1.00 0.00 ? 25 PHE A HD1  4  
ATOM   2782  H  HD2  . PHE A 1 25 ? 11.790 1.174   -2.406  1.00 0.00 ? 25 PHE A HD2  4  
ATOM   2783  H  HE1  . PHE A 1 25 ? 11.116 -1.239  -6.705  1.00 0.00 ? 25 PHE A HE1  4  
ATOM   2784  H  HE2  . PHE A 1 25 ? 11.582 -1.299  -2.425  1.00 0.00 ? 25 PHE A HE2  4  
ATOM   2785  H  HZ   . PHE A 1 25 ? 11.177 -2.501  -4.563  1.00 0.00 ? 25 PHE A HZ   4  
ATOM   2786  N  N    . HIS A 1 26 ? 10.371 5.541   -2.909  1.00 0.00 ? 26 HIS A N    4  
ATOM   2787  C  CA   . HIS A 1 26 ? 10.851 6.730   -2.217  1.00 0.00 ? 26 HIS A CA   4  
ATOM   2788  C  C    . HIS A 1 26 ? 12.173 6.375   -1.529  1.00 0.00 ? 26 HIS A C    4  
ATOM   2789  O  O    . HIS A 1 26 ? 12.500 5.198   -1.370  1.00 0.00 ? 26 HIS A O    4  
ATOM   2790  C  CB   . HIS A 1 26 ? 9.843  7.230   -1.178  1.00 0.00 ? 26 HIS A CB   4  
ATOM   2791  C  CG   . HIS A 1 26 ? 8.507  7.670   -1.719  1.00 0.00 ? 26 HIS A CG   4  
ATOM   2792  N  ND1  . HIS A 1 26 ? 7.352  6.888   -1.748  1.00 0.00 ? 26 HIS A ND1  4  
ATOM   2793  C  CD2  . HIS A 1 26 ? 8.199  8.948   -2.093  1.00 0.00 ? 26 HIS A CD2  4  
ATOM   2794  C  CE1  . HIS A 1 26 ? 6.367  7.731   -2.107  1.00 0.00 ? 26 HIS A CE1  4  
ATOM   2795  N  NE2  . HIS A 1 26 ? 6.844  8.969   -2.326  1.00 0.00 ? 26 HIS A NE2  4  
ATOM   2796  H  H    . HIS A 1 26 ? 9.681  4.963   -2.453  1.00 0.00 ? 26 HIS A H    4  
ATOM   2797  H  HA   . HIS A 1 26 ? 11.026 7.536   -2.928  1.00 0.00 ? 26 HIS A HA   4  
ATOM   2798  H  HB2  . HIS A 1 26 ? 9.687  6.466   -0.420  1.00 0.00 ? 26 HIS A HB2  4  
ATOM   2799  H  HB3  . HIS A 1 26 ? 10.287 8.096   -0.689  1.00 0.00 ? 26 HIS A HB3  4  
ATOM   2800  H  HD2  . HIS A 1 26 ? 8.874  9.790   -2.120  1.00 0.00 ? 26 HIS A HD2  4  
ATOM   2801  H  HE1  . HIS A 1 26 ? 5.327  7.456   -2.205  1.00 0.00 ? 26 HIS A HE1  4  
ATOM   2802  H  HE2  . HIS A 1 26 ? 6.293  9.781   -2.578  1.00 0.00 ? 26 HIS A HE2  4  
ATOM   2803  N  N    . LEU A 1 27 ? 12.916 7.395   -1.090  1.00 0.00 ? 27 LEU A N    4  
ATOM   2804  C  CA   . LEU A 1 27 ? 14.086 7.226   -0.235  1.00 0.00 ? 27 LEU A CA   4  
ATOM   2805  C  C    . LEU A 1 27 ? 13.752 6.335   0.967   1.00 0.00 ? 27 LEU A C    4  
ATOM   2806  O  O    . LEU A 1 27 ? 14.441 5.350   1.232   1.00 0.00 ? 27 LEU A O    4  
ATOM   2807  C  CB   . LEU A 1 27 ? 14.581 8.600   0.238   1.00 0.00 ? 27 LEU A CB   4  
ATOM   2808  C  CG   . LEU A 1 27 ? 15.005 9.542   -0.901  1.00 0.00 ? 27 LEU A CG   4  
ATOM   2809  C  CD1  . LEU A 1 27 ? 15.157 10.960  -0.352  1.00 0.00 ? 27 LEU A CD1  4  
ATOM   2810  C  CD2  . LEU A 1 27 ? 16.332 9.123   -1.540  1.00 0.00 ? 27 LEU A CD2  4  
ATOM   2811  H  H    . LEU A 1 27 ? 12.613 8.337   -1.292  1.00 0.00 ? 27 LEU A H    4  
ATOM   2812  H  HA   . LEU A 1 27 ? 14.863 6.742   -0.820  1.00 0.00 ? 27 LEU A HA   4  
ATOM   2813  H  HB2  . LEU A 1 27 ? 13.769 9.071   0.793   1.00 0.00 ? 27 LEU A HB2  4  
ATOM   2814  H  HB3  . LEU A 1 27 ? 15.426 8.457   0.910   1.00 0.00 ? 27 LEU A HB3  4  
ATOM   2815  H  HG   . LEU A 1 27 ? 14.237 9.566   -1.672  1.00 0.00 ? 27 LEU A HG   4  
ATOM   2816  H  HD11 . LEU A 1 27 ? 15.428 11.630  -1.167  1.00 0.00 ? 27 LEU A HD11 4  
ATOM   2817  H  HD12 . LEU A 1 27 ? 14.213 11.293  0.080   1.00 0.00 ? 27 LEU A HD12 4  
ATOM   2818  H  HD13 . LEU A 1 27 ? 15.934 10.987  0.414   1.00 0.00 ? 27 LEU A HD13 4  
ATOM   2819  H  HD21 . LEU A 1 27 ? 16.276 8.103   -1.904  1.00 0.00 ? 27 LEU A HD21 4  
ATOM   2820  H  HD22 . LEU A 1 27 ? 16.563 9.784   -2.375  1.00 0.00 ? 27 LEU A HD22 4  
ATOM   2821  H  HD23 . LEU A 1 27 ? 17.132 9.182   -0.807  1.00 0.00 ? 27 LEU A HD23 4  
ATOM   2822  N  N    . PHE A 1 28 ? 12.656 6.671   1.654   1.00 0.00 ? 28 PHE A N    4  
ATOM   2823  C  CA   . PHE A 1 28 ? 12.122 5.946   2.799   1.00 0.00 ? 28 PHE A CA   4  
ATOM   2824  C  C    . PHE A 1 28 ? 11.927 4.459   2.495   1.00 0.00 ? 28 PHE A C    4  
ATOM   2825  O  O    . PHE A 1 28 ? 12.203 3.611   3.341   1.00 0.00 ? 28 PHE A O    4  
ATOM   2826  C  CB   . PHE A 1 28 ? 10.786 6.570   3.211   1.00 0.00 ? 28 PHE A CB   4  
ATOM   2827  C  CG   . PHE A 1 28 ? 10.833 8.077   3.370   1.00 0.00 ? 28 PHE A CG   4  
ATOM   2828  C  CD1  . PHE A 1 28 ? 11.471 8.650   4.487   1.00 0.00 ? 28 PHE A CD1  4  
ATOM   2829  C  CD2  . PHE A 1 28 ? 10.354 8.907   2.340   1.00 0.00 ? 28 PHE A CD2  4  
ATOM   2830  C  CE1  . PHE A 1 28 ? 11.580 10.047  4.595   1.00 0.00 ? 28 PHE A CE1  4  
ATOM   2831  C  CE2  . PHE A 1 28 ? 10.527 10.298  2.416   1.00 0.00 ? 28 PHE A CE2  4  
ATOM   2832  C  CZ   . PHE A 1 28 ? 11.087 10.872  3.568   1.00 0.00 ? 28 PHE A CZ   4  
ATOM   2833  H  H    . PHE A 1 28 ? 12.168 7.506   1.371   1.00 0.00 ? 28 PHE A H    4  
ATOM   2834  H  HA   . PHE A 1 28 ? 12.825 6.061   3.621   1.00 0.00 ? 28 PHE A HA   4  
ATOM   2835  H  HB2  . PHE A 1 28 ? 10.047 6.310   2.451   1.00 0.00 ? 28 PHE A HB2  4  
ATOM   2836  H  HB3  . PHE A 1 28 ? 10.465 6.124   4.153   1.00 0.00 ? 28 PHE A HB3  4  
ATOM   2837  H  HD1  . PHE A 1 28 ? 11.878 8.019   5.264   1.00 0.00 ? 28 PHE A HD1  4  
ATOM   2838  H  HD2  . PHE A 1 28 ? 9.849  8.481   1.488   1.00 0.00 ? 28 PHE A HD2  4  
ATOM   2839  H  HE1  . PHE A 1 28 ? 12.044 10.487  5.466   1.00 0.00 ? 28 PHE A HE1  4  
ATOM   2840  H  HE2  . PHE A 1 28 ? 10.194 10.931  1.607   1.00 0.00 ? 28 PHE A HE2  4  
ATOM   2841  H  HZ   . PHE A 1 28 ? 11.117 11.945  3.662   1.00 0.00 ? 28 PHE A HZ   4  
ATOM   2842  N  N    . CYS A 1 29 ? 11.422 4.151   1.295   1.00 0.00 ? 29 CYS A N    4  
ATOM   2843  C  CA   . CYS A 1 29 ? 11.046 2.804   0.899   1.00 0.00 ? 29 CYS A CA   4  
ATOM   2844  C  C    . CYS A 1 29 ? 12.281 1.934   0.646   1.00 0.00 ? 29 CYS A C    4  
ATOM   2845  O  O    . CYS A 1 29 ? 12.191 0.712   0.752   1.00 0.00 ? 29 CYS A O    4  
ATOM   2846  C  CB   . CYS A 1 29 ? 10.120 2.870   -0.317  1.00 0.00 ? 29 CYS A CB   4  
ATOM   2847  S  SG   . CYS A 1 29 ? 8.650  3.894   -0.039  1.00 0.00 ? 29 CYS A SG   4  
ATOM   2848  H  H    . CYS A 1 29 ? 11.302 4.888   0.614   1.00 0.00 ? 29 CYS A H    4  
ATOM   2849  H  HA   . CYS A 1 29 ? 10.479 2.351   1.715   1.00 0.00 ? 29 CYS A HA   4  
ATOM   2850  H  HB2  . CYS A 1 29 ? 10.671 3.277   -1.164  1.00 0.00 ? 29 CYS A HB2  4  
ATOM   2851  H  HB3  . CYS A 1 29 ? 9.792  1.861   -0.570  1.00 0.00 ? 29 CYS A HB3  4  
ATOM   2852  N  N    . LEU A 1 30 ? 13.427 2.548   0.316   1.00 0.00 ? 30 LEU A N    4  
ATOM   2853  C  CA   . LEU A 1 30 ? 14.706 1.851   0.283   1.00 0.00 ? 30 LEU A CA   4  
ATOM   2854  C  C    . LEU A 1 30 ? 15.123 1.522   1.716   1.00 0.00 ? 30 LEU A C    4  
ATOM   2855  O  O    . LEU A 1 30 ? 15.363 0.360   2.041   1.00 0.00 ? 30 LEU A O    4  
ATOM   2856  C  CB   . LEU A 1 30 ? 15.777 2.683   -0.439  1.00 0.00 ? 30 LEU A CB   4  
ATOM   2857  C  CG   . LEU A 1 30 ? 15.424 3.041   -1.891  1.00 0.00 ? 30 LEU A CG   4  
ATOM   2858  C  CD1  . LEU A 1 30 ? 16.546 3.897   -2.485  1.00 0.00 ? 30 LEU A CD1  4  
ATOM   2859  C  CD2  . LEU A 1 30 ? 15.247 1.796   -2.764  1.00 0.00 ? 30 LEU A CD2  4  
ATOM   2860  H  H    . LEU A 1 30 ? 13.437 3.553   0.196   1.00 0.00 ? 30 LEU A H    4  
ATOM   2861  H  HA   . LEU A 1 30 ? 14.594 0.909   -0.243  1.00 0.00 ? 30 LEU A HA   4  
ATOM   2862  H  HB2  . LEU A 1 30 ? 15.940 3.605   0.116   1.00 0.00 ? 30 LEU A HB2  4  
ATOM   2863  H  HB3  . LEU A 1 30 ? 16.706 2.112   -0.446  1.00 0.00 ? 30 LEU A HB3  4  
ATOM   2864  H  HG   . LEU A 1 30 ? 14.503 3.618   -1.909  1.00 0.00 ? 30 LEU A HG   4  
ATOM   2865  H  HD11 . LEU A 1 30 ? 17.494 3.361   -2.437  1.00 0.00 ? 30 LEU A HD11 4  
ATOM   2866  H  HD12 . LEU A 1 30 ? 16.322 4.126   -3.526  1.00 0.00 ? 30 LEU A HD12 4  
ATOM   2867  H  HD13 . LEU A 1 30 ? 16.632 4.829   -1.927  1.00 0.00 ? 30 LEU A HD13 4  
ATOM   2868  H  HD21 . LEU A 1 30 ? 14.397 1.204   -2.430  1.00 0.00 ? 30 LEU A HD21 4  
ATOM   2869  H  HD22 . LEU A 1 30 ? 15.070 2.092   -3.798  1.00 0.00 ? 30 LEU A HD22 4  
ATOM   2870  H  HD23 . LEU A 1 30 ? 16.155 1.198   -2.709  1.00 0.00 ? 30 LEU A HD23 4  
ATOM   2871  N  N    . ARG A 1 31 ? 15.198 2.552   2.565   1.00 0.00 ? 31 ARG A N    4  
ATOM   2872  C  CA   . ARG A 1 31 ? 15.360 2.421   4.009   1.00 0.00 ? 31 ARG A CA   4  
ATOM   2873  C  C    . ARG A 1 31 ? 14.918 3.731   4.674   1.00 0.00 ? 31 ARG A C    4  
ATOM   2874  O  O    . ARG A 1 31 ? 15.199 4.801   4.135   1.00 0.00 ? 31 ARG A O    4  
ATOM   2875  C  CB   . ARG A 1 31 ? 16.805 2.031   4.377   1.00 0.00 ? 31 ARG A CB   4  
ATOM   2876  C  CG   . ARG A 1 31 ? 17.856 3.063   3.952   1.00 0.00 ? 31 ARG A CG   4  
ATOM   2877  C  CD   . ARG A 1 31 ? 19.262 2.599   4.349   1.00 0.00 ? 31 ARG A CD   4  
ATOM   2878  N  NE   . ARG A 1 31 ? 20.307 3.484   3.812   1.00 0.00 ? 31 ARG A NE   4  
ATOM   2879  C  CZ   . ARG A 1 31 ? 20.668 4.682   4.309   1.00 0.00 ? 31 ARG A CZ   4  
ATOM   2880  N  NH1  . ARG A 1 31 ? 20.050 5.202   5.377   1.00 0.00 ? 31 ARG A NH1  4  
ATOM   2881  N  NH2  . ARG A 1 31 ? 21.660 5.362   3.721   1.00 0.00 ? 31 ARG A NH2  4  
ATOM   2882  H  H    . ARG A 1 31 ? 15.001 3.475   2.200   1.00 0.00 ? 31 ARG A H    4  
ATOM   2883  H  HA   . ARG A 1 31 ? 14.697 1.618   4.332   1.00 0.00 ? 31 ARG A HA   4  
ATOM   2884  H  HB2  . ARG A 1 31 ? 16.876 1.900   5.456   1.00 0.00 ? 31 ARG A HB2  4  
ATOM   2885  H  HB3  . ARG A 1 31 ? 17.045 1.074   3.911   1.00 0.00 ? 31 ARG A HB3  4  
ATOM   2886  H  HG2  . ARG A 1 31 ? 17.813 3.199   2.871   1.00 0.00 ? 31 ARG A HG2  4  
ATOM   2887  H  HG3  . ARG A 1 31 ? 17.650 4.008   4.451   1.00 0.00 ? 31 ARG A HG3  4  
ATOM   2888  H  HD2  . ARG A 1 31 ? 19.343 2.532   5.435   1.00 0.00 ? 31 ARG A HD2  4  
ATOM   2889  H  HD3  . ARG A 1 31 ? 19.431 1.604   3.936   1.00 0.00 ? 31 ARG A HD3  4  
ATOM   2890  H  HE   . ARG A 1 31 ? 20.797 3.145   2.997   1.00 0.00 ? 31 ARG A HE   4  
ATOM   2891  H  HH11 . ARG A 1 31 ? 19.297 4.698   5.821   1.00 0.00 ? 31 ARG A HH11 4  
ATOM   2892  H  HH12 . ARG A 1 31 ? 20.302 6.121   5.717   1.00 0.00 ? 31 ARG A HH12 4  
ATOM   2893  H  HH21 . ARG A 1 31 ? 22.135 4.976   2.918   1.00 0.00 ? 31 ARG A HH21 4  
ATOM   2894  H  HH22 . ARG A 1 31 ? 21.914 6.294   4.037   1.00 0.00 ? 31 ARG A HH22 4  
ATOM   2895  N  N    . PRO A 1 32 ? 14.223 3.675   5.824   1.00 0.00 ? 32 PRO A N    4  
ATOM   2896  C  CA   . PRO A 1 32 ? 13.571 4.832   6.428   1.00 0.00 ? 32 PRO A CA   4  
ATOM   2897  C  C    . PRO A 1 32 ? 14.571 5.950   6.736   1.00 0.00 ? 32 PRO A C    4  
ATOM   2898  O  O    . PRO A 1 32 ? 14.260 7.124   6.546   1.00 0.00 ? 32 PRO A O    4  
ATOM   2899  C  CB   . PRO A 1 32 ? 12.889 4.309   7.695   1.00 0.00 ? 32 PRO A CB   4  
ATOM   2900  C  CG   . PRO A 1 32 ? 13.725 3.088   8.074   1.00 0.00 ? 32 PRO A CG   4  
ATOM   2901  C  CD   . PRO A 1 32 ? 14.137 2.526   6.713   1.00 0.00 ? 32 PRO A CD   4  
ATOM   2902  H  HA   . PRO A 1 32 ? 12.803 5.219   5.758   1.00 0.00 ? 32 PRO A HA   4  
ATOM   2903  H  HB2  . PRO A 1 32 ? 12.854 5.051   8.494   1.00 0.00 ? 32 PRO A HB2  4  
ATOM   2904  H  HB3  . PRO A 1 32 ? 11.878 3.980   7.445   1.00 0.00 ? 32 PRO A HB3  4  
ATOM   2905  H  HG2  . PRO A 1 32 ? 14.610 3.408   8.624   1.00 0.00 ? 32 PRO A HG2  4  
ATOM   2906  H  HG3  . PRO A 1 32 ? 13.158 2.366   8.663   1.00 0.00 ? 32 PRO A HG3  4  
ATOM   2907  H  HD2  . PRO A 1 32 ? 15.081 1.991   6.808   1.00 0.00 ? 32 PRO A HD2  4  
ATOM   2908  H  HD3  . PRO A 1 32 ? 13.361 1.854   6.348   1.00 0.00 ? 32 PRO A HD3  4  
ATOM   2909  N  N    . ALA A 1 33 ? 15.779 5.583   7.184   1.00 0.00 ? 33 ALA A N    4  
ATOM   2910  C  CA   . ALA A 1 33 ? 16.810 6.523   7.594   1.00 0.00 ? 33 ALA A CA   4  
ATOM   2911  C  C    . ALA A 1 33 ? 17.645 7.044   6.415   1.00 0.00 ? 33 ALA A C    4  
ATOM   2912  O  O    . ALA A 1 33 ? 18.684 7.660   6.646   1.00 0.00 ? 33 ALA A O    4  
ATOM   2913  C  CB   . ALA A 1 33 ? 17.700 5.852   8.644   1.00 0.00 ? 33 ALA A CB   4  
ATOM   2914  H  H    . ALA A 1 33 ? 15.975 4.599   7.297   1.00 0.00 ? 33 ALA A H    4  
ATOM   2915  H  HA   . ALA A 1 33 ? 16.332 7.376   8.072   1.00 0.00 ? 33 ALA A HA   4  
ATOM   2916  H  HB1  . ALA A 1 33 ? 18.427 6.567   9.032   1.00 0.00 ? 33 ALA A HB1  4  
ATOM   2917  H  HB2  . ALA A 1 33 ? 17.087 5.495   9.471   1.00 0.00 ? 33 ALA A HB2  4  
ATOM   2918  H  HB3  . ALA A 1 33 ? 18.229 5.007   8.199   1.00 0.00 ? 33 ALA A HB3  4  
ATOM   2919  N  N    . LEU A 1 34 ? 17.229 6.800   5.162   1.00 0.00 ? 34 LEU A N    4  
ATOM   2920  C  CA   . LEU A 1 34 ? 17.833 7.436   3.999   1.00 0.00 ? 34 LEU A CA   4  
ATOM   2921  C  C    . LEU A 1 34 ? 17.302 8.865   3.898   1.00 0.00 ? 34 LEU A C    4  
ATOM   2922  O  O    . LEU A 1 34 ? 16.280 9.114   3.262   1.00 0.00 ? 34 LEU A O    4  
ATOM   2923  C  CB   . LEU A 1 34 ? 17.559 6.605   2.735   1.00 0.00 ? 34 LEU A CB   4  
ATOM   2924  C  CG   . LEU A 1 34 ? 18.179 7.174   1.449   1.00 0.00 ? 34 LEU A CG   4  
ATOM   2925  C  CD1  . LEU A 1 34 ? 19.698 7.336   1.541   1.00 0.00 ? 34 LEU A CD1  4  
ATOM   2926  C  CD2  . LEU A 1 34 ? 17.870 6.232   0.282   1.00 0.00 ? 34 LEU A CD2  4  
ATOM   2927  H  H    . LEU A 1 34 ? 16.388 6.260   5.006   1.00 0.00 ? 34 LEU A H    4  
ATOM   2928  H  HA   . LEU A 1 34 ? 18.912 7.464   4.144   1.00 0.00 ? 34 LEU A HA   4  
ATOM   2929  H  HB2  . LEU A 1 34 ? 17.967 5.608   2.885   1.00 0.00 ? 34 LEU A HB2  4  
ATOM   2930  H  HB3  . LEU A 1 34 ? 16.482 6.520   2.595   1.00 0.00 ? 34 LEU A HB3  4  
ATOM   2931  H  HG   . LEU A 1 34 ? 17.737 8.145   1.236   1.00 0.00 ? 34 LEU A HG   4  
ATOM   2932  H  HD11 . LEU A 1 34 ? 20.158 6.382   1.788   1.00 0.00 ? 34 LEU A HD11 4  
ATOM   2933  H  HD12 . LEU A 1 34 ? 20.089 7.675   0.581   1.00 0.00 ? 34 LEU A HD12 4  
ATOM   2934  H  HD13 . LEU A 1 34 ? 19.953 8.078   2.294   1.00 0.00 ? 34 LEU A HD13 4  
ATOM   2935  H  HD21 . LEU A 1 34 ? 16.795 6.092   0.202   1.00 0.00 ? 34 LEU A HD21 4  
ATOM   2936  H  HD22 . LEU A 1 34 ? 18.243 6.657   -0.649  1.00 0.00 ? 34 LEU A HD22 4  
ATOM   2937  H  HD23 . LEU A 1 34 ? 18.340 5.262   0.447   1.00 0.00 ? 34 LEU A HD23 4  
ATOM   2938  N  N    . TYR A 1 35 ? 18.000 9.793   4.558   1.00 0.00 ? 35 TYR A N    4  
ATOM   2939  C  CA   . TYR A 1 35 ? 17.794 11.230  4.426   1.00 0.00 ? 35 TYR A CA   4  
ATOM   2940  C  C    . TYR A 1 35 ? 18.676 11.801  3.311   1.00 0.00 ? 35 TYR A C    4  
ATOM   2941  O  O    . TYR A 1 35 ? 18.370 12.856  2.758   1.00 0.00 ? 35 TYR A O    4  
ATOM   2942  C  CB   . TYR A 1 35 ? 18.091 11.899  5.771   1.00 0.00 ? 35 TYR A CB   4  
ATOM   2943  C  CG   . TYR A 1 35 ? 17.322 11.291  6.930   1.00 0.00 ? 35 TYR A CG   4  
ATOM   2944  C  CD1  . TYR A 1 35 ? 15.916 11.352  6.946   1.00 0.00 ? 35 TYR A CD1  4  
ATOM   2945  C  CD2  . TYR A 1 35 ? 17.999 10.569  7.931   1.00 0.00 ? 35 TYR A CD2  4  
ATOM   2946  C  CE1  . TYR A 1 35 ? 15.191 10.701  7.959   1.00 0.00 ? 35 TYR A CE1  4  
ATOM   2947  C  CE2  . TYR A 1 35 ? 17.275 9.933   8.955   1.00 0.00 ? 35 TYR A CE2  4  
ATOM   2948  C  CZ   . TYR A 1 35 ? 15.870 9.995   8.966   1.00 0.00 ? 35 TYR A CZ   4  
ATOM   2949  O  OH   . TYR A 1 35 ? 15.164 9.352   9.940   1.00 0.00 ? 35 TYR A OH   4  
ATOM   2950  H  H    . TYR A 1 35 ? 18.820 9.494   5.073   1.00 0.00 ? 35 TYR A H    4  
ATOM   2951  H  HA   . TYR A 1 35 ? 16.754 11.432  4.169   1.00 0.00 ? 35 TYR A HA   4  
ATOM   2952  H  HB2  . TYR A 1 35 ? 19.163 11.818  5.969   1.00 0.00 ? 35 TYR A HB2  4  
ATOM   2953  H  HB3  . TYR A 1 35 ? 17.833 12.957  5.701   1.00 0.00 ? 35 TYR A HB3  4  
ATOM   2954  H  HD1  . TYR A 1 35 ? 15.386 11.889  6.172   1.00 0.00 ? 35 TYR A HD1  4  
ATOM   2955  H  HD2  . TYR A 1 35 ? 19.076 10.487  7.913   1.00 0.00 ? 35 TYR A HD2  4  
ATOM   2956  H  HE1  . TYR A 1 35 ? 14.112 10.739  7.958   1.00 0.00 ? 35 TYR A HE1  4  
ATOM   2957  H  HE2  . TYR A 1 35 ? 17.802 9.377   9.716   1.00 0.00 ? 35 TYR A HE2  4  
ATOM   2958  H  HH   . TYR A 1 35 ? 15.721 8.894   10.573  1.00 0.00 ? 35 TYR A HH   4  
ATOM   2959  N  N    . GLU A 1 36 ? 19.751 11.084  2.964   1.00 0.00 ? 36 GLU A N    4  
ATOM   2960  C  CA   . GLU A 1 36 ? 20.627 11.388  1.846   1.00 0.00 ? 36 GLU A CA   4  
ATOM   2961  C  C    . GLU A 1 36 ? 19.873 11.139  0.536   1.00 0.00 ? 36 GLU A C    4  
ATOM   2962  O  O    . GLU A 1 36 ? 18.933 10.347  0.510   1.00 0.00 ? 36 GLU A O    4  
ATOM   2963  C  CB   . GLU A 1 36 ? 21.892 10.511  1.909   1.00 0.00 ? 36 GLU A CB   4  
ATOM   2964  C  CG   . GLU A 1 36 ? 22.490 10.336  3.318   1.00 0.00 ? 36 GLU A CG   4  
ATOM   2965  C  CD   . GLU A 1 36 ? 21.906 9.136   4.073   1.00 0.00 ? 36 GLU A CD   4  
ATOM   2966  O  OE1  . GLU A 1 36 ? 22.453 8.026   3.894   1.00 0.00 ? 36 GLU A OE1  4  
ATOM   2967  O  OE2  . GLU A 1 36 ? 20.911 9.336   4.803   1.00 0.00 ? 36 GLU A OE2  4  
ATOM   2968  H  H    . GLU A 1 36 ? 19.974 10.265  3.512   1.00 0.00 ? 36 GLU A H    4  
ATOM   2969  H  HA   . GLU A 1 36 ? 20.921 12.435  1.914   1.00 0.00 ? 36 GLU A HA   4  
ATOM   2970  H  HB2  . GLU A 1 36 ? 21.685 9.522   1.497   1.00 0.00 ? 36 GLU A HB2  4  
ATOM   2971  H  HB3  . GLU A 1 36 ? 22.643 10.980  1.274   1.00 0.00 ? 36 GLU A HB3  4  
ATOM   2972  H  HG2  . GLU A 1 36 ? 23.561 10.160  3.210   1.00 0.00 ? 36 GLU A HG2  4  
ATOM   2973  H  HG3  . GLU A 1 36 ? 22.358 11.250  3.899   1.00 0.00 ? 36 GLU A HG3  4  
ATOM   2974  N  N    . VAL A 1 37 ? 20.279 11.816  -0.545  1.00 0.00 ? 37 VAL A N    4  
ATOM   2975  C  CA   . VAL A 1 37 ? 19.590 11.790  -1.832  1.00 0.00 ? 37 VAL A CA   4  
ATOM   2976  C  C    . VAL A 1 37 ? 20.592 11.358  -2.908  1.00 0.00 ? 37 VAL A C    4  
ATOM   2977  O  O    . VAL A 1 37 ? 21.303 12.207  -3.444  1.00 0.00 ? 37 VAL A O    4  
ATOM   2978  C  CB   . VAL A 1 37 ? 18.983 13.175  -2.134  1.00 0.00 ? 37 VAL A CB   4  
ATOM   2979  C  CG1  . VAL A 1 37 ? 18.157 13.126  -3.427  1.00 0.00 ? 37 VAL A CG1  4  
ATOM   2980  C  CG2  . VAL A 1 37 ? 18.081 13.658  -0.989  1.00 0.00 ? 37 VAL A CG2  4  
ATOM   2981  H  H    . VAL A 1 37 ? 21.075 12.431  -0.460  1.00 0.00 ? 37 VAL A H    4  
ATOM   2982  H  HA   . VAL A 1 37 ? 18.758 11.088  -1.817  1.00 0.00 ? 37 VAL A HA   4  
ATOM   2983  H  HB   . VAL A 1 37 ? 19.783 13.905  -2.255  1.00 0.00 ? 37 VAL A HB   4  
ATOM   2984  H  HG11 . VAL A 1 37 ? 17.352 12.397  -3.325  1.00 0.00 ? 37 VAL A HG11 4  
ATOM   2985  H  HG12 . VAL A 1 37 ? 17.725 14.107  -3.627  1.00 0.00 ? 37 VAL A HG12 4  
ATOM   2986  H  HG13 . VAL A 1 37 ? 18.783 12.848  -4.275  1.00 0.00 ? 37 VAL A HG13 4  
ATOM   2987  H  HG21 . VAL A 1 37 ? 18.669 13.842  -0.090  1.00 0.00 ? 37 VAL A HG21 4  
ATOM   2988  H  HG22 . VAL A 1 37 ? 17.592 14.590  -1.274  1.00 0.00 ? 37 VAL A HG22 4  
ATOM   2989  H  HG23 . VAL A 1 37 ? 17.321 12.910  -0.771  1.00 0.00 ? 37 VAL A HG23 4  
ATOM   2990  N  N    . PRO A 1 38 ? 20.669 10.058  -3.239  1.00 0.00 ? 38 PRO A N    4  
ATOM   2991  C  CA   . PRO A 1 38 ? 21.563 9.562   -4.268  1.00 0.00 ? 38 PRO A CA   4  
ATOM   2992  C  C    . PRO A 1 38 ? 20.771 9.394   -5.561  1.00 0.00 ? 38 PRO A C    4  
ATOM   2993  O  O    . PRO A 1 38 ? 20.425 8.274   -5.933  1.00 0.00 ? 38 PRO A O    4  
ATOM   2994  C  CB   . PRO A 1 38 ? 22.064 8.226   -3.725  1.00 0.00 ? 38 PRO A CB   4  
ATOM   2995  C  CG   . PRO A 1 38 ? 20.849 7.685   -2.971  1.00 0.00 ? 38 PRO A CG   4  
ATOM   2996  C  CD   . PRO A 1 38 ? 20.122 8.940   -2.479  1.00 0.00 ? 38 PRO A CD   4  
ATOM   2997  H  HA   . PRO A 1 38 ? 22.419 10.215  -4.444  1.00 0.00 ? 38 PRO A HA   4  
ATOM   2998  H  HB2  . PRO A 1 38 ? 22.416 7.553   -4.507  1.00 0.00 ? 38 PRO A HB2  4  
ATOM   2999  H  HB3  . PRO A 1 38 ? 22.873 8.420   -3.025  1.00 0.00 ? 38 PRO A HB3  4  
ATOM   3000  H  HG2  . PRO A 1 38 ? 20.213 7.134   -3.663  1.00 0.00 ? 38 PRO A HG2  4  
ATOM   3001  H  HG3  . PRO A 1 38 ? 21.133 7.038   -2.141  1.00 0.00 ? 38 PRO A HG3  4  
ATOM   3002  H  HD2  . PRO A 1 38 ? 19.055 8.828   -2.665  1.00 0.00 ? 38 PRO A HD2  4  
ATOM   3003  H  HD3  . PRO A 1 38 ? 20.297 9.064   -1.414  1.00 0.00 ? 38 PRO A HD3  4  
ATOM   3004  N  N    . ASP A 1 39 ? 20.489 10.505  -6.253  1.00 0.00 ? 39 ASP A N    4  
ATOM   3005  C  CA   . ASP A 1 39 ? 19.828 10.480  -7.550  1.00 0.00 ? 39 ASP A CA   4  
ATOM   3006  C  C    . ASP A 1 39 ? 20.822 10.041  -8.633  1.00 0.00 ? 39 ASP A C    4  
ATOM   3007  O  O    . ASP A 1 39 ? 21.173 10.804  -9.532  1.00 0.00 ? 39 ASP A O    4  
ATOM   3008  C  CB   . ASP A 1 39 ? 19.191 11.849  -7.832  1.00 0.00 ? 39 ASP A CB   4  
ATOM   3009  C  CG   . ASP A 1 39 ? 18.329 11.839  -9.093  1.00 0.00 ? 39 ASP A CG   4  
ATOM   3010  O  OD1  . ASP A 1 39 ? 17.601 10.839  -9.280  1.00 0.00 ? 39 ASP A OD1  4  
ATOM   3011  O  OD2  . ASP A 1 39 ? 18.387 12.843  -9.833  1.00 0.00 ? 39 ASP A OD2  4  
ATOM   3012  H  H    . ASP A 1 39 ? 20.786 11.399  -5.888  1.00 0.00 ? 39 ASP A H    4  
ATOM   3013  H  HA   . ASP A 1 39 ? 19.023 9.745   -7.503  1.00 0.00 ? 39 ASP A HA   4  
ATOM   3014  H  HB2  . ASP A 1 39 ? 18.552 12.121  -6.992  1.00 0.00 ? 39 ASP A HB2  4  
ATOM   3015  H  HB3  . ASP A 1 39 ? 19.973 12.603  -7.927  1.00 0.00 ? 39 ASP A HB3  4  
ATOM   3016  N  N    . GLY A 1 40 ? 21.274 8.790   -8.521  1.00 0.00 ? 40 GLY A N    4  
ATOM   3017  C  CA   . GLY A 1 40 ? 22.364 8.216   -9.284  1.00 0.00 ? 40 GLY A CA   4  
ATOM   3018  C  C    . GLY A 1 40 ? 22.422 6.712   -9.022  1.00 0.00 ? 40 GLY A C    4  
ATOM   3019  O  O    . GLY A 1 40 ? 22.446 5.921   -9.963  1.00 0.00 ? 40 GLY A O    4  
ATOM   3020  H  H    . GLY A 1 40 ? 20.948 8.253   -7.728  1.00 0.00 ? 40 GLY A H    4  
ATOM   3021  H  HA2  . GLY A 1 40 ? 22.211 8.400   -10.349 1.00 0.00 ? 40 GLY A HA2  4  
ATOM   3022  H  HA3  . GLY A 1 40 ? 23.301 8.670   -8.964  1.00 0.00 ? 40 GLY A HA3  4  
ATOM   3023  N  N    . GLU A 1 41 ? 22.409 6.323   -7.738  1.00 0.00 ? 41 GLU A N    4  
ATOM   3024  C  CA   . GLU A 1 41 ? 22.358 4.933   -7.302  1.00 0.00 ? 41 GLU A CA   4  
ATOM   3025  C  C    . GLU A 1 41 ? 20.921 4.408   -7.400  1.00 0.00 ? 41 GLU A C    4  
ATOM   3026  O  O    . GLU A 1 41 ? 20.316 4.038   -6.394  1.00 0.00 ? 41 GLU A O    4  
ATOM   3027  C  CB   . GLU A 1 41 ? 22.904 4.819   -5.872  1.00 0.00 ? 41 GLU A CB   4  
ATOM   3028  C  CG   . GLU A 1 41 ? 24.342 5.342   -5.755  1.00 0.00 ? 41 GLU A CG   4  
ATOM   3029  C  CD   . GLU A 1 41 ? 24.847 5.229   -4.320  1.00 0.00 ? 41 GLU A CD   4  
ATOM   3030  O  OE1  . GLU A 1 41 ? 25.244 4.105   -3.945  1.00 0.00 ? 41 GLU A OE1  4  
ATOM   3031  O  OE2  . GLU A 1 41 ? 24.816 6.266   -3.623  1.00 0.00 ? 41 GLU A OE2  4  
ATOM   3032  H  H    . GLU A 1 41 ? 22.395 7.031   -7.017  1.00 0.00 ? 41 GLU A H    4  
ATOM   3033  H  HA   . GLU A 1 41 ? 22.992 4.325   -7.951  1.00 0.00 ? 41 GLU A HA   4  
ATOM   3034  H  HB2  . GLU A 1 41 ? 22.263 5.376   -5.189  1.00 0.00 ? 41 GLU A HB2  4  
ATOM   3035  H  HB3  . GLU A 1 41 ? 22.893 3.769   -5.573  1.00 0.00 ? 41 GLU A HB3  4  
ATOM   3036  H  HG2  . GLU A 1 41 ? 24.993 4.760   -6.408  1.00 0.00 ? 41 GLU A HG2  4  
ATOM   3037  H  HG3  . GLU A 1 41 ? 24.391 6.388   -6.057  1.00 0.00 ? 41 GLU A HG3  4  
ATOM   3038  N  N    . TRP A 1 42 ? 20.381 4.377   -8.622  1.00 0.00 ? 42 TRP A N    4  
ATOM   3039  C  CA   . TRP A 1 42 ? 19.014 3.972   -8.908  1.00 0.00 ? 42 TRP A CA   4  
ATOM   3040  C  C    . TRP A 1 42 ? 18.909 2.448   -8.828  1.00 0.00 ? 42 TRP A C    4  
ATOM   3041  O  O    . TRP A 1 42 ? 18.979 1.748   -9.839  1.00 0.00 ? 42 TRP A O    4  
ATOM   3042  C  CB   . TRP A 1 42 ? 18.594 4.522   -10.277 1.00 0.00 ? 42 TRP A CB   4  
ATOM   3043  C  CG   . TRP A 1 42 ? 18.087 5.932   -10.300 1.00 0.00 ? 42 TRP A CG   4  
ATOM   3044  C  CD1  . TRP A 1 42 ? 18.516 6.953   -9.524  1.00 0.00 ? 42 TRP A CD1  4  
ATOM   3045  C  CD2  . TRP A 1 42 ? 17.010 6.480   -11.119 1.00 0.00 ? 42 TRP A CD2  4  
ATOM   3046  N  NE1  . TRP A 1 42 ? 17.784 8.087   -9.806  1.00 0.00 ? 42 TRP A NE1  4  
ATOM   3047  C  CE2  . TRP A 1 42 ? 16.832 7.852   -10.774 1.00 0.00 ? 42 TRP A CE2  4  
ATOM   3048  C  CE3  . TRP A 1 42 ? 16.159 5.955   -12.117 1.00 0.00 ? 42 TRP A CE3  4  
ATOM   3049  C  CZ2  . TRP A 1 42 ? 15.858 8.660   -11.381 1.00 0.00 ? 42 TRP A CZ2  4  
ATOM   3050  C  CZ3  . TRP A 1 42 ? 15.189 6.760   -12.743 1.00 0.00 ? 42 TRP A CZ3  4  
ATOM   3051  C  CH2  . TRP A 1 42 ? 15.030 8.106   -12.369 1.00 0.00 ? 42 TRP A CH2  4  
ATOM   3052  H  H    . TRP A 1 42 ? 20.950 4.687   -9.400  1.00 0.00 ? 42 TRP A H    4  
ATOM   3053  H  HA   . TRP A 1 42 ? 18.339 4.393   -8.160  1.00 0.00 ? 42 TRP A HA   4  
ATOM   3054  H  HB2  . TRP A 1 42 ? 19.425 4.431   -10.979 1.00 0.00 ? 42 TRP A HB2  4  
ATOM   3055  H  HB3  . TRP A 1 42 ? 17.770 3.913   -10.643 1.00 0.00 ? 42 TRP A HB3  4  
ATOM   3056  H  HD1  . TRP A 1 42 ? 19.297 6.892   -8.782  1.00 0.00 ? 42 TRP A HD1  4  
ATOM   3057  H  HE1  . TRP A 1 42 ? 17.942 8.982   -9.357  1.00 0.00 ? 42 TRP A HE1  4  
ATOM   3058  H  HE3  . TRP A 1 42 ? 16.257 4.920   -12.407 1.00 0.00 ? 42 TRP A HE3  4  
ATOM   3059  H  HZ2  . TRP A 1 42 ? 15.753 9.696   -11.096 1.00 0.00 ? 42 TRP A HZ2  4  
ATOM   3060  H  HZ3  . TRP A 1 42 ? 14.554 6.337   -13.507 1.00 0.00 ? 42 TRP A HZ3  4  
ATOM   3061  H  HH2  . TRP A 1 42 ? 14.275 8.715   -12.846 1.00 0.00 ? 42 TRP A HH2  4  
ATOM   3062  N  N    . GLN A 1 43 ? 18.732 1.949   -7.600  1.00 0.00 ? 43 GLN A N    4  
ATOM   3063  C  CA   . GLN A 1 43 ? 18.550 0.544   -7.275  1.00 0.00 ? 43 GLN A CA   4  
ATOM   3064  C  C    . GLN A 1 43 ? 17.422 0.395   -6.252  1.00 0.00 ? 43 GLN A C    4  
ATOM   3065  O  O    . GLN A 1 43 ? 16.949 1.380   -5.687  1.00 0.00 ? 43 GLN A O    4  
ATOM   3066  C  CB   . GLN A 1 43 ? 19.860 -0.018  -6.704  1.00 0.00 ? 43 GLN A CB   4  
ATOM   3067  C  CG   . GLN A 1 43 ? 20.965 -0.192  -7.754  1.00 0.00 ? 43 GLN A CG   4  
ATOM   3068  C  CD   . GLN A 1 43 ? 20.662 -1.340  -8.714  1.00 0.00 ? 43 GLN A CD   4  
ATOM   3069  O  OE1  . GLN A 1 43 ? 21.021 -2.484  -8.437  1.00 0.00 ? 43 GLN A OE1  4  
ATOM   3070  N  NE2  . GLN A 1 43 ? 20.015 -1.045  -9.843  1.00 0.00 ? 43 GLN A NE2  4  
ATOM   3071  H  H    . GLN A 1 43 ? 18.732 2.598   -6.825  1.00 0.00 ? 43 GLN A H    4  
ATOM   3072  H  HA   . GLN A 1 43 ? 18.260 -0.016  -8.161  1.00 0.00 ? 43 GLN A HA   4  
ATOM   3073  H  HB2  . GLN A 1 43 ? 20.219 0.653   -5.922  1.00 0.00 ? 43 GLN A HB2  4  
ATOM   3074  H  HB3  . GLN A 1 43 ? 19.669 -0.991  -6.251  1.00 0.00 ? 43 GLN A HB3  4  
ATOM   3075  H  HG2  . GLN A 1 43 ? 21.122 0.735   -8.305  1.00 0.00 ? 43 GLN A HG2  4  
ATOM   3076  H  HG3  . GLN A 1 43 ? 21.891 -0.430  -7.230  1.00 0.00 ? 43 GLN A HG3  4  
ATOM   3077  H  HE21 . GLN A 1 43 ? 19.725 -0.089  -10.024 1.00 0.00 ? 43 GLN A HE21 4  
ATOM   3078  H  HE22 . GLN A 1 43 ? 19.820 -1.781  -10.508 1.00 0.00 ? 43 GLN A HE22 4  
ATOM   3079  N  N    . CYS A 1 44 ? 16.993 -0.853  -6.033  1.00 0.00 ? 44 CYS A N    4  
ATOM   3080  C  CA   . CYS A 1 44 ? 16.098 -1.245  -4.955  1.00 0.00 ? 44 CYS A CA   4  
ATOM   3081  C  C    . CYS A 1 44 ? 16.608 -2.557  -4.354  1.00 0.00 ? 44 CYS A C    4  
ATOM   3082  O  O    . CYS A 1 44 ? 17.253 -3.326  -5.066  1.00 0.00 ? 44 CYS A O    4  
ATOM   3083  C  CB   . CYS A 1 44 ? 14.662 -1.372  -5.477  1.00 0.00 ? 44 CYS A CB   4  
ATOM   3084  S  SG   . CYS A 1 44 ? 14.375 -2.622  -6.754  1.00 0.00 ? 44 CYS A SG   4  
ATOM   3085  H  H    . CYS A 1 44 ? 17.409 -1.607  -6.564  1.00 0.00 ? 44 CYS A H    4  
ATOM   3086  H  HA   . CYS A 1 44 ? 16.120 -0.476  -4.186  1.00 0.00 ? 44 CYS A HA   4  
ATOM   3087  H  HB2  . CYS A 1 44 ? 14.013 -1.638  -4.647  1.00 0.00 ? 44 CYS A HB2  4  
ATOM   3088  H  HB3  . CYS A 1 44 ? 14.340 -0.402  -5.858  1.00 0.00 ? 44 CYS A HB3  4  
ATOM   3089  N  N    . PRO A 1 45 ? 16.333 -2.839  -3.067  1.00 0.00 ? 45 PRO A N    4  
ATOM   3090  C  CA   . PRO A 1 45 ? 16.909 -3.975  -2.353  1.00 0.00 ? 45 PRO A CA   4  
ATOM   3091  C  C    . PRO A 1 45 ? 16.396 -5.336  -2.848  1.00 0.00 ? 45 PRO A C    4  
ATOM   3092  O  O    . PRO A 1 45 ? 16.848 -6.367  -2.354  1.00 0.00 ? 45 PRO A O    4  
ATOM   3093  C  CB   . PRO A 1 45 ? 16.574 -3.741  -0.875  1.00 0.00 ? 45 PRO A CB   4  
ATOM   3094  C  CG   . PRO A 1 45 ? 15.311 -2.885  -0.928  1.00 0.00 ? 45 PRO A CG   4  
ATOM   3095  C  CD   . PRO A 1 45 ? 15.569 -2.007  -2.149  1.00 0.00 ? 45 PRO A CD   4  
ATOM   3096  H  HA   . PRO A 1 45 ? 17.994 -3.962  -2.465  1.00 0.00 ? 45 PRO A HA   4  
ATOM   3097  H  HB2  . PRO A 1 45 ? 16.418 -4.666  -0.316  1.00 0.00 ? 45 PRO A HB2  4  
ATOM   3098  H  HB3  . PRO A 1 45 ? 17.372 -3.156  -0.415  1.00 0.00 ? 45 PRO A HB3  4  
ATOM   3099  H  HG2  . PRO A 1 45 ? 14.447 -3.526  -1.113  1.00 0.00 ? 45 PRO A HG2  4  
ATOM   3100  H  HG3  . PRO A 1 45 ? 15.166 -2.300  -0.019  1.00 0.00 ? 45 PRO A HG3  4  
ATOM   3101  H  HD2  . PRO A 1 45 ? 14.618 -1.668  -2.557  1.00 0.00 ? 45 PRO A HD2  4  
ATOM   3102  H  HD3  . PRO A 1 45 ? 16.178 -1.152  -1.850  1.00 0.00 ? 45 PRO A HD3  4  
ATOM   3103  N  N    . ALA A 1 46 ? 15.456 -5.357  -3.804  1.00 0.00 ? 46 ALA A N    4  
ATOM   3104  C  CA   . ALA A 1 46 ? 15.056 -6.566  -4.505  1.00 0.00 ? 46 ALA A CA   4  
ATOM   3105  C  C    . ALA A 1 46 ? 16.131 -6.937  -5.528  1.00 0.00 ? 46 ALA A C    4  
ATOM   3106  O  O    . ALA A 1 46 ? 16.542 -8.093  -5.602  1.00 0.00 ? 46 ALA A O    4  
ATOM   3107  C  CB   . ALA A 1 46 ? 13.704 -6.341  -5.186  1.00 0.00 ? 46 ALA A CB   4  
ATOM   3108  H  H    . ALA A 1 46 ? 15.116 -4.488  -4.183  1.00 0.00 ? 46 ALA A H    4  
ATOM   3109  H  HA   . ALA A 1 46 ? 14.942 -7.385  -3.792  1.00 0.00 ? 46 ALA A HA   4  
ATOM   3110  H  HB1  . ALA A 1 46 ? 13.774 -5.529  -5.911  1.00 0.00 ? 46 ALA A HB1  4  
ATOM   3111  H  HB2  . ALA A 1 46 ? 13.398 -7.253  -5.701  1.00 0.00 ? 46 ALA A HB2  4  
ATOM   3112  H  HB3  . ALA A 1 46 ? 12.953 -6.089  -4.437  1.00 0.00 ? 46 ALA A HB3  4  
ATOM   3113  N  N    . CYS A 1 47 ? 16.575 -5.952  -6.320  1.00 0.00 ? 47 CYS A N    4  
ATOM   3114  C  CA   . CYS A 1 47 ? 17.596 -6.129  -7.337  1.00 0.00 ? 47 CYS A CA   4  
ATOM   3115  C  C    . CYS A 1 47 ? 18.978 -6.201  -6.688  1.00 0.00 ? 47 CYS A C    4  
ATOM   3116  O  O    . CYS A 1 47 ? 19.691 -7.187  -6.856  1.00 0.00 ? 47 CYS A O    4  
ATOM   3117  C  CB   . CYS A 1 47 ? 17.513 -4.982  -8.346  1.00 0.00 ? 47 CYS A CB   4  
ATOM   3118  S  SG   . CYS A 1 47 ? 15.994 -4.966  -9.331  1.00 0.00 ? 47 CYS A SG   4  
ATOM   3119  H  H    . CYS A 1 47 ? 16.244 -5.009  -6.174  1.00 0.00 ? 47 CYS A H    4  
ATOM   3120  H  HA   . CYS A 1 47 ? 17.405 -7.056  -7.872  1.00 0.00 ? 47 CYS A HA   4  
ATOM   3121  H  HB2  . CYS A 1 47 ? 17.591 -4.029  -7.821  1.00 0.00 ? 47 CYS A HB2  4  
ATOM   3122  H  HB3  . CYS A 1 47 ? 18.354 -5.070  -9.032  1.00 0.00 ? 47 CYS A HB3  4  
ATOM   3123  N  N    . GLN A 1 48 ? 19.348 -5.146  -5.953  1.00 0.00 ? 48 GLN A N    4  
ATOM   3124  C  CA   . GLN A 1 48 ? 20.624 -5.033  -5.266  1.00 0.00 ? 48 GLN A CA   4  
ATOM   3125  C  C    . GLN A 1 48 ? 20.616 -5.948  -4.035  1.00 0.00 ? 48 GLN A C    4  
ATOM   3126  O  O    . GLN A 1 48 ? 19.642 -5.932  -3.287  1.00 0.00 ? 48 GLN A O    4  
ATOM   3127  C  CB   . GLN A 1 48 ? 20.825 -3.564  -4.878  1.00 0.00 ? 48 GLN A CB   4  
ATOM   3128  C  CG   . GLN A 1 48 ? 22.179 -3.260  -4.224  1.00 0.00 ? 48 GLN A CG   4  
ATOM   3129  C  CD   . GLN A 1 48 ? 23.380 -3.641  -5.090  1.00 0.00 ? 48 GLN A CD   4  
ATOM   3130  O  OE1  . GLN A 1 48 ? 24.337 -4.230  -4.592  1.00 0.00 ? 48 GLN A OE1  4  
ATOM   3131  N  NE2  . GLN A 1 48 ? 23.351 -3.300  -6.381  1.00 0.00 ? 48 GLN A NE2  4  
ATOM   3132  H  H    . GLN A 1 48 ? 18.681 -4.399  -5.818  1.00 0.00 ? 48 GLN A H    4  
ATOM   3133  H  HA   . GLN A 1 48 ? 21.408 -5.310  -5.968  1.00 0.00 ? 48 GLN A HA   4  
ATOM   3134  H  HB2  . GLN A 1 48 ? 20.728 -2.955  -5.777  1.00 0.00 ? 48 GLN A HB2  4  
ATOM   3135  H  HB3  . GLN A 1 48 ? 20.037 -3.277  -4.181  1.00 0.00 ? 48 GLN A HB3  4  
ATOM   3136  H  HG2  . GLN A 1 48 ? 22.232 -2.191  -4.020  1.00 0.00 ? 48 GLN A HG2  4  
ATOM   3137  H  HG3  . GLN A 1 48 ? 22.244 -3.787  -3.272  1.00 0.00 ? 48 GLN A HG3  4  
ATOM   3138  H  HE21 . GLN A 1 48 ? 22.536 -2.847  -6.777  1.00 0.00 ? 48 GLN A HE21 4  
ATOM   3139  H  HE22 . GLN A 1 48 ? 24.143 -3.530  -6.966  1.00 0.00 ? 48 GLN A HE22 4  
ATOM   3140  N  N    . PRO A 1 49 ? 21.674 -6.745  -3.808  1.00 0.00 ? 49 PRO A N    4  
ATOM   3141  C  CA   . PRO A 1 49 ? 21.847 -7.475  -2.562  1.00 0.00 ? 49 PRO A CA   4  
ATOM   3142  C  C    . PRO A 1 49 ? 21.897 -6.542  -1.350  1.00 0.00 ? 49 PRO A C    4  
ATOM   3143  O  O    . PRO A 1 49 ? 22.663 -5.581  -1.337  1.00 0.00 ? 49 PRO A O    4  
ATOM   3144  C  CB   . PRO A 1 49 ? 23.138 -8.275  -2.731  1.00 0.00 ? 49 PRO A CB   4  
ATOM   3145  C  CG   . PRO A 1 49 ? 23.119 -8.594  -4.223  1.00 0.00 ? 49 PRO A CG   4  
ATOM   3146  C  CD   . PRO A 1 49 ? 22.533 -7.320  -4.834  1.00 0.00 ? 49 PRO A CD   4  
ATOM   3147  H  HA   . PRO A 1 49 ? 21.021 -8.179  -2.463  1.00 0.00 ? 49 PRO A HA   4  
ATOM   3148  H  HB2  . PRO A 1 49 ? 23.999 -7.645  -2.509  1.00 0.00 ? 49 PRO A HB2  4  
ATOM   3149  H  HB3  . PRO A 1 49 ? 23.153 -9.174  -2.113  1.00 0.00 ? 49 PRO A HB3  4  
ATOM   3150  H  HG2  . PRO A 1 49 ? 24.111 -8.822  -4.613  1.00 0.00 ? 49 PRO A HG2  4  
ATOM   3151  H  HG3  . PRO A 1 49 ? 22.440 -9.429  -4.405  1.00 0.00 ? 49 PRO A HG3  4  
ATOM   3152  H  HD2  . PRO A 1 49 ? 23.340 -6.625  -5.060  1.00 0.00 ? 49 PRO A HD2  4  
ATOM   3153  H  HD3  . PRO A 1 49 ? 21.989 -7.567  -5.745  1.00 0.00 ? 49 PRO A HD3  4  
ATOM   3154  N  N    . ALA A 1 50 ? 21.061 -6.826  -0.345  1.00 0.00 ? 50 ALA A N    4  
ATOM   3155  C  CA   . ALA A 1 50 ? 20.826 -5.955  0.795   1.00 0.00 ? 50 ALA A CA   4  
ATOM   3156  C  C    . ALA A 1 50 ? 20.281 -6.790  1.952   1.00 0.00 ? 50 ALA A C    4  
ATOM   3157  O  O    . ALA A 1 50 ? 19.446 -7.667  1.736   1.00 0.00 ? 50 ALA A O    4  
ATOM   3158  C  CB   . ALA A 1 50 ? 19.836 -4.854  0.406   1.00 0.00 ? 50 ALA A CB   4  
ATOM   3159  H  H    . ALA A 1 50 ? 20.482 -7.652  -0.407  1.00 0.00 ? 50 ALA A H    4  
ATOM   3160  H  HA   . ALA A 1 50 ? 21.767 -5.493  1.100   1.00 0.00 ? 50 ALA A HA   4  
ATOM   3161  H  HB1  . ALA A 1 50 ? 20.247 -4.250  -0.405  1.00 0.00 ? 50 ALA A HB1  4  
ATOM   3162  H  HB2  . ALA A 1 50 ? 18.898 -5.301  0.078   1.00 0.00 ? 50 ALA A HB2  4  
ATOM   3163  H  HB3  . ALA A 1 50 ? 19.646 -4.210  1.265   1.00 0.00 ? 50 ALA A HB3  4  
ATOM   3164  N  N    . THR A 1 51 ? 20.771 -6.526  3.169   1.00 0.00 ? 51 THR A N    4  
ATOM   3165  C  CA   . THR A 1 51 ? 20.392 -7.227  4.386   1.00 0.00 ? 51 THR A CA   4  
ATOM   3166  C  C    . THR A 1 51 ? 20.330 -6.212  5.528   1.00 0.00 ? 51 THR A C    4  
ATOM   3167  O  O    . THR A 1 51 ? 19.240 -6.086  6.127   1.00 0.00 ? 51 THR A O    4  
ATOM   3168  C  CB   . THR A 1 51 ? 21.407 -8.340  4.703   1.00 0.00 ? 51 THR A CB   4  
ATOM   3169  O  OG1  . THR A 1 51 ? 22.716 -7.809  4.748   1.00 0.00 ? 51 THR A OG1  4  
ATOM   3170  C  CG2  . THR A 1 51 ? 21.362 -9.478  3.679   1.00 0.00 ? 51 THR A CG2  4  
ATOM   3171  O  OXT  . THR A 1 51 ? 21.380 -5.581  5.780   1.00 0.00 ? 51 THR A OXT  4  
ATOM   3172  H  H    . THR A 1 51 ? 21.453 -5.788  3.272   1.00 0.00 ? 51 THR A H    4  
ATOM   3173  H  HA   . THR A 1 51 ? 19.402 -7.675  4.277   1.00 0.00 ? 51 THR A HA   4  
ATOM   3174  H  HB   . THR A 1 51 ? 21.165 -8.753  5.683   1.00 0.00 ? 51 THR A HB   4  
ATOM   3175  H  HG1  . THR A 1 51 ? 22.684 -6.998  5.267   1.00 0.00 ? 51 THR A HG1  4  
ATOM   3176  H  HG21 . THR A 1 51 ? 20.347 -9.869  3.604   1.00 0.00 ? 51 THR A HG21 4  
ATOM   3177  H  HG22 . THR A 1 51 ? 21.687 -9.127  2.700   1.00 0.00 ? 51 THR A HG22 4  
ATOM   3178  H  HG23 . THR A 1 51 ? 22.028 -10.280 4.002   1.00 0.00 ? 51 THR A HG23 4  
HETATM 3179  ZN ZN   . ZN  B 2 .  ? 7.009  4.857   -1.331  1.00 0.00 ? 52 ZN  A ZN   4  
HETATM 3180  ZN ZN   . ZN  C 2 .  ? 14.898 -2.983  -8.959  1.00 0.00 ? 53 ZN  A ZN   4  
ATOM   3181  N  N    . ALA A 1 1  ? 3.956  10.655  -3.429  1.00 0.00 ? 1  ALA A N    5  
ATOM   3182  C  CA   . ALA A 1 1  ? 3.532  10.178  -4.758  1.00 0.00 ? 1  ALA A CA   5  
ATOM   3183  C  C    . ALA A 1 1  ? 3.398  8.655   -4.783  1.00 0.00 ? 1  ALA A C    5  
ATOM   3184  O  O    . ALA A 1 1  ? 3.717  7.986   -3.802  1.00 0.00 ? 1  ALA A O    5  
ATOM   3185  C  CB   . ALA A 1 1  ? 4.483  10.686  -5.848  1.00 0.00 ? 1  ALA A CB   5  
ATOM   3186  H  H1   . ALA A 1 1  ? 4.909  10.375  -3.248  1.00 0.00 ? 1  ALA A H1   5  
ATOM   3187  H  H2   . ALA A 1 1  ? 3.886  11.666  -3.415  1.00 0.00 ? 1  ALA A H2   5  
ATOM   3188  H  H3   . ALA A 1 1  ? 3.352  10.260  -2.723  1.00 0.00 ? 1  ALA A H3   5  
ATOM   3189  H  HA   . ALA A 1 1  ? 2.544  10.597  -4.951  1.00 0.00 ? 1  ALA A HA   5  
ATOM   3190  H  HB1  . ALA A 1 1  ? 4.117  10.401  -6.835  1.00 0.00 ? 1  ALA A HB1  5  
ATOM   3191  H  HB2  . ALA A 1 1  ? 4.552  11.773  -5.806  1.00 0.00 ? 1  ALA A HB2  5  
ATOM   3192  H  HB3  . ALA A 1 1  ? 5.474  10.264  -5.701  1.00 0.00 ? 1  ALA A HB3  5  
ATOM   3193  N  N    . ARG A 1 2  ? 2.911  8.119   -5.910  1.00 0.00 ? 2  ARG A N    5  
ATOM   3194  C  CA   . ARG A 1 2  ? 2.503  6.727   -6.053  1.00 0.00 ? 2  ARG A CA   5  
ATOM   3195  C  C    . ARG A 1 2  ? 3.728  5.815   -6.185  1.00 0.00 ? 2  ARG A C    5  
ATOM   3196  O  O    . ARG A 1 2  ? 4.094  5.375   -7.275  1.00 0.00 ? 2  ARG A O    5  
ATOM   3197  C  CB   . ARG A 1 2  ? 1.520  6.587   -7.228  1.00 0.00 ? 2  ARG A CB   5  
ATOM   3198  C  CG   . ARG A 1 2  ? 0.074  6.950   -6.853  1.00 0.00 ? 2  ARG A CG   5  
ATOM   3199  C  CD   . ARG A 1 2  ? -0.085 8.365   -6.282  1.00 0.00 ? 2  ARG A CD   5  
ATOM   3200  N  NE   . ARG A 1 2  ? -1.496 8.765   -6.203  1.00 0.00 ? 2  ARG A NE   5  
ATOM   3201  C  CZ   . ARG A 1 2  ? -2.359 8.439   -5.224  1.00 0.00 ? 2  ARG A CZ   5  
ATOM   3202  N  NH1  . ARG A 1 2  ? -2.000 7.638   -4.211  1.00 0.00 ? 2  ARG A NH1  5  
ATOM   3203  N  NH2  . ARG A 1 2  ? -3.607 8.926   -5.265  1.00 0.00 ? 2  ARG A NH2  5  
ATOM   3204  H  H    . ARG A 1 2  ? 2.739  8.729   -6.696  1.00 0.00 ? 2  ARG A H    5  
ATOM   3205  H  HA   . ARG A 1 2  ? 1.967  6.425   -5.153  1.00 0.00 ? 2  ARG A HA   5  
ATOM   3206  H  HB2  . ARG A 1 2  ? 1.855  7.198   -8.067  1.00 0.00 ? 2  ARG A HB2  5  
ATOM   3207  H  HB3  . ARG A 1 2  ? 1.501  5.548   -7.553  1.00 0.00 ? 2  ARG A HB3  5  
ATOM   3208  H  HG2  . ARG A 1 2  ? -0.532 6.867   -7.756  1.00 0.00 ? 2  ARG A HG2  5  
ATOM   3209  H  HG3  . ARG A 1 2  ? -0.298 6.227   -6.126  1.00 0.00 ? 2  ARG A HG3  5  
ATOM   3210  H  HD2  . ARG A 1 2  ? 0.368  8.431   -5.292  1.00 0.00 ? 2  ARG A HD2  5  
ATOM   3211  H  HD3  . ARG A 1 2  ? 0.419  9.070   -6.945  1.00 0.00 ? 2  ARG A HD3  5  
ATOM   3212  H  HE   . ARG A 1 2  ? -1.830 9.355   -6.952  1.00 0.00 ? 2  ARG A HE   5  
ATOM   3213  H  HH11 . ARG A 1 2  ? -1.080 7.217   -4.179  1.00 0.00 ? 2  ARG A HH11 5  
ATOM   3214  H  HH12 . ARG A 1 2  ? -2.668 7.403   -3.491  1.00 0.00 ? 2  ARG A HH12 5  
ATOM   3215  H  HH21 . ARG A 1 2  ? -3.894 9.525   -6.025  1.00 0.00 ? 2  ARG A HH21 5  
ATOM   3216  H  HH22 . ARG A 1 2  ? -4.272 8.688   -4.543  1.00 0.00 ? 2  ARG A HH22 5  
ATOM   3217  N  N    . CYS A 1 3  ? 4.316  5.506   -5.029  1.00 0.00 ? 3  CYS A N    5  
ATOM   3218  C  CA   . CYS A 1 3  ? 5.351  4.507   -4.811  1.00 0.00 ? 3  CYS A CA   5  
ATOM   3219  C  C    . CYS A 1 3  ? 4.750  3.107   -5.002  1.00 0.00 ? 3  CYS A C    5  
ATOM   3220  O  O    . CYS A 1 3  ? 3.535  2.940   -4.937  1.00 0.00 ? 3  CYS A O    5  
ATOM   3221  C  CB   . CYS A 1 3  ? 5.847  4.742   -3.376  1.00 0.00 ? 3  CYS A CB   5  
ATOM   3222  S  SG   . CYS A 1 3  ? 6.999  3.562   -2.642  1.00 0.00 ? 3  CYS A SG   5  
ATOM   3223  H  H    . CYS A 1 3  ? 3.998  6.011   -4.212  1.00 0.00 ? 3  CYS A H    5  
ATOM   3224  H  HA   . CYS A 1 3  ? 6.172  4.658   -5.512  1.00 0.00 ? 3  CYS A HA   5  
ATOM   3225  H  HB2  . CYS A 1 3  ? 6.332  5.719   -3.357  1.00 0.00 ? 3  CYS A HB2  5  
ATOM   3226  H  HB3  . CYS A 1 3  ? 4.978  4.775   -2.717  1.00 0.00 ? 3  CYS A HB3  5  
ATOM   3227  N  N    . LYS A 1 4  ? 5.572  2.091   -5.286  1.00 0.00 ? 4  LYS A N    5  
ATOM   3228  C  CA   . LYS A 1 4  ? 5.101  0.718   -5.389  1.00 0.00 ? 4  LYS A CA   5  
ATOM   3229  C  C    . LYS A 1 4  ? 4.786  0.147   -4.004  1.00 0.00 ? 4  LYS A C    5  
ATOM   3230  O  O    . LYS A 1 4  ? 3.761  -0.509  -3.829  1.00 0.00 ? 4  LYS A O    5  
ATOM   3231  C  CB   . LYS A 1 4  ? 6.132  -0.136  -6.137  1.00 0.00 ? 4  LYS A CB   5  
ATOM   3232  C  CG   . LYS A 1 4  ? 6.432  0.343   -7.568  1.00 0.00 ? 4  LYS A CG   5  
ATOM   3233  C  CD   . LYS A 1 4  ? 5.205  0.369   -8.491  1.00 0.00 ? 4  LYS A CD   5  
ATOM   3234  C  CE   . LYS A 1 4  ? 5.544  0.858   -9.908  1.00 0.00 ? 4  LYS A CE   5  
ATOM   3235  N  NZ   . LYS A 1 4  ? 6.318  -0.127  -10.687 1.00 0.00 ? 4  LYS A NZ   5  
ATOM   3236  H  H    . LYS A 1 4  ? 6.568  2.242   -5.372  1.00 0.00 ? 4  LYS A H    5  
ATOM   3237  H  HA   . LYS A 1 4  ? 4.173  0.692   -5.952  1.00 0.00 ? 4  LYS A HA   5  
ATOM   3238  H  HB2  . LYS A 1 4  ? 7.063  -0.131  -5.569  1.00 0.00 ? 4  LYS A HB2  5  
ATOM   3239  H  HB3  . LYS A 1 4  ? 5.757  -1.156  -6.183  1.00 0.00 ? 4  LYS A HB3  5  
ATOM   3240  H  HG2  . LYS A 1 4  ? 6.858  1.341   -7.521  1.00 0.00 ? 4  LYS A HG2  5  
ATOM   3241  H  HG3  . LYS A 1 4  ? 7.176  -0.335  -7.985  1.00 0.00 ? 4  LYS A HG3  5  
ATOM   3242  H  HD2  . LYS A 1 4  ? 4.752  -0.624  -8.536  1.00 0.00 ? 4  LYS A HD2  5  
ATOM   3243  H  HD3  . LYS A 1 4  ? 4.474  1.067   -8.087  1.00 0.00 ? 4  LYS A HD3  5  
ATOM   3244  H  HE2  . LYS A 1 4  ? 4.610  1.041   -10.439 1.00 0.00 ? 4  LYS A HE2  5  
ATOM   3245  H  HE3  . LYS A 1 4  ? 6.099  1.795   -9.852  1.00 0.00 ? 4  LYS A HE3  5  
ATOM   3246  H  HZ1  . LYS A 1 4  ? 6.472  0.226   -11.622 1.00 0.00 ? 4  LYS A HZ1  5  
ATOM   3247  H  HZ2  . LYS A 1 4  ? 7.220  -0.292  -10.264 1.00 0.00 ? 4  LYS A HZ2  5  
ATOM   3248  H  HZ3  . LYS A 1 4  ? 5.809  -0.998  -10.744 1.00 0.00 ? 4  LYS A HZ3  5  
ATOM   3249  N  N    . VAL A 1 5  ? 5.662  0.412   -3.029  1.00 0.00 ? 5  VAL A N    5  
ATOM   3250  C  CA   . VAL A 1 5  ? 5.577  -0.108  -1.669  1.00 0.00 ? 5  VAL A CA   5  
ATOM   3251  C  C    . VAL A 1 5  ? 4.289  0.372   -0.990  1.00 0.00 ? 5  VAL A C    5  
ATOM   3252  O  O    . VAL A 1 5  ? 3.402  -0.435  -0.714  1.00 0.00 ? 5  VAL A O    5  
ATOM   3253  C  CB   . VAL A 1 5  ? 6.844  0.286   -0.885  1.00 0.00 ? 5  VAL A CB   5  
ATOM   3254  C  CG1  . VAL A 1 5  ? 6.807  -0.194  0.571   1.00 0.00 ? 5  VAL A CG1  5  
ATOM   3255  C  CG2  . VAL A 1 5  ? 8.099  -0.288  -1.554  1.00 0.00 ? 5  VAL A CG2  5  
ATOM   3256  H  H    . VAL A 1 5  ? 6.475  0.953   -3.274  1.00 0.00 ? 5  VAL A H    5  
ATOM   3257  H  HA   . VAL A 1 5  ? 5.549  -1.196  -1.723  1.00 0.00 ? 5  VAL A HA   5  
ATOM   3258  H  HB   . VAL A 1 5  ? 6.931  1.368   -0.867  1.00 0.00 ? 5  VAL A HB   5  
ATOM   3259  H  HG11 . VAL A 1 5  ? 5.968  0.252   1.103   1.00 0.00 ? 5  VAL A HG11 5  
ATOM   3260  H  HG12 . VAL A 1 5  ? 6.721  -1.281  0.606   1.00 0.00 ? 5  VAL A HG12 5  
ATOM   3261  H  HG13 . VAL A 1 5  ? 7.728  0.113   1.071   1.00 0.00 ? 5  VAL A HG13 5  
ATOM   3262  H  HG21 . VAL A 1 5  ? 8.013  -1.371  -1.650  1.00 0.00 ? 5  VAL A HG21 5  
ATOM   3263  H  HG22 . VAL A 1 5  ? 8.250  0.150   -2.541  1.00 0.00 ? 5  VAL A HG22 5  
ATOM   3264  H  HG23 . VAL A 1 5  ? 8.968  -0.058  -0.941  1.00 0.00 ? 5  VAL A HG23 5  
ATOM   3265  N  N    . CYS A 1 6  ? 4.195  1.678   -0.712  1.00 0.00 ? 6  CYS A N    5  
ATOM   3266  C  CA   . CYS A 1 6  ? 3.140  2.264   0.113   1.00 0.00 ? 6  CYS A CA   5  
ATOM   3267  C  C    . CYS A 1 6  ? 2.028  2.853   -0.759  1.00 0.00 ? 6  CYS A C    5  
ATOM   3268  O  O    . CYS A 1 6  ? 0.849  2.646   -0.481  1.00 0.00 ? 6  CYS A O    5  
ATOM   3269  C  CB   . CYS A 1 6  ? 3.729  3.303   1.075   1.00 0.00 ? 6  CYS A CB   5  
ATOM   3270  S  SG   . CYS A 1 6  ? 4.778  4.588   0.347   1.00 0.00 ? 6  CYS A SG   5  
ATOM   3271  H  H    . CYS A 1 6  ? 4.937  2.282   -1.028  1.00 0.00 ? 6  CYS A H    5  
ATOM   3272  H  HA   . CYS A 1 6  ? 2.690  1.489   0.737   1.00 0.00 ? 6  CYS A HA   5  
ATOM   3273  H  HB2  . CYS A 1 6  ? 2.906  3.792   1.597   1.00 0.00 ? 6  CYS A HB2  5  
ATOM   3274  H  HB3  . CYS A 1 6  ? 4.331  2.780   1.818   1.00 0.00 ? 6  CYS A HB3  5  
ATOM   3275  N  N    . ARG A 1 7  ? 2.409  3.610   -1.794  1.00 0.00 ? 7  ARG A N    5  
ATOM   3276  C  CA   . ARG A 1 7  ? 1.542  4.084   -2.868  1.00 0.00 ? 7  ARG A CA   5  
ATOM   3277  C  C    . ARG A 1 7  ? 0.567  5.199   -2.477  1.00 0.00 ? 7  ARG A C    5  
ATOM   3278  O  O    . ARG A 1 7  ? -0.139 5.714   -3.344  1.00 0.00 ? 7  ARG A O    5  
ATOM   3279  C  CB   . ARG A 1 7  ? 0.838  2.890   -3.537  1.00 0.00 ? 7  ARG A CB   5  
ATOM   3280  C  CG   . ARG A 1 7  ? 0.405  3.205   -4.975  1.00 0.00 ? 7  ARG A CG   5  
ATOM   3281  C  CD   . ARG A 1 7  ? 0.326  1.919   -5.808  1.00 0.00 ? 7  ARG A CD   5  
ATOM   3282  N  NE   . ARG A 1 7  ? 0.168  2.212   -7.238  1.00 0.00 ? 7  ARG A NE   5  
ATOM   3283  C  CZ   . ARG A 1 7  ? 1.144  2.666   -8.044  1.00 0.00 ? 7  ARG A CZ   5  
ATOM   3284  N  NH1  . ARG A 1 7  ? 2.379  2.893   -7.572  1.00 0.00 ? 7  ARG A NH1  5  
ATOM   3285  N  NH2  . ARG A 1 7  ? 0.878  2.903   -9.335  1.00 0.00 ? 7  ARG A NH2  5  
ATOM   3286  H  H    . ARG A 1 7  ? 3.399  3.751   -1.927  1.00 0.00 ? 7  ARG A H    5  
ATOM   3287  H  HA   . ARG A 1 7  ? 2.218  4.538   -3.586  1.00 0.00 ? 7  ARG A HA   5  
ATOM   3288  H  HB2  . ARG A 1 7  ? 1.542  2.057   -3.559  1.00 0.00 ? 7  ARG A HB2  5  
ATOM   3289  H  HB3  . ARG A 1 7  ? -0.032 2.579   -2.957  1.00 0.00 ? 7  ARG A HB3  5  
ATOM   3290  H  HG2  . ARG A 1 7  ? -0.567 3.697   -4.971  1.00 0.00 ? 7  ARG A HG2  5  
ATOM   3291  H  HG3  . ARG A 1 7  ? 1.128  3.881   -5.428  1.00 0.00 ? 7  ARG A HG3  5  
ATOM   3292  H  HD2  . ARG A 1 7  ? 1.226  1.319   -5.669  1.00 0.00 ? 7  ARG A HD2  5  
ATOM   3293  H  HD3  . ARG A 1 7  ? -0.528 1.331   -5.468  1.00 0.00 ? 7  ARG A HD3  5  
ATOM   3294  H  HE   . ARG A 1 7  ? -0.749 2.054   -7.631  1.00 0.00 ? 7  ARG A HE   5  
ATOM   3295  H  HH11 . ARG A 1 7  ? 2.588  2.737   -6.592  1.00 0.00 ? 7  ARG A HH11 5  
ATOM   3296  H  HH12 . ARG A 1 7  ? 3.093  3.291   -8.166  1.00 0.00 ? 7  ARG A HH12 5  
ATOM   3297  H  HH21 . ARG A 1 7  ? -0.047 2.734   -9.702  1.00 0.00 ? 7  ARG A HH21 5  
ATOM   3298  H  HH22 . ARG A 1 7  ? 1.599  3.253   -9.950  1.00 0.00 ? 7  ARG A HH22 5  
ATOM   3299  N  N    . LYS A 1 8  ? 0.569  5.640   -1.214  1.00 0.00 ? 8  LYS A N    5  
ATOM   3300  C  CA   . LYS A 1 8  ? -0.157 6.824   -0.793  1.00 0.00 ? 8  LYS A CA   5  
ATOM   3301  C  C    . LYS A 1 8  ? 0.485  8.093   -1.357  1.00 0.00 ? 8  LYS A C    5  
ATOM   3302  O  O    . LYS A 1 8  ? 1.671  8.107   -1.687  1.00 0.00 ? 8  LYS A O    5  
ATOM   3303  C  CB   . LYS A 1 8  ? -0.218 6.872   0.740   1.00 0.00 ? 8  LYS A CB   5  
ATOM   3304  C  CG   . LYS A 1 8  ? 1.155  7.110   1.389   1.00 0.00 ? 8  LYS A CG   5  
ATOM   3305  C  CD   . LYS A 1 8  ? 1.092  7.133   2.923   1.00 0.00 ? 8  LYS A CD   5  
ATOM   3306  C  CE   . LYS A 1 8  ? 0.224  8.256   3.507   1.00 0.00 ? 8  LYS A CE   5  
ATOM   3307  N  NZ   . LYS A 1 8  ? 0.667  9.594   3.076   1.00 0.00 ? 8  LYS A NZ   5  
ATOM   3308  H  H    . LYS A 1 8  ? 1.102  5.153   -0.510  1.00 0.00 ? 8  LYS A H    5  
ATOM   3309  H  HA   . LYS A 1 8  ? -1.181 6.747   -1.163  1.00 0.00 ? 8  LYS A HA   5  
ATOM   3310  H  HB2  . LYS A 1 8  ? -0.887 7.686   1.009   1.00 0.00 ? 8  LYS A HB2  5  
ATOM   3311  H  HB3  . LYS A 1 8  ? -0.637 5.933   1.112   1.00 0.00 ? 8  LYS A HB3  5  
ATOM   3312  H  HG2  . LYS A 1 8  ? 1.835  6.309   1.097   1.00 0.00 ? 8  LYS A HG2  5  
ATOM   3313  H  HG3  . LYS A 1 8  ? 1.575  8.050   1.039   1.00 0.00 ? 8  LYS A HG3  5  
ATOM   3314  H  HD2  . LYS A 1 8  ? 0.708  6.173   3.275   1.00 0.00 ? 8  LYS A HD2  5  
ATOM   3315  H  HD3  . LYS A 1 8  ? 2.108  7.250   3.301   1.00 0.00 ? 8  LYS A HD3  5  
ATOM   3316  H  HE2  . LYS A 1 8  ? -0.821 8.114   3.231   1.00 0.00 ? 8  LYS A HE2  5  
ATOM   3317  H  HE3  . LYS A 1 8  ? 0.295  8.211   4.594   1.00 0.00 ? 8  LYS A HE3  5  
ATOM   3318  H  HZ1  . LYS A 1 8  ? 0.127  10.302  3.551   1.00 0.00 ? 8  LYS A HZ1  5  
ATOM   3319  H  HZ2  . LYS A 1 8  ? 1.646  9.717   3.309   1.00 0.00 ? 8  LYS A HZ2  5  
ATOM   3320  H  HZ3  . LYS A 1 8  ? 0.546  9.706   2.077   1.00 0.00 ? 8  LYS A HZ3  5  
ATOM   3321  N  N    . LYS A 1 9  ? -0.316 9.159   -1.472  1.00 0.00 ? 9  LYS A N    5  
ATOM   3322  C  CA   . LYS A 1 9  ? 0.167  10.500  -1.762  1.00 0.00 ? 9  LYS A CA   5  
ATOM   3323  C  C    . LYS A 1 9  ? 0.349  11.230  -0.425  1.00 0.00 ? 9  LYS A C    5  
ATOM   3324  O  O    . LYS A 1 9  ? -0.214 10.812  0.589   1.00 0.00 ? 9  LYS A O    5  
ATOM   3325  C  CB   . LYS A 1 9  ? -0.816 11.210  -2.706  1.00 0.00 ? 9  LYS A CB   5  
ATOM   3326  C  CG   . LYS A 1 9  ? -0.209 12.497  -3.279  1.00 0.00 ? 9  LYS A CG   5  
ATOM   3327  C  CD   . LYS A 1 9  ? -1.101 13.129  -4.351  1.00 0.00 ? 9  LYS A CD   5  
ATOM   3328  C  CE   . LYS A 1 9  ? -0.377 14.277  -5.067  1.00 0.00 ? 9  LYS A CE   5  
ATOM   3329  N  NZ   . LYS A 1 9  ? 0.063  15.337  -4.137  1.00 0.00 ? 9  LYS A NZ   5  
ATOM   3330  H  H    . LYS A 1 9  ? -1.280 9.070   -1.186  1.00 0.00 ? 9  LYS A H    5  
ATOM   3331  H  HA   . LYS A 1 9  ? 1.133  10.443  -2.265  1.00 0.00 ? 9  LYS A HA   5  
ATOM   3332  H  HB2  . LYS A 1 9  ? -1.033 10.539  -3.540  1.00 0.00 ? 9  LYS A HB2  5  
ATOM   3333  H  HB3  . LYS A 1 9  ? -1.745 11.437  -2.179  1.00 0.00 ? 9  LYS A HB3  5  
ATOM   3334  H  HG2  . LYS A 1 9  ? -0.072 13.220  -2.477  1.00 0.00 ? 9  LYS A HG2  5  
ATOM   3335  H  HG3  . LYS A 1 9  ? 0.756  12.258  -3.724  1.00 0.00 ? 9  LYS A HG3  5  
ATOM   3336  H  HD2  . LYS A 1 9  ? -1.361 12.373  -5.096  1.00 0.00 ? 9  LYS A HD2  5  
ATOM   3337  H  HD3  . LYS A 1 9  ? -2.019 13.495  -3.891  1.00 0.00 ? 9  LYS A HD3  5  
ATOM   3338  H  HE2  . LYS A 1 9  ? 0.499  13.887  -5.589  1.00 0.00 ? 9  LYS A HE2  5  
ATOM   3339  H  HE3  . LYS A 1 9  ? -1.052 14.715  -5.803  1.00 0.00 ? 9  LYS A HE3  5  
ATOM   3340  H  HZ1  . LYS A 1 9  ? 0.483  16.091  -4.661  1.00 0.00 ? 9  LYS A HZ1  5  
ATOM   3341  H  HZ2  . LYS A 1 9  ? -0.726 15.690  -3.617  1.00 0.00 ? 9  LYS A HZ2  5  
ATOM   3342  H  HZ3  . LYS A 1 9  ? 0.754  14.968  -3.495  1.00 0.00 ? 9  LYS A HZ3  5  
ATOM   3343  N  N    . GLY A 1 10 ? 1.156  12.296  -0.414  1.00 0.00 ? 10 GLY A N    5  
ATOM   3344  C  CA   . GLY A 1 10 ? 1.470  13.066  0.780   1.00 0.00 ? 10 GLY A CA   5  
ATOM   3345  C  C    . GLY A 1 10 ? 2.970  13.313  0.828   1.00 0.00 ? 10 GLY A C    5  
ATOM   3346  O  O    . GLY A 1 10 ? 3.412  14.461  0.814   1.00 0.00 ? 10 GLY A O    5  
ATOM   3347  H  H    . GLY A 1 10 ? 1.585  12.599  -1.278  1.00 0.00 ? 10 GLY A H    5  
ATOM   3348  H  HA2  . GLY A 1 10 ? 0.943  14.020  0.730   1.00 0.00 ? 10 GLY A HA2  5  
ATOM   3349  H  HA3  . GLY A 1 10 ? 1.179  12.542  1.692   1.00 0.00 ? 10 GLY A HA3  5  
ATOM   3350  N  N    . GLU A 1 11 ? 3.749  12.225  0.849   1.00 0.00 ? 11 GLU A N    5  
ATOM   3351  C  CA   . GLU A 1 11 ? 5.198  12.261  0.750   1.00 0.00 ? 11 GLU A CA   5  
ATOM   3352  C  C    . GLU A 1 11 ? 5.588  12.433  -0.718  1.00 0.00 ? 11 GLU A C    5  
ATOM   3353  O  O    . GLU A 1 11 ? 6.213  11.560  -1.321  1.00 0.00 ? 11 GLU A O    5  
ATOM   3354  C  CB   . GLU A 1 11 ? 5.827  11.002  1.368   1.00 0.00 ? 11 GLU A CB   5  
ATOM   3355  C  CG   . GLU A 1 11 ? 5.334  10.672  2.787   1.00 0.00 ? 11 GLU A CG   5  
ATOM   3356  C  CD   . GLU A 1 11 ? 3.932  10.059  2.840   1.00 0.00 ? 11 GLU A CD   5  
ATOM   3357  O  OE1  . GLU A 1 11 ? 3.448  9.597   1.784   1.00 0.00 ? 11 GLU A OE1  5  
ATOM   3358  O  OE2  . GLU A 1 11 ? 3.338  10.079  3.940   1.00 0.00 ? 11 GLU A OE2  5  
ATOM   3359  H  H    . GLU A 1 11 ? 3.315  11.312  0.902   1.00 0.00 ? 11 GLU A H    5  
ATOM   3360  H  HA   . GLU A 1 11 ? 5.576  13.114  1.314   1.00 0.00 ? 11 GLU A HA   5  
ATOM   3361  H  HB2  . GLU A 1 11 ? 5.663  10.140  0.723   1.00 0.00 ? 11 GLU A HB2  5  
ATOM   3362  H  HB3  . GLU A 1 11 ? 6.900  11.192  1.425   1.00 0.00 ? 11 GLU A HB3  5  
ATOM   3363  H  HG2  . GLU A 1 11 ? 6.021  9.946   3.224   1.00 0.00 ? 11 GLU A HG2  5  
ATOM   3364  H  HG3  . GLU A 1 11 ? 5.358  11.576  3.396   1.00 0.00 ? 11 GLU A HG3  5  
ATOM   3365  N  N    . ASP A 1 12 ? 5.210  13.574  -1.300  1.00 0.00 ? 12 ASP A N    5  
ATOM   3366  C  CA   . ASP A 1 12 ? 5.640  14.002  -2.620  1.00 0.00 ? 12 ASP A CA   5  
ATOM   3367  C  C    . ASP A 1 12 ? 7.005  14.685  -2.495  1.00 0.00 ? 12 ASP A C    5  
ATOM   3368  O  O    . ASP A 1 12 ? 7.171  15.842  -2.878  1.00 0.00 ? 12 ASP A O    5  
ATOM   3369  C  CB   . ASP A 1 12 ? 4.556  14.907  -3.219  1.00 0.00 ? 12 ASP A CB   5  
ATOM   3370  C  CG   . ASP A 1 12 ? 3.213  14.185  -3.302  1.00 0.00 ? 12 ASP A CG   5  
ATOM   3371  O  OD1  . ASP A 1 12 ? 3.129  13.230  -4.101  1.00 0.00 ? 12 ASP A OD1  5  
ATOM   3372  O  OD2  . ASP A 1 12 ? 2.286  14.579  -2.558  1.00 0.00 ? 12 ASP A OD2  5  
ATOM   3373  H  H    . ASP A 1 12 ? 4.669  14.232  -0.753  1.00 0.00 ? 12 ASP A H    5  
ATOM   3374  H  HA   . ASP A 1 12 ? 5.749  13.142  -3.280  1.00 0.00 ? 12 ASP A HA   5  
ATOM   3375  H  HB2  . ASP A 1 12 ? 4.450  15.797  -2.596  1.00 0.00 ? 12 ASP A HB2  5  
ATOM   3376  H  HB3  . ASP A 1 12 ? 4.853  15.212  -4.225  1.00 0.00 ? 12 ASP A HB3  5  
ATOM   3377  N  N    . ASP A 1 13 ? 7.976  13.948  -1.939  1.00 0.00 ? 13 ASP A N    5  
ATOM   3378  C  CA   . ASP A 1 13 ? 9.273  14.465  -1.530  1.00 0.00 ? 13 ASP A CA   5  
ATOM   3379  C  C    . ASP A 1 13 ? 10.224 14.457  -2.727  1.00 0.00 ? 13 ASP A C    5  
ATOM   3380  O  O    . ASP A 1 13 ? 10.412 15.485  -3.372  1.00 0.00 ? 13 ASP A O    5  
ATOM   3381  C  CB   . ASP A 1 13 ? 9.781  13.633  -0.339  1.00 0.00 ? 13 ASP A CB   5  
ATOM   3382  C  CG   . ASP A 1 13 ? 11.203 13.998  0.089   1.00 0.00 ? 13 ASP A CG   5  
ATOM   3383  O  OD1  . ASP A 1 13 ? 11.540 15.201  0.041   1.00 0.00 ? 13 ASP A OD1  5  
ATOM   3384  O  OD2  . ASP A 1 13 ? 11.949 13.059  0.445   1.00 0.00 ? 13 ASP A OD2  5  
ATOM   3385  H  H    . ASP A 1 13 ? 7.770  12.985  -1.713  1.00 0.00 ? 13 ASP A H    5  
ATOM   3386  H  HA   . ASP A 1 13 ? 9.162  15.491  -1.187  1.00 0.00 ? 13 ASP A HA   5  
ATOM   3387  H  HB2  . ASP A 1 13 ? 9.112  13.787  0.509   1.00 0.00 ? 13 ASP A HB2  5  
ATOM   3388  H  HB3  . ASP A 1 13 ? 9.750  12.575  -0.595  1.00 0.00 ? 13 ASP A HB3  5  
ATOM   3389  N  N    . LYS A 1 14 ? 10.795 13.287  -3.029  1.00 0.00 ? 14 LYS A N    5  
ATOM   3390  C  CA   . LYS A 1 14 ? 11.723 13.065  -4.129  1.00 0.00 ? 14 LYS A CA   5  
ATOM   3391  C  C    . LYS A 1 14 ? 11.923 11.558  -4.289  1.00 0.00 ? 14 LYS A C    5  
ATOM   3392  O  O    . LYS A 1 14 ? 12.894 10.988  -3.794  1.00 0.00 ? 14 LYS A O    5  
ATOM   3393  C  CB   . LYS A 1 14 ? 13.036 13.851  -3.931  1.00 0.00 ? 14 LYS A CB   5  
ATOM   3394  C  CG   . LYS A 1 14 ? 13.764 13.575  -2.606  1.00 0.00 ? 14 LYS A CG   5  
ATOM   3395  C  CD   . LYS A 1 14 ? 14.591 14.796  -2.185  1.00 0.00 ? 14 LYS A CD   5  
ATOM   3396  C  CE   . LYS A 1 14 ? 15.331 14.585  -0.858  1.00 0.00 ? 14 LYS A CE   5  
ATOM   3397  N  NZ   . LYS A 1 14 ? 14.417 14.487  0.296   1.00 0.00 ? 14 LYS A NZ   5  
ATOM   3398  H  H    . LYS A 1 14 ? 10.586 12.500  -2.434  1.00 0.00 ? 14 LYS A H    5  
ATOM   3399  H  HA   . LYS A 1 14 ? 11.263 13.437  -5.045  1.00 0.00 ? 14 LYS A HA   5  
ATOM   3400  H  HB2  . LYS A 1 14 ? 13.714 13.624  -4.756  1.00 0.00 ? 14 LYS A HB2  5  
ATOM   3401  H  HB3  . LYS A 1 14 ? 12.796 14.915  -3.980  1.00 0.00 ? 14 LYS A HB3  5  
ATOM   3402  H  HG2  . LYS A 1 14 ? 13.046 13.349  -1.824  1.00 0.00 ? 14 LYS A HG2  5  
ATOM   3403  H  HG3  . LYS A 1 14 ? 14.424 12.718  -2.732  1.00 0.00 ? 14 LYS A HG3  5  
ATOM   3404  H  HD2  . LYS A 1 14 ? 15.327 15.001  -2.964  1.00 0.00 ? 14 LYS A HD2  5  
ATOM   3405  H  HD3  . LYS A 1 14 ? 13.938 15.664  -2.087  1.00 0.00 ? 14 LYS A HD3  5  
ATOM   3406  H  HE2  . LYS A 1 14 ? 15.949 13.689  -0.912  1.00 0.00 ? 14 LYS A HE2  5  
ATOM   3407  H  HE3  . LYS A 1 14 ? 15.983 15.444  -0.698  1.00 0.00 ? 14 LYS A HE3  5  
ATOM   3408  H  HZ1  . LYS A 1 14 ? 13.818 15.301  0.334   1.00 0.00 ? 14 LYS A HZ1  5  
ATOM   3409  H  HZ2  . LYS A 1 14 ? 13.823 13.670  0.224   1.00 0.00 ? 14 LYS A HZ2  5  
ATOM   3410  H  HZ3  . LYS A 1 14 ? 14.962 14.435  1.150   1.00 0.00 ? 14 LYS A HZ3  5  
ATOM   3411  N  N    . LEU A 1 15 ? 10.971 10.907  -4.969  1.00 0.00 ? 15 LEU A N    5  
ATOM   3412  C  CA   . LEU A 1 15 ? 10.982 9.467   -5.179  1.00 0.00 ? 15 LEU A CA   5  
ATOM   3413  C  C    . LEU A 1 15 ? 12.101 9.081   -6.147  1.00 0.00 ? 15 LEU A C    5  
ATOM   3414  O  O    . LEU A 1 15 ? 12.661 9.925   -6.846  1.00 0.00 ? 15 LEU A O    5  
ATOM   3415  C  CB   . LEU A 1 15 ? 9.623  8.979   -5.710  1.00 0.00 ? 15 LEU A CB   5  
ATOM   3416  C  CG   . LEU A 1 15 ? 8.514  8.939   -4.645  1.00 0.00 ? 15 LEU A CG   5  
ATOM   3417  C  CD1  . LEU A 1 15 ? 8.021  10.340  -4.258  1.00 0.00 ? 15 LEU A CD1  5  
ATOM   3418  C  CD2  . LEU A 1 15 ? 7.345  8.102   -5.179  1.00 0.00 ? 15 LEU A CD2  5  
ATOM   3419  H  H    . LEU A 1 15 ? 10.210 11.437  -5.370  1.00 0.00 ? 15 LEU A H    5  
ATOM   3420  H  HA   . LEU A 1 15 ? 11.176 8.974   -4.225  1.00 0.00 ? 15 LEU A HA   5  
ATOM   3421  H  HB2  . LEU A 1 15 ? 9.311  9.596   -6.556  1.00 0.00 ? 15 LEU A HB2  5  
ATOM   3422  H  HB3  . LEU A 1 15 ? 9.753  7.954   -6.064  1.00 0.00 ? 15 LEU A HB3  5  
ATOM   3423  H  HG   . LEU A 1 15 ? 8.894  8.436   -3.757  1.00 0.00 ? 15 LEU A HG   5  
ATOM   3424  H  HD11 . LEU A 1 15 ? 8.763  10.850  -3.645  1.00 0.00 ? 15 LEU A HD11 5  
ATOM   3425  H  HD12 . LEU A 1 15 ? 7.821  10.931  -5.152  1.00 0.00 ? 15 LEU A HD12 5  
ATOM   3426  H  HD13 . LEU A 1 15 ? 7.104  10.264  -3.677  1.00 0.00 ? 15 LEU A HD13 5  
ATOM   3427  H  HD21 . LEU A 1 15 ? 6.983  8.520   -6.119  1.00 0.00 ? 15 LEU A HD21 5  
ATOM   3428  H  HD22 . LEU A 1 15 ? 7.673  7.077   -5.350  1.00 0.00 ? 15 LEU A HD22 5  
ATOM   3429  H  HD23 . LEU A 1 15 ? 6.532  8.089   -4.452  1.00 0.00 ? 15 LEU A HD23 5  
ATOM   3430  N  N    . ILE A 1 16 ? 12.412 7.783   -6.174  1.00 0.00 ? 16 ILE A N    5  
ATOM   3431  C  CA   . ILE A 1 16 ? 13.564 7.212   -6.844  1.00 0.00 ? 16 ILE A CA   5  
ATOM   3432  C  C    . ILE A 1 16 ? 13.145 5.869   -7.446  1.00 0.00 ? 16 ILE A C    5  
ATOM   3433  O  O    . ILE A 1 16 ? 12.578 5.023   -6.755  1.00 0.00 ? 16 ILE A O    5  
ATOM   3434  C  CB   . ILE A 1 16 ? 14.745 7.119   -5.858  1.00 0.00 ? 16 ILE A CB   5  
ATOM   3435  C  CG1  . ILE A 1 16 ? 15.943 6.423   -6.520  1.00 0.00 ? 16 ILE A CG1  5  
ATOM   3436  C  CG2  . ILE A 1 16 ? 14.374 6.432   -4.533  1.00 0.00 ? 16 ILE A CG2  5  
ATOM   3437  C  CD1  . ILE A 1 16 ? 17.253 6.721   -5.783  1.00 0.00 ? 16 ILE A CD1  5  
ATOM   3438  H  H    . ILE A 1 16 ? 11.869 7.150   -5.604  1.00 0.00 ? 16 ILE A H    5  
ATOM   3439  H  HA   . ILE A 1 16 ? 13.865 7.870   -7.662  1.00 0.00 ? 16 ILE A HA   5  
ATOM   3440  H  HB   . ILE A 1 16 ? 15.038 8.144   -5.622  1.00 0.00 ? 16 ILE A HB   5  
ATOM   3441  H  HG12 . ILE A 1 16 ? 15.772 5.345   -6.548  1.00 0.00 ? 16 ILE A HG12 5  
ATOM   3442  H  HG13 . ILE A 1 16 ? 16.050 6.796   -7.541  1.00 0.00 ? 16 ILE A HG13 5  
ATOM   3443  H  HG21 . ILE A 1 16 ? 13.611 7.006   -4.007  1.00 0.00 ? 16 ILE A HG21 5  
ATOM   3444  H  HG22 . ILE A 1 16 ? 14.011 5.422   -4.707  1.00 0.00 ? 16 ILE A HG22 5  
ATOM   3445  H  HG23 . ILE A 1 16 ? 15.245 6.381   -3.886  1.00 0.00 ? 16 ILE A HG23 5  
ATOM   3446  H  HD11 . ILE A 1 16 ? 17.259 6.259   -4.796  1.00 0.00 ? 16 ILE A HD11 5  
ATOM   3447  H  HD12 . ILE A 1 16 ? 18.086 6.322   -6.361  1.00 0.00 ? 16 ILE A HD12 5  
ATOM   3448  H  HD13 . ILE A 1 16 ? 17.384 7.798   -5.677  1.00 0.00 ? 16 ILE A HD13 5  
ATOM   3449  N  N    . LEU A 1 17 ? 13.367 5.709   -8.756  1.00 0.00 ? 17 LEU A N    5  
ATOM   3450  C  CA   . LEU A 1 17 ? 12.919 4.566   -9.534  1.00 0.00 ? 17 LEU A CA   5  
ATOM   3451  C  C    . LEU A 1 17 ? 14.111 3.649   -9.793  1.00 0.00 ? 17 LEU A C    5  
ATOM   3452  O  O    . LEU A 1 17 ? 15.193 4.126   -10.130 1.00 0.00 ? 17 LEU A O    5  
ATOM   3453  C  CB   . LEU A 1 17 ? 12.323 5.038   -10.869 1.00 0.00 ? 17 LEU A CB   5  
ATOM   3454  C  CG   . LEU A 1 17 ? 10.841 5.439   -10.787 1.00 0.00 ? 17 LEU A CG   5  
ATOM   3455  C  CD1  . LEU A 1 17 ? 10.589 6.629   -9.852  1.00 0.00 ? 17 LEU A CD1  5  
ATOM   3456  C  CD2  . LEU A 1 17 ? 10.343 5.791   -12.195 1.00 0.00 ? 17 LEU A CD2  5  
ATOM   3457  H  H    . LEU A 1 17 ? 13.871 6.425   -9.258  1.00 0.00 ? 17 LEU A H    5  
ATOM   3458  H  HA   . LEU A 1 17 ? 12.154 4.009   -8.999  1.00 0.00 ? 17 LEU A HA   5  
ATOM   3459  H  HB2  . LEU A 1 17 ? 12.914 5.869   -11.263 1.00 0.00 ? 17 LEU A HB2  5  
ATOM   3460  H  HB3  . LEU A 1 17 ? 12.390 4.207   -11.572 1.00 0.00 ? 17 LEU A HB3  5  
ATOM   3461  H  HG   . LEU A 1 17 ? 10.263 4.584   -10.435 1.00 0.00 ? 17 LEU A HG   5  
ATOM   3462  H  HD11 . LEU A 1 17 ? 9.550  6.948   -9.937  1.00 0.00 ? 17 LEU A HD11 5  
ATOM   3463  H  HD12 . LEU A 1 17 ? 10.770 6.345   -8.818  1.00 0.00 ? 17 LEU A HD12 5  
ATOM   3464  H  HD13 . LEU A 1 17 ? 11.239 7.462   -10.121 1.00 0.00 ? 17 LEU A HD13 5  
ATOM   3465  H  HD21 . LEU A 1 17 ? 10.492 4.943   -12.864 1.00 0.00 ? 17 LEU A HD21 5  
ATOM   3466  H  HD22 . LEU A 1 17 ? 9.278  6.028   -12.163 1.00 0.00 ? 17 LEU A HD22 5  
ATOM   3467  H  HD23 . LEU A 1 17 ? 10.889 6.652   -12.580 1.00 0.00 ? 17 LEU A HD23 5  
ATOM   3468  N  N    . CYS A 1 18 ? 13.910 2.332   -9.654  1.00 0.00 ? 18 CYS A N    5  
ATOM   3469  C  CA   . CYS A 1 18 ? 14.895 1.356   -10.090 1.00 0.00 ? 18 CYS A CA   5  
ATOM   3470  C  C    . CYS A 1 18 ? 14.942 1.356   -11.616 1.00 0.00 ? 18 CYS A C    5  
ATOM   3471  O  O    . CYS A 1 18 ? 13.934 1.069   -12.260 1.00 0.00 ? 18 CYS A O    5  
ATOM   3472  C  CB   . CYS A 1 18 ? 14.547 -0.037  -9.568  1.00 0.00 ? 18 CYS A CB   5  
ATOM   3473  S  SG   . CYS A 1 18 ? 15.675 -1.327  -10.146 1.00 0.00 ? 18 CYS A SG   5  
ATOM   3474  H  H    . CYS A 1 18 ? 13.028 2.001   -9.285  1.00 0.00 ? 18 CYS A H    5  
ATOM   3475  H  HA   . CYS A 1 18 ? 15.873 1.627   -9.689  1.00 0.00 ? 18 CYS A HA   5  
ATOM   3476  H  HB2  . CYS A 1 18 ? 14.568 -0.012  -8.481  1.00 0.00 ? 18 CYS A HB2  5  
ATOM   3477  H  HB3  . CYS A 1 18 ? 13.548 -0.320  -9.893  1.00 0.00 ? 18 CYS A HB3  5  
ATOM   3478  N  N    . ASP A 1 19 ? 16.113 1.669   -12.179 1.00 0.00 ? 19 ASP A N    5  
ATOM   3479  C  CA   . ASP A 1 19 ? 16.327 1.722   -13.619 1.00 0.00 ? 19 ASP A CA   5  
ATOM   3480  C  C    . ASP A 1 19 ? 15.964 0.389   -14.277 1.00 0.00 ? 19 ASP A C    5  
ATOM   3481  O  O    . ASP A 1 19 ? 15.229 0.358   -15.261 1.00 0.00 ? 19 ASP A O    5  
ATOM   3482  C  CB   . ASP A 1 19 ? 17.785 2.104   -13.897 1.00 0.00 ? 19 ASP A CB   5  
ATOM   3483  C  CG   . ASP A 1 19 ? 18.062 2.181   -15.395 1.00 0.00 ? 19 ASP A CG   5  
ATOM   3484  O  OD1  . ASP A 1 19 ? 17.680 3.212   -15.991 1.00 0.00 ? 19 ASP A OD1  5  
ATOM   3485  O  OD2  . ASP A 1 19 ? 18.640 1.203   -15.917 1.00 0.00 ? 19 ASP A OD2  5  
ATOM   3486  H  H    . ASP A 1 19 ? 16.894 1.892   -11.579 1.00 0.00 ? 19 ASP A H    5  
ATOM   3487  H  HA   . ASP A 1 19 ? 15.682 2.497   -14.032 1.00 0.00 ? 19 ASP A HA   5  
ATOM   3488  H  HB2  . ASP A 1 19 ? 17.994 3.077   -13.451 1.00 0.00 ? 19 ASP A HB2  5  
ATOM   3489  H  HB3  . ASP A 1 19 ? 18.453 1.367   -13.446 1.00 0.00 ? 19 ASP A HB3  5  
ATOM   3490  N  N    . GLU A 1 20 ? 16.468 -0.705  -13.697 1.00 0.00 ? 20 GLU A N    5  
ATOM   3491  C  CA   . GLU A 1 20 ? 16.424 -2.041  -14.269 1.00 0.00 ? 20 GLU A CA   5  
ATOM   3492  C  C    . GLU A 1 20 ? 14.982 -2.510  -14.482 1.00 0.00 ? 20 GLU A C    5  
ATOM   3493  O  O    . GLU A 1 20 ? 14.583 -2.772  -15.615 1.00 0.00 ? 20 GLU A O    5  
ATOM   3494  C  CB   . GLU A 1 20 ? 17.197 -2.994  -13.344 1.00 0.00 ? 20 GLU A CB   5  
ATOM   3495  C  CG   . GLU A 1 20 ? 17.301 -4.419  -13.897 1.00 0.00 ? 20 GLU A CG   5  
ATOM   3496  C  CD   . GLU A 1 20 ? 17.956 -5.348  -12.878 1.00 0.00 ? 20 GLU A CD   5  
ATOM   3497  O  OE1  . GLU A 1 20 ? 19.142 -5.108  -12.563 1.00 0.00 ? 20 GLU A OE1  5  
ATOM   3498  O  OE2  . GLU A 1 20 ? 17.251 -6.270  -12.414 1.00 0.00 ? 20 GLU A OE2  5  
ATOM   3499  H  H    . GLU A 1 20 ? 17.035 -0.567  -12.874 1.00 0.00 ? 20 GLU A H    5  
ATOM   3500  H  HA   . GLU A 1 20 ? 16.934 -2.013  -15.234 1.00 0.00 ? 20 GLU A HA   5  
ATOM   3501  H  HB2  . GLU A 1 20 ? 18.210 -2.609  -13.214 1.00 0.00 ? 20 GLU A HB2  5  
ATOM   3502  H  HB3  . GLU A 1 20 ? 16.706 -3.036  -12.370 1.00 0.00 ? 20 GLU A HB3  5  
ATOM   3503  H  HG2  . GLU A 1 20 ? 16.309 -4.806  -14.132 1.00 0.00 ? 20 GLU A HG2  5  
ATOM   3504  H  HG3  . GLU A 1 20 ? 17.899 -4.411  -14.810 1.00 0.00 ? 20 GLU A HG3  5  
ATOM   3505  N  N    . CYS A 1 21 ? 14.215 -2.623  -13.389 1.00 0.00 ? 21 CYS A N    5  
ATOM   3506  C  CA   . CYS A 1 21 ? 12.906 -3.269  -13.374 1.00 0.00 ? 21 CYS A CA   5  
ATOM   3507  C  C    . CYS A 1 21 ? 11.767 -2.339  -12.934 1.00 0.00 ? 21 CYS A C    5  
ATOM   3508  O  O    . CYS A 1 21 ? 10.703 -2.832  -12.562 1.00 0.00 ? 21 CYS A O    5  
ATOM   3509  C  CB   . CYS A 1 21 ? 12.997 -4.532  -12.508 1.00 0.00 ? 21 CYS A CB   5  
ATOM   3510  S  SG   . CYS A 1 21 ? 13.417 -4.254  -10.767 1.00 0.00 ? 21 CYS A SG   5  
ATOM   3511  H  H    . CYS A 1 21 ? 14.595 -2.316  -12.506 1.00 0.00 ? 21 CYS A H    5  
ATOM   3512  H  HA   . CYS A 1 21 ? 12.645 -3.602  -14.380 1.00 0.00 ? 21 CYS A HA   5  
ATOM   3513  H  HB2  . CYS A 1 21 ? 12.048 -5.069  -12.556 1.00 0.00 ? 21 CYS A HB2  5  
ATOM   3514  H  HB3  . CYS A 1 21 ? 13.772 -5.176  -12.931 1.00 0.00 ? 21 CYS A HB3  5  
ATOM   3515  N  N    . ASN A 1 22 ? 11.968 -1.012  -12.986 1.00 0.00 ? 22 ASN A N    5  
ATOM   3516  C  CA   . ASN A 1 22 ? 10.922 -0.005  -12.813 1.00 0.00 ? 22 ASN A CA   5  
ATOM   3517  C  C    . ASN A 1 22 ? 10.159 -0.199  -11.500 1.00 0.00 ? 22 ASN A C    5  
ATOM   3518  O  O    . ASN A 1 22 ? 8.993  -0.590  -11.499 1.00 0.00 ? 22 ASN A O    5  
ATOM   3519  C  CB   . ASN A 1 22 ? 9.993  0.025   -14.035 1.00 0.00 ? 22 ASN A CB   5  
ATOM   3520  C  CG   . ASN A 1 22 ? 8.982  1.169   -13.944 1.00 0.00 ? 22 ASN A CG   5  
ATOM   3521  O  OD1  . ASN A 1 22 ? 7.808  0.949   -13.654 1.00 0.00 ? 22 ASN A OD1  5  
ATOM   3522  N  ND2  . ASN A 1 22 ? 9.439  2.401   -14.180 1.00 0.00 ? 22 ASN A ND2  5  
ATOM   3523  H  H    . ASN A 1 22 ? 12.898 -0.665  -13.177 1.00 0.00 ? 22 ASN A H    5  
ATOM   3524  H  HA   . ASN A 1 22 ? 11.411 0.966   -12.767 1.00 0.00 ? 22 ASN A HA   5  
ATOM   3525  H  HB2  . ASN A 1 22 ? 10.594 0.159   -14.937 1.00 0.00 ? 22 ASN A HB2  5  
ATOM   3526  H  HB3  . ASN A 1 22 ? 9.457  -0.922  -14.110 1.00 0.00 ? 22 ASN A HB3  5  
ATOM   3527  H  HD21 . ASN A 1 22 ? 10.411 2.539   -14.426 1.00 0.00 ? 22 ASN A HD21 5  
ATOM   3528  H  HD22 . ASN A 1 22 ? 8.802  3.185   -14.136 1.00 0.00 ? 22 ASN A HD22 5  
ATOM   3529  N  N    . LYS A 1 23 ? 10.825 0.076   -10.376 1.00 0.00 ? 23 LYS A N    5  
ATOM   3530  C  CA   . LYS A 1 23 ? 10.247 0.046   -9.053  1.00 0.00 ? 23 LYS A CA   5  
ATOM   3531  C  C    . LYS A 1 23 ? 10.379 1.441   -8.448  1.00 0.00 ? 23 LYS A C    5  
ATOM   3532  O  O    . LYS A 1 23 ? 11.458 1.816   -7.994  1.00 0.00 ? 23 LYS A O    5  
ATOM   3533  C  CB   . LYS A 1 23 ? 10.977 -1.010  -8.219  1.00 0.00 ? 23 LYS A CB   5  
ATOM   3534  C  CG   . LYS A 1 23 ? 10.868 -2.434  -8.785  1.00 0.00 ? 23 LYS A CG   5  
ATOM   3535  C  CD   . LYS A 1 23 ? 9.423  -2.947  -8.854  1.00 0.00 ? 23 LYS A CD   5  
ATOM   3536  C  CE   . LYS A 1 23 ? 9.360  -4.435  -9.217  1.00 0.00 ? 23 LYS A CE   5  
ATOM   3537  N  NZ   . LYS A 1 23 ? 9.981  -4.719  -10.524 1.00 0.00 ? 23 LYS A NZ   5  
ATOM   3538  H  H    . LYS A 1 23 ? 11.797 0.326   -10.414 1.00 0.00 ? 23 LYS A H    5  
ATOM   3539  H  HA   . LYS A 1 23 ? 9.190  -0.210  -9.084  1.00 0.00 ? 23 LYS A HA   5  
ATOM   3540  H  HB2  . LYS A 1 23 ? 12.034 -0.751  -8.150  1.00 0.00 ? 23 LYS A HB2  5  
ATOM   3541  H  HB3  . LYS A 1 23 ? 10.549 -0.986  -7.226  1.00 0.00 ? 23 LYS A HB3  5  
ATOM   3542  H  HG2  . LYS A 1 23 ? 11.320 -2.458  -9.776  1.00 0.00 ? 23 LYS A HG2  5  
ATOM   3543  H  HG3  . LYS A 1 23 ? 11.435 -3.097  -8.130  1.00 0.00 ? 23 LYS A HG3  5  
ATOM   3544  H  HD2  . LYS A 1 23 ? 8.950  -2.810  -7.881  1.00 0.00 ? 23 LYS A HD2  5  
ATOM   3545  H  HD3  . LYS A 1 23 ? 8.861  -2.387  -9.600  1.00 0.00 ? 23 LYS A HD3  5  
ATOM   3546  H  HE2  . LYS A 1 23 ? 9.864  -5.024  -8.450  1.00 0.00 ? 23 LYS A HE2  5  
ATOM   3547  H  HE3  . LYS A 1 23 ? 8.313  -4.740  -9.258  1.00 0.00 ? 23 LYS A HE3  5  
ATOM   3548  H  HZ1  . LYS A 1 23 ? 9.587  -4.121  -11.240 1.00 0.00 ? 23 LYS A HZ1  5  
ATOM   3549  H  HZ2  . LYS A 1 23 ? 10.976 -4.543  -10.475 1.00 0.00 ? 23 LYS A HZ2  5  
ATOM   3550  H  HZ3  . LYS A 1 23 ? 9.830  -5.686  -10.772 1.00 0.00 ? 23 LYS A HZ3  5  
ATOM   3551  N  N    . ALA A 1 24 ? 9.275  2.199   -8.446  1.00 0.00 ? 24 ALA A N    5  
ATOM   3552  C  CA   . ALA A 1 24 ? 9.182  3.481   -7.767  1.00 0.00 ? 24 ALA A CA   5  
ATOM   3553  C  C    . ALA A 1 24 ? 9.202  3.268   -6.254  1.00 0.00 ? 24 ALA A C    5  
ATOM   3554  O  O    . ALA A 1 24 ? 8.443  2.459   -5.724  1.00 0.00 ? 24 ALA A O    5  
ATOM   3555  C  CB   . ALA A 1 24 ? 7.912  4.219   -8.204  1.00 0.00 ? 24 ALA A CB   5  
ATOM   3556  H  H    . ALA A 1 24 ? 8.440  1.845   -8.889  1.00 0.00 ? 24 ALA A H    5  
ATOM   3557  H  HA   . ALA A 1 24 ? 10.034 4.093   -8.058  1.00 0.00 ? 24 ALA A HA   5  
ATOM   3558  H  HB1  . ALA A 1 24 ? 7.023  3.658   -7.916  1.00 0.00 ? 24 ALA A HB1  5  
ATOM   3559  H  HB2  . ALA A 1 24 ? 7.881  5.199   -7.727  1.00 0.00 ? 24 ALA A HB2  5  
ATOM   3560  H  HB3  . ALA A 1 24 ? 7.917  4.352   -9.286  1.00 0.00 ? 24 ALA A HB3  5  
ATOM   3561  N  N    . PHE A 1 25 ? 10.089 3.998   -5.576  1.00 0.00 ? 25 PHE A N    5  
ATOM   3562  C  CA   . PHE A 1 25 ? 10.427 3.808   -4.177  1.00 0.00 ? 25 PHE A CA   5  
ATOM   3563  C  C    . PHE A 1 25 ? 10.684 5.173   -3.547  1.00 0.00 ? 25 PHE A C    5  
ATOM   3564  O  O    . PHE A 1 25 ? 11.164 6.079   -4.224  1.00 0.00 ? 25 PHE A O    5  
ATOM   3565  C  CB   . PHE A 1 25 ? 11.698 2.948   -4.080  1.00 0.00 ? 25 PHE A CB   5  
ATOM   3566  C  CG   . PHE A 1 25 ? 11.468 1.520   -3.624  1.00 0.00 ? 25 PHE A CG   5  
ATOM   3567  C  CD1  . PHE A 1 25 ? 11.212 0.507   -4.566  1.00 0.00 ? 25 PHE A CD1  5  
ATOM   3568  C  CD2  . PHE A 1 25 ? 11.596 1.187   -2.262  1.00 0.00 ? 25 PHE A CD2  5  
ATOM   3569  C  CE1  . PHE A 1 25 ? 11.120 -0.834  -4.152  1.00 0.00 ? 25 PHE A CE1  5  
ATOM   3570  C  CE2  . PHE A 1 25 ? 11.544 -0.156  -1.854  1.00 0.00 ? 25 PHE A CE2  5  
ATOM   3571  C  CZ   . PHE A 1 25 ? 11.302 -1.167  -2.799  1.00 0.00 ? 25 PHE A CZ   5  
ATOM   3572  H  H    . PHE A 1 25 ? 10.673 4.648   -6.086  1.00 0.00 ? 25 PHE A H    5  
ATOM   3573  H  HA   . PHE A 1 25 ? 9.621  3.316   -3.637  1.00 0.00 ? 25 PHE A HA   5  
ATOM   3574  H  HB2  . PHE A 1 25 ? 12.207 2.927   -5.047  1.00 0.00 ? 25 PHE A HB2  5  
ATOM   3575  H  HB3  . PHE A 1 25 ? 12.383 3.416   -3.372  1.00 0.00 ? 25 PHE A HB3  5  
ATOM   3576  H  HD1  . PHE A 1 25 ? 11.097 0.757   -5.608  1.00 0.00 ? 25 PHE A HD1  5  
ATOM   3577  H  HD2  . PHE A 1 25 ? 11.755 1.961   -1.528  1.00 0.00 ? 25 PHE A HD2  5  
ATOM   3578  H  HE1  . PHE A 1 25 ? 10.921 -1.612  -4.873  1.00 0.00 ? 25 PHE A HE1  5  
ATOM   3579  H  HE2  . PHE A 1 25 ? 11.676 -0.409  -0.811  1.00 0.00 ? 25 PHE A HE2  5  
ATOM   3580  H  HZ   . PHE A 1 25 ? 11.247 -2.199  -2.483  1.00 0.00 ? 25 PHE A HZ   5  
ATOM   3581  N  N    . HIS A 1 26 ? 10.340 5.332   -2.264  1.00 0.00 ? 26 HIS A N    5  
ATOM   3582  C  CA   . HIS A 1 26 ? 10.772 6.490   -1.498  1.00 0.00 ? 26 HIS A CA   5  
ATOM   3583  C  C    . HIS A 1 26 ? 12.132 6.157   -0.894  1.00 0.00 ? 26 HIS A C    5  
ATOM   3584  O  O    . HIS A 1 26 ? 12.479 4.991   -0.711  1.00 0.00 ? 26 HIS A O    5  
ATOM   3585  C  CB   . HIS A 1 26 ? 9.803  6.837   -0.367  1.00 0.00 ? 26 HIS A CB   5  
ATOM   3586  C  CG   . HIS A 1 26 ? 8.479  7.384   -0.817  1.00 0.00 ? 26 HIS A CG   5  
ATOM   3587  N  ND1  . HIS A 1 26 ? 7.299  6.650   -0.918  1.00 0.00 ? 26 HIS A ND1  5  
ATOM   3588  C  CD2  . HIS A 1 26 ? 8.225  8.699   -1.083  1.00 0.00 ? 26 HIS A CD2  5  
ATOM   3589  C  CE1  . HIS A 1 26 ? 6.354  7.545   -1.248  1.00 0.00 ? 26 HIS A CE1  5  
ATOM   3590  N  NE2  . HIS A 1 26 ? 6.882  8.777   -1.357  1.00 0.00 ? 26 HIS A NE2  5  
ATOM   3591  H  H    . HIS A 1 26 ? 9.895  4.572   -1.770  1.00 0.00 ? 26 HIS A H    5  
ATOM   3592  H  HA   . HIS A 1 26 ? 10.869 7.368   -2.140  1.00 0.00 ? 26 HIS A HA   5  
ATOM   3593  H  HB2  . HIS A 1 26 ? 9.647  5.964   0.258   1.00 0.00 ? 26 HIS A HB2  5  
ATOM   3594  H  HB3  . HIS A 1 26 ? 10.272 7.603   0.248   1.00 0.00 ? 26 HIS A HB3  5  
ATOM   3595  H  HD2  . HIS A 1 26 ? 8.928  9.518   -1.047  1.00 0.00 ? 26 HIS A HD2  5  
ATOM   3596  H  HE1  . HIS A 1 26 ? 5.308  7.313   -1.388  1.00 0.00 ? 26 HIS A HE1  5  
ATOM   3597  H  HE2  . HIS A 1 26 ? 6.375  9.628   -1.558  1.00 0.00 ? 26 HIS A HE2  5  
ATOM   3598  N  N    . LEU A 1 27 ? 12.879 7.204   -0.549  1.00 0.00 ? 27 LEU A N    5  
ATOM   3599  C  CA   . LEU A 1 27 ? 14.101 7.112   0.230   1.00 0.00 ? 27 LEU A CA   5  
ATOM   3600  C  C    . LEU A 1 27 ? 13.857 6.324   1.520   1.00 0.00 ? 27 LEU A C    5  
ATOM   3601  O  O    . LEU A 1 27 ? 14.624 5.420   1.843   1.00 0.00 ? 27 LEU A O    5  
ATOM   3602  C  CB   . LEU A 1 27 ? 14.619 8.527   0.500   1.00 0.00 ? 27 LEU A CB   5  
ATOM   3603  C  CG   . LEU A 1 27 ? 14.842 9.342   -0.787  1.00 0.00 ? 27 LEU A CG   5  
ATOM   3604  C  CD1  . LEU A 1 27 ? 15.262 10.757  -0.394  1.00 0.00 ? 27 LEU A CD1  5  
ATOM   3605  C  CD2  . LEU A 1 27 ? 15.915 8.710   -1.679  1.00 0.00 ? 27 LEU A CD2  5  
ATOM   3606  H  H    . LEU A 1 27 ? 12.523 8.128   -0.744  1.00 0.00 ? 27 LEU A H    5  
ATOM   3607  H  HA   . LEU A 1 27 ? 14.850 6.570   -0.341  1.00 0.00 ? 27 LEU A HA   5  
ATOM   3608  H  HB2  . LEU A 1 27 ? 13.894 9.048   1.127   1.00 0.00 ? 27 LEU A HB2  5  
ATOM   3609  H  HB3  . LEU A 1 27 ? 15.567 8.461   1.033   1.00 0.00 ? 27 LEU A HB3  5  
ATOM   3610  H  HG   . LEU A 1 27 ? 13.924 9.423   -1.369  1.00 0.00 ? 27 LEU A HG   5  
ATOM   3611  H  HD11 . LEU A 1 27 ? 14.440 11.264  0.110   1.00 0.00 ? 27 LEU A HD11 5  
ATOM   3612  H  HD12 . LEU A 1 27 ? 16.111 10.700  0.282   1.00 0.00 ? 27 LEU A HD12 5  
ATOM   3613  H  HD13 . LEU A 1 27 ? 15.546 11.320  -1.280  1.00 0.00 ? 27 LEU A HD13 5  
ATOM   3614  H  HD21 . LEU A 1 27 ? 15.590 7.735   -2.035  1.00 0.00 ? 27 LEU A HD21 5  
ATOM   3615  H  HD22 . LEU A 1 27 ? 16.078 9.342   -2.551  1.00 0.00 ? 27 LEU A HD22 5  
ATOM   3616  H  HD23 . LEU A 1 27 ? 16.844 8.595   -1.123  1.00 0.00 ? 27 LEU A HD23 5  
ATOM   3617  N  N    . PHE A 1 28 ? 12.754 6.627   2.212   1.00 0.00 ? 28 PHE A N    5  
ATOM   3618  C  CA   . PHE A 1 28 ? 12.368 5.979   3.461   1.00 0.00 ? 28 PHE A CA   5  
ATOM   3619  C  C    . PHE A 1 28 ? 12.076 4.493   3.225   1.00 0.00 ? 28 PHE A C    5  
ATOM   3620  O  O    . PHE A 1 28 ? 12.576 3.642   3.958   1.00 0.00 ? 28 PHE A O    5  
ATOM   3621  C  CB   . PHE A 1 28 ? 11.156 6.679   4.108   1.00 0.00 ? 28 PHE A CB   5  
ATOM   3622  C  CG   . PHE A 1 28 ? 10.862 8.089   3.625   1.00 0.00 ? 28 PHE A CG   5  
ATOM   3623  C  CD1  . PHE A 1 28 ? 11.807 9.116   3.811   1.00 0.00 ? 28 PHE A CD1  5  
ATOM   3624  C  CD2  . PHE A 1 28 ? 9.710  8.334   2.854   1.00 0.00 ? 28 PHE A CD2  5  
ATOM   3625  C  CE1  . PHE A 1 28 ? 11.607 10.375  3.218   1.00 0.00 ? 28 PHE A CE1  5  
ATOM   3626  C  CE2  . PHE A 1 28 ? 9.512  9.591   2.259   1.00 0.00 ? 28 PHE A CE2  5  
ATOM   3627  C  CZ   . PHE A 1 28 ? 10.458 10.613  2.443   1.00 0.00 ? 28 PHE A CZ   5  
ATOM   3628  H  H    . PHE A 1 28 ? 12.169 7.372   1.863   1.00 0.00 ? 28 PHE A H    5  
ATOM   3629  H  HA   . PHE A 1 28 ? 13.212 6.069   4.148   1.00 0.00 ? 28 PHE A HA   5  
ATOM   3630  H  HB2  . PHE A 1 28 ? 10.264 6.074   3.941   1.00 0.00 ? 28 PHE A HB2  5  
ATOM   3631  H  HB3  . PHE A 1 28 ? 11.315 6.711   5.188   1.00 0.00 ? 28 PHE A HB3  5  
ATOM   3632  H  HD1  . PHE A 1 28 ? 12.705 8.931   4.384   1.00 0.00 ? 28 PHE A HD1  5  
ATOM   3633  H  HD2  . PHE A 1 28 ? 8.981  7.554   2.690   1.00 0.00 ? 28 PHE A HD2  5  
ATOM   3634  H  HE1  . PHE A 1 28 ? 12.340 11.159  3.348   1.00 0.00 ? 28 PHE A HE1  5  
ATOM   3635  H  HE2  . PHE A 1 28 ? 8.640  9.761   1.650   1.00 0.00 ? 28 PHE A HE2  5  
ATOM   3636  H  HZ   . PHE A 1 28 ? 10.298 11.580  1.988   1.00 0.00 ? 28 PHE A HZ   5  
ATOM   3637  N  N    . CYS A 1 29 ? 11.261 4.192   2.201   1.00 0.00 ? 29 CYS A N    5  
ATOM   3638  C  CA   . CYS A 1 29 ? 10.832 2.837   1.867   1.00 0.00 ? 29 CYS A CA   5  
ATOM   3639  C  C    . CYS A 1 29 ? 12.028 1.940   1.536   1.00 0.00 ? 29 CYS A C    5  
ATOM   3640  O  O    . CYS A 1 29 ? 11.992 0.750   1.843   1.00 0.00 ? 29 CYS A O    5  
ATOM   3641  C  CB   . CYS A 1 29 ? 9.837  2.854   0.699   1.00 0.00 ? 29 CYS A CB   5  
ATOM   3642  S  SG   . CYS A 1 29 ? 8.278  3.727   0.999   1.00 0.00 ? 29 CYS A SG   5  
ATOM   3643  H  H    . CYS A 1 29 ? 10.924 4.944   1.620   1.00 0.00 ? 29 CYS A H    5  
ATOM   3644  H  HA   . CYS A 1 29 ? 10.320 2.417   2.735   1.00 0.00 ? 29 CYS A HA   5  
ATOM   3645  H  HB2  . CYS A 1 29 ? 10.317 3.316   -0.162  1.00 0.00 ? 29 CYS A HB2  5  
ATOM   3646  H  HB3  . CYS A 1 29 ? 9.587  1.824   0.438   1.00 0.00 ? 29 CYS A HB3  5  
ATOM   3647  N  N    . LEU A 1 30 ? 13.079 2.498   0.917   1.00 0.00 ? 30 LEU A N    5  
ATOM   3648  C  CA   . LEU A 1 30 ? 14.348 1.804   0.752   1.00 0.00 ? 30 LEU A CA   5  
ATOM   3649  C  C    . LEU A 1 30 ? 14.943 1.488   2.124   1.00 0.00 ? 30 LEU A C    5  
ATOM   3650  O  O    . LEU A 1 30 ? 14.916 0.334   2.549   1.00 0.00 ? 30 LEU A O    5  
ATOM   3651  C  CB   . LEU A 1 30 ? 15.315 2.617   -0.121  1.00 0.00 ? 30 LEU A CB   5  
ATOM   3652  C  CG   . LEU A 1 30 ? 14.850 2.767   -1.576  1.00 0.00 ? 30 LEU A CG   5  
ATOM   3653  C  CD1  . LEU A 1 30 ? 15.615 3.913   -2.241  1.00 0.00 ? 30 LEU A CD1  5  
ATOM   3654  C  CD2  . LEU A 1 30 ? 15.050 1.481   -2.385  1.00 0.00 ? 30 LEU A CD2  5  
ATOM   3655  H  H    . LEU A 1 30 ? 13.023 3.465   0.623   1.00 0.00 ? 30 LEU A H    5  
ATOM   3656  H  HA   . LEU A 1 30 ? 14.165 0.856   0.258   1.00 0.00 ? 30 LEU A HA   5  
ATOM   3657  H  HB2  . LEU A 1 30 ? 15.422 3.610   0.310   1.00 0.00 ? 30 LEU A HB2  5  
ATOM   3658  H  HB3  . LEU A 1 30 ? 16.293 2.131   -0.122  1.00 0.00 ? 30 LEU A HB3  5  
ATOM   3659  H  HG   . LEU A 1 30 ? 13.797 3.023   -1.589  1.00 0.00 ? 30 LEU A HG   5  
ATOM   3660  H  HD11 . LEU A 1 30 ? 16.684 3.764   -2.118  1.00 0.00 ? 30 LEU A HD11 5  
ATOM   3661  H  HD12 . LEU A 1 30 ? 15.371 3.955   -3.302  1.00 0.00 ? 30 LEU A HD12 5  
ATOM   3662  H  HD13 . LEU A 1 30 ? 15.336 4.858   -1.778  1.00 0.00 ? 30 LEU A HD13 5  
ATOM   3663  H  HD21 . LEU A 1 30 ? 16.103 1.202   -2.390  1.00 0.00 ? 30 LEU A HD21 5  
ATOM   3664  H  HD22 . LEU A 1 30 ? 14.463 0.670   -1.956  1.00 0.00 ? 30 LEU A HD22 5  
ATOM   3665  H  HD23 . LEU A 1 30 ? 14.720 1.638   -3.412  1.00 0.00 ? 30 LEU A HD23 5  
ATOM   3666  N  N    . ARG A 1 31 ? 15.478 2.506   2.805   1.00 0.00 ? 31 ARG A N    5  
ATOM   3667  C  CA   . ARG A 1 31 ? 16.140 2.387   4.102   1.00 0.00 ? 31 ARG A CA   5  
ATOM   3668  C  C    . ARG A 1 31 ? 15.978 3.705   4.866   1.00 0.00 ? 31 ARG A C    5  
ATOM   3669  O  O    . ARG A 1 31 ? 15.868 4.758   4.242   1.00 0.00 ? 31 ARG A O    5  
ATOM   3670  C  CB   . ARG A 1 31 ? 17.643 2.106   3.912   1.00 0.00 ? 31 ARG A CB   5  
ATOM   3671  C  CG   . ARG A 1 31 ? 18.041 0.684   3.482   1.00 0.00 ? 31 ARG A CG   5  
ATOM   3672  C  CD   . ARG A 1 31 ? 18.043 -0.337  4.631   1.00 0.00 ? 31 ARG A CD   5  
ATOM   3673  N  NE   . ARG A 1 31 ? 16.693 -0.709  5.078   1.00 0.00 ? 31 ARG A NE   5  
ATOM   3674  C  CZ   . ARG A 1 31 ? 15.903 -1.638  4.513   1.00 0.00 ? 31 ARG A CZ   5  
ATOM   3675  N  NH1  . ARG A 1 31 ? 16.305 -2.321  3.432   1.00 0.00 ? 31 ARG A NH1  5  
ATOM   3676  N  NH2  . ARG A 1 31 ? 14.693 -1.879  5.035   1.00 0.00 ? 31 ARG A NH2  5  
ATOM   3677  H  H    . ARG A 1 31 ? 15.375 3.435   2.419   1.00 0.00 ? 31 ARG A H    5  
ATOM   3678  H  HA   . ARG A 1 31 ? 15.655 1.594   4.667   1.00 0.00 ? 31 ARG A HA   5  
ATOM   3679  H  HB2  . ARG A 1 31 ? 18.007 2.800   3.155   1.00 0.00 ? 31 ARG A HB2  5  
ATOM   3680  H  HB3  . ARG A 1 31 ? 18.173 2.331   4.837   1.00 0.00 ? 31 ARG A HB3  5  
ATOM   3681  H  HG2  . ARG A 1 31 ? 17.431 0.335   2.650   1.00 0.00 ? 31 ARG A HG2  5  
ATOM   3682  H  HG3  . ARG A 1 31 ? 19.070 0.746   3.124   1.00 0.00 ? 31 ARG A HG3  5  
ATOM   3683  H  HD2  . ARG A 1 31 ? 18.583 -1.231  4.312   1.00 0.00 ? 31 ARG A HD2  5  
ATOM   3684  H  HD3  . ARG A 1 31 ? 18.586 0.082   5.479   1.00 0.00 ? 31 ARG A HD3  5  
ATOM   3685  H  HE   . ARG A 1 31 ? 16.343 -0.222  5.892   1.00 0.00 ? 31 ARG A HE   5  
ATOM   3686  H  HH11 . ARG A 1 31 ? 17.203 -2.126  3.015   1.00 0.00 ? 31 ARG A HH11 5  
ATOM   3687  H  HH12 . ARG A 1 31 ? 15.699 -3.009  3.007   1.00 0.00 ? 31 ARG A HH12 5  
ATOM   3688  H  HH21 . ARG A 1 31 ? 14.374 -1.359  5.840   1.00 0.00 ? 31 ARG A HH21 5  
ATOM   3689  H  HH22 . ARG A 1 31 ? 14.081 -2.562  4.611   1.00 0.00 ? 31 ARG A HH22 5  
ATOM   3690  N  N    . PRO A 1 32 ? 16.011 3.684   6.209   1.00 0.00 ? 32 PRO A N    5  
ATOM   3691  C  CA   . PRO A 1 32 ? 16.086 4.895   7.012   1.00 0.00 ? 32 PRO A CA   5  
ATOM   3692  C  C    . PRO A 1 32 ? 17.405 5.634   6.759   1.00 0.00 ? 32 PRO A C    5  
ATOM   3693  O  O    . PRO A 1 32 ? 17.409 6.859   6.682   1.00 0.00 ? 32 PRO A O    5  
ATOM   3694  C  CB   . PRO A 1 32 ? 15.950 4.437   8.467   1.00 0.00 ? 32 PRO A CB   5  
ATOM   3695  C  CG   . PRO A 1 32 ? 16.472 3.002   8.442   1.00 0.00 ? 32 PRO A CG   5  
ATOM   3696  C  CD   . PRO A 1 32 ? 16.059 2.503   7.056   1.00 0.00 ? 32 PRO A CD   5  
ATOM   3697  H  HA   . PRO A 1 32 ? 15.255 5.562   6.770   1.00 0.00 ? 32 PRO A HA   5  
ATOM   3698  H  HB2  . PRO A 1 32 ? 16.505 5.069   9.163   1.00 0.00 ? 32 PRO A HB2  5  
ATOM   3699  H  HB3  . PRO A 1 32 ? 14.892 4.421   8.737   1.00 0.00 ? 32 PRO A HB3  5  
ATOM   3700  H  HG2  . PRO A 1 32 ? 17.561 3.010   8.519   1.00 0.00 ? 32 PRO A HG2  5  
ATOM   3701  H  HG3  . PRO A 1 32 ? 16.049 2.395   9.243   1.00 0.00 ? 32 PRO A HG3  5  
ATOM   3702  H  HD2  . PRO A 1 32 ? 16.781 1.765   6.710   1.00 0.00 ? 32 PRO A HD2  5  
ATOM   3703  H  HD3  . PRO A 1 32 ? 15.063 2.060   7.106   1.00 0.00 ? 32 PRO A HD3  5  
ATOM   3704  N  N    . ALA A 1 33 ? 18.506 4.885   6.595   1.00 0.00 ? 33 ALA A N    5  
ATOM   3705  C  CA   . ALA A 1 33 ? 19.818 5.397   6.215   1.00 0.00 ? 33 ALA A CA   5  
ATOM   3706  C  C    . ALA A 1 33 ? 19.749 6.358   5.027   1.00 0.00 ? 33 ALA A C    5  
ATOM   3707  O  O    . ALA A 1 33 ? 20.431 7.382   5.019   1.00 0.00 ? 33 ALA A O    5  
ATOM   3708  C  CB   . ALA A 1 33 ? 20.753 4.225   5.912   1.00 0.00 ? 33 ALA A CB   5  
ATOM   3709  H  H    . ALA A 1 33 ? 18.422 3.886   6.708   1.00 0.00 ? 33 ALA A H    5  
ATOM   3710  H  HA   . ALA A 1 33 ? 20.220 5.942   7.067   1.00 0.00 ? 33 ALA A HA   5  
ATOM   3711  H  HB1  . ALA A 1 33 ? 20.822 3.571   6.782   1.00 0.00 ? 33 ALA A HB1  5  
ATOM   3712  H  HB2  . ALA A 1 33 ? 20.377 3.654   5.061   1.00 0.00 ? 33 ALA A HB2  5  
ATOM   3713  H  HB3  . ALA A 1 33 ? 21.749 4.604   5.675   1.00 0.00 ? 33 ALA A HB3  5  
ATOM   3714  N  N    . LEU A 1 34 ? 18.933 6.021   4.023   1.00 0.00 ? 34 LEU A N    5  
ATOM   3715  C  CA   . LEU A 1 34 ? 18.594 6.930   2.939   1.00 0.00 ? 34 LEU A CA   5  
ATOM   3716  C  C    . LEU A 1 34 ? 17.556 7.925   3.464   1.00 0.00 ? 34 LEU A C    5  
ATOM   3717  O  O    . LEU A 1 34 ? 16.354 7.735   3.291   1.00 0.00 ? 34 LEU A O    5  
ATOM   3718  C  CB   . LEU A 1 34 ? 18.097 6.150   1.710   1.00 0.00 ? 34 LEU A CB   5  
ATOM   3719  C  CG   . LEU A 1 34 ? 19.242 5.682   0.795   1.00 0.00 ? 34 LEU A CG   5  
ATOM   3720  C  CD1  . LEU A 1 34 ? 20.218 4.723   1.489   1.00 0.00 ? 34 LEU A CD1  5  
ATOM   3721  C  CD2  . LEU A 1 34 ? 18.652 4.992   -0.438  1.00 0.00 ? 34 LEU A CD2  5  
ATOM   3722  H  H    . LEU A 1 34 ? 18.392 5.173   4.116   1.00 0.00 ? 34 LEU A H    5  
ATOM   3723  H  HA   . LEU A 1 34 ? 19.475 7.498   2.635   1.00 0.00 ? 34 LEU A HA   5  
ATOM   3724  H  HB2  . LEU A 1 34 ? 17.488 5.301   2.023   1.00 0.00 ? 34 LEU A HB2  5  
ATOM   3725  H  HB3  . LEU A 1 34 ? 17.473 6.815   1.112   1.00 0.00 ? 34 LEU A HB3  5  
ATOM   3726  H  HG   . LEU A 1 34 ? 19.800 6.555   0.455   1.00 0.00 ? 34 LEU A HG   5  
ATOM   3727  H  HD11 . LEU A 1 34 ? 20.759 5.237   2.282   1.00 0.00 ? 34 LEU A HD11 5  
ATOM   3728  H  HD12 . LEU A 1 34 ? 19.678 3.873   1.905   1.00 0.00 ? 34 LEU A HD12 5  
ATOM   3729  H  HD13 . LEU A 1 34 ? 20.947 4.356   0.764   1.00 0.00 ? 34 LEU A HD13 5  
ATOM   3730  H  HD21 . LEU A 1 34 ? 19.451 4.715   -1.125  1.00 0.00 ? 34 LEU A HD21 5  
ATOM   3731  H  HD22 . LEU A 1 34 ? 18.110 4.096   -0.136  1.00 0.00 ? 34 LEU A HD22 5  
ATOM   3732  H  HD23 . LEU A 1 34 ? 17.969 5.671   -0.952  1.00 0.00 ? 34 LEU A HD23 5  
ATOM   3733  N  N    . TYR A 1 35 ? 18.043 8.984   4.120   1.00 0.00 ? 35 TYR A N    5  
ATOM   3734  C  CA   . TYR A 1 35 ? 17.245 10.142  4.498   1.00 0.00 ? 35 TYR A CA   5  
ATOM   3735  C  C    . TYR A 1 35 ? 17.053 11.035  3.273   1.00 0.00 ? 35 TYR A C    5  
ATOM   3736  O  O    . TYR A 1 35 ? 15.924 11.345  2.896   1.00 0.00 ? 35 TYR A O    5  
ATOM   3737  C  CB   . TYR A 1 35 ? 17.934 10.906  5.637   1.00 0.00 ? 35 TYR A CB   5  
ATOM   3738  C  CG   . TYR A 1 35 ? 18.178 10.075  6.883   1.00 0.00 ? 35 TYR A CG   5  
ATOM   3739  C  CD1  . TYR A 1 35 ? 17.123 9.822   7.780   1.00 0.00 ? 35 TYR A CD1  5  
ATOM   3740  C  CD2  . TYR A 1 35 ? 19.451 9.526   7.129   1.00 0.00 ? 35 TYR A CD2  5  
ATOM   3741  C  CE1  . TYR A 1 35 ? 17.337 9.014   8.910   1.00 0.00 ? 35 TYR A CE1  5  
ATOM   3742  C  CE2  . TYR A 1 35 ? 19.661 8.706   8.250   1.00 0.00 ? 35 TYR A CE2  5  
ATOM   3743  C  CZ   . TYR A 1 35 ? 18.601 8.439   9.135   1.00 0.00 ? 35 TYR A CZ   5  
ATOM   3744  O  OH   . TYR A 1 35 ? 18.800 7.615   10.203  1.00 0.00 ? 35 TYR A OH   5  
ATOM   3745  H  H    . TYR A 1 35 ? 19.032 9.007   4.323   1.00 0.00 ? 35 TYR A H    5  
ATOM   3746  H  HA   . TYR A 1 35 ? 16.269 9.813   4.848   1.00 0.00 ? 35 TYR A HA   5  
ATOM   3747  H  HB2  . TYR A 1 35 ? 18.892 11.294  5.284   1.00 0.00 ? 35 TYR A HB2  5  
ATOM   3748  H  HB3  . TYR A 1 35 ? 17.305 11.756  5.909   1.00 0.00 ? 35 TYR A HB3  5  
ATOM   3749  H  HD1  . TYR A 1 35 ? 16.142 10.236  7.595   1.00 0.00 ? 35 TYR A HD1  5  
ATOM   3750  H  HD2  . TYR A 1 35 ? 20.269 9.722   6.452   1.00 0.00 ? 35 TYR A HD2  5  
ATOM   3751  H  HE1  . TYR A 1 35 ? 16.519 8.810   9.586   1.00 0.00 ? 35 TYR A HE1  5  
ATOM   3752  H  HE2  . TYR A 1 35 ? 20.634 8.271   8.424   1.00 0.00 ? 35 TYR A HE2  5  
ATOM   3753  H  HH   . TYR A 1 35 ? 18.012 7.489   10.735  1.00 0.00 ? 35 TYR A HH   5  
ATOM   3754  N  N    . GLU A 1 36 ? 18.176 11.426  2.661   1.00 0.00 ? 36 GLU A N    5  
ATOM   3755  C  CA   . GLU A 1 36 ? 18.253 12.211  1.437   1.00 0.00 ? 36 GLU A CA   5  
ATOM   3756  C  C    . GLU A 1 36 ? 18.698 11.330  0.266   1.00 0.00 ? 36 GLU A C    5  
ATOM   3757  O  O    . GLU A 1 36 ? 19.079 10.174  0.449   1.00 0.00 ? 36 GLU A O    5  
ATOM   3758  C  CB   . GLU A 1 36 ? 19.203 13.398  1.651   1.00 0.00 ? 36 GLU A CB   5  
ATOM   3759  C  CG   . GLU A 1 36 ? 18.626 14.417  2.644   1.00 0.00 ? 36 GLU A CG   5  
ATOM   3760  C  CD   . GLU A 1 36 ? 17.387 15.111  2.083   1.00 0.00 ? 36 GLU A CD   5  
ATOM   3761  O  OE1  . GLU A 1 36 ? 17.579 16.051  1.282   1.00 0.00 ? 36 GLU A OE1  5  
ATOM   3762  O  OE2  . GLU A 1 36 ? 16.269 14.678  2.437   1.00 0.00 ? 36 GLU A OE2  5  
ATOM   3763  H  H    . GLU A 1 36 ? 19.047 11.094  3.048   1.00 0.00 ? 36 GLU A H    5  
ATOM   3764  H  HA   . GLU A 1 36 ? 17.267 12.598  1.180   1.00 0.00 ? 36 GLU A HA   5  
ATOM   3765  H  HB2  . GLU A 1 36 ? 20.159 13.029  2.027   1.00 0.00 ? 36 GLU A HB2  5  
ATOM   3766  H  HB3  . GLU A 1 36 ? 19.381 13.910  0.705   1.00 0.00 ? 36 GLU A HB3  5  
ATOM   3767  H  HG2  . GLU A 1 36 ? 18.379 13.928  3.588   1.00 0.00 ? 36 GLU A HG2  5  
ATOM   3768  H  HG3  . GLU A 1 36 ? 19.384 15.175  2.843   1.00 0.00 ? 36 GLU A HG3  5  
ATOM   3769  N  N    . VAL A 1 37 ? 18.611 11.888  -0.948  1.00 0.00 ? 37 VAL A N    5  
ATOM   3770  C  CA   . VAL A 1 37 ? 18.770 11.155  -2.195  1.00 0.00 ? 37 VAL A CA   5  
ATOM   3771  C  C    . VAL A 1 37 ? 20.211 10.659  -2.378  1.00 0.00 ? 37 VAL A C    5  
ATOM   3772  O  O    . VAL A 1 37 ? 21.145 11.363  -1.994  1.00 0.00 ? 37 VAL A O    5  
ATOM   3773  C  CB   . VAL A 1 37 ? 18.286 12.035  -3.366  1.00 0.00 ? 37 VAL A CB   5  
ATOM   3774  C  CG1  . VAL A 1 37 ? 19.200 13.242  -3.618  1.00 0.00 ? 37 VAL A CG1  5  
ATOM   3775  C  CG2  . VAL A 1 37 ? 18.134 11.231  -4.661  1.00 0.00 ? 37 VAL A CG2  5  
ATOM   3776  H  H    . VAL A 1 37 ? 18.345 12.860  -1.010  1.00 0.00 ? 37 VAL A H    5  
ATOM   3777  H  HA   . VAL A 1 37 ? 18.094 10.310  -2.120  1.00 0.00 ? 37 VAL A HA   5  
ATOM   3778  H  HB   . VAL A 1 37 ? 17.296 12.416  -3.107  1.00 0.00 ? 37 VAL A HB   5  
ATOM   3779  H  HG11 . VAL A 1 37 ? 18.749 13.886  -4.374  1.00 0.00 ? 37 VAL A HG11 5  
ATOM   3780  H  HG12 . VAL A 1 37 ? 19.331 13.821  -2.704  1.00 0.00 ? 37 VAL A HG12 5  
ATOM   3781  H  HG13 . VAL A 1 37 ? 20.176 12.916  -3.979  1.00 0.00 ? 37 VAL A HG13 5  
ATOM   3782  H  HG21 . VAL A 1 37 ? 17.441 10.404  -4.508  1.00 0.00 ? 37 VAL A HG21 5  
ATOM   3783  H  HG22 . VAL A 1 37 ? 17.734 11.875  -5.445  1.00 0.00 ? 37 VAL A HG22 5  
ATOM   3784  H  HG23 . VAL A 1 37 ? 19.097 10.840  -4.988  1.00 0.00 ? 37 VAL A HG23 5  
ATOM   3785  N  N    . PRO A 1 38 ? 20.415 9.453   -2.941  1.00 0.00 ? 38 PRO A N    5  
ATOM   3786  C  CA   . PRO A 1 38 ? 21.732 9.007   -3.365  1.00 0.00 ? 38 PRO A CA   5  
ATOM   3787  C  C    . PRO A 1 38 ? 22.055 9.668   -4.703  1.00 0.00 ? 38 PRO A C    5  
ATOM   3788  O  O    . PRO A 1 38 ? 21.441 9.340   -5.718  1.00 0.00 ? 38 PRO A O    5  
ATOM   3789  C  CB   . PRO A 1 38 ? 21.652 7.481   -3.476  1.00 0.00 ? 38 PRO A CB   5  
ATOM   3790  C  CG   . PRO A 1 38 ? 20.168 7.213   -3.713  1.00 0.00 ? 38 PRO A CG   5  
ATOM   3791  C  CD   . PRO A 1 38 ? 19.483 8.334   -2.932  1.00 0.00 ? 38 PRO A CD   5  
ATOM   3792  H  HA   . PRO A 1 38 ? 22.494 9.262   -2.626  1.00 0.00 ? 38 PRO A HA   5  
ATOM   3793  H  HB2  . PRO A 1 38 ? 22.276 7.080   -4.277  1.00 0.00 ? 38 PRO A HB2  5  
ATOM   3794  H  HB3  . PRO A 1 38 ? 21.944 7.040   -2.522  1.00 0.00 ? 38 PRO A HB3  5  
ATOM   3795  H  HG2  . PRO A 1 38 ? 19.949 7.323   -4.775  1.00 0.00 ? 38 PRO A HG2  5  
ATOM   3796  H  HG3  . PRO A 1 38 ? 19.865 6.221   -3.370  1.00 0.00 ? 38 PRO A HG3  5  
ATOM   3797  H  HD2  . PRO A 1 38 ? 18.536 8.572   -3.413  1.00 0.00 ? 38 PRO A HD2  5  
ATOM   3798  H  HD3  . PRO A 1 38 ? 19.317 8.017   -1.901  1.00 0.00 ? 38 PRO A HD3  5  
ATOM   3799  N  N    . ASP A 1 39 ? 23.014 10.601  -4.698  1.00 0.00 ? 39 ASP A N    5  
ATOM   3800  C  CA   . ASP A 1 39 ? 23.497 11.271  -5.899  1.00 0.00 ? 39 ASP A CA   5  
ATOM   3801  C  C    . ASP A 1 39 ? 24.441 10.338  -6.667  1.00 0.00 ? 39 ASP A C    5  
ATOM   3802  O  O    . ASP A 1 39 ? 25.642 10.582  -6.761  1.00 0.00 ? 39 ASP A O    5  
ATOM   3803  C  CB   . ASP A 1 39 ? 24.157 12.600  -5.499  1.00 0.00 ? 39 ASP A CB   5  
ATOM   3804  C  CG   . ASP A 1 39 ? 24.605 13.420  -6.708  1.00 0.00 ? 39 ASP A CG   5  
ATOM   3805  O  OD1  . ASP A 1 39 ? 23.801 13.523  -7.660  1.00 0.00 ? 39 ASP A OD1  5  
ATOM   3806  O  OD2  . ASP A 1 39 ? 25.739 13.942  -6.653  1.00 0.00 ? 39 ASP A OD2  5  
ATOM   3807  H  H    . ASP A 1 39 ? 23.453 10.844  -3.822  1.00 0.00 ? 39 ASP A H    5  
ATOM   3808  H  HA   . ASP A 1 39 ? 22.641 11.501  -6.537  1.00 0.00 ? 39 ASP A HA   5  
ATOM   3809  H  HB2  . ASP A 1 39 ? 23.439 13.197  -4.936  1.00 0.00 ? 39 ASP A HB2  5  
ATOM   3810  H  HB3  . ASP A 1 39 ? 25.017 12.400  -4.858  1.00 0.00 ? 39 ASP A HB3  5  
ATOM   3811  N  N    . GLY A 1 40 ? 23.881 9.253   -7.212  1.00 0.00 ? 40 GLY A N    5  
ATOM   3812  C  CA   . GLY A 1 40 ? 24.589 8.300   -8.046  1.00 0.00 ? 40 GLY A CA   5  
ATOM   3813  C  C    . GLY A 1 40 ? 23.642 7.191   -8.499  1.00 0.00 ? 40 GLY A C    5  
ATOM   3814  O  O    . GLY A 1 40 ? 22.447 7.226   -8.206  1.00 0.00 ? 40 GLY A O    5  
ATOM   3815  H  H    . GLY A 1 40 ? 22.901 9.068   -7.029  1.00 0.00 ? 40 GLY A H    5  
ATOM   3816  H  HA2  . GLY A 1 40 ? 24.989 8.810   -8.923  1.00 0.00 ? 40 GLY A HA2  5  
ATOM   3817  H  HA3  . GLY A 1 40 ? 25.410 7.861   -7.477  1.00 0.00 ? 40 GLY A HA3  5  
ATOM   3818  N  N    . GLU A 1 41 ? 24.188 6.201   -9.216  1.00 0.00 ? 41 GLU A N    5  
ATOM   3819  C  CA   . GLU A 1 41 ? 23.440 5.048   -9.697  1.00 0.00 ? 41 GLU A CA   5  
ATOM   3820  C  C    . GLU A 1 41 ? 22.924 4.219   -8.518  1.00 0.00 ? 41 GLU A C    5  
ATOM   3821  O  O    . GLU A 1 41 ? 23.618 4.066   -7.513  1.00 0.00 ? 41 GLU A O    5  
ATOM   3822  C  CB   . GLU A 1 41 ? 24.331 4.194   -10.606 1.00 0.00 ? 41 GLU A CB   5  
ATOM   3823  C  CG   . GLU A 1 41 ? 24.760 4.957   -11.865 1.00 0.00 ? 41 GLU A CG   5  
ATOM   3824  C  CD   . GLU A 1 41 ? 25.644 4.089   -12.754 1.00 0.00 ? 41 GLU A CD   5  
ATOM   3825  O  OE1  . GLU A 1 41 ? 25.069 3.243   -13.473 1.00 0.00 ? 41 GLU A OE1  5  
ATOM   3826  O  OE2  . GLU A 1 41 ? 26.877 4.282   -12.693 1.00 0.00 ? 41 GLU A OE2  5  
ATOM   3827  H  H    . GLU A 1 41 ? 25.175 6.234   -9.419  1.00 0.00 ? 41 GLU A H    5  
ATOM   3828  H  HA   . GLU A 1 41 ? 22.590 5.406   -10.282 1.00 0.00 ? 41 GLU A HA   5  
ATOM   3829  H  HB2  . GLU A 1 41 ? 25.218 3.877   -10.056 1.00 0.00 ? 41 GLU A HB2  5  
ATOM   3830  H  HB3  . GLU A 1 41 ? 23.777 3.305   -10.913 1.00 0.00 ? 41 GLU A HB3  5  
ATOM   3831  H  HG2  . GLU A 1 41 ? 23.875 5.253   -12.428 1.00 0.00 ? 41 GLU A HG2  5  
ATOM   3832  H  HG3  . GLU A 1 41 ? 25.315 5.856   -11.592 1.00 0.00 ? 41 GLU A HG3  5  
ATOM   3833  N  N    . TRP A 1 42 ? 21.697 3.699   -8.642  1.00 0.00 ? 42 TRP A N    5  
ATOM   3834  C  CA   . TRP A 1 42 ? 20.978 3.057   -7.553  1.00 0.00 ? 42 TRP A CA   5  
ATOM   3835  C  C    . TRP A 1 42 ? 19.874 2.162   -8.119  1.00 0.00 ? 42 TRP A C    5  
ATOM   3836  O  O    . TRP A 1 42 ? 19.361 2.416   -9.209  1.00 0.00 ? 42 TRP A O    5  
ATOM   3837  C  CB   . TRP A 1 42 ? 20.393 4.122   -6.617  1.00 0.00 ? 42 TRP A CB   5  
ATOM   3838  C  CG   . TRP A 1 42 ? 19.637 3.569   -5.449  1.00 0.00 ? 42 TRP A CG   5  
ATOM   3839  C  CD1  . TRP A 1 42 ? 18.297 3.410   -5.389  1.00 0.00 ? 42 TRP A CD1  5  
ATOM   3840  C  CD2  . TRP A 1 42 ? 20.164 3.005   -4.210  1.00 0.00 ? 42 TRP A CD2  5  
ATOM   3841  N  NE1  . TRP A 1 42 ? 17.959 2.791   -4.207  1.00 0.00 ? 42 TRP A NE1  5  
ATOM   3842  C  CE2  . TRP A 1 42 ? 19.071 2.511   -3.440  1.00 0.00 ? 42 TRP A CE2  5  
ATOM   3843  C  CE3  . TRP A 1 42 ? 21.456 2.842   -3.667  1.00 0.00 ? 42 TRP A CE3  5  
ATOM   3844  C  CZ2  . TRP A 1 42 ? 19.249 1.888   -2.195  1.00 0.00 ? 42 TRP A CZ2  5  
ATOM   3845  C  CZ3  . TRP A 1 42 ? 21.647 2.223   -2.418  1.00 0.00 ? 42 TRP A CZ3  5  
ATOM   3846  C  CH2  . TRP A 1 42 ? 20.548 1.746   -1.682  1.00 0.00 ? 42 TRP A CH2  5  
ATOM   3847  H  H    . TRP A 1 42 ? 21.201 3.811   -9.514  1.00 0.00 ? 42 TRP A H    5  
ATOM   3848  H  HA   . TRP A 1 42 ? 21.672 2.432   -6.988  1.00 0.00 ? 42 TRP A HA   5  
ATOM   3849  H  HB2  . TRP A 1 42 ? 21.207 4.736   -6.224  1.00 0.00 ? 42 TRP A HB2  5  
ATOM   3850  H  HB3  . TRP A 1 42 ? 19.727 4.765   -7.197  1.00 0.00 ? 42 TRP A HB3  5  
ATOM   3851  H  HD1  . TRP A 1 42 ? 17.600 3.684   -6.166  1.00 0.00 ? 42 TRP A HD1  5  
ATOM   3852  H  HE1  . TRP A 1 42 ? 17.006 2.559   -3.968  1.00 0.00 ? 42 TRP A HE1  5  
ATOM   3853  H  HE3  . TRP A 1 42 ? 22.313 3.197   -4.221  1.00 0.00 ? 42 TRP A HE3  5  
ATOM   3854  H  HZ2  . TRP A 1 42 ? 18.401 1.523   -1.637  1.00 0.00 ? 42 TRP A HZ2  5  
ATOM   3855  H  HZ3  . TRP A 1 42 ? 22.645 2.110   -2.022  1.00 0.00 ? 42 TRP A HZ3  5  
ATOM   3856  H  HH2  . TRP A 1 42 ? 20.702 1.272   -0.725  1.00 0.00 ? 42 TRP A HH2  5  
ATOM   3857  N  N    . GLN A 1 43 ? 19.522 1.109   -7.370  1.00 0.00 ? 43 GLN A N    5  
ATOM   3858  C  CA   . GLN A 1 43 ? 18.451 0.177   -7.694  1.00 0.00 ? 43 GLN A CA   5  
ATOM   3859  C  C    . GLN A 1 43 ? 17.687 -0.191  -6.418  1.00 0.00 ? 43 GLN A C    5  
ATOM   3860  O  O    . GLN A 1 43 ? 18.159 0.047   -5.308  1.00 0.00 ? 43 GLN A O    5  
ATOM   3861  C  CB   . GLN A 1 43 ? 19.040 -1.082  -8.342  1.00 0.00 ? 43 GLN A CB   5  
ATOM   3862  C  CG   . GLN A 1 43 ? 19.759 -0.786  -9.663  1.00 0.00 ? 43 GLN A CG   5  
ATOM   3863  C  CD   . GLN A 1 43 ? 20.232 -2.073  -10.330 1.00 0.00 ? 43 GLN A CD   5  
ATOM   3864  O  OE1  . GLN A 1 43 ? 21.428 -2.345  -10.395 1.00 0.00 ? 43 GLN A OE1  5  
ATOM   3865  N  NE2  . GLN A 1 43 ? 19.286 -2.864  -10.835 1.00 0.00 ? 43 GLN A NE2  5  
ATOM   3866  H  H    . GLN A 1 43 ? 19.971 0.984   -6.475  1.00 0.00 ? 43 GLN A H    5  
ATOM   3867  H  HA   . GLN A 1 43 ? 17.749 0.640   -8.392  1.00 0.00 ? 43 GLN A HA   5  
ATOM   3868  H  HB2  . GLN A 1 43 ? 19.748 -1.545  -7.656  1.00 0.00 ? 43 GLN A HB2  5  
ATOM   3869  H  HB3  . GLN A 1 43 ? 18.229 -1.785  -8.532  1.00 0.00 ? 43 GLN A HB3  5  
ATOM   3870  H  HG2  . GLN A 1 43 ? 19.083 -0.262  -10.340 1.00 0.00 ? 43 GLN A HG2  5  
ATOM   3871  H  HG3  . GLN A 1 43 ? 20.629 -0.157  -9.479  1.00 0.00 ? 43 GLN A HG3  5  
ATOM   3872  H  HE21 . GLN A 1 43 ? 18.316 -2.597  -10.750 1.00 0.00 ? 43 GLN A HE21 5  
ATOM   3873  H  HE22 . GLN A 1 43 ? 19.537 -3.711  -11.340 1.00 0.00 ? 43 GLN A HE22 5  
ATOM   3874  N  N    . CYS A 1 44 ? 16.509 -0.801  -6.579  1.00 0.00 ? 44 CYS A N    5  
ATOM   3875  C  CA   . CYS A 1 44 ? 15.720 -1.331  -5.475  1.00 0.00 ? 44 CYS A CA   5  
ATOM   3876  C  C    . CYS A 1 44 ? 16.420 -2.558  -4.872  1.00 0.00 ? 44 CYS A C    5  
ATOM   3877  O  O    . CYS A 1 44 ? 17.170 -3.239  -5.573  1.00 0.00 ? 44 CYS A O    5  
ATOM   3878  C  CB   . CYS A 1 44 ? 14.316 -1.684  -5.984  1.00 0.00 ? 44 CYS A CB   5  
ATOM   3879  S  SG   . CYS A 1 44 ? 14.248 -2.998  -7.229  1.00 0.00 ? 44 CYS A SG   5  
ATOM   3880  H  H    . CYS A 1 44 ? 16.183 -0.976  -7.515  1.00 0.00 ? 44 CYS A H    5  
ATOM   3881  H  HA   . CYS A 1 44 ? 15.626 -0.545  -4.726  1.00 0.00 ? 44 CYS A HA   5  
ATOM   3882  H  HB2  . CYS A 1 44 ? 13.697 -2.014  -5.152  1.00 0.00 ? 44 CYS A HB2  5  
ATOM   3883  H  HB3  . CYS A 1 44 ? 13.861 -0.785  -6.403  1.00 0.00 ? 44 CYS A HB3  5  
ATOM   3884  N  N    . PRO A 1 45 ? 16.180 -2.869  -3.586  1.00 0.00 ? 45 PRO A N    5  
ATOM   3885  C  CA   . PRO A 1 45 ? 16.909 -3.911  -2.875  1.00 0.00 ? 45 PRO A CA   5  
ATOM   3886  C  C    . PRO A 1 45 ? 16.559 -5.329  -3.342  1.00 0.00 ? 45 PRO A C    5  
ATOM   3887  O  O    . PRO A 1 45 ? 17.185 -6.284  -2.886  1.00 0.00 ? 45 PRO A O    5  
ATOM   3888  C  CB   . PRO A 1 45 ? 16.595 -3.701  -1.390  1.00 0.00 ? 45 PRO A CB   5  
ATOM   3889  C  CG   . PRO A 1 45 ? 15.237 -3.002  -1.416  1.00 0.00 ? 45 PRO A CG   5  
ATOM   3890  C  CD   . PRO A 1 45 ? 15.355 -2.118  -2.655  1.00 0.00 ? 45 PRO A CD   5  
ATOM   3891  H  HA   . PRO A 1 45 ? 17.974 -3.753  -3.029  1.00 0.00 ? 45 PRO A HA   5  
ATOM   3892  H  HB2  . PRO A 1 45 ? 16.567 -4.633  -0.821  1.00 0.00 ? 45 PRO A HB2  5  
ATOM   3893  H  HB3  . PRO A 1 45 ? 17.333 -3.022  -0.959  1.00 0.00 ? 45 PRO A HB3  5  
ATOM   3894  H  HG2  . PRO A 1 45 ? 14.449 -3.744  -1.570  1.00 0.00 ? 45 PRO A HG2  5  
ATOM   3895  H  HG3  . PRO A 1 45 ? 15.047 -2.425  -0.511  1.00 0.00 ? 45 PRO A HG3  5  
ATOM   3896  H  HD2  . PRO A 1 45 ? 14.364 -1.887  -3.042  1.00 0.00 ? 45 PRO A HD2  5  
ATOM   3897  H  HD3  . PRO A 1 45 ? 15.886 -1.205  -2.387  1.00 0.00 ? 45 PRO A HD3  5  
ATOM   3898  N  N    . ALA A 1 46 ? 15.576 -5.481  -4.240  1.00 0.00 ? 46 ALA A N    5  
ATOM   3899  C  CA   . ALA A 1 46 ? 15.304 -6.741  -4.913  1.00 0.00 ? 46 ALA A CA   5  
ATOM   3900  C  C    . ALA A 1 46 ? 16.449 -7.072  -5.868  1.00 0.00 ? 46 ALA A C    5  
ATOM   3901  O  O    . ALA A 1 46 ? 16.861 -8.227  -5.955  1.00 0.00 ? 46 ALA A O    5  
ATOM   3902  C  CB   . ALA A 1 46 ? 13.974 -6.647  -5.664  1.00 0.00 ? 46 ALA A CB   5  
ATOM   3903  H  H    . ALA A 1 46 ? 15.126 -4.667  -4.625  1.00 0.00 ? 46 ALA A H    5  
ATOM   3904  H  HA   . ALA A 1 46 ? 15.217 -7.534  -4.168  1.00 0.00 ? 46 ALA A HA   5  
ATOM   3905  H  HB1  . ALA A 1 46 ? 14.029 -5.878  -6.435  1.00 0.00 ? 46 ALA A HB1  5  
ATOM   3906  H  HB2  . ALA A 1 46 ? 13.754 -7.606  -6.135  1.00 0.00 ? 46 ALA A HB2  5  
ATOM   3907  H  HB3  . ALA A 1 46 ? 13.172 -6.402  -4.967  1.00 0.00 ? 46 ALA A HB3  5  
ATOM   3908  N  N    . CYS A 1 47 ? 16.969 -6.058  -6.576  1.00 0.00 ? 47 CYS A N    5  
ATOM   3909  C  CA   . CYS A 1 47 ? 18.145 -6.202  -7.410  1.00 0.00 ? 47 CYS A CA   5  
ATOM   3910  C  C    . CYS A 1 47 ? 19.397 -6.381  -6.550  1.00 0.00 ? 47 CYS A C    5  
ATOM   3911  O  O    . CYS A 1 47 ? 20.174 -7.301  -6.794  1.00 0.00 ? 47 CYS A O    5  
ATOM   3912  C  CB   . CYS A 1 47 ? 18.281 -5.006  -8.349  1.00 0.00 ? 47 CYS A CB   5  
ATOM   3913  S  SG   . CYS A 1 47 ? 16.870 -4.720  -9.443  1.00 0.00 ? 47 CYS A SG   5  
ATOM   3914  H  H    . CYS A 1 47 ? 16.614 -5.119  -6.461  1.00 0.00 ? 47 CYS A H    5  
ATOM   3915  H  HA   . CYS A 1 47 ? 18.005 -7.086  -8.028  1.00 0.00 ? 47 CYS A HA   5  
ATOM   3916  H  HB2  . CYS A 1 47 ? 18.460 -4.102  -7.768  1.00 0.00 ? 47 CYS A HB2  5  
ATOM   3917  H  HB3  . CYS A 1 47 ? 19.143 -5.184  -8.990  1.00 0.00 ? 47 CYS A HB3  5  
ATOM   3918  N  N    . GLN A 1 48 ? 19.577 -5.514  -5.543  1.00 0.00 ? 48 GLN A N    5  
ATOM   3919  C  CA   . GLN A 1 48 ? 20.754 -5.481  -4.693  1.00 0.00 ? 48 GLN A CA   5  
ATOM   3920  C  C    . GLN A 1 48 ? 20.388 -5.718  -3.220  1.00 0.00 ? 48 GLN A C    5  
ATOM   3921  O  O    . GLN A 1 48 ? 20.140 -4.761  -2.489  1.00 0.00 ? 48 GLN A O    5  
ATOM   3922  C  CB   . GLN A 1 48 ? 21.497 -4.153  -4.914  1.00 0.00 ? 48 GLN A CB   5  
ATOM   3923  C  CG   . GLN A 1 48 ? 20.630 -2.881  -4.920  1.00 0.00 ? 48 GLN A CG   5  
ATOM   3924  C  CD   . GLN A 1 48 ? 21.483 -1.613  -5.006  1.00 0.00 ? 48 GLN A CD   5  
ATOM   3925  O  OE1  . GLN A 1 48 ? 22.676 -1.671  -5.296  1.00 0.00 ? 48 GLN A OE1  5  
ATOM   3926  N  NE2  . GLN A 1 48 ? 20.884 -0.454  -4.726  1.00 0.00 ? 48 GLN A NE2  5  
ATOM   3927  H  H    . GLN A 1 48 ? 18.918 -4.762  -5.407  1.00 0.00 ? 48 GLN A H    5  
ATOM   3928  H  HA   . GLN A 1 48 ? 21.457 -6.266  -4.973  1.00 0.00 ? 48 GLN A HA   5  
ATOM   3929  H  HB2  . GLN A 1 48 ? 22.233 -4.065  -4.121  1.00 0.00 ? 48 GLN A HB2  5  
ATOM   3930  H  HB3  . GLN A 1 48 ? 22.015 -4.213  -5.875  1.00 0.00 ? 48 GLN A HB3  5  
ATOM   3931  H  HG2  . GLN A 1 48 ? 19.957 -2.901  -5.776  1.00 0.00 ? 48 GLN A HG2  5  
ATOM   3932  H  HG3  . GLN A 1 48 ? 20.033 -2.824  -4.012  1.00 0.00 ? 48 GLN A HG3  5  
ATOM   3933  H  HE21 . GLN A 1 48 ? 19.886 -0.425  -4.549  1.00 0.00 ? 48 GLN A HE21 5  
ATOM   3934  H  HE22 . GLN A 1 48 ? 21.437 0.392   -4.697  1.00 0.00 ? 48 GLN A HE22 5  
ATOM   3935  N  N    . PRO A 1 49 ? 20.354 -6.984  -2.768  1.00 0.00 ? 49 PRO A N    5  
ATOM   3936  C  CA   . PRO A 1 49 ? 20.249 -7.319  -1.353  1.00 0.00 ? 49 PRO A CA   5  
ATOM   3937  C  C    . PRO A 1 49 ? 21.466 -6.836  -0.555  1.00 0.00 ? 49 PRO A C    5  
ATOM   3938  O  O    . PRO A 1 49 ? 22.392 -7.601  -0.288  1.00 0.00 ? 49 PRO A O    5  
ATOM   3939  C  CB   . PRO A 1 49 ? 20.058 -8.837  -1.300  1.00 0.00 ? 49 PRO A CB   5  
ATOM   3940  C  CG   . PRO A 1 49 ? 19.268 -9.103  -2.577  1.00 0.00 ? 49 PRO A CG   5  
ATOM   3941  C  CD   . PRO A 1 49 ? 19.885 -8.112  -3.563  1.00 0.00 ? 49 PRO A CD   5  
ATOM   3942  H  HA   . PRO A 1 49 ? 19.345 -6.859  -0.951  1.00 0.00 ? 49 PRO A HA   5  
ATOM   3943  H  HB2  . PRO A 1 49 ? 21.014 -9.352  -1.376  1.00 0.00 ? 49 PRO A HB2  5  
ATOM   3944  H  HB3  . PRO A 1 49 ? 19.522 -9.156  -0.405  1.00 0.00 ? 49 PRO A HB3  5  
ATOM   3945  H  HG2  . PRO A 1 49 ? 19.359 -10.136 -2.915  1.00 0.00 ? 49 PRO A HG2  5  
ATOM   3946  H  HG3  . PRO A 1 49 ? 18.220 -8.851  -2.412  1.00 0.00 ? 49 PRO A HG3  5  
ATOM   3947  H  HD2  . PRO A 1 49 ? 20.734 -8.571  -4.072  1.00 0.00 ? 49 PRO A HD2  5  
ATOM   3948  H  HD3  . PRO A 1 49 ? 19.124 -7.826  -4.287  1.00 0.00 ? 49 PRO A HD3  5  
ATOM   3949  N  N    . ALA A 1 50 ? 21.447 -5.559  -0.155  1.00 0.00 ? 50 ALA A N    5  
ATOM   3950  C  CA   . ALA A 1 50 ? 22.420 -4.962  0.749   1.00 0.00 ? 50 ALA A CA   5  
ATOM   3951  C  C    . ALA A 1 50 ? 22.126 -5.394  2.189   1.00 0.00 ? 50 ALA A C    5  
ATOM   3952  O  O    . ALA A 1 50 ? 21.729 -4.580  3.021   1.00 0.00 ? 50 ALA A O    5  
ATOM   3953  C  CB   . ALA A 1 50 ? 22.387 -3.439  0.582   1.00 0.00 ? 50 ALA A CB   5  
ATOM   3954  H  H    . ALA A 1 50 ? 20.704 -4.967  -0.501  1.00 0.00 ? 50 ALA A H    5  
ATOM   3955  H  HA   . ALA A 1 50 ? 23.421 -5.302  0.481   1.00 0.00 ? 50 ALA A HA   5  
ATOM   3956  H  HB1  . ALA A 1 50 ? 21.396 -3.053  0.823   1.00 0.00 ? 50 ALA A HB1  5  
ATOM   3957  H  HB2  . ALA A 1 50 ? 23.124 -2.978  1.241   1.00 0.00 ? 50 ALA A HB2  5  
ATOM   3958  H  HB3  . ALA A 1 50 ? 22.626 -3.180  -0.450  1.00 0.00 ? 50 ALA A HB3  5  
ATOM   3959  N  N    . THR A 1 51 ? 22.315 -6.689  2.462   1.00 0.00 ? 51 THR A N    5  
ATOM   3960  C  CA   . THR A 1 51 ? 21.905 -7.355  3.687   1.00 0.00 ? 51 THR A CA   5  
ATOM   3961  C  C    . THR A 1 51 ? 22.951 -8.416  4.032   1.00 0.00 ? 51 THR A C    5  
ATOM   3962  O  O    . THR A 1 51 ? 23.566 -8.285  5.113   1.00 0.00 ? 51 THR A O    5  
ATOM   3963  C  CB   . THR A 1 51 ? 20.519 -7.997  3.500   1.00 0.00 ? 51 THR A CB   5  
ATOM   3964  O  OG1  . THR A 1 51 ? 20.513 -8.820  2.351   1.00 0.00 ? 51 THR A OG1  5  
ATOM   3965  C  CG2  . THR A 1 51 ? 19.407 -6.951  3.370   1.00 0.00 ? 51 THR A CG2  5  
ATOM   3966  O  OXT  . THR A 1 51 ? 23.115 -9.341  3.206   1.00 0.00 ? 51 THR A OXT  5  
ATOM   3967  H  H    . THR A 1 51 ? 22.653 -7.288  1.719   1.00 0.00 ? 51 THR A H    5  
ATOM   3968  H  HA   . THR A 1 51 ? 21.857 -6.643  4.512   1.00 0.00 ? 51 THR A HA   5  
ATOM   3969  H  HB   . THR A 1 51 ? 20.307 -8.614  4.374   1.00 0.00 ? 51 THR A HB   5  
ATOM   3970  H  HG1  . THR A 1 51 ? 21.319 -9.348  2.366   1.00 0.00 ? 51 THR A HG1  5  
ATOM   3971  H  HG21 . THR A 1 51 ? 19.431 -6.276  4.225   1.00 0.00 ? 51 THR A HG21 5  
ATOM   3972  H  HG22 . THR A 1 51 ? 19.527 -6.377  2.452   1.00 0.00 ? 51 THR A HG22 5  
ATOM   3973  H  HG23 . THR A 1 51 ? 18.441 -7.455  3.343   1.00 0.00 ? 51 THR A HG23 5  
HETATM 3974  ZN ZN   . ZN  B 2 .  ? 6.876  4.622   -0.596  1.00 0.00 ? 52 ZN  A ZN   5  
HETATM 3975  ZN ZN   . ZN  C 2 .  ? 15.010 -3.380  -9.360  1.00 0.00 ? 53 ZN  A ZN   5  
ATOM   3976  N  N    . ALA A 1 1  ? 4.023  11.017  -5.812  1.00 0.00 ? 1  ALA A N    6  
ATOM   3977  C  CA   . ALA A 1 1  ? 2.728  10.801  -6.477  1.00 0.00 ? 1  ALA A CA   6  
ATOM   3978  C  C    . ALA A 1 1  ? 2.128  9.449   -6.087  1.00 0.00 ? 1  ALA A C    6  
ATOM   3979  O  O    . ALA A 1 1  ? 1.058  9.409   -5.481  1.00 0.00 ? 1  ALA A O    6  
ATOM   3980  C  CB   . ALA A 1 1  ? 2.862  10.939  -7.998  1.00 0.00 ? 1  ALA A CB   6  
ATOM   3981  H  H1   . ALA A 1 1  ? 3.928  10.847  -4.818  1.00 0.00 ? 1  ALA A H1   6  
ATOM   3982  H  H2   . ALA A 1 1  ? 4.709  10.381  -6.188  1.00 0.00 ? 1  ALA A H2   6  
ATOM   3983  H  H3   . ALA A 1 1  ? 4.331  11.967  -5.958  1.00 0.00 ? 1  ALA A H3   6  
ATOM   3984  H  HA   . ALA A 1 1  ? 2.051  11.581  -6.129  1.00 0.00 ? 1  ALA A HA   6  
ATOM   3985  H  HB1  . ALA A 1 1  ? 3.221  11.938  -8.245  1.00 0.00 ? 1  ALA A HB1  6  
ATOM   3986  H  HB2  . ALA A 1 1  ? 3.567  10.203  -8.387  1.00 0.00 ? 1  ALA A HB2  6  
ATOM   3987  H  HB3  . ALA A 1 1  ? 1.891  10.786  -8.467  1.00 0.00 ? 1  ALA A HB3  6  
ATOM   3988  N  N    . ARG A 1 2  ? 2.807  8.347   -6.435  1.00 0.00 ? 2  ARG A N    6  
ATOM   3989  C  CA   . ARG A 1 2  ? 2.424  7.004   -6.017  1.00 0.00 ? 2  ARG A CA   6  
ATOM   3990  C  C    . ARG A 1 2  ? 3.657  6.098   -6.010  1.00 0.00 ? 2  ARG A C    6  
ATOM   3991  O  O    . ARG A 1 2  ? 4.660  6.415   -6.647  1.00 0.00 ? 2  ARG A O    6  
ATOM   3992  C  CB   . ARG A 1 2  ? 1.311  6.475   -6.939  1.00 0.00 ? 2  ARG A CB   6  
ATOM   3993  C  CG   . ARG A 1 2  ? 0.533  5.271   -6.385  1.00 0.00 ? 2  ARG A CG   6  
ATOM   3994  C  CD   . ARG A 1 2  ? -0.136 5.596   -5.044  1.00 0.00 ? 2  ARG A CD   6  
ATOM   3995  N  NE   . ARG A 1 2  ? -1.127 4.581   -4.671  1.00 0.00 ? 2  ARG A NE   6  
ATOM   3996  C  CZ   . ARG A 1 2  ? -1.982 4.705   -3.640  1.00 0.00 ? 2  ARG A CZ   6  
ATOM   3997  N  NH1  . ARG A 1 2  ? -1.978 5.808   -2.877  1.00 0.00 ? 2  ARG A NH1  6  
ATOM   3998  N  NH2  . ARG A 1 2  ? -2.840 3.714   -3.368  1.00 0.00 ? 2  ARG A NH2  6  
ATOM   3999  H  H    . ARG A 1 2  ? 3.670  8.430   -6.954  1.00 0.00 ? 2  ARG A H    6  
ATOM   4000  H  HA   . ARG A 1 2  ? 2.065  7.086   -4.992  1.00 0.00 ? 2  ARG A HA   6  
ATOM   4001  H  HB2  . ARG A 1 2  ? 0.586  7.271   -7.115  1.00 0.00 ? 2  ARG A HB2  6  
ATOM   4002  H  HB3  . ARG A 1 2  ? 1.748  6.203   -7.902  1.00 0.00 ? 2  ARG A HB3  6  
ATOM   4003  H  HG2  . ARG A 1 2  ? -0.245 5.026   -7.111  1.00 0.00 ? 2  ARG A HG2  6  
ATOM   4004  H  HG3  . ARG A 1 2  ? 1.181  4.401   -6.281  1.00 0.00 ? 2  ARG A HG3  6  
ATOM   4005  H  HD2  . ARG A 1 2  ? 0.614  5.633   -4.255  1.00 0.00 ? 2  ARG A HD2  6  
ATOM   4006  H  HD3  . ARG A 1 2  ? -0.627 6.568   -5.125  1.00 0.00 ? 2  ARG A HD3  6  
ATOM   4007  H  HE   . ARG A 1 2  ? -1.152 3.738   -5.227  1.00 0.00 ? 2  ARG A HE   6  
ATOM   4008  H  HH11 . ARG A 1 2  ? -1.322 6.553   -3.069  1.00 0.00 ? 2  ARG A HH11 6  
ATOM   4009  H  HH12 . ARG A 1 2  ? -2.605 5.885   -2.091  1.00 0.00 ? 2  ARG A HH12 6  
ATOM   4010  H  HH21 . ARG A 1 2  ? -2.853 2.880   -3.938  1.00 0.00 ? 2  ARG A HH21 6  
ATOM   4011  H  HH22 . ARG A 1 2  ? -3.467 3.786   -2.579  1.00 0.00 ? 2  ARG A HH22 6  
ATOM   4012  N  N    . CYS A 1 3  ? 3.579  4.980   -5.279  1.00 0.00 ? 3  CYS A N    6  
ATOM   4013  C  CA   . CYS A 1 3  ? 4.707  4.114   -4.970  1.00 0.00 ? 3  CYS A CA   6  
ATOM   4014  C  C    . CYS A 1 3  ? 4.272  2.647   -4.991  1.00 0.00 ? 3  CYS A C    6  
ATOM   4015  O  O    . CYS A 1 3  ? 3.103  2.345   -4.752  1.00 0.00 ? 3  CYS A O    6  
ATOM   4016  C  CB   . CYS A 1 3  ? 5.229  4.516   -3.591  1.00 0.00 ? 3  CYS A CB   6  
ATOM   4017  S  SG   . CYS A 1 3  ? 6.614  3.549   -2.949  1.00 0.00 ? 3  CYS A SG   6  
ATOM   4018  H  H    . CYS A 1 3  ? 2.700  4.750   -4.837  1.00 0.00 ? 3  CYS A H    6  
ATOM   4019  H  HA   . CYS A 1 3  ? 5.504  4.250   -5.703  1.00 0.00 ? 3  CYS A HA   6  
ATOM   4020  H  HB2  . CYS A 1 3  ? 5.557  5.554   -3.654  1.00 0.00 ? 3  CYS A HB2  6  
ATOM   4021  H  HB3  . CYS A 1 3  ? 4.410  4.444   -2.873  1.00 0.00 ? 3  CYS A HB3  6  
ATOM   4022  N  N    . LYS A 1 4  ? 5.220  1.743   -5.268  1.00 0.00 ? 4  LYS A N    6  
ATOM   4023  C  CA   . LYS A 1 4  ? 5.021  0.300   -5.206  1.00 0.00 ? 4  LYS A CA   6  
ATOM   4024  C  C    . LYS A 1 4  ? 4.799  -0.175  -3.768  1.00 0.00 ? 4  LYS A C    6  
ATOM   4025  O  O    . LYS A 1 4  ? 3.849  -0.906  -3.494  1.00 0.00 ? 4  LYS A O    6  
ATOM   4026  C  CB   . LYS A 1 4  ? 6.223  -0.402  -5.854  1.00 0.00 ? 4  LYS A CB   6  
ATOM   4027  C  CG   . LYS A 1 4  ? 6.072  -1.929  -5.840  1.00 0.00 ? 4  LYS A CG   6  
ATOM   4028  C  CD   . LYS A 1 4  ? 7.246  -2.584  -6.576  1.00 0.00 ? 4  LYS A CD   6  
ATOM   4029  C  CE   . LYS A 1 4  ? 7.156  -4.116  -6.558  1.00 0.00 ? 4  LYS A CE   6  
ATOM   4030  N  NZ   . LYS A 1 4  ? 7.296  -4.669  -5.197  1.00 0.00 ? 4  LYS A NZ   6  
ATOM   4031  H  H    . LYS A 1 4  ? 6.149  2.072   -5.497  1.00 0.00 ? 4  LYS A H    6  
ATOM   4032  H  HA   . LYS A 1 4  ? 4.139  0.050   -5.789  1.00 0.00 ? 4  LYS A HA   6  
ATOM   4033  H  HB2  . LYS A 1 4  ? 6.310  -0.062  -6.888  1.00 0.00 ? 4  LYS A HB2  6  
ATOM   4034  H  HB3  . LYS A 1 4  ? 7.131  -0.128  -5.313  1.00 0.00 ? 4  LYS A HB3  6  
ATOM   4035  H  HG2  . LYS A 1 4  ? 6.048  -2.278  -4.810  1.00 0.00 ? 4  LYS A HG2  6  
ATOM   4036  H  HG3  . LYS A 1 4  ? 5.138  -2.203  -6.333  1.00 0.00 ? 4  LYS A HG3  6  
ATOM   4037  H  HD2  . LYS A 1 4  ? 7.241  -2.249  -7.615  1.00 0.00 ? 4  LYS A HD2  6  
ATOM   4038  H  HD3  . LYS A 1 4  ? 8.184  -2.271  -6.117  1.00 0.00 ? 4  LYS A HD3  6  
ATOM   4039  H  HE2  . LYS A 1 4  ? 6.199  -4.431  -6.977  1.00 0.00 ? 4  LYS A HE2  6  
ATOM   4040  H  HE3  . LYS A 1 4  ? 7.957  -4.521  -7.177  1.00 0.00 ? 4  LYS A HE3  6  
ATOM   4041  H  HZ1  . LYS A 1 4  ? 7.264  -5.678  -5.238  1.00 0.00 ? 4  LYS A HZ1  6  
ATOM   4042  H  HZ2  . LYS A 1 4  ? 8.179  -4.380  -4.801  1.00 0.00 ? 4  LYS A HZ2  6  
ATOM   4043  H  HZ3  . LYS A 1 4  ? 6.541  -4.338  -4.612  1.00 0.00 ? 4  LYS A HZ3  6  
ATOM   4044  N  N    . VAL A 1 5  ? 5.699  0.219   -2.862  1.00 0.00 ? 5  VAL A N    6  
ATOM   4045  C  CA   . VAL A 1 5  ? 5.773  -0.304  -1.504  1.00 0.00 ? 5  VAL A CA   6  
ATOM   4046  C  C    . VAL A 1 5  ? 4.611  0.233   -0.671  1.00 0.00 ? 5  VAL A C    6  
ATOM   4047  O  O    . VAL A 1 5  ? 3.686  -0.514  -0.352  1.00 0.00 ? 5  VAL A O    6  
ATOM   4048  C  CB   . VAL A 1 5  ? 7.140  0.030   -0.885  1.00 0.00 ? 5  VAL A CB   6  
ATOM   4049  C  CG1  . VAL A 1 5  ? 7.247  -0.432  0.574   1.00 0.00 ? 5  VAL A CG1  6  
ATOM   4050  C  CG2  . VAL A 1 5  ? 8.255  -0.646  -1.686  1.00 0.00 ? 5  VAL A CG2  6  
ATOM   4051  H  H    . VAL A 1 5  ? 6.437  0.827   -3.181  1.00 0.00 ? 5  VAL A H    6  
ATOM   4052  H  HA   . VAL A 1 5  ? 5.688  -1.389  -1.545  1.00 0.00 ? 5  VAL A HA   6  
ATOM   4053  H  HB   . VAL A 1 5  ? 7.297  1.105   -0.922  1.00 0.00 ? 5  VAL A HB   6  
ATOM   4054  H  HG11 . VAL A 1 5  ? 8.248  -0.216  0.952   1.00 0.00 ? 5  VAL A HG11 6  
ATOM   4055  H  HG12 . VAL A 1 5  ? 6.529  0.095   1.203   1.00 0.00 ? 5  VAL A HG12 6  
ATOM   4056  H  HG13 . VAL A 1 5  ? 7.065  -1.505  0.642   1.00 0.00 ? 5  VAL A HG13 6  
ATOM   4057  H  HG21 . VAL A 1 5  ? 8.110  -1.726  -1.701  1.00 0.00 ? 5  VAL A HG21 6  
ATOM   4058  H  HG22 . VAL A 1 5  ? 8.259  -0.270  -2.709  1.00 0.00 ? 5  VAL A HG22 6  
ATOM   4059  H  HG23 . VAL A 1 5  ? 9.215  -0.422  -1.222  1.00 0.00 ? 5  VAL A HG23 6  
ATOM   4060  N  N    . CYS A 1 6  ? 4.666  1.516   -0.297  1.00 0.00 ? 6  CYS A N    6  
ATOM   4061  C  CA   . CYS A 1 6  ? 3.736  2.077   0.671   1.00 0.00 ? 6  CYS A CA   6  
ATOM   4062  C  C    . CYS A 1 6  ? 2.347  2.263   0.057   1.00 0.00 ? 6  CYS A C    6  
ATOM   4063  O  O    . CYS A 1 6  ? 1.353  2.061   0.752   1.00 0.00 ? 6  CYS A O    6  
ATOM   4064  C  CB   . CYS A 1 6  ? 4.281  3.373   1.283   1.00 0.00 ? 6  CYS A CB   6  
ATOM   4065  S  SG   . CYS A 1 6  ? 4.662  4.730   0.146   1.00 0.00 ? 6  CYS A SG   6  
ATOM   4066  H  H    . CYS A 1 6  ? 5.429  2.095   -0.617  1.00 0.00 ? 6  CYS A H    6  
ATOM   4067  H  HA   . CYS A 1 6  ? 3.636  1.367   1.495   1.00 0.00 ? 6  CYS A HA   6  
ATOM   4068  H  HB2  . CYS A 1 6  ? 3.541  3.738   1.995   1.00 0.00 ? 6  CYS A HB2  6  
ATOM   4069  H  HB3  . CYS A 1 6  ? 5.191  3.144   1.837   1.00 0.00 ? 6  CYS A HB3  6  
ATOM   4070  N  N    . ARG A 1 7  ? 2.280  2.627   -1.233  1.00 0.00 ? 7  ARG A N    6  
ATOM   4071  C  CA   . ARG A 1 7  ? 1.040  2.929   -1.941  1.00 0.00 ? 7  ARG A CA   6  
ATOM   4072  C  C    . ARG A 1 7  ? 0.279  4.033   -1.205  1.00 0.00 ? 7  ARG A C    6  
ATOM   4073  O  O    . ARG A 1 7  ? -0.855 3.839   -0.771  1.00 0.00 ? 7  ARG A O    6  
ATOM   4074  C  CB   . ARG A 1 7  ? 0.205  1.653   -2.145  1.00 0.00 ? 7  ARG A CB   6  
ATOM   4075  C  CG   . ARG A 1 7  ? 0.896  0.688   -3.119  1.00 0.00 ? 7  ARG A CG   6  
ATOM   4076  C  CD   . ARG A 1 7  ? 0.534  -0.767  -2.814  1.00 0.00 ? 7  ARG A CD   6  
ATOM   4077  N  NE   . ARG A 1 7  ? 1.236  -1.224  -1.608  1.00 0.00 ? 7  ARG A NE   6  
ATOM   4078  C  CZ   . ARG A 1 7  ? 1.013  -2.369  -0.946  1.00 0.00 ? 7  ARG A CZ   6  
ATOM   4079  N  NH1  . ARG A 1 7  ? 0.048  -3.215  -1.334  1.00 0.00 ? 7  ARG A NH1  6  
ATOM   4080  N  NH2  . ARG A 1 7  ? 1.776  -2.661  0.114   1.00 0.00 ? 7  ARG A NH2  6  
ATOM   4081  H  H    . ARG A 1 7  ? 3.143  2.746   -1.744  1.00 0.00 ? 7  ARG A H    6  
ATOM   4082  H  HA   . ARG A 1 7  ? 1.299  3.319   -2.927  1.00 0.00 ? 7  ARG A HA   6  
ATOM   4083  H  HB2  . ARG A 1 7  ? 0.035  1.164   -1.187  1.00 0.00 ? 7  ARG A HB2  6  
ATOM   4084  H  HB3  . ARG A 1 7  ? -0.767 1.910   -2.567  1.00 0.00 ? 7  ARG A HB3  6  
ATOM   4085  H  HG2  . ARG A 1 7  ? 0.598  0.938   -4.138  1.00 0.00 ? 7  ARG A HG2  6  
ATOM   4086  H  HG3  . ARG A 1 7  ? 1.977  0.787   -3.043  1.00 0.00 ? 7  ARG A HG3  6  
ATOM   4087  H  HD2  . ARG A 1 7  ? -0.547 -0.853  -2.693  1.00 0.00 ? 7  ARG A HD2  6  
ATOM   4088  H  HD3  . ARG A 1 7  ? 0.852  -1.389  -3.651  1.00 0.00 ? 7  ARG A HD3  6  
ATOM   4089  H  HE   . ARG A 1 7  ? 1.997  -0.639  -1.280  1.00 0.00 ? 7  ARG A HE   6  
ATOM   4090  H  HH11 . ARG A 1 7  ? -0.519 -2.996  -2.141  1.00 0.00 ? 7  ARG A HH11 6  
ATOM   4091  H  HH12 . ARG A 1 7  ? -0.112 -4.073  -0.829  1.00 0.00 ? 7  ARG A HH12 6  
ATOM   4092  H  HH21 . ARG A 1 7  ? 2.519  -2.024  0.374   1.00 0.00 ? 7  ARG A HH21 6  
ATOM   4093  H  HH22 . ARG A 1 7  ? 1.630  -3.509  0.642   1.00 0.00 ? 7  ARG A HH22 6  
ATOM   4094  N  N    . LYS A 1 8  ? 0.931  5.193   -1.070  1.00 0.00 ? 8  LYS A N    6  
ATOM   4095  C  CA   . LYS A 1 8  ? 0.403  6.383   -0.418  1.00 0.00 ? 8  LYS A CA   6  
ATOM   4096  C  C    . LYS A 1 8  ? 0.587  7.592   -1.339  1.00 0.00 ? 8  LYS A C    6  
ATOM   4097  O  O    . LYS A 1 8  ? 1.183  7.487   -2.410  1.00 0.00 ? 8  LYS A O    6  
ATOM   4098  C  CB   . LYS A 1 8  ? 1.139  6.616   0.908   1.00 0.00 ? 8  LYS A CB   6  
ATOM   4099  C  CG   . LYS A 1 8  ? 0.844  5.530   1.950   1.00 0.00 ? 8  LYS A CG   6  
ATOM   4100  C  CD   . LYS A 1 8  ? 1.664  5.740   3.229   1.00 0.00 ? 8  LYS A CD   6  
ATOM   4101  C  CE   . LYS A 1 8  ? 1.193  6.947   4.052   1.00 0.00 ? 8  LYS A CE   6  
ATOM   4102  N  NZ   . LYS A 1 8  ? 2.046  7.154   5.233   1.00 0.00 ? 8  LYS A NZ   6  
ATOM   4103  H  H    . LYS A 1 8  ? 1.856  5.272   -1.470  1.00 0.00 ? 8  LYS A H    6  
ATOM   4104  H  HA   . LYS A 1 8  ? -0.660 6.276   -0.208  1.00 0.00 ? 8  LYS A HA   6  
ATOM   4105  H  HB2  . LYS A 1 8  ? 2.209  6.645   0.705   1.00 0.00 ? 8  LYS A HB2  6  
ATOM   4106  H  HB3  . LYS A 1 8  ? 0.827  7.579   1.314   1.00 0.00 ? 8  LYS A HB3  6  
ATOM   4107  H  HG2  . LYS A 1 8  ? -0.220 5.520   2.188   1.00 0.00 ? 8  LYS A HG2  6  
ATOM   4108  H  HG3  . LYS A 1 8  ? 1.115  4.560   1.537   1.00 0.00 ? 8  LYS A HG3  6  
ATOM   4109  H  HD2  . LYS A 1 8  ? 1.573  4.844   3.846   1.00 0.00 ? 8  LYS A HD2  6  
ATOM   4110  H  HD3  . LYS A 1 8  ? 2.714  5.869   2.962   1.00 0.00 ? 8  LYS A HD3  6  
ATOM   4111  H  HE2  . LYS A 1 8  ? 1.239  7.857   3.454   1.00 0.00 ? 8  LYS A HE2  6  
ATOM   4112  H  HE3  . LYS A 1 8  ? 0.163  6.788   4.376   1.00 0.00 ? 8  LYS A HE3  6  
ATOM   4113  H  HZ1  . LYS A 1 8  ? 1.714  7.948   5.759   1.00 0.00 ? 8  LYS A HZ1  6  
ATOM   4114  H  HZ2  . LYS A 1 8  ? 2.040  6.330   5.817   1.00 0.00 ? 8  LYS A HZ2  6  
ATOM   4115  H  HZ3  . LYS A 1 8  ? 2.994  7.340   4.920   1.00 0.00 ? 8  LYS A HZ3  6  
ATOM   4116  N  N    . LYS A 1 9  ? 0.044  8.735   -0.910  1.00 0.00 ? 9  LYS A N    6  
ATOM   4117  C  CA   . LYS A 1 9  ? 0.283  10.038  -1.506  1.00 0.00 ? 9  LYS A CA   6  
ATOM   4118  C  C    . LYS A 1 9  ? 0.347  11.045  -0.357  1.00 0.00 ? 9  LYS A C    6  
ATOM   4119  O  O    . LYS A 1 9  ? -0.668 11.632  0.016   1.00 0.00 ? 9  LYS A O    6  
ATOM   4120  C  CB   . LYS A 1 9  ? -0.824 10.359  -2.520  1.00 0.00 ? 9  LYS A CB   6  
ATOM   4121  C  CG   . LYS A 1 9  ? -0.535 11.675  -3.258  1.00 0.00 ? 9  LYS A CG   6  
ATOM   4122  C  CD   . LYS A 1 9  ? -1.741 12.159  -4.072  1.00 0.00 ? 9  LYS A CD   6  
ATOM   4123  C  CE   . LYS A 1 9  ? -2.129 11.186  -5.192  1.00 0.00 ? 9  LYS A CE   6  
ATOM   4124  N  NZ   . LYS A 1 9  ? -3.243 11.717  -5.998  1.00 0.00 ? 9  LYS A NZ   6  
ATOM   4125  H  H    . LYS A 1 9  ? -0.476 8.723   -0.045  1.00 0.00 ? 9  LYS A H    6  
ATOM   4126  H  HA   . LYS A 1 9  ? 1.240  10.033  -2.029  1.00 0.00 ? 9  LYS A HA   6  
ATOM   4127  H  HB2  . LYS A 1 9  ? -0.867 9.547   -3.249  1.00 0.00 ? 9  LYS A HB2  6  
ATOM   4128  H  HB3  . LYS A 1 9  ? -1.785 10.425  -2.004  1.00 0.00 ? 9  LYS A HB3  6  
ATOM   4129  H  HG2  . LYS A 1 9  ? -0.297 12.457  -2.536  1.00 0.00 ? 9  LYS A HG2  6  
ATOM   4130  H  HG3  . LYS A 1 9  ? 0.329  11.543  -3.910  1.00 0.00 ? 9  LYS A HG3  6  
ATOM   4131  H  HD2  . LYS A 1 9  ? -2.588 12.302  -3.401  1.00 0.00 ? 9  LYS A HD2  6  
ATOM   4132  H  HD3  . LYS A 1 9  ? -1.483 13.123  -4.514  1.00 0.00 ? 9  LYS A HD3  6  
ATOM   4133  H  HE2  . LYS A 1 9  ? -1.270 11.019  -5.842  1.00 0.00 ? 9  LYS A HE2  6  
ATOM   4134  H  HE3  . LYS A 1 9  ? -2.443 10.233  -4.765  1.00 0.00 ? 9  LYS A HE3  6  
ATOM   4135  H  HZ1  . LYS A 1 9  ? -2.971 12.595  -6.418  1.00 0.00 ? 9  LYS A HZ1  6  
ATOM   4136  H  HZ2  . LYS A 1 9  ? -3.479 11.057  -6.725  1.00 0.00 ? 9  LYS A HZ2  6  
ATOM   4137  H  HZ3  . LYS A 1 9  ? -4.049 11.865  -5.407  1.00 0.00 ? 9  LYS A HZ3  6  
ATOM   4138  N  N    . GLY A 1 10 ? 1.535  11.198  0.236   1.00 0.00 ? 10 GLY A N    6  
ATOM   4139  C  CA   . GLY A 1 10 ? 1.728  11.951  1.463   1.00 0.00 ? 10 GLY A CA   6  
ATOM   4140  C  C    . GLY A 1 10 ? 3.198  12.320  1.607   1.00 0.00 ? 10 GLY A C    6  
ATOM   4141  O  O    . GLY A 1 10 ? 3.556  13.491  1.498   1.00 0.00 ? 10 GLY A O    6  
ATOM   4142  H  H    . GLY A 1 10 ? 2.342  10.745  -0.169  1.00 0.00 ? 10 GLY A H    6  
ATOM   4143  H  HA2  . GLY A 1 10 ? 1.133  12.866  1.439   1.00 0.00 ? 10 GLY A HA2  6  
ATOM   4144  H  HA3  . GLY A 1 10 ? 1.419  11.342  2.316   1.00 0.00 ? 10 GLY A HA3  6  
ATOM   4145  N  N    . GLU A 1 11 ? 4.050  11.312  1.828   1.00 0.00 ? 11 GLU A N    6  
ATOM   4146  C  CA   . GLU A 1 11 ? 5.491  11.478  1.956   1.00 0.00 ? 11 GLU A CA   6  
ATOM   4147  C  C    . GLU A 1 11 ? 6.162  11.520  0.576   1.00 0.00 ? 11 GLU A C    6  
ATOM   4148  O  O    . GLU A 1 11 ? 7.142  10.819  0.328   1.00 0.00 ? 11 GLU A O    6  
ATOM   4149  C  CB   . GLU A 1 11 ? 6.076  10.402  2.890   1.00 0.00 ? 11 GLU A CB   6  
ATOM   4150  C  CG   . GLU A 1 11 ? 5.858  8.943   2.448   1.00 0.00 ? 11 GLU A CG   6  
ATOM   4151  C  CD   . GLU A 1 11 ? 4.505  8.390   2.885   1.00 0.00 ? 11 GLU A CD   6  
ATOM   4152  O  OE1  . GLU A 1 11 ? 3.540  8.548   2.108   1.00 0.00 ? 11 GLU A OE1  6  
ATOM   4153  O  OE2  . GLU A 1 11 ? 4.454  7.824   4.000   1.00 0.00 ? 11 GLU A OE2  6  
ATOM   4154  H  H    . GLU A 1 11 ? 3.685  10.369  1.869   1.00 0.00 ? 11 GLU A H    6  
ATOM   4155  H  HA   . GLU A 1 11 ? 5.692  12.438  2.435   1.00 0.00 ? 11 GLU A HA   6  
ATOM   4156  H  HB2  . GLU A 1 11 ? 7.149  10.577  2.956   1.00 0.00 ? 11 GLU A HB2  6  
ATOM   4157  H  HB3  . GLU A 1 11 ? 5.660  10.534  3.891   1.00 0.00 ? 11 GLU A HB3  6  
ATOM   4158  H  HG2  . GLU A 1 11 ? 5.962  8.840   1.369   1.00 0.00 ? 11 GLU A HG2  6  
ATOM   4159  H  HG3  . GLU A 1 11 ? 6.634  8.337   2.916   1.00 0.00 ? 11 GLU A HG3  6  
ATOM   4160  N  N    . ASP A 1 12 ? 5.649  12.372  -0.320  1.00 0.00 ? 12 ASP A N    6  
ATOM   4161  C  CA   . ASP A 1 12 ? 6.140  12.507  -1.685  1.00 0.00 ? 12 ASP A CA   6  
ATOM   4162  C  C    . ASP A 1 12 ? 7.306  13.497  -1.717  1.00 0.00 ? 12 ASP A C    6  
ATOM   4163  O  O    . ASP A 1 12 ? 7.244  14.528  -2.384  1.00 0.00 ? 12 ASP A O    6  
ATOM   4164  C  CB   . ASP A 1 12 ? 4.987  12.913  -2.608  1.00 0.00 ? 12 ASP A CB   6  
ATOM   4165  C  CG   . ASP A 1 12 ? 3.890  11.852  -2.647  1.00 0.00 ? 12 ASP A CG   6  
ATOM   4166  O  OD1  . ASP A 1 12 ? 4.218  10.704  -3.024  1.00 0.00 ? 12 ASP A OD1  6  
ATOM   4167  O  OD2  . ASP A 1 12 ? 2.734  12.210  -2.336  1.00 0.00 ? 12 ASP A OD2  6  
ATOM   4168  H  H    . ASP A 1 12 ? 4.874  12.958  -0.041  1.00 0.00 ? 12 ASP A H    6  
ATOM   4169  H  HA   . ASP A 1 12 ? 6.519  11.551  -2.039  1.00 0.00 ? 12 ASP A HA   6  
ATOM   4170  H  HB2  . ASP A 1 12 ? 4.568  13.858  -2.260  1.00 0.00 ? 12 ASP A HB2  6  
ATOM   4171  H  HB3  . ASP A 1 12 ? 5.367  13.045  -3.623  1.00 0.00 ? 12 ASP A HB3  6  
ATOM   4172  N  N    . ASP A 1 13 ? 8.377  13.160  -0.988  1.00 0.00 ? 13 ASP A N    6  
ATOM   4173  C  CA   . ASP A 1 13 ? 9.603  13.938  -0.909  1.00 0.00 ? 13 ASP A CA   6  
ATOM   4174  C  C    . ASP A 1 13 ? 10.383 13.804  -2.216  1.00 0.00 ? 13 ASP A C    6  
ATOM   4175  O  O    . ASP A 1 13 ? 10.508 14.764  -2.975  1.00 0.00 ? 13 ASP A O    6  
ATOM   4176  C  CB   . ASP A 1 13 ? 10.412 13.464  0.307   1.00 0.00 ? 13 ASP A CB   6  
ATOM   4177  C  CG   . ASP A 1 13 ? 11.807 14.076  0.375   1.00 0.00 ? 13 ASP A CG   6  
ATOM   4178  O  OD1  . ASP A 1 13 ? 11.910 15.316  0.251   1.00 0.00 ? 13 ASP A OD1  6  
ATOM   4179  O  OD2  . ASP A 1 13 ? 12.768 13.292  0.523   1.00 0.00 ? 13 ASP A OD2  6  
ATOM   4180  H  H    . ASP A 1 13 ? 8.335  12.298  -0.461  1.00 0.00 ? 13 ASP A H    6  
ATOM   4181  H  HA   . ASP A 1 13 ? 9.355  14.986  -0.759  1.00 0.00 ? 13 ASP A HA   6  
ATOM   4182  H  HB2  . ASP A 1 13 ? 9.871  13.721  1.219   1.00 0.00 ? 13 ASP A HB2  6  
ATOM   4183  H  HB3  . ASP A 1 13 ? 10.515 12.381  0.262   1.00 0.00 ? 13 ASP A HB3  6  
ATOM   4184  N  N    . LYS A 1 14 ? 10.919 12.605  -2.454  1.00 0.00 ? 14 LYS A N    6  
ATOM   4185  C  CA   . LYS A 1 14 ? 11.850 12.292  -3.525  1.00 0.00 ? 14 LYS A CA   6  
ATOM   4186  C  C    . LYS A 1 14 ? 11.583 10.847  -3.935  1.00 0.00 ? 14 LYS A C    6  
ATOM   4187  O  O    . LYS A 1 14 ? 12.140 9.918   -3.349  1.00 0.00 ? 14 LYS A O    6  
ATOM   4188  C  CB   . LYS A 1 14 ? 13.302 12.477  -3.058  1.00 0.00 ? 14 LYS A CB   6  
ATOM   4189  C  CG   . LYS A 1 14 ? 13.655 13.942  -2.773  1.00 0.00 ? 14 LYS A CG   6  
ATOM   4190  C  CD   . LYS A 1 14 ? 15.108 14.067  -2.298  1.00 0.00 ? 14 LYS A CD   6  
ATOM   4191  C  CE   . LYS A 1 14 ? 15.349 15.394  -1.569  1.00 0.00 ? 14 LYS A CE   6  
ATOM   4192  N  NZ   . LYS A 1 14 ? 14.757 15.391  -0.216  1.00 0.00 ? 14 LYS A NZ   6  
ATOM   4193  H  H    . LYS A 1 14 ? 10.688 11.863  -1.813  1.00 0.00 ? 14 LYS A H    6  
ATOM   4194  H  HA   . LYS A 1 14 ? 11.683 12.940  -4.384  1.00 0.00 ? 14 LYS A HA   6  
ATOM   4195  H  HB2  . LYS A 1 14 ? 13.445 11.895  -2.148  1.00 0.00 ? 14 LYS A HB2  6  
ATOM   4196  H  HB3  . LYS A 1 14 ? 13.974 12.104  -3.834  1.00 0.00 ? 14 LYS A HB3  6  
ATOM   4197  H  HG2  . LYS A 1 14 ? 13.512 14.542  -3.674  1.00 0.00 ? 14 LYS A HG2  6  
ATOM   4198  H  HG3  . LYS A 1 14 ? 12.998 14.323  -2.000  1.00 0.00 ? 14 LYS A HG3  6  
ATOM   4199  H  HD2  . LYS A 1 14 ? 15.347 13.251  -1.617  1.00 0.00 ? 14 LYS A HD2  6  
ATOM   4200  H  HD3  . LYS A 1 14 ? 15.766 13.999  -3.164  1.00 0.00 ? 14 LYS A HD3  6  
ATOM   4201  H  HE2  . LYS A 1 14 ? 16.424 15.545  -1.465  1.00 0.00 ? 14 LYS A HE2  6  
ATOM   4202  H  HE3  . LYS A 1 14 ? 14.935 16.219  -2.151  1.00 0.00 ? 14 LYS A HE3  6  
ATOM   4203  H  HZ1  . LYS A 1 14 ? 15.123 14.607  0.312   1.00 0.00 ? 14 LYS A HZ1  6  
ATOM   4204  H  HZ2  . LYS A 1 14 ? 14.984 16.250  0.262   1.00 0.00 ? 14 LYS A HZ2  6  
ATOM   4205  H  HZ3  . LYS A 1 14 ? 13.749 15.301  -0.265  1.00 0.00 ? 14 LYS A HZ3  6  
ATOM   4206  N  N    . LEU A 1 15 ? 10.707 10.665  -4.929  1.00 0.00 ? 15 LEU A N    6  
ATOM   4207  C  CA   . LEU A 1 15 ? 10.447 9.367   -5.527  1.00 0.00 ? 15 LEU A CA   6  
ATOM   4208  C  C    . LEU A 1 15 ? 11.662 8.923   -6.342  1.00 0.00 ? 15 LEU A C    6  
ATOM   4209  O  O    . LEU A 1 15 ? 11.791 9.259   -7.518  1.00 0.00 ? 15 LEU A O    6  
ATOM   4210  C  CB   . LEU A 1 15 ? 9.174  9.383   -6.385  1.00 0.00 ? 15 LEU A CB   6  
ATOM   4211  C  CG   . LEU A 1 15 ? 7.884  9.309   -5.550  1.00 0.00 ? 15 LEU A CG   6  
ATOM   4212  C  CD1  . LEU A 1 15 ? 7.543  10.641  -4.870  1.00 0.00 ? 15 LEU A CD1  6  
ATOM   4213  C  CD2  . LEU A 1 15 ? 6.720  8.891   -6.454  1.00 0.00 ? 15 LEU A CD2  6  
ATOM   4214  H  H    . LEU A 1 15 ? 10.231 11.471  -5.306  1.00 0.00 ? 15 LEU A H    6  
ATOM   4215  H  HA   . LEU A 1 15 ? 10.286 8.652   -4.722  1.00 0.00 ? 15 LEU A HA   6  
ATOM   4216  H  HB2  . LEU A 1 15 ? 9.160  10.260  -7.036  1.00 0.00 ? 15 LEU A HB2  6  
ATOM   4217  H  HB3  . LEU A 1 15 ? 9.203  8.487   -7.010  1.00 0.00 ? 15 LEU A HB3  6  
ATOM   4218  H  HG   . LEU A 1 15 ? 7.993  8.536   -4.789  1.00 0.00 ? 15 LEU A HG   6  
ATOM   4219  H  HD11 . LEU A 1 15 ? 6.568  10.565  -4.390  1.00 0.00 ? 15 LEU A HD11 6  
ATOM   4220  H  HD12 . LEU A 1 15 ? 8.278  10.884  -4.104  1.00 0.00 ? 15 LEU A HD12 6  
ATOM   4221  H  HD13 . LEU A 1 15 ? 7.512  11.443  -5.608  1.00 0.00 ? 15 LEU A HD13 6  
ATOM   4222  H  HD21 . LEU A 1 15 ? 5.828  8.746   -5.847  1.00 0.00 ? 15 LEU A HD21 6  
ATOM   4223  H  HD22 . LEU A 1 15 ? 6.534  9.656   -7.208  1.00 0.00 ? 15 LEU A HD22 6  
ATOM   4224  H  HD23 . LEU A 1 15 ? 6.953  7.950   -6.951  1.00 0.00 ? 15 LEU A HD23 6  
ATOM   4225  N  N    . ILE A 1 16 ? 12.556 8.171   -5.694  1.00 0.00 ? 16 ILE A N    6  
ATOM   4226  C  CA   . ILE A 1 16 ? 13.662 7.470   -6.326  1.00 0.00 ? 16 ILE A CA   6  
ATOM   4227  C  C    . ILE A 1 16 ? 13.120 6.223   -7.029  1.00 0.00 ? 16 ILE A C    6  
ATOM   4228  O  O    . ILE A 1 16 ? 12.771 5.240   -6.379  1.00 0.00 ? 16 ILE A O    6  
ATOM   4229  C  CB   . ILE A 1 16 ? 14.771 7.157   -5.294  1.00 0.00 ? 16 ILE A CB   6  
ATOM   4230  C  CG1  . ILE A 1 16 ? 15.792 6.167   -5.884  1.00 0.00 ? 16 ILE A CG1  6  
ATOM   4231  C  CG2  . ILE A 1 16 ? 14.233 6.642   -3.949  1.00 0.00 ? 16 ILE A CG2  6  
ATOM   4232  C  CD1  . ILE A 1 16 ? 17.116 6.149   -5.114  1.00 0.00 ? 16 ILE A CD1  6  
ATOM   4233  H  H    . ILE A 1 16 ? 12.356 7.961   -4.728  1.00 0.00 ? 16 ILE A H    6  
ATOM   4234  H  HA   . ILE A 1 16 ? 14.109 8.123   -7.078  1.00 0.00 ? 16 ILE A HA   6  
ATOM   4235  H  HB   . ILE A 1 16 ? 15.291 8.095   -5.092  1.00 0.00 ? 16 ILE A HB   6  
ATOM   4236  H  HG12 . ILE A 1 16 ? 15.375 5.157   -5.883  1.00 0.00 ? 16 ILE A HG12 6  
ATOM   4237  H  HG13 . ILE A 1 16 ? 16.015 6.462   -6.912  1.00 0.00 ? 16 ILE A HG13 6  
ATOM   4238  H  HG21 . ILE A 1 16 ? 13.603 5.764   -4.081  1.00 0.00 ? 16 ILE A HG21 6  
ATOM   4239  H  HG22 . ILE A 1 16 ? 15.055 6.383   -3.288  1.00 0.00 ? 16 ILE A HG22 6  
ATOM   4240  H  HG23 . ILE A 1 16 ? 13.663 7.425   -3.458  1.00 0.00 ? 16 ILE A HG23 6  
ATOM   4241  H  HD11 . ILE A 1 16 ? 16.984 5.771   -4.103  1.00 0.00 ? 16 ILE A HD11 6  
ATOM   4242  H  HD12 . ILE A 1 16 ? 17.807 5.491   -5.636  1.00 0.00 ? 16 ILE A HD12 6  
ATOM   4243  H  HD13 . ILE A 1 16 ? 17.540 7.151   -5.077  1.00 0.00 ? 16 ILE A HD13 6  
ATOM   4244  N  N    . LEU A 1 17 ? 13.041 6.259   -8.363  1.00 0.00 ? 17 LEU A N    6  
ATOM   4245  C  CA   . LEU A 1 17 ? 12.759 5.071   -9.147  1.00 0.00 ? 17 LEU A CA   6  
ATOM   4246  C  C    . LEU A 1 17 ? 13.987 4.159   -9.136  1.00 0.00 ? 17 LEU A C    6  
ATOM   4247  O  O    . LEU A 1 17 ? 15.117 4.644   -9.078  1.00 0.00 ? 17 LEU A O    6  
ATOM   4248  C  CB   . LEU A 1 17 ? 12.398 5.443   -10.590 1.00 0.00 ? 17 LEU A CB   6  
ATOM   4249  C  CG   . LEU A 1 17 ? 11.061 6.197   -10.714 1.00 0.00 ? 17 LEU A CG   6  
ATOM   4250  C  CD1  . LEU A 1 17 ? 11.271 7.715   -10.772 1.00 0.00 ? 17 LEU A CD1  6  
ATOM   4251  C  CD2  . LEU A 1 17 ? 10.328 5.745   -11.984 1.00 0.00 ? 17 LEU A CD2  6  
ATOM   4252  H  H    . LEU A 1 17 ? 13.315 7.087   -8.870  1.00 0.00 ? 17 LEU A H    6  
ATOM   4253  H  HA   . LEU A 1 17 ? 11.916 4.552   -8.695  1.00 0.00 ? 17 LEU A HA   6  
ATOM   4254  H  HB2  . LEU A 1 17 ? 13.203 6.026   -11.042 1.00 0.00 ? 17 LEU A HB2  6  
ATOM   4255  H  HB3  . LEU A 1 17 ? 12.313 4.503   -11.131 1.00 0.00 ? 17 LEU A HB3  6  
ATOM   4256  H  HG   . LEU A 1 17 ? 10.425 5.962   -9.861  1.00 0.00 ? 17 LEU A HG   6  
ATOM   4257  H  HD11 . LEU A 1 17 ? 11.873 7.977   -11.642 1.00 0.00 ? 17 LEU A HD11 6  
ATOM   4258  H  HD12 . LEU A 1 17 ? 10.306 8.216   -10.842 1.00 0.00 ? 17 LEU A HD12 6  
ATOM   4259  H  HD13 . LEU A 1 17 ? 11.776 8.064   -9.874  1.00 0.00 ? 17 LEU A HD13 6  
ATOM   4260  H  HD21 . LEU A 1 17 ? 9.389  6.290   -12.082 1.00 0.00 ? 17 LEU A HD21 6  
ATOM   4261  H  HD22 . LEU A 1 17 ? 10.947 5.938   -12.862 1.00 0.00 ? 17 LEU A HD22 6  
ATOM   4262  H  HD23 . LEU A 1 17 ? 10.108 4.678   -11.927 1.00 0.00 ? 17 LEU A HD23 6  
ATOM   4263  N  N    . CYS A 1 18 ? 13.769 2.840   -9.196  1.00 0.00 ? 18 CYS A N    6  
ATOM   4264  C  CA   . CYS A 1 18 ? 14.862 1.902   -9.417  1.00 0.00 ? 18 CYS A CA   6  
ATOM   4265  C  C    . CYS A 1 18 ? 15.365 2.045   -10.855 1.00 0.00 ? 18 CYS A C    6  
ATOM   4266  O  O    . CYS A 1 18 ? 14.572 1.946   -11.786 1.00 0.00 ? 18 CYS A O    6  
ATOM   4267  C  CB   . CYS A 1 18 ? 14.414 0.468   -9.130  1.00 0.00 ? 18 CYS A CB   6  
ATOM   4268  S  SG   . CYS A 1 18 ? 15.653 -0.769  -9.597  1.00 0.00 ? 18 CYS A SG   6  
ATOM   4269  H  H    . CYS A 1 18 ? 12.815 2.497   -9.210  1.00 0.00 ? 18 CYS A H    6  
ATOM   4270  H  HA   . CYS A 1 18 ? 15.670 2.129   -8.725  1.00 0.00 ? 18 CYS A HA   6  
ATOM   4271  H  HB2  . CYS A 1 18 ? 14.222 0.380   -8.062  1.00 0.00 ? 18 CYS A HB2  6  
ATOM   4272  H  HB3  . CYS A 1 18 ? 13.488 0.244   -9.664  1.00 0.00 ? 18 CYS A HB3  6  
ATOM   4273  N  N    . ASP A 1 19 ? 16.671 2.276   -11.036 1.00 0.00 ? 19 ASP A N    6  
ATOM   4274  C  CA   . ASP A 1 19 ? 17.269 2.493   -12.349 1.00 0.00 ? 19 ASP A CA   6  
ATOM   4275  C  C    . ASP A 1 19 ? 17.060 1.286   -13.269 1.00 0.00 ? 19 ASP A C    6  
ATOM   4276  O  O    . ASP A 1 19 ? 16.689 1.447   -14.430 1.00 0.00 ? 19 ASP A O    6  
ATOM   4277  C  CB   . ASP A 1 19 ? 18.750 2.892   -12.219 1.00 0.00 ? 19 ASP A CB   6  
ATOM   4278  C  CG   . ASP A 1 19 ? 19.688 1.777   -11.747 1.00 0.00 ? 19 ASP A CG   6  
ATOM   4279  O  OD1  . ASP A 1 19 ? 19.236 0.920   -10.958 1.00 0.00 ? 19 ASP A OD1  6  
ATOM   4280  O  OD2  . ASP A 1 19 ? 20.857 1.803   -12.186 1.00 0.00 ? 19 ASP A OD2  6  
ATOM   4281  H  H    . ASP A 1 19 ? 17.290 2.277   -10.236 1.00 0.00 ? 19 ASP A H    6  
ATOM   4282  H  HA   . ASP A 1 19 ? 16.752 3.341   -12.797 1.00 0.00 ? 19 ASP A HA   6  
ATOM   4283  H  HB2  . ASP A 1 19 ? 19.092 3.227   -13.199 1.00 0.00 ? 19 ASP A HB2  6  
ATOM   4284  H  HB3  . ASP A 1 19 ? 18.831 3.732   -11.528 1.00 0.00 ? 19 ASP A HB3  6  
ATOM   4285  N  N    . GLU A 1 20 ? 17.260 0.081   -12.724 1.00 0.00 ? 20 GLU A N    6  
ATOM   4286  C  CA   . GLU A 1 20 ? 17.281 -1.167  -13.468 1.00 0.00 ? 20 GLU A CA   6  
ATOM   4287  C  C    . GLU A 1 20 ? 15.911 -1.447  -14.093 1.00 0.00 ? 20 GLU A C    6  
ATOM   4288  O  O    . GLU A 1 20 ? 15.808 -1.562  -15.313 1.00 0.00 ? 20 GLU A O    6  
ATOM   4289  C  CB   . GLU A 1 20 ? 17.740 -2.296  -12.532 1.00 0.00 ? 20 GLU A CB   6  
ATOM   4290  C  CG   . GLU A 1 20 ? 17.957 -3.614  -13.284 1.00 0.00 ? 20 GLU A CG   6  
ATOM   4291  C  CD   . GLU A 1 20 ? 18.424 -4.720  -12.341 1.00 0.00 ? 20 GLU A CD   6  
ATOM   4292  O  OE1  . GLU A 1 20 ? 19.504 -4.539  -11.740 1.00 0.00 ? 20 GLU A OE1  6  
ATOM   4293  O  OE2  . GLU A 1 20 ? 17.689 -5.725  -12.233 1.00 0.00 ? 20 GLU A OE2  6  
ATOM   4294  H  H    . GLU A 1 20 ? 17.627 0.071   -11.781 1.00 0.00 ? 20 GLU A H    6  
ATOM   4295  H  HA   . GLU A 1 20 ? 18.019 -1.069  -14.267 1.00 0.00 ? 20 GLU A HA   6  
ATOM   4296  H  HB2  . GLU A 1 20 ? 18.687 -2.002  -12.073 1.00 0.00 ? 20 GLU A HB2  6  
ATOM   4297  H  HB3  . GLU A 1 20 ? 17.000 -2.452  -11.747 1.00 0.00 ? 20 GLU A HB3  6  
ATOM   4298  H  HG2  . GLU A 1 20 ? 17.027 -3.925  -13.761 1.00 0.00 ? 20 GLU A HG2  6  
ATOM   4299  H  HG3  . GLU A 1 20 ? 18.715 -3.470  -14.055 1.00 0.00 ? 20 GLU A HG3  6  
ATOM   4300  N  N    . CYS A 1 21 ? 14.867 -1.557  -13.259 1.00 0.00 ? 21 CYS A N    6  
ATOM   4301  C  CA   . CYS A 1 21 ? 13.547 -2.030  -13.673 1.00 0.00 ? 21 CYS A CA   6  
ATOM   4302  C  C    . CYS A 1 21 ? 12.504 -0.907  -13.767 1.00 0.00 ? 21 CYS A C    6  
ATOM   4303  O  O    . CYS A 1 21 ? 11.388 -1.167  -14.215 1.00 0.00 ? 21 CYS A O    6  
ATOM   4304  C  CB   . CYS A 1 21 ? 13.080 -3.171  -12.758 1.00 0.00 ? 21 CYS A CB   6  
ATOM   4305  S  SG   . CYS A 1 21 ? 12.969 -2.820  -10.983 1.00 0.00 ? 21 CYS A SG   6  
ATOM   4306  H  H    . CYS A 1 21 ? 15.017 -1.365  -12.279 1.00 0.00 ? 21 CYS A H    6  
ATOM   4307  H  HA   . CYS A 1 21 ? 13.614 -2.463  -14.672 1.00 0.00 ? 21 CYS A HA   6  
ATOM   4308  H  HB2  . CYS A 1 21 ? 12.089 -3.489  -13.091 1.00 0.00 ? 21 CYS A HB2  6  
ATOM   4309  H  HB3  . CYS A 1 21 ? 13.764 -4.013  -12.880 1.00 0.00 ? 21 CYS A HB3  6  
ATOM   4310  N  N    . ASN A 1 22 ? 12.848 0.327   -13.373 1.00 0.00 ? 22 ASN A N    6  
ATOM   4311  C  CA   . ASN A 1 22 ? 12.011 1.512   -13.545 1.00 0.00 ? 22 ASN A CA   6  
ATOM   4312  C  C    . ASN A 1 22 ? 10.680 1.345   -12.806 1.00 0.00 ? 22 ASN A C    6  
ATOM   4313  O  O    . ASN A 1 22 ? 9.608  1.415   -13.409 1.00 0.00 ? 22 ASN A O    6  
ATOM   4314  C  CB   . ASN A 1 22 ? 11.870 1.860   -15.035 1.00 0.00 ? 22 ASN A CB   6  
ATOM   4315  C  CG   . ASN A 1 22 ? 11.466 3.320   -15.251 1.00 0.00 ? 22 ASN A CG   6  
ATOM   4316  O  OD1  . ASN A 1 22 ? 12.286 4.137   -15.662 1.00 0.00 ? 22 ASN A OD1  6  
ATOM   4317  N  ND2  . ASN A 1 22 ? 10.202 3.657   -14.990 1.00 0.00 ? 22 ASN A ND2  6  
ATOM   4318  H  H    . ASN A 1 22 ? 13.764 0.482   -12.971 1.00 0.00 ? 22 ASN A H    6  
ATOM   4319  H  HA   . ASN A 1 22 ? 12.527 2.352   -13.084 1.00 0.00 ? 22 ASN A HA   6  
ATOM   4320  H  HB2  . ASN A 1 22 ? 12.841 1.716   -15.515 1.00 0.00 ? 22 ASN A HB2  6  
ATOM   4321  H  HB3  . ASN A 1 22 ? 11.146 1.200   -15.515 1.00 0.00 ? 22 ASN A HB3  6  
ATOM   4322  H  HD21 . ASN A 1 22 ? 9.569  2.958   -14.619 1.00 0.00 ? 22 ASN A HD21 6  
ATOM   4323  H  HD22 . ASN A 1 22 ? 9.898  4.610   -15.138 1.00 0.00 ? 22 ASN A HD22 6  
ATOM   4324  N  N    . LYS A 1 23 ? 10.761 1.114   -11.491 1.00 0.00 ? 23 LYS A N    6  
ATOM   4325  C  CA   . LYS A 1 23 ? 9.634  0.990   -10.590 1.00 0.00 ? 23 LYS A CA   6  
ATOM   4326  C  C    . LYS A 1 23 ? 9.763  2.043   -9.490  1.00 0.00 ? 23 LYS A C    6  
ATOM   4327  O  O    . LYS A 1 23 ? 10.873 2.355   -9.065  1.00 0.00 ? 23 LYS A O    6  
ATOM   4328  C  CB   . LYS A 1 23 ? 9.644  -0.424  -10.001 1.00 0.00 ? 23 LYS A CB   6  
ATOM   4329  C  CG   . LYS A 1 23 ? 9.518  -1.540  -11.051 1.00 0.00 ? 23 LYS A CG   6  
ATOM   4330  C  CD   . LYS A 1 23 ? 8.220  -1.475  -11.867 1.00 0.00 ? 23 LYS A CD   6  
ATOM   4331  C  CE   . LYS A 1 23 ? 8.179  -2.614  -12.891 1.00 0.00 ? 23 LYS A CE   6  
ATOM   4332  N  NZ   . LYS A 1 23 ? 6.998  -2.511  -13.767 1.00 0.00 ? 23 LYS A NZ   6  
ATOM   4333  H  H    . LYS A 1 23 ? 11.662 0.983   -11.060 1.00 0.00 ? 23 LYS A H    6  
ATOM   4334  H  HA   . LYS A 1 23 ? 8.693  1.168   -11.110 1.00 0.00 ? 23 LYS A HA   6  
ATOM   4335  H  HB2  . LYS A 1 23 ? 10.584 -0.572  -9.463  1.00 0.00 ? 23 LYS A HB2  6  
ATOM   4336  H  HB3  . LYS A 1 23 ? 8.826  -0.495  -9.294  1.00 0.00 ? 23 LYS A HB3  6  
ATOM   4337  H  HG2  . LYS A 1 23 ? 10.367 -1.491  -11.731 1.00 0.00 ? 23 LYS A HG2  6  
ATOM   4338  H  HG3  . LYS A 1 23 ? 9.557  -2.498  -10.533 1.00 0.00 ? 23 LYS A HG3  6  
ATOM   4339  H  HD2  . LYS A 1 23 ? 7.363  -1.549  -11.196 1.00 0.00 ? 23 LYS A HD2  6  
ATOM   4340  H  HD3  . LYS A 1 23 ? 8.167  -0.532  -12.410 1.00 0.00 ? 23 LYS A HD3  6  
ATOM   4341  H  HE2  . LYS A 1 23 ? 9.073  -2.569  -13.517 1.00 0.00 ? 23 LYS A HE2  6  
ATOM   4342  H  HE3  . LYS A 1 23 ? 8.159  -3.573  -12.373 1.00 0.00 ? 23 LYS A HE3  6  
ATOM   4343  H  HZ1  . LYS A 1 23 ? 6.155  -2.565  -13.213 1.00 0.00 ? 23 LYS A HZ1  6  
ATOM   4344  H  HZ2  . LYS A 1 23 ? 7.019  -1.630  -14.260 1.00 0.00 ? 23 LYS A HZ2  6  
ATOM   4345  H  HZ3  . LYS A 1 23 ? 7.008  -3.266  -14.437 1.00 0.00 ? 23 LYS A HZ3  6  
ATOM   4346  N  N    . ALA A 1 24 ? 8.625  2.584   -9.043  1.00 0.00 ? 24 ALA A N    6  
ATOM   4347  C  CA   . ALA A 1 24 ? 8.544  3.744   -8.166  1.00 0.00 ? 24 ALA A CA   6  
ATOM   4348  C  C    . ALA A 1 24 ? 8.733  3.347   -6.701  1.00 0.00 ? 24 ALA A C    6  
ATOM   4349  O  O    . ALA A 1 24 ? 7.969  2.540   -6.170  1.00 0.00 ? 24 ALA A O    6  
ATOM   4350  C  CB   . ALA A 1 24 ? 7.196  4.443   -8.369  1.00 0.00 ? 24 ALA A CB   6  
ATOM   4351  H  H    . ALA A 1 24 ? 7.759  2.222   -9.408  1.00 0.00 ? 24 ALA A H    6  
ATOM   4352  H  HA   . ALA A 1 24 ? 9.321  4.453   -8.451  1.00 0.00 ? 24 ALA A HA   6  
ATOM   4353  H  HB1  . ALA A 1 24 ? 7.140  5.323   -7.726  1.00 0.00 ? 24 ALA A HB1  6  
ATOM   4354  H  HB2  . ALA A 1 24 ? 7.097  4.758   -9.407  1.00 0.00 ? 24 ALA A HB2  6  
ATOM   4355  H  HB3  . ALA A 1 24 ? 6.378  3.765   -8.120  1.00 0.00 ? 24 ALA A HB3  6  
ATOM   4356  N  N    . PHE A 1 25 ? 9.749  3.935   -6.059  1.00 0.00 ? 25 PHE A N    6  
ATOM   4357  C  CA   . PHE A 1 25 ? 9.998  3.858   -4.627  1.00 0.00 ? 25 PHE A CA   6  
ATOM   4358  C  C    . PHE A 1 25 ? 10.281 5.259   -4.082  1.00 0.00 ? 25 PHE A C    6  
ATOM   4359  O  O    . PHE A 1 25 ? 10.528 6.183   -4.852  1.00 0.00 ? 25 PHE A O    6  
ATOM   4360  C  CB   . PHE A 1 25 ? 11.211 2.954   -4.366  1.00 0.00 ? 25 PHE A CB   6  
ATOM   4361  C  CG   . PHE A 1 25 ? 10.968 1.467   -4.537  1.00 0.00 ? 25 PHE A CG   6  
ATOM   4362  C  CD1  . PHE A 1 25 ? 10.884 0.907   -5.824  1.00 0.00 ? 25 PHE A CD1  6  
ATOM   4363  C  CD2  . PHE A 1 25 ? 10.932 0.625   -3.409  1.00 0.00 ? 25 PHE A CD2  6  
ATOM   4364  C  CE1  . PHE A 1 25 ? 10.666 -0.471  -5.985  1.00 0.00 ? 25 PHE A CE1  6  
ATOM   4365  C  CE2  . PHE A 1 25 ? 10.805 -0.766  -3.576  1.00 0.00 ? 25 PHE A CE2  6  
ATOM   4366  C  CZ   . PHE A 1 25 ? 10.616 -1.308  -4.858  1.00 0.00 ? 25 PHE A CZ   6  
ATOM   4367  H  H    . PHE A 1 25 ? 10.348 4.567   -6.576  1.00 0.00 ? 25 PHE A H    6  
ATOM   4368  H  HA   . PHE A 1 25 ? 9.137  3.447   -4.102  1.00 0.00 ? 25 PHE A HA   6  
ATOM   4369  H  HB2  . PHE A 1 25 ? 12.029 3.245   -5.025  1.00 0.00 ? 25 PHE A HB2  6  
ATOM   4370  H  HB3  . PHE A 1 25 ? 11.534 3.131   -3.340  1.00 0.00 ? 25 PHE A HB3  6  
ATOM   4371  H  HD1  . PHE A 1 25 ? 10.994 1.536   -6.692  1.00 0.00 ? 25 PHE A HD1  6  
ATOM   4372  H  HD2  . PHE A 1 25 ? 11.022 1.041   -2.415  1.00 0.00 ? 25 PHE A HD2  6  
ATOM   4373  H  HE1  . PHE A 1 25 ? 10.570 -0.891  -6.976  1.00 0.00 ? 25 PHE A HE1  6  
ATOM   4374  H  HE2  . PHE A 1 25 ? 10.838 -1.420  -2.717  1.00 0.00 ? 25 PHE A HE2  6  
ATOM   4375  H  HZ   . PHE A 1 25 ? 10.484 -2.372  -4.980  1.00 0.00 ? 25 PHE A HZ   6  
ATOM   4376  N  N    . HIS A 1 26 ? 10.222 5.413   -2.753  1.00 0.00 ? 26 HIS A N    6  
ATOM   4377  C  CA   . HIS A 1 26 ? 10.695 6.598   -2.045  1.00 0.00 ? 26 HIS A CA   6  
ATOM   4378  C  C    . HIS A 1 26 ? 12.016 6.240   -1.362  1.00 0.00 ? 26 HIS A C    6  
ATOM   4379  O  O    . HIS A 1 26 ? 12.324 5.063   -1.171  1.00 0.00 ? 26 HIS A O    6  
ATOM   4380  C  CB   . HIS A 1 26 ? 9.692  7.058   -0.981  1.00 0.00 ? 26 HIS A CB   6  
ATOM   4381  C  CG   . HIS A 1 26 ? 8.332  7.469   -1.487  1.00 0.00 ? 26 HIS A CG   6  
ATOM   4382  N  ND1  . HIS A 1 26 ? 7.190  6.667   -1.458  1.00 0.00 ? 26 HIS A ND1  6  
ATOM   4383  C  CD2  . HIS A 1 26 ? 7.991  8.732   -1.882  1.00 0.00 ? 26 HIS A CD2  6  
ATOM   4384  C  CE1  . HIS A 1 26 ? 6.184  7.474   -1.832  1.00 0.00 ? 26 HIS A CE1  6  
ATOM   4385  N  NE2  . HIS A 1 26 ? 6.633  8.712   -2.102  1.00 0.00 ? 26 HIS A NE2  6  
ATOM   4386  H  H    . HIS A 1 26 ? 9.961  4.619   -2.187  1.00 0.00 ? 26 HIS A H    6  
ATOM   4387  H  HA   . HIS A 1 26 ? 10.867 7.424   -2.734  1.00 0.00 ? 26 HIS A HA   6  
ATOM   4388  H  HB2  . HIS A 1 26 ? 9.565  6.269   -0.242  1.00 0.00 ? 26 HIS A HB2  6  
ATOM   4389  H  HB3  . HIS A 1 26 ? 10.123 7.920   -0.471  1.00 0.00 ? 26 HIS A HB3  6  
ATOM   4390  H  HD2  . HIS A 1 26 ? 8.644  9.590   -1.943  1.00 0.00 ? 26 HIS A HD2  6  
ATOM   4391  H  HE1  . HIS A 1 26 ? 5.148  7.176   -1.896  1.00 0.00 ? 26 HIS A HE1  6  
ATOM   4392  H  HE2  . HIS A 1 26 ? 6.057  9.498   -2.378  1.00 0.00 ? 26 HIS A HE2  6  
ATOM   4393  N  N    . LEU A 1 27 ? 12.783 7.259   -0.955  1.00 0.00 ? 27 LEU A N    6  
ATOM   4394  C  CA   . LEU A 1 27 ? 13.950 7.069   -0.103  1.00 0.00 ? 27 LEU A CA   6  
ATOM   4395  C  C    . LEU A 1 27 ? 13.551 6.395   1.208   1.00 0.00 ? 27 LEU A C    6  
ATOM   4396  O  O    . LEU A 1 27 ? 14.245 5.489   1.658   1.00 0.00 ? 27 LEU A O    6  
ATOM   4397  C  CB   . LEU A 1 27 ? 14.641 8.407   0.175   1.00 0.00 ? 27 LEU A CB   6  
ATOM   4398  C  CG   . LEU A 1 27 ? 15.297 9.032   -1.066  1.00 0.00 ? 27 LEU A CG   6  
ATOM   4399  C  CD1  . LEU A 1 27 ? 15.675 10.478  -0.741  1.00 0.00 ? 27 LEU A CD1  6  
ATOM   4400  C  CD2  . LEU A 1 27 ? 16.577 8.289   -1.477  1.00 0.00 ? 27 LEU A CD2  6  
ATOM   4401  H  H    . LEU A 1 27 ? 12.512 8.204   -1.188  1.00 0.00 ? 27 LEU A H    6  
ATOM   4402  H  HA   . LEU A 1 27 ? 14.648 6.408   -0.612  1.00 0.00 ? 27 LEU A HA   6  
ATOM   4403  H  HB2  . LEU A 1 27 ? 13.892 9.092   0.575   1.00 0.00 ? 27 LEU A HB2  6  
ATOM   4404  H  HB3  . LEU A 1 27 ? 15.413 8.251   0.929   1.00 0.00 ? 27 LEU A HB3  6  
ATOM   4405  H  HG   . LEU A 1 27 ? 14.592 9.040   -1.897  1.00 0.00 ? 27 LEU A HG   6  
ATOM   4406  H  HD11 . LEU A 1 27 ? 14.794 11.036  -0.427  1.00 0.00 ? 27 LEU A HD11 6  
ATOM   4407  H  HD12 . LEU A 1 27 ? 16.406 10.484  0.064   1.00 0.00 ? 27 LEU A HD12 6  
ATOM   4408  H  HD13 . LEU A 1 27 ? 16.104 10.952  -1.625  1.00 0.00 ? 27 LEU A HD13 6  
ATOM   4409  H  HD21 . LEU A 1 27 ? 17.322 8.363   -0.686  1.00 0.00 ? 27 LEU A HD21 6  
ATOM   4410  H  HD22 . LEU A 1 27 ? 16.382 7.238   -1.670  1.00 0.00 ? 27 LEU A HD22 6  
ATOM   4411  H  HD23 . LEU A 1 27 ? 16.977 8.737   -2.386  1.00 0.00 ? 27 LEU A HD23 6  
ATOM   4412  N  N    . PHE A 1 28 ? 12.417 6.802   1.792   1.00 0.00 ? 28 PHE A N    6  
ATOM   4413  C  CA   . PHE A 1 28 ? 11.795 6.138   2.932   1.00 0.00 ? 28 PHE A CA   6  
ATOM   4414  C  C    . PHE A 1 28 ? 11.710 4.624   2.733   1.00 0.00 ? 28 PHE A C    6  
ATOM   4415  O  O    . PHE A 1 28 ? 12.122 3.859   3.602   1.00 0.00 ? 28 PHE A O    6  
ATOM   4416  C  CB   . PHE A 1 28 ? 10.400 6.722   3.170   1.00 0.00 ? 28 PHE A CB   6  
ATOM   4417  C  CG   . PHE A 1 28 ? 10.379 8.232   3.315   1.00 0.00 ? 28 PHE A CG   6  
ATOM   4418  C  CD1  . PHE A 1 28 ? 11.077 8.847   4.371   1.00 0.00 ? 28 PHE A CD1  6  
ATOM   4419  C  CD2  . PHE A 1 28 ? 9.718  9.025   2.360   1.00 0.00 ? 28 PHE A CD2  6  
ATOM   4420  C  CE1  . PHE A 1 28 ? 11.104 10.248  4.479   1.00 0.00 ? 28 PHE A CE1  6  
ATOM   4421  C  CE2  . PHE A 1 28 ? 9.772  10.425  2.451   1.00 0.00 ? 28 PHE A CE2  6  
ATOM   4422  C  CZ   . PHE A 1 28 ? 10.439 11.037  3.525   1.00 0.00 ? 28 PHE A CZ   6  
ATOM   4423  H  H    . PHE A 1 28 ? 11.934 7.596   1.397   1.00 0.00 ? 28 PHE A H    6  
ATOM   4424  H  HA   . PHE A 1 28 ? 12.402 6.339   3.813   1.00 0.00 ? 28 PHE A HA   6  
ATOM   4425  H  HB2  . PHE A 1 28 ? 9.759  6.424   2.339   1.00 0.00 ? 28 PHE A HB2  6  
ATOM   4426  H  HB3  . PHE A 1 28 ? 9.990  6.284   4.081   1.00 0.00 ? 28 PHE A HB3  6  
ATOM   4427  H  HD1  . PHE A 1 28 ? 11.594 8.247   5.107   1.00 0.00 ? 28 PHE A HD1  6  
ATOM   4428  H  HD2  . PHE A 1 28 ? 9.151  8.570   1.561   1.00 0.00 ? 28 PHE A HD2  6  
ATOM   4429  H  HE1  . PHE A 1 28 ? 11.631 10.718  5.297   1.00 0.00 ? 28 PHE A HE1  6  
ATOM   4430  H  HE2  . PHE A 1 28 ? 9.271  11.035  1.717   1.00 0.00 ? 28 PHE A HE2  6  
ATOM   4431  H  HZ   . PHE A 1 28 ? 10.422 12.112  3.619   1.00 0.00 ? 28 PHE A HZ   6  
ATOM   4432  N  N    . CYS A 1 29 ? 11.164 4.205   1.587   1.00 0.00 ? 29 CYS A N    6  
ATOM   4433  C  CA   . CYS A 1 29 ? 10.821 2.817   1.319   1.00 0.00 ? 29 CYS A CA   6  
ATOM   4434  C  C    . CYS A 1 29 ? 12.084 1.981   1.099   1.00 0.00 ? 29 CYS A C    6  
ATOM   4435  O  O    . CYS A 1 29 ? 12.129 0.824   1.513   1.00 0.00 ? 29 CYS A O    6  
ATOM   4436  C  CB   . CYS A 1 29 ? 9.879  2.748   0.113   1.00 0.00 ? 29 CYS A CB   6  
ATOM   4437  S  SG   . CYS A 1 29 ? 8.386  3.768   0.275   1.00 0.00 ? 29 CYS A SG   6  
ATOM   4438  H  H    . CYS A 1 29 ? 10.945 4.887   0.876   1.00 0.00 ? 29 CYS A H    6  
ATOM   4439  H  HA   . CYS A 1 29 ? 10.285 2.418   2.183   1.00 0.00 ? 29 CYS A HA   6  
ATOM   4440  H  HB2  . CYS A 1 29 ? 10.420 3.081   -0.773  1.00 0.00 ? 29 CYS A HB2  6  
ATOM   4441  H  HB3  . CYS A 1 29 ? 9.573  1.712   -0.038  1.00 0.00 ? 29 CYS A HB3  6  
ATOM   4442  N  N    . LEU A 1 30 ? 13.107 2.564   0.458   1.00 0.00 ? 30 LEU A N    6  
ATOM   4443  C  CA   . LEU A 1 30 ? 14.388 1.907   0.236   1.00 0.00 ? 30 LEU A CA   6  
ATOM   4444  C  C    . LEU A 1 30 ? 15.299 2.012   1.458   1.00 0.00 ? 30 LEU A C    6  
ATOM   4445  O  O    . LEU A 1 30 ? 15.549 1.021   2.140   1.00 0.00 ? 30 LEU A O    6  
ATOM   4446  C  CB   . LEU A 1 30 ? 15.089 2.499   -0.998  1.00 0.00 ? 30 LEU A CB   6  
ATOM   4447  C  CG   . LEU A 1 30 ? 14.351 2.255   -2.318  1.00 0.00 ? 30 LEU A CG   6  
ATOM   4448  C  CD1  . LEU A 1 30 ? 15.130 2.910   -3.463  1.00 0.00 ? 30 LEU A CD1  6  
ATOM   4449  C  CD2  . LEU A 1 30 ? 14.191 0.762   -2.612  1.00 0.00 ? 30 LEU A CD2  6  
ATOM   4450  H  H    . LEU A 1 30 ? 12.995 3.510   0.114   1.00 0.00 ? 30 LEU A H    6  
ATOM   4451  H  HA   . LEU A 1 30 ? 14.233 0.848   0.060   1.00 0.00 ? 30 LEU A HA   6  
ATOM   4452  H  HB2  . LEU A 1 30 ? 15.192 3.575   -0.863  1.00 0.00 ? 30 LEU A HB2  6  
ATOM   4453  H  HB3  . LEU A 1 30 ? 16.082 2.056   -1.082  1.00 0.00 ? 30 LEU A HB3  6  
ATOM   4454  H  HG   . LEU A 1 30 ? 13.371 2.717   -2.253  1.00 0.00 ? 30 LEU A HG   6  
ATOM   4455  H  HD11 . LEU A 1 30 ? 14.580 2.800   -4.399  1.00 0.00 ? 30 LEU A HD11 6  
ATOM   4456  H  HD12 . LEU A 1 30 ? 15.263 3.971   -3.257  1.00 0.00 ? 30 LEU A HD12 6  
ATOM   4457  H  HD13 . LEU A 1 30 ? 16.110 2.442   -3.567  1.00 0.00 ? 30 LEU A HD13 6  
ATOM   4458  H  HD21 . LEU A 1 30 ? 13.461 0.314   -1.939  1.00 0.00 ? 30 LEU A HD21 6  
ATOM   4459  H  HD22 . LEU A 1 30 ? 13.843 0.624   -3.635  1.00 0.00 ? 30 LEU A HD22 6  
ATOM   4460  H  HD23 . LEU A 1 30 ? 15.152 0.265   -2.484  1.00 0.00 ? 30 LEU A HD23 6  
ATOM   4461  N  N    . ARG A 1 31 ? 15.826 3.217   1.689   1.00 0.00 ? 31 ARG A N    6  
ATOM   4462  C  CA   . ARG A 1 31 ? 16.893 3.510   2.631   1.00 0.00 ? 31 ARG A CA   6  
ATOM   4463  C  C    . ARG A 1 31 ? 16.568 4.803   3.387   1.00 0.00 ? 31 ARG A C    6  
ATOM   4464  O  O    . ARG A 1 31 ? 17.031 5.868   2.982   1.00 0.00 ? 31 ARG A O    6  
ATOM   4465  C  CB   . ARG A 1 31 ? 18.190 3.677   1.826   1.00 0.00 ? 31 ARG A CB   6  
ATOM   4466  C  CG   . ARG A 1 31 ? 18.665 2.360   1.197   1.00 0.00 ? 31 ARG A CG   6  
ATOM   4467  C  CD   . ARG A 1 31 ? 19.763 2.633   0.171   1.00 0.00 ? 31 ARG A CD   6  
ATOM   4468  N  NE   . ARG A 1 31 ? 19.230 3.182   -1.081  1.00 0.00 ? 31 ARG A NE   6  
ATOM   4469  C  CZ   . ARG A 1 31 ? 19.983 3.455   -2.158  1.00 0.00 ? 31 ARG A CZ   6  
ATOM   4470  N  NH1  . ARG A 1 31 ? 21.314 3.289   -2.128  1.00 0.00 ? 31 ARG A NH1  6  
ATOM   4471  N  NH2  . ARG A 1 31 ? 19.397 3.897   -3.278  1.00 0.00 ? 31 ARG A NH2  6  
ATOM   4472  H  H    . ARG A 1 31 ? 15.439 3.997   1.179   1.00 0.00 ? 31 ARG A H    6  
ATOM   4473  H  HA   . ARG A 1 31 ? 17.043 2.687   3.329   1.00 0.00 ? 31 ARG A HA   6  
ATOM   4474  H  HB2  . ARG A 1 31 ? 18.026 4.416   1.041   1.00 0.00 ? 31 ARG A HB2  6  
ATOM   4475  H  HB3  . ARG A 1 31 ? 18.980 4.040   2.486   1.00 0.00 ? 31 ARG A HB3  6  
ATOM   4476  H  HG2  . ARG A 1 31 ? 19.059 1.718   1.986   1.00 0.00 ? 31 ARG A HG2  6  
ATOM   4477  H  HG3  . ARG A 1 31 ? 17.857 1.832   0.694   1.00 0.00 ? 31 ARG A HG3  6  
ATOM   4478  H  HD2  . ARG A 1 31 ? 20.487 3.328   0.595   1.00 0.00 ? 31 ARG A HD2  6  
ATOM   4479  H  HD3  . ARG A 1 31 ? 20.248 1.690   -0.064  1.00 0.00 ? 31 ARG A HD3  6  
ATOM   4480  H  HE   . ARG A 1 31 ? 18.231 3.326   -1.130  1.00 0.00 ? 31 ARG A HE   6  
ATOM   4481  H  HH11 . ARG A 1 31 ? 21.779 2.943   -1.293  1.00 0.00 ? 31 ARG A HH11 6  
ATOM   4482  H  HH12 . ARG A 1 31 ? 21.864 3.491   -2.950  1.00 0.00 ? 31 ARG A HH12 6  
ATOM   4483  H  HH21 . ARG A 1 31 ? 18.395 4.010   -3.324  1.00 0.00 ? 31 ARG A HH21 6  
ATOM   4484  H  HH22 . ARG A 1 31 ? 19.967 4.111   -4.088  1.00 0.00 ? 31 ARG A HH22 6  
ATOM   4485  N  N    . PRO A 1 32 ? 15.786 4.746   4.476   1.00 0.00 ? 32 PRO A N    6  
ATOM   4486  C  CA   . PRO A 1 32 ? 15.248 5.930   5.135   1.00 0.00 ? 32 PRO A CA   6  
ATOM   4487  C  C    . PRO A 1 32 ? 16.347 6.805   5.753   1.00 0.00 ? 32 PRO A C    6  
ATOM   4488  O  O    . PRO A 1 32 ? 16.140 8.003   5.932   1.00 0.00 ? 32 PRO A O    6  
ATOM   4489  C  CB   . PRO A 1 32 ? 14.292 5.393   6.204   1.00 0.00 ? 32 PRO A CB   6  
ATOM   4490  C  CG   . PRO A 1 32 ? 14.905 4.042   6.569   1.00 0.00 ? 32 PRO A CG   6  
ATOM   4491  C  CD   . PRO A 1 32 ? 15.473 3.547   5.238   1.00 0.00 ? 32 PRO A CD   6  
ATOM   4492  H  HA   . PRO A 1 32 ? 14.689 6.534   4.420   1.00 0.00 ? 32 PRO A HA   6  
ATOM   4493  H  HB2  . PRO A 1 32 ? 14.207 6.056   7.066   1.00 0.00 ? 32 PRO A HB2  6  
ATOM   4494  H  HB3  . PRO A 1 32 ? 13.309 5.224   5.762   1.00 0.00 ? 32 PRO A HB3  6  
ATOM   4495  H  HG2  . PRO A 1 32 ? 15.720 4.195   7.277   1.00 0.00 ? 32 PRO A HG2  6  
ATOM   4496  H  HG3  . PRO A 1 32 ? 14.169 3.353   6.986   1.00 0.00 ? 32 PRO A HG3  6  
ATOM   4497  H  HD2  . PRO A 1 32 ? 16.351 2.932   5.428   1.00 0.00 ? 32 PRO A HD2  6  
ATOM   4498  H  HD3  . PRO A 1 32 ? 14.716 2.972   4.702   1.00 0.00 ? 32 PRO A HD3  6  
ATOM   4499  N  N    . ALA A 1 33 ? 17.510 6.218   6.067   1.00 0.00 ? 33 ALA A N    6  
ATOM   4500  C  CA   . ALA A 1 33 ? 18.715 6.937   6.463   1.00 0.00 ? 33 ALA A CA   6  
ATOM   4501  C  C    . ALA A 1 33 ? 19.119 8.016   5.454   1.00 0.00 ? 33 ALA A C    6  
ATOM   4502  O  O    . ALA A 1 33 ? 19.587 9.081   5.854   1.00 0.00 ? 33 ALA A O    6  
ATOM   4503  C  CB   . ALA A 1 33 ? 19.856 5.937   6.668   1.00 0.00 ? 33 ALA A CB   6  
ATOM   4504  H  H    . ALA A 1 33 ? 17.592 5.219   5.951   1.00 0.00 ? 33 ALA A H    6  
ATOM   4505  H  HA   . ALA A 1 33 ? 18.514 7.425   7.414   1.00 0.00 ? 33 ALA A HA   6  
ATOM   4506  H  HB1  . ALA A 1 33 ? 19.572 5.202   7.422   1.00 0.00 ? 33 ALA A HB1  6  
ATOM   4507  H  HB2  . ALA A 1 33 ? 20.076 5.423   5.731   1.00 0.00 ? 33 ALA A HB2  6  
ATOM   4508  H  HB3  . ALA A 1 33 ? 20.749 6.465   7.005   1.00 0.00 ? 33 ALA A HB3  6  
ATOM   4509  N  N    . LEU A 1 34 ? 18.963 7.734   4.157   1.00 0.00 ? 34 LEU A N    6  
ATOM   4510  C  CA   . LEU A 1 34 ? 19.100 8.734   3.108   1.00 0.00 ? 34 LEU A CA   6  
ATOM   4511  C  C    . LEU A 1 34 ? 17.817 9.566   3.054   1.00 0.00 ? 34 LEU A C    6  
ATOM   4512  O  O    . LEU A 1 34 ? 16.722 9.011   2.994   1.00 0.00 ? 34 LEU A O    6  
ATOM   4513  C  CB   . LEU A 1 34 ? 19.397 8.074   1.758   1.00 0.00 ? 34 LEU A CB   6  
ATOM   4514  C  CG   . LEU A 1 34 ? 20.870 7.683   1.556   1.00 0.00 ? 34 LEU A CG   6  
ATOM   4515  C  CD1  . LEU A 1 34 ? 21.805 8.894   1.429   1.00 0.00 ? 34 LEU A CD1  6  
ATOM   4516  C  CD2  . LEU A 1 34 ? 21.397 6.708   2.615   1.00 0.00 ? 34 LEU A CD2  6  
ATOM   4517  H  H    . LEU A 1 34 ? 18.530 6.855   3.909   1.00 0.00 ? 34 LEU A H    6  
ATOM   4518  H  HA   . LEU A 1 34 ? 19.945 9.380   3.324   1.00 0.00 ? 34 LEU A HA   6  
ATOM   4519  H  HB2  . LEU A 1 34 ? 18.769 7.194   1.630   1.00 0.00 ? 34 LEU A HB2  6  
ATOM   4520  H  HB3  . LEU A 1 34 ? 19.140 8.778   0.968   1.00 0.00 ? 34 LEU A HB3  6  
ATOM   4521  H  HG   . LEU A 1 34 ? 20.898 7.172   0.601   1.00 0.00 ? 34 LEU A HG   6  
ATOM   4522  H  HD11 . LEU A 1 34 ? 21.404 9.598   0.699   1.00 0.00 ? 34 LEU A HD11 6  
ATOM   4523  H  HD12 . LEU A 1 34 ? 21.931 9.399   2.385   1.00 0.00 ? 34 LEU A HD12 6  
ATOM   4524  H  HD13 . LEU A 1 34 ? 22.784 8.558   1.088   1.00 0.00 ? 34 LEU A HD13 6  
ATOM   4525  H  HD21 . LEU A 1 34 ? 22.373 6.332   2.308   1.00 0.00 ? 34 LEU A HD21 6  
ATOM   4526  H  HD22 . LEU A 1 34 ? 21.507 7.210   3.578   1.00 0.00 ? 34 LEU A HD22 6  
ATOM   4527  H  HD23 . LEU A 1 34 ? 20.713 5.866   2.719   1.00 0.00 ? 34 LEU A HD23 6  
ATOM   4528  N  N    . TYR A 1 35 ? 17.967 10.895  3.084   1.00 0.00 ? 35 TYR A N    6  
ATOM   4529  C  CA   . TYR A 1 35 ? 16.892 11.868  2.894   1.00 0.00 ? 35 TYR A CA   6  
ATOM   4530  C  C    . TYR A 1 35 ? 17.080 12.636  1.582   1.00 0.00 ? 35 TYR A C    6  
ATOM   4531  O  O    . TYR A 1 35 ? 16.125 13.196  1.046   1.00 0.00 ? 35 TYR A O    6  
ATOM   4532  C  CB   . TYR A 1 35 ? 16.858 12.814  4.098   1.00 0.00 ? 35 TYR A CB   6  
ATOM   4533  C  CG   . TYR A 1 35 ? 16.675 12.091  5.419   1.00 0.00 ? 35 TYR A CG   6  
ATOM   4534  C  CD1  . TYR A 1 35 ? 15.401 11.624  5.793   1.00 0.00 ? 35 TYR A CD1  6  
ATOM   4535  C  CD2  . TYR A 1 35 ? 17.794 11.778  6.213   1.00 0.00 ? 35 TYR A CD2  6  
ATOM   4536  C  CE1  . TYR A 1 35 ? 15.242 10.870  6.969   1.00 0.00 ? 35 TYR A CE1  6  
ATOM   4537  C  CE2  . TYR A 1 35 ? 17.636 11.019  7.387   1.00 0.00 ? 35 TYR A CE2  6  
ATOM   4538  C  CZ   . TYR A 1 35 ? 16.363 10.555  7.758   1.00 0.00 ? 35 TYR A CZ   6  
ATOM   4539  O  OH   . TYR A 1 35 ? 16.213 9.793   8.880   1.00 0.00 ? 35 TYR A OH   6  
ATOM   4540  H  H    . TYR A 1 35 ? 18.908 11.263  3.159   1.00 0.00 ? 35 TYR A H    6  
ATOM   4541  H  HA   . TYR A 1 35 ? 15.927 11.362  2.842   1.00 0.00 ? 35 TYR A HA   6  
ATOM   4542  H  HB2  . TYR A 1 35 ? 17.791 13.382  4.125   1.00 0.00 ? 35 TYR A HB2  6  
ATOM   4543  H  HB3  . TYR A 1 35 ? 16.032 13.517  3.968   1.00 0.00 ? 35 TYR A HB3  6  
ATOM   4544  H  HD1  . TYR A 1 35 ? 14.542 11.832  5.171   1.00 0.00 ? 35 TYR A HD1  6  
ATOM   4545  H  HD2  . TYR A 1 35 ? 18.781 12.099  5.916   1.00 0.00 ? 35 TYR A HD2  6  
ATOM   4546  H  HE1  . TYR A 1 35 ? 14.266 10.502  7.246   1.00 0.00 ? 35 TYR A HE1  6  
ATOM   4547  H  HE2  . TYR A 1 35 ? 18.502 10.769  7.982   1.00 0.00 ? 35 TYR A HE2  6  
ATOM   4548  H  HH   . TYR A 1 35 ? 17.042 9.616   9.328   1.00 0.00 ? 35 TYR A HH   6  
ATOM   4549  N  N    . GLU A 1 36 ? 18.318 12.660  1.077   1.00 0.00 ? 36 GLU A N    6  
ATOM   4550  C  CA   . GLU A 1 36 ? 18.709 13.124  -0.241  1.00 0.00 ? 36 GLU A CA   6  
ATOM   4551  C  C    . GLU A 1 36 ? 18.884 11.909  -1.155  1.00 0.00 ? 36 GLU A C    6  
ATOM   4552  O  O    . GLU A 1 36 ? 19.061 10.787  -0.681  1.00 0.00 ? 36 GLU A O    6  
ATOM   4553  C  CB   . GLU A 1 36 ? 20.002 13.952  -0.140  1.00 0.00 ? 36 GLU A CB   6  
ATOM   4554  C  CG   . GLU A 1 36 ? 21.201 13.219  0.493   1.00 0.00 ? 36 GLU A CG   6  
ATOM   4555  C  CD   . GLU A 1 36 ? 21.105 13.107  2.016   1.00 0.00 ? 36 GLU A CD   6  
ATOM   4556  O  OE1  . GLU A 1 36 ? 21.465 14.102  2.682   1.00 0.00 ? 36 GLU A OE1  6  
ATOM   4557  O  OE2  . GLU A 1 36 ? 20.652 12.039  2.485   1.00 0.00 ? 36 GLU A OE2  6  
ATOM   4558  H  H    . GLU A 1 36 ? 19.046 12.191  1.597   1.00 0.00 ? 36 GLU A H    6  
ATOM   4559  H  HA   . GLU A 1 36 ? 17.930 13.762  -0.656  1.00 0.00 ? 36 GLU A HA   6  
ATOM   4560  H  HB2  . GLU A 1 36 ? 20.288 14.251  -1.149  1.00 0.00 ? 36 GLU A HB2  6  
ATOM   4561  H  HB3  . GLU A 1 36 ? 19.803 14.858  0.434   1.00 0.00 ? 36 GLU A HB3  6  
ATOM   4562  H  HG2  . GLU A 1 36 ? 21.317 12.228  0.056   1.00 0.00 ? 36 GLU A HG2  6  
ATOM   4563  H  HG3  . GLU A 1 36 ? 22.101 13.790  0.264   1.00 0.00 ? 36 GLU A HG3  6  
ATOM   4564  N  N    . VAL A 1 37 ? 18.832 12.125  -2.474  1.00 0.00 ? 37 VAL A N    6  
ATOM   4565  C  CA   . VAL A 1 37 ? 19.195 11.100  -3.442  1.00 0.00 ? 37 VAL A CA   6  
ATOM   4566  C  C    . VAL A 1 37 ? 20.705 10.822  -3.333  1.00 0.00 ? 37 VAL A C    6  
ATOM   4567  O  O    . VAL A 1 37 ? 21.474 11.766  -3.157  1.00 0.00 ? 37 VAL A O    6  
ATOM   4568  C  CB   . VAL A 1 37 ? 18.743 11.538  -4.850  1.00 0.00 ? 37 VAL A CB   6  
ATOM   4569  C  CG1  . VAL A 1 37 ? 19.602 12.667  -5.435  1.00 0.00 ? 37 VAL A CG1  6  
ATOM   4570  C  CG2  . VAL A 1 37 ? 18.709 10.353  -5.824  1.00 0.00 ? 37 VAL A CG2  6  
ATOM   4571  H  H    . VAL A 1 37 ? 18.671 13.063  -2.812  1.00 0.00 ? 37 VAL A H    6  
ATOM   4572  H  HA   . VAL A 1 37 ? 18.621 10.215  -3.178  1.00 0.00 ? 37 VAL A HA   6  
ATOM   4573  H  HB   . VAL A 1 37 ? 17.720 11.908  -4.768  1.00 0.00 ? 37 VAL A HB   6  
ATOM   4574  H  HG11 . VAL A 1 37 ? 19.154 13.018  -6.364  1.00 0.00 ? 37 VAL A HG11 6  
ATOM   4575  H  HG12 . VAL A 1 37 ? 19.655 13.503  -4.736  1.00 0.00 ? 37 VAL A HG12 6  
ATOM   4576  H  HG13 . VAL A 1 37 ? 20.611 12.312  -5.648  1.00 0.00 ? 37 VAL A HG13 6  
ATOM   4577  H  HG21 . VAL A 1 37 ? 19.701 9.924   -5.943  1.00 0.00 ? 37 VAL A HG21 6  
ATOM   4578  H  HG22 . VAL A 1 37 ? 18.028 9.588   -5.450  1.00 0.00 ? 37 VAL A HG22 6  
ATOM   4579  H  HG23 . VAL A 1 37 ? 18.351 10.690  -6.797  1.00 0.00 ? 37 VAL A HG23 6  
ATOM   4580  N  N    . PRO A 1 38 ? 21.152 9.556   -3.406  1.00 0.00 ? 38 PRO A N    6  
ATOM   4581  C  CA   . PRO A 1 38 ? 22.569 9.232   -3.526  1.00 0.00 ? 38 PRO A CA   6  
ATOM   4582  C  C    . PRO A 1 38 ? 23.053 9.477   -4.956  1.00 0.00 ? 38 PRO A C    6  
ATOM   4583  O  O    . PRO A 1 38 ? 22.245 9.667   -5.863  1.00 0.00 ? 38 PRO A O    6  
ATOM   4584  C  CB   . PRO A 1 38 ? 22.688 7.760   -3.128  1.00 0.00 ? 38 PRO A CB   6  
ATOM   4585  C  CG   . PRO A 1 38 ? 21.324 7.187   -3.505  1.00 0.00 ? 38 PRO A CG   6  
ATOM   4586  C  CD   . PRO A 1 38 ? 20.361 8.345   -3.245  1.00 0.00 ? 38 PRO A CD   6  
ATOM   4587  H  HA   . PRO A 1 38 ? 23.165 9.835   -2.838  1.00 0.00 ? 38 PRO A HA   6  
ATOM   4588  H  HB2  . PRO A 1 38 ? 23.505 7.243   -3.634  1.00 0.00 ? 38 PRO A HB2  6  
ATOM   4589  H  HB3  . PRO A 1 38 ? 22.815 7.690   -2.048  1.00 0.00 ? 38 PRO A HB3  6  
ATOM   4590  H  HG2  . PRO A 1 38 ? 21.332 6.955   -4.570  1.00 0.00 ? 38 PRO A HG2  6  
ATOM   4591  H  HG3  . PRO A 1 38 ? 21.073 6.299   -2.926  1.00 0.00 ? 38 PRO A HG3  6  
ATOM   4592  H  HD2  . PRO A 1 38 ? 19.541 8.294   -3.962  1.00 0.00 ? 38 PRO A HD2  6  
ATOM   4593  H  HD3  . PRO A 1 38 ? 19.972 8.289   -2.227  1.00 0.00 ? 38 PRO A HD3  6  
ATOM   4594  N  N    . ASP A 1 39 ? 24.377 9.469   -5.152  1.00 0.00 ? 39 ASP A N    6  
ATOM   4595  C  CA   . ASP A 1 39 ? 25.007 9.683   -6.448  1.00 0.00 ? 39 ASP A CA   6  
ATOM   4596  C  C    . ASP A 1 39 ? 25.656 8.380   -6.924  1.00 0.00 ? 39 ASP A C    6  
ATOM   4597  O  O    . ASP A 1 39 ? 26.876 8.292   -7.050  1.00 0.00 ? 39 ASP A O    6  
ATOM   4598  C  CB   . ASP A 1 39 ? 26.005 10.847  -6.341  1.00 0.00 ? 39 ASP A CB   6  
ATOM   4599  C  CG   . ASP A 1 39 ? 26.643 11.204  -7.685  1.00 0.00 ? 39 ASP A CG   6  
ATOM   4600  O  OD1  . ASP A 1 39 ? 25.919 11.142  -8.703  1.00 0.00 ? 39 ASP A OD1  6  
ATOM   4601  O  OD2  . ASP A 1 39 ? 27.845 11.547  -7.668  1.00 0.00 ? 39 ASP A OD2  6  
ATOM   4602  H  H    . ASP A 1 39 ? 24.986 9.310   -4.362  1.00 0.00 ? 39 ASP A H    6  
ATOM   4603  H  HA   . ASP A 1 39 ? 24.258 9.968   -7.185  1.00 0.00 ? 39 ASP A HA   6  
ATOM   4604  H  HB2  . ASP A 1 39 ? 25.480 11.729  -5.976  1.00 0.00 ? 39 ASP A HB2  6  
ATOM   4605  H  HB3  . ASP A 1 39 ? 26.788 10.591  -5.626  1.00 0.00 ? 39 ASP A HB3  6  
ATOM   4606  N  N    . GLY A 1 40 ? 24.830 7.357   -7.175  1.00 0.00 ? 40 GLY A N    6  
ATOM   4607  C  CA   . GLY A 1 40 ? 25.280 6.143   -7.839  1.00 0.00 ? 40 GLY A CA   6  
ATOM   4608  C  C    . GLY A 1 40 ? 24.276 5.007   -7.678  1.00 0.00 ? 40 GLY A C    6  
ATOM   4609  O  O    . GLY A 1 40 ? 23.688 4.557   -8.658  1.00 0.00 ? 40 GLY A O    6  
ATOM   4610  H  H    . GLY A 1 40 ? 23.846 7.457   -6.970  1.00 0.00 ? 40 GLY A H    6  
ATOM   4611  H  HA2  . GLY A 1 40 ? 25.417 6.355   -8.900  1.00 0.00 ? 40 GLY A HA2  6  
ATOM   4612  H  HA3  . GLY A 1 40 ? 26.234 5.817   -7.421  1.00 0.00 ? 40 GLY A HA3  6  
ATOM   4613  N  N    . GLU A 1 41 ? 24.105 4.528   -6.442  1.00 0.00 ? 41 GLU A N    6  
ATOM   4614  C  CA   . GLU A 1 41 ? 23.359 3.313   -6.156  1.00 0.00 ? 41 GLU A CA   6  
ATOM   4615  C  C    . GLU A 1 41 ? 21.862 3.618   -6.084  1.00 0.00 ? 41 GLU A C    6  
ATOM   4616  O  O    . GLU A 1 41 ? 21.430 4.333   -5.180  1.00 0.00 ? 41 GLU A O    6  
ATOM   4617  C  CB   . GLU A 1 41 ? 23.881 2.699   -4.849  1.00 0.00 ? 41 GLU A CB   6  
ATOM   4618  C  CG   . GLU A 1 41 ? 23.141 1.410   -4.467  1.00 0.00 ? 41 GLU A CG   6  
ATOM   4619  C  CD   . GLU A 1 41 ? 23.188 0.385   -5.592  1.00 0.00 ? 41 GLU A CD   6  
ATOM   4620  O  OE1  . GLU A 1 41 ? 24.247 -0.264  -5.736  1.00 0.00 ? 41 GLU A OE1  6  
ATOM   4621  O  OE2  . GLU A 1 41 ? 22.169 0.286   -6.308  1.00 0.00 ? 41 GLU A OE2  6  
ATOM   4622  H  H    . GLU A 1 41 ? 24.580 4.981   -5.675  1.00 0.00 ? 41 GLU A H    6  
ATOM   4623  H  HA   . GLU A 1 41 ? 23.546 2.605   -6.965  1.00 0.00 ? 41 GLU A HA   6  
ATOM   4624  H  HB2  . GLU A 1 41 ? 24.940 2.463   -4.974  1.00 0.00 ? 41 GLU A HB2  6  
ATOM   4625  H  HB3  . GLU A 1 41 ? 23.783 3.418   -4.036  1.00 0.00 ? 41 GLU A HB3  6  
ATOM   4626  H  HG2  . GLU A 1 41 ? 23.607 0.983   -3.578  1.00 0.00 ? 41 GLU A HG2  6  
ATOM   4627  H  HG3  . GLU A 1 41 ? 22.100 1.633   -4.234  1.00 0.00 ? 41 GLU A HG3  6  
ATOM   4628  N  N    . TRP A 1 42 ? 21.079 3.073   -7.026  1.00 0.00 ? 42 TRP A N    6  
ATOM   4629  C  CA   . TRP A 1 42 ? 19.679 3.423   -7.231  1.00 0.00 ? 42 TRP A CA   6  
ATOM   4630  C  C    . TRP A 1 42 ? 18.851 2.169   -7.510  1.00 0.00 ? 42 TRP A C    6  
ATOM   4631  O  O    . TRP A 1 42 ? 18.202 2.082   -8.549  1.00 0.00 ? 42 TRP A O    6  
ATOM   4632  C  CB   . TRP A 1 42 ? 19.566 4.406   -8.406  1.00 0.00 ? 42 TRP A CB   6  
ATOM   4633  C  CG   . TRP A 1 42 ? 20.371 5.665   -8.319  1.00 0.00 ? 42 TRP A CG   6  
ATOM   4634  C  CD1  . TRP A 1 42 ? 20.413 6.495   -7.257  1.00 0.00 ? 42 TRP A CD1  6  
ATOM   4635  C  CD2  . TRP A 1 42 ? 21.247 6.258   -9.326  1.00 0.00 ? 42 TRP A CD2  6  
ATOM   4636  N  NE1  . TRP A 1 42 ? 21.254 7.552   -7.528  1.00 0.00 ? 42 TRP A NE1  6  
ATOM   4637  C  CE2  . TRP A 1 42 ? 21.798 7.458   -8.791  1.00 0.00 ? 42 TRP A CE2  6  
ATOM   4638  C  CE3  . TRP A 1 42 ? 21.640 5.900   -10.635 1.00 0.00 ? 42 TRP A CE3  6  
ATOM   4639  C  CZ2  . TRP A 1 42 ? 22.690 8.264   -9.515  1.00 0.00 ? 42 TRP A CZ2  6  
ATOM   4640  C  CZ3  . TRP A 1 42 ? 22.545 6.693   -11.364 1.00 0.00 ? 42 TRP A CZ3  6  
ATOM   4641  C  CH2  . TRP A 1 42 ? 23.071 7.872   -10.808 1.00 0.00 ? 42 TRP A CH2  6  
ATOM   4642  H  H    . TRP A 1 42 ? 21.496 2.426   -7.681  1.00 0.00 ? 42 TRP A H    6  
ATOM   4643  H  HA   . TRP A 1 42 ? 19.269 3.889   -6.337  1.00 0.00 ? 42 TRP A HA   6  
ATOM   4644  H  HB2  . TRP A 1 42 ? 19.882 3.887   -9.314  1.00 0.00 ? 42 TRP A HB2  6  
ATOM   4645  H  HB3  . TRP A 1 42 ? 18.519 4.698   -8.519  1.00 0.00 ? 42 TRP A HB3  6  
ATOM   4646  H  HD1  . TRP A 1 42 ? 19.874 6.342   -6.335  1.00 0.00 ? 42 TRP A HD1  6  
ATOM   4647  H  HE1  . TRP A 1 42 ? 21.430 8.296   -6.867  1.00 0.00 ? 42 TRP A HE1  6  
ATOM   4648  H  HE3  . TRP A 1 42 ? 21.251 4.996   -11.079 1.00 0.00 ? 42 TRP A HE3  6  
ATOM   4649  H  HZ2  . TRP A 1 42 ? 23.080 9.174   -9.085  1.00 0.00 ? 42 TRP A HZ2  6  
ATOM   4650  H  HZ3  . TRP A 1 42 ? 22.840 6.393   -12.359 1.00 0.00 ? 42 TRP A HZ3  6  
ATOM   4651  H  HH2  . TRP A 1 42 ? 23.765 8.476   -11.373 1.00 0.00 ? 42 TRP A HH2  6  
ATOM   4652  N  N    . GLN A 1 43 ? 18.839 1.212   -6.572  1.00 0.00 ? 43 GLN A N    6  
ATOM   4653  C  CA   . GLN A 1 43 ? 18.229 -0.099  -6.786  1.00 0.00 ? 43 GLN A CA   6  
ATOM   4654  C  C    . GLN A 1 43 ? 17.332 -0.509  -5.623  1.00 0.00 ? 43 GLN A C    6  
ATOM   4655  O  O    . GLN A 1 43 ? 17.489 -0.031  -4.500  1.00 0.00 ? 43 GLN A O    6  
ATOM   4656  C  CB   . GLN A 1 43 ? 19.297 -1.163  -7.075  1.00 0.00 ? 43 GLN A CB   6  
ATOM   4657  C  CG   . GLN A 1 43 ? 19.917 -0.917  -8.455  1.00 0.00 ? 43 GLN A CG   6  
ATOM   4658  C  CD   . GLN A 1 43 ? 20.884 -2.010  -8.897  1.00 0.00 ? 43 GLN A CD   6  
ATOM   4659  O  OE1  . GLN A 1 43 ? 21.197 -2.931  -8.145  1.00 0.00 ? 43 GLN A OE1  6  
ATOM   4660  N  NE2  . GLN A 1 43 ? 21.340 -1.920  -10.147 1.00 0.00 ? 43 GLN A NE2  6  
ATOM   4661  H  H    . GLN A 1 43 ? 19.368 1.359   -5.725  1.00 0.00 ? 43 GLN A H    6  
ATOM   4662  H  HA   . GLN A 1 43 ? 17.574 -0.054  -7.655  1.00 0.00 ? 43 GLN A HA   6  
ATOM   4663  H  HB2  . GLN A 1 43 ? 20.059 -1.151  -6.296  1.00 0.00 ? 43 GLN A HB2  6  
ATOM   4664  H  HB3  . GLN A 1 43 ? 18.824 -2.145  -7.084  1.00 0.00 ? 43 GLN A HB3  6  
ATOM   4665  H  HG2  . GLN A 1 43 ? 19.111 -0.880  -9.187  1.00 0.00 ? 43 GLN A HG2  6  
ATOM   4666  H  HG3  . GLN A 1 43 ? 20.448 0.036   -8.462  1.00 0.00 ? 43 GLN A HG3  6  
ATOM   4667  H  HE21 . GLN A 1 43 ? 21.056 -1.138  -10.725 1.00 0.00 ? 43 GLN A HE21 6  
ATOM   4668  H  HE22 . GLN A 1 43 ? 21.928 -2.654  -10.518 1.00 0.00 ? 43 GLN A HE22 6  
ATOM   4669  N  N    . CYS A 1 44 ? 16.371 -1.389  -5.936  1.00 0.00 ? 44 CYS A N    6  
ATOM   4670  C  CA   . CYS A 1 44 ? 15.305 -1.835  -5.050  1.00 0.00 ? 44 CYS A CA   6  
ATOM   4671  C  C    . CYS A 1 44 ? 15.544 -3.298  -4.663  1.00 0.00 ? 44 CYS A C    6  
ATOM   4672  O  O    . CYS A 1 44 ? 16.173 -4.009  -5.441  1.00 0.00 ? 44 CYS A O    6  
ATOM   4673  C  CB   . CYS A 1 44 ? 13.958 -1.624  -5.751  1.00 0.00 ? 44 CYS A CB   6  
ATOM   4674  S  SG   . CYS A 1 44 ? 13.637 -2.650  -7.209  1.00 0.00 ? 44 CYS A SG   6  
ATOM   4675  H  H    . CYS A 1 44 ? 16.376 -1.781  -6.866  1.00 0.00 ? 44 CYS A H    6  
ATOM   4676  H  HA   . CYS A 1 44 ? 15.328 -1.226  -4.152  1.00 0.00 ? 44 CYS A HA   6  
ATOM   4677  H  HB2  . CYS A 1 44 ? 13.164 -1.832  -5.045  1.00 0.00 ? 44 CYS A HB2  6  
ATOM   4678  H  HB3  . CYS A 1 44 ? 13.878 -0.575  -6.039  1.00 0.00 ? 44 CYS A HB3  6  
ATOM   4679  N  N    . PRO A 1 45 ? 15.023 -3.764  -3.510  1.00 0.00 ? 45 PRO A N    6  
ATOM   4680  C  CA   . PRO A 1 45 ? 15.351 -5.047  -2.885  1.00 0.00 ? 45 PRO A CA   6  
ATOM   4681  C  C    . PRO A 1 45 ? 15.559 -6.241  -3.823  1.00 0.00 ? 45 PRO A C    6  
ATOM   4682  O  O    . PRO A 1 45 ? 16.489 -7.018  -3.619  1.00 0.00 ? 45 PRO A O    6  
ATOM   4683  C  CB   . PRO A 1 45 ? 14.233 -5.327  -1.878  1.00 0.00 ? 45 PRO A CB   6  
ATOM   4684  C  CG   . PRO A 1 45 ? 13.761 -3.927  -1.500  1.00 0.00 ? 45 PRO A CG   6  
ATOM   4685  C  CD   . PRO A 1 45 ? 13.873 -3.186  -2.830  1.00 0.00 ? 45 PRO A CD   6  
ATOM   4686  H  HA   . PRO A 1 45 ? 16.272 -4.893  -2.328  1.00 0.00 ? 45 PRO A HA   6  
ATOM   4687  H  HB2  . PRO A 1 45 ? 13.413 -5.858  -2.366  1.00 0.00 ? 45 PRO A HB2  6  
ATOM   4688  H  HB3  . PRO A 1 45 ? 14.588 -5.891  -1.013  1.00 0.00 ? 45 PRO A HB3  6  
ATOM   4689  H  HG2  . PRO A 1 45 ? 12.744 -3.923  -1.107  1.00 0.00 ? 45 PRO A HG2  6  
ATOM   4690  H  HG3  . PRO A 1 45 ? 14.454 -3.491  -0.779  1.00 0.00 ? 45 PRO A HG3  6  
ATOM   4691  H  HD2  . PRO A 1 45 ? 12.974 -3.388  -3.416  1.00 0.00 ? 45 PRO A HD2  6  
ATOM   4692  H  HD3  . PRO A 1 45 ? 13.974 -2.118  -2.641  1.00 0.00 ? 45 PRO A HD3  6  
ATOM   4693  N  N    . ALA A 1 46 ? 14.680 -6.408  -4.819  1.00 0.00 ? 46 ALA A N    6  
ATOM   4694  C  CA   . ALA A 1 46 ? 14.673 -7.566  -5.698  1.00 0.00 ? 46 ALA A CA   6  
ATOM   4695  C  C    . ALA A 1 46 ? 15.896 -7.536  -6.612  1.00 0.00 ? 46 ALA A C    6  
ATOM   4696  O  O    . ALA A 1 46 ? 16.506 -8.574  -6.863  1.00 0.00 ? 46 ALA A O    6  
ATOM   4697  C  CB   . ALA A 1 46 ? 13.381 -7.575  -6.518  1.00 0.00 ? 46 ALA A CB   6  
ATOM   4698  H  H    . ALA A 1 46 ? 14.078 -5.641  -5.071  1.00 0.00 ? 46 ALA A H    6  
ATOM   4699  H  HA   . ALA A 1 46 ? 14.701 -8.475  -5.093  1.00 0.00 ? 46 ALA A HA   6  
ATOM   4700  H  HB1  . ALA A 1 46 ? 13.315 -6.674  -7.128  1.00 0.00 ? 46 ALA A HB1  6  
ATOM   4701  H  HB2  . ALA A 1 46 ? 13.367 -8.450  -7.170  1.00 0.00 ? 46 ALA A HB2  6  
ATOM   4702  H  HB3  . ALA A 1 46 ? 12.521 -7.619  -5.849  1.00 0.00 ? 46 ALA A HB3  6  
ATOM   4703  N  N    . CYS A 1 47 ? 16.249 -6.342  -7.102  1.00 0.00 ? 47 CYS A N    6  
ATOM   4704  C  CA   . CYS A 1 47 ? 17.492 -6.101  -7.805  1.00 0.00 ? 47 CYS A CA   6  
ATOM   4705  C  C    . CYS A 1 47 ? 18.679 -6.218  -6.846  1.00 0.00 ? 47 CYS A C    6  
ATOM   4706  O  O    . CYS A 1 47 ? 19.656 -6.900  -7.152  1.00 0.00 ? 47 CYS A O    6  
ATOM   4707  C  CB   . CYS A 1 47 ? 17.435 -4.726  -8.474  1.00 0.00 ? 47 CYS A CB   6  
ATOM   4708  S  SG   . CYS A 1 47 ? 16.028 -4.491  -9.590  1.00 0.00 ? 47 CYS A SG   6  
ATOM   4709  H  H    . CYS A 1 47 ? 15.724 -5.521  -6.837  1.00 0.00 ? 47 CYS A H    6  
ATOM   4710  H  HA   . CYS A 1 47 ? 17.575 -6.851  -8.586  1.00 0.00 ? 47 CYS A HA   6  
ATOM   4711  H  HB2  . CYS A 1 47 ? 17.380 -3.956  -7.706  1.00 0.00 ? 47 CYS A HB2  6  
ATOM   4712  H  HB3  . CYS A 1 47 ? 18.350 -4.582  -9.046  1.00 0.00 ? 47 CYS A HB3  6  
ATOM   4713  N  N    . GLN A 1 48 ? 18.587 -5.553  -5.687  1.00 0.00 ? 48 GLN A N    6  
ATOM   4714  C  CA   . GLN A 1 48 ? 19.657 -5.441  -4.711  1.00 0.00 ? 48 GLN A CA   6  
ATOM   4715  C  C    . GLN A 1 48 ? 19.073 -4.944  -3.385  1.00 0.00 ? 48 GLN A C    6  
ATOM   4716  O  O    . GLN A 1 48 ? 18.331 -3.963  -3.398  1.00 0.00 ? 48 GLN A O    6  
ATOM   4717  C  CB   . GLN A 1 48 ? 20.685 -4.421  -5.210  1.00 0.00 ? 48 GLN A CB   6  
ATOM   4718  C  CG   . GLN A 1 48 ? 21.953 -4.409  -4.343  1.00 0.00 ? 48 GLN A CG   6  
ATOM   4719  C  CD   . GLN A 1 48 ? 22.836 -3.193  -4.614  1.00 0.00 ? 48 GLN A CD   6  
ATOM   4720  O  OE1  . GLN A 1 48 ? 23.344 -2.582  -3.676  1.00 0.00 ? 48 GLN A OE1  6  
ATOM   4721  N  NE2  . GLN A 1 48 ? 23.030 -2.832  -5.883  1.00 0.00 ? 48 GLN A NE2  6  
ATOM   4722  H  H    . GLN A 1 48 ? 17.738 -5.040  -5.492  1.00 0.00 ? 48 GLN A H    6  
ATOM   4723  H  HA   . GLN A 1 48 ? 20.136 -6.412  -4.617  1.00 0.00 ? 48 GLN A HA   6  
ATOM   4724  H  HB2  . GLN A 1 48 ? 20.969 -4.664  -6.234  1.00 0.00 ? 48 GLN A HB2  6  
ATOM   4725  H  HB3  . GLN A 1 48 ? 20.209 -3.440  -5.182  1.00 0.00 ? 48 GLN A HB3  6  
ATOM   4726  H  HG2  . GLN A 1 48 ? 21.685 -4.386  -3.287  1.00 0.00 ? 48 GLN A HG2  6  
ATOM   4727  H  HG3  . GLN A 1 48 ? 22.525 -5.316  -4.534  1.00 0.00 ? 48 GLN A HG3  6  
ATOM   4728  H  HE21 . GLN A 1 48 ? 22.535 -3.294  -6.636  1.00 0.00 ? 48 GLN A HE21 6  
ATOM   4729  H  HE22 . GLN A 1 48 ? 23.578 -1.997  -6.066  1.00 0.00 ? 48 GLN A HE22 6  
ATOM   4730  N  N    . PRO A 1 49 ? 19.417 -5.559  -2.240  1.00 0.00 ? 49 PRO A N    6  
ATOM   4731  C  CA   . PRO A 1 49 ? 19.095 -5.015  -0.928  1.00 0.00 ? 49 PRO A CA   6  
ATOM   4732  C  C    . PRO A 1 49 ? 20.095 -3.899  -0.611  1.00 0.00 ? 49 PRO A C    6  
ATOM   4733  O  O    . PRO A 1 49 ? 20.997 -4.068  0.208   1.00 0.00 ? 49 PRO A O    6  
ATOM   4734  C  CB   . PRO A 1 49 ? 19.174 -6.208  0.032   1.00 0.00 ? 49 PRO A CB   6  
ATOM   4735  C  CG   . PRO A 1 49 ? 20.222 -7.108  -0.621  1.00 0.00 ? 49 PRO A CG   6  
ATOM   4736  C  CD   . PRO A 1 49 ? 19.977 -6.895  -2.115  1.00 0.00 ? 49 PRO A CD   6  
ATOM   4737  H  HA   . PRO A 1 49 ? 18.084 -4.607  -0.891  1.00 0.00 ? 49 PRO A HA   6  
ATOM   4738  H  HB2  . PRO A 1 49 ? 19.436 -5.929  1.053   1.00 0.00 ? 49 PRO A HB2  6  
ATOM   4739  H  HB3  . PRO A 1 49 ? 18.215 -6.729  0.026   1.00 0.00 ? 49 PRO A HB3  6  
ATOM   4740  H  HG2  . PRO A 1 49 ? 21.219 -6.751  -0.361  1.00 0.00 ? 49 PRO A HG2  6  
ATOM   4741  H  HG3  . PRO A 1 49 ? 20.110 -8.152  -0.329  1.00 0.00 ? 49 PRO A HG3  6  
ATOM   4742  H  HD2  . PRO A 1 49 ? 20.923 -6.999  -2.647  1.00 0.00 ? 49 PRO A HD2  6  
ATOM   4743  H  HD3  . PRO A 1 49 ? 19.254 -7.624  -2.482  1.00 0.00 ? 49 PRO A HD3  6  
ATOM   4744  N  N    . ALA A 1 50 ? 19.930 -2.758  -1.290  1.00 0.00 ? 50 ALA A N    6  
ATOM   4745  C  CA   . ALA A 1 50 ? 20.893 -1.667  -1.295  1.00 0.00 ? 50 ALA A CA   6  
ATOM   4746  C  C    . ALA A 1 50 ? 20.969 -0.966  0.064   1.00 0.00 ? 50 ALA A C    6  
ATOM   4747  O  O    . ALA A 1 50 ? 20.042 -1.050  0.868   1.00 0.00 ? 50 ALA A O    6  
ATOM   4748  C  CB   . ALA A 1 50 ? 20.529 -0.674  -2.403  1.00 0.00 ? 50 ALA A CB   6  
ATOM   4749  H  H    . ALA A 1 50 ? 19.156 -2.698  -1.938  1.00 0.00 ? 50 ALA A H    6  
ATOM   4750  H  HA   . ALA A 1 50 ? 21.875 -2.084  -1.520  1.00 0.00 ? 50 ALA A HA   6  
ATOM   4751  H  HB1  . ALA A 1 50 ? 20.517 -1.184  -3.367  1.00 0.00 ? 50 ALA A HB1  6  
ATOM   4752  H  HB2  . ALA A 1 50 ? 19.545 -0.245  -2.211  1.00 0.00 ? 50 ALA A HB2  6  
ATOM   4753  H  HB3  . ALA A 1 50 ? 21.266 0.127   -2.436  1.00 0.00 ? 50 ALA A HB3  6  
ATOM   4754  N  N    . THR A 1 51 ? 22.087 -0.269  0.296   1.00 0.00 ? 51 THR A N    6  
ATOM   4755  C  CA   . THR A 1 51 ? 22.388 0.459   1.523   1.00 0.00 ? 51 THR A CA   6  
ATOM   4756  C  C    . THR A 1 51 ? 22.714 1.919   1.181   1.00 0.00 ? 51 THR A C    6  
ATOM   4757  O  O    . THR A 1 51 ? 22.992 2.192   -0.010  1.00 0.00 ? 51 THR A O    6  
ATOM   4758  C  CB   . THR A 1 51 ? 23.543 -0.246  2.254   1.00 0.00 ? 51 THR A CB   6  
ATOM   4759  O  OG1  . THR A 1 51 ? 23.258 -1.627  2.366   1.00 0.00 ? 51 THR A OG1  6  
ATOM   4760  C  CG2  . THR A 1 51 ? 23.773 0.307   3.664   1.00 0.00 ? 51 THR A CG2  6  
ATOM   4761  O  OXT  . THR A 1 51 ? 22.631 2.755   2.107   1.00 0.00 ? 51 THR A OXT  6  
ATOM   4762  H  H    . THR A 1 51 ? 22.777 -0.210  -0.438  1.00 0.00 ? 51 THR A H    6  
ATOM   4763  H  HA   . THR A 1 51 ? 21.516 0.459   2.180   1.00 0.00 ? 51 THR A HA   6  
ATOM   4764  H  HB   . THR A 1 51 ? 24.461 -0.133  1.674   1.00 0.00 ? 51 THR A HB   6  
ATOM   4765  H  HG1  . THR A 1 51 ? 22.388 -1.729  2.758   1.00 0.00 ? 51 THR A HG1  6  
ATOM   4766  H  HG21 . THR A 1 51 ? 24.537 -0.289  4.166   1.00 0.00 ? 51 THR A HG21 6  
ATOM   4767  H  HG22 . THR A 1 51 ? 24.118 1.340   3.619   1.00 0.00 ? 51 THR A HG22 6  
ATOM   4768  H  HG23 . THR A 1 51 ? 22.850 0.259   4.242   1.00 0.00 ? 51 THR A HG23 6  
HETATM 4769  ZN ZN   . ZN  B 2 .  ? 6.678  4.691   -0.959  1.00 0.00 ? 52 ZN  A ZN   6  
HETATM 4770  ZN ZN   . ZN  C 2 .  ? 14.548 -2.755  -9.315  1.00 0.00 ? 53 ZN  A ZN   6  
ATOM   4771  N  N    . ALA A 1 1  ? 4.988  10.738  -7.337  1.00 0.00 ? 1  ALA A N    7  
ATOM   4772  C  CA   . ALA A 1 1  ? 3.607  10.442  -7.752  1.00 0.00 ? 1  ALA A CA   7  
ATOM   4773  C  C    . ALA A 1 1  ? 2.995  9.363   -6.857  1.00 0.00 ? 1  ALA A C    7  
ATOM   4774  O  O    . ALA A 1 1  ? 2.055  9.645   -6.118  1.00 0.00 ? 1  ALA A O    7  
ATOM   4775  C  CB   . ALA A 1 1  ? 3.549  10.053  -9.231  1.00 0.00 ? 1  ALA A CB   7  
ATOM   4776  H  H1   . ALA A 1 1  ? 5.565  9.920   -7.464  1.00 0.00 ? 1  ALA A H1   7  
ATOM   4777  H  H2   . ALA A 1 1  ? 5.357  11.505  -7.879  1.00 0.00 ? 1  ALA A H2   7  
ATOM   4778  H  H3   . ALA A 1 1  ? 4.984  10.989  -6.353  1.00 0.00 ? 1  ALA A H3   7  
ATOM   4779  H  HA   . ALA A 1 1  ? 3.026  11.356  -7.624  1.00 0.00 ? 1  ALA A HA   7  
ATOM   4780  H  HB1  . ALA A 1 1  ? 4.158  9.168   -9.419  1.00 0.00 ? 1  ALA A HB1  7  
ATOM   4781  H  HB2  . ALA A 1 1  ? 2.517  9.847   -9.517  1.00 0.00 ? 1  ALA A HB2  7  
ATOM   4782  H  HB3  . ALA A 1 1  ? 3.926  10.876  -9.840  1.00 0.00 ? 1  ALA A HB3  7  
ATOM   4783  N  N    . ARG A 1 2  ? 3.521  8.133   -6.939  1.00 0.00 ? 2  ARG A N    7  
ATOM   4784  C  CA   . ARG A 1 2  ? 3.217  7.041   -6.023  1.00 0.00 ? 2  ARG A CA   7  
ATOM   4785  C  C    . ARG A 1 2  ? 4.489  6.222   -5.773  1.00 0.00 ? 2  ARG A C    7  
ATOM   4786  O  O    . ARG A 1 2  ? 5.534  6.497   -6.361  1.00 0.00 ? 2  ARG A O    7  
ATOM   4787  C  CB   . ARG A 1 2  ? 2.094  6.152   -6.589  1.00 0.00 ? 2  ARG A CB   7  
ATOM   4788  C  CG   . ARG A 1 2  ? 0.766  6.902   -6.751  1.00 0.00 ? 2  ARG A CG   7  
ATOM   4789  C  CD   . ARG A 1 2  ? -0.382 5.946   -7.087  1.00 0.00 ? 2  ARG A CD   7  
ATOM   4790  N  NE   . ARG A 1 2  ? -0.190 5.305   -8.394  1.00 0.00 ? 2  ARG A NE   7  
ATOM   4791  C  CZ   . ARG A 1 2  ? -1.021 4.397   -8.935  1.00 0.00 ? 2  ARG A CZ   7  
ATOM   4792  N  NH1  . ARG A 1 2  ? -2.109 3.985   -8.269  1.00 0.00 ? 2  ARG A NH1  7  
ATOM   4793  N  NH2  . ARG A 1 2  ? -0.760 3.902   -10.152 1.00 0.00 ? 2  ARG A NH2  7  
ATOM   4794  H  H    . ARG A 1 2  ? 4.282  7.969   -7.584  1.00 0.00 ? 2  ARG A H    7  
ATOM   4795  H  HA   . ARG A 1 2  ? 2.901  7.453   -5.066  1.00 0.00 ? 2  ARG A HA   7  
ATOM   4796  H  HB2  . ARG A 1 2  ? 2.409  5.745   -7.552  1.00 0.00 ? 2  ARG A HB2  7  
ATOM   4797  H  HB3  . ARG A 1 2  ? 1.922  5.322   -5.903  1.00 0.00 ? 2  ARG A HB3  7  
ATOM   4798  H  HG2  . ARG A 1 2  ? 0.526  7.407   -5.816  1.00 0.00 ? 2  ARG A HG2  7  
ATOM   4799  H  HG3  . ARG A 1 2  ? 0.850  7.647   -7.544  1.00 0.00 ? 2  ARG A HG3  7  
ATOM   4800  H  HD2  . ARG A 1 2  ? -0.457 5.187   -6.307  1.00 0.00 ? 2  ARG A HD2  7  
ATOM   4801  H  HD3  . ARG A 1 2  ? -1.311 6.520   -7.110  1.00 0.00 ? 2  ARG A HD3  7  
ATOM   4802  H  HE   . ARG A 1 2  ? 0.621  5.592   -8.925  1.00 0.00 ? 2  ARG A HE   7  
ATOM   4803  H  HH11 . ARG A 1 2  ? -2.312 4.357   -7.353  1.00 0.00 ? 2  ARG A HH11 7  
ATOM   4804  H  HH12 . ARG A 1 2  ? -2.733 3.306   -8.681  1.00 0.00 ? 2  ARG A HH12 7  
ATOM   4805  H  HH21 . ARG A 1 2  ? 0.053  4.212   -10.663 1.00 0.00 ? 2  ARG A HH21 7  
ATOM   4806  H  HH22 . ARG A 1 2  ? -1.380 3.224   -10.571 1.00 0.00 ? 2  ARG A HH22 7  
ATOM   4807  N  N    . CYS A 1 3  ? 4.382  5.217   -4.895  1.00 0.00 ? 3  CYS A N    7  
ATOM   4808  C  CA   . CYS A 1 3  ? 5.471  4.356   -4.452  1.00 0.00 ? 3  CYS A CA   7  
ATOM   4809  C  C    . CYS A 1 3  ? 5.010  2.898   -4.507  1.00 0.00 ? 3  CYS A C    7  
ATOM   4810  O  O    . CYS A 1 3  ? 3.827  2.616   -4.329  1.00 0.00 ? 3  CYS A O    7  
ATOM   4811  C  CB   . CYS A 1 3  ? 5.858  4.776   -3.030  1.00 0.00 ? 3  CYS A CB   7  
ATOM   4812  S  SG   . CYS A 1 3  ? 6.956  3.675   -2.101  1.00 0.00 ? 3  CYS A SG   7  
ATOM   4813  H  H    . CYS A 1 3  ? 3.483  5.055   -4.465  1.00 0.00 ? 3  CYS A H    7  
ATOM   4814  H  HA   . CYS A 1 3  ? 6.340  4.472   -5.100  1.00 0.00 ? 3  CYS A HA   7  
ATOM   4815  H  HB2  . CYS A 1 3  ? 6.340  5.752   -3.100  1.00 0.00 ? 3  CYS A HB2  7  
ATOM   4816  H  HB3  . CYS A 1 3  ? 4.942  4.877   -2.449  1.00 0.00 ? 3  CYS A HB3  7  
ATOM   4817  N  N    . LYS A 1 4  ? 5.948  1.975   -4.753  1.00 0.00 ? 4  LYS A N    7  
ATOM   4818  C  CA   . LYS A 1 4  ? 5.723  0.534   -4.757  1.00 0.00 ? 4  LYS A CA   7  
ATOM   4819  C  C    . LYS A 1 4  ? 5.133  0.068   -3.426  1.00 0.00 ? 4  LYS A C    7  
ATOM   4820  O  O    . LYS A 1 4  ? 4.142  -0.658  -3.399  1.00 0.00 ? 4  LYS A O    7  
ATOM   4821  C  CB   . LYS A 1 4  ? 7.053  -0.163  -5.081  1.00 0.00 ? 4  LYS A CB   7  
ATOM   4822  C  CG   . LYS A 1 4  ? 6.969  -1.693  -5.203  1.00 0.00 ? 4  LYS A CG   7  
ATOM   4823  C  CD   . LYS A 1 4  ? 7.099  -2.426  -3.857  1.00 0.00 ? 4  LYS A CD   7  
ATOM   4824  C  CE   . LYS A 1 4  ? 7.274  -3.936  -4.046  1.00 0.00 ? 4  LYS A CE   7  
ATOM   4825  N  NZ   . LYS A 1 4  ? 6.067  -4.566  -4.611  1.00 0.00 ? 4  LYS A NZ   7  
ATOM   4826  H  H    . LYS A 1 4  ? 6.891  2.293   -4.935  1.00 0.00 ? 4  LYS A H    7  
ATOM   4827  H  HA   . LYS A 1 4  ? 5.019  0.302   -5.549  1.00 0.00 ? 4  LYS A HA   7  
ATOM   4828  H  HB2  . LYS A 1 4  ? 7.386  0.220   -6.050  1.00 0.00 ? 4  LYS A HB2  7  
ATOM   4829  H  HB3  . LYS A 1 4  ? 7.797  0.108   -4.332  1.00 0.00 ? 4  LYS A HB3  7  
ATOM   4830  H  HG2  . LYS A 1 4  ? 6.043  -1.967  -5.708  1.00 0.00 ? 4  LYS A HG2  7  
ATOM   4831  H  HG3  . LYS A 1 4  ? 7.807  -2.006  -5.830  1.00 0.00 ? 4  LYS A HG3  7  
ATOM   4832  H  HD2  . LYS A 1 4  ? 7.973  -2.046  -3.328  1.00 0.00 ? 4  LYS A HD2  7  
ATOM   4833  H  HD3  . LYS A 1 4  ? 6.224  -2.263  -3.232  1.00 0.00 ? 4  LYS A HD3  7  
ATOM   4834  H  HE2  . LYS A 1 4  ? 8.125  -4.132  -4.700  1.00 0.00 ? 4  LYS A HE2  7  
ATOM   4835  H  HE3  . LYS A 1 4  ? 7.474  -4.389  -3.074  1.00 0.00 ? 4  LYS A HE3  7  
ATOM   4836  H  HZ1  . LYS A 1 4  ? 6.213  -5.563  -4.695  1.00 0.00 ? 4  LYS A HZ1  7  
ATOM   4837  H  HZ2  . LYS A 1 4  ? 5.280  -4.397  -4.001  1.00 0.00 ? 4  LYS A HZ2  7  
ATOM   4838  H  HZ3  . LYS A 1 4  ? 5.872  -4.179  -5.523  1.00 0.00 ? 4  LYS A HZ3  7  
ATOM   4839  N  N    . VAL A 1 5  ? 5.766  0.479   -2.328  1.00 0.00 ? 5  VAL A N    7  
ATOM   4840  C  CA   . VAL A 1 5  ? 5.382  0.134   -0.967  1.00 0.00 ? 5  VAL A CA   7  
ATOM   4841  C  C    . VAL A 1 5  ? 4.009  0.728   -0.643  1.00 0.00 ? 5  VAL A C    7  
ATOM   4842  O  O    . VAL A 1 5  ? 3.102  -0.002  -0.241  1.00 0.00 ? 5  VAL A O    7  
ATOM   4843  C  CB   . VAL A 1 5  ? 6.486  0.593   0.001   1.00 0.00 ? 5  VAL A CB   7  
ATOM   4844  C  CG1  . VAL A 1 5  ? 6.148  0.334   1.471   1.00 0.00 ? 5  VAL A CG1  7  
ATOM   4845  C  CG2  . VAL A 1 5  ? 7.795  -0.133  -0.339  1.00 0.00 ? 5  VAL A CG2  7  
ATOM   4846  H  H    . VAL A 1 5  ? 6.592  1.042   -2.458  1.00 0.00 ? 5  VAL A H    7  
ATOM   4847  H  HA   . VAL A 1 5  ? 5.307  -0.951  -0.893  1.00 0.00 ? 5  VAL A HA   7  
ATOM   4848  H  HB   . VAL A 1 5  ? 6.639  1.663   -0.114  1.00 0.00 ? 5  VAL A HB   7  
ATOM   4849  H  HG11 . VAL A 1 5  ? 5.257  0.890   1.761   1.00 0.00 ? 5  VAL A HG11 7  
ATOM   4850  H  HG12 . VAL A 1 5  ? 5.985  -0.731  1.639   1.00 0.00 ? 5  VAL A HG12 7  
ATOM   4851  H  HG13 . VAL A 1 5  ? 6.983  0.676   2.086   1.00 0.00 ? 5  VAL A HG13 7  
ATOM   4852  H  HG21 . VAL A 1 5  ? 8.136  0.171   -1.326  1.00 0.00 ? 5  VAL A HG21 7  
ATOM   4853  H  HG22 . VAL A 1 5  ? 8.570  0.116   0.385   1.00 0.00 ? 5  VAL A HG22 7  
ATOM   4854  H  HG23 . VAL A 1 5  ? 7.641  -1.212  -0.328  1.00 0.00 ? 5  VAL A HG23 7  
ATOM   4855  N  N    . CYS A 1 6  ? 3.843  2.044   -0.826  1.00 0.00 ? 6  CYS A N    7  
ATOM   4856  C  CA   . CYS A 1 6  ? 2.659  2.756   -0.364  1.00 0.00 ? 6  CYS A CA   7  
ATOM   4857  C  C    . CYS A 1 6  ? 1.437  2.428   -1.229  1.00 0.00 ? 6  CYS A C    7  
ATOM   4858  O  O    . CYS A 1 6  ? 0.346  2.231   -0.698  1.00 0.00 ? 6  CYS A O    7  
ATOM   4859  C  CB   . CYS A 1 6  ? 2.905  4.272   -0.356  1.00 0.00 ? 6  CYS A CB   7  
ATOM   4860  S  SG   . CYS A 1 6  ? 4.415  4.853   0.466   1.00 0.00 ? 6  CYS A SG   7  
ATOM   4861  H  H    . CYS A 1 6  ? 4.604  2.583   -1.209  1.00 0.00 ? 6  CYS A H    7  
ATOM   4862  H  HA   . CYS A 1 6  ? 2.455  2.453   0.664   1.00 0.00 ? 6  CYS A HA   7  
ATOM   4863  H  HB2  . CYS A 1 6  ? 2.921  4.640   -1.381  1.00 0.00 ? 6  CYS A HB2  7  
ATOM   4864  H  HB3  . CYS A 1 6  ? 2.059  4.740   0.149   1.00 0.00 ? 6  CYS A HB3  7  
ATOM   4865  N  N    . ARG A 1 7  ? 1.628  2.377   -2.556  1.00 0.00 ? 7  ARG A N    7  
ATOM   4866  C  CA   . ARG A 1 7  ? 0.576  2.305   -3.572  1.00 0.00 ? 7  ARG A CA   7  
ATOM   4867  C  C    . ARG A 1 7  ? -0.374 3.503   -3.454  1.00 0.00 ? 7  ARG A C    7  
ATOM   4868  O  O    . ARG A 1 7  ? -1.564 3.389   -3.749  1.00 0.00 ? 7  ARG A O    7  
ATOM   4869  C  CB   . ARG A 1 7  ? -0.146 0.947   -3.532  1.00 0.00 ? 7  ARG A CB   7  
ATOM   4870  C  CG   . ARG A 1 7  ? 0.785  -0.185  -3.990  1.00 0.00 ? 7  ARG A CG   7  
ATOM   4871  C  CD   . ARG A 1 7  ? 0.528  -1.473  -3.205  1.00 0.00 ? 7  ARG A CD   7  
ATOM   4872  N  NE   . ARG A 1 7  ? 0.984  -1.335  -1.814  1.00 0.00 ? 7  ARG A NE   7  
ATOM   4873  C  CZ   . ARG A 1 7  ? 0.611  -2.116  -0.787  1.00 0.00 ? 7  ARG A CZ   7  
ATOM   4874  N  NH1  . ARG A 1 7  ? -0.222 -3.150  -0.970  1.00 0.00 ? 7  ARG A NH1  7  
ATOM   4875  N  NH2  . ARG A 1 7  ? 1.085  -1.851  0.437   1.00 0.00 ? 7  ARG A NH2  7  
ATOM   4876  H  H    . ARG A 1 7  ? 2.573  2.481   -2.900  1.00 0.00 ? 7  ARG A H    7  
ATOM   4877  H  HA   . ARG A 1 7  ? 1.058  2.393   -4.547  1.00 0.00 ? 7  ARG A HA   7  
ATOM   4878  H  HB2  . ARG A 1 7  ? -0.524 0.758   -2.529  1.00 0.00 ? 7  ARG A HB2  7  
ATOM   4879  H  HB3  . ARG A 1 7  ? -1.000 0.959   -4.212  1.00 0.00 ? 7  ARG A HB3  7  
ATOM   4880  H  HG2  . ARG A 1 7  ? 0.622  -0.367  -5.053  1.00 0.00 ? 7  ARG A HG2  7  
ATOM   4881  H  HG3  . ARG A 1 7  ? 1.826  0.104   -3.855  1.00 0.00 ? 7  ARG A HG3  7  
ATOM   4882  H  HD2  . ARG A 1 7  ? -0.538 -1.700  -3.246  1.00 0.00 ? 7  ARG A HD2  7  
ATOM   4883  H  HD3  . ARG A 1 7  ? 1.084  -2.286  -3.673  1.00 0.00 ? 7  ARG A HD3  7  
ATOM   4884  H  HE   . ARG A 1 7  ? 1.643  -0.590  -1.624  1.00 0.00 ? 7  ARG A HE   7  
ATOM   4885  H  HH11 . ARG A 1 7  ? -0.566 -3.366  -1.895  1.00 0.00 ? 7  ARG A HH11 7  
ATOM   4886  H  HH12 . ARG A 1 7  ? -0.496 -3.729  -0.190  1.00 0.00 ? 7  ARG A HH12 7  
ATOM   4887  H  HH21 . ARG A 1 7  ? 1.744  -1.089  0.554   1.00 0.00 ? 7  ARG A HH21 7  
ATOM   4888  H  HH22 . ARG A 1 7  ? 0.813  -2.410  1.233   1.00 0.00 ? 7  ARG A HH22 7  
ATOM   4889  N  N    . LYS A 1 8  ? 0.170  4.646   -3.018  1.00 0.00 ? 8  LYS A N    7  
ATOM   4890  C  CA   . LYS A 1 8  ? -0.514 5.905   -2.762  1.00 0.00 ? 8  LYS A CA   7  
ATOM   4891  C  C    . LYS A 1 8  ? 0.522  7.021   -2.888  1.00 0.00 ? 8  LYS A C    7  
ATOM   4892  O  O    . LYS A 1 8  ? 1.725  6.752   -2.902  1.00 0.00 ? 8  LYS A O    7  
ATOM   4893  C  CB   . LYS A 1 8  ? -1.091 5.942   -1.335  1.00 0.00 ? 8  LYS A CB   7  
ATOM   4894  C  CG   . LYS A 1 8  ? -2.116 4.857   -0.983  1.00 0.00 ? 8  LYS A CG   7  
ATOM   4895  C  CD   . LYS A 1 8  ? -3.431 5.013   -1.760  1.00 0.00 ? 8  LYS A CD   7  
ATOM   4896  C  CE   . LYS A 1 8  ? -4.397 3.861   -1.463  1.00 0.00 ? 8  LYS A CE   7  
ATOM   4897  N  NZ   . LYS A 1 8  ? -3.868 2.566   -1.928  1.00 0.00 ? 8  LYS A NZ   7  
ATOM   4898  H  H    . LYS A 1 8  ? 1.168  4.665   -2.862  1.00 0.00 ? 8  LYS A H    7  
ATOM   4899  H  HA   . LYS A 1 8  ? -1.302 6.065   -3.494  1.00 0.00 ? 8  LYS A HA   7  
ATOM   4900  H  HB2  . LYS A 1 8  ? -0.254 5.841   -0.643  1.00 0.00 ? 8  LYS A HB2  7  
ATOM   4901  H  HB3  . LYS A 1 8  ? -1.562 6.914   -1.168  1.00 0.00 ? 8  LYS A HB3  7  
ATOM   4902  H  HG2  . LYS A 1 8  ? -1.674 3.878   -1.144  1.00 0.00 ? 8  LYS A HG2  7  
ATOM   4903  H  HG3  . LYS A 1 8  ? -2.342 4.944   0.081   1.00 0.00 ? 8  LYS A HG3  7  
ATOM   4904  H  HD2  . LYS A 1 8  ? -3.902 5.952   -1.464  1.00 0.00 ? 8  LYS A HD2  7  
ATOM   4905  H  HD3  . LYS A 1 8  ? -3.246 5.052   -2.832  1.00 0.00 ? 8  LYS A HD3  7  
ATOM   4906  H  HE2  . LYS A 1 8  ? -4.590 3.809   -0.391  1.00 0.00 ? 8  LYS A HE2  7  
ATOM   4907  H  HE3  . LYS A 1 8  ? -5.339 4.055   -1.978  1.00 0.00 ? 8  LYS A HE3  7  
ATOM   4908  H  HZ1  . LYS A 1 8  ? -4.565 1.846   -1.796  1.00 0.00 ? 8  LYS A HZ1  7  
ATOM   4909  H  HZ2  . LYS A 1 8  ? -3.626 2.629   -2.908  1.00 0.00 ? 8  LYS A HZ2  7  
ATOM   4910  H  HZ3  . LYS A 1 8  ? -3.039 2.326   -1.403  1.00 0.00 ? 8  LYS A HZ3  7  
ATOM   4911  N  N    . LYS A 1 9  ? 0.055  8.272   -2.964  1.00 0.00 ? 9  LYS A N    7  
ATOM   4912  C  CA   . LYS A 1 9  ? 0.908  9.444   -2.856  1.00 0.00 ? 9  LYS A CA   7  
ATOM   4913  C  C    . LYS A 1 9  ? 1.248  9.631   -1.375  1.00 0.00 ? 9  LYS A C    7  
ATOM   4914  O  O    . LYS A 1 9  ? 0.557  10.358  -0.665  1.00 0.00 ? 9  LYS A O    7  
ATOM   4915  C  CB   . LYS A 1 9  ? 0.188  10.662  -3.455  1.00 0.00 ? 9  LYS A CB   7  
ATOM   4916  C  CG   . LYS A 1 9  ? 1.127  11.874  -3.541  1.00 0.00 ? 9  LYS A CG   7  
ATOM   4917  C  CD   . LYS A 1 9  ? 0.387  13.168  -3.903  1.00 0.00 ? 9  LYS A CD   7  
ATOM   4918  C  CE   . LYS A 1 9  ? -0.306 13.090  -5.268  1.00 0.00 ? 9  LYS A CE   7  
ATOM   4919  N  NZ   . LYS A 1 9  ? -0.888 14.389  -5.649  1.00 0.00 ? 9  LYS A NZ   7  
ATOM   4920  H  H    . LYS A 1 9  ? -0.944 8.421   -2.972  1.00 0.00 ? 9  LYS A H    7  
ATOM   4921  H  HA   . LYS A 1 9  ? 1.827  9.284   -3.423  1.00 0.00 ? 9  LYS A HA   7  
ATOM   4922  H  HB2  . LYS A 1 9  ? -0.142 10.403  -4.463  1.00 0.00 ? 9  LYS A HB2  7  
ATOM   4923  H  HB3  . LYS A 1 9  ? -0.685 10.910  -2.848  1.00 0.00 ? 9  LYS A HB3  7  
ATOM   4924  H  HG2  . LYS A 1 9  ? 1.614  12.032  -2.577  1.00 0.00 ? 9  LYS A HG2  7  
ATOM   4925  H  HG3  . LYS A 1 9  ? 1.900  11.678  -4.285  1.00 0.00 ? 9  LYS A HG3  7  
ATOM   4926  H  HD2  . LYS A 1 9  ? -0.351 13.385  -3.130  1.00 0.00 ? 9  LYS A HD2  7  
ATOM   4927  H  HD3  . LYS A 1 9  ? 1.119  13.977  -3.920  1.00 0.00 ? 9  LYS A HD3  7  
ATOM   4928  H  HE2  . LYS A 1 9  ? 0.416  12.791  -6.028  1.00 0.00 ? 9  LYS A HE2  7  
ATOM   4929  H  HE3  . LYS A 1 9  ? -1.111 12.354  -5.233  1.00 0.00 ? 9  LYS A HE3  7  
ATOM   4930  H  HZ1  . LYS A 1 9  ? -0.156 15.081  -5.725  1.00 0.00 ? 9  LYS A HZ1  7  
ATOM   4931  H  HZ2  . LYS A 1 9  ? -1.360 14.302  -6.539  1.00 0.00 ? 9  LYS A HZ2  7  
ATOM   4932  H  HZ3  . LYS A 1 9  ? -1.554 14.682  -4.947  1.00 0.00 ? 9  LYS A HZ3  7  
ATOM   4933  N  N    . GLY A 1 10 ? 2.292  8.935   -0.909  1.00 0.00 ? 10 GLY A N    7  
ATOM   4934  C  CA   . GLY A 1 10 ? 2.768  9.014   0.464   1.00 0.00 ? 10 GLY A CA   7  
ATOM   4935  C  C    . GLY A 1 10 ? 3.592  10.282  0.677   1.00 0.00 ? 10 GLY A C    7  
ATOM   4936  O  O    . GLY A 1 10 ? 3.186  11.369  0.263   1.00 0.00 ? 10 GLY A O    7  
ATOM   4937  H  H    . GLY A 1 10 ? 2.809  8.353   -1.554  1.00 0.00 ? 10 GLY A H    7  
ATOM   4938  H  HA2  . GLY A 1 10 ? 1.924  9.013   1.156   1.00 0.00 ? 10 GLY A HA2  7  
ATOM   4939  H  HA3  . GLY A 1 10 ? 3.384  8.134   0.660   1.00 0.00 ? 10 GLY A HA3  7  
ATOM   4940  N  N    . GLU A 1 11 ? 4.756  10.143  1.319   1.00 0.00 ? 11 GLU A N    7  
ATOM   4941  C  CA   . GLU A 1 11 ? 5.629  11.259  1.645   1.00 0.00 ? 11 GLU A CA   7  
ATOM   4942  C  C    . GLU A 1 11 ? 6.457  11.610  0.410   1.00 0.00 ? 11 GLU A C    7  
ATOM   4943  O  O    . GLU A 1 11 ? 7.660  11.352  0.380   1.00 0.00 ? 11 GLU A O    7  
ATOM   4944  C  CB   . GLU A 1 11 ? 6.533  10.915  2.839   1.00 0.00 ? 11 GLU A CB   7  
ATOM   4945  C  CG   . GLU A 1 11 ? 5.776  10.575  4.132   1.00 0.00 ? 11 GLU A CG   7  
ATOM   4946  C  CD   . GLU A 1 11 ? 5.064  9.220   4.106   1.00 0.00 ? 11 GLU A CD   7  
ATOM   4947  O  OE1  . GLU A 1 11 ? 5.542  8.325   3.375   1.00 0.00 ? 11 GLU A OE1  7  
ATOM   4948  O  OE2  . GLU A 1 11 ? 4.043  9.106   4.819   1.00 0.00 ? 11 GLU A OE2  7  
ATOM   4949  H  H    . GLU A 1 11 ? 5.025  9.230   1.665   1.00 0.00 ? 11 GLU A H    7  
ATOM   4950  H  HA   . GLU A 1 11 ? 5.034  12.126  1.929   1.00 0.00 ? 11 GLU A HA   7  
ATOM   4951  H  HB2  . GLU A 1 11 ? 7.189  10.089  2.570   1.00 0.00 ? 11 GLU A HB2  7  
ATOM   4952  H  HB3  . GLU A 1 11 ? 7.150  11.792  3.047   1.00 0.00 ? 11 GLU A HB3  7  
ATOM   4953  H  HG2  . GLU A 1 11 ? 6.499  10.550  4.948   1.00 0.00 ? 11 GLU A HG2  7  
ATOM   4954  H  HG3  . GLU A 1 11 ? 5.051  11.363  4.338   1.00 0.00 ? 11 GLU A HG3  7  
ATOM   4955  N  N    . ASP A 1 12 ? 5.808  12.195  -0.605  1.00 0.00 ? 12 ASP A N    7  
ATOM   4956  C  CA   . ASP A 1 12 ? 6.405  12.504  -1.898  1.00 0.00 ? 12 ASP A CA   7  
ATOM   4957  C  C    . ASP A 1 12 ? 7.279  13.756  -1.779  1.00 0.00 ? 12 ASP A C    7  
ATOM   4958  O  O    . ASP A 1 12 ? 6.960  14.814  -2.318  1.00 0.00 ? 12 ASP A O    7  
ATOM   4959  C  CB   . ASP A 1 12 ? 5.314  12.638  -2.972  1.00 0.00 ? 12 ASP A CB   7  
ATOM   4960  C  CG   . ASP A 1 12 ? 4.723  11.292  -3.395  1.00 0.00 ? 12 ASP A CG   7  
ATOM   4961  O  OD1  . ASP A 1 12 ? 4.433  10.469  -2.501  1.00 0.00 ? 12 ASP A OD1  7  
ATOM   4962  O  OD2  . ASP A 1 12 ? 4.578  11.102  -4.623  1.00 0.00 ? 12 ASP A OD2  7  
ATOM   4963  H  H    . ASP A 1 12 ? 4.809  12.323  -0.512  1.00 0.00 ? 12 ASP A H    7  
ATOM   4964  H  HA   . ASP A 1 12 ? 7.052  11.680  -2.192  1.00 0.00 ? 12 ASP A HA   7  
ATOM   4965  H  HB2  . ASP A 1 12 ? 4.517  13.283  -2.602  1.00 0.00 ? 12 ASP A HB2  7  
ATOM   4966  H  HB3  . ASP A 1 12 ? 5.755  13.096  -3.860  1.00 0.00 ? 12 ASP A HB3  7  
ATOM   4967  N  N    . ASP A 1 13 ? 8.395  13.599  -1.063  1.00 0.00 ? 13 ASP A N    7  
ATOM   4968  C  CA   . ASP A 1 13 ? 9.421  14.594  -0.810  1.00 0.00 ? 13 ASP A CA   7  
ATOM   4969  C  C    . ASP A 1 13 ? 10.581 14.341  -1.771  1.00 0.00 ? 13 ASP A C    7  
ATOM   4970  O  O    . ASP A 1 13 ? 10.978 15.221  -2.532  1.00 0.00 ? 13 ASP A O    7  
ATOM   4971  C  CB   . ASP A 1 13 ? 9.860  14.455  0.655   1.00 0.00 ? 13 ASP A CB   7  
ATOM   4972  C  CG   . ASP A 1 13 ? 10.989 15.407  1.046   1.00 0.00 ? 13 ASP A CG   7  
ATOM   4973  O  OD1  . ASP A 1 13 ? 10.964 16.563  0.572   1.00 0.00 ? 13 ASP A OD1  7  
ATOM   4974  O  OD2  . ASP A 1 13 ? 11.868 14.956  1.812   1.00 0.00 ? 13 ASP A OD2  7  
ATOM   4975  H  H    . ASP A 1 13 ? 8.543  12.691  -0.643  1.00 0.00 ? 13 ASP A H    7  
ATOM   4976  H  HA   . ASP A 1 13 ? 9.027  15.594  -0.967  1.00 0.00 ? 13 ASP A HA   7  
ATOM   4977  H  HB2  . ASP A 1 13 ? 9.004  14.623  1.311   1.00 0.00 ? 13 ASP A HB2  7  
ATOM   4978  H  HB3  . ASP A 1 13 ? 10.208 13.437  0.815   1.00 0.00 ? 13 ASP A HB3  7  
ATOM   4979  N  N    . LYS A 1 14 ? 11.109 13.114  -1.718  1.00 0.00 ? 14 LYS A N    7  
ATOM   4980  C  CA   . LYS A 1 14 ? 12.336 12.688  -2.366  1.00 0.00 ? 14 LYS A CA   7  
ATOM   4981  C  C    . LYS A 1 14 ? 12.133 11.249  -2.839  1.00 0.00 ? 14 LYS A C    7  
ATOM   4982  O  O    . LYS A 1 14 ? 12.488 10.300  -2.139  1.00 0.00 ? 14 LYS A O    7  
ATOM   4983  C  CB   . LYS A 1 14 ? 13.499 12.781  -1.375  1.00 0.00 ? 14 LYS A CB   7  
ATOM   4984  C  CG   . LYS A 1 14 ? 13.879 14.223  -1.020  1.00 0.00 ? 14 LYS A CG   7  
ATOM   4985  C  CD   . LYS A 1 14 ? 14.880 14.209  0.136   1.00 0.00 ? 14 LYS A CD   7  
ATOM   4986  C  CE   . LYS A 1 14 ? 15.203 15.629  0.612   1.00 0.00 ? 14 LYS A CE   7  
ATOM   4987  N  NZ   . LYS A 1 14 ? 15.961 15.614  1.876   1.00 0.00 ? 14 LYS A NZ   7  
ATOM   4988  H  H    . LYS A 1 14 ? 10.664 12.451  -1.101  1.00 0.00 ? 14 LYS A H    7  
ATOM   4989  H  HA   . LYS A 1 14 ? 12.564 13.314  -3.229  1.00 0.00 ? 14 LYS A HA   7  
ATOM   4990  H  HB2  . LYS A 1 14 ? 13.210 12.252  -0.465  1.00 0.00 ? 14 LYS A HB2  7  
ATOM   4991  H  HB3  . LYS A 1 14 ? 14.373 12.298  -1.815  1.00 0.00 ? 14 LYS A HB3  7  
ATOM   4992  H  HG2  . LYS A 1 14 ? 14.311 14.718  -1.890  1.00 0.00 ? 14 LYS A HG2  7  
ATOM   4993  H  HG3  . LYS A 1 14 ? 12.999 14.776  -0.701  1.00 0.00 ? 14 LYS A HG3  7  
ATOM   4994  H  HD2  . LYS A 1 14 ? 14.441 13.654  0.967   1.00 0.00 ? 14 LYS A HD2  7  
ATOM   4995  H  HD3  . LYS A 1 14 ? 15.792 13.707  -0.187  1.00 0.00 ? 14 LYS A HD3  7  
ATOM   4996  H  HE2  . LYS A 1 14 ? 15.779 16.150  -0.153  1.00 0.00 ? 14 LYS A HE2  7  
ATOM   4997  H  HE3  . LYS A 1 14 ? 14.272 16.170  0.786   1.00 0.00 ? 14 LYS A HE3  7  
ATOM   4998  H  HZ1  . LYS A 1 14 ? 15.431 15.121  2.581   1.00 0.00 ? 14 LYS A HZ1  7  
ATOM   4999  H  HZ2  . LYS A 1 14 ? 16.855 15.149  1.763   1.00 0.00 ? 14 LYS A HZ2  7  
ATOM   5000  H  HZ3  . LYS A 1 14 ? 16.131 16.558  2.187   1.00 0.00 ? 14 LYS A HZ3  7  
ATOM   5001  N  N    . LEU A 1 15 ? 11.542 11.094  -4.028  1.00 0.00 ? 15 LEU A N    7  
ATOM   5002  C  CA   . LEU A 1 15 ? 11.415 9.799   -4.678  1.00 0.00 ? 15 LEU A CA   7  
ATOM   5003  C  C    . LEU A 1 15 ? 12.763 9.330   -5.231  1.00 0.00 ? 15 LEU A C    7  
ATOM   5004  O  O    . LEU A 1 15 ? 13.707 10.107  -5.369  1.00 0.00 ? 15 LEU A O    7  
ATOM   5005  C  CB   . LEU A 1 15 ? 10.349 9.831   -5.786  1.00 0.00 ? 15 LEU A CB   7  
ATOM   5006  C  CG   . LEU A 1 15 ? 8.910  9.761   -5.245  1.00 0.00 ? 15 LEU A CG   7  
ATOM   5007  C  CD1  . LEU A 1 15 ? 8.454  11.089  -4.634  1.00 0.00 ? 15 LEU A CD1  7  
ATOM   5008  C  CD2  . LEU A 1 15 ? 7.953  9.378   -6.379  1.00 0.00 ? 15 LEU A CD2  7  
ATOM   5009  H  H    . LEU A 1 15 ? 11.234 11.913  -4.531  1.00 0.00 ? 15 LEU A H    7  
ATOM   5010  H  HA   . LEU A 1 15 ? 11.097 9.076   -3.928  1.00 0.00 ? 15 LEU A HA   7  
ATOM   5011  H  HB2  . LEU A 1 15 ? 10.479 10.717  -6.412  1.00 0.00 ? 15 LEU A HB2  7  
ATOM   5012  H  HB3  . LEU A 1 15 ? 10.492 8.947   -6.411  1.00 0.00 ? 15 LEU A HB3  7  
ATOM   5013  H  HG   . LEU A 1 15 ? 8.845  8.979   -4.486  1.00 0.00 ? 15 LEU A HG   7  
ATOM   5014  H  HD11 . LEU A 1 15 ? 8.625  11.908  -5.333  1.00 0.00 ? 15 LEU A HD11 7  
ATOM   5015  H  HD12 . LEU A 1 15 ? 7.390  11.031  -4.415  1.00 0.00 ? 15 LEU A HD12 7  
ATOM   5016  H  HD13 . LEU A 1 15 ? 8.986  11.287  -3.705  1.00 0.00 ? 15 LEU A HD13 7  
ATOM   5017  H  HD21 . LEU A 1 15 ? 6.948  9.250   -5.976  1.00 0.00 ? 15 LEU A HD21 7  
ATOM   5018  H  HD22 . LEU A 1 15 ? 7.945  10.158  -7.142  1.00 0.00 ? 15 LEU A HD22 7  
ATOM   5019  H  HD23 . LEU A 1 15 ? 8.264  8.437   -6.832  1.00 0.00 ? 15 LEU A HD23 7  
ATOM   5020  N  N    . ILE A 1 16 ? 12.825 8.035   -5.543  1.00 0.00 ? 16 ILE A N    7  
ATOM   5021  C  CA   . ILE A 1 16 ? 14.019 7.311   -5.935  1.00 0.00 ? 16 ILE A CA   7  
ATOM   5022  C  C    . ILE A 1 16 ? 13.553 6.080   -6.715  1.00 0.00 ? 16 ILE A C    7  
ATOM   5023  O  O    . ILE A 1 16 ? 12.939 5.176   -6.152  1.00 0.00 ? 16 ILE A O    7  
ATOM   5024  C  CB   . ILE A 1 16 ? 14.889 6.981   -4.702  1.00 0.00 ? 16 ILE A CB   7  
ATOM   5025  C  CG1  . ILE A 1 16 ? 15.983 5.964   -5.077  1.00 0.00 ? 16 ILE A CG1  7  
ATOM   5026  C  CG2  . ILE A 1 16 ? 14.055 6.508   -3.501  1.00 0.00 ? 16 ILE A CG2  7  
ATOM   5027  C  CD1  . ILE A 1 16 ? 17.085 5.853   -4.017  1.00 0.00 ? 16 ILE A CD1  7  
ATOM   5028  H  H    . ILE A 1 16 ? 11.998 7.474   -5.384  1.00 0.00 ? 16 ILE A H    7  
ATOM   5029  H  HA   . ILE A 1 16 ? 14.613 7.939   -6.603  1.00 0.00 ? 16 ILE A HA   7  
ATOM   5030  H  HB   . ILE A 1 16 ? 15.382 7.907   -4.401  1.00 0.00 ? 16 ILE A HB   7  
ATOM   5031  H  HG12 . ILE A 1 16 ? 15.545 4.975   -5.225  1.00 0.00 ? 16 ILE A HG12 7  
ATOM   5032  H  HG13 . ILE A 1 16 ? 16.454 6.290   -6.007  1.00 0.00 ? 16 ILE A HG13 7  
ATOM   5033  H  HG21 . ILE A 1 16 ? 13.382 7.298   -3.171  1.00 0.00 ? 16 ILE A HG21 7  
ATOM   5034  H  HG22 . ILE A 1 16 ? 13.468 5.631   -3.762  1.00 0.00 ? 16 ILE A HG22 7  
ATOM   5035  H  HG23 . ILE A 1 16 ? 14.703 6.264   -2.663  1.00 0.00 ? 16 ILE A HG23 7  
ATOM   5036  H  HD11 . ILE A 1 16 ? 16.707 5.374   -3.115  1.00 0.00 ? 16 ILE A HD11 7  
ATOM   5037  H  HD12 . ILE A 1 16 ? 17.903 5.250   -4.410  1.00 0.00 ? 16 ILE A HD12 7  
ATOM   5038  H  HD13 . ILE A 1 16 ? 17.469 6.841   -3.774  1.00 0.00 ? 16 ILE A HD13 7  
ATOM   5039  N  N    . LEU A 1 17 ? 13.794 6.079   -8.030  1.00 0.00 ? 17 LEU A N    7  
ATOM   5040  C  CA   . LEU A 1 17 ? 13.331 5.037   -8.932  1.00 0.00 ? 17 LEU A CA   7  
ATOM   5041  C  C    . LEU A 1 17 ? 14.417 3.972   -9.073  1.00 0.00 ? 17 LEU A C    7  
ATOM   5042  O  O    . LEU A 1 17 ? 15.603 4.292   -9.143  1.00 0.00 ? 17 LEU A O    7  
ATOM   5043  C  CB   . LEU A 1 17 ? 12.990 5.641   -10.303 1.00 0.00 ? 17 LEU A CB   7  
ATOM   5044  C  CG   . LEU A 1 17 ? 11.571 6.234   -10.387 1.00 0.00 ? 17 LEU A CG   7  
ATOM   5045  C  CD1  . LEU A 1 17 ? 11.326 7.358   -9.372  1.00 0.00 ? 17 LEU A CD1  7  
ATOM   5046  C  CD2  . LEU A 1 17 ? 11.338 6.769   -11.803 1.00 0.00 ? 17 LEU A CD2  7  
ATOM   5047  H  H    . LEU A 1 17 ? 14.324 6.835   -8.437  1.00 0.00 ? 17 LEU A H    7  
ATOM   5048  H  HA   . LEU A 1 17 ? 12.430 4.571   -8.535  1.00 0.00 ? 17 LEU A HA   7  
ATOM   5049  H  HB2  . LEU A 1 17 ? 13.729 6.401   -10.564 1.00 0.00 ? 17 LEU A HB2  7  
ATOM   5050  H  HB3  . LEU A 1 17 ? 13.044 4.841   -11.044 1.00 0.00 ? 17 LEU A HB3  7  
ATOM   5051  H  HG   . LEU A 1 17 ? 10.846 5.438   -10.209 1.00 0.00 ? 17 LEU A HG   7  
ATOM   5052  H  HD11 . LEU A 1 17 ? 10.354 7.816   -9.561  1.00 0.00 ? 17 LEU A HD11 7  
ATOM   5053  H  HD12 . LEU A 1 17 ? 11.317 6.959   -8.358  1.00 0.00 ? 17 LEU A HD12 7  
ATOM   5054  H  HD13 . LEU A 1 17 ? 12.101 8.119   -9.459  1.00 0.00 ? 17 LEU A HD13 7  
ATOM   5055  H  HD21 . LEU A 1 17 ? 11.471 5.967   -12.530 1.00 0.00 ? 17 LEU A HD21 7  
ATOM   5056  H  HD22 . LEU A 1 17 ? 10.322 7.155   -11.892 1.00 0.00 ? 17 LEU A HD22 7  
ATOM   5057  H  HD23 . LEU A 1 17 ? 12.044 7.571   -12.022 1.00 0.00 ? 17 LEU A HD23 7  
ATOM   5058  N  N    . CYS A 1 18 ? 13.999 2.702   -9.110  1.00 0.00 ? 18 CYS A N    7  
ATOM   5059  C  CA   . CYS A 1 18 ? 14.862 1.590   -9.465  1.00 0.00 ? 18 CYS A CA   7  
ATOM   5060  C  C    . CYS A 1 18 ? 15.164 1.670   -10.958 1.00 0.00 ? 18 CYS A C    7  
ATOM   5061  O  O    . CYS A 1 18 ? 14.289 1.380   -11.770 1.00 0.00 ? 18 CYS A O    7  
ATOM   5062  C  CB   . CYS A 1 18 ? 14.173 0.271   -9.105  1.00 0.00 ? 18 CYS A CB   7  
ATOM   5063  S  SG   . CYS A 1 18 ? 14.936 -1.191  -9.845  1.00 0.00 ? 18 CYS A SG   7  
ATOM   5064  H  H    . CYS A 1 18 ? 13.015 2.512   -8.988  1.00 0.00 ? 18 CYS A H    7  
ATOM   5065  H  HA   . CYS A 1 18 ? 15.794 1.638   -8.905  1.00 0.00 ? 18 CYS A HA   7  
ATOM   5066  H  HB2  . CYS A 1 18 ? 14.194 0.164   -8.022  1.00 0.00 ? 18 CYS A HB2  7  
ATOM   5067  H  HB3  . CYS A 1 18 ? 13.132 0.289   -9.430  1.00 0.00 ? 18 CYS A HB3  7  
ATOM   5068  N  N    . ASP A 1 19 ? 16.387 2.067   -11.323 1.00 0.00 ? 19 ASP A N    7  
ATOM   5069  C  CA   . ASP A 1 19 ? 16.730 2.344   -12.714 1.00 0.00 ? 19 ASP A CA   7  
ATOM   5070  C  C    . ASP A 1 19 ? 16.680 1.084   -13.588 1.00 0.00 ? 19 ASP A C    7  
ATOM   5071  O  O    . ASP A 1 19 ? 16.429 1.189   -14.787 1.00 0.00 ? 19 ASP A O    7  
ATOM   5072  C  CB   . ASP A 1 19 ? 18.068 3.092   -12.811 1.00 0.00 ? 19 ASP A CB   7  
ATOM   5073  C  CG   . ASP A 1 19 ? 19.245 2.352   -12.179 1.00 0.00 ? 19 ASP A CG   7  
ATOM   5074  O  OD1  . ASP A 1 19 ? 19.574 1.257   -12.682 1.00 0.00 ? 19 ASP A OD1  7  
ATOM   5075  O  OD2  . ASP A 1 19 ? 19.809 2.912   -11.213 1.00 0.00 ? 19 ASP A OD2  7  
ATOM   5076  H  H    . ASP A 1 19 ? 17.092 2.227   -10.615 1.00 0.00 ? 19 ASP A H    7  
ATOM   5077  H  HA   . ASP A 1 19 ? 15.972 3.024   -13.104 1.00 0.00 ? 19 ASP A HA   7  
ATOM   5078  H  HB2  . ASP A 1 19 ? 18.297 3.272   -13.862 1.00 0.00 ? 19 ASP A HB2  7  
ATOM   5079  H  HB3  . ASP A 1 19 ? 17.959 4.058   -12.317 1.00 0.00 ? 19 ASP A HB3  7  
ATOM   5080  N  N    . GLU A 1 20 ? 16.866 -0.101  -12.989 1.00 0.00 ? 20 GLU A N    7  
ATOM   5081  C  CA   . GLU A 1 20 ? 16.841 -1.376  -13.686 1.00 0.00 ? 20 GLU A CA   7  
ATOM   5082  C  C    . GLU A 1 20 ? 15.432 -1.686  -14.203 1.00 0.00 ? 20 GLU A C    7  
ATOM   5083  O  O    . GLU A 1 20 ? 15.207 -1.653  -15.412 1.00 0.00 ? 20 GLU A O    7  
ATOM   5084  C  CB   . GLU A 1 20 ? 17.371 -2.477  -12.759 1.00 0.00 ? 20 GLU A CB   7  
ATOM   5085  C  CG   . GLU A 1 20 ? 18.854 -2.255  -12.422 1.00 0.00 ? 20 GLU A CG   7  
ATOM   5086  C  CD   . GLU A 1 20 ? 19.429 -3.332  -11.506 1.00 0.00 ? 20 GLU A CD   7  
ATOM   5087  O  OE1  . GLU A 1 20 ? 18.742 -4.357  -11.305 1.00 0.00 ? 20 GLU A OE1  7  
ATOM   5088  O  OE2  . GLU A 1 20 ? 20.555 -3.106  -11.011 1.00 0.00 ? 20 GLU A OE2  7  
ATOM   5089  H  H    . GLU A 1 20 ? 17.124 -0.116  -12.014 1.00 0.00 ? 20 GLU A H    7  
ATOM   5090  H  HA   . GLU A 1 20 ? 17.510 -1.312  -14.546 1.00 0.00 ? 20 GLU A HA   7  
ATOM   5091  H  HB2  . GLU A 1 20 ? 16.795 -2.504  -11.833 1.00 0.00 ? 20 GLU A HB2  7  
ATOM   5092  H  HB3  . GLU A 1 20 ? 17.268 -3.433  -13.271 1.00 0.00 ? 20 GLU A HB3  7  
ATOM   5093  H  HG2  . GLU A 1 20 ? 19.434 -2.246  -13.345 1.00 0.00 ? 20 GLU A HG2  7  
ATOM   5094  H  HG3  . GLU A 1 20 ? 18.978 -1.292  -11.927 1.00 0.00 ? 20 GLU A HG3  7  
ATOM   5095  N  N    . CYS A 1 21 ? 14.493 -2.001  -13.298 1.00 0.00 ? 21 CYS A N    7  
ATOM   5096  C  CA   . CYS A 1 21 ? 13.164 -2.504  -13.647 1.00 0.00 ? 21 CYS A CA   7  
ATOM   5097  C  C    . CYS A 1 21 ? 12.059 -1.457  -13.448 1.00 0.00 ? 21 CYS A C    7  
ATOM   5098  O  O    . CYS A 1 21 ? 10.882 -1.802  -13.547 1.00 0.00 ? 21 CYS A O    7  
ATOM   5099  C  CB   . CYS A 1 21 ? 12.867 -3.818  -12.906 1.00 0.00 ? 21 CYS A CB   7  
ATOM   5100  S  SG   . CYS A 1 21 ? 12.646 -3.732  -11.107 1.00 0.00 ? 21 CYS A SG   7  
ATOM   5101  H  H    . CYS A 1 21 ? 14.730 -1.932  -12.322 1.00 0.00 ? 21 CYS A H    7  
ATOM   5102  H  HA   . CYS A 1 21 ? 13.146 -2.760  -14.707 1.00 0.00 ? 21 CYS A HA   7  
ATOM   5103  H  HB2  . CYS A 1 21 ? 11.947 -4.237  -13.320 1.00 0.00 ? 21 CYS A HB2  7  
ATOM   5104  H  HB3  . CYS A 1 21 ? 13.679 -4.520  -13.107 1.00 0.00 ? 21 CYS A HB3  7  
ATOM   5105  N  N    . ASN A 1 22 ? 12.420 -0.193  -13.186 1.00 0.00 ? 22 ASN A N    7  
ATOM   5106  C  CA   . ASN A 1 22 ? 11.520 0.958   -13.188 1.00 0.00 ? 22 ASN A CA   7  
ATOM   5107  C  C    . ASN A 1 22 ? 10.376 0.787   -12.185 1.00 0.00 ? 22 ASN A C    7  
ATOM   5108  O  O    . ASN A 1 22 ? 9.236  0.524   -12.567 1.00 0.00 ? 22 ASN A O    7  
ATOM   5109  C  CB   . ASN A 1 22 ? 11.038 1.257   -14.615 1.00 0.00 ? 22 ASN A CB   7  
ATOM   5110  C  CG   . ASN A 1 22 ? 10.301 2.594   -14.722 1.00 0.00 ? 22 ASN A CG   7  
ATOM   5111  O  OD1  . ASN A 1 22 ? 10.285 3.390   -13.786 1.00 0.00 ? 22 ASN A OD1  7  
ATOM   5112  N  ND2  . ASN A 1 22 ? 9.695  2.850   -15.882 1.00 0.00 ? 22 ASN A ND2  7  
ATOM   5113  H  H    . ASN A 1 22 ? 13.389 0.008   -12.981 1.00 0.00 ? 22 ASN A H    7  
ATOM   5114  H  HA   . ASN A 1 22 ? 12.105 1.820   -12.876 1.00 0.00 ? 22 ASN A HA   7  
ATOM   5115  H  HB2  . ASN A 1 22 ? 11.908 1.300   -15.274 1.00 0.00 ? 22 ASN A HB2  7  
ATOM   5116  H  HB3  . ASN A 1 22 ? 10.379 0.456   -14.954 1.00 0.00 ? 22 ASN A HB3  7  
ATOM   5117  H  HD21 . ASN A 1 22 ? 9.728  2.169   -16.629 1.00 0.00 ? 22 ASN A HD21 7  
ATOM   5118  H  HD22 . ASN A 1 22 ? 9.216  3.733   -16.006 1.00 0.00 ? 22 ASN A HD22 7  
ATOM   5119  N  N    . LYS A 1 23 ? 10.696 0.941   -10.895 1.00 0.00 ? 23 LYS A N    7  
ATOM   5120  C  CA   . LYS A 1 23 ? 9.759  0.927   -9.792  1.00 0.00 ? 23 LYS A CA   7  
ATOM   5121  C  C    . LYS A 1 23 ? 10.053 2.133   -8.902  1.00 0.00 ? 23 LYS A C    7  
ATOM   5122  O  O    . LYS A 1 23 ? 11.180 2.289   -8.438  1.00 0.00 ? 23 LYS A O    7  
ATOM   5123  C  CB   . LYS A 1 23 ? 9.954  -0.379  -9.015  1.00 0.00 ? 23 LYS A CB   7  
ATOM   5124  C  CG   . LYS A 1 23 ? 9.645  -1.641  -9.836  1.00 0.00 ? 23 LYS A CG   7  
ATOM   5125  C  CD   . LYS A 1 23 ? 8.148  -1.796  -10.145 1.00 0.00 ? 23 LYS A CD   7  
ATOM   5126  C  CE   . LYS A 1 23 ? 7.903  -2.857  -11.224 1.00 0.00 ? 23 LYS A CE   7  
ATOM   5127  N  NZ   . LYS A 1 23 ? 8.318  -2.387  -12.560 1.00 0.00 ? 23 LYS A NZ   7  
ATOM   5128  H  H    . LYS A 1 23 ? 11.659 1.043   -10.624 1.00 0.00 ? 23 LYS A H    7  
ATOM   5129  H  HA   . LYS A 1 23 ? 8.734  1.012   -10.152 1.00 0.00 ? 23 LYS A HA   7  
ATOM   5130  H  HB2  . LYS A 1 23 ? 10.993 -0.441  -8.683  1.00 0.00 ? 23 LYS A HB2  7  
ATOM   5131  H  HB3  . LYS A 1 23 ? 9.317  -0.338  -8.140  1.00 0.00 ? 23 LYS A HB3  7  
ATOM   5132  H  HG2  . LYS A 1 23 ? 10.227 -1.623  -10.755 1.00 0.00 ? 23 LYS A HG2  7  
ATOM   5133  H  HG3  . LYS A 1 23 ? 9.964  -2.511  -9.260  1.00 0.00 ? 23 LYS A HG3  7  
ATOM   5134  H  HD2  . LYS A 1 23 ? 7.636  -2.093  -9.228  1.00 0.00 ? 23 LYS A HD2  7  
ATOM   5135  H  HD3  . LYS A 1 23 ? 7.713  -0.861  -10.489 1.00 0.00 ? 23 LYS A HD3  7  
ATOM   5136  H  HE2  . LYS A 1 23 ? 8.436  -3.775  -10.973 1.00 0.00 ? 23 LYS A HE2  7  
ATOM   5137  H  HE3  . LYS A 1 23 ? 6.834  -3.072  -11.260 1.00 0.00 ? 23 LYS A HE3  7  
ATOM   5138  H  HZ1  . LYS A 1 23 ? 7.851  -1.518  -12.778 1.00 0.00 ? 23 LYS A HZ1  7  
ATOM   5139  H  HZ2  . LYS A 1 23 ? 9.318  -2.225  -12.589 1.00 0.00 ? 23 LYS A HZ2  7  
ATOM   5140  H  HZ3  . LYS A 1 23 ? 8.081  -3.079  -13.255 1.00 0.00 ? 23 LYS A HZ3  7  
ATOM   5141  N  N    . ALA A 1 24 ? 9.047  2.986   -8.677  1.00 0.00 ? 24 ALA A N    7  
ATOM   5142  C  CA   . ALA A 1 24 ? 9.168  4.162   -7.829  1.00 0.00 ? 24 ALA A CA   7  
ATOM   5143  C  C    . ALA A 1 24 ? 9.176  3.757   -6.357  1.00 0.00 ? 24 ALA A C    7  
ATOM   5144  O  O    . ALA A 1 24 ? 8.414  2.882   -5.949  1.00 0.00 ? 24 ALA A O    7  
ATOM   5145  C  CB   . ALA A 1 24 ? 8.021  5.132   -8.121  1.00 0.00 ? 24 ALA A CB   7  
ATOM   5146  H  H    . ALA A 1 24 ? 8.141  2.794   -9.080  1.00 0.00 ? 24 ALA A H    7  
ATOM   5147  H  HA   . ALA A 1 24 ? 10.101 4.673   -8.065  1.00 0.00 ? 24 ALA A HA   7  
ATOM   5148  H  HB1  . ALA A 1 24 ? 8.042  5.423   -9.172  1.00 0.00 ? 24 ALA A HB1  7  
ATOM   5149  H  HB2  . ALA A 1 24 ? 7.064  4.660   -7.896  1.00 0.00 ? 24 ALA A HB2  7  
ATOM   5150  H  HB3  . ALA A 1 24 ? 8.134  6.025   -7.506  1.00 0.00 ? 24 ALA A HB3  7  
ATOM   5151  N  N    . PHE A 1 25 ? 10.040 4.402   -5.566  1.00 0.00 ? 25 PHE A N    7  
ATOM   5152  C  CA   . PHE A 1 25 ? 10.083 4.279   -4.118  1.00 0.00 ? 25 PHE A CA   7  
ATOM   5153  C  C    . PHE A 1 25 ? 10.381 5.640   -3.492  1.00 0.00 ? 25 PHE A C    7  
ATOM   5154  O  O    . PHE A 1 25 ? 10.774 6.572   -4.190  1.00 0.00 ? 25 PHE A O    7  
ATOM   5155  C  CB   . PHE A 1 25 ? 11.196 3.302   -3.721  1.00 0.00 ? 25 PHE A CB   7  
ATOM   5156  C  CG   . PHE A 1 25 ? 10.851 1.829   -3.805  1.00 0.00 ? 25 PHE A CG   7  
ATOM   5157  C  CD1  . PHE A 1 25 ? 10.992 1.142   -5.025  1.00 0.00 ? 25 PHE A CD1  7  
ATOM   5158  C  CD2  . PHE A 1 25 ? 10.557 1.111   -2.630  1.00 0.00 ? 25 PHE A CD2  7  
ATOM   5159  C  CE1  . PHE A 1 25 ? 10.817 -0.251  -5.075  1.00 0.00 ? 25 PHE A CE1  7  
ATOM   5160  C  CE2  . PHE A 1 25 ? 10.463 -0.292  -2.668  1.00 0.00 ? 25 PHE A CE2  7  
ATOM   5161  C  CZ   . PHE A 1 25 ? 10.582 -0.972  -3.893  1.00 0.00 ? 25 PHE A CZ   7  
ATOM   5162  H  H    . PHE A 1 25 ? 10.688 5.059   -5.981  1.00 0.00 ? 25 PHE A H    7  
ATOM   5163  H  HA   . PHE A 1 25 ? 9.130  3.921   -3.736  1.00 0.00 ? 25 PHE A HA   7  
ATOM   5164  H  HB2  . PHE A 1 25 ? 12.067 3.496   -4.350  1.00 0.00 ? 25 PHE A HB2  7  
ATOM   5165  H  HB3  . PHE A 1 25 ? 11.480 3.512   -2.690  1.00 0.00 ? 25 PHE A HB3  7  
ATOM   5166  H  HD1  . PHE A 1 25 ? 11.251 1.683   -5.922  1.00 0.00 ? 25 PHE A HD1  7  
ATOM   5167  H  HD2  . PHE A 1 25 ? 10.444 1.632   -1.686  1.00 0.00 ? 25 PHE A HD2  7  
ATOM   5168  H  HE1  . PHE A 1 25 ? 10.891 -0.771  -6.018  1.00 0.00 ? 25 PHE A HE1  7  
ATOM   5169  H  HE2  . PHE A 1 25 ? 10.303 -0.848  -1.757  1.00 0.00 ? 25 PHE A HE2  7  
ATOM   5170  H  HZ   . PHE A 1 25 ? 10.494 -2.048  -3.923  1.00 0.00 ? 25 PHE A HZ   7  
ATOM   5171  N  N    . HIS A 1 26 ? 10.180 5.737   -2.172  1.00 0.00 ? 26 HIS A N    7  
ATOM   5172  C  CA   . HIS A 1 26 ? 10.632 6.855   -1.355  1.00 0.00 ? 26 HIS A CA   7  
ATOM   5173  C  C    . HIS A 1 26 ? 11.925 6.415   -0.662  1.00 0.00 ? 26 HIS A C    7  
ATOM   5174  O  O    . HIS A 1 26 ? 12.088 5.233   -0.352  1.00 0.00 ? 26 HIS A O    7  
ATOM   5175  C  CB   . HIS A 1 26 ? 9.595  7.210   -0.284  1.00 0.00 ? 26 HIS A CB   7  
ATOM   5176  C  CG   . HIS A 1 26 ? 8.239  7.637   -0.789  1.00 0.00 ? 26 HIS A CG   7  
ATOM   5177  N  ND1  . HIS A 1 26 ? 7.076  6.869   -0.706  1.00 0.00 ? 26 HIS A ND1  7  
ATOM   5178  C  CD2  . HIS A 1 26 ? 7.935  8.865   -1.300  1.00 0.00 ? 26 HIS A CD2  7  
ATOM   5179  C  CE1  . HIS A 1 26 ? 6.092  7.666   -1.152  1.00 0.00 ? 26 HIS A CE1  7  
ATOM   5180  N  NE2  . HIS A 1 26 ? 6.576  8.866   -1.515  1.00 0.00 ? 26 HIS A NE2  7  
ATOM   5181  H  H    . HIS A 1 26 ? 9.808  4.937   -1.680  1.00 0.00 ? 26 HIS A H    7  
ATOM   5182  H  HA   . HIS A 1 26 ? 10.821 7.737   -1.966  1.00 0.00 ? 26 HIS A HA   7  
ATOM   5183  H  HB2  . HIS A 1 26 ? 9.464  6.356   0.375   1.00 0.00 ? 26 HIS A HB2  7  
ATOM   5184  H  HB3  . HIS A 1 26 ? 9.999  8.030   0.309   1.00 0.00 ? 26 HIS A HB3  7  
ATOM   5185  H  HD2  . HIS A 1 26 ? 8.618  9.685   -1.463  1.00 0.00 ? 26 HIS A HD2  7  
ATOM   5186  H  HE1  . HIS A 1 26 ? 5.055  7.376   -1.235  1.00 0.00 ? 26 HIS A HE1  7  
ATOM   5187  H  HE2  . HIS A 1 26 ? 6.020  9.633   -1.874  1.00 0.00 ? 26 HIS A HE2  7  
ATOM   5188  N  N    . LEU A 1 27 ? 12.828 7.364   -0.383  1.00 0.00 ? 27 LEU A N    7  
ATOM   5189  C  CA   . LEU A 1 27 ? 13.992 7.119   0.463   1.00 0.00 ? 27 LEU A CA   7  
ATOM   5190  C  C    . LEU A 1 27 ? 13.567 6.562   1.822   1.00 0.00 ? 27 LEU A C    7  
ATOM   5191  O  O    . LEU A 1 27 ? 14.195 5.636   2.327   1.00 0.00 ? 27 LEU A O    7  
ATOM   5192  C  CB   . LEU A 1 27 ? 14.794 8.409   0.664   1.00 0.00 ? 27 LEU A CB   7  
ATOM   5193  C  CG   . LEU A 1 27 ? 15.465 8.934   -0.615  1.00 0.00 ? 27 LEU A CG   7  
ATOM   5194  C  CD1  . LEU A 1 27 ? 15.938 10.371  -0.378  1.00 0.00 ? 27 LEU A CD1  7  
ATOM   5195  C  CD2  . LEU A 1 27 ? 16.677 8.085   -1.021  1.00 0.00 ? 27 LEU A CD2  7  
ATOM   5196  H  H    . LEU A 1 27 ? 12.674 8.305   -0.721  1.00 0.00 ? 27 LEU A H    7  
ATOM   5197  H  HA   . LEU A 1 27 ? 14.625 6.376   -0.018  1.00 0.00 ? 27 LEU A HA   7  
ATOM   5198  H  HB2  . LEU A 1 27 ? 14.107 9.165   1.047   1.00 0.00 ? 27 LEU A HB2  7  
ATOM   5199  H  HB3  . LEU A 1 27 ? 15.565 8.227   1.414   1.00 0.00 ? 27 LEU A HB3  7  
ATOM   5200  H  HG   . LEU A 1 27 ? 14.743 8.940   -1.431  1.00 0.00 ? 27 LEU A HG   7  
ATOM   5201  H  HD11 . LEU A 1 27 ? 16.290 10.797  -1.315  1.00 0.00 ? 27 LEU A HD11 7  
ATOM   5202  H  HD12 . LEU A 1 27 ? 15.119 10.975  0.004   1.00 0.00 ? 27 LEU A HD12 7  
ATOM   5203  H  HD13 . LEU A 1 27 ? 16.748 10.389  0.347   1.00 0.00 ? 27 LEU A HD13 7  
ATOM   5204  H  HD21 . LEU A 1 27 ? 17.094 8.478   -1.947  1.00 0.00 ? 27 LEU A HD21 7  
ATOM   5205  H  HD22 . LEU A 1 27 ? 17.442 8.124   -0.246  1.00 0.00 ? 27 LEU A HD22 7  
ATOM   5206  H  HD23 . LEU A 1 27 ? 16.394 7.048   -1.183  1.00 0.00 ? 27 LEU A HD23 7  
ATOM   5207  N  N    . PHE A 1 28 ? 12.491 7.116   2.394   1.00 0.00 ? 28 PHE A N    7  
ATOM   5208  C  CA   . PHE A 1 28 ? 11.885 6.661   3.638   1.00 0.00 ? 28 PHE A CA   7  
ATOM   5209  C  C    . PHE A 1 28 ? 11.641 5.152   3.632   1.00 0.00 ? 28 PHE A C    7  
ATOM   5210  O  O    . PHE A 1 28 ? 12.069 4.452   4.547   1.00 0.00 ? 28 PHE A O    7  
ATOM   5211  C  CB   . PHE A 1 28 ? 10.570 7.415   3.865   1.00 0.00 ? 28 PHE A CB   7  
ATOM   5212  C  CG   . PHE A 1 28 ? 10.710 8.926   3.866   1.00 0.00 ? 28 PHE A CG   7  
ATOM   5213  C  CD1  . PHE A 1 28 ? 11.549 9.558   4.804   1.00 0.00 ? 28 PHE A CD1  7  
ATOM   5214  C  CD2  . PHE A 1 28 ? 10.024 9.701   2.911   1.00 0.00 ? 28 PHE A CD2  7  
ATOM   5215  C  CE1  . PHE A 1 28 ? 11.709 10.954  4.780   1.00 0.00 ? 28 PHE A CE1  7  
ATOM   5216  C  CE2  . PHE A 1 28 ? 10.174 11.097  2.898   1.00 0.00 ? 28 PHE A CE2  7  
ATOM   5217  C  CZ   . PHE A 1 28 ? 11.019 11.726  3.828   1.00 0.00 ? 28 PHE A CZ   7  
ATOM   5218  H  H    . PHE A 1 28 ? 12.057 7.901   1.931   1.00 0.00 ? 28 PHE A H    7  
ATOM   5219  H  HA   . PHE A 1 28 ? 12.565 6.897   4.455   1.00 0.00 ? 28 PHE A HA   7  
ATOM   5220  H  HB2  . PHE A 1 28 ? 9.873  7.112   3.082   1.00 0.00 ? 28 PHE A HB2  7  
ATOM   5221  H  HB3  . PHE A 1 28 ? 10.152 7.109   4.824   1.00 0.00 ? 28 PHE A HB3  7  
ATOM   5222  H  HD1  . PHE A 1 28 ? 12.072 8.976   5.548   1.00 0.00 ? 28 PHE A HD1  7  
ATOM   5223  H  HD2  . PHE A 1 28 ? 9.368  9.233   2.195   1.00 0.00 ? 28 PHE A HD2  7  
ATOM   5224  H  HE1  . PHE A 1 28 ? 12.359 11.435  5.496   1.00 0.00 ? 28 PHE A HE1  7  
ATOM   5225  H  HE2  . PHE A 1 28 ? 9.628  11.688  2.181   1.00 0.00 ? 28 PHE A HE2  7  
ATOM   5226  H  HZ   . PHE A 1 28 ? 11.128 12.800  3.817   1.00 0.00 ? 28 PHE A HZ   7  
ATOM   5227  N  N    . CYS A 1 29 ? 10.946 4.662   2.599   1.00 0.00 ? 29 CYS A N    7  
ATOM   5228  C  CA   . CYS A 1 29 ? 10.531 3.271   2.501   1.00 0.00 ? 29 CYS A CA   7  
ATOM   5229  C  C    . CYS A 1 29 ? 11.745 2.359   2.292   1.00 0.00 ? 29 CYS A C    7  
ATOM   5230  O  O    . CYS A 1 29 ? 11.780 1.253   2.828   1.00 0.00 ? 29 CYS A O    7  
ATOM   5231  C  CB   . CYS A 1 29 ? 9.502  3.110   1.374   1.00 0.00 ? 29 CYS A CB   7  
ATOM   5232  S  SG   . CYS A 1 29 ? 8.054  4.197   1.493   1.00 0.00 ? 29 CYS A SG   7  
ATOM   5233  H  H    . CYS A 1 29 ? 10.688 5.285   1.848   1.00 0.00 ? 29 CYS A H    7  
ATOM   5234  H  HA   . CYS A 1 29 ? 10.044 2.989   3.436   1.00 0.00 ? 29 CYS A HA   7  
ATOM   5235  H  HB2  . CYS A 1 29 ? 9.984  3.308   0.417   1.00 0.00 ? 29 CYS A HB2  7  
ATOM   5236  H  HB3  . CYS A 1 29 ? 9.148  2.080   1.374   1.00 0.00 ? 29 CYS A HB3  7  
ATOM   5237  N  N    . LEU A 1 30 ? 12.741 2.824   1.525   1.00 0.00 ? 30 LEU A N    7  
ATOM   5238  C  CA   . LEU A 1 30 ? 13.949 2.067   1.229   1.00 0.00 ? 30 LEU A CA   7  
ATOM   5239  C  C    . LEU A 1 30 ? 14.973 2.162   2.361   1.00 0.00 ? 30 LEU A C    7  
ATOM   5240  O  O    . LEU A 1 30 ? 15.145 1.211   3.122   1.00 0.00 ? 30 LEU A O    7  
ATOM   5241  C  CB   . LEU A 1 30 ? 14.560 2.553   -0.090  1.00 0.00 ? 30 LEU A CB   7  
ATOM   5242  C  CG   . LEU A 1 30 ? 13.773 2.126   -1.330  1.00 0.00 ? 30 LEU A CG   7  
ATOM   5243  C  CD1  . LEU A 1 30 ? 14.349 2.900   -2.516  1.00 0.00 ? 30 LEU A CD1  7  
ATOM   5244  C  CD2  . LEU A 1 30 ? 13.882 0.620   -1.595  1.00 0.00 ? 30 LEU A CD2  7  
ATOM   5245  H  H    . LEU A 1 30 ? 12.647 3.739   1.103   1.00 0.00 ? 30 LEU A H    7  
ATOM   5246  H  HA   . LEU A 1 30 ? 13.701 1.015   1.121   1.00 0.00 ? 30 LEU A HA   7  
ATOM   5247  H  HB2  . LEU A 1 30 ? 14.615 3.643   -0.065  1.00 0.00 ? 30 LEU A HB2  7  
ATOM   5248  H  HB3  . LEU A 1 30 ? 15.568 2.153   -0.192  1.00 0.00 ? 30 LEU A HB3  7  
ATOM   5249  H  HG   . LEU A 1 30 ? 12.727 2.391   -1.199  1.00 0.00 ? 30 LEU A HG   7  
ATOM   5250  H  HD11 . LEU A 1 30 ? 15.435 2.817   -2.522  1.00 0.00 ? 30 LEU A HD11 7  
ATOM   5251  H  HD12 . LEU A 1 30 ? 13.954 2.519   -3.457  1.00 0.00 ? 30 LEU A HD12 7  
ATOM   5252  H  HD13 . LEU A 1 30 ? 14.082 3.948   -2.408  1.00 0.00 ? 30 LEU A HD13 7  
ATOM   5253  H  HD21 . LEU A 1 30 ? 14.927 0.319   -1.568  1.00 0.00 ? 30 LEU A HD21 7  
ATOM   5254  H  HD22 . LEU A 1 30 ? 13.325 0.056   -0.847  1.00 0.00 ? 30 LEU A HD22 7  
ATOM   5255  H  HD23 . LEU A 1 30 ? 13.470 0.386   -2.577  1.00 0.00 ? 30 LEU A HD23 7  
ATOM   5256  N  N    . ARG A 1 31 ? 15.698 3.283   2.414   1.00 0.00 ? 31 ARG A N    7  
ATOM   5257  C  CA   . ARG A 1 31 ? 16.867 3.498   3.254   1.00 0.00 ? 31 ARG A CA   7  
ATOM   5258  C  C    . ARG A 1 31 ? 16.762 4.894   3.883   1.00 0.00 ? 31 ARG A C    7  
ATOM   5259  O  O    . ARG A 1 31 ? 17.341 5.840   3.353   1.00 0.00 ? 31 ARG A O    7  
ATOM   5260  C  CB   . ARG A 1 31 ? 18.145 3.382   2.401   1.00 0.00 ? 31 ARG A CB   7  
ATOM   5261  C  CG   . ARG A 1 31 ? 18.320 2.053   1.653   1.00 0.00 ? 31 ARG A CG   7  
ATOM   5262  C  CD   . ARG A 1 31 ? 18.534 0.840   2.565   1.00 0.00 ? 31 ARG A CD   7  
ATOM   5263  N  NE   . ARG A 1 31 ? 18.674 -0.386  1.763   1.00 0.00 ? 31 ARG A NE   7  
ATOM   5264  C  CZ   . ARG A 1 31 ? 17.661 -1.112  1.254   1.00 0.00 ? 31 ARG A CZ   7  
ATOM   5265  N  NH1  . ARG A 1 31 ? 16.385 -0.842  1.562   1.00 0.00 ? 31 ARG A NH1  7  
ATOM   5266  N  NH2  . ARG A 1 31 ? 17.930 -2.123  0.417   1.00 0.00 ? 31 ARG A NH2  7  
ATOM   5267  H  H    . ARG A 1 31 ? 15.384 4.062   1.852   1.00 0.00 ? 31 ARG A H    7  
ATOM   5268  H  HA   . ARG A 1 31 ? 16.925 2.742   4.034   1.00 0.00 ? 31 ARG A HA   7  
ATOM   5269  H  HB2  . ARG A 1 31 ? 18.127 4.167   1.643   1.00 0.00 ? 31 ARG A HB2  7  
ATOM   5270  H  HB3  . ARG A 1 31 ? 19.013 3.542   3.041   1.00 0.00 ? 31 ARG A HB3  7  
ATOM   5271  H  HG2  . ARG A 1 31 ? 17.462 1.877   1.007   1.00 0.00 ? 31 ARG A HG2  7  
ATOM   5272  H  HG3  . ARG A 1 31 ? 19.198 2.148   1.012   1.00 0.00 ? 31 ARG A HG3  7  
ATOM   5273  H  HD2  . ARG A 1 31 ? 19.455 0.987   3.131   1.00 0.00 ? 31 ARG A HD2  7  
ATOM   5274  H  HD3  . ARG A 1 31 ? 17.717 0.733   3.277   1.00 0.00 ? 31 ARG A HD3  7  
ATOM   5275  H  HE   . ARG A 1 31 ? 19.618 -0.657  1.529   1.00 0.00 ? 31 ARG A HE   7  
ATOM   5276  H  HH11 . ARG A 1 31 ? 16.157 -0.093  2.204   1.00 0.00 ? 31 ARG A HH11 7  
ATOM   5277  H  HH12 . ARG A 1 31 ? 15.637 -1.398  1.173   1.00 0.00 ? 31 ARG A HH12 7  
ATOM   5278  H  HH21 . ARG A 1 31 ? 18.877 -2.304  0.111   1.00 0.00 ? 31 ARG A HH21 7  
ATOM   5279  H  HH22 . ARG A 1 31 ? 17.182 -2.686  0.040   1.00 0.00 ? 31 ARG A HH22 7  
ATOM   5280  N  N    . PRO A 1 32 ? 16.037 5.049   5.004   1.00 0.00 ? 32 PRO A N    7  
ATOM   5281  C  CA   . PRO A 1 32 ? 15.694 6.354   5.560   1.00 0.00 ? 32 PRO A CA   7  
ATOM   5282  C  C    . PRO A 1 32 ? 16.936 7.156   5.975   1.00 0.00 ? 32 PRO A C    7  
ATOM   5283  O  O    . PRO A 1 32 ? 16.913 8.384   5.929   1.00 0.00 ? 32 PRO A O    7  
ATOM   5284  C  CB   . PRO A 1 32 ? 14.788 6.055   6.758   1.00 0.00 ? 32 PRO A CB   7  
ATOM   5285  C  CG   . PRO A 1 32 ? 15.269 4.683   7.227   1.00 0.00 ? 32 PRO A CG   7  
ATOM   5286  C  CD   . PRO A 1 32 ? 15.654 3.987   5.920   1.00 0.00 ? 32 PRO A CD   7  
ATOM   5287  H  HA   . PRO A 1 32 ? 15.133 6.935   4.826   1.00 0.00 ? 32 PRO A HA   7  
ATOM   5288  H  HB2  . PRO A 1 32 ? 14.861 6.809   7.543   1.00 0.00 ? 32 PRO A HB2  7  
ATOM   5289  H  HB3  . PRO A 1 32 ? 13.756 5.965   6.417   1.00 0.00 ? 32 PRO A HB3  7  
ATOM   5290  H  HG2  . PRO A 1 32 ? 16.156 4.804   7.851   1.00 0.00 ? 32 PRO A HG2  7  
ATOM   5291  H  HG3  . PRO A 1 32 ? 14.498 4.139   7.773   1.00 0.00 ? 32 PRO A HG3  7  
ATOM   5292  H  HD2  . PRO A 1 32 ? 16.467 3.289   6.116   1.00 0.00 ? 32 PRO A HD2  7  
ATOM   5293  H  HD3  . PRO A 1 32 ? 14.791 3.459   5.513   1.00 0.00 ? 32 PRO A HD3  7  
ATOM   5294  N  N    . ALA A 1 33 ? 18.019 6.464   6.353   1.00 0.00 ? 33 ALA A N    7  
ATOM   5295  C  CA   . ALA A 1 33 ? 19.324 7.051   6.635   1.00 0.00 ? 33 ALA A CA   7  
ATOM   5296  C  C    . ALA A 1 33 ? 19.854 7.913   5.487   1.00 0.00 ? 33 ALA A C    7  
ATOM   5297  O  O    . ALA A 1 33 ? 20.511 8.921   5.732   1.00 0.00 ? 33 ALA A O    7  
ATOM   5298  C  CB   . ALA A 1 33 ? 20.318 5.935   6.965   1.00 0.00 ? 33 ALA A CB   7  
ATOM   5299  H  H    . ALA A 1 33 ? 17.950 5.458   6.407   1.00 0.00 ? 33 ALA A H    7  
ATOM   5300  H  HA   . ALA A 1 33 ? 19.222 7.686   7.514   1.00 0.00 ? 33 ALA A HA   7  
ATOM   5301  H  HB1  . ALA A 1 33 ? 19.954 5.351   7.811   1.00 0.00 ? 33 ALA A HB1  7  
ATOM   5302  H  HB2  . ALA A 1 33 ? 20.443 5.279   6.102   1.00 0.00 ? 33 ALA A HB2  7  
ATOM   5303  H  HB3  . ALA A 1 33 ? 21.285 6.369   7.224   1.00 0.00 ? 33 ALA A HB3  7  
ATOM   5304  N  N    . LEU A 1 34 ? 19.588 7.510   4.238   1.00 0.00 ? 34 LEU A N    7  
ATOM   5305  C  CA   . LEU A 1 34 ? 19.840 8.342   3.071   1.00 0.00 ? 34 LEU A CA   7  
ATOM   5306  C  C    . LEU A 1 34 ? 18.756 9.414   3.000   1.00 0.00 ? 34 LEU A C    7  
ATOM   5307  O  O    . LEU A 1 34 ? 17.722 9.215   2.369   1.00 0.00 ? 34 LEU A O    7  
ATOM   5308  C  CB   . LEU A 1 34 ? 19.880 7.490   1.792   1.00 0.00 ? 34 LEU A CB   7  
ATOM   5309  C  CG   . LEU A 1 34 ? 20.890 6.330   1.839   1.00 0.00 ? 34 LEU A CG   7  
ATOM   5310  C  CD1  . LEU A 1 34 ? 20.849 5.578   0.504   1.00 0.00 ? 34 LEU A CD1  7  
ATOM   5311  C  CD2  . LEU A 1 34 ? 22.322 6.814   2.101   1.00 0.00 ? 34 LEU A CD2  7  
ATOM   5312  H  H    . LEU A 1 34 ? 19.003 6.696   4.112   1.00 0.00 ? 34 LEU A H    7  
ATOM   5313  H  HA   . LEU A 1 34 ? 20.805 8.842   3.171   1.00 0.00 ? 34 LEU A HA   7  
ATOM   5314  H  HB2  . LEU A 1 34 ? 18.892 7.065   1.610   1.00 0.00 ? 34 LEU A HB2  7  
ATOM   5315  H  HB3  . LEU A 1 34 ? 20.128 8.143   0.953   1.00 0.00 ? 34 LEU A HB3  7  
ATOM   5316  H  HG   . LEU A 1 34 ? 20.605 5.634   2.629   1.00 0.00 ? 34 LEU A HG   7  
ATOM   5317  H  HD11 . LEU A 1 34 ? 21.510 4.712   0.547   1.00 0.00 ? 34 LEU A HD11 7  
ATOM   5318  H  HD12 . LEU A 1 34 ? 19.834 5.236   0.300   1.00 0.00 ? 34 LEU A HD12 7  
ATOM   5319  H  HD13 . LEU A 1 34 ? 21.172 6.234   -0.306  1.00 0.00 ? 34 LEU A HD13 7  
ATOM   5320  H  HD21 . LEU A 1 34 ? 23.010 5.970   2.033   1.00 0.00 ? 34 LEU A HD21 7  
ATOM   5321  H  HD22 . LEU A 1 34 ? 22.605 7.565   1.363   1.00 0.00 ? 34 LEU A HD22 7  
ATOM   5322  H  HD23 . LEU A 1 34 ? 22.404 7.239   3.101   1.00 0.00 ? 34 LEU A HD23 7  
ATOM   5323  N  N    . TYR A 1 35 ? 18.992 10.550  3.662   1.00 0.00 ? 35 TYR A N    7  
ATOM   5324  C  CA   . TYR A 1 35 ? 18.030 11.640  3.745   1.00 0.00 ? 35 TYR A CA   7  
ATOM   5325  C  C    . TYR A 1 35 ? 17.881 12.353  2.400   1.00 0.00 ? 35 TYR A C    7  
ATOM   5326  O  O    . TYR A 1 35 ? 16.781 12.781  2.057   1.00 0.00 ? 35 TYR A O    7  
ATOM   5327  C  CB   . TYR A 1 35 ? 18.440 12.611  4.857   1.00 0.00 ? 35 TYR A CB   7  
ATOM   5328  C  CG   . TYR A 1 35 ? 18.592 11.951  6.215   1.00 0.00 ? 35 TYR A CG   7  
ATOM   5329  C  CD1  . TYR A 1 35 ? 17.462 11.430  6.873   1.00 0.00 ? 35 TYR A CD1  7  
ATOM   5330  C  CD2  . TYR A 1 35 ? 19.868 11.780  6.782   1.00 0.00 ? 35 TYR A CD2  7  
ATOM   5331  C  CE1  . TYR A 1 35 ? 17.608 10.734  8.085   1.00 0.00 ? 35 TYR A CE1  7  
ATOM   5332  C  CE2  . TYR A 1 35 ? 20.013 11.089  7.998   1.00 0.00 ? 35 TYR A CE2  7  
ATOM   5333  C  CZ   . TYR A 1 35 ? 18.884 10.557  8.644   1.00 0.00 ? 35 TYR A CZ   7  
ATOM   5334  O  OH   . TYR A 1 35 ? 19.024 9.870   9.815   1.00 0.00 ? 35 TYR A OH   7  
ATOM   5335  H  H    . TYR A 1 35 ? 19.846 10.632  4.197   1.00 0.00 ? 35 TYR A H    7  
ATOM   5336  H  HA   . TYR A 1 35 ? 17.060 11.218  4.004   1.00 0.00 ? 35 TYR A HA   7  
ATOM   5337  H  HB2  . TYR A 1 35 ? 19.384 13.084  4.580   1.00 0.00 ? 35 TYR A HB2  7  
ATOM   5338  H  HB3  . TYR A 1 35 ? 17.678 13.389  4.938   1.00 0.00 ? 35 TYR A HB3  7  
ATOM   5339  H  HD1  . TYR A 1 35 ? 16.479 11.549  6.440   1.00 0.00 ? 35 TYR A HD1  7  
ATOM   5340  H  HD2  . TYR A 1 35 ? 20.746 12.157  6.278   1.00 0.00 ? 35 TYR A HD2  7  
ATOM   5341  H  HE1  . TYR A 1 35 ? 16.738 10.323  8.577   1.00 0.00 ? 35 TYR A HE1  7  
ATOM   5342  H  HE2  . TYR A 1 35 ? 20.998 10.946  8.418   1.00 0.00 ? 35 TYR A HE2  7  
ATOM   5343  H  HH   . TYR A 1 35 ? 19.933 9.821   10.117  1.00 0.00 ? 35 TYR A HH   7  
ATOM   5344  N  N    . GLU A 1 36 ? 18.980 12.470  1.645   1.00 0.00 ? 36 GLU A N    7  
ATOM   5345  C  CA   . GLU A 1 36 ? 19.016 13.038  0.302   1.00 0.00 ? 36 GLU A CA   7  
ATOM   5346  C  C    . GLU A 1 36 ? 19.067 11.917  -0.739  1.00 0.00 ? 36 GLU A C    7  
ATOM   5347  O  O    . GLU A 1 36 ? 19.463 10.790  -0.437  1.00 0.00 ? 36 GLU A O    7  
ATOM   5348  C  CB   . GLU A 1 36 ? 20.225 13.978  0.161   1.00 0.00 ? 36 GLU A CB   7  
ATOM   5349  C  CG   . GLU A 1 36 ? 20.000 15.340  0.834   1.00 0.00 ? 36 GLU A CG   7  
ATOM   5350  C  CD   . GLU A 1 36 ? 19.752 15.234  2.336   1.00 0.00 ? 36 GLU A CD   7  
ATOM   5351  O  OE1  . GLU A 1 36 ? 20.721 14.903  3.052   1.00 0.00 ? 36 GLU A OE1  7  
ATOM   5352  O  OE2  . GLU A 1 36 ? 18.591 15.471  2.736   1.00 0.00 ? 36 GLU A OE2  7  
ATOM   5353  H  H    . GLU A 1 36 ? 19.844 12.101  2.013   1.00 0.00 ? 36 GLU A H    7  
ATOM   5354  H  HA   . GLU A 1 36 ? 18.117 13.626  0.116   1.00 0.00 ? 36 GLU A HA   7  
ATOM   5355  H  HB2  . GLU A 1 36 ? 21.115 13.501  0.574   1.00 0.00 ? 36 GLU A HB2  7  
ATOM   5356  H  HB3  . GLU A 1 36 ? 20.402 14.169  -0.898  1.00 0.00 ? 36 GLU A HB3  7  
ATOM   5357  H  HG2  . GLU A 1 36 ? 20.885 15.956  0.676   1.00 0.00 ? 36 GLU A HG2  7  
ATOM   5358  H  HG3  . GLU A 1 36 ? 19.151 15.837  0.362   1.00 0.00 ? 36 GLU A HG3  7  
ATOM   5359  N  N    . VAL A 1 37 ? 18.658 12.239  -1.973  1.00 0.00 ? 37 VAL A N    7  
ATOM   5360  C  CA   . VAL A 1 37 ? 18.748 11.346  -3.121  1.00 0.00 ? 37 VAL A CA   7  
ATOM   5361  C  C    . VAL A 1 37 ? 20.230 11.121  -3.455  1.00 0.00 ? 37 VAL A C    7  
ATOM   5362  O  O    . VAL A 1 37 ? 20.943 12.097  -3.681  1.00 0.00 ? 37 VAL A O    7  
ATOM   5363  C  CB   . VAL A 1 37 ? 17.986 11.960  -4.312  1.00 0.00 ? 37 VAL A CB   7  
ATOM   5364  C  CG1  . VAL A 1 37 ? 18.073 11.071  -5.561  1.00 0.00 ? 37 VAL A CG1  7  
ATOM   5365  C  CG2  . VAL A 1 37 ? 16.503 12.177  -3.979  1.00 0.00 ? 37 VAL A CG2  7  
ATOM   5366  H  H    . VAL A 1 37 ? 18.349 13.185  -2.144  1.00 0.00 ? 37 VAL A H    7  
ATOM   5367  H  HA   . VAL A 1 37 ? 18.252 10.416  -2.858  1.00 0.00 ? 37 VAL A HA   7  
ATOM   5368  H  HB   . VAL A 1 37 ? 18.431 12.927  -4.549  1.00 0.00 ? 37 VAL A HB   7  
ATOM   5369  H  HG11 . VAL A 1 37 ? 17.626 10.098  -5.359  1.00 0.00 ? 37 VAL A HG11 7  
ATOM   5370  H  HG12 . VAL A 1 37 ? 17.530 11.542  -6.382  1.00 0.00 ? 37 VAL A HG12 7  
ATOM   5371  H  HG13 . VAL A 1 37 ? 19.109 10.937  -5.870  1.00 0.00 ? 37 VAL A HG13 7  
ATOM   5372  H  HG21 . VAL A 1 37 ? 16.395 12.864  -3.140  1.00 0.00 ? 37 VAL A HG21 7  
ATOM   5373  H  HG22 . VAL A 1 37 ? 15.993 12.608  -4.841  1.00 0.00 ? 37 VAL A HG22 7  
ATOM   5374  H  HG23 . VAL A 1 37 ? 16.032 11.225  -3.731  1.00 0.00 ? 37 VAL A HG23 7  
ATOM   5375  N  N    . PRO A 1 38 ? 20.715 9.867   -3.479  1.00 0.00 ? 38 PRO A N    7  
ATOM   5376  C  CA   . PRO A 1 38 ? 22.136 9.563   -3.575  1.00 0.00 ? 38 PRO A CA   7  
ATOM   5377  C  C    . PRO A 1 38 ? 22.677 9.904   -4.965  1.00 0.00 ? 38 PRO A C    7  
ATOM   5378  O  O    . PRO A 1 38 ? 21.942 9.868   -5.953  1.00 0.00 ? 38 PRO A O    7  
ATOM   5379  C  CB   . PRO A 1 38 ? 22.245 8.061   -3.305  1.00 0.00 ? 38 PRO A CB   7  
ATOM   5380  C  CG   . PRO A 1 38 ? 20.912 7.523   -3.822  1.00 0.00 ? 38 PRO A CG   7  
ATOM   5381  C  CD   . PRO A 1 38 ? 19.937 8.640   -3.452  1.00 0.00 ? 38 PRO A CD   7  
ATOM   5382  H  HA   . PRO A 1 38 ? 22.692 10.116  -2.817  1.00 0.00 ? 38 PRO A HA   7  
ATOM   5383  H  HB2  . PRO A 1 38 ? 23.099 7.600   -3.807  1.00 0.00 ? 38 PRO A HB2  7  
ATOM   5384  H  HB3  . PRO A 1 38 ? 22.307 7.893   -2.230  1.00 0.00 ? 38 PRO A HB3  7  
ATOM   5385  H  HG2  . PRO A 1 38 ? 20.957 7.420   -4.907  1.00 0.00 ? 38 PRO A HG2  7  
ATOM   5386  H  HG3  . PRO A 1 38 ? 20.643 6.569   -3.364  1.00 0.00 ? 38 PRO A HG3  7  
ATOM   5387  H  HD2  . PRO A 1 38 ? 19.111 8.659   -4.162  1.00 0.00 ? 38 PRO A HD2  7  
ATOM   5388  H  HD3  . PRO A 1 38 ? 19.568 8.473   -2.439  1.00 0.00 ? 38 PRO A HD3  7  
ATOM   5389  N  N    . ASP A 1 39 ? 23.978 10.209  -5.036  1.00 0.00 ? 39 ASP A N    7  
ATOM   5390  C  CA   . ASP A 1 39 ? 24.633 10.708  -6.238  1.00 0.00 ? 39 ASP A CA   7  
ATOM   5391  C  C    . ASP A 1 39 ? 25.091 9.537   -7.114  1.00 0.00 ? 39 ASP A C    7  
ATOM   5392  O  O    . ASP A 1 39 ? 26.260 9.457   -7.491  1.00 0.00 ? 39 ASP A O    7  
ATOM   5393  C  CB   . ASP A 1 39 ? 25.810 11.608  -5.833  1.00 0.00 ? 39 ASP A CB   7  
ATOM   5394  C  CG   . ASP A 1 39 ? 25.356 12.788  -4.978  1.00 0.00 ? 39 ASP A CG   7  
ATOM   5395  O  OD1  . ASP A 1 39 ? 24.921 13.793  -5.579  1.00 0.00 ? 39 ASP A OD1  7  
ATOM   5396  O  OD2  . ASP A 1 39 ? 25.449 12.658  -3.738  1.00 0.00 ? 39 ASP A OD2  7  
ATOM   5397  H  H    . ASP A 1 39 ? 24.521 10.210  -4.185  1.00 0.00 ? 39 ASP A H    7  
ATOM   5398  H  HA   . ASP A 1 39 ? 23.932 11.314  -6.814  1.00 0.00 ? 39 ASP A HA   7  
ATOM   5399  H  HB2  . ASP A 1 39 ? 26.542 11.024  -5.274  1.00 0.00 ? 39 ASP A HB2  7  
ATOM   5400  H  HB3  . ASP A 1 39 ? 26.292 11.998  -6.730  1.00 0.00 ? 39 ASP A HB3  7  
ATOM   5401  N  N    . GLY A 1 40 ? 24.170 8.625   -7.444  1.00 0.00 ? 40 GLY A N    7  
ATOM   5402  C  CA   . GLY A 1 40 ? 24.480 7.442   -8.230  1.00 0.00 ? 40 GLY A CA   7  
ATOM   5403  C  C    . GLY A 1 40 ? 23.264 6.531   -8.377  1.00 0.00 ? 40 GLY A C    7  
ATOM   5404  O  O    . GLY A 1 40 ? 22.157 6.883   -7.973  1.00 0.00 ? 40 GLY A O    7  
ATOM   5405  H  H    . GLY A 1 40 ? 23.223 8.730   -7.100  1.00 0.00 ? 40 GLY A H    7  
ATOM   5406  H  HA2  . GLY A 1 40 ? 24.817 7.746   -9.221  1.00 0.00 ? 40 GLY A HA2  7  
ATOM   5407  H  HA3  . GLY A 1 40 ? 25.280 6.887   -7.737  1.00 0.00 ? 40 GLY A HA3  7  
ATOM   5408  N  N    . GLU A 1 41 ? 23.501 5.352   -8.960  1.00 0.00 ? 41 GLU A N    7  
ATOM   5409  C  CA   . GLU A 1 41 ? 22.476 4.412   -9.395  1.00 0.00 ? 41 GLU A CA   7  
ATOM   5410  C  C    . GLU A 1 41 ? 21.744 3.808   -8.192  1.00 0.00 ? 41 GLU A C    7  
ATOM   5411  O  O    . GLU A 1 41 ? 22.239 3.864   -7.065  1.00 0.00 ? 41 GLU A O    7  
ATOM   5412  C  CB   . GLU A 1 41 ? 23.116 3.304   -10.249 1.00 0.00 ? 41 GLU A CB   7  
ATOM   5413  C  CG   . GLU A 1 41 ? 23.878 3.833   -11.475 1.00 0.00 ? 41 GLU A CG   7  
ATOM   5414  C  CD   . GLU A 1 41 ? 25.344 4.140   -11.173 1.00 0.00 ? 41 GLU A CD   7  
ATOM   5415  O  OE1  . GLU A 1 41 ? 26.162 3.207   -11.315 1.00 0.00 ? 41 GLU A OE1  7  
ATOM   5416  O  OE2  . GLU A 1 41 ? 25.622 5.298   -10.792 1.00 0.00 ? 41 GLU A OE2  7  
ATOM   5417  H  H    . GLU A 1 41 ? 24.447 5.167   -9.266  1.00 0.00 ? 41 GLU A H    7  
ATOM   5418  H  HA   . GLU A 1 41 ? 21.753 4.950   -10.010 1.00 0.00 ? 41 GLU A HA   7  
ATOM   5419  H  HB2  . GLU A 1 41 ? 23.788 2.700   -9.635  1.00 0.00 ? 41 GLU A HB2  7  
ATOM   5420  H  HB3  . GLU A 1 41 ? 22.318 2.653   -10.609 1.00 0.00 ? 41 GLU A HB3  7  
ATOM   5421  H  HG2  . GLU A 1 41 ? 23.856 3.063   -12.248 1.00 0.00 ? 41 GLU A HG2  7  
ATOM   5422  H  HG3  . GLU A 1 41 ? 23.380 4.721   -11.869 1.00 0.00 ? 41 GLU A HG3  7  
ATOM   5423  N  N    . TRP A 1 42 ? 20.564 3.222   -8.431  1.00 0.00 ? 42 TRP A N    7  
ATOM   5424  C  CA   . TRP A 1 42 ? 19.855 2.448   -7.422  1.00 0.00 ? 42 TRP A CA   7  
ATOM   5425  C  C    . TRP A 1 42 ? 18.959 1.394   -8.067  1.00 0.00 ? 42 TRP A C    7  
ATOM   5426  O  O    . TRP A 1 42 ? 18.385 1.618   -9.130  1.00 0.00 ? 42 TRP A O    7  
ATOM   5427  C  CB   . TRP A 1 42 ? 19.011 3.365   -6.529  1.00 0.00 ? 42 TRP A CB   7  
ATOM   5428  C  CG   . TRP A 1 42 ? 18.271 2.624   -5.457  1.00 0.00 ? 42 TRP A CG   7  
ATOM   5429  C  CD1  . TRP A 1 42 ? 16.963 2.283   -5.491  1.00 0.00 ? 42 TRP A CD1  7  
ATOM   5430  C  CD2  . TRP A 1 42 ? 18.815 2.003   -4.255  1.00 0.00 ? 42 TRP A CD2  7  
ATOM   5431  N  NE1  . TRP A 1 42 ? 16.665 1.490   -4.403  1.00 0.00 ? 42 TRP A NE1  7  
ATOM   5432  C  CE2  . TRP A 1 42 ? 17.771 1.280   -3.605  1.00 0.00 ? 42 TRP A CE2  7  
ATOM   5433  C  CE3  . TRP A 1 42 ? 20.094 1.956   -3.660  1.00 0.00 ? 42 TRP A CE3  7  
ATOM   5434  C  CZ2  . TRP A 1 42 ? 17.988 0.546   -2.429  1.00 0.00 ? 42 TRP A CZ2  7  
ATOM   5435  C  CZ3  . TRP A 1 42 ? 20.318 1.236   -2.473  1.00 0.00 ? 42 TRP A CZ3  7  
ATOM   5436  C  CH2  . TRP A 1 42 ? 19.270 0.532   -1.858  1.00 0.00 ? 42 TRP A CH2  7  
ATOM   5437  H  H    . TRP A 1 42 ? 20.208 3.188   -9.382  1.00 0.00 ? 42 TRP A H    7  
ATOM   5438  H  HA   . TRP A 1 42 ? 20.588 1.931   -6.799  1.00 0.00 ? 42 TRP A HA   7  
ATOM   5439  H  HB2  . TRP A 1 42 ? 19.665 4.094   -6.046  1.00 0.00 ? 42 TRP A HB2  7  
ATOM   5440  H  HB3  . TRP A 1 42 ? 18.292 3.903   -7.151  1.00 0.00 ? 42 TRP A HB3  7  
ATOM   5441  H  HD1  . TRP A 1 42 ? 16.270 2.543   -6.278  1.00 0.00 ? 42 TRP A HD1  7  
ATOM   5442  H  HE1  . TRP A 1 42 ? 15.744 1.109   -4.244  1.00 0.00 ? 42 TRP A HE1  7  
ATOM   5443  H  HE3  . TRP A 1 42 ? 20.914 2.484   -4.126  1.00 0.00 ? 42 TRP A HE3  7  
ATOM   5444  H  HZ2  . TRP A 1 42 ? 17.185 -0.013  -1.973  1.00 0.00 ? 42 TRP A HZ2  7  
ATOM   5445  H  HZ3  . TRP A 1 42 ? 21.306 1.219   -2.035  1.00 0.00 ? 42 TRP A HZ3  7  
ATOM   5446  H  HH2  . TRP A 1 42 ? 19.458 -0.030  -0.956  1.00 0.00 ? 42 TRP A HH2  7  
ATOM   5447  N  N    . GLN A 1 43 ? 18.813 0.257   -7.378  1.00 0.00 ? 43 GLN A N    7  
ATOM   5448  C  CA   . GLN A 1 43 ? 17.845 -0.772  -7.702  1.00 0.00 ? 43 GLN A CA   7  
ATOM   5449  C  C    . GLN A 1 43 ? 17.178 -1.287  -6.425  1.00 0.00 ? 43 GLN A C    7  
ATOM   5450  O  O    . GLN A 1 43 ? 17.759 -1.226  -5.343  1.00 0.00 ? 43 GLN A O    7  
ATOM   5451  C  CB   . GLN A 1 43 ? 18.479 -1.869  -8.567  1.00 0.00 ? 43 GLN A CB   7  
ATOM   5452  C  CG   . GLN A 1 43 ? 19.585 -2.679  -7.875  1.00 0.00 ? 43 GLN A CG   7  
ATOM   5453  C  CD   . GLN A 1 43 ? 20.867 -1.874  -7.686  1.00 0.00 ? 43 GLN A CD   7  
ATOM   5454  O  OE1  . GLN A 1 43 ? 21.168 -1.436  -6.579  1.00 0.00 ? 43 GLN A OE1  7  
ATOM   5455  N  NE2  . GLN A 1 43 ? 21.617 -1.672  -8.769  1.00 0.00 ? 43 GLN A NE2  7  
ATOM   5456  H  H    . GLN A 1 43 ? 19.349 0.125   -6.531  1.00 0.00 ? 43 GLN A H    7  
ATOM   5457  H  HA   . GLN A 1 43 ? 17.059 -0.308  -8.296  1.00 0.00 ? 43 GLN A HA   7  
ATOM   5458  H  HB2  . GLN A 1 43 ? 17.690 -2.550  -8.874  1.00 0.00 ? 43 GLN A HB2  7  
ATOM   5459  H  HB3  . GLN A 1 43 ? 18.884 -1.407  -9.467  1.00 0.00 ? 43 GLN A HB3  7  
ATOM   5460  H  HG2  . GLN A 1 43 ? 19.235 -3.037  -6.911  1.00 0.00 ? 43 GLN A HG2  7  
ATOM   5461  H  HG3  . GLN A 1 43 ? 19.817 -3.551  -8.487  1.00 0.00 ? 43 GLN A HG3  7  
ATOM   5462  H  HE21 . GLN A 1 43 ? 21.327 -2.078  -9.656  1.00 0.00 ? 43 GLN A HE21 7  
ATOM   5463  H  HE22 . GLN A 1 43 ? 22.462 -1.122  -8.703  1.00 0.00 ? 43 GLN A HE22 7  
ATOM   5464  N  N    . CYS A 1 44 ? 15.936 -1.765  -6.559  1.00 0.00 ? 44 CYS A N    7  
ATOM   5465  C  CA   . CYS A 1 44 ? 15.041 -2.097  -5.460  1.00 0.00 ? 44 CYS A CA   7  
ATOM   5466  C  C    . CYS A 1 44 ? 15.470 -3.394  -4.762  1.00 0.00 ? 44 CYS A C    7  
ATOM   5467  O  O    . CYS A 1 44 ? 16.235 -4.164  -5.334  1.00 0.00 ? 44 CYS A O    7  
ATOM   5468  C  CB   . CYS A 1 44 ? 13.603 -2.178  -5.999  1.00 0.00 ? 44 CYS A CB   7  
ATOM   5469  S  SG   . CYS A 1 44 ? 13.299 -3.371  -7.331  1.00 0.00 ? 44 CYS A SG   7  
ATOM   5470  H  H    . CYS A 1 44 ? 15.591 -1.913  -7.490  1.00 0.00 ? 44 CYS A H    7  
ATOM   5471  H  HA   . CYS A 1 44 ? 15.083 -1.266  -4.756  1.00 0.00 ? 44 CYS A HA   7  
ATOM   5472  H  HB2  . CYS A 1 44 ? 12.925 -2.428  -5.184  1.00 0.00 ? 44 CYS A HB2  7  
ATOM   5473  H  HB3  . CYS A 1 44 ? 13.327 -1.193  -6.376  1.00 0.00 ? 44 CYS A HB3  7  
ATOM   5474  N  N    . PRO A 1 45 ? 14.974 -3.661  -3.541  1.00 0.00 ? 45 PRO A N    7  
ATOM   5475  C  CA   . PRO A 1 45 ? 15.178 -4.912  -2.816  1.00 0.00 ? 45 PRO A CA   7  
ATOM   5476  C  C    . PRO A 1 45 ? 14.922 -6.200  -3.604  1.00 0.00 ? 45 PRO A C    7  
ATOM   5477  O  O    . PRO A 1 45 ? 15.500 -7.232  -3.272  1.00 0.00 ? 45 PRO A O    7  
ATOM   5478  C  CB   . PRO A 1 45 ? 14.268 -4.811  -1.593  1.00 0.00 ? 45 PRO A CB   7  
ATOM   5479  C  CG   . PRO A 1 45 ? 14.338 -3.323  -1.262  1.00 0.00 ? 45 PRO A CG   7  
ATOM   5480  C  CD   . PRO A 1 45 ? 14.422 -2.661  -2.638  1.00 0.00 ? 45 PRO A CD   7  
ATOM   5481  H  HA   . PRO A 1 45 ? 16.208 -4.926  -2.463  1.00 0.00 ? 45 PRO A HA   7  
ATOM   5482  H  HB2  . PRO A 1 45 ? 13.248 -5.074  -1.873  1.00 0.00 ? 45 PRO A HB2  7  
ATOM   5483  H  HB3  . PRO A 1 45 ? 14.612 -5.438  -0.768  1.00 0.00 ? 45 PRO A HB3  7  
ATOM   5484  H  HG2  . PRO A 1 45 ? 13.469 -2.986  -0.694  1.00 0.00 ? 45 PRO A HG2  7  
ATOM   5485  H  HG3  . PRO A 1 45 ? 15.254 -3.124  -0.706  1.00 0.00 ? 45 PRO A HG3  7  
ATOM   5486  H  HD2  . PRO A 1 45 ? 13.421 -2.377  -2.962  1.00 0.00 ? 45 PRO A HD2  7  
ATOM   5487  H  HD3  . PRO A 1 45 ? 15.069 -1.786  -2.576  1.00 0.00 ? 45 PRO A HD3  7  
ATOM   5488  N  N    . ALA A 1 46 ? 14.058 -6.162  -4.627  1.00 0.00 ? 46 ALA A N    7  
ATOM   5489  C  CA   . ALA A 1 46 ? 13.820 -7.306  -5.493  1.00 0.00 ? 46 ALA A CA   7  
ATOM   5490  C  C    . ALA A 1 46 ? 15.044 -7.581  -6.368  1.00 0.00 ? 46 ALA A C    7  
ATOM   5491  O  O    . ALA A 1 46 ? 15.361 -8.738  -6.631  1.00 0.00 ? 46 ALA A O    7  
ATOM   5492  C  CB   . ALA A 1 46 ? 12.577 -7.061  -6.350  1.00 0.00 ? 46 ALA A CB   7  
ATOM   5493  H  H    . ALA A 1 46 ? 13.689 -5.275  -4.931  1.00 0.00 ? 46 ALA A H    7  
ATOM   5494  H  HA   . ALA A 1 46 ? 13.627 -8.184  -4.873  1.00 0.00 ? 46 ALA A HA   7  
ATOM   5495  H  HB1  . ALA A 1 46 ? 12.740 -6.217  -7.020  1.00 0.00 ? 46 ALA A HB1  7  
ATOM   5496  H  HB2  . ALA A 1 46 ? 12.363 -7.949  -6.946  1.00 0.00 ? 46 ALA A HB2  7  
ATOM   5497  H  HB3  . ALA A 1 46 ? 11.721 -6.851  -5.708  1.00 0.00 ? 46 ALA A HB3  7  
ATOM   5498  N  N    . CYS A 1 47 ? 15.727 -6.517  -6.813  1.00 0.00 ? 47 CYS A N    7  
ATOM   5499  C  CA   . CYS A 1 47 ? 16.972 -6.617  -7.546  1.00 0.00 ? 47 CYS A CA   7  
ATOM   5500  C  C    . CYS A 1 47 ? 18.144 -6.951  -6.618  1.00 0.00 ? 47 CYS A C    7  
ATOM   5501  O  O    . CYS A 1 47 ? 18.972 -7.788  -6.971  1.00 0.00 ? 47 CYS A O    7  
ATOM   5502  C  CB   . CYS A 1 47 ? 17.240 -5.318  -8.304  1.00 0.00 ? 47 CYS A CB   7  
ATOM   5503  S  SG   . CYS A 1 47 ? 15.964 -4.779  -9.473  1.00 0.00 ? 47 CYS A SG   7  
ATOM   5504  H  H    . CYS A 1 47 ? 15.443 -5.585  -6.548  1.00 0.00 ? 47 CYS A H    7  
ATOM   5505  H  HA   . CYS A 1 47 ? 16.860 -7.407  -8.283  1.00 0.00 ? 47 CYS A HA   7  
ATOM   5506  H  HB2  . CYS A 1 47 ? 17.406 -4.515  -7.589  1.00 0.00 ? 47 CYS A HB2  7  
ATOM   5507  H  HB3  . CYS A 1 47 ? 18.154 -5.470  -8.874  1.00 0.00 ? 47 CYS A HB3  7  
ATOM   5508  N  N    . GLN A 1 48 ? 18.214 -6.304  -5.443  1.00 0.00 ? 48 GLN A N    7  
ATOM   5509  C  CA   . GLN A 1 48 ? 19.239 -6.511  -4.431  1.00 0.00 ? 48 GLN A CA   7  
ATOM   5510  C  C    . GLN A 1 48 ? 18.646 -7.140  -3.159  1.00 0.00 ? 48 GLN A C    7  
ATOM   5511  O  O    . GLN A 1 48 ? 18.444 -6.441  -2.166  1.00 0.00 ? 48 GLN A O    7  
ATOM   5512  C  CB   . GLN A 1 48 ? 19.942 -5.175  -4.137  1.00 0.00 ? 48 GLN A CB   7  
ATOM   5513  C  CG   . GLN A 1 48 ? 19.009 -3.982  -3.884  1.00 0.00 ? 48 GLN A CG   7  
ATOM   5514  C  CD   . GLN A 1 48 ? 19.707 -2.855  -3.125  1.00 0.00 ? 48 GLN A CD   7  
ATOM   5515  O  OE1  . GLN A 1 48 ? 19.548 -2.735  -1.911  1.00 0.00 ? 48 GLN A OE1  7  
ATOM   5516  N  NE2  . GLN A 1 48 ? 20.476 -2.022  -3.827  1.00 0.00 ? 48 GLN A NE2  7  
ATOM   5517  H  H    . GLN A 1 48 ? 17.539 -5.583  -5.234  1.00 0.00 ? 48 GLN A H    7  
ATOM   5518  H  HA   . GLN A 1 48 ? 20.014 -7.185  -4.796  1.00 0.00 ? 48 GLN A HA   7  
ATOM   5519  H  HB2  . GLN A 1 48 ? 20.564 -5.325  -3.258  1.00 0.00 ? 48 GLN A HB2  7  
ATOM   5520  H  HB3  . GLN A 1 48 ? 20.582 -4.920  -4.982  1.00 0.00 ? 48 GLN A HB3  7  
ATOM   5521  H  HG2  . GLN A 1 48 ? 18.650 -3.605  -4.837  1.00 0.00 ? 48 GLN A HG2  7  
ATOM   5522  H  HG3  . GLN A 1 48 ? 18.150 -4.287  -3.296  1.00 0.00 ? 48 GLN A HG3  7  
ATOM   5523  H  HE21 . GLN A 1 48 ? 20.568 -2.128  -4.830  1.00 0.00 ? 48 GLN A HE21 7  
ATOM   5524  H  HE22 . GLN A 1 48 ? 20.937 -1.258  -3.351  1.00 0.00 ? 48 GLN A HE22 7  
ATOM   5525  N  N    . PRO A 1 49 ? 18.383 -8.458  -3.149  1.00 0.00 ? 49 PRO A N    7  
ATOM   5526  C  CA   . PRO A 1 49 ? 18.039 -9.183  -1.935  1.00 0.00 ? 49 PRO A CA   7  
ATOM   5527  C  C    . PRO A 1 49 ? 19.323 -9.591  -1.209  1.00 0.00 ? 49 PRO A C    7  
ATOM   5528  O  O    . PRO A 1 49 ? 20.428 -9.333  -1.689  1.00 0.00 ? 49 PRO A O    7  
ATOM   5529  C  CB   . PRO A 1 49 ? 17.243 -10.398 -2.419  1.00 0.00 ? 49 PRO A CB   7  
ATOM   5530  C  CG   . PRO A 1 49 ? 17.896 -10.706 -3.763  1.00 0.00 ? 49 PRO A CG   7  
ATOM   5531  C  CD   . PRO A 1 49 ? 18.213 -9.314  -4.310  1.00 0.00 ? 49 PRO A CD   7  
ATOM   5532  H  HA   . PRO A 1 49 ? 17.414 -8.586  -1.268  1.00 0.00 ? 49 PRO A HA   7  
ATOM   5533  H  HB2  . PRO A 1 49 ? 17.286 -11.247 -1.733  1.00 0.00 ? 49 PRO A HB2  7  
ATOM   5534  H  HB3  . PRO A 1 49 ? 16.205 -10.103 -2.588  1.00 0.00 ? 49 PRO A HB3  7  
ATOM   5535  H  HG2  . PRO A 1 49 ? 18.822 -11.256 -3.594  1.00 0.00 ? 49 PRO A HG2  7  
ATOM   5536  H  HG3  . PRO A 1 49 ? 17.239 -11.271 -4.425  1.00 0.00 ? 49 PRO A HG3  7  
ATOM   5537  H  HD2  . PRO A 1 49 ? 19.115 -9.359  -4.920  1.00 0.00 ? 49 PRO A HD2  7  
ATOM   5538  H  HD3  . PRO A 1 49 ? 17.366 -8.964  -4.896  1.00 0.00 ? 49 PRO A HD3  7  
ATOM   5539  N  N    . ALA A 1 50 ? 19.179 -10.236 -0.046  1.00 0.00 ? 50 ALA A N    7  
ATOM   5540  C  CA   . ALA A 1 50 ? 20.290 -10.874 0.643   1.00 0.00 ? 50 ALA A CA   7  
ATOM   5541  C  C    . ALA A 1 50 ? 20.696 -12.135 -0.125  1.00 0.00 ? 50 ALA A C    7  
ATOM   5542  O  O    . ALA A 1 50 ? 20.107 -13.197 0.070   1.00 0.00 ? 50 ALA A O    7  
ATOM   5543  C  CB   . ALA A 1 50 ? 19.887 -11.189 2.087   1.00 0.00 ? 50 ALA A CB   7  
ATOM   5544  H  H    . ALA A 1 50 ? 18.250 -10.390 0.317   1.00 0.00 ? 50 ALA A H    7  
ATOM   5545  H  HA   . ALA A 1 50 ? 21.137 -10.186 0.684   1.00 0.00 ? 50 ALA A HA   7  
ATOM   5546  H  HB1  . ALA A 1 50 ? 19.646 -10.262 2.609   1.00 0.00 ? 50 ALA A HB1  7  
ATOM   5547  H  HB2  . ALA A 1 50 ? 19.016 -11.845 2.105   1.00 0.00 ? 50 ALA A HB2  7  
ATOM   5548  H  HB3  . ALA A 1 50 ? 20.717 -11.678 2.599   1.00 0.00 ? 50 ALA A HB3  7  
ATOM   5549  N  N    . THR A 1 51 ? 21.691 -12.004 -1.010  1.00 0.00 ? 51 THR A N    7  
ATOM   5550  C  CA   . THR A 1 51 ? 22.277 -13.105 -1.761  1.00 0.00 ? 51 THR A CA   7  
ATOM   5551  C  C    . THR A 1 51 ? 23.758 -12.826 -2.039  1.00 0.00 ? 51 THR A C    7  
ATOM   5552  O  O    . THR A 1 51 ? 24.383 -13.691 -2.691  1.00 0.00 ? 51 THR A O    7  
ATOM   5553  C  CB   . THR A 1 51 ? 21.477 -13.342 -3.055  1.00 0.00 ? 51 THR A CB   7  
ATOM   5554  O  OG1  . THR A 1 51 ? 21.924 -14.529 -3.677  1.00 0.00 ? 51 THR A OG1  7  
ATOM   5555  C  CG2  . THR A 1 51 ? 21.600 -12.180 -4.049  1.00 0.00 ? 51 THR A CG2  7  
ATOM   5556  O  OXT  . THR A 1 51 ? 24.241 -11.755 -1.606  1.00 0.00 ? 51 THR A OXT  7  
ATOM   5557  H  H    . THR A 1 51 ? 22.123 -11.098 -1.132  1.00 0.00 ? 51 THR A H    7  
ATOM   5558  H  HA   . THR A 1 51 ? 22.228 -14.012 -1.155  1.00 0.00 ? 51 THR A HA   7  
ATOM   5559  H  HB   . THR A 1 51 ? 20.424 -13.474 -2.803  1.00 0.00 ? 51 THR A HB   7  
ATOM   5560  H  HG1  . THR A 1 51 ? 22.887 -14.499 -3.705  1.00 0.00 ? 51 THR A HG1  7  
ATOM   5561  H  HG21 . THR A 1 51 ? 20.973 -12.383 -4.917  1.00 0.00 ? 51 THR A HG21 7  
ATOM   5562  H  HG22 . THR A 1 51 ? 21.273 -11.250 -3.587  1.00 0.00 ? 51 THR A HG22 7  
ATOM   5563  H  HG23 . THR A 1 51 ? 22.632 -12.069 -4.383  1.00 0.00 ? 51 THR A HG23 7  
HETATM 5564  ZN ZN   . ZN  B 2 .  ? 6.628  4.887   -0.177  1.00 0.00 ? 52 ZN  A ZN   7  
HETATM 5565  ZN ZN   . ZN  C 2 .  ? 14.185 -3.323  -9.452  1.00 0.00 ? 53 ZN  A ZN   7  
ATOM   5566  N  N    . ALA A 1 1  ? 4.655  11.780  -8.411  1.00 0.00 ? 1  ALA A N    8  
ATOM   5567  C  CA   . ALA A 1 1  ? 4.520  10.339  -8.690  1.00 0.00 ? 1  ALA A CA   8  
ATOM   5568  C  C    . ALA A 1 1  ? 4.336  9.554   -7.390  1.00 0.00 ? 1  ALA A C    8  
ATOM   5569  O  O    . ALA A 1 1  ? 4.490  10.116  -6.307  1.00 0.00 ? 1  ALA A O    8  
ATOM   5570  C  CB   . ALA A 1 1  ? 5.726  9.827   -9.484  1.00 0.00 ? 1  ALA A CB   8  
ATOM   5571  H  H1   . ALA A 1 1  ? 5.467  11.929  -7.828  1.00 0.00 ? 1  ALA A H1   8  
ATOM   5572  H  H2   . ALA A 1 1  ? 4.756  12.294  -9.275  1.00 0.00 ? 1  ALA A H2   8  
ATOM   5573  H  H3   . ALA A 1 1  ? 3.836  12.102  -7.916  1.00 0.00 ? 1  ALA A H3   8  
ATOM   5574  H  HA   . ALA A 1 1  ? 3.627  10.202  -9.301  1.00 0.00 ? 1  ALA A HA   8  
ATOM   5575  H  HB1  . ALA A 1 1  ? 5.813  10.382  -10.418 1.00 0.00 ? 1  ALA A HB1  8  
ATOM   5576  H  HB2  . ALA A 1 1  ? 6.640  9.960   -8.905  1.00 0.00 ? 1  ALA A HB2  8  
ATOM   5577  H  HB3  . ALA A 1 1  ? 5.602  8.768   -9.717  1.00 0.00 ? 1  ALA A HB3  8  
ATOM   5578  N  N    . ARG A 1 2  ? 3.990  8.264   -7.504  1.00 0.00 ? 2  ARG A N    8  
ATOM   5579  C  CA   . ARG A 1 2  ? 3.672  7.401   -6.374  1.00 0.00 ? 2  ARG A CA   8  
ATOM   5580  C  C    . ARG A 1 2  ? 4.657  6.235   -6.309  1.00 0.00 ? 2  ARG A C    8  
ATOM   5581  O  O    . ARG A 1 2  ? 4.918  5.567   -7.308  1.00 0.00 ? 2  ARG A O    8  
ATOM   5582  C  CB   . ARG A 1 2  ? 2.228  6.892   -6.481  1.00 0.00 ? 2  ARG A CB   8  
ATOM   5583  C  CG   . ARG A 1 2  ? 1.176  7.992   -6.262  1.00 0.00 ? 2  ARG A CG   8  
ATOM   5584  C  CD   . ARG A 1 2  ? 0.785  8.206   -4.792  1.00 0.00 ? 2  ARG A CD   8  
ATOM   5585  N  NE   . ARG A 1 2  ? 1.850  8.825   -3.984  1.00 0.00 ? 2  ARG A NE   8  
ATOM   5586  C  CZ   . ARG A 1 2  ? 2.588  8.213   -3.042  1.00 0.00 ? 2  ARG A CZ   8  
ATOM   5587  N  NH1  . ARG A 1 2  ? 2.592  6.880   -2.909  1.00 0.00 ? 2  ARG A NH1  8  
ATOM   5588  N  NH2  . ARG A 1 2  ? 3.336  8.959   -2.223  1.00 0.00 ? 2  ARG A NH2  8  
ATOM   5589  H  H    . ARG A 1 2  ? 3.924  7.856   -8.426  1.00 0.00 ? 2  ARG A H    8  
ATOM   5590  H  HA   . ARG A 1 2  ? 3.773  7.962   -5.450  1.00 0.00 ? 2  ARG A HA   8  
ATOM   5591  H  HB2  . ARG A 1 2  ? 2.090  6.473   -7.479  1.00 0.00 ? 2  ARG A HB2  8  
ATOM   5592  H  HB3  . ARG A 1 2  ? 2.062  6.093   -5.758  1.00 0.00 ? 2  ARG A HB3  8  
ATOM   5593  H  HG2  . ARG A 1 2  ? 1.502  8.934   -6.702  1.00 0.00 ? 2  ARG A HG2  8  
ATOM   5594  H  HG3  . ARG A 1 2  ? 0.269  7.677   -6.782  1.00 0.00 ? 2  ARG A HG3  8  
ATOM   5595  H  HD2  . ARG A 1 2  ? -0.060 8.895   -4.775  1.00 0.00 ? 2  ARG A HD2  8  
ATOM   5596  H  HD3  . ARG A 1 2  ? 0.441  7.268   -4.357  1.00 0.00 ? 2  ARG A HD3  8  
ATOM   5597  H  HE   . ARG A 1 2  ? 1.971  9.827   -4.083  1.00 0.00 ? 2  ARG A HE   8  
ATOM   5598  H  HH11 . ARG A 1 2  ? 2.053  6.307   -3.541  1.00 0.00 ? 2  ARG A HH11 8  
ATOM   5599  H  HH12 . ARG A 1 2  ? 3.130  6.444   -2.173  1.00 0.00 ? 2  ARG A HH12 8  
ATOM   5600  H  HH21 . ARG A 1 2  ? 3.357  9.962   -2.363  1.00 0.00 ? 2  ARG A HH21 8  
ATOM   5601  H  HH22 . ARG A 1 2  ? 3.830  8.547   -1.446  1.00 0.00 ? 2  ARG A HH22 8  
ATOM   5602  N  N    . CYS A 1 3  ? 5.179  5.999   -5.102  1.00 0.00 ? 3  CYS A N    8  
ATOM   5603  C  CA   . CYS A 1 3  ? 5.989  4.850   -4.732  1.00 0.00 ? 3  CYS A CA   8  
ATOM   5604  C  C    . CYS A 1 3  ? 5.134  3.585   -4.709  1.00 0.00 ? 3  CYS A C    8  
ATOM   5605  O  O    . CYS A 1 3  ? 3.975  3.627   -4.300  1.00 0.00 ? 3  CYS A O    8  
ATOM   5606  C  CB   . CYS A 1 3  ? 6.555  5.135   -3.342  1.00 0.00 ? 3  CYS A CB   8  
ATOM   5607  S  SG   . CYS A 1 3  ? 7.291  3.749   -2.443  1.00 0.00 ? 3  CYS A SG   8  
ATOM   5608  H  H    . CYS A 1 3  ? 4.938  6.635   -4.357  1.00 0.00 ? 3  CYS A H    8  
ATOM   5609  H  HA   . CYS A 1 3  ? 6.811  4.736   -5.439  1.00 0.00 ? 3  CYS A HA   8  
ATOM   5610  H  HB2  . CYS A 1 3  ? 7.310  5.915   -3.442  1.00 0.00 ? 3  CYS A HB2  8  
ATOM   5611  H  HB3  . CYS A 1 3  ? 5.730  5.504   -2.734  1.00 0.00 ? 3  CYS A HB3  8  
ATOM   5612  N  N    . LYS A 1 4  ? 5.720  2.461   -5.132  1.00 0.00 ? 4  LYS A N    8  
ATOM   5613  C  CA   . LYS A 1 4  ? 5.049  1.174   -5.205  1.00 0.00 ? 4  LYS A CA   8  
ATOM   5614  C  C    . LYS A 1 4  ? 4.766  0.614   -3.809  1.00 0.00 ? 4  LYS A C    8  
ATOM   5615  O  O    . LYS A 1 4  ? 3.685  0.075   -3.573  1.00 0.00 ? 4  LYS A O    8  
ATOM   5616  C  CB   . LYS A 1 4  ? 5.904  0.207   -6.034  1.00 0.00 ? 4  LYS A CB   8  
ATOM   5617  C  CG   . LYS A 1 4  ? 6.107  0.662   -7.489  1.00 0.00 ? 4  LYS A CG   8  
ATOM   5618  C  CD   . LYS A 1 4  ? 4.822  0.548   -8.322  1.00 0.00 ? 4  LYS A CD   8  
ATOM   5619  C  CE   . LYS A 1 4  ? 5.044  0.980   -9.777  1.00 0.00 ? 4  LYS A CE   8  
ATOM   5620  N  NZ   . LYS A 1 4  ? 5.265  2.433   -9.897  1.00 0.00 ? 4  LYS A NZ   8  
ATOM   5621  H  H    . LYS A 1 4  ? 6.689  2.487   -5.422  1.00 0.00 ? 4  LYS A H    8  
ATOM   5622  H  HA   . LYS A 1 4  ? 4.091  1.305   -5.696  1.00 0.00 ? 4  LYS A HA   8  
ATOM   5623  H  HB2  . LYS A 1 4  ? 6.883  0.127   -5.558  1.00 0.00 ? 4  LYS A HB2  8  
ATOM   5624  H  HB3  . LYS A 1 4  ? 5.434  -0.775  -6.032  1.00 0.00 ? 4  LYS A HB3  8  
ATOM   5625  H  HG2  . LYS A 1 4  ? 6.478  1.685   -7.508  1.00 0.00 ? 4  LYS A HG2  8  
ATOM   5626  H  HG3  . LYS A 1 4  ? 6.864  0.017   -7.936  1.00 0.00 ? 4  LYS A HG3  8  
ATOM   5627  H  HD2  . LYS A 1 4  ? 4.496  -0.493  -8.316  1.00 0.00 ? 4  LYS A HD2  8  
ATOM   5628  H  HD3  . LYS A 1 4  ? 4.028  1.162   -7.897  1.00 0.00 ? 4  LYS A HD3  8  
ATOM   5629  H  HE2  . LYS A 1 4  ? 5.897  0.444   -10.196 1.00 0.00 ? 4  LYS A HE2  8  
ATOM   5630  H  HE3  . LYS A 1 4  ? 4.155  0.722   -10.357 1.00 0.00 ? 4  LYS A HE3  8  
ATOM   5631  H  HZ1  . LYS A 1 4  ? 4.469  2.930   -9.523  1.00 0.00 ? 4  LYS A HZ1  8  
ATOM   5632  H  HZ2  . LYS A 1 4  ? 6.094  2.700   -9.386  1.00 0.00 ? 4  LYS A HZ2  8  
ATOM   5633  H  HZ3  . LYS A 1 4  ? 5.381  2.677   -10.871 1.00 0.00 ? 4  LYS A HZ3  8  
ATOM   5634  N  N    . VAL A 1 5  ? 5.732  0.744   -2.892  1.00 0.00 ? 5  VAL A N    8  
ATOM   5635  C  CA   . VAL A 1 5  ? 5.688  0.139   -1.566  1.00 0.00 ? 5  VAL A CA   8  
ATOM   5636  C  C    . VAL A 1 5  ? 4.508  0.700   -0.767  1.00 0.00 ? 5  VAL A C    8  
ATOM   5637  O  O    . VAL A 1 5  ? 3.566  -0.033  -0.473  1.00 0.00 ? 5  VAL A O    8  
ATOM   5638  C  CB   . VAL A 1 5  ? 7.024  0.335   -0.825  1.00 0.00 ? 5  VAL A CB   8  
ATOM   5639  C  CG1  . VAL A 1 5  ? 6.988  -0.339  0.554   1.00 0.00 ? 5  VAL A CG1  8  
ATOM   5640  C  CG2  . VAL A 1 5  ? 8.199  -0.243  -1.620  1.00 0.00 ? 5  VAL A CG2  8  
ATOM   5641  H  H    . VAL A 1 5  ? 6.581  1.208   -3.175  1.00 0.00 ? 5  VAL A H    8  
ATOM   5642  H  HA   . VAL A 1 5  ? 5.539  -0.933  -1.692  1.00 0.00 ? 5  VAL A HA   8  
ATOM   5643  H  HB   . VAL A 1 5  ? 7.204  1.397   -0.680  1.00 0.00 ? 5  VAL A HB   8  
ATOM   5644  H  HG11 . VAL A 1 5  ? 6.763  -1.401  0.445   1.00 0.00 ? 5  VAL A HG11 8  
ATOM   5645  H  HG12 . VAL A 1 5  ? 7.956  -0.231  1.044   1.00 0.00 ? 5  VAL A HG12 8  
ATOM   5646  H  HG13 . VAL A 1 5  ? 6.233  0.123   1.190   1.00 0.00 ? 5  VAL A HG13 8  
ATOM   5647  H  HG21 . VAL A 1 5  ? 8.043  -1.306  -1.803  1.00 0.00 ? 5  VAL A HG21 8  
ATOM   5648  H  HG22 . VAL A 1 5  ? 8.311  0.274   -2.573  1.00 0.00 ? 5  VAL A HG22 8  
ATOM   5649  H  HG23 . VAL A 1 5  ? 9.118  -0.109  -1.047  1.00 0.00 ? 5  VAL A HG23 8  
ATOM   5650  N  N    . CYS A 1 6  ? 4.562  1.991   -0.413  1.00 0.00 ? 6  CYS A N    8  
ATOM   5651  C  CA   . CYS A 1 6  ? 3.521  2.623   0.386   1.00 0.00 ? 6  CYS A CA   8  
ATOM   5652  C  C    . CYS A 1 6  ? 2.242  2.823   -0.430  1.00 0.00 ? 6  CYS A C    8  
ATOM   5653  O  O    . CYS A 1 6  ? 1.159  2.547   0.079   1.00 0.00 ? 6  CYS A O    8  
ATOM   5654  C  CB   . CYS A 1 6  ? 4.013  3.927   1.029   1.00 0.00 ? 6  CYS A CB   8  
ATOM   5655  S  SG   . CYS A 1 6  ? 4.709  5.196   -0.062  1.00 0.00 ? 6  CYS A SG   8  
ATOM   5656  H  H    . CYS A 1 6  ? 5.361  2.544   -0.684  1.00 0.00 ? 6  CYS A H    8  
ATOM   5657  H  HA   . CYS A 1 6  ? 3.276  1.951   1.212   1.00 0.00 ? 6  CYS A HA   8  
ATOM   5658  H  HB2  . CYS A 1 6  ? 3.168  4.375   1.555   1.00 0.00 ? 6  CYS A HB2  8  
ATOM   5659  H  HB3  . CYS A 1 6  ? 4.773  3.684   1.772   1.00 0.00 ? 6  CYS A HB3  8  
ATOM   5660  N  N    . ARG A 1 7  ? 2.372  3.282   -1.685  1.00 0.00 ? 7  ARG A N    8  
ATOM   5661  C  CA   . ARG A 1 7  ? 1.275  3.537   -2.621  1.00 0.00 ? 7  ARG A CA   8  
ATOM   5662  C  C    . ARG A 1 7  ? 0.066  4.229   -1.975  1.00 0.00 ? 7  ARG A C    8  
ATOM   5663  O  O    . ARG A 1 7  ? -1.080 3.876   -2.245  1.00 0.00 ? 7  ARG A O    8  
ATOM   5664  C  CB   . ARG A 1 7  ? 0.931  2.274   -3.431  1.00 0.00 ? 7  ARG A CB   8  
ATOM   5665  C  CG   . ARG A 1 7  ? 0.550  1.054   -2.584  1.00 0.00 ? 7  ARG A CG   8  
ATOM   5666  C  CD   . ARG A 1 7  ? 0.197  -0.129  -3.490  1.00 0.00 ? 7  ARG A CD   8  
ATOM   5667  N  NE   . ARG A 1 7  ? -0.096 -1.337  -2.705  1.00 0.00 ? 7  ARG A NE   8  
ATOM   5668  C  CZ   . ARG A 1 7  ? 0.819  -2.157  -2.158  1.00 0.00 ? 7  ARG A CZ   8  
ATOM   5669  N  NH1  . ARG A 1 7  ? 2.132  -1.928  -2.295  1.00 0.00 ? 7  ARG A NH1  8  
ATOM   5670  N  NH2  . ARG A 1 7  ? 0.409  -3.226  -1.461  1.00 0.00 ? 7  ARG A NH2  8  
ATOM   5671  H  H    . ARG A 1 7  ? 3.305  3.440   -2.040  1.00 0.00 ? 7  ARG A H    8  
ATOM   5672  H  HA   . ARG A 1 7  ? 1.652  4.255   -3.347  1.00 0.00 ? 7  ARG A HA   8  
ATOM   5673  H  HB2  . ARG A 1 7  ? 0.114  2.505   -4.117  1.00 0.00 ? 7  ARG A HB2  8  
ATOM   5674  H  HB3  . ARG A 1 7  ? 1.801  2.010   -4.032  1.00 0.00 ? 7  ARG A HB3  8  
ATOM   5675  H  HG2  . ARG A 1 7  ? 1.392  0.769   -1.957  1.00 0.00 ? 7  ARG A HG2  8  
ATOM   5676  H  HG3  . ARG A 1 7  ? -0.305 1.290   -1.950  1.00 0.00 ? 7  ARG A HG3  8  
ATOM   5677  H  HD2  . ARG A 1 7  ? -0.690 0.125   -4.072  1.00 0.00 ? 7  ARG A HD2  8  
ATOM   5678  H  HD3  . ARG A 1 7  ? 1.013  -0.326  -4.187  1.00 0.00 ? 7  ARG A HD3  8  
ATOM   5679  H  HE   . ARG A 1 7  ? -1.073 -1.555  -2.573  1.00 0.00 ? 7  ARG A HE   8  
ATOM   5680  H  HH11 . ARG A 1 7  ? 2.465  -1.109  -2.792  1.00 0.00 ? 7  ARG A HH11 8  
ATOM   5681  H  HH12 . ARG A 1 7  ? 2.805  -2.540  -1.860  1.00 0.00 ? 7  ARG A HH12 8  
ATOM   5682  H  HH21 . ARG A 1 7  ? -0.577 -3.411  -1.349  1.00 0.00 ? 7  ARG A HH21 8  
ATOM   5683  H  HH22 . ARG A 1 7  ? 1.084  -3.849  -1.042  1.00 0.00 ? 7  ARG A HH22 8  
ATOM   5684  N  N    . LYS A 1 8  ? 0.344  5.234   -1.136  1.00 0.00 ? 8  LYS A N    8  
ATOM   5685  C  CA   . LYS A 1 8  ? -0.620 6.168   -0.575  1.00 0.00 ? 8  LYS A CA   8  
ATOM   5686  C  C    . LYS A 1 8  ? 0.041  7.546   -0.548  1.00 0.00 ? 8  LYS A C    8  
ATOM   5687  O  O    . LYS A 1 8  ? 1.249  7.643   -0.332  1.00 0.00 ? 8  LYS A O    8  
ATOM   5688  C  CB   . LYS A 1 8  ? -1.008 5.755   0.853   1.00 0.00 ? 8  LYS A CB   8  
ATOM   5689  C  CG   . LYS A 1 8  ? -1.765 4.423   0.962   1.00 0.00 ? 8  LYS A CG   8  
ATOM   5690  C  CD   . LYS A 1 8  ? -3.173 4.493   0.357   1.00 0.00 ? 8  LYS A CD   8  
ATOM   5691  C  CE   . LYS A 1 8  ? -3.905 3.167   0.579   1.00 0.00 ? 8  LYS A CE   8  
ATOM   5692  N  NZ   . LYS A 1 8  ? -5.259 3.193   -0.002  1.00 0.00 ? 8  LYS A NZ   8  
ATOM   5693  H  H    . LYS A 1 8  ? 1.313  5.423   -0.924  1.00 0.00 ? 8  LYS A H    8  
ATOM   5694  H  HA   . LYS A 1 8  ? -1.508 6.221   -1.200  1.00 0.00 ? 8  LYS A HA   8  
ATOM   5695  H  HB2  . LYS A 1 8  ? -0.090 5.672   1.436   1.00 0.00 ? 8  LYS A HB2  8  
ATOM   5696  H  HB3  . LYS A 1 8  ? -1.628 6.540   1.292   1.00 0.00 ? 8  LYS A HB3  8  
ATOM   5697  H  HG2  . LYS A 1 8  ? -1.196 3.627   0.486   1.00 0.00 ? 8  LYS A HG2  8  
ATOM   5698  H  HG3  . LYS A 1 8  ? -1.858 4.184   2.022   1.00 0.00 ? 8  LYS A HG3  8  
ATOM   5699  H  HD2  . LYS A 1 8  ? -3.730 5.301   0.835   1.00 0.00 ? 8  LYS A HD2  8  
ATOM   5700  H  HD3  . LYS A 1 8  ? -3.110 4.689   -0.714  1.00 0.00 ? 8  LYS A HD3  8  
ATOM   5701  H  HE2  . LYS A 1 8  ? -3.339 2.360   0.111   1.00 0.00 ? 8  LYS A HE2  8  
ATOM   5702  H  HE3  . LYS A 1 8  ? -3.984 2.969   1.648   1.00 0.00 ? 8  LYS A HE3  8  
ATOM   5703  H  HZ1  . LYS A 1 8  ? -5.799 3.931   0.428   1.00 0.00 ? 8  LYS A HZ1  8  
ATOM   5704  H  HZ2  . LYS A 1 8  ? -5.199 3.356   -0.997  1.00 0.00 ? 8  LYS A HZ2  8  
ATOM   5705  H  HZ3  . LYS A 1 8  ? -5.715 2.307   0.165   1.00 0.00 ? 8  LYS A HZ3  8  
ATOM   5706  N  N    . LYS A 1 9  ? -0.746 8.608   -0.760  1.00 0.00 ? 9  LYS A N    8  
ATOM   5707  C  CA   . LYS A 1 9  ? -0.237 9.970   -0.807  1.00 0.00 ? 9  LYS A CA   8  
ATOM   5708  C  C    . LYS A 1 9  ? 0.210  10.379  0.597   1.00 0.00 ? 9  LYS A C    8  
ATOM   5709  O  O    . LYS A 1 9  ? -0.507 10.147  1.569   1.00 0.00 ? 9  LYS A O    8  
ATOM   5710  C  CB   . LYS A 1 9  ? -1.322 10.903  -1.370  1.00 0.00 ? 9  LYS A CB   8  
ATOM   5711  C  CG   . LYS A 1 9  ? -0.815 12.327  -1.652  1.00 0.00 ? 9  LYS A CG   8  
ATOM   5712  C  CD   . LYS A 1 9  ? -0.945 13.278  -0.449  1.00 0.00 ? 9  LYS A CD   8  
ATOM   5713  C  CE   . LYS A 1 9  ? -0.168 14.581  -0.672  1.00 0.00 ? 9  LYS A CE   8  
ATOM   5714  N  NZ   . LYS A 1 9  ? 1.290  14.389  -0.556  1.00 0.00 ? 9  LYS A NZ   8  
ATOM   5715  H  H    . LYS A 1 9  ? -1.738 8.469   -0.892  1.00 0.00 ? 9  LYS A H    8  
ATOM   5716  H  HA   . LYS A 1 9  ? 0.617  9.990   -1.486  1.00 0.00 ? 9  LYS A HA   8  
ATOM   5717  H  HB2  . LYS A 1 9  ? -1.644 10.482  -2.326  1.00 0.00 ? 9  LYS A HB2  8  
ATOM   5718  H  HB3  . LYS A 1 9  ? -2.182 10.940  -0.698  1.00 0.00 ? 9  LYS A HB3  8  
ATOM   5719  H  HG2  . LYS A 1 9  ? 0.213  12.272  -2.003  1.00 0.00 ? 9  LYS A HG2  8  
ATOM   5720  H  HG3  . LYS A 1 9  ? -1.415 12.747  -2.461  1.00 0.00 ? 9  LYS A HG3  8  
ATOM   5721  H  HD2  . LYS A 1 9  ? -2.003 13.517  -0.322  1.00 0.00 ? 9  LYS A HD2  8  
ATOM   5722  H  HD3  . LYS A 1 9  ? -0.596 12.821  0.474   1.00 0.00 ? 9  LYS A HD3  8  
ATOM   5723  H  HE2  . LYS A 1 9  ? -0.405 14.984  -1.657  1.00 0.00 ? 9  LYS A HE2  8  
ATOM   5724  H  HE3  . LYS A 1 9  ? -0.475 15.306  0.084   1.00 0.00 ? 9  LYS A HE3  8  
ATOM   5725  H  HZ1  . LYS A 1 9  ? 1.767  15.257  -0.754  1.00 0.00 ? 9  LYS A HZ1  8  
ATOM   5726  H  HZ2  . LYS A 1 9  ? 1.537  14.087  0.379   1.00 0.00 ? 9  LYS A HZ2  8  
ATOM   5727  H  HZ3  . LYS A 1 9  ? 1.611  13.680  -1.205  1.00 0.00 ? 9  LYS A HZ3  8  
ATOM   5728  N  N    . GLY A 1 10 ? 1.401  10.976  0.699   1.00 0.00 ? 10 GLY A N    8  
ATOM   5729  C  CA   . GLY A 1 10 ? 1.977  11.376  1.970   1.00 0.00 ? 10 GLY A CA   8  
ATOM   5730  C  C    . GLY A 1 10 ? 3.256  12.163  1.716   1.00 0.00 ? 10 GLY A C    8  
ATOM   5731  O  O    . GLY A 1 10 ? 3.189  13.332  1.335   1.00 0.00 ? 10 GLY A O    8  
ATOM   5732  H  H    . GLY A 1 10 ? 1.922  11.192  -0.144  1.00 0.00 ? 10 GLY A H    8  
ATOM   5733  H  HA2  . GLY A 1 10 ? 1.272  12.014  2.506   1.00 0.00 ? 10 GLY A HA2  8  
ATOM   5734  H  HA3  . GLY A 1 10 ? 2.190  10.489  2.571   1.00 0.00 ? 10 GLY A HA3  8  
ATOM   5735  N  N    . GLU A 1 11 ? 4.412  11.517  1.907   1.00 0.00 ? 11 GLU A N    8  
ATOM   5736  C  CA   . GLU A 1 11 ? 5.720  12.123  1.709   1.00 0.00 ? 11 GLU A CA   8  
ATOM   5737  C  C    . GLU A 1 11 ? 6.094  12.065  0.226   1.00 0.00 ? 11 GLU A C    8  
ATOM   5738  O  O    . GLU A 1 11 ? 7.033  11.370  -0.155  1.00 0.00 ? 11 GLU A O    8  
ATOM   5739  C  CB   . GLU A 1 11 ? 6.769  11.406  2.569   1.00 0.00 ? 11 GLU A CB   8  
ATOM   5740  C  CG   . GLU A 1 11 ? 6.440  11.407  4.064   1.00 0.00 ? 11 GLU A CG   8  
ATOM   5741  C  CD   . GLU A 1 11 ? 7.550  10.710  4.847   1.00 0.00 ? 11 GLU A CD   8  
ATOM   5742  O  OE1  . GLU A 1 11 ? 7.588  9.462   4.784   1.00 0.00 ? 11 GLU A OE1  8  
ATOM   5743  O  OE2  . GLU A 1 11 ? 8.342  11.437  5.484   1.00 0.00 ? 11 GLU A OE2  8  
ATOM   5744  H  H    . GLU A 1 11 ? 4.389  10.558  2.222   1.00 0.00 ? 11 GLU A H    8  
ATOM   5745  H  HA   . GLU A 1 11 ? 5.698  13.165  2.027   1.00 0.00 ? 11 GLU A HA   8  
ATOM   5746  H  HB2  . GLU A 1 11 ? 6.866  10.373  2.232   1.00 0.00 ? 11 GLU A HB2  8  
ATOM   5747  H  HB3  . GLU A 1 11 ? 7.722  11.919  2.438   1.00 0.00 ? 11 GLU A HB3  8  
ATOM   5748  H  HG2  . GLU A 1 11 ? 6.339  12.435  4.412   1.00 0.00 ? 11 GLU A HG2  8  
ATOM   5749  H  HG3  . GLU A 1 11 ? 5.503  10.879  4.247   1.00 0.00 ? 11 GLU A HG3  8  
ATOM   5750  N  N    . ASP A 1 12 ? 5.367  12.810  -0.614  1.00 0.00 ? 12 ASP A N    8  
ATOM   5751  C  CA   . ASP A 1 12 ? 5.645  12.927  -2.041  1.00 0.00 ? 12 ASP A CA   8  
ATOM   5752  C  C    . ASP A 1 12 ? 6.787  13.927  -2.256  1.00 0.00 ? 12 ASP A C    8  
ATOM   5753  O  O    . ASP A 1 12 ? 6.614  14.959  -2.903  1.00 0.00 ? 12 ASP A O    8  
ATOM   5754  C  CB   . ASP A 1 12 ? 4.362  13.310  -2.790  1.00 0.00 ? 12 ASP A CB   8  
ATOM   5755  C  CG   . ASP A 1 12 ? 3.291  12.233  -2.647  1.00 0.00 ? 12 ASP A CG   8  
ATOM   5756  O  OD1  . ASP A 1 12 ? 2.659  12.190  -1.569  1.00 0.00 ? 12 ASP A OD1  8  
ATOM   5757  O  OD2  . ASP A 1 12 ? 3.129  11.439  -3.598  1.00 0.00 ? 12 ASP A OD2  8  
ATOM   5758  H  H    . ASP A 1 12 ? 4.578  13.322  -0.242  1.00 0.00 ? 12 ASP A H    8  
ATOM   5759  H  HA   . ASP A 1 12 ? 5.963  11.960  -2.430  1.00 0.00 ? 12 ASP A HA   8  
ATOM   5760  H  HB2  . ASP A 1 12 ? 3.982  14.253  -2.395  1.00 0.00 ? 12 ASP A HB2  8  
ATOM   5761  H  HB3  . ASP A 1 12 ? 4.591  13.436  -3.850  1.00 0.00 ? 12 ASP A HB3  8  
ATOM   5762  N  N    . ASP A 1 13 ? 7.958  13.598  -1.699  1.00 0.00 ? 13 ASP A N    8  
ATOM   5763  C  CA   . ASP A 1 13 ? 9.114  14.471  -1.585  1.00 0.00 ? 13 ASP A CA   8  
ATOM   5764  C  C    . ASP A 1 13 ? 10.031 14.259  -2.788  1.00 0.00 ? 13 ASP A C    8  
ATOM   5765  O  O    . ASP A 1 13 ? 10.132 15.124  -3.656  1.00 0.00 ? 13 ASP A O    8  
ATOM   5766  C  CB   . ASP A 1 13 ? 9.818  14.176  -0.251  1.00 0.00 ? 13 ASP A CB   8  
ATOM   5767  C  CG   . ASP A 1 13 ? 11.167 14.877  -0.126  1.00 0.00 ? 13 ASP A CG   8  
ATOM   5768  O  OD1  . ASP A 1 13 ? 11.188 16.119  -0.257  1.00 0.00 ? 13 ASP A OD1  8  
ATOM   5769  O  OD2  . ASP A 1 13 ? 12.165 14.152  0.080   1.00 0.00 ? 13 ASP A OD2  8  
ATOM   5770  H  H    . ASP A 1 13 ? 8.014  12.706  -1.226  1.00 0.00 ? 13 ASP A H    8  
ATOM   5771  H  HA   . ASP A 1 13 ? 8.799  15.511  -1.570  1.00 0.00 ? 13 ASP A HA   8  
ATOM   5772  H  HB2  . ASP A 1 13 ? 9.175  14.495  0.572   1.00 0.00 ? 13 ASP A HB2  8  
ATOM   5773  H  HB3  . ASP A 1 13 ? 9.974  13.103  -0.160  1.00 0.00 ? 13 ASP A HB3  8  
ATOM   5774  N  N    . LYS A 1 14 ? 10.699 13.103  -2.820  1.00 0.00 ? 14 LYS A N    8  
ATOM   5775  C  CA   . LYS A 1 14 ? 11.705 12.744  -3.804  1.00 0.00 ? 14 LYS A CA   8  
ATOM   5776  C  C    . LYS A 1 14 ? 11.556 11.256  -4.109  1.00 0.00 ? 14 LYS A C    8  
ATOM   5777  O  O    . LYS A 1 14 ? 12.191 10.413  -3.476  1.00 0.00 ? 14 LYS A O    8  
ATOM   5778  C  CB   . LYS A 1 14 ? 13.111 13.095  -3.298  1.00 0.00 ? 14 LYS A CB   8  
ATOM   5779  C  CG   . LYS A 1 14 ? 13.312 14.615  -3.204  1.00 0.00 ? 14 LYS A CG   8  
ATOM   5780  C  CD   . LYS A 1 14 ? 14.782 15.006  -3.017  1.00 0.00 ? 14 LYS A CD   8  
ATOM   5781  C  CE   . LYS A 1 14 ? 15.435 14.432  -1.754  1.00 0.00 ? 14 LYS A CE   8  
ATOM   5782  N  NZ   . LYS A 1 14 ? 14.798 14.900  -0.510  1.00 0.00 ? 14 LYS A NZ   8  
ATOM   5783  H  H    . LYS A 1 14 ? 10.514 12.440  -2.084  1.00 0.00 ? 14 LYS A H    8  
ATOM   5784  H  HA   . LYS A 1 14 ? 11.540 13.292  -4.732  1.00 0.00 ? 14 LYS A HA   8  
ATOM   5785  H  HB2  . LYS A 1 14 ? 13.263 12.636  -2.321  1.00 0.00 ? 14 LYS A HB2  8  
ATOM   5786  H  HB3  . LYS A 1 14 ? 13.839 12.691  -4.005  1.00 0.00 ? 14 LYS A HB3  8  
ATOM   5787  H  HG2  . LYS A 1 14 ? 12.968 15.073  -4.132  1.00 0.00 ? 14 LYS A HG2  8  
ATOM   5788  H  HG3  . LYS A 1 14 ? 12.720 15.024  -2.388  1.00 0.00 ? 14 LYS A HG3  8  
ATOM   5789  H  HD2  . LYS A 1 14 ? 15.346 14.660  -3.883  1.00 0.00 ? 14 LYS A HD2  8  
ATOM   5790  H  HD3  . LYS A 1 14 ? 14.847 16.095  -2.984  1.00 0.00 ? 14 LYS A HD3  8  
ATOM   5791  H  HE2  . LYS A 1 14 ? 15.420 13.343  -1.781  1.00 0.00 ? 14 LYS A HE2  8  
ATOM   5792  H  HE3  . LYS A 1 14 ? 16.471 14.766  -1.745  1.00 0.00 ? 14 LYS A HE3  8  
ATOM   5793  H  HZ1  . LYS A 1 14 ? 14.726 15.907  -0.516  1.00 0.00 ? 14 LYS A HZ1  8  
ATOM   5794  H  HZ2  . LYS A 1 14 ? 13.873 14.500  -0.408  1.00 0.00 ? 14 LYS A HZ2  8  
ATOM   5795  H  HZ3  . LYS A 1 14 ? 15.376 14.623  0.279   1.00 0.00 ? 14 LYS A HZ3  8  
ATOM   5796  N  N    . LEU A 1 15 ? 10.700 10.949  -5.088  1.00 0.00 ? 15 LEU A N    8  
ATOM   5797  C  CA   . LEU A 1 15 ? 10.486 9.599   -5.583  1.00 0.00 ? 15 LEU A CA   8  
ATOM   5798  C  C    . LEU A 1 15 ? 11.738 9.149   -6.338  1.00 0.00 ? 15 LEU A C    8  
ATOM   5799  O  O    . LEU A 1 15 ? 12.128 9.776   -7.322  1.00 0.00 ? 15 LEU A O    8  
ATOM   5800  C  CB   . LEU A 1 15 ? 9.261  9.560   -6.513  1.00 0.00 ? 15 LEU A CB   8  
ATOM   5801  C  CG   . LEU A 1 15 ? 7.887  9.592   -5.817  1.00 0.00 ? 15 LEU A CG   8  
ATOM   5802  C  CD1  . LEU A 1 15 ? 7.597  8.289   -5.065  1.00 0.00 ? 15 LEU A CD1  8  
ATOM   5803  C  CD2  . LEU A 1 15 ? 7.683  10.801  -4.898  1.00 0.00 ? 15 LEU A CD2  8  
ATOM   5804  H  H    . LEU A 1 15 ? 10.184 11.699  -5.523  1.00 0.00 ? 15 LEU A H    8  
ATOM   5805  H  HA   . LEU A 1 15 ? 10.321 8.937   -4.735  1.00 0.00 ? 15 LEU A HA   8  
ATOM   5806  H  HB2  . LEU A 1 15 ? 9.321  10.401  -7.207  1.00 0.00 ? 15 LEU A HB2  8  
ATOM   5807  H  HB3  . LEU A 1 15 ? 9.304  8.636   -7.094  1.00 0.00 ? 15 LEU A HB3  8  
ATOM   5808  H  HG   . LEU A 1 15 ? 7.145  9.667   -6.610  1.00 0.00 ? 15 LEU A HG   8  
ATOM   5809  H  HD11 . LEU A 1 15 ? 8.309  8.139   -4.256  1.00 0.00 ? 15 LEU A HD11 8  
ATOM   5810  H  HD12 . LEU A 1 15 ? 6.592  8.335   -4.645  1.00 0.00 ? 15 LEU A HD12 8  
ATOM   5811  H  HD13 . LEU A 1 15 ? 7.656  7.446   -5.752  1.00 0.00 ? 15 LEU A HD13 8  
ATOM   5812  H  HD21 . LEU A 1 15 ? 7.909  11.720  -5.438  1.00 0.00 ? 15 LEU A HD21 8  
ATOM   5813  H  HD22 . LEU A 1 15 ? 6.642  10.834  -4.574  1.00 0.00 ? 15 LEU A HD22 8  
ATOM   5814  H  HD23 . LEU A 1 15 ? 8.317  10.728  -4.016  1.00 0.00 ? 15 LEU A HD23 8  
ATOM   5815  N  N    . ILE A 1 16 ? 12.367 8.072   -5.855  1.00 0.00 ? 16 ILE A N    8  
ATOM   5816  C  CA   . ILE A 1 16 ? 13.549 7.459   -6.444  1.00 0.00 ? 16 ILE A CA   8  
ATOM   5817  C  C    . ILE A 1 16 ? 13.114 6.233   -7.248  1.00 0.00 ? 16 ILE A C    8  
ATOM   5818  O  O    . ILE A 1 16 ? 12.480 5.329   -6.709  1.00 0.00 ? 16 ILE A O    8  
ATOM   5819  C  CB   . ILE A 1 16 ? 14.589 7.146   -5.347  1.00 0.00 ? 16 ILE A CB   8  
ATOM   5820  C  CG1  . ILE A 1 16 ? 15.823 6.462   -5.960  1.00 0.00 ? 16 ILE A CG1  8  
ATOM   5821  C  CG2  . ILE A 1 16 ? 14.034 6.315   -4.182  1.00 0.00 ? 16 ILE A CG2  8  
ATOM   5822  C  CD1  . ILE A 1 16 ? 16.980 6.360   -4.962  1.00 0.00 ? 16 ILE A CD1  8  
ATOM   5823  H  H    . ILE A 1 16 ? 11.928 7.577   -5.091  1.00 0.00 ? 16 ILE A H    8  
ATOM   5824  H  HA   . ILE A 1 16 ? 14.020 8.170   -7.125  1.00 0.00 ? 16 ILE A HA   8  
ATOM   5825  H  HB   . ILE A 1 16 ? 14.906 8.105   -4.934  1.00 0.00 ? 16 ILE A HB   8  
ATOM   5826  H  HG12 . ILE A 1 16 ? 15.565 5.458   -6.302  1.00 0.00 ? 16 ILE A HG12 8  
ATOM   5827  H  HG13 . ILE A 1 16 ? 16.164 7.056   -6.810  1.00 0.00 ? 16 ILE A HG13 8  
ATOM   5828  H  HG21 . ILE A 1 16 ? 13.759 5.317   -4.515  1.00 0.00 ? 16 ILE A HG21 8  
ATOM   5829  H  HG22 . ILE A 1 16 ? 14.785 6.224   -3.401  1.00 0.00 ? 16 ILE A HG22 8  
ATOM   5830  H  HG23 . ILE A 1 16 ? 13.171 6.804   -3.738  1.00 0.00 ? 16 ILE A HG23 8  
ATOM   5831  H  HD11 . ILE A 1 16 ? 17.892 6.098   -5.495  1.00 0.00 ? 16 ILE A HD11 8  
ATOM   5832  H  HD12 . ILE A 1 16 ? 17.126 7.317   -4.461  1.00 0.00 ? 16 ILE A HD12 8  
ATOM   5833  H  HD13 . ILE A 1 16 ? 16.781 5.587   -4.220  1.00 0.00 ? 16 ILE A HD13 8  
ATOM   5834  N  N    . LEU A 1 17 ? 13.428 6.214   -8.547  1.00 0.00 ? 17 LEU A N    8  
ATOM   5835  C  CA   . LEU A 1 17 ? 13.227 5.064   -9.415  1.00 0.00 ? 17 LEU A CA   8  
ATOM   5836  C  C    . LEU A 1 17 ? 14.454 4.153   -9.361  1.00 0.00 ? 17 LEU A C    8  
ATOM   5837  O  O    . LEU A 1 17 ? 15.581 4.639   -9.307  1.00 0.00 ? 17 LEU A O    8  
ATOM   5838  C  CB   . LEU A 1 17 ? 13.007 5.557   -10.852 1.00 0.00 ? 17 LEU A CB   8  
ATOM   5839  C  CG   . LEU A 1 17 ? 11.606 6.149   -11.071 1.00 0.00 ? 17 LEU A CG   8  
ATOM   5840  C  CD1  . LEU A 1 17 ? 11.631 7.136   -12.243 1.00 0.00 ? 17 LEU A CD1  8  
ATOM   5841  C  CD2  . LEU A 1 17 ? 10.592 5.040   -11.379 1.00 0.00 ? 17 LEU A CD2  8  
ATOM   5842  H  H    . LEU A 1 17 ? 13.933 6.993   -8.941  1.00 0.00 ? 17 LEU A H    8  
ATOM   5843  H  HA   . LEU A 1 17 ? 12.352 4.501   -9.096  1.00 0.00 ? 17 LEU A HA   8  
ATOM   5844  H  HB2  . LEU A 1 17 ? 13.759 6.321   -11.060 1.00 0.00 ? 17 LEU A HB2  8  
ATOM   5845  H  HB3  . LEU A 1 17 ? 13.156 4.731   -11.548 1.00 0.00 ? 17 LEU A HB3  8  
ATOM   5846  H  HG   . LEU A 1 17 ? 11.289 6.689   -10.178 1.00 0.00 ? 17 LEU A HG   8  
ATOM   5847  H  HD11 . LEU A 1 17 ? 11.972 6.633   -13.149 1.00 0.00 ? 17 LEU A HD11 8  
ATOM   5848  H  HD12 . LEU A 1 17 ? 10.630 7.536   -12.410 1.00 0.00 ? 17 LEU A HD12 8  
ATOM   5849  H  HD13 . LEU A 1 17 ? 12.304 7.963   -12.016 1.00 0.00 ? 17 LEU A HD13 8  
ATOM   5850  H  HD21 . LEU A 1 17 ? 9.594  5.470   -11.478 1.00 0.00 ? 17 LEU A HD21 8  
ATOM   5851  H  HD22 . LEU A 1 17 ? 10.856 4.536   -12.309 1.00 0.00 ? 17 LEU A HD22 8  
ATOM   5852  H  HD23 . LEU A 1 17 ? 10.581 4.308   -10.575 1.00 0.00 ? 17 LEU A HD23 8  
ATOM   5853  N  N    . CYS A 1 18 ? 14.231 2.832   -9.370  1.00 0.00 ? 18 CYS A N    8  
ATOM   5854  C  CA   . CYS A 1 18 ? 15.307 1.869   -9.560  1.00 0.00 ? 18 CYS A CA   8  
ATOM   5855  C  C    . CYS A 1 18 ? 15.716 1.867   -11.030 1.00 0.00 ? 18 CYS A C    8  
ATOM   5856  O  O    . CYS A 1 18 ? 14.858 1.783   -11.905 1.00 0.00 ? 18 CYS A O    8  
ATOM   5857  C  CB   . CYS A 1 18 ? 14.873 0.472   -9.117  1.00 0.00 ? 18 CYS A CB   8  
ATOM   5858  S  SG   . CYS A 1 18 ? 16.052 -0.810  -9.611  1.00 0.00 ? 18 CYS A SG   8  
ATOM   5859  H  H    . CYS A 1 18 ? 13.275 2.494   -9.349  1.00 0.00 ? 18 CYS A H    8  
ATOM   5860  H  HA   . CYS A 1 18 ? 16.176 2.139   -8.962  1.00 0.00 ? 18 CYS A HA   8  
ATOM   5861  H  HB2  . CYS A 1 18 ? 14.784 0.470   -8.031  1.00 0.00 ? 18 CYS A HB2  8  
ATOM   5862  H  HB3  . CYS A 1 18 ? 13.899 0.221   -9.542  1.00 0.00 ? 18 CYS A HB3  8  
ATOM   5863  N  N    . ASP A 1 19 ? 17.021 1.954   -11.300 1.00 0.00 ? 19 ASP A N    8  
ATOM   5864  C  CA   . ASP A 1 19 ? 17.524 2.178   -12.650 1.00 0.00 ? 19 ASP A CA   8  
ATOM   5865  C  C    . ASP A 1 19 ? 17.305 0.931   -13.507 1.00 0.00 ? 19 ASP A C    8  
ATOM   5866  O  O    . ASP A 1 19 ? 16.946 1.037   -14.680 1.00 0.00 ? 19 ASP A O    8  
ATOM   5867  C  CB   . ASP A 1 19 ? 19.004 2.580   -12.608 1.00 0.00 ? 19 ASP A CB   8  
ATOM   5868  C  CG   . ASP A 1 19 ? 19.194 4.008   -12.101 1.00 0.00 ? 19 ASP A CG   8  
ATOM   5869  O  OD1  . ASP A 1 19 ? 18.762 4.282   -10.960 1.00 0.00 ? 19 ASP A OD1  8  
ATOM   5870  O  OD2  . ASP A 1 19 ? 19.775 4.810   -12.863 1.00 0.00 ? 19 ASP A OD2  8  
ATOM   5871  H  H    . ASP A 1 19 ? 17.693 1.880   -10.542 1.00 0.00 ? 19 ASP A H    8  
ATOM   5872  H  HA   . ASP A 1 19 ? 16.964 2.994   -13.106 1.00 0.00 ? 19 ASP A HA   8  
ATOM   5873  H  HB2  . ASP A 1 19 ? 19.564 1.888   -11.978 1.00 0.00 ? 19 ASP A HB2  8  
ATOM   5874  H  HB3  . ASP A 1 19 ? 19.408 2.522   -13.620 1.00 0.00 ? 19 ASP A HB3  8  
ATOM   5875  N  N    . GLU A 1 20 ? 17.502 -0.245  -12.905 1.00 0.00 ? 20 GLU A N    8  
ATOM   5876  C  CA   . GLU A 1 20 ? 17.401 -1.532  -13.567 1.00 0.00 ? 20 GLU A CA   8  
ATOM   5877  C  C    . GLU A 1 20 ? 15.954 -1.823  -13.973 1.00 0.00 ? 20 GLU A C    8  
ATOM   5878  O  O    . GLU A 1 20 ? 15.655 -1.898  -15.163 1.00 0.00 ? 20 GLU A O    8  
ATOM   5879  C  CB   . GLU A 1 20 ? 17.947 -2.620  -12.635 1.00 0.00 ? 20 GLU A CB   8  
ATOM   5880  C  CG   . GLU A 1 20 ? 19.438 -2.425  -12.342 1.00 0.00 ? 20 GLU A CG   8  
ATOM   5881  C  CD   . GLU A 1 20 ? 19.951 -3.527  -11.424 1.00 0.00 ? 20 GLU A CD   8  
ATOM   5882  O  OE1  . GLU A 1 20 ? 19.625 -3.456  -10.220 1.00 0.00 ? 20 GLU A OE1  8  
ATOM   5883  O  OE2  . GLU A 1 20 ? 20.655 -4.423  -11.937 1.00 0.00 ? 20 GLU A OE2  8  
ATOM   5884  H  H    . GLU A 1 20 ? 17.805 -0.244  -11.944 1.00 0.00 ? 20 GLU A H    8  
ATOM   5885  H  HA   . GLU A 1 20 ? 18.017 -1.514  -14.468 1.00 0.00 ? 20 GLU A HA   8  
ATOM   5886  H  HB2  . GLU A 1 20 ? 17.400 -2.610  -11.690 1.00 0.00 ? 20 GLU A HB2  8  
ATOM   5887  H  HB3  . GLU A 1 20 ? 17.812 -3.591  -13.111 1.00 0.00 ? 20 GLU A HB3  8  
ATOM   5888  H  HG2  . GLU A 1 20 ? 19.998 -2.441  -13.278 1.00 0.00 ? 20 GLU A HG2  8  
ATOM   5889  H  HG3  . GLU A 1 20 ? 19.606 -1.466  -11.852 1.00 0.00 ? 20 GLU A HG3  8  
ATOM   5890  N  N    . CYS A 1 21 ? 15.060 -2.000  -12.989 1.00 0.00 ? 21 CYS A N    8  
ATOM   5891  C  CA   . CYS A 1 21 ? 13.710 -2.500  -13.235 1.00 0.00 ? 21 CYS A CA   8  
ATOM   5892  C  C    . CYS A 1 21 ? 12.681 -1.383  -13.427 1.00 0.00 ? 21 CYS A C    8  
ATOM   5893  O  O    . CYS A 1 21 ? 11.559 -1.678  -13.835 1.00 0.00 ? 21 CYS A O    8  
ATOM   5894  C  CB   . CYS A 1 21 ? 13.273 -3.473  -12.133 1.00 0.00 ? 21 CYS A CB   8  
ATOM   5895  S  SG   . CYS A 1 21 ? 13.042 -2.771  -10.481 1.00 0.00 ? 21 CYS A SG   8  
ATOM   5896  H  H    . CYS A 1 21 ? 15.335 -1.803  -12.038 1.00 0.00 ? 21 CYS A H    8  
ATOM   5897  H  HA   . CYS A 1 21 ? 13.716 -3.086  -14.156 1.00 0.00 ? 21 CYS A HA   8  
ATOM   5898  H  HB2  . CYS A 1 21 ? 12.314 -3.901  -12.433 1.00 0.00 ? 21 CYS A HB2  8  
ATOM   5899  H  HB3  . CYS A 1 21 ? 14.000 -4.283  -12.063 1.00 0.00 ? 21 CYS A HB3  8  
ATOM   5900  N  N    . ASN A 1 22 ? 13.037 -0.122  -13.140 1.00 0.00 ? 22 ASN A N    8  
ATOM   5901  C  CA   . ASN A 1 22 ? 12.187 1.040   -13.385 1.00 0.00 ? 22 ASN A CA   8  
ATOM   5902  C  C    . ASN A 1 22 ? 10.888 0.915   -12.591 1.00 0.00 ? 22 ASN A C    8  
ATOM   5903  O  O    . ASN A 1 22 ? 9.797  0.872   -13.159 1.00 0.00 ? 22 ASN A O    8  
ATOM   5904  C  CB   . ASN A 1 22 ? 11.990 1.278   -14.889 1.00 0.00 ? 22 ASN A CB   8  
ATOM   5905  C  CG   . ASN A 1 22 ? 13.308 1.661   -15.566 1.00 0.00 ? 22 ASN A CG   8  
ATOM   5906  O  OD1  . ASN A 1 22 ? 13.546 2.835   -15.836 1.00 0.00 ? 22 ASN A OD1  8  
ATOM   5907  N  ND2  . ASN A 1 22 ? 14.182 0.683   -15.818 1.00 0.00 ? 22 ASN A ND2  8  
ATOM   5908  H  H    . ASN A 1 22 ? 13.965 0.066   -12.783 1.00 0.00 ? 22 ASN A H    8  
ATOM   5909  H  HA   . ASN A 1 22 ? 12.686 1.928   -13.006 1.00 0.00 ? 22 ASN A HA   8  
ATOM   5910  H  HB2  . ASN A 1 22 ? 11.571 0.394   -15.371 1.00 0.00 ? 22 ASN A HB2  8  
ATOM   5911  H  HB3  . ASN A 1 22 ? 11.294 2.109   -15.022 1.00 0.00 ? 22 ASN A HB3  8  
ATOM   5912  H  HD21 . ASN A 1 22 ? 13.957 -0.278  -15.592 1.00 0.00 ? 22 ASN A HD21 8  
ATOM   5913  H  HD22 . ASN A 1 22 ? 15.112 0.923   -16.137 1.00 0.00 ? 22 ASN A HD22 8  
ATOM   5914  N  N    . LYS A 1 23 ? 11.032 0.839   -11.262 1.00 0.00 ? 23 LYS A N    8  
ATOM   5915  C  CA   . LYS A 1 23 ? 9.960  0.799   -10.292 1.00 0.00 ? 23 LYS A CA   8  
ATOM   5916  C  C    . LYS A 1 23 ? 10.225 1.876   -9.241  1.00 0.00 ? 23 LYS A C    8  
ATOM   5917  O  O    . LYS A 1 23 ? 11.374 2.106   -8.864  1.00 0.00 ? 23 LYS A O    8  
ATOM   5918  C  CB   . LYS A 1 23 ? 9.939  -0.593  -9.657  1.00 0.00 ? 23 LYS A CB   8  
ATOM   5919  C  CG   . LYS A 1 23 ? 9.659  -1.724  -10.661 1.00 0.00 ? 23 LYS A CG   8  
ATOM   5920  C  CD   . LYS A 1 23 ? 8.243  -1.678  -11.256 1.00 0.00 ? 23 LYS A CD   8  
ATOM   5921  C  CE   . LYS A 1 23 ? 8.082  -2.694  -12.392 1.00 0.00 ? 23 LYS A CE   8  
ATOM   5922  N  NZ   . LYS A 1 23 ? 8.804  -2.279  -13.611 1.00 0.00 ? 23 LYS A NZ   8  
ATOM   5923  H  H    . LYS A 1 23 ? 11.953 0.774   -10.862 1.00 0.00 ? 23 LYS A H    8  
ATOM   5924  H  HA   . LYS A 1 23 ? 9.004  1.020   -10.765 1.00 0.00 ? 23 LYS A HA   8  
ATOM   5925  H  HB2  . LYS A 1 23 ? 10.913 -0.781  -9.198  1.00 0.00 ? 23 LYS A HB2  8  
ATOM   5926  H  HB3  . LYS A 1 23 ? 9.187  -0.595  -8.878  1.00 0.00 ? 23 LYS A HB3  8  
ATOM   5927  H  HG2  . LYS A 1 23 ? 10.399 -1.684  -11.457 1.00 0.00 ? 23 LYS A HG2  8  
ATOM   5928  H  HG3  . LYS A 1 23 ? 9.778  -2.676  -10.143 1.00 0.00 ? 23 LYS A HG3  8  
ATOM   5929  H  HD2  . LYS A 1 23 ? 7.529  -1.909  -10.465 1.00 0.00 ? 23 LYS A HD2  8  
ATOM   5930  H  HD3  . LYS A 1 23 ? 8.012  -0.690  -11.653 1.00 0.00 ? 23 LYS A HD3  8  
ATOM   5931  H  HE2  . LYS A 1 23 ? 8.439  -3.673  -12.068 1.00 0.00 ? 23 LYS A HE2  8  
ATOM   5932  H  HE3  . LYS A 1 23 ? 7.022  -2.774  -12.638 1.00 0.00 ? 23 LYS A HE3  8  
ATOM   5933  H  HZ1  . LYS A 1 23 ? 9.800  -2.216  -13.434 1.00 0.00 ? 23 LYS A HZ1  8  
ATOM   5934  H  HZ2  . LYS A 1 23 ? 8.645  -2.954  -14.346 1.00 0.00 ? 23 LYS A HZ2  8  
ATOM   5935  H  HZ3  . LYS A 1 23 ? 8.474  -1.374  -13.913 1.00 0.00 ? 23 LYS A HZ3  8  
ATOM   5936  N  N    . ALA A 1 24 ? 9.154  2.542   -8.794  1.00 0.00 ? 24 ALA A N    8  
ATOM   5937  C  CA   . ALA A 1 24 ? 9.216  3.738   -7.967  1.00 0.00 ? 24 ALA A CA   8  
ATOM   5938  C  C    . ALA A 1 24 ? 9.288  3.385   -6.481  1.00 0.00 ? 24 ALA A C    8  
ATOM   5939  O  O    . ALA A 1 24 ? 8.591  2.486   -6.010  1.00 0.00 ? 24 ALA A O    8  
ATOM   5940  C  CB   . ALA A 1 24 ? 7.996  4.617   -8.250  1.00 0.00 ? 24 ALA A CB   8  
ATOM   5941  H  H    . ALA A 1 24 ? 8.247  2.243   -9.109  1.00 0.00 ? 24 ALA A H    8  
ATOM   5942  H  HA   . ALA A 1 24 ? 10.102 4.313   -8.243  1.00 0.00 ? 24 ALA A HA   8  
ATOM   5943  H  HB1  . ALA A 1 24 ? 7.084  4.087   -7.978  1.00 0.00 ? 24 ALA A HB1  8  
ATOM   5944  H  HB2  . ALA A 1 24 ? 8.062  5.537   -7.668  1.00 0.00 ? 24 ALA A HB2  8  
ATOM   5945  H  HB3  . ALA A 1 24 ? 7.962  4.871   -9.310  1.00 0.00 ? 24 ALA A HB3  8  
ATOM   5946  N  N    . PHE A 1 25 ? 10.122 4.134   -5.756  1.00 0.00 ? 25 PHE A N    8  
ATOM   5947  C  CA   . PHE A 1 25 ? 10.441 3.956   -4.349  1.00 0.00 ? 25 PHE A CA   8  
ATOM   5948  C  C    . PHE A 1 25 ? 10.614 5.327   -3.696  1.00 0.00 ? 25 PHE A C    8  
ATOM   5949  O  O    . PHE A 1 25 ? 10.582 6.357   -4.368  1.00 0.00 ? 25 PHE A O    8  
ATOM   5950  C  CB   . PHE A 1 25 ? 11.739 3.142   -4.222  1.00 0.00 ? 25 PHE A CB   8  
ATOM   5951  C  CG   . PHE A 1 25 ? 11.554 1.647   -4.352  1.00 0.00 ? 25 PHE A CG   8  
ATOM   5952  C  CD1  . PHE A 1 25 ? 11.225 0.883   -3.218  1.00 0.00 ? 25 PHE A CD1  8  
ATOM   5953  C  CD2  . PHE A 1 25 ? 11.763 1.013   -5.591  1.00 0.00 ? 25 PHE A CD2  8  
ATOM   5954  C  CE1  . PHE A 1 25 ? 11.104 -0.515  -3.327  1.00 0.00 ? 25 PHE A CE1  8  
ATOM   5955  C  CE2  . PHE A 1 25 ? 11.583 -0.375  -5.710  1.00 0.00 ? 25 PHE A CE2  8  
ATOM   5956  C  CZ   . PHE A 1 25 ? 11.261 -1.140  -4.576  1.00 0.00 ? 25 PHE A CZ   8  
ATOM   5957  H  H    . PHE A 1 25 ? 10.645 4.859   -6.229  1.00 0.00 ? 25 PHE A H    8  
ATOM   5958  H  HA   . PHE A 1 25 ? 9.641  3.424   -3.839  1.00 0.00 ? 25 PHE A HA   8  
ATOM   5959  H  HB2  . PHE A 1 25 ? 12.451 3.472   -4.980  1.00 0.00 ? 25 PHE A HB2  8  
ATOM   5960  H  HB3  . PHE A 1 25 ? 12.192 3.328   -3.248  1.00 0.00 ? 25 PHE A HB3  8  
ATOM   5961  H  HD1  . PHE A 1 25 ? 11.081 1.368   -2.260  1.00 0.00 ? 25 PHE A HD1  8  
ATOM   5962  H  HD2  . PHE A 1 25 ? 12.074 1.589   -6.448  1.00 0.00 ? 25 PHE A HD2  8  
ATOM   5963  H  HE1  . PHE A 1 25 ? 10.886 -1.109  -2.452  1.00 0.00 ? 25 PHE A HE1  8  
ATOM   5964  H  HE2  . PHE A 1 25 ? 11.714 -0.856  -6.668  1.00 0.00 ? 25 PHE A HE2  8  
ATOM   5965  H  HZ   . PHE A 1 25 ? 11.146 -2.211  -4.661  1.00 0.00 ? 25 PHE A HZ   8  
ATOM   5966  N  N    . HIS A 1 26 ? 10.769 5.324   -2.369  1.00 0.00 ? 26 HIS A N    8  
ATOM   5967  C  CA   . HIS A 1 26 ? 11.186 6.468   -1.571  1.00 0.00 ? 26 HIS A CA   8  
ATOM   5968  C  C    . HIS A 1 26 ? 12.425 6.035   -0.799  1.00 0.00 ? 26 HIS A C    8  
ATOM   5969  O  O    . HIS A 1 26 ? 12.563 4.855   -0.475  1.00 0.00 ? 26 HIS A O    8  
ATOM   5970  C  CB   . HIS A 1 26 ? 10.123 6.847   -0.543  1.00 0.00 ? 26 HIS A CB   8  
ATOM   5971  C  CG   . HIS A 1 26 ? 8.893  7.516   -1.083  1.00 0.00 ? 26 HIS A CG   8  
ATOM   5972  N  ND1  . HIS A 1 26 ? 7.616  6.958   -1.075  1.00 0.00 ? 26 HIS A ND1  8  
ATOM   5973  C  CD2  . HIS A 1 26 ? 8.827  8.815   -1.497  1.00 0.00 ? 26 HIS A CD2  8  
ATOM   5974  C  CE1  . HIS A 1 26 ? 6.806  7.940   -1.497  1.00 0.00 ? 26 HIS A CE1  8  
ATOM   5975  N  NE2  . HIS A 1 26 ? 7.501  9.060   -1.759  1.00 0.00 ? 26 HIS A NE2  8  
ATOM   5976  H  H    . HIS A 1 26 ? 10.747 4.436   -1.891  1.00 0.00 ? 26 HIS A H    8  
ATOM   5977  H  HA   . HIS A 1 26 ? 11.422 7.334   -2.192  1.00 0.00 ? 26 HIS A HA   8  
ATOM   5978  H  HB2  . HIS A 1 26 ? 9.828  5.956   0.007   1.00 0.00 ? 26 HIS A HB2  8  
ATOM   5979  H  HB3  . HIS A 1 26 ? 10.581 7.538   0.162   1.00 0.00 ? 26 HIS A HB3  8  
ATOM   5980  H  HD2  . HIS A 1 26 ? 9.641  9.524   -1.551  1.00 0.00 ? 26 HIS A HD2  8  
ATOM   5981  H  HE1  . HIS A 1 26 ? 5.739  7.841   -1.606  1.00 0.00 ? 26 HIS A HE1  8  
ATOM   5982  H  HE2  . HIS A 1 26 ? 7.110  9.948   -2.044  1.00 0.00 ? 26 HIS A HE2  8  
ATOM   5983  N  N    . LEU A 1 27 ? 13.299 6.986   -0.460  1.00 0.00 ? 27 LEU A N    8  
ATOM   5984  C  CA   . LEU A 1 27 ? 14.392 6.734   0.466   1.00 0.00 ? 27 LEU A CA   8  
ATOM   5985  C  C    . LEU A 1 27 ? 13.817 6.232   1.794   1.00 0.00 ? 27 LEU A C    8  
ATOM   5986  O  O    . LEU A 1 27 ? 14.316 5.256   2.347   1.00 0.00 ? 27 LEU A O    8  
ATOM   5987  C  CB   . LEU A 1 27 ? 15.242 7.992   0.675   1.00 0.00 ? 27 LEU A CB   8  
ATOM   5988  C  CG   . LEU A 1 27 ? 16.038 8.496   -0.544  1.00 0.00 ? 27 LEU A CG   8  
ATOM   5989  C  CD1  . LEU A 1 27 ? 16.900 7.404   -1.185  1.00 0.00 ? 27 LEU A CD1  8  
ATOM   5990  C  CD2  . LEU A 1 27 ? 15.172 9.188   -1.606  1.00 0.00 ? 27 LEU A CD2  8  
ATOM   5991  H  H    . LEU A 1 27 ? 13.137 7.937   -0.760  1.00 0.00 ? 27 LEU A H    8  
ATOM   5992  H  HA   . LEU A 1 27 ? 15.030 5.949   0.067   1.00 0.00 ? 27 LEU A HA   8  
ATOM   5993  H  HB2  . LEU A 1 27 ? 14.603 8.796   1.044   1.00 0.00 ? 27 LEU A HB2  8  
ATOM   5994  H  HB3  . LEU A 1 27 ? 15.971 7.748   1.447   1.00 0.00 ? 27 LEU A HB3  8  
ATOM   5995  H  HG   . LEU A 1 27 ? 16.724 9.249   -0.163  1.00 0.00 ? 27 LEU A HG   8  
ATOM   5996  H  HD11 . LEU A 1 27 ? 17.516 6.921   -0.427  1.00 0.00 ? 27 LEU A HD11 8  
ATOM   5997  H  HD12 . LEU A 1 27 ? 16.279 6.656   -1.673  1.00 0.00 ? 27 LEU A HD12 8  
ATOM   5998  H  HD13 . LEU A 1 27 ? 17.552 7.854   -1.932  1.00 0.00 ? 27 LEU A HD13 8  
ATOM   5999  H  HD21 . LEU A 1 27 ? 15.820 9.728   -2.295  1.00 0.00 ? 27 LEU A HD21 8  
ATOM   6000  H  HD22 . LEU A 1 27 ? 14.595 8.461   -2.174  1.00 0.00 ? 27 LEU A HD22 8  
ATOM   6001  H  HD23 . LEU A 1 27 ? 14.497 9.901   -1.133  1.00 0.00 ? 27 LEU A HD23 8  
ATOM   6002  N  N    . PHE A 1 28 ? 12.731 6.869   2.256   1.00 0.00 ? 28 PHE A N    8  
ATOM   6003  C  CA   . PHE A 1 28 ? 11.896 6.444   3.376   1.00 0.00 ? 28 PHE A CA   8  
ATOM   6004  C  C    . PHE A 1 28 ? 11.647 4.932   3.369   1.00 0.00 ? 28 PHE A C    8  
ATOM   6005  O  O    . PHE A 1 28 ? 11.948 4.244   4.343   1.00 0.00 ? 28 PHE A O    8  
ATOM   6006  C  CB   . PHE A 1 28 ? 10.554 7.195   3.333   1.00 0.00 ? 28 PHE A CB   8  
ATOM   6007  C  CG   . PHE A 1 28 ? 10.643 8.692   3.087   1.00 0.00 ? 28 PHE A CG   8  
ATOM   6008  C  CD1  . PHE A 1 28 ? 11.562 9.484   3.802   1.00 0.00 ? 28 PHE A CD1  8  
ATOM   6009  C  CD2  . PHE A 1 28 ? 9.844  9.286   2.092   1.00 0.00 ? 28 PHE A CD2  8  
ATOM   6010  C  CE1  . PHE A 1 28 ? 11.718 10.844  3.481   1.00 0.00 ? 28 PHE A CE1  8  
ATOM   6011  C  CE2  . PHE A 1 28 ? 10.046 10.627  1.729   1.00 0.00 ? 28 PHE A CE2  8  
ATOM   6012  C  CZ   . PHE A 1 28 ? 10.979 11.410  2.428   1.00 0.00 ? 28 PHE A CZ   8  
ATOM   6013  H  H    . PHE A 1 28 ? 12.441 7.703   1.768   1.00 0.00 ? 28 PHE A H    8  
ATOM   6014  H  HA   . PHE A 1 28 ? 12.405 6.713   4.298   1.00 0.00 ? 28 PHE A HA   8  
ATOM   6015  H  HB2  . PHE A 1 28 ? 9.950  6.753   2.538   1.00 0.00 ? 28 PHE A HB2  8  
ATOM   6016  H  HB3  . PHE A 1 28 ? 10.030 7.033   4.278   1.00 0.00 ? 28 PHE A HB3  8  
ATOM   6017  H  HD1  . PHE A 1 28 ? 12.151 9.057   4.600   1.00 0.00 ? 28 PHE A HD1  8  
ATOM   6018  H  HD2  . PHE A 1 28 ? 9.074  8.716   1.594   1.00 0.00 ? 28 PHE A HD2  8  
ATOM   6019  H  HE1  . PHE A 1 28 ? 12.406 11.456  4.042   1.00 0.00 ? 28 PHE A HE1  8  
ATOM   6020  H  HE2  . PHE A 1 28 ? 9.468  11.059  0.928   1.00 0.00 ? 28 PHE A HE2  8  
ATOM   6021  H  HZ   . PHE A 1 28 ? 11.116 12.450  2.169   1.00 0.00 ? 28 PHE A HZ   8  
ATOM   6022  N  N    . CYS A 1 29 ? 11.086 4.431   2.263   1.00 0.00 ? 29 CYS A N    8  
ATOM   6023  C  CA   . CYS A 1 29 ? 10.573 3.074   2.134   1.00 0.00 ? 29 CYS A CA   8  
ATOM   6024  C  C    . CYS A 1 29 ? 11.713 2.071   1.952   1.00 0.00 ? 29 CYS A C    8  
ATOM   6025  O  O    . CYS A 1 29 ? 11.623 0.950   2.447   1.00 0.00 ? 29 CYS A O    8  
ATOM   6026  C  CB   . CYS A 1 29 ? 9.594  3.018   0.957   1.00 0.00 ? 29 CYS A CB   8  
ATOM   6027  S  SG   . CYS A 1 29 ? 8.136  4.077   1.161   1.00 0.00 ? 29 CYS A SG   8  
ATOM   6028  H  H    . CYS A 1 29 ? 10.976 5.042   1.468   1.00 0.00 ? 29 CYS A H    8  
ATOM   6029  H  HA   . CYS A 1 29 ? 10.025 2.814   3.042   1.00 0.00 ? 29 CYS A HA   8  
ATOM   6030  H  HB2  . CYS A 1 29 ? 10.117 3.327   0.050   1.00 0.00 ? 29 CYS A HB2  8  
ATOM   6031  H  HB3  . CYS A 1 29 ? 9.249  1.991   0.826   1.00 0.00 ? 29 CYS A HB3  8  
ATOM   6032  N  N    . LEU A 1 30 ? 12.776 2.472   1.244   1.00 0.00 ? 30 LEU A N    8  
ATOM   6033  C  CA   . LEU A 1 30 ? 13.991 1.685   1.099   1.00 0.00 ? 30 LEU A CA   8  
ATOM   6034  C  C    . LEU A 1 30 ? 14.666 1.499   2.459   1.00 0.00 ? 30 LEU A C    8  
ATOM   6035  O  O    . LEU A 1 30 ? 14.676 0.392   2.994   1.00 0.00 ? 30 LEU A O    8  
ATOM   6036  C  CB   . LEU A 1 30 ? 14.923 2.353   0.078   1.00 0.00 ? 30 LEU A CB   8  
ATOM   6037  C  CG   . LEU A 1 30 ? 14.358 2.335   -1.352  1.00 0.00 ? 30 LEU A CG   8  
ATOM   6038  C  CD1  . LEU A 1 30 ? 15.083 3.390   -2.194  1.00 0.00 ? 30 LEU A CD1  8  
ATOM   6039  C  CD2  . LEU A 1 30 ? 14.503 0.957   -2.005  1.00 0.00 ? 30 LEU A CD2  8  
ATOM   6040  H  H    . LEU A 1 30 ? 12.767 3.397   0.831   1.00 0.00 ? 30 LEU A H    8  
ATOM   6041  H  HA   . LEU A 1 30 ? 13.729 0.700   0.730   1.00 0.00 ? 30 LEU A HA   8  
ATOM   6042  H  HB2  . LEU A 1 30 ? 15.074 3.389   0.383   1.00 0.00 ? 30 LEU A HB2  8  
ATOM   6043  H  HB3  . LEU A 1 30 ? 15.887 1.843   0.078   1.00 0.00 ? 30 LEU A HB3  8  
ATOM   6044  H  HG   . LEU A 1 30 ? 13.301 2.584   -1.329  1.00 0.00 ? 30 LEU A HG   8  
ATOM   6045  H  HD11 . LEU A 1 30 ? 14.748 3.338   -3.230  1.00 0.00 ? 30 LEU A HD11 8  
ATOM   6046  H  HD12 . LEU A 1 30 ? 14.866 4.383   -1.804  1.00 0.00 ? 30 LEU A HD12 8  
ATOM   6047  H  HD13 . LEU A 1 30 ? 16.158 3.228   -2.150  1.00 0.00 ? 30 LEU A HD13 8  
ATOM   6048  H  HD21 . LEU A 1 30 ? 15.543 0.643   -1.982  1.00 0.00 ? 30 LEU A HD21 8  
ATOM   6049  H  HD22 . LEU A 1 30 ? 13.893 0.223   -1.479  1.00 0.00 ? 30 LEU A HD22 8  
ATOM   6050  H  HD23 . LEU A 1 30 ? 14.172 1.001   -3.043  1.00 0.00 ? 30 LEU A HD23 8  
ATOM   6051  N  N    . ARG A 1 31 ? 15.231 2.582   3.002   1.00 0.00 ? 31 ARG A N    8  
ATOM   6052  C  CA   . ARG A 1 31 ? 15.856 2.621   4.317   1.00 0.00 ? 31 ARG A CA   8  
ATOM   6053  C  C    . ARG A 1 31 ? 15.717 4.042   4.880   1.00 0.00 ? 31 ARG A C    8  
ATOM   6054  O  O    . ARG A 1 31 ? 16.313 4.959   4.320   1.00 0.00 ? 31 ARG A O    8  
ATOM   6055  C  CB   . ARG A 1 31 ? 17.346 2.255   4.223   1.00 0.00 ? 31 ARG A CB   8  
ATOM   6056  C  CG   . ARG A 1 31 ? 17.594 0.796   3.816   1.00 0.00 ? 31 ARG A CG   8  
ATOM   6057  C  CD   . ARG A 1 31 ? 19.064 0.411   4.021   1.00 0.00 ? 31 ARG A CD   8  
ATOM   6058  N  NE   . ARG A 1 31 ? 19.973 1.267   3.244   1.00 0.00 ? 31 ARG A NE   8  
ATOM   6059  C  CZ   . ARG A 1 31 ? 20.295 1.109   1.949   1.00 0.00 ? 31 ARG A CZ   8  
ATOM   6060  N  NH1  . ARG A 1 31 ? 19.771 0.119   1.212   1.00 0.00 ? 31 ARG A NH1  8  
ATOM   6061  N  NH2  . ARG A 1 31 ? 21.161 1.961   1.385   1.00 0.00 ? 31 ARG A NH2  8  
ATOM   6062  H  H    . ARG A 1 31 ? 15.122 3.458   2.512   1.00 0.00 ? 31 ARG A H    8  
ATOM   6063  H  HA   . ARG A 1 31 ? 15.363 1.898   4.966   1.00 0.00 ? 31 ARG A HA   8  
ATOM   6064  H  HB2  . ARG A 1 31 ? 17.834 2.915   3.505   1.00 0.00 ? 31 ARG A HB2  8  
ATOM   6065  H  HB3  . ARG A 1 31 ? 17.792 2.417   5.205   1.00 0.00 ? 31 ARG A HB3  8  
ATOM   6066  H  HG2  . ARG A 1 31 ? 16.982 0.140   4.434   1.00 0.00 ? 31 ARG A HG2  8  
ATOM   6067  H  HG3  . ARG A 1 31 ? 17.328 0.650   2.770   1.00 0.00 ? 31 ARG A HG3  8  
ATOM   6068  H  HD2  . ARG A 1 31 ? 19.312 0.519   5.077   1.00 0.00 ? 31 ARG A HD2  8  
ATOM   6069  H  HD3  . ARG A 1 31 ? 19.207 -0.636  3.755   1.00 0.00 ? 31 ARG A HD3  8  
ATOM   6070  H  HE   . ARG A 1 31 ? 20.391 2.037   3.748   1.00 0.00 ? 31 ARG A HE   8  
ATOM   6071  H  HH11 . ARG A 1 31 ? 19.126 -0.550  1.623   1.00 0.00 ? 31 ARG A HH11 8  
ATOM   6072  H  HH12 . ARG A 1 31 ? 20.039 -0.002  0.247   1.00 0.00 ? 31 ARG A HH12 8  
ATOM   6073  H  HH21 . ARG A 1 31 ? 21.559 2.713   1.930   1.00 0.00 ? 31 ARG A HH21 8  
ATOM   6074  H  HH22 . ARG A 1 31 ? 21.431 1.850   0.419   1.00 0.00 ? 31 ARG A HH22 8  
ATOM   6075  N  N    . PRO A 1 32 ? 14.987 4.245   5.990   1.00 0.00 ? 32 PRO A N    8  
ATOM   6076  C  CA   . PRO A 1 32 ? 14.612 5.566   6.484   1.00 0.00 ? 32 PRO A CA   8  
ATOM   6077  C  C    . PRO A 1 32 ? 15.815 6.416   6.920   1.00 0.00 ? 32 PRO A C    8  
ATOM   6078  O  O    . PRO A 1 32 ? 15.695 7.635   7.012   1.00 0.00 ? 32 PRO A O    8  
ATOM   6079  C  CB   . PRO A 1 32 ? 13.671 5.298   7.659   1.00 0.00 ? 32 PRO A CB   8  
ATOM   6080  C  CG   . PRO A 1 32 ? 14.208 3.985   8.225   1.00 0.00 ? 32 PRO A CG   8  
ATOM   6081  C  CD   . PRO A 1 32 ? 14.634 3.227   6.968   1.00 0.00 ? 32 PRO A CD   8  
ATOM   6082  H  HA   . PRO A 1 32 ? 14.076 6.112   5.709   1.00 0.00 ? 32 PRO A HA   8  
ATOM   6083  H  HB2  . PRO A 1 32 ? 13.672 6.101   8.398   1.00 0.00 ? 32 PRO A HB2  8  
ATOM   6084  H  HB3  . PRO A 1 32 ? 12.660 5.136   7.280   1.00 0.00 ? 32 PRO A HB3  8  
ATOM   6085  H  HG2  . PRO A 1 32 ? 15.082 4.187   8.845   1.00 0.00 ? 32 PRO A HG2  8  
ATOM   6086  H  HG3  . PRO A 1 32 ? 13.456 3.444   8.801   1.00 0.00 ? 32 PRO A HG3  8  
ATOM   6087  H  HD2  . PRO A 1 32 ? 15.472 2.567   7.196   1.00 0.00 ? 32 PRO A HD2  8  
ATOM   6088  H  HD3  . PRO A 1 32 ? 13.788 2.649   6.591   1.00 0.00 ? 32 PRO A HD3  8  
ATOM   6089  N  N    . ALA A 1 33 ? 16.968 5.785   7.183   1.00 0.00 ? 33 ALA A N    8  
ATOM   6090  C  CA   . ALA A 1 33 ? 18.240 6.462   7.400   1.00 0.00 ? 33 ALA A CA   8  
ATOM   6091  C  C    . ALA A 1 33 ? 18.632 7.377   6.234   1.00 0.00 ? 33 ALA A C    8  
ATOM   6092  O  O    . ALA A 1 33 ? 19.281 8.398   6.450   1.00 0.00 ? 33 ALA A O    8  
ATOM   6093  C  CB   . ALA A 1 33 ? 19.328 5.414   7.646   1.00 0.00 ? 33 ALA A CB   8  
ATOM   6094  H  H    . ALA A 1 33 ? 16.984 4.776   7.154   1.00 0.00 ? 33 ALA A H    8  
ATOM   6095  H  HA   . ALA A 1 33 ? 18.149 7.075   8.295   1.00 0.00 ? 33 ALA A HA   8  
ATOM   6096  H  HB1  . ALA A 1 33 ? 19.064 4.801   8.508   1.00 0.00 ? 33 ALA A HB1  8  
ATOM   6097  H  HB2  . ALA A 1 33 ? 19.434 4.773   6.769   1.00 0.00 ? 33 ALA A HB2  8  
ATOM   6098  H  HB3  . ALA A 1 33 ? 20.280 5.910   7.842   1.00 0.00 ? 33 ALA A HB3  8  
ATOM   6099  N  N    . LEU A 1 34 ? 18.267 6.998   5.004   1.00 0.00 ? 34 LEU A N    8  
ATOM   6100  C  CA   . LEU A 1 34 ? 18.469 7.807   3.810   1.00 0.00 ? 34 LEU A CA   8  
ATOM   6101  C  C    . LEU A 1 34 ? 17.290 8.763   3.613   1.00 0.00 ? 34 LEU A C    8  
ATOM   6102  O  O    . LEU A 1 34 ? 16.194 8.530   4.121   1.00 0.00 ? 34 LEU A O    8  
ATOM   6103  C  CB   . LEU A 1 34 ? 18.661 6.914   2.581   1.00 0.00 ? 34 LEU A CB   8  
ATOM   6104  C  CG   . LEU A 1 34 ? 20.049 6.259   2.478   1.00 0.00 ? 34 LEU A CG   8  
ATOM   6105  C  CD1  . LEU A 1 34 ? 21.180 7.273   2.266   1.00 0.00 ? 34 LEU A CD1  8  
ATOM   6106  C  CD2  . LEU A 1 34 ? 20.385 5.320   3.644   1.00 0.00 ? 34 LEU A CD2  8  
ATOM   6107  H  H    . LEU A 1 34 ? 17.706 6.164   4.907   1.00 0.00 ? 34 LEU A H    8  
ATOM   6108  H  HA   . LEU A 1 34 ? 19.380 8.391   3.905   1.00 0.00 ? 34 LEU A HA   8  
ATOM   6109  H  HB2  . LEU A 1 34 ? 17.891 6.142   2.565   1.00 0.00 ? 34 LEU A HB2  8  
ATOM   6110  H  HB3  . LEU A 1 34 ? 18.534 7.525   1.688   1.00 0.00 ? 34 LEU A HB3  8  
ATOM   6111  H  HG   . LEU A 1 34 ? 20.004 5.657   1.579   1.00 0.00 ? 34 LEU A HG   8  
ATOM   6112  H  HD11 . LEU A 1 34 ? 21.381 7.837   3.177   1.00 0.00 ? 34 LEU A HD11 8  
ATOM   6113  H  HD12 . LEU A 1 34 ? 22.090 6.742   1.986   1.00 0.00 ? 34 LEU A HD12 8  
ATOM   6114  H  HD13 . LEU A 1 34 ? 20.917 7.963   1.464   1.00 0.00 ? 34 LEU A HD13 8  
ATOM   6115  H  HD21 . LEU A 1 34 ? 19.550 4.647   3.833   1.00 0.00 ? 34 LEU A HD21 8  
ATOM   6116  H  HD22 . LEU A 1 34 ? 21.265 4.729   3.389   1.00 0.00 ? 34 LEU A HD22 8  
ATOM   6117  H  HD23 . LEU A 1 34 ? 20.605 5.892   4.545   1.00 0.00 ? 34 LEU A HD23 8  
ATOM   6118  N  N    . TYR A 1 35 ? 17.534 9.840   2.856   1.00 0.00 ? 35 TYR A N    8  
ATOM   6119  C  CA   . TYR A 1 35 ? 16.629 10.972  2.695   1.00 0.00 ? 35 TYR A CA   8  
ATOM   6120  C  C    . TYR A 1 35 ? 16.778 11.558  1.292   1.00 0.00 ? 35 TYR A C    8  
ATOM   6121  O  O    . TYR A 1 35 ? 15.790 11.743  0.583   1.00 0.00 ? 35 TYR A O    8  
ATOM   6122  C  CB   . TYR A 1 35 ? 16.922 12.033  3.765   1.00 0.00 ? 35 TYR A CB   8  
ATOM   6123  C  CG   . TYR A 1 35 ? 16.568 11.598  5.174   1.00 0.00 ? 35 TYR A CG   8  
ATOM   6124  C  CD1  . TYR A 1 35 ? 15.225 11.618  5.591   1.00 0.00 ? 35 TYR A CD1  8  
ATOM   6125  C  CD2  . TYR A 1 35 ? 17.564 11.119  6.047   1.00 0.00 ? 35 TYR A CD2  8  
ATOM   6126  C  CE1  . TYR A 1 35 ? 14.875 11.149  6.869   1.00 0.00 ? 35 TYR A CE1  8  
ATOM   6127  C  CE2  . TYR A 1 35 ? 17.215 10.663  7.330   1.00 0.00 ? 35 TYR A CE2  8  
ATOM   6128  C  CZ   . TYR A 1 35 ? 15.869 10.667  7.737   1.00 0.00 ? 35 TYR A CZ   8  
ATOM   6129  O  OH   . TYR A 1 35 ? 15.526 10.216  8.977   1.00 0.00 ? 35 TYR A OH   8  
ATOM   6130  H  H    . TYR A 1 35 ? 18.444 9.918   2.428   1.00 0.00 ? 35 TYR A H    8  
ATOM   6131  H  HA   . TYR A 1 35 ? 15.597 10.643  2.800   1.00 0.00 ? 35 TYR A HA   8  
ATOM   6132  H  HB2  . TYR A 1 35 ? 17.981 12.297  3.726   1.00 0.00 ? 35 TYR A HB2  8  
ATOM   6133  H  HB3  . TYR A 1 35 ? 16.339 12.927  3.533   1.00 0.00 ? 35 TYR A HB3  8  
ATOM   6134  H  HD1  . TYR A 1 35 ? 14.463 11.995  4.928   1.00 0.00 ? 35 TYR A HD1  8  
ATOM   6135  H  HD2  . TYR A 1 35 ? 18.597 11.093  5.733   1.00 0.00 ? 35 TYR A HD2  8  
ATOM   6136  H  HE1  . TYR A 1 35 ? 13.840 11.156  7.179   1.00 0.00 ? 35 TYR A HE1  8  
ATOM   6137  H  HE2  . TYR A 1 35 ? 17.982 10.299  7.996   1.00 0.00 ? 35 TYR A HE2  8  
ATOM   6138  H  HH   . TYR A 1 35 ? 16.273 9.871   9.471   1.00 0.00 ? 35 TYR A HH   8  
ATOM   6139  N  N    . GLU A 1 36 ? 18.026 11.825  0.897   1.00 0.00 ? 36 GLU A N    8  
ATOM   6140  C  CA   . GLU A 1 36 ? 18.388 12.359  -0.407  1.00 0.00 ? 36 GLU A CA   8  
ATOM   6141  C  C    . GLU A 1 36 ? 18.724 11.222  -1.374  1.00 0.00 ? 36 GLU A C    8  
ATOM   6142  O  O    . GLU A 1 36 ? 19.181 10.156  -0.963  1.00 0.00 ? 36 GLU A O    8  
ATOM   6143  C  CB   . GLU A 1 36 ? 19.559 13.344  -0.260  1.00 0.00 ? 36 GLU A CB   8  
ATOM   6144  C  CG   . GLU A 1 36 ? 19.099 14.746  0.166   1.00 0.00 ? 36 GLU A CG   8  
ATOM   6145  C  CD   . GLU A 1 36 ? 18.223 14.741  1.418   1.00 0.00 ? 36 GLU A CD   8  
ATOM   6146  O  OE1  . GLU A 1 36 ? 18.803 14.610  2.517   1.00 0.00 ? 36 GLU A OE1  8  
ATOM   6147  O  OE2  . GLU A 1 36 ? 16.989 14.853  1.249   1.00 0.00 ? 36 GLU A OE2  8  
ATOM   6148  H  H    . GLU A 1 36 ? 18.767 11.676  1.564   1.00 0.00 ? 36 GLU A H    8  
ATOM   6149  H  HA   . GLU A 1 36 ? 17.545 12.905  -0.823  1.00 0.00 ? 36 GLU A HA   8  
ATOM   6150  H  HB2  . GLU A 1 36 ? 20.279 12.955  0.462   1.00 0.00 ? 36 GLU A HB2  8  
ATOM   6151  H  HB3  . GLU A 1 36 ? 20.065 13.448  -1.221  1.00 0.00 ? 36 GLU A HB3  8  
ATOM   6152  H  HG2  . GLU A 1 36 ? 19.980 15.360  0.357   1.00 0.00 ? 36 GLU A HG2  8  
ATOM   6153  H  HG3  . GLU A 1 36 ? 18.543 15.203  -0.653  1.00 0.00 ? 36 GLU A HG3  8  
ATOM   6154  N  N    . VAL A 1 37 ? 18.481 11.465  -2.667  1.00 0.00 ? 37 VAL A N    8  
ATOM   6155  C  CA   . VAL A 1 37 ? 18.797 10.543  -3.749  1.00 0.00 ? 37 VAL A CA   8  
ATOM   6156  C  C    . VAL A 1 37 ? 20.324 10.435  -3.869  1.00 0.00 ? 37 VAL A C    8  
ATOM   6157  O  O    . VAL A 1 37 ? 20.982 11.465  -4.016  1.00 0.00 ? 37 VAL A O    8  
ATOM   6158  C  CB   . VAL A 1 37 ? 18.164 11.053  -5.058  1.00 0.00 ? 37 VAL A CB   8  
ATOM   6159  C  CG1  . VAL A 1 37 ? 18.473 10.122  -6.238  1.00 0.00 ? 37 VAL A CG1  8  
ATOM   6160  C  CG2  . VAL A 1 37 ? 16.639 11.184  -4.931  1.00 0.00 ? 37 VAL A CG2  8  
ATOM   6161  H  H    . VAL A 1 37 ? 18.124 12.373  -2.924  1.00 0.00 ? 37 VAL A H    8  
ATOM   6162  H  HA   . VAL A 1 37 ? 18.341 9.586   -3.512  1.00 0.00 ? 37 VAL A HA   8  
ATOM   6163  H  HB   . VAL A 1 37 ? 18.575 12.038  -5.283  1.00 0.00 ? 37 VAL A HB   8  
ATOM   6164  H  HG11 . VAL A 1 37 ? 18.017 10.518  -7.146  1.00 0.00 ? 37 VAL A HG11 8  
ATOM   6165  H  HG12 . VAL A 1 37 ? 19.548 10.051  -6.402  1.00 0.00 ? 37 VAL A HG12 8  
ATOM   6166  H  HG13 . VAL A 1 37 ? 18.072 9.127   -6.048  1.00 0.00 ? 37 VAL A HG13 8  
ATOM   6167  H  HG21 . VAL A 1 37 ? 16.221 11.535  -5.875  1.00 0.00 ? 37 VAL A HG21 8  
ATOM   6168  H  HG22 . VAL A 1 37 ? 16.202 10.216  -4.691  1.00 0.00 ? 37 VAL A HG22 8  
ATOM   6169  H  HG23 . VAL A 1 37 ? 16.374 11.899  -4.153  1.00 0.00 ? 37 VAL A HG23 8  
ATOM   6170  N  N    . PRO A 1 38 ? 20.908 9.225   -3.801  1.00 0.00 ? 38 PRO A N    8  
ATOM   6171  C  CA   . PRO A 1 38 ? 22.351 9.040   -3.809  1.00 0.00 ? 38 PRO A CA   8  
ATOM   6172  C  C    . PRO A 1 38 ? 22.928 9.345   -5.192  1.00 0.00 ? 38 PRO A C    8  
ATOM   6173  O  O    . PRO A 1 38 ? 22.238 9.220   -6.203  1.00 0.00 ? 38 PRO A O    8  
ATOM   6174  C  CB   . PRO A 1 38 ? 22.573 7.572   -3.441  1.00 0.00 ? 38 PRO A CB   8  
ATOM   6175  C  CG   . PRO A 1 38 ? 21.322 6.888   -3.989  1.00 0.00 ? 38 PRO A CG   8  
ATOM   6176  C  CD   . PRO A 1 38 ? 20.234 7.938   -3.767  1.00 0.00 ? 38 PRO A CD   8  
ATOM   6177  H  HA   . PRO A 1 38 ? 22.821 9.683   -3.062  1.00 0.00 ? 38 PRO A HA   8  
ATOM   6178  H  HB2  . PRO A 1 38 ? 23.490 7.160   -3.867  1.00 0.00 ? 38 PRO A HB2  8  
ATOM   6179  H  HB3  . PRO A 1 38 ? 22.586 7.475   -2.356  1.00 0.00 ? 38 PRO A HB3  8  
ATOM   6180  H  HG2  . PRO A 1 38 ? 21.444 6.708   -5.059  1.00 0.00 ? 38 PRO A HG2  8  
ATOM   6181  H  HG3  . PRO A 1 38 ? 21.104 5.954   -3.471  1.00 0.00 ? 38 PRO A HG3  8  
ATOM   6182  H  HD2  . PRO A 1 38 ? 19.480 7.853   -4.548  1.00 0.00 ? 38 PRO A HD2  8  
ATOM   6183  H  HD3  . PRO A 1 38 ? 19.788 7.794   -2.782  1.00 0.00 ? 38 PRO A HD3  8  
ATOM   6184  N  N    . ASP A 1 39 ? 24.213 9.717   -5.227  1.00 0.00 ? 39 ASP A N    8  
ATOM   6185  C  CA   . ASP A 1 39 ? 24.910 10.125  -6.439  1.00 0.00 ? 39 ASP A CA   8  
ATOM   6186  C  C    . ASP A 1 39 ? 25.415 8.893   -7.197  1.00 0.00 ? 39 ASP A C    8  
ATOM   6187  O  O    . ASP A 1 39 ? 26.612 8.756   -7.451  1.00 0.00 ? 39 ASP A O    8  
ATOM   6188  C  CB   . ASP A 1 39 ? 26.055 11.080  -6.066  1.00 0.00 ? 39 ASP A CB   8  
ATOM   6189  C  CG   . ASP A 1 39 ? 25.547 12.320  -5.337  1.00 0.00 ? 39 ASP A CG   8  
ATOM   6190  O  OD1  . ASP A 1 39 ? 25.456 12.249  -4.092  1.00 0.00 ? 39 ASP A OD1  8  
ATOM   6191  O  OD2  . ASP A 1 39 ? 25.255 13.314  -6.036  1.00 0.00 ? 39 ASP A OD2  8  
ATOM   6192  H  H    . ASP A 1 39 ? 24.711 9.824   -4.354  1.00 0.00 ? 39 ASP A H    8  
ATOM   6193  H  HA   . ASP A 1 39 ? 24.223 10.670  -7.089  1.00 0.00 ? 39 ASP A HA   8  
ATOM   6194  H  HB2  . ASP A 1 39 ? 26.771 10.561  -5.425  1.00 0.00 ? 39 ASP A HB2  8  
ATOM   6195  H  HB3  . ASP A 1 39 ? 26.570 11.396  -6.974  1.00 0.00 ? 39 ASP A HB3  8  
ATOM   6196  N  N    . GLY A 1 40 ? 24.496 7.995   -7.569  1.00 0.00 ? 40 GLY A N    8  
ATOM   6197  C  CA   . GLY A 1 40 ? 24.778 6.890   -8.469  1.00 0.00 ? 40 GLY A CA   8  
ATOM   6198  C  C    . GLY A 1 40 ? 23.494 6.155   -8.846  1.00 0.00 ? 40 GLY A C    8  
ATOM   6199  O  O    . GLY A 1 40 ? 22.459 6.331   -8.203  1.00 0.00 ? 40 GLY A O    8  
ATOM   6200  H  H    . GLY A 1 40 ? 23.539 8.115   -7.261  1.00 0.00 ? 40 GLY A H    8  
ATOM   6201  H  HA2  . GLY A 1 40 ? 25.249 7.276   -9.374  1.00 0.00 ? 40 GLY A HA2  8  
ATOM   6202  H  HA3  . GLY A 1 40 ? 25.459 6.190   -7.984  1.00 0.00 ? 40 GLY A HA3  8  
ATOM   6203  N  N    . GLU A 1 41 ? 23.582 5.323   -9.891  1.00 0.00 ? 41 GLU A N    8  
ATOM   6204  C  CA   . GLU A 1 41 ? 22.479 4.532   -10.418 1.00 0.00 ? 41 GLU A CA   8  
ATOM   6205  C  C    . GLU A 1 41 ? 21.940 3.605   -9.328  1.00 0.00 ? 41 GLU A C    8  
ATOM   6206  O  O    . GLU A 1 41 ? 22.691 2.799   -8.779  1.00 0.00 ? 41 GLU A O    8  
ATOM   6207  C  CB   . GLU A 1 41 ? 22.937 3.708   -11.633 1.00 0.00 ? 41 GLU A CB   8  
ATOM   6208  C  CG   . GLU A 1 41 ? 23.531 4.553   -12.771 1.00 0.00 ? 41 GLU A CG   8  
ATOM   6209  C  CD   . GLU A 1 41 ? 25.039 4.753   -12.627 1.00 0.00 ? 41 GLU A CD   8  
ATOM   6210  O  OE1  . GLU A 1 41 ? 25.426 5.738   -11.960 1.00 0.00 ? 41 GLU A OE1  8  
ATOM   6211  O  OE2  . GLU A 1 41 ? 25.781 3.911   -13.176 1.00 0.00 ? 41 GLU A OE2  8  
ATOM   6212  H  H    . GLU A 1 41 ? 24.455 5.294   -10.402 1.00 0.00 ? 41 GLU A H    8  
ATOM   6213  H  HA   . GLU A 1 41 ? 21.693 5.216   -10.741 1.00 0.00 ? 41 GLU A HA   8  
ATOM   6214  H  HB2  . GLU A 1 41 ? 23.664 2.955   -11.327 1.00 0.00 ? 41 GLU A HB2  8  
ATOM   6215  H  HB3  . GLU A 1 41 ? 22.060 3.190   -12.024 1.00 0.00 ? 41 GLU A HB3  8  
ATOM   6216  H  HG2  . GLU A 1 41 ? 23.357 4.026   -13.711 1.00 0.00 ? 41 GLU A HG2  8  
ATOM   6217  H  HG3  . GLU A 1 41 ? 23.024 5.517   -12.826 1.00 0.00 ? 41 GLU A HG3  8  
ATOM   6218  N  N    . TRP A 1 42 ? 20.653 3.739   -8.988  1.00 0.00 ? 42 TRP A N    8  
ATOM   6219  C  CA   . TRP A 1 42 ? 20.072 3.064   -7.841  1.00 0.00 ? 42 TRP A CA   8  
ATOM   6220  C  C    . TRP A 1 42 ? 19.630 1.653   -8.220  1.00 0.00 ? 42 TRP A C    8  
ATOM   6221  O  O    . TRP A 1 42 ? 19.127 1.426   -9.320  1.00 0.00 ? 42 TRP A O    8  
ATOM   6222  C  CB   . TRP A 1 42 ? 18.898 3.863   -7.269  1.00 0.00 ? 42 TRP A CB   8  
ATOM   6223  C  CG   . TRP A 1 42 ? 18.310 3.238   -6.041  1.00 0.00 ? 42 TRP A CG   8  
ATOM   6224  C  CD1  . TRP A 1 42 ? 17.067 2.717   -5.929  1.00 0.00 ? 42 TRP A CD1  8  
ATOM   6225  C  CD2  . TRP A 1 42 ? 18.978 2.948   -4.776  1.00 0.00 ? 42 TRP A CD2  8  
ATOM   6226  N  NE1  . TRP A 1 42 ? 16.930 2.107   -4.700  1.00 0.00 ? 42 TRP A NE1  8  
ATOM   6227  C  CE2  . TRP A 1 42 ? 18.084 2.205   -3.951  1.00 0.00 ? 42 TRP A CE2  8  
ATOM   6228  C  CE3  . TRP A 1 42 ? 20.262 3.215   -4.250  1.00 0.00 ? 42 TRP A CE3  8  
ATOM   6229  C  CZ2  . TRP A 1 42 ? 18.452 1.736   -2.680  1.00 0.00 ? 42 TRP A CZ2  8  
ATOM   6230  C  CZ3  . TRP A 1 42 ? 20.635 2.762   -2.972  1.00 0.00 ? 42 TRP A CZ3  8  
ATOM   6231  C  CH2  . TRP A 1 42 ? 19.734 2.019   -2.190  1.00 0.00 ? 42 TRP A CH2  8  
ATOM   6232  H  H    . TRP A 1 42 ? 20.038 4.295   -9.571  1.00 0.00 ? 42 TRP A H    8  
ATOM   6233  H  HA   . TRP A 1 42 ? 20.836 2.998   -7.067  1.00 0.00 ? 42 TRP A HA   8  
ATOM   6234  H  HB2  . TRP A 1 42 ? 19.257 4.861   -7.009  1.00 0.00 ? 42 TRP A HB2  8  
ATOM   6235  H  HB3  . TRP A 1 42 ? 18.124 3.958   -8.033  1.00 0.00 ? 42 TRP A HB3  8  
ATOM   6236  H  HD1  . TRP A 1 42 ? 16.312 2.728   -6.700  1.00 0.00 ? 42 TRP A HD1  8  
ATOM   6237  H  HE1  . TRP A 1 42 ? 16.084 1.634   -4.418  1.00 0.00 ? 42 TRP A HE1  8  
ATOM   6238  H  HE3  . TRP A 1 42 ? 20.972 3.777   -4.838  1.00 0.00 ? 42 TRP A HE3  8  
ATOM   6239  H  HZ2  . TRP A 1 42 ? 17.763 1.158   -2.084  1.00 0.00 ? 42 TRP A HZ2  8  
ATOM   6240  H  HZ3  . TRP A 1 42 ? 21.622 2.982   -2.591  1.00 0.00 ? 42 TRP A HZ3  8  
ATOM   6241  H  HH2  . TRP A 1 42 ? 20.029 1.663   -1.217  1.00 0.00 ? 42 TRP A HH2  8  
ATOM   6242  N  N    . GLN A 1 43 ? 19.805 0.715   -7.283  1.00 0.00 ? 43 GLN A N    8  
ATOM   6243  C  CA   . GLN A 1 43 ? 19.268 -0.632  -7.357  1.00 0.00 ? 43 GLN A CA   8  
ATOM   6244  C  C    . GLN A 1 43 ? 18.404 -0.866  -6.118  1.00 0.00 ? 43 GLN A C    8  
ATOM   6245  O  O    . GLN A 1 43 ? 18.853 -0.603  -5.002  1.00 0.00 ? 43 GLN A O    8  
ATOM   6246  C  CB   . GLN A 1 43 ? 20.418 -1.648  -7.391  1.00 0.00 ? 43 GLN A CB   8  
ATOM   6247  C  CG   . GLN A 1 43 ? 21.433 -1.362  -8.506  1.00 0.00 ? 43 GLN A CG   8  
ATOM   6248  C  CD   . GLN A 1 43 ? 22.524 -2.430  -8.532  1.00 0.00 ? 43 GLN A CD   8  
ATOM   6249  O  OE1  . GLN A 1 43 ? 23.655 -2.176  -8.125  1.00 0.00 ? 43 GLN A OE1  8  
ATOM   6250  N  NE2  . GLN A 1 43 ? 22.185 -3.633  -8.995  1.00 0.00 ? 43 GLN A NE2  8  
ATOM   6251  H  H    . GLN A 1 43 ? 20.243 0.980   -6.412  1.00 0.00 ? 43 GLN A H    8  
ATOM   6252  H  HA   . GLN A 1 43 ? 18.665 -0.737  -8.264  1.00 0.00 ? 43 GLN A HA   8  
ATOM   6253  H  HB2  . GLN A 1 43 ? 20.946 -1.627  -6.437  1.00 0.00 ? 43 GLN A HB2  8  
ATOM   6254  H  HB3  . GLN A 1 43 ? 19.994 -2.643  -7.530  1.00 0.00 ? 43 GLN A HB3  8  
ATOM   6255  H  HG2  . GLN A 1 43 ? 20.927 -1.328  -9.471  1.00 0.00 ? 43 GLN A HG2  8  
ATOM   6256  H  HG3  . GLN A 1 43 ? 21.909 -0.396  -8.334  1.00 0.00 ? 43 GLN A HG3  8  
ATOM   6257  H  HE21 . GLN A 1 43 ? 21.247 -3.778  -9.360  1.00 0.00 ? 43 GLN A HE21 8  
ATOM   6258  H  HE22 . GLN A 1 43 ? 22.871 -4.375  -9.021  1.00 0.00 ? 43 GLN A HE22 8  
ATOM   6259  N  N    . CYS A 1 44 ? 17.170 -1.346  -6.303  1.00 0.00 ? 44 CYS A N    8  
ATOM   6260  C  CA   . CYS A 1 44 ? 16.253 -1.634  -5.207  1.00 0.00 ? 44 CYS A CA   8  
ATOM   6261  C  C    . CYS A 1 44 ? 16.566 -3.008  -4.591  1.00 0.00 ? 44 CYS A C    8  
ATOM   6262  O  O    . CYS A 1 44 ? 17.247 -3.821  -5.219  1.00 0.00 ? 44 CYS A O    8  
ATOM   6263  C  CB   . CYS A 1 44 ? 14.804 -1.538  -5.692  1.00 0.00 ? 44 CYS A CB   8  
ATOM   6264  S  SG   . CYS A 1 44 ? 14.327 -2.686  -7.003  1.00 0.00 ? 44 CYS A SG   8  
ATOM   6265  H  H    . CYS A 1 44 ? 16.891 -1.617  -7.233  1.00 0.00 ? 44 CYS A H    8  
ATOM   6266  H  HA   . CYS A 1 44 ? 16.374 -0.846  -4.463  1.00 0.00 ? 44 CYS A HA   8  
ATOM   6267  H  HB2  . CYS A 1 44 ? 14.135 -1.718  -4.854  1.00 0.00 ? 44 CYS A HB2  8  
ATOM   6268  H  HB3  . CYS A 1 44 ? 14.626 -0.521  -6.044  1.00 0.00 ? 44 CYS A HB3  8  
ATOM   6269  N  N    . PRO A 1 45 ? 16.055 -3.286  -3.377  1.00 0.00 ? 45 PRO A N    8  
ATOM   6270  C  CA   . PRO A 1 45 ? 16.113 -4.597  -2.740  1.00 0.00 ? 45 PRO A CA   8  
ATOM   6271  C  C    . PRO A 1 45 ? 15.478 -5.765  -3.504  1.00 0.00 ? 45 PRO A C    8  
ATOM   6272  O  O    . PRO A 1 45 ? 15.645 -6.908  -3.082  1.00 0.00 ? 45 PRO A O    8  
ATOM   6273  C  CB   . PRO A 1 45 ? 15.455 -4.417  -1.373  1.00 0.00 ? 45 PRO A CB   8  
ATOM   6274  C  CG   . PRO A 1 45 ? 15.844 -2.987  -1.015  1.00 0.00 ? 45 PRO A CG   8  
ATOM   6275  C  CD   . PRO A 1 45 ? 15.786 -2.275  -2.365  1.00 0.00 ? 45 PRO A CD   8  
ATOM   6276  H  HA   . PRO A 1 45 ? 17.164 -4.823  -2.570  1.00 0.00 ? 45 PRO A HA   8  
ATOM   6277  H  HB2  . PRO A 1 45 ? 14.372 -4.483  -1.474  1.00 0.00 ? 45 PRO A HB2  8  
ATOM   6278  H  HB3  . PRO A 1 45 ? 15.816 -5.141  -0.640  1.00 0.00 ? 45 PRO A HB3  8  
ATOM   6279  H  HG2  . PRO A 1 45 ? 15.175 -2.543  -0.278  1.00 0.00 ? 45 PRO A HG2  8  
ATOM   6280  H  HG3  . PRO A 1 45 ? 16.872 -2.977  -0.651  1.00 0.00 ? 45 PRO A HG3  8  
ATOM   6281  H  HD2  . PRO A 1 45 ? 14.786 -1.869  -2.522  1.00 0.00 ? 45 PRO A HD2  8  
ATOM   6282  H  HD3  . PRO A 1 45 ? 16.531 -1.479  -2.369  1.00 0.00 ? 45 PRO A HD3  8  
ATOM   6283  N  N    . ALA A 1 46 ? 14.740 -5.514  -4.593  1.00 0.00 ? 46 ALA A N    8  
ATOM   6284  C  CA   . ALA A 1 46 ? 14.294 -6.576  -5.483  1.00 0.00 ? 46 ALA A CA   8  
ATOM   6285  C  C    . ALA A 1 46 ? 15.468 -7.066  -6.328  1.00 0.00 ? 46 ALA A C    8  
ATOM   6286  O  O    . ALA A 1 46 ? 15.693 -8.270  -6.429  1.00 0.00 ? 46 ALA A O    8  
ATOM   6287  C  CB   . ALA A 1 46 ? 13.135 -6.096  -6.362  1.00 0.00 ? 46 ALA A CB   8  
ATOM   6288  H  H    . ALA A 1 46 ? 14.635 -4.565  -4.917  1.00 0.00 ? 46 ALA A H    8  
ATOM   6289  H  HA   . ALA A 1 46 ? 13.916 -7.408  -4.885  1.00 0.00 ? 46 ALA A HA   8  
ATOM   6290  H  HB1  . ALA A 1 46 ? 13.477 -5.342  -7.068  1.00 0.00 ? 46 ALA A HB1  8  
ATOM   6291  H  HB2  . ALA A 1 46 ? 12.736 -6.940  -6.923  1.00 0.00 ? 46 ALA A HB2  8  
ATOM   6292  H  HB3  . ALA A 1 46 ? 12.345 -5.678  -5.739  1.00 0.00 ? 46 ALA A HB3  8  
ATOM   6293  N  N    . CYS A 1 47 ? 16.210 -6.133  -6.938  1.00 0.00 ? 47 CYS A N    8  
ATOM   6294  C  CA   . CYS A 1 47 ? 17.273 -6.453  -7.869  1.00 0.00 ? 47 CYS A CA   8  
ATOM   6295  C  C    . CYS A 1 47 ? 18.528 -6.884  -7.115  1.00 0.00 ? 47 CYS A C    8  
ATOM   6296  O  O    . CYS A 1 47 ? 19.028 -7.987  -7.322  1.00 0.00 ? 47 CYS A O    8  
ATOM   6297  C  CB   . CYS A 1 47 ? 17.565 -5.253  -8.770  1.00 0.00 ? 47 CYS A CB   8  
ATOM   6298  S  SG   . CYS A 1 47 ? 16.176 -4.643  -9.750  1.00 0.00 ? 47 CYS A SG   8  
ATOM   6299  H  H    . CYS A 1 47 ? 16.035 -5.153  -6.767  1.00 0.00 ? 47 CYS A H    8  
ATOM   6300  H  HA   . CYS A 1 47 ? 16.937 -7.267  -8.509  1.00 0.00 ? 47 CYS A HA   8  
ATOM   6301  H  HB2  . CYS A 1 47 ? 17.945 -4.423  -8.175  1.00 0.00 ? 47 CYS A HB2  8  
ATOM   6302  H  HB3  . CYS A 1 47 ? 18.338 -5.571  -9.466  1.00 0.00 ? 47 CYS A HB3  8  
ATOM   6303  N  N    . GLN A 1 48 ? 19.035 -6.001  -6.246  1.00 0.00 ? 48 GLN A N    8  
ATOM   6304  C  CA   . GLN A 1 48 ? 20.090 -6.316  -5.298  1.00 0.00 ? 48 GLN A CA   8  
ATOM   6305  C  C    . GLN A 1 48 ? 19.488 -7.156  -4.167  1.00 0.00 ? 48 GLN A C    8  
ATOM   6306  O  O    . GLN A 1 48 ? 18.527 -6.705  -3.550  1.00 0.00 ? 48 GLN A O    8  
ATOM   6307  C  CB   . GLN A 1 48 ? 20.686 -4.998  -4.779  1.00 0.00 ? 48 GLN A CB   8  
ATOM   6308  C  CG   . GLN A 1 48 ? 21.636 -5.172  -3.586  1.00 0.00 ? 48 GLN A CG   8  
ATOM   6309  C  CD   . GLN A 1 48 ? 22.759 -6.169  -3.856  1.00 0.00 ? 48 GLN A CD   8  
ATOM   6310  O  OE1  . GLN A 1 48 ? 23.429 -6.092  -4.883  1.00 0.00 ? 48 GLN A OE1  8  
ATOM   6311  N  NE2  . GLN A 1 48 ? 22.969 -7.116  -2.939  1.00 0.00 ? 48 GLN A NE2  8  
ATOM   6312  H  H    . GLN A 1 48 ? 18.548 -5.124  -6.116  1.00 0.00 ? 48 GLN A H    8  
ATOM   6313  H  HA   . GLN A 1 48 ? 20.877 -6.847  -5.827  1.00 0.00 ? 48 GLN A HA   8  
ATOM   6314  H  HB2  . GLN A 1 48 ? 21.225 -4.513  -5.596  1.00 0.00 ? 48 GLN A HB2  8  
ATOM   6315  H  HB3  . GLN A 1 48 ? 19.875 -4.343  -4.459  1.00 0.00 ? 48 GLN A HB3  8  
ATOM   6316  H  HG2  . GLN A 1 48 ? 22.082 -4.205  -3.353  1.00 0.00 ? 48 GLN A HG2  8  
ATOM   6317  H  HG3  . GLN A 1 48 ? 21.055 -5.488  -2.719  1.00 0.00 ? 48 GLN A HG3  8  
ATOM   6318  H  HE21 . GLN A 1 48 ? 22.388 -7.159  -2.111  1.00 0.00 ? 48 GLN A HE21 8  
ATOM   6319  H  HE22 . GLN A 1 48 ? 23.702 -7.795  -3.088  1.00 0.00 ? 48 GLN A HE22 8  
ATOM   6320  N  N    . PRO A 1 49 ? 20.029 -8.347  -3.852  1.00 0.00 ? 49 PRO A N    8  
ATOM   6321  C  CA   . PRO A 1 49 ? 19.598 -9.117  -2.692  1.00 0.00 ? 49 PRO A CA   8  
ATOM   6322  C  C    . PRO A 1 49 ? 20.246 -8.566  -1.416  1.00 0.00 ? 49 PRO A C    8  
ATOM   6323  O  O    . PRO A 1 49 ? 21.106 -9.207  -0.816  1.00 0.00 ? 49 PRO A O    8  
ATOM   6324  C  CB   . PRO A 1 49 ? 19.989 -10.568 -3.001  1.00 0.00 ? 49 PRO A CB   8  
ATOM   6325  C  CG   . PRO A 1 49 ? 21.219 -10.407 -3.891  1.00 0.00 ? 49 PRO A CG   8  
ATOM   6326  C  CD   . PRO A 1 49 ? 20.871 -9.167  -4.712  1.00 0.00 ? 49 PRO A CD   8  
ATOM   6327  H  HA   . PRO A 1 49 ? 18.514 -9.078  -2.576  1.00 0.00 ? 49 PRO A HA   8  
ATOM   6328  H  HB2  . PRO A 1 49 ? 20.187 -11.171 -2.114  1.00 0.00 ? 49 PRO A HB2  8  
ATOM   6329  H  HB3  . PRO A 1 49 ? 19.194 -11.029 -3.590  1.00 0.00 ? 49 PRO A HB3  8  
ATOM   6330  H  HG2  . PRO A 1 49 ? 22.094 -10.203 -3.271  1.00 0.00 ? 49 PRO A HG2  8  
ATOM   6331  H  HG3  . PRO A 1 49 ? 21.397 -11.282 -4.517  1.00 0.00 ? 49 PRO A HG3  8  
ATOM   6332  H  HD2  . PRO A 1 49 ? 21.792 -8.666  -5.012  1.00 0.00 ? 49 PRO A HD2  8  
ATOM   6333  H  HD3  . PRO A 1 49 ? 20.305 -9.467  -5.594  1.00 0.00 ? 49 PRO A HD3  8  
ATOM   6334  N  N    . ALA A 1 50 ? 19.824 -7.362  -1.011  1.00 0.00 ? 50 ALA A N    8  
ATOM   6335  C  CA   . ALA A 1 50 ? 20.142 -6.756  0.274   1.00 0.00 ? 50 ALA A CA   8  
ATOM   6336  C  C    . ALA A 1 50 ? 19.173 -5.602  0.532   1.00 0.00 ? 50 ALA A C    8  
ATOM   6337  O  O    . ALA A 1 50 ? 18.707 -4.965  -0.411  1.00 0.00 ? 50 ALA A O    8  
ATOM   6338  C  CB   . ALA A 1 50 ? 21.591 -6.253  0.302   1.00 0.00 ? 50 ALA A CB   8  
ATOM   6339  H  H    . ALA A 1 50 ? 19.156 -6.868  -1.592  1.00 0.00 ? 50 ALA A H    8  
ATOM   6340  H  HA   . ALA A 1 50 ? 20.015 -7.507  1.054   1.00 0.00 ? 50 ALA A HA   8  
ATOM   6341  H  HB1  . ALA A 1 50 ? 22.286 -7.076  0.137   1.00 0.00 ? 50 ALA A HB1  8  
ATOM   6342  H  HB2  . ALA A 1 50 ? 21.742 -5.494  -0.465  1.00 0.00 ? 50 ALA A HB2  8  
ATOM   6343  H  HB3  . ALA A 1 50 ? 21.801 -5.813  1.277   1.00 0.00 ? 50 ALA A HB3  8  
ATOM   6344  N  N    . THR A 1 51 ? 18.872 -5.344  1.810   1.00 0.00 ? 51 THR A N    8  
ATOM   6345  C  CA   . THR A 1 51 ? 17.989 -4.268  2.239   1.00 0.00 ? 51 THR A CA   8  
ATOM   6346  C  C    . THR A 1 51 ? 18.660 -2.908  2.026   1.00 0.00 ? 51 THR A C    8  
ATOM   6347  O  O    . THR A 1 51 ? 19.880 -2.815  2.290   1.00 0.00 ? 51 THR A O    8  
ATOM   6348  C  CB   . THR A 1 51 ? 17.618 -4.482  3.715   1.00 0.00 ? 51 THR A CB   8  
ATOM   6349  O  OG1  . THR A 1 51 ? 17.116 -5.791  3.892   1.00 0.00 ? 51 THR A OG1  8  
ATOM   6350  C  CG2  . THR A 1 51 ? 16.559 -3.480  4.188   1.00 0.00 ? 51 THR A CG2  8  
ATOM   6351  O  OXT  . THR A 1 51 ? 17.942 -1.969  1.620   1.00 0.00 ? 51 THR A OXT  8  
ATOM   6352  H  H    . THR A 1 51 ? 19.285 -5.915  2.533   1.00 0.00 ? 51 THR A H    8  
ATOM   6353  H  HA   . THR A 1 51 ? 17.076 -4.312  1.645   1.00 0.00 ? 51 THR A HA   8  
ATOM   6354  H  HB   . THR A 1 51 ? 18.511 -4.369  4.332   1.00 0.00 ? 51 THR A HB   8  
ATOM   6355  H  HG1  . THR A 1 51 ? 16.349 -5.903  3.327   1.00 0.00 ? 51 THR A HG1  8  
ATOM   6356  H  HG21 . THR A 1 51 ? 16.952 -2.465  4.144   1.00 0.00 ? 51 THR A HG21 8  
ATOM   6357  H  HG22 . THR A 1 51 ? 15.671 -3.548  3.559   1.00 0.00 ? 51 THR A HG22 8  
ATOM   6358  H  HG23 . THR A 1 51 ? 16.284 -3.703  5.219   1.00 0.00 ? 51 THR A HG23 8  
HETATM 6359  ZN ZN   . ZN  B 2 .  ? 6.950  5.029   -0.564  1.00 0.00 ? 52 ZN  A ZN   8  
HETATM 6360  ZN ZN   . ZN  C 2 .  ? 14.950 -2.777  -9.209  1.00 0.00 ? 53 ZN  A ZN   8  
ATOM   6361  N  N    . ALA A 1 1  ? 3.514  10.677  -5.883  1.00 0.00 ? 1  ALA A N    9  
ATOM   6362  C  CA   . ALA A 1 1  ? 2.749  9.736   -6.723  1.00 0.00 ? 1  ALA A CA   9  
ATOM   6363  C  C    . ALA A 1 1  ? 2.773  8.327   -6.124  1.00 0.00 ? 1  ALA A C    9  
ATOM   6364  O  O    . ALA A 1 1  ? 3.269  8.134   -5.015  1.00 0.00 ? 1  ALA A O    9  
ATOM   6365  C  CB   . ALA A 1 1  ? 3.276  9.756   -8.163  1.00 0.00 ? 1  ALA A CB   9  
ATOM   6366  H  H1   . ALA A 1 1  ? 3.127  10.684  -4.945  1.00 0.00 ? 1  ALA A H1   9  
ATOM   6367  H  H2   . ALA A 1 1  ? 4.477  10.380  -5.833  1.00 0.00 ? 1  ALA A H2   9  
ATOM   6368  H  H3   . ALA A 1 1  ? 3.462  11.608  -6.269  1.00 0.00 ? 1  ALA A H3   9  
ATOM   6369  H  HA   . ALA A 1 1  ? 1.713  10.079  -6.737  1.00 0.00 ? 1  ALA A HA   9  
ATOM   6370  H  HB1  . ALA A 1 1  ? 2.617  9.186   -8.818  1.00 0.00 ? 1  ALA A HB1  9  
ATOM   6371  H  HB2  . ALA A 1 1  ? 3.313  10.784  -8.526  1.00 0.00 ? 1  ALA A HB2  9  
ATOM   6372  H  HB3  . ALA A 1 1  ? 4.276  9.326   -8.203  1.00 0.00 ? 1  ALA A HB3  9  
ATOM   6373  N  N    . ARG A 1 2  ? 2.225  7.345   -6.854  1.00 0.00 ? 2  ARG A N    9  
ATOM   6374  C  CA   . ARG A 1 2  ? 1.978  6.003   -6.347  1.00 0.00 ? 2  ARG A CA   9  
ATOM   6375  C  C    . ARG A 1 2  ? 3.297  5.223   -6.277  1.00 0.00 ? 2  ARG A C    9  
ATOM   6376  O  O    . ARG A 1 2  ? 3.687  4.547   -7.229  1.00 0.00 ? 2  ARG A O    9  
ATOM   6377  C  CB   . ARG A 1 2  ? 0.926  5.307   -7.227  1.00 0.00 ? 2  ARG A CB   9  
ATOM   6378  C  CG   . ARG A 1 2  ? 0.415  3.984   -6.634  1.00 0.00 ? 2  ARG A CG   9  
ATOM   6379  C  CD   . ARG A 1 2  ? -0.567 4.175   -5.468  1.00 0.00 ? 2  ARG A CD   9  
ATOM   6380  N  NE   . ARG A 1 2  ? -1.807 4.828   -5.907  1.00 0.00 ? 2  ARG A NE   9  
ATOM   6381  C  CZ   . ARG A 1 2  ? -2.859 5.112   -5.119  1.00 0.00 ? 2  ARG A CZ   9  
ATOM   6382  N  NH1  . ARG A 1 2  ? -2.851 4.812   -3.812  1.00 0.00 ? 2  ARG A NH1  9  
ATOM   6383  N  NH2  . ARG A 1 2  ? -3.936 5.705   -5.651  1.00 0.00 ? 2  ARG A NH2  9  
ATOM   6384  H  H    . ARG A 1 2  ? 1.873  7.559   -7.775  1.00 0.00 ? 2  ARG A H    9  
ATOM   6385  H  HA   . ARG A 1 2  ? 1.566  6.098   -5.341  1.00 0.00 ? 2  ARG A HA   9  
ATOM   6386  H  HB2  . ARG A 1 2  ? 0.081  5.981   -7.376  1.00 0.00 ? 2  ARG A HB2  9  
ATOM   6387  H  HB3  . ARG A 1 2  ? 1.362  5.105   -8.207  1.00 0.00 ? 2  ARG A HB3  9  
ATOM   6388  H  HG2  . ARG A 1 2  ? -0.099 3.430   -7.420  1.00 0.00 ? 2  ARG A HG2  9  
ATOM   6389  H  HG3  . ARG A 1 2  ? 1.259  3.380   -6.295  1.00 0.00 ? 2  ARG A HG3  9  
ATOM   6390  H  HD2  . ARG A 1 2  ? -0.817 3.192   -5.070  1.00 0.00 ? 2  ARG A HD2  9  
ATOM   6391  H  HD3  . ARG A 1 2  ? -0.104 4.767   -4.680  1.00 0.00 ? 2  ARG A HD3  9  
ATOM   6392  H  HE   . ARG A 1 2  ? -1.867 5.069   -6.886  1.00 0.00 ? 2  ARG A HE   9  
ATOM   6393  H  HH11 . ARG A 1 2  ? -2.055 4.351   -3.388  1.00 0.00 ? 2  ARG A HH11 9  
ATOM   6394  H  HH12 . ARG A 1 2  ? -3.649 5.031   -3.236  1.00 0.00 ? 2  ARG A HH12 9  
ATOM   6395  H  HH21 . ARG A 1 2  ? -3.957 5.933   -6.635  1.00 0.00 ? 2  ARG A HH21 9  
ATOM   6396  H  HH22 . ARG A 1 2  ? -4.736 5.923   -5.074  1.00 0.00 ? 2  ARG A HH22 9  
ATOM   6397  N  N    . CYS A 1 3  ? 3.955  5.300   -5.116  1.00 0.00 ? 3  CYS A N    9  
ATOM   6398  C  CA   . CYS A 1 3  ? 5.133  4.515   -4.784  1.00 0.00 ? 3  CYS A CA   9  
ATOM   6399  C  C    . CYS A 1 3  ? 4.734  3.048   -4.634  1.00 0.00 ? 3  CYS A C    9  
ATOM   6400  O  O    . CYS A 1 3  ? 3.722  2.747   -4.010  1.00 0.00 ? 3  CYS A O    9  
ATOM   6401  C  CB   . CYS A 1 3  ? 5.696  5.038   -3.461  1.00 0.00 ? 3  CYS A CB   9  
ATOM   6402  S  SG   . CYS A 1 3  ? 6.937  3.984   -2.665  1.00 0.00 ? 3  CYS A SG   9  
ATOM   6403  H  H    . CYS A 1 3  ? 3.616  5.950   -4.422  1.00 0.00 ? 3  CYS A H    9  
ATOM   6404  H  HA   . CYS A 1 3  ? 5.883  4.629   -5.568  1.00 0.00 ? 3  CYS A HA   9  
ATOM   6405  H  HB2  . CYS A 1 3  ? 6.131  6.025   -3.630  1.00 0.00 ? 3  CYS A HB2  9  
ATOM   6406  H  HB3  . CYS A 1 3  ? 4.864  5.136   -2.762  1.00 0.00 ? 3  CYS A HB3  9  
ATOM   6407  N  N    . LYS A 1 4  ? 5.521  2.132   -5.202  1.00 0.00 ? 4  LYS A N    9  
ATOM   6408  C  CA   . LYS A 1 4  ? 5.158  0.727   -5.294  1.00 0.00 ? 4  LYS A CA   9  
ATOM   6409  C  C    . LYS A 1 4  ? 5.160  0.041   -3.922  1.00 0.00 ? 4  LYS A C    9  
ATOM   6410  O  O    . LYS A 1 4  ? 4.416  -0.918  -3.726  1.00 0.00 ? 4  LYS A O    9  
ATOM   6411  C  CB   . LYS A 1 4  ? 6.091  0.029   -6.290  1.00 0.00 ? 4  LYS A CB   9  
ATOM   6412  C  CG   . LYS A 1 4  ? 6.021  0.612   -7.711  1.00 0.00 ? 4  LYS A CG   9  
ATOM   6413  C  CD   . LYS A 1 4  ? 4.653  0.401   -8.378  1.00 0.00 ? 4  LYS A CD   9  
ATOM   6414  C  CE   . LYS A 1 4  ? 4.622  0.964   -9.804  1.00 0.00 ? 4  LYS A CE   9  
ATOM   6415  N  NZ   . LYS A 1 4  ? 4.693  2.436   -9.817  1.00 0.00 ? 4  LYS A NZ   9  
ATOM   6416  H  H    . LYS A 1 4  ? 6.379  2.420   -5.652  1.00 0.00 ? 4  LYS A H    9  
ATOM   6417  H  HA   . LYS A 1 4  ? 4.139  0.655   -5.667  1.00 0.00 ? 4  LYS A HA   9  
ATOM   6418  H  HB2  . LYS A 1 4  ? 7.115  0.126   -5.924  1.00 0.00 ? 4  LYS A HB2  9  
ATOM   6419  H  HB3  . LYS A 1 4  ? 5.833  -1.028  -6.331  1.00 0.00 ? 4  LYS A HB3  9  
ATOM   6420  H  HG2  . LYS A 1 4  ? 6.258  1.674   -7.685  1.00 0.00 ? 4  LYS A HG2  9  
ATOM   6421  H  HG3  . LYS A 1 4  ? 6.778  0.111   -8.316  1.00 0.00 ? 4  LYS A HG3  9  
ATOM   6422  H  HD2  . LYS A 1 4  ? 4.447  -0.670  -8.419  1.00 0.00 ? 4  LYS A HD2  9  
ATOM   6423  H  HD3  . LYS A 1 4  ? 3.864  0.888   -7.806  1.00 0.00 ? 4  LYS A HD3  9  
ATOM   6424  H  HE2  . LYS A 1 4  ? 5.450  0.554   -10.383 1.00 0.00 ? 4  LYS A HE2  9  
ATOM   6425  H  HE3  . LYS A 1 4  ? 3.686  0.663   -10.276 1.00 0.00 ? 4  LYS A HE3  9  
ATOM   6426  H  HZ1  . LYS A 1 4  ? 4.612  2.771   -10.767 1.00 0.00 ? 4  LYS A HZ1  9  
ATOM   6427  H  HZ2  . LYS A 1 4  ? 3.942  2.824   -9.261  1.00 0.00 ? 4  LYS A HZ2  9  
ATOM   6428  H  HZ3  . LYS A 1 4  ? 5.577  2.737   -9.433  1.00 0.00 ? 4  LYS A HZ3  9  
ATOM   6429  N  N    . VAL A 1 5  ? 5.965  0.541   -2.975  1.00 0.00 ? 5  VAL A N    9  
ATOM   6430  C  CA   . VAL A 1 5  ? 5.991  0.077   -1.594  1.00 0.00 ? 5  VAL A CA   9  
ATOM   6431  C  C    . VAL A 1 5  ? 4.710  0.494   -0.866  1.00 0.00 ? 5  VAL A C    9  
ATOM   6432  O  O    . VAL A 1 5  ? 3.842  -0.342  -0.622  1.00 0.00 ? 5  VAL A O    9  
ATOM   6433  C  CB   . VAL A 1 5  ? 7.259  0.595   -0.890  1.00 0.00 ? 5  VAL A CB   9  
ATOM   6434  C  CG1  . VAL A 1 5  ? 7.328  0.181   0.585   1.00 0.00 ? 5  VAL A CG1  9  
ATOM   6435  C  CG2  . VAL A 1 5  ? 8.510  0.074   -1.600  1.00 0.00 ? 5  VAL A CG2  9  
ATOM   6436  H  H    . VAL A 1 5  ? 6.581  1.299   -3.224  1.00 0.00 ? 5  VAL A H    9  
ATOM   6437  H  HA   . VAL A 1 5  ? 6.041  -1.011  -1.593  1.00 0.00 ? 5  VAL A HA   9  
ATOM   6438  H  HB   . VAL A 1 5  ? 7.271  1.682   -0.935  1.00 0.00 ? 5  VAL A HB   9  
ATOM   6439  H  HG11 . VAL A 1 5  ? 8.253  0.560   1.021   1.00 0.00 ? 5  VAL A HG11 9  
ATOM   6440  H  HG12 . VAL A 1 5  ? 6.493  0.600   1.146   1.00 0.00 ? 5  VAL A HG12 9  
ATOM   6441  H  HG13 . VAL A 1 5  ? 7.310  -0.907  0.669   1.00 0.00 ? 5  VAL A HG13 9  
ATOM   6442  H  HG21 . VAL A 1 5  ? 8.498  -1.015  -1.637  1.00 0.00 ? 5  VAL A HG21 9  
ATOM   6443  H  HG22 . VAL A 1 5  ? 8.556  0.469   -2.615  1.00 0.00 ? 5  VAL A HG22 9  
ATOM   6444  H  HG23 . VAL A 1 5  ? 9.397  0.399   -1.057  1.00 0.00 ? 5  VAL A HG23 9  
ATOM   6445  N  N    . CYS A 1 6  ? 4.594  1.779   -0.504  1.00 0.00 ? 6  CYS A N    9  
ATOM   6446  C  CA   . CYS A 1 6  ? 3.537  2.257   0.381   1.00 0.00 ? 6  CYS A CA   9  
ATOM   6447  C  C    . CYS A 1 6  ? 2.193  2.428   -0.334  1.00 0.00 ? 6  CYS A C    9  
ATOM   6448  O  O    . CYS A 1 6  ? 1.156  2.388   0.328   1.00 0.00 ? 6  CYS A O    9  
ATOM   6449  C  CB   . CYS A 1 6  ? 3.967  3.537   1.111   1.00 0.00 ? 6  CYS A CB   9  
ATOM   6450  S  SG   . CYS A 1 6  ? 4.511  4.942   0.102   1.00 0.00 ? 6  CYS A SG   9  
ATOM   6451  H  H    . CYS A 1 6  ? 5.314  2.431   -0.779  1.00 0.00 ? 6  CYS A H    9  
ATOM   6452  H  HA   . CYS A 1 6  ? 3.385  1.506   1.159   1.00 0.00 ? 6  CYS A HA   9  
ATOM   6453  H  HB2  . CYS A 1 6  ? 3.125  3.878   1.717   1.00 0.00 ? 6  CYS A HB2  9  
ATOM   6454  H  HB3  . CYS A 1 6  ? 4.784  3.293   1.791   1.00 0.00 ? 6  CYS A HB3  9  
ATOM   6455  N  N    . ARG A 1 7  ? 2.207  2.615   -1.664  1.00 0.00 ? 7  ARG A N    9  
ATOM   6456  C  CA   . ARG A 1 7  ? 1.024  2.733   -2.515  1.00 0.00 ? 7  ARG A CA   9  
ATOM   6457  C  C    . ARG A 1 7  ? 0.070  3.787   -1.960  1.00 0.00 ? 7  ARG A C    9  
ATOM   6458  O  O    . ARG A 1 7  ? -1.140 3.577   -1.893  1.00 0.00 ? 7  ARG A O    9  
ATOM   6459  C  CB   . ARG A 1 7  ? 0.361  1.361   -2.711  1.00 0.00 ? 7  ARG A CB   9  
ATOM   6460  C  CG   . ARG A 1 7  ? 1.346  0.365   -3.338  1.00 0.00 ? 7  ARG A CG   9  
ATOM   6461  C  CD   . ARG A 1 7  ? 0.667  -0.965  -3.680  1.00 0.00 ? 7  ARG A CD   9  
ATOM   6462  N  NE   . ARG A 1 7  ? -0.345 -0.814  -4.735  1.00 0.00 ? 7  ARG A NE   9  
ATOM   6463  C  CZ   . ARG A 1 7  ? -0.087 -0.654  -6.045  1.00 0.00 ? 7  ARG A CZ   9  
ATOM   6464  N  NH1  . ARG A 1 7  ? 1.174  -0.643  -6.503  1.00 0.00 ? 7  ARG A NH1  9  
ATOM   6465  N  NH2  . ARG A 1 7  ? -1.103 -0.505  -6.905  1.00 0.00 ? 7  ARG A NH2  9  
ATOM   6466  H  H    . ARG A 1 7  ? 3.100  2.646   -2.139  1.00 0.00 ? 7  ARG A H    9  
ATOM   6467  H  HA   . ARG A 1 7  ? 1.339  3.091   -3.493  1.00 0.00 ? 7  ARG A HA   9  
ATOM   6468  H  HB2  . ARG A 1 7  ? 0.012  0.972   -1.752  1.00 0.00 ? 7  ARG A HB2  9  
ATOM   6469  H  HB3  . ARG A 1 7  ? -0.497 1.479   -3.372  1.00 0.00 ? 7  ARG A HB3  9  
ATOM   6470  H  HG2  . ARG A 1 7  ? 1.782  0.800   -4.237  1.00 0.00 ? 7  ARG A HG2  9  
ATOM   6471  H  HG3  . ARG A 1 7  ? 2.149  0.161   -2.629  1.00 0.00 ? 7  ARG A HG3  9  
ATOM   6472  H  HD2  . ARG A 1 7  ? 1.424  -1.688  -3.991  1.00 0.00 ? 7  ARG A HD2  9  
ATOM   6473  H  HD3  . ARG A 1 7  ? 0.182  -1.355  -2.784  1.00 0.00 ? 7  ARG A HD3  9  
ATOM   6474  H  HE   . ARG A 1 7  ? -1.309 -0.829  -4.434  1.00 0.00 ? 7  ARG A HE   9  
ATOM   6475  H  HH11 . ARG A 1 7  ? 1.943  -0.761  -5.859  1.00 0.00 ? 7  ARG A HH11 9  
ATOM   6476  H  HH12 . ARG A 1 7  ? 1.359  -0.534  -7.489  1.00 0.00 ? 7  ARG A HH12 9  
ATOM   6477  H  HH21 . ARG A 1 7  ? -2.056 -0.521  -6.571  1.00 0.00 ? 7  ARG A HH21 9  
ATOM   6478  H  HH22 . ARG A 1 7  ? -0.927 -0.391  -7.893  1.00 0.00 ? 7  ARG A HH22 9  
ATOM   6479  N  N    . LYS A 1 8  ? 0.638  4.939   -1.591  1.00 0.00 ? 8  LYS A N    9  
ATOM   6480  C  CA   . LYS A 1 8  ? -0.029 5.979   -0.831  1.00 0.00 ? 8  LYS A CA   9  
ATOM   6481  C  C    . LYS A 1 8  ? 0.803  7.255   -0.953  1.00 0.00 ? 8  LYS A C    9  
ATOM   6482  O  O    . LYS A 1 8  ? 1.991  7.191   -1.272  1.00 0.00 ? 8  LYS A O    9  
ATOM   6483  C  CB   . LYS A 1 8  ? -0.113 5.485   0.622   1.00 0.00 ? 8  LYS A CB   9  
ATOM   6484  C  CG   . LYS A 1 8  ? -0.930 6.358   1.579   1.00 0.00 ? 8  LYS A CG   9  
ATOM   6485  C  CD   . LYS A 1 8  ? -0.812 5.880   3.036   1.00 0.00 ? 8  LYS A CD   9  
ATOM   6486  C  CE   . LYS A 1 8  ? -1.211 4.413   3.266   1.00 0.00 ? 8  LYS A CE   9  
ATOM   6487  N  NZ   . LYS A 1 8  ? -0.102 3.468   3.021   1.00 0.00 ? 8  LYS A NZ   9  
ATOM   6488  H  H    . LYS A 1 8  ? 1.629  5.064   -1.744  1.00 0.00 ? 8  LYS A H    9  
ATOM   6489  H  HA   . LYS A 1 8  ? -1.031 6.147   -1.221  1.00 0.00 ? 8  LYS A HA   9  
ATOM   6490  H  HB2  . LYS A 1 8  ? -0.594 4.508   0.600   1.00 0.00 ? 8  LYS A HB2  9  
ATOM   6491  H  HB3  . LYS A 1 8  ? 0.903  5.386   1.005   1.00 0.00 ? 8  LYS A HB3  9  
ATOM   6492  H  HG2  . LYS A 1 8  ? -0.571 7.386   1.552   1.00 0.00 ? 8  LYS A HG2  9  
ATOM   6493  H  HG3  . LYS A 1 8  ? -1.976 6.345   1.271   1.00 0.00 ? 8  LYS A HG3  9  
ATOM   6494  H  HD2  . LYS A 1 8  ? 0.206  6.046   3.394   1.00 0.00 ? 8  LYS A HD2  9  
ATOM   6495  H  HD3  . LYS A 1 8  ? -1.479 6.507   3.629   1.00 0.00 ? 8  LYS A HD3  9  
ATOM   6496  H  HE2  . LYS A 1 8  ? -1.502 4.303   4.312   1.00 0.00 ? 8  LYS A HE2  9  
ATOM   6497  H  HE3  . LYS A 1 8  ? -2.069 4.156   2.643   1.00 0.00 ? 8  LYS A HE3  9  
ATOM   6498  H  HZ1  . LYS A 1 8  ? -0.406 2.532   3.249   1.00 0.00 ? 8  LYS A HZ1  9  
ATOM   6499  H  HZ2  . LYS A 1 8  ? 0.187  3.485   2.053   1.00 0.00 ? 8  LYS A HZ2  9  
ATOM   6500  H  HZ3  . LYS A 1 8  ? 0.684  3.709   3.606   1.00 0.00 ? 8  LYS A HZ3  9  
ATOM   6501  N  N    . LYS A 1 9  ? 0.180  8.409   -0.698  1.00 0.00 ? 9  LYS A N    9  
ATOM   6502  C  CA   . LYS A 1 9  ? 0.889  9.668   -0.561  1.00 0.00 ? 9  LYS A CA   9  
ATOM   6503  C  C    . LYS A 1 9  ? 1.702  9.625   0.734   1.00 0.00 ? 9  LYS A C    9  
ATOM   6504  O  O    . LYS A 1 9  ? 1.127  9.604   1.822   1.00 0.00 ? 9  LYS A O    9  
ATOM   6505  C  CB   . LYS A 1 9  ? -0.117 10.828  -0.564  1.00 0.00 ? 9  LYS A CB   9  
ATOM   6506  C  CG   . LYS A 1 9  ? 0.583  12.180  -0.380  1.00 0.00 ? 9  LYS A CG   9  
ATOM   6507  C  CD   . LYS A 1 9  ? -0.423 13.328  -0.526  1.00 0.00 ? 9  LYS A CD   9  
ATOM   6508  C  CE   . LYS A 1 9  ? 0.209  14.684  -0.188  1.00 0.00 ? 9  LYS A CE   9  
ATOM   6509  N  NZ   . LYS A 1 9  ? 1.346  15.006  -1.069  1.00 0.00 ? 9  LYS A NZ   9  
ATOM   6510  H  H    . LYS A 1 9  ? -0.806 8.400   -0.481  1.00 0.00 ? 9  LYS A H    9  
ATOM   6511  H  HA   . LYS A 1 9  ? 1.554  9.794   -1.416  1.00 0.00 ? 9  LYS A HA   9  
ATOM   6512  H  HB2  . LYS A 1 9  ? -0.642 10.828  -1.522  1.00 0.00 ? 9  LYS A HB2  9  
ATOM   6513  H  HB3  . LYS A 1 9  ? -0.842 10.688  0.240   1.00 0.00 ? 9  LYS A HB3  9  
ATOM   6514  H  HG2  . LYS A 1 9  ? 1.036  12.228  0.611   1.00 0.00 ? 9  LYS A HG2  9  
ATOM   6515  H  HG3  . LYS A 1 9  ? 1.363  12.277  -1.133  1.00 0.00 ? 9  LYS A HG3  9  
ATOM   6516  H  HD2  . LYS A 1 9  ? -0.811 13.346  -1.545  1.00 0.00 ? 9  LYS A HD2  9  
ATOM   6517  H  HD3  . LYS A 1 9  ? -1.255 13.158  0.159   1.00 0.00 ? 9  LYS A HD3  9  
ATOM   6518  H  HE2  . LYS A 1 9  ? -0.548 15.462  -0.296  1.00 0.00 ? 9  LYS A HE2  9  
ATOM   6519  H  HE3  . LYS A 1 9  ? 0.554  14.677  0.847   1.00 0.00 ? 9  LYS A HE3  9  
ATOM   6520  H  HZ1  . LYS A 1 9  ? 1.712  15.916  -0.833  1.00 0.00 ? 9  LYS A HZ1  9  
ATOM   6521  H  HZ2  . LYS A 1 9  ? 2.072  14.315  -0.947  1.00 0.00 ? 9  LYS A HZ2  9  
ATOM   6522  H  HZ3  . LYS A 1 9  ? 1.043  15.006  -2.033  1.00 0.00 ? 9  LYS A HZ3  9  
ATOM   6523  N  N    . GLY A 1 10 ? 3.031  9.579   0.603   1.00 0.00 ? 10 GLY A N    9  
ATOM   6524  C  CA   . GLY A 1 10 ? 3.966  9.747   1.703   1.00 0.00 ? 10 GLY A CA   9  
ATOM   6525  C  C    . GLY A 1 10 ? 4.577  11.141  1.609   1.00 0.00 ? 10 GLY A C    9  
ATOM   6526  O  O    . GLY A 1 10 ? 3.868  12.113  1.339   1.00 0.00 ? 10 GLY A O    9  
ATOM   6527  H  H    . GLY A 1 10 ? 3.421  9.638   -0.331  1.00 0.00 ? 10 GLY A H    9  
ATOM   6528  H  HA2  . GLY A 1 10 ? 3.482  9.633   2.674   1.00 0.00 ? 10 GLY A HA2  9  
ATOM   6529  H  HA3  . GLY A 1 10 ? 4.747  8.991   1.603   1.00 0.00 ? 10 GLY A HA3  9  
ATOM   6530  N  N    . GLU A 1 11 ? 5.897  11.232  1.799   1.00 0.00 ? 11 GLU A N    9  
ATOM   6531  C  CA   . GLU A 1 11 ? 6.661  12.438  1.531   1.00 0.00 ? 11 GLU A CA   9  
ATOM   6532  C  C    . GLU A 1 11 ? 6.839  12.554  0.017   1.00 0.00 ? 11 GLU A C    9  
ATOM   6533  O  O    . GLU A 1 11 ? 7.919  12.277  -0.505  1.00 0.00 ? 11 GLU A O    9  
ATOM   6534  C  CB   . GLU A 1 11 ? 8.019  12.402  2.249   1.00 0.00 ? 11 GLU A CB   9  
ATOM   6535  C  CG   . GLU A 1 11 ? 7.937  12.175  3.768   1.00 0.00 ? 11 GLU A CG   9  
ATOM   6536  C  CD   . GLU A 1 11 ? 7.606  10.739  4.179   1.00 0.00 ? 11 GLU A CD   9  
ATOM   6537  O  OE1  . GLU A 1 11 ? 7.819  9.827   3.347   1.00 0.00 ? 11 GLU A OE1  9  
ATOM   6538  O  OE2  . GLU A 1 11 ? 7.134  10.577  5.325   1.00 0.00 ? 11 GLU A OE2  9  
ATOM   6539  H  H    . GLU A 1 11 ? 6.415  10.413  2.093   1.00 0.00 ? 11 GLU A H    9  
ATOM   6540  H  HA   . GLU A 1 11 ? 6.120  13.309  1.900   1.00 0.00 ? 11 GLU A HA   9  
ATOM   6541  H  HB2  . GLU A 1 11 ? 8.646  11.634  1.799   1.00 0.00 ? 11 GLU A HB2  9  
ATOM   6542  H  HB3  . GLU A 1 11 ? 8.499  13.371  2.086   1.00 0.00 ? 11 GLU A HB3  9  
ATOM   6543  H  HG2  . GLU A 1 11 ? 8.909  12.417  4.199   1.00 0.00 ? 11 GLU A HG2  9  
ATOM   6544  H  HG3  . GLU A 1 11 ? 7.196  12.855  4.191   1.00 0.00 ? 11 GLU A HG3  9  
ATOM   6545  N  N    . ASP A 1 12 ? 5.772  12.954  -0.687  1.00 0.00 ? 12 ASP A N    9  
ATOM   6546  C  CA   . ASP A 1 12 ? 5.749  13.029  -2.143  1.00 0.00 ? 12 ASP A CA   9  
ATOM   6547  C  C    . ASP A 1 12 ? 6.453  14.307  -2.600  1.00 0.00 ? 12 ASP A C    9  
ATOM   6548  O  O    . ASP A 1 12 ? 5.830  15.219  -3.141  1.00 0.00 ? 12 ASP A O    9  
ATOM   6549  C  CB   . ASP A 1 12 ? 4.310  12.934  -2.672  1.00 0.00 ? 12 ASP A CB   9  
ATOM   6550  C  CG   . ASP A 1 12 ? 3.693  11.541  -2.549  1.00 0.00 ? 12 ASP A CG   9  
ATOM   6551  O  OD1  . ASP A 1 12 ? 4.194  10.737  -1.734  1.00 0.00 ? 12 ASP A OD1  9  
ATOM   6552  O  OD2  . ASP A 1 12 ? 2.719  11.298  -3.294  1.00 0.00 ? 12 ASP A OD2  9  
ATOM   6553  H  H    . ASP A 1 12 ? 4.904  13.104  -0.191  1.00 0.00 ? 12 ASP A H    9  
ATOM   6554  H  HA   . ASP A 1 12 ? 6.302  12.185  -2.545  1.00 0.00 ? 12 ASP A HA   9  
ATOM   6555  H  HB2  . ASP A 1 12 ? 3.687  13.653  -2.142  1.00 0.00 ? 12 ASP A HB2  9  
ATOM   6556  H  HB3  . ASP A 1 12 ? 4.315  13.187  -3.735  1.00 0.00 ? 12 ASP A HB3  9  
ATOM   6557  N  N    . ASP A 1 13 ? 7.767  14.347  -2.358  1.00 0.00 ? 13 ASP A N    9  
ATOM   6558  C  CA   . ASP A 1 13 ? 8.649  15.481  -2.561  1.00 0.00 ? 13 ASP A CA   9  
ATOM   6559  C  C    . ASP A 1 13 ? 9.736  15.077  -3.554  1.00 0.00 ? 13 ASP A C    9  
ATOM   6560  O  O    . ASP A 1 13 ? 9.923  15.729  -4.580  1.00 0.00 ? 13 ASP A O    9  
ATOM   6561  C  CB   . ASP A 1 13 ? 9.237  15.897  -1.206  1.00 0.00 ? 13 ASP A CB   9  
ATOM   6562  C  CG   . ASP A 1 13 ? 10.154 17.112  -1.320  1.00 0.00 ? 13 ASP A CG   9  
ATOM   6563  O  OD1  . ASP A 1 13 ? 9.853  17.999  -2.148  1.00 0.00 ? 13 ASP A OD1  9  
ATOM   6564  O  OD2  . ASP A 1 13 ? 11.177 17.129  -0.598  1.00 0.00 ? 13 ASP A OD2  9  
ATOM   6565  H  H    . ASP A 1 13 ? 8.177  13.533  -1.923  1.00 0.00 ? 13 ASP A H    9  
ATOM   6566  H  HA   . ASP A 1 13 ? 8.092  16.319  -2.971  1.00 0.00 ? 13 ASP A HA   9  
ATOM   6567  H  HB2  . ASP A 1 13 ? 8.427  16.122  -0.511  1.00 0.00 ? 13 ASP A HB2  9  
ATOM   6568  H  HB3  . ASP A 1 13 ? 9.803  15.063  -0.794  1.00 0.00 ? 13 ASP A HB3  9  
ATOM   6569  N  N    . LYS A 1 14 ? 10.441 13.988  -3.228  1.00 0.00 ? 14 LYS A N    9  
ATOM   6570  C  CA   . LYS A 1 14 ? 11.588 13.477  -3.961  1.00 0.00 ? 14 LYS A CA   9  
ATOM   6571  C  C    . LYS A 1 14 ? 11.368 11.993  -4.265  1.00 0.00 ? 14 LYS A C    9  
ATOM   6572  O  O    . LYS A 1 14 ? 12.038 11.136  -3.690  1.00 0.00 ? 14 LYS A O    9  
ATOM   6573  C  CB   . LYS A 1 14 ? 12.872 13.681  -3.138  1.00 0.00 ? 14 LYS A CB   9  
ATOM   6574  C  CG   . LYS A 1 14 ? 13.160 15.133  -2.738  1.00 0.00 ? 14 LYS A CG   9  
ATOM   6575  C  CD   . LYS A 1 14 ? 13.407 16.051  -3.942  1.00 0.00 ? 14 LYS A CD   9  
ATOM   6576  C  CE   . LYS A 1 14 ? 13.800 17.467  -3.501  1.00 0.00 ? 14 LYS A CE   9  
ATOM   6577  N  NZ   . LYS A 1 14 ? 12.721 18.144  -2.757  1.00 0.00 ? 14 LYS A NZ   9  
ATOM   6578  H  H    . LYS A 1 14 ? 10.188 13.514  -2.374  1.00 0.00 ? 14 LYS A H    9  
ATOM   6579  H  HA   . LYS A 1 14 ? 11.707 13.988  -4.914  1.00 0.00 ? 14 LYS A HA   9  
ATOM   6580  H  HB2  . LYS A 1 14 ? 12.771 13.110  -2.215  1.00 0.00 ? 14 LYS A HB2  9  
ATOM   6581  H  HB3  . LYS A 1 14 ? 13.723 13.296  -3.703  1.00 0.00 ? 14 LYS A HB3  9  
ATOM   6582  H  HG2  . LYS A 1 14 ? 12.330 15.501  -2.143  1.00 0.00 ? 14 LYS A HG2  9  
ATOM   6583  H  HG3  . LYS A 1 14 ? 14.054 15.134  -2.112  1.00 0.00 ? 14 LYS A HG3  9  
ATOM   6584  H  HD2  . LYS A 1 14 ? 14.219 15.635  -4.541  1.00 0.00 ? 14 LYS A HD2  9  
ATOM   6585  H  HD3  . LYS A 1 14 ? 12.514 16.112  -4.563  1.00 0.00 ? 14 LYS A HD3  9  
ATOM   6586  H  HE2  . LYS A 1 14 ? 14.692 17.421  -2.875  1.00 0.00 ? 14 LYS A HE2  9  
ATOM   6587  H  HE3  . LYS A 1 14 ? 14.028 18.057  -4.389  1.00 0.00 ? 14 LYS A HE3  9  
ATOM   6588  H  HZ1  . LYS A 1 14 ? 12.512 17.648  -1.897  1.00 0.00 ? 14 LYS A HZ1  9  
ATOM   6589  H  HZ2  . LYS A 1 14 ? 12.999 19.087  -2.529  1.00 0.00 ? 14 LYS A HZ2  9  
ATOM   6590  H  HZ3  . LYS A 1 14 ? 11.873 18.173  -3.309  1.00 0.00 ? 14 LYS A HZ3  9  
ATOM   6591  N  N    . LEU A 1 15 ? 10.430 11.676  -5.166  1.00 0.00 ? 15 LEU A N    9  
ATOM   6592  C  CA   . LEU A 1 15 ? 10.320 10.316  -5.678  1.00 0.00 ? 15 LEU A CA   9  
ATOM   6593  C  C    . LEU A 1 15 ? 11.519 10.003  -6.573  1.00 0.00 ? 15 LEU A C    9  
ATOM   6594  O  O    . LEU A 1 15 ? 12.181 10.900  -7.094  1.00 0.00 ? 15 LEU A O    9  
ATOM   6595  C  CB   . LEU A 1 15 ? 9.000  10.066  -6.425  1.00 0.00 ? 15 LEU A CB   9  
ATOM   6596  C  CG   . LEU A 1 15 ? 7.815  9.790   -5.485  1.00 0.00 ? 15 LEU A CG   9  
ATOM   6597  C  CD1  . LEU A 1 15 ? 7.226  11.078  -4.905  1.00 0.00 ? 15 LEU A CD1  9  
ATOM   6598  C  CD2  . LEU A 1 15 ? 6.724  9.033   -6.251  1.00 0.00 ? 15 LEU A CD2  9  
ATOM   6599  H  H    . LEU A 1 15 ? 9.876  12.404  -5.595  1.00 0.00 ? 15 LEU A H    9  
ATOM   6600  H  HA   . LEU A 1 15 ? 10.357 9.628   -4.832  1.00 0.00 ? 15 LEU A HA   9  
ATOM   6601  H  HB2  . LEU A 1 15 ? 8.777  10.901  -7.095  1.00 0.00 ? 15 LEU A HB2  9  
ATOM   6602  H  HB3  . LEU A 1 15 ? 9.137  9.169   -7.032  1.00 0.00 ? 15 LEU A HB3  9  
ATOM   6603  H  HG   . LEU A 1 15 ? 8.137  9.146   -4.666  1.00 0.00 ? 15 LEU A HG   9  
ATOM   6604  H  HD11 . LEU A 1 15 ? 6.328  10.831  -4.339  1.00 0.00 ? 15 LEU A HD11 9  
ATOM   6605  H  HD12 . LEU A 1 15 ? 7.944  11.555  -4.238  1.00 0.00 ? 15 LEU A HD12 9  
ATOM   6606  H  HD13 . LEU A 1 15 ? 6.961  11.769  -5.705  1.00 0.00 ? 15 LEU A HD13 9  
ATOM   6607  H  HD21 . LEU A 1 15 ? 7.120  8.091   -6.629  1.00 0.00 ? 15 LEU A HD21 9  
ATOM   6608  H  HD22 . LEU A 1 15 ? 5.893  8.812   -5.583  1.00 0.00 ? 15 LEU A HD22 9  
ATOM   6609  H  HD23 . LEU A 1 15 ? 6.374  9.637   -7.087  1.00 0.00 ? 15 LEU A HD23 9  
ATOM   6610  N  N    . ILE A 1 16 ? 11.785 8.707   -6.734  1.00 0.00 ? 16 ILE A N    9  
ATOM   6611  C  CA   . ILE A 1 16 ? 12.982 8.170   -7.351  1.00 0.00 ? 16 ILE A CA   9  
ATOM   6612  C  C    . ILE A 1 16 ? 12.619 6.810   -7.949  1.00 0.00 ? 16 ILE A C    9  
ATOM   6613  O  O    . ILE A 1 16 ? 11.976 5.996   -7.289  1.00 0.00 ? 16 ILE A O    9  
ATOM   6614  C  CB   . ILE A 1 16 ? 14.112 8.105   -6.302  1.00 0.00 ? 16 ILE A CB   9  
ATOM   6615  C  CG1  . ILE A 1 16 ? 15.363 7.445   -6.907  1.00 0.00 ? 16 ILE A CG1  9  
ATOM   6616  C  CG2  . ILE A 1 16 ? 13.676 7.398   -5.007  1.00 0.00 ? 16 ILE A CG2  9  
ATOM   6617  C  CD1  . ILE A 1 16 ? 16.618 7.728   -6.077  1.00 0.00 ? 16 ILE A CD1  9  
ATOM   6618  H  H    . ILE A 1 16 ? 11.164 8.034   -6.305  1.00 0.00 ? 16 ILE A H    9  
ATOM   6619  H  HA   . ILE A 1 16 ? 13.296 8.832   -8.159  1.00 0.00 ? 16 ILE A HA   9  
ATOM   6620  H  HB   . ILE A 1 16 ? 14.369 9.133   -6.034  1.00 0.00 ? 16 ILE A HB   9  
ATOM   6621  H  HG12 . ILE A 1 16 ? 15.218 6.366   -6.982  1.00 0.00 ? 16 ILE A HG12 9  
ATOM   6622  H  HG13 . ILE A 1 16 ? 15.531 7.853   -7.906  1.00 0.00 ? 16 ILE A HG13 9  
ATOM   6623  H  HG21 . ILE A 1 16 ? 14.499 7.381   -4.297  1.00 0.00 ? 16 ILE A HG21 9  
ATOM   6624  H  HG22 . ILE A 1 16 ? 12.855 7.935   -4.536  1.00 0.00 ? 16 ILE A HG22 9  
ATOM   6625  H  HG23 . ILE A 1 16 ? 13.371 6.372   -5.204  1.00 0.00 ? 16 ILE A HG23 9  
ATOM   6626  H  HD11 . ILE A 1 16 ? 16.777 8.804   -6.002  1.00 0.00 ? 16 ILE A HD11 9  
ATOM   6627  H  HD12 . ILE A 1 16 ? 16.541 7.299   -5.080  1.00 0.00 ? 16 ILE A HD12 9  
ATOM   6628  H  HD13 . ILE A 1 16 ? 17.474 7.281   -6.573  1.00 0.00 ? 16 ILE A HD13 9  
ATOM   6629  N  N    . LEU A 1 17 ? 12.984 6.583   -9.216  1.00 0.00 ? 17 LEU A N    9  
ATOM   6630  C  CA   . LEU A 1 17 ? 12.803 5.300   -9.876  1.00 0.00 ? 17 LEU A CA   9  
ATOM   6631  C  C    . LEU A 1 17 ? 14.015 4.418   -9.588  1.00 0.00 ? 17 LEU A C    9  
ATOM   6632  O  O    . LEU A 1 17 ? 15.144 4.906   -9.572  1.00 0.00 ? 17 LEU A O    9  
ATOM   6633  C  CB   . LEU A 1 17 ? 12.629 5.498   -11.389 1.00 0.00 ? 17 LEU A CB   9  
ATOM   6634  C  CG   . LEU A 1 17 ? 11.178 5.808   -11.797 1.00 0.00 ? 17 LEU A CG   9  
ATOM   6635  C  CD1  . LEU A 1 17 ? 10.660 7.123   -11.201 1.00 0.00 ? 17 LEU A CD1  9  
ATOM   6636  C  CD2  . LEU A 1 17 ? 11.094 5.876   -13.326 1.00 0.00 ? 17 LEU A CD2  9  
ATOM   6637  H  H    . LEU A 1 17 ? 13.509 7.285   -9.715  1.00 0.00 ? 17 LEU A H    9  
ATOM   6638  H  HA   . LEU A 1 17 ? 11.908 4.810   -9.496  1.00 0.00 ? 17 LEU A HA   9  
ATOM   6639  H  HB2  . LEU A 1 17 ? 13.298 6.287   -11.740 1.00 0.00 ? 17 LEU A HB2  9  
ATOM   6640  H  HB3  . LEU A 1 17 ? 12.908 4.565   -11.880 1.00 0.00 ? 17 LEU A HB3  9  
ATOM   6641  H  HG   . LEU A 1 17 ? 10.533 4.995   -11.462 1.00 0.00 ? 17 LEU A HG   9  
ATOM   6642  H  HD11 . LEU A 1 17 ? 10.552 7.033   -10.121 1.00 0.00 ? 17 LEU A HD11 9  
ATOM   6643  H  HD12 . LEU A 1 17 ? 11.349 7.937   -11.431 1.00 0.00 ? 17 LEU A HD12 9  
ATOM   6644  H  HD13 . LEU A 1 17 ? 9.681  7.356   -11.621 1.00 0.00 ? 17 LEU A HD13 9  
ATOM   6645  H  HD21 . LEU A 1 17 ? 11.719 6.688   -13.700 1.00 0.00 ? 17 LEU A HD21 9  
ATOM   6646  H  HD22 . LEU A 1 17 ? 11.437 4.935   -13.757 1.00 0.00 ? 17 LEU A HD22 9  
ATOM   6647  H  HD23 . LEU A 1 17 ? 10.062 6.046   -13.634 1.00 0.00 ? 17 LEU A HD23 9  
ATOM   6648  N  N    . CYS A 1 18 ? 13.781 3.119   -9.367  1.00 0.00 ? 18 CYS A N    9  
ATOM   6649  C  CA   . CYS A 1 18 ? 14.859 2.146   -9.303  1.00 0.00 ? 18 CYS A CA   9  
ATOM   6650  C  C    . CYS A 1 18 ? 15.458 1.954   -10.698 1.00 0.00 ? 18 CYS A C    9  
ATOM   6651  O  O    . CYS A 1 18 ? 14.717 1.756   -11.657 1.00 0.00 ? 18 CYS A O    9  
ATOM   6652  C  CB   . CYS A 1 18 ? 14.358 0.822   -8.721  1.00 0.00 ? 18 CYS A CB   9  
ATOM   6653  S  SG   . CYS A 1 18 ? 15.580 -0.512  -8.804  1.00 0.00 ? 18 CYS A SG   9  
ATOM   6654  H  H    . CYS A 1 18 ? 12.826 2.789   -9.318  1.00 0.00 ? 18 CYS A H    9  
ATOM   6655  H  HA   . CYS A 1 18 ? 15.618 2.535   -8.628  1.00 0.00 ? 18 CYS A HA   9  
ATOM   6656  H  HB2  . CYS A 1 18 ? 14.088 0.990   -7.678  1.00 0.00 ? 18 CYS A HB2  9  
ATOM   6657  H  HB3  . CYS A 1 18 ? 13.469 0.483   -9.254  1.00 0.00 ? 18 CYS A HB3  9  
ATOM   6658  N  N    . ASP A 1 19 ? 16.791 2.011   -10.812 1.00 0.00 ? 19 ASP A N    9  
ATOM   6659  C  CA   . ASP A 1 19 ? 17.477 2.005   -12.101 1.00 0.00 ? 19 ASP A CA   9  
ATOM   6660  C  C    . ASP A 1 19 ? 17.223 0.689   -12.834 1.00 0.00 ? 19 ASP A C    9  
ATOM   6661  O  O    . ASP A 1 19 ? 16.842 0.681   -14.003 1.00 0.00 ? 19 ASP A O    9  
ATOM   6662  C  CB   . ASP A 1 19 ? 18.991 2.195   -11.908 1.00 0.00 ? 19 ASP A CB   9  
ATOM   6663  C  CG   . ASP A 1 19 ? 19.393 3.591   -11.438 1.00 0.00 ? 19 ASP A CG   9  
ATOM   6664  O  OD1  . ASP A 1 19 ? 18.693 4.555   -11.815 1.00 0.00 ? 19 ASP A OD1  9  
ATOM   6665  O  OD2  . ASP A 1 19 ? 20.414 3.670   -10.721 1.00 0.00 ? 19 ASP A OD2  9  
ATOM   6666  H  H    . ASP A 1 19 ? 17.352 2.064   -9.971  1.00 0.00 ? 19 ASP A H    9  
ATOM   6667  H  HA   . ASP A 1 19 ? 17.085 2.812   -12.719 1.00 0.00 ? 19 ASP A HA   9  
ATOM   6668  H  HB2  . ASP A 1 19 ? 19.363 1.458   -11.195 1.00 0.00 ? 19 ASP A HB2  9  
ATOM   6669  H  HB3  . ASP A 1 19 ? 19.488 2.026   -12.865 1.00 0.00 ? 19 ASP A HB3  9  
ATOM   6670  N  N    . GLU A 1 20 ? 17.434 -0.419  -12.120 1.00 0.00 ? 20 GLU A N    9  
ATOM   6671  C  CA   . GLU A 1 20 ? 17.470 -1.760  -12.675 1.00 0.00 ? 20 GLU A CA   9  
ATOM   6672  C  C    . GLU A 1 20 ? 16.099 -2.212  -13.189 1.00 0.00 ? 20 GLU A C    9  
ATOM   6673  O  O    . GLU A 1 20 ? 15.998 -2.684  -14.320 1.00 0.00 ? 20 GLU A O    9  
ATOM   6674  C  CB   . GLU A 1 20 ? 18.018 -2.703  -11.599 1.00 0.00 ? 20 GLU A CB   9  
ATOM   6675  C  CG   . GLU A 1 20 ? 18.295 -4.105  -12.151 1.00 0.00 ? 20 GLU A CG   9  
ATOM   6676  C  CD   . GLU A 1 20 ? 18.876 -5.019  -11.078 1.00 0.00 ? 20 GLU A CD   9  
ATOM   6677  O  OE1  . GLU A 1 20 ? 19.776 -4.547  -10.350 1.00 0.00 ? 20 GLU A OE1  9  
ATOM   6678  O  OE2  . GLU A 1 20 ? 18.404 -6.174  -10.999 1.00 0.00 ? 20 GLU A OE2  9  
ATOM   6679  H  H    . GLU A 1 20 ? 17.702 -0.301  -11.155 1.00 0.00 ? 20 GLU A H    9  
ATOM   6680  H  HA   . GLU A 1 20 ? 18.171 -1.757  -13.510 1.00 0.00 ? 20 GLU A HA   9  
ATOM   6681  H  HB2  . GLU A 1 20 ? 18.957 -2.286  -11.227 1.00 0.00 ? 20 GLU A HB2  9  
ATOM   6682  H  HB3  . GLU A 1 20 ? 17.310 -2.774  -10.772 1.00 0.00 ? 20 GLU A HB3  9  
ATOM   6683  H  HG2  . GLU A 1 20 ? 17.369 -4.543  -12.525 1.00 0.00 ? 20 GLU A HG2  9  
ATOM   6684  H  HG3  . GLU A 1 20 ? 19.010 -4.037  -12.972 1.00 0.00 ? 20 GLU A HG3  9  
ATOM   6685  N  N    . CYS A 1 21 ? 15.059 -2.075  -12.355 1.00 0.00 ? 21 CYS A N    9  
ATOM   6686  C  CA   . CYS A 1 21 ? 13.735 -2.654  -12.586 1.00 0.00 ? 21 CYS A CA   9  
ATOM   6687  C  C    . CYS A 1 21 ? 12.617 -1.609  -12.730 1.00 0.00 ? 21 CYS A C    9  
ATOM   6688  O  O    . CYS A 1 21 ? 11.460 -1.994  -12.885 1.00 0.00 ? 21 CYS A O    9  
ATOM   6689  C  CB   . CYS A 1 21 ? 13.431 -3.752  -11.543 1.00 0.00 ? 21 CYS A CB   9  
ATOM   6690  S  SG   . CYS A 1 21 ? 14.414 -3.747  -10.016 1.00 0.00 ? 21 CYS A SG   9  
ATOM   6691  H  H    . CYS A 1 21 ? 15.206 -1.570  -11.493 1.00 0.00 ? 21 CYS A H    9  
ATOM   6692  H  HA   . CYS A 1 21 ? 13.735 -3.163  -13.550 1.00 0.00 ? 21 CYS A HA   9  
ATOM   6693  H  HB2  . CYS A 1 21 ? 12.379 -3.705  -11.257 1.00 0.00 ? 21 CYS A HB2  9  
ATOM   6694  H  HB3  . CYS A 1 21 ? 13.607 -4.722  -12.015 1.00 0.00 ? 21 CYS A HB3  9  
ATOM   6695  N  N    . ASN A 1 22 ? 12.945 -0.307  -12.720 1.00 0.00 ? 22 ASN A N    9  
ATOM   6696  C  CA   . ASN A 1 22 ? 12.026 0.777   -13.067 1.00 0.00 ? 22 ASN A CA   9  
ATOM   6697  C  C    . ASN A 1 22 ? 10.740 0.717   -12.235 1.00 0.00 ? 22 ASN A C    9  
ATOM   6698  O  O    . ASN A 1 22 ? 9.643  0.558   -12.770 1.00 0.00 ? 22 ASN A O    9  
ATOM   6699  C  CB   . ASN A 1 22 ? 11.786 0.785   -14.586 1.00 0.00 ? 22 ASN A CB   9  
ATOM   6700  C  CG   . ASN A 1 22 ? 11.241 2.124   -15.087 1.00 0.00 ? 22 ASN A CG   9  
ATOM   6701  O  OD1  . ASN A 1 22 ? 11.975 2.906   -15.688 1.00 0.00 ? 22 ASN A OD1  9  
ATOM   6702  N  ND2  . ASN A 1 22 ? 9.954  2.391   -14.864 1.00 0.00 ? 22 ASN A ND2  9  
ATOM   6703  H  H    . ASN A 1 22 ? 13.902 -0.038  -12.533 1.00 0.00 ? 22 ASN A H    9  
ATOM   6704  H  HA   . ASN A 1 22 ? 12.519 1.717   -12.829 1.00 0.00 ? 22 ASN A HA   9  
ATOM   6705  H  HB2  . ASN A 1 22 ? 12.744 0.616   -15.085 1.00 0.00 ? 22 ASN A HB2  9  
ATOM   6706  H  HB3  . ASN A 1 22 ? 11.106 -0.021  -14.865 1.00 0.00 ? 22 ASN A HB3  9  
ATOM   6707  H  HD21 . ASN A 1 22 ? 9.398  1.733   -14.331 1.00 0.00 ? 22 ASN A HD21 9  
ATOM   6708  H  HD22 . ASN A 1 22 ? 9.555  3.253   -15.210 1.00 0.00 ? 22 ASN A HD22 9  
ATOM   6709  N  N    . LYS A 1 23 ? 10.887 0.839   -10.912 1.00 0.00 ? 23 LYS A N    9  
ATOM   6710  C  CA   . LYS A 1 23 ? 9.797  0.920   -9.961  1.00 0.00 ? 23 LYS A CA   9  
ATOM   6711  C  C    . LYS A 1 23 ? 9.864  2.275   -9.263  1.00 0.00 ? 23 LYS A C    9  
ATOM   6712  O  O    . LYS A 1 23 ? 10.916 2.643   -8.743  1.00 0.00 ? 23 LYS A O    9  
ATOM   6713  C  CB   . LYS A 1 23 ? 9.952  -0.220  -8.953  1.00 0.00 ? 23 LYS A CB   9  
ATOM   6714  C  CG   . LYS A 1 23 ? 9.681  -1.580  -9.613  1.00 0.00 ? 23 LYS A CG   9  
ATOM   6715  C  CD   . LYS A 1 23 ? 9.619  -2.725  -8.595  1.00 0.00 ? 23 LYS A CD   9  
ATOM   6716  C  CE   . LYS A 1 23 ? 10.980 -3.005  -7.952  1.00 0.00 ? 23 LYS A CE   9  
ATOM   6717  N  NZ   . LYS A 1 23 ? 10.927 -4.181  -7.065  1.00 0.00 ? 23 LYS A NZ   9  
ATOM   6718  H  H    . LYS A 1 23 ? 11.812 0.893   -10.517 1.00 0.00 ? 23 LYS A H    9  
ATOM   6719  H  HA   . LYS A 1 23 ? 8.828  0.823   -10.454 1.00 0.00 ? 23 LYS A HA   9  
ATOM   6720  H  HB2  . LYS A 1 23 ? 10.960 -0.198  -8.532  1.00 0.00 ? 23 LYS A HB2  9  
ATOM   6721  H  HB3  . LYS A 1 23 ? 9.233  -0.054  -8.158  1.00 0.00 ? 23 LYS A HB3  9  
ATOM   6722  H  HG2  . LYS A 1 23 ? 8.719  -1.534  -10.125 1.00 0.00 ? 23 LYS A HG2  9  
ATOM   6723  H  HG3  . LYS A 1 23 ? 10.452 -1.795  -10.352 1.00 0.00 ? 23 LYS A HG3  9  
ATOM   6724  H  HD2  . LYS A 1 23 ? 8.883  -2.488  -7.825  1.00 0.00 ? 23 LYS A HD2  9  
ATOM   6725  H  HD3  . LYS A 1 23 ? 9.290  -3.624  -9.122  1.00 0.00 ? 23 LYS A HD3  9  
ATOM   6726  H  HE2  . LYS A 1 23 ? 11.717 -3.192  -8.733  1.00 0.00 ? 23 LYS A HE2  9  
ATOM   6727  H  HE3  . LYS A 1 23 ? 11.300 -2.145  -7.365  1.00 0.00 ? 23 LYS A HE3  9  
ATOM   6728  H  HZ1  . LYS A 1 23 ? 10.250 -4.026  -6.331  1.00 0.00 ? 23 LYS A HZ1  9  
ATOM   6729  H  HZ2  . LYS A 1 23 ? 10.663 -4.997  -7.597  1.00 0.00 ? 23 LYS A HZ2  9  
ATOM   6730  H  HZ3  . LYS A 1 23 ? 11.836 -4.334  -6.653  1.00 0.00 ? 23 LYS A HZ3  9  
ATOM   6731  N  N    . ALA A 1 24 ? 8.741  3.007   -9.244  1.00 0.00 ? 24 ALA A N    9  
ATOM   6732  C  CA   . ALA A 1 24 ? 8.629  4.283   -8.552  1.00 0.00 ? 24 ALA A CA   9  
ATOM   6733  C  C    . ALA A 1 24 ? 8.660  4.066   -7.039  1.00 0.00 ? 24 ALA A C    9  
ATOM   6734  O  O    . ALA A 1 24 ? 7.925  3.230   -6.514  1.00 0.00 ? 24 ALA A O    9  
ATOM   6735  C  CB   . ALA A 1 24 ? 7.342  5.000   -8.967  1.00 0.00 ? 24 ALA A CB   9  
ATOM   6736  H  H    . ALA A 1 24 ? 7.924  2.654   -9.718  1.00 0.00 ? 24 ALA A H    9  
ATOM   6737  H  HA   . ALA A 1 24 ? 9.468  4.911   -8.851  1.00 0.00 ? 24 ALA A HA   9  
ATOM   6738  H  HB1  . ALA A 1 24 ? 7.313  5.988   -8.506  1.00 0.00 ? 24 ALA A HB1  9  
ATOM   6739  H  HB2  . ALA A 1 24 ? 7.314  5.114   -10.052 1.00 0.00 ? 24 ALA A HB2  9  
ATOM   6740  H  HB3  . ALA A 1 24 ? 6.471  4.433   -8.638  1.00 0.00 ? 24 ALA A HB3  9  
ATOM   6741  N  N    . PHE A 1 25 ? 9.520  4.820   -6.353  1.00 0.00 ? 25 PHE A N    9  
ATOM   6742  C  CA   . PHE A 1 25 ? 9.865  4.638   -4.953  1.00 0.00 ? 25 PHE A CA   9  
ATOM   6743  C  C    . PHE A 1 25 ? 10.099 6.011   -4.315  1.00 0.00 ? 25 PHE A C    9  
ATOM   6744  O  O    . PHE A 1 25 ? 10.206 7.014   -5.019  1.00 0.00 ? 25 PHE A O    9  
ATOM   6745  C  CB   . PHE A 1 25 ? 11.141 3.782   -4.857  1.00 0.00 ? 25 PHE A CB   9  
ATOM   6746  C  CG   . PHE A 1 25 ? 10.937 2.318   -4.506  1.00 0.00 ? 25 PHE A CG   9  
ATOM   6747  C  CD1  . PHE A 1 25 ? 10.472 1.408   -5.473  1.00 0.00 ? 25 PHE A CD1  9  
ATOM   6748  C  CD2  . PHE A 1 25 ? 11.356 1.838   -3.251  1.00 0.00 ? 25 PHE A CD2  9  
ATOM   6749  C  CE1  . PHE A 1 25 ? 10.428 0.033   -5.187  1.00 0.00 ? 25 PHE A CE1  9  
ATOM   6750  C  CE2  . PHE A 1 25 ? 11.381 0.458   -2.992  1.00 0.00 ? 25 PHE A CE2  9  
ATOM   6751  C  CZ   . PHE A 1 25 ? 10.907 -0.447  -3.957  1.00 0.00 ? 25 PHE A CZ   9  
ATOM   6752  H  H    . PHE A 1 25 ? 10.074 5.503   -6.855  1.00 0.00 ? 25 PHE A H    9  
ATOM   6753  H  HA   . PHE A 1 25 ? 9.057  4.143   -4.419  1.00 0.00 ? 25 PHE A HA   9  
ATOM   6754  H  HB2  . PHE A 1 25 ? 11.692 3.832   -5.800  1.00 0.00 ? 25 PHE A HB2  9  
ATOM   6755  H  HB3  . PHE A 1 25 ? 11.780 4.219   -4.091  1.00 0.00 ? 25 PHE A HB3  9  
ATOM   6756  H  HD1  . PHE A 1 25 ? 10.157 1.759   -6.440  1.00 0.00 ? 25 PHE A HD1  9  
ATOM   6757  H  HD2  . PHE A 1 25 ? 11.688 2.527   -2.493  1.00 0.00 ? 25 PHE A HD2  9  
ATOM   6758  H  HE1  . PHE A 1 25 ? 10.032 -0.658  -5.915  1.00 0.00 ? 25 PHE A HE1  9  
ATOM   6759  H  HE2  . PHE A 1 25 ? 11.738 0.094   -2.039  1.00 0.00 ? 25 PHE A HE2  9  
ATOM   6760  H  HZ   . PHE A 1 25 ? 10.893 -1.506  -3.743  1.00 0.00 ? 25 PHE A HZ   9  
ATOM   6761  N  N    . HIS A 1 26 ? 10.149 6.050   -2.979  1.00 0.00 ? 26 HIS A N    9  
ATOM   6762  C  CA   . HIS A 1 26 ? 10.601 7.203   -2.207  1.00 0.00 ? 26 HIS A CA   9  
ATOM   6763  C  C    . HIS A 1 26 ? 12.015 6.901   -1.708  1.00 0.00 ? 26 HIS A C    9  
ATOM   6764  O  O    . HIS A 1 26 ? 12.413 5.741   -1.621  1.00 0.00 ? 26 HIS A O    9  
ATOM   6765  C  CB   . HIS A 1 26 ? 9.686  7.467   -1.004  1.00 0.00 ? 26 HIS A CB   9  
ATOM   6766  C  CG   . HIS A 1 26 ? 8.288  7.923   -1.331  1.00 0.00 ? 26 HIS A CG   9  
ATOM   6767  N  ND1  . HIS A 1 26 ? 7.137  7.145   -1.197  1.00 0.00 ? 26 HIS A ND1  9  
ATOM   6768  C  CD2  . HIS A 1 26 ? 7.935  9.199   -1.668  1.00 0.00 ? 26 HIS A CD2  9  
ATOM   6769  C  CE1  . HIS A 1 26 ? 6.115  7.974   -1.459  1.00 0.00 ? 26 HIS A CE1  9  
ATOM   6770  N  NE2  . HIS A 1 26 ? 6.561  9.209   -1.741  1.00 0.00 ? 26 HIS A NE2  9  
ATOM   6771  H  H    . HIS A 1 26 ? 10.014 5.187   -2.474  1.00 0.00 ? 26 HIS A H    9  
ATOM   6772  H  HA   . HIS A 1 26 ? 10.627 8.102   -2.825  1.00 0.00 ? 26 HIS A HA   9  
ATOM   6773  H  HB2  . HIS A 1 26 ? 9.633  6.565   -0.401  1.00 0.00 ? 26 HIS A HB2  9  
ATOM   6774  H  HB3  . HIS A 1 26 ? 10.142 8.245   -0.390  1.00 0.00 ? 26 HIS A HB3  9  
ATOM   6775  H  HD2  . HIS A 1 26 ? 8.599  10.041  -1.800  1.00 0.00 ? 26 HIS A HD2  9  
ATOM   6776  H  HE1  . HIS A 1 26 ? 5.072  7.693   -1.434  1.00 0.00 ? 26 HIS A HE1  9  
ATOM   6777  H  HE2  . HIS A 1 26 ? 5.970  10.011  -1.929  1.00 0.00 ? 26 HIS A HE2  9  
ATOM   6778  N  N    . LEU A 1 27 ? 12.757 7.954   -1.345  1.00 0.00 ? 27 LEU A N    9  
ATOM   6779  C  CA   . LEU A 1 27 ? 14.039 7.859   -0.652  1.00 0.00 ? 27 LEU A CA   9  
ATOM   6780  C  C    . LEU A 1 27 ? 13.931 6.924   0.555   1.00 0.00 ? 27 LEU A C    9  
ATOM   6781  O  O    . LEU A 1 27 ? 14.716 5.990   0.706   1.00 0.00 ? 27 LEU A O    9  
ATOM   6782  C  CB   . LEU A 1 27 ? 14.494 9.260   -0.212  1.00 0.00 ? 27 LEU A CB   9  
ATOM   6783  C  CG   . LEU A 1 27 ? 14.555 10.284  -1.358  1.00 0.00 ? 27 LEU A CG   9  
ATOM   6784  C  CD1  . LEU A 1 27 ? 14.950 11.655  -0.809  1.00 0.00 ? 27 LEU A CD1  9  
ATOM   6785  C  CD2  . LEU A 1 27 ? 15.553 9.862   -2.438  1.00 0.00 ? 27 LEU A CD2  9  
ATOM   6786  H  H    . LEU A 1 27 ? 12.363 8.874   -1.475  1.00 0.00 ? 27 LEU A H    9  
ATOM   6787  H  HA   . LEU A 1 27 ? 14.781 7.447   -1.332  1.00 0.00 ? 27 LEU A HA   9  
ATOM   6788  H  HB2  . LEU A 1 27 ? 13.793 9.631   0.536   1.00 0.00 ? 27 LEU A HB2  9  
ATOM   6789  H  HB3  . LEU A 1 27 ? 15.483 9.180   0.243   1.00 0.00 ? 27 LEU A HB3  9  
ATOM   6790  H  HG   . LEU A 1 27 ? 13.573 10.395  -1.814  1.00 0.00 ? 27 LEU A HG   9  
ATOM   6791  H  HD11 . LEU A 1 27 ? 14.209 11.993  -0.084  1.00 0.00 ? 27 LEU A HD11 9  
ATOM   6792  H  HD12 . LEU A 1 27 ? 15.922 11.594  -0.327  1.00 0.00 ? 27 LEU A HD12 9  
ATOM   6793  H  HD13 . LEU A 1 27 ? 15.005 12.375  -1.625  1.00 0.00 ? 27 LEU A HD13 9  
ATOM   6794  H  HD21 . LEU A 1 27 ? 15.654 10.652  -3.181  1.00 0.00 ? 27 LEU A HD21 9  
ATOM   6795  H  HD22 . LEU A 1 27 ? 16.519 9.658   -1.979  1.00 0.00 ? 27 LEU A HD22 9  
ATOM   6796  H  HD23 . LEU A 1 27 ? 15.203 8.966   -2.942  1.00 0.00 ? 27 LEU A HD23 9  
ATOM   6797  N  N    . PHE A 1 28 ? 12.917 7.169   1.388   1.00 0.00 ? 28 PHE A N    9  
ATOM   6798  C  CA   . PHE A 1 28 ? 12.687 6.468   2.640   1.00 0.00 ? 28 PHE A CA   9  
ATOM   6799  C  C    . PHE A 1 28 ? 12.291 5.014   2.374   1.00 0.00 ? 28 PHE A C    9  
ATOM   6800  O  O    . PHE A 1 28 ? 12.804 4.104   3.023   1.00 0.00 ? 28 PHE A O    9  
ATOM   6801  C  CB   . PHE A 1 28 ? 11.610 7.214   3.441   1.00 0.00 ? 28 PHE A CB   9  
ATOM   6802  C  CG   . PHE A 1 28 ? 11.826 8.717   3.502   1.00 0.00 ? 28 PHE A CG   9  
ATOM   6803  C  CD1  . PHE A 1 28 ? 12.849 9.246   4.311   1.00 0.00 ? 28 PHE A CD1  9  
ATOM   6804  C  CD2  . PHE A 1 28 ? 11.128 9.565   2.619   1.00 0.00 ? 28 PHE A CD2  9  
ATOM   6805  C  CE1  . PHE A 1 28 ? 13.161 10.616  4.247   1.00 0.00 ? 28 PHE A CE1  9  
ATOM   6806  C  CE2  . PHE A 1 28 ? 11.477 10.923  2.519   1.00 0.00 ? 28 PHE A CE2  9  
ATOM   6807  C  CZ   . PHE A 1 28 ? 12.490 11.449  3.337   1.00 0.00 ? 28 PHE A CZ   9  
ATOM   6808  H  H    . PHE A 1 28 ? 12.309 7.946   1.174   1.00 0.00 ? 28 PHE A H    9  
ATOM   6809  H  HA   . PHE A 1 28 ? 13.610 6.487   3.220   1.00 0.00 ? 28 PHE A HA   9  
ATOM   6810  H  HB2  . PHE A 1 28 ? 10.639 7.020   2.987   1.00 0.00 ? 28 PHE A HB2  9  
ATOM   6811  H  HB3  . PHE A 1 28 ? 11.587 6.814   4.456   1.00 0.00 ? 28 PHE A HB3  9  
ATOM   6812  H  HD1  . PHE A 1 28 ? 13.407 8.598   4.971   1.00 0.00 ? 28 PHE A HD1  9  
ATOM   6813  H  HD2  . PHE A 1 28 ? 10.337 9.175   1.996   1.00 0.00 ? 28 PHE A HD2  9  
ATOM   6814  H  HE1  . PHE A 1 28 ? 13.930 11.032  4.881   1.00 0.00 ? 28 PHE A HE1  9  
ATOM   6815  H  HE2  . PHE A 1 28 ? 10.975 11.562  1.810   1.00 0.00 ? 28 PHE A HE2  9  
ATOM   6816  H  HZ   . PHE A 1 28 ? 12.756 12.495  3.265   1.00 0.00 ? 28 PHE A HZ   9  
ATOM   6817  N  N    . CYS A 1 29 ? 11.383 4.801   1.411   1.00 0.00 ? 29 CYS A N    9  
ATOM   6818  C  CA   . CYS A 1 29 ? 10.855 3.484   1.072   1.00 0.00 ? 29 CYS A CA   9  
ATOM   6819  C  C    . CYS A 1 29 ? 11.920 2.584   0.440   1.00 0.00 ? 29 CYS A C    9  
ATOM   6820  O  O    . CYS A 1 29 ? 11.823 1.365   0.571   1.00 0.00 ? 29 CYS A O    9  
ATOM   6821  C  CB   . CYS A 1 29 ? 9.642  3.617   0.145   1.00 0.00 ? 29 CYS A CB   9  
ATOM   6822  S  SG   . CYS A 1 29 ? 8.224  4.508   0.840   1.00 0.00 ? 29 CYS A SG   9  
ATOM   6823  H  H    . CYS A 1 29 ? 11.032 5.594   0.895   1.00 0.00 ? 29 CYS A H    9  
ATOM   6824  H  HA   . CYS A 1 29 ? 10.513 3.006   1.991   1.00 0.00 ? 29 CYS A HA   9  
ATOM   6825  H  HB2  . CYS A 1 29 ? 9.954  4.117   -0.770  1.00 0.00 ? 29 CYS A HB2  9  
ATOM   6826  H  HB3  . CYS A 1 29 ? 9.299  2.615   -0.115  1.00 0.00 ? 29 CYS A HB3  9  
ATOM   6827  N  N    . LEU A 1 30 ? 12.924 3.157   -0.244  1.00 0.00 ? 30 LEU A N    9  
ATOM   6828  C  CA   . LEU A 1 30 ? 14.088 2.394   -0.681  1.00 0.00 ? 30 LEU A CA   9  
ATOM   6829  C  C    . LEU A 1 30 ? 14.787 1.798   0.536   1.00 0.00 ? 30 LEU A C    9  
ATOM   6830  O  O    . LEU A 1 30 ? 14.795 0.581   0.707   1.00 0.00 ? 30 LEU A O    9  
ATOM   6831  C  CB   . LEU A 1 30 ? 15.070 3.255   -1.496  1.00 0.00 ? 30 LEU A CB   9  
ATOM   6832  C  CG   . LEU A 1 30 ? 14.632 3.564   -2.932  1.00 0.00 ? 30 LEU A CG   9  
ATOM   6833  C  CD1  . LEU A 1 30 ? 15.515 4.683   -3.495  1.00 0.00 ? 30 LEU A CD1  9  
ATOM   6834  C  CD2  . LEU A 1 30 ? 14.751 2.344   -3.856  1.00 0.00 ? 30 LEU A CD2  9  
ATOM   6835  H  H    . LEU A 1 30 ? 12.920 4.156   -0.403  1.00 0.00 ? 30 LEU A H    9  
ATOM   6836  H  HA   . LEU A 1 30 ? 13.759 1.565   -1.296  1.00 0.00 ? 30 LEU A HA   9  
ATOM   6837  H  HB2  . LEU A 1 30 ? 15.215 4.192   -0.965  1.00 0.00 ? 30 LEU A HB2  9  
ATOM   6838  H  HB3  . LEU A 1 30 ? 16.028 2.740   -1.563  1.00 0.00 ? 30 LEU A HB3  9  
ATOM   6839  H  HG   . LEU A 1 30 ? 13.604 3.908   -2.919  1.00 0.00 ? 30 LEU A HG   9  
ATOM   6840  H  HD11 . LEU A 1 30 ? 15.229 4.895   -4.526  1.00 0.00 ? 30 LEU A HD11 9  
ATOM   6841  H  HD12 . LEU A 1 30 ? 15.391 5.587   -2.899  1.00 0.00 ? 30 LEU A HD12 9  
ATOM   6842  H  HD13 . LEU A 1 30 ? 16.562 4.382   -3.473  1.00 0.00 ? 30 LEU A HD13 9  
ATOM   6843  H  HD21 . LEU A 1 30 ? 14.395 2.605   -4.853  1.00 0.00 ? 30 LEU A HD21 9  
ATOM   6844  H  HD22 . LEU A 1 30 ? 15.794 2.037   -3.924  1.00 0.00 ? 30 LEU A HD22 9  
ATOM   6845  H  HD23 . LEU A 1 30 ? 14.157 1.512   -3.485  1.00 0.00 ? 30 LEU A HD23 9  
ATOM   6846  N  N    . ARG A 1 31 ? 15.391 2.659   1.360   1.00 0.00 ? 31 ARG A N    9  
ATOM   6847  C  CA   . ARG A 1 31 ? 16.285 2.251   2.438   1.00 0.00 ? 31 ARG A CA   9  
ATOM   6848  C  C    . ARG A 1 31 ? 16.126 3.220   3.612   1.00 0.00 ? 31 ARG A C    9  
ATOM   6849  O  O    . ARG A 1 31 ? 16.051 4.428   3.390   1.00 0.00 ? 31 ARG A O    9  
ATOM   6850  C  CB   . ARG A 1 31 ? 17.737 2.230   1.928   1.00 0.00 ? 31 ARG A CB   9  
ATOM   6851  C  CG   . ARG A 1 31 ? 17.895 1.252   0.758   1.00 0.00 ? 31 ARG A CG   9  
ATOM   6852  C  CD   . ARG A 1 31 ? 19.328 1.144   0.235   1.00 0.00 ? 31 ARG A CD   9  
ATOM   6853  N  NE   . ARG A 1 31 ? 19.356 0.275   -0.949  1.00 0.00 ? 31 ARG A NE   9  
ATOM   6854  C  CZ   . ARG A 1 31 ? 19.165 -1.055  -0.935  1.00 0.00 ? 31 ARG A CZ   9  
ATOM   6855  N  NH1  . ARG A 1 31 ? 19.152 -1.744  0.215   1.00 0.00 ? 31 ARG A NH1  9  
ATOM   6856  N  NH2  . ARG A 1 31 ? 18.970 -1.696  -2.091  1.00 0.00 ? 31 ARG A NH2  9  
ATOM   6857  H  H    . ARG A 1 31 ? 15.263 3.647   1.194   1.00 0.00 ? 31 ARG A H    9  
ATOM   6858  H  HA   . ARG A 1 31 ? 16.017 1.245   2.757   1.00 0.00 ? 31 ARG A HA   9  
ATOM   6859  H  HB2  . ARG A 1 31 ? 18.021 3.226   1.593   1.00 0.00 ? 31 ARG A HB2  9  
ATOM   6860  H  HB3  . ARG A 1 31 ? 18.400 1.931   2.739   1.00 0.00 ? 31 ARG A HB3  9  
ATOM   6861  H  HG2  . ARG A 1 31 ? 17.535 0.272   1.069   1.00 0.00 ? 31 ARG A HG2  9  
ATOM   6862  H  HG3  . ARG A 1 31 ? 17.298 1.592   -0.084  1.00 0.00 ? 31 ARG A HG3  9  
ATOM   6863  H  HD2  . ARG A 1 31 ? 19.672 2.136   -0.061  1.00 0.00 ? 31 ARG A HD2  9  
ATOM   6864  H  HD3  . ARG A 1 31 ? 19.999 0.768   1.007   1.00 0.00 ? 31 ARG A HD3  9  
ATOM   6865  H  HE   . ARG A 1 31 ? 19.413 0.738   -1.845  1.00 0.00 ? 31 ARG A HE   9  
ATOM   6866  H  HH11 . ARG A 1 31 ? 19.247 -1.260  1.103   1.00 0.00 ? 31 ARG A HH11 9  
ATOM   6867  H  HH12 . ARG A 1 31 ? 19.079 -2.754  0.204   1.00 0.00 ? 31 ARG A HH12 9  
ATOM   6868  H  HH21 . ARG A 1 31 ? 18.942 -1.171  -2.958  1.00 0.00 ? 31 ARG A HH21 9  
ATOM   6869  H  HH22 . ARG A 1 31 ? 18.821 -2.698  -2.108  1.00 0.00 ? 31 ARG A HH22 9  
ATOM   6870  N  N    . PRO A 1 32 ? 16.073 2.721   4.859   1.00 0.00 ? 32 PRO A N    9  
ATOM   6871  C  CA   . PRO A 1 32 ? 15.720 3.520   6.024   1.00 0.00 ? 32 PRO A CA   9  
ATOM   6872  C  C    . PRO A 1 32 ? 16.769 4.607   6.284   1.00 0.00 ? 32 PRO A C    9  
ATOM   6873  O  O    . PRO A 1 32 ? 16.415 5.742   6.594   1.00 0.00 ? 32 PRO A O    9  
ATOM   6874  C  CB   . PRO A 1 32 ? 15.626 2.526   7.184   1.00 0.00 ? 32 PRO A CB   9  
ATOM   6875  C  CG   . PRO A 1 32 ? 16.587 1.408   6.781   1.00 0.00 ? 32 PRO A CG   9  
ATOM   6876  C  CD   . PRO A 1 32 ? 16.456 1.374   5.257   1.00 0.00 ? 32 PRO A CD   9  
ATOM   6877  H  HA   . PRO A 1 32 ? 14.747 3.993   5.874   1.00 0.00 ? 32 PRO A HA   9  
ATOM   6878  H  HB2  . PRO A 1 32 ? 15.887 2.971   8.145   1.00 0.00 ? 32 PRO A HB2  9  
ATOM   6879  H  HB3  . PRO A 1 32 ? 14.613 2.121   7.223   1.00 0.00 ? 32 PRO A HB3  9  
ATOM   6880  H  HG2  . PRO A 1 32 ? 17.606 1.678   7.059   1.00 0.00 ? 32 PRO A HG2  9  
ATOM   6881  H  HG3  . PRO A 1 32 ? 16.322 0.453   7.236   1.00 0.00 ? 32 PRO A HG3  9  
ATOM   6882  H  HD2  . PRO A 1 32 ? 17.398 1.060   4.806   1.00 0.00 ? 32 PRO A HD2  9  
ATOM   6883  H  HD3  . PRO A 1 32 ? 15.660 0.680   4.985   1.00 0.00 ? 32 PRO A HD3  9  
ATOM   6884  N  N    . ALA A 1 33 ? 18.053 4.260   6.131   1.00 0.00 ? 33 ALA A N    9  
ATOM   6885  C  CA   . ALA A 1 33 ? 19.170 5.187   6.243   1.00 0.00 ? 33 ALA A CA   9  
ATOM   6886  C  C    . ALA A 1 33 ? 19.157 6.257   5.147   1.00 0.00 ? 33 ALA A C    9  
ATOM   6887  O  O    . ALA A 1 33 ? 19.715 7.335   5.347   1.00 0.00 ? 33 ALA A O    9  
ATOM   6888  C  CB   . ALA A 1 33 ? 20.481 4.397   6.204   1.00 0.00 ? 33 ALA A CB   9  
ATOM   6889  H  H    . ALA A 1 33 ? 18.269 3.306   5.881   1.00 0.00 ? 33 ALA A H    9  
ATOM   6890  H  HA   . ALA A 1 33 ? 19.106 5.686   7.209   1.00 0.00 ? 33 ALA A HA   9  
ATOM   6891  H  HB1  . ALA A 1 33 ? 20.494 3.665   7.012   1.00 0.00 ? 33 ALA A HB1  9  
ATOM   6892  H  HB2  . ALA A 1 33 ? 20.578 3.879   5.249   1.00 0.00 ? 33 ALA A HB2  9  
ATOM   6893  H  HB3  . ALA A 1 33 ? 21.324 5.077   6.330   1.00 0.00 ? 33 ALA A HB3  9  
ATOM   6894  N  N    . LEU A 1 34 ? 18.556 5.962   3.986   1.00 0.00 ? 34 LEU A N    9  
ATOM   6895  C  CA   . LEU A 1 34 ? 18.551 6.858   2.838   1.00 0.00 ? 34 LEU A CA   9  
ATOM   6896  C  C    . LEU A 1 34 ? 17.440 7.891   3.019   1.00 0.00 ? 34 LEU A C    9  
ATOM   6897  O  O    . LEU A 1 34 ? 16.375 7.798   2.413   1.00 0.00 ? 34 LEU A O    9  
ATOM   6898  C  CB   . LEU A 1 34 ? 18.404 6.035   1.550   1.00 0.00 ? 34 LEU A CB   9  
ATOM   6899  C  CG   . LEU A 1 34 ? 18.530 6.857   0.257   1.00 0.00 ? 34 LEU A CG   9  
ATOM   6900  C  CD1  . LEU A 1 34 ? 19.940 7.435   0.088   1.00 0.00 ? 34 LEU A CD1  9  
ATOM   6901  C  CD2  . LEU A 1 34 ? 18.199 5.947   -0.929  1.00 0.00 ? 34 LEU A CD2  9  
ATOM   6902  H  H    . LEU A 1 34 ? 18.027 5.105   3.909   1.00 0.00 ? 34 LEU A H    9  
ATOM   6903  H  HA   . LEU A 1 34 ? 19.511 7.372   2.802   1.00 0.00 ? 34 LEU A HA   9  
ATOM   6904  H  HB2  . LEU A 1 34 ? 19.178 5.268   1.542   1.00 0.00 ? 34 LEU A HB2  9  
ATOM   6905  H  HB3  . LEU A 1 34 ? 17.432 5.545   1.555   1.00 0.00 ? 34 LEU A HB3  9  
ATOM   6906  H  HG   . LEU A 1 34 ? 17.808 7.674   0.259   1.00 0.00 ? 34 LEU A HG   9  
ATOM   6907  H  HD11 . LEU A 1 34 ? 20.138 8.194   0.845   1.00 0.00 ? 34 LEU A HD11 9  
ATOM   6908  H  HD12 . LEU A 1 34 ? 20.685 6.642   0.168   1.00 0.00 ? 34 LEU A HD12 9  
ATOM   6909  H  HD13 . LEU A 1 34 ? 20.031 7.906   -0.889  1.00 0.00 ? 34 LEU A HD13 9  
ATOM   6910  H  HD21 . LEU A 1 34 ? 18.215 6.524   -1.851  1.00 0.00 ? 34 LEU A HD21 9  
ATOM   6911  H  HD22 . LEU A 1 34 ? 18.924 5.136   -0.998  1.00 0.00 ? 34 LEU A HD22 9  
ATOM   6912  H  HD23 . LEU A 1 34 ? 17.202 5.525   -0.804  1.00 0.00 ? 34 LEU A HD23 9  
ATOM   6913  N  N    . TYR A 1 35 ? 17.707 8.889   3.866   1.00 0.00 ? 35 TYR A N    9  
ATOM   6914  C  CA   . TYR A 1 35 ? 16.863 10.064  4.014   1.00 0.00 ? 35 TYR A CA   9  
ATOM   6915  C  C    . TYR A 1 35 ? 16.981 10.976  2.793   1.00 0.00 ? 35 TYR A C    9  
ATOM   6916  O  O    . TYR A 1 35 ? 15.975 11.490  2.306   1.00 0.00 ? 35 TYR A O    9  
ATOM   6917  C  CB   . TYR A 1 35 ? 17.229 10.801  5.307   1.00 0.00 ? 35 TYR A CB   9  
ATOM   6918  C  CG   . TYR A 1 35 ? 17.208 9.914   6.539   1.00 0.00 ? 35 TYR A CG   9  
ATOM   6919  C  CD1  . TYR A 1 35 ? 15.986 9.412   7.022   1.00 0.00 ? 35 TYR A CD1  9  
ATOM   6920  C  CD2  . TYR A 1 35 ? 18.415 9.491   7.125   1.00 0.00 ? 35 TYR A CD2  9  
ATOM   6921  C  CE1  . TYR A 1 35 ? 15.971 8.477   8.072   1.00 0.00 ? 35 TYR A CE1  9  
ATOM   6922  C  CE2  . TYR A 1 35 ? 18.401 8.549   8.168   1.00 0.00 ? 35 TYR A CE2  9  
ATOM   6923  C  CZ   . TYR A 1 35 ? 17.180 8.028   8.629   1.00 0.00 ? 35 TYR A CZ   9  
ATOM   6924  O  OH   . TYR A 1 35 ? 17.172 7.079   9.609   1.00 0.00 ? 35 TYR A OH   9  
ATOM   6925  H  H    . TYR A 1 35 ? 18.560 8.844   4.408   1.00 0.00 ? 35 TYR A H    9  
ATOM   6926  H  HA   . TYR A 1 35 ? 15.831 9.729   4.092   1.00 0.00 ? 35 TYR A HA   9  
ATOM   6927  H  HB2  . TYR A 1 35 ? 18.227 11.231  5.195   1.00 0.00 ? 35 TYR A HB2  9  
ATOM   6928  H  HB3  . TYR A 1 35 ? 16.520 11.620  5.455   1.00 0.00 ? 35 TYR A HB3  9  
ATOM   6929  H  HD1  . TYR A 1 35 ? 15.054 9.730   6.580   1.00 0.00 ? 35 TYR A HD1  9  
ATOM   6930  H  HD2  . TYR A 1 35 ? 19.361 9.861   6.757   1.00 0.00 ? 35 TYR A HD2  9  
ATOM   6931  H  HE1  . TYR A 1 35 ? 15.029 8.079   8.418   1.00 0.00 ? 35 TYR A HE1  9  
ATOM   6932  H  HE2  . TYR A 1 35 ? 19.332 8.203   8.593   1.00 0.00 ? 35 TYR A HE2  9  
ATOM   6933  H  HH   . TYR A 1 35 ? 16.292 6.757   9.813   1.00 0.00 ? 35 TYR A HH   9  
ATOM   6934  N  N    . GLU A 1 36 ? 18.214 11.159  2.304   1.00 0.00 ? 36 GLU A N    9  
ATOM   6935  C  CA   . GLU A 1 36 ? 18.567 12.145  1.291   1.00 0.00 ? 36 GLU A CA   9  
ATOM   6936  C  C    . GLU A 1 36 ? 18.596 11.517  -0.105  1.00 0.00 ? 36 GLU A C    9  
ATOM   6937  O  O    . GLU A 1 36 ? 18.542 10.296  -0.250  1.00 0.00 ? 36 GLU A O    9  
ATOM   6938  C  CB   . GLU A 1 36 ? 19.932 12.764  1.634   1.00 0.00 ? 36 GLU A CB   9  
ATOM   6939  C  CG   . GLU A 1 36 ? 19.997 13.314  3.066   1.00 0.00 ? 36 GLU A CG   9  
ATOM   6940  C  CD   . GLU A 1 36 ? 18.860 14.289  3.364   1.00 0.00 ? 36 GLU A CD   9  
ATOM   6941  O  OE1  . GLU A 1 36 ? 18.839 15.352  2.709   1.00 0.00 ? 36 GLU A OE1  9  
ATOM   6942  O  OE2  . GLU A 1 36 ? 18.029 13.947  4.232   1.00 0.00 ? 36 GLU A OE2  9  
ATOM   6943  H  H    . GLU A 1 36 ? 18.967 10.645  2.733   1.00 0.00 ? 36 GLU A H    9  
ATOM   6944  H  HA   . GLU A 1 36 ? 17.821 12.940  1.282   1.00 0.00 ? 36 GLU A HA   9  
ATOM   6945  H  HB2  . GLU A 1 36 ? 20.711 12.009  1.518   1.00 0.00 ? 36 GLU A HB2  9  
ATOM   6946  H  HB3  . GLU A 1 36 ? 20.136 13.580  0.939   1.00 0.00 ? 36 GLU A HB3  9  
ATOM   6947  H  HG2  . GLU A 1 36 ? 19.967 12.492  3.781   1.00 0.00 ? 36 GLU A HG2  9  
ATOM   6948  H  HG3  . GLU A 1 36 ? 20.945 13.836  3.197   1.00 0.00 ? 36 GLU A HG3  9  
ATOM   6949  N  N    . VAL A 1 37 ? 18.674 12.368  -1.135  1.00 0.00 ? 37 VAL A N    9  
ATOM   6950  C  CA   . VAL A 1 37 ? 18.771 11.966  -2.534  1.00 0.00 ? 37 VAL A CA   9  
ATOM   6951  C  C    . VAL A 1 37 ? 20.110 11.252  -2.775  1.00 0.00 ? 37 VAL A C    9  
ATOM   6952  O  O    . VAL A 1 37 ? 21.138 11.733  -2.298  1.00 0.00 ? 37 VAL A O    9  
ATOM   6953  C  CB   . VAL A 1 37 ? 18.619 13.206  -3.433  1.00 0.00 ? 37 VAL A CB   9  
ATOM   6954  C  CG1  . VAL A 1 37 ? 18.847 12.869  -4.913  1.00 0.00 ? 37 VAL A CG1  9  
ATOM   6955  C  CG2  . VAL A 1 37 ? 17.221 13.824  -3.282  1.00 0.00 ? 37 VAL A CG2  9  
ATOM   6956  H  H    . VAL A 1 37 ? 18.723 13.357  -0.933  1.00 0.00 ? 37 VAL A H    9  
ATOM   6957  H  HA   . VAL A 1 37 ? 17.933 11.308  -2.750  1.00 0.00 ? 37 VAL A HA   9  
ATOM   6958  H  HB   . VAL A 1 37 ? 19.360 13.950  -3.136  1.00 0.00 ? 37 VAL A HB   9  
ATOM   6959  H  HG11 . VAL A 1 37 ? 19.888 12.593  -5.082  1.00 0.00 ? 37 VAL A HG11 9  
ATOM   6960  H  HG12 . VAL A 1 37 ? 18.200 12.045  -5.216  1.00 0.00 ? 37 VAL A HG12 9  
ATOM   6961  H  HG13 . VAL A 1 37 ? 18.628 13.741  -5.529  1.00 0.00 ? 37 VAL A HG13 9  
ATOM   6962  H  HG21 . VAL A 1 37 ? 17.035 14.110  -2.247  1.00 0.00 ? 37 VAL A HG21 9  
ATOM   6963  H  HG22 . VAL A 1 37 ? 17.145 14.717  -3.904  1.00 0.00 ? 37 VAL A HG22 9  
ATOM   6964  H  HG23 . VAL A 1 37 ? 16.462 13.109  -3.598  1.00 0.00 ? 37 VAL A HG23 9  
ATOM   6965  N  N    . PRO A 1 38 ? 20.117 10.113  -3.491  1.00 0.00 ? 38 PRO A N    9  
ATOM   6966  C  CA   . PRO A 1 38 ? 21.341 9.478   -3.965  1.00 0.00 ? 38 PRO A CA   9  
ATOM   6967  C  C    . PRO A 1 38 ? 21.668 9.927   -5.391  1.00 0.00 ? 38 PRO A C    9  
ATOM   6968  O  O    . PRO A 1 38 ? 20.775 10.299  -6.152  1.00 0.00 ? 38 PRO A O    9  
ATOM   6969  C  CB   . PRO A 1 38 ? 21.054 7.975   -3.940  1.00 0.00 ? 38 PRO A CB   9  
ATOM   6970  C  CG   . PRO A 1 38 ? 19.561 7.925   -4.250  1.00 0.00 ? 38 PRO A CG   9  
ATOM   6971  C  CD   . PRO A 1 38 ? 19.018 9.161   -3.536  1.00 0.00 ? 38 PRO A CD   9  
ATOM   6972  H  HA   . PRO A 1 38 ? 22.187 9.689   -3.310  1.00 0.00 ? 38 PRO A HA   9  
ATOM   6973  H  HB2  . PRO A 1 38 ? 21.649 7.418   -4.667  1.00 0.00 ? 38 PRO A HB2  9  
ATOM   6974  H  HB3  . PRO A 1 38 ? 21.232 7.586   -2.938  1.00 0.00 ? 38 PRO A HB3  9  
ATOM   6975  H  HG2  . PRO A 1 38 ? 19.407 8.056   -5.319  1.00 0.00 ? 38 PRO A HG2  9  
ATOM   6976  H  HG3  . PRO A 1 38 ? 19.095 6.999   -3.920  1.00 0.00 ? 38 PRO A HG3  9  
ATOM   6977  H  HD2  . PRO A 1 38 ? 18.167 9.553   -4.094  1.00 0.00 ? 38 PRO A HD2  9  
ATOM   6978  H  HD3  . PRO A 1 38 ? 18.719 8.896   -2.523  1.00 0.00 ? 38 PRO A HD3  9  
ATOM   6979  N  N    . ASP A 1 39 ? 22.951 9.836   -5.758  1.00 0.00 ? 39 ASP A N    9  
ATOM   6980  C  CA   . ASP A 1 39 ? 23.434 10.009  -7.121  1.00 0.00 ? 39 ASP A CA   9  
ATOM   6981  C  C    . ASP A 1 39 ? 24.417 8.878   -7.427  1.00 0.00 ? 39 ASP A C    9  
ATOM   6982  O  O    . ASP A 1 39 ? 25.631 9.079   -7.430  1.00 0.00 ? 39 ASP A O    9  
ATOM   6983  C  CB   . ASP A 1 39 ? 24.072 11.397  -7.275  1.00 0.00 ? 39 ASP A CB   9  
ATOM   6984  C  CG   . ASP A 1 39 ? 23.039 12.510  -7.120  1.00 0.00 ? 39 ASP A CG   9  
ATOM   6985  O  OD1  . ASP A 1 39 ? 22.337 12.777  -8.119  1.00 0.00 ? 39 ASP A OD1  9  
ATOM   6986  O  OD2  . ASP A 1 39 ? 22.966 13.072  -6.004  1.00 0.00 ? 39 ASP A OD2  9  
ATOM   6987  H  H    . ASP A 1 39 ? 23.634 9.581   -5.060  1.00 0.00 ? 39 ASP A H    9  
ATOM   6988  H  HA   . ASP A 1 39 ? 22.614 9.936   -7.838  1.00 0.00 ? 39 ASP A HA   9  
ATOM   6989  H  HB2  . ASP A 1 39 ? 24.860 11.527  -6.532  1.00 0.00 ? 39 ASP A HB2  9  
ATOM   6990  H  HB3  . ASP A 1 39 ? 24.515 11.478  -8.268  1.00 0.00 ? 39 ASP A HB3  9  
ATOM   6991  N  N    . GLY A 1 40 ? 23.878 7.677   -7.661  1.00 0.00 ? 40 GLY A N    9  
ATOM   6992  C  CA   . GLY A 1 40 ? 24.653 6.463   -7.858  1.00 0.00 ? 40 GLY A CA   9  
ATOM   6993  C  C    . GLY A 1 40 ? 23.733 5.327   -8.304  1.00 0.00 ? 40 GLY A C    9  
ATOM   6994  O  O    . GLY A 1 40 ? 22.761 5.566   -9.019  1.00 0.00 ? 40 GLY A O    9  
ATOM   6995  H  H    . GLY A 1 40 ? 22.874 7.585   -7.680  1.00 0.00 ? 40 GLY A H    9  
ATOM   6996  H  HA2  . GLY A 1 40 ? 25.412 6.624   -8.625  1.00 0.00 ? 40 GLY A HA2  9  
ATOM   6997  H  HA3  . GLY A 1 40 ? 25.141 6.201   -6.918  1.00 0.00 ? 40 GLY A HA3  9  
ATOM   6998  N  N    . GLU A 1 41 ? 24.038 4.099   -7.870  1.00 0.00 ? 41 GLU A N    9  
ATOM   6999  C  CA   . GLU A 1 41 ? 23.244 2.914   -8.164  1.00 0.00 ? 41 GLU A CA   9  
ATOM   7000  C  C    . GLU A 1 41 ? 21.949 2.946   -7.348  1.00 0.00 ? 41 GLU A C    9  
ATOM   7001  O  O    . GLU A 1 41 ? 21.938 2.541   -6.186  1.00 0.00 ? 41 GLU A O    9  
ATOM   7002  C  CB   . GLU A 1 41 ? 24.060 1.653   -7.845  1.00 0.00 ? 41 GLU A CB   9  
ATOM   7003  C  CG   . GLU A 1 41 ? 25.315 1.543   -8.716  1.00 0.00 ? 41 GLU A CG   9  
ATOM   7004  C  CD   . GLU A 1 41 ? 26.068 0.249   -8.424  1.00 0.00 ? 41 GLU A CD   9  
ATOM   7005  O  OE1  . GLU A 1 41 ? 26.625 0.158   -7.308  1.00 0.00 ? 41 GLU A OE1  9  
ATOM   7006  O  OE2  . GLU A 1 41 ? 26.072 -0.625  -9.318  1.00 0.00 ? 41 GLU A OE2  9  
ATOM   7007  H  H    . GLU A 1 41 ? 24.859 3.974   -7.296  1.00 0.00 ? 41 GLU A H    9  
ATOM   7008  H  HA   . GLU A 1 41 ? 22.997 2.895   -9.227  1.00 0.00 ? 41 GLU A HA   9  
ATOM   7009  H  HB2  . GLU A 1 41 ? 24.355 1.657   -6.794  1.00 0.00 ? 41 GLU A HB2  9  
ATOM   7010  H  HB3  . GLU A 1 41 ? 23.438 0.776   -8.027  1.00 0.00 ? 41 GLU A HB3  9  
ATOM   7011  H  HG2  . GLU A 1 41 ? 25.027 1.564   -9.769  1.00 0.00 ? 41 GLU A HG2  9  
ATOM   7012  H  HG3  . GLU A 1 41 ? 25.984 2.382   -8.520  1.00 0.00 ? 41 GLU A HG3  9  
ATOM   7013  N  N    . TRP A 1 42 ? 20.857 3.422   -7.957  1.00 0.00 ? 42 TRP A N    9  
ATOM   7014  C  CA   . TRP A 1 42 ? 19.548 3.482   -7.325  1.00 0.00 ? 42 TRP A CA   9  
ATOM   7015  C  C    . TRP A 1 42 ? 18.884 2.109   -7.418  1.00 0.00 ? 42 TRP A C    9  
ATOM   7016  O  O    . TRP A 1 42 ? 17.908 1.935   -8.141  1.00 0.00 ? 42 TRP A O    9  
ATOM   7017  C  CB   . TRP A 1 42 ? 18.689 4.572   -7.989  1.00 0.00 ? 42 TRP A CB   9  
ATOM   7018  C  CG   . TRP A 1 42 ? 19.284 5.944   -8.111  1.00 0.00 ? 42 TRP A CG   9  
ATOM   7019  C  CD1  . TRP A 1 42 ? 20.282 6.452   -7.354  1.00 0.00 ? 42 TRP A CD1  9  
ATOM   7020  C  CD2  . TRP A 1 42 ? 18.886 7.020   -9.016  1.00 0.00 ? 42 TRP A CD2  9  
ATOM   7021  N  NE1  . TRP A 1 42 ? 20.520 7.759   -7.718  1.00 0.00 ? 42 TRP A NE1  9  
ATOM   7022  C  CE2  . TRP A 1 42 ? 19.687 8.165   -8.736  1.00 0.00 ? 42 TRP A CE2  9  
ATOM   7023  C  CE3  . TRP A 1 42 ? 17.911 7.156   -10.028 1.00 0.00 ? 42 TRP A CE3  9  
ATOM   7024  C  CZ2  . TRP A 1 42 ? 19.533 9.380   -9.422  1.00 0.00 ? 42 TRP A CZ2  9  
ATOM   7025  C  CZ3  . TRP A 1 42 ? 17.750 8.367   -10.726 1.00 0.00 ? 42 TRP A CZ3  9  
ATOM   7026  C  CH2  . TRP A 1 42 ? 18.557 9.478   -10.424 1.00 0.00 ? 42 TRP A CH2  9  
ATOM   7027  H  H    . TRP A 1 42 ? 20.921 3.719   -8.925  1.00 0.00 ? 42 TRP A H    9  
ATOM   7028  H  HA   . TRP A 1 42 ? 19.657 3.745   -6.271  1.00 0.00 ? 42 TRP A HA   9  
ATOM   7029  H  HB2  . TRP A 1 42 ? 18.429 4.254   -8.999  1.00 0.00 ? 42 TRP A HB2  9  
ATOM   7030  H  HB3  . TRP A 1 42 ? 17.764 4.666   -7.417  1.00 0.00 ? 42 TRP A HB3  9  
ATOM   7031  H  HD1  . TRP A 1 42 ? 20.800 5.929   -6.564  1.00 0.00 ? 42 TRP A HD1  9  
ATOM   7032  H  HE1  . TRP A 1 42 ? 21.195 8.348   -7.254  1.00 0.00 ? 42 TRP A HE1  9  
ATOM   7033  H  HE3  . TRP A 1 42 ? 17.280 6.316   -10.272 1.00 0.00 ? 42 TRP A HE3  9  
ATOM   7034  H  HZ2  . TRP A 1 42 ? 20.156 10.228  -9.175  1.00 0.00 ? 42 TRP A HZ2  9  
ATOM   7035  H  HZ3  . TRP A 1 42 ? 16.999 8.443   -11.499 1.00 0.00 ? 42 TRP A HZ3  9  
ATOM   7036  H  HH2  . TRP A 1 42 ? 18.426 10.405  -10.963 1.00 0.00 ? 42 TRP A HH2  9  
ATOM   7037  N  N    . GLN A 1 43 ? 19.419 1.122   -6.692  1.00 0.00 ? 43 GLN A N    9  
ATOM   7038  C  CA   . GLN A 1 43 ? 18.872 -0.225  -6.660  1.00 0.00 ? 43 GLN A CA   9  
ATOM   7039  C  C    . GLN A 1 43 ? 17.984 -0.394  -5.427  1.00 0.00 ? 43 GLN A C    9  
ATOM   7040  O  O    . GLN A 1 43 ? 18.364 -0.008  -4.321  1.00 0.00 ? 43 GLN A O    9  
ATOM   7041  C  CB   . GLN A 1 43 ? 20.004 -1.252  -6.648  1.00 0.00 ? 43 GLN A CB   9  
ATOM   7042  C  CG   . GLN A 1 43 ? 20.791 -1.277  -7.962  1.00 0.00 ? 43 GLN A CG   9  
ATOM   7043  C  CD   . GLN A 1 43 ? 21.895 -2.331  -7.898  1.00 0.00 ? 43 GLN A CD   9  
ATOM   7044  O  OE1  . GLN A 1 43 ? 22.913 -2.121  -7.243  1.00 0.00 ? 43 GLN A OE1  9  
ATOM   7045  N  NE2  . GLN A 1 43 ? 21.694 -3.479  -8.548  1.00 0.00 ? 43 GLN A NE2  9  
ATOM   7046  H  H    . GLN A 1 43 ? 20.238 1.321   -6.132  1.00 0.00 ? 43 GLN A H    9  
ATOM   7047  H  HA   . GLN A 1 43 ? 18.281 -0.400  -7.563  1.00 0.00 ? 43 GLN A HA   9  
ATOM   7048  H  HB2  . GLN A 1 43 ? 20.679 -1.027  -5.821  1.00 0.00 ? 43 GLN A HB2  9  
ATOM   7049  H  HB3  . GLN A 1 43 ? 19.573 -2.240  -6.495  1.00 0.00 ? 43 GLN A HB3  9  
ATOM   7050  H  HG2  . GLN A 1 43 ? 20.115 -1.496  -8.789  1.00 0.00 ? 43 GLN A HG2  9  
ATOM   7051  H  HG3  . GLN A 1 43 ? 21.245 -0.302  -8.134  1.00 0.00 ? 43 GLN A HG3  9  
ATOM   7052  H  HE21 . GLN A 1 43 ? 20.857 -3.629  -9.107  1.00 0.00 ? 43 GLN A HE21 9  
ATOM   7053  H  HE22 . GLN A 1 43 ? 22.403 -4.197  -8.505  1.00 0.00 ? 43 GLN A HE22 9  
ATOM   7054  N  N    . CYS A 1 44 ? 16.799 -0.980  -5.629  1.00 0.00 ? 44 CYS A N    9  
ATOM   7055  C  CA   . CYS A 1 44 ? 15.793 -1.203  -4.602  1.00 0.00 ? 44 CYS A CA   9  
ATOM   7056  C  C    . CYS A 1 44 ? 16.146 -2.459  -3.791  1.00 0.00 ? 44 CYS A C    9  
ATOM   7057  O  O    . CYS A 1 44 ? 16.941 -3.273  -4.262  1.00 0.00 ? 44 CYS A O    9  
ATOM   7058  C  CB   . CYS A 1 44 ? 14.412 -1.299  -5.269  1.00 0.00 ? 44 CYS A CB   9  
ATOM   7059  S  SG   . CYS A 1 44 ? 14.122 -2.751  -6.313  1.00 0.00 ? 44 CYS A SG   9  
ATOM   7060  H  H    . CYS A 1 44 ? 16.606 -1.349  -6.545  1.00 0.00 ? 44 CYS A H    9  
ATOM   7061  H  HA   . CYS A 1 44 ? 15.789 -0.333  -3.949  1.00 0.00 ? 44 CYS A HA   9  
ATOM   7062  H  HB2  . CYS A 1 44 ? 13.634 -1.300  -4.511  1.00 0.00 ? 44 CYS A HB2  9  
ATOM   7063  H  HB3  . CYS A 1 44 ? 14.267 -0.409  -5.883  1.00 0.00 ? 44 CYS A HB3  9  
ATOM   7064  N  N    . PRO A 1 45 ? 15.557 -2.629  -2.592  1.00 0.00 ? 45 PRO A N    9  
ATOM   7065  C  CA   . PRO A 1 45 ? 15.632 -3.829  -1.763  1.00 0.00 ? 45 PRO A CA   9  
ATOM   7066  C  C    . PRO A 1 45 ? 15.546 -5.176  -2.487  1.00 0.00 ? 45 PRO A C    9  
ATOM   7067  O  O    . PRO A 1 45 ? 16.134 -6.147  -2.016  1.00 0.00 ? 45 PRO A O    9  
ATOM   7068  C  CB   . PRO A 1 45 ? 14.503 -3.671  -0.750  1.00 0.00 ? 45 PRO A CB   9  
ATOM   7069  C  CG   . PRO A 1 45 ? 14.569 -2.176  -0.463  1.00 0.00 ? 45 PRO A CG   9  
ATOM   7070  C  CD   . PRO A 1 45 ? 14.888 -1.577  -1.836  1.00 0.00 ? 45 PRO A CD   9  
ATOM   7071  H  HA   . PRO A 1 45 ? 16.567 -3.788  -1.208  1.00 0.00 ? 45 PRO A HA   9  
ATOM   7072  H  HB2  . PRO A 1 45 ? 13.548 -3.915  -1.217  1.00 0.00 ? 45 PRO A HB2  9  
ATOM   7073  H  HB3  . PRO A 1 45 ? 14.655 -4.273  0.146   1.00 0.00 ? 45 PRO A HB3  9  
ATOM   7074  H  HG2  . PRO A 1 45 ? 13.634 -1.794  -0.050  1.00 0.00 ? 45 PRO A HG2  9  
ATOM   7075  H  HG3  . PRO A 1 45 ? 15.397 -1.983  0.221   1.00 0.00 ? 45 PRO A HG3  9  
ATOM   7076  H  HD2  . PRO A 1 45 ? 13.949 -1.307  -2.320  1.00 0.00 ? 45 PRO A HD2  9  
ATOM   7077  H  HD3  . PRO A 1 45 ? 15.522 -0.698  -1.714  1.00 0.00 ? 45 PRO A HD3  9  
ATOM   7078  N  N    . ALA A 1 46 ? 14.791 -5.257  -3.590  1.00 0.00 ? 46 ALA A N    9  
ATOM   7079  C  CA   . ALA A 1 46 ? 14.544 -6.512  -4.278  1.00 0.00 ? 46 ALA A CA   9  
ATOM   7080  C  C    . ALA A 1 46 ? 15.818 -6.950  -4.992  1.00 0.00 ? 46 ALA A C    9  
ATOM   7081  O  O    . ALA A 1 46 ? 16.278 -8.073  -4.789  1.00 0.00 ? 46 ALA A O    9  
ATOM   7082  C  CB   . ALA A 1 46 ? 13.376 -6.356  -5.258  1.00 0.00 ? 46 ALA A CB   9  
ATOM   7083  H  H    . ALA A 1 46 ? 14.481 -4.416  -4.045  1.00 0.00 ? 46 ALA A H    9  
ATOM   7084  H  HA   . ALA A 1 46 ? 14.265 -7.271  -3.545  1.00 0.00 ? 46 ALA A HA   9  
ATOM   7085  H  HB1  . ALA A 1 46 ? 13.622 -5.631  -6.032  1.00 0.00 ? 46 ALA A HB1  9  
ATOM   7086  H  HB2  . ALA A 1 46 ? 13.168 -7.318  -5.728  1.00 0.00 ? 46 ALA A HB2  9  
ATOM   7087  H  HB3  . ALA A 1 46 ? 12.487 -6.024  -4.720  1.00 0.00 ? 46 ALA A HB3  9  
ATOM   7088  N  N    . CYS A 1 47 ? 16.387 -6.063  -5.819  1.00 0.00 ? 47 CYS A N    9  
ATOM   7089  C  CA   . CYS A 1 47 ? 17.550 -6.384  -6.620  1.00 0.00 ? 47 CYS A CA   9  
ATOM   7090  C  C    . CYS A 1 47 ? 18.835 -6.312  -5.790  1.00 0.00 ? 47 CYS A C    9  
ATOM   7091  O  O    . CYS A 1 47 ? 19.572 -7.293  -5.720  1.00 0.00 ? 47 CYS A O    9  
ATOM   7092  C  CB   . CYS A 1 47 ? 17.611 -5.529  -7.891  1.00 0.00 ? 47 CYS A CB   9  
ATOM   7093  S  SG   . CYS A 1 47 ? 17.430 -3.728  -7.764  1.00 0.00 ? 47 CYS A SG   9  
ATOM   7094  H  H    . CYS A 1 47 ? 15.996 -5.140  -5.919  1.00 0.00 ? 47 CYS A H    9  
ATOM   7095  H  HA   . CYS A 1 47 ? 17.429 -7.413  -6.950  1.00 0.00 ? 47 CYS A HA   9  
ATOM   7096  H  HB2  . CYS A 1 47 ? 18.586 -5.722  -8.327  1.00 0.00 ? 47 CYS A HB2  9  
ATOM   7097  H  HB3  . CYS A 1 47 ? 16.844 -5.882  -8.584  1.00 0.00 ? 47 CYS A HB3  9  
ATOM   7098  N  N    . GLN A 1 48 ? 19.104 -5.160  -5.164  1.00 0.00 ? 48 GLN A N    9  
ATOM   7099  C  CA   . GLN A 1 48 ? 20.165 -5.010  -4.177  1.00 0.00 ? 48 GLN A CA   9  
ATOM   7100  C  C    . GLN A 1 48 ? 19.545 -5.256  -2.796  1.00 0.00 ? 48 GLN A C    9  
ATOM   7101  O  O    . GLN A 1 48 ? 18.663 -4.488  -2.422  1.00 0.00 ? 48 GLN A O    9  
ATOM   7102  C  CB   . GLN A 1 48 ? 20.752 -3.599  -4.298  1.00 0.00 ? 48 GLN A CB   9  
ATOM   7103  C  CG   . GLN A 1 48 ? 21.840 -3.307  -3.256  1.00 0.00 ? 48 GLN A CG   9  
ATOM   7104  C  CD   . GLN A 1 48 ? 22.291 -1.849  -3.312  1.00 0.00 ? 48 GLN A CD   9  
ATOM   7105  O  OE1  . GLN A 1 48 ? 22.043 -1.088  -2.380  1.00 0.00 ? 48 GLN A OE1  9  
ATOM   7106  N  NE2  . GLN A 1 48 ? 22.960 -1.451  -4.396  1.00 0.00 ? 48 GLN A NE2  9  
ATOM   7107  H  H    . GLN A 1 48 ? 18.427 -4.411  -5.220  1.00 0.00 ? 48 GLN A H    9  
ATOM   7108  H  HA   . GLN A 1 48 ? 20.981 -5.693  -4.398  1.00 0.00 ? 48 GLN A HA   9  
ATOM   7109  H  HB2  . GLN A 1 48 ? 21.197 -3.505  -5.291  1.00 0.00 ? 48 GLN A HB2  9  
ATOM   7110  H  HB3  . GLN A 1 48 ? 19.949 -2.871  -4.197  1.00 0.00 ? 48 GLN A HB3  9  
ATOM   7111  H  HG2  . GLN A 1 48 ? 21.458 -3.503  -2.254  1.00 0.00 ? 48 GLN A HG2  9  
ATOM   7112  H  HG3  . GLN A 1 48 ? 22.696 -3.959  -3.433  1.00 0.00 ? 48 GLN A HG3  9  
ATOM   7113  H  HE21 . GLN A 1 48 ? 23.100 -2.082  -5.177  1.00 0.00 ? 48 GLN A HE21 9  
ATOM   7114  H  HE22 . GLN A 1 48 ? 23.288 -0.495  -4.451  1.00 0.00 ? 48 GLN A HE22 9  
ATOM   7115  N  N    . PRO A 1 49 ? 19.977 -6.280  -2.035  1.00 0.00 ? 49 PRO A N    9  
ATOM   7116  C  CA   . PRO A 1 49 ? 19.327 -6.741  -0.808  1.00 0.00 ? 49 PRO A CA   9  
ATOM   7117  C  C    . PRO A 1 49 ? 18.859 -5.635  0.145   1.00 0.00 ? 49 PRO A C    9  
ATOM   7118  O  O    . PRO A 1 49 ? 19.501 -4.591  0.262   1.00 0.00 ? 49 PRO A O    9  
ATOM   7119  C  CB   . PRO A 1 49 ? 20.348 -7.644  -0.121  1.00 0.00 ? 49 PRO A CB   9  
ATOM   7120  C  CG   . PRO A 1 49 ? 21.091 -8.260  -1.301  1.00 0.00 ? 49 PRO A CG   9  
ATOM   7121  C  CD   . PRO A 1 49 ? 21.134 -7.120  -2.318  1.00 0.00 ? 49 PRO A CD   9  
ATOM   7122  H  HA   . PRO A 1 49 ? 18.475 -7.351  -1.107  1.00 0.00 ? 49 PRO A HA   9  
ATOM   7123  H  HB2  . PRO A 1 49 ? 21.042 -7.038  0.461   1.00 0.00 ? 49 PRO A HB2  9  
ATOM   7124  H  HB3  . PRO A 1 49 ? 19.876 -8.398  0.512   1.00 0.00 ? 49 PRO A HB3  9  
ATOM   7125  H  HG2  . PRO A 1 49 ? 22.087 -8.611  -1.027  1.00 0.00 ? 49 PRO A HG2  9  
ATOM   7126  H  HG3  . PRO A 1 49 ? 20.500 -9.084  -1.705  1.00 0.00 ? 49 PRO A HG3  9  
ATOM   7127  H  HD2  . PRO A 1 49 ? 22.045 -6.535  -2.184  1.00 0.00 ? 49 PRO A HD2  9  
ATOM   7128  H  HD3  . PRO A 1 49 ? 21.102 -7.554  -3.318  1.00 0.00 ? 49 PRO A HD3  9  
ATOM   7129  N  N    . ALA A 1 50 ? 17.742 -5.893  0.836   1.00 0.00 ? 50 ALA A N    9  
ATOM   7130  C  CA   . ALA A 1 50 ? 17.178 -5.027  1.862   1.00 0.00 ? 50 ALA A CA   9  
ATOM   7131  C  C    . ALA A 1 50 ? 18.231 -4.660  2.910   1.00 0.00 ? 50 ALA A C    9  
ATOM   7132  O  O    . ALA A 1 50 ? 18.678 -5.515  3.670   1.00 0.00 ? 50 ALA A O    9  
ATOM   7133  C  CB   . ALA A 1 50 ? 15.982 -5.726  2.516   1.00 0.00 ? 50 ALA A CB   9  
ATOM   7134  H  H    . ALA A 1 50 ? 17.258 -6.760  0.653   1.00 0.00 ? 50 ALA A H    9  
ATOM   7135  H  HA   . ALA A 1 50 ? 16.813 -4.120  1.379   1.00 0.00 ? 50 ALA A HA   9  
ATOM   7136  H  HB1  . ALA A 1 50 ? 15.531 -5.063  3.257   1.00 0.00 ? 50 ALA A HB1  9  
ATOM   7137  H  HB2  . ALA A 1 50 ? 15.236 -5.973  1.761   1.00 0.00 ? 50 ALA A HB2  9  
ATOM   7138  H  HB3  . ALA A 1 50 ? 16.304 -6.644  3.008   1.00 0.00 ? 50 ALA A HB3  9  
ATOM   7139  N  N    . THR A 1 51 ? 18.640 -3.387  2.911   1.00 0.00 ? 51 THR A N    9  
ATOM   7140  C  CA   . THR A 1 51 ? 19.748 -2.857  3.693   1.00 0.00 ? 51 THR A CA   9  
ATOM   7141  C  C    . THR A 1 51 ? 19.467 -1.372  3.909   1.00 0.00 ? 51 THR A C    9  
ATOM   7142  O  O    . THR A 1 51 ? 19.147 -0.714  2.895   1.00 0.00 ? 51 THR A O    9  
ATOM   7143  C  CB   . THR A 1 51 ? 21.083 -3.060  2.952   1.00 0.00 ? 51 THR A CB   9  
ATOM   7144  O  OG1  . THR A 1 51 ? 21.267 -4.413  2.584   1.00 0.00 ? 51 THR A OG1  9  
ATOM   7145  C  CG2  . THR A 1 51 ? 22.267 -2.631  3.823   1.00 0.00 ? 51 THR A CG2  9  
ATOM   7146  O  OXT  . THR A 1 51 ? 19.564 -0.922  5.071   1.00 0.00 ? 51 THR A OXT  9  
ATOM   7147  H  H    . THR A 1 51 ? 18.165 -2.725  2.314   1.00 0.00 ? 51 THR A H    9  
ATOM   7148  H  HA   . THR A 1 51 ? 19.786 -3.361  4.660   1.00 0.00 ? 51 THR A HA   9  
ATOM   7149  H  HB   . THR A 1 51 ? 21.093 -2.460  2.041   1.00 0.00 ? 51 THR A HB   9  
ATOM   7150  H  HG1  . THR A 1 51 ? 20.602 -4.642  1.928   1.00 0.00 ? 51 THR A HG1  9  
ATOM   7151  H  HG21 . THR A 1 51 ? 23.198 -2.808  3.284   1.00 0.00 ? 51 THR A HG21 9  
ATOM   7152  H  HG22 . THR A 1 51 ? 22.198 -1.570  4.063   1.00 0.00 ? 51 THR A HG22 9  
ATOM   7153  H  HG23 . THR A 1 51 ? 22.276 -3.209  4.748   1.00 0.00 ? 51 THR A HG23 9  
HETATM 7154  ZN ZN   . ZN  B 2 .  ? 6.655  5.160   -0.715  1.00 0.00 ? 52 ZN  A ZN   9  
HETATM 7155  ZN ZN   . ZN  C 2 .  ? 15.406 -2.726  -8.214  1.00 0.00 ? 53 ZN  A ZN   9  
ATOM   7156  N  N    . ALA A 1 1  ? 5.263  11.248  -6.186  1.00 0.00 ? 1  ALA A N    10 
ATOM   7157  C  CA   . ALA A 1 1  ? 4.459  10.319  -7.001  1.00 0.00 ? 1  ALA A CA   10 
ATOM   7158  C  C    . ALA A 1 1  ? 4.183  9.028   -6.227  1.00 0.00 ? 1  ALA A C    10 
ATOM   7159  O  O    . ALA A 1 1  ? 4.693  8.855   -5.121  1.00 0.00 ? 1  ALA A O    10 
ATOM   7160  C  CB   . ALA A 1 1  ? 5.155  10.032  -8.335  1.00 0.00 ? 1  ALA A CB   10 
ATOM   7161  H  H1   . ALA A 1 1  ? 4.789  11.416  -5.305  1.00 0.00 ? 1  ALA A H1   10 
ATOM   7162  H  H2   . ALA A 1 1  ? 6.159  10.828  -5.989  1.00 0.00 ? 1  ALA A H2   10 
ATOM   7163  H  H3   . ALA A 1 1  ? 5.391  12.123  -6.674  1.00 0.00 ? 1  ALA A H3   10 
ATOM   7164  H  HA   . ALA A 1 1  ? 3.503  10.801  -7.208  1.00 0.00 ? 1  ALA A HA   10 
ATOM   7165  H  HB1  . ALA A 1 1  ? 6.106  9.526   -8.159  1.00 0.00 ? 1  ALA A HB1  10 
ATOM   7166  H  HB2  . ALA A 1 1  ? 4.526  9.400   -8.962  1.00 0.00 ? 1  ALA A HB2  10 
ATOM   7167  H  HB3  . ALA A 1 1  ? 5.343  10.969  -8.861  1.00 0.00 ? 1  ALA A HB3  10 
ATOM   7168  N  N    . ARG A 1 2  ? 3.366  8.133   -6.793  1.00 0.00 ? 2  ARG A N    10 
ATOM   7169  C  CA   . ARG A 1 2  ? 2.923  6.931   -6.101  1.00 0.00 ? 2  ARG A CA   10 
ATOM   7170  C  C    . ARG A 1 2  ? 4.066  5.922   -6.023  1.00 0.00 ? 2  ARG A C    10 
ATOM   7171  O  O    . ARG A 1 2  ? 4.453  5.334   -7.032  1.00 0.00 ? 2  ARG A O    10 
ATOM   7172  C  CB   . ARG A 1 2  ? 1.677  6.344   -6.776  1.00 0.00 ? 2  ARG A CB   10 
ATOM   7173  C  CG   . ARG A 1 2  ? 1.168  5.122   -5.996  1.00 0.00 ? 2  ARG A CG   10 
ATOM   7174  C  CD   . ARG A 1 2  ? -0.158 4.599   -6.558  1.00 0.00 ? 2  ARG A CD   10 
ATOM   7175  N  NE   . ARG A 1 2  ? -1.256 5.561   -6.380  1.00 0.00 ? 2  ARG A NE   10 
ATOM   7176  C  CZ   . ARG A 1 2  ? -1.937 5.769   -5.239  1.00 0.00 ? 2  ARG A CZ   10 
ATOM   7177  N  NH1  . ARG A 1 2  ? -1.628 5.100   -4.120  1.00 0.00 ? 2  ARG A NH1  10 
ATOM   7178  N  NH2  . ARG A 1 2  ? -2.937 6.659   -5.221  1.00 0.00 ? 2  ARG A NH2  10 
ATOM   7179  H  H    . ARG A 1 2  ? 3.005  8.304   -7.721  1.00 0.00 ? 2  ARG A H    10 
ATOM   7180  H  HA   . ARG A 1 2  ? 2.628  7.211   -5.091  1.00 0.00 ? 2  ARG A HA   10 
ATOM   7181  H  HB2  . ARG A 1 2  ? 0.903  7.111   -6.796  1.00 0.00 ? 2  ARG A HB2  10 
ATOM   7182  H  HB3  . ARG A 1 2  ? 1.910  6.052   -7.801  1.00 0.00 ? 2  ARG A HB3  10 
ATOM   7183  H  HG2  . ARG A 1 2  ? 1.901  4.318   -6.067  1.00 0.00 ? 2  ARG A HG2  10 
ATOM   7184  H  HG3  . ARG A 1 2  ? 1.043  5.384   -4.945  1.00 0.00 ? 2  ARG A HG3  10 
ATOM   7185  H  HD2  . ARG A 1 2  ? -0.036 4.402   -7.623  1.00 0.00 ? 2  ARG A HD2  10 
ATOM   7186  H  HD3  . ARG A 1 2  ? -0.409 3.655   -6.071  1.00 0.00 ? 2  ARG A HD3  10 
ATOM   7187  H  HE   . ARG A 1 2  ? -1.522 6.089   -7.200  1.00 0.00 ? 2  ARG A HE   10 
ATOM   7188  H  HH11 . ARG A 1 2  ? -0.872 4.430   -4.121  1.00 0.00 ? 2  ARG A HH11 10 
ATOM   7189  H  HH12 . ARG A 1 2  ? -2.148 5.250   -3.267  1.00 0.00 ? 2  ARG A HH12 10 
ATOM   7190  H  HH21 . ARG A 1 2  ? -3.185 7.161   -6.062  1.00 0.00 ? 2  ARG A HH21 10 
ATOM   7191  H  HH22 . ARG A 1 2  ? -3.466 6.816   -4.375  1.00 0.00 ? 2  ARG A HH22 10 
ATOM   7192  N  N    . CYS A 1 3  ? 4.597  5.725   -4.813  1.00 0.00 ? 3  CYS A N    10 
ATOM   7193  C  CA   . CYS A 1 3  ? 5.532  4.657   -4.506  1.00 0.00 ? 3  CYS A CA   10 
ATOM   7194  C  C    . CYS A 1 3  ? 4.805  3.314   -4.516  1.00 0.00 ? 3  CYS A C    10 
ATOM   7195  O  O    . CYS A 1 3  ? 3.645  3.238   -4.116  1.00 0.00 ? 3  CYS A O    10 
ATOM   7196  C  CB   . CYS A 1 3  ? 6.139  4.928   -3.134  1.00 0.00 ? 3  CYS A CB   10 
ATOM   7197  S  SG   . CYS A 1 3  ? 7.209  3.622   -2.486  1.00 0.00 ? 3  CYS A SG   10 
ATOM   7198  H  H    . CYS A 1 3  ? 4.239  6.267   -4.035  1.00 0.00 ? 3  CYS A H    10 
ATOM   7199  H  HA   . CYS A 1 3  ? 6.335  4.652   -5.244  1.00 0.00 ? 3  CYS A HA   10 
ATOM   7200  H  HB2  . CYS A 1 3  ? 6.725  5.844   -3.209  1.00 0.00 ? 3  CYS A HB2  10 
ATOM   7201  H  HB3  . CYS A 1 3  ? 5.322  5.075   -2.427  1.00 0.00 ? 3  CYS A HB3  10 
ATOM   7202  N  N    . LYS A 1 4  ? 5.497  2.258   -4.959  1.00 0.00 ? 4  LYS A N    10 
ATOM   7203  C  CA   . LYS A 1 4  ? 4.987  0.896   -4.981  1.00 0.00 ? 4  LYS A CA   10 
ATOM   7204  C  C    . LYS A 1 4  ? 4.828  0.381   -3.548  1.00 0.00 ? 4  LYS A C    10 
ATOM   7205  O  O    . LYS A 1 4  ? 3.743  -0.048  -3.163  1.00 0.00 ? 4  LYS A O    10 
ATOM   7206  C  CB   . LYS A 1 4  ? 5.929  0.028   -5.834  1.00 0.00 ? 4  LYS A CB   10 
ATOM   7207  C  CG   . LYS A 1 4  ? 5.309  -1.269  -6.382  1.00 0.00 ? 4  LYS A CG   10 
ATOM   7208  C  CD   . LYS A 1 4  ? 4.914  -2.335  -5.350  1.00 0.00 ? 4  LYS A CD   10 
ATOM   7209  C  CE   . LYS A 1 4  ? 6.097  -2.823  -4.504  1.00 0.00 ? 4  LYS A CE   10 
ATOM   7210  N  NZ   . LYS A 1 4  ? 5.673  -3.841  -3.527  1.00 0.00 ? 4  LYS A NZ   10 
ATOM   7211  H  H    . LYS A 1 4  ? 6.456  2.396   -5.247  1.00 0.00 ? 4  LYS A H    10 
ATOM   7212  H  HA   . LYS A 1 4  ? 4.013  0.906   -5.464  1.00 0.00 ? 4  LYS A HA   10 
ATOM   7213  H  HB2  . LYS A 1 4  ? 6.204  0.614   -6.713  1.00 0.00 ? 4  LYS A HB2  10 
ATOM   7214  H  HB3  . LYS A 1 4  ? 6.841  -0.189  -5.279  1.00 0.00 ? 4  LYS A HB3  10 
ATOM   7215  H  HG2  . LYS A 1 4  ? 4.421  -1.007  -6.960  1.00 0.00 ? 4  LYS A HG2  10 
ATOM   7216  H  HG3  . LYS A 1 4  ? 6.029  -1.717  -7.068  1.00 0.00 ? 4  LYS A HG3  10 
ATOM   7217  H  HD2  . LYS A 1 4  ? 4.120  -1.958  -4.709  1.00 0.00 ? 4  LYS A HD2  10 
ATOM   7218  H  HD3  . LYS A 1 4  ? 4.512  -3.189  -5.898  1.00 0.00 ? 4  LYS A HD3  10 
ATOM   7219  H  HE2  . LYS A 1 4  ? 6.856  -3.253  -5.158  1.00 0.00 ? 4  LYS A HE2  10 
ATOM   7220  H  HE3  . LYS A 1 4  ? 6.538  -1.993  -3.954  1.00 0.00 ? 4  LYS A HE3  10 
ATOM   7221  H  HZ1  . LYS A 1 4  ? 5.272  -4.632  -4.011  1.00 0.00 ? 4  LYS A HZ1  10 
ATOM   7222  H  HZ2  . LYS A 1 4  ? 6.470  -4.148  -2.988  1.00 0.00 ? 4  LYS A HZ2  10 
ATOM   7223  H  HZ3  . LYS A 1 4  ? 4.983  -3.446  -2.903  1.00 0.00 ? 4  LYS A HZ3  10 
ATOM   7224  N  N    . VAL A 1 5  ? 5.914  0.449   -2.770  1.00 0.00 ? 5  VAL A N    10 
ATOM   7225  C  CA   . VAL A 1 5  ? 6.056  -0.172  -1.455  1.00 0.00 ? 5  VAL A CA   10 
ATOM   7226  C  C    . VAL A 1 5  ? 4.900  0.218   -0.533  1.00 0.00 ? 5  VAL A C    10 
ATOM   7227  O  O    . VAL A 1 5  ? 4.080  -0.628  -0.182  1.00 0.00 ? 5  VAL A O    10 
ATOM   7228  C  CB   . VAL A 1 5  ? 7.417  0.190   -0.836  1.00 0.00 ? 5  VAL A CB   10 
ATOM   7229  C  CG1  . VAL A 1 5  ? 7.595  -0.430  0.556   1.00 0.00 ? 5  VAL A CG1  10 
ATOM   7230  C  CG2  . VAL A 1 5  ? 8.570  -0.284  -1.724  1.00 0.00 ? 5  VAL A CG2  10 
ATOM   7231  H  H    . VAL A 1 5  ? 6.728  0.891   -3.170  1.00 0.00 ? 5  VAL A H    10 
ATOM   7232  H  HA   . VAL A 1 5  ? 6.031  -1.252  -1.588  1.00 0.00 ? 5  VAL A HA   10 
ATOM   7233  H  HB   . VAL A 1 5  ? 7.493  1.270   -0.736  1.00 0.00 ? 5  VAL A HB   10 
ATOM   7234  H  HG11 . VAL A 1 5  ? 8.583  -0.178  0.944   1.00 0.00 ? 5  VAL A HG11 10 
ATOM   7235  H  HG12 . VAL A 1 5  ? 6.851  -0.041  1.252   1.00 0.00 ? 5  VAL A HG12 10 
ATOM   7236  H  HG13 . VAL A 1 5  ? 7.500  -1.514  0.498   1.00 0.00 ? 5  VAL A HG13 10 
ATOM   7237  H  HG21 . VAL A 1 5  ? 9.504  -0.067  -1.213  1.00 0.00 ? 5  VAL A HG21 10 
ATOM   7238  H  HG22 . VAL A 1 5  ? 8.497  -1.358  -1.897  1.00 0.00 ? 5  VAL A HG22 10 
ATOM   7239  H  HG23 . VAL A 1 5  ? 8.568  0.239   -2.681  1.00 0.00 ? 5  VAL A HG23 10 
ATOM   7240  N  N    . CYS A 1 6  ? 4.844  1.498   -0.147  1.00 0.00 ? 6  CYS A N    10 
ATOM   7241  C  CA   . CYS A 1 6  ? 3.789  2.018   0.711   1.00 0.00 ? 6  CYS A CA   10 
ATOM   7242  C  C    . CYS A 1 6  ? 2.482  2.268   -0.050  1.00 0.00 ? 6  CYS A C    10 
ATOM   7243  O  O    . CYS A 1 6  ? 1.470  2.550   0.590   1.00 0.00 ? 6  CYS A O    10 
ATOM   7244  C  CB   . CYS A 1 6  ? 4.274  3.264   1.465   1.00 0.00 ? 6  CYS A CB   10 
ATOM   7245  S  SG   . CYS A 1 6  ? 4.966  4.618   0.476   1.00 0.00 ? 6  CYS A SG   10 
ATOM   7246  H  H    . CYS A 1 6  ? 5.549  2.137   -0.479  1.00 0.00 ? 6  CYS A H    10 
ATOM   7247  H  HA   . CYS A 1 6  ? 3.567  1.271   1.476   1.00 0.00 ? 6  CYS A HA   10 
ATOM   7248  H  HB2  . CYS A 1 6  ? 3.438  3.665   2.040   1.00 0.00 ? 6  CYS A HB2  10 
ATOM   7249  H  HB3  . CYS A 1 6  ? 5.045  2.959   2.174   1.00 0.00 ? 6  CYS A HB3  10 
ATOM   7250  N  N    . ARG A 1 7  ? 2.480  2.146   -1.389  1.00 0.00 ? 7  ARG A N    10 
ATOM   7251  C  CA   . ARG A 1 7  ? 1.283  2.235   -2.221  1.00 0.00 ? 7  ARG A CA   10 
ATOM   7252  C  C    . ARG A 1 7  ? 0.590  3.576   -1.964  1.00 0.00 ? 7  ARG A C    10 
ATOM   7253  O  O    . ARG A 1 7  ? -0.607 3.630   -1.687  1.00 0.00 ? 7  ARG A O    10 
ATOM   7254  C  CB   . ARG A 1 7  ? 0.390  1.009   -1.965  1.00 0.00 ? 7  ARG A CB   10 
ATOM   7255  C  CG   . ARG A 1 7  ? -0.661 0.812   -3.067  1.00 0.00 ? 7  ARG A CG   10 
ATOM   7256  C  CD   . ARG A 1 7  ? -1.468 -0.468  -2.828  1.00 0.00 ? 7  ARG A CD   10 
ATOM   7257  N  NE   . ARG A 1 7  ? -2.233 -0.396  -1.575  1.00 0.00 ? 7  ARG A NE   10 
ATOM   7258  C  CZ   . ARG A 1 7  ? -2.894 -1.423  -1.014  1.00 0.00 ? 7  ARG A CZ   10 
ATOM   7259  N  NH1  . ARG A 1 7  ? -2.919 -2.627  -1.604  1.00 0.00 ? 7  ARG A NH1  10 
ATOM   7260  N  NH2  . ARG A 1 7  ? -3.536 -1.240  0.147   1.00 0.00 ? 7  ARG A NH2  10 
ATOM   7261  H  H    . ARG A 1 7  ? 3.344  1.927   -1.865  1.00 0.00 ? 7  ARG A H    10 
ATOM   7262  H  HA   . ARG A 1 7  ? 1.590  2.199   -3.264  1.00 0.00 ? 7  ARG A HA   10 
ATOM   7263  H  HB2  . ARG A 1 7  ? 1.025  0.122   -1.950  1.00 0.00 ? 7  ARG A HB2  10 
ATOM   7264  H  HB3  . ARG A 1 7  ? -0.094 1.100   -0.992  1.00 0.00 ? 7  ARG A HB3  10 
ATOM   7265  H  HG2  . ARG A 1 7  ? -1.344 1.660   -3.106  1.00 0.00 ? 7  ARG A HG2  10 
ATOM   7266  H  HG3  . ARG A 1 7  ? -0.156 0.726   -4.030  1.00 0.00 ? 7  ARG A HG3  10 
ATOM   7267  H  HD2  . ARG A 1 7  ? -2.161 -0.606  -3.660  1.00 0.00 ? 7  ARG A HD2  10 
ATOM   7268  H  HD3  . ARG A 1 7  ? -0.781 -1.316  -2.796  1.00 0.00 ? 7  ARG A HD3  10 
ATOM   7269  H  HE   . ARG A 1 7  ? -2.245 0.498   -1.105  1.00 0.00 ? 7  ARG A HE   10 
ATOM   7270  H  HH11 . ARG A 1 7  ? -2.441 -2.768  -2.482  1.00 0.00 ? 7  ARG A HH11 10 
ATOM   7271  H  HH12 . ARG A 1 7  ? -3.414 -3.396  -1.178  1.00 0.00 ? 7  ARG A HH12 10 
ATOM   7272  H  HH21 . ARG A 1 7  ? -3.522 -0.337  0.598   1.00 0.00 ? 7  ARG A HH21 10 
ATOM   7273  H  HH22 . ARG A 1 7  ? -4.035 -2.005  0.581   1.00 0.00 ? 7  ARG A HH22 10 
ATOM   7274  N  N    . LYS A 1 8  ? 1.363  4.665   -2.056  1.00 0.00 ? 8  LYS A N    10 
ATOM   7275  C  CA   . LYS A 1 8  ? 0.941  5.986   -1.616  1.00 0.00 ? 8  LYS A CA   10 
ATOM   7276  C  C    . LYS A 1 8  ? 1.804  7.054   -2.292  1.00 0.00 ? 8  LYS A C    10 
ATOM   7277  O  O    . LYS A 1 8  ? 2.992  6.830   -2.521  1.00 0.00 ? 8  LYS A O    10 
ATOM   7278  C  CB   . LYS A 1 8  ? 1.105  6.036   -0.089  1.00 0.00 ? 8  LYS A CB   10 
ATOM   7279  C  CG   . LYS A 1 8  ? 0.501  7.291   0.552   1.00 0.00 ? 8  LYS A CG   10 
ATOM   7280  C  CD   . LYS A 1 8  ? 0.772  7.355   2.061   1.00 0.00 ? 8  LYS A CD   10 
ATOM   7281  C  CE   . LYS A 1 8  ? 2.274  7.421   2.380   1.00 0.00 ? 8  LYS A CE   10 
ATOM   7282  N  NZ   . LYS A 1 8  ? 2.519  7.868   3.761   1.00 0.00 ? 8  LYS A NZ   10 
ATOM   7283  H  H    . LYS A 1 8  ? 2.324  4.560   -2.352  1.00 0.00 ? 8  LYS A H    10 
ATOM   7284  H  HA   . LYS A 1 8  ? -0.107 6.145   -1.870  1.00 0.00 ? 8  LYS A HA   10 
ATOM   7285  H  HB2  . LYS A 1 8  ? 0.611  5.171   0.361   1.00 0.00 ? 8  LYS A HB2  10 
ATOM   7286  H  HB3  . LYS A 1 8  ? 2.172  5.984   0.122   1.00 0.00 ? 8  LYS A HB3  10 
ATOM   7287  H  HG2  . LYS A 1 8  ? 0.913  8.185   0.091   1.00 0.00 ? 8  LYS A HG2  10 
ATOM   7288  H  HG3  . LYS A 1 8  ? -0.577 7.285   0.388   1.00 0.00 ? 8  LYS A HG3  10 
ATOM   7289  H  HD2  . LYS A 1 8  ? 0.286  8.254   2.444   1.00 0.00 ? 8  LYS A HD2  10 
ATOM   7290  H  HD3  . LYS A 1 8  ? 0.332  6.486   2.553   1.00 0.00 ? 8  LYS A HD3  10 
ATOM   7291  H  HE2  . LYS A 1 8  ? 2.731  6.442   2.252   1.00 0.00 ? 8  LYS A HE2  10 
ATOM   7292  H  HE3  . LYS A 1 8  ? 2.760  8.124   1.704   1.00 0.00 ? 8  LYS A HE3  10 
ATOM   7293  H  HZ1  . LYS A 1 8  ? 3.516  8.012   3.891   1.00 0.00 ? 8  LYS A HZ1  10 
ATOM   7294  H  HZ2  . LYS A 1 8  ? 2.051  8.747   3.926   1.00 0.00 ? 8  LYS A HZ2  10 
ATOM   7295  H  HZ3  . LYS A 1 8  ? 2.189  7.176   4.417   1.00 0.00 ? 8  LYS A HZ3  10 
ATOM   7296  N  N    . LYS A 1 9  ? 1.195  8.206   -2.607  1.00 0.00 ? 9  LYS A N    10 
ATOM   7297  C  CA   . LYS A 1 9  ? 1.891  9.409   -3.050  1.00 0.00 ? 9  LYS A CA   10 
ATOM   7298  C  C    . LYS A 1 9  ? 1.881  10.458  -1.931  1.00 0.00 ? 9  LYS A C    10 
ATOM   7299  O  O    . LYS A 1 9  ? 1.363  11.559  -2.104  1.00 0.00 ? 9  LYS A O    10 
ATOM   7300  C  CB   . LYS A 1 9  ? 1.272  9.937   -4.355  1.00 0.00 ? 9  LYS A CB   10 
ATOM   7301  C  CG   . LYS A 1 9  ? -0.243 10.197  -4.271  1.00 0.00 ? 9  LYS A CG   10 
ATOM   7302  C  CD   . LYS A 1 9  ? -0.749 11.122  -5.390  1.00 0.00 ? 9  LYS A CD   10 
ATOM   7303  C  CE   . LYS A 1 9  ? -0.051 12.492  -5.459  1.00 0.00 ? 9  LYS A CE   10 
ATOM   7304  N  NZ   . LYS A 1 9  ? 0.095  13.130  -4.137  1.00 0.00 ? 9  LYS A NZ   10 
ATOM   7305  H  H    . LYS A 1 9  ? 0.209  8.294   -2.414  1.00 0.00 ? 9  LYS A H    10 
ATOM   7306  H  HA   . LYS A 1 9  ? 2.938  9.188   -3.257  1.00 0.00 ? 9  LYS A HA   10 
ATOM   7307  H  HB2  . LYS A 1 9  ? 1.812  10.849  -4.608  1.00 0.00 ? 9  LYS A HB2  10 
ATOM   7308  H  HB3  . LYS A 1 9  ? 1.433  9.213   -5.152  1.00 0.00 ? 9  LYS A HB3  10 
ATOM   7309  H  HG2  . LYS A 1 9  ? -0.762 9.242   -4.355  1.00 0.00 ? 9  LYS A HG2  10 
ATOM   7310  H  HG3  . LYS A 1 9  ? -0.523 10.630  -3.312  1.00 0.00 ? 9  LYS A HG3  10 
ATOM   7311  H  HD2  . LYS A 1 9  ? -0.622 10.621  -6.351  1.00 0.00 ? 9  LYS A HD2  10 
ATOM   7312  H  HD3  . LYS A 1 9  ? -1.816 11.285  -5.232  1.00 0.00 ? 9  LYS A HD3  10 
ATOM   7313  H  HE2  . LYS A 1 9  ? 0.939  12.384  -5.905  1.00 0.00 ? 9  LYS A HE2  10 
ATOM   7314  H  HE3  . LYS A 1 9  ? -0.634 13.151  -6.105  1.00 0.00 ? 9  LYS A HE3  10 
ATOM   7315  H  HZ1  . LYS A 1 9  ? 0.629  12.530  -3.519  1.00 0.00 ? 9  LYS A HZ1  10 
ATOM   7316  H  HZ2  . LYS A 1 9  ? 0.609  13.995  -4.234  1.00 0.00 ? 9  LYS A HZ2  10 
ATOM   7317  H  HZ3  . LYS A 1 9  ? -0.811 13.314  -3.730  1.00 0.00 ? 9  LYS A HZ3  10 
ATOM   7318  N  N    . GLY A 1 10 ? 2.454  10.109  -0.775  1.00 0.00 ? 10 GLY A N    10 
ATOM   7319  C  CA   . GLY A 1 10 ? 2.455  10.973  0.395   1.00 0.00 ? 10 GLY A CA   10 
ATOM   7320  C  C    . GLY A 1 10 ? 3.684  11.867  0.349   1.00 0.00 ? 10 GLY A C    10 
ATOM   7321  O  O    . GLY A 1 10 ? 3.573  13.075  0.153   1.00 0.00 ? 10 GLY A O    10 
ATOM   7322  H  H    . GLY A 1 10 ? 2.914  9.214   -0.704  1.00 0.00 ? 10 GLY A H    10 
ATOM   7323  H  HA2  . GLY A 1 10 ? 1.551  11.585  0.429   1.00 0.00 ? 10 GLY A HA2  10 
ATOM   7324  H  HA3  . GLY A 1 10 ? 2.496  10.362  1.297   1.00 0.00 ? 10 GLY A HA3  10 
ATOM   7325  N  N    . GLU A 1 11 ? 4.857  11.250  0.523   1.00 0.00 ? 11 GLU A N    10 
ATOM   7326  C  CA   . GLU A 1 11 ? 6.118  11.945  0.702   1.00 0.00 ? 11 GLU A CA   10 
ATOM   7327  C  C    . GLU A 1 11 ? 6.696  12.264  -0.679  1.00 0.00 ? 11 GLU A C    10 
ATOM   7328  O  O    . GLU A 1 11 ? 7.708  11.691  -1.077  1.00 0.00 ? 11 GLU A O    10 
ATOM   7329  C  CB   . GLU A 1 11 ? 7.078  11.101  1.558   1.00 0.00 ? 11 GLU A CB   10 
ATOM   7330  C  CG   . GLU A 1 11 ? 6.493  10.637  2.903   1.00 0.00 ? 11 GLU A CG   10 
ATOM   7331  C  CD   . GLU A 1 11 ? 5.576  9.413   2.827   1.00 0.00 ? 11 GLU A CD   10 
ATOM   7332  O  OE1  . GLU A 1 11 ? 5.449  8.825   1.730   1.00 0.00 ? 11 GLU A OE1  10 
ATOM   7333  O  OE2  . GLU A 1 11 ? 4.999  9.080   3.887   1.00 0.00 ? 11 GLU A OE2  10 
ATOM   7334  H  H    . GLU A 1 11 ? 4.868  10.247  0.655   1.00 0.00 ? 11 GLU A H    10 
ATOM   7335  H  HA   . GLU A 1 11 ? 5.949  12.878  1.237   1.00 0.00 ? 11 GLU A HA   10 
ATOM   7336  H  HB2  . GLU A 1 11 ? 7.427  10.232  1.002   1.00 0.00 ? 11 GLU A HB2  10 
ATOM   7337  H  HB3  . GLU A 1 11 ? 7.938  11.737  1.779   1.00 0.00 ? 11 GLU A HB3  10 
ATOM   7338  H  HG2  . GLU A 1 11 ? 7.328  10.369  3.553   1.00 0.00 ? 11 GLU A HG2  10 
ATOM   7339  H  HG3  . GLU A 1 11 ? 5.955  11.465  3.366   1.00 0.00 ? 11 GLU A HG3  10 
ATOM   7340  N  N    . ASP A 1 12 ? 6.038  13.170  -1.413  1.00 0.00 ? 12 ASP A N    10 
ATOM   7341  C  CA   . ASP A 1 12 ? 6.382  13.513  -2.788  1.00 0.00 ? 12 ASP A CA   10 
ATOM   7342  C  C    . ASP A 1 12 ? 7.584  14.464  -2.799  1.00 0.00 ? 12 ASP A C    10 
ATOM   7343  O  O    . ASP A 1 12 ? 7.474  15.620  -3.205  1.00 0.00 ? 12 ASP A O    10 
ATOM   7344  C  CB   . ASP A 1 12 ? 5.157  14.111  -3.501  1.00 0.00 ? 12 ASP A CB   10 
ATOM   7345  C  CG   . ASP A 1 12 ? 3.976  13.148  -3.622  1.00 0.00 ? 12 ASP A CG   10 
ATOM   7346  O  OD1  . ASP A 1 12 ? 4.222  11.922  -3.674  1.00 0.00 ? 12 ASP A OD1  10 
ATOM   7347  O  OD2  . ASP A 1 12 ? 2.838  13.658  -3.708  1.00 0.00 ? 12 ASP A OD2  10 
ATOM   7348  H  H    . ASP A 1 12 ? 5.203  13.585  -1.020  1.00 0.00 ? 12 ASP A H    10 
ATOM   7349  H  HA   . ASP A 1 12 ? 6.669  12.613  -3.329  1.00 0.00 ? 12 ASP A HA   10 
ATOM   7350  H  HB2  . ASP A 1 12 ? 4.834  14.997  -2.952  1.00 0.00 ? 12 ASP A HB2  10 
ATOM   7351  H  HB3  . ASP A 1 12 ? 5.447  14.408  -4.511  1.00 0.00 ? 12 ASP A HB3  10 
ATOM   7352  N  N    . ASP A 1 13 ? 8.736  13.952  -2.352  1.00 0.00 ? 13 ASP A N    10 
ATOM   7353  C  CA   . ASP A 1 13 ? 9.945  14.708  -2.073  1.00 0.00 ? 13 ASP A CA   10 
ATOM   7354  C  C    . ASP A 1 13 ? 10.873 14.620  -3.285  1.00 0.00 ? 13 ASP A C    10 
ATOM   7355  O  O    . ASP A 1 13 ? 11.058 15.602  -4.001  1.00 0.00 ? 13 ASP A O    10 
ATOM   7356  C  CB   . ASP A 1 13 ? 10.579 14.163  -0.783  1.00 0.00 ? 13 ASP A CB   10 
ATOM   7357  C  CG   . ASP A 1 13 ? 11.922 14.801  -0.441  1.00 0.00 ? 13 ASP A CG   10 
ATOM   7358  O  OD1  . ASP A 1 13 ? 12.098 15.999  -0.754  1.00 0.00 ? 13 ASP A OD1  10 
ATOM   7359  O  OD2  . ASP A 1 13 ? 12.769 14.072  0.120   1.00 0.00 ? 13 ASP A OD2  10 
ATOM   7360  H  H    . ASP A 1 13 ? 8.735  12.981  -2.072  1.00 0.00 ? 13 ASP A H    10 
ATOM   7361  H  HA   . ASP A 1 13 ? 9.699  15.753  -1.903  1.00 0.00 ? 13 ASP A HA   10 
ATOM   7362  H  HB2  . ASP A 1 13 ? 9.895  14.346  0.047   1.00 0.00 ? 13 ASP A HB2  10 
ATOM   7363  H  HB3  . ASP A 1 13 ? 10.715 13.086  -0.873  1.00 0.00 ? 13 ASP A HB3  10 
ATOM   7364  N  N    . LYS A 1 14 ? 11.432 13.429  -3.517  1.00 0.00 ? 14 LYS A N    10 
ATOM   7365  C  CA   . LYS A 1 14 ? 12.346 13.143  -4.615  1.00 0.00 ? 14 LYS A CA   10 
ATOM   7366  C  C    . LYS A 1 14 ? 12.489 11.628  -4.769  1.00 0.00 ? 14 LYS A C    10 
ATOM   7367  O  O    . LYS A 1 14 ? 13.493 11.053  -4.360  1.00 0.00 ? 14 LYS A O    10 
ATOM   7368  C  CB   . LYS A 1 14 ? 13.698 13.860  -4.410  1.00 0.00 ? 14 LYS A CB   10 
ATOM   7369  C  CG   . LYS A 1 14 ? 14.337 13.649  -3.027  1.00 0.00 ? 14 LYS A CG   10 
ATOM   7370  C  CD   . LYS A 1 14 ? 15.588 14.519  -2.866  1.00 0.00 ? 14 LYS A CD   10 
ATOM   7371  C  CE   . LYS A 1 14 ? 16.256 14.313  -1.500  1.00 0.00 ? 14 LYS A CE   10 
ATOM   7372  N  NZ   . LYS A 1 14 ? 15.439 14.820  -0.381  1.00 0.00 ? 14 LYS A NZ   10 
ATOM   7373  H  H    . LYS A 1 14 ? 11.221 12.684  -2.870  1.00 0.00 ? 14 LYS A H    10 
ATOM   7374  H  HA   . LYS A 1 14 ? 11.911 13.525  -5.540  1.00 0.00 ? 14 LYS A HA   10 
ATOM   7375  H  HB2  . LYS A 1 14 ? 14.396 13.523  -5.181  1.00 0.00 ? 14 LYS A HB2  10 
ATOM   7376  H  HB3  . LYS A 1 14 ? 13.537 14.932  -4.543  1.00 0.00 ? 14 LYS A HB3  10 
ATOM   7377  H  HG2  . LYS A 1 14 ? 13.623 13.928  -2.261  1.00 0.00 ? 14 LYS A HG2  10 
ATOM   7378  H  HG3  . LYS A 1 14 ? 14.618 12.608  -2.881  1.00 0.00 ? 14 LYS A HG3  10 
ATOM   7379  H  HD2  . LYS A 1 14 ? 16.302 14.249  -3.645  1.00 0.00 ? 14 LYS A HD2  10 
ATOM   7380  H  HD3  . LYS A 1 14 ? 15.323 15.571  -2.986  1.00 0.00 ? 14 LYS A HD3  10 
ATOM   7381  H  HE2  . LYS A 1 14 ? 16.463 13.255  -1.344  1.00 0.00 ? 14 LYS A HE2  10 
ATOM   7382  H  HE3  . LYS A 1 14 ? 17.202 14.854  -1.501  1.00 0.00 ? 14 LYS A HE3  10 
ATOM   7383  H  HZ1  . LYS A 1 14 ? 15.966 14.733  0.482   1.00 0.00 ? 14 LYS A HZ1  10 
ATOM   7384  H  HZ2  . LYS A 1 14 ? 15.220 15.794  -0.528  1.00 0.00 ? 14 LYS A HZ2  10 
ATOM   7385  H  HZ3  . LYS A 1 14 ? 14.571 14.301  -0.295  1.00 0.00 ? 14 LYS A HZ3  10 
ATOM   7386  N  N    . LEU A 1 15 ? 11.493 10.968  -5.374  1.00 0.00 ? 15 LEU A N    10 
ATOM   7387  C  CA   . LEU A 1 15 ? 11.438 9.511   -5.373  1.00 0.00 ? 15 LEU A CA   10 
ATOM   7388  C  C    . LEU A 1 15 ? 12.558 8.931   -6.238  1.00 0.00 ? 15 LEU A C    10 
ATOM   7389  O  O    . LEU A 1 15 ? 12.976 9.533   -7.227  1.00 0.00 ? 15 LEU A O    10 
ATOM   7390  C  CB   . LEU A 1 15 ? 10.072 8.995   -5.853  1.00 0.00 ? 15 LEU A CB   10 
ATOM   7391  C  CG   . LEU A 1 15 ? 8.994  9.028   -4.758  1.00 0.00 ? 15 LEU A CG   10 
ATOM   7392  C  CD1  . LEU A 1 15 ? 8.535  10.450  -4.416  1.00 0.00 ? 15 LEU A CD1  10 
ATOM   7393  C  CD2  . LEU A 1 15 ? 7.795  8.187   -5.202  1.00 0.00 ? 15 LEU A CD2  10 
ATOM   7394  H  H    . LEU A 1 15 ? 10.709 11.480  -5.747  1.00 0.00 ? 15 LEU A H    10 
ATOM   7395  H  HA   . LEU A 1 15 ? 11.591 9.164   -4.350  1.00 0.00 ? 15 LEU A HA   10 
ATOM   7396  H  HB2  . LEU A 1 15 ? 9.741  9.558   -6.729  1.00 0.00 ? 15 LEU A HB2  10 
ATOM   7397  H  HB3  . LEU A 1 15 ? 10.199 7.950   -6.147  1.00 0.00 ? 15 LEU A HB3  10 
ATOM   7398  H  HG   . LEU A 1 15 ? 9.398  8.560   -3.860  1.00 0.00 ? 15 LEU A HG   10 
ATOM   7399  H  HD11 . LEU A 1 15 ? 8.265  10.987  -5.325  1.00 0.00 ? 15 LEU A HD11 10 
ATOM   7400  H  HD12 . LEU A 1 15 ? 7.667  10.405  -3.758  1.00 0.00 ? 15 LEU A HD12 10 
ATOM   7401  H  HD13 . LEU A 1 15 ? 9.327  10.991  -3.897  1.00 0.00 ? 15 LEU A HD13 10 
ATOM   7402  H  HD21 . LEU A 1 15 ? 8.112  7.168   -5.426  1.00 0.00 ? 15 LEU A HD21 10 
ATOM   7403  H  HD22 . LEU A 1 15 ? 7.061  8.149   -4.397  1.00 0.00 ? 15 LEU A HD22 10 
ATOM   7404  H  HD23 . LEU A 1 15 ? 7.340  8.623   -6.092  1.00 0.00 ? 15 LEU A HD23 10 
ATOM   7405  N  N    . ILE A 1 16 ? 13.041 7.757   -5.823  1.00 0.00 ? 16 ILE A N    10 
ATOM   7406  C  CA   . ILE A 1 16 ? 14.230 7.094   -6.330  1.00 0.00 ? 16 ILE A CA   10 
ATOM   7407  C  C    . ILE A 1 16 ? 13.795 5.777   -6.976  1.00 0.00 ? 16 ILE A C    10 
ATOM   7408  O  O    . ILE A 1 16 ? 14.024 4.689   -6.451  1.00 0.00 ? 16 ILE A O    10 
ATOM   7409  C  CB   . ILE A 1 16 ? 15.268 6.986   -5.192  1.00 0.00 ? 16 ILE A CB   10 
ATOM   7410  C  CG1  . ILE A 1 16 ? 16.636 6.528   -5.718  1.00 0.00 ? 16 ILE A CG1  10 
ATOM   7411  C  CG2  . ILE A 1 16 ? 14.816 6.132   -3.995  1.00 0.00 ? 16 ILE A CG2  10 
ATOM   7412  C  CD1  . ILE A 1 16 ? 17.736 6.748   -4.673  1.00 0.00 ? 16 ILE A CD1  10 
ATOM   7413  H  H    . ILE A 1 16 ? 12.549 7.286   -5.077  1.00 0.00 ? 16 ILE A H    10 
ATOM   7414  H  HA   . ILE A 1 16 ? 14.680 7.707   -7.114  1.00 0.00 ? 16 ILE A HA   10 
ATOM   7415  H  HB   . ILE A 1 16 ? 15.401 8.004   -4.825  1.00 0.00 ? 16 ILE A HB   10 
ATOM   7416  H  HG12 . ILE A 1 16 ? 16.591 5.473   -5.994  1.00 0.00 ? 16 ILE A HG12 10 
ATOM   7417  H  HG13 . ILE A 1 16 ? 16.892 7.119   -6.600  1.00 0.00 ? 16 ILE A HG13 10 
ATOM   7418  H  HG21 . ILE A 1 16 ? 14.883 5.068   -4.214  1.00 0.00 ? 16 ILE A HG21 10 
ATOM   7419  H  HG22 . ILE A 1 16 ? 15.455 6.342   -3.139  1.00 0.00 ? 16 ILE A HG22 10 
ATOM   7420  H  HG23 . ILE A 1 16 ? 13.792 6.370   -3.717  1.00 0.00 ? 16 ILE A HG23 10 
ATOM   7421  H  HD11 . ILE A 1 16 ? 17.679 7.761   -4.274  1.00 0.00 ? 16 ILE A HD11 10 
ATOM   7422  H  HD12 . ILE A 1 16 ? 17.640 6.030   -3.858  1.00 0.00 ? 16 ILE A HD12 10 
ATOM   7423  H  HD13 . ILE A 1 16 ? 18.711 6.618   -5.140  1.00 0.00 ? 16 ILE A HD13 10 
ATOM   7424  N  N    . LEU A 1 17 ? 13.113 5.894   -8.121  1.00 0.00 ? 17 LEU A N    10 
ATOM   7425  C  CA   . LEU A 1 17 ? 12.507 4.775   -8.818  1.00 0.00 ? 17 LEU A CA   10 
ATOM   7426  C  C    . LEU A 1 17 ? 13.612 3.897   -9.409  1.00 0.00 ? 17 LEU A C    10 
ATOM   7427  O  O    . LEU A 1 17 ? 14.636 4.414   -9.854  1.00 0.00 ? 17 LEU A O    10 
ATOM   7428  C  CB   . LEU A 1 17 ? 11.583 5.285   -9.933  1.00 0.00 ? 17 LEU A CB   10 
ATOM   7429  C  CG   . LEU A 1 17 ? 10.381 6.115   -9.439  1.00 0.00 ? 17 LEU A CG   10 
ATOM   7430  C  CD1  . LEU A 1 17 ? 10.665 7.623   -9.426  1.00 0.00 ? 17 LEU A CD1  10 
ATOM   7431  C  CD2  . LEU A 1 17 ? 9.180  5.865   -10.360 1.00 0.00 ? 17 LEU A CD2  10 
ATOM   7432  H  H    . LEU A 1 17 ? 13.044 6.797   -8.562  1.00 0.00 ? 17 LEU A H    10 
ATOM   7433  H  HA   . LEU A 1 17 ? 11.920 4.190   -8.107  1.00 0.00 ? 17 LEU A HA   10 
ATOM   7434  H  HB2  . LEU A 1 17 ? 12.159 5.866   -10.657 1.00 0.00 ? 17 LEU A HB2  10 
ATOM   7435  H  HB3  . LEU A 1 17 ? 11.205 4.395   -10.434 1.00 0.00 ? 17 LEU A HB3  10 
ATOM   7436  H  HG   . LEU A 1 17 ? 10.109 5.811   -8.429  1.00 0.00 ? 17 LEU A HG   10 
ATOM   7437  H  HD11 . LEU A 1 17 ? 11.437 7.866   -8.702  1.00 0.00 ? 17 LEU A HD11 10 
ATOM   7438  H  HD12 . LEU A 1 17 ? 10.982 7.955   -10.415 1.00 0.00 ? 17 LEU A HD12 10 
ATOM   7439  H  HD13 . LEU A 1 17 ? 9.759  8.162   -9.146  1.00 0.00 ? 17 LEU A HD13 10 
ATOM   7440  H  HD21 . LEU A 1 17 ? 9.417  6.184   -11.376 1.00 0.00 ? 17 LEU A HD21 10 
ATOM   7441  H  HD22 . LEU A 1 17 ? 8.928  4.805   -10.371 1.00 0.00 ? 17 LEU A HD22 10 
ATOM   7442  H  HD23 . LEU A 1 17 ? 8.314  6.424   -10.003 1.00 0.00 ? 17 LEU A HD23 10 
ATOM   7443  N  N    . CYS A 1 18 ? 13.406 2.574   -9.419  1.00 0.00 ? 18 CYS A N    10 
ATOM   7444  C  CA   . CYS A 1 18 ? 14.379 1.652   -9.982  1.00 0.00 ? 18 CYS A CA   10 
ATOM   7445  C  C    . CYS A 1 18 ? 14.423 1.802   -11.500 1.00 0.00 ? 18 CYS A C    10 
ATOM   7446  O  O    . CYS A 1 18 ? 13.458 1.465   -12.182 1.00 0.00 ? 18 CYS A O    10 
ATOM   7447  C  CB   . CYS A 1 18 ? 14.055 0.214   -9.573  1.00 0.00 ? 18 CYS A CB   10 
ATOM   7448  S  SG   . CYS A 1 18 ? 15.189 -1.012  -10.277 1.00 0.00 ? 18 CYS A SG   10 
ATOM   7449  H  H    . CYS A 1 18 ? 12.546 2.200   -9.043  1.00 0.00 ? 18 CYS A H    10 
ATOM   7450  H  HA   . CYS A 1 18 ? 15.359 1.892   -9.573  1.00 0.00 ? 18 CYS A HA   10 
ATOM   7451  H  HB2  . CYS A 1 18 ? 14.109 0.152   -8.487  1.00 0.00 ? 18 CYS A HB2  10 
ATOM   7452  H  HB3  . CYS A 1 18 ? 13.042 -0.044  -9.883  1.00 0.00 ? 18 CYS A HB3  10 
ATOM   7453  N  N    . ASP A 1 19 ? 15.555 2.291   -12.018 1.00 0.00 ? 19 ASP A N    10 
ATOM   7454  C  CA   . ASP A 1 19 ? 15.809 2.460   -13.442 1.00 0.00 ? 19 ASP A CA   10 
ATOM   7455  C  C    . ASP A 1 19 ? 15.555 1.175   -14.238 1.00 0.00 ? 19 ASP A C    10 
ATOM   7456  O  O    . ASP A 1 19 ? 14.970 1.230   -15.318 1.00 0.00 ? 19 ASP A O    10 
ATOM   7457  C  CB   . ASP A 1 19 ? 17.234 2.994   -13.655 1.00 0.00 ? 19 ASP A CB   10 
ATOM   7458  C  CG   . ASP A 1 19 ? 18.288 2.158   -12.932 1.00 0.00 ? 19 ASP A CG   10 
ATOM   7459  O  OD1  . ASP A 1 19 ? 18.767 1.179   -13.542 1.00 0.00 ? 19 ASP A OD1  10 
ATOM   7460  O  OD2  . ASP A 1 19 ? 18.576 2.501   -11.765 1.00 0.00 ? 19 ASP A OD2  10 
ATOM   7461  H  H    . ASP A 1 19 ? 16.299 2.557   -11.386 1.00 0.00 ? 19 ASP A H    10 
ATOM   7462  H  HA   . ASP A 1 19 ? 15.117 3.214   -13.815 1.00 0.00 ? 19 ASP A HA   10 
ATOM   7463  H  HB2  . ASP A 1 19 ? 17.458 3.019   -14.722 1.00 0.00 ? 19 ASP A HB2  10 
ATOM   7464  H  HB3  . ASP A 1 19 ? 17.284 4.015   -13.273 1.00 0.00 ? 19 ASP A HB3  10 
ATOM   7465  N  N    . GLU A 1 20 ? 15.971 0.028   -13.693 1.00 0.00 ? 20 GLU A N    10 
ATOM   7466  C  CA   . GLU A 1 20 ? 15.965 -1.248  -14.392 1.00 0.00 ? 20 GLU A CA   10 
ATOM   7467  C  C    . GLU A 1 20 ? 14.532 -1.711  -14.668 1.00 0.00 ? 20 GLU A C    10 
ATOM   7468  O  O    . GLU A 1 20 ? 14.125 -1.794  -15.825 1.00 0.00 ? 20 GLU A O    10 
ATOM   7469  C  CB   . GLU A 1 20 ? 16.756 -2.275  -13.571 1.00 0.00 ? 20 GLU A CB   10 
ATOM   7470  C  CG   . GLU A 1 20 ? 16.869 -3.631  -14.276 1.00 0.00 ? 20 GLU A CG   10 
ATOM   7471  C  CD   . GLU A 1 20 ? 17.640 -4.623  -13.412 1.00 0.00 ? 20 GLU A CD   10 
ATOM   7472  O  OE1  . GLU A 1 20 ? 18.877 -4.465  -13.330 1.00 0.00 ? 20 GLU A OE1  10 
ATOM   7473  O  OE2  . GLU A 1 20 ? 16.976 -5.515  -12.840 1.00 0.00 ? 20 GLU A OE2  10 
ATOM   7474  H  H    . GLU A 1 20 ? 16.452 0.083   -12.808 1.00 0.00 ? 20 GLU A H    10 
ATOM   7475  H  HA   . GLU A 1 20 ? 16.479 -1.114  -15.346 1.00 0.00 ? 20 GLU A HA   10 
ATOM   7476  H  HB2  . GLU A 1 20 ? 17.765 -1.889  -13.422 1.00 0.00 ? 20 GLU A HB2  10 
ATOM   7477  H  HB3  . GLU A 1 20 ? 16.288 -2.424  -12.598 1.00 0.00 ? 20 GLU A HB3  10 
ATOM   7478  H  HG2  . GLU A 1 20 ? 15.876 -4.037  -14.474 1.00 0.00 ? 20 GLU A HG2  10 
ATOM   7479  H  HG3  . GLU A 1 20 ? 17.390 -3.505  -15.226 1.00 0.00 ? 20 GLU A HG3  10 
ATOM   7480  N  N    . CYS A 1 21 ? 13.779 -2.020  -13.604 1.00 0.00 ? 21 CYS A N    10 
ATOM   7481  C  CA   . CYS A 1 21 ? 12.480 -2.682  -13.686 1.00 0.00 ? 21 CYS A CA   10 
ATOM   7482  C  C    . CYS A 1 21 ? 11.308 -1.755  -13.342 1.00 0.00 ? 21 CYS A C    10 
ATOM   7483  O  O    . CYS A 1 21 ? 10.179 -2.232  -13.231 1.00 0.00 ? 21 CYS A O    10 
ATOM   7484  C  CB   . CYS A 1 21 ? 12.494 -3.943  -12.811 1.00 0.00 ? 21 CYS A CB   10 
ATOM   7485  S  SG   . CYS A 1 21 ? 12.825 -3.694  -11.047 1.00 0.00 ? 21 CYS A SG   10 
ATOM   7486  H  H    . CYS A 1 21 ? 14.163 -1.853  -12.686 1.00 0.00 ? 21 CYS A H    10 
ATOM   7487  H  HA   . CYS A 1 21 ? 12.307 -3.025  -14.708 1.00 0.00 ? 21 CYS A HA   10 
ATOM   7488  H  HB2  . CYS A 1 21 ? 11.529 -4.445  -12.904 1.00 0.00 ? 21 CYS A HB2  10 
ATOM   7489  H  HB3  . CYS A 1 21 ? 13.265 -4.616  -13.194 1.00 0.00 ? 21 CYS A HB3  10 
ATOM   7490  N  N    . ASN A 1 22 ? 11.552 -0.444  -13.191 1.00 0.00 ? 22 ASN A N    10 
ATOM   7491  C  CA   . ASN A 1 22 ? 10.519 0.582   -13.076 1.00 0.00 ? 22 ASN A CA   10 
ATOM   7492  C  C    . ASN A 1 22 ? 9.569  0.284   -11.908 1.00 0.00 ? 22 ASN A C    10 
ATOM   7493  O  O    . ASN A 1 22 ? 8.351  0.259   -12.070 1.00 0.00 ? 22 ASN A O    10 
ATOM   7494  C  CB   . ASN A 1 22 ? 9.813  0.764   -14.430 1.00 0.00 ? 22 ASN A CB   10 
ATOM   7495  C  CG   . ASN A 1 22 ? 9.132  2.128   -14.557 1.00 0.00 ? 22 ASN A CG   10 
ATOM   7496  O  OD1  . ASN A 1 22 ? 9.654  3.021   -15.219 1.00 0.00 ? 22 ASN A OD1  10 
ATOM   7497  N  ND2  . ASN A 1 22 ? 7.958  2.292   -13.948 1.00 0.00 ? 22 ASN A ND2  10 
ATOM   7498  H  H    . ASN A 1 22 ? 12.508 -0.114  -13.214 1.00 0.00 ? 22 ASN A H    10 
ATOM   7499  H  HA   . ASN A 1 22 ? 11.020 1.523   -12.855 1.00 0.00 ? 22 ASN A HA   10 
ATOM   7500  H  HB2  . ASN A 1 22 ? 10.565 0.703   -15.221 1.00 0.00 ? 22 ASN A HB2  10 
ATOM   7501  H  HB3  . ASN A 1 22 ? 9.085  -0.034  -14.585 1.00 0.00 ? 22 ASN A HB3  10 
ATOM   7502  H  HD21 . ASN A 1 22 ? 7.594  1.544   -13.368 1.00 0.00 ? 22 ASN A HD21 10 
ATOM   7503  H  HD22 . ASN A 1 22 ? 7.461  3.166   -14.044 1.00 0.00 ? 22 ASN A HD22 10 
ATOM   7504  N  N    . LYS A 1 23 ? 10.148 0.044   -10.726 1.00 0.00 ? 23 LYS A N    10 
ATOM   7505  C  CA   . LYS A 1 23 ? 9.439  -0.102  -9.469  1.00 0.00 ? 23 LYS A CA   10 
ATOM   7506  C  C    . LYS A 1 23 ? 9.659  1.161   -8.640  1.00 0.00 ? 23 LYS A C    10 
ATOM   7507  O  O    . LYS A 1 23 ? 10.802 1.532   -8.368  1.00 0.00 ? 23 LYS A O    10 
ATOM   7508  C  CB   . LYS A 1 23 ? 9.964  -1.347  -8.749  1.00 0.00 ? 23 LYS A CB   10 
ATOM   7509  C  CG   . LYS A 1 23 ? 9.530  -2.619  -9.490  1.00 0.00 ? 23 LYS A CG   10 
ATOM   7510  C  CD   . LYS A 1 23 ? 9.981  -3.877  -8.741  1.00 0.00 ? 23 LYS A CD   10 
ATOM   7511  C  CE   . LYS A 1 23 ? 9.583  -5.128  -9.532  1.00 0.00 ? 23 LYS A CE   10 
ATOM   7512  N  NZ   . LYS A 1 23 ? 10.049 -6.362  -8.874  1.00 0.00 ? 23 LYS A NZ   10 
ATOM   7513  H  H    . LYS A 1 23 ? 11.153 0.009   -10.666 1.00 0.00 ? 23 LYS A H    10 
ATOM   7514  H  HA   . LYS A 1 23 ? 8.369  -0.234  -9.637  1.00 0.00 ? 23 LYS A HA   10 
ATOM   7515  H  HB2  . LYS A 1 23 ? 11.054 -1.310  -8.683  1.00 0.00 ? 23 LYS A HB2  10 
ATOM   7516  H  HB3  . LYS A 1 23 ? 9.549  -1.356  -7.744  1.00 0.00 ? 23 LYS A HB3  10 
ATOM   7517  H  HG2  . LYS A 1 23 ? 8.444  -2.630  -9.583  1.00 0.00 ? 23 LYS A HG2  10 
ATOM   7518  H  HG3  . LYS A 1 23 ? 9.966  -2.621  -10.489 1.00 0.00 ? 23 LYS A HG3  10 
ATOM   7519  H  HD2  . LYS A 1 23 ? 11.064 -3.853  -8.616  1.00 0.00 ? 23 LYS A HD2  10 
ATOM   7520  H  HD3  . LYS A 1 23 ? 9.512  -3.900  -7.756  1.00 0.00 ? 23 LYS A HD3  10 
ATOM   7521  H  HE2  . LYS A 1 23 ? 8.497  -5.168  -9.627  1.00 0.00 ? 23 LYS A HE2  10 
ATOM   7522  H  HE3  . LYS A 1 23 ? 10.019 -5.083  -10.532 1.00 0.00 ? 23 LYS A HE3  10 
ATOM   7523  H  HZ1  . LYS A 1 23 ? 9.772  -7.163  -9.425  1.00 0.00 ? 23 LYS A HZ1  10 
ATOM   7524  H  HZ2  . LYS A 1 23 ? 11.057 -6.346  -8.795  1.00 0.00 ? 23 LYS A HZ2  10 
ATOM   7525  H  HZ3  . LYS A 1 23 ? 9.641  -6.434  -7.953  1.00 0.00 ? 23 LYS A HZ3  10 
ATOM   7526  N  N    . ALA A 1 24 ? 8.563  1.827   -8.260  1.00 0.00 ? 24 ALA A N    10 
ATOM   7527  C  CA   . ALA A 1 24 ? 8.603  3.143   -7.644  1.00 0.00 ? 24 ALA A CA   10 
ATOM   7528  C  C    . ALA A 1 24 ? 8.938  3.019   -6.157  1.00 0.00 ? 24 ALA A C    10 
ATOM   7529  O  O    . ALA A 1 24 ? 8.372  2.174   -5.464  1.00 0.00 ? 24 ALA A O    10 
ATOM   7530  C  CB   . ALA A 1 24 ? 7.271  3.863   -7.867  1.00 0.00 ? 24 ALA A CB   10 
ATOM   7531  H  H    . ALA A 1 24 ? 7.656  1.443   -8.480  1.00 0.00 ? 24 ALA A H    10 
ATOM   7532  H  HA   . ALA A 1 24 ? 9.381  3.720   -8.140  1.00 0.00 ? 24 ALA A HA   10 
ATOM   7533  H  HB1  . ALA A 1 24 ? 7.324  4.869   -7.448  1.00 0.00 ? 24 ALA A HB1  10 
ATOM   7534  H  HB2  . ALA A 1 24 ? 7.065  3.937   -8.934  1.00 0.00 ? 24 ALA A HB2  10 
ATOM   7535  H  HB3  . ALA A 1 24 ? 6.461  3.312   -7.390  1.00 0.00 ? 24 ALA A HB3  10 
ATOM   7536  N  N    . PHE A 1 25 ? 9.860  3.861   -5.679  1.00 0.00 ? 25 PHE A N    10 
ATOM   7537  C  CA   . PHE A 1 25 ? 10.465 3.749   -4.360  1.00 0.00 ? 25 PHE A CA   10 
ATOM   7538  C  C    . PHE A 1 25 ? 10.790 5.134   -3.811  1.00 0.00 ? 25 PHE A C    10 
ATOM   7539  O  O    . PHE A 1 25 ? 11.224 6.005   -4.561  1.00 0.00 ? 25 PHE A O    10 
ATOM   7540  C  CB   . PHE A 1 25 ? 11.763 2.927   -4.461  1.00 0.00 ? 25 PHE A CB   10 
ATOM   7541  C  CG   . PHE A 1 25 ? 11.635 1.501   -3.968  1.00 0.00 ? 25 PHE A CG   10 
ATOM   7542  C  CD1  . PHE A 1 25 ? 11.084 0.508   -4.799  1.00 0.00 ? 25 PHE A CD1  10 
ATOM   7543  C  CD2  . PHE A 1 25 ? 12.058 1.168   -2.667  1.00 0.00 ? 25 PHE A CD2  10 
ATOM   7544  C  CE1  . PHE A 1 25 ? 10.941 -0.808  -4.327  1.00 0.00 ? 25 PHE A CE1  10 
ATOM   7545  C  CE2  . PHE A 1 25 ? 11.959 -0.157  -2.212  1.00 0.00 ? 25 PHE A CE2  10 
ATOM   7546  C  CZ   . PHE A 1 25 ? 11.389 -1.143  -3.038  1.00 0.00 ? 25 PHE A CZ   10 
ATOM   7547  H  H    . PHE A 1 25 ? 10.231 4.576   -6.288  1.00 0.00 ? 25 PHE A H    10 
ATOM   7548  H  HA   . PHE A 1 25 ? 9.788  3.254   -3.664  1.00 0.00 ? 25 PHE A HA   10 
ATOM   7549  H  HB2  . PHE A 1 25 ? 12.112 2.912   -5.497  1.00 0.00 ? 25 PHE A HB2  10 
ATOM   7550  H  HB3  . PHE A 1 25 ? 12.541 3.412   -3.866  1.00 0.00 ? 25 PHE A HB3  10 
ATOM   7551  H  HD1  . PHE A 1 25 ? 10.762 0.753   -5.800  1.00 0.00 ? 25 PHE A HD1  10 
ATOM   7552  H  HD2  . PHE A 1 25 ? 12.462 1.927   -2.013  1.00 0.00 ? 25 PHE A HD2  10 
ATOM   7553  H  HE1  . PHE A 1 25 ? 10.499 -1.563  -4.959  1.00 0.00 ? 25 PHE A HE1  10 
ATOM   7554  H  HE2  . PHE A 1 25 ? 12.295 -0.412  -1.217  1.00 0.00 ? 25 PHE A HE2  10 
ATOM   7555  H  HZ   . PHE A 1 25 ? 11.282 -2.155  -2.674  1.00 0.00 ? 25 PHE A HZ   10 
ATOM   7556  N  N    . HIS A 1 26 ? 10.566 5.336   -2.506  1.00 0.00 ? 26 HIS A N    10 
ATOM   7557  C  CA   . HIS A 1 26 ? 11.062 6.502   -1.790  1.00 0.00 ? 26 HIS A CA   10 
ATOM   7558  C  C    . HIS A 1 26 ? 12.437 6.141   -1.233  1.00 0.00 ? 26 HIS A C    10 
ATOM   7559  O  O    . HIS A 1 26 ? 12.765 4.964   -1.075  1.00 0.00 ? 26 HIS A O    10 
ATOM   7560  C  CB   . HIS A 1 26 ? 10.161 6.871   -0.608  1.00 0.00 ? 26 HIS A CB   10 
ATOM   7561  C  CG   . HIS A 1 26 ? 8.798  7.408   -0.953  1.00 0.00 ? 26 HIS A CG   10 
ATOM   7562  N  ND1  . HIS A 1 26 ? 7.602  6.697   -0.866  1.00 0.00 ? 26 HIS A ND1  10 
ATOM   7563  C  CD2  . HIS A 1 26 ? 8.531  8.712   -1.251  1.00 0.00 ? 26 HIS A CD2  10 
ATOM   7564  C  CE1  . HIS A 1 26 ? 6.637  7.595   -1.119  1.00 0.00 ? 26 HIS A CE1  10 
ATOM   7565  N  NE2  . HIS A 1 26 ? 7.165  8.808   -1.362  1.00 0.00 ? 26 HIS A NE2  10 
ATOM   7566  H  H    . HIS A 1 26 ? 10.150 4.596   -1.961  1.00 0.00 ? 26 HIS A H    10 
ATOM   7567  H  HA   . HIS A 1 26 ? 11.148 7.365   -2.452  1.00 0.00 ? 26 HIS A HA   10 
ATOM   7568  H  HB2  . HIS A 1 26 ? 10.049 6.010   0.043   1.00 0.00 ? 26 HIS A HB2  10 
ATOM   7569  H  HB3  . HIS A 1 26 ? 10.668 7.647   -0.036  1.00 0.00 ? 26 HIS A HB3  10 
ATOM   7570  H  HD2  . HIS A 1 26 ? 9.248  9.516   -1.335  1.00 0.00 ? 26 HIS A HD2  10 
ATOM   7571  H  HE1  . HIS A 1 26 ? 5.579  7.377   -1.127  1.00 0.00 ? 26 HIS A HE1  10 
ATOM   7572  H  HE2  . HIS A 1 26 ? 6.649  9.656   -1.555  1.00 0.00 ? 26 HIS A HE2  10 
ATOM   7573  N  N    . LEU A 1 27 ? 13.229 7.162   -0.897  1.00 0.00 ? 27 LEU A N    10 
ATOM   7574  C  CA   . LEU A 1 27 ? 14.463 6.987   -0.150  1.00 0.00 ? 27 LEU A CA   10 
ATOM   7575  C  C    . LEU A 1 27 ? 14.136 6.336   1.198   1.00 0.00 ? 27 LEU A C    10 
ATOM   7576  O  O    . LEU A 1 27 ? 14.805 5.397   1.622   1.00 0.00 ? 27 LEU A O    10 
ATOM   7577  C  CB   . LEU A 1 27 ? 15.146 8.340   0.064   1.00 0.00 ? 27 LEU A CB   10 
ATOM   7578  C  CG   . LEU A 1 27 ? 15.807 8.940   -1.187  1.00 0.00 ? 27 LEU A CG   10 
ATOM   7579  C  CD1  . LEU A 1 27 ? 14.815 9.391   -2.263  1.00 0.00 ? 27 LEU A CD1  10 
ATOM   7580  C  CD2  . LEU A 1 27 ? 16.597 10.174  -0.753  1.00 0.00 ? 27 LEU A CD2  10 
ATOM   7581  H  H    . LEU A 1 27 ? 12.915 8.106   -1.075  1.00 0.00 ? 27 LEU A H    10 
ATOM   7582  H  HA   . LEU A 1 27 ? 15.138 6.339   -0.704  1.00 0.00 ? 27 LEU A HA   10 
ATOM   7583  H  HB2  . LEU A 1 27 ? 14.431 9.047   0.485   1.00 0.00 ? 27 LEU A HB2  10 
ATOM   7584  H  HB3  . LEU A 1 27 ? 15.944 8.175   0.788   1.00 0.00 ? 27 LEU A HB3  10 
ATOM   7585  H  HG   . LEU A 1 27 ? 16.501 8.215   -1.614  1.00 0.00 ? 27 LEU A HG   10 
ATOM   7586  H  HD11 . LEU A 1 27 ? 14.308 8.544   -2.716  1.00 0.00 ? 27 LEU A HD11 10 
ATOM   7587  H  HD12 . LEU A 1 27 ? 14.076 10.068  -1.832  1.00 0.00 ? 27 LEU A HD12 10 
ATOM   7588  H  HD13 . LEU A 1 27 ? 15.365 9.911   -3.046  1.00 0.00 ? 27 LEU A HD13 10 
ATOM   7589  H  HD21 . LEU A 1 27 ? 17.158 10.575  -1.595  1.00 0.00 ? 27 LEU A HD21 10 
ATOM   7590  H  HD22 . LEU A 1 27 ? 15.910 10.938  -0.390  1.00 0.00 ? 27 LEU A HD22 10 
ATOM   7591  H  HD23 . LEU A 1 27 ? 17.284 9.901   0.044   1.00 0.00 ? 27 LEU A HD23 10 
ATOM   7592  N  N    . PHE A 1 28 ? 13.063 6.819   1.833   1.00 0.00 ? 28 PHE A N    10 
ATOM   7593  C  CA   . PHE A 1 28 ? 12.550 6.328   3.103   1.00 0.00 ? 28 PHE A CA   10 
ATOM   7594  C  C    . PHE A 1 28 ? 12.221 4.832   3.037   1.00 0.00 ? 28 PHE A C    10 
ATOM   7595  O  O    . PHE A 1 28 ? 12.466 4.104   3.997   1.00 0.00 ? 28 PHE A O    10 
ATOM   7596  C  CB   . PHE A 1 28 ? 11.314 7.143   3.515   1.00 0.00 ? 28 PHE A CB   10 
ATOM   7597  C  CG   . PHE A 1 28 ? 11.392 8.628   3.194   1.00 0.00 ? 28 PHE A CG   10 
ATOM   7598  C  CD1  . PHE A 1 28 ? 12.480 9.395   3.657   1.00 0.00 ? 28 PHE A CD1  10 
ATOM   7599  C  CD2  . PHE A 1 28 ? 10.483 9.193   2.277   1.00 0.00 ? 28 PHE A CD2  10 
ATOM   7600  C  CE1  . PHE A 1 28 ? 12.663 10.709  3.191   1.00 0.00 ? 28 PHE A CE1  10 
ATOM   7601  C  CE2  . PHE A 1 28 ? 10.693 10.491  1.782   1.00 0.00 ? 28 PHE A CE2  10 
ATOM   7602  C  CZ   . PHE A 1 28 ? 11.777 11.252  2.246   1.00 0.00 ? 28 PHE A CZ   10 
ATOM   7603  H  H    . PHE A 1 28 ? 12.588 7.606   1.418   1.00 0.00 ? 28 PHE A H    10 
ATOM   7604  H  HA   . PHE A 1 28 ? 13.328 6.490   3.847   1.00 0.00 ? 28 PHE A HA   10 
ATOM   7605  H  HB2  . PHE A 1 28 ? 10.446 6.726   3.006   1.00 0.00 ? 28 PHE A HB2  10 
ATOM   7606  H  HB3  . PHE A 1 28 ? 11.156 7.022   4.588   1.00 0.00 ? 28 PHE A HB3  10 
ATOM   7607  H  HD1  . PHE A 1 28 ? 13.192 8.969   4.350   1.00 0.00 ? 28 PHE A HD1  10 
ATOM   7608  H  HD2  . PHE A 1 28 ? 9.632  8.626   1.927   1.00 0.00 ? 28 PHE A HD2  10 
ATOM   7609  H  HE1  . PHE A 1 28 ? 13.493 11.302  3.548   1.00 0.00 ? 28 PHE A HE1  10 
ATOM   7610  H  HE2  . PHE A 1 28 ? 10.027 10.902  1.038   1.00 0.00 ? 28 PHE A HE2  10 
ATOM   7611  H  HZ   . PHE A 1 28 ? 11.926 12.256  1.878   1.00 0.00 ? 28 PHE A HZ   10 
ATOM   7612  N  N    . CYS A 1 29 ? 11.656 4.380   1.908   1.00 0.00 ? 29 CYS A N    10 
ATOM   7613  C  CA   . CYS A 1 29 ? 11.256 2.993   1.702   1.00 0.00 ? 29 CYS A CA   10 
ATOM   7614  C  C    . CYS A 1 29 ? 12.472 2.081   1.507   1.00 0.00 ? 29 CYS A C    10 
ATOM   7615  O  O    . CYS A 1 29 ? 12.397 0.906   1.860   1.00 0.00 ? 29 CYS A O    10 
ATOM   7616  C  CB   . CYS A 1 29 ? 10.261 2.898   0.542   1.00 0.00 ? 29 CYS A CB   10 
ATOM   7617  S  SG   . CYS A 1 29 ? 8.708  3.783   0.849   1.00 0.00 ? 29 CYS A SG   10 
ATOM   7618  H  H    . CYS A 1 29 ? 11.528 5.021   1.140   1.00 0.00 ? 29 CYS A H    10 
ATOM   7619  H  HA   . CYS A 1 29 ? 10.733 2.652   2.597   1.00 0.00 ? 29 CYS A HA   10 
ATOM   7620  H  HB2  . CYS A 1 29 ? 10.725 3.304   -0.356  1.00 0.00 ? 29 CYS A HB2  10 
ATOM   7621  H  HB3  . CYS A 1 29 ? 10.019 1.849   0.362   1.00 0.00 ? 29 CYS A HB3  10 
ATOM   7622  N  N    . LEU A 1 30 ? 13.581 2.595   0.952   1.00 0.00 ? 30 LEU A N    10 
ATOM   7623  C  CA   . LEU A 1 30 ? 14.844 1.861   0.956   1.00 0.00 ? 30 LEU A CA   10 
ATOM   7624  C  C    . LEU A 1 30 ? 15.291 1.689   2.410   1.00 0.00 ? 30 LEU A C    10 
ATOM   7625  O  O    . LEU A 1 30 ? 15.547 0.569   2.849   1.00 0.00 ? 30 LEU A O    10 
ATOM   7626  C  CB   . LEU A 1 30 ? 15.922 2.563   0.116   1.00 0.00 ? 30 LEU A CB   10 
ATOM   7627  C  CG   . LEU A 1 30 ? 15.608 2.646   -1.386  1.00 0.00 ? 30 LEU A CG   10 
ATOM   7628  C  CD1  . LEU A 1 30 ? 16.658 3.529   -2.069  1.00 0.00 ? 30 LEU A CD1  10 
ATOM   7629  C  CD2  . LEU A 1 30 ? 15.615 1.268   -2.060  1.00 0.00 ? 30 LEU A CD2  10 
ATOM   7630  H  H    . LEU A 1 30 ? 13.585 3.555   0.632   1.00 0.00 ? 30 LEU A H    10 
ATOM   7631  H  HA   . LEU A 1 30 ? 14.681 0.869   0.550   1.00 0.00 ? 30 LEU A HA   10 
ATOM   7632  H  HB2  . LEU A 1 30 ? 16.061 3.570   0.501   1.00 0.00 ? 30 LEU A HB2  10 
ATOM   7633  H  HB3  . LEU A 1 30 ? 16.859 2.020   0.230   1.00 0.00 ? 30 LEU A HB3  10 
ATOM   7634  H  HG   . LEU A 1 30 ? 14.632 3.105   -1.525  1.00 0.00 ? 30 LEU A HG   10 
ATOM   7635  H  HD11 . LEU A 1 30 ? 17.656 3.122   -1.905  1.00 0.00 ? 30 LEU A HD11 10 
ATOM   7636  H  HD12 . LEU A 1 30 ? 16.464 3.576   -3.140  1.00 0.00 ? 30 LEU A HD12 10 
ATOM   7637  H  HD13 . LEU A 1 30 ? 16.614 4.539   -1.662  1.00 0.00 ? 30 LEU A HD13 10 
ATOM   7638  H  HD21 . LEU A 1 30 ? 16.583 0.785   -1.922  1.00 0.00 ? 30 LEU A HD21 10 
ATOM   7639  H  HD22 . LEU A 1 30 ? 14.836 0.634   -1.640  1.00 0.00 ? 30 LEU A HD22 10 
ATOM   7640  H  HD23 . LEU A 1 30 ? 15.426 1.382   -3.127  1.00 0.00 ? 30 LEU A HD23 10 
ATOM   7641  N  N    . ARG A 1 31 ? 15.364 2.804   3.145   1.00 0.00 ? 31 ARG A N    10 
ATOM   7642  C  CA   . ARG A 1 31 ? 15.544 2.842   4.593   1.00 0.00 ? 31 ARG A CA   10 
ATOM   7643  C  C    . ARG A 1 31 ? 15.300 4.272   5.092   1.00 0.00 ? 31 ARG A C    10 
ATOM   7644  O  O    . ARG A 1 31 ? 15.663 5.220   4.400   1.00 0.00 ? 31 ARG A O    10 
ATOM   7645  C  CB   . ARG A 1 31 ? 16.932 2.321   5.010   1.00 0.00 ? 31 ARG A CB   10 
ATOM   7646  C  CG   . ARG A 1 31 ? 18.094 3.078   4.356   1.00 0.00 ? 31 ARG A CG   10 
ATOM   7647  C  CD   . ARG A 1 31 ? 19.454 2.651   4.919   1.00 0.00 ? 31 ARG A CD   10 
ATOM   7648  N  NE   . ARG A 1 31 ? 19.818 1.283   4.524   1.00 0.00 ? 31 ARG A NE   10 
ATOM   7649  C  CZ   . ARG A 1 31 ? 19.639 0.163   5.246   1.00 0.00 ? 31 ARG A CZ   10 
ATOM   7650  N  NH1  . ARG A 1 31 ? 19.004 0.192   6.428   1.00 0.00 ? 31 ARG A NH1  10 
ATOM   7651  N  NH2  . ARG A 1 31 ? 20.100 -1.004  4.783   1.00 0.00 ? 31 ARG A NH2  10 
ATOM   7652  H  H    . ARG A 1 31 ? 15.176 3.683   2.679   1.00 0.00 ? 31 ARG A H    10 
ATOM   7653  H  HA   . ARG A 1 31 ? 14.789 2.181   5.019   1.00 0.00 ? 31 ARG A HA   10 
ATOM   7654  H  HB2  . ARG A 1 31 ? 17.028 2.419   6.091   1.00 0.00 ? 31 ARG A HB2  10 
ATOM   7655  H  HB3  . ARG A 1 31 ? 17.011 1.264   4.760   1.00 0.00 ? 31 ARG A HB3  10 
ATOM   7656  H  HG2  . ARG A 1 31 ? 18.084 2.930   3.276   1.00 0.00 ? 31 ARG A HG2  10 
ATOM   7657  H  HG3  . ARG A 1 31 ? 17.984 4.138   4.567   1.00 0.00 ? 31 ARG A HG3  10 
ATOM   7658  H  HD2  . ARG A 1 31 ? 20.211 3.314   4.500   1.00 0.00 ? 31 ARG A HD2  10 
ATOM   7659  H  HD3  . ARG A 1 31 ? 19.474 2.773   6.002   1.00 0.00 ? 31 ARG A HD3  10 
ATOM   7660  H  HE   . ARG A 1 31 ? 20.350 1.214   3.665   1.00 0.00 ? 31 ARG A HE   10 
ATOM   7661  H  HH11 . ARG A 1 31 ? 18.646 1.064   6.788   1.00 0.00 ? 31 ARG A HH11 10 
ATOM   7662  H  HH12 . ARG A 1 31 ? 18.881 -0.656  6.960   1.00 0.00 ? 31 ARG A HH12 10 
ATOM   7663  H  HH21 . ARG A 1 31 ? 20.599 -1.035  3.900   1.00 0.00 ? 31 ARG A HH21 10 
ATOM   7664  H  HH22 . ARG A 1 31 ? 19.978 -1.854  5.312   1.00 0.00 ? 31 ARG A HH22 10 
ATOM   7665  N  N    . PRO A 1 32 ? 14.693 4.461   6.277   1.00 0.00 ? 32 PRO A N    10 
ATOM   7666  C  CA   . PRO A 1 32 ? 14.348 5.780   6.795   1.00 0.00 ? 32 PRO A CA   10 
ATOM   7667  C  C    . PRO A 1 32 ? 15.591 6.655   6.981   1.00 0.00 ? 32 PRO A C    10 
ATOM   7668  O  O    . PRO A 1 32 ? 15.557 7.842   6.670   1.00 0.00 ? 32 PRO A O    10 
ATOM   7669  C  CB   . PRO A 1 32 ? 13.614 5.530   8.116   1.00 0.00 ? 32 PRO A CB   10 
ATOM   7670  C  CG   . PRO A 1 32 ? 14.137 4.167   8.568   1.00 0.00 ? 32 PRO A CG   10 
ATOM   7671  C  CD   . PRO A 1 32 ? 14.356 3.431   7.246   1.00 0.00 ? 32 PRO A CD   10 
ATOM   7672  H  HA   . PRO A 1 32 ? 13.665 6.285   6.112   1.00 0.00 ? 32 PRO A HA   10 
ATOM   7673  H  HB2  . PRO A 1 32 ? 13.797 6.310   8.857   1.00 0.00 ? 32 PRO A HB2  10 
ATOM   7674  H  HB3  . PRO A 1 32 ? 12.543 5.446   7.917   1.00 0.00 ? 32 PRO A HB3  10 
ATOM   7675  H  HG2  . PRO A 1 32 ? 15.091 4.296   9.081   1.00 0.00 ? 32 PRO A HG2  10 
ATOM   7676  H  HG3  . PRO A 1 32 ? 13.431 3.648   9.216   1.00 0.00 ? 32 PRO A HG3  10 
ATOM   7677  H  HD2  . PRO A 1 32 ? 15.143 2.686   7.366   1.00 0.00 ? 32 PRO A HD2  10 
ATOM   7678  H  HD3  . PRO A 1 32 ? 13.428 2.948   6.939   1.00 0.00 ? 32 PRO A HD3  10 
ATOM   7679  N  N    . ALA A 1 33 ? 16.693 6.054   7.452   1.00 0.00 ? 33 ALA A N    10 
ATOM   7680  C  CA   . ALA A 1 33 ? 17.989 6.702   7.618   1.00 0.00 ? 33 ALA A CA   10 
ATOM   7681  C  C    . ALA A 1 33 ? 18.487 7.387   6.342   1.00 0.00 ? 33 ALA A C    10 
ATOM   7682  O  O    . ALA A 1 33 ? 19.188 8.394   6.423   1.00 0.00 ? 33 ALA A O    10 
ATOM   7683  C  CB   . ALA A 1 33 ? 19.007 5.664   8.098   1.00 0.00 ? 33 ALA A CB   10 
ATOM   7684  H  H    . ALA A 1 33 ? 16.634 5.077   7.697   1.00 0.00 ? 33 ALA A H    10 
ATOM   7685  H  HA   . ALA A 1 33 ? 17.887 7.458   8.394   1.00 0.00 ? 33 ALA A HA   10 
ATOM   7686  H  HB1  . ALA A 1 33 ? 19.969 6.145   8.271   1.00 0.00 ? 33 ALA A HB1  10 
ATOM   7687  H  HB2  . ALA A 1 33 ? 18.664 5.212   9.030   1.00 0.00 ? 33 ALA A HB2  10 
ATOM   7688  H  HB3  . ALA A 1 33 ? 19.127 4.885   7.344   1.00 0.00 ? 33 ALA A HB3  10 
ATOM   7689  N  N    . LEU A 1 34 ? 18.145 6.838   5.170   1.00 0.00 ? 34 LEU A N    10 
ATOM   7690  C  CA   . LEU A 1 34 ? 18.376 7.484   3.888   1.00 0.00 ? 34 LEU A CA   10 
ATOM   7691  C  C    . LEU A 1 34 ? 17.304 8.560   3.698   1.00 0.00 ? 34 LEU A C    10 
ATOM   7692  O  O    . LEU A 1 34 ? 16.196 8.269   3.253   1.00 0.00 ? 34 LEU A O    10 
ATOM   7693  C  CB   . LEU A 1 34 ? 18.363 6.421   2.778   1.00 0.00 ? 34 LEU A CB   10 
ATOM   7694  C  CG   . LEU A 1 34 ? 18.816 6.936   1.404   1.00 0.00 ? 34 LEU A CG   10 
ATOM   7695  C  CD1  . LEU A 1 34 ? 20.341 7.098   1.343   1.00 0.00 ? 34 LEU A CD1  10 
ATOM   7696  C  CD2  . LEU A 1 34 ? 18.377 5.933   0.332   1.00 0.00 ? 34 LEU A CD2  10 
ATOM   7697  H  H    . LEU A 1 34 ? 17.515 6.049   5.178   1.00 0.00 ? 34 LEU A H    10 
ATOM   7698  H  HA   . LEU A 1 34 ? 19.363 7.947   3.901   1.00 0.00 ? 34 LEU A HA   10 
ATOM   7699  H  HB2  . LEU A 1 34 ? 19.024 5.604   3.063   1.00 0.00 ? 34 LEU A HB2  10 
ATOM   7700  H  HB3  . LEU A 1 34 ? 17.353 6.024   2.687   1.00 0.00 ? 34 LEU A HB3  10 
ATOM   7701  H  HG   . LEU A 1 34 ? 18.341 7.894   1.193   1.00 0.00 ? 34 LEU A HG   10 
ATOM   7702  H  HD11 . LEU A 1 34 ? 20.829 6.148   1.562   1.00 0.00 ? 34 LEU A HD11 10 
ATOM   7703  H  HD12 . LEU A 1 34 ? 20.636 7.422   0.345   1.00 0.00 ? 34 LEU A HD12 10 
ATOM   7704  H  HD13 . LEU A 1 34 ? 20.676 7.844   2.062   1.00 0.00 ? 34 LEU A HD13 10 
ATOM   7705  H  HD21 . LEU A 1 34 ? 17.294 5.825   0.353   1.00 0.00 ? 34 LEU A HD21 10 
ATOM   7706  H  HD22 . LEU A 1 34 ? 18.672 6.287   -0.654  1.00 0.00 ? 34 LEU A HD22 10 
ATOM   7707  H  HD23 . LEU A 1 34 ? 18.837 4.961   0.516   1.00 0.00 ? 34 LEU A HD23 10 
ATOM   7708  N  N    . TYR A 1 35 ? 17.642 9.802   4.062   1.00 0.00 ? 35 TYR A N    10 
ATOM   7709  C  CA   . TYR A 1 35 ? 16.822 10.985  3.824   1.00 0.00 ? 35 TYR A CA   10 
ATOM   7710  C  C    . TYR A 1 35 ? 17.203 11.670  2.511   1.00 0.00 ? 35 TYR A C    10 
ATOM   7711  O  O    . TYR A 1 35 ? 16.329 12.192  1.819   1.00 0.00 ? 35 TYR A O    10 
ATOM   7712  C  CB   . TYR A 1 35 ? 16.956 11.951  5.006   1.00 0.00 ? 35 TYR A CB   10 
ATOM   7713  C  CG   . TYR A 1 35 ? 16.497 11.362  6.327   1.00 0.00 ? 35 TYR A CG   10 
ATOM   7714  C  CD1  . TYR A 1 35 ? 15.122 11.230  6.597   1.00 0.00 ? 35 TYR A CD1  10 
ATOM   7715  C  CD2  . TYR A 1 35 ? 17.440 10.895  7.261   1.00 0.00 ? 35 TYR A CD2  10 
ATOM   7716  C  CE1  . TYR A 1 35 ? 14.692 10.631  7.793   1.00 0.00 ? 35 TYR A CE1  10 
ATOM   7717  C  CE2  . TYR A 1 35 ? 17.010 10.288  8.454   1.00 0.00 ? 35 TYR A CE2  10 
ATOM   7718  C  CZ   . TYR A 1 35 ? 15.635 10.144  8.714   1.00 0.00 ? 35 TYR A CZ   10 
ATOM   7719  O  OH   . TYR A 1 35 ? 15.216 9.515   9.850   1.00 0.00 ? 35 TYR A OH   10 
ATOM   7720  H  H    . TYR A 1 35 ? 18.536 9.940   4.512   1.00 0.00 ? 35 TYR A H    10 
ATOM   7721  H  HA   . TYR A 1 35 ? 15.776 10.691  3.754   1.00 0.00 ? 35 TYR A HA   10 
ATOM   7722  H  HB2  . TYR A 1 35 ? 17.999 12.264  5.090   1.00 0.00 ? 35 TYR A HB2  10 
ATOM   7723  H  HB3  . TYR A 1 35 ? 16.349 12.835  4.799   1.00 0.00 ? 35 TYR A HB3  10 
ATOM   7724  H  HD1  . TYR A 1 35 ? 14.392 11.583  5.884   1.00 0.00 ? 35 TYR A HD1  10 
ATOM   7725  H  HD2  . TYR A 1 35 ? 18.497 10.992  7.063   1.00 0.00 ? 35 TYR A HD2  10 
ATOM   7726  H  HE1  . TYR A 1 35 ? 13.636 10.516  7.988   1.00 0.00 ? 35 TYR A HE1  10 
ATOM   7727  H  HE2  . TYR A 1 35 ? 17.740 9.920   9.160   1.00 0.00 ? 35 TYR A HE2  10 
ATOM   7728  H  HH   . TYR A 1 35 ? 15.939 9.205   10.400  1.00 0.00 ? 35 TYR A HH   10 
ATOM   7729  N  N    . GLU A 1 36 ? 18.502 11.673  2.187   1.00 0.00 ? 36 GLU A N    10 
ATOM   7730  C  CA   . GLU A 1 36 ? 19.066 12.252  0.972   1.00 0.00 ? 36 GLU A CA   10 
ATOM   7731  C  C    . GLU A 1 36 ? 19.667 11.144  0.108   1.00 0.00 ? 36 GLU A C    10 
ATOM   7732  O  O    . GLU A 1 36 ? 19.917 10.042  0.595   1.00 0.00 ? 36 GLU A O    10 
ATOM   7733  C  CB   . GLU A 1 36 ? 20.122 13.304  1.340   1.00 0.00 ? 36 GLU A CB   10 
ATOM   7734  C  CG   . GLU A 1 36 ? 19.526 14.478  2.130   1.00 0.00 ? 36 GLU A CG   10 
ATOM   7735  C  CD   . GLU A 1 36 ? 18.451 15.212  1.335   1.00 0.00 ? 36 GLU A CD   10 
ATOM   7736  O  OE1  . GLU A 1 36 ? 18.822 15.846  0.323   1.00 0.00 ? 36 GLU A OE1  10 
ATOM   7737  O  OE2  . GLU A 1 36 ? 17.269 15.113  1.733   1.00 0.00 ? 36 GLU A OE2  10 
ATOM   7738  H  H    . GLU A 1 36 ? 19.135 11.166  2.785   1.00 0.00 ? 36 GLU A H    10 
ATOM   7739  H  HA   . GLU A 1 36 ? 18.284 12.729  0.382   1.00 0.00 ? 36 GLU A HA   10 
ATOM   7740  H  HB2  . GLU A 1 36 ? 20.905 12.834  1.938   1.00 0.00 ? 36 GLU A HB2  10 
ATOM   7741  H  HB3  . GLU A 1 36 ? 20.575 13.694  0.427   1.00 0.00 ? 36 GLU A HB3  10 
ATOM   7742  H  HG2  . GLU A 1 36 ? 19.107 14.122  3.071   1.00 0.00 ? 36 GLU A HG2  10 
ATOM   7743  H  HG3  . GLU A 1 36 ? 20.325 15.184  2.360   1.00 0.00 ? 36 GLU A HG3  10 
ATOM   7744  N  N    . VAL A 1 37 ? 19.877 11.434  -1.181  1.00 0.00 ? 37 VAL A N    10 
ATOM   7745  C  CA   . VAL A 1 37 ? 20.231 10.448  -2.193  1.00 0.00 ? 37 VAL A CA   10 
ATOM   7746  C  C    . VAL A 1 37 ? 21.570 9.759   -1.883  1.00 0.00 ? 37 VAL A C    10 
ATOM   7747  O  O    . VAL A 1 37 ? 22.404 10.334  -1.185  1.00 0.00 ? 37 VAL A O    10 
ATOM   7748  C  CB   . VAL A 1 37 ? 20.237 11.105  -3.586  1.00 0.00 ? 37 VAL A CB   10 
ATOM   7749  C  CG1  . VAL A 1 37 ? 18.835 11.598  -3.972  1.00 0.00 ? 37 VAL A CG1  10 
ATOM   7750  C  CG2  . VAL A 1 37 ? 21.247 12.255  -3.701  1.00 0.00 ? 37 VAL A CG2  10 
ATOM   7751  H  H    . VAL A 1 37 ? 19.705 12.374  -1.504  1.00 0.00 ? 37 VAL A H    10 
ATOM   7752  H  HA   . VAL A 1 37 ? 19.436 9.703   -2.178  1.00 0.00 ? 37 VAL A HA   10 
ATOM   7753  H  HB   . VAL A 1 37 ? 20.521 10.346  -4.310  1.00 0.00 ? 37 VAL A HB   10 
ATOM   7754  H  HG11 . VAL A 1 37 ? 18.852 11.987  -4.990  1.00 0.00 ? 37 VAL A HG11 10 
ATOM   7755  H  HG12 . VAL A 1 37 ? 18.128 10.769  -3.929  1.00 0.00 ? 37 VAL A HG12 10 
ATOM   7756  H  HG13 . VAL A 1 37 ? 18.503 12.389  -3.299  1.00 0.00 ? 37 VAL A HG13 10 
ATOM   7757  H  HG21 . VAL A 1 37 ? 20.996 13.064  -3.016  1.00 0.00 ? 37 VAL A HG21 10 
ATOM   7758  H  HG22 . VAL A 1 37 ? 22.253 11.897  -3.481  1.00 0.00 ? 37 VAL A HG22 10 
ATOM   7759  H  HG23 . VAL A 1 37 ? 21.235 12.644  -4.719  1.00 0.00 ? 37 VAL A HG23 10 
ATOM   7760  N  N    . PRO A 1 38 ? 21.785 8.533   -2.393  1.00 0.00 ? 38 PRO A N    10 
ATOM   7761  C  CA   . PRO A 1 38 ? 23.052 7.826   -2.290  1.00 0.00 ? 38 PRO A CA   10 
ATOM   7762  C  C    . PRO A 1 38 ? 23.970 8.301   -3.421  1.00 0.00 ? 38 PRO A C    10 
ATOM   7763  O  O    . PRO A 1 38 ? 24.348 9.472   -3.433  1.00 0.00 ? 38 PRO A O    10 
ATOM   7764  C  CB   . PRO A 1 38 ? 22.664 6.343   -2.345  1.00 0.00 ? 38 PRO A CB   10 
ATOM   7765  C  CG   . PRO A 1 38 ? 21.457 6.339   -3.281  1.00 0.00 ? 38 PRO A CG   10 
ATOM   7766  C  CD   . PRO A 1 38 ? 20.755 7.650   -2.921  1.00 0.00 ? 38 PRO A CD   10 
ATOM   7767  H  HA   . PRO A 1 38 ? 23.543 8.024   -1.336  1.00 0.00 ? 38 PRO A HA   10 
ATOM   7768  H  HB2  . PRO A 1 38 ? 23.468 5.673   -2.654  1.00 0.00 ? 38 PRO A HB2  10 
ATOM   7769  H  HB3  . PRO A 1 38 ? 22.318 6.052   -1.353  1.00 0.00 ? 38 PRO A HB3  10 
ATOM   7770  H  HG2  . PRO A 1 38 ? 21.786 6.374   -4.320  1.00 0.00 ? 38 PRO A HG2  10 
ATOM   7771  H  HG3  . PRO A 1 38 ? 20.814 5.475   -3.119  1.00 0.00 ? 38 PRO A HG3  10 
ATOM   7772  H  HD2  . PRO A 1 38 ? 20.276 8.068   -3.807  1.00 0.00 ? 38 PRO A HD2  10 
ATOM   7773  H  HD3  . PRO A 1 38 ? 20.014 7.456   -2.146  1.00 0.00 ? 38 PRO A HD3  10 
ATOM   7774  N  N    . ASP A 1 39 ? 24.288 7.441   -4.399  1.00 0.00 ? 39 ASP A N    10 
ATOM   7775  C  CA   . ASP A 1 39 ? 24.970 7.825   -5.629  1.00 0.00 ? 39 ASP A CA   10 
ATOM   7776  C  C    . ASP A 1 39 ? 23.955 8.223   -6.705  1.00 0.00 ? 39 ASP A C    10 
ATOM   7777  O  O    . ASP A 1 39 ? 24.135 7.911   -7.882  1.00 0.00 ? 39 ASP A O    10 
ATOM   7778  C  CB   . ASP A 1 39 ? 25.875 6.673   -6.088  1.00 0.00 ? 39 ASP A CB   10 
ATOM   7779  C  CG   . ASP A 1 39 ? 26.918 6.318   -5.031  1.00 0.00 ? 39 ASP A CG   10 
ATOM   7780  O  OD1  . ASP A 1 39 ? 27.972 6.992   -5.021  1.00 0.00 ? 39 ASP A OD1  10 
ATOM   7781  O  OD2  . ASP A 1 39 ? 26.642 5.380   -4.251  1.00 0.00 ? 39 ASP A OD2  10 
ATOM   7782  H  H    . ASP A 1 39 ? 24.009 6.474   -4.325  1.00 0.00 ? 39 ASP A H    10 
ATOM   7783  H  HA   . ASP A 1 39 ? 25.596 8.699   -5.446  1.00 0.00 ? 39 ASP A HA   10 
ATOM   7784  H  HB2  . ASP A 1 39 ? 25.266 5.794   -6.302  1.00 0.00 ? 39 ASP A HB2  10 
ATOM   7785  H  HB3  . ASP A 1 39 ? 26.399 6.962   -7.000  1.00 0.00 ? 39 ASP A HB3  10 
ATOM   7786  N  N    . GLY A 1 40 ? 22.895 8.932   -6.296  1.00 0.00 ? 40 GLY A N    10 
ATOM   7787  C  CA   . GLY A 1 40 ? 21.892 9.496   -7.185  1.00 0.00 ? 40 GLY A CA   10 
ATOM   7788  C  C    . GLY A 1 40 ? 21.024 8.400   -7.801  1.00 0.00 ? 40 GLY A C    10 
ATOM   7789  O  O    . GLY A 1 40 ? 19.965 8.075   -7.268  1.00 0.00 ? 40 GLY A O    10 
ATOM   7790  H  H    . GLY A 1 40 ? 22.827 9.142   -5.311  1.00 0.00 ? 40 GLY A H    10 
ATOM   7791  H  HA2  . GLY A 1 40 ? 21.259 10.171  -6.610  1.00 0.00 ? 40 GLY A HA2  10 
ATOM   7792  H  HA3  . GLY A 1 40 ? 22.380 10.073  -7.973  1.00 0.00 ? 40 GLY A HA3  10 
ATOM   7793  N  N    . GLU A 1 41 ? 21.477 7.850   -8.934  1.00 0.00 ? 41 GLU A N    10 
ATOM   7794  C  CA   . GLU A 1 41 ? 20.859 6.713   -9.595  1.00 0.00 ? 41 GLU A CA   10 
ATOM   7795  C  C    . GLU A 1 41 ? 21.027 5.466   -8.726  1.00 0.00 ? 41 GLU A C    10 
ATOM   7796  O  O    . GLU A 1 41 ? 22.112 5.221   -8.199  1.00 0.00 ? 41 GLU A O    10 
ATOM   7797  C  CB   . GLU A 1 41 ? 21.506 6.501   -10.971 1.00 0.00 ? 41 GLU A CB   10 
ATOM   7798  C  CG   . GLU A 1 41 ? 21.306 7.714   -11.890 1.00 0.00 ? 41 GLU A CG   10 
ATOM   7799  C  CD   . GLU A 1 41 ? 21.947 7.480   -13.254 1.00 0.00 ? 41 GLU A CD   10 
ATOM   7800  O  OE1  . GLU A 1 41 ? 23.173 7.698   -13.350 1.00 0.00 ? 41 GLU A OE1  10 
ATOM   7801  O  OE2  . GLU A 1 41 ? 21.200 7.083   -14.175 1.00 0.00 ? 41 GLU A OE2  10 
ATOM   7802  H  H    . GLU A 1 41 ? 22.389 8.135   -9.264  1.00 0.00 ? 41 GLU A H    10 
ATOM   7803  H  HA   . GLU A 1 41 ? 19.797 6.921   -9.738  1.00 0.00 ? 41 GLU A HA   10 
ATOM   7804  H  HB2  . GLU A 1 41 ? 22.574 6.317   -10.846 1.00 0.00 ? 41 GLU A HB2  10 
ATOM   7805  H  HB3  . GLU A 1 41 ? 21.055 5.627   -11.443 1.00 0.00 ? 41 GLU A HB3  10 
ATOM   7806  H  HG2  . GLU A 1 41 ? 20.238 7.895   -12.020 1.00 0.00 ? 41 GLU A HG2  10 
ATOM   7807  H  HG3  . GLU A 1 41 ? 21.759 8.601   -11.447 1.00 0.00 ? 41 GLU A HG3  10 
ATOM   7808  N  N    . TRP A 1 42 ? 19.946 4.696   -8.556  1.00 0.00 ? 42 TRP A N    10 
ATOM   7809  C  CA   . TRP A 1 42 ? 19.886 3.604   -7.597  1.00 0.00 ? 42 TRP A CA   10 
ATOM   7810  C  C    . TRP A 1 42 ? 18.693 2.705   -7.918  1.00 0.00 ? 42 TRP A C    10 
ATOM   7811  O  O    . TRP A 1 42 ? 17.716 3.162   -8.511  1.00 0.00 ? 42 TRP A O    10 
ATOM   7812  C  CB   . TRP A 1 42 ? 19.772 4.168   -6.176  1.00 0.00 ? 42 TRP A CB   10 
ATOM   7813  C  CG   . TRP A 1 42 ? 20.132 3.219   -5.078  1.00 0.00 ? 42 TRP A CG   10 
ATOM   7814  C  CD1  . TRP A 1 42 ? 19.271 2.421   -4.408  1.00 0.00 ? 42 TRP A CD1  10 
ATOM   7815  C  CD2  . TRP A 1 42 ? 21.449 2.950   -4.513  1.00 0.00 ? 42 TRP A CD2  10 
ATOM   7816  N  NE1  . TRP A 1 42 ? 19.963 1.660   -3.492  1.00 0.00 ? 42 TRP A NE1  10 
ATOM   7817  C  CE2  . TRP A 1 42 ? 21.312 1.949   -3.508  1.00 0.00 ? 42 TRP A CE2  10 
ATOM   7818  C  CE3  . TRP A 1 42 ? 22.748 3.446   -4.755  1.00 0.00 ? 42 TRP A CE3  10 
ATOM   7819  C  CZ2  . TRP A 1 42 ? 22.409 1.461   -2.784  1.00 0.00 ? 42 TRP A CZ2  10 
ATOM   7820  C  CZ3  . TRP A 1 42 ? 23.853 2.976   -4.022  1.00 0.00 ? 42 TRP A CZ3  10 
ATOM   7821  C  CH2  . TRP A 1 42 ? 23.686 1.985   -3.039  1.00 0.00 ? 42 TRP A CH2  10 
ATOM   7822  H  H    . TRP A 1 42 ? 19.099 4.906   -9.066  1.00 0.00 ? 42 TRP A H    10 
ATOM   7823  H  HA   . TRP A 1 42 ? 20.805 3.021   -7.683  1.00 0.00 ? 42 TRP A HA   10 
ATOM   7824  H  HB2  . TRP A 1 42 ? 20.436 5.029   -6.072  1.00 0.00 ? 42 TRP A HB2  10 
ATOM   7825  H  HB3  . TRP A 1 42 ? 18.746 4.503   -6.025  1.00 0.00 ? 42 TRP A HB3  10 
ATOM   7826  H  HD1  . TRP A 1 42 ? 18.206 2.373   -4.581  1.00 0.00 ? 42 TRP A HD1  10 
ATOM   7827  H  HE1  . TRP A 1 42 ? 19.510 0.981   -2.899  1.00 0.00 ? 42 TRP A HE1  10 
ATOM   7828  H  HE3  . TRP A 1 42 ? 22.897 4.201   -5.515  1.00 0.00 ? 42 TRP A HE3  10 
ATOM   7829  H  HZ2  . TRP A 1 42 ? 22.273 0.689   -2.042  1.00 0.00 ? 42 TRP A HZ2  10 
ATOM   7830  H  HZ3  . TRP A 1 42 ? 24.837 3.372   -4.223  1.00 0.00 ? 42 TRP A HZ3  10 
ATOM   7831  H  HH2  . TRP A 1 42 ? 24.542 1.625   -2.489  1.00 0.00 ? 42 TRP A HH2  10 
ATOM   7832  N  N    . GLN A 1 43 ? 18.777 1.432   -7.514  1.00 0.00 ? 43 GLN A N    10 
ATOM   7833  C  CA   . GLN A 1 43 ? 17.805 0.398   -7.843  1.00 0.00 ? 43 GLN A CA   10 
ATOM   7834  C  C    . GLN A 1 43 ? 17.211 -0.203  -6.564  1.00 0.00 ? 43 GLN A C    10 
ATOM   7835  O  O    . GLN A 1 43 ? 17.783 -0.083  -5.481  1.00 0.00 ? 43 GLN A O    10 
ATOM   7836  C  CB   . GLN A 1 43 ? 18.474 -0.679  -8.700  1.00 0.00 ? 43 GLN A CB   10 
ATOM   7837  C  CG   . GLN A 1 43 ? 18.988 -0.153  -10.045 1.00 0.00 ? 43 GLN A CG   10 
ATOM   7838  C  CD   . GLN A 1 43 ? 19.735 -1.231  -10.828 1.00 0.00 ? 43 GLN A CD   10 
ATOM   7839  O  OE1  . GLN A 1 43 ? 20.172 -2.232  -10.266 1.00 0.00 ? 43 GLN A OE1  10 
ATOM   7840  N  NE2  . GLN A 1 43 ? 19.886 -1.033  -12.137 1.00 0.00 ? 43 GLN A NE2  10 
ATOM   7841  H  H    . GLN A 1 43 ? 19.601 1.142   -7.001  1.00 0.00 ? 43 GLN A H    10 
ATOM   7842  H  HA   . GLN A 1 43 ? 16.986 0.820   -8.421  1.00 0.00 ? 43 GLN A HA   10 
ATOM   7843  H  HB2  . GLN A 1 43 ? 19.305 -1.105  -8.146  1.00 0.00 ? 43 GLN A HB2  10 
ATOM   7844  H  HB3  . GLN A 1 43 ? 17.750 -1.462  -8.909  1.00 0.00 ? 43 GLN A HB3  10 
ATOM   7845  H  HG2  . GLN A 1 43 ? 18.135 0.190   -10.628 1.00 0.00 ? 43 GLN A HG2  10 
ATOM   7846  H  HG3  . GLN A 1 43 ? 19.672 0.683   -9.887  1.00 0.00 ? 43 GLN A HG3  10 
ATOM   7847  H  HE21 . GLN A 1 43 ? 19.497 -0.201  -12.572 1.00 0.00 ? 43 GLN A HE21 10 
ATOM   7848  H  HE22 . GLN A 1 43 ? 20.338 -1.743  -12.698 1.00 0.00 ? 43 GLN A HE22 10 
ATOM   7849  N  N    . CYS A 1 44 ? 16.045 -0.845  -6.698  1.00 0.00 ? 44 CYS A N    10 
ATOM   7850  C  CA   . CYS A 1 44 ? 15.252 -1.354  -5.585  1.00 0.00 ? 44 CYS A CA   10 
ATOM   7851  C  C    . CYS A 1 44 ? 15.948 -2.565  -4.942  1.00 0.00 ? 44 CYS A C    10 
ATOM   7852  O  O    . CYS A 1 44 ? 16.745 -3.210  -5.618  1.00 0.00 ? 44 CYS A O    10 
ATOM   7853  C  CB   . CYS A 1 44 ? 13.842 -1.693  -6.094  1.00 0.00 ? 44 CYS A CB   10 
ATOM   7854  S  SG   . CYS A 1 44 ? 13.737 -2.968  -7.378  1.00 0.00 ? 44 CYS A SG   10 
ATOM   7855  H  H    . CYS A 1 44 ? 15.669 -0.959  -7.625  1.00 0.00 ? 44 CYS A H    10 
ATOM   7856  H  HA   . CYS A 1 44 ? 15.172 -0.545  -4.858  1.00 0.00 ? 44 CYS A HA   10 
ATOM   7857  H  HB2  . CYS A 1 44 ? 13.233 -2.036  -5.263  1.00 0.00 ? 44 CYS A HB2  10 
ATOM   7858  H  HB3  . CYS A 1 44 ? 13.387 -0.782  -6.486  1.00 0.00 ? 44 CYS A HB3  10 
ATOM   7859  N  N    . PRO A 1 45 ? 15.645 -2.907  -3.672  1.00 0.00 ? 45 PRO A N    10 
ATOM   7860  C  CA   . PRO A 1 45 ? 16.372 -3.883  -2.859  1.00 0.00 ? 45 PRO A CA   10 
ATOM   7861  C  C    . PRO A 1 45 ? 16.740 -5.199  -3.557  1.00 0.00 ? 45 PRO A C    10 
ATOM   7862  O  O    . PRO A 1 45 ? 17.807 -5.749  -3.295  1.00 0.00 ? 45 PRO A O    10 
ATOM   7863  C  CB   . PRO A 1 45 ? 15.497 -4.138  -1.630  1.00 0.00 ? 45 PRO A CB   10 
ATOM   7864  C  CG   . PRO A 1 45 ? 14.772 -2.807  -1.463  1.00 0.00 ? 45 PRO A CG   10 
ATOM   7865  C  CD   . PRO A 1 45 ? 14.507 -2.415  -2.915  1.00 0.00 ? 45 PRO A CD   10 
ATOM   7866  H  HA   . PRO A 1 45 ? 17.279 -3.400  -2.505  1.00 0.00 ? 45 PRO A HA   10 
ATOM   7867  H  HB2  . PRO A 1 45 ? 14.765 -4.919  -1.846  1.00 0.00 ? 45 PRO A HB2  10 
ATOM   7868  H  HB3  . PRO A 1 45 ? 16.086 -4.401  -0.751  1.00 0.00 ? 45 PRO A HB3  10 
ATOM   7869  H  HG2  . PRO A 1 45 ? 13.852 -2.902  -0.883  1.00 0.00 ? 45 PRO A HG2  10 
ATOM   7870  H  HG3  . PRO A 1 45 ? 15.442 -2.079  -1.002  1.00 0.00 ? 45 PRO A HG3  10 
ATOM   7871  H  HD2  . PRO A 1 45 ? 13.610 -2.935  -3.252  1.00 0.00 ? 45 PRO A HD2  10 
ATOM   7872  H  HD3  . PRO A 1 45 ? 14.379 -1.337  -2.985  1.00 0.00 ? 45 PRO A HD3  10 
ATOM   7873  N  N    . ALA A 1 46 ? 15.855 -5.721  -4.416  1.00 0.00 ? 46 ALA A N    10 
ATOM   7874  C  CA   . ALA A 1 46 ? 16.051 -6.991  -5.097  1.00 0.00 ? 46 ALA A CA   10 
ATOM   7875  C  C    . ALA A 1 46 ? 17.161 -6.863  -6.139  1.00 0.00 ? 46 ALA A C    10 
ATOM   7876  O  O    . ALA A 1 46 ? 18.004 -7.750  -6.264  1.00 0.00 ? 46 ALA A O    10 
ATOM   7877  C  CB   . ALA A 1 46 ? 14.736 -7.421  -5.753  1.00 0.00 ? 46 ALA A CB   10 
ATOM   7878  H  H    . ALA A 1 46 ? 15.084 -5.152  -4.728  1.00 0.00 ? 46 ALA A H    10 
ATOM   7879  H  HA   . ALA A 1 46 ? 16.332 -7.751  -4.365  1.00 0.00 ? 46 ALA A HA   10 
ATOM   7880  H  HB1  . ALA A 1 46 ? 14.417 -6.676  -6.483  1.00 0.00 ? 46 ALA A HB1  10 
ATOM   7881  H  HB2  . ALA A 1 46 ? 14.873 -8.379  -6.256  1.00 0.00 ? 46 ALA A HB2  10 
ATOM   7882  H  HB3  . ALA A 1 46 ? 13.963 -7.530  -4.991  1.00 0.00 ? 46 ALA A HB3  10 
ATOM   7883  N  N    . CYS A 1 47 ? 17.148 -5.756  -6.888  1.00 0.00 ? 47 CYS A N    10 
ATOM   7884  C  CA   . CYS A 1 47 ? 18.135 -5.439  -7.901  1.00 0.00 ? 47 CYS A CA   10 
ATOM   7885  C  C    . CYS A 1 47 ? 19.457 -5.037  -7.241  1.00 0.00 ? 47 CYS A C    10 
ATOM   7886  O  O    . CYS A 1 47 ? 20.499 -5.627  -7.518  1.00 0.00 ? 47 CYS A O    10 
ATOM   7887  C  CB   . CYS A 1 47 ? 17.583 -4.313  -8.780  1.00 0.00 ? 47 CYS A CB   10 
ATOM   7888  S  SG   . CYS A 1 47 ? 16.064 -4.713  -9.676  1.00 0.00 ? 47 CYS A SG   10 
ATOM   7889  H  H    . CYS A 1 47 ? 16.471 -5.034  -6.683  1.00 0.00 ? 47 CYS A H    10 
ATOM   7890  H  HA   . CYS A 1 47 ? 18.281 -6.321  -8.519  1.00 0.00 ? 47 CYS A HA   10 
ATOM   7891  H  HB2  . CYS A 1 47 ? 17.356 -3.470  -8.133  1.00 0.00 ? 47 CYS A HB2  10 
ATOM   7892  H  HB3  . CYS A 1 47 ? 18.337 -4.012  -9.507  1.00 0.00 ? 47 CYS A HB3  10 
ATOM   7893  N  N    . GLN A 1 48 ? 19.393 -4.029  -6.363  1.00 0.00 ? 48 GLN A N    10 
ATOM   7894  C  CA   . GLN A 1 48 ? 20.499 -3.488  -5.591  1.00 0.00 ? 48 GLN A CA   10 
ATOM   7895  C  C    . GLN A 1 48 ? 20.026 -3.375  -4.141  1.00 0.00 ? 48 GLN A C    10 
ATOM   7896  O  O    . GLN A 1 48 ? 19.180 -2.529  -3.855  1.00 0.00 ? 48 GLN A O    10 
ATOM   7897  C  CB   . GLN A 1 48 ? 20.859 -2.114  -6.161  1.00 0.00 ? 48 GLN A CB   10 
ATOM   7898  C  CG   . GLN A 1 48 ? 22.029 -1.441  -5.439  1.00 0.00 ? 48 GLN A CG   10 
ATOM   7899  C  CD   . GLN A 1 48 ? 22.346 -0.080  -6.057  1.00 0.00 ? 48 GLN A CD   10 
ATOM   7900  O  OE1  . GLN A 1 48 ? 21.471 0.577   -6.618  1.00 0.00 ? 48 GLN A OE1  10 
ATOM   7901  N  NE2  . GLN A 1 48 ? 23.605 0.352   -5.956  1.00 0.00 ? 48 GLN A NE2  10 
ATOM   7902  H  H    . GLN A 1 48 ? 18.487 -3.616  -6.189  1.00 0.00 ? 48 GLN A H    10 
ATOM   7903  H  HA   . GLN A 1 48 ? 21.381 -4.120  -5.677  1.00 0.00 ? 48 GLN A HA   10 
ATOM   7904  H  HB2  . GLN A 1 48 ? 21.127 -2.233  -7.214  1.00 0.00 ? 48 GLN A HB2  10 
ATOM   7905  H  HB3  . GLN A 1 48 ? 19.984 -1.470  -6.077  1.00 0.00 ? 48 GLN A HB3  10 
ATOM   7906  H  HG2  . GLN A 1 48 ? 21.784 -1.289  -4.388  1.00 0.00 ? 48 GLN A HG2  10 
ATOM   7907  H  HG3  . GLN A 1 48 ? 22.906 -2.086  -5.509  1.00 0.00 ? 48 GLN A HG3  10 
ATOM   7908  H  HE21 . GLN A 1 48 ? 24.294 -0.208  -5.474  1.00 0.00 ? 48 GLN A HE21 10 
ATOM   7909  H  HE22 . GLN A 1 48 ? 23.847 1.260   -6.331  1.00 0.00 ? 48 GLN A HE22 10 
ATOM   7910  N  N    . PRO A 1 49 ? 20.548 -4.207  -3.226  1.00 0.00 ? 49 PRO A N    10 
ATOM   7911  C  CA   . PRO A 1 49 ? 20.334 -4.071  -1.794  1.00 0.00 ? 49 PRO A CA   10 
ATOM   7912  C  C    . PRO A 1 49 ? 20.599 -2.653  -1.289  1.00 0.00 ? 49 PRO A C    10 
ATOM   7913  O  O    . PRO A 1 49 ? 21.625 -2.057  -1.614  1.00 0.00 ? 49 PRO A O    10 
ATOM   7914  C  CB   . PRO A 1 49 ? 21.250 -5.110  -1.150  1.00 0.00 ? 49 PRO A CB   10 
ATOM   7915  C  CG   . PRO A 1 49 ? 21.225 -6.235  -2.186  1.00 0.00 ? 49 PRO A CG   10 
ATOM   7916  C  CD   . PRO A 1 49 ? 21.202 -5.474  -3.512  1.00 0.00 ? 49 PRO A CD   10 
ATOM   7917  H  HA   . PRO A 1 49 ? 19.305 -4.355  -1.578  1.00 0.00 ? 49 PRO A HA   10 
ATOM   7918  H  HB2  . PRO A 1 49 ? 22.263 -4.715  -1.071  1.00 0.00 ? 49 PRO A HB2  10 
ATOM   7919  H  HB3  . PRO A 1 49 ? 20.888 -5.435  -0.174  1.00 0.00 ? 49 PRO A HB3  10 
ATOM   7920  H  HG2  . PRO A 1 49 ? 22.088 -6.897  -2.101  1.00 0.00 ? 49 PRO A HG2  10 
ATOM   7921  H  HG3  . PRO A 1 49 ? 20.301 -6.804  -2.078  1.00 0.00 ? 49 PRO A HG3  10 
ATOM   7922  H  HD2  . PRO A 1 49 ? 22.227 -5.282  -3.833  1.00 0.00 ? 49 PRO A HD2  10 
ATOM   7923  H  HD3  . PRO A 1 49 ? 20.670 -6.047  -4.273  1.00 0.00 ? 49 PRO A HD3  10 
ATOM   7924  N  N    . ALA A 1 50 ? 19.655 -2.117  -0.507  1.00 0.00 ? 50 ALA A N    10 
ATOM   7925  C  CA   . ALA A 1 50 ? 19.789 -0.828  0.152   1.00 0.00 ? 50 ALA A CA   10 
ATOM   7926  C  C    . ALA A 1 50 ? 20.955 -0.872  1.139   1.00 0.00 ? 50 ALA A C    10 
ATOM   7927  O  O    . ALA A 1 50 ? 20.887 -1.574  2.147   1.00 0.00 ? 50 ALA A O    10 
ATOM   7928  C  CB   . ALA A 1 50 ? 18.479 -0.479  0.866   1.00 0.00 ? 50 ALA A CB   10 
ATOM   7929  H  H    . ALA A 1 50 ? 18.828 -2.658  -0.303  1.00 0.00 ? 50 ALA A H    10 
ATOM   7930  H  HA   . ALA A 1 50 ? 19.971 -0.064  -0.605  1.00 0.00 ? 50 ALA A HA   10 
ATOM   7931  H  HB1  . ALA A 1 50 ? 17.666 -0.428  0.141   1.00 0.00 ? 50 ALA A HB1  10 
ATOM   7932  H  HB2  . ALA A 1 50 ? 18.240 -1.239  1.613   1.00 0.00 ? 50 ALA A HB2  10 
ATOM   7933  H  HB3  . ALA A 1 50 ? 18.577 0.487   1.362   1.00 0.00 ? 50 ALA A HB3  10 
ATOM   7934  N  N    . THR A 1 51 ? 22.024 -0.129  0.840   1.00 0.00 ? 51 THR A N    10 
ATOM   7935  C  CA   . THR A 1 51 ? 23.122 0.111   1.763   1.00 0.00 ? 51 THR A CA   10 
ATOM   7936  C  C    . THR A 1 51 ? 22.600 0.878   2.975   1.00 0.00 ? 51 THR A C    10 
ATOM   7937  O  O    . THR A 1 51 ? 22.002 1.955   2.754   1.00 0.00 ? 51 THR A O    10 
ATOM   7938  C  CB   . THR A 1 51 ? 24.226 0.902   1.046   1.00 0.00 ? 51 THR A CB   10 
ATOM   7939  O  OG1  . THR A 1 51 ? 23.665 2.036   0.417   1.00 0.00 ? 51 THR A OG1  10 
ATOM   7940  C  CG2  . THR A 1 51 ? 24.939 0.038   0.003   1.00 0.00 ? 51 THR A CG2  10 
ATOM   7941  O  OXT  . THR A 1 51 ? 22.769 0.362   4.101   1.00 0.00 ? 51 THR A OXT  10 
ATOM   7942  H  H    . THR A 1 51 ? 22.028 0.408   -0.014  1.00 0.00 ? 51 THR A H    10 
ATOM   7943  H  HA   . THR A 1 51 ? 23.533 -0.844  2.096   1.00 0.00 ? 51 THR A HA   10 
ATOM   7944  H  HB   . THR A 1 51 ? 24.960 1.232   1.784   1.00 0.00 ? 51 THR A HB   10 
ATOM   7945  H  HG1  . THR A 1 51 ? 23.102 2.482   1.059   1.00 0.00 ? 51 THR A HG1  10 
ATOM   7946  H  HG21 . THR A 1 51 ? 25.393 -0.827  0.488   1.00 0.00 ? 51 THR A HG21 10 
ATOM   7947  H  HG22 . THR A 1 51 ? 24.236 -0.307  -0.755  1.00 0.00 ? 51 THR A HG22 10 
ATOM   7948  H  HG23 . THR A 1 51 ? 25.725 0.623   -0.477  1.00 0.00 ? 51 THR A HG23 10 
HETATM 7949  ZN ZN   . ZN  B 2 .  ? 7.064  4.706   -0.468  1.00 0.00 ? 52 ZN  A ZN   10 
HETATM 7950  ZN ZN   . ZN  C 2 .  ? 14.461 -3.068  -9.558  1.00 0.00 ? 53 ZN  A ZN   10 
ATOM   7951  N  N    . ALA A 1 1  ? 4.804  10.805  -5.842  1.00 0.00 ? 1  ALA A N    11 
ATOM   7952  C  CA   . ALA A 1 1  ? 3.877  9.875   -6.513  1.00 0.00 ? 1  ALA A CA   11 
ATOM   7953  C  C    . ALA A 1 1  ? 3.559  8.681   -5.607  1.00 0.00 ? 1  ALA A C    11 
ATOM   7954  O  O    . ALA A 1 1  ? 3.989  8.645   -4.454  1.00 0.00 ? 1  ALA A O    11 
ATOM   7955  C  CB   . ALA A 1 1  ? 4.447  9.429   -7.865  1.00 0.00 ? 1  ALA A CB   11 
ATOM   7956  H  H1   . ALA A 1 1  ? 5.657  10.320  -5.604  1.00 0.00 ? 1  ALA A H1   11 
ATOM   7957  H  H2   . ALA A 1 1  ? 5.008  11.589  -6.445  1.00 0.00 ? 1  ALA A H2   11 
ATOM   7958  H  H3   . ALA A 1 1  ? 4.372  11.146  -4.990  1.00 0.00 ? 1  ALA A H3   11 
ATOM   7959  H  HA   . ALA A 1 1  ? 2.949  10.416  -6.700  1.00 0.00 ? 1  ALA A HA   11 
ATOM   7960  H  HB1  . ALA A 1 1  ? 5.334  8.814   -7.717  1.00 0.00 ? 1  ALA A HB1  11 
ATOM   7961  H  HB2  . ALA A 1 1  ? 3.705  8.854   -8.420  1.00 0.00 ? 1  ALA A HB2  11 
ATOM   7962  H  HB3  . ALA A 1 1  ? 4.715  10.306  -8.457  1.00 0.00 ? 1  ALA A HB3  11 
ATOM   7963  N  N    . ARG A 1 2  ? 2.809  7.702   -6.130  1.00 0.00 ? 2  ARG A N    11 
ATOM   7964  C  CA   . ARG A 1 2  ? 2.584  6.431   -5.459  1.00 0.00 ? 2  ARG A CA   11 
ATOM   7965  C  C    . ARG A 1 2  ? 3.870  5.605   -5.438  1.00 0.00 ? 2  ARG A C    11 
ATOM   7966  O  O    . ARG A 1 2  ? 4.380  5.215   -6.487  1.00 0.00 ? 2  ARG A O    11 
ATOM   7967  C  CB   . ARG A 1 2  ? 1.433  5.671   -6.132  1.00 0.00 ? 2  ARG A CB   11 
ATOM   7968  C  CG   . ARG A 1 2  ? 1.273  4.276   -5.510  1.00 0.00 ? 2  ARG A CG   11 
ATOM   7969  C  CD   . ARG A 1 2  ? -0.070 3.624   -5.847  1.00 0.00 ? 2  ARG A CD   11 
ATOM   7970  N  NE   . ARG A 1 2  ? -1.188 4.317   -5.188  1.00 0.00 ? 2  ARG A NE   11 
ATOM   7971  C  CZ   . ARG A 1 2  ? -2.423 3.812   -5.022  1.00 0.00 ? 2  ARG A CZ   11 
ATOM   7972  N  NH1  . ARG A 1 2  ? -2.733 2.587   -5.471  1.00 0.00 ? 2  ARG A NH1  11 
ATOM   7973  N  NH2  . ARG A 1 2  ? -3.357 4.543   -4.400  1.00 0.00 ? 2  ARG A NH2  11 
ATOM   7974  H  H    . ARG A 1 2  ? 2.455  7.800   -7.070  1.00 0.00 ? 2  ARG A H    11 
ATOM   7975  H  HA   . ARG A 1 2  ? 2.274  6.636   -4.433  1.00 0.00 ? 2  ARG A HA   11 
ATOM   7976  H  HB2  . ARG A 1 2  ? 0.519  6.251   -5.998  1.00 0.00 ? 2  ARG A HB2  11 
ATOM   7977  H  HB3  . ARG A 1 2  ? 1.627  5.564   -7.201  1.00 0.00 ? 2  ARG A HB3  11 
ATOM   7978  H  HG2  . ARG A 1 2  ? 2.068  3.627   -5.880  1.00 0.00 ? 2  ARG A HG2  11 
ATOM   7979  H  HG3  . ARG A 1 2  ? 1.369  4.350   -4.428  1.00 0.00 ? 2  ARG A HG3  11 
ATOM   7980  H  HD2  . ARG A 1 2  ? -0.219 3.630   -6.927  1.00 0.00 ? 2  ARG A HD2  11 
ATOM   7981  H  HD3  . ARG A 1 2  ? -0.031 2.590   -5.500  1.00 0.00 ? 2  ARG A HD3  11 
ATOM   7982  H  HE   . ARG A 1 2  ? -0.995 5.240   -4.829  1.00 0.00 ? 2  ARG A HE   11 
ATOM   7983  H  HH11 . ARG A 1 2  ? -2.039 2.031   -5.947  1.00 0.00 ? 2  ARG A HH11 11 
ATOM   7984  H  HH12 . ARG A 1 2  ? -3.661 2.212   -5.332  1.00 0.00 ? 2  ARG A HH12 11 
ATOM   7985  H  HH21 . ARG A 1 2  ? -3.140 5.471   -4.068  1.00 0.00 ? 2  ARG A HH21 11 
ATOM   7986  H  HH22 . ARG A 1 2  ? -4.286 4.170   -4.262  1.00 0.00 ? 2  ARG A HH22 11 
ATOM   7987  N  N    . CYS A 1 3  ? 4.376  5.339   -4.231  1.00 0.00 ? 3  CYS A N    11 
ATOM   7988  C  CA   . CYS A 1 3  ? 5.455  4.397   -3.974  1.00 0.00 ? 3  CYS A CA   11 
ATOM   7989  C  C    . CYS A 1 3  ? 4.887  2.976   -3.939  1.00 0.00 ? 3  CYS A C    11 
ATOM   7990  O  O    . CYS A 1 3  ? 3.763  2.766   -3.486  1.00 0.00 ? 3  CYS A O    11 
ATOM   7991  C  CB   . CYS A 1 3  ? 6.099  4.772   -2.638  1.00 0.00 ? 3  CYS A CB   11 
ATOM   7992  S  SG   . CYS A 1 3  ? 7.265  3.583   -1.926  1.00 0.00 ? 3  CYS A SG   11 
ATOM   7993  H  H    . CYS A 1 3  ? 3.914  5.735   -3.424  1.00 0.00 ? 3  CYS A H    11 
ATOM   7994  H  HA   . CYS A 1 3  ? 6.210  4.473   -4.758  1.00 0.00 ? 3  CYS A HA   11 
ATOM   7995  H  HB2  . CYS A 1 3  ? 6.623  5.718   -2.781  1.00 0.00 ? 3  CYS A HB2  11 
ATOM   7996  H  HB3  . CYS A 1 3  ? 5.302  4.915   -1.910  1.00 0.00 ? 3  CYS A HB3  11 
ATOM   7997  N  N    . LYS A 1 4  ? 5.674  2.003   -4.416  1.00 0.00 ? 4  LYS A N    11 
ATOM   7998  C  CA   . LYS A 1 4  ? 5.334  0.586   -4.417  1.00 0.00 ? 4  LYS A CA   11 
ATOM   7999  C  C    . LYS A 1 4  ? 5.015  0.102   -3.000  1.00 0.00 ? 4  LYS A C    11 
ATOM   8000  O  O    . LYS A 1 4  ? 3.960  -0.486  -2.764  1.00 0.00 ? 4  LYS A O    11 
ATOM   8001  C  CB   . LYS A 1 4  ? 6.498  -0.199  -5.044  1.00 0.00 ? 4  LYS A CB   11 
ATOM   8002  C  CG   . LYS A 1 4  ? 6.225  -1.700  -5.232  1.00 0.00 ? 4  LYS A CG   11 
ATOM   8003  C  CD   . LYS A 1 4  ? 5.760  -2.069  -6.649  1.00 0.00 ? 4  LYS A CD   11 
ATOM   8004  C  CE   . LYS A 1 4  ? 4.428  -1.418  -7.038  1.00 0.00 ? 4  LYS A CE   11 
ATOM   8005  N  NZ   . LYS A 1 4  ? 3.926  -1.942  -8.320  1.00 0.00 ? 4  LYS A NZ   11 
ATOM   8006  H  H    . LYS A 1 4  ? 6.583  2.257   -4.777  1.00 0.00 ? 4  LYS A H    11 
ATOM   8007  H  HA   . LYS A 1 4  ? 4.446  0.458   -5.027  1.00 0.00 ? 4  LYS A HA   11 
ATOM   8008  H  HB2  . LYS A 1 4  ? 6.757  0.237   -6.012  1.00 0.00 ? 4  LYS A HB2  11 
ATOM   8009  H  HB3  . LYS A 1 4  ? 7.360  -0.093  -4.382  1.00 0.00 ? 4  LYS A HB3  11 
ATOM   8010  H  HG2  . LYS A 1 4  ? 7.164  -2.229  -5.060  1.00 0.00 ? 4  LYS A HG2  11 
ATOM   8011  H  HG3  . LYS A 1 4  ? 5.502  -2.061  -4.500  1.00 0.00 ? 4  LYS A HG3  11 
ATOM   8012  H  HD2  . LYS A 1 4  ? 6.530  -1.778  -7.367  1.00 0.00 ? 4  LYS A HD2  11 
ATOM   8013  H  HD3  . LYS A 1 4  ? 5.648  -3.154  -6.688  1.00 0.00 ? 4  LYS A HD3  11 
ATOM   8014  H  HE2  . LYS A 1 4  ? 3.686  -1.616  -6.264  1.00 0.00 ? 4  LYS A HE2  11 
ATOM   8015  H  HE3  . LYS A 1 4  ? 4.563  -0.341  -7.143  1.00 0.00 ? 4  LYS A HE3  11 
ATOM   8016  H  HZ1  . LYS A 1 4  ? 3.776  -2.939  -8.246  1.00 0.00 ? 4  LYS A HZ1  11 
ATOM   8017  H  HZ2  . LYS A 1 4  ? 3.051  -1.491  -8.550  1.00 0.00 ? 4  LYS A HZ2  11 
ATOM   8018  H  HZ3  . LYS A 1 4  ? 4.596  -1.757  -9.052  1.00 0.00 ? 4  LYS A HZ3  11 
ATOM   8019  N  N    . VAL A 1 5  ? 5.932  0.367   -2.066  1.00 0.00 ? 5  VAL A N    11 
ATOM   8020  C  CA   . VAL A 1 5  ? 5.835  -0.026  -0.666  1.00 0.00 ? 5  VAL A CA   11 
ATOM   8021  C  C    . VAL A 1 5  ? 4.568  0.563   -0.042  1.00 0.00 ? 5  VAL A C    11 
ATOM   8022  O  O    . VAL A 1 5  ? 3.756  -0.175  0.515   1.00 0.00 ? 5  VAL A O    11 
ATOM   8023  C  CB   . VAL A 1 5  ? 7.109  0.403   0.083   1.00 0.00 ? 5  VAL A CB   11 
ATOM   8024  C  CG1  . VAL A 1 5  ? 7.046  0.072   1.578   1.00 0.00 ? 5  VAL A CG1  11 
ATOM   8025  C  CG2  . VAL A 1 5  ? 8.342  -0.283  -0.521  1.00 0.00 ? 5  VAL A CG2  11 
ATOM   8026  H  H    . VAL A 1 5  ? 6.759  0.862   -2.363  1.00 0.00 ? 5  VAL A H    11 
ATOM   8027  H  HA   . VAL A 1 5  ? 5.769  -1.112  -0.619  1.00 0.00 ? 5  VAL A HA   11 
ATOM   8028  H  HB   . VAL A 1 5  ? 7.230  1.479   -0.010  1.00 0.00 ? 5  VAL A HB   11 
ATOM   8029  H  HG11 . VAL A 1 5  ? 7.980  0.375   2.053   1.00 0.00 ? 5  VAL A HG11 11 
ATOM   8030  H  HG12 . VAL A 1 5  ? 6.229  0.613   2.057   1.00 0.00 ? 5  VAL A HG12 11 
ATOM   8031  H  HG13 . VAL A 1 5  ? 6.902  -1.000  1.720   1.00 0.00 ? 5  VAL A HG13 11 
ATOM   8032  H  HG21 . VAL A 1 5  ? 8.226  -1.365  -0.480  1.00 0.00 ? 5  VAL A HG21 11 
ATOM   8033  H  HG22 . VAL A 1 5  ? 8.476  0.024   -1.558  1.00 0.00 ? 5  VAL A HG22 11 
ATOM   8034  H  HG23 . VAL A 1 5  ? 9.235  -0.002  0.037   1.00 0.00 ? 5  VAL A HG23 11 
ATOM   8035  N  N    . CYS A 1 6  ? 4.391  1.885   -0.154  1.00 0.00 ? 6  CYS A N    11 
ATOM   8036  C  CA   . CYS A 1 6  ? 3.270  2.592   0.451   1.00 0.00 ? 6  CYS A CA   11 
ATOM   8037  C  C    . CYS A 1 6  ? 1.934  2.232   -0.208  1.00 0.00 ? 6  CYS A C    11 
ATOM   8038  O  O    . CYS A 1 6  ? 0.897  2.370   0.437   1.00 0.00 ? 6  CYS A O    11 
ATOM   8039  C  CB   . CYS A 1 6  ? 3.487  4.107   0.374   1.00 0.00 ? 6  CYS A CB   11 
ATOM   8040  S  SG   . CYS A 1 6  ? 5.065  4.723   1.021   1.00 0.00 ? 6  CYS A SG   11 
ATOM   8041  H  H    . CYS A 1 6  ? 5.076  2.428   -0.658  1.00 0.00 ? 6  CYS A H    11 
ATOM   8042  H  HA   . CYS A 1 6  ? 3.220  2.317   1.506   1.00 0.00 ? 6  CYS A HA   11 
ATOM   8043  H  HB2  . CYS A 1 6  ? 3.394  4.431   -0.662  1.00 0.00 ? 6  CYS A HB2  11 
ATOM   8044  H  HB3  . CYS A 1 6  ? 2.692  4.586   0.946   1.00 0.00 ? 6  CYS A HB3  11 
ATOM   8045  N  N    . ARG A 1 7  ? 1.968  1.799   -1.481  1.00 0.00 ? 7  ARG A N    11 
ATOM   8046  C  CA   . ARG A 1 7  ? 0.832  1.602   -2.383  1.00 0.00 ? 7  ARG A CA   11 
ATOM   8047  C  C    . ARG A 1 7  ? -0.236 2.691   -2.247  1.00 0.00 ? 7  ARG A C    11 
ATOM   8048  O  O    . ARG A 1 7  ? -1.435 2.421   -2.284  1.00 0.00 ? 7  ARG A O    11 
ATOM   8049  C  CB   . ARG A 1 7  ? 0.321  0.152   -2.346  1.00 0.00 ? 7  ARG A CB   11 
ATOM   8050  C  CG   . ARG A 1 7  ? -0.475 -0.247  -1.093  1.00 0.00 ? 7  ARG A CG   11 
ATOM   8051  C  CD   . ARG A 1 7  ? -0.161 -1.687  -0.677  1.00 0.00 ? 7  ARG A CD   11 
ATOM   8052  N  NE   . ARG A 1 7  ? 1.222  -1.804  -0.189  1.00 0.00 ? 7  ARG A NE   11 
ATOM   8053  C  CZ   . ARG A 1 7  ? 1.811  -2.948  0.195   1.00 0.00 ? 7  ARG A CZ   11 
ATOM   8054  N  NH1  . ARG A 1 7  ? 1.145  -4.110  0.155   1.00 0.00 ? 7  ARG A NH1  11 
ATOM   8055  N  NH2  . ARG A 1 7  ? 3.079  -2.919  0.623   1.00 0.00 ? 7  ARG A NH2  11 
ATOM   8056  H  H    . ARG A 1 7  ? 2.875  1.723   -1.920  1.00 0.00 ? 7  ARG A H    11 
ATOM   8057  H  HA   . ARG A 1 7  ? 1.245  1.731   -3.383  1.00 0.00 ? 7  ARG A HA   11 
ATOM   8058  H  HB2  . ARG A 1 7  ? -0.316 -0.016  -3.216  1.00 0.00 ? 7  ARG A HB2  11 
ATOM   8059  H  HB3  . ARG A 1 7  ? 1.191  -0.496  -2.455  1.00 0.00 ? 7  ARG A HB3  11 
ATOM   8060  H  HG2  . ARG A 1 7  ? -0.248 0.396   -0.251  1.00 0.00 ? 7  ARG A HG2  11 
ATOM   8061  H  HG3  . ARG A 1 7  ? -1.541 -0.158  -1.307  1.00 0.00 ? 7  ARG A HG3  11 
ATOM   8062  H  HD2  . ARG A 1 7  ? -0.843 -1.972  0.126   1.00 0.00 ? 7  ARG A HD2  11 
ATOM   8063  H  HD3  . ARG A 1 7  ? -0.318 -2.350  -1.530  1.00 0.00 ? 7  ARG A HD3  11 
ATOM   8064  H  HE   . ARG A 1 7  ? 1.765  -0.951  -0.142  1.00 0.00 ? 7  ARG A HE   11 
ATOM   8065  H  HH11 . ARG A 1 7  ? 0.186  -4.130  -0.162  1.00 0.00 ? 7  ARG A HH11 11 
ATOM   8066  H  HH12 . ARG A 1 7  ? 1.592  -4.966  0.447   1.00 0.00 ? 7  ARG A HH12 11 
ATOM   8067  H  HH21 . ARG A 1 7  ? 3.567  -2.031  0.661   1.00 0.00 ? 7  ARG A HH21 11 
ATOM   8068  H  HH22 . ARG A 1 7  ? 3.547  -3.764  0.918   1.00 0.00 ? 7  ARG A HH22 11 
ATOM   8069  N  N    . LYS A 1 8  ? 0.234  3.936   -2.118  1.00 0.00 ? 8  LYS A N    11 
ATOM   8070  C  CA   . LYS A 1 8  ? -0.535 5.118   -1.773  1.00 0.00 ? 8  LYS A CA   11 
ATOM   8071  C  C    . LYS A 1 8  ? 0.378  6.321   -2.023  1.00 0.00 ? 8  LYS A C    11 
ATOM   8072  O  O    . LYS A 1 8  ? 1.580  6.239   -1.772  1.00 0.00 ? 8  LYS A O    11 
ATOM   8073  C  CB   . LYS A 1 8  ? -0.988 5.038   -0.308  1.00 0.00 ? 8  LYS A CB   11 
ATOM   8074  C  CG   . LYS A 1 8  ? -1.997 6.140   0.041   1.00 0.00 ? 8  LYS A CG   11 
ATOM   8075  C  CD   . LYS A 1 8  ? -2.356 6.159   1.533   1.00 0.00 ? 8  LYS A CD   11 
ATOM   8076  C  CE   . LYS A 1 8  ? -3.078 4.881   1.984   1.00 0.00 ? 8  LYS A CE   11 
ATOM   8077  N  NZ   . LYS A 1 8  ? -3.553 4.996   3.375   1.00 0.00 ? 8  LYS A NZ   11 
ATOM   8078  H  H    . LYS A 1 8  ? 1.236  4.065   -2.148  1.00 0.00 ? 8  LYS A H    11 
ATOM   8079  H  HA   . LYS A 1 8  ? -1.413 5.173   -2.413  1.00 0.00 ? 8  LYS A HA   11 
ATOM   8080  H  HB2  . LYS A 1 8  ? -1.463 4.071   -0.139  1.00 0.00 ? 8  LYS A HB2  11 
ATOM   8081  H  HB3  . LYS A 1 8  ? -0.112 5.124   0.335   1.00 0.00 ? 8  LYS A HB3  11 
ATOM   8082  H  HG2  . LYS A 1 8  ? -1.569 7.111   -0.200  1.00 0.00 ? 8  LYS A HG2  11 
ATOM   8083  H  HG3  . LYS A 1 8  ? -2.903 6.005   -0.552  1.00 0.00 ? 8  LYS A HG3  11 
ATOM   8084  H  HD2  . LYS A 1 8  ? -1.447 6.294   2.120   1.00 0.00 ? 8  LYS A HD2  11 
ATOM   8085  H  HD3  . LYS A 1 8  ? -3.011 7.014   1.707   1.00 0.00 ? 8  LYS A HD3  11 
ATOM   8086  H  HE2  . LYS A 1 8  ? -3.936 4.699   1.336   1.00 0.00 ? 8  LYS A HE2  11 
ATOM   8087  H  HE3  . LYS A 1 8  ? -2.399 4.030   1.926   1.00 0.00 ? 8  LYS A HE3  11 
ATOM   8088  H  HZ1  . LYS A 1 8  ? -2.769 5.157   3.991   1.00 0.00 ? 8  LYS A HZ1  11 
ATOM   8089  H  HZ2  . LYS A 1 8  ? -4.203 5.765   3.452   1.00 0.00 ? 8  LYS A HZ2  11 
ATOM   8090  H  HZ3  . LYS A 1 8  ? -4.016 4.140   3.644   1.00 0.00 ? 8  LYS A HZ3  11 
ATOM   8091  N  N    . LYS A 1 9  ? -0.179 7.421   -2.542  1.00 0.00 ? 9  LYS A N    11 
ATOM   8092  C  CA   . LYS A 1 9  ? 0.536  8.686   -2.623  1.00 0.00 ? 9  LYS A CA   11 
ATOM   8093  C  C    . LYS A 1 9  ? 0.672  9.282   -1.219  1.00 0.00 ? 9  LYS A C    11 
ATOM   8094  O  O    . LYS A 1 9  ? -0.317 9.361   -0.491  1.00 0.00 ? 9  LYS A O    11 
ATOM   8095  C  CB   . LYS A 1 9  ? -0.202 9.642   -3.570  1.00 0.00 ? 9  LYS A CB   11 
ATOM   8096  C  CG   . LYS A 1 9  ? 0.698  10.835  -3.911  1.00 0.00 ? 9  LYS A CG   11 
ATOM   8097  C  CD   . LYS A 1 9  ? 0.012  11.874  -4.804  1.00 0.00 ? 9  LYS A CD   11 
ATOM   8098  C  CE   . LYS A 1 9  ? -1.012 12.703  -4.019  1.00 0.00 ? 9  LYS A CE   11 
ATOM   8099  N  NZ   . LYS A 1 9  ? -1.446 13.885  -4.784  1.00 0.00 ? 9  LYS A NZ   11 
ATOM   8100  H  H    . LYS A 1 9  ? -1.169 7.430   -2.737  1.00 0.00 ? 9  LYS A H    11 
ATOM   8101  H  HA   . LYS A 1 9  ? 1.527  8.496   -3.039  1.00 0.00 ? 9  LYS A HA   11 
ATOM   8102  H  HB2  . LYS A 1 9  ? -0.443 9.116   -4.496  1.00 0.00 ? 9  LYS A HB2  11 
ATOM   8103  H  HB3  . LYS A 1 9  ? -1.126 9.979   -3.097  1.00 0.00 ? 9  LYS A HB3  11 
ATOM   8104  H  HG2  . LYS A 1 9  ? 1.035  11.323  -2.996  1.00 0.00 ? 9  LYS A HG2  11 
ATOM   8105  H  HG3  . LYS A 1 9  ? 1.573  10.458  -4.439  1.00 0.00 ? 9  LYS A HG3  11 
ATOM   8106  H  HD2  . LYS A 1 9  ? 0.785  12.543  -5.183  1.00 0.00 ? 9  LYS A HD2  11 
ATOM   8107  H  HD3  . LYS A 1 9  ? -0.467 11.382  -5.651  1.00 0.00 ? 9  LYS A HD3  11 
ATOM   8108  H  HE2  . LYS A 1 9  ? -1.884 12.092  -3.783  1.00 0.00 ? 9  LYS A HE2  11 
ATOM   8109  H  HE3  . LYS A 1 9  ? -0.564 13.053  -3.088  1.00 0.00 ? 9  LYS A HE3  11 
ATOM   8110  H  HZ1  . LYS A 1 9  ? -0.644 14.471  -4.974  1.00 0.00 ? 9  LYS A HZ1  11 
ATOM   8111  H  HZ2  . LYS A 1 9  ? -1.867 13.595  -5.655  1.00 0.00 ? 9  LYS A HZ2  11 
ATOM   8112  H  HZ3  . LYS A 1 9  ? -2.119 14.409  -4.243  1.00 0.00 ? 9  LYS A HZ3  11 
ATOM   8113  N  N    . GLY A 1 10 ? 1.891  9.686   -0.841  1.00 0.00 ? 10 GLY A N    11 
ATOM   8114  C  CA   . GLY A 1 10 ? 2.191  10.205  0.486   1.00 0.00 ? 10 GLY A CA   11 
ATOM   8115  C  C    . GLY A 1 10 ? 3.234  11.312  0.385   1.00 0.00 ? 10 GLY A C    11 
ATOM   8116  O  O    . GLY A 1 10 ? 2.898  12.444  0.037   1.00 0.00 ? 10 GLY A O    11 
ATOM   8117  H  H    . GLY A 1 10 ? 2.653  9.623   -1.500  1.00 0.00 ? 10 GLY A H    11 
ATOM   8118  H  HA2  . GLY A 1 10 ? 1.298  10.626  0.951   1.00 0.00 ? 10 GLY A HA2  11 
ATOM   8119  H  HA3  . GLY A 1 10 ? 2.565  9.390   1.109   1.00 0.00 ? 10 GLY A HA3  11 
ATOM   8120  N  N    . GLU A 1 11 ? 4.494  10.986  0.693   1.00 0.00 ? 11 GLU A N    11 
ATOM   8121  C  CA   . GLU A 1 11 ? 5.588  11.945  0.725   1.00 0.00 ? 11 GLU A CA   11 
ATOM   8122  C  C    . GLU A 1 11 ? 6.024  12.256  -0.706  1.00 0.00 ? 11 GLU A C    11 
ATOM   8123  O  O    . GLU A 1 11 ? 6.983  11.671  -1.207  1.00 0.00 ? 11 GLU A O    11 
ATOM   8124  C  CB   . GLU A 1 11 ? 6.751  11.383  1.551   1.00 0.00 ? 11 GLU A CB   11 
ATOM   8125  C  CG   . GLU A 1 11 ? 6.394  11.237  3.034   1.00 0.00 ? 11 GLU A CG   11 
ATOM   8126  C  CD   . GLU A 1 11 ? 7.410  10.364  3.763   1.00 0.00 ? 11 GLU A CD   11 
ATOM   8127  O  OE1  . GLU A 1 11 ? 7.320  9.129   3.586   1.00 0.00 ? 11 GLU A OE1  11 
ATOM   8128  O  OE2  . GLU A 1 11 ? 8.255  10.944  4.479   1.00 0.00 ? 11 GLU A OE2  11 
ATOM   8129  H  H    . GLU A 1 11 ? 4.701  10.038  0.973   1.00 0.00 ? 11 GLU A H    11 
ATOM   8130  H  HA   . GLU A 1 11 ? 5.260  12.866  1.206   1.00 0.00 ? 11 GLU A HA   11 
ATOM   8131  H  HB2  . GLU A 1 11 ? 7.034  10.410  1.152   1.00 0.00 ? 11 GLU A HB2  11 
ATOM   8132  H  HB3  . GLU A 1 11 ? 7.601  12.064  1.475   1.00 0.00 ? 11 GLU A HB3  11 
ATOM   8133  H  HG2  . GLU A 1 11 ? 6.376  12.228  3.489   1.00 0.00 ? 11 GLU A HG2  11 
ATOM   8134  H  HG3  . GLU A 1 11 ? 5.413  10.777  3.149   1.00 0.00 ? 11 GLU A HG3  11 
ATOM   8135  N  N    . ASP A 1 12 ? 5.332  13.197  -1.357  1.00 0.00 ? 12 ASP A N    11 
ATOM   8136  C  CA   . ASP A 1 12 ? 5.677  13.684  -2.687  1.00 0.00 ? 12 ASP A CA   11 
ATOM   8137  C  C    . ASP A 1 12 ? 6.842  14.679  -2.603  1.00 0.00 ? 12 ASP A C    11 
ATOM   8138  O  O    . ASP A 1 12 ? 6.731  15.814  -3.062  1.00 0.00 ? 12 ASP A O    11 
ATOM   8139  C  CB   . ASP A 1 12 ? 4.434  14.303  -3.345  1.00 0.00 ? 12 ASP A CB   11 
ATOM   8140  C  CG   . ASP A 1 12 ? 3.268  13.323  -3.457  1.00 0.00 ? 12 ASP A CG   11 
ATOM   8141  O  OD1  . ASP A 1 12 ? 3.535  12.142  -3.771  1.00 0.00 ? 12 ASP A OD1  11 
ATOM   8142  O  OD2  . ASP A 1 12 ? 2.122  13.776  -3.248  1.00 0.00 ? 12 ASP A OD2  11 
ATOM   8143  H  H    . ASP A 1 12 ? 4.505  13.576  -0.915  1.00 0.00 ? 12 ASP A H    11 
ATOM   8144  H  HA   . ASP A 1 12 ? 5.998  12.850  -3.310  1.00 0.00 ? 12 ASP A HA   11 
ATOM   8145  H  HB2  . ASP A 1 12 ? 4.117  15.162  -2.752  1.00 0.00 ? 12 ASP A HB2  11 
ATOM   8146  H  HB3  . ASP A 1 12 ? 4.690  14.641  -4.351  1.00 0.00 ? 12 ASP A HB3  11 
ATOM   8147  N  N    . ASP A 1 13 ? 7.960  14.239  -2.013  1.00 0.00 ? 13 ASP A N    11 
ATOM   8148  C  CA   . ASP A 1 13 ? 9.144  15.046  -1.768  1.00 0.00 ? 13 ASP A CA   11 
ATOM   8149  C  C    . ASP A 1 13 ? 10.149 14.820  -2.891  1.00 0.00 ? 13 ASP A C    11 
ATOM   8150  O  O    . ASP A 1 13 ? 10.418 15.721  -3.684  1.00 0.00 ? 13 ASP A O    11 
ATOM   8151  C  CB   . ASP A 1 13 ? 9.745  14.690  -0.400  1.00 0.00 ? 13 ASP A CB   11 
ATOM   8152  C  CG   . ASP A 1 13 ? 11.052 15.444  -0.146  1.00 0.00 ? 13 ASP A CG   11 
ATOM   8153  O  OD1  . ASP A 1 13 ? 10.957 16.645  0.186   1.00 0.00 ? 13 ASP A OD1  11 
ATOM   8154  O  OD2  . ASP A 1 13 ? 12.123 14.816  -0.299  1.00 0.00 ? 13 ASP A OD2  11 
ATOM   8155  H  H    . ASP A 1 13 ? 7.984  13.279  -1.697  1.00 0.00 ? 13 ASP A H    11 
ATOM   8156  H  HA   . ASP A 1 13 ? 8.884  16.101  -1.743  1.00 0.00 ? 13 ASP A HA   11 
ATOM   8157  H  HB2  . ASP A 1 13 ? 9.027  14.946  0.381   1.00 0.00 ? 13 ASP A HB2  11 
ATOM   8158  H  HB3  . ASP A 1 13 ? 9.932  13.619  -0.343  1.00 0.00 ? 13 ASP A HB3  11 
ATOM   8159  N  N    . LYS A 1 14 ? 10.689 13.599  -2.950  1.00 0.00 ? 14 LYS A N    11 
ATOM   8160  C  CA   . LYS A 1 14 ? 11.823 13.257  -3.789  1.00 0.00 ? 14 LYS A CA   11 
ATOM   8161  C  C    . LYS A 1 14 ? 11.920 11.734  -3.886  1.00 0.00 ? 14 LYS A C    11 
ATOM   8162  O  O    . LYS A 1 14 ? 12.755 11.112  -3.230  1.00 0.00 ? 14 LYS A O    11 
ATOM   8163  C  CB   . LYS A 1 14 ? 13.070 13.893  -3.160  1.00 0.00 ? 14 LYS A CB   11 
ATOM   8164  C  CG   . LYS A 1 14 ? 14.331 13.776  -4.015  1.00 0.00 ? 14 LYS A CG   11 
ATOM   8165  C  CD   . LYS A 1 14 ? 15.430 14.708  -3.485  1.00 0.00 ? 14 LYS A CD   11 
ATOM   8166  C  CE   . LYS A 1 14 ? 15.831 14.432  -2.028  1.00 0.00 ? 14 LYS A CE   11 
ATOM   8167  N  NZ   . LYS A 1 14 ? 14.997 15.151  -1.039  1.00 0.00 ? 14 LYS A NZ   11 
ATOM   8168  H  H    . LYS A 1 14 ? 10.381 12.920  -2.270  1.00 0.00 ? 14 LYS A H    11 
ATOM   8169  H  HA   . LYS A 1 14 ? 11.682 13.671  -4.786  1.00 0.00 ? 14 LYS A HA   11 
ATOM   8170  H  HB2  . LYS A 1 14 ? 12.879 14.957  -3.006  1.00 0.00 ? 14 LYS A HB2  11 
ATOM   8171  H  HB3  . LYS A 1 14 ? 13.241 13.414  -2.197  1.00 0.00 ? 14 LYS A HB3  11 
ATOM   8172  H  HG2  . LYS A 1 14 ? 14.688 12.745  -4.014  1.00 0.00 ? 14 LYS A HG2  11 
ATOM   8173  H  HG3  . LYS A 1 14 ? 14.099 14.066  -5.040  1.00 0.00 ? 14 LYS A HG3  11 
ATOM   8174  H  HD2  . LYS A 1 14 ? 16.309 14.559  -4.114  1.00 0.00 ? 14 LYS A HD2  11 
ATOM   8175  H  HD3  . LYS A 1 14 ? 15.121 15.749  -3.593  1.00 0.00 ? 14 LYS A HD3  11 
ATOM   8176  H  HE2  . LYS A 1 14 ? 15.802 13.362  -1.826  1.00 0.00 ? 14 LYS A HE2  11 
ATOM   8177  H  HE3  . LYS A 1 14 ? 16.856 14.779  -1.903  1.00 0.00 ? 14 LYS A HE3  11 
ATOM   8178  H  HZ1  . LYS A 1 14 ? 15.004 16.139  -1.243  1.00 0.00 ? 14 LYS A HZ1  11 
ATOM   8179  H  HZ2  . LYS A 1 14 ? 14.040 14.819  -1.029  1.00 0.00 ? 14 LYS A HZ2  11 
ATOM   8180  H  HZ3  . LYS A 1 14 ? 15.399 15.019  -0.116  1.00 0.00 ? 14 LYS A HZ3  11 
ATOM   8181  N  N    . LEU A 1 15 ? 11.047 11.130  -4.700  1.00 0.00 ? 15 LEU A N    11 
ATOM   8182  C  CA   . LEU A 1 15 ? 11.055 9.691   -4.920  1.00 0.00 ? 15 LEU A CA   11 
ATOM   8183  C  C    . LEU A 1 15 ? 12.274 9.280   -5.753  1.00 0.00 ? 15 LEU A C    11 
ATOM   8184  O  O    . LEU A 1 15 ? 12.850 10.082  -6.486  1.00 0.00 ? 15 LEU A O    11 
ATOM   8185  C  CB   . LEU A 1 15 ? 9.754  9.220   -5.590  1.00 0.00 ? 15 LEU A CB   11 
ATOM   8186  C  CG   . LEU A 1 15 ? 8.581  9.073   -4.605  1.00 0.00 ? 15 LEU A CG   11 
ATOM   8187  C  CD1  . LEU A 1 15 ? 8.020  10.428  -4.155  1.00 0.00 ? 15 LEU A CD1  11 
ATOM   8188  C  CD2  . LEU A 1 15 ? 7.469  8.252   -5.266  1.00 0.00 ? 15 LEU A CD2  11 
ATOM   8189  H  H    . LEU A 1 15 ? 10.380 11.687  -5.212  1.00 0.00 ? 15 LEU A H    11 
ATOM   8190  H  HA   . LEU A 1 15 ? 11.136 9.194   -3.952  1.00 0.00 ? 15 LEU A HA   11 
ATOM   8191  H  HB2  . LEU A 1 15 ? 9.486  9.891   -6.409  1.00 0.00 ? 15 LEU A HB2  11 
ATOM   8192  H  HB3  . LEU A 1 15 ? 9.940  8.228   -6.005  1.00 0.00 ? 15 LEU A HB3  11 
ATOM   8193  H  HG   . LEU A 1 15 ? 8.916  8.516   -3.731  1.00 0.00 ? 15 LEU A HG   11 
ATOM   8194  H  HD11 . LEU A 1 15 ? 7.808  11.054  -5.021  1.00 0.00 ? 15 LEU A HD11 11 
ATOM   8195  H  HD12 . LEU A 1 15 ? 7.098  10.276  -3.595  1.00 0.00 ? 15 LEU A HD12 11 
ATOM   8196  H  HD13 . LEU A 1 15 ? 8.732  10.937  -3.506  1.00 0.00 ? 15 LEU A HD13 11 
ATOM   8197  H  HD21 . LEU A 1 15 ? 6.638  8.128   -4.571  1.00 0.00 ? 15 LEU A HD21 11 
ATOM   8198  H  HD22 . LEU A 1 15 ? 7.122  8.756   -6.165  1.00 0.00 ? 15 LEU A HD22 11 
ATOM   8199  H  HD23 . LEU A 1 15 ? 7.846  7.263   -5.532  1.00 0.00 ? 15 LEU A HD23 11 
ATOM   8200  N  N    . ILE A 1 16 ? 12.646 8.007   -5.608  1.00 0.00 ? 16 ILE A N    11 
ATOM   8201  C  CA   . ILE A 1 16 ? 13.763 7.342   -6.251  1.00 0.00 ? 16 ILE A CA   11 
ATOM   8202  C  C    . ILE A 1 16 ? 13.185 6.162   -7.035  1.00 0.00 ? 16 ILE A C    11 
ATOM   8203  O  O    . ILE A 1 16 ? 13.060 5.050   -6.526  1.00 0.00 ? 16 ILE A O    11 
ATOM   8204  C  CB   . ILE A 1 16 ? 14.825 6.966   -5.192  1.00 0.00 ? 16 ILE A CB   11 
ATOM   8205  C  CG1  . ILE A 1 16 ? 15.934 6.089   -5.796  1.00 0.00 ? 16 ILE A CG1  11 
ATOM   8206  C  CG2  . ILE A 1 16 ? 14.225 6.316   -3.935  1.00 0.00 ? 16 ILE A CG2  11 
ATOM   8207  C  CD1  . ILE A 1 16 ? 17.214 6.096   -4.951  1.00 0.00 ? 16 ILE A CD1  11 
ATOM   8208  H  H    . ILE A 1 16 ? 12.073 7.426   -5.011  1.00 0.00 ? 16 ILE A H    11 
ATOM   8209  H  HA   . ILE A 1 16 ? 14.244 8.015   -6.963  1.00 0.00 ? 16 ILE A HA   11 
ATOM   8210  H  HB   . ILE A 1 16 ? 15.280 7.906   -4.876  1.00 0.00 ? 16 ILE A HB   11 
ATOM   8211  H  HG12 . ILE A 1 16 ? 15.588 5.060   -5.897  1.00 0.00 ? 16 ILE A HG12 11 
ATOM   8212  H  HG13 . ILE A 1 16 ? 16.184 6.478   -6.783  1.00 0.00 ? 16 ILE A HG13 11 
ATOM   8213  H  HG21 . ILE A 1 16 ? 13.470 6.963   -3.497  1.00 0.00 ? 16 ILE A HG21 11 
ATOM   8214  H  HG22 . ILE A 1 16 ? 13.782 5.348   -4.159  1.00 0.00 ? 16 ILE A HG22 11 
ATOM   8215  H  HG23 . ILE A 1 16 ? 15.001 6.180   -3.189  1.00 0.00 ? 16 ILE A HG23 11 
ATOM   8216  H  HD11 . ILE A 1 16 ? 17.028 5.712   -3.950  1.00 0.00 ? 16 ILE A HD11 11 
ATOM   8217  H  HD12 . ILE A 1 16 ? 17.961 5.458   -5.420  1.00 0.00 ? 16 ILE A HD12 11 
ATOM   8218  H  HD13 . ILE A 1 16 ? 17.606 7.110   -4.884  1.00 0.00 ? 16 ILE A HD13 11 
ATOM   8219  N  N    . LEU A 1 17 ? 12.787 6.433   -8.283  1.00 0.00 ? 17 LEU A N    11 
ATOM   8220  C  CA   . LEU A 1 17 ? 12.371 5.413   -9.231  1.00 0.00 ? 17 LEU A CA   11 
ATOM   8221  C  C    . LEU A 1 17 ? 13.601 4.609   -9.646  1.00 0.00 ? 17 LEU A C    11 
ATOM   8222  O  O    . LEU A 1 17 ? 14.632 5.190   -9.980  1.00 0.00 ? 17 LEU A O    11 
ATOM   8223  C  CB   . LEU A 1 17 ? 11.712 6.069   -10.453 1.00 0.00 ? 17 LEU A CB   11 
ATOM   8224  C  CG   . LEU A 1 17 ? 10.241 6.465   -10.231 1.00 0.00 ? 17 LEU A CG   11 
ATOM   8225  C  CD1  . LEU A 1 17 ? 10.038 7.420   -9.048  1.00 0.00 ? 17 LEU A CD1  11 
ATOM   8226  C  CD2  . LEU A 1 17 ? 9.707  7.123   -11.507 1.00 0.00 ? 17 LEU A CD2  11 
ATOM   8227  H  H    . LEU A 1 17 ? 12.888 7.374   -8.634  1.00 0.00 ? 17 LEU A H    11 
ATOM   8228  H  HA   . LEU A 1 17 ? 11.648 4.749   -8.757  1.00 0.00 ? 17 LEU A HA   11 
ATOM   8229  H  HB2  . LEU A 1 17 ? 12.293 6.945   -10.753 1.00 0.00 ? 17 LEU A HB2  11 
ATOM   8230  H  HB3  . LEU A 1 17 ? 11.731 5.347   -11.271 1.00 0.00 ? 17 LEU A HB3  11 
ATOM   8231  H  HG   . LEU A 1 17 ? 9.658  5.561   -10.051 1.00 0.00 ? 17 LEU A HG   11 
ATOM   8232  H  HD11 . LEU A 1 17 ? 10.697 8.284   -9.143  1.00 0.00 ? 17 LEU A HD11 11 
ATOM   8233  H  HD12 . LEU A 1 17 ? 9.004  7.764   -9.026  1.00 0.00 ? 17 LEU A HD12 11 
ATOM   8234  H  HD13 . LEU A 1 17 ? 10.240 6.905   -8.109  1.00 0.00 ? 17 LEU A HD13 11 
ATOM   8235  H  HD21 . LEU A 1 17 ? 10.257 8.043   -11.713 1.00 0.00 ? 17 LEU A HD21 11 
ATOM   8236  H  HD22 . LEU A 1 17 ? 9.820  6.443   -12.352 1.00 0.00 ? 17 LEU A HD22 11 
ATOM   8237  H  HD23 . LEU A 1 17 ? 8.648  7.360   -11.388 1.00 0.00 ? 17 LEU A HD23 11 
ATOM   8238  N  N    . CYS A 1 18 ? 13.497 3.274   -9.613  1.00 0.00 ? 18 CYS A N    11 
ATOM   8239  C  CA   . CYS A 1 18 ? 14.650 2.408   -9.787  1.00 0.00 ? 18 CYS A CA   11 
ATOM   8240  C  C    . CYS A 1 18 ? 15.155 2.468   -11.229 1.00 0.00 ? 18 CYS A C    11 
ATOM   8241  O  O    . CYS A 1 18 ? 14.366 2.457   -12.170 1.00 0.00 ? 18 CYS A O    11 
ATOM   8242  C  CB   . CYS A 1 18 ? 14.310 0.976   -9.367  1.00 0.00 ? 18 CYS A CB   11 
ATOM   8243  S  SG   . CYS A 1 18 ? 15.604 -0.224  -9.756  1.00 0.00 ? 18 CYS A SG   11 
ATOM   8244  H  H    . CYS A 1 18 ? 12.619 2.854   -9.338  1.00 0.00 ? 18 CYS A H    11 
ATOM   8245  H  HA   . CYS A 1 18 ? 15.436 2.759   -9.121  1.00 0.00 ? 18 CYS A HA   11 
ATOM   8246  H  HB2  . CYS A 1 18 ? 14.133 0.965   -8.291  1.00 0.00 ? 18 CYS A HB2  11 
ATOM   8247  H  HB3  . CYS A 1 18 ? 13.403 0.644   -9.867  1.00 0.00 ? 18 CYS A HB3  11 
ATOM   8248  N  N    . ASP A 1 19 ? 16.480 2.535   -11.395 1.00 0.00 ? 19 ASP A N    11 
ATOM   8249  C  CA   . ASP A 1 19 ? 17.127 2.695   -12.688 1.00 0.00 ? 19 ASP A CA   11 
ATOM   8250  C  C    . ASP A 1 19 ? 16.832 1.484   -13.571 1.00 0.00 ? 19 ASP A C    11 
ATOM   8251  O  O    . ASP A 1 19 ? 16.393 1.626   -14.710 1.00 0.00 ? 19 ASP A O    11 
ATOM   8252  C  CB   . ASP A 1 19 ? 18.633 2.883   -12.476 1.00 0.00 ? 19 ASP A CB   11 
ATOM   8253  C  CG   . ASP A 1 19 ? 19.362 3.051   -13.804 1.00 0.00 ? 19 ASP A CG   11 
ATOM   8254  O  OD1  . ASP A 1 19 ? 19.319 4.182   -14.337 1.00 0.00 ? 19 ASP A OD1  11 
ATOM   8255  O  OD2  . ASP A 1 19 ? 19.942 2.045   -14.267 1.00 0.00 ? 19 ASP A OD2  11 
ATOM   8256  H  H    . ASP A 1 19 ? 17.075 2.420   -10.584 1.00 0.00 ? 19 ASP A H    11 
ATOM   8257  H  HA   . ASP A 1 19 ? 16.729 3.587   -13.170 1.00 0.00 ? 19 ASP A HA   11 
ATOM   8258  H  HB2  . ASP A 1 19 ? 18.802 3.774   -11.868 1.00 0.00 ? 19 ASP A HB2  11 
ATOM   8259  H  HB3  . ASP A 1 19 ? 19.045 2.024   -11.946 1.00 0.00 ? 19 ASP A HB3  11 
ATOM   8260  N  N    . GLU A 1 20 ? 17.054 0.294   -13.008 1.00 0.00 ? 20 GLU A N    11 
ATOM   8261  C  CA   . GLU A 1 20 ? 17.017 -0.970  -13.721 1.00 0.00 ? 20 GLU A CA   11 
ATOM   8262  C  C    . GLU A 1 20 ? 15.601 -1.297  -14.202 1.00 0.00 ? 20 GLU A C    11 
ATOM   8263  O  O    . GLU A 1 20 ? 15.390 -1.486  -15.398 1.00 0.00 ? 20 GLU A O    11 
ATOM   8264  C  CB   . GLU A 1 20 ? 17.558 -2.067  -12.792 1.00 0.00 ? 20 GLU A CB   11 
ATOM   8265  C  CG   . GLU A 1 20 ? 17.599 -3.446  -13.460 1.00 0.00 ? 20 GLU A CG   11 
ATOM   8266  C  CD   . GLU A 1 20 ? 18.058 -4.515  -12.473 1.00 0.00 ? 20 GLU A CD   11 
ATOM   8267  O  OE1  . GLU A 1 20 ? 19.221 -4.411  -12.024 1.00 0.00 ? 20 GLU A OE1  11 
ATOM   8268  O  OE2  . GLU A 1 20 ? 17.236 -5.405  -12.170 1.00 0.00 ? 20 GLU A OE2  11 
ATOM   8269  H  H    . GLU A 1 20 ? 17.407 0.289   -12.063 1.00 0.00 ? 20 GLU A H    11 
ATOM   8270  H  HA   . GLU A 1 20 ? 17.679 -0.899  -14.586 1.00 0.00 ? 20 GLU A HA   11 
ATOM   8271  H  HB2  . GLU A 1 20 ? 18.574 -1.799  -12.495 1.00 0.00 ? 20 GLU A HB2  11 
ATOM   8272  H  HB3  . GLU A 1 20 ? 16.933 -2.127  -11.899 1.00 0.00 ? 20 GLU A HB3  11 
ATOM   8273  H  HG2  . GLU A 1 20 ? 16.609 -3.720  -13.826 1.00 0.00 ? 20 GLU A HG2  11 
ATOM   8274  H  HG3  . GLU A 1 20 ? 18.288 -3.420  -14.304 1.00 0.00 ? 20 GLU A HG3  11 
ATOM   8275  N  N    . CYS A 1 21 ? 14.644 -1.376  -13.266 1.00 0.00 ? 21 CYS A N    11 
ATOM   8276  C  CA   . CYS A 1 21 ? 13.308 -1.910  -13.520 1.00 0.00 ? 21 CYS A CA   11 
ATOM   8277  C  C    . CYS A 1 21 ? 12.161 -0.925  -13.257 1.00 0.00 ? 21 CYS A C    11 
ATOM   8278  O  O    . CYS A 1 21 ? 11.006 -1.348  -13.274 1.00 0.00 ? 21 CYS A O    11 
ATOM   8279  C  CB   . CYS A 1 21 ? 13.145 -3.200  -12.708 1.00 0.00 ? 21 CYS A CB   11 
ATOM   8280  S  SG   . CYS A 1 21 ? 13.269 -2.992  -10.912 1.00 0.00 ? 21 CYS A SG   11 
ATOM   8281  H  H    . CYS A 1 21 ? 14.873 -1.099  -12.322 1.00 0.00 ? 21 CYS A H    11 
ATOM   8282  H  HA   . CYS A 1 21 ? 13.216 -2.197  -14.568 1.00 0.00 ? 21 CYS A HA   11 
ATOM   8283  H  HB2  . CYS A 1 21 ? 12.178 -3.650  -12.939 1.00 0.00 ? 21 CYS A HB2  11 
ATOM   8284  H  HB3  . CYS A 1 21 ? 13.928 -3.899  -13.012 1.00 0.00 ? 21 CYS A HB3  11 
ATOM   8285  N  N    . ASN A 1 22 ? 12.452 0.364   -13.023 1.00 0.00 ? 22 ASN A N    11 
ATOM   8286  C  CA   . ASN A 1 22 ? 11.458 1.437   -12.974 1.00 0.00 ? 22 ASN A CA   11 
ATOM   8287  C  C    . ASN A 1 22 ? 10.301 1.125   -12.017 1.00 0.00 ? 22 ASN A C    11 
ATOM   8288  O  O    . ASN A 1 22 ? 9.131  1.204   -12.389 1.00 0.00 ? 22 ASN A O    11 
ATOM   8289  C  CB   . ASN A 1 22 ? 10.992 1.777   -14.398 1.00 0.00 ? 22 ASN A CB   11 
ATOM   8290  C  CG   . ASN A 1 22 ? 10.150 3.053   -14.465 1.00 0.00 ? 22 ASN A CG   11 
ATOM   8291  O  OD1  . ASN A 1 22 ? 10.187 3.888   -13.564 1.00 0.00 ? 22 ASN A OD1  11 
ATOM   8292  N  ND2  . ASN A 1 22 ? 9.382  3.208   -15.545 1.00 0.00 ? 22 ASN A ND2  11 
ATOM   8293  H  H    . ASN A 1 22 ? 13.421 0.648   -12.973 1.00 0.00 ? 22 ASN A H    11 
ATOM   8294  H  HA   . ASN A 1 22 ? 11.955 2.320   -12.581 1.00 0.00 ? 22 ASN A HA   11 
ATOM   8295  H  HB2  . ASN A 1 22 ? 11.870 1.926   -15.030 1.00 0.00 ? 22 ASN A HB2  11 
ATOM   8296  H  HB3  . ASN A 1 22 ? 10.412 0.940   -14.790 1.00 0.00 ? 22 ASN A HB3  11 
ATOM   8297  H  HD21 . ASN A 1 22 ? 9.375  2.498   -16.264 1.00 0.00 ? 22 ASN A HD21 11 
ATOM   8298  H  HD22 . ASN A 1 22 ? 8.808  4.036   -15.630 1.00 0.00 ? 22 ASN A HD22 11 
ATOM   8299  N  N    . LYS A 1 23 ? 10.643 0.762   -10.776 1.00 0.00 ? 23 LYS A N    11 
ATOM   8300  C  CA   . LYS A 1 23 ? 9.723  0.629   -9.665  1.00 0.00 ? 23 LYS A CA   11 
ATOM   8301  C  C    . LYS A 1 23 ? 9.860  1.864   -8.775  1.00 0.00 ? 23 LYS A C    11 
ATOM   8302  O  O    . LYS A 1 23 ? 10.973 2.240   -8.411  1.00 0.00 ? 23 LYS A O    11 
ATOM   8303  C  CB   . LYS A 1 23 ? 10.063 -0.648  -8.892  1.00 0.00 ? 23 LYS A CB   11 
ATOM   8304  C  CG   . LYS A 1 23 ? 9.727  -1.896  -9.717  1.00 0.00 ? 23 LYS A CG   11 
ATOM   8305  C  CD   . LYS A 1 23 ? 10.015 -3.167  -8.909  1.00 0.00 ? 23 LYS A CD   11 
ATOM   8306  C  CE   . LYS A 1 23 ? 9.579  -4.435  -9.654  1.00 0.00 ? 23 LYS A CE   11 
ATOM   8307  N  NZ   . LYS A 1 23 ? 10.320 -4.631  -10.913 1.00 0.00 ? 23 LYS A NZ   11 
ATOM   8308  H  H    . LYS A 1 23 ? 11.616 0.638   -10.554 1.00 0.00 ? 23 LYS A H    11 
ATOM   8309  H  HA   . LYS A 1 23 ? 8.693  0.554   -10.019 1.00 0.00 ? 23 LYS A HA   11 
ATOM   8310  H  HB2  . LYS A 1 23 ? 11.123 -0.652  -8.630  1.00 0.00 ? 23 LYS A HB2  11 
ATOM   8311  H  HB3  . LYS A 1 23 ? 9.472  -0.653  -7.979  1.00 0.00 ? 23 LYS A HB3  11 
ATOM   8312  H  HG2  . LYS A 1 23 ? 8.670  -1.872  -9.986  1.00 0.00 ? 23 LYS A HG2  11 
ATOM   8313  H  HG3  . LYS A 1 23 ? 10.324 -1.894  -10.629 1.00 0.00 ? 23 LYS A HG3  11 
ATOM   8314  H  HD2  . LYS A 1 23 ? 11.080 -3.219  -8.681  1.00 0.00 ? 23 LYS A HD2  11 
ATOM   8315  H  HD3  . LYS A 1 23 ? 9.465  -3.118  -7.968  1.00 0.00 ? 23 LYS A HD3  11 
ATOM   8316  H  HE2  . LYS A 1 23 ? 9.756  -5.298  -9.010  1.00 0.00 ? 23 LYS A HE2  11 
ATOM   8317  H  HE3  . LYS A 1 23 ? 8.512  -4.380  -9.873  1.00 0.00 ? 23 LYS A HE3  11 
ATOM   8318  H  HZ1  . LYS A 1 23 ? 10.137 -3.863  -11.543 1.00 0.00 ? 23 LYS A HZ1  11 
ATOM   8319  H  HZ2  . LYS A 1 23 ? 11.311 -4.678  -10.722 1.00 0.00 ? 23 LYS A HZ2  11 
ATOM   8320  H  HZ3  . LYS A 1 23 ? 10.025 -5.493  -11.349 1.00 0.00 ? 23 LYS A HZ3  11 
ATOM   8321  N  N    . ALA A 1 24 ? 8.727  2.490   -8.436  1.00 0.00 ? 24 ALA A N    11 
ATOM   8322  C  CA   . ALA A 1 24 ? 8.678  3.678   -7.598  1.00 0.00 ? 24 ALA A CA   11 
ATOM   8323  C  C    . ALA A 1 24 ? 8.975  3.307   -6.146  1.00 0.00 ? 24 ALA A C    11 
ATOM   8324  O  O    . ALA A 1 24 ? 8.302  2.449   -5.578  1.00 0.00 ? 24 ALA A O    11 
ATOM   8325  C  CB   . ALA A 1 24 ? 7.303  4.337   -7.725  1.00 0.00 ? 24 ALA A CB   11 
ATOM   8326  H  H    . ALA A 1 24 ? 7.848  2.121   -8.769  1.00 0.00 ? 24 ALA A H    11 
ATOM   8327  H  HA   . ALA A 1 24 ? 9.422  4.392   -7.951  1.00 0.00 ? 24 ALA A HA   11 
ATOM   8328  H  HB1  . ALA A 1 24 ? 7.268  5.236   -7.109  1.00 0.00 ? 24 ALA A HB1  11 
ATOM   8329  H  HB2  . ALA A 1 24 ? 7.121  4.613   -8.764  1.00 0.00 ? 24 ALA A HB2  11 
ATOM   8330  H  HB3  . ALA A 1 24 ? 6.524  3.646   -7.397  1.00 0.00 ? 24 ALA A HB3  11 
ATOM   8331  N  N    . PHE A 1 25 ? 9.981  3.957   -5.552  1.00 0.00 ? 25 PHE A N    11 
ATOM   8332  C  CA   . PHE A 1 25 ? 10.308 3.849   -4.136  1.00 0.00 ? 25 PHE A CA   11 
ATOM   8333  C  C    . PHE A 1 25 ? 10.588 5.235   -3.566  1.00 0.00 ? 25 PHE A C    11 
ATOM   8334  O  O    . PHE A 1 25 ? 10.881 6.167   -4.310  1.00 0.00 ? 25 PHE A O    11 
ATOM   8335  C  CB   . PHE A 1 25 ? 11.549 2.963   -3.954  1.00 0.00 ? 25 PHE A CB   11 
ATOM   8336  C  CG   . PHE A 1 25 ? 11.259 1.479   -3.850  1.00 0.00 ? 25 PHE A CG   11 
ATOM   8337  C  CD1  . PHE A 1 25 ? 11.044 0.714   -5.012  1.00 0.00 ? 25 PHE A CD1  11 
ATOM   8338  C  CD2  . PHE A 1 25 ? 11.252 0.854   -2.589  1.00 0.00 ? 25 PHE A CD2  11 
ATOM   8339  C  CE1  . PHE A 1 25 ? 10.807 -0.668  -4.912  1.00 0.00 ? 25 PHE A CE1  11 
ATOM   8340  C  CE2  . PHE A 1 25 ? 11.065 -0.535  -2.495  1.00 0.00 ? 25 PHE A CE2  11 
ATOM   8341  C  CZ   . PHE A 1 25 ? 10.829 -1.295  -3.654  1.00 0.00 ? 25 PHE A CZ   11 
ATOM   8342  H  H    . PHE A 1 25 ? 10.517 4.625   -6.087  1.00 0.00 ? 25 PHE A H    11 
ATOM   8343  H  HA   . PHE A 1 25 ? 9.480  3.413   -3.581  1.00 0.00 ? 25 PHE A HA   11 
ATOM   8344  H  HB2  . PHE A 1 25 ? 12.245 3.136   -4.778  1.00 0.00 ? 25 PHE A HB2  11 
ATOM   8345  H  HB3  . PHE A 1 25 ? 12.053 3.259   -3.032  1.00 0.00 ? 25 PHE A HB3  11 
ATOM   8346  H  HD1  . PHE A 1 25 ? 11.066 1.185   -5.982  1.00 0.00 ? 25 PHE A HD1  11 
ATOM   8347  H  HD2  . PHE A 1 25 ? 11.404 1.437   -1.688  1.00 0.00 ? 25 PHE A HD2  11 
ATOM   8348  H  HE1  . PHE A 1 25 ? 10.632 -1.252  -5.802  1.00 0.00 ? 25 PHE A HE1  11 
ATOM   8349  H  HE2  . PHE A 1 25 ? 11.094 -1.020  -1.529  1.00 0.00 ? 25 PHE A HE2  11 
ATOM   8350  H  HZ   . PHE A 1 25 ? 10.670 -2.361  -3.577  1.00 0.00 ? 25 PHE A HZ   11 
ATOM   8351  N  N    . HIS A 1 26 ? 10.466 5.366   -2.240  1.00 0.00 ? 26 HIS A N    11 
ATOM   8352  C  CA   . HIS A 1 26 ? 10.937 6.531   -1.507  1.00 0.00 ? 26 HIS A CA   11 
ATOM   8353  C  C    . HIS A 1 26 ? 12.328 6.187   -0.986  1.00 0.00 ? 26 HIS A C    11 
ATOM   8354  O  O    . HIS A 1 26 ? 12.611 5.029   -0.679  1.00 0.00 ? 26 HIS A O    11 
ATOM   8355  C  CB   . HIS A 1 26 ? 10.048 6.846   -0.303  1.00 0.00 ? 26 HIS A CB   11 
ATOM   8356  C  CG   . HIS A 1 26 ? 8.699  7.426   -0.623  1.00 0.00 ? 26 HIS A CG   11 
ATOM   8357  N  ND1  . HIS A 1 26 ? 7.483  6.758   -0.482  1.00 0.00 ? 26 HIS A ND1  11 
ATOM   8358  C  CD2  . HIS A 1 26 ? 8.469  8.722   -0.982  1.00 0.00 ? 26 HIS A CD2  11 
ATOM   8359  C  CE1  . HIS A 1 26 ? 6.543  7.669   -0.776  1.00 0.00 ? 26 HIS A CE1  11 
ATOM   8360  N  NE2  . HIS A 1 26 ? 7.105  8.850   -1.086  1.00 0.00 ? 26 HIS A NE2  11 
ATOM   8361  H  H    . HIS A 1 26 ? 10.176 4.566   -1.696  1.00 0.00 ? 26 HIS A H    11 
ATOM   8362  H  HA   . HIS A 1 26 ? 10.988 7.412   -2.149  1.00 0.00 ? 26 HIS A HA   11 
ATOM   8363  H  HB2  . HIS A 1 26 ? 9.922  5.946   0.289   1.00 0.00 ? 26 HIS A HB2  11 
ATOM   8364  H  HB3  . HIS A 1 26 ? 10.574 7.576   0.311   1.00 0.00 ? 26 HIS A HB3  11 
ATOM   8365  H  HD2  . HIS A 1 26 ? 9.205  9.499   -1.126  1.00 0.00 ? 26 HIS A HD2  11 
ATOM   8366  H  HE1  . HIS A 1 26 ? 5.479  7.481   -0.765  1.00 0.00 ? 26 HIS A HE1  11 
ATOM   8367  H  HE2  . HIS A 1 26 ? 6.615  9.704   -1.321  1.00 0.00 ? 26 HIS A HE2  11 
ATOM   8368  N  N    . LEU A 1 27 ? 13.179 7.206   -0.853  1.00 0.00 ? 27 LEU A N    11 
ATOM   8369  C  CA   . LEU A 1 27 ? 14.461 7.098   -0.172  1.00 0.00 ? 27 LEU A CA   11 
ATOM   8370  C  C    . LEU A 1 27 ? 14.249 6.526   1.231   1.00 0.00 ? 27 LEU A C    11 
ATOM   8371  O  O    . LEU A 1 27 ? 14.936 5.588   1.632   1.00 0.00 ? 27 LEU A O    11 
ATOM   8372  C  CB   . LEU A 1 27 ? 15.112 8.484   -0.123  1.00 0.00 ? 27 LEU A CB   11 
ATOM   8373  C  CG   . LEU A 1 27 ? 15.455 9.029   -1.518  1.00 0.00 ? 27 LEU A CG   11 
ATOM   8374  C  CD1  . LEU A 1 27 ? 15.642 10.546  -1.440  1.00 0.00 ? 27 LEU A CD1  11 
ATOM   8375  C  CD2  . LEU A 1 27 ? 16.744 8.387   -2.043  1.00 0.00 ? 27 LEU A CD2  11 
ATOM   8376  H  H    . LEU A 1 27 ? 12.889 8.125   -1.155  1.00 0.00 ? 27 LEU A H    11 
ATOM   8377  H  HA   . LEU A 1 27 ? 15.104 6.416   -0.724  1.00 0.00 ? 27 LEU A HA   11 
ATOM   8378  H  HB2  . LEU A 1 27 ? 14.416 9.164   0.372   1.00 0.00 ? 27 LEU A HB2  11 
ATOM   8379  H  HB3  . LEU A 1 27 ? 16.031 8.433   0.457   1.00 0.00 ? 27 LEU A HB3  11 
ATOM   8380  H  HG   . LEU A 1 27 ? 14.646 8.833   -2.220  1.00 0.00 ? 27 LEU A HG   11 
ATOM   8381  H  HD11 . LEU A 1 27 ? 15.903 10.936  -2.422  1.00 0.00 ? 27 LEU A HD11 11 
ATOM   8382  H  HD12 . LEU A 1 27 ? 14.717 11.018  -1.107  1.00 0.00 ? 27 LEU A HD12 11 
ATOM   8383  H  HD13 . LEU A 1 27 ? 16.436 10.781  -0.734  1.00 0.00 ? 27 LEU A HD13 11 
ATOM   8384  H  HD21 . LEU A 1 27 ? 16.662 7.303   -2.060  1.00 0.00 ? 27 LEU A HD21 11 
ATOM   8385  H  HD22 . LEU A 1 27 ? 16.936 8.737   -3.056  1.00 0.00 ? 27 LEU A HD22 11 
ATOM   8386  H  HD23 . LEU A 1 27 ? 17.579 8.660   -1.398  1.00 0.00 ? 27 LEU A HD23 11 
ATOM   8387  N  N    . PHE A 1 28 ? 13.240 7.057   1.930   1.00 0.00 ? 28 PHE A N    11 
ATOM   8388  C  CA   . PHE A 1 28 ? 12.769 6.594   3.227   1.00 0.00 ? 28 PHE A CA   11 
ATOM   8389  C  C    . PHE A 1 28 ? 12.536 5.080   3.236   1.00 0.00 ? 28 PHE A C    11 
ATOM   8390  O  O    . PHE A 1 28 ? 13.063 4.377   4.097   1.00 0.00 ? 28 PHE A O    11 
ATOM   8391  C  CB   . PHE A 1 28 ? 11.479 7.344   3.603   1.00 0.00 ? 28 PHE A CB   11 
ATOM   8392  C  CG   . PHE A 1 28 ? 11.447 8.819   3.236   1.00 0.00 ? 28 PHE A CG   11 
ATOM   8393  C  CD1  . PHE A 1 28 ? 12.509 9.673   3.598   1.00 0.00 ? 28 PHE A CD1  11 
ATOM   8394  C  CD2  . PHE A 1 28 ? 10.404 9.312   2.430   1.00 0.00 ? 28 PHE A CD2  11 
ATOM   8395  C  CE1  . PHE A 1 28 ? 12.517 11.011  3.163   1.00 0.00 ? 28 PHE A CE1  11 
ATOM   8396  C  CE2  . PHE A 1 28 ? 10.431 10.639  1.970   1.00 0.00 ? 28 PHE A CE2  11 
ATOM   8397  C  CZ   . PHE A 1 28 ? 11.471 11.497  2.358   1.00 0.00 ? 28 PHE A CZ   11 
ATOM   8398  H  H    . PHE A 1 28 ? 12.760 7.847   1.524   1.00 0.00 ? 28 PHE A H    11 
ATOM   8399  H  HA   . PHE A 1 28 ? 13.535 6.843   3.960   1.00 0.00 ? 28 PHE A HA   11 
ATOM   8400  H  HB2  . PHE A 1 28 ? 10.647 6.850   3.097   1.00 0.00 ? 28 PHE A HB2  11 
ATOM   8401  H  HB3  . PHE A 1 28 ? 11.317 7.245   4.677   1.00 0.00 ? 28 PHE A HB3  11 
ATOM   8402  H  HD1  . PHE A 1 28 ? 13.324 9.304   4.203   1.00 0.00 ? 28 PHE A HD1  11 
ATOM   8403  H  HD2  . PHE A 1 28 ? 9.570  8.681   2.162   1.00 0.00 ? 28 PHE A HD2  11 
ATOM   8404  H  HE1  . PHE A 1 28 ? 13.328 11.666  3.446   1.00 0.00 ? 28 PHE A HE1  11 
ATOM   8405  H  HE2  . PHE A 1 28 ? 9.644  11.003  1.328   1.00 0.00 ? 28 PHE A HE2  11 
ATOM   8406  H  HZ   . PHE A 1 28 ? 11.449 12.532  2.049   1.00 0.00 ? 28 PHE A HZ   11 
ATOM   8407  N  N    . CYS A 1 29 ? 11.737 4.588   2.278   1.00 0.00 ? 29 CYS A N    11 
ATOM   8408  C  CA   . CYS A 1 29 ? 11.258 3.212   2.241   1.00 0.00 ? 29 CYS A CA   11 
ATOM   8409  C  C    . CYS A 1 29 ? 12.397 2.241   1.925   1.00 0.00 ? 29 CYS A C    11 
ATOM   8410  O  O    . CYS A 1 29 ? 12.396 1.123   2.436   1.00 0.00 ? 29 CYS A O    11 
ATOM   8411  C  CB   . CYS A 1 29 ? 10.113 3.072   1.232   1.00 0.00 ? 29 CYS A CB   11 
ATOM   8412  S  SG   . CYS A 1 29 ? 8.613  3.996   1.658   1.00 0.00 ? 29 CYS A SG   11 
ATOM   8413  H  H    . CYS A 1 29 ? 11.418 5.212   1.552   1.00 0.00 ? 29 CYS A H    11 
ATOM   8414  H  HA   . CYS A 1 29 ? 10.862 2.957   3.226   1.00 0.00 ? 29 CYS A HA   11 
ATOM   8415  H  HB2  . CYS A 1 29 ? 10.457 3.404   0.252   1.00 0.00 ? 29 CYS A HB2  11 
ATOM   8416  H  HB3  . CYS A 1 29 ? 9.835  2.019   1.161   1.00 0.00 ? 29 CYS A HB3  11 
ATOM   8417  N  N    . LEU A 1 30 ? 13.365 2.657   1.094   1.00 0.00 ? 30 LEU A N    11 
ATOM   8418  C  CA   . LEU A 1 30 ? 14.598 1.903   0.907   1.00 0.00 ? 30 LEU A CA   11 
ATOM   8419  C  C    . LEU A 1 30 ? 15.332 1.786   2.243   1.00 0.00 ? 30 LEU A C    11 
ATOM   8420  O  O    . LEU A 1 30 ? 15.554 0.683   2.738   1.00 0.00 ? 30 LEU A O    11 
ATOM   8421  C  CB   . LEU A 1 30 ? 15.495 2.557   -0.154  1.00 0.00 ? 30 LEU A CB   11 
ATOM   8422  C  CG   . LEU A 1 30 ? 14.906 2.575   -1.571  1.00 0.00 ? 30 LEU A CG   11 
ATOM   8423  C  CD1  . LEU A 1 30 ? 15.822 3.405   -2.476  1.00 0.00 ? 30 LEU A CD1  11 
ATOM   8424  C  CD2  . LEU A 1 30 ? 14.772 1.173   -2.169  1.00 0.00 ? 30 LEU A CD2  11 
ATOM   8425  H  H    . LEU A 1 30 ? 13.286 3.564   0.652   1.00 0.00 ? 30 LEU A H    11 
ATOM   8426  H  HA   . LEU A 1 30 ? 14.354 0.897   0.586   1.00 0.00 ? 30 LEU A HA   11 
ATOM   8427  H  HB2  . LEU A 1 30 ? 15.691 3.585   0.151   1.00 0.00 ? 30 LEU A HB2  11 
ATOM   8428  H  HB3  . LEU A 1 30 ? 16.444 2.018   -0.190  1.00 0.00 ? 30 LEU A HB3  11 
ATOM   8429  H  HG   . LEU A 1 30 ? 13.926 3.042   -1.546  1.00 0.00 ? 30 LEU A HG   11 
ATOM   8430  H  HD11 . LEU A 1 30 ? 15.946 4.402   -2.056  1.00 0.00 ? 30 LEU A HD11 11 
ATOM   8431  H  HD12 . LEU A 1 30 ? 16.801 2.931   -2.554  1.00 0.00 ? 30 LEU A HD12 11 
ATOM   8432  H  HD13 . LEU A 1 30 ? 15.385 3.486   -3.472  1.00 0.00 ? 30 LEU A HD13 11 
ATOM   8433  H  HD21 . LEU A 1 30 ? 15.747 0.687   -2.171  1.00 0.00 ? 30 LEU A HD21 11 
ATOM   8434  H  HD22 . LEU A 1 30 ? 14.067 0.575   -1.594  1.00 0.00 ? 30 LEU A HD22 11 
ATOM   8435  H  HD23 . LEU A 1 30 ? 14.408 1.243   -3.194  1.00 0.00 ? 30 LEU A HD23 11 
ATOM   8436  N  N    . ARG A 1 31 ? 15.700 2.932   2.823   1.00 0.00 ? 31 ARG A N    11 
ATOM   8437  C  CA   . ARG A 1 31 ? 16.447 3.005   4.070   1.00 0.00 ? 31 ARG A CA   11 
ATOM   8438  C  C    . ARG A 1 31 ? 16.325 4.434   4.613   1.00 0.00 ? 31 ARG A C    11 
ATOM   8439  O  O    . ARG A 1 31 ? 16.650 5.367   3.883   1.00 0.00 ? 31 ARG A O    11 
ATOM   8440  C  CB   . ARG A 1 31 ? 17.921 2.645   3.796   1.00 0.00 ? 31 ARG A CB   11 
ATOM   8441  C  CG   . ARG A 1 31 ? 18.766 2.509   5.071   1.00 0.00 ? 31 ARG A CG   11 
ATOM   8442  C  CD   . ARG A 1 31 ? 18.518 1.198   5.832   1.00 0.00 ? 31 ARG A CD   11 
ATOM   8443  N  NE   . ARG A 1 31 ? 19.287 0.076   5.270   1.00 0.00 ? 31 ARG A NE   11 
ATOM   8444  C  CZ   . ARG A 1 31 ? 18.829 -0.891  4.455   1.00 0.00 ? 31 ARG A CZ   11 
ATOM   8445  N  NH1  . ARG A 1 31 ? 17.587 -0.862  3.954   1.00 0.00 ? 31 ARG A NH1  11 
ATOM   8446  N  NH2  . ARG A 1 31 ? 19.635 -1.908  4.133   1.00 0.00 ? 31 ARG A NH2  11 
ATOM   8447  H  H    . ARG A 1 31 ? 15.445 3.798   2.368   1.00 0.00 ? 31 ARG A H    11 
ATOM   8448  H  HA   . ARG A 1 31 ? 16.006 2.288   4.759   1.00 0.00 ? 31 ARG A HA   11 
ATOM   8449  H  HB2  . ARG A 1 31 ? 17.990 1.717   3.230   1.00 0.00 ? 31 ARG A HB2  11 
ATOM   8450  H  HB3  . ARG A 1 31 ? 18.357 3.434   3.181   1.00 0.00 ? 31 ARG A HB3  11 
ATOM   8451  H  HG2  . ARG A 1 31 ? 19.821 2.554   4.798   1.00 0.00 ? 31 ARG A HG2  11 
ATOM   8452  H  HG3  . ARG A 1 31 ? 18.561 3.351   5.729   1.00 0.00 ? 31 ARG A HG3  11 
ATOM   8453  H  HD2  . ARG A 1 31 ? 18.877 1.339   6.853   1.00 0.00 ? 31 ARG A HD2  11 
ATOM   8454  H  HD3  . ARG A 1 31 ? 17.456 0.962   5.889   1.00 0.00 ? 31 ARG A HD3  11 
ATOM   8455  H  HE   . ARG A 1 31 ? 20.244 0.006   5.584   1.00 0.00 ? 31 ARG A HE   11 
ATOM   8456  H  HH11 . ARG A 1 31 ? 16.964 -0.085  4.123   1.00 0.00 ? 31 ARG A HH11 11 
ATOM   8457  H  HH12 . ARG A 1 31 ? 17.306 -1.578  3.291   1.00 0.00 ? 31 ARG A HH12 11 
ATOM   8458  H  HH21 . ARG A 1 31 ? 20.579 -1.953  4.487   1.00 0.00 ? 31 ARG A HH21 11 
ATOM   8459  H  HH22 . ARG A 1 31 ? 19.275 -2.672  3.569   1.00 0.00 ? 31 ARG A HH22 11 
ATOM   8460  N  N    . PRO A 1 32 ? 15.887 4.644   5.867   1.00 0.00 ? 32 PRO A N    11 
ATOM   8461  C  CA   . PRO A 1 32 ? 15.633 5.976   6.406   1.00 0.00 ? 32 PRO A CA   11 
ATOM   8462  C  C    . PRO A 1 32 ? 16.892 6.851   6.402   1.00 0.00 ? 32 PRO A C    11 
ATOM   8463  O  O    . PRO A 1 32 ? 16.789 8.060   6.212   1.00 0.00 ? 32 PRO A O    11 
ATOM   8464  C  CB   . PRO A 1 32 ? 15.096 5.754   7.823   1.00 0.00 ? 32 PRO A CB   11 
ATOM   8465  C  CG   . PRO A 1 32 ? 15.713 4.416   8.227   1.00 0.00 ? 32 PRO A CG   11 
ATOM   8466  C  CD   . PRO A 1 32 ? 15.736 3.641   6.909   1.00 0.00 ? 32 PRO A CD   11 
ATOM   8467  H  HA   . PRO A 1 32 ? 14.865 6.474   5.817   1.00 0.00 ? 32 PRO A HA   11 
ATOM   8468  H  HB2  . PRO A 1 32 ? 15.366 6.560   8.509   1.00 0.00 ? 32 PRO A HB2  11 
ATOM   8469  H  HB3  . PRO A 1 32 ? 14.012 5.644   7.779   1.00 0.00 ? 32 PRO A HB3  11 
ATOM   8470  H  HG2  . PRO A 1 32 ? 16.734 4.578   8.575   1.00 0.00 ? 32 PRO A HG2  11 
ATOM   8471  H  HG3  . PRO A 1 32 ? 15.131 3.908   8.996   1.00 0.00 ? 32 PRO A HG3  11 
ATOM   8472  H  HD2  . PRO A 1 32 ? 16.553 2.923   6.928   1.00 0.00 ? 32 PRO A HD2  11 
ATOM   8473  H  HD3  . PRO A 1 32 ? 14.785 3.126   6.770   1.00 0.00 ? 32 PRO A HD3  11 
ATOM   8474  N  N    . ALA A 1 33 ? 18.074 6.238   6.575   1.00 0.00 ? 33 ALA A N    11 
ATOM   8475  C  CA   . ALA A 1 33 ? 19.377 6.868   6.393   1.00 0.00 ? 33 ALA A CA   11 
ATOM   8476  C  C    . ALA A 1 33 ? 19.466 7.688   5.102   1.00 0.00 ? 33 ALA A C    11 
ATOM   8477  O  O    . ALA A 1 33 ? 20.078 8.755   5.093   1.00 0.00 ? 33 ALA A O    11 
ATOM   8478  C  CB   . ALA A 1 33 ? 20.471 5.798   6.427   1.00 0.00 ? 33 ALA A CB   11 
ATOM   8479  H  H    . ALA A 1 33 ? 18.069 5.252   6.791   1.00 0.00 ? 33 ALA A H    11 
ATOM   8480  H  HA   . ALA A 1 33 ? 19.536 7.543   7.230   1.00 0.00 ? 33 ALA A HA   11 
ATOM   8481  H  HB1  . ALA A 1 33 ? 21.451 6.275   6.361   1.00 0.00 ? 33 ALA A HB1  11 
ATOM   8482  H  HB2  . ALA A 1 33 ? 20.413 5.237   7.360   1.00 0.00 ? 33 ALA A HB2  11 
ATOM   8483  H  HB3  . ALA A 1 33 ? 20.352 5.114   5.586   1.00 0.00 ? 33 ALA A HB3  11 
ATOM   8484  N  N    . LEU A 1 34 ? 18.879 7.181   4.013   1.00 0.00 ? 34 LEU A N    11 
ATOM   8485  C  CA   . LEU A 1 34 ? 18.691 7.946   2.792   1.00 0.00 ? 34 LEU A CA   11 
ATOM   8486  C  C    . LEU A 1 34 ? 17.548 8.936   3.021   1.00 0.00 ? 34 LEU A C    11 
ATOM   8487  O  O    . LEU A 1 34 ? 16.375 8.580   2.908   1.00 0.00 ? 34 LEU A O    11 
ATOM   8488  C  CB   . LEU A 1 34 ? 18.401 7.027   1.594   1.00 0.00 ? 34 LEU A CB   11 
ATOM   8489  C  CG   . LEU A 1 34 ? 19.478 5.963   1.328   1.00 0.00 ? 34 LEU A CG   11 
ATOM   8490  C  CD1  . LEU A 1 34 ? 19.022 5.081   0.160   1.00 0.00 ? 34 LEU A CD1  11 
ATOM   8491  C  CD2  . LEU A 1 34 ? 20.837 6.591   0.996   1.00 0.00 ? 34 LEU A CD2  11 
ATOM   8492  H  H    . LEU A 1 34 ? 18.362 6.317   4.107   1.00 0.00 ? 34 LEU A H    11 
ATOM   8493  H  HA   . LEU A 1 34 ? 19.596 8.510   2.567   1.00 0.00 ? 34 LEU A HA   11 
ATOM   8494  H  HB2  . LEU A 1 34 ? 17.452 6.516   1.753   1.00 0.00 ? 34 LEU A HB2  11 
ATOM   8495  H  HB3  . LEU A 1 34 ? 18.305 7.650   0.706   1.00 0.00 ? 34 LEU A HB3  11 
ATOM   8496  H  HG   . LEU A 1 34 ? 19.589 5.326   2.204   1.00 0.00 ? 34 LEU A HG   11 
ATOM   8497  H  HD11 . LEU A 1 34 ? 19.761 4.302   -0.027  1.00 0.00 ? 34 LEU A HD11 11 
ATOM   8498  H  HD12 . LEU A 1 34 ? 18.070 4.607   0.405   1.00 0.00 ? 34 LEU A HD12 11 
ATOM   8499  H  HD13 . LEU A 1 34 ? 18.900 5.683   -0.741  1.00 0.00 ? 34 LEU A HD13 11 
ATOM   8500  H  HD21 . LEU A 1 34 ? 21.238 7.106   1.868   1.00 0.00 ? 34 LEU A HD21 11 
ATOM   8501  H  HD22 . LEU A 1 34 ? 21.540 5.811   0.706   1.00 0.00 ? 34 LEU A HD22 11 
ATOM   8502  H  HD23 . LEU A 1 34 ? 20.733 7.301   0.175   1.00 0.00 ? 34 LEU A HD23 11 
ATOM   8503  N  N    . TYR A 1 35 ? 17.904 10.174  3.375   1.00 0.00 ? 35 TYR A N    11 
ATOM   8504  C  CA   . TYR A 1 35 ? 16.989 11.306  3.422   1.00 0.00 ? 35 TYR A CA   11 
ATOM   8505  C  C    . TYR A 1 35 ? 17.015 12.008  2.066   1.00 0.00 ? 35 TYR A C    11 
ATOM   8506  O  O    . TYR A 1 35 ? 15.970 12.244  1.463   1.00 0.00 ? 35 TYR A O    11 
ATOM   8507  C  CB   . TYR A 1 35 ? 17.392 12.252  4.560   1.00 0.00 ? 35 TYR A CB   11 
ATOM   8508  C  CG   . TYR A 1 35 ? 17.413 11.586  5.923   1.00 0.00 ? 35 TYR A CG   11 
ATOM   8509  C  CD1  . TYR A 1 35 ? 16.206 11.311  6.592   1.00 0.00 ? 35 TYR A CD1  11 
ATOM   8510  C  CD2  . TYR A 1 35 ? 18.634 11.169  6.487   1.00 0.00 ? 35 TYR A CD2  11 
ATOM   8511  C  CE1  . TYR A 1 35 ? 16.221 10.629  7.821   1.00 0.00 ? 35 TYR A CE1  11 
ATOM   8512  C  CE2  . TYR A 1 35 ? 18.647 10.470  7.705   1.00 0.00 ? 35 TYR A CE2  11 
ATOM   8513  C  CZ   . TYR A 1 35 ? 17.440 10.189  8.367   1.00 0.00 ? 35 TYR A CZ   11 
ATOM   8514  O  OH   . TYR A 1 35 ? 17.453 9.472   9.528   1.00 0.00 ? 35 TYR A OH   11 
ATOM   8515  H  H    . TYR A 1 35 ? 18.880 10.355  3.560   1.00 0.00 ? 35 TYR A H    11 
ATOM   8516  H  HA   . TYR A 1 35 ? 15.974 10.961  3.613   1.00 0.00 ? 35 TYR A HA   11 
ATOM   8517  H  HB2  . TYR A 1 35 ? 18.381 12.665  4.350   1.00 0.00 ? 35 TYR A HB2  11 
ATOM   8518  H  HB3  . TYR A 1 35 ? 16.678 13.078  4.590   1.00 0.00 ? 35 TYR A HB3  11 
ATOM   8519  H  HD1  . TYR A 1 35 ? 15.264 11.613  6.157   1.00 0.00 ? 35 TYR A HD1  11 
ATOM   8520  H  HD2  . TYR A 1 35 ? 19.566 11.367  5.977   1.00 0.00 ? 35 TYR A HD2  11 
ATOM   8521  H  HE1  . TYR A 1 35 ? 15.289 10.405  8.321   1.00 0.00 ? 35 TYR A HE1  11 
ATOM   8522  H  HE2  . TYR A 1 35 ? 19.584 10.130  8.121   1.00 0.00 ? 35 TYR A HE2  11 
ATOM   8523  H  HH   . TYR A 1 35 ? 16.577 9.315   9.885   1.00 0.00 ? 35 TYR A HH   11 
ATOM   8524  N  N    . GLU A 1 36 ? 18.230 12.311  1.595   1.00 0.00 ? 36 GLU A N    11 
ATOM   8525  C  CA   . GLU A 1 36 ? 18.523 12.784  0.249   1.00 0.00 ? 36 GLU A CA   11 
ATOM   8526  C  C    . GLU A 1 36 ? 19.055 11.631  -0.609  1.00 0.00 ? 36 GLU A C    11 
ATOM   8527  O  O    . GLU A 1 36 ? 19.332 10.544  -0.101  1.00 0.00 ? 36 GLU A O    11 
ATOM   8528  C  CB   . GLU A 1 36 ? 19.536 13.937  0.324   1.00 0.00 ? 36 GLU A CB   11 
ATOM   8529  C  CG   . GLU A 1 36 ? 19.053 15.099  1.206   1.00 0.00 ? 36 GLU A CG   11 
ATOM   8530  C  CD   . GLU A 1 36 ? 17.754 15.711  0.692   1.00 0.00 ? 36 GLU A CD   11 
ATOM   8531  O  OE1  . GLU A 1 36 ? 17.842 16.541  -0.237  1.00 0.00 ? 36 GLU A OE1  11 
ATOM   8532  O  OE2  . GLU A 1 36 ? 16.687 15.318  1.213   1.00 0.00 ? 36 GLU A OE2  11 
ATOM   8533  H  H    . GLU A 1 36 ? 19.019 12.094  2.185   1.00 0.00 ? 36 GLU A H    11 
ATOM   8534  H  HA   . GLU A 1 36 ? 17.610 13.149  -0.218  1.00 0.00 ? 36 GLU A HA   11 
ATOM   8535  H  HB2  . GLU A 1 36 ? 20.476 13.560  0.728   1.00 0.00 ? 36 GLU A HB2  11 
ATOM   8536  H  HB3  . GLU A 1 36 ? 19.721 14.320  -0.680  1.00 0.00 ? 36 GLU A HB3  11 
ATOM   8537  H  HG2  . GLU A 1 36 ? 18.915 14.762  2.234   1.00 0.00 ? 36 GLU A HG2  11 
ATOM   8538  H  HG3  . GLU A 1 36 ? 19.823 15.873  1.209   1.00 0.00 ? 36 GLU A HG3  11 
ATOM   8539  N  N    . VAL A 1 37 ? 19.180 11.872  -1.921  1.00 0.00 ? 37 VAL A N    11 
ATOM   8540  C  CA   . VAL A 1 37 ? 19.546 10.857  -2.898  1.00 0.00 ? 37 VAL A CA   11 
ATOM   8541  C  C    . VAL A 1 37 ? 20.993 10.385  -2.696  1.00 0.00 ? 37 VAL A C    11 
ATOM   8542  O  O    . VAL A 1 37 ? 21.818 11.149  -2.196  1.00 0.00 ? 37 VAL A O    11 
ATOM   8543  C  CB   . VAL A 1 37 ? 19.332 11.389  -4.327  1.00 0.00 ? 37 VAL A CB   11 
ATOM   8544  C  CG1  . VAL A 1 37 ? 17.847 11.647  -4.609  1.00 0.00 ? 37 VAL A CG1  11 
ATOM   8545  C  CG2  . VAL A 1 37 ? 20.147 12.654  -4.634  1.00 0.00 ? 37 VAL A CG2  11 
ATOM   8546  H  H    . VAL A 1 37 ? 18.961 12.789  -2.277  1.00 0.00 ? 37 VAL A H    11 
ATOM   8547  H  HA   . VAL A 1 37 ? 18.865 10.023  -2.754  1.00 0.00 ? 37 VAL A HA   11 
ATOM   8548  H  HB   . VAL A 1 37 ? 19.661 10.611  -5.011  1.00 0.00 ? 37 VAL A HB   11 
ATOM   8549  H  HG11 . VAL A 1 37 ? 17.281 10.724  -4.483  1.00 0.00 ? 37 VAL A HG11 11 
ATOM   8550  H  HG12 . VAL A 1 37 ? 17.456 12.405  -3.930  1.00 0.00 ? 37 VAL A HG12 11 
ATOM   8551  H  HG13 . VAL A 1 37 ? 17.721 11.993  -5.635  1.00 0.00 ? 37 VAL A HG13 11 
ATOM   8552  H  HG21 . VAL A 1 37 ? 21.211 12.465  -4.487  1.00 0.00 ? 37 VAL A HG21 11 
ATOM   8553  H  HG22 . VAL A 1 37 ? 19.990 12.941  -5.673  1.00 0.00 ? 37 VAL A HG22 11 
ATOM   8554  H  HG23 . VAL A 1 37 ? 19.838 13.481  -3.994  1.00 0.00 ? 37 VAL A HG23 11 
ATOM   8555  N  N    . PRO A 1 38 ? 21.310 9.135   -3.076  1.00 0.00 ? 38 PRO A N    11 
ATOM   8556  C  CA   . PRO A 1 38 ? 22.680 8.650   -3.143  1.00 0.00 ? 38 PRO A CA   11 
ATOM   8557  C  C    . PRO A 1 38 ? 23.264 8.938   -4.527  1.00 0.00 ? 38 PRO A C    11 
ATOM   8558  O  O    . PRO A 1 38 ? 22.573 8.812   -5.538  1.00 0.00 ? 38 PRO A O    11 
ATOM   8559  C  CB   . PRO A 1 38 ? 22.598 7.147   -2.870  1.00 0.00 ? 38 PRO A CB   11 
ATOM   8560  C  CG   . PRO A 1 38 ? 21.217 6.773   -3.404  1.00 0.00 ? 38 PRO A CG   11 
ATOM   8561  C  CD   . PRO A 1 38 ? 20.380 8.016   -3.103  1.00 0.00 ? 38 PRO A CD   11 
ATOM   8562  H  HA   . PRO A 1 38 ? 23.304 9.111   -2.374  1.00 0.00 ? 38 PRO A HA   11 
ATOM   8563  H  HB2  . PRO A 1 38 ? 23.397 6.585   -3.357  1.00 0.00 ? 38 PRO A HB2  11 
ATOM   8564  H  HB3  . PRO A 1 38 ? 22.622 6.977   -1.793  1.00 0.00 ? 38 PRO A HB3  11 
ATOM   8565  H  HG2  . PRO A 1 38 ? 21.280 6.627   -4.481  1.00 0.00 ? 38 PRO A HG2  11 
ATOM   8566  H  HG3  . PRO A 1 38 ? 20.817 5.878   -2.926  1.00 0.00 ? 38 PRO A HG3  11 
ATOM   8567  H  HD2  . PRO A 1 38 ? 19.620 8.145   -3.874  1.00 0.00 ? 38 PRO A HD2  11 
ATOM   8568  H  HD3  . PRO A 1 38 ? 19.913 7.911   -2.123  1.00 0.00 ? 38 PRO A HD3  11 
ATOM   8569  N  N    . ASP A 1 39 ? 24.547 9.313   -4.566  1.00 0.00 ? 39 ASP A N    11 
ATOM   8570  C  CA   . ASP A 1 39 ? 25.313 9.537   -5.784  1.00 0.00 ? 39 ASP A CA   11 
ATOM   8571  C  C    . ASP A 1 39 ? 25.836 8.205   -6.337  1.00 0.00 ? 39 ASP A C    11 
ATOM   8572  O  O    . ASP A 1 39 ? 27.042 7.991   -6.443  1.00 0.00 ? 39 ASP A O    11 
ATOM   8573  C  CB   . ASP A 1 39 ? 26.429 10.561  -5.506  1.00 0.00 ? 39 ASP A CB   11 
ATOM   8574  C  CG   . ASP A 1 39 ? 27.412 10.130  -4.415  1.00 0.00 ? 39 ASP A CG   11 
ATOM   8575  O  OD1  . ASP A 1 39 ? 26.939 9.859   -3.289  1.00 0.00 ? 39 ASP A OD1  11 
ATOM   8576  O  OD2  . ASP A 1 39 ? 28.625 10.099  -4.719  1.00 0.00 ? 39 ASP A OD2  11 
ATOM   8577  H  H    . ASP A 1 39 ? 25.061 9.406   -3.698  1.00 0.00 ? 39 ASP A H    11 
ATOM   8578  H  HA   . ASP A 1 39 ? 24.661 9.978   -6.539  1.00 0.00 ? 39 ASP A HA   11 
ATOM   8579  H  HB2  . ASP A 1 39 ? 26.978 10.743  -6.432  1.00 0.00 ? 39 ASP A HB2  11 
ATOM   8580  H  HB3  . ASP A 1 39 ? 25.972 11.501  -5.197  1.00 0.00 ? 39 ASP A HB3  11 
ATOM   8581  N  N    . GLY A 1 40 ? 24.914 7.310   -6.707  1.00 0.00 ? 40 GLY A N    11 
ATOM   8582  C  CA   . GLY A 1 40 ? 25.241 6.003   -7.255  1.00 0.00 ? 40 GLY A CA   11 
ATOM   8583  C  C    . GLY A 1 40 ? 24.008 5.347   -7.872  1.00 0.00 ? 40 GLY A C    11 
ATOM   8584  O  O    . GLY A 1 40 ? 23.012 6.018   -8.141  1.00 0.00 ? 40 GLY A O    11 
ATOM   8585  H  H    . GLY A 1 40 ? 23.935 7.542   -6.598  1.00 0.00 ? 40 GLY A H    11 
ATOM   8586  H  HA2  . GLY A 1 40 ? 26.004 6.104   -8.030  1.00 0.00 ? 40 GLY A HA2  11 
ATOM   8587  H  HA3  . GLY A 1 40 ? 25.627 5.372   -6.453  1.00 0.00 ? 40 GLY A HA3  11 
ATOM   8588  N  N    . GLU A 1 41 ? 24.084 4.031   -8.093  1.00 0.00 ? 41 GLU A N    11 
ATOM   8589  C  CA   . GLU A 1 41 ? 23.102 3.278   -8.856  1.00 0.00 ? 41 GLU A CA   11 
ATOM   8590  C  C    . GLU A 1 41 ? 21.830 3.118   -8.025  1.00 0.00 ? 41 GLU A C    11 
ATOM   8591  O  O    . GLU A 1 41 ? 21.844 2.454   -6.988  1.00 0.00 ? 41 GLU A O    11 
ATOM   8592  C  CB   . GLU A 1 41 ? 23.667 1.903   -9.249  1.00 0.00 ? 41 GLU A CB   11 
ATOM   8593  C  CG   . GLU A 1 41 ? 24.816 1.974   -10.269 1.00 0.00 ? 41 GLU A CG   11 
ATOM   8594  C  CD   . GLU A 1 41 ? 26.104 2.590   -9.722  1.00 0.00 ? 41 GLU A CD   11 
ATOM   8595  O  OE1  . GLU A 1 41 ? 26.374 2.389   -8.518  1.00 0.00 ? 41 GLU A OE1  11 
ATOM   8596  O  OE2  . GLU A 1 41 ? 26.793 3.261   -10.519 1.00 0.00 ? 41 GLU A OE2  11 
ATOM   8597  H  H    . GLU A 1 41 ? 24.933 3.542   -7.834  1.00 0.00 ? 41 GLU A H    11 
ATOM   8598  H  HA   . GLU A 1 41 ? 22.871 3.822   -9.775  1.00 0.00 ? 41 GLU A HA   11 
ATOM   8599  H  HB2  . GLU A 1 41 ? 23.993 1.363   -8.358  1.00 0.00 ? 41 GLU A HB2  11 
ATOM   8600  H  HB3  . GLU A 1 41 ? 22.861 1.331   -9.711  1.00 0.00 ? 41 GLU A HB3  11 
ATOM   8601  H  HG2  . GLU A 1 41 ? 25.048 0.960   -10.595 1.00 0.00 ? 41 GLU A HG2  11 
ATOM   8602  H  HG3  . GLU A 1 41 ? 24.484 2.544   -11.138 1.00 0.00 ? 41 GLU A HG3  11 
ATOM   8603  N  N    . TRP A 1 42 ? 20.730 3.726   -8.483  1.00 0.00 ? 42 TRP A N    11 
ATOM   8604  C  CA   . TRP A 1 42 ? 19.439 3.675   -7.813  1.00 0.00 ? 42 TRP A CA   11 
ATOM   8605  C  C    . TRP A 1 42 ? 18.773 2.328   -8.095  1.00 0.00 ? 42 TRP A C    11 
ATOM   8606  O  O    . TRP A 1 42 ? 17.860 2.240   -8.909  1.00 0.00 ? 42 TRP A O    11 
ATOM   8607  C  CB   . TRP A 1 42 ? 18.570 4.851   -8.284  1.00 0.00 ? 42 TRP A CB   11 
ATOM   8608  C  CG   . TRP A 1 42 ? 19.031 6.235   -7.919  1.00 0.00 ? 42 TRP A CG   11 
ATOM   8609  C  CD1  . TRP A 1 42 ? 20.102 6.549   -7.153  1.00 0.00 ? 42 TRP A CD1  11 
ATOM   8610  C  CD2  . TRP A 1 42 ? 18.417 7.511   -8.273  1.00 0.00 ? 42 TRP A CD2  11 
ATOM   8611  N  NE1  . TRP A 1 42 ? 20.203 7.917   -7.026  1.00 0.00 ? 42 TRP A NE1  11 
ATOM   8612  C  CE2  . TRP A 1 42 ? 19.185 8.564   -7.694  1.00 0.00 ? 42 TRP A CE2  11 
ATOM   8613  C  CE3  . TRP A 1 42 ? 17.280 7.887   -9.023  1.00 0.00 ? 42 TRP A CE3  11 
ATOM   8614  C  CZ2  . TRP A 1 42 ? 18.852 9.917   -7.859  1.00 0.00 ? 42 TRP A CZ2  11 
ATOM   8615  C  CZ3  . TRP A 1 42 ? 16.925 9.241   -9.178  1.00 0.00 ? 42 TRP A CZ3  11 
ATOM   8616  C  CH2  . TRP A 1 42 ? 17.710 10.255  -8.601  1.00 0.00 ? 42 TRP A CH2  11 
ATOM   8617  H  H    . TRP A 1 42 ? 20.792 4.265   -9.334  1.00 0.00 ? 42 TRP A H    11 
ATOM   8618  H  HA   . TRP A 1 42 ? 19.572 3.765   -6.734  1.00 0.00 ? 42 TRP A HA   11 
ATOM   8619  H  HB2  . TRP A 1 42 ? 18.484 4.810   -9.374  1.00 0.00 ? 42 TRP A HB2  11 
ATOM   8620  H  HB3  . TRP A 1 42 ? 17.573 4.725   -7.859  1.00 0.00 ? 42 TRP A HB3  11 
ATOM   8621  H  HD1  . TRP A 1 42 ? 20.783 5.843   -6.703  1.00 0.00 ? 42 TRP A HD1  11 
ATOM   8622  H  HE1  . TRP A 1 42 ? 20.948 8.360   -6.502  1.00 0.00 ? 42 TRP A HE1  11 
ATOM   8623  H  HE3  . TRP A 1 42 ? 16.668 7.123   -9.479  1.00 0.00 ? 42 TRP A HE3  11 
ATOM   8624  H  HZ2  . TRP A 1 42 ? 19.468 10.689  -7.422  1.00 0.00 ? 42 TRP A HZ2  11 
ATOM   8625  H  HZ3  . TRP A 1 42 ? 16.048 9.502   -9.751  1.00 0.00 ? 42 TRP A HZ3  11 
ATOM   8626  H  HH2  . TRP A 1 42 ? 17.437 11.291  -8.732  1.00 0.00 ? 42 TRP A HH2  11 
ATOM   8627  N  N    . GLN A 1 43 ? 19.223 1.275   -7.405  1.00 0.00 ? 43 GLN A N    11 
ATOM   8628  C  CA   . GLN A 1 43 ? 18.568 -0.026  -7.399  1.00 0.00 ? 43 GLN A CA   11 
ATOM   8629  C  C    . GLN A 1 43 ? 17.435 -0.051  -6.367  1.00 0.00 ? 43 GLN A C    11 
ATOM   8630  O  O    . GLN A 1 43 ? 17.180 0.948   -5.695  1.00 0.00 ? 43 GLN A O    11 
ATOM   8631  C  CB   . GLN A 1 43 ? 19.617 -1.116  -7.126  1.00 0.00 ? 43 GLN A CB   11 
ATOM   8632  C  CG   . GLN A 1 43 ? 20.705 -1.156  -8.208  1.00 0.00 ? 43 GLN A CG   11 
ATOM   8633  C  CD   . GLN A 1 43 ? 20.135 -1.540  -9.572  1.00 0.00 ? 43 GLN A CD   11 
ATOM   8634  O  OE1  . GLN A 1 43 ? 19.887 -0.678  -10.412 1.00 0.00 ? 43 GLN A OE1  11 
ATOM   8635  N  NE2  . GLN A 1 43 ? 19.932 -2.840  -9.788  1.00 0.00 ? 43 GLN A NE2  11 
ATOM   8636  H  H    . GLN A 1 43 ? 20.029 1.406   -6.807  1.00 0.00 ? 43 GLN A H    11 
ATOM   8637  H  HA   . GLN A 1 43 ? 18.123 -0.196  -8.382  1.00 0.00 ? 43 GLN A HA   11 
ATOM   8638  H  HB2  . GLN A 1 43 ? 20.086 -0.923  -6.160  1.00 0.00 ? 43 GLN A HB2  11 
ATOM   8639  H  HB3  . GLN A 1 43 ? 19.136 -2.094  -7.085  1.00 0.00 ? 43 GLN A HB3  11 
ATOM   8640  H  HG2  . GLN A 1 43 ? 21.200 -0.187  -8.283  1.00 0.00 ? 43 GLN A HG2  11 
ATOM   8641  H  HG3  . GLN A 1 43 ? 21.456 -1.891  -7.921  1.00 0.00 ? 43 GLN A HG3  11 
ATOM   8642  H  HE21 . GLN A 1 43 ? 20.148 -3.509  -9.063  1.00 0.00 ? 43 GLN A HE21 11 
ATOM   8643  H  HE22 . GLN A 1 43 ? 19.598 -3.163  -10.694 1.00 0.00 ? 43 GLN A HE22 11 
ATOM   8644  N  N    . CYS A 1 44 ? 16.746 -1.195  -6.250  1.00 0.00 ? 44 CYS A N    11 
ATOM   8645  C  CA   . CYS A 1 44 ? 15.702 -1.416  -5.257  1.00 0.00 ? 44 CYS A CA   11 
ATOM   8646  C  C    . CYS A 1 44 ? 15.739 -2.871  -4.758  1.00 0.00 ? 44 CYS A C    11 
ATOM   8647  O  O    . CYS A 1 44 ? 16.394 -3.708  -5.381  1.00 0.00 ? 44 CYS A O    11 
ATOM   8648  C  CB   . CYS A 1 44 ? 14.345 -1.034  -5.864  1.00 0.00 ? 44 CYS A CB   11 
ATOM   8649  S  SG   . CYS A 1 44 ? 13.770 -2.083  -7.217  1.00 0.00 ? 44 CYS A SG   11 
ATOM   8650  H  H    . CYS A 1 44 ? 16.996 -1.982  -6.833  1.00 0.00 ? 44 CYS A H    11 
ATOM   8651  H  HA   . CYS A 1 44 ? 15.894 -0.757  -4.410  1.00 0.00 ? 44 CYS A HA   11 
ATOM   8652  H  HB2  . CYS A 1 44 ? 13.573 -1.067  -5.100  1.00 0.00 ? 44 CYS A HB2  11 
ATOM   8653  H  HB3  . CYS A 1 44 ? 14.407 -0.007  -6.225  1.00 0.00 ? 44 CYS A HB3  11 
ATOM   8654  N  N    . PRO A 1 45 ? 15.036 -3.182  -3.651  1.00 0.00 ? 45 PRO A N    11 
ATOM   8655  C  CA   . PRO A 1 45 ? 14.836 -4.526  -3.119  1.00 0.00 ? 45 PRO A CA   11 
ATOM   8656  C  C    . PRO A 1 45 ? 14.434 -5.610  -4.122  1.00 0.00 ? 45 PRO A C    11 
ATOM   8657  O  O    . PRO A 1 45 ? 14.703 -6.784  -3.874  1.00 0.00 ? 45 PRO A O    11 
ATOM   8658  C  CB   . PRO A 1 45 ? 13.793 -4.365  -2.017  1.00 0.00 ? 45 PRO A CB   11 
ATOM   8659  C  CG   . PRO A 1 45 ? 14.182 -3.018  -1.418  1.00 0.00 ? 45 PRO A CG   11 
ATOM   8660  C  CD   . PRO A 1 45 ? 14.648 -2.214  -2.633  1.00 0.00 ? 45 PRO A CD   11 
ATOM   8661  H  HA   . PRO A 1 45 ? 15.761 -4.832  -2.632  1.00 0.00 ? 45 PRO A HA   11 
ATOM   8662  H  HB2  . PRO A 1 45 ? 12.797 -4.296  -2.458  1.00 0.00 ? 45 PRO A HB2  11 
ATOM   8663  H  HB3  . PRO A 1 45 ? 13.834 -5.172  -1.284  1.00 0.00 ? 45 PRO A HB3  11 
ATOM   8664  H  HG2  . PRO A 1 45 ? 13.351 -2.539  -0.898  1.00 0.00 ? 45 PRO A HG2  11 
ATOM   8665  H  HG3  . PRO A 1 45 ? 15.025 -3.153  -0.739  1.00 0.00 ? 45 PRO A HG3  11 
ATOM   8666  H  HD2  . PRO A 1 45 ? 13.821 -1.601  -2.985  1.00 0.00 ? 45 PRO A HD2  11 
ATOM   8667  H  HD3  . PRO A 1 45 ? 15.494 -1.594  -2.339  1.00 0.00 ? 45 PRO A HD3  11 
ATOM   8668  N  N    . ALA A 1 46 ? 13.778 -5.249  -5.233  1.00 0.00 ? 46 ALA A N    11 
ATOM   8669  C  CA   . ALA A 1 46 ? 13.411 -6.204  -6.268  1.00 0.00 ? 46 ALA A CA   11 
ATOM   8670  C  C    . ALA A 1 46 ? 14.656 -6.720  -6.988  1.00 0.00 ? 46 ALA A C    11 
ATOM   8671  O  O    . ALA A 1 46 ? 14.714 -7.894  -7.348  1.00 0.00 ? 46 ALA A O    11 
ATOM   8672  C  CB   . ALA A 1 46 ? 12.439 -5.561  -7.260  1.00 0.00 ? 46 ALA A CB   11 
ATOM   8673  H  H    . ALA A 1 46 ? 13.671 -4.272  -5.449  1.00 0.00 ? 46 ALA A H    11 
ATOM   8674  H  HA   . ALA A 1 46 ? 12.898 -7.047  -5.801  1.00 0.00 ? 46 ALA A HA   11 
ATOM   8675  H  HB1  . ALA A 1 46 ? 12.092 -6.315  -7.967  1.00 0.00 ? 46 ALA A HB1  11 
ATOM   8676  H  HB2  . ALA A 1 46 ? 11.581 -5.150  -6.726  1.00 0.00 ? 46 ALA A HB2  11 
ATOM   8677  H  HB3  . ALA A 1 46 ? 12.939 -4.767  -7.813  1.00 0.00 ? 46 ALA A HB3  11 
ATOM   8678  N  N    . CYS A 1 47 ? 15.642 -5.840  -7.210  1.00 0.00 ? 47 CYS A N    11 
ATOM   8679  C  CA   . CYS A 1 47 ? 16.853 -6.173  -7.930  1.00 0.00 ? 47 CYS A CA   11 
ATOM   8680  C  C    . CYS A 1 47 ? 17.784 -6.987  -7.033  1.00 0.00 ? 47 CYS A C    11 
ATOM   8681  O  O    . CYS A 1 47 ? 18.148 -8.114  -7.361  1.00 0.00 ? 47 CYS A O    11 
ATOM   8682  C  CB   . CYS A 1 47 ? 17.542 -4.895  -8.410  1.00 0.00 ? 47 CYS A CB   11 
ATOM   8683  S  SG   . CYS A 1 47 ? 16.498 -3.753  -9.338  1.00 0.00 ? 47 CYS A SG   11 
ATOM   8684  H  H    . CYS A 1 47 ? 15.585 -4.906  -6.832  1.00 0.00 ? 47 CYS A H    11 
ATOM   8685  H  HA   . CYS A 1 47 ? 16.575 -6.751  -8.808  1.00 0.00 ? 47 CYS A HA   11 
ATOM   8686  H  HB2  . CYS A 1 47 ? 17.938 -4.345  -7.557  1.00 0.00 ? 47 CYS A HB2  11 
ATOM   8687  H  HB3  . CYS A 1 47 ? 18.369 -5.189  -9.052  1.00 0.00 ? 47 CYS A HB3  11 
ATOM   8688  N  N    . GLN A 1 48 ? 18.176 -6.388  -5.904  1.00 0.00 ? 48 GLN A N    11 
ATOM   8689  C  CA   . GLN A 1 48 ? 19.214 -6.900  -5.027  1.00 0.00 ? 48 GLN A CA   11 
ATOM   8690  C  C    . GLN A 1 48 ? 18.668 -8.069  -4.193  1.00 0.00 ? 48 GLN A C    11 
ATOM   8691  O  O    . GLN A 1 48 ? 17.489 -8.059  -3.841  1.00 0.00 ? 48 GLN A O    11 
ATOM   8692  C  CB   . GLN A 1 48 ? 19.727 -5.749  -4.150  1.00 0.00 ? 48 GLN A CB   11 
ATOM   8693  C  CG   . GLN A 1 48 ? 18.662 -5.231  -3.172  1.00 0.00 ? 48 GLN A CG   11 
ATOM   8694  C  CD   . GLN A 1 48 ? 19.011 -3.858  -2.605  1.00 0.00 ? 48 GLN A CD   11 
ATOM   8695  O  OE1  . GLN A 1 48 ? 18.292 -2.888  -2.835  1.00 0.00 ? 48 GLN A OE1  11 
ATOM   8696  N  NE2  . GLN A 1 48 ? 20.115 -3.769  -1.860  1.00 0.00 ? 48 GLN A NE2  11 
ATOM   8697  H  H    . GLN A 1 48 ? 17.787 -5.485  -5.675  1.00 0.00 ? 48 GLN A H    11 
ATOM   8698  H  HA   . GLN A 1 48 ? 20.037 -7.228  -5.661  1.00 0.00 ? 48 GLN A HA   11 
ATOM   8699  H  HB2  . GLN A 1 48 ? 20.592 -6.091  -3.584  1.00 0.00 ? 48 GLN A HB2  11 
ATOM   8700  H  HB3  . GLN A 1 48 ? 20.036 -4.931  -4.806  1.00 0.00 ? 48 GLN A HB3  11 
ATOM   8701  H  HG2  . GLN A 1 48 ? 17.708 -5.149  -3.684  1.00 0.00 ? 48 GLN A HG2  11 
ATOM   8702  H  HG3  . GLN A 1 48 ? 18.547 -5.936  -2.352  1.00 0.00 ? 48 GLN A HG3  11 
ATOM   8703  H  HE21 . GLN A 1 48 ? 20.686 -4.588  -1.703  1.00 0.00 ? 48 GLN A HE21 11 
ATOM   8704  H  HE22 . GLN A 1 48 ? 20.367 -2.877  -1.457  1.00 0.00 ? 48 GLN A HE22 11 
ATOM   8705  N  N    . PRO A 1 49 ? 19.498 -9.067  -3.849  1.00 0.00 ? 49 PRO A N    11 
ATOM   8706  C  CA   . PRO A 1 49 ? 19.121 -10.139 -2.935  1.00 0.00 ? 49 PRO A CA   11 
ATOM   8707  C  C    . PRO A 1 49 ? 19.286 -9.666  -1.486  1.00 0.00 ? 49 PRO A C    11 
ATOM   8708  O  O    . PRO A 1 49 ? 20.060 -10.235 -0.718  1.00 0.00 ? 49 PRO A O    11 
ATOM   8709  C  CB   . PRO A 1 49 ? 20.041 -11.308 -3.305  1.00 0.00 ? 49 PRO A CB   11 
ATOM   8710  C  CG   . PRO A 1 49 ? 21.314 -10.602 -3.764  1.00 0.00 ? 49 PRO A CG   11 
ATOM   8711  C  CD   . PRO A 1 49 ? 20.771 -9.368  -4.484  1.00 0.00 ? 49 PRO A CD   11 
ATOM   8712  H  HA   . PRO A 1 49 ? 18.085 -10.448 -3.088  1.00 0.00 ? 49 PRO A HA   11 
ATOM   8713  H  HB2  . PRO A 1 49 ? 20.217 -12.008 -2.486  1.00 0.00 ? 49 PRO A HB2  11 
ATOM   8714  H  HB3  . PRO A 1 49 ? 19.610 -11.840 -4.156  1.00 0.00 ? 49 PRO A HB3  11 
ATOM   8715  H  HG2  . PRO A 1 49 ? 21.893 -10.294 -2.892  1.00 0.00 ? 49 PRO A HG2  11 
ATOM   8716  H  HG3  . PRO A 1 49 ? 21.923 -11.229 -4.418  1.00 0.00 ? 49 PRO A HG3  11 
ATOM   8717  H  HD2  . PRO A 1 49 ? 21.479 -8.543  -4.392  1.00 0.00 ? 49 PRO A HD2  11 
ATOM   8718  H  HD3  . PRO A 1 49 ? 20.600 -9.604  -5.536  1.00 0.00 ? 49 PRO A HD3  11 
ATOM   8719  N  N    . ALA A 1 50 ? 18.554 -8.606  -1.125  1.00 0.00 ? 50 ALA A N    11 
ATOM   8720  C  CA   . ALA A 1 50 ? 18.707 -7.870  0.121   1.00 0.00 ? 50 ALA A CA   11 
ATOM   8721  C  C    . ALA A 1 50 ? 17.568 -6.854  0.246   1.00 0.00 ? 50 ALA A C    11 
ATOM   8722  O  O    . ALA A 1 50 ? 16.699 -6.777  -0.624  1.00 0.00 ? 50 ALA A O    11 
ATOM   8723  C  CB   . ALA A 1 50 ? 20.078 -7.177  0.160   1.00 0.00 ? 50 ALA A CB   11 
ATOM   8724  H  H    . ALA A 1 50 ? 17.879 -8.240  -1.785  1.00 0.00 ? 50 ALA A H    11 
ATOM   8725  H  HA   . ALA A 1 50 ? 18.640 -8.567  0.958   1.00 0.00 ? 50 ALA A HA   11 
ATOM   8726  H  HB1  . ALA A 1 50 ? 20.169 -6.482  -0.674  1.00 0.00 ? 50 ALA A HB1  11 
ATOM   8727  H  HB2  . ALA A 1 50 ? 20.199 -6.628  1.093   1.00 0.00 ? 50 ALA A HB2  11 
ATOM   8728  H  HB3  . ALA A 1 50 ? 20.880 -7.912  0.095   1.00 0.00 ? 50 ALA A HB3  11 
ATOM   8729  N  N    . THR A 1 51 ? 17.578 -6.073  1.331   1.00 0.00 ? 51 THR A N    11 
ATOM   8730  C  CA   . THR A 1 51 ? 16.709 -4.922  1.516   1.00 0.00 ? 51 THR A CA   11 
ATOM   8731  C  C    . THR A 1 51 ? 17.513 -3.812  2.194   1.00 0.00 ? 51 THR A C    11 
ATOM   8732  O  O    . THR A 1 51 ? 18.321 -4.149  3.088   1.00 0.00 ? 51 THR A O    11 
ATOM   8733  C  CB   . THR A 1 51 ? 15.480 -5.325  2.346   1.00 0.00 ? 51 THR A CB   11 
ATOM   8734  O  OG1  . THR A 1 51 ? 14.830 -6.422  1.734   1.00 0.00 ? 51 THR A OG1  11 
ATOM   8735  C  CG2  . THR A 1 51 ? 14.477 -4.175  2.479   1.00 0.00 ? 51 THR A CG2  11 
ATOM   8736  O  OXT  . THR A 1 51 ? 17.312 -2.639  1.811   1.00 0.00 ? 51 THR A OXT  11 
ATOM   8737  H  H    . THR A 1 51 ? 18.297 -6.205  2.028   1.00 0.00 ? 51 THR A H    11 
ATOM   8738  H  HA   . THR A 1 51 ? 16.380 -4.554  0.544   1.00 0.00 ? 51 THR A HA   11 
ATOM   8739  H  HB   . THR A 1 51 ? 15.800 -5.628  3.344   1.00 0.00 ? 51 THR A HB   11 
ATOM   8740  H  HG1  . THR A 1 51 ? 14.806 -6.273  0.786   1.00 0.00 ? 51 THR A HG1  11 
ATOM   8741  H  HG21 . THR A 1 51 ? 13.607 -4.516  3.041   1.00 0.00 ? 51 THR A HG21 11 
ATOM   8742  H  HG22 . THR A 1 51 ? 14.928 -3.336  3.010   1.00 0.00 ? 51 THR A HG22 11 
ATOM   8743  H  HG23 . THR A 1 51 ? 14.154 -3.843  1.493   1.00 0.00 ? 51 THR A HG23 11 
HETATM 8744  ZN ZN   . ZN  B 2 .  ? 7.151  4.755   0.050   1.00 0.00 ? 52 ZN  A ZN   11 
HETATM 8745  ZN ZN   . ZN  C 2 .  ? 14.730 -2.290  -9.287  1.00 0.00 ? 53 ZN  A ZN   11 
ATOM   8746  N  N    . ALA A 1 1  ? 6.144  11.412  -7.521  1.00 0.00 ? 1  ALA A N    12 
ATOM   8747  C  CA   . ALA A 1 1  ? 5.643  10.241  -8.264  1.00 0.00 ? 1  ALA A CA   12 
ATOM   8748  C  C    . ALA A 1 1  ? 5.219  9.135   -7.298  1.00 0.00 ? 1  ALA A C    12 
ATOM   8749  O  O    . ALA A 1 1  ? 5.731  9.054   -6.185  1.00 0.00 ? 1  ALA A O    12 
ATOM   8750  C  CB   . ALA A 1 1  ? 6.686  9.729   -9.261  1.00 0.00 ? 1  ALA A CB   12 
ATOM   8751  H  H1   . ALA A 1 1  ? 6.395  12.154  -8.158  1.00 0.00 ? 1  ALA A H1   12 
ATOM   8752  H  H2   . ALA A 1 1  ? 5.434  11.743  -6.884  1.00 0.00 ? 1  ALA A H2   12 
ATOM   8753  H  H3   . ALA A 1 1  ? 6.951  11.143  -6.981  1.00 0.00 ? 1  ALA A H3   12 
ATOM   8754  H  HA   . ALA A 1 1  ? 4.766  10.565  -8.828  1.00 0.00 ? 1  ALA A HA   12 
ATOM   8755  H  HB1  . ALA A 1 1  ? 7.587  9.411   -8.737  1.00 0.00 ? 1  ALA A HB1  12 
ATOM   8756  H  HB2  . ALA A 1 1  ? 6.281  8.883   -9.818  1.00 0.00 ? 1  ALA A HB2  12 
ATOM   8757  H  HB3  . ALA A 1 1  ? 6.943  10.522  -9.965  1.00 0.00 ? 1  ALA A HB3  12 
ATOM   8758  N  N    . ARG A 1 2  ? 4.271  8.292   -7.717  1.00 0.00 ? 2  ARG A N    12 
ATOM   8759  C  CA   . ARG A 1 2  ? 3.620  7.335   -6.833  1.00 0.00 ? 2  ARG A CA   12 
ATOM   8760  C  C    . ARG A 1 2  ? 4.547  6.155   -6.537  1.00 0.00 ? 2  ARG A C    12 
ATOM   8761  O  O    . ARG A 1 2  ? 4.873  5.390   -7.443  1.00 0.00 ? 2  ARG A O    12 
ATOM   8762  C  CB   . ARG A 1 2  ? 2.296  6.859   -7.462  1.00 0.00 ? 2  ARG A CB   12 
ATOM   8763  C  CG   . ARG A 1 2  ? 1.068  7.469   -6.772  1.00 0.00 ? 2  ARG A CG   12 
ATOM   8764  C  CD   . ARG A 1 2  ? 0.587  6.614   -5.590  1.00 0.00 ? 2  ARG A CD   12 
ATOM   8765  N  NE   . ARG A 1 2  ? 1.656  6.297   -4.634  1.00 0.00 ? 2  ARG A NE   12 
ATOM   8766  C  CZ   . ARG A 1 2  ? 2.082  7.091   -3.638  1.00 0.00 ? 2  ARG A CZ   12 
ATOM   8767  N  NH1  . ARG A 1 2  ? 1.631  8.344   -3.508  1.00 0.00 ? 2  ARG A NH1  12 
ATOM   8768  N  NH2  . ARG A 1 2  ? 2.980  6.621   -2.767  1.00 0.00 ? 2  ARG A NH2  12 
ATOM   8769  H  H    . ARG A 1 2  ? 3.948  8.353   -8.671  1.00 0.00 ? 2  ARG A H    12 
ATOM   8770  H  HA   . ARG A 1 2  ? 3.407  7.852   -5.897  1.00 0.00 ? 2  ARG A HA   12 
ATOM   8771  H  HB2  . ARG A 1 2  ? 2.272  7.137   -8.517  1.00 0.00 ? 2  ARG A HB2  12 
ATOM   8772  H  HB3  . ARG A 1 2  ? 2.215  5.771   -7.413  1.00 0.00 ? 2  ARG A HB3  12 
ATOM   8773  H  HG2  . ARG A 1 2  ? 1.278  8.490   -6.454  1.00 0.00 ? 2  ARG A HG2  12 
ATOM   8774  H  HG3  . ARG A 1 2  ? 0.251  7.504   -7.496  1.00 0.00 ? 2  ARG A HG3  12 
ATOM   8775  H  HD2  . ARG A 1 2  ? -0.238 7.118   -5.084  1.00 0.00 ? 2  ARG A HD2  12 
ATOM   8776  H  HD3  . ARG A 1 2  ? 0.207  5.669   -5.982  1.00 0.00 ? 2  ARG A HD3  12 
ATOM   8777  H  HE   . ARG A 1 2  ? 2.078  5.381   -4.721  1.00 0.00 ? 2  ARG A HE   12 
ATOM   8778  H  HH11 . ARG A 1 2  ? 0.957  8.714   -4.159  1.00 0.00 ? 2  ARG A HH11 12 
ATOM   8779  H  HH12 . ARG A 1 2  ? 2.022  8.940   -2.785  1.00 0.00 ? 2  ARG A HH12 12 
ATOM   8780  H  HH21 . ARG A 1 2  ? 3.334  5.680   -2.861  1.00 0.00 ? 2  ARG A HH21 12 
ATOM   8781  H  HH22 . ARG A 1 2  ? 3.312  7.224   -2.025  1.00 0.00 ? 2  ARG A HH22 12 
ATOM   8782  N  N    . CYS A 1 3  ? 4.937  5.991   -5.267  1.00 0.00 ? 3  CYS A N    12 
ATOM   8783  C  CA   . CYS A 1 3  ? 5.630  4.799   -4.795  1.00 0.00 ? 3  CYS A CA   12 
ATOM   8784  C  C    . CYS A 1 3  ? 4.679  3.599   -4.795  1.00 0.00 ? 3  CYS A C    12 
ATOM   8785  O  O    . CYS A 1 3  ? 3.513  3.727   -4.416  1.00 0.00 ? 3  CYS A O    12 
ATOM   8786  C  CB   . CYS A 1 3  ? 6.171  5.042   -3.386  1.00 0.00 ? 3  CYS A CB   12 
ATOM   8787  S  SG   . CYS A 1 3  ? 6.894  3.596   -2.568  1.00 0.00 ? 3  CYS A SG   12 
ATOM   8788  H  H    . CYS A 1 3  ? 4.739  6.721   -4.596  1.00 0.00 ? 3  CYS A H    12 
ATOM   8789  H  HA   . CYS A 1 3  ? 6.476  4.603   -5.454  1.00 0.00 ? 3  CYS A HA   12 
ATOM   8790  H  HB2  . CYS A 1 3  ? 6.929  5.823   -3.434  1.00 0.00 ? 3  CYS A HB2  12 
ATOM   8791  H  HB3  . CYS A 1 3  ? 5.349  5.380   -2.759  1.00 0.00 ? 3  CYS A HB3  12 
ATOM   8792  N  N    . LYS A 1 4  ? 5.201  2.435   -5.204  1.00 0.00 ? 4  LYS A N    12 
ATOM   8793  C  CA   . LYS A 1 4  ? 4.468  1.180   -5.317  1.00 0.00 ? 4  LYS A CA   12 
ATOM   8794  C  C    . LYS A 1 4  ? 4.255  0.518   -3.952  1.00 0.00 ? 4  LYS A C    12 
ATOM   8795  O  O    . LYS A 1 4  ? 3.215  -0.097  -3.725  1.00 0.00 ? 4  LYS A O    12 
ATOM   8796  C  CB   . LYS A 1 4  ? 5.229  0.237   -6.256  1.00 0.00 ? 4  LYS A CB   12 
ATOM   8797  C  CG   . LYS A 1 4  ? 5.251  0.762   -7.697  1.00 0.00 ? 4  LYS A CG   12 
ATOM   8798  C  CD   . LYS A 1 4  ? 6.045  -0.186  -8.604  1.00 0.00 ? 4  LYS A CD   12 
ATOM   8799  C  CE   . LYS A 1 4  ? 6.125  0.329   -10.047 1.00 0.00 ? 4  LYS A CE   12 
ATOM   8800  N  NZ   . LYS A 1 4  ? 4.804  0.371   -10.700 1.00 0.00 ? 4  LYS A NZ   12 
ATOM   8801  H  H    . LYS A 1 4  ? 6.176  2.409   -5.471  1.00 0.00 ? 4  LYS A H    12 
ATOM   8802  H  HA   . LYS A 1 4  ? 3.491  1.376   -5.751  1.00 0.00 ? 4  LYS A HA   12 
ATOM   8803  H  HB2  . LYS A 1 4  ? 6.250  0.120   -5.890  1.00 0.00 ? 4  LYS A HB2  12 
ATOM   8804  H  HB3  . LYS A 1 4  ? 4.734  -0.734  -6.248  1.00 0.00 ? 4  LYS A HB3  12 
ATOM   8805  H  HG2  . LYS A 1 4  ? 4.223  0.847   -8.051  1.00 0.00 ? 4  LYS A HG2  12 
ATOM   8806  H  HG3  . LYS A 1 4  ? 5.717  1.747   -7.722  1.00 0.00 ? 4  LYS A HG3  12 
ATOM   8807  H  HD2  . LYS A 1 4  ? 7.060  -0.275  -8.212  1.00 0.00 ? 4  LYS A HD2  12 
ATOM   8808  H  HD3  . LYS A 1 4  ? 5.585  -1.176  -8.595  1.00 0.00 ? 4  LYS A HD3  12 
ATOM   8809  H  HE2  . LYS A 1 4  ? 6.559  1.328   -10.059 1.00 0.00 ? 4  LYS A HE2  12 
ATOM   8810  H  HE3  . LYS A 1 4  ? 6.771  -0.337  -10.623 1.00 0.00 ? 4  LYS A HE3  12 
ATOM   8811  H  HZ1  . LYS A 1 4  ? 4.392  -0.551  -10.698 1.00 0.00 ? 4  LYS A HZ1  12 
ATOM   8812  H  HZ2  . LYS A 1 4  ? 4.198  1.009   -10.206 1.00 0.00 ? 4  LYS A HZ2  12 
ATOM   8813  H  HZ3  . LYS A 1 4  ? 4.910  0.686   -11.654 1.00 0.00 ? 4  LYS A HZ3  12 
ATOM   8814  N  N    . VAL A 1 5  ? 5.241  0.630   -3.057  1.00 0.00 ? 5  VAL A N    12 
ATOM   8815  C  CA   . VAL A 1 5  ? 5.229  -0.011  -1.745  1.00 0.00 ? 5  VAL A CA   12 
ATOM   8816  C  C    . VAL A 1 5  ? 4.042  0.499   -0.928  1.00 0.00 ? 5  VAL A C    12 
ATOM   8817  O  O    . VAL A 1 5  ? 3.105  -0.253  -0.668  1.00 0.00 ? 5  VAL A O    12 
ATOM   8818  C  CB   . VAL A 1 5  ? 6.564  0.219   -1.017  1.00 0.00 ? 5  VAL A CB   12 
ATOM   8819  C  CG1  . VAL A 1 5  ? 6.574  -0.437  0.371   1.00 0.00 ? 5  VAL A CG1  12 
ATOM   8820  C  CG2  . VAL A 1 5  ? 7.737  -0.339  -1.826  1.00 0.00 ? 5  VAL A CG2  12 
ATOM   8821  H  H    . VAL A 1 5  ? 6.070  1.133   -3.333  1.00 0.00 ? 5  VAL A H    12 
ATOM   8822  H  HA   . VAL A 1 5  ? 5.112  -1.084  -1.892  1.00 0.00 ? 5  VAL A HA   12 
ATOM   8823  H  HB   . VAL A 1 5  ? 6.724  1.286   -0.882  1.00 0.00 ? 5  VAL A HB   12 
ATOM   8824  H  HG11 . VAL A 1 5  ? 5.806  -0.002  1.010   1.00 0.00 ? 5  VAL A HG11 12 
ATOM   8825  H  HG12 . VAL A 1 5  ? 6.402  -1.510  0.279   1.00 0.00 ? 5  VAL A HG12 12 
ATOM   8826  H  HG13 . VAL A 1 5  ? 7.543  -0.269  0.845   1.00 0.00 ? 5  VAL A HG13 12 
ATOM   8827  H  HG21 . VAL A 1 5  ? 8.646  -0.208  -1.244  1.00 0.00 ? 5  VAL A HG21 12 
ATOM   8828  H  HG22 . VAL A 1 5  ? 7.590  -1.401  -2.023  1.00 0.00 ? 5  VAL A HG22 12 
ATOM   8829  H  HG23 . VAL A 1 5  ? 7.851  0.193   -2.771  1.00 0.00 ? 5  VAL A HG23 12 
ATOM   8830  N  N    . CYS A 1 6  ? 4.090  1.771   -0.517  1.00 0.00 ? 6  CYS A N    12 
ATOM   8831  C  CA   . CYS A 1 6  ? 3.139  2.334   0.431   1.00 0.00 ? 6  CYS A CA   12 
ATOM   8832  C  C    . CYS A 1 6  ? 1.812  2.676   -0.251  1.00 0.00 ? 6  CYS A C    12 
ATOM   8833  O  O    . CYS A 1 6  ? 0.755  2.440   0.329   1.00 0.00 ? 6  CYS A O    12 
ATOM   8834  C  CB   . CYS A 1 6  ? 3.742  3.545   1.155   1.00 0.00 ? 6  CYS A CB   12 
ATOM   8835  S  SG   . CYS A 1 6  ? 4.450  4.859   0.126   1.00 0.00 ? 6  CYS A SG   12 
ATOM   8836  H  H    . CYS A 1 6  ? 4.872  2.341   -0.803  1.00 0.00 ? 6  CYS A H    12 
ATOM   8837  H  HA   . CYS A 1 6  ? 2.930  1.587   1.199   1.00 0.00 ? 6  CYS A HA   12 
ATOM   8838  H  HB2  . CYS A 1 6  ? 2.960  3.990   1.772   1.00 0.00 ? 6  CYS A HB2  12 
ATOM   8839  H  HB3  . CYS A 1 6  ? 4.531  3.195   1.822   1.00 0.00 ? 6  CYS A HB3  12 
ATOM   8840  N  N    . ARG A 1 7  ? 1.869  3.232   -1.470  1.00 0.00 ? 7  ARG A N    12 
ATOM   8841  C  CA   . ARG A 1 7  ? 0.724  3.811   -2.172  1.00 0.00 ? 7  ARG A CA   12 
ATOM   8842  C  C    . ARG A 1 7  ? 0.028  4.875   -1.314  1.00 0.00 ? 7  ARG A C    12 
ATOM   8843  O  O    . ARG A 1 7  ? -1.199 4.956   -1.291  1.00 0.00 ? 7  ARG A O    12 
ATOM   8844  C  CB   . ARG A 1 7  ? -0.241 2.716   -2.654  1.00 0.00 ? 7  ARG A CB   12 
ATOM   8845  C  CG   . ARG A 1 7  ? 0.432  1.760   -3.651  1.00 0.00 ? 7  ARG A CG   12 
ATOM   8846  C  CD   . ARG A 1 7  ? 0.018  0.305   -3.411  1.00 0.00 ? 7  ARG A CD   12 
ATOM   8847  N  NE   . ARG A 1 7  ? 0.542  -0.187  -2.126  1.00 0.00 ? 7  ARG A NE   12 
ATOM   8848  C  CZ   . ARG A 1 7  ? -0.164 -0.488  -1.020  1.00 0.00 ? 7  ARG A CZ   12 
ATOM   8849  N  NH1  . ARG A 1 7  ? -1.503 -0.405  -0.991  1.00 0.00 ? 7  ARG A NH1  12 
ATOM   8850  N  NH2  . ARG A 1 7  ? 0.490  -0.872  0.082   1.00 0.00 ? 7  ARG A NH2  12 
ATOM   8851  H  H    . ARG A 1 7  ? 2.772  3.330   -1.911  1.00 0.00 ? 7  ARG A H    12 
ATOM   8852  H  HA   . ARG A 1 7  ? 1.107  4.309   -3.058  1.00 0.00 ? 7  ARG A HA   12 
ATOM   8853  H  HB2  . ARG A 1 7  ? -0.628 2.176   -1.791  1.00 0.00 ? 7  ARG A HB2  12 
ATOM   8854  H  HB3  . ARG A 1 7  ? -1.092 3.176   -3.159  1.00 0.00 ? 7  ARG A HB3  12 
ATOM   8855  H  HG2  . ARG A 1 7  ? 0.151  2.052   -4.664  1.00 0.00 ? 7  ARG A HG2  12 
ATOM   8856  H  HG3  . ARG A 1 7  ? 1.516  1.827   -3.576  1.00 0.00 ? 7  ARG A HG3  12 
ATOM   8857  H  HD2  . ARG A 1 7  ? -1.066 0.218   -3.487  1.00 0.00 ? 7  ARG A HD2  12 
ATOM   8858  H  HD3  . ARG A 1 7  ? 0.456  -0.307  -4.200  1.00 0.00 ? 7  ARG A HD3  12 
ATOM   8859  H  HE   . ARG A 1 7  ? 1.550  -0.270  -2.070  1.00 0.00 ? 7  ARG A HE   12 
ATOM   8860  H  HH11 . ARG A 1 7  ? -2.015 -0.102  -1.805  1.00 0.00 ? 7  ARG A HH11 12 
ATOM   8861  H  HH12 . ARG A 1 7  ? -2.006 -0.631  -0.145  1.00 0.00 ? 7  ARG A HH12 12 
ATOM   8862  H  HH21 . ARG A 1 7  ? 1.504  -0.890  0.070   1.00 0.00 ? 7  ARG A HH21 12 
ATOM   8863  H  HH22 . ARG A 1 7  ? -0.008 -1.103  0.929   1.00 0.00 ? 7  ARG A HH22 12 
ATOM   8864  N  N    . LYS A 1 8  ? 0.827  5.692   -0.615  1.00 0.00 ? 8  LYS A N    12 
ATOM   8865  C  CA   . LYS A 1 8  ? 0.375  6.746   0.279   1.00 0.00 ? 8  LYS A CA   12 
ATOM   8866  C  C    . LYS A 1 8  ? 0.871  8.079   -0.274  1.00 0.00 ? 8  LYS A C    12 
ATOM   8867  O  O    . LYS A 1 8  ? 2.068  8.237   -0.511  1.00 0.00 ? 8  LYS A O    12 
ATOM   8868  C  CB   . LYS A 1 8  ? 0.907  6.463   1.691   1.00 0.00 ? 8  LYS A CB   12 
ATOM   8869  C  CG   . LYS A 1 8  ? 0.472  7.520   2.720   1.00 0.00 ? 8  LYS A CG   12 
ATOM   8870  C  CD   . LYS A 1 8  ? 1.540  8.591   2.991   1.00 0.00 ? 8  LYS A CD   12 
ATOM   8871  C  CE   . LYS A 1 8  ? 2.667  8.065   3.889   1.00 0.00 ? 8  LYS A CE   12 
ATOM   8872  N  NZ   . LYS A 1 8  ? 3.676  9.107   4.145   1.00 0.00 ? 8  LYS A NZ   12 
ATOM   8873  H  H    . LYS A 1 8  ? 1.824  5.573   -0.702  1.00 0.00 ? 8  LYS A H    12 
ATOM   8874  H  HA   . LYS A 1 8  ? -0.713 6.758   0.334   1.00 0.00 ? 8  LYS A HA   12 
ATOM   8875  H  HB2  . LYS A 1 8  ? 0.498  5.500   2.005   1.00 0.00 ? 8  LYS A HB2  12 
ATOM   8876  H  HB3  . LYS A 1 8  ? 1.992  6.386   1.658   1.00 0.00 ? 8  LYS A HB3  12 
ATOM   8877  H  HG2  . LYS A 1 8  ? -0.442 8.005   2.374   1.00 0.00 ? 8  LYS A HG2  12 
ATOM   8878  H  HG3  . LYS A 1 8  ? 0.242  7.020   3.662   1.00 0.00 ? 8  LYS A HG3  12 
ATOM   8879  H  HD2  . LYS A 1 8  ? 1.963  8.953   2.055   1.00 0.00 ? 8  LYS A HD2  12 
ATOM   8880  H  HD3  . LYS A 1 8  ? 1.059  9.429   3.498   1.00 0.00 ? 8  LYS A HD3  12 
ATOM   8881  H  HE2  . LYS A 1 8  ? 2.250  7.741   4.842   1.00 0.00 ? 8  LYS A HE2  12 
ATOM   8882  H  HE3  . LYS A 1 8  ? 3.165  7.219   3.416   1.00 0.00 ? 8  LYS A HE3  12 
ATOM   8883  H  HZ1  . LYS A 1 8  ? 4.110  9.384   3.271   1.00 0.00 ? 8  LYS A HZ1  12 
ATOM   8884  H  HZ2  . LYS A 1 8  ? 3.247  9.912   4.578   1.00 0.00 ? 8  LYS A HZ2  12 
ATOM   8885  H  HZ3  . LYS A 1 8  ? 4.402  8.750   4.750   1.00 0.00 ? 8  LYS A HZ3  12 
ATOM   8886  N  N    . LYS A 1 9  ? -0.050 9.027   -0.487  1.00 0.00 ? 9  LYS A N    12 
ATOM   8887  C  CA   . LYS A 1 9  ? 0.289  10.402  -0.817  1.00 0.00 ? 9  LYS A CA   12 
ATOM   8888  C  C    . LYS A 1 9  ? 0.906  11.079  0.406   1.00 0.00 ? 9  LYS A C    12 
ATOM   8889  O  O    . LYS A 1 9  ? 0.228  11.272  1.413   1.00 0.00 ? 9  LYS A O    12 
ATOM   8890  C  CB   . LYS A 1 9  ? -0.959 11.144  -1.318  1.00 0.00 ? 9  LYS A CB   12 
ATOM   8891  C  CG   . LYS A 1 9  ? -0.706 12.631  -1.621  1.00 0.00 ? 9  LYS A CG   12 
ATOM   8892  C  CD   . LYS A 1 9  ? 0.448  12.913  -2.598  1.00 0.00 ? 9  LYS A CD   12 
ATOM   8893  C  CE   . LYS A 1 9  ? 0.294  12.234  -3.965  1.00 0.00 ? 9  LYS A CE   12 
ATOM   8894  N  NZ   . LYS A 1 9  ? -0.932 12.664  -4.660  1.00 0.00 ? 9  LYS A NZ   12 
ATOM   8895  H  H    . LYS A 1 9  ? -1.018 8.819   -0.291  1.00 0.00 ? 9  LYS A H    12 
ATOM   8896  H  HA   . LYS A 1 9  ? 1.004  10.384  -1.634  1.00 0.00 ? 9  LYS A HA   12 
ATOM   8897  H  HB2  . LYS A 1 9  ? -1.326 10.649  -2.220  1.00 0.00 ? 9  LYS A HB2  12 
ATOM   8898  H  HB3  . LYS A 1 9  ? -1.737 11.084  -0.554  1.00 0.00 ? 9  LYS A HB3  12 
ATOM   8899  H  HG2  . LYS A 1 9  ? -1.627 13.060  -2.017  1.00 0.00 ? 9  LYS A HG2  12 
ATOM   8900  H  HG3  . LYS A 1 9  ? -0.489 13.149  -0.685  1.00 0.00 ? 9  LYS A HG3  12 
ATOM   8901  H  HD2  . LYS A 1 9  ? 0.508  13.992  -2.749  1.00 0.00 ? 9  LYS A HD2  12 
ATOM   8902  H  HD3  . LYS A 1 9  ? 1.394  12.598  -2.154  1.00 0.00 ? 9  LYS A HD3  12 
ATOM   8903  H  HE2  . LYS A 1 9  ? 1.153  12.502  -4.582  1.00 0.00 ? 9  LYS A HE2  12 
ATOM   8904  H  HE3  . LYS A 1 9  ? 0.284  11.152  -3.849  1.00 0.00 ? 9  LYS A HE3  12 
ATOM   8905  H  HZ1  . LYS A 1 9  ? -0.981 12.221  -5.567  1.00 0.00 ? 9  LYS A HZ1  12 
ATOM   8906  H  HZ2  . LYS A 1 9  ? -1.742 12.400  -4.116  1.00 0.00 ? 9  LYS A HZ2  12 
ATOM   8907  H  HZ3  . LYS A 1 9  ? -0.922 13.667  -4.779  1.00 0.00 ? 9  LYS A HZ3  12 
ATOM   8908  N  N    . GLY A 1 10 ? 2.190  11.437  0.313   1.00 0.00 ? 10 GLY A N    12 
ATOM   8909  C  CA   . GLY A 1 10 ? 2.847  12.275  1.299   1.00 0.00 ? 10 GLY A CA   12 
ATOM   8910  C  C    . GLY A 1 10 ? 4.146  12.829  0.724   1.00 0.00 ? 10 GLY A C    12 
ATOM   8911  O  O    . GLY A 1 10 ? 4.158  13.919  0.157   1.00 0.00 ? 10 GLY A O    12 
ATOM   8912  H  H    . GLY A 1 10 ? 2.717  11.167  -0.511  1.00 0.00 ? 10 GLY A H    12 
ATOM   8913  H  HA2  . GLY A 1 10 ? 2.196  13.110  1.565   1.00 0.00 ? 10 GLY A HA2  12 
ATOM   8914  H  HA3  . GLY A 1 10 ? 3.059  11.685  2.194   1.00 0.00 ? 10 GLY A HA3  12 
ATOM   8915  N  N    . GLU A 1 11 ? 5.233  12.067  0.873   1.00 0.00 ? 11 GLU A N    12 
ATOM   8916  C  CA   . GLU A 1 11 ? 6.596  12.500  0.590   1.00 0.00 ? 11 GLU A CA   12 
ATOM   8917  C  C    . GLU A 1 11 ? 7.003  12.121  -0.840  1.00 0.00 ? 11 GLU A C    12 
ATOM   8918  O  O    . GLU A 1 11 ? 8.141  11.720  -1.082  1.00 0.00 ? 11 GLU A O    12 
ATOM   8919  C  CB   . GLU A 1 11 ? 7.563  11.959  1.667   1.00 0.00 ? 11 GLU A CB   12 
ATOM   8920  C  CG   . GLU A 1 11 ? 7.583  10.429  1.829   1.00 0.00 ? 11 GLU A CG   12 
ATOM   8921  C  CD   . GLU A 1 11 ? 6.389  9.867   2.595   1.00 0.00 ? 11 GLU A CD   12 
ATOM   8922  O  OE1  . GLU A 1 11 ? 6.446  9.876   3.842   1.00 0.00 ? 11 GLU A OE1  12 
ATOM   8923  O  OE2  . GLU A 1 11 ? 5.417  9.449   1.924   1.00 0.00 ? 11 GLU A OE2  12 
ATOM   8924  H  H    . GLU A 1 11 ? 5.107  11.126  1.217   1.00 0.00 ? 11 GLU A H    12 
ATOM   8925  H  HA   . GLU A 1 11 ? 6.643  13.588  0.653   1.00 0.00 ? 11 GLU A HA   12 
ATOM   8926  H  HB2  . GLU A 1 11 ? 8.571  12.280  1.393   1.00 0.00 ? 11 GLU A HB2  12 
ATOM   8927  H  HB3  . GLU A 1 11 ? 7.329  12.402  2.638   1.00 0.00 ? 11 GLU A HB3  12 
ATOM   8928  H  HG2  . GLU A 1 11 ? 7.646  9.955   0.857   1.00 0.00 ? 11 GLU A HG2  12 
ATOM   8929  H  HG3  . GLU A 1 11 ? 8.475  10.160  2.390   1.00 0.00 ? 11 GLU A HG3  12 
ATOM   8930  N  N    . ASP A 1 12 ? 6.079  12.266  -1.800  1.00 0.00 ? 12 ASP A N    12 
ATOM   8931  C  CA   . ASP A 1 12 ? 6.229  11.759  -3.160  1.00 0.00 ? 12 ASP A CA   12 
ATOM   8932  C  C    . ASP A 1 12 ? 6.956  12.777  -4.044  1.00 0.00 ? 12 ASP A C    12 
ATOM   8933  O  O    . ASP A 1 12 ? 6.465  13.146  -5.110  1.00 0.00 ? 12 ASP A O    12 
ATOM   8934  C  CB   . ASP A 1 12 ? 4.851  11.382  -3.719  1.00 0.00 ? 12 ASP A CB   12 
ATOM   8935  C  CG   . ASP A 1 12 ? 4.255  10.187  -2.987  1.00 0.00 ? 12 ASP A CG   12 
ATOM   8936  O  OD1  . ASP A 1 12 ? 4.624  9.050   -3.348  1.00 0.00 ? 12 ASP A OD1  12 
ATOM   8937  O  OD2  . ASP A 1 12 ? 3.427  10.426  -2.083  1.00 0.00 ? 12 ASP A OD2  12 
ATOM   8938  H  H    . ASP A 1 12 ? 5.190  12.677  -1.553  1.00 0.00 ? 12 ASP A H    12 
ATOM   8939  H  HA   . ASP A 1 12 ? 6.832  10.855  -3.148  1.00 0.00 ? 12 ASP A HA   12 
ATOM   8940  H  HB2  . ASP A 1 12 ? 4.181  12.239  -3.633  1.00 0.00 ? 12 ASP A HB2  12 
ATOM   8941  H  HB3  . ASP A 1 12 ? 4.942  11.112  -4.771  1.00 0.00 ? 12 ASP A HB3  12 
ATOM   8942  N  N    . ASP A 1 13 ? 8.147  13.199  -3.605  1.00 0.00 ? 13 ASP A N    12 
ATOM   8943  C  CA   . ASP A 1 13 ? 8.889  14.307  -4.185  1.00 0.00 ? 13 ASP A CA   12 
ATOM   8944  C  C    . ASP A 1 13 ? 9.870  13.793  -5.240  1.00 0.00 ? 13 ASP A C    12 
ATOM   8945  O  O    . ASP A 1 13 ? 9.615  13.915  -6.437  1.00 0.00 ? 13 ASP A O    12 
ATOM   8946  C  CB   . ASP A 1 13 ? 9.579  15.091  -3.061  1.00 0.00 ? 13 ASP A CB   12 
ATOM   8947  C  CG   . ASP A 1 13 ? 10.460 16.214  -3.603  1.00 0.00 ? 13 ASP A CG   12 
ATOM   8948  O  OD1  . ASP A 1 13 ? 9.895  17.116  -4.258  1.00 0.00 ? 13 ASP A OD1  12 
ATOM   8949  O  OD2  . ASP A 1 13 ? 11.683 16.146  -3.356  1.00 0.00 ? 13 ASP A OD2  12 
ATOM   8950  H  H    . ASP A 1 13 ? 8.506  12.800  -2.747  1.00 0.00 ? 13 ASP A H    12 
ATOM   8951  H  HA   . ASP A 1 13 ? 8.202  14.992  -4.675  1.00 0.00 ? 13 ASP A HA   12 
ATOM   8952  H  HB2  . ASP A 1 13 ? 8.818  15.527  -2.415  1.00 0.00 ? 13 ASP A HB2  12 
ATOM   8953  H  HB3  . ASP A 1 13 ? 10.185 14.416  -2.458  1.00 0.00 ? 13 ASP A HB3  12 
ATOM   8954  N  N    . LYS A 1 14 ? 10.981 13.207  -4.783  1.00 0.00 ? 14 LYS A N    12 
ATOM   8955  C  CA   . LYS A 1 14 ? 12.130 12.845  -5.596  1.00 0.00 ? 14 LYS A CA   12 
ATOM   8956  C  C    . LYS A 1 14 ? 12.429 11.364  -5.356  1.00 0.00 ? 14 LYS A C    12 
ATOM   8957  O  O    . LYS A 1 14 ? 13.346 11.003  -4.622  1.00 0.00 ? 14 LYS A O    12 
ATOM   8958  C  CB   . LYS A 1 14 ? 13.300 13.778  -5.259  1.00 0.00 ? 14 LYS A CB   12 
ATOM   8959  C  CG   . LYS A 1 14 ? 14.479 13.582  -6.218  1.00 0.00 ? 14 LYS A CG   12 
ATOM   8960  C  CD   . LYS A 1 14 ? 15.619 14.539  -5.857  1.00 0.00 ? 14 LYS A CD   12 
ATOM   8961  C  CE   . LYS A 1 14 ? 16.806 14.313  -6.795  1.00 0.00 ? 14 LYS A CE   12 
ATOM   8962  N  NZ   . LYS A 1 14 ? 17.988 15.080  -6.372  1.00 0.00 ? 14 LYS A NZ   12 
ATOM   8963  H  H    . LYS A 1 14 ? 11.060 13.074  -3.788  1.00 0.00 ? 14 LYS A H    12 
ATOM   8964  H  HA   . LYS A 1 14 ? 11.907 12.981  -6.654  1.00 0.00 ? 14 LYS A HA   12 
ATOM   8965  H  HB2  . LYS A 1 14 ? 12.956 14.810  -5.359  1.00 0.00 ? 14 LYS A HB2  12 
ATOM   8966  H  HB3  . LYS A 1 14 ? 13.618 13.609  -4.229  1.00 0.00 ? 14 LYS A HB3  12 
ATOM   8967  H  HG2  . LYS A 1 14 ? 14.839 12.555  -6.159  1.00 0.00 ? 14 LYS A HG2  12 
ATOM   8968  H  HG3  . LYS A 1 14 ? 14.151 13.783  -7.239  1.00 0.00 ? 14 LYS A HG3  12 
ATOM   8969  H  HD2  . LYS A 1 14 ? 15.273 15.571  -5.944  1.00 0.00 ? 14 LYS A HD2  12 
ATOM   8970  H  HD3  . LYS A 1 14 ? 15.928 14.360  -4.826  1.00 0.00 ? 14 LYS A HD3  12 
ATOM   8971  H  HE2  . LYS A 1 14 ? 17.076 13.257  -6.799  1.00 0.00 ? 14 LYS A HE2  12 
ATOM   8972  H  HE3  . LYS A 1 14 ? 16.531 14.607  -7.809  1.00 0.00 ? 14 LYS A HE3  12 
ATOM   8973  H  HZ1  . LYS A 1 14 ? 17.793 16.070  -6.384  1.00 0.00 ? 14 LYS A HZ1  12 
ATOM   8974  H  HZ2  . LYS A 1 14 ? 18.271 14.792  -5.446  1.00 0.00 ? 14 LYS A HZ2  12 
ATOM   8975  H  HZ3  . LYS A 1 14 ? 18.750 14.870  -7.007  1.00 0.00 ? 14 LYS A HZ3  12 
ATOM   8976  N  N    . LEU A 1 15 ? 11.617 10.515  -5.991  1.00 0.00 ? 15 LEU A N    12 
ATOM   8977  C  CA   . LEU A 1 15 ? 11.570 9.080   -5.752  1.00 0.00 ? 15 LEU A CA   12 
ATOM   8978  C  C    . LEU A 1 15 ? 12.847 8.427   -6.274  1.00 0.00 ? 15 LEU A C    12 
ATOM   8979  O  O    . LEU A 1 15 ? 13.379 8.833   -7.307  1.00 0.00 ? 15 LEU A O    12 
ATOM   8980  C  CB   . LEU A 1 15 ? 10.362 8.469   -6.481  1.00 0.00 ? 15 LEU A CB   12 
ATOM   8981  C  CG   . LEU A 1 15 ? 8.989  8.706   -5.831  1.00 0.00 ? 15 LEU A CG   12 
ATOM   8982  C  CD1  . LEU A 1 15 ? 8.782  7.824   -4.596  1.00 0.00 ? 15 LEU A CD1  12 
ATOM   8983  C  CD2  . LEU A 1 15 ? 8.726  10.172  -5.471  1.00 0.00 ? 15 LEU A CD2  12 
ATOM   8984  H  H    . LEU A 1 15 ? 10.912 10.913  -6.591  1.00 0.00 ? 15 LEU A H    12 
ATOM   8985  H  HA   . LEU A 1 15 ? 11.488 8.898   -4.679  1.00 0.00 ? 15 LEU A HA   12 
ATOM   8986  H  HB2  . LEU A 1 15 ? 10.337 8.870   -7.498  1.00 0.00 ? 15 LEU A HB2  12 
ATOM   8987  H  HB3  . LEU A 1 15 ? 10.504 7.387   -6.550  1.00 0.00 ? 15 LEU A HB3  12 
ATOM   8988  H  HG   . LEU A 1 15 ? 8.242  8.403   -6.564  1.00 0.00 ? 15 LEU A HG   12 
ATOM   8989  H  HD11 . LEU A 1 15 ? 7.784  7.994   -4.194  1.00 0.00 ? 15 LEU A HD11 12 
ATOM   8990  H  HD12 . LEU A 1 15 ? 8.873  6.775   -4.873  1.00 0.00 ? 15 LEU A HD12 12 
ATOM   8991  H  HD13 . LEU A 1 15 ? 9.519  8.063   -3.831  1.00 0.00 ? 15 LEU A HD13 12 
ATOM   8992  H  HD21 . LEU A 1 15 ? 7.690  10.279  -5.163  1.00 0.00 ? 15 LEU A HD21 12 
ATOM   8993  H  HD22 . LEU A 1 15 ? 9.361  10.486  -4.643  1.00 0.00 ? 15 LEU A HD22 12 
ATOM   8994  H  HD23 . LEU A 1 15 ? 8.899  10.810  -6.337  1.00 0.00 ? 15 LEU A HD23 12 
ATOM   8995  N  N    . ILE A 1 16 ? 13.327 7.405   -5.555  1.00 0.00 ? 16 ILE A N    12 
ATOM   8996  C  CA   . ILE A 1 16 ? 14.391 6.538   -6.029  1.00 0.00 ? 16 ILE A CA   12 
ATOM   8997  C  C    . ILE A 1 16 ? 13.762 5.501   -6.967  1.00 0.00 ? 16 ILE A C    12 
ATOM   8998  O  O    . ILE A 1 16 ? 13.544 4.345   -6.607  1.00 0.00 ? 16 ILE A O    12 
ATOM   8999  C  CB   . ILE A 1 16 ? 15.235 5.994   -4.855  1.00 0.00 ? 16 ILE A CB   12 
ATOM   9000  C  CG1  . ILE A 1 16 ? 16.271 4.972   -5.345  1.00 0.00 ? 16 ILE A CG1  12 
ATOM   9001  C  CG2  . ILE A 1 16 ? 14.424 5.418   -3.686  1.00 0.00 ? 16 ILE A CG2  12 
ATOM   9002  C  CD1  . ILE A 1 16 ? 17.504 4.939   -4.439  1.00 0.00 ? 16 ILE A CD1  12 
ATOM   9003  H  H    . ILE A 1 16 ? 12.791 7.088   -4.758  1.00 0.00 ? 16 ILE A H    12 
ATOM   9004  H  HA   . ILE A 1 16 ? 15.085 7.130   -6.628  1.00 0.00 ? 16 ILE A HA   12 
ATOM   9005  H  HB   . ILE A 1 16 ? 15.779 6.853   -4.458  1.00 0.00 ? 16 ILE A HB   12 
ATOM   9006  H  HG12 . ILE A 1 16 ? 15.824 3.977   -5.389  1.00 0.00 ? 16 ILE A HG12 12 
ATOM   9007  H  HG13 . ILE A 1 16 ? 16.608 5.253   -6.341  1.00 0.00 ? 16 ILE A HG13 12 
ATOM   9008  H  HG21 . ILE A 1 16 ? 15.096 5.058   -2.909  1.00 0.00 ? 16 ILE A HG21 12 
ATOM   9009  H  HG22 . ILE A 1 16 ? 13.804 6.198   -3.245  1.00 0.00 ? 16 ILE A HG22 12 
ATOM   9010  H  HG23 . ILE A 1 16 ? 13.800 4.592   -4.021  1.00 0.00 ? 16 ILE A HG23 12 
ATOM   9011  H  HD11 . ILE A 1 16 ? 18.218 4.208   -4.817  1.00 0.00 ? 16 ILE A HD11 12 
ATOM   9012  H  HD12 . ILE A 1 16 ? 17.970 5.922   -4.437  1.00 0.00 ? 16 ILE A HD12 12 
ATOM   9013  H  HD13 . ILE A 1 16 ? 17.235 4.674   -3.419  1.00 0.00 ? 16 ILE A HD13 12 
ATOM   9014  N  N    . LEU A 1 17 ? 13.465 5.956   -8.190  1.00 0.00 ? 17 LEU A N    12 
ATOM   9015  C  CA   . LEU A 1 17 ? 13.045 5.133   -9.313  1.00 0.00 ? 17 LEU A CA   12 
ATOM   9016  C  C    . LEU A 1 17 ? 14.231 4.285   -9.765  1.00 0.00 ? 17 LEU A C    12 
ATOM   9017  O  O    . LEU A 1 17 ? 15.246 4.824   -10.202 1.00 0.00 ? 17 LEU A O    12 
ATOM   9018  C  CB   . LEU A 1 17 ? 12.576 6.047   -10.456 1.00 0.00 ? 17 LEU A CB   12 
ATOM   9019  C  CG   . LEU A 1 17 ? 11.180 6.637   -10.200 1.00 0.00 ? 17 LEU A CG   12 
ATOM   9020  C  CD1  . LEU A 1 17 ? 11.035 7.988   -10.909 1.00 0.00 ? 17 LEU A CD1  12 
ATOM   9021  C  CD2  . LEU A 1 17 ? 10.096 5.682   -10.718 1.00 0.00 ? 17 LEU A CD2  12 
ATOM   9022  H  H    . LEU A 1 17 ? 13.592 6.945   -8.368  1.00 0.00 ? 17 LEU A H    12 
ATOM   9023  H  HA   . LEU A 1 17 ? 12.222 4.488   -9.008  1.00 0.00 ? 17 LEU A HA   12 
ATOM   9024  H  HB2  . LEU A 1 17 ? 13.300 6.859   -10.561 1.00 0.00 ? 17 LEU A HB2  12 
ATOM   9025  H  HB3  . LEU A 1 17 ? 12.556 5.484   -11.392 1.00 0.00 ? 17 LEU A HB3  12 
ATOM   9026  H  HG   . LEU A 1 17 ? 11.037 6.798   -9.131  1.00 0.00 ? 17 LEU A HG   12 
ATOM   9027  H  HD11 . LEU A 1 17 ? 10.034 8.388   -10.742 1.00 0.00 ? 17 LEU A HD11 12 
ATOM   9028  H  HD12 . LEU A 1 17 ? 11.764 8.694   -10.509 1.00 0.00 ? 17 LEU A HD12 12 
ATOM   9029  H  HD13 . LEU A 1 17 ? 11.200 7.870   -11.980 1.00 0.00 ? 17 LEU A HD13 12 
ATOM   9030  H  HD21 . LEU A 1 17 ? 9.112  6.077   -10.467 1.00 0.00 ? 17 LEU A HD21 12 
ATOM   9031  H  HD22 . LEU A 1 17 ? 10.170 5.582   -11.800 1.00 0.00 ? 17 LEU A HD22 12 
ATOM   9032  H  HD23 . LEU A 1 17 ? 10.212 4.696   -10.268 1.00 0.00 ? 17 LEU A HD23 12 
ATOM   9033  N  N    . CYS A 1 18 ? 14.100 2.959   -9.650  1.00 0.00 ? 18 CYS A N    12 
ATOM   9034  C  CA   . CYS A 1 18 ? 15.213 2.040   -9.831  1.00 0.00 ? 18 CYS A CA   12 
ATOM   9035  C  C    . CYS A 1 18 ? 15.656 1.983   -11.298 1.00 0.00 ? 18 CYS A C    12 
ATOM   9036  O  O    . CYS A 1 18 ? 14.827 1.821   -12.189 1.00 0.00 ? 18 CYS A O    12 
ATOM   9037  C  CB   . CYS A 1 18 ? 14.821 0.656   -9.311  1.00 0.00 ? 18 CYS A CB   12 
ATOM   9038  S  SG   . CYS A 1 18 ? 16.067 -0.614  -9.612  1.00 0.00 ? 18 CYS A SG   12 
ATOM   9039  H  H    . CYS A 1 18 ? 13.226 2.583   -9.305  1.00 0.00 ? 18 CYS A H    12 
ATOM   9040  H  HA   . CYS A 1 18 ? 16.037 2.395   -9.215  1.00 0.00 ? 18 CYS A HA   12 
ATOM   9041  H  HB2  . CYS A 1 18 ? 14.652 0.727   -8.236  1.00 0.00 ? 18 CYS A HB2  12 
ATOM   9042  H  HB3  . CYS A 1 18 ? 13.897 0.326   -9.784  1.00 0.00 ? 18 CYS A HB3  12 
ATOM   9043  N  N    . ASP A 1 19 ? 16.967 2.085   -11.541 1.00 0.00 ? 19 ASP A N    12 
ATOM   9044  C  CA   . ASP A 1 19 ? 17.574 2.031   -12.866 1.00 0.00 ? 19 ASP A CA   12 
ATOM   9045  C  C    . ASP A 1 19 ? 17.175 0.750   -13.595 1.00 0.00 ? 19 ASP A C    12 
ATOM   9046  O  O    . ASP A 1 19 ? 16.697 0.791   -14.727 1.00 0.00 ? 19 ASP A O    12 
ATOM   9047  C  CB   . ASP A 1 19 ? 19.107 2.087   -12.745 1.00 0.00 ? 19 ASP A CB   12 
ATOM   9048  C  CG   . ASP A 1 19 ? 19.625 3.375   -12.112 1.00 0.00 ? 19 ASP A CG   12 
ATOM   9049  O  OD1  . ASP A 1 19 ? 19.104 4.445   -12.494 1.00 0.00 ? 19 ASP A OD1  12 
ATOM   9050  O  OD2  . ASP A 1 19 ? 20.546 3.267   -11.270 1.00 0.00 ? 19 ASP A OD2  12 
ATOM   9051  H  H    . ASP A 1 19 ? 17.591 2.215   -10.760 1.00 0.00 ? 19 ASP A H    12 
ATOM   9052  H  HA   . ASP A 1 19 ? 17.224 2.882   -13.446 1.00 0.00 ? 19 ASP A HA   12 
ATOM   9053  H  HB2  . ASP A 1 19 ? 19.458 1.239   -12.156 1.00 0.00 ? 19 ASP A HB2  12 
ATOM   9054  H  HB3  . ASP A 1 19 ? 19.538 2.009   -13.744 1.00 0.00 ? 19 ASP A HB3  12 
ATOM   9055  N  N    . GLU A 1 20 ? 17.382 -0.382  -12.921 1.00 0.00 ? 20 GLU A N    12 
ATOM   9056  C  CA   . GLU A 1 20 ? 17.285 -1.711  -13.495 1.00 0.00 ? 20 GLU A CA   12 
ATOM   9057  C  C    . GLU A 1 20 ? 15.851 -2.040  -13.915 1.00 0.00 ? 20 GLU A C    12 
ATOM   9058  O  O    . GLU A 1 20 ? 15.599 -2.315  -15.087 1.00 0.00 ? 20 GLU A O    12 
ATOM   9059  C  CB   . GLU A 1 20 ? 17.839 -2.716  -12.469 1.00 0.00 ? 20 GLU A CB   12 
ATOM   9060  C  CG   . GLU A 1 20 ? 17.802 -4.173  -12.945 1.00 0.00 ? 20 GLU A CG   12 
ATOM   9061  C  CD   . GLU A 1 20 ? 18.666 -4.395  -14.182 1.00 0.00 ? 20 GLU A CD   12 
ATOM   9062  O  OE1  . GLU A 1 20 ? 19.899 -4.245  -14.046 1.00 0.00 ? 20 GLU A OE1  12 
ATOM   9063  O  OE2  . GLU A 1 20 ? 18.079 -4.710  -15.239 1.00 0.00 ? 20 GLU A OE2  12 
ATOM   9064  H  H    . GLU A 1 20 ? 17.738 -0.301  -11.980 1.00 0.00 ? 20 GLU A H    12 
ATOM   9065  H  HA   . GLU A 1 20 ? 17.920 -1.738  -14.381 1.00 0.00 ? 20 GLU A HA   12 
ATOM   9066  H  HB2  . GLU A 1 20 ? 18.877 -2.453  -12.254 1.00 0.00 ? 20 GLU A HB2  12 
ATOM   9067  H  HB3  . GLU A 1 20 ? 17.263 -2.647  -11.545 1.00 0.00 ? 20 GLU A HB3  12 
ATOM   9068  H  HG2  . GLU A 1 20 ? 18.186 -4.808  -12.145 1.00 0.00 ? 20 GLU A HG2  12 
ATOM   9069  H  HG3  . GLU A 1 20 ? 16.774 -4.475  -13.152 1.00 0.00 ? 20 GLU A HG3  12 
ATOM   9070  N  N    . CYS A 1 21 ? 14.918 -2.006  -12.955 1.00 0.00 ? 21 CYS A N    12 
ATOM   9071  C  CA   . CYS A 1 21 ? 13.559 -2.516  -13.111 1.00 0.00 ? 21 CYS A CA   12 
ATOM   9072  C  C    . CYS A 1 21 ? 12.460 -1.464  -12.904 1.00 0.00 ? 21 CYS A C    12 
ATOM   9073  O  O    . CYS A 1 21 ? 11.286 -1.828  -12.874 1.00 0.00 ? 21 CYS A O    12 
ATOM   9074  C  CB   . CYS A 1 21 ? 13.402 -3.716  -12.170 1.00 0.00 ? 21 CYS A CB   12 
ATOM   9075  S  SG   . CYS A 1 21 ? 13.818 -3.385  -10.435 1.00 0.00 ? 21 CYS A SG   12 
ATOM   9076  H  H    . CYS A 1 21 ? 15.186 -1.651  -12.049 1.00 0.00 ? 21 CYS A H    12 
ATOM   9077  H  HA   . CYS A 1 21 ? 13.415 -2.893  -14.125 1.00 0.00 ? 21 CYS A HA   12 
ATOM   9078  H  HB2  . CYS A 1 21 ? 12.381 -4.098  -12.222 1.00 0.00 ? 21 CYS A HB2  12 
ATOM   9079  H  HB3  . CYS A 1 21 ? 14.077 -4.501  -12.520 1.00 0.00 ? 21 CYS A HB3  12 
ATOM   9080  N  N    . ASN A 1 22 ? 12.817 -0.178  -12.770 1.00 0.00 ? 22 ASN A N    12 
ATOM   9081  C  CA   . ASN A 1 22 ? 11.885 0.950   -12.784 1.00 0.00 ? 22 ASN A CA   12 
ATOM   9082  C  C    . ASN A 1 22 ? 10.726 0.781   -11.796 1.00 0.00 ? 22 ASN A C    12 
ATOM   9083  O  O    . ASN A 1 22 ? 9.567  1.038   -12.120 1.00 0.00 ? 22 ASN A O    12 
ATOM   9084  C  CB   . ASN A 1 22 ? 11.432 1.226   -14.226 1.00 0.00 ? 22 ASN A CB   12 
ATOM   9085  C  CG   . ASN A 1 22 ? 10.736 2.579   -14.368 1.00 0.00 ? 22 ASN A CG   12 
ATOM   9086  O  OD1  . ASN A 1 22 ? 9.555  2.644   -14.700 1.00 0.00 ? 22 ASN A OD1  12 
ATOM   9087  N  ND2  . ASN A 1 22 ? 11.468 3.668   -14.119 1.00 0.00 ? 22 ASN A ND2  12 
ATOM   9088  H  H    . ASN A 1 22 ? 13.800 0.059   -12.752 1.00 0.00 ? 22 ASN A H    12 
ATOM   9089  H  HA   . ASN A 1 22 ? 12.430 1.825   -12.446 1.00 0.00 ? 22 ASN A HA   12 
ATOM   9090  H  HB2  . ASN A 1 22 ? 12.310 1.230   -14.877 1.00 0.00 ? 22 ASN A HB2  12 
ATOM   9091  H  HB3  . ASN A 1 22 ? 10.760 0.430   -14.550 1.00 0.00 ? 22 ASN A HB3  12 
ATOM   9092  H  HD21 . ASN A 1 22 ? 12.445 3.573   -13.874 1.00 0.00 ? 22 ASN A HD21 12 
ATOM   9093  H  HD22 . ASN A 1 22 ? 11.037 4.580   -14.190 1.00 0.00 ? 22 ASN A HD22 12 
ATOM   9094  N  N    . LYS A 1 23 ? 11.054 0.358   -10.572 1.00 0.00 ? 23 LYS A N    12 
ATOM   9095  C  CA   . LYS A 1 23 ? 10.144 0.336   -9.448  1.00 0.00 ? 23 LYS A CA   12 
ATOM   9096  C  C    . LYS A 1 23 ? 10.267 1.664   -8.703  1.00 0.00 ? 23 LYS A C    12 
ATOM   9097  O  O    . LYS A 1 23 ? 11.364 2.055   -8.306  1.00 0.00 ? 23 LYS A O    12 
ATOM   9098  C  CB   . LYS A 1 23 ? 10.493 -0.849  -8.546  1.00 0.00 ? 23 LYS A CB   12 
ATOM   9099  C  CG   . LYS A 1 23 ? 10.281 -2.186  -9.267  1.00 0.00 ? 23 LYS A CG   12 
ATOM   9100  C  CD   . LYS A 1 23 ? 10.571 -3.361  -8.328  1.00 0.00 ? 23 LYS A CD   12 
ATOM   9101  C  CE   . LYS A 1 23 ? 10.366 -4.692  -9.060  1.00 0.00 ? 23 LYS A CE   12 
ATOM   9102  N  NZ   . LYS A 1 23 ? 10.663 -5.843  -8.188  1.00 0.00 ? 23 LYS A NZ   12 
ATOM   9103  H  H    . LYS A 1 23 ? 12.007 0.098   -10.378 1.00 0.00 ? 23 LYS A H    12 
ATOM   9104  H  HA   . LYS A 1 23 ? 9.119  0.203   -9.795  1.00 0.00 ? 23 LYS A HA   12 
ATOM   9105  H  HB2  . LYS A 1 23 ? 11.531 -0.770  -8.213  1.00 0.00 ? 23 LYS A HB2  12 
ATOM   9106  H  HB3  . LYS A 1 23 ? 9.832  -0.804  -7.687  1.00 0.00 ? 23 LYS A HB3  12 
ATOM   9107  H  HG2  . LYS A 1 23 ? 9.248  -2.247  -9.613  1.00 0.00 ? 23 LYS A HG2  12 
ATOM   9108  H  HG3  . LYS A 1 23 ? 10.944 -2.249  -10.130 1.00 0.00 ? 23 LYS A HG3  12 
ATOM   9109  H  HD2  . LYS A 1 23 ? 11.601 -3.293  -7.976  1.00 0.00 ? 23 LYS A HD2  12 
ATOM   9110  H  HD3  . LYS A 1 23 ? 9.897  -3.313  -7.472  1.00 0.00 ? 23 LYS A HD3  12 
ATOM   9111  H  HE2  . LYS A 1 23 ? 9.332  -4.765  -9.398  1.00 0.00 ? 23 LYS A HE2  12 
ATOM   9112  H  HE3  . LYS A 1 23 ? 11.022 -4.735  -9.931  1.00 0.00 ? 23 LYS A HE3  12 
ATOM   9113  H  HZ1  . LYS A 1 23 ? 10.054 -5.827  -7.382  1.00 0.00 ? 23 LYS A HZ1  12 
ATOM   9114  H  HZ2  . LYS A 1 23 ? 10.514 -6.701  -8.701  1.00 0.00 ? 23 LYS A HZ2  12 
ATOM   9115  H  HZ3  . LYS A 1 23 ? 11.625 -5.801  -7.883  1.00 0.00 ? 23 LYS A HZ3  12 
ATOM   9116  N  N    . ALA A 1 24 ? 9.135  2.356   -8.532  1.00 0.00 ? 24 ALA A N    12 
ATOM   9117  C  CA   . ALA A 1 24 ? 9.048  3.573   -7.745  1.00 0.00 ? 24 ALA A CA   12 
ATOM   9118  C  C    . ALA A 1 24 ? 9.109  3.226   -6.258  1.00 0.00 ? 24 ALA A C    12 
ATOM   9119  O  O    . ALA A 1 24 ? 8.229  2.546   -5.731  1.00 0.00 ? 24 ALA A O    12 
ATOM   9120  C  CB   . ALA A 1 24 ? 7.768  4.334   -8.102  1.00 0.00 ? 24 ALA A CB   12 
ATOM   9121  H  H    . ALA A 1 24 ? 8.274  1.995   -8.914  1.00 0.00 ? 24 ALA A H    12 
ATOM   9122  H  HA   . ALA A 1 24 ? 9.884  4.225   -7.998  1.00 0.00 ? 24 ALA A HA   12 
ATOM   9123  H  HB1  . ALA A 1 24 ? 6.894  3.739   -7.849  1.00 0.00 ? 24 ALA A HB1  12 
ATOM   9124  H  HB2  . ALA A 1 24 ? 7.733  5.280   -7.560  1.00 0.00 ? 24 ALA A HB2  12 
ATOM   9125  H  HB3  . ALA A 1 24 ? 7.747  4.544   -9.170  1.00 0.00 ? 24 ALA A HB3  12 
ATOM   9126  N  N    . PHE A 1 25 ? 10.189 3.665   -5.606  1.00 0.00 ? 25 PHE A N    12 
ATOM   9127  C  CA   . PHE A 1 25 ? 10.416 3.524   -4.178  1.00 0.00 ? 25 PHE A CA   12 
ATOM   9128  C  C    . PHE A 1 25 ? 10.772 4.884   -3.583  1.00 0.00 ? 25 PHE A C    12 
ATOM   9129  O  O    . PHE A 1 25 ? 11.387 5.714   -4.248  1.00 0.00 ? 25 PHE A O    12 
ATOM   9130  C  CB   . PHE A 1 25 ? 11.582 2.553   -3.929  1.00 0.00 ? 25 PHE A CB   12 
ATOM   9131  C  CG   . PHE A 1 25 ? 11.196 1.095   -3.774  1.00 0.00 ? 25 PHE A CG   12 
ATOM   9132  C  CD1  . PHE A 1 25 ? 10.836 0.328   -4.898  1.00 0.00 ? 25 PHE A CD1  12 
ATOM   9133  C  CD2  . PHE A 1 25 ? 11.251 0.486   -2.504  1.00 0.00 ? 25 PHE A CD2  12 
ATOM   9134  C  CE1  . PHE A 1 25 ? 10.507 -1.031  -4.748  1.00 0.00 ? 25 PHE A CE1  12 
ATOM   9135  C  CE2  . PHE A 1 25 ? 10.933 -0.875  -2.360  1.00 0.00 ? 25 PHE A CE2  12 
ATOM   9136  C  CZ   . PHE A 1 25 ? 10.546 -1.630  -3.479  1.00 0.00 ? 25 PHE A CZ   12 
ATOM   9137  H  H    . PHE A 1 25 ? 10.894 4.165   -6.129  1.00 0.00 ? 25 PHE A H    12 
ATOM   9138  H  HA   . PHE A 1 25 ? 9.530  3.145   -3.670  1.00 0.00 ? 25 PHE A HA   12 
ATOM   9139  H  HB2  . PHE A 1 25 ? 12.312 2.642   -4.738  1.00 0.00 ? 25 PHE A HB2  12 
ATOM   9140  H  HB3  . PHE A 1 25 ? 12.082 2.851   -3.004  1.00 0.00 ? 25 PHE A HB3  12 
ATOM   9141  H  HD1  . PHE A 1 25 ? 10.816 0.783   -5.877  1.00 0.00 ? 25 PHE A HD1  12 
ATOM   9142  H  HD2  . PHE A 1 25 ? 11.531 1.061   -1.633  1.00 0.00 ? 25 PHE A HD2  12 
ATOM   9143  H  HE1  . PHE A 1 25 ? 10.227 -1.624  -5.603  1.00 0.00 ? 25 PHE A HE1  12 
ATOM   9144  H  HE2  . PHE A 1 25 ? 10.964 -1.336  -1.382  1.00 0.00 ? 25 PHE A HE2  12 
ATOM   9145  H  HZ   . PHE A 1 25 ? 10.281 -2.672  -3.363  1.00 0.00 ? 25 PHE A HZ   12 
ATOM   9146  N  N    . HIS A 1 26 ? 10.353 5.113   -2.332  1.00 0.00 ? 26 HIS A N    12 
ATOM   9147  C  CA   . HIS A 1 26 ? 10.835 6.234   -1.541  1.00 0.00 ? 26 HIS A CA   12 
ATOM   9148  C  C    . HIS A 1 26 ? 12.147 5.780   -0.901  1.00 0.00 ? 26 HIS A C    12 
ATOM   9149  O  O    . HIS A 1 26 ? 12.424 4.581   -0.824  1.00 0.00 ? 26 HIS A O    12 
ATOM   9150  C  CB   . HIS A 1 26 ? 9.851  6.595   -0.425  1.00 0.00 ? 26 HIS A CB   12 
ATOM   9151  C  CG   . HIS A 1 26 ? 8.563  7.228   -0.875  1.00 0.00 ? 26 HIS A CG   12 
ATOM   9152  N  ND1  . HIS A 1 26 ? 7.317  6.605   -0.863  1.00 0.00 ? 26 HIS A ND1  12 
ATOM   9153  C  CD2  . HIS A 1 26 ? 8.413  8.538   -1.222  1.00 0.00 ? 26 HIS A CD2  12 
ATOM   9154  C  CE1  . HIS A 1 26 ? 6.437  7.564   -1.185  1.00 0.00 ? 26 HIS A CE1  12 
ATOM   9155  N  NE2  . HIS A 1 26 ? 7.065  8.730   -1.408  1.00 0.00 ? 26 HIS A NE2  12 
ATOM   9156  H  H    . HIS A 1 26 ? 9.790  4.418   -1.867  1.00 0.00 ? 26 HIS A H    12 
ATOM   9157  H  HA   . HIS A 1 26 ? 11.014 7.111   -2.165  1.00 0.00 ? 26 HIS A HA   12 
ATOM   9158  H  HB2  . HIS A 1 26 ? 9.626  5.705   0.155   1.00 0.00 ? 26 HIS A HB2  12 
ATOM   9159  H  HB3  . HIS A 1 26 ? 10.336 7.309   0.240   1.00 0.00 ? 26 HIS A HB3  12 
ATOM   9160  H  HD2  . HIS A 1 26 ? 9.189  9.287   -1.272  1.00 0.00 ? 26 HIS A HD2  12 
ATOM   9161  H  HE1  . HIS A 1 26 ? 5.370  7.422   -1.262  1.00 0.00 ? 26 HIS A HE1  12 
ATOM   9162  H  HE2  . HIS A 1 26 ? 6.612  9.602   -1.639  1.00 0.00 ? 26 HIS A HE2  12 
ATOM   9163  N  N    . LEU A 1 27 ? 12.941 6.731   -0.406  1.00 0.00 ? 27 LEU A N    12 
ATOM   9164  C  CA   . LEU A 1 27 ? 14.099 6.413   0.415   1.00 0.00 ? 27 LEU A CA   12 
ATOM   9165  C  C    . LEU A 1 27 ? 13.663 5.594   1.628   1.00 0.00 ? 27 LEU A C    12 
ATOM   9166  O  O    . LEU A 1 27 ? 14.193 4.513   1.852   1.00 0.00 ? 27 LEU A O    12 
ATOM   9167  C  CB   . LEU A 1 27 ? 14.831 7.689   0.837   1.00 0.00 ? 27 LEU A CB   12 
ATOM   9168  C  CG   . LEU A 1 27 ? 15.260 8.575   -0.343  1.00 0.00 ? 27 LEU A CG   12 
ATOM   9169  C  CD1  . LEU A 1 27 ? 15.907 9.836   0.230   1.00 0.00 ? 27 LEU A CD1  12 
ATOM   9170  C  CD2  . LEU A 1 27 ? 16.247 7.869   -1.281  1.00 0.00 ? 27 LEU A CD2  12 
ATOM   9171  H  H    . LEU A 1 27 ? 12.684 7.702   -0.521  1.00 0.00 ? 27 LEU A H    12 
ATOM   9172  H  HA   . LEU A 1 27 ? 14.782 5.795   -0.164  1.00 0.00 ? 27 LEU A HA   12 
ATOM   9173  H  HB2  . LEU A 1 27 ? 14.170 8.268   1.484   1.00 0.00 ? 27 LEU A HB2  12 
ATOM   9174  H  HB3  . LEU A 1 27 ? 15.718 7.404   1.406   1.00 0.00 ? 27 LEU A HB3  12 
ATOM   9175  H  HG   . LEU A 1 27 ? 14.388 8.876   -0.923  1.00 0.00 ? 27 LEU A HG   12 
ATOM   9176  H  HD11 . LEU A 1 27 ? 16.773 9.558   0.830   1.00 0.00 ? 27 LEU A HD11 12 
ATOM   9177  H  HD12 . LEU A 1 27 ? 16.222 10.498  -0.573  1.00 0.00 ? 27 LEU A HD12 12 
ATOM   9178  H  HD13 . LEU A 1 27 ? 15.190 10.363  0.859   1.00 0.00 ? 27 LEU A HD13 12 
ATOM   9179  H  HD21 . LEU A 1 27 ? 17.166 7.619   -0.751  1.00 0.00 ? 27 LEU A HD21 12 
ATOM   9180  H  HD22 . LEU A 1 27 ? 15.811 6.963   -1.692  1.00 0.00 ? 27 LEU A HD22 12 
ATOM   9181  H  HD23 . LEU A 1 27 ? 16.477 8.524   -2.118  1.00 0.00 ? 27 LEU A HD23 12 
ATOM   9182  N  N    . PHE A 1 28 ? 12.659 6.084   2.364   1.00 0.00 ? 28 PHE A N    12 
ATOM   9183  C  CA   . PHE A 1 28 ? 12.109 5.426   3.543   1.00 0.00 ? 28 PHE A CA   12 
ATOM   9184  C  C    . PHE A 1 28 ? 11.697 3.979   3.239   1.00 0.00 ? 28 PHE A C    12 
ATOM   9185  O  O    . PHE A 1 28 ? 12.053 3.068   3.983   1.00 0.00 ? 28 PHE A O    12 
ATOM   9186  C  CB   . PHE A 1 28 ? 10.919 6.231   4.076   1.00 0.00 ? 28 PHE A CB   12 
ATOM   9187  C  CG   . PHE A 1 28 ? 11.192 7.713   4.268   1.00 0.00 ? 28 PHE A CG   12 
ATOM   9188  C  CD1  . PHE A 1 28 ? 11.876 8.171   5.411   1.00 0.00 ? 28 PHE A CD1  12 
ATOM   9189  C  CD2  . PHE A 1 28 ? 10.792 8.635   3.281   1.00 0.00 ? 28 PHE A CD2  12 
ATOM   9190  C  CE1  . PHE A 1 28 ? 12.117 9.546   5.585   1.00 0.00 ? 28 PHE A CE1  12 
ATOM   9191  C  CE2  . PHE A 1 28 ? 11.062 10.005  3.442   1.00 0.00 ? 28 PHE A CE2  12 
ATOM   9192  C  CZ   . PHE A 1 28 ? 11.693 10.465  4.609   1.00 0.00 ? 28 PHE A CZ   12 
ATOM   9193  H  H    . PHE A 1 28 ? 12.280 6.985   2.115   1.00 0.00 ? 28 PHE A H    12 
ATOM   9194  H  HA   . PHE A 1 28 ? 12.880 5.418   4.313   1.00 0.00 ? 28 PHE A HA   12 
ATOM   9195  H  HB2  . PHE A 1 28 ? 10.088 6.109   3.379   1.00 0.00 ? 28 PHE A HB2  12 
ATOM   9196  H  HB3  . PHE A 1 28 ? 10.612 5.805   5.033   1.00 0.00 ? 28 PHE A HB3  12 
ATOM   9197  H  HD1  . PHE A 1 28 ? 12.209 7.470   6.163   1.00 0.00 ? 28 PHE A HD1  12 
ATOM   9198  H  HD2  . PHE A 1 28 ? 10.272 8.298   2.398   1.00 0.00 ? 28 PHE A HD2  12 
ATOM   9199  H  HE1  . PHE A 1 28 ? 12.626 9.897   6.471   1.00 0.00 ? 28 PHE A HE1  12 
ATOM   9200  H  HE2  . PHE A 1 28 ? 10.771 10.710  2.677   1.00 0.00 ? 28 PHE A HE2  12 
ATOM   9201  H  HZ   . PHE A 1 28 ? 11.836 11.527  4.749   1.00 0.00 ? 28 PHE A HZ   12 
ATOM   9202  N  N    . CYS A 1 29 ? 10.954 3.778   2.142   1.00 0.00 ? 29 CYS A N    12 
ATOM   9203  C  CA   . CYS A 1 29 ? 10.447 2.475   1.726   1.00 0.00 ? 29 CYS A CA   12 
ATOM   9204  C  C    . CYS A 1 29 ? 11.578 1.529   1.309   1.00 0.00 ? 29 CYS A C    12 
ATOM   9205  O  O    . CYS A 1 29 ? 11.447 0.319   1.482   1.00 0.00 ? 29 CYS A O    12 
ATOM   9206  C  CB   . CYS A 1 29 ? 9.435  2.651   0.591   1.00 0.00 ? 29 CYS A CB   12 
ATOM   9207  S  SG   . CYS A 1 29 ? 7.974  3.629   1.033   1.00 0.00 ? 29 CYS A SG   12 
ATOM   9208  H  H    . CYS A 1 29 ? 10.729 4.573   1.562   1.00 0.00 ? 29 CYS A H    12 
ATOM   9209  H  HA   . CYS A 1 29 ? 9.923  2.023   2.570   1.00 0.00 ? 29 CYS A HA   12 
ATOM   9210  H  HB2  . CYS A 1 29 ? 9.933  3.135   -0.248  1.00 0.00 ? 29 CYS A HB2  12 
ATOM   9211  H  HB3  . CYS A 1 29 ? 9.090  1.668   0.266   1.00 0.00 ? 29 CYS A HB3  12 
ATOM   9212  N  N    . LEU A 1 30 ? 12.676 2.067   0.758   1.00 0.00 ? 30 LEU A N    12 
ATOM   9213  C  CA   . LEU A 1 30 ? 13.897 1.305   0.527   1.00 0.00 ? 30 LEU A CA   12 
ATOM   9214  C  C    . LEU A 1 30 ? 14.455 0.876   1.888   1.00 0.00 ? 30 LEU A C    12 
ATOM   9215  O  O    . LEU A 1 30 ? 14.405 -0.304  2.231   1.00 0.00 ? 30 LEU A O    12 
ATOM   9216  C  CB   . LEU A 1 30 ? 14.863 2.137   -0.336  1.00 0.00 ? 30 LEU A CB   12 
ATOM   9217  C  CG   . LEU A 1 30 ? 15.993 1.344   -1.008  1.00 0.00 ? 30 LEU A CG   12 
ATOM   9218  C  CD1  . LEU A 1 30 ? 16.706 2.269   -1.998  1.00 0.00 ? 30 LEU A CD1  12 
ATOM   9219  C  CD2  . LEU A 1 30 ? 17.012 0.772   -0.016  1.00 0.00 ? 30 LEU A CD2  12 
ATOM   9220  H  H    . LEU A 1 30 ? 12.702 3.061   0.575   1.00 0.00 ? 30 LEU A H    12 
ATOM   9221  H  HA   . LEU A 1 30 ? 13.633 0.415   -0.037  1.00 0.00 ? 30 LEU A HA   12 
ATOM   9222  H  HB2  . LEU A 1 30 ? 14.270 2.578   -1.141  1.00 0.00 ? 30 LEU A HB2  12 
ATOM   9223  H  HB3  . LEU A 1 30 ? 15.307 2.944   0.242   1.00 0.00 ? 30 LEU A HB3  12 
ATOM   9224  H  HG   . LEU A 1 30 ? 15.563 0.523   -1.573  1.00 0.00 ? 30 LEU A HG   12 
ATOM   9225  H  HD11 . LEU A 1 30 ? 17.524 1.738   -2.482  1.00 0.00 ? 30 LEU A HD11 12 
ATOM   9226  H  HD12 . LEU A 1 30 ? 16.001 2.600   -2.762  1.00 0.00 ? 30 LEU A HD12 12 
ATOM   9227  H  HD13 . LEU A 1 30 ? 17.104 3.139   -1.480  1.00 0.00 ? 30 LEU A HD13 12 
ATOM   9228  H  HD21 . LEU A 1 30 ? 16.566 -0.053  0.533   1.00 0.00 ? 30 LEU A HD21 12 
ATOM   9229  H  HD22 . LEU A 1 30 ? 17.877 0.386   -0.557  1.00 0.00 ? 30 LEU A HD22 12 
ATOM   9230  H  HD23 . LEU A 1 30 ? 17.343 1.545   0.678   1.00 0.00 ? 30 LEU A HD23 12 
ATOM   9231  N  N    . ARG A 1 31 ? 14.964 1.843   2.658   1.00 0.00 ? 31 ARG A N    12 
ATOM   9232  C  CA   . ARG A 1 31 ? 15.340 1.706   4.062   1.00 0.00 ? 31 ARG A CA   12 
ATOM   9233  C  C    . ARG A 1 31 ? 15.265 3.094   4.711   1.00 0.00 ? 31 ARG A C    12 
ATOM   9234  O  O    . ARG A 1 31 ? 15.694 4.064   4.087   1.00 0.00 ? 31 ARG A O    12 
ATOM   9235  C  CB   . ARG A 1 31 ? 16.776 1.178   4.225   1.00 0.00 ? 31 ARG A CB   12 
ATOM   9236  C  CG   . ARG A 1 31 ? 16.952 -0.305  3.872   1.00 0.00 ? 31 ARG A CG   12 
ATOM   9237  C  CD   . ARG A 1 31 ? 18.317 -0.819  4.345   1.00 0.00 ? 31 ARG A CD   12 
ATOM   9238  N  NE   . ARG A 1 31 ? 18.378 -0.881  5.814   1.00 0.00 ? 31 ARG A NE   12 
ATOM   9239  C  CZ   . ARG A 1 31 ? 19.453 -0.642  6.587   1.00 0.00 ? 31 ARG A CZ   12 
ATOM   9240  N  NH1  . ARG A 1 31 ? 20.651 -0.361  6.055   1.00 0.00 ? 31 ARG A NH1  12 
ATOM   9241  N  NH2  . ARG A 1 31 ? 19.318 -0.683  7.919   1.00 0.00 ? 31 ARG A NH2  12 
ATOM   9242  H  H    . ARG A 1 31 ? 14.945 2.782   2.285   1.00 0.00 ? 31 ARG A H    12 
ATOM   9243  H  HA   . ARG A 1 31 ? 14.641 1.022   4.540   1.00 0.00 ? 31 ARG A HA   12 
ATOM   9244  H  HB2  . ARG A 1 31 ? 17.457 1.778   3.620   1.00 0.00 ? 31 ARG A HB2  12 
ATOM   9245  H  HB3  . ARG A 1 31 ? 17.048 1.311   5.273   1.00 0.00 ? 31 ARG A HB3  12 
ATOM   9246  H  HG2  . ARG A 1 31 ? 16.163 -0.898  4.337   1.00 0.00 ? 31 ARG A HG2  12 
ATOM   9247  H  HG3  . ARG A 1 31 ? 16.898 -0.428  2.793   1.00 0.00 ? 31 ARG A HG3  12 
ATOM   9248  H  HD2  . ARG A 1 31 ? 18.466 -1.826  3.952   1.00 0.00 ? 31 ARG A HD2  12 
ATOM   9249  H  HD3  . ARG A 1 31 ? 19.088 -0.167  3.935   1.00 0.00 ? 31 ARG A HD3  12 
ATOM   9250  H  HE   . ARG A 1 31 ? 17.513 -1.121  6.276   1.00 0.00 ? 31 ARG A HE   12 
ATOM   9251  H  HH11 . ARG A 1 31 ? 20.774 -0.338  5.055   1.00 0.00 ? 31 ARG A HH11 12 
ATOM   9252  H  HH12 . ARG A 1 31 ? 21.445 -0.186  6.655   1.00 0.00 ? 31 ARG A HH12 12 
ATOM   9253  H  HH21 . ARG A 1 31 ? 18.420 -0.894  8.330   1.00 0.00 ? 31 ARG A HH21 12 
ATOM   9254  H  HH22 . ARG A 1 31 ? 20.109 -0.505  8.520   1.00 0.00 ? 31 ARG A HH22 12 
ATOM   9255  N  N    . PRO A 1 32 ? 14.819 3.215   5.973   1.00 0.00 ? 32 PRO A N    12 
ATOM   9256  C  CA   . PRO A 1 32 ? 14.916 4.454   6.737   1.00 0.00 ? 32 PRO A CA   12 
ATOM   9257  C  C    . PRO A 1 32 ? 16.336 4.621   7.300   1.00 0.00 ? 32 PRO A C    12 
ATOM   9258  O  O    . PRO A 1 32 ? 16.526 4.808   8.501   1.00 0.00 ? 32 PRO A O    12 
ATOM   9259  C  CB   . PRO A 1 32 ? 13.838 4.323   7.818   1.00 0.00 ? 32 PRO A CB   12 
ATOM   9260  C  CG   . PRO A 1 32 ? 13.844 2.823   8.107   1.00 0.00 ? 32 PRO A CG   12 
ATOM   9261  C  CD   . PRO A 1 32 ? 14.083 2.212   6.725   1.00 0.00 ? 32 PRO A CD   12 
ATOM   9262  H  HA   . PRO A 1 32 ? 14.684 5.322   6.116   1.00 0.00 ? 32 PRO A HA   12 
ATOM   9263  H  HB2  . PRO A 1 32 ? 14.027 4.927   8.707   1.00 0.00 ? 32 PRO A HB2  12 
ATOM   9264  H  HB3  . PRO A 1 32 ? 12.872 4.592   7.388   1.00 0.00 ? 32 PRO A HB3  12 
ATOM   9265  H  HG2  . PRO A 1 32 ? 14.683 2.585   8.763   1.00 0.00 ? 32 PRO A HG2  12 
ATOM   9266  H  HG3  . PRO A 1 32 ? 12.909 2.484   8.555   1.00 0.00 ? 32 PRO A HG3  12 
ATOM   9267  H  HD2  . PRO A 1 32 ? 14.645 1.282   6.826   1.00 0.00 ? 32 PRO A HD2  12 
ATOM   9268  H  HD3  . PRO A 1 32 ? 13.125 2.023   6.240   1.00 0.00 ? 32 PRO A HD3  12 
ATOM   9269  N  N    . ALA A 1 33 ? 17.330 4.536   6.408   1.00 0.00 ? 33 ALA A N    12 
ATOM   9270  C  CA   . ALA A 1 33 ? 18.731 4.858   6.632   1.00 0.00 ? 33 ALA A CA   12 
ATOM   9271  C  C    . ALA A 1 33 ? 19.130 5.965   5.662   1.00 0.00 ? 33 ALA A C    12 
ATOM   9272  O  O    . ALA A 1 33 ? 19.710 6.971   6.056   1.00 0.00 ? 33 ALA A O    12 
ATOM   9273  C  CB   . ALA A 1 33 ? 19.589 3.608   6.422   1.00 0.00 ? 33 ALA A CB   12 
ATOM   9274  H  H    . ALA A 1 33 ? 17.062 4.396   5.445   1.00 0.00 ? 33 ALA A H    12 
ATOM   9275  H  HA   . ALA A 1 33 ? 18.886 5.217   7.646   1.00 0.00 ? 33 ALA A HA   12 
ATOM   9276  H  HB1  . ALA A 1 33 ? 20.640 3.860   6.569   1.00 0.00 ? 33 ALA A HB1  12 
ATOM   9277  H  HB2  . ALA A 1 33 ? 19.304 2.839   7.141   1.00 0.00 ? 33 ALA A HB2  12 
ATOM   9278  H  HB3  . ALA A 1 33 ? 19.455 3.219   5.412   1.00 0.00 ? 33 ALA A HB3  12 
ATOM   9279  N  N    . LEU A 1 34 ? 18.781 5.775   4.385   1.00 0.00 ? 34 LEU A N    12 
ATOM   9280  C  CA   . LEU A 1 34 ? 18.879 6.803   3.365   1.00 0.00 ? 34 LEU A CA   12 
ATOM   9281  C  C    . LEU A 1 34 ? 17.879 7.911   3.693   1.00 0.00 ? 34 LEU A C    12 
ATOM   9282  O  O    . LEU A 1 34 ? 16.698 7.638   3.905   1.00 0.00 ? 34 LEU A O    12 
ATOM   9283  C  CB   . LEU A 1 34 ? 18.562 6.207   1.985   1.00 0.00 ? 34 LEU A CB   12 
ATOM   9284  C  CG   . LEU A 1 34 ? 19.559 5.131   1.524   1.00 0.00 ? 34 LEU A CG   12 
ATOM   9285  C  CD1  . LEU A 1 34 ? 19.028 4.460   0.253   1.00 0.00 ? 34 LEU A CD1  12 
ATOM   9286  C  CD2  . LEU A 1 34 ? 20.943 5.727   1.235   1.00 0.00 ? 34 LEU A CD2  12 
ATOM   9287  H  H    . LEU A 1 34 ? 18.366 4.892   4.135   1.00 0.00 ? 34 LEU A H    12 
ATOM   9288  H  HA   . LEU A 1 34 ? 19.887 7.215   3.364   1.00 0.00 ? 34 LEU A HA   12 
ATOM   9289  H  HB2  . LEU A 1 34 ? 17.564 5.763   2.026   1.00 0.00 ? 34 LEU A HB2  12 
ATOM   9290  H  HB3  . LEU A 1 34 ? 18.546 7.013   1.250   1.00 0.00 ? 34 LEU A HB3  12 
ATOM   9291  H  HG   . LEU A 1 34 ? 19.655 4.363   2.291   1.00 0.00 ? 34 LEU A HG   12 
ATOM   9292  H  HD11 . LEU A 1 34 ? 18.921 5.192   -0.547  1.00 0.00 ? 34 LEU A HD11 12 
ATOM   9293  H  HD12 . LEU A 1 34 ? 19.716 3.677   -0.067  1.00 0.00 ? 34 LEU A HD12 12 
ATOM   9294  H  HD13 . LEU A 1 34 ? 18.058 4.009   0.463   1.00 0.00 ? 34 LEU A HD13 12 
ATOM   9295  H  HD21 . LEU A 1 34 ? 21.598 4.952   0.836   1.00 0.00 ? 34 LEU A HD21 12 
ATOM   9296  H  HD22 . LEU A 1 34 ? 20.860 6.532   0.505   1.00 0.00 ? 34 LEU A HD22 12 
ATOM   9297  H  HD23 . LEU A 1 34 ? 21.391 6.113   2.149   1.00 0.00 ? 34 LEU A HD23 12 
ATOM   9298  N  N    . TYR A 1 35 ? 18.375 9.153   3.750   1.00 0.00 ? 35 TYR A N    12 
ATOM   9299  C  CA   . TYR A 1 35 ? 17.583 10.364  3.928   1.00 0.00 ? 35 TYR A CA   12 
ATOM   9300  C  C    . TYR A 1 35 ? 17.805 11.313  2.750   1.00 0.00 ? 35 TYR A C    12 
ATOM   9301  O  O    . TYR A 1 35 ? 16.865 11.970  2.305   1.00 0.00 ? 35 TYR A O    12 
ATOM   9302  C  CB   . TYR A 1 35 ? 17.920 11.019  5.276   1.00 0.00 ? 35 TYR A CB   12 
ATOM   9303  C  CG   . TYR A 1 35 ? 17.879 10.066  6.461   1.00 0.00 ? 35 TYR A CG   12 
ATOM   9304  C  CD1  . TYR A 1 35 ? 16.746 9.258   6.679   1.00 0.00 ? 35 TYR A CD1  12 
ATOM   9305  C  CD2  . TYR A 1 35 ? 19.009 9.912   7.287   1.00 0.00 ? 35 TYR A CD2  12 
ATOM   9306  C  CE1  . TYR A 1 35 ? 16.771 8.254   7.662   1.00 0.00 ? 35 TYR A CE1  12 
ATOM   9307  C  CE2  . TYR A 1 35 ? 19.012 8.947   8.309   1.00 0.00 ? 35 TYR A CE2  12 
ATOM   9308  C  CZ   . TYR A 1 35 ? 17.908 8.093   8.473   1.00 0.00 ? 35 TYR A CZ   12 
ATOM   9309  O  OH   . TYR A 1 35 ? 17.956 7.092   9.399   1.00 0.00 ? 35 TYR A OH   12 
ATOM   9310  H  H    . TYR A 1 35 ? 19.369 9.269   3.616   1.00 0.00 ? 35 TYR A H    12 
ATOM   9311  H  HA   . TYR A 1 35 ? 16.524 10.114  3.927   1.00 0.00 ? 35 TYR A HA   12 
ATOM   9312  H  HB2  . TYR A 1 35 ? 18.916 11.461  5.205   1.00 0.00 ? 35 TYR A HB2  12 
ATOM   9313  H  HB3  . TYR A 1 35 ? 17.201 11.821  5.456   1.00 0.00 ? 35 TYR A HB3  12 
ATOM   9314  H  HD1  . TYR A 1 35 ? 15.862 9.383   6.071   1.00 0.00 ? 35 TYR A HD1  12 
ATOM   9315  H  HD2  . TYR A 1 35 ? 19.889 10.520  7.129   1.00 0.00 ? 35 TYR A HD2  12 
ATOM   9316  H  HE1  . TYR A 1 35 ? 15.914 7.608   7.789   1.00 0.00 ? 35 TYR A HE1  12 
ATOM   9317  H  HE2  . TYR A 1 35 ? 19.894 8.812   8.918   1.00 0.00 ? 35 TYR A HE2  12 
ATOM   9318  H  HH   . TYR A 1 35 ? 17.237 6.458   9.309   1.00 0.00 ? 35 TYR A HH   12 
ATOM   9319  N  N    . GLU A 1 36 ? 19.038 11.358  2.232   1.00 0.00 ? 36 GLU A N    12 
ATOM   9320  C  CA   . GLU A 1 36 ? 19.374 12.024  0.983   1.00 0.00 ? 36 GLU A CA   12 
ATOM   9321  C  C    . GLU A 1 36 ? 19.171 11.045  -0.176  1.00 0.00 ? 36 GLU A C    12 
ATOM   9322  O  O    . GLU A 1 36 ? 19.349 9.838   -0.009  1.00 0.00 ? 36 GLU A O    12 
ATOM   9323  C  CB   . GLU A 1 36 ? 20.830 12.510  1.018   1.00 0.00 ? 36 GLU A CB   12 
ATOM   9324  C  CG   . GLU A 1 36 ? 21.141 13.386  2.240   1.00 0.00 ? 36 GLU A CG   12 
ATOM   9325  C  CD   . GLU A 1 36 ? 20.210 14.591  2.335   1.00 0.00 ? 36 GLU A CD   12 
ATOM   9326  O  OE1  . GLU A 1 36 ? 20.357 15.491  1.481   1.00 0.00 ? 36 GLU A OE1  12 
ATOM   9327  O  OE2  . GLU A 1 36 ? 19.364 14.586  3.256   1.00 0.00 ? 36 GLU A OE2  12 
ATOM   9328  H  H    . GLU A 1 36 ? 19.768 10.839  2.693   1.00 0.00 ? 36 GLU A H    12 
ATOM   9329  H  HA   . GLU A 1 36 ? 18.721 12.887  0.837   1.00 0.00 ? 36 GLU A HA   12 
ATOM   9330  H  HB2  . GLU A 1 36 ? 21.499 11.649  1.030   1.00 0.00 ? 36 GLU A HB2  12 
ATOM   9331  H  HB3  . GLU A 1 36 ? 21.023 13.084  0.110   1.00 0.00 ? 36 GLU A HB3  12 
ATOM   9332  H  HG2  . GLU A 1 36 ? 21.063 12.794  3.152   1.00 0.00 ? 36 GLU A HG2  12 
ATOM   9333  H  HG3  . GLU A 1 36 ? 22.167 13.746  2.160   1.00 0.00 ? 36 GLU A HG3  12 
ATOM   9334  N  N    . VAL A 1 37 ? 18.801 11.563  -1.353  1.00 0.00 ? 37 VAL A N    12 
ATOM   9335  C  CA   . VAL A 1 37 ? 18.738 10.773  -2.575  1.00 0.00 ? 37 VAL A CA   12 
ATOM   9336  C  C    . VAL A 1 37 ? 20.168 10.503  -3.062  1.00 0.00 ? 37 VAL A C    12 
ATOM   9337  O  O    . VAL A 1 37 ? 20.992 11.418  -3.034  1.00 0.00 ? 37 VAL A O    12 
ATOM   9338  C  CB   . VAL A 1 37 ? 17.898 11.497  -3.644  1.00 0.00 ? 37 VAL A CB   12 
ATOM   9339  C  CG1  . VAL A 1 37 ? 17.842 10.699  -4.955  1.00 0.00 ? 37 VAL A CG1  12 
ATOM   9340  C  CG2  . VAL A 1 37 ? 16.460 11.719  -3.156  1.00 0.00 ? 37 VAL A CG2  12 
ATOM   9341  H  H    . VAL A 1 37 ? 18.695 12.565  -1.431  1.00 0.00 ? 37 VAL A H    12 
ATOM   9342  H  HA   . VAL A 1 37 ? 18.229 9.843   -2.341  1.00 0.00 ? 37 VAL A HA   12 
ATOM   9343  H  HB   . VAL A 1 37 ? 18.349 12.469  -3.848  1.00 0.00 ? 37 VAL A HB   12 
ATOM   9344  H  HG11 . VAL A 1 37 ? 17.187 11.202  -5.666  1.00 0.00 ? 37 VAL A HG11 12 
ATOM   9345  H  HG12 . VAL A 1 37 ? 18.833 10.620  -5.401  1.00 0.00 ? 37 VAL A HG12 12 
ATOM   9346  H  HG13 . VAL A 1 37 ? 17.446 9.701   -4.770  1.00 0.00 ? 37 VAL A HG13 12 
ATOM   9347  H  HG21 . VAL A 1 37 ? 15.881 12.215  -3.931  1.00 0.00 ? 37 VAL A HG21 12 
ATOM   9348  H  HG22 . VAL A 1 37 ? 15.988 10.762  -2.935  1.00 0.00 ? 37 VAL A HG22 12 
ATOM   9349  H  HG23 . VAL A 1 37 ? 16.448 12.345  -2.263  1.00 0.00 ? 37 VAL A HG23 12 
ATOM   9350  N  N    . PRO A 1 38 ? 20.489 9.273   -3.501  1.00 0.00 ? 38 PRO A N    12 
ATOM   9351  C  CA   . PRO A 1 38 ? 21.743 8.993   -4.179  1.00 0.00 ? 38 PRO A CA   12 
ATOM   9352  C  C    . PRO A 1 38 ? 21.630 9.477   -5.623  1.00 0.00 ? 38 PRO A C    12 
ATOM   9353  O  O    . PRO A 1 38 ? 21.249 8.717   -6.513  1.00 0.00 ? 38 PRO A O    12 
ATOM   9354  C  CB   . PRO A 1 38 ? 21.942 7.480   -4.073  1.00 0.00 ? 38 PRO A CB   12 
ATOM   9355  C  CG   . PRO A 1 38 ? 20.514 6.946   -4.004  1.00 0.00 ? 38 PRO A CG   12 
ATOM   9356  C  CD   . PRO A 1 38 ? 19.759 8.040   -3.245  1.00 0.00 ? 38 PRO A CD   12 
ATOM   9357  H  HA   . PRO A 1 38 ? 22.584 9.489   -3.692  1.00 0.00 ? 38 PRO A HA   12 
ATOM   9358  H  HB2  . PRO A 1 38 ? 22.505 7.064   -4.909  1.00 0.00 ? 38 PRO A HB2  12 
ATOM   9359  H  HB3  . PRO A 1 38 ? 22.454 7.257   -3.137  1.00 0.00 ? 38 PRO A HB3  12 
ATOM   9360  H  HG2  . PRO A 1 38 ? 20.118 6.869   -5.017  1.00 0.00 ? 38 PRO A HG2  12 
ATOM   9361  H  HG3  . PRO A 1 38 ? 20.458 5.977   -3.505  1.00 0.00 ? 38 PRO A HG3  12 
ATOM   9362  H  HD2  . PRO A 1 38 ? 18.736 8.085   -3.614  1.00 0.00 ? 38 PRO A HD2  12 
ATOM   9363  H  HD3  . PRO A 1 38 ? 19.761 7.819   -2.176  1.00 0.00 ? 38 PRO A HD3  12 
ATOM   9364  N  N    . ASP A 1 39 ? 21.966 10.752  -5.851  1.00 0.00 ? 39 ASP A N    12 
ATOM   9365  C  CA   . ASP A 1 39 ? 22.121 11.316  -7.183  1.00 0.00 ? 39 ASP A CA   12 
ATOM   9366  C  C    . ASP A 1 39 ? 23.404 10.790  -7.835  1.00 0.00 ? 39 ASP A C    12 
ATOM   9367  O  O    . ASP A 1 39 ? 24.362 11.536  -8.040  1.00 0.00 ? 39 ASP A O    12 
ATOM   9368  C  CB   . ASP A 1 39 ? 22.079 12.850  -7.116  1.00 0.00 ? 39 ASP A CB   12 
ATOM   9369  C  CG   . ASP A 1 39 ? 20.678 13.357  -6.788  1.00 0.00 ? 39 ASP A CG   12 
ATOM   9370  O  OD1  . ASP A 1 39 ? 20.351 13.432  -5.584  1.00 0.00 ? 39 ASP A OD1  12 
ATOM   9371  O  OD2  . ASP A 1 39 ? 19.947 13.673  -7.752  1.00 0.00 ? 39 ASP A OD2  12 
ATOM   9372  H  H    . ASP A 1 39 ? 22.162 11.350  -5.060  1.00 0.00 ? 39 ASP A H    12 
ATOM   9373  H  HA   . ASP A 1 39 ? 21.279 10.998  -7.793  1.00 0.00 ? 39 ASP A HA   12 
ATOM   9374  H  HB2  . ASP A 1 39 ? 22.789 13.213  -6.372  1.00 0.00 ? 39 ASP A HB2  12 
ATOM   9375  H  HB3  . ASP A 1 39 ? 22.360 13.256  -8.089  1.00 0.00 ? 39 ASP A HB3  12 
ATOM   9376  N  N    . GLY A 1 40 ? 23.403 9.496   -8.173  1.00 0.00 ? 40 GLY A N    12 
ATOM   9377  C  CA   . GLY A 1 40 ? 24.500 8.823   -8.847  1.00 0.00 ? 40 GLY A CA   12 
ATOM   9378  C  C    . GLY A 1 40 ? 24.015 7.503   -9.439  1.00 0.00 ? 40 GLY A C    12 
ATOM   9379  O  O    . GLY A 1 40 ? 24.114 7.292   -10.646 1.00 0.00 ? 40 GLY A O    12 
ATOM   9380  H  H    . GLY A 1 40 ? 22.610 8.933   -7.892  1.00 0.00 ? 40 GLY A H    12 
ATOM   9381  H  HA2  . GLY A 1 40 ? 24.888 9.454   -9.647  1.00 0.00 ? 40 GLY A HA2  12 
ATOM   9382  H  HA3  . GLY A 1 40 ? 25.294 8.624   -8.126  1.00 0.00 ? 40 GLY A HA3  12 
ATOM   9383  N  N    . GLU A 1 41 ? 23.481 6.627   -8.581  1.00 0.00 ? 41 GLU A N    12 
ATOM   9384  C  CA   . GLU A 1 41 ? 22.856 5.367   -8.948  1.00 0.00 ? 41 GLU A CA   12 
ATOM   9385  C  C    . GLU A 1 41 ? 21.595 5.173   -8.106  1.00 0.00 ? 41 GLU A C    12 
ATOM   9386  O  O    . GLU A 1 41 ? 21.509 5.688   -6.993  1.00 0.00 ? 41 GLU A O    12 
ATOM   9387  C  CB   . GLU A 1 41 ? 23.847 4.204   -8.785  1.00 0.00 ? 41 GLU A CB   12 
ATOM   9388  C  CG   . GLU A 1 41 ? 24.316 3.956   -7.342  1.00 0.00 ? 41 GLU A CG   12 
ATOM   9389  C  CD   . GLU A 1 41 ? 25.216 5.069   -6.810  1.00 0.00 ? 41 GLU A CD   12 
ATOM   9390  O  OE1  . GLU A 1 41 ? 26.409 5.063   -7.184  1.00 0.00 ? 41 GLU A OE1  12 
ATOM   9391  O  OE2  . GLU A 1 41 ? 24.692 5.919   -6.057  1.00 0.00 ? 41 GLU A OE2  12 
ATOM   9392  H  H    . GLU A 1 41 ? 23.511 6.835   -7.590  1.00 0.00 ? 41 GLU A H    12 
ATOM   9393  H  HA   . GLU A 1 41 ? 22.557 5.404   -9.996  1.00 0.00 ? 41 GLU A HA   12 
ATOM   9394  H  HB2  . GLU A 1 41 ? 23.361 3.297   -9.146  1.00 0.00 ? 41 GLU A HB2  12 
ATOM   9395  H  HB3  . GLU A 1 41 ? 24.719 4.388   -9.415  1.00 0.00 ? 41 GLU A HB3  12 
ATOM   9396  H  HG2  . GLU A 1 41 ? 23.458 3.829   -6.681  1.00 0.00 ? 41 GLU A HG2  12 
ATOM   9397  H  HG3  . GLU A 1 41 ? 24.886 3.026   -7.323  1.00 0.00 ? 41 GLU A HG3  12 
ATOM   9398  N  N    . TRP A 1 42 ? 20.616 4.442   -8.646  1.00 0.00 ? 42 TRP A N    12 
ATOM   9399  C  CA   . TRP A 1 42 ? 19.281 4.345   -8.078  1.00 0.00 ? 42 TRP A CA   12 
ATOM   9400  C  C    . TRP A 1 42 ? 18.837 2.885   -8.128  1.00 0.00 ? 42 TRP A C    12 
ATOM   9401  O  O    . TRP A 1 42 ? 18.537 2.369   -9.199  1.00 0.00 ? 42 TRP A O    12 
ATOM   9402  C  CB   . TRP A 1 42 ? 18.340 5.263   -8.864  1.00 0.00 ? 42 TRP A CB   12 
ATOM   9403  C  CG   . TRP A 1 42 ? 18.670 6.727   -8.819  1.00 0.00 ? 42 TRP A CG   12 
ATOM   9404  C  CD1  . TRP A 1 42 ? 18.177 7.619   -7.931  1.00 0.00 ? 42 TRP A CD1  12 
ATOM   9405  C  CD2  . TRP A 1 42 ? 19.549 7.492   -9.700  1.00 0.00 ? 42 TRP A CD2  12 
ATOM   9406  N  NE1  . TRP A 1 42 ? 18.638 8.883   -8.235  1.00 0.00 ? 42 TRP A NE1  12 
ATOM   9407  C  CE2  . TRP A 1 42 ? 19.491 8.865   -9.321  1.00 0.00 ? 42 TRP A CE2  12 
ATOM   9408  C  CE3  . TRP A 1 42 ? 20.381 7.170   -10.795 1.00 0.00 ? 42 TRP A CE3  12 
ATOM   9409  C  CZ2  . TRP A 1 42 ? 20.198 9.866   -10.006 1.00 0.00 ? 42 TRP A CZ2  12 
ATOM   9410  C  CZ3  . TRP A 1 42 ? 21.115 8.161   -11.472 1.00 0.00 ? 42 TRP A CZ3  12 
ATOM   9411  C  CH2  . TRP A 1 42 ? 21.029 9.506   -11.077 1.00 0.00 ? 42 TRP A CH2  12 
ATOM   9412  H  H    . TRP A 1 42 ? 20.764 4.004   -9.549  1.00 0.00 ? 42 TRP A H    12 
ATOM   9413  H  HA   . TRP A 1 42 ? 19.275 4.671   -7.037  1.00 0.00 ? 42 TRP A HA   12 
ATOM   9414  H  HB2  . TRP A 1 42 ? 18.348 4.958   -9.912  1.00 0.00 ? 42 TRP A HB2  12 
ATOM   9415  H  HB3  . TRP A 1 42 ? 17.326 5.128   -8.484  1.00 0.00 ? 42 TRP A HB3  12 
ATOM   9416  H  HD1  . TRP A 1 42 ? 17.494 7.383   -7.129  1.00 0.00 ? 42 TRP A HD1  12 
ATOM   9417  H  HE1  . TRP A 1 42 ? 18.370 9.704   -7.713  1.00 0.00 ? 42 TRP A HE1  12 
ATOM   9418  H  HE3  . TRP A 1 42 ? 20.459 6.144   -11.116 1.00 0.00 ? 42 TRP A HE3  12 
ATOM   9419  H  HZ2  . TRP A 1 42 ? 20.097 10.903  -9.722  1.00 0.00 ? 42 TRP A HZ2  12 
ATOM   9420  H  HZ3  . TRP A 1 42 ? 21.742 7.885   -12.307 1.00 0.00 ? 42 TRP A HZ3  12 
ATOM   9421  H  HH2  . TRP A 1 42 ? 21.597 10.262  -11.600 1.00 0.00 ? 42 TRP A HH2  12 
ATOM   9422  N  N    . GLN A 1 43 ? 18.833 2.209   -6.976  1.00 0.00 ? 43 GLN A N    12 
ATOM   9423  C  CA   . GLN A 1 43 ? 18.458 0.804   -6.841  1.00 0.00 ? 43 GLN A CA   12 
ATOM   9424  C  C    . GLN A 1 43 ? 17.357 0.678   -5.785  1.00 0.00 ? 43 GLN A C    12 
ATOM   9425  O  O    . GLN A 1 43 ? 17.050 1.639   -5.083  1.00 0.00 ? 43 GLN A O    12 
ATOM   9426  C  CB   . GLN A 1 43 ? 19.690 -0.045  -6.482  1.00 0.00 ? 43 GLN A CB   12 
ATOM   9427  C  CG   . GLN A 1 43 ? 20.544 -0.447  -7.695  1.00 0.00 ? 43 GLN A CG   12 
ATOM   9428  C  CD   . GLN A 1 43 ? 21.151 0.744   -8.434  1.00 0.00 ? 43 GLN A CD   12 
ATOM   9429  O  OE1  . GLN A 1 43 ? 21.737 1.628   -7.814  1.00 0.00 ? 43 GLN A OE1  12 
ATOM   9430  N  NE2  . GLN A 1 43 ? 20.970 0.792   -9.756  1.00 0.00 ? 43 GLN A NE2  12 
ATOM   9431  H  H    . GLN A 1 43 ? 19.055 2.710   -6.127  1.00 0.00 ? 43 GLN A H    12 
ATOM   9432  H  HA   . GLN A 1 43 ? 18.044 0.425   -7.774  1.00 0.00 ? 43 GLN A HA   12 
ATOM   9433  H  HB2  . GLN A 1 43 ? 20.304 0.478   -5.747  1.00 0.00 ? 43 GLN A HB2  12 
ATOM   9434  H  HB3  . GLN A 1 43 ? 19.350 -0.981  -6.040  1.00 0.00 ? 43 GLN A HB3  12 
ATOM   9435  H  HG2  . GLN A 1 43 ? 21.362 -1.079  -7.348  1.00 0.00 ? 43 GLN A HG2  12 
ATOM   9436  H  HG3  . GLN A 1 43 ? 19.927 -1.033  -8.377  1.00 0.00 ? 43 GLN A HG3  12 
ATOM   9437  H  HE21 . GLN A 1 43 ? 20.511 0.026   -10.228 1.00 0.00 ? 43 GLN A HE21 12 
ATOM   9438  H  HE22 . GLN A 1 43 ? 21.171 1.653   -10.257 1.00 0.00 ? 43 GLN A HE22 12 
ATOM   9439  N  N    . CYS A 1 44 ? 16.757 -0.515  -5.692  1.00 0.00 ? 44 CYS A N    12 
ATOM   9440  C  CA   . CYS A 1 44 ? 15.663 -0.845  -4.783  1.00 0.00 ? 44 CYS A CA   12 
ATOM   9441  C  C    . CYS A 1 44 ? 15.990 -2.167  -4.070  1.00 0.00 ? 44 CYS A C    12 
ATOM   9442  O  O    . CYS A 1 44 ? 16.953 -2.826  -4.457  1.00 0.00 ? 44 CYS A O    12 
ATOM   9443  C  CB   . CYS A 1 44 ? 14.367 -0.933  -5.598  1.00 0.00 ? 44 CYS A CB   12 
ATOM   9444  S  SG   . CYS A 1 44 ? 14.340 -2.245  -6.847  1.00 0.00 ? 44 CYS A SG   12 
ATOM   9445  H  H    . CYS A 1 44 ? 17.105 -1.269  -6.265  1.00 0.00 ? 44 CYS A H    12 
ATOM   9446  H  HA   . CYS A 1 44 ? 15.564 -0.054  -4.039  1.00 0.00 ? 44 CYS A HA   12 
ATOM   9447  H  HB2  . CYS A 1 44 ? 13.518 -1.106  -4.942  1.00 0.00 ? 44 CYS A HB2  12 
ATOM   9448  H  HB3  . CYS A 1 44 ? 14.204 0.024   -6.096  1.00 0.00 ? 44 CYS A HB3  12 
ATOM   9449  N  N    . PRO A 1 45 ? 15.221 -2.588  -3.048  1.00 0.00 ? 45 PRO A N    12 
ATOM   9450  C  CA   . PRO A 1 45 ? 15.539 -3.742  -2.211  1.00 0.00 ? 45 PRO A CA   12 
ATOM   9451  C  C    . PRO A 1 45 ? 15.497 -5.082  -2.953  1.00 0.00 ? 45 PRO A C    12 
ATOM   9452  O  O    . PRO A 1 45 ? 16.067 -6.062  -2.481  1.00 0.00 ? 45 PRO A O    12 
ATOM   9453  C  CB   . PRO A 1 45 ? 14.512 -3.740  -1.075  1.00 0.00 ? 45 PRO A CB   12 
ATOM   9454  C  CG   . PRO A 1 45 ? 14.070 -2.283  -1.010  1.00 0.00 ? 45 PRO A CG   12 
ATOM   9455  C  CD   . PRO A 1 45 ? 14.073 -1.900  -2.487  1.00 0.00 ? 45 PRO A CD   12 
ATOM   9456  H  HA   . PRO A 1 45 ? 16.526 -3.589  -1.778  1.00 0.00 ? 45 PRO A HA   12 
ATOM   9457  H  HB2  . PRO A 1 45 ? 13.651 -4.353  -1.350  1.00 0.00 ? 45 PRO A HB2  12 
ATOM   9458  H  HB3  . PRO A 1 45 ? 14.936 -4.087  -0.132  1.00 0.00 ? 45 PRO A HB3  12 
ATOM   9459  H  HG2  . PRO A 1 45 ? 13.091 -2.166  -0.545  1.00 0.00 ? 45 PRO A HG2  12 
ATOM   9460  H  HG3  . PRO A 1 45 ? 14.822 -1.702  -0.474  1.00 0.00 ? 45 PRO A HG3  12 
ATOM   9461  H  HD2  . PRO A 1 45 ? 13.186 -2.316  -2.963  1.00 0.00 ? 45 PRO A HD2  12 
ATOM   9462  H  HD3  . PRO A 1 45 ? 14.090 -0.817  -2.598  1.00 0.00 ? 45 PRO A HD3  12 
ATOM   9463  N  N    . ALA A 1 46 ? 14.796 -5.144  -4.094  1.00 0.00 ? 46 ALA A N    12 
ATOM   9464  C  CA   . ALA A 1 46 ? 14.797 -6.318  -4.952  1.00 0.00 ? 46 ALA A CA   12 
ATOM   9465  C  C    . ALA A 1 46 ? 16.189 -6.511  -5.548  1.00 0.00 ? 46 ALA A C    12 
ATOM   9466  O  O    . ALA A 1 46 ? 16.690 -7.631  -5.605  1.00 0.00 ? 46 ALA A O    12 
ATOM   9467  C  CB   . ALA A 1 46 ? 13.748 -6.150  -6.053  1.00 0.00 ? 46 ALA A CB   12 
ATOM   9468  H  H    . ALA A 1 46 ? 14.415 -4.298  -4.483  1.00 0.00 ? 46 ALA A H    12 
ATOM   9469  H  HA   . ALA A 1 46 ? 14.533 -7.195  -4.359  1.00 0.00 ? 46 ALA A HA   12 
ATOM   9470  H  HB1  . ALA A 1 46 ? 13.729 -7.044  -6.676  1.00 0.00 ? 46 ALA A HB1  12 
ATOM   9471  H  HB2  . ALA A 1 46 ? 12.764 -6.007  -5.606  1.00 0.00 ? 46 ALA A HB2  12 
ATOM   9472  H  HB3  . ALA A 1 46 ? 13.989 -5.287  -6.676  1.00 0.00 ? 46 ALA A HB3  12 
ATOM   9473  N  N    . CYS A 1 47 ? 16.807 -5.407  -5.983  1.00 0.00 ? 47 CYS A N    12 
ATOM   9474  C  CA   . CYS A 1 47 ? 18.164 -5.393  -6.488  1.00 0.00 ? 47 CYS A CA   12 
ATOM   9475  C  C    . CYS A 1 47 ? 19.184 -5.486  -5.348  1.00 0.00 ? 47 CYS A C    12 
ATOM   9476  O  O    . CYS A 1 47 ? 20.263 -6.042  -5.538  1.00 0.00 ? 47 CYS A O    12 
ATOM   9477  C  CB   . CYS A 1 47 ? 18.368 -4.138  -7.333  1.00 0.00 ? 47 CYS A CB   12 
ATOM   9478  S  SG   . CYS A 1 47 ? 17.214 -3.982  -8.721  1.00 0.00 ? 47 CYS A SG   12 
ATOM   9479  H  H    . CYS A 1 47 ? 16.367 -4.507  -5.865  1.00 0.00 ? 47 CYS A H    12 
ATOM   9480  H  HA   . CYS A 1 47 ? 18.282 -6.251  -7.144  1.00 0.00 ? 47 CYS A HA   12 
ATOM   9481  H  HB2  . CYS A 1 47 ? 18.271 -3.253  -6.705  1.00 0.00 ? 47 CYS A HB2  12 
ATOM   9482  H  HB3  . CYS A 1 47 ? 19.376 -4.168  -7.741  1.00 0.00 ? 47 CYS A HB3  12 
ATOM   9483  N  N    . GLN A 1 48 ? 18.826 -4.961  -4.168  1.00 0.00 ? 48 GLN A N    12 
ATOM   9484  C  CA   . GLN A 1 48 ? 19.651 -4.897  -2.973  1.00 0.00 ? 48 GLN A CA   12 
ATOM   9485  C  C    . GLN A 1 48 ? 19.021 -5.731  -1.845  1.00 0.00 ? 48 GLN A C    12 
ATOM   9486  O  O    . GLN A 1 48 ? 18.402 -5.161  -0.946  1.00 0.00 ? 48 GLN A O    12 
ATOM   9487  C  CB   . GLN A 1 48 ? 19.745 -3.427  -2.557  1.00 0.00 ? 48 GLN A CB   12 
ATOM   9488  C  CG   . GLN A 1 48 ? 20.454 -2.564  -3.605  1.00 0.00 ? 48 GLN A CG   12 
ATOM   9489  C  CD   . GLN A 1 48 ? 20.367 -1.087  -3.238  1.00 0.00 ? 48 GLN A CD   12 
ATOM   9490  O  OE1  . GLN A 1 48 ? 21.374 -0.459  -2.923  1.00 0.00 ? 48 GLN A OE1  12 
ATOM   9491  N  NE2  . GLN A 1 48 ? 19.156 -0.527  -3.282  1.00 0.00 ? 48 GLN A NE2  12 
ATOM   9492  H  H    . GLN A 1 48 ? 17.982 -4.408  -4.134  1.00 0.00 ? 48 GLN A H    12 
ATOM   9493  H  HA   . GLN A 1 48 ? 20.664 -5.249  -3.164  1.00 0.00 ? 48 GLN A HA   12 
ATOM   9494  H  HB2  . GLN A 1 48 ? 18.736 -3.042  -2.407  1.00 0.00 ? 48 GLN A HB2  12 
ATOM   9495  H  HB3  . GLN A 1 48 ? 20.291 -3.357  -1.619  1.00 0.00 ? 48 GLN A HB3  12 
ATOM   9496  H  HG2  . GLN A 1 48 ? 21.500 -2.867  -3.670  1.00 0.00 ? 48 GLN A HG2  12 
ATOM   9497  H  HG3  . GLN A 1 48 ? 19.996 -2.699  -4.584  1.00 0.00 ? 48 GLN A HG3  12 
ATOM   9498  H  HE21 . GLN A 1 48 ? 18.357 -1.084  -3.555  1.00 0.00 ? 48 GLN A HE21 12 
ATOM   9499  H  HE22 . GLN A 1 48 ? 19.057 0.455   -3.064  1.00 0.00 ? 48 GLN A HE22 12 
ATOM   9500  N  N    . PRO A 1 49 ? 19.182 -7.066  -1.844  1.00 0.00 ? 49 PRO A N    12 
ATOM   9501  C  CA   . PRO A 1 49 ? 18.745 -7.923  -0.748  1.00 0.00 ? 49 PRO A CA   12 
ATOM   9502  C  C    . PRO A 1 49 ? 19.732 -7.831  0.423   1.00 0.00 ? 49 PRO A C    12 
ATOM   9503  O  O    . PRO A 1 49 ? 20.493 -8.761  0.687   1.00 0.00 ? 49 PRO A O    12 
ATOM   9504  C  CB   . PRO A 1 49 ? 18.654 -9.328  -1.352  1.00 0.00 ? 49 PRO A CB   12 
ATOM   9505  C  CG   . PRO A 1 49 ? 19.727 -9.301  -2.438  1.00 0.00 ? 49 PRO A CG   12 
ATOM   9506  C  CD   . PRO A 1 49 ? 19.635 -7.870  -2.966  1.00 0.00 ? 49 PRO A CD   12 
ATOM   9507  H  HA   . PRO A 1 49 ? 17.752 -7.635  -0.395  1.00 0.00 ? 49 PRO A HA   12 
ATOM   9508  H  HB2  . PRO A 1 49 ? 18.809 -10.128 -0.626  1.00 0.00 ? 49 PRO A HB2  12 
ATOM   9509  H  HB3  . PRO A 1 49 ? 17.677 -9.447  -1.827  1.00 0.00 ? 49 PRO A HB3  12 
ATOM   9510  H  HG2  . PRO A 1 49 ? 20.706 -9.461  -1.985  1.00 0.00 ? 49 PRO A HG2  12 
ATOM   9511  H  HG3  . PRO A 1 49 ? 19.547 -10.043 -3.217  1.00 0.00 ? 49 PRO A HG3  12 
ATOM   9512  H  HD2  . PRO A 1 49 ? 20.609 -7.552  -3.335  1.00 0.00 ? 49 PRO A HD2  12 
ATOM   9513  H  HD3  . PRO A 1 49 ? 18.891 -7.828  -3.763  1.00 0.00 ? 49 PRO A HD3  12 
ATOM   9514  N  N    . ALA A 1 50 ? 19.706 -6.695  1.129   1.00 0.00 ? 50 ALA A N    12 
ATOM   9515  C  CA   . ALA A 1 50 ? 20.519 -6.451  2.312   1.00 0.00 ? 50 ALA A CA   12 
ATOM   9516  C  C    . ALA A 1 50 ? 20.031 -7.290  3.496   1.00 0.00 ? 50 ALA A C    12 
ATOM   9517  O  O    . ALA A 1 50 ? 18.847 -7.621  3.583   1.00 0.00 ? 50 ALA A O    12 
ATOM   9518  C  CB   . ALA A 1 50 ? 20.477 -4.958  2.650   1.00 0.00 ? 50 ALA A CB   12 
ATOM   9519  H  H    . ALA A 1 50 ? 19.074 -5.963  0.832   1.00 0.00 ? 50 ALA A H    12 
ATOM   9520  H  HA   . ALA A 1 50 ? 21.553 -6.719  2.085   1.00 0.00 ? 50 ALA A HA   12 
ATOM   9521  H  HB1  . ALA A 1 50 ? 19.454 -4.659  2.877   1.00 0.00 ? 50 ALA A HB1  12 
ATOM   9522  H  HB2  . ALA A 1 50 ? 21.112 -4.756  3.513   1.00 0.00 ? 50 ALA A HB2  12 
ATOM   9523  H  HB3  . ALA A 1 50 ? 20.839 -4.380  1.799   1.00 0.00 ? 50 ALA A HB3  12 
ATOM   9524  N  N    . THR A 1 51 ? 20.948 -7.626  4.410   1.00 0.00 ? 51 THR A N    12 
ATOM   9525  C  CA   . THR A 1 51 ? 20.642 -8.265  5.682   1.00 0.00 ? 51 THR A CA   12 
ATOM   9526  C  C    . THR A 1 51 ? 21.650 -7.780  6.723   1.00 0.00 ? 51 THR A C    12 
ATOM   9527  O  O    . THR A 1 51 ? 22.852 -7.745  6.378   1.00 0.00 ? 51 THR A O    12 
ATOM   9528  C  CB   . THR A 1 51 ? 20.681 -9.795  5.528   1.00 0.00 ? 51 THR A CB   12 
ATOM   9529  O  OG1  . THR A 1 51 ? 19.854 -10.203 4.457   1.00 0.00 ? 51 THR A OG1  12 
ATOM   9530  C  CG2  . THR A 1 51 ? 20.206 -10.497 6.805   1.00 0.00 ? 51 THR A CG2  12 
ATOM   9531  O  OXT  . THR A 1 51 ? 21.203 -7.445  7.842   1.00 0.00 ? 51 THR A OXT  12 
ATOM   9532  H  H    . THR A 1 51 ? 21.910 -7.350  4.270   1.00 0.00 ? 51 THR A H    12 
ATOM   9533  H  HA   . THR A 1 51 ? 19.642 -7.966  6.007   1.00 0.00 ? 51 THR A HA   12 
ATOM   9534  H  HB   . THR A 1 51 ? 21.702 -10.114 5.311   1.00 0.00 ? 51 THR A HB   12 
ATOM   9535  H  HG1  . THR A 1 51 ? 19.112 -9.594  4.394   1.00 0.00 ? 51 THR A HG1  12 
ATOM   9536  H  HG21 . THR A 1 51 ? 20.207 -11.577 6.648   1.00 0.00 ? 51 THR A HG21 12 
ATOM   9537  H  HG22 . THR A 1 51 ? 20.873 -10.264 7.636   1.00 0.00 ? 51 THR A HG22 12 
ATOM   9538  H  HG23 . THR A 1 51 ? 19.195 -10.174 7.055   1.00 0.00 ? 51 THR A HG23 12 
HETATM 9539  ZN ZN   . ZN  B 2 .  ? 6.644  4.649   -0.541  1.00 0.00 ? 52 ZN  A ZN   12 
HETATM 9540  ZN ZN   . ZN  C 2 .  ? 15.337 -2.660  -8.870  1.00 0.00 ? 53 ZN  A ZN   12 
ATOM   9541  N  N    . ALA A 1 1  ? 4.657  11.821  -6.281  1.00 0.00 ? 1  ALA A N    13 
ATOM   9542  C  CA   . ALA A 1 1  ? 3.769  10.737  -6.741  1.00 0.00 ? 1  ALA A CA   13 
ATOM   9543  C  C    . ALA A 1 1  ? 3.620  9.647   -5.676  1.00 0.00 ? 1  ALA A C    13 
ATOM   9544  O  O    . ALA A 1 1  ? 4.338  9.648   -4.680  1.00 0.00 ? 1  ALA A O    13 
ATOM   9545  C  CB   . ALA A 1 1  ? 4.290  10.140  -8.053  1.00 0.00 ? 1  ALA A CB   13 
ATOM   9546  H  H1   . ALA A 1 1  ? 4.282  12.255  -5.444  1.00 0.00 ? 1  ALA A H1   13 
ATOM   9547  H  H2   . ALA A 1 1  ? 5.564  11.436  -6.064  1.00 0.00 ? 1  ALA A H2   13 
ATOM   9548  H  H3   . ALA A 1 1  ? 4.751  12.522  -7.001  1.00 0.00 ? 1  ALA A H3   13 
ATOM   9549  H  HA   . ALA A 1 1  ? 2.785  11.172  -6.928  1.00 0.00 ? 1  ALA A HA   13 
ATOM   9550  H  HB1  . ALA A 1 1  ? 3.596  9.386   -8.426  1.00 0.00 ? 1  ALA A HB1  13 
ATOM   9551  H  HB2  . ALA A 1 1  ? 4.389  10.927  -8.803  1.00 0.00 ? 1  ALA A HB2  13 
ATOM   9552  H  HB3  . ALA A 1 1  ? 5.264  9.678   -7.889  1.00 0.00 ? 1  ALA A HB3  13 
ATOM   9553  N  N    . ARG A 1 2  ? 2.693  8.709   -5.897  1.00 0.00 ? 2  ARG A N    13 
ATOM   9554  C  CA   . ARG A 1 2  ? 2.573  7.496   -5.096  1.00 0.00 ? 2  ARG A CA   13 
ATOM   9555  C  C    . ARG A 1 2  ? 3.731  6.523   -5.362  1.00 0.00 ? 2  ARG A C    13 
ATOM   9556  O  O    . ARG A 1 2  ? 4.620  6.805   -6.167  1.00 0.00 ? 2  ARG A O    13 
ATOM   9557  C  CB   . ARG A 1 2  ? 1.189  6.863   -5.296  1.00 0.00 ? 2  ARG A CB   13 
ATOM   9558  C  CG   . ARG A 1 2  ? 0.975  6.289   -6.705  1.00 0.00 ? 2  ARG A CG   13 
ATOM   9559  C  CD   . ARG A 1 2  ? -0.474 5.832   -6.914  1.00 0.00 ? 2  ARG A CD   13 
ATOM   9560  N  NE   . ARG A 1 2  ? -0.820 4.665   -6.087  1.00 0.00 ? 2  ARG A NE   13 
ATOM   9561  C  CZ   . ARG A 1 2  ? -1.411 4.685   -4.879  1.00 0.00 ? 2  ARG A CZ   13 
ATOM   9562  N  NH1  . ARG A 1 2  ? -1.705 5.836   -4.258  1.00 0.00 ? 2  ARG A NH1  13 
ATOM   9563  N  NH2  . ARG A 1 2  ? -1.707 3.527   -4.278  1.00 0.00 ? 2  ARG A NH2  13 
ATOM   9564  H  H    . ARG A 1 2  ? 2.111  8.787   -6.718  1.00 0.00 ? 2  ARG A H    13 
ATOM   9565  H  HA   . ARG A 1 2  ? 2.631  7.785   -4.045  1.00 0.00 ? 2  ARG A HA   13 
ATOM   9566  H  HB2  . ARG A 1 2  ? 1.059  6.068   -4.562  1.00 0.00 ? 2  ARG A HB2  13 
ATOM   9567  H  HB3  . ARG A 1 2  ? 0.437  7.629   -5.108  1.00 0.00 ? 2  ARG A HB3  13 
ATOM   9568  H  HG2  . ARG A 1 2  ? 1.196  7.056   -7.447  1.00 0.00 ? 2  ARG A HG2  13 
ATOM   9569  H  HG3  . ARG A 1 2  ? 1.646  5.445   -6.870  1.00 0.00 ? 2  ARG A HG3  13 
ATOM   9570  H  HD2  . ARG A 1 2  ? -1.159 6.661   -6.742  1.00 0.00 ? 2  ARG A HD2  13 
ATOM   9571  H  HD3  . ARG A 1 2  ? -0.581 5.532   -7.957  1.00 0.00 ? 2  ARG A HD3  13 
ATOM   9572  H  HE   . ARG A 1 2  ? -0.610 3.764   -6.493  1.00 0.00 ? 2  ARG A HE   13 
ATOM   9573  H  HH11 . ARG A 1 2  ? -1.498 6.719   -4.700  1.00 0.00 ? 2  ARG A HH11 13 
ATOM   9574  H  HH12 . ARG A 1 2  ? -2.146 5.825   -3.349  1.00 0.00 ? 2  ARG A HH12 13 
ATOM   9575  H  HH21 . ARG A 1 2  ? -1.516 2.649   -4.740  1.00 0.00 ? 2  ARG A HH21 13 
ATOM   9576  H  HH22 . ARG A 1 2  ? -2.090 3.523   -3.342  1.00 0.00 ? 2  ARG A HH22 13 
ATOM   9577  N  N    . CYS A 1 3  ? 3.707  5.376   -4.675  1.00 0.00 ? 3  CYS A N    13 
ATOM   9578  C  CA   . CYS A 1 3  ? 4.804  4.418   -4.599  1.00 0.00 ? 3  CYS A CA   13 
ATOM   9579  C  C    . CYS A 1 3  ? 4.305  3.005   -4.914  1.00 0.00 ? 3  CYS A C    13 
ATOM   9580  O  O    . CYS A 1 3  ? 3.102  2.752   -4.878  1.00 0.00 ? 3  CYS A O    13 
ATOM   9581  C  CB   . CYS A 1 3  ? 5.362  4.520   -3.178  1.00 0.00 ? 3  CYS A CB   13 
ATOM   9582  S  SG   . CYS A 1 3  ? 6.873  3.607   -2.802  1.00 0.00 ? 3  CYS A SG   13 
ATOM   9583  H  H    . CYS A 1 3  ? 2.902  5.177   -4.101  1.00 0.00 ? 3  CYS A H    13 
ATOM   9584  H  HA   . CYS A 1 3  ? 5.594  4.679   -5.306  1.00 0.00 ? 3  CYS A HA   13 
ATOM   9585  H  HB2  . CYS A 1 3  ? 5.584  5.572   -3.003  1.00 0.00 ? 3  CYS A HB2  13 
ATOM   9586  H  HB3  . CYS A 1 3  ? 4.585  4.201   -2.483  1.00 0.00 ? 3  CYS A HB3  13 
ATOM   9587  N  N    . LYS A 1 4  ? 5.224  2.081   -5.218  1.00 0.00 ? 4  LYS A N    13 
ATOM   9588  C  CA   . LYS A 1 4  ? 4.935  0.662   -5.363  1.00 0.00 ? 4  LYS A CA   13 
ATOM   9589  C  C    . LYS A 1 4  ? 4.886  -0.041  -4.004  1.00 0.00 ? 4  LYS A C    13 
ATOM   9590  O  O    . LYS A 1 4  ? 4.030  -0.896  -3.783  1.00 0.00 ? 4  LYS A O    13 
ATOM   9591  C  CB   . LYS A 1 4  ? 5.986  0.020   -6.274  1.00 0.00 ? 4  LYS A CB   13 
ATOM   9592  C  CG   . LYS A 1 4  ? 6.057  0.644   -7.676  1.00 0.00 ? 4  LYS A CG   13 
ATOM   9593  C  CD   . LYS A 1 4  ? 4.726  0.682   -8.446  1.00 0.00 ? 4  LYS A CD   13 
ATOM   9594  C  CE   . LYS A 1 4  ? 4.053  -0.687  -8.608  1.00 0.00 ? 4  LYS A CE   13 
ATOM   9595  N  NZ   . LYS A 1 4  ? 4.908  -1.646  -9.329  1.00 0.00 ? 4  LYS A NZ   13 
ATOM   9596  H  H    . LYS A 1 4  ? 6.192  2.354   -5.320  1.00 0.00 ? 4  LYS A H    13 
ATOM   9597  H  HA   . LYS A 1 4  ? 3.960  0.534   -5.821  1.00 0.00 ? 4  LYS A HA   13 
ATOM   9598  H  HB2  . LYS A 1 4  ? 6.965  0.129   -5.803  1.00 0.00 ? 4  LYS A HB2  13 
ATOM   9599  H  HB3  . LYS A 1 4  ? 5.765  -1.041  -6.361  1.00 0.00 ? 4  LYS A HB3  13 
ATOM   9600  H  HG2  . LYS A 1 4  ? 6.411  1.669   -7.582  1.00 0.00 ? 4  LYS A HG2  13 
ATOM   9601  H  HG3  . LYS A 1 4  ? 6.795  0.094   -8.259  1.00 0.00 ? 4  LYS A HG3  13 
ATOM   9602  H  HD2  . LYS A 1 4  ? 4.036  1.358   -7.940  1.00 0.00 ? 4  LYS A HD2  13 
ATOM   9603  H  HD3  . LYS A 1 4  ? 4.920  1.097   -9.437  1.00 0.00 ? 4  LYS A HD3  13 
ATOM   9604  H  HE2  . LYS A 1 4  ? 3.792  -1.099  -7.634  1.00 0.00 ? 4  LYS A HE2  13 
ATOM   9605  H  HE3  . LYS A 1 4  ? 3.131  -0.552  -9.178  1.00 0.00 ? 4  LYS A HE3  13 
ATOM   9606  H  HZ1  . LYS A 1 4  ? 5.145  -1.274  -10.238 1.00 0.00 ? 4  LYS A HZ1  13 
ATOM   9607  H  HZ2  . LYS A 1 4  ? 5.752  -1.810  -8.800  1.00 0.00 ? 4  LYS A HZ2  13 
ATOM   9608  H  HZ3  . LYS A 1 4  ? 4.411  -2.518  -9.445  1.00 0.00 ? 4  LYS A HZ3  13 
ATOM   9609  N  N    . VAL A 1 5  ? 5.805  0.317   -3.102  1.00 0.00 ? 5  VAL A N    13 
ATOM   9610  C  CA   . VAL A 1 5  ? 5.895  -0.242  -1.759  1.00 0.00 ? 5  VAL A CA   13 
ATOM   9611  C  C    . VAL A 1 5  ? 4.676  0.179   -0.938  1.00 0.00 ? 5  VAL A C    13 
ATOM   9612  O  O    . VAL A 1 5  ? 3.782  -0.631  -0.697  1.00 0.00 ? 5  VAL A O    13 
ATOM   9613  C  CB   . VAL A 1 5  ? 7.220  0.181   -1.101  1.00 0.00 ? 5  VAL A CB   13 
ATOM   9614  C  CG1  . VAL A 1 5  ? 7.348  -0.325  0.342   1.00 0.00 ? 5  VAL A CG1  13 
ATOM   9615  C  CG2  . VAL A 1 5  ? 8.408  -0.354  -1.903  1.00 0.00 ? 5  VAL A CG2  13 
ATOM   9616  H  H    . VAL A 1 5  ? 6.498  0.991   -3.385  1.00 0.00 ? 5  VAL A H    13 
ATOM   9617  H  HA   . VAL A 1 5  ? 5.898  -1.329  -1.836  1.00 0.00 ? 5  VAL A HA   13 
ATOM   9618  H  HB   . VAL A 1 5  ? 7.287  1.266   -1.085  1.00 0.00 ? 5  VAL A HB   13 
ATOM   9619  H  HG11 . VAL A 1 5  ? 7.285  -1.412  0.364   1.00 0.00 ? 5  VAL A HG11 13 
ATOM   9620  H  HG12 . VAL A 1 5  ? 8.311  -0.011  0.748   1.00 0.00 ? 5  VAL A HG12 13 
ATOM   9621  H  HG13 . VAL A 1 5  ? 6.564  0.094   0.973   1.00 0.00 ? 5  VAL A HG13 13 
ATOM   9622  H  HG21 . VAL A 1 5  ? 8.438  0.097   -2.896  1.00 0.00 ? 5  VAL A HG21 13 
ATOM   9623  H  HG22 . VAL A 1 5  ? 9.324  -0.098  -1.374  1.00 0.00 ? 5  VAL A HG22 13 
ATOM   9624  H  HG23 . VAL A 1 5  ? 8.344  -1.438  -1.999  1.00 0.00 ? 5  VAL A HG23 13 
ATOM   9625  N  N    . CYS A 1 6  ? 4.644  1.444   -0.504  1.00 0.00 ? 6  CYS A N    13 
ATOM   9626  C  CA   . CYS A 1 6  ? 3.664  1.921   0.463   1.00 0.00 ? 6  CYS A CA   13 
ATOM   9627  C  C    . CYS A 1 6  ? 2.318  2.252   -0.187  1.00 0.00 ? 6  CYS A C    13 
ATOM   9628  O  O    . CYS A 1 6  ? 1.308  2.249   0.515   1.00 0.00 ? 6  CYS A O    13 
ATOM   9629  C  CB   . CYS A 1 6  ? 4.221  3.098   1.274   1.00 0.00 ? 6  CYS A CB   13 
ATOM   9630  S  SG   . CYS A 1 6  ? 4.839  4.523   0.344   1.00 0.00 ? 6  CYS A SG   13 
ATOM   9631  H  H    . CYS A 1 6  ? 5.387  2.071   -0.774  1.00 0.00 ? 6  CYS A H    13 
ATOM   9632  H  HA   . CYS A 1 6  ? 3.478  1.121   1.182   1.00 0.00 ? 6  CYS A HA   13 
ATOM   9633  H  HB2  . CYS A 1 6  ? 3.434  3.452   1.940   1.00 0.00 ? 6  CYS A HB2  13 
ATOM   9634  H  HB3  . CYS A 1 6  ? 5.042  2.734   1.892   1.00 0.00 ? 6  CYS A HB3  13 
ATOM   9635  N  N    . ARG A 1 7  ? 2.286  2.519   -1.503  1.00 0.00 ? 7  ARG A N    13 
ATOM   9636  C  CA   . ARG A 1 7  ? 1.051  2.751   -2.254  1.00 0.00 ? 7  ARG A CA   13 
ATOM   9637  C  C    . ARG A 1 7  ? 0.239  3.879   -1.612  1.00 0.00 ? 7  ARG A C    13 
ATOM   9638  O  O    . ARG A 1 7  ? -0.974 3.776   -1.437  1.00 0.00 ? 7  ARG A O    13 
ATOM   9639  C  CB   . ARG A 1 7  ? 0.285  1.426   -2.411  1.00 0.00 ? 7  ARG A CB   13 
ATOM   9640  C  CG   . ARG A 1 7  ? 0.956  0.567   -3.492  1.00 0.00 ? 7  ARG A CG   13 
ATOM   9641  C  CD   . ARG A 1 7  ? 0.666  -0.921  -3.289  1.00 0.00 ? 7  ARG A CD   13 
ATOM   9642  N  NE   . ARG A 1 7  ? 1.451  -1.447  -2.164  1.00 0.00 ? 7  ARG A NE   13 
ATOM   9643  C  CZ   . ARG A 1 7  ? 1.374  -2.691  -1.668  1.00 0.00 ? 7  ARG A CZ   13 
ATOM   9644  N  NH1  . ARG A 1 7  ? 0.486  -3.572  -2.150  1.00 0.00 ? 7  ARG A NH1  13 
ATOM   9645  N  NH2  . ARG A 1 7  ? 2.206  -3.045  -0.681  1.00 0.00 ? 7  ARG A NH2  13 
ATOM   9646  H  H    . ARG A 1 7  ? 3.151  2.515   -2.024  1.00 0.00 ? 7  ARG A H    13 
ATOM   9647  H  HA   . ARG A 1 7  ? 1.306  3.112   -3.248  1.00 0.00 ? 7  ARG A HA   13 
ATOM   9648  H  HB2  . ARG A 1 7  ? 0.265  0.895   -1.460  1.00 0.00 ? 7  ARG A HB2  13 
ATOM   9649  H  HB3  . ARG A 1 7  ? -0.746 1.597   -2.717  1.00 0.00 ? 7  ARG A HB3  13 
ATOM   9650  H  HG2  . ARG A 1 7  ? 0.587  0.882   -4.469  1.00 0.00 ? 7  ARG A HG2  13 
ATOM   9651  H  HG3  . ARG A 1 7  ? 2.034  0.714   -3.470  1.00 0.00 ? 7  ARG A HG3  13 
ATOM   9652  H  HD2  . ARG A 1 7  ? -0.401 -1.065  -3.116  1.00 0.00 ? 7  ARG A HD2  13 
ATOM   9653  H  HD3  . ARG A 1 7  ? 0.959  -1.458  -4.192  1.00 0.00 ? 7  ARG A HD3  13 
ATOM   9654  H  HE   . ARG A 1 7  ? 2.156  -0.833  -1.775  1.00 0.00 ? 7  ARG A HE   13 
ATOM   9655  H  HH11 . ARG A 1 7  ? -0.136 -3.302  -2.897  1.00 0.00 ? 7  ARG A HH11 13 
ATOM   9656  H  HH12 . ARG A 1 7  ? 0.437  -4.507  -1.771  1.00 0.00 ? 7  ARG A HH12 13 
ATOM   9657  H  HH21 . ARG A 1 7  ? 2.887  -2.372  -0.348  1.00 0.00 ? 7  ARG A HH21 13 
ATOM   9658  H  HH22 . ARG A 1 7  ? 2.173  -3.972  -0.281  1.00 0.00 ? 7  ARG A HH22 13 
ATOM   9659  N  N    . LYS A 1 8  ? 0.939  4.973   -1.295  1.00 0.00 ? 8  LYS A N    13 
ATOM   9660  C  CA   . LYS A 1 8  ? 0.432  6.066   -0.489  1.00 0.00 ? 8  LYS A CA   13 
ATOM   9661  C  C    . LYS A 1 8  ? 1.296  7.293   -0.771  1.00 0.00 ? 8  LYS A C    13 
ATOM   9662  O  O    . LYS A 1 8  ? 2.446  7.351   -0.340  1.00 0.00 ? 8  LYS A O    13 
ATOM   9663  C  CB   . LYS A 1 8  ? 0.500  5.664   0.990   1.00 0.00 ? 8  LYS A CB   13 
ATOM   9664  C  CG   . LYS A 1 8  ? -0.020 6.771   1.922   1.00 0.00 ? 8  LYS A CG   13 
ATOM   9665  C  CD   . LYS A 1 8  ? 0.585  6.670   3.328   1.00 0.00 ? 8  LYS A CD   13 
ATOM   9666  C  CE   . LYS A 1 8  ? 1.886  7.477   3.477   1.00 0.00 ? 8  LYS A CE   13 
ATOM   9667  N  NZ   . LYS A 1 8  ? 2.956  7.026   2.571   1.00 0.00 ? 8  LYS A NZ   13 
ATOM   9668  H  H    . LYS A 1 8  ? 1.926  4.989   -1.508  1.00 0.00 ? 8  LYS A H    13 
ATOM   9669  H  HA   . LYS A 1 8  ? -0.607 6.275   -0.743  1.00 0.00 ? 8  LYS A HA   13 
ATOM   9670  H  HB2  . LYS A 1 8  ? -0.109 4.771   1.153   1.00 0.00 ? 8  LYS A HB2  13 
ATOM   9671  H  HB3  . LYS A 1 8  ? 1.533  5.411   1.221   1.00 0.00 ? 8  LYS A HB3  13 
ATOM   9672  H  HG2  . LYS A 1 8  ? 0.183  7.766   1.530   1.00 0.00 ? 8  LYS A HG2  13 
ATOM   9673  H  HG3  . LYS A 1 8  ? -1.103 6.659   1.993   1.00 0.00 ? 8  LYS A HG3  13 
ATOM   9674  H  HD2  . LYS A 1 8  ? -0.133 7.086   4.035   1.00 0.00 ? 8  LYS A HD2  13 
ATOM   9675  H  HD3  . LYS A 1 8  ? 0.751  5.624   3.592   1.00 0.00 ? 8  LYS A HD3  13 
ATOM   9676  H  HE2  . LYS A 1 8  ? 1.685  8.532   3.283   1.00 0.00 ? 8  LYS A HE2  13 
ATOM   9677  H  HE3  . LYS A 1 8  ? 2.242  7.378   4.502   1.00 0.00 ? 8  LYS A HE3  13 
ATOM   9678  H  HZ1  . LYS A 1 8  ? 3.808  7.533   2.778   1.00 0.00 ? 8  LYS A HZ1  13 
ATOM   9679  H  HZ2  . LYS A 1 8  ? 3.128  6.040   2.702   1.00 0.00 ? 8  LYS A HZ2  13 
ATOM   9680  H  HZ3  . LYS A 1 8  ? 2.704  7.202   1.605   1.00 0.00 ? 8  LYS A HZ3  13 
ATOM   9681  N  N    . LYS A 1 9  ? 0.725  8.276   -1.475  1.00 0.00 ? 9  LYS A N    13 
ATOM   9682  C  CA   . LYS A 1 9  ? 1.327  9.589   -1.636  1.00 0.00 ? 9  LYS A CA   13 
ATOM   9683  C  C    . LYS A 1 9  ? 1.279  10.306  -0.283  1.00 0.00 ? 9  LYS A C    13 
ATOM   9684  O  O    . LYS A 1 9  ? 0.252  10.274  0.393   1.00 0.00 ? 9  LYS A O    13 
ATOM   9685  C  CB   . LYS A 1 9  ? 0.535  10.366  -2.698  1.00 0.00 ? 9  LYS A CB   13 
ATOM   9686  C  CG   . LYS A 1 9  ? 1.202  11.702  -3.039  1.00 0.00 ? 9  LYS A CG   13 
ATOM   9687  C  CD   . LYS A 1 9  ? 0.267  12.579  -3.880  1.00 0.00 ? 9  LYS A CD   13 
ATOM   9688  C  CE   . LYS A 1 9  ? 0.949  13.871  -4.350  1.00 0.00 ? 9  LYS A CE   13 
ATOM   9689  N  NZ   . LYS A 1 9  ? 1.525  14.648  -3.236  1.00 0.00 ? 9  LYS A NZ   13 
ATOM   9690  H  H    . LYS A 1 9  ? -0.220 8.154   -1.806  1.00 0.00 ? 9  LYS A H    13 
ATOM   9691  H  HA   . LYS A 1 9  ? 2.359  9.474   -1.973  1.00 0.00 ? 9  LYS A HA   13 
ATOM   9692  H  HB2  . LYS A 1 9  ? 0.471  9.770   -3.610  1.00 0.00 ? 9  LYS A HB2  13 
ATOM   9693  H  HB3  . LYS A 1 9  ? -0.474 10.550  -2.322  1.00 0.00 ? 9  LYS A HB3  13 
ATOM   9694  H  HG2  . LYS A 1 9  ? 1.436  12.233  -2.117  1.00 0.00 ? 9  LYS A HG2  13 
ATOM   9695  H  HG3  . LYS A 1 9  ? 2.123  11.504  -3.587  1.00 0.00 ? 9  LYS A HG3  13 
ATOM   9696  H  HD2  . LYS A 1 9  ? -0.058 12.018  -4.757  1.00 0.00 ? 9  LYS A HD2  13 
ATOM   9697  H  HD3  . LYS A 1 9  ? -0.612 12.833  -3.286  1.00 0.00 ? 9  LYS A HD3  13 
ATOM   9698  H  HE2  . LYS A 1 9  ? 1.738  13.622  -5.060  1.00 0.00 ? 9  LYS A HE2  13 
ATOM   9699  H  HE3  . LYS A 1 9  ? 0.209  14.488  -4.863  1.00 0.00 ? 9  LYS A HE3  13 
ATOM   9700  H  HZ1  . LYS A 1 9  ? 2.269  14.118  -2.794  1.00 0.00 ? 9  LYS A HZ1  13 
ATOM   9701  H  HZ2  . LYS A 1 9  ? 1.919  15.508  -3.593  1.00 0.00 ? 9  LYS A HZ2  13 
ATOM   9702  H  HZ3  . LYS A 1 9  ? 0.813  14.861  -2.553  1.00 0.00 ? 9  LYS A HZ3  13 
ATOM   9703  N  N    . GLY A 1 10 ? 2.384  10.943  0.118   1.00 0.00 ? 10 GLY A N    13 
ATOM   9704  C  CA   . GLY A 1 10 ? 2.423  11.733  1.337   1.00 0.00 ? 10 GLY A CA   13 
ATOM   9705  C  C    . GLY A 1 10 ? 3.810  12.331  1.537   1.00 0.00 ? 10 GLY A C    13 
ATOM   9706  O  O    . GLY A 1 10 ? 3.971  13.549  1.504   1.00 0.00 ? 10 GLY A O    13 
ATOM   9707  H  H    . GLY A 1 10 ? 3.207  10.935  -0.469  1.00 0.00 ? 10 GLY A H    13 
ATOM   9708  H  HA2  . GLY A 1 10 ? 1.689  12.539  1.269   1.00 0.00 ? 10 GLY A HA2  13 
ATOM   9709  H  HA3  . GLY A 1 10 ? 2.185  11.098  2.193   1.00 0.00 ? 10 GLY A HA3  13 
ATOM   9710  N  N    . GLU A 1 11 ? 4.807  11.463  1.734   1.00 0.00 ? 11 GLU A N    13 
ATOM   9711  C  CA   . GLU A 1 11 ? 6.210  11.835  1.864   1.00 0.00 ? 11 GLU A CA   13 
ATOM   9712  C  C    . GLU A 1 11 ? 6.900  11.886  0.497   1.00 0.00 ? 11 GLU A C    13 
ATOM   9713  O  O    . GLU A 1 11 ? 8.087  11.580  0.388   1.00 0.00 ? 11 GLU A O    13 
ATOM   9714  C  CB   . GLU A 1 11 ? 6.927  10.904  2.863   1.00 0.00 ? 11 GLU A CB   13 
ATOM   9715  C  CG   . GLU A 1 11 ? 7.091  9.432   2.439   1.00 0.00 ? 11 GLU A CG   13 
ATOM   9716  C  CD   . GLU A 1 11 ? 5.783  8.650   2.418   1.00 0.00 ? 11 GLU A CD   13 
ATOM   9717  O  OE1  . GLU A 1 11 ? 5.090  8.703   1.378   1.00 0.00 ? 11 GLU A OE1  13 
ATOM   9718  O  OE2  . GLU A 1 11 ? 5.470  8.013   3.448   1.00 0.00 ? 11 GLU A OE2  13 
ATOM   9719  H  H    . GLU A 1 11 ? 4.597  10.476  1.678   1.00 0.00 ? 11 GLU A H    13 
ATOM   9720  H  HA   . GLU A 1 11 ? 6.268  12.840  2.287   1.00 0.00 ? 11 GLU A HA   13 
ATOM   9721  H  HB2  . GLU A 1 11 ? 7.928  11.316  3.018   1.00 0.00 ? 11 GLU A HB2  13 
ATOM   9722  H  HB3  . GLU A 1 11 ? 6.401  10.935  3.820   1.00 0.00 ? 11 GLU A HB3  13 
ATOM   9723  H  HG2  . GLU A 1 11 ? 7.564  9.359   1.462   1.00 0.00 ? 11 GLU A HG2  13 
ATOM   9724  H  HG3  . GLU A 1 11 ? 7.753  8.951   3.161   1.00 0.00 ? 11 GLU A HG3  13 
ATOM   9725  N  N    . ASP A 1 12 ? 6.168  12.291  -0.551  1.00 0.00 ? 12 ASP A N    13 
ATOM   9726  C  CA   . ASP A 1 12 ? 6.609  12.193  -1.933  1.00 0.00 ? 12 ASP A CA   13 
ATOM   9727  C  C    . ASP A 1 12 ? 7.423  13.424  -2.337  1.00 0.00 ? 12 ASP A C    13 
ATOM   9728  O  O    . ASP A 1 12 ? 7.138  14.089  -3.331  1.00 0.00 ? 12 ASP A O    13 
ATOM   9729  C  CB   . ASP A 1 12 ? 5.413  11.902  -2.847  1.00 0.00 ? 12 ASP A CB   13 
ATOM   9730  C  CG   . ASP A 1 12 ? 4.371  13.010  -2.911  1.00 0.00 ? 12 ASP A CG   13 
ATOM   9731  O  OD1  . ASP A 1 12 ? 3.798  13.343  -1.850  1.00 0.00 ? 12 ASP A OD1  13 
ATOM   9732  O  OD2  . ASP A 1 12 ? 4.107  13.466  -4.045  1.00 0.00 ? 12 ASP A OD2  13 
ATOM   9733  H  H    . ASP A 1 12 ? 5.235  12.652  -0.397  1.00 0.00 ? 12 ASP A H    13 
ATOM   9734  H  HA   . ASP A 1 12 ? 7.279  11.341  -2.028  1.00 0.00 ? 12 ASP A HA   13 
ATOM   9735  H  HB2  . ASP A 1 12 ? 5.800  11.744  -3.851  1.00 0.00 ? 12 ASP A HB2  13 
ATOM   9736  H  HB3  . ASP A 1 12 ? 4.922  10.990  -2.504  1.00 0.00 ? 12 ASP A HB3  13 
ATOM   9737  N  N    . ASP A 1 13 ? 8.470  13.687  -1.551  1.00 0.00 ? 13 ASP A N    13 
ATOM   9738  C  CA   . ASP A 1 13 ? 9.480  14.702  -1.787  1.00 0.00 ? 13 ASP A CA   13 
ATOM   9739  C  C    . ASP A 1 13 ? 10.295 14.364  -3.036  1.00 0.00 ? 13 ASP A C    13 
ATOM   9740  O  O    . ASP A 1 13 ? 10.367 15.158  -3.972  1.00 0.00 ? 13 ASP A O    13 
ATOM   9741  C  CB   . ASP A 1 13 ? 10.353 14.785  -0.531  1.00 0.00 ? 13 ASP A CB   13 
ATOM   9742  C  CG   . ASP A 1 13 ? 11.549 15.714  -0.704  1.00 0.00 ? 13 ASP A CG   13 
ATOM   9743  O  OD1  . ASP A 1 13 ? 11.337 16.854  -1.167  1.00 0.00 ? 13 ASP A OD1  13 
ATOM   9744  O  OD2  . ASP A 1 13 ? 12.663 15.254  -0.380  1.00 0.00 ? 13 ASP A OD2  13 
ATOM   9745  H  H    . ASP A 1 13 ? 8.614  13.086  -0.751  1.00 0.00 ? 13 ASP A H    13 
ATOM   9746  H  HA   . ASP A 1 13 ? 8.992  15.662  -1.934  1.00 0.00 ? 13 ASP A HA   13 
ATOM   9747  H  HB2  . ASP A 1 13 ? 9.749  15.135  0.308   1.00 0.00 ? 13 ASP A HB2  13 
ATOM   9748  H  HB3  . ASP A 1 13 ? 10.720 13.788  -0.288  1.00 0.00 ? 13 ASP A HB3  13 
ATOM   9749  N  N    . LYS A 1 14 ? 10.911 13.179  -3.031  1.00 0.00 ? 14 LYS A N    13 
ATOM   9750  C  CA   . LYS A 1 14 ? 11.859 12.724  -4.036  1.00 0.00 ? 14 LYS A CA   13 
ATOM   9751  C  C    . LYS A 1 14 ? 11.718 11.206  -4.180  1.00 0.00 ? 14 LYS A C    13 
ATOM   9752  O  O    . LYS A 1 14 ? 12.371 10.447  -3.466  1.00 0.00 ? 14 LYS A O    13 
ATOM   9753  C  CB   . LYS A 1 14 ? 13.292 13.126  -3.649  1.00 0.00 ? 14 LYS A CB   13 
ATOM   9754  C  CG   . LYS A 1 14 ? 13.556 14.629  -3.828  1.00 0.00 ? 14 LYS A CG   13 
ATOM   9755  C  CD   . LYS A 1 14 ? 15.050 14.978  -3.747  1.00 0.00 ? 14 LYS A CD   13 
ATOM   9756  C  CE   . LYS A 1 14 ? 15.669 14.829  -2.350  1.00 0.00 ? 14 LYS A CE   13 
ATOM   9757  N  NZ   . LYS A 1 14 ? 15.153 15.828  -1.398  1.00 0.00 ? 14 LYS A NZ   13 
ATOM   9758  H  H    . LYS A 1 14 ? 10.724 12.564  -2.255  1.00 0.00 ? 14 LYS A H    13 
ATOM   9759  H  HA   . LYS A 1 14 ? 11.631 13.173  -5.002  1.00 0.00 ? 14 LYS A HA   13 
ATOM   9760  H  HB2  . LYS A 1 14 ? 13.471 12.843  -2.613  1.00 0.00 ? 14 LYS A HB2  13 
ATOM   9761  H  HB3  . LYS A 1 14 ? 13.983 12.581  -4.296  1.00 0.00 ? 14 LYS A HB3  13 
ATOM   9762  H  HG2  . LYS A 1 14 ? 13.206 14.922  -4.819  1.00 0.00 ? 14 LYS A HG2  13 
ATOM   9763  H  HG3  . LYS A 1 14 ? 12.999 15.204  -3.089  1.00 0.00 ? 14 LYS A HG3  13 
ATOM   9764  H  HD2  . LYS A 1 14 ? 15.596 14.337  -4.441  1.00 0.00 ? 14 LYS A HD2  13 
ATOM   9765  H  HD3  . LYS A 1 14 ? 15.183 16.011  -4.074  1.00 0.00 ? 14 LYS A HD3  13 
ATOM   9766  H  HE2  . LYS A 1 14 ? 15.488 13.830  -1.956  1.00 0.00 ? 14 LYS A HE2  13 
ATOM   9767  H  HE3  . LYS A 1 14 ? 16.746 14.977  -2.437  1.00 0.00 ? 14 LYS A HE3  13 
ATOM   9768  H  HZ1  . LYS A 1 14 ? 15.293 16.760  -1.760  1.00 0.00 ? 14 LYS A HZ1  13 
ATOM   9769  H  HZ2  . LYS A 1 14 ? 14.167 15.673  -1.227  1.00 0.00 ? 14 LYS A HZ2  13 
ATOM   9770  H  HZ3  . LYS A 1 14 ? 15.646 15.748  -0.515  1.00 0.00 ? 14 LYS A HZ3  13 
ATOM   9771  N  N    . LEU A 1 15 ? 10.861 10.769  -5.111  1.00 0.00 ? 15 LEU A N    13 
ATOM   9772  C  CA   . LEU A 1 15 ? 10.775 9.373   -5.523  1.00 0.00 ? 15 LEU A CA   13 
ATOM   9773  C  C    . LEU A 1 15 ? 12.038 9.004   -6.305  1.00 0.00 ? 15 LEU A C    13 
ATOM   9774  O  O    . LEU A 1 15 ? 12.353 9.628   -7.317  1.00 0.00 ? 15 LEU A O    13 
ATOM   9775  C  CB   . LEU A 1 15 ? 9.521  9.114   -6.375  1.00 0.00 ? 15 LEU A CB   13 
ATOM   9776  C  CG   . LEU A 1 15 ? 8.208  8.926   -5.592  1.00 0.00 ? 15 LEU A CG   13 
ATOM   9777  C  CD1  . LEU A 1 15 ? 8.166  7.580   -4.858  1.00 0.00 ? 15 LEU A CD1  13 
ATOM   9778  C  CD2  . LEU A 1 15 ? 7.928  10.055  -4.600  1.00 0.00 ? 15 LEU A CD2  13 
ATOM   9779  H  H    . LEU A 1 15 ? 10.293 11.447  -5.594  1.00 0.00 ? 15 LEU A H    13 
ATOM   9780  H  HA   . LEU A 1 15 ? 10.722 8.750   -4.632  1.00 0.00 ? 15 LEU A HA   13 
ATOM   9781  H  HB2  . LEU A 1 15 ? 9.399  9.943   -7.075  1.00 0.00 ? 15 LEU A HB2  13 
ATOM   9782  H  HB3  . LEU A 1 15 ? 9.678  8.203   -6.954  1.00 0.00 ? 15 LEU A HB3  13 
ATOM   9783  H  HG   . LEU A 1 15 ? 7.399  8.915   -6.324  1.00 0.00 ? 15 LEU A HG   13 
ATOM   9784  H  HD11 . LEU A 1 15 ? 8.404  6.767   -5.544  1.00 0.00 ? 15 LEU A HD11 13 
ATOM   9785  H  HD12 . LEU A 1 15 ? 8.876  7.572   -4.034  1.00 0.00 ? 15 LEU A HD12 13 
ATOM   9786  H  HD13 . LEU A 1 15 ? 7.165  7.415   -4.455  1.00 0.00 ? 15 LEU A HD13 13 
ATOM   9787  H  HD21 . LEU A 1 15 ? 7.900  11.014  -5.120  1.00 0.00 ? 15 LEU A HD21 13 
ATOM   9788  H  HD22 . LEU A 1 15 ? 6.963  9.865   -4.135  1.00 0.00 ? 15 LEU A HD22 13 
ATOM   9789  H  HD23 . LEU A 1 15 ? 8.686  10.083  -3.819  1.00 0.00 ? 15 LEU A HD23 13 
ATOM   9790  N  N    . ILE A 1 16 ? 12.753 7.991   -5.809  1.00 0.00 ? 16 ILE A N    13 
ATOM   9791  C  CA   . ILE A 1 16 ? 13.888 7.355   -6.457  1.00 0.00 ? 16 ILE A CA   13 
ATOM   9792  C  C    . ILE A 1 16 ? 13.386 6.115   -7.200  1.00 0.00 ? 16 ILE A C    13 
ATOM   9793  O  O    . ILE A 1 16 ? 13.173 5.058   -6.608  1.00 0.00 ? 16 ILE A O    13 
ATOM   9794  C  CB   . ILE A 1 16 ? 14.993 7.071   -5.417  1.00 0.00 ? 16 ILE A CB   13 
ATOM   9795  C  CG1  . ILE A 1 16 ? 16.129 6.236   -6.033  1.00 0.00 ? 16 ILE A CG1  13 
ATOM   9796  C  CG2  . ILE A 1 16 ? 14.465 6.416   -4.129  1.00 0.00 ? 16 ILE A CG2  13 
ATOM   9797  C  CD1  . ILE A 1 16 ? 17.450 6.420   -5.276  1.00 0.00 ? 16 ILE A CD1  13 
ATOM   9798  H  H    . ILE A 1 16 ? 12.370 7.502   -5.013  1.00 0.00 ? 16 ILE A H    13 
ATOM   9799  H  HA   . ILE A 1 16 ? 14.322 8.040   -7.188  1.00 0.00 ? 16 ILE A HA   13 
ATOM   9800  H  HB   . ILE A 1 16 ? 15.407 8.040   -5.135  1.00 0.00 ? 16 ILE A HB   13 
ATOM   9801  H  HG12 . ILE A 1 16 ? 15.848 5.181   -6.033  1.00 0.00 ? 16 ILE A HG12 13 
ATOM   9802  H  HG13 . ILE A 1 16 ? 16.296 6.558   -7.063  1.00 0.00 ? 16 ILE A HG13 13 
ATOM   9803  H  HG21 . ILE A 1 16 ? 15.280 6.252   -3.432  1.00 0.00 ? 16 ILE A HG21 13 
ATOM   9804  H  HG22 . ILE A 1 16 ? 13.751 7.075   -3.640  1.00 0.00 ? 16 ILE A HG22 13 
ATOM   9805  H  HG23 . ILE A 1 16 ? 13.992 5.457   -4.328  1.00 0.00 ? 16 ILE A HG23 13 
ATOM   9806  H  HD11 . ILE A 1 16 ? 17.785 7.452   -5.378  1.00 0.00 ? 16 ILE A HD11 13 
ATOM   9807  H  HD12 . ILE A 1 16 ? 17.347 6.183   -4.220  1.00 0.00 ? 16 ILE A HD12 13 
ATOM   9808  H  HD13 . ILE A 1 16 ? 18.205 5.761   -5.702  1.00 0.00 ? 16 ILE A HD13 13 
ATOM   9809  N  N    . LEU A 1 17 ? 13.173 6.253   -8.514  1.00 0.00 ? 17 LEU A N    13 
ATOM   9810  C  CA   . LEU A 1 17 ? 12.767 5.145   -9.363  1.00 0.00 ? 17 LEU A CA   13 
ATOM   9811  C  C    . LEU A 1 17 ? 13.933 4.165   -9.508  1.00 0.00 ? 17 LEU A C    13 
ATOM   9812  O  O    . LEU A 1 17 ? 15.078 4.580   -9.683  1.00 0.00 ? 17 LEU A O    13 
ATOM   9813  C  CB   . LEU A 1 17 ? 12.321 5.665   -10.737 1.00 0.00 ? 17 LEU A CB   13 
ATOM   9814  C  CG   . LEU A 1 17 ? 10.863 6.157   -10.766 1.00 0.00 ? 17 LEU A CG   13 
ATOM   9815  C  CD1  . LEU A 1 17 ? 10.603 7.315   -9.796  1.00 0.00 ? 17 LEU A CD1  13 
ATOM   9816  C  CD2  . LEU A 1 17 ? 10.513 6.597   -12.191 1.00 0.00 ? 17 LEU A CD2  13 
ATOM   9817  H  H    . LEU A 1 17 ? 13.345 7.143   -8.956  1.00 0.00 ? 17 LEU A H    13 
ATOM   9818  H  HA   . LEU A 1 17 ? 11.925 4.634   -8.897  1.00 0.00 ? 17 LEU A HA   13 
ATOM   9819  H  HB2  . LEU A 1 17 ? 12.994 6.461   -11.066 1.00 0.00 ? 17 LEU A HB2  13 
ATOM   9820  H  HB3  . LEU A 1 17 ? 12.394 4.838   -11.446 1.00 0.00 ? 17 LEU A HB3  13 
ATOM   9821  H  HG   . LEU A 1 17 ? 10.207 5.327   -10.499 1.00 0.00 ? 17 LEU A HG   13 
ATOM   9822  H  HD11 . LEU A 1 17 ? 10.686 6.968   -8.767  1.00 0.00 ? 17 LEU A HD11 13 
ATOM   9823  H  HD12 . LEU A 1 17 ? 11.317 8.121   -9.970  1.00 0.00 ? 17 LEU A HD12 13 
ATOM   9824  H  HD13 . LEU A 1 17 ? 9.593  7.698   -9.942  1.00 0.00 ? 17 LEU A HD13 13 
ATOM   9825  H  HD21 . LEU A 1 17 ? 9.468  6.905   -12.238 1.00 0.00 ? 17 LEU A HD21 13 
ATOM   9826  H  HD22 . LEU A 1 17 ? 11.146 7.434   -12.490 1.00 0.00 ? 17 LEU A HD22 13 
ATOM   9827  H  HD23 . LEU A 1 17 ? 10.663 5.769   -12.883 1.00 0.00 ? 17 LEU A HD23 13 
ATOM   9828  N  N    . CYS A 1 18 ? 13.635 2.862   -9.438  1.00 0.00 ? 18 CYS A N    13 
ATOM   9829  C  CA   . CYS A 1 18 ? 14.590 1.818   -9.772  1.00 0.00 ? 18 CYS A CA   13 
ATOM   9830  C  C    . CYS A 1 18 ? 14.837 1.837   -11.277 1.00 0.00 ? 18 CYS A C    13 
ATOM   9831  O  O    . CYS A 1 18 ? 13.937 1.516   -12.050 1.00 0.00 ? 18 CYS A O    13 
ATOM   9832  C  CB   . CYS A 1 18 ? 14.060 0.455   -9.319  1.00 0.00 ? 18 CYS A CB   13 
ATOM   9833  S  SG   . CYS A 1 18 ? 15.066 -0.950  -9.855  1.00 0.00 ? 18 CYS A SG   13 
ATOM   9834  H  H    . CYS A 1 18 ? 12.685 2.587   -9.229  1.00 0.00 ? 18 CYS A H    13 
ATOM   9835  H  HA   . CYS A 1 18 ? 15.523 2.007   -9.242  1.00 0.00 ? 18 CYS A HA   13 
ATOM   9836  H  HB2  . CYS A 1 18 ? 14.025 0.452   -8.231  1.00 0.00 ? 18 CYS A HB2  13 
ATOM   9837  H  HB3  . CYS A 1 18 ? 13.051 0.293   -9.696  1.00 0.00 ? 18 CYS A HB3  13 
ATOM   9838  N  N    . ASP A 1 19 ? 16.057 2.206   -11.683 1.00 0.00 ? 19 ASP A N    13 
ATOM   9839  C  CA   . ASP A 1 19 ? 16.451 2.321   -13.080 1.00 0.00 ? 19 ASP A CA   13 
ATOM   9840  C  C    . ASP A 1 19 ? 16.207 1.011   -13.834 1.00 0.00 ? 19 ASP A C    13 
ATOM   9841  O  O    . ASP A 1 19 ? 15.638 1.016   -14.923 1.00 0.00 ? 19 ASP A O    13 
ATOM   9842  C  CB   . ASP A 1 19 ? 17.925 2.735   -13.148 1.00 0.00 ? 19 ASP A CB   13 
ATOM   9843  C  CG   . ASP A 1 19 ? 18.391 2.904   -14.590 1.00 0.00 ? 19 ASP A CG   13 
ATOM   9844  O  OD1  . ASP A 1 19 ? 18.140 3.995   -15.145 1.00 0.00 ? 19 ASP A OD1  13 
ATOM   9845  O  OD2  . ASP A 1 19 ? 18.986 1.936   -15.113 1.00 0.00 ? 19 ASP A OD2  13 
ATOM   9846  H  H    . ASP A 1 19 ? 16.752 2.440   -10.985 1.00 0.00 ? 19 ASP A H    13 
ATOM   9847  H  HA   . ASP A 1 19 ? 15.849 3.102   -13.540 1.00 0.00 ? 19 ASP A HA   13 
ATOM   9848  H  HB2  . ASP A 1 19 ? 18.057 3.683   -12.623 1.00 0.00 ? 19 ASP A HB2  13 
ATOM   9849  H  HB3  . ASP A 1 19 ? 18.543 1.981   -12.658 1.00 0.00 ? 19 ASP A HB3  13 
ATOM   9850  N  N    . GLU A 1 20 ? 16.621 -0.103  -13.222 1.00 0.00 ? 20 GLU A N    13 
ATOM   9851  C  CA   . GLU A 1 20 ? 16.681 -1.415  -13.841 1.00 0.00 ? 20 GLU A CA   13 
ATOM   9852  C  C    . GLU A 1 20 ? 15.290 -1.885  -14.277 1.00 0.00 ? 20 GLU A C    13 
ATOM   9853  O  O    . GLU A 1 20 ? 15.066 -2.102  -15.466 1.00 0.00 ? 20 GLU A O    13 
ATOM   9854  C  CB   . GLU A 1 20 ? 17.326 -2.399  -12.858 1.00 0.00 ? 20 GLU A CB   13 
ATOM   9855  C  CG   . GLU A 1 20 ? 18.792 -2.045  -12.580 1.00 0.00 ? 20 GLU A CG   13 
ATOM   9856  C  CD   . GLU A 1 20 ? 19.387 -2.965  -11.519 1.00 0.00 ? 20 GLU A CD   13 
ATOM   9857  O  OE1  . GLU A 1 20 ? 19.653 -4.137  -11.863 1.00 0.00 ? 20 GLU A OE1  13 
ATOM   9858  O  OE2  . GLU A 1 20 ? 19.554 -2.483  -10.378 1.00 0.00 ? 20 GLU A OE2  13 
ATOM   9859  H  H    . GLU A 1 20 ? 17.040 -0.007  -12.311 1.00 0.00 ? 20 GLU A H    13 
ATOM   9860  H  HA   . GLU A 1 20 ? 17.314 -1.350  -14.727 1.00 0.00 ? 20 GLU A HA   13 
ATOM   9861  H  HB2  . GLU A 1 20 ? 16.773 -2.390  -11.918 1.00 0.00 ? 20 GLU A HB2  13 
ATOM   9862  H  HB3  . GLU A 1 20 ? 17.286 -3.402  -13.286 1.00 0.00 ? 20 GLU A HB3  13 
ATOM   9863  H  HG2  . GLU A 1 20 ? 19.369 -2.144  -13.500 1.00 0.00 ? 20 GLU A HG2  13 
ATOM   9864  H  HG3  . GLU A 1 20 ? 18.876 -1.016  -12.229 1.00 0.00 ? 20 GLU A HG3  13 
ATOM   9865  N  N    . CYS A 1 21 ? 14.368 -2.053  -13.317 1.00 0.00 ? 21 CYS A N    13 
ATOM   9866  C  CA   . CYS A 1 21 ? 13.073 -2.691  -13.537 1.00 0.00 ? 21 CYS A CA   13 
ATOM   9867  C  C    . CYS A 1 21 ? 11.889 -1.738  -13.309 1.00 0.00 ? 21 CYS A C    13 
ATOM   9868  O  O    . CYS A 1 21 ? 10.756 -2.207  -13.195 1.00 0.00 ? 21 CYS A O    13 
ATOM   9869  C  CB   . CYS A 1 21 ? 12.973 -3.985  -12.718 1.00 0.00 ? 21 CYS A CB   13 
ATOM   9870  S  SG   . CYS A 1 21 ? 13.069 -3.816  -10.918 1.00 0.00 ? 21 CYS A SG   13 
ATOM   9871  H  H    . CYS A 1 21 ? 14.609 -1.793  -12.374 1.00 0.00 ? 21 CYS A H    13 
ATOM   9872  H  HA   . CYS A 1 21 ? 12.992 -2.999  -14.580 1.00 0.00 ? 21 CYS A HA   13 
ATOM   9873  H  HB2  . CYS A 1 21 ? 12.030 -4.479  -12.959 1.00 0.00 ? 21 CYS A HB2  13 
ATOM   9874  H  HB3  . CYS A 1 21 ? 13.788 -4.645  -13.026 1.00 0.00 ? 21 CYS A HB3  13 
ATOM   9875  N  N    . ASN A 1 22 ? 12.141 -0.419  -13.257 1.00 0.00 ? 22 ASN A N    13 
ATOM   9876  C  CA   . ASN A 1 22 ? 11.131 0.638   -13.285 1.00 0.00 ? 22 ASN A CA   13 
ATOM   9877  C  C    . ASN A 1 22 ? 10.064 0.467   -12.203 1.00 0.00 ? 22 ASN A C    13 
ATOM   9878  O  O    . ASN A 1 22 ? 8.935  0.072   -12.492 1.00 0.00 ? 22 ASN A O    13 
ATOM   9879  C  CB   . ASN A 1 22 ? 10.533 0.743   -14.697 1.00 0.00 ? 22 ASN A CB   13 
ATOM   9880  C  CG   . ASN A 1 22 ? 9.594  1.940   -14.862 1.00 0.00 ? 22 ASN A CG   13 
ATOM   9881  O  OD1  . ASN A 1 22 ? 9.546  2.834   -14.020 1.00 0.00 ? 22 ASN A OD1  13 
ATOM   9882  N  ND2  . ASN A 1 22 ? 8.840  1.959   -15.961 1.00 0.00 ? 22 ASN A ND2  13 
ATOM   9883  H  H    . ASN A 1 22 ? 13.100 -0.109  -13.169 1.00 0.00 ? 22 ASN A H    13 
ATOM   9884  H  HA   . ASN A 1 22 ? 11.645 1.580   -13.097 1.00 0.00 ? 22 ASN A HA   13 
ATOM   9885  H  HB2  . ASN A 1 22 ? 11.349 0.854   -15.415 1.00 0.00 ? 22 ASN A HB2  13 
ATOM   9886  H  HB3  . ASN A 1 22 ? 9.986  -0.173  -14.924 1.00 0.00 ? 22 ASN A HB3  13 
ATOM   9887  H  HD21 . ASN A 1 22 ? 8.909  1.207   -16.633 1.00 0.00 ? 22 ASN A HD21 13 
ATOM   9888  H  HD22 . ASN A 1 22 ? 8.209  2.734   -16.116 1.00 0.00 ? 22 ASN A HD22 13 
ATOM   9889  N  N    . LYS A 1 23 ? 10.421 0.786   -10.954 1.00 0.00 ? 23 LYS A N    13 
ATOM   9890  C  CA   . LYS A 1 23 ? 9.529  0.768   -9.816  1.00 0.00 ? 23 LYS A CA   13 
ATOM   9891  C  C    . LYS A 1 23 ? 9.747  2.043   -9.002  1.00 0.00 ? 23 LYS A C    13 
ATOM   9892  O  O    . LYS A 1 23 ? 10.875 2.332   -8.607  1.00 0.00 ? 23 LYS A O    13 
ATOM   9893  C  CB   . LYS A 1 23 ? 9.844  -0.476  -8.984  1.00 0.00 ? 23 LYS A CB   13 
ATOM   9894  C  CG   . LYS A 1 23 ? 9.431  -1.753  -9.727  1.00 0.00 ? 23 LYS A CG   13 
ATOM   9895  C  CD   . LYS A 1 23 ? 9.708  -3.004  -8.885  1.00 0.00 ? 23 LYS A CD   13 
ATOM   9896  C  CE   . LYS A 1 23 ? 9.198  -4.271  -9.584  1.00 0.00 ? 23 LYS A CE   13 
ATOM   9897  N  NZ   . LYS A 1 23 ? 9.826  -4.483  -10.901 1.00 0.00 ? 23 LYS A NZ   13 
ATOM   9898  H  H    . LYS A 1 23 ? 11.379 1.006   -10.740 1.00 0.00 ? 23 LYS A H    13 
ATOM   9899  H  HA   . LYS A 1 23 ? 8.487  0.730   -10.136 1.00 0.00 ? 23 LYS A HA   13 
ATOM   9900  H  HB2  . LYS A 1 23 ? 10.911 -0.513  -8.753  1.00 0.00 ? 23 LYS A HB2  13 
ATOM   9901  H  HB3  . LYS A 1 23 ? 9.285  -0.388  -8.061  1.00 0.00 ? 23 LYS A HB3  13 
ATOM   9902  H  HG2  . LYS A 1 23 ? 8.369  -1.702  -9.965  1.00 0.00 ? 23 LYS A HG2  13 
ATOM   9903  H  HG3  . LYS A 1 23 ? 10.001 -1.821  -10.651 1.00 0.00 ? 23 LYS A HG3  13 
ATOM   9904  H  HD2  . LYS A 1 23 ? 10.781 -3.089  -8.703  1.00 0.00 ? 23 LYS A HD2  13 
ATOM   9905  H  HD3  . LYS A 1 23 ? 9.199  -2.909  -7.925  1.00 0.00 ? 23 LYS A HD3  13 
ATOM   9906  H  HE2  . LYS A 1 23 ? 9.417  -5.132  -8.950  1.00 0.00 ? 23 LYS A HE2  13 
ATOM   9907  H  HE3  . LYS A 1 23 ? 8.117  -4.203  -9.714  1.00 0.00 ? 23 LYS A HE3  13 
ATOM   9908  H  HZ1  . LYS A 1 23 ? 9.606  -3.716  -11.522 1.00 0.00 ? 23 LYS A HZ1  13 
ATOM   9909  H  HZ2  . LYS A 1 23 ? 10.829 -4.544  -10.795 1.00 0.00 ? 23 LYS A HZ2  13 
ATOM   9910  H  HZ3  . LYS A 1 23 ? 9.482  -5.343  -11.306 1.00 0.00 ? 23 LYS A HZ3  13 
ATOM   9911  N  N    . ALA A 1 24 ? 8.667  2.791   -8.747  1.00 0.00 ? 24 ALA A N    13 
ATOM   9912  C  CA   . ALA A 1 24 ? 8.675  3.964   -7.884  1.00 0.00 ? 24 ALA A CA   13 
ATOM   9913  C  C    . ALA A 1 24 ? 8.871  3.541   -6.426  1.00 0.00 ? 24 ALA A C    13 
ATOM   9914  O  O    . ALA A 1 24 ? 7.983  2.933   -5.832  1.00 0.00 ? 24 ALA A O    13 
ATOM   9915  C  CB   . ALA A 1 24 ? 7.367  4.742   -8.069  1.00 0.00 ? 24 ALA A CB   13 
ATOM   9916  H  H    . ALA A 1 24 ? 7.781  2.517   -9.145  1.00 0.00 ? 24 ALA A H    13 
ATOM   9917  H  HA   . ALA A 1 24 ? 9.490  4.621   -8.187  1.00 0.00 ? 24 ALA A HA   13 
ATOM   9918  H  HB1  . ALA A 1 24 ? 6.511  4.123   -7.799  1.00 0.00 ? 24 ALA A HB1  13 
ATOM   9919  H  HB2  . ALA A 1 24 ? 7.375  5.631   -7.436  1.00 0.00 ? 24 ALA A HB2  13 
ATOM   9920  H  HB3  . ALA A 1 24 ? 7.270  5.052   -9.110  1.00 0.00 ? 24 ALA A HB3  13 
ATOM   9921  N  N    . PHE A 1 25 ? 10.043 3.864   -5.868  1.00 0.00 ? 25 PHE A N    13 
ATOM   9922  C  CA   . PHE A 1 25 ? 10.361 3.746   -4.452  1.00 0.00 ? 25 PHE A CA   13 
ATOM   9923  C  C    . PHE A 1 25 ? 10.669 5.130   -3.887  1.00 0.00 ? 25 PHE A C    13 
ATOM   9924  O  O    . PHE A 1 25 ? 11.239 5.964   -4.586  1.00 0.00 ? 25 PHE A O    13 
ATOM   9925  C  CB   . PHE A 1 25 ? 11.600 2.854   -4.281  1.00 0.00 ? 25 PHE A CB   13 
ATOM   9926  C  CG   . PHE A 1 25 ? 11.318 1.365   -4.209  1.00 0.00 ? 25 PHE A CG   13 
ATOM   9927  C  CD1  . PHE A 1 25 ? 10.932 0.656   -5.362  1.00 0.00 ? 25 PHE A CD1  13 
ATOM   9928  C  CD2  . PHE A 1 25 ? 11.520 0.671   -3.001  1.00 0.00 ? 25 PHE A CD2  13 
ATOM   9929  C  CE1  . PHE A 1 25 ? 10.732 -0.734  -5.301  1.00 0.00 ? 25 PHE A CE1  13 
ATOM   9930  C  CE2  . PHE A 1 25 ? 11.372 -0.725  -2.956  1.00 0.00 ? 25 PHE A CE2  13 
ATOM   9931  C  CZ   . PHE A 1 25 ? 10.951 -1.426  -4.098  1.00 0.00 ? 25 PHE A CZ   13 
ATOM   9932  H  H    . PHE A 1 25 ? 10.736 4.327   -6.441  1.00 0.00 ? 25 PHE A H    13 
ATOM   9933  H  HA   . PHE A 1 25 ? 9.534  3.310   -3.891  1.00 0.00 ? 25 PHE A HA   13 
ATOM   9934  H  HB2  . PHE A 1 25 ? 12.296 3.037   -5.104  1.00 0.00 ? 25 PHE A HB2  13 
ATOM   9935  H  HB3  . PHE A 1 25 ? 12.109 3.145   -3.358  1.00 0.00 ? 25 PHE A HB3  13 
ATOM   9936  H  HD1  . PHE A 1 25 ? 10.795 1.176   -6.296  1.00 0.00 ? 25 PHE A HD1  13 
ATOM   9937  H  HD2  . PHE A 1 25 ? 11.800 1.202   -2.103  1.00 0.00 ? 25 PHE A HD2  13 
ATOM   9938  H  HE1  . PHE A 1 25 ? 10.431 -1.279  -6.181  1.00 0.00 ? 25 PHE A HE1  13 
ATOM   9939  H  HE2  . PHE A 1 25 ? 11.553 -1.257  -2.032  1.00 0.00 ? 25 PHE A HE2  13 
ATOM   9940  H  HZ   . PHE A 1 25 ? 10.808 -2.496  -4.053  1.00 0.00 ? 25 PHE A HZ   13 
ATOM   9941  N  N    . HIS A 1 26 ? 10.283 5.387   -2.633  1.00 0.00 ? 26 HIS A N    13 
ATOM   9942  C  CA   . HIS A 1 26 ? 10.750 6.567   -1.920  1.00 0.00 ? 26 HIS A CA   13 
ATOM   9943  C  C    . HIS A 1 26 ? 12.164 6.283   -1.415  1.00 0.00 ? 26 HIS A C    13 
ATOM   9944  O  O    . HIS A 1 26 ? 12.568 5.128   -1.282  1.00 0.00 ? 26 HIS A O    13 
ATOM   9945  C  CB   . HIS A 1 26 ? 9.859  6.905   -0.722  1.00 0.00 ? 26 HIS A CB   13 
ATOM   9946  C  CG   . HIS A 1 26 ? 8.470  7.378   -1.054  1.00 0.00 ? 26 HIS A CG   13 
ATOM   9947  N  ND1  . HIS A 1 26 ? 7.318  6.592   -1.021  1.00 0.00 ? 26 HIS A ND1  13 
ATOM   9948  C  CD2  . HIS A 1 26 ? 8.128  8.680   -1.281  1.00 0.00 ? 26 HIS A CD2  13 
ATOM   9949  C  CE1  . HIS A 1 26 ? 6.304  7.448   -1.224  1.00 0.00 ? 26 HIS A CE1  13 
ATOM   9950  N  NE2  . HIS A 1 26 ? 6.757  8.703   -1.388  1.00 0.00 ? 26 HIS A NE2  13 
ATOM   9951  H  H    . HIS A 1 26 ? 9.750  4.699   -2.120  1.00 0.00 ? 26 HIS A H    13 
ATOM   9952  H  HA   . HIS A 1 26 ? 10.776 7.433   -2.584  1.00 0.00 ? 26 HIS A HA   13 
ATOM   9953  H  HB2  . HIS A 1 26 ? 9.797  6.049   -0.060  1.00 0.00 ? 26 HIS A HB2  13 
ATOM   9954  H  HB3  . HIS A 1 26 ? 10.342 7.709   -0.171  1.00 0.00 ? 26 HIS A HB3  13 
ATOM   9955  H  HD2  . HIS A 1 26 ? 8.796  9.527   -1.305  1.00 0.00 ? 26 HIS A HD2  13 
ATOM   9956  H  HE1  . HIS A 1 26 ? 5.259  7.174   -1.240  1.00 0.00 ? 26 HIS A HE1  13 
ATOM   9957  H  HE2  . HIS A 1 26 ? 6.186  9.523   -1.524  1.00 0.00 ? 26 HIS A HE2  13 
ATOM   9958  N  N    . LEU A 1 27 ? 12.900 7.351   -1.098  1.00 0.00 ? 27 LEU A N    13 
ATOM   9959  C  CA   . LEU A 1 27 ? 14.174 7.271   -0.403  1.00 0.00 ? 27 LEU A CA   13 
ATOM   9960  C  C    . LEU A 1 27 ? 14.001 6.498   0.907   1.00 0.00 ? 27 LEU A C    13 
ATOM   9961  O  O    . LEU A 1 27 ? 14.735 5.545   1.162   1.00 0.00 ? 27 LEU A O    13 
ATOM   9962  C  CB   . LEU A 1 27 ? 14.698 8.691   -0.168  1.00 0.00 ? 27 LEU A CB   13 
ATOM   9963  C  CG   . LEU A 1 27 ? 15.074 9.399   -1.481  1.00 0.00 ? 27 LEU A CG   13 
ATOM   9964  C  CD1  . LEU A 1 27 ? 15.225 10.901  -1.232  1.00 0.00 ? 27 LEU A CD1  13 
ATOM   9965  C  CD2  . LEU A 1 27 ? 16.397 8.879   -2.052  1.00 0.00 ? 27 LEU A CD2  13 
ATOM   9966  H  H    . LEU A 1 27 ? 12.525 8.270   -1.284  1.00 0.00 ? 27 LEU A H    13 
ATOM   9967  H  HA   . LEU A 1 27 ? 14.880 6.720   -1.018  1.00 0.00 ? 27 LEU A HA   13 
ATOM   9968  H  HB2  . LEU A 1 27 ? 13.912 9.259   0.334   1.00 0.00 ? 27 LEU A HB2  13 
ATOM   9969  H  HB3  . LEU A 1 27 ? 15.572 8.663   0.479   1.00 0.00 ? 27 LEU A HB3  13 
ATOM   9970  H  HG   . LEU A 1 27 ? 14.291 9.252   -2.221  1.00 0.00 ? 27 LEU A HG   13 
ATOM   9971  H  HD11 . LEU A 1 27 ? 15.481 11.400  -2.166  1.00 0.00 ? 27 LEU A HD11 13 
ATOM   9972  H  HD12 . LEU A 1 27 ? 14.291 11.314  -0.849  1.00 0.00 ? 27 LEU A HD12 13 
ATOM   9973  H  HD13 . LEU A 1 27 ? 16.018 11.071  -0.507  1.00 0.00 ? 27 LEU A HD13 13 
ATOM   9974  H  HD21 . LEU A 1 27 ? 16.569 9.341   -3.024  1.00 0.00 ? 27 LEU A HD21 13 
ATOM   9975  H  HD22 . LEU A 1 27 ? 17.209 9.140   -1.377  1.00 0.00 ? 27 LEU A HD22 13 
ATOM   9976  H  HD23 . LEU A 1 27 ? 16.383 7.801   -2.182  1.00 0.00 ? 27 LEU A HD23 13 
ATOM   9977  N  N    . PHE A 1 28 ? 12.982 6.876   1.689   1.00 0.00 ? 28 PHE A N    13 
ATOM   9978  C  CA   . PHE A 1 28 ? 12.518 6.150   2.862   1.00 0.00 ? 28 PHE A CA   13 
ATOM   9979  C  C    . PHE A 1 28 ? 12.361 4.650   2.588   1.00 0.00 ? 28 PHE A C    13 
ATOM   9980  O  O    . PHE A 1 28 ? 12.895 3.830   3.334   1.00 0.00 ? 28 PHE A O    13 
ATOM   9981  C  CB   . PHE A 1 28 ? 11.192 6.749   3.347   1.00 0.00 ? 28 PHE A CB   13 
ATOM   9982  C  CG   . PHE A 1 28 ? 11.235 8.241   3.621   1.00 0.00 ? 28 PHE A CG   13 
ATOM   9983  C  CD1  . PHE A 1 28 ? 11.816 8.723   4.809   1.00 0.00 ? 28 PHE A CD1  13 
ATOM   9984  C  CD2  . PHE A 1 28 ? 10.685 9.151   2.696   1.00 0.00 ? 28 PHE A CD2  13 
ATOM   9985  C  CE1  . PHE A 1 28 ? 11.813 10.101  5.085   1.00 0.00 ? 28 PHE A CE1  13 
ATOM   9986  C  CE2  . PHE A 1 28 ? 10.724 10.531  2.952   1.00 0.00 ? 28 PHE A CE2  13 
ATOM   9987  C  CZ   . PHE A 1 28 ? 11.270 11.005  4.156   1.00 0.00 ? 28 PHE A CZ   13 
ATOM   9988  H  H    . PHE A 1 28 ? 12.476 7.711   1.433   1.00 0.00 ? 28 PHE A H    13 
ATOM   9989  H  HA   . PHE A 1 28 ? 13.257 6.290   3.649   1.00 0.00 ? 28 PHE A HA   13 
ATOM   9990  H  HB2  . PHE A 1 28 ? 10.425 6.550   2.598   1.00 0.00 ? 28 PHE A HB2  13 
ATOM   9991  H  HB3  . PHE A 1 28 ? 10.896 6.238   4.263   1.00 0.00 ? 28 PHE A HB3  13 
ATOM   9992  H  HD1  . PHE A 1 28 ? 12.253 8.034   5.519   1.00 0.00 ? 28 PHE A HD1  13 
ATOM   9993  H  HD2  . PHE A 1 28 ? 10.214 8.797   1.794   1.00 0.00 ? 28 PHE A HD2  13 
ATOM   9994  H  HE1  . PHE A 1 28 ? 12.218 10.465  6.016   1.00 0.00 ? 28 PHE A HE1  13 
ATOM   9995  H  HE2  . PHE A 1 28 ? 10.316 11.225  2.232   1.00 0.00 ? 28 PHE A HE2  13 
ATOM   9996  H  HZ   . PHE A 1 28 ? 11.261 12.064  4.369   1.00 0.00 ? 28 PHE A HZ   13 
ATOM   9997  N  N    . CYS A 1 29 ? 11.621 4.297   1.526   1.00 0.00 ? 29 CYS A N    13 
ATOM   9998  C  CA   . CYS A 1 29 ? 11.234 2.921   1.235   1.00 0.00 ? 29 CYS A CA   13 
ATOM   9999  C  C    . CYS A 1 29 ? 12.448 2.069   0.857   1.00 0.00 ? 29 CYS A C    13 
ATOM   10000 O  O    . CYS A 1 29 ? 12.456 0.876   1.156   1.00 0.00 ? 29 CYS A O    13 
ATOM   10001 C  CB   . CYS A 1 29 ? 10.156 2.875   0.145   1.00 0.00 ? 29 CYS A CB   13 
ATOM   10002 S  SG   . CYS A 1 29 ? 8.597  3.698   0.574   1.00 0.00 ? 29 CYS A SG   13 
ATOM   10003 H  H    . CYS A 1 29 ? 11.295 5.018   0.900   1.00 0.00 ? 29 CYS A H    13 
ATOM   10004 H  HA   . CYS A 1 29 ? 10.796 2.494   2.139   1.00 0.00 ? 29 CYS A HA   13 
ATOM   10005 H  HB2  . CYS A 1 29 ? 10.554 3.332   -0.759  1.00 0.00 ? 29 CYS A HB2  13 
ATOM   10006 H  HB3  . CYS A 1 29 ? 9.924  1.832   -0.073  1.00 0.00 ? 29 CYS A HB3  13 
ATOM   10007 N  N    . LEU A 1 30 ? 13.466 2.656   0.206   1.00 0.00 ? 30 LEU A N    13 
ATOM   10008 C  CA   . LEU A 1 30 ? 14.742 1.976   0.022   1.00 0.00 ? 30 LEU A CA   13 
ATOM   10009 C  C    . LEU A 1 30 ? 15.384 1.744   1.389   1.00 0.00 ? 30 LEU A C    13 
ATOM   10010 O  O    . LEU A 1 30 ? 15.519 0.602   1.824   1.00 0.00 ? 30 LEU A O    13 
ATOM   10011 C  CB   . LEU A 1 30 ? 15.699 2.767   -0.882  1.00 0.00 ? 30 LEU A CB   13 
ATOM   10012 C  CG   . LEU A 1 30 ? 15.271 2.926   -2.346  1.00 0.00 ? 30 LEU A CG   13 
ATOM   10013 C  CD1  . LEU A 1 30 ? 16.407 3.632   -3.093  1.00 0.00 ? 30 LEU A CD1  13 
ATOM   10014 C  CD2  . LEU A 1 30 ? 15.000 1.590   -3.039  1.00 0.00 ? 30 LEU A CD2  13 
ATOM   10015 H  H    . LEU A 1 30 ? 13.386 3.623   -0.082  1.00 0.00 ? 30 LEU A H    13 
ATOM   10016 H  HA   . LEU A 1 30 ? 14.576 1.000   -0.419  1.00 0.00 ? 30 LEU A HA   13 
ATOM   10017 H  HB2  . LEU A 1 30 ? 15.828 3.764   -0.466  1.00 0.00 ? 30 LEU A HB2  13 
ATOM   10018 H  HB3  . LEU A 1 30 ? 16.663 2.257   -0.875  1.00 0.00 ? 30 LEU A HB3  13 
ATOM   10019 H  HG   . LEU A 1 30 ? 14.376 3.543   -2.391  1.00 0.00 ? 30 LEU A HG   13 
ATOM   10020 H  HD11 . LEU A 1 30 ? 16.648 4.570   -2.596  1.00 0.00 ? 30 LEU A HD11 13 
ATOM   10021 H  HD12 . LEU A 1 30 ? 17.297 3.003   -3.107  1.00 0.00 ? 30 LEU A HD12 13 
ATOM   10022 H  HD13 . LEU A 1 30 ? 16.101 3.832   -4.119  1.00 0.00 ? 30 LEU A HD13 13 
ATOM   10023 H  HD21 . LEU A 1 30 ? 14.762 1.764   -4.089  1.00 0.00 ? 30 LEU A HD21 13 
ATOM   10024 H  HD22 . LEU A 1 30 ? 15.879 0.949   -2.967  1.00 0.00 ? 30 LEU A HD22 13 
ATOM   10025 H  HD23 . LEU A 1 30 ? 14.152 1.092   -2.576  1.00 0.00 ? 30 LEU A HD23 13 
ATOM   10026 N  N    . ARG A 1 31 ? 15.798 2.835   2.042   1.00 0.00 ? 31 ARG A N    13 
ATOM   10027 C  CA   . ARG A 1 31 ? 16.522 2.820   3.304   1.00 0.00 ? 31 ARG A CA   13 
ATOM   10028 C  C    . ARG A 1 31 ? 16.160 4.097   4.072   1.00 0.00 ? 31 ARG A C    13 
ATOM   10029 O  O    . ARG A 1 31 ? 16.327 5.186   3.528   1.00 0.00 ? 31 ARG A O    13 
ATOM   10030 C  CB   . ARG A 1 31 ? 18.040 2.752   3.060   1.00 0.00 ? 31 ARG A CB   13 
ATOM   10031 C  CG   . ARG A 1 31 ? 18.471 1.503   2.277   1.00 0.00 ? 31 ARG A CG   13 
ATOM   10032 C  CD   . ARG A 1 31 ? 19.991 1.296   2.293   1.00 0.00 ? 31 ARG A CD   13 
ATOM   10033 N  NE   . ARG A 1 31 ? 20.735 2.458   1.788   1.00 0.00 ? 31 ARG A NE   13 
ATOM   10034 C  CZ   . ARG A 1 31 ? 20.922 2.779   0.495   1.00 0.00 ? 31 ARG A CZ   13 
ATOM   10035 N  NH1  . ARG A 1 31 ? 20.343 2.082   -0.492  1.00 0.00 ? 31 ARG A NH1  13 
ATOM   10036 N  NH2  . ARG A 1 31 ? 21.700 3.821   0.180   1.00 0.00 ? 31 ARG A NH2  13 
ATOM   10037 H  H    . ARG A 1 31 ? 15.570 3.736   1.642   1.00 0.00 ? 31 ARG A H    13 
ATOM   10038 H  HA   . ARG A 1 31 ? 16.218 1.940   3.870   1.00 0.00 ? 31 ARG A HA   13 
ATOM   10039 H  HB2  . ARG A 1 31 ? 18.357 3.636   2.510   1.00 0.00 ? 31 ARG A HB2  13 
ATOM   10040 H  HB3  . ARG A 1 31 ? 18.541 2.748   4.030   1.00 0.00 ? 31 ARG A HB3  13 
ATOM   10041 H  HG2  . ARG A 1 31 ? 18.012 0.623   2.729   1.00 0.00 ? 31 ARG A HG2  13 
ATOM   10042 H  HG3  . ARG A 1 31 ? 18.134 1.585   1.244   1.00 0.00 ? 31 ARG A HG3  13 
ATOM   10043 H  HD2  . ARG A 1 31 ? 20.305 1.115   3.322   1.00 0.00 ? 31 ARG A HD2  13 
ATOM   10044 H  HD3  . ARG A 1 31 ? 20.241 0.409   1.708   1.00 0.00 ? 31 ARG A HD3  13 
ATOM   10045 H  HE   . ARG A 1 31 ? 21.176 3.039   2.486   1.00 0.00 ? 31 ARG A HE   13 
ATOM   10046 H  HH11 . ARG A 1 31 ? 19.755 1.288   -0.290  1.00 0.00 ? 31 ARG A HH11 13 
ATOM   10047 H  HH12 . ARG A 1 31 ? 20.490 2.381   -1.451  1.00 0.00 ? 31 ARG A HH12 13 
ATOM   10048 H  HH21 . ARG A 1 31 ? 22.158 4.366   0.895   1.00 0.00 ? 31 ARG A HH21 13 
ATOM   10049 H  HH22 . ARG A 1 31 ? 21.813 4.070   -0.798  1.00 0.00 ? 31 ARG A HH22 13 
ATOM   10050 N  N    . PRO A 1 32 ? 15.701 3.990   5.331   1.00 0.00 ? 32 PRO A N    13 
ATOM   10051 C  CA   . PRO A 1 32 ? 15.120 5.100   6.081   1.00 0.00 ? 32 PRO A CA   13 
ATOM   10052 C  C    . PRO A 1 32 ? 16.076 6.291   6.211   1.00 0.00 ? 32 PRO A C    13 
ATOM   10053 O  O    . PRO A 1 32 ? 15.632 7.437   6.198   1.00 0.00 ? 32 PRO A O    13 
ATOM   10054 C  CB   . PRO A 1 32 ? 14.763 4.519   7.452   1.00 0.00 ? 32 PRO A CB   13 
ATOM   10055 C  CG   . PRO A 1 32 ? 15.798 3.411   7.642   1.00 0.00 ? 32 PRO A CG   13 
ATOM   10056 C  CD   . PRO A 1 32 ? 15.979 2.874   6.222   1.00 0.00 ? 32 PRO A CD   13 
ATOM   10057 H  HA   . PRO A 1 32 ? 14.203 5.436   5.595   1.00 0.00 ? 32 PRO A HA   13 
ATOM   10058 H  HB2  . PRO A 1 32 ? 14.799 5.262   8.251   1.00 0.00 ? 32 PRO A HB2  13 
ATOM   10059 H  HB3  . PRO A 1 32 ? 13.769 4.069   7.403   1.00 0.00 ? 32 PRO A HB3  13 
ATOM   10060 H  HG2  . PRO A 1 32 ? 16.735 3.842   7.995   1.00 0.00 ? 32 PRO A HG2  13 
ATOM   10061 H  HG3  . PRO A 1 32 ? 15.456 2.641   8.335   1.00 0.00 ? 32 PRO A HG3  13 
ATOM   10062 H  HD2  . PRO A 1 32 ? 16.989 2.483   6.095   1.00 0.00 ? 32 PRO A HD2  13 
ATOM   10063 H  HD3  . PRO A 1 32 ? 15.247 2.084   6.040   1.00 0.00 ? 32 PRO A HD3  13 
ATOM   10064 N  N    . ALA A 1 33 ? 17.384 6.019   6.322   1.00 0.00 ? 33 ALA A N    13 
ATOM   10065 C  CA   . ALA A 1 33 ? 18.423 7.026   6.480   1.00 0.00 ? 33 ALA A CA   13 
ATOM   10066 C  C    . ALA A 1 33 ? 18.562 7.945   5.262   1.00 0.00 ? 33 ALA A C    13 
ATOM   10067 O  O    . ALA A 1 33 ? 19.097 9.045   5.396   1.00 0.00 ? 33 ALA A O    13 
ATOM   10068 C  CB   . ALA A 1 33 ? 19.752 6.327   6.777   1.00 0.00 ? 33 ALA A CB   13 
ATOM   10069 H  H    . ALA A 1 33 ? 17.674 5.053   6.316   1.00 0.00 ? 33 ALA A H    13 
ATOM   10070 H  HA   . ALA A 1 33 ? 18.170 7.642   7.343   1.00 0.00 ? 33 ALA A HA   13 
ATOM   10071 H  HB1  . ALA A 1 33 ? 20.040 5.700   5.933   1.00 0.00 ? 33 ALA A HB1  13 
ATOM   10072 H  HB2  . ALA A 1 33 ? 20.530 7.073   6.951   1.00 0.00 ? 33 ALA A HB2  13 
ATOM   10073 H  HB3  . ALA A 1 33 ? 19.652 5.707   7.669   1.00 0.00 ? 33 ALA A HB3  13 
ATOM   10074 N  N    . LEU A 1 34 ? 18.111 7.510   4.077   1.00 0.00 ? 34 LEU A N    13 
ATOM   10075 C  CA   . LEU A 1 34 ? 18.046 8.375   2.909   1.00 0.00 ? 34 LEU A CA   13 
ATOM   10076 C  C    . LEU A 1 34 ? 16.919 9.394   3.086   1.00 0.00 ? 34 LEU A C    13 
ATOM   10077 O  O    . LEU A 1 34 ? 15.745 9.026   3.126   1.00 0.00 ? 34 LEU A O    13 
ATOM   10078 C  CB   . LEU A 1 34 ? 17.829 7.556   1.631   1.00 0.00 ? 34 LEU A CB   13 
ATOM   10079 C  CG   . LEU A 1 34 ? 18.923 6.527   1.318   1.00 0.00 ? 34 LEU A CG   13 
ATOM   10080 C  CD1  . LEU A 1 34 ? 18.491 5.742   0.075   1.00 0.00 ? 34 LEU A CD1  13 
ATOM   10081 C  CD2  . LEU A 1 34 ? 20.283 7.195   1.078   1.00 0.00 ? 34 LEU A CD2  13 
ATOM   10082 H  H    . LEU A 1 34 ? 17.652 6.611   4.020   1.00 0.00 ? 34 LEU A H    13 
ATOM   10083 H  HA   . LEU A 1 34 ? 18.990 8.910   2.807   1.00 0.00 ? 34 LEU A HA   13 
ATOM   10084 H  HB2  . LEU A 1 34 ? 16.876 7.035   1.710   1.00 0.00 ? 34 LEU A HB2  13 
ATOM   10085 H  HB3  . LEU A 1 34 ? 17.777 8.253   0.794   1.00 0.00 ? 34 LEU A HB3  13 
ATOM   10086 H  HG   . LEU A 1 34 ? 19.020 5.827   2.144   1.00 0.00 ? 34 LEU A HG   13 
ATOM   10087 H  HD11 . LEU A 1 34 ? 18.321 6.421   -0.760  1.00 0.00 ? 34 LEU A HD11 13 
ATOM   10088 H  HD12 . LEU A 1 34 ? 19.257 5.020   -0.204  1.00 0.00 ? 34 LEU A HD12 13 
ATOM   10089 H  HD13 . LEU A 1 34 ? 17.567 5.205   0.289   1.00 0.00 ? 34 LEU A HD13 13 
ATOM   10090 H  HD21 . LEU A 1 34 ? 20.662 7.621   2.006   1.00 0.00 ? 34 LEU A HD21 13 
ATOM   10091 H  HD22 . LEU A 1 34 ? 21.001 6.456   0.726   1.00 0.00 ? 34 LEU A HD22 13 
ATOM   10092 H  HD23 . LEU A 1 34 ? 20.191 7.984   0.332   1.00 0.00 ? 34 LEU A HD23 13 
ATOM   10093 N  N    . TYR A 1 35 ? 17.298 10.673  3.187   1.00 0.00 ? 35 TYR A N    13 
ATOM   10094 C  CA   . TYR A 1 35 ? 16.401 11.823  3.147   1.00 0.00 ? 35 TYR A CA   13 
ATOM   10095 C  C    . TYR A 1 35 ? 16.632 12.602  1.853   1.00 0.00 ? 35 TYR A C    13 
ATOM   10096 O  O    . TYR A 1 35 ? 15.679 13.031  1.205   1.00 0.00 ? 35 TYR A O    13 
ATOM   10097 C  CB   . TYR A 1 35 ? 16.628 12.687  4.393   1.00 0.00 ? 35 TYR A CB   13 
ATOM   10098 C  CG   . TYR A 1 35 ? 16.510 11.903  5.687   1.00 0.00 ? 35 TYR A CG   13 
ATOM   10099 C  CD1  . TYR A 1 35 ? 15.287 11.291  6.019   1.00 0.00 ? 35 TYR A CD1  13 
ATOM   10100 C  CD2  . TYR A 1 35 ? 17.652 11.644  6.468   1.00 0.00 ? 35 TYR A CD2  13 
ATOM   10101 C  CE1  . TYR A 1 35 ? 15.210 10.412  7.112   1.00 0.00 ? 35 TYR A CE1  13 
ATOM   10102 C  CE2  . TYR A 1 35 ? 17.572 10.772  7.567   1.00 0.00 ? 35 TYR A CE2  13 
ATOM   10103 C  CZ   . TYR A 1 35 ? 16.359 10.133  7.872   1.00 0.00 ? 35 TYR A CZ   13 
ATOM   10104 O  OH   . TYR A 1 35 ? 16.302 9.233   8.895   1.00 0.00 ? 35 TYR A OH   13 
ATOM   10105 H  H    . TYR A 1 35 ? 18.286 10.866  3.243   1.00 0.00 ? 35 TYR A H    13 
ATOM   10106 H  HA   . TYR A 1 35 ? 15.364 11.490  3.145   1.00 0.00 ? 35 TYR A HA   13 
ATOM   10107 H  HB2  . TYR A 1 35 ? 17.622 13.138  4.333   1.00 0.00 ? 35 TYR A HB2  13 
ATOM   10108 H  HB3  . TYR A 1 35 ? 15.887 13.488  4.402   1.00 0.00 ? 35 TYR A HB3  13 
ATOM   10109 H  HD1  . TYR A 1 35 ? 14.411 11.477  5.417   1.00 0.00 ? 35 TYR A HD1  13 
ATOM   10110 H  HD2  . TYR A 1 35 ? 18.603 12.088  6.210   1.00 0.00 ? 35 TYR A HD2  13 
ATOM   10111 H  HE1  . TYR A 1 35 ? 14.277 9.919   7.340   1.00 0.00 ? 35 TYR A HE1  13 
ATOM   10112 H  HE2  . TYR A 1 35 ? 18.459 10.553  8.146   1.00 0.00 ? 35 TYR A HE2  13 
ATOM   10113 H  HH   . TYR A 1 35 ? 15.444 8.809   8.976   1.00 0.00 ? 35 TYR A HH   13 
ATOM   10114 N  N    . GLU A 1 36 ? 17.909 12.764  1.483   1.00 0.00 ? 36 GLU A N    13 
ATOM   10115 C  CA   . GLU A 1 36 ? 18.349 13.269  0.192   1.00 0.00 ? 36 GLU A CA   13 
ATOM   10116 C  C    . GLU A 1 36 ? 18.827 12.102  -0.675  1.00 0.00 ? 36 GLU A C    13 
ATOM   10117 O  O    . GLU A 1 36 ? 18.991 10.982  -0.190  1.00 0.00 ? 36 GLU A O    13 
ATOM   10118 C  CB   . GLU A 1 36 ? 19.464 14.307  0.391   1.00 0.00 ? 36 GLU A CB   13 
ATOM   10119 C  CG   . GLU A 1 36 ? 18.975 15.546  1.152   1.00 0.00 ? 36 GLU A CG   13 
ATOM   10120 C  CD   . GLU A 1 36 ? 17.833 16.242  0.418   1.00 0.00 ? 36 GLU A CD   13 
ATOM   10121 O  OE1  . GLU A 1 36 ? 18.097 16.769  -0.684  1.00 0.00 ? 36 GLU A OE1  13 
ATOM   10122 O  OE2  . GLU A 1 36 ? 16.701 16.200  0.944   1.00 0.00 ? 36 GLU A OE2  13 
ATOM   10123 H  H    . GLU A 1 36 ? 18.623 12.414  2.103   1.00 0.00 ? 36 GLU A H    13 
ATOM   10124 H  HA   . GLU A 1 36 ? 17.516 13.736  -0.333  1.00 0.00 ? 36 GLU A HA   13 
ATOM   10125 H  HB2  . GLU A 1 36 ? 20.288 13.851  0.942   1.00 0.00 ? 36 GLU A HB2  13 
ATOM   10126 H  HB3  . GLU A 1 36 ? 19.838 14.629  -0.581  1.00 0.00 ? 36 GLU A HB3  13 
ATOM   10127 H  HG2  . GLU A 1 36 ? 18.647 15.262  2.153   1.00 0.00 ? 36 GLU A HG2  13 
ATOM   10128 H  HG3  . GLU A 1 36 ? 19.803 16.249  1.250   1.00 0.00 ? 36 GLU A HG3  13 
ATOM   10129 N  N    . VAL A 1 37 ? 19.032 12.370  -1.970  1.00 0.00 ? 37 VAL A N    13 
ATOM   10130 C  CA   . VAL A 1 37 ? 19.281 11.342  -2.971  1.00 0.00 ? 37 VAL A CA   13 
ATOM   10131 C  C    . VAL A 1 37 ? 20.661 10.702  -2.752  1.00 0.00 ? 37 VAL A C    13 
ATOM   10132 O  O    . VAL A 1 37 ? 21.600 11.407  -2.383  1.00 0.00 ? 37 VAL A O    13 
ATOM   10133 C  CB   . VAL A 1 37 ? 19.115 11.944  -4.380  1.00 0.00 ? 37 VAL A CB   13 
ATOM   10134 C  CG1  . VAL A 1 37 ? 20.207 12.965  -4.727  1.00 0.00 ? 37 VAL A CG1  13 
ATOM   10135 C  CG2  . VAL A 1 37 ? 19.075 10.854  -5.458  1.00 0.00 ? 37 VAL A CG2  13 
ATOM   10136 H  H    . VAL A 1 37 ? 18.937 13.324  -2.288  1.00 0.00 ? 37 VAL A H    13 
ATOM   10137 H  HA   . VAL A 1 37 ? 18.494 10.606  -2.838  1.00 0.00 ? 37 VAL A HA   13 
ATOM   10138 H  HB   . VAL A 1 37 ? 18.153 12.461  -4.409  1.00 0.00 ? 37 VAL A HB   13 
ATOM   10139 H  HG11 . VAL A 1 37 ? 21.178 12.476  -4.813  1.00 0.00 ? 37 VAL A HG11 13 
ATOM   10140 H  HG12 . VAL A 1 37 ? 19.971 13.437  -5.681  1.00 0.00 ? 37 VAL A HG12 13 
ATOM   10141 H  HG13 . VAL A 1 37 ? 20.262 13.741  -3.962  1.00 0.00 ? 37 VAL A HG13 13 
ATOM   10142 H  HG21 . VAL A 1 37 ? 20.019 10.311  -5.493  1.00 0.00 ? 37 VAL A HG21 13 
ATOM   10143 H  HG22 . VAL A 1 37 ? 18.263 10.157  -5.252  1.00 0.00 ? 37 VAL A HG22 13 
ATOM   10144 H  HG23 . VAL A 1 37 ? 18.899 11.311  -6.433  1.00 0.00 ? 37 VAL A HG23 13 
ATOM   10145 N  N    . PRO A 1 38 ? 20.806 9.380   -2.952  1.00 0.00 ? 38 PRO A N    13 
ATOM   10146 C  CA   . PRO A 1 38 ? 22.107 8.733   -2.990  1.00 0.00 ? 38 PRO A CA   13 
ATOM   10147 C  C    . PRO A 1 38 ? 22.717 8.947   -4.372  1.00 0.00 ? 38 PRO A C    13 
ATOM   10148 O  O    . PRO A 1 38 ? 22.188 8.451   -5.365  1.00 0.00 ? 38 PRO A O    13 
ATOM   10149 C  CB   . PRO A 1 38 ? 21.847 7.249   -2.705  1.00 0.00 ? 38 PRO A CB   13 
ATOM   10150 C  CG   . PRO A 1 38 ? 20.413 7.040   -3.181  1.00 0.00 ? 38 PRO A CG   13 
ATOM   10151 C  CD   . PRO A 1 38 ? 19.751 8.382   -2.873  1.00 0.00 ? 38 PRO A CD   13 
ATOM   10152 H  HA   . PRO A 1 38 ? 22.770 9.125   -2.217  1.00 0.00 ? 38 PRO A HA   13 
ATOM   10153 H  HB2  . PRO A 1 38 ? 22.552 6.591   -3.216  1.00 0.00 ? 38 PRO A HB2  13 
ATOM   10154 H  HB3  . PRO A 1 38 ? 21.892 7.078   -1.629  1.00 0.00 ? 38 PRO A HB3  13 
ATOM   10155 H  HG2  . PRO A 1 38 ? 20.408 6.868   -4.258  1.00 0.00 ? 38 PRO A HG2  13 
ATOM   10156 H  HG3  . PRO A 1 38 ? 19.924 6.209   -2.673  1.00 0.00 ? 38 PRO A HG3  13 
ATOM   10157 H  HD2  . PRO A 1 38 ? 18.954 8.562   -3.592  1.00 0.00 ? 38 PRO A HD2  13 
ATOM   10158 H  HD3  . PRO A 1 38 ? 19.356 8.370   -1.858  1.00 0.00 ? 38 PRO A HD3  13 
ATOM   10159 N  N    . ASP A 1 39 ? 23.829 9.687   -4.439  1.00 0.00 ? 39 ASP A N    13 
ATOM   10160 C  CA   . ASP A 1 39 ? 24.634 9.795   -5.646  1.00 0.00 ? 39 ASP A CA   13 
ATOM   10161 C  C    . ASP A 1 39 ? 25.474 8.522   -5.803  1.00 0.00 ? 39 ASP A C    13 
ATOM   10162 O  O    . ASP A 1 39 ? 26.690 8.537   -5.616  1.00 0.00 ? 39 ASP A O    13 
ATOM   10163 C  CB   . ASP A 1 39 ? 25.487 11.071  -5.579  1.00 0.00 ? 39 ASP A CB   13 
ATOM   10164 C  CG   . ASP A 1 39 ? 26.318 11.291  -6.842  1.00 0.00 ? 39 ASP A CG   13 
ATOM   10165 O  OD1  . ASP A 1 39 ? 25.808 10.959  -7.936  1.00 0.00 ? 39 ASP A OD1  13 
ATOM   10166 O  OD2  . ASP A 1 39 ? 27.449 11.803  -6.695  1.00 0.00 ? 39 ASP A OD2  13 
ATOM   10167 H  H    . ASP A 1 39 ? 24.189 10.114  -3.597  1.00 0.00 ? 39 ASP A H    13 
ATOM   10168 H  HA   . ASP A 1 39 ? 23.967 9.887   -6.506  1.00 0.00 ? 39 ASP A HA   13 
ATOM   10169 H  HB2  . ASP A 1 39 ? 24.828 11.932  -5.455  1.00 0.00 ? 39 ASP A HB2  13 
ATOM   10170 H  HB3  . ASP A 1 39 ? 26.152 11.019  -4.716  1.00 0.00 ? 39 ASP A HB3  13 
ATOM   10171 N  N    . GLY A 1 40 ? 24.806 7.409   -6.121  1.00 0.00 ? 40 GLY A N    13 
ATOM   10172 C  CA   . GLY A 1 40 ? 25.419 6.094   -6.164  1.00 0.00 ? 40 GLY A CA   13 
ATOM   10173 C  C    . GLY A 1 40 ? 24.452 5.093   -6.785  1.00 0.00 ? 40 GLY A C    13 
ATOM   10174 O  O    . GLY A 1 40 ? 24.410 4.963   -8.007  1.00 0.00 ? 40 GLY A O    13 
ATOM   10175 H  H    . GLY A 1 40 ? 23.802 7.468   -6.243  1.00 0.00 ? 40 GLY A H    13 
ATOM   10176 H  HA2  . GLY A 1 40 ? 26.324 6.134   -6.774  1.00 0.00 ? 40 GLY A HA2  13 
ATOM   10177 H  HA3  . GLY A 1 40 ? 25.687 5.782   -5.154  1.00 0.00 ? 40 GLY A HA3  13 
ATOM   10178 N  N    . GLU A 1 41 ? 23.694 4.377   -5.947  1.00 0.00 ? 41 GLU A N    13 
ATOM   10179 C  CA   . GLU A 1 41 ? 22.849 3.271   -6.374  1.00 0.00 ? 41 GLU A CA   13 
ATOM   10180 C  C    . GLU A 1 41 ? 21.419 3.763   -6.607  1.00 0.00 ? 41 GLU A C    13 
ATOM   10181 O  O    . GLU A 1 41 ? 20.903 4.567   -5.831  1.00 0.00 ? 41 GLU A O    13 
ATOM   10182 C  CB   . GLU A 1 41 ? 22.943 2.102   -5.376  1.00 0.00 ? 41 GLU A CB   13 
ATOM   10183 C  CG   . GLU A 1 41 ? 22.062 2.188   -4.120  1.00 0.00 ? 41 GLU A CG   13 
ATOM   10184 C  CD   . GLU A 1 41 ? 22.300 3.412   -3.239  1.00 0.00 ? 41 GLU A CD   13 
ATOM   10185 O  OE1  . GLU A 1 41 ? 23.451 3.898   -3.202  1.00 0.00 ? 41 GLU A OE1  13 
ATOM   10186 O  OE2  . GLU A 1 41 ? 21.322 3.816   -2.573  1.00 0.00 ? 41 GLU A OE2  13 
ATOM   10187 H  H    . GLU A 1 41 ? 23.754 4.550   -4.950  1.00 0.00 ? 41 GLU A H    13 
ATOM   10188 H  HA   . GLU A 1 41 ? 23.240 2.888   -7.317  1.00 0.00 ? 41 GLU A HA   13 
ATOM   10189 H  HB2  . GLU A 1 41 ? 22.644 1.196   -5.905  1.00 0.00 ? 41 GLU A HB2  13 
ATOM   10190 H  HB3  . GLU A 1 41 ? 23.984 1.977   -5.075  1.00 0.00 ? 41 GLU A HB3  13 
ATOM   10191 H  HG2  . GLU A 1 41 ? 21.011 2.152   -4.409  1.00 0.00 ? 41 GLU A HG2  13 
ATOM   10192 H  HG3  . GLU A 1 41 ? 22.274 1.311   -3.509  1.00 0.00 ? 41 GLU A HG3  13 
ATOM   10193 N  N    . TRP A 1 42 ? 20.797 3.293   -7.694  1.00 0.00 ? 42 TRP A N    13 
ATOM   10194 C  CA   . TRP A 1 42 ? 19.515 3.782   -8.186  1.00 0.00 ? 42 TRP A CA   13 
ATOM   10195 C  C    . TRP A 1 42 ? 18.659 2.576   -8.567  1.00 0.00 ? 42 TRP A C    13 
ATOM   10196 O  O    . TRP A 1 42 ? 18.275 2.405   -9.723  1.00 0.00 ? 42 TRP A O    13 
ATOM   10197 C  CB   . TRP A 1 42 ? 19.750 4.753   -9.351  1.00 0.00 ? 42 TRP A CB   13 
ATOM   10198 C  CG   . TRP A 1 42 ? 20.663 5.902   -9.034  1.00 0.00 ? 42 TRP A CG   13 
ATOM   10199 C  CD1  . TRP A 1 42 ? 20.465 6.806   -8.050  1.00 0.00 ? 42 TRP A CD1  13 
ATOM   10200 C  CD2  . TRP A 1 42 ? 21.946 6.253   -9.640  1.00 0.00 ? 42 TRP A CD2  13 
ATOM   10201 N  NE1  . TRP A 1 42 ? 21.532 7.675   -7.993  1.00 0.00 ? 42 TRP A NE1  13 
ATOM   10202 C  CE2  . TRP A 1 42 ? 22.477 7.384   -8.953  1.00 0.00 ? 42 TRP A CE2  13 
ATOM   10203 C  CE3  . TRP A 1 42 ? 22.725 5.723   -10.692 1.00 0.00 ? 42 TRP A CE3  13 
ATOM   10204 C  CZ2  . TRP A 1 42 ? 23.712 7.959   -9.287  1.00 0.00 ? 42 TRP A CZ2  13 
ATOM   10205 C  CZ3  . TRP A 1 42 ? 23.967 6.292   -11.037 1.00 0.00 ? 42 TRP A CZ3  13 
ATOM   10206 C  CH2  . TRP A 1 42 ? 24.461 7.406   -10.336 1.00 0.00 ? 42 TRP A CH2  13 
ATOM   10207 H  H    . TRP A 1 42 ? 21.276 2.613   -8.266  1.00 0.00 ? 42 TRP A H    13 
ATOM   10208 H  HA   . TRP A 1 42 ? 18.981 4.317   -7.400  1.00 0.00 ? 42 TRP A HA   13 
ATOM   10209 H  HB2  . TRP A 1 42 ? 20.185 4.198   -10.185 1.00 0.00 ? 42 TRP A HB2  13 
ATOM   10210 H  HB3  . TRP A 1 42 ? 18.787 5.159   -9.669  1.00 0.00 ? 42 TRP A HB3  13 
ATOM   10211 H  HD1  . TRP A 1 42 ? 19.616 6.826   -7.382  1.00 0.00 ? 42 TRP A HD1  13 
ATOM   10212 H  HE1  . TRP A 1 42 ? 21.606 8.400   -7.291  1.00 0.00 ? 42 TRP A HE1  13 
ATOM   10213 H  HE3  . TRP A 1 42 ? 22.368 4.863   -11.240 1.00 0.00 ? 42 TRP A HE3  13 
ATOM   10214 H  HZ2  . TRP A 1 42 ? 24.083 8.816   -8.745  1.00 0.00 ? 42 TRP A HZ2  13 
ATOM   10215 H  HZ3  . TRP A 1 42 ? 24.545 5.867   -11.844 1.00 0.00 ? 42 TRP A HZ3  13 
ATOM   10216 H  HH2  . TRP A 1 42 ? 25.416 7.834   -10.603 1.00 0.00 ? 42 TRP A HH2  13 
ATOM   10217 N  N    . GLN A 1 43 ? 18.382 1.732   -7.566  1.00 0.00 ? 43 GLN A N    13 
ATOM   10218 C  CA   . GLN A 1 43 ? 17.777 0.420   -7.730  1.00 0.00 ? 43 GLN A CA   13 
ATOM   10219 C  C    . GLN A 1 43 ? 16.878 0.096   -6.535  1.00 0.00 ? 43 GLN A C    13 
ATOM   10220 O  O    . GLN A 1 43 ? 16.881 0.825   -5.545  1.00 0.00 ? 43 GLN A O    13 
ATOM   10221 C  CB   . GLN A 1 43 ? 18.880 -0.630  -7.921  1.00 0.00 ? 43 GLN A CB   13 
ATOM   10222 C  CG   . GLN A 1 43 ? 19.783 -0.765  -6.684  1.00 0.00 ? 43 GLN A CG   13 
ATOM   10223 C  CD   . GLN A 1 43 ? 20.904 -1.797  -6.827  1.00 0.00 ? 43 GLN A CD   13 
ATOM   10224 O  OE1  . GLN A 1 43 ? 21.755 -1.883  -5.945  1.00 0.00 ? 43 GLN A OE1  13 
ATOM   10225 N  NE2  . GLN A 1 43 ? 20.919 -2.596  -7.896  1.00 0.00 ? 43 GLN A NE2  13 
ATOM   10226 H  H    . GLN A 1 43 ? 18.659 1.989   -6.629  1.00 0.00 ? 43 GLN A H    13 
ATOM   10227 H  HA   . GLN A 1 43 ? 17.162 0.424   -8.626  1.00 0.00 ? 43 GLN A HA   13 
ATOM   10228 H  HB2  . GLN A 1 43 ? 18.404 -1.586  -8.129  1.00 0.00 ? 43 GLN A HB2  13 
ATOM   10229 H  HB3  . GLN A 1 43 ? 19.488 -0.344  -8.780  1.00 0.00 ? 43 GLN A HB3  13 
ATOM   10230 H  HG2  . GLN A 1 43 ? 20.247 0.199   -6.471  1.00 0.00 ? 43 GLN A HG2  13 
ATOM   10231 H  HG3  . GLN A 1 43 ? 19.179 -1.053  -5.825  1.00 0.00 ? 43 GLN A HG3  13 
ATOM   10232 H  HE21 . GLN A 1 43 ? 20.255 -2.472  -8.657  1.00 0.00 ? 43 GLN A HE21 13 
ATOM   10233 H  HE22 . GLN A 1 43 ? 21.639 -3.303  -7.970  1.00 0.00 ? 43 GLN A HE22 13 
ATOM   10234 N  N    . CYS A 1 44 ? 16.116 -1.003  -6.636  1.00 0.00 ? 44 CYS A N    13 
ATOM   10235 C  CA   . CYS A 1 44 ? 15.261 -1.510  -5.568  1.00 0.00 ? 44 CYS A CA   13 
ATOM   10236 C  C    . CYS A 1 44 ? 15.976 -2.636  -4.802  1.00 0.00 ? 44 CYS A C    13 
ATOM   10237 O  O    . CYS A 1 44 ? 16.967 -3.173  -5.300  1.00 0.00 ? 44 CYS A O    13 
ATOM   10238 C  CB   . CYS A 1 44 ? 13.918 -1.967  -6.153  1.00 0.00 ? 44 CYS A CB   13 
ATOM   10239 S  SG   . CYS A 1 44 ? 13.961 -3.360  -7.304  1.00 0.00 ? 44 CYS A SG   13 
ATOM   10240 H  H    . CYS A 1 44 ? 16.219 -1.582  -7.454  1.00 0.00 ? 44 CYS A H    13 
ATOM   10241 H  HA   . CYS A 1 44 ? 15.042 -0.687  -4.890  1.00 0.00 ? 44 CYS A HA   13 
ATOM   10242 H  HB2  . CYS A 1 44 ? 13.264 -2.261  -5.337  1.00 0.00 ? 44 CYS A HB2  13 
ATOM   10243 H  HB3  . CYS A 1 44 ? 13.449 -1.125  -6.664  1.00 0.00 ? 44 CYS A HB3  13 
ATOM   10244 N  N    . PRO A 1 45 ? 15.484 -3.024  -3.610  1.00 0.00 ? 45 PRO A N    13 
ATOM   10245 C  CA   . PRO A 1 45 ? 16.028 -4.126  -2.826  1.00 0.00 ? 45 PRO A CA   13 
ATOM   10246 C  C    . PRO A 1 45 ? 16.100 -5.467  -3.562  1.00 0.00 ? 45 PRO A C    13 
ATOM   10247 O  O    . PRO A 1 45 ? 16.923 -6.305  -3.204  1.00 0.00 ? 45 PRO A O    13 
ATOM   10248 C  CB   . PRO A 1 45 ? 15.151 -4.227  -1.580  1.00 0.00 ? 45 PRO A CB   13 
ATOM   10249 C  CG   . PRO A 1 45 ? 14.730 -2.778  -1.362  1.00 0.00 ? 45 PRO A CG   13 
ATOM   10250 C  CD   . PRO A 1 45 ? 14.533 -2.283  -2.793  1.00 0.00 ? 45 PRO A CD   13 
ATOM   10251 H  HA   . PRO A 1 45 ? 17.025 -3.836  -2.503  1.00 0.00 ? 45 PRO A HA   13 
ATOM   10252 H  HB2  . PRO A 1 45 ? 14.266 -4.828  -1.798  1.00 0.00 ? 45 PRO A HB2  13 
ATOM   10253 H  HB3  . PRO A 1 45 ? 15.690 -4.636  -0.726  1.00 0.00 ? 45 PRO A HB3  13 
ATOM   10254 H  HG2  . PRO A 1 45 ? 13.822 -2.696  -0.763  1.00 0.00 ? 45 PRO A HG2  13 
ATOM   10255 H  HG3  . PRO A 1 45 ? 15.548 -2.230  -0.891  1.00 0.00 ? 45 PRO A HG3  13 
ATOM   10256 H  HD2  . PRO A 1 45 ? 13.522 -2.535  -3.111  1.00 0.00 ? 45 PRO A HD2  13 
ATOM   10257 H  HD3  . PRO A 1 45 ? 14.690 -1.207  -2.818  1.00 0.00 ? 45 PRO A HD3  13 
ATOM   10258 N  N    . ALA A 1 46 ? 15.234 -5.686  -4.561  1.00 0.00 ? 46 ALA A N    13 
ATOM   10259 C  CA   . ALA A 1 46 ? 15.137 -6.950  -5.270  1.00 0.00 ? 46 ALA A CA   13 
ATOM   10260 C  C    . ALA A 1 46 ? 16.315 -7.102  -6.231  1.00 0.00 ? 46 ALA A C    13 
ATOM   10261 O  O    . ALA A 1 46 ? 16.862 -8.195  -6.362  1.00 0.00 ? 46 ALA A O    13 
ATOM   10262 C  CB   . ALA A 1 46 ? 13.803 -7.026  -6.016  1.00 0.00 ? 46 ALA A CB   13 
ATOM   10263 H  H    . ALA A 1 46 ? 14.679 -4.923  -4.912  1.00 0.00 ? 46 ALA A H    13 
ATOM   10264 H  HA   . ALA A 1 46 ? 15.162 -7.768  -4.547  1.00 0.00 ? 46 ALA A HA   13 
ATOM   10265 H  HB1  . ALA A 1 46 ? 12.979 -6.906  -5.312  1.00 0.00 ? 46 ALA A HB1  13 
ATOM   10266 H  HB2  . ALA A 1 46 ? 13.746 -6.245  -6.773  1.00 0.00 ? 46 ALA A HB2  13 
ATOM   10267 H  HB3  . ALA A 1 46 ? 13.713 -7.998  -6.504  1.00 0.00 ? 46 ALA A HB3  13 
ATOM   10268 N  N    . CYS A 1 47 ? 16.700 -6.009  -6.903  1.00 0.00 ? 47 CYS A N    13 
ATOM   10269 C  CA   . CYS A 1 47 ? 17.926 -5.961  -7.676  1.00 0.00 ? 47 CYS A CA   13 
ATOM   10270 C  C    . CYS A 1 47 ? 19.142 -6.053  -6.755  1.00 0.00 ? 47 CYS A C    13 
ATOM   10271 O  O    . CYS A 1 47 ? 20.068 -6.821  -7.016  1.00 0.00 ? 47 CYS A O    13 
ATOM   10272 C  CB   . CYS A 1 47 ? 17.991 -4.671  -8.491  1.00 0.00 ? 47 CYS A CB   13 
ATOM   10273 S  SG   . CYS A 1 47 ? 16.663 -4.395  -9.689  1.00 0.00 ? 47 CYS A SG   13 
ATOM   10274 H  H    . CYS A 1 47 ? 16.215 -5.135  -6.769  1.00 0.00 ? 47 CYS A H    13 
ATOM   10275 H  HA   . CYS A 1 47 ? 17.917 -6.799  -8.367  1.00 0.00 ? 47 CYS A HA   13 
ATOM   10276 H  HB2  . CYS A 1 47 ? 18.016 -3.820  -7.812  1.00 0.00 ? 47 CYS A HB2  13 
ATOM   10277 H  HB3  . CYS A 1 47 ? 18.924 -4.703  -9.048  1.00 0.00 ? 47 CYS A HB3  13 
ATOM   10278 N  N    . GLN A 1 48 ? 19.136 -5.250  -5.687  1.00 0.00 ? 48 GLN A N    13 
ATOM   10279 C  CA   . GLN A 1 48 ? 20.262 -5.084  -4.780  1.00 0.00 ? 48 GLN A CA   13 
ATOM   10280 C  C    . GLN A 1 48 ? 20.476 -6.361  -3.952  1.00 0.00 ? 48 GLN A C    13 
ATOM   10281 O  O    . GLN A 1 48 ? 19.572 -7.192  -3.863  1.00 0.00 ? 48 GLN A O    13 
ATOM   10282 C  CB   . GLN A 1 48 ? 19.955 -3.878  -3.885  1.00 0.00 ? 48 GLN A CB   13 
ATOM   10283 C  CG   . GLN A 1 48 ? 21.136 -3.407  -3.030  1.00 0.00 ? 48 GLN A CG   13 
ATOM   10284 C  CD   . GLN A 1 48 ? 20.837 -2.043  -2.413  1.00 0.00 ? 48 GLN A CD   13 
ATOM   10285 O  OE1  . GLN A 1 48 ? 20.548 -1.940  -1.223  1.00 0.00 ? 48 GLN A OE1  13 
ATOM   10286 N  NE2  . GLN A 1 48 ? 20.892 -0.992  -3.232  1.00 0.00 ? 48 GLN A NE2  13 
ATOM   10287 H  H    . GLN A 1 48 ? 18.321 -4.673  -5.523  1.00 0.00 ? 48 GLN A H    13 
ATOM   10288 H  HA   . GLN A 1 48 ? 21.139 -4.847  -5.380  1.00 0.00 ? 48 GLN A HA   13 
ATOM   10289 H  HB2  . GLN A 1 48 ? 19.646 -3.054  -4.529  1.00 0.00 ? 48 GLN A HB2  13 
ATOM   10290 H  HB3  . GLN A 1 48 ? 19.129 -4.135  -3.226  1.00 0.00 ? 48 GLN A HB3  13 
ATOM   10291 H  HG2  . GLN A 1 48 ? 21.327 -4.127  -2.234  1.00 0.00 ? 48 GLN A HG2  13 
ATOM   10292 H  HG3  . GLN A 1 48 ? 22.029 -3.319  -3.650  1.00 0.00 ? 48 GLN A HG3  13 
ATOM   10293 H  HE21 . GLN A 1 48 ? 21.171 -1.128  -4.197  1.00 0.00 ? 48 GLN A HE21 13 
ATOM   10294 H  HE22 . GLN A 1 48 ? 20.676 -0.069  -2.881  1.00 0.00 ? 48 GLN A HE22 13 
ATOM   10295 N  N    . PRO A 1 49 ? 21.679 -6.559  -3.387  1.00 0.00 ? 49 PRO A N    13 
ATOM   10296 C  CA   . PRO A 1 49 ? 21.904 -7.600  -2.390  1.00 0.00 ? 49 PRO A CA   13 
ATOM   10297 C  C    . PRO A 1 49 ? 21.185 -7.279  -1.072  1.00 0.00 ? 49 PRO A C    13 
ATOM   10298 O  O    . PRO A 1 49 ? 21.817 -6.924  -0.077  1.00 0.00 ? 49 PRO A O    13 
ATOM   10299 C  CB   . PRO A 1 49 ? 23.423 -7.711  -2.245  1.00 0.00 ? 49 PRO A CB   13 
ATOM   10300 C  CG   . PRO A 1 49 ? 23.892 -7.414  -3.665  1.00 0.00 ? 49 PRO A CG   13 
ATOM   10301 C  CD   . PRO A 1 49 ? 22.925 -6.314  -4.102  1.00 0.00 ? 49 PRO A CD   13 
ATOM   10302 H  HA   . PRO A 1 49 ? 21.540 -8.553  -2.776  1.00 0.00 ? 49 PRO A HA   13 
ATOM   10303 H  HB2  . PRO A 1 49 ? 23.807 -6.932  -1.585  1.00 0.00 ? 49 PRO A HB2  13 
ATOM   10304 H  HB3  . PRO A 1 49 ? 23.738 -8.696  -1.898  1.00 0.00 ? 49 PRO A HB3  13 
ATOM   10305 H  HG2  . PRO A 1 49 ? 24.932 -7.091  -3.701  1.00 0.00 ? 49 PRO A HG2  13 
ATOM   10306 H  HG3  . PRO A 1 49 ? 23.748 -8.298  -4.286  1.00 0.00 ? 49 PRO A HG3  13 
ATOM   10307 H  HD2  . PRO A 1 49 ? 23.322 -5.343  -3.809  1.00 0.00 ? 49 PRO A HD2  13 
ATOM   10308 H  HD3  . PRO A 1 49 ? 22.801 -6.356  -5.186  1.00 0.00 ? 49 PRO A HD3  13 
ATOM   10309 N  N    . ALA A 1 50 ? 19.854 -7.405  -1.077  1.00 0.00 ? 50 ALA A N    13 
ATOM   10310 C  CA   . ALA A 1 50 ? 18.969 -6.954  -0.015  1.00 0.00 ? 50 ALA A CA   13 
ATOM   10311 C  C    . ALA A 1 50 ? 17.610 -7.647  -0.161  1.00 0.00 ? 50 ALA A C    13 
ATOM   10312 O  O    . ALA A 1 50 ? 17.428 -8.482  -1.048  1.00 0.00 ? 50 ALA A O    13 
ATOM   10313 C  CB   . ALA A 1 50 ? 18.833 -5.428  -0.082  1.00 0.00 ? 50 ALA A CB   13 
ATOM   10314 H  H    . ALA A 1 50 ? 19.406 -7.728  -1.927  1.00 0.00 ? 50 ALA A H    13 
ATOM   10315 H  HA   . ALA A 1 50 ? 19.391 -7.231  0.953   1.00 0.00 ? 50 ALA A HA   13 
ATOM   10316 H  HB1  . ALA A 1 50 ? 18.198 -5.064  0.726   1.00 0.00 ? 50 ALA A HB1  13 
ATOM   10317 H  HB2  . ALA A 1 50 ? 19.814 -4.960  0.013   1.00 0.00 ? 50 ALA A HB2  13 
ATOM   10318 H  HB3  . ALA A 1 50 ? 18.396 -5.141  -1.037  1.00 0.00 ? 50 ALA A HB3  13 
ATOM   10319 N  N    . THR A 1 51 ? 16.667 -7.310  0.727   1.00 0.00 ? 51 THR A N    13 
ATOM   10320 C  CA   . THR A 1 51 ? 15.332 -7.890  0.790   1.00 0.00 ? 51 THR A CA   13 
ATOM   10321 C  C    . THR A 1 51 ? 14.301 -6.764  0.738   1.00 0.00 ? 51 THR A C    13 
ATOM   10322 O  O    . THR A 1 51 ? 14.407 -5.860  1.596   1.00 0.00 ? 51 THR A O    13 
ATOM   10323 C  CB   . THR A 1 51 ? 15.182 -8.705  2.084   1.00 0.00 ? 51 THR A CB   13 
ATOM   10324 O  OG1  . THR A 1 51 ? 15.505 -7.902  3.202   1.00 0.00 ? 51 THR A OG1  13 
ATOM   10325 C  CG2  . THR A 1 51 ? 16.078 -9.947  2.078   1.00 0.00 ? 51 THR A CG2  13 
ATOM   10326 O  OXT  . THR A 1 51 ? 13.423 -6.828  -0.151  1.00 0.00 ? 51 THR A OXT  13 
ATOM   10327 H  H    . THR A 1 51 ? 16.880 -6.610  1.422   1.00 0.00 ? 51 THR A H    13 
ATOM   10328 H  HA   . THR A 1 51 ? 15.153 -8.553  -0.058  1.00 0.00 ? 51 THR A HA   13 
ATOM   10329 H  HB   . THR A 1 51 ? 14.144 -9.028  2.172   1.00 0.00 ? 51 THR A HB   13 
ATOM   10330 H  HG1  . THR A 1 51 ? 15.059 -7.055  3.095   1.00 0.00 ? 51 THR A HG1  13 
ATOM   10331 H  HG21 . THR A 1 51 ? 15.902 -10.525 2.985   1.00 0.00 ? 51 THR A HG21 13 
ATOM   10332 H  HG22 . THR A 1 51 ? 15.847 -10.566 1.212   1.00 0.00 ? 51 THR A HG22 13 
ATOM   10333 H  HG23 . THR A 1 51 ? 17.130 -9.658  2.044   1.00 0.00 ? 51 THR A HG23 13 
HETATM 10334 ZN ZN   . ZN  B 2 .  ? 6.888  4.559   -0.707  1.00 0.00 ? 52 ZN  A ZN   13 
HETATM 10335 ZN ZN   . ZN  C 2 .  ? 14.726 -3.184  -9.459  1.00 0.00 ? 53 ZN  A ZN   13 
ATOM   10336 N  N    . ALA A 1 1  ? 5.391  10.128  -10.196 1.00 0.00 ? 1  ALA A N    14 
ATOM   10337 C  CA   . ALA A 1 1  ? 5.720  8.805   -9.637  1.00 0.00 ? 1  ALA A CA   14 
ATOM   10338 C  C    . ALA A 1 1  ? 4.707  8.402   -8.565  1.00 0.00 ? 1  ALA A C    14 
ATOM   10339 O  O    . ALA A 1 1  ? 3.981  9.250   -8.049  1.00 0.00 ? 1  ALA A O    14 
ATOM   10340 C  CB   . ALA A 1 1  ? 7.143  8.795   -9.072  1.00 0.00 ? 1  ALA A CB   14 
ATOM   10341 H  H1   . ALA A 1 1  ? 6.065  10.382  -10.904 1.00 0.00 ? 1  ALA A H1   14 
ATOM   10342 H  H2   . ALA A 1 1  ? 4.466  10.098  -10.602 1.00 0.00 ? 1  ALA A H2   14 
ATOM   10343 H  H3   . ALA A 1 1  ? 5.402  10.811  -9.453  1.00 0.00 ? 1  ALA A H3   14 
ATOM   10344 H  HA   . ALA A 1 1  ? 5.670  8.079   -10.451 1.00 0.00 ? 1  ALA A HA   14 
ATOM   10345 H  HB1  . ALA A 1 1  ? 7.384  7.807   -8.675  1.00 0.00 ? 1  ALA A HB1  14 
ATOM   10346 H  HB2  . ALA A 1 1  ? 7.856  9.041   -9.860  1.00 0.00 ? 1  ALA A HB2  14 
ATOM   10347 H  HB3  . ALA A 1 1  ? 7.227  9.531   -8.273  1.00 0.00 ? 1  ALA A HB3  14 
ATOM   10348 N  N    . ARG A 1 2  ? 4.666  7.106   -8.234  1.00 0.00 ? 2  ARG A N    14 
ATOM   10349 C  CA   . ARG A 1 2  ? 3.920  6.585   -7.098  1.00 0.00 ? 2  ARG A CA   14 
ATOM   10350 C  C    . ARG A 1 2  ? 4.633  5.341   -6.577  1.00 0.00 ? 2  ARG A C    14 
ATOM   10351 O  O    . ARG A 1 2  ? 4.924  4.432   -7.351  1.00 0.00 ? 2  ARG A O    14 
ATOM   10352 C  CB   . ARG A 1 2  ? 2.479  6.274   -7.531  1.00 0.00 ? 2  ARG A CB   14 
ATOM   10353 C  CG   . ARG A 1 2  ? 1.558  5.808   -6.400  1.00 0.00 ? 2  ARG A CG   14 
ATOM   10354 C  CD   . ARG A 1 2  ? 1.443  6.859   -5.294  1.00 0.00 ? 2  ARG A CD   14 
ATOM   10355 N  NE   . ARG A 1 2  ? 1.090  8.182   -5.836  1.00 0.00 ? 2  ARG A NE   14 
ATOM   10356 C  CZ   . ARG A 1 2  ? 1.680  9.351   -5.529  1.00 0.00 ? 2  ARG A CZ   14 
ATOM   10357 N  NH1  . ARG A 1 2  ? 2.563  9.447   -4.527  1.00 0.00 ? 2  ARG A NH1  14 
ATOM   10358 N  NH2  . ARG A 1 2  ? 1.368  10.445  -6.234  1.00 0.00 ? 2  ARG A NH2  14 
ATOM   10359 H  H    . ARG A 1 2  ? 5.254  6.451   -8.730  1.00 0.00 ? 2  ARG A H    14 
ATOM   10360 H  HA   . ARG A 1 2  ? 3.920  7.350   -6.321  1.00 0.00 ? 2  ARG A HA   14 
ATOM   10361 H  HB2  . ARG A 1 2  ? 2.045  7.174   -7.959  1.00 0.00 ? 2  ARG A HB2  14 
ATOM   10362 H  HB3  . ARG A 1 2  ? 2.495  5.501   -8.299  1.00 0.00 ? 2  ARG A HB3  14 
ATOM   10363 H  HG2  . ARG A 1 2  ? 0.565  5.626   -6.815  1.00 0.00 ? 2  ARG A HG2  14 
ATOM   10364 H  HG3  . ARG A 1 2  ? 1.929  4.873   -5.977  1.00 0.00 ? 2  ARG A HG3  14 
ATOM   10365 H  HD2  . ARG A 1 2  ? 0.672  6.546   -4.593  1.00 0.00 ? 2  ARG A HD2  14 
ATOM   10366 H  HD3  . ARG A 1 2  ? 2.397  6.885   -4.779  1.00 0.00 ? 2  ARG A HD3  14 
ATOM   10367 H  HE   . ARG A 1 2  ? 0.391  8.184   -6.564  1.00 0.00 ? 2  ARG A HE   14 
ATOM   10368 H  HH11 . ARG A 1 2  ? 2.688  8.672   -3.889  1.00 0.00 ? 2  ARG A HH11 14 
ATOM   10369 H  HH12 . ARG A 1 2  ? 2.931  10.354  -4.265  1.00 0.00 ? 2  ARG A HH12 14 
ATOM   10370 H  HH21 . ARG A 1 2  ? 0.718  10.395  -7.004  1.00 0.00 ? 2  ARG A HH21 14 
ATOM   10371 H  HH22 . ARG A 1 2  ? 1.792  11.335  -5.992  1.00 0.00 ? 2  ARG A HH22 14 
ATOM   10372 N  N    . CYS A 1 3  ? 4.916  5.310   -5.271  1.00 0.00 ? 3  CYS A N    14 
ATOM   10373 C  CA   . CYS A 1 3  ? 5.777  4.304   -4.670  1.00 0.00 ? 3  CYS A CA   14 
ATOM   10374 C  C    . CYS A 1 3  ? 5.100  2.933   -4.676  1.00 0.00 ? 3  CYS A C    14 
ATOM   10375 O  O    . CYS A 1 3  ? 3.926  2.819   -4.329  1.00 0.00 ? 3  CYS A O    14 
ATOM   10376 C  CB   . CYS A 1 3  ? 6.134  4.729   -3.246  1.00 0.00 ? 3  CYS A CB   14 
ATOM   10377 S  SG   . CYS A 1 3  ? 7.214  3.569   -2.376  1.00 0.00 ? 3  CYS A SG   14 
ATOM   10378 H  H    . CYS A 1 3  ? 4.604  6.068   -4.683  1.00 0.00 ? 3  CYS A H    14 
ATOM   10379 H  HA   . CYS A 1 3  ? 6.704  4.259   -5.240  1.00 0.00 ? 3  CYS A HA   14 
ATOM   10380 H  HB2  . CYS A 1 3  ? 6.647  5.690   -3.294  1.00 0.00 ? 3  CYS A HB2  14 
ATOM   10381 H  HB3  . CYS A 1 3  ? 5.217  4.841   -2.667  1.00 0.00 ? 3  CYS A HB3  14 
ATOM   10382 N  N    . LYS A 1 4  ? 5.860  1.900   -5.060  1.00 0.00 ? 4  LYS A N    14 
ATOM   10383 C  CA   . LYS A 1 4  ? 5.457  0.502   -5.005  1.00 0.00 ? 4  LYS A CA   14 
ATOM   10384 C  C    . LYS A 1 4  ? 5.012  0.121   -3.594  1.00 0.00 ? 4  LYS A C    14 
ATOM   10385 O  O    . LYS A 1 4  ? 3.934  -0.442  -3.416  1.00 0.00 ? 4  LYS A O    14 
ATOM   10386 C  CB   . LYS A 1 4  ? 6.618  -0.368  -5.513  1.00 0.00 ? 4  LYS A CB   14 
ATOM   10387 C  CG   . LYS A 1 4  ? 6.288  -1.866  -5.621  1.00 0.00 ? 4  LYS A CG   14 
ATOM   10388 C  CD   . LYS A 1 4  ? 6.578  -2.647  -4.330  1.00 0.00 ? 4  LYS A CD   14 
ATOM   10389 C  CE   . LYS A 1 4  ? 6.302  -4.140  -4.536  1.00 0.00 ? 4  LYS A CE   14 
ATOM   10390 N  NZ   . LYS A 1 4  ? 6.542  -4.910  -3.302  1.00 0.00 ? 4  LYS A NZ   14 
ATOM   10391 H  H    . LYS A 1 4  ? 6.814  2.089   -5.337  1.00 0.00 ? 4  LYS A H    14 
ATOM   10392 H  HA   . LYS A 1 4  ? 4.618  0.368   -5.681  1.00 0.00 ? 4  LYS A HA   14 
ATOM   10393 H  HB2  . LYS A 1 4  ? 6.866  -0.017  -6.517  1.00 0.00 ? 4  LYS A HB2  14 
ATOM   10394 H  HB3  . LYS A 1 4  ? 7.491  -0.227  -4.874  1.00 0.00 ? 4  LYS A HB3  14 
ATOM   10395 H  HG2  . LYS A 1 4  ? 5.245  -1.993  -5.915  1.00 0.00 ? 4  LYS A HG2  14 
ATOM   10396 H  HG3  . LYS A 1 4  ? 6.918  -2.285  -6.407  1.00 0.00 ? 4  LYS A HG3  14 
ATOM   10397 H  HD2  . LYS A 1 4  ? 7.624  -2.507  -4.052  1.00 0.00 ? 4  LYS A HD2  14 
ATOM   10398 H  HD3  . LYS A 1 4  ? 5.947  -2.294  -3.517  1.00 0.00 ? 4  LYS A HD3  14 
ATOM   10399 H  HE2  . LYS A 1 4  ? 5.261  -4.277  -4.834  1.00 0.00 ? 4  LYS A HE2  14 
ATOM   10400 H  HE3  . LYS A 1 4  ? 6.948  -4.527  -5.325  1.00 0.00 ? 4  LYS A HE3  14 
ATOM   10401 H  HZ1  . LYS A 1 4  ? 5.942  -4.569  -2.565  1.00 0.00 ? 4  LYS A HZ1  14 
ATOM   10402 H  HZ2  . LYS A 1 4  ? 6.342  -5.887  -3.467  1.00 0.00 ? 4  LYS A HZ2  14 
ATOM   10403 H  HZ3  . LYS A 1 4  ? 7.508  -4.811  -3.020  1.00 0.00 ? 4  LYS A HZ3  14 
ATOM   10404 N  N    . VAL A 1 5  ? 5.860  0.423   -2.608  1.00 0.00 ? 5  VAL A N    14 
ATOM   10405 C  CA   . VAL A 1 5  ? 5.688  0.030   -1.217  1.00 0.00 ? 5  VAL A CA   14 
ATOM   10406 C  C    . VAL A 1 5  ? 4.457  0.719   -0.621  1.00 0.00 ? 5  VAL A C    14 
ATOM   10407 O  O    . VAL A 1 5  ? 3.546  0.042   -0.148  1.00 0.00 ? 5  VAL A O    14 
ATOM   10408 C  CB   . VAL A 1 5  ? 6.986  0.321   -0.441  1.00 0.00 ? 5  VAL A CB   14 
ATOM   10409 C  CG1  . VAL A 1 5  ? 6.849  0.051   1.062   1.00 0.00 ? 5  VAL A CG1  14 
ATOM   10410 C  CG2  . VAL A 1 5  ? 8.132  -0.537  -0.996  1.00 0.00 ? 5  VAL A CG2  14 
ATOM   10411 H  H    . VAL A 1 5  ? 6.717  0.892   -2.858  1.00 0.00 ? 5  VAL A H    14 
ATOM   10412 H  HA   . VAL A 1 5  ? 5.521  -1.047  -1.182  1.00 0.00 ? 5  VAL A HA   14 
ATOM   10413 H  HB   . VAL A 1 5  ? 7.252  1.369   -0.563  1.00 0.00 ? 5  VAL A HB   14 
ATOM   10414 H  HG11 . VAL A 1 5  ? 6.103  0.712   1.502   1.00 0.00 ? 5  VAL A HG11 14 
ATOM   10415 H  HG12 . VAL A 1 5  ? 6.562  -0.986  1.233   1.00 0.00 ? 5  VAL A HG12 14 
ATOM   10416 H  HG13 . VAL A 1 5  ? 7.807  0.246   1.548   1.00 0.00 ? 5  VAL A HG13 14 
ATOM   10417 H  HG21 . VAL A 1 5  ? 9.043  -0.351  -0.428  1.00 0.00 ? 5  VAL A HG21 14 
ATOM   10418 H  HG22 . VAL A 1 5  ? 7.880  -1.594  -0.917  1.00 0.00 ? 5  VAL A HG22 14 
ATOM   10419 H  HG23 . VAL A 1 5  ? 8.322  -0.292  -2.040  1.00 0.00 ? 5  VAL A HG23 14 
ATOM   10420 N  N    . CYS A 1 6  ? 4.424  2.057   -0.648  1.00 0.00 ? 6  CYS A N    14 
ATOM   10421 C  CA   . CYS A 1 6  ? 3.417  2.839   0.054   1.00 0.00 ? 6  CYS A CA   14 
ATOM   10422 C  C    . CYS A 1 6  ? 2.092  2.819   -0.705  1.00 0.00 ? 6  CYS A C    14 
ATOM   10423 O  O    . CYS A 1 6  ? 1.050  2.518   -0.126  1.00 0.00 ? 6  CYS A O    14 
ATOM   10424 C  CB   . CYS A 1 6  ? 3.880  4.290   0.237   1.00 0.00 ? 6  CYS A CB   14 
ATOM   10425 S  SG   . CYS A 1 6  ? 5.524  4.518   0.950   1.00 0.00 ? 6  CYS A SG   14 
ATOM   10426 H  H    . CYS A 1 6  ? 5.176  2.553   -1.096  1.00 0.00 ? 6  CYS A H    14 
ATOM   10427 H  HA   . CYS A 1 6  ? 3.268  2.410   1.046   1.00 0.00 ? 6  CYS A HA   14 
ATOM   10428 H  HB2  . CYS A 1 6  ? 3.866  4.814   -0.719  1.00 0.00 ? 6  CYS A HB2  14 
ATOM   10429 H  HB3  . CYS A 1 6  ? 3.166  4.782   0.896   1.00 0.00 ? 6  CYS A HB3  14 
ATOM   10430 N  N    . ARG A 1 7  ? 2.144  3.171   -1.996  1.00 0.00 ? 7  ARG A N    14 
ATOM   10431 C  CA   . ARG A 1 7  ? 0.985  3.432   -2.839  1.00 0.00 ? 7  ARG A CA   14 
ATOM   10432 C  C    . ARG A 1 7  ? 0.136  4.584   -2.284  1.00 0.00 ? 7  ARG A C    14 
ATOM   10433 O  O    . ARG A 1 7  ? -1.081 4.597   -2.466  1.00 0.00 ? 7  ARG A O    14 
ATOM   10434 C  CB   . ARG A 1 7  ? 0.164  2.153   -3.076  1.00 0.00 ? 7  ARG A CB   14 
ATOM   10435 C  CG   . ARG A 1 7  ? 1.064  0.963   -3.435  1.00 0.00 ? 7  ARG A CG   14 
ATOM   10436 C  CD   . ARG A 1 7  ? 0.255  -0.227  -3.963  1.00 0.00 ? 7  ARG A CD   14 
ATOM   10437 N  NE   . ARG A 1 7  ? -0.361 0.062   -5.266  1.00 0.00 ? 7  ARG A NE   14 
ATOM   10438 C  CZ   . ARG A 1 7  ? 0.295  0.126   -6.439  1.00 0.00 ? 7  ARG A CZ   14 
ATOM   10439 N  NH1  . ARG A 1 7  ? 1.616  -0.093  -6.502  1.00 0.00 ? 7  ARG A NH1  14 
ATOM   10440 N  NH2  . ARG A 1 7  ? -0.383 0.413   -7.558  1.00 0.00 ? 7  ARG A NH2  14 
ATOM   10441 H  H    . ARG A 1 7  ? 3.051  3.289   -2.428  1.00 0.00 ? 7  ARG A H    14 
ATOM   10442 H  HA   . ARG A 1 7  ? 1.370  3.757   -3.805  1.00 0.00 ? 7  ARG A HA   14 
ATOM   10443 H  HB2  . ARG A 1 7  ? -0.416 1.902   -2.187  1.00 0.00 ? 7  ARG A HB2  14 
ATOM   10444 H  HB3  . ARG A 1 7  ? -0.530 2.348   -3.894  1.00 0.00 ? 7  ARG A HB3  14 
ATOM   10445 H  HG2  . ARG A 1 7  ? 1.794  1.273   -4.182  1.00 0.00 ? 7  ARG A HG2  14 
ATOM   10446 H  HG3  . ARG A 1 7  ? 1.597  0.637   -2.541  1.00 0.00 ? 7  ARG A HG3  14 
ATOM   10447 H  HD2  . ARG A 1 7  ? 0.907  -1.097  -4.048  1.00 0.00 ? 7  ARG A HD2  14 
ATOM   10448 H  HD3  . ARG A 1 7  ? -0.531 -0.465  -3.247  1.00 0.00 ? 7  ARG A HD3  14 
ATOM   10449 H  HE   . ARG A 1 7  ? -1.357 0.232   -5.262  1.00 0.00 ? 7  ARG A HE   14 
ATOM   10450 H  HH11 . ARG A 1 7  ? 2.133  -0.301  -5.659  1.00 0.00 ? 7  ARG A HH11 14 
ATOM   10451 H  HH12 . ARG A 1 7  ? 2.103  -0.039  -7.385  1.00 0.00 ? 7  ARG A HH12 14 
ATOM   10452 H  HH21 . ARG A 1 7  ? -1.380 0.577   -7.520  1.00 0.00 ? 7  ARG A HH21 14 
ATOM   10453 H  HH22 . ARG A 1 7  ? 0.095  0.467   -8.446  1.00 0.00 ? 7  ARG A HH22 14 
ATOM   10454 N  N    . LYS A 1 8  ? 0.781  5.551   -1.617  1.00 0.00 ? 8  LYS A N    14 
ATOM   10455 C  CA   . LYS A 1 8  ? 0.143  6.712   -1.011  1.00 0.00 ? 8  LYS A CA   14 
ATOM   10456 C  C    . LYS A 1 8  ? 0.495  7.964   -1.810  1.00 0.00 ? 8  LYS A C    14 
ATOM   10457 O  O    . LYS A 1 8  ? 1.622  8.094   -2.287  1.00 0.00 ? 8  LYS A O    14 
ATOM   10458 C  CB   . LYS A 1 8  ? 0.624  6.893   0.434   1.00 0.00 ? 8  LYS A CB   14 
ATOM   10459 C  CG   . LYS A 1 8  ? 0.148  5.774   1.364   1.00 0.00 ? 8  LYS A CG   14 
ATOM   10460 C  CD   . LYS A 1 8  ? 0.768  5.857   2.768   1.00 0.00 ? 8  LYS A CD   14 
ATOM   10461 C  CE   . LYS A 1 8  ? 0.345  7.092   3.579   1.00 0.00 ? 8  LYS A CE   14 
ATOM   10462 N  NZ   . LYS A 1 8  ? 1.178  8.277   3.299   1.00 0.00 ? 8  LYS A NZ   14 
ATOM   10463 H  H    . LYS A 1 8  ? 1.785  5.495   -1.539  1.00 0.00 ? 8  LYS A H    14 
ATOM   10464 H  HA   . LYS A 1 8  ? -0.940 6.591   -0.988  1.00 0.00 ? 8  LYS A HA   14 
ATOM   10465 H  HB2  . LYS A 1 8  ? 1.713  6.935   0.438   1.00 0.00 ? 8  LYS A HB2  14 
ATOM   10466 H  HB3  . LYS A 1 8  ? 0.217  7.839   0.793   1.00 0.00 ? 8  LYS A HB3  14 
ATOM   10467 H  HG2  . LYS A 1 8  ? -0.939 5.802   1.441   1.00 0.00 ? 8  LYS A HG2  14 
ATOM   10468 H  HG3  . LYS A 1 8  ? 0.433  4.813   0.936   1.00 0.00 ? 8  LYS A HG3  14 
ATOM   10469 H  HD2  . LYS A 1 8  ? 0.430  4.974   3.313   1.00 0.00 ? 8  LYS A HD2  14 
ATOM   10470 H  HD3  . LYS A 1 8  ? 1.856  5.811   2.703   1.00 0.00 ? 8  LYS A HD3  14 
ATOM   10471 H  HE2  . LYS A 1 8  ? -0.704 7.321   3.393   1.00 0.00 ? 8  LYS A HE2  14 
ATOM   10472 H  HE3  . LYS A 1 8  ? 0.465  6.859   4.637   1.00 0.00 ? 8  LYS A HE3  14 
ATOM   10473 H  HZ1  . LYS A 1 8  ? 2.158  8.067   3.460   1.00 0.00 ? 8  LYS A HZ1  14 
ATOM   10474 H  HZ2  . LYS A 1 8  ? 1.096  8.569   2.336   1.00 0.00 ? 8  LYS A HZ2  14 
ATOM   10475 H  HZ3  . LYS A 1 8  ? 0.901  9.041   3.898   1.00 0.00 ? 8  LYS A HZ3  14 
ATOM   10476 N  N    . LYS A 1 9  ? -0.478 8.872   -1.945  1.00 0.00 ? 9  LYS A N    14 
ATOM   10477 C  CA   . LYS A 1 9  ? -0.293 10.216  -2.471  1.00 0.00 ? 9  LYS A CA   14 
ATOM   10478 C  C    . LYS A 1 9  ? -0.245 11.180  -1.287  1.00 0.00 ? 9  LYS A C    14 
ATOM   10479 O  O    . LYS A 1 9  ? -1.213 11.276  -0.533  1.00 0.00 ? 9  LYS A O    14 
ATOM   10480 C  CB   . LYS A 1 9  ? -1.439 10.552  -3.435  1.00 0.00 ? 9  LYS A CB   14 
ATOM   10481 C  CG   . LYS A 1 9  ? -1.261 11.951  -4.044  1.00 0.00 ? 9  LYS A CG   14 
ATOM   10482 C  CD   . LYS A 1 9  ? -2.320 12.262  -5.110  1.00 0.00 ? 9  LYS A CD   14 
ATOM   10483 C  CE   . LYS A 1 9  ? -3.726 12.393  -4.510  1.00 0.00 ? 9  LYS A CE   14 
ATOM   10484 N  NZ   . LYS A 1 9  ? -4.707 12.829  -5.520  1.00 0.00 ? 9  LYS A NZ   14 
ATOM   10485 H  H    . LYS A 1 9  ? -1.381 8.669   -1.541  1.00 0.00 ? 9  LYS A H    14 
ATOM   10486 H  HA   . LYS A 1 9  ? 0.641  10.284  -3.022  1.00 0.00 ? 9  LYS A HA   14 
ATOM   10487 H  HB2  . LYS A 1 9  ? -1.443 9.815   -4.241  1.00 0.00 ? 9  LYS A HB2  14 
ATOM   10488 H  HB3  . LYS A 1 9  ? -2.384 10.497  -2.894  1.00 0.00 ? 9  LYS A HB3  14 
ATOM   10489 H  HG2  . LYS A 1 9  ? -1.311 12.710  -3.262  1.00 0.00 ? 9  LYS A HG2  14 
ATOM   10490 H  HG3  . LYS A 1 9  ? -0.278 12.008  -4.512  1.00 0.00 ? 9  LYS A HG3  14 
ATOM   10491 H  HD2  . LYS A 1 9  ? -2.050 13.210  -5.581  1.00 0.00 ? 9  LYS A HD2  14 
ATOM   10492 H  HD3  . LYS A 1 9  ? -2.312 11.481  -5.871  1.00 0.00 ? 9  LYS A HD3  14 
ATOM   10493 H  HE2  . LYS A 1 9  ? -4.053 11.433  -4.112  1.00 0.00 ? 9  LYS A HE2  14 
ATOM   10494 H  HE3  . LYS A 1 9  ? -3.710 13.125  -3.701  1.00 0.00 ? 9  LYS A HE3  14 
ATOM   10495 H  HZ1  . LYS A 1 9  ? -5.619 12.908  -5.091  1.00 0.00 ? 9  LYS A HZ1  14 
ATOM   10496 H  HZ2  . LYS A 1 9  ? -4.436 13.727  -5.893  1.00 0.00 ? 9  LYS A HZ2  14 
ATOM   10497 H  HZ3  . LYS A 1 9  ? -4.748 12.153  -6.269  1.00 0.00 ? 9  LYS A HZ3  14 
ATOM   10498 N  N    . GLY A 1 10 ? 0.881  11.877  -1.117  1.00 0.00 ? 10 GLY A N    14 
ATOM   10499 C  CA   . GLY A 1 10 ? 1.133  12.688  0.062   1.00 0.00 ? 10 GLY A CA   14 
ATOM   10500 C  C    . GLY A 1 10 ? 2.618  13.006  0.158   1.00 0.00 ? 10 GLY A C    14 
ATOM   10501 O  O    . GLY A 1 10 ? 3.021  14.156  -0.011  1.00 0.00 ? 10 GLY A O    14 
ATOM   10502 H  H    . GLY A 1 10 ? 1.623  11.800  -1.804  1.00 0.00 ? 10 GLY A H    14 
ATOM   10503 H  HA2  . GLY A 1 10 ? 0.563  13.617  -0.016  1.00 0.00 ? 10 GLY A HA2  14 
ATOM   10504 H  HA3  . GLY A 1 10 ? 0.828  12.151  0.962   1.00 0.00 ? 10 GLY A HA3  14 
ATOM   10505 N  N    . GLU A 1 11 ? 3.432  11.974  0.413   1.00 0.00 ? 11 GLU A N    14 
ATOM   10506 C  CA   . GLU A 1 11 ? 4.880  12.078  0.509   1.00 0.00 ? 11 GLU A CA   14 
ATOM   10507 C  C    . GLU A 1 11 ? 5.519  12.084  -0.886  1.00 0.00 ? 11 GLU A C    14 
ATOM   10508 O  O    . GLU A 1 11 ? 6.424  11.301  -1.169  1.00 0.00 ? 11 GLU A O    14 
ATOM   10509 C  CB   . GLU A 1 11 ? 5.438  10.967  1.418   1.00 0.00 ? 11 GLU A CB   14 
ATOM   10510 C  CG   . GLU A 1 11 ? 5.063  9.535   0.997   1.00 0.00 ? 11 GLU A CG   14 
ATOM   10511 C  CD   . GLU A 1 11 ? 3.770  9.039   1.641   1.00 0.00 ? 11 GLU A CD   14 
ATOM   10512 O  OE1  . GLU A 1 11 ? 2.690  9.349   1.091   1.00 0.00 ? 11 GLU A OE1  14 
ATOM   10513 O  OE2  . GLU A 1 11 ? 3.874  8.351   2.680   1.00 0.00 ? 11 GLU A OE2  14 
ATOM   10514 H  H    . GLU A 1 11 ? 3.024  11.054  0.521   1.00 0.00 ? 11 GLU A H    14 
ATOM   10515 H  HA   . GLU A 1 11 ? 5.136  13.027  0.984   1.00 0.00 ? 11 GLU A HA   14 
ATOM   10516 H  HB2  . GLU A 1 11 ? 6.526  11.062  1.401   1.00 0.00 ? 11 GLU A HB2  14 
ATOM   10517 H  HB3  . GLU A 1 11 ? 5.104  11.134  2.445   1.00 0.00 ? 11 GLU A HB3  14 
ATOM   10518 H  HG2  . GLU A 1 11 ? 4.968  9.461   -0.085  1.00 0.00 ? 11 GLU A HG2  14 
ATOM   10519 H  HG3  . GLU A 1 11 ? 5.867  8.871   1.317   1.00 0.00 ? 11 GLU A HG3  14 
ATOM   10520 N  N    . ASP A 1 12 ? 5.071  12.999  -1.753  1.00 0.00 ? 12 ASP A N    14 
ATOM   10521 C  CA   . ASP A 1 12 ? 5.492  13.074  -3.147  1.00 0.00 ? 12 ASP A CA   14 
ATOM   10522 C  C    . ASP A 1 12 ? 6.776  13.910  -3.235  1.00 0.00 ? 12 ASP A C    14 
ATOM   10523 O  O    . ASP A 1 12 ? 6.855  14.854  -4.018  1.00 0.00 ? 12 ASP A O    14 
ATOM   10524 C  CB   . ASP A 1 12 ? 4.350  13.656  -3.997  1.00 0.00 ? 12 ASP A CB   14 
ATOM   10525 C  CG   . ASP A 1 12 ? 3.147  12.720  -4.146  1.00 0.00 ? 12 ASP A CG   14 
ATOM   10526 O  OD1  . ASP A 1 12 ? 2.878  11.934  -3.211  1.00 0.00 ? 12 ASP A OD1  14 
ATOM   10527 O  OD2  . ASP A 1 12 ? 2.508  12.788  -5.217  1.00 0.00 ? 12 ASP A OD2  14 
ATOM   10528 H  H    . ASP A 1 12 ? 4.353  13.641  -1.447  1.00 0.00 ? 12 ASP A H    14 
ATOM   10529 H  HA   . ASP A 1 12 ? 5.702  12.077  -3.529  1.00 0.00 ? 12 ASP A HA   14 
ATOM   10530 H  HB2  . ASP A 1 12 ? 4.016  14.595  -3.557  1.00 0.00 ? 12 ASP A HB2  14 
ATOM   10531 H  HB3  . ASP A 1 12 ? 4.728  13.853  -5.003  1.00 0.00 ? 12 ASP A HB3  14 
ATOM   10532 N  N    . ASP A 1 13 ? 7.772  13.560  -2.408  1.00 0.00 ? 13 ASP A N    14 
ATOM   10533 C  CA   . ASP A 1 13 ? 8.976  14.345  -2.178  1.00 0.00 ? 13 ASP A CA   14 
ATOM   10534 C  C    . ASP A 1 13 ? 10.221 13.536  -2.548  1.00 0.00 ? 13 ASP A C    14 
ATOM   10535 O  O    . ASP A 1 13 ? 10.756 13.692  -3.645  1.00 0.00 ? 13 ASP A O    14 
ATOM   10536 C  CB   . ASP A 1 13 ? 8.962  14.821  -0.716  1.00 0.00 ? 13 ASP A CB   14 
ATOM   10537 C  CG   . ASP A 1 13 ? 10.172 15.666  -0.326  1.00 0.00 ? 13 ASP A CG   14 
ATOM   10538 O  OD1  . ASP A 1 13 ? 10.868 16.170  -1.235  1.00 0.00 ? 13 ASP A OD1  14 
ATOM   10539 O  OD2  . ASP A 1 13 ? 10.405 15.783  0.898   1.00 0.00 ? 13 ASP A OD2  14 
ATOM   10540 H  H    . ASP A 1 13 ? 7.656  12.723  -1.854  1.00 0.00 ? 13 ASP A H    14 
ATOM   10541 H  HA   . ASP A 1 13 ? 8.971  15.235  -2.802  1.00 0.00 ? 13 ASP A HA   14 
ATOM   10542 H  HB2  . ASP A 1 13 ? 8.066  15.421  -0.554  1.00 0.00 ? 13 ASP A HB2  14 
ATOM   10543 H  HB3  . ASP A 1 13 ? 8.905  13.960  -0.052  1.00 0.00 ? 13 ASP A HB3  14 
ATOM   10544 N  N    . LYS A 1 14 ? 10.665 12.651  -1.648  1.00 0.00 ? 14 LYS A N    14 
ATOM   10545 C  CA   . LYS A 1 14 ? 11.947 11.964  -1.748  1.00 0.00 ? 14 LYS A CA   14 
ATOM   10546 C  C    . LYS A 1 14 ? 11.751 10.575  -2.353  1.00 0.00 ? 14 LYS A C    14 
ATOM   10547 O  O    . LYS A 1 14 ? 12.073 9.568   -1.720  1.00 0.00 ? 14 LYS A O    14 
ATOM   10548 C  CB   . LYS A 1 14 ? 12.617 11.886  -0.367  1.00 0.00 ? 14 LYS A CB   14 
ATOM   10549 C  CG   . LYS A 1 14 ? 12.888 13.245  0.293   1.00 0.00 ? 14 LYS A CG   14 
ATOM   10550 C  CD   . LYS A 1 14 ? 13.815 14.130  -0.552  1.00 0.00 ? 14 LYS A CD   14 
ATOM   10551 C  CE   . LYS A 1 14 ? 14.251 15.394  0.200   1.00 0.00 ? 14 LYS A CE   14 
ATOM   10552 N  NZ   . LYS A 1 14 ? 13.122 16.306  0.453   1.00 0.00 ? 14 LYS A NZ   14 
ATOM   10553 H  H    . LYS A 1 14 ? 10.125 12.526  -0.808  1.00 0.00 ? 14 LYS A H    14 
ATOM   10554 H  HA   . LYS A 1 14 ? 12.620 12.504  -2.412  1.00 0.00 ? 14 LYS A HA   14 
ATOM   10555 H  HB2  . LYS A 1 14 ? 11.979 11.305  0.300   1.00 0.00 ? 14 LYS A HB2  14 
ATOM   10556 H  HB3  . LYS A 1 14 ? 13.571 11.375  -0.482  1.00 0.00 ? 14 LYS A HB3  14 
ATOM   10557 H  HG2  . LYS A 1 14 ? 11.943 13.748  0.479   1.00 0.00 ? 14 LYS A HG2  14 
ATOM   10558 H  HG3  . LYS A 1 14 ? 13.368 13.055  1.254   1.00 0.00 ? 14 LYS A HG3  14 
ATOM   10559 H  HD2  . LYS A 1 14 ? 14.708 13.559  -0.805  1.00 0.00 ? 14 LYS A HD2  14 
ATOM   10560 H  HD3  . LYS A 1 14 ? 13.313 14.428  -1.474  1.00 0.00 ? 14 LYS A HD3  14 
ATOM   10561 H  HE2  . LYS A 1 14 ? 14.717 15.119  1.147   1.00 0.00 ? 14 LYS A HE2  14 
ATOM   10562 H  HE3  . LYS A 1 14 ? 14.987 15.921  -0.410  1.00 0.00 ? 14 LYS A HE3  14 
ATOM   10563 H  HZ1  . LYS A 1 14 ? 12.432 15.866  1.049   1.00 0.00 ? 14 LYS A HZ1  14 
ATOM   10564 H  HZ2  . LYS A 1 14 ? 13.448 17.155  0.891   1.00 0.00 ? 14 LYS A HZ2  14 
ATOM   10565 H  HZ3  . LYS A 1 14 ? 12.655 16.532  -0.419  1.00 0.00 ? 14 LYS A HZ3  14 
ATOM   10566 N  N    . LEU A 1 15 ? 11.237 10.525  -3.589  1.00 0.00 ? 15 LEU A N    14 
ATOM   10567 C  CA   . LEU A 1 15 ? 11.190 9.300   -4.375  1.00 0.00 ? 15 LEU A CA   14 
ATOM   10568 C  C    . LEU A 1 15 ? 12.586 8.944   -4.896  1.00 0.00 ? 15 LEU A C    14 
ATOM   10569 O  O    . LEU A 1 15 ? 13.463 9.800   -5.013  1.00 0.00 ? 15 LEU A O    14 
ATOM   10570 C  CB   . LEU A 1 15 ? 10.194 9.420   -5.543  1.00 0.00 ? 15 LEU A CB   14 
ATOM   10571 C  CG   . LEU A 1 15 ? 8.702  9.334   -5.174  1.00 0.00 ? 15 LEU A CG   14 
ATOM   10572 C  CD1  . LEU A 1 15 ? 8.309  7.954   -4.630  1.00 0.00 ? 15 LEU A CD1  14 
ATOM   10573 C  CD2  . LEU A 1 15 ? 8.241  10.441  -4.221  1.00 0.00 ? 15 LEU A CD2  14 
ATOM   10574 H  H    . LEU A 1 15 ? 10.962 11.391  -4.031  1.00 0.00 ? 15 LEU A H    14 
ATOM   10575 H  HA   . LEU A 1 15 ? 10.864 8.490   -3.726  1.00 0.00 ? 15 LEU A HA   14 
ATOM   10576 H  HB2  . LEU A 1 15 ? 10.375 10.357  -6.072  1.00 0.00 ? 15 LEU A HB2  14 
ATOM   10577 H  HB3  . LEU A 1 15 ? 10.386 8.601   -6.241  1.00 0.00 ? 15 LEU A HB3  14 
ATOM   10578 H  HG   . LEU A 1 15 ? 8.148  9.472   -6.102  1.00 0.00 ? 15 LEU A HG   14 
ATOM   10579 H  HD11 . LEU A 1 15 ? 7.227  7.903   -4.519  1.00 0.00 ? 15 LEU A HD11 14 
ATOM   10580 H  HD12 . LEU A 1 15 ? 8.629  7.178   -5.325  1.00 0.00 ? 15 LEU A HD12 14 
ATOM   10581 H  HD13 . LEU A 1 15 ? 8.767  7.771   -3.659  1.00 0.00 ? 15 LEU A HD13 14 
ATOM   10582 H  HD21 . LEU A 1 15 ? 7.156  10.392  -4.126  1.00 0.00 ? 15 LEU A HD21 14 
ATOM   10583 H  HD22 . LEU A 1 15 ? 8.680  10.316  -3.234  1.00 0.00 ? 15 LEU A HD22 14 
ATOM   10584 H  HD23 . LEU A 1 15 ? 8.518  11.416  -4.622  1.00 0.00 ? 15 LEU A HD23 14 
ATOM   10585 N  N    . ILE A 1 16 ? 12.769 7.659   -5.213  1.00 0.00 ? 16 ILE A N    14 
ATOM   10586 C  CA   . ILE A 1 16 ? 13.964 7.082   -5.802  1.00 0.00 ? 16 ILE A CA   14 
ATOM   10587 C  C    . ILE A 1 16 ? 13.548 5.824   -6.568  1.00 0.00 ? 16 ILE A C    14 
ATOM   10588 O  O    . ILE A 1 16 ? 13.073 4.856   -5.976  1.00 0.00 ? 16 ILE A O    14 
ATOM   10589 C  CB   . ILE A 1 16 ? 15.043 6.820   -4.730  1.00 0.00 ? 16 ILE A CB   14 
ATOM   10590 C  CG1  . ILE A 1 16 ? 16.130 5.894   -5.299  1.00 0.00 ? 16 ILE A CG1  14 
ATOM   10591 C  CG2  . ILE A 1 16 ? 14.480 6.237   -3.424  1.00 0.00 ? 16 ILE A CG2  14 
ATOM   10592 C  CD1  . ILE A 1 16 ? 17.484 6.101   -4.619  1.00 0.00 ? 16 ILE A CD1  14 
ATOM   10593 H  H    . ILE A 1 16 ? 12.006 7.021   -5.042  1.00 0.00 ? 16 ILE A H    14 
ATOM   10594 H  HA   . ILE A 1 16 ? 14.385 7.791   -6.517  1.00 0.00 ? 16 ILE A HA   14 
ATOM   10595 H  HB   . ILE A 1 16 ? 15.500 7.782   -4.491  1.00 0.00 ? 16 ILE A HB   14 
ATOM   10596 H  HG12 . ILE A 1 16 ? 15.806 4.859   -5.173  1.00 0.00 ? 16 ILE A HG12 14 
ATOM   10597 H  HG13 . ILE A 1 16 ? 16.274 6.101   -6.361  1.00 0.00 ? 16 ILE A HG13 14 
ATOM   10598 H  HG21 . ILE A 1 16 ? 15.291 6.016   -2.733  1.00 0.00 ? 16 ILE A HG21 14 
ATOM   10599 H  HG22 . ILE A 1 16 ? 13.821 6.961   -2.945  1.00 0.00 ? 16 ILE A HG22 14 
ATOM   10600 H  HG23 . ILE A 1 16 ? 13.929 5.318   -3.612  1.00 0.00 ? 16 ILE A HG23 14 
ATOM   10601 H  HD11 . ILE A 1 16 ? 18.207 5.398   -5.034  1.00 0.00 ? 16 ILE A HD11 14 
ATOM   10602 H  HD12 . ILE A 1 16 ? 17.828 7.117   -4.811  1.00 0.00 ? 16 ILE A HD12 14 
ATOM   10603 H  HD13 . ILE A 1 16 ? 17.413 5.944   -3.545  1.00 0.00 ? 16 ILE A HD13 14 
ATOM   10604 N  N    . LEU A 1 17 ? 13.700 5.856   -7.896  1.00 0.00 ? 17 LEU A N    14 
ATOM   10605 C  CA   . LEU A 1 17 ? 13.374 4.749   -8.781  1.00 0.00 ? 17 LEU A CA   14 
ATOM   10606 C  C    . LEU A 1 17 ? 14.598 3.851   -8.953  1.00 0.00 ? 17 LEU A C    14 
ATOM   10607 O  O    . LEU A 1 17 ? 15.733 4.328   -8.951  1.00 0.00 ? 17 LEU A O    14 
ATOM   10608 C  CB   . LEU A 1 17 ? 12.897 5.285   -10.139 1.00 0.00 ? 17 LEU A CB   14 
ATOM   10609 C  CG   . LEU A 1 17 ? 11.405 5.661   -10.162 1.00 0.00 ? 17 LEU A CG   14 
ATOM   10610 C  CD1  . LEU A 1 17 ? 11.046 6.766   -9.159  1.00 0.00 ? 17 LEU A CD1  14 
ATOM   10611 C  CD2  . LEU A 1 17 ? 11.030 6.122   -11.575 1.00 0.00 ? 17 LEU A CD2  14 
ATOM   10612 H  H    . LEU A 1 17 ? 14.108 6.675   -8.324  1.00 0.00 ? 17 LEU A H    14 
ATOM   10613 H  HA   . LEU A 1 17 ? 12.575 4.150   -8.350  1.00 0.00 ? 17 LEU A HA   14 
ATOM   10614 H  HB2  . LEU A 1 17 ? 13.506 6.144   -10.431 1.00 0.00 ? 17 LEU A HB2  14 
ATOM   10615 H  HB3  . LEU A 1 17 ? 13.039 4.496   -10.880 1.00 0.00 ? 17 LEU A HB3  14 
ATOM   10616 H  HG   . LEU A 1 17 ? 10.814 4.774   -9.932  1.00 0.00 ? 17 LEU A HG   14 
ATOM   10617 H  HD11 . LEU A 1 17 ? 11.703 7.625   -9.295  1.00 0.00 ? 17 LEU A HD11 14 
ATOM   10618 H  HD12 . LEU A 1 17 ? 10.014 7.080   -9.315  1.00 0.00 ? 17 LEU A HD12 14 
ATOM   10619 H  HD13 . LEU A 1 17 ? 11.135 6.397   -8.138  1.00 0.00 ? 17 LEU A HD13 14 
ATOM   10620 H  HD21 . LEU A 1 17 ? 9.964  6.343   -11.622 1.00 0.00 ? 17 LEU A HD21 14 
ATOM   10621 H  HD22 . LEU A 1 17 ? 11.593 7.018   -11.837 1.00 0.00 ? 17 LEU A HD22 14 
ATOM   10622 H  HD23 . LEU A 1 17 ? 11.257 5.335   -12.294 1.00 0.00 ? 17 LEU A HD23 14 
ATOM   10623 N  N    . CYS A 1 18 ? 14.351 2.550   -9.130  1.00 0.00 ? 18 CYS A N    14 
ATOM   10624 C  CA   . CYS A 1 18 ? 15.367 1.585   -9.520  1.00 0.00 ? 18 CYS A CA   14 
ATOM   10625 C  C    . CYS A 1 18 ? 15.799 1.830   -10.967 1.00 0.00 ? 18 CYS A C    14 
ATOM   10626 O  O    . CYS A 1 18 ? 14.957 2.005   -11.842 1.00 0.00 ? 18 CYS A O    14 
ATOM   10627 C  CB   . CYS A 1 18 ? 14.808 0.173   -9.322  1.00 0.00 ? 18 CYS A CB   14 
ATOM   10628 S  SG   . CYS A 1 18 ? 15.771 -1.137  -10.107 1.00 0.00 ? 18 CYS A SG   14 
ATOM   10629 H  H    . CYS A 1 18 ? 13.398 2.222   -9.046  1.00 0.00 ? 18 CYS A H    14 
ATOM   10630 H  HA   . CYS A 1 18 ? 16.240 1.685   -8.875  1.00 0.00 ? 18 CYS A HA   14 
ATOM   10631 H  HB2  . CYS A 1 18 ? 14.776 -0.022  -8.250  1.00 0.00 ? 18 CYS A HB2  14 
ATOM   10632 H  HB3  . CYS A 1 18 ? 13.792 0.110   -9.710  1.00 0.00 ? 18 CYS A HB3  14 
ATOM   10633 N  N    . ASP A 1 19 ? 17.112 1.836   -11.219 1.00 0.00 ? 19 ASP A N    14 
ATOM   10634 C  CA   . ASP A 1 19 ? 17.669 2.016   -12.553 1.00 0.00 ? 19 ASP A CA   14 
ATOM   10635 C  C    . ASP A 1 19 ? 17.139 0.958   -13.523 1.00 0.00 ? 19 ASP A C    14 
ATOM   10636 O  O    . ASP A 1 19 ? 16.651 1.289   -14.602 1.00 0.00 ? 19 ASP A O    14 
ATOM   10637 C  CB   . ASP A 1 19 ? 19.200 1.981   -12.470 1.00 0.00 ? 19 ASP A CB   14 
ATOM   10638 C  CG   . ASP A 1 19 ? 19.835 2.182   -13.842 1.00 0.00 ? 19 ASP A CG   14 
ATOM   10639 O  OD1  . ASP A 1 19 ? 19.947 3.359   -14.248 1.00 0.00 ? 19 ASP A OD1  14 
ATOM   10640 O  OD2  . ASP A 1 19 ? 20.184 1.156   -14.464 1.00 0.00 ? 19 ASP A OD2  14 
ATOM   10641 H  H    . ASP A 1 19 ? 17.763 1.708   -10.454 1.00 0.00 ? 19 ASP A H    14 
ATOM   10642 H  HA   . ASP A 1 19 ? 17.370 2.998   -12.918 1.00 0.00 ? 19 ASP A HA   14 
ATOM   10643 H  HB2  . ASP A 1 19 ? 19.543 2.776   -11.806 1.00 0.00 ? 19 ASP A HB2  14 
ATOM   10644 H  HB3  . ASP A 1 19 ? 19.527 1.024   -12.061 1.00 0.00 ? 19 ASP A HB3  14 
ATOM   10645 N  N    . GLU A 1 20 ? 17.219 -0.310  -13.108 1.00 0.00 ? 20 GLU A N    14 
ATOM   10646 C  CA   . GLU A 1 20 ? 16.973 -1.471  -13.949 1.00 0.00 ? 20 GLU A CA   14 
ATOM   10647 C  C    . GLU A 1 20 ? 15.522 -1.518  -14.443 1.00 0.00 ? 20 GLU A C    14 
ATOM   10648 O  O    . GLU A 1 20 ? 15.286 -1.515  -15.650 1.00 0.00 ? 20 GLU A O    14 
ATOM   10649 C  CB   . GLU A 1 20 ? 17.334 -2.743  -13.165 1.00 0.00 ? 20 GLU A CB   14 
ATOM   10650 C  CG   . GLU A 1 20 ? 17.310 -3.992  -14.055 1.00 0.00 ? 20 GLU A CG   14 
ATOM   10651 C  CD   . GLU A 1 20 ? 17.580 -5.255  -13.243 1.00 0.00 ? 20 GLU A CD   14 
ATOM   10652 O  OE1  . GLU A 1 20 ? 18.704 -5.359  -12.706 1.00 0.00 ? 20 GLU A OE1  14 
ATOM   10653 O  OE2  . GLU A 1 20 ? 16.652 -6.089  -13.163 1.00 0.00 ? 20 GLU A OE2  14 
ATOM   10654 H  H    . GLU A 1 20 ? 17.624 -0.466  -12.198 1.00 0.00 ? 20 GLU A H    14 
ATOM   10655 H  HA   . GLU A 1 20 ? 17.638 -1.403  -14.811 1.00 0.00 ? 20 GLU A HA   14 
ATOM   10656 H  HB2  . GLU A 1 20 ? 18.338 -2.640  -12.743 1.00 0.00 ? 20 GLU A HB2  14 
ATOM   10657 H  HB3  . GLU A 1 20 ? 16.626 -2.883  -12.348 1.00 0.00 ? 20 GLU A HB3  14 
ATOM   10658 H  HG2  . GLU A 1 20 ? 16.336 -4.087  -14.536 1.00 0.00 ? 20 GLU A HG2  14 
ATOM   10659 H  HG3  . GLU A 1 20 ? 18.073 -3.898  -14.829 1.00 0.00 ? 20 GLU A HG3  14 
ATOM   10660 N  N    . CYS A 1 21 ? 14.563 -1.572  -13.509 1.00 0.00 ? 21 CYS A N    14 
ATOM   10661 C  CA   . CYS A 1 21 ? 13.155 -1.852  -13.785 1.00 0.00 ? 21 CYS A CA   14 
ATOM   10662 C  C    . CYS A 1 21 ? 12.211 -0.713  -13.382 1.00 0.00 ? 21 CYS A C    14 
ATOM   10663 O  O    . CYS A 1 21 ? 11.001 -0.854  -13.546 1.00 0.00 ? 21 CYS A O    14 
ATOM   10664 C  CB   . CYS A 1 21 ? 12.764 -3.168  -13.101 1.00 0.00 ? 21 CYS A CB   14 
ATOM   10665 S  SG   . CYS A 1 21 ? 12.931 -3.195  -11.296 1.00 0.00 ? 21 CYS A SG   14 
ATOM   10666 H  H    . CYS A 1 21 ? 14.837 -1.471  -12.545 1.00 0.00 ? 21 CYS A H    14 
ATOM   10667 H  HA   . CYS A 1 21 ? 13.011 -2.002  -14.855 1.00 0.00 ? 21 CYS A HA   14 
ATOM   10668 H  HB2  . CYS A 1 21 ? 11.725 -3.397  -13.345 1.00 0.00 ? 21 CYS A HB2  14 
ATOM   10669 H  HB3  . CYS A 1 21 ? 13.394 -3.965  -13.502 1.00 0.00 ? 21 CYS A HB3  14 
ATOM   10670 N  N    . ASN A 1 22 ? 12.735 0.401   -12.853 1.00 0.00 ? 22 ASN A N    14 
ATOM   10671 C  CA   . ASN A 1 22 ? 11.980 1.634   -12.635 1.00 0.00 ? 22 ASN A CA   14 
ATOM   10672 C  C    . ASN A 1 22 ? 10.803 1.449   -11.673 1.00 0.00 ? 22 ASN A C    14 
ATOM   10673 O  O    . ASN A 1 22 ? 9.772  2.101   -11.815 1.00 0.00 ? 22 ASN A O    14 
ATOM   10674 C  CB   . ASN A 1 22 ? 11.573 2.265   -13.977 1.00 0.00 ? 22 ASN A CB   14 
ATOM   10675 C  CG   . ASN A 1 22 ? 12.727 2.346   -14.982 1.00 0.00 ? 22 ASN A CG   14 
ATOM   10676 O  OD1  . ASN A 1 22 ? 12.520 2.124   -16.173 1.00 0.00 ? 22 ASN A OD1  14 
ATOM   10677 N  ND2  . ASN A 1 22 ? 13.944 2.647   -14.520 1.00 0.00 ? 22 ASN A ND2  14 
ATOM   10678 H  H    . ASN A 1 22 ? 13.735 0.459   -12.710 1.00 0.00 ? 22 ASN A H    14 
ATOM   10679 H  HA   . ASN A 1 22 ? 12.622 2.353   -12.137 1.00 0.00 ? 22 ASN A HA   14 
ATOM   10680 H  HB2  . ASN A 1 22 ? 10.770 1.675   -14.420 1.00 0.00 ? 22 ASN A HB2  14 
ATOM   10681 H  HB3  . ASN A 1 22 ? 11.205 3.277   -13.797 1.00 0.00 ? 22 ASN A HB3  14 
ATOM   10682 H  HD21 . ASN A 1 22 ? 14.102 2.764   -13.526 1.00 0.00 ? 22 ASN A HD21 14 
ATOM   10683 H  HD22 . ASN A 1 22 ? 14.733 2.628   -15.156 1.00 0.00 ? 22 ASN A HD22 14 
ATOM   10684 N  N    . LYS A 1 23 ? 10.975 0.570   -10.677 1.00 0.00 ? 23 LYS A N    14 
ATOM   10685 C  CA   . LYS A 1 23 ? 10.064 0.433   -9.559  1.00 0.00 ? 23 LYS A CA   14 
ATOM   10686 C  C    . LYS A 1 23 ? 10.396 1.536   -8.557  1.00 0.00 ? 23 LYS A C    14 
ATOM   10687 O  O    . LYS A 1 23 ? 11.565 1.723   -8.216  1.00 0.00 ? 23 LYS A O    14 
ATOM   10688 C  CB   . LYS A 1 23 ? 10.235 -0.956  -8.935  1.00 0.00 ? 23 LYS A CB   14 
ATOM   10689 C  CG   . LYS A 1 23 ? 9.720  -2.054  -9.873  1.00 0.00 ? 23 LYS A CG   14 
ATOM   10690 C  CD   . LYS A 1 23 ? 9.947  -3.439  -9.257  1.00 0.00 ? 23 LYS A CD   14 
ATOM   10691 C  CE   . LYS A 1 23 ? 9.502  -4.536  -10.230 1.00 0.00 ? 23 LYS A CE   14 
ATOM   10692 N  NZ   . LYS A 1 23 ? 9.797  -5.881  -9.706  1.00 0.00 ? 23 LYS A NZ   14 
ATOM   10693 H  H    . LYS A 1 23 ? 11.835 0.046   -10.622 1.00 0.00 ? 23 LYS A H    14 
ATOM   10694 H  HA   . LYS A 1 23 ? 9.031  0.538   -9.899  1.00 0.00 ? 23 LYS A HA   14 
ATOM   10695 H  HB2  . LYS A 1 23 ? 11.292 -1.128  -8.717  1.00 0.00 ? 23 LYS A HB2  14 
ATOM   10696 H  HB3  . LYS A 1 23 ? 9.667  -0.994  -8.006  1.00 0.00 ? 23 LYS A HB3  14 
ATOM   10697 H  HG2  . LYS A 1 23 ? 8.654  -1.907  -10.050 1.00 0.00 ? 23 LYS A HG2  14 
ATOM   10698 H  HG3  . LYS A 1 23 ? 10.243 -1.994  -10.828 1.00 0.00 ? 23 LYS A HG3  14 
ATOM   10699 H  HD2  . LYS A 1 23 ? 11.008 -3.562  -9.032  1.00 0.00 ? 23 LYS A HD2  14 
ATOM   10700 H  HD3  . LYS A 1 23 ? 9.380  -3.519  -8.328  1.00 0.00 ? 23 LYS A HD3  14 
ATOM   10701 H  HE2  . LYS A 1 23 ? 8.428  -4.451  -10.403 1.00 0.00 ? 23 LYS A HE2  14 
ATOM   10702 H  HE3  . LYS A 1 23 ? 10.021 -4.415  -11.180 1.00 0.00 ? 23 LYS A HE3  14 
ATOM   10703 H  HZ1  . LYS A 1 23 ? 9.316  -6.022  -8.829  1.00 0.00 ? 23 LYS A HZ1  14 
ATOM   10704 H  HZ2  . LYS A 1 23 ? 9.489  -6.577  -10.371 1.00 0.00 ? 23 LYS A HZ2  14 
ATOM   10705 H  HZ3  . LYS A 1 23 ? 10.793 -5.980  -9.562  1.00 0.00 ? 23 LYS A HZ3  14 
ATOM   10706 N  N    . ALA A 1 24 ? 9.376  2.284   -8.123  1.00 0.00 ? 24 ALA A N    14 
ATOM   10707 C  CA   . ALA A 1 24 ? 9.542  3.482   -7.315  1.00 0.00 ? 24 ALA A CA   14 
ATOM   10708 C  C    . ALA A 1 24 ? 9.570  3.113   -5.832  1.00 0.00 ? 24 ALA A C    14 
ATOM   10709 O  O    . ALA A 1 24 ? 8.711  2.374   -5.355  1.00 0.00 ? 24 ALA A O    14 
ATOM   10710 C  CB   . ALA A 1 24 ? 8.424  4.479   -7.628  1.00 0.00 ? 24 ALA A CB   14 
ATOM   10711 H  H    . ALA A 1 24 ? 8.439  2.046   -8.413  1.00 0.00 ? 24 ALA A H    14 
ATOM   10712 H  HA   . ALA A 1 24 ? 10.479 3.969   -7.578  1.00 0.00 ? 24 ALA A HA   14 
ATOM   10713 H  HB1  . ALA A 1 24 ? 8.537  5.371   -7.009  1.00 0.00 ? 24 ALA A HB1  14 
ATOM   10714 H  HB2  . ALA A 1 24 ? 8.474  4.770   -8.678  1.00 0.00 ? 24 ALA A HB2  14 
ATOM   10715 H  HB3  . ALA A 1 24 ? 7.458  4.016   -7.435  1.00 0.00 ? 24 ALA A HB3  14 
ATOM   10716 N  N    . PHE A 1 25 ? 10.575 3.631   -5.121  1.00 0.00 ? 25 PHE A N    14 
ATOM   10717 C  CA   . PHE A 1 25 ? 10.730 3.549   -3.676  1.00 0.00 ? 25 PHE A CA   14 
ATOM   10718 C  C    . PHE A 1 25 ? 10.922 4.965   -3.130  1.00 0.00 ? 25 PHE A C    14 
ATOM   10719 O  O    . PHE A 1 25 ? 11.010 5.913   -3.905  1.00 0.00 ? 25 PHE A O    14 
ATOM   10720 C  CB   . PHE A 1 25 ? 11.946 2.662   -3.359  1.00 0.00 ? 25 PHE A CB   14 
ATOM   10721 C  CG   . PHE A 1 25 ? 11.706 1.192   -3.649  1.00 0.00 ? 25 PHE A CG   14 
ATOM   10722 C  CD1  . PHE A 1 25 ? 11.794 0.709   -4.969  1.00 0.00 ? 25 PHE A CD1  14 
ATOM   10723 C  CD2  . PHE A 1 25 ? 11.343 0.314   -2.609  1.00 0.00 ? 25 PHE A CD2  14 
ATOM   10724 C  CE1  . PHE A 1 25 ? 11.481 -0.630  -5.254  1.00 0.00 ? 25 PHE A CE1  14 
ATOM   10725 C  CE2  . PHE A 1 25 ? 11.062 -1.034  -2.892  1.00 0.00 ? 25 PHE A CE2  14 
ATOM   10726 C  CZ   . PHE A 1 25 ? 11.117 -1.504  -4.215  1.00 0.00 ? 25 PHE A CZ   14 
ATOM   10727 H  H    . PHE A 1 25 ? 11.260 4.199   -5.603  1.00 0.00 ? 25 PHE A H    14 
ATOM   10728 H  HA   . PHE A 1 25 ? 9.849  3.112   -3.209  1.00 0.00 ? 25 PHE A HA   14 
ATOM   10729 H  HB2  . PHE A 1 25 ? 12.810 2.998   -3.938  1.00 0.00 ? 25 PHE A HB2  14 
ATOM   10730 H  HB3  . PHE A 1 25 ? 12.210 2.771   -2.304  1.00 0.00 ? 25 PHE A HB3  14 
ATOM   10731 H  HD1  . PHE A 1 25 ? 12.105 1.366   -5.766  1.00 0.00 ? 25 PHE A HD1  14 
ATOM   10732 H  HD2  . PHE A 1 25 ? 11.280 0.670   -1.592  1.00 0.00 ? 25 PHE A HD2  14 
ATOM   10733 H  HE1  . PHE A 1 25 ? 11.540 -0.991  -6.268  1.00 0.00 ? 25 PHE A HE1  14 
ATOM   10734 H  HE2  . PHE A 1 25 ? 10.800 -1.709  -2.090  1.00 0.00 ? 25 PHE A HE2  14 
ATOM   10735 H  HZ   . PHE A 1 25 ? 10.893 -2.538  -4.432  1.00 0.00 ? 25 PHE A HZ   14 
ATOM   10736 N  N    . HIS A 1 26 ? 10.931 5.112   -1.802  1.00 0.00 ? 26 HIS A N    14 
ATOM   10737 C  CA   . HIS A 1 26 ? 11.351 6.337   -1.133  1.00 0.00 ? 26 HIS A CA   14 
ATOM   10738 C  C    . HIS A 1 26 ? 12.659 6.037   -0.416  1.00 0.00 ? 26 HIS A C    14 
ATOM   10739 O  O    . HIS A 1 26 ? 13.033 4.876   -0.259  1.00 0.00 ? 26 HIS A O    14 
ATOM   10740 C  CB   . HIS A 1 26 ? 10.344 6.801   -0.075  1.00 0.00 ? 26 HIS A CB   14 
ATOM   10741 C  CG   . HIS A 1 26 ? 9.029  7.297   -0.601  1.00 0.00 ? 26 HIS A CG   14 
ATOM   10742 N  ND1  . HIS A 1 26 ? 7.866  6.537   -0.675  1.00 0.00 ? 26 HIS A ND1  14 
ATOM   10743 C  CD2  . HIS A 1 26 ? 8.754  8.593   -0.931  1.00 0.00 ? 26 HIS A CD2  14 
ATOM   10744 C  CE1  . HIS A 1 26 ? 6.911  7.393   -1.070  1.00 0.00 ? 26 HIS A CE1  14 
ATOM   10745 N  NE2  . HIS A 1 26 ? 7.415  8.628   -1.235  1.00 0.00 ? 26 HIS A NE2  14 
ATOM   10746 H  H    . HIS A 1 26 ? 10.804 4.295   -1.223  1.00 0.00 ? 26 HIS A H    14 
ATOM   10747 H  HA   . HIS A 1 26 ? 11.515 7.140   -1.847  1.00 0.00 ? 26 HIS A HA   14 
ATOM   10748 H  HB2  . HIS A 1 26 ? 10.164 5.997   0.634   1.00 0.00 ? 26 HIS A HB2  14 
ATOM   10749 H  HB3  . HIS A 1 26 ? 10.787 7.631   0.476   1.00 0.00 ? 26 HIS A HB3  14 
ATOM   10750 H  HD2  . HIS A 1 26 ? 9.434  9.430   -0.907  1.00 0.00 ? 26 HIS A HD2  14 
ATOM   10751 H  HE1  . HIS A 1 26 ? 5.874  7.128   -1.220  1.00 0.00 ? 26 HIS A HE1  14 
ATOM   10752 H  HE2  . HIS A 1 26 ? 6.891  9.454   -1.491  1.00 0.00 ? 26 HIS A HE2  14 
ATOM   10753 N  N    . LEU A 1 27 ? 13.333 7.087   0.059   1.00 0.00 ? 27 LEU A N    14 
ATOM   10754 C  CA   . LEU A 1 27 ? 14.460 6.931   0.965   1.00 0.00 ? 27 LEU A CA   14 
ATOM   10755 C  C    . LEU A 1 27 ? 13.993 6.219   2.237   1.00 0.00 ? 27 LEU A C    14 
ATOM   10756 O  O    . LEU A 1 27 ? 14.702 5.364   2.754   1.00 0.00 ? 27 LEU A O    14 
ATOM   10757 C  CB   . LEU A 1 27 ? 15.068 8.294   1.302   1.00 0.00 ? 27 LEU A CB   14 
ATOM   10758 C  CG   . LEU A 1 27 ? 15.494 9.100   0.066   1.00 0.00 ? 27 LEU A CG   14 
ATOM   10759 C  CD1  . LEU A 1 27 ? 16.042 10.446  0.541   1.00 0.00 ? 27 LEU A CD1  14 
ATOM   10760 C  CD2  . LEU A 1 27 ? 16.565 8.387   -0.765  1.00 0.00 ? 27 LEU A CD2  14 
ATOM   10761 H  H    . LEU A 1 27 ? 13.006 8.019   -0.150  1.00 0.00 ? 27 LEU A H    14 
ATOM   10762 H  HA   . LEU A 1 27 ? 15.223 6.314   0.493   1.00 0.00 ? 27 LEU A HA   14 
ATOM   10763 H  HB2  . LEU A 1 27 ? 14.328 8.870   1.857   1.00 0.00 ? 27 LEU A HB2  14 
ATOM   10764 H  HB3  . LEU A 1 27 ? 15.940 8.131   1.938   1.00 0.00 ? 27 LEU A HB3  14 
ATOM   10765 H  HG   . LEU A 1 27 ? 14.632 9.287   -0.572  1.00 0.00 ? 27 LEU A HG   14 
ATOM   10766 H  HD11 . LEU A 1 27 ? 15.287 10.963  1.134   1.00 0.00 ? 27 LEU A HD11 14 
ATOM   10767 H  HD12 . LEU A 1 27 ? 16.923 10.279  1.157   1.00 0.00 ? 27 LEU A HD12 14 
ATOM   10768 H  HD13 . LEU A 1 27 ? 16.308 11.066  -0.315  1.00 0.00 ? 27 LEU A HD13 14 
ATOM   10769 H  HD21 . LEU A 1 27 ? 16.185 7.448   -1.158  1.00 0.00 ? 27 LEU A HD21 14 
ATOM   10770 H  HD22 . LEU A 1 27 ? 16.835 9.020   -1.609  1.00 0.00 ? 27 LEU A HD22 14 
ATOM   10771 H  HD23 . LEU A 1 27 ? 17.451 8.193   -0.161  1.00 0.00 ? 27 LEU A HD23 14 
ATOM   10772 N  N    . PHE A 1 28 ? 12.776 6.540   2.700   1.00 0.00 ? 28 PHE A N    14 
ATOM   10773 C  CA   . PHE A 1 28 ? 12.089 5.864   3.796   1.00 0.00 ? 28 PHE A CA   14 
ATOM   10774 C  C    . PHE A 1 28 ? 12.104 4.343   3.611   1.00 0.00 ? 28 PHE A C    14 
ATOM   10775 O  O    . PHE A 1 28 ? 12.479 3.608   4.523   1.00 0.00 ? 28 PHE A O    14 
ATOM   10776 C  CB   . PHE A 1 28 ? 10.643 6.375   3.917   1.00 0.00 ? 28 PHE A CB   14 
ATOM   10777 C  CG   . PHE A 1 28 ? 10.435 7.864   3.689   1.00 0.00 ? 28 PHE A CG   14 
ATOM   10778 C  CD1  . PHE A 1 28 ? 11.293 8.809   4.286   1.00 0.00 ? 28 PHE A CD1  14 
ATOM   10779 C  CD2  . PHE A 1 28 ? 9.418  8.302   2.817   1.00 0.00 ? 28 PHE A CD2  14 
ATOM   10780 C  CE1  . PHE A 1 28 ? 11.166 10.173  3.972   1.00 0.00 ? 28 PHE A CE1  14 
ATOM   10781 C  CE2  . PHE A 1 28 ? 9.305  9.663   2.492   1.00 0.00 ? 28 PHE A CE2  14 
ATOM   10782 C  CZ   . PHE A 1 28 ? 10.177 10.600  3.069   1.00 0.00 ? 28 PHE A CZ   14 
ATOM   10783 H  H    . PHE A 1 28 ? 12.280 7.291   2.241   1.00 0.00 ? 28 PHE A H    14 
ATOM   10784 H  HA   . PHE A 1 28 ? 12.610 6.113   4.719   1.00 0.00 ? 28 PHE A HA   14 
ATOM   10785 H  HB2  . PHE A 1 28 ? 10.029 5.838   3.195   1.00 0.00 ? 28 PHE A HB2  14 
ATOM   10786 H  HB3  . PHE A 1 28 ? 10.270 6.122   4.911   1.00 0.00 ? 28 PHE A HB3  14 
ATOM   10787 H  HD1  . PHE A 1 28 ? 12.062 8.490   4.975   1.00 0.00 ? 28 PHE A HD1  14 
ATOM   10788 H  HD2  . PHE A 1 28 ? 8.726  7.597   2.379   1.00 0.00 ? 28 PHE A HD2  14 
ATOM   10789 H  HE1  . PHE A 1 28 ? 11.831 10.894  4.426   1.00 0.00 ? 28 PHE A HE1  14 
ATOM   10790 H  HE2  . PHE A 1 28 ? 8.547  9.988   1.794   1.00 0.00 ? 28 PHE A HE2  14 
ATOM   10791 H  HZ   . PHE A 1 28 ? 10.074 11.648  2.826   1.00 0.00 ? 28 PHE A HZ   14 
ATOM   10792 N  N    . CYS A 1 29 ? 11.683 3.883   2.426   1.00 0.00 ? 29 CYS A N    14 
ATOM   10793 C  CA   . CYS A 1 29 ? 11.421 2.480   2.128   1.00 0.00 ? 29 CYS A CA   14 
ATOM   10794 C  C    . CYS A 1 29 ? 12.735 1.747   1.843   1.00 0.00 ? 29 CYS A C    14 
ATOM   10795 O  O    . CYS A 1 29 ? 12.913 0.603   2.253   1.00 0.00 ? 29 CYS A O    14 
ATOM   10796 C  CB   . CYS A 1 29 ? 10.468 2.384   0.928   1.00 0.00 ? 29 CYS A CB   14 
ATOM   10797 S  SG   . CYS A 1 29 ? 9.027  3.479   1.009   1.00 0.00 ? 29 CYS A SG   14 
ATOM   10798 H  H    . CYS A 1 29 ? 11.511 4.554   1.691   1.00 0.00 ? 29 CYS A H    14 
ATOM   10799 H  HA   . CYS A 1 29 ? 10.932 2.020   2.988   1.00 0.00 ? 29 CYS A HA   14 
ATOM   10800 H  HB2  . CYS A 1 29 ? 11.012 2.653   0.025   1.00 0.00 ? 29 CYS A HB2  14 
ATOM   10801 H  HB3  . CYS A 1 29 ? 10.115 1.357   0.822   1.00 0.00 ? 29 CYS A HB3  14 
ATOM   10802 N  N    . LEU A 1 30 ? 13.646 2.424   1.131   1.00 0.00 ? 30 LEU A N    14 
ATOM   10803 C  CA   . LEU A 1 30 ? 14.998 1.979   0.834   1.00 0.00 ? 30 LEU A CA   14 
ATOM   10804 C  C    . LEU A 1 30 ? 15.763 1.744   2.138   1.00 0.00 ? 30 LEU A C    14 
ATOM   10805 O  O    . LEU A 1 30 ? 16.098 0.608   2.468   1.00 0.00 ? 30 LEU A O    14 
ATOM   10806 C  CB   . LEU A 1 30 ? 15.645 3.035   -0.082  1.00 0.00 ? 30 LEU A CB   14 
ATOM   10807 C  CG   . LEU A 1 30 ? 16.982 2.656   -0.736  1.00 0.00 ? 30 LEU A CG   14 
ATOM   10808 C  CD1  . LEU A 1 30 ? 17.307 3.713   -1.799  1.00 0.00 ? 30 LEU A CD1  14 
ATOM   10809 C  CD2  . LEU A 1 30 ? 18.156 2.578   0.247   1.00 0.00 ? 30 LEU A CD2  14 
ATOM   10810 H  H    . LEU A 1 30 ? 13.398 3.350   0.810   1.00 0.00 ? 30 LEU A H    14 
ATOM   10811 H  HA   . LEU A 1 30 ? 14.939 1.040   0.288   1.00 0.00 ? 30 LEU A HA   14 
ATOM   10812 H  HB2  . LEU A 1 30 ? 14.943 3.203   -0.902  1.00 0.00 ? 30 LEU A HB2  14 
ATOM   10813 H  HB3  . LEU A 1 30 ? 15.772 3.974   0.456   1.00 0.00 ? 30 LEU A HB3  14 
ATOM   10814 H  HG   . LEU A 1 30 ? 16.858 1.695   -1.226  1.00 0.00 ? 30 LEU A HG   14 
ATOM   10815 H  HD11 . LEU A 1 30 ? 16.531 3.721   -2.564  1.00 0.00 ? 30 LEU A HD11 14 
ATOM   10816 H  HD12 . LEU A 1 30 ? 17.364 4.699   -1.335  1.00 0.00 ? 30 LEU A HD12 14 
ATOM   10817 H  HD13 . LEU A 1 30 ? 18.262 3.493   -2.273  1.00 0.00 ? 30 LEU A HD13 14 
ATOM   10818 H  HD21 . LEU A 1 30 ? 18.204 3.488   0.846   1.00 0.00 ? 30 LEU A HD21 14 
ATOM   10819 H  HD22 . LEU A 1 30 ? 18.056 1.712   0.896   1.00 0.00 ? 30 LEU A HD22 14 
ATOM   10820 H  HD23 . LEU A 1 30 ? 19.090 2.470   -0.306  1.00 0.00 ? 30 LEU A HD23 14 
ATOM   10821 N  N    . ARG A 1 31 ? 16.034 2.829   2.868   1.00 0.00 ? 31 ARG A N    14 
ATOM   10822 C  CA   . ARG A 1 31 ? 16.727 2.836   4.146   1.00 0.00 ? 31 ARG A CA   14 
ATOM   10823 C  C    . ARG A 1 31 ? 16.550 4.235   4.752   1.00 0.00 ? 31 ARG A C    14 
ATOM   10824 O  O    . ARG A 1 31 ? 17.191 5.172   4.280   1.00 0.00 ? 31 ARG A O    14 
ATOM   10825 C  CB   . ARG A 1 31 ? 18.213 2.496   3.944   1.00 0.00 ? 31 ARG A CB   14 
ATOM   10826 C  CG   . ARG A 1 31 ? 18.962 2.435   5.279   1.00 0.00 ? 31 ARG A CG   14 
ATOM   10827 C  CD   . ARG A 1 31 ? 20.449 2.159   5.038   1.00 0.00 ? 31 ARG A CD   14 
ATOM   10828 N  NE   . ARG A 1 31 ? 21.195 2.086   6.301   1.00 0.00 ? 31 ARG A NE   14 
ATOM   10829 C  CZ   . ARG A 1 31 ? 21.254 1.013   7.111   1.00 0.00 ? 31 ARG A CZ   14 
ATOM   10830 N  NH1  . ARG A 1 31 ? 20.590 -0.114  6.812   1.00 0.00 ? 31 ARG A NH1  14 
ATOM   10831 N  NH2  . ARG A 1 31 ? 21.985 1.072   8.231   1.00 0.00 ? 31 ARG A NH2  14 
ATOM   10832 H  H    . ARG A 1 31 ? 15.679 3.713   2.529   1.00 0.00 ? 31 ARG A H    14 
ATOM   10833 H  HA   . ARG A 1 31 ? 16.284 2.064   4.774   1.00 0.00 ? 31 ARG A HA   14 
ATOM   10834 H  HB2  . ARG A 1 31 ? 18.306 1.524   3.462   1.00 0.00 ? 31 ARG A HB2  14 
ATOM   10835 H  HB3  . ARG A 1 31 ? 18.675 3.244   3.299   1.00 0.00 ? 31 ARG A HB3  14 
ATOM   10836 H  HG2  . ARG A 1 31 ? 18.865 3.383   5.808   1.00 0.00 ? 31 ARG A HG2  14 
ATOM   10837 H  HG3  . ARG A 1 31 ? 18.530 1.643   5.892   1.00 0.00 ? 31 ARG A HG3  14 
ATOM   10838 H  HD2  . ARG A 1 31 ? 20.573 1.237   4.468   1.00 0.00 ? 31 ARG A HD2  14 
ATOM   10839 H  HD3  . ARG A 1 31 ? 20.865 2.977   4.448   1.00 0.00 ? 31 ARG A HD3  14 
ATOM   10840 H  HE   . ARG A 1 31 ? 21.707 2.915   6.566   1.00 0.00 ? 31 ARG A HE   14 
ATOM   10841 H  HH11 . ARG A 1 31 ? 20.034 -0.165  5.972   1.00 0.00 ? 31 ARG A HH11 14 
ATOM   10842 H  HH12 . ARG A 1 31 ? 20.642 -0.917  7.423   1.00 0.00 ? 31 ARG A HH12 14 
ATOM   10843 H  HH21 . ARG A 1 31 ? 22.490 1.914   8.465   1.00 0.00 ? 31 ARG A HH21 14 
ATOM   10844 H  HH22 . ARG A 1 31 ? 22.039 0.274   8.848   1.00 0.00 ? 31 ARG A HH22 14 
ATOM   10845 N  N    . PRO A 1 32 ? 15.718 4.394   5.796   1.00 0.00 ? 32 PRO A N    14 
ATOM   10846 C  CA   . PRO A 1 32 ? 15.292 5.694   6.307   1.00 0.00 ? 32 PRO A CA   14 
ATOM   10847 C  C    . PRO A 1 32 ? 16.435 6.562   6.848   1.00 0.00 ? 32 PRO A C    14 
ATOM   10848 O  O    . PRO A 1 32 ? 16.245 7.762   7.027   1.00 0.00 ? 32 PRO A O    14 
ATOM   10849 C  CB   . PRO A 1 32 ? 14.276 5.374   7.405   1.00 0.00 ? 32 PRO A CB   14 
ATOM   10850 C  CG   . PRO A 1 32 ? 14.803 4.056   7.969   1.00 0.00 ? 32 PRO A CG   14 
ATOM   10851 C  CD   . PRO A 1 32 ? 15.329 3.343   6.723   1.00 0.00 ? 32 PRO A CD   14 
ATOM   10852 H  HA   . PRO A 1 32 ? 14.798 6.255   5.513   1.00 0.00 ? 32 PRO A HA   14 
ATOM   10853 H  HB2  . PRO A 1 32 ? 14.206 6.154   8.164   1.00 0.00 ? 32 PRO A HB2  14 
ATOM   10854 H  HB3  . PRO A 1 32 ? 13.297 5.200   6.954   1.00 0.00 ? 32 PRO A HB3  14 
ATOM   10855 H  HG2  . PRO A 1 32 ? 15.629 4.259   8.652   1.00 0.00 ? 32 PRO A HG2  14 
ATOM   10856 H  HG3  . PRO A 1 32 ? 14.025 3.483   8.477   1.00 0.00 ? 32 PRO A HG3  14 
ATOM   10857 H  HD2  . PRO A 1 32 ? 16.168 2.701   6.993   1.00 0.00 ? 32 PRO A HD2  14 
ATOM   10858 H  HD3  . PRO A 1 32 ? 14.528 2.751   6.277   1.00 0.00 ? 32 PRO A HD3  14 
ATOM   10859 N  N    . ALA A 1 33 ? 17.615 5.978   7.101   1.00 0.00 ? 33 ALA A N    14 
ATOM   10860 C  CA   . ALA A 1 33 ? 18.833 6.715   7.410   1.00 0.00 ? 33 ALA A CA   14 
ATOM   10861 C  C    . ALA A 1 33 ? 19.165 7.771   6.350   1.00 0.00 ? 33 ALA A C    14 
ATOM   10862 O  O    . ALA A 1 33 ? 19.700 8.827   6.685   1.00 0.00 ? 33 ALA A O    14 
ATOM   10863 C  CB   . ALA A 1 33 ? 19.997 5.733   7.571   1.00 0.00 ? 33 ALA A CB   14 
ATOM   10864 H  H    . ALA A 1 33 ? 17.694 4.978   6.995   1.00 0.00 ? 33 ALA A H    14 
ATOM   10865 H  HA   . ALA A 1 33 ? 18.683 7.225   8.361   1.00 0.00 ? 33 ALA A HA   14 
ATOM   10866 H  HB1  . ALA A 1 33 ? 20.194 5.230   6.624   1.00 0.00 ? 33 ALA A HB1  14 
ATOM   10867 H  HB2  . ALA A 1 33 ? 20.892 6.274   7.878   1.00 0.00 ? 33 ALA A HB2  14 
ATOM   10868 H  HB3  . ALA A 1 33 ? 19.753 4.989   8.331   1.00 0.00 ? 33 ALA A HB3  14 
ATOM   10869 N  N    . LEU A 1 34 ? 18.862 7.485   5.079   1.00 0.00 ? 34 LEU A N    14 
ATOM   10870 C  CA   . LEU A 1 34 ? 18.984 8.451   3.997   1.00 0.00 ? 34 LEU A CA   14 
ATOM   10871 C  C    . LEU A 1 34 ? 17.858 9.481   4.087   1.00 0.00 ? 34 LEU A C    14 
ATOM   10872 O  O    . LEU A 1 34 ? 16.700 9.124   4.298   1.00 0.00 ? 34 LEU A O    14 
ATOM   10873 C  CB   . LEU A 1 34 ? 18.973 7.754   2.633   1.00 0.00 ? 34 LEU A CB   14 
ATOM   10874 C  CG   . LEU A 1 34 ? 20.304 7.084   2.253   1.00 0.00 ? 34 LEU A CG   14 
ATOM   10875 C  CD1  . LEU A 1 34 ? 21.447 8.086   2.039   1.00 0.00 ? 34 LEU A CD1  14 
ATOM   10876 C  CD2  . LEU A 1 34 ? 20.736 5.979   3.223   1.00 0.00 ? 34 LEU A CD2  14 
ATOM   10877 H  H    . LEU A 1 34 ? 18.398 6.609   4.881   1.00 0.00 ? 34 LEU A H    14 
ATOM   10878 H  HA   . LEU A 1 34 ? 19.943 8.956   4.073   1.00 0.00 ? 34 LEU A HA   14 
ATOM   10879 H  HB2  . LEU A 1 34 ? 18.169 7.019   2.605   1.00 0.00 ? 34 LEU A HB2  14 
ATOM   10880 H  HB3  . LEU A 1 34 ? 18.763 8.505   1.870   1.00 0.00 ? 34 LEU A HB3  14 
ATOM   10881 H  HG   . LEU A 1 34 ? 20.117 6.621   1.291   1.00 0.00 ? 34 LEU A HG   14 
ATOM   10882 H  HD11 . LEU A 1 34 ? 21.116 8.898   1.391   1.00 0.00 ? 34 LEU A HD11 14 
ATOM   10883 H  HD12 . LEU A 1 34 ? 21.794 8.498   2.986   1.00 0.00 ? 34 LEU A HD12 14 
ATOM   10884 H  HD13 . LEU A 1 34 ? 22.284 7.576   1.561   1.00 0.00 ? 34 LEU A HD13 14 
ATOM   10885 H  HD21 . LEU A 1 34 ? 19.900 5.305   3.411   1.00 0.00 ? 34 LEU A HD21 14 
ATOM   10886 H  HD22 . LEU A 1 34 ? 21.554 5.410   2.782   1.00 0.00 ? 34 LEU A HD22 14 
ATOM   10887 H  HD23 . LEU A 1 34 ? 21.078 6.406   4.165   1.00 0.00 ? 34 LEU A HD23 14 
ATOM   10888 N  N    . TYR A 1 35 ? 18.217 10.758  3.910   1.00 0.00 ? 35 TYR A N    14 
ATOM   10889 C  CA   . TYR A 1 35 ? 17.292 11.877  3.748   1.00 0.00 ? 35 TYR A CA   14 
ATOM   10890 C  C    . TYR A 1 35 ? 17.614 12.654  2.470   1.00 0.00 ? 35 TYR A C    14 
ATOM   10891 O  O    . TYR A 1 35 ? 16.706 13.164  1.812   1.00 0.00 ? 35 TYR A O    14 
ATOM   10892 C  CB   . TYR A 1 35 ? 17.342 12.767  4.993   1.00 0.00 ? 35 TYR A CB   14 
ATOM   10893 C  CG   . TYR A 1 35 ? 16.973 12.028  6.265   1.00 0.00 ? 35 TYR A CG   14 
ATOM   10894 C  CD1  . TYR A 1 35 ? 15.626 11.709  6.524   1.00 0.00 ? 35 TYR A CD1  14 
ATOM   10895 C  CD2  . TYR A 1 35 ? 17.980 11.547  7.124   1.00 0.00 ? 35 TYR A CD2  14 
ATOM   10896 C  CE1  . TYR A 1 35 ? 15.287 10.937  7.648   1.00 0.00 ? 35 TYR A CE1  14 
ATOM   10897 C  CE2  . TYR A 1 35 ? 17.641 10.773  8.247   1.00 0.00 ? 35 TYR A CE2  14 
ATOM   10898 C  CZ   . TYR A 1 35 ? 16.293 10.466  8.508   1.00 0.00 ? 35 TYR A CZ   14 
ATOM   10899 O  OH   . TYR A 1 35 ? 15.961 9.707   9.592   1.00 0.00 ? 35 TYR A OH   14 
ATOM   10900 H  H    . TYR A 1 35 ? 19.202 10.959  3.830   1.00 0.00 ? 35 TYR A H    14 
ATOM   10901 H  HA   . TYR A 1 35 ? 16.276 11.503  3.641   1.00 0.00 ? 35 TYR A HA   14 
ATOM   10902 H  HB2  . TYR A 1 35 ? 18.347 13.183  5.093   1.00 0.00 ? 35 TYR A HB2  14 
ATOM   10903 H  HB3  . TYR A 1 35 ? 16.641 13.594  4.859   1.00 0.00 ? 35 TYR A HB3  14 
ATOM   10904 H  HD1  . TYR A 1 35 ? 14.851 12.045  5.851   1.00 0.00 ? 35 TYR A HD1  14 
ATOM   10905 H  HD2  . TYR A 1 35 ? 19.019 11.755  6.914   1.00 0.00 ? 35 TYR A HD2  14 
ATOM   10906 H  HE1  . TYR A 1 35 ? 14.253 10.687  7.838   1.00 0.00 ? 35 TYR A HE1  14 
ATOM   10907 H  HE2  . TYR A 1 35 ? 18.419 10.398  8.894   1.00 0.00 ? 35 TYR A HE2  14 
ATOM   10908 H  HH   . TYR A 1 35 ? 16.725 9.407   10.090  1.00 0.00 ? 35 TYR A HH   14 
ATOM   10909 N  N    . GLU A 1 36 ? 18.902 12.741  2.120   1.00 0.00 ? 36 GLU A N    14 
ATOM   10910 C  CA   . GLU A 1 36 ? 19.360 13.236  0.830   1.00 0.00 ? 36 GLU A CA   14 
ATOM   10911 C  C    . GLU A 1 36 ? 19.166 12.146  -0.229  1.00 0.00 ? 36 GLU A C    14 
ATOM   10912 O  O    . GLU A 1 36 ? 19.234 10.958  0.082   1.00 0.00 ? 36 GLU A O    14 
ATOM   10913 C  CB   . GLU A 1 36 ? 20.826 13.681  0.924   1.00 0.00 ? 36 GLU A CB   14 
ATOM   10914 C  CG   . GLU A 1 36 ? 21.794 12.542  1.277   1.00 0.00 ? 36 GLU A CG   14 
ATOM   10915 C  CD   . GLU A 1 36 ? 23.219 13.065  1.423   1.00 0.00 ? 36 GLU A CD   14 
ATOM   10916 O  OE1  . GLU A 1 36 ? 23.540 13.530  2.539   1.00 0.00 ? 36 GLU A OE1  14 
ATOM   10917 O  OE2  . GLU A 1 36 ? 23.958 12.996  0.419   1.00 0.00 ? 36 GLU A OE2  14 
ATOM   10918 H  H    . GLU A 1 36 ? 19.592 12.351  2.741   1.00 0.00 ? 36 GLU A H    14 
ATOM   10919 H  HA   . GLU A 1 36 ? 18.765 14.110  0.556   1.00 0.00 ? 36 GLU A HA   14 
ATOM   10920 H  HB2  . GLU A 1 36 ? 21.124 14.104  -0.036  1.00 0.00 ? 36 GLU A HB2  14 
ATOM   10921 H  HB3  . GLU A 1 36 ? 20.907 14.461  1.682   1.00 0.00 ? 36 GLU A HB3  14 
ATOM   10922 H  HG2  . GLU A 1 36 ? 21.507 12.072  2.217   1.00 0.00 ? 36 GLU A HG2  14 
ATOM   10923 H  HG3  . GLU A 1 36 ? 21.782 11.786  0.492   1.00 0.00 ? 36 GLU A HG3  14 
ATOM   10924 N  N    . VAL A 1 37 ? 18.912 12.554  -1.477  1.00 0.00 ? 37 VAL A N    14 
ATOM   10925 C  CA   . VAL A 1 37 ? 18.761 11.634  -2.597  1.00 0.00 ? 37 VAL A CA   14 
ATOM   10926 C  C    . VAL A 1 37 ? 20.155 11.211  -3.077  1.00 0.00 ? 37 VAL A C    14 
ATOM   10927 O  O    . VAL A 1 37 ? 21.006 12.077  -3.273  1.00 0.00 ? 37 VAL A O    14 
ATOM   10928 C  CB   . VAL A 1 37 ? 17.951 12.299  -3.724  1.00 0.00 ? 37 VAL A CB   14 
ATOM   10929 C  CG1  . VAL A 1 37 ? 17.756 11.337  -4.904  1.00 0.00 ? 37 VAL A CG1  14 
ATOM   10930 C  CG2  . VAL A 1 37 ? 16.569 12.743  -3.224  1.00 0.00 ? 37 VAL A CG2  14 
ATOM   10931 H  H    . VAL A 1 37 ? 18.910 13.543  -1.679  1.00 0.00 ? 37 VAL A H    14 
ATOM   10932 H  HA   . VAL A 1 37 ? 18.185 10.779  -2.257  1.00 0.00 ? 37 VAL A HA   14 
ATOM   10933 H  HB   . VAL A 1 37 ? 18.490 13.178  -4.077  1.00 0.00 ? 37 VAL A HB   14 
ATOM   10934 H  HG11 . VAL A 1 37 ? 17.162 11.823  -5.679  1.00 0.00 ? 37 VAL A HG11 14 
ATOM   10935 H  HG12 . VAL A 1 37 ? 18.716 11.057  -5.337  1.00 0.00 ? 37 VAL A HG12 14 
ATOM   10936 H  HG13 . VAL A 1 37 ? 17.237 10.436  -4.572  1.00 0.00 ? 37 VAL A HG13 14 
ATOM   10937 H  HG21 . VAL A 1 37 ? 16.004 13.180  -4.047  1.00 0.00 ? 37 VAL A HG21 14 
ATOM   10938 H  HG22 . VAL A 1 37 ? 16.019 11.886  -2.832  1.00 0.00 ? 37 VAL A HG22 14 
ATOM   10939 H  HG23 . VAL A 1 37 ? 16.669 13.495  -2.441  1.00 0.00 ? 37 VAL A HG23 14 
ATOM   10940 N  N    . PRO A 1 38 ? 20.416 9.905   -3.265  1.00 0.00 ? 38 PRO A N    14 
ATOM   10941 C  CA   . PRO A 1 38 ? 21.622 9.439   -3.925  1.00 0.00 ? 38 PRO A CA   14 
ATOM   10942 C  C    . PRO A 1 38 ? 21.369 9.430   -5.430  1.00 0.00 ? 38 PRO A C    14 
ATOM   10943 O  O    . PRO A 1 38 ? 20.918 8.427   -5.982  1.00 0.00 ? 38 PRO A O    14 
ATOM   10944 C  CB   . PRO A 1 38 ? 21.889 8.042   -3.360  1.00 0.00 ? 38 PRO A CB   14 
ATOM   10945 C  CG   . PRO A 1 38 ? 20.491 7.525   -3.026  1.00 0.00 ? 38 PRO A CG   14 
ATOM   10946 C  CD   . PRO A 1 38 ? 19.714 8.788   -2.647  1.00 0.00 ? 38 PRO A CD   14 
ATOM   10947 H  HA   . PRO A 1 38 ? 22.484 10.070  -3.701  1.00 0.00 ? 38 PRO A HA   14 
ATOM   10948 H  HB2  . PRO A 1 38 ? 22.418 7.391   -4.059  1.00 0.00 ? 38 PRO A HB2  14 
ATOM   10949 H  HB3  . PRO A 1 38 ? 22.463 8.141   -2.441  1.00 0.00 ? 38 PRO A HB3  14 
ATOM   10950 H  HG2  . PRO A 1 38 ? 20.059 7.079   -3.921  1.00 0.00 ? 38 PRO A HG2  14 
ATOM   10951 H  HG3  . PRO A 1 38 ? 20.505 6.793   -2.217  1.00 0.00 ? 38 PRO A HG3  14 
ATOM   10952 H  HD2  . PRO A 1 38 ? 18.695 8.706   -3.024  1.00 0.00 ? 38 PRO A HD2  14 
ATOM   10953 H  HD3  . PRO A 1 38 ? 19.709 8.904   -1.563  1.00 0.00 ? 38 PRO A HD3  14 
ATOM   10954 N  N    . ASP A 1 39 ? 21.666 10.554  -6.091  1.00 0.00 ? 39 ASP A N    14 
ATOM   10955 C  CA   . ASP A 1 39 ? 21.550 10.702  -7.535  1.00 0.00 ? 39 ASP A CA   14 
ATOM   10956 C  C    . ASP A 1 39 ? 22.732 10.017  -8.231  1.00 0.00 ? 39 ASP A C    14 
ATOM   10957 O  O    . ASP A 1 39 ? 23.549 10.668  -8.880  1.00 0.00 ? 39 ASP A O    14 
ATOM   10958 C  CB   . ASP A 1 39 ? 21.445 12.191  -7.891  1.00 0.00 ? 39 ASP A CB   14 
ATOM   10959 C  CG   . ASP A 1 39 ? 20.200 12.826  -7.275  1.00 0.00 ? 39 ASP A CG   14 
ATOM   10960 O  OD1  . ASP A 1 39 ? 19.124 12.685  -7.895  1.00 0.00 ? 39 ASP A OD1  14 
ATOM   10961 O  OD2  . ASP A 1 39 ? 20.346 13.430  -6.191  1.00 0.00 ? 39 ASP A OD2  14 
ATOM   10962 H  H    . ASP A 1 39 ? 21.962 11.364  -5.563  1.00 0.00 ? 39 ASP A H    14 
ATOM   10963 H  HA   . ASP A 1 39 ? 20.632 10.219  -7.875  1.00 0.00 ? 39 ASP A HA   14 
ATOM   10964 H  HB2  . ASP A 1 39 ? 22.332 12.719  -7.538  1.00 0.00 ? 39 ASP A HB2  14 
ATOM   10965 H  HB3  . ASP A 1 39 ? 21.386 12.299  -8.975  1.00 0.00 ? 39 ASP A HB3  14 
ATOM   10966 N  N    . GLY A 1 40 ? 22.808 8.689   -8.088  1.00 0.00 ? 40 GLY A N    14 
ATOM   10967 C  CA   . GLY A 1 40 ? 23.710 7.820   -8.823  1.00 0.00 ? 40 GLY A CA   14 
ATOM   10968 C  C    . GLY A 1 40 ? 23.022 6.489   -9.122  1.00 0.00 ? 40 GLY A C    14 
ATOM   10969 O  O    . GLY A 1 40 ? 21.802 6.376   -9.008  1.00 0.00 ? 40 GLY A O    14 
ATOM   10970 H  H    . GLY A 1 40 ? 22.137 8.239   -7.477  1.00 0.00 ? 40 GLY A H    14 
ATOM   10971 H  HA2  . GLY A 1 40 ? 24.010 8.278   -9.766  1.00 0.00 ? 40 GLY A HA2  14 
ATOM   10972 H  HA3  . GLY A 1 40 ? 24.595 7.642   -8.210  1.00 0.00 ? 40 GLY A HA3  14 
ATOM   10973 N  N    . GLU A 1 41 ? 23.813 5.479   -9.502  1.00 0.00 ? 41 GLU A N    14 
ATOM   10974 C  CA   . GLU A 1 41 ? 23.320 4.136   -9.772  1.00 0.00 ? 41 GLU A CA   14 
ATOM   10975 C  C    . GLU A 1 41 ? 22.732 3.528   -8.494  1.00 0.00 ? 41 GLU A C    14 
ATOM   10976 O  O    . GLU A 1 41 ? 23.381 3.535   -7.450  1.00 0.00 ? 41 GLU A O    14 
ATOM   10977 C  CB   . GLU A 1 41 ? 24.463 3.275   -10.325 1.00 0.00 ? 41 GLU A CB   14 
ATOM   10978 C  CG   . GLU A 1 41 ? 23.975 1.892   -10.773 1.00 0.00 ? 41 GLU A CG   14 
ATOM   10979 C  CD   . GLU A 1 41 ? 25.128 1.052   -11.310 1.00 0.00 ? 41 GLU A CD   14 
ATOM   10980 O  OE1  . GLU A 1 41 ? 25.520 1.299   -12.472 1.00 0.00 ? 41 GLU A OE1  14 
ATOM   10981 O  OE2  . GLU A 1 41 ? 25.609 0.188   -10.545 1.00 0.00 ? 41 GLU A OE2  14 
ATOM   10982 H  H    . GLU A 1 41 ? 24.807 5.636   -9.575  1.00 0.00 ? 41 GLU A H    14 
ATOM   10983 H  HA   . GLU A 1 41 ? 22.546 4.206   -10.539 1.00 0.00 ? 41 GLU A HA   14 
ATOM   10984 H  HB2  . GLU A 1 41 ? 24.904 3.780   -11.186 1.00 0.00 ? 41 GLU A HB2  14 
ATOM   10985 H  HB3  . GLU A 1 41 ? 25.233 3.153   -9.560  1.00 0.00 ? 41 GLU A HB3  14 
ATOM   10986 H  HG2  . GLU A 1 41 ? 23.521 1.364   -9.934  1.00 0.00 ? 41 GLU A HG2  14 
ATOM   10987 H  HG3  . GLU A 1 41 ? 23.226 2.008   -11.558 1.00 0.00 ? 41 GLU A HG3  14 
ATOM   10988 N  N    . TRP A 1 42 ? 21.502 3.010   -8.587  1.00 0.00 ? 42 TRP A N    14 
ATOM   10989 C  CA   . TRP A 1 42 ? 20.878 2.211   -7.546  1.00 0.00 ? 42 TRP A CA   14 
ATOM   10990 C  C    . TRP A 1 42 ? 19.883 1.243   -8.187  1.00 0.00 ? 42 TRP A C    14 
ATOM   10991 O  O    . TRP A 1 42 ? 19.291 1.553   -9.220  1.00 0.00 ? 42 TRP A O    14 
ATOM   10992 C  CB   . TRP A 1 42 ? 20.182 3.120   -6.525  1.00 0.00 ? 42 TRP A CB   14 
ATOM   10993 C  CG   . TRP A 1 42 ? 19.451 2.390   -5.439  1.00 0.00 ? 42 TRP A CG   14 
ATOM   10994 C  CD1  . TRP A 1 42 ? 20.028 1.792   -4.373  1.00 0.00 ? 42 TRP A CD1  14 
ATOM   10995 C  CD2  . TRP A 1 42 ? 18.024 2.094   -5.337  1.00 0.00 ? 42 TRP A CD2  14 
ATOM   10996 N  NE1  . TRP A 1 42 ? 19.067 1.149   -3.623  1.00 0.00 ? 42 TRP A NE1  14 
ATOM   10997 C  CE2  . TRP A 1 42 ? 17.811 1.295   -4.176  1.00 0.00 ? 42 TRP A CE2  14 
ATOM   10998 C  CE3  . TRP A 1 42 ? 16.888 2.403   -6.116  1.00 0.00 ? 42 TRP A CE3  14 
ATOM   10999 C  CZ2  . TRP A 1 42 ? 16.543 0.823   -3.811  1.00 0.00 ? 42 TRP A CZ2  14 
ATOM   11000 C  CZ3  . TRP A 1 42 ? 15.606 1.951   -5.749  1.00 0.00 ? 42 TRP A CZ3  14 
ATOM   11001 C  CH2  . TRP A 1 42 ? 15.434 1.161   -4.600  1.00 0.00 ? 42 TRP A CH2  14 
ATOM   11002 H  H    . TRP A 1 42 ? 21.009 3.075   -9.467  1.00 0.00 ? 42 TRP A H    14 
ATOM   11003 H  HA   . TRP A 1 42 ? 21.645 1.627   -7.035  1.00 0.00 ? 42 TRP A HA   14 
ATOM   11004 H  HB2  . TRP A 1 42 ? 20.930 3.764   -6.058  1.00 0.00 ? 42 TRP A HB2  14 
ATOM   11005 H  HB3  . TRP A 1 42 ? 19.464 3.752   -7.053  1.00 0.00 ? 42 TRP A HB3  14 
ATOM   11006 H  HD1  . TRP A 1 42 ? 21.087 1.792   -4.157  1.00 0.00 ? 42 TRP A HD1  14 
ATOM   11007 H  HE1  . TRP A 1 42 ? 19.284 0.627   -2.788  1.00 0.00 ? 42 TRP A HE1  14 
ATOM   11008 H  HE3  . TRP A 1 42 ? 17.008 3.009   -7.001  1.00 0.00 ? 42 TRP A HE3  14 
ATOM   11009 H  HZ2  . TRP A 1 42 ? 16.419 0.196   -2.941  1.00 0.00 ? 42 TRP A HZ2  14 
ATOM   11010 H  HZ3  . TRP A 1 42 ? 14.748 2.214   -6.350  1.00 0.00 ? 42 TRP A HZ3  14 
ATOM   11011 H  HH2  . TRP A 1 42 ? 14.456 0.802   -4.325  1.00 0.00 ? 42 TRP A HH2  14 
ATOM   11012 N  N    . GLN A 1 43 ? 19.701 0.072   -7.564  1.00 0.00 ? 43 GLN A N    14 
ATOM   11013 C  CA   . GLN A 1 43 ? 18.652 -0.874  -7.904  1.00 0.00 ? 43 GLN A CA   14 
ATOM   11014 C  C    . GLN A 1 43 ? 17.988 -1.411  -6.637  1.00 0.00 ? 43 GLN A C    14 
ATOM   11015 O  O    . GLN A 1 43 ? 18.549 -1.322  -5.546  1.00 0.00 ? 43 GLN A O    14 
ATOM   11016 C  CB   . GLN A 1 43 ? 19.192 -1.978  -8.831  1.00 0.00 ? 43 GLN A CB   14 
ATOM   11017 C  CG   . GLN A 1 43 ? 20.471 -2.675  -8.341  1.00 0.00 ? 43 GLN A CG   14 
ATOM   11018 C  CD   . GLN A 1 43 ? 20.270 -3.457  -7.045  1.00 0.00 ? 43 GLN A CD   14 
ATOM   11019 O  OE1  . GLN A 1 43 ? 19.433 -4.353  -6.981  1.00 0.00 ? 43 GLN A OE1  14 
ATOM   11020 N  NE2  . GLN A 1 43 ? 21.042 -3.133  -6.007  1.00 0.00 ? 43 GLN A NE2  14 
ATOM   11021 H  H    . GLN A 1 43 ? 20.215 -0.110  -6.712  1.00 0.00 ? 43 GLN A H    14 
ATOM   11022 H  HA   . GLN A 1 43 ? 17.874 -0.338  -8.447  1.00 0.00 ? 43 GLN A HA   14 
ATOM   11023 H  HB2  . GLN A 1 43 ? 18.415 -2.726  -8.995  1.00 0.00 ? 43 GLN A HB2  14 
ATOM   11024 H  HB3  . GLN A 1 43 ? 19.420 -1.521  -9.795  1.00 0.00 ? 43 GLN A HB3  14 
ATOM   11025 H  HG2  . GLN A 1 43 ? 20.783 -3.384  -9.108  1.00 0.00 ? 43 GLN A HG2  14 
ATOM   11026 H  HG3  . GLN A 1 43 ? 21.269 -1.942  -8.221  1.00 0.00 ? 43 GLN A HG3  14 
ATOM   11027 H  HE21 . GLN A 1 43 ? 21.723 -2.390  -6.091  1.00 0.00 ? 43 GLN A HE21 14 
ATOM   11028 H  HE22 . GLN A 1 43 ? 20.951 -3.657  -5.147  1.00 0.00 ? 43 GLN A HE22 14 
ATOM   11029 N  N    . CYS A 1 44 ? 16.775 -1.948  -6.793  1.00 0.00 ? 44 CYS A N    14 
ATOM   11030 C  CA   . CYS A 1 44 ? 15.895 -2.312  -5.693  1.00 0.00 ? 44 CYS A CA   14 
ATOM   11031 C  C    . CYS A 1 44 ? 16.147 -3.755  -5.240  1.00 0.00 ? 44 CYS A C    14 
ATOM   11032 O  O    . CYS A 1 44 ? 16.650 -4.563  -6.020  1.00 0.00 ? 44 CYS A O    14 
ATOM   11033 C  CB   . CYS A 1 44 ? 14.436 -2.079  -6.104  1.00 0.00 ? 44 CYS A CB   14 
ATOM   11034 S  SG   . CYS A 1 44 ? 13.861 -2.981  -7.566  1.00 0.00 ? 44 CYS A SG   14 
ATOM   11035 H  H    . CYS A 1 44 ? 16.440 -2.110  -7.729  1.00 0.00 ? 44 CYS A H    14 
ATOM   11036 H  HA   . CYS A 1 44 ? 16.097 -1.629  -4.873  1.00 0.00 ? 44 CYS A HA   14 
ATOM   11037 H  HB2  . CYS A 1 44 ? 13.786 -2.353  -5.277  1.00 0.00 ? 44 CYS A HB2  14 
ATOM   11038 H  HB3  . CYS A 1 44 ? 14.304 -1.014  -6.295  1.00 0.00 ? 44 CYS A HB3  14 
ATOM   11039 N  N    . PRO A 1 45 ? 15.759 -4.098  -3.997  1.00 0.00 ? 45 PRO A N    14 
ATOM   11040 C  CA   . PRO A 1 45 ? 15.732 -5.469  -3.496  1.00 0.00 ? 45 PRO A CA   14 
ATOM   11041 C  C    . PRO A 1 45 ? 14.841 -6.463  -4.256  1.00 0.00 ? 45 PRO A C    14 
ATOM   11042 O  O    . PRO A 1 45 ? 14.707 -7.601  -3.808  1.00 0.00 ? 45 PRO A O    14 
ATOM   11043 C  CB   . PRO A 1 45 ? 15.309 -5.360  -2.031  1.00 0.00 ? 45 PRO A CB   14 
ATOM   11044 C  CG   . PRO A 1 45 ? 15.925 -4.030  -1.612  1.00 0.00 ? 45 PRO A CG   14 
ATOM   11045 C  CD   . PRO A 1 45 ? 15.769 -3.174  -2.870  1.00 0.00 ? 45 PRO A CD   14 
ATOM   11046 H  HA   . PRO A 1 45 ? 16.756 -5.842  -3.515  1.00 0.00 ? 45 PRO A HA   14 
ATOM   11047 H  HB2  . PRO A 1 45 ? 14.222 -5.292  -1.967  1.00 0.00 ? 45 PRO A HB2  14 
ATOM   11048 H  HB3  . PRO A 1 45 ? 15.676 -6.193  -1.432  1.00 0.00 ? 45 PRO A HB3  14 
ATOM   11049 H  HG2  . PRO A 1 45 ? 15.424 -3.593  -0.747  1.00 0.00 ? 45 PRO A HG2  14 
ATOM   11050 H  HG3  . PRO A 1 45 ? 16.986 -4.179  -1.403  1.00 0.00 ? 45 PRO A HG3  14 
ATOM   11051 H  HD2  . PRO A 1 45 ? 14.819 -2.638  -2.836  1.00 0.00 ? 45 PRO A HD2  14 
ATOM   11052 H  HD3  . PRO A 1 45 ? 16.602 -2.470  -2.915  1.00 0.00 ? 45 PRO A HD3  14 
ATOM   11053 N  N    . ALA A 1 46 ? 14.213 -6.060  -5.369  1.00 0.00 ? 46 ALA A N    14 
ATOM   11054 C  CA   . ALA A 1 46 ? 13.540 -6.979  -6.277  1.00 0.00 ? 46 ALA A CA   14 
ATOM   11055 C  C    . ALA A 1 46 ? 14.540 -7.559  -7.281  1.00 0.00 ? 46 ALA A C    14 
ATOM   11056 O  O    . ALA A 1 46 ? 14.403 -8.718  -7.667  1.00 0.00 ? 46 ALA A O    14 
ATOM   11057 C  CB   . ALA A 1 46 ? 12.388 -6.273  -6.997  1.00 0.00 ? 46 ALA A CB   14 
ATOM   11058 H  H    . ALA A 1 46 ? 14.297 -5.100  -5.666  1.00 0.00 ? 46 ALA A H    14 
ATOM   11059 H  HA   . ALA A 1 46 ? 13.101 -7.800  -5.708  1.00 0.00 ? 46 ALA A HA   14 
ATOM   11060 H  HB1  . ALA A 1 46 ? 11.806 -7.012  -7.551  1.00 0.00 ? 46 ALA A HB1  14 
ATOM   11061 H  HB2  . ALA A 1 46 ? 11.739 -5.784  -6.270  1.00 0.00 ? 46 ALA A HB2  14 
ATOM   11062 H  HB3  . ALA A 1 46 ? 12.774 -5.537  -7.699  1.00 0.00 ? 46 ALA A HB3  14 
ATOM   11063 N  N    . CYS A 1 47 ? 15.528 -6.763  -7.722  1.00 0.00 ? 47 CYS A N    14 
ATOM   11064 C  CA   . CYS A 1 47 ? 16.525 -7.195  -8.687  1.00 0.00 ? 47 CYS A CA   14 
ATOM   11065 C  C    . CYS A 1 47 ? 17.539 -8.106  -7.996  1.00 0.00 ? 47 CYS A C    14 
ATOM   11066 O  O    . CYS A 1 47 ? 17.567 -9.309  -8.250  1.00 0.00 ? 47 CYS A O    14 
ATOM   11067 C  CB   . CYS A 1 47 ? 17.199 -5.982  -9.333  1.00 0.00 ? 47 CYS A CB   14 
ATOM   11068 S  SG   . CYS A 1 47 ? 16.094 -4.787  -10.115 1.00 0.00 ? 47 CYS A SG   14 
ATOM   11069 H  H    . CYS A 1 47 ? 15.660 -5.842  -7.329  1.00 0.00 ? 47 CYS A H    14 
ATOM   11070 H  HA   . CYS A 1 47 ? 16.034 -7.751  -9.485  1.00 0.00 ? 47 CYS A HA   14 
ATOM   11071 H  HB2  . CYS A 1 47 ? 17.776 -5.428  -8.596  1.00 0.00 ? 47 CYS A HB2  14 
ATOM   11072 H  HB3  . CYS A 1 47 ? 17.877 -6.356  -10.096 1.00 0.00 ? 47 CYS A HB3  14 
ATOM   11073 N  N    . GLN A 1 48 ? 18.370 -7.528  -7.120  1.00 0.00 ? 48 GLN A N    14 
ATOM   11074 C  CA   . GLN A 1 48 ? 19.237 -8.273  -6.225  1.00 0.00 ? 48 GLN A CA   14 
ATOM   11075 C  C    . GLN A 1 48 ? 18.414 -8.728  -5.015  1.00 0.00 ? 48 GLN A C    14 
ATOM   11076 O  O    . GLN A 1 48 ? 17.414 -8.092  -4.692  1.00 0.00 ? 48 GLN A O    14 
ATOM   11077 C  CB   . GLN A 1 48 ? 20.392 -7.371  -5.784  1.00 0.00 ? 48 GLN A CB   14 
ATOM   11078 C  CG   . GLN A 1 48 ? 21.317 -7.032  -6.963  1.00 0.00 ? 48 GLN A CG   14 
ATOM   11079 C  CD   . GLN A 1 48 ? 22.429 -6.061  -6.571  1.00 0.00 ? 48 GLN A CD   14 
ATOM   11080 O  OE1  . GLN A 1 48 ? 22.674 -5.818  -5.392  1.00 0.00 ? 48 GLN A OE1  14 
ATOM   11081 N  NE2  . GLN A 1 48 ? 23.104 -5.488  -7.570  1.00 0.00 ? 48 GLN A NE2  14 
ATOM   11082 H  H    . GLN A 1 48 ? 18.305 -6.533  -6.954  1.00 0.00 ? 48 GLN A H    14 
ATOM   11083 H  HA   . GLN A 1 48 ? 19.660 -9.123  -6.757  1.00 0.00 ? 48 GLN A HA   14 
ATOM   11084 H  HB2  . GLN A 1 48 ? 19.983 -6.456  -5.356  1.00 0.00 ? 48 GLN A HB2  14 
ATOM   11085 H  HB3  . GLN A 1 48 ? 20.969 -7.893  -5.022  1.00 0.00 ? 48 GLN A HB3  14 
ATOM   11086 H  HG2  . GLN A 1 48 ? 21.771 -7.951  -7.336  1.00 0.00 ? 48 GLN A HG2  14 
ATOM   11087 H  HG3  . GLN A 1 48 ? 20.736 -6.582  -7.768  1.00 0.00 ? 48 GLN A HG3  14 
ATOM   11088 H  HE21 . GLN A 1 48 ? 22.869 -5.710  -8.529  1.00 0.00 ? 48 GLN A HE21 14 
ATOM   11089 H  HE22 . GLN A 1 48 ? 23.839 -4.828  -7.357  1.00 0.00 ? 48 GLN A HE22 14 
ATOM   11090 N  N    . PRO A 1 49 ? 18.806 -9.821  -4.341  1.00 0.00 ? 49 PRO A N    14 
ATOM   11091 C  CA   . PRO A 1 49 ? 18.223 -10.188 -3.059  1.00 0.00 ? 49 PRO A CA   14 
ATOM   11092 C  C    . PRO A 1 49 ? 18.480 -9.140  -1.974  1.00 0.00 ? 49 PRO A C    14 
ATOM   11093 O  O    . PRO A 1 49 ? 19.398 -8.327  -2.087  1.00 0.00 ? 49 PRO A O    14 
ATOM   11094 C  CB   . PRO A 1 49 ? 18.845 -11.536 -2.699  1.00 0.00 ? 49 PRO A CB   14 
ATOM   11095 C  CG   . PRO A 1 49 ? 19.051 -12.174 -4.072  1.00 0.00 ? 49 PRO A CG   14 
ATOM   11096 C  CD   . PRO A 1 49 ? 19.437 -10.981 -4.949  1.00 0.00 ? 49 PRO A CD   14 
ATOM   11097 H  HA   . PRO A 1 49 ? 17.150 -10.325 -3.194  1.00 0.00 ? 49 PRO A HA   14 
ATOM   11098 H  HB2  . PRO A 1 49 ? 19.815 -11.381 -2.227  1.00 0.00 ? 49 PRO A HB2  14 
ATOM   11099 H  HB3  . PRO A 1 49 ? 18.199 -12.134 -2.056  1.00 0.00 ? 49 PRO A HB3  14 
ATOM   11100 H  HG2  . PRO A 1 49 ? 19.820 -12.947 -4.060  1.00 0.00 ? 49 PRO A HG2  14 
ATOM   11101 H  HG3  . PRO A 1 49 ? 18.104 -12.589 -4.420  1.00 0.00 ? 49 PRO A HG3  14 
ATOM   11102 H  HD2  . PRO A 1 49 ? 20.519 -10.846 -4.935  1.00 0.00 ? 49 PRO A HD2  14 
ATOM   11103 H  HD3  . PRO A 1 49 ? 19.092 -11.156 -5.968  1.00 0.00 ? 49 PRO A HD3  14 
ATOM   11104 N  N    . ALA A 1 50 ? 17.666 -9.176  -0.913  1.00 0.00 ? 50 ALA A N    14 
ATOM   11105 C  CA   . ALA A 1 50 ? 17.887 -8.406  0.303   1.00 0.00 ? 50 ALA A CA   14 
ATOM   11106 C  C    . ALA A 1 50 ? 19.027 -9.037  1.110   1.00 0.00 ? 50 ALA A C    14 
ATOM   11107 O  O    . ALA A 1 50 ? 18.789 -9.726  2.099   1.00 0.00 ? 50 ALA A O    14 
ATOM   11108 C  CB   . ALA A 1 50 ? 16.585 -8.341  1.108   1.00 0.00 ? 50 ALA A CB   14 
ATOM   11109 H  H    . ALA A 1 50 ? 16.907 -9.842  -0.908  1.00 0.00 ? 50 ALA A H    14 
ATOM   11110 H  HA   . ALA A 1 50 ? 18.163 -7.383  0.043   1.00 0.00 ? 50 ALA A HA   14 
ATOM   11111 H  HB1  . ALA A 1 50 ? 16.744 -7.765  2.020   1.00 0.00 ? 50 ALA A HB1  14 
ATOM   11112 H  HB2  . ALA A 1 50 ? 15.811 -7.853  0.513   1.00 0.00 ? 50 ALA A HB2  14 
ATOM   11113 H  HB3  . ALA A 1 50 ? 16.249 -9.345  1.371   1.00 0.00 ? 50 ALA A HB3  14 
ATOM   11114 N  N    . THR A 1 51 ? 20.266 -8.799  0.666   1.00 0.00 ? 51 THR A N    14 
ATOM   11115 C  CA   . THR A 1 51 ? 21.478 -9.189  1.368   1.00 0.00 ? 51 THR A CA   14 
ATOM   11116 C  C    . THR A 1 51 ? 21.632 -8.360  2.646   1.00 0.00 ? 51 THR A C    14 
ATOM   11117 O  O    . THR A 1 51 ? 21.720 -7.119  2.510   1.00 0.00 ? 51 THR A O    14 
ATOM   11118 C  CB   . THR A 1 51 ? 22.689 -9.000  0.443   1.00 0.00 ? 51 THR A CB   14 
ATOM   11119 O  OG1  . THR A 1 51 ? 22.718 -7.672  -0.042  1.00 0.00 ? 51 THR A OG1  14 
ATOM   11120 C  CG2  . THR A 1 51 ? 22.650 -9.965  -0.746  1.00 0.00 ? 51 THR A CG2  14 
ATOM   11121 O  OXT  . THR A 1 51 ? 21.667 -8.980  3.731   1.00 0.00 ? 51 THR A OXT  14 
ATOM   11122 H  H    . THR A 1 51 ? 20.380 -8.263  -0.185  1.00 0.00 ? 51 THR A H    14 
ATOM   11123 H  HA   . THR A 1 51 ? 21.411 -10.245 1.639   1.00 0.00 ? 51 THR A HA   14 
ATOM   11124 H  HB   . THR A 1 51 ? 23.599 -9.187  1.014   1.00 0.00 ? 51 THR A HB   14 
ATOM   11125 H  HG1  . THR A 1 51 ? 22.559 -7.086  0.705   1.00 0.00 ? 51 THR A HG1  14 
ATOM   11126 H  HG21 . THR A 1 51 ? 21.775 -9.774  -1.366  1.00 0.00 ? 51 THR A HG21 14 
ATOM   11127 H  HG22 . THR A 1 51 ? 23.547 -9.829  -1.351  1.00 0.00 ? 51 THR A HG22 14 
ATOM   11128 H  HG23 . THR A 1 51 ? 22.618 -10.994 -0.386  1.00 0.00 ? 51 THR A HG23 14 
HETATM 11129 ZN ZN   . ZN  B 2 .  ? 7.451  4.518   -0.300  1.00 0.00 ? 52 ZN  A ZN   14 
HETATM 11130 ZN ZN   . ZN  C 2 .  ? 14.611 -3.080  -9.735  1.00 0.00 ? 53 ZN  A ZN   14 
ATOM   11131 N  N    . ALA A 1 1  ? 4.284  9.666   -10.567 1.00 0.00 ? 1  ALA A N    15 
ATOM   11132 C  CA   . ALA A 1 1  ? 4.843  8.518   -9.830  1.00 0.00 ? 1  ALA A CA   15 
ATOM   11133 C  C    . ALA A 1 1  ? 4.029  8.237   -8.568  1.00 0.00 ? 1  ALA A C    15 
ATOM   11134 O  O    . ALA A 1 1  ? 3.393  9.141   -8.030  1.00 0.00 ? 1  ALA A O    15 
ATOM   11135 C  CB   . ALA A 1 1  ? 6.314  8.758   -9.482  1.00 0.00 ? 1  ALA A CB   15 
ATOM   11136 H  H1   . ALA A 1 1  ? 4.303  10.481  -9.969  1.00 0.00 ? 1  ALA A H1   15 
ATOM   11137 H  H2   . ALA A 1 1  ? 4.829  9.841   -11.399 1.00 0.00 ? 1  ALA A H2   15 
ATOM   11138 H  H3   . ALA A 1 1  ? 3.328  9.466   -10.823 1.00 0.00 ? 1  ALA A H3   15 
ATOM   11139 H  HA   . ALA A 1 1  ? 4.784  7.648   -10.487 1.00 0.00 ? 1  ALA A HA   15 
ATOM   11140 H  HB1  . ALA A 1 1  ? 6.406  9.630   -8.833  1.00 0.00 ? 1  ALA A HB1  15 
ATOM   11141 H  HB2  . ALA A 1 1  ? 6.719  7.885   -8.968  1.00 0.00 ? 1  ALA A HB2  15 
ATOM   11142 H  HB3  . ALA A 1 1  ? 6.888  8.929   -10.393 1.00 0.00 ? 1  ALA A HB3  15 
ATOM   11143 N  N    . ARG A 1 2  ? 4.054  6.983   -8.103  1.00 0.00 ? 2  ARG A N    15 
ATOM   11144 C  CA   . ARG A 1 2  ? 3.523  6.570   -6.813  1.00 0.00 ? 2  ARG A CA   15 
ATOM   11145 C  C    . ARG A 1 2  ? 4.253  5.295   -6.394  1.00 0.00 ? 2  ARG A C    15 
ATOM   11146 O  O    . ARG A 1 2  ? 4.568  4.461   -7.241  1.00 0.00 ? 2  ARG A O    15 
ATOM   11147 C  CB   . ARG A 1 2  ? 2.007  6.341   -6.926  1.00 0.00 ? 2  ARG A CB   15 
ATOM   11148 C  CG   . ARG A 1 2  ? 1.305  5.983   -5.606  1.00 0.00 ? 2  ARG A CG   15 
ATOM   11149 C  CD   . ARG A 1 2  ? 0.950  7.192   -4.730  1.00 0.00 ? 2  ARG A CD   15 
ATOM   11150 N  NE   . ARG A 1 2  ? 2.109  7.796   -4.053  1.00 0.00 ? 2  ARG A NE   15 
ATOM   11151 C  CZ   . ARG A 1 2  ? 2.586  9.036   -4.265  1.00 0.00 ? 2  ARG A CZ   15 
ATOM   11152 N  NH1  . ARG A 1 2  ? 2.242  9.735   -5.354  1.00 0.00 ? 2  ARG A NH1  15 
ATOM   11153 N  NH2  . ARG A 1 2  ? 3.402  9.605   -3.369  1.00 0.00 ? 2  ARG A NH2  15 
ATOM   11154 H  H    . ARG A 1 2  ? 4.562  6.279   -8.621  1.00 0.00 ? 2  ARG A H    15 
ATOM   11155 H  HA   . ARG A 1 2  ? 3.738  7.353   -6.090  1.00 0.00 ? 2  ARG A HA   15 
ATOM   11156 H  HB2  . ARG A 1 2  ? 1.529  7.227   -7.346  1.00 0.00 ? 2  ARG A HB2  15 
ATOM   11157 H  HB3  . ARG A 1 2  ? 1.851  5.516   -7.622  1.00 0.00 ? 2  ARG A HB3  15 
ATOM   11158 H  HG2  . ARG A 1 2  ? 0.359  5.509   -5.874  1.00 0.00 ? 2  ARG A HG2  15 
ATOM   11159 H  HG3  . ARG A 1 2  ? 1.879  5.257   -5.033  1.00 0.00 ? 2  ARG A HG3  15 
ATOM   11160 H  HD2  . ARG A 1 2  ? 0.391  7.921   -5.317  1.00 0.00 ? 2  ARG A HD2  15 
ATOM   11161 H  HD3  . ARG A 1 2  ? 0.284  6.837   -3.942  1.00 0.00 ? 2  ARG A HD3  15 
ATOM   11162 H  HE   . ARG A 1 2  ? 2.409  7.336   -3.203  1.00 0.00 ? 2  ARG A HE   15 
ATOM   11163 H  HH11 . ARG A 1 2  ? 1.700  9.316   -6.095  1.00 0.00 ? 2  ARG A HH11 15 
ATOM   11164 H  HH12 . ARG A 1 2  ? 2.534  10.705  -5.421  1.00 0.00 ? 2  ARG A HH12 15 
ATOM   11165 H  HH21 . ARG A 1 2  ? 3.606  9.160   -2.479  1.00 0.00 ? 2  ARG A HH21 15 
ATOM   11166 H  HH22 . ARG A 1 2  ? 3.685  10.568  -3.513  1.00 0.00 ? 2  ARG A HH22 15 
ATOM   11167 N  N    . CYS A 1 3  ? 4.523  5.149   -5.094  1.00 0.00 ? 3  CYS A N    15 
ATOM   11168 C  CA   . CYS A 1 3  ? 5.396  4.112   -4.569  1.00 0.00 ? 3  CYS A CA   15 
ATOM   11169 C  C    . CYS A 1 3  ? 4.767  2.721   -4.694  1.00 0.00 ? 3  CYS A C    15 
ATOM   11170 O  O    . CYS A 1 3  ? 3.557  2.561   -4.548  1.00 0.00 ? 3  CYS A O    15 
ATOM   11171 C  CB   . CYS A 1 3  ? 5.718  4.447   -3.113  1.00 0.00 ? 3  CYS A CB   15 
ATOM   11172 S  SG   . CYS A 1 3  ? 6.772  3.263   -2.244  1.00 0.00 ? 3  CYS A SG   15 
ATOM   11173 H  H    . CYS A 1 3  ? 4.182  5.844   -4.447  1.00 0.00 ? 3  CYS A H    15 
ATOM   11174 H  HA   . CYS A 1 3  ? 6.329  4.137   -5.133  1.00 0.00 ? 3  CYS A HA   15 
ATOM   11175 H  HB2  . CYS A 1 3  ? 6.234  5.406   -3.118  1.00 0.00 ? 3  CYS A HB2  15 
ATOM   11176 H  HB3  . CYS A 1 3  ? 4.785  4.543   -2.554  1.00 0.00 ? 3  CYS A HB3  15 
ATOM   11177 N  N    . LYS A 1 4  ? 5.611  1.718   -4.956  1.00 0.00 ? 4  LYS A N    15 
ATOM   11178 C  CA   . LYS A 1 4  ? 5.259  0.307   -4.935  1.00 0.00 ? 4  LYS A CA   15 
ATOM   11179 C  C    . LYS A 1 4  ? 4.893  -0.134  -3.518  1.00 0.00 ? 4  LYS A C    15 
ATOM   11180 O  O    . LYS A 1 4  ? 3.800  -0.647  -3.293  1.00 0.00 ? 4  LYS A O    15 
ATOM   11181 C  CB   . LYS A 1 4  ? 6.435  -0.490  -5.523  1.00 0.00 ? 4  LYS A CB   15 
ATOM   11182 C  CG   . LYS A 1 4  ? 6.184  -1.996  -5.702  1.00 0.00 ? 4  LYS A CG   15 
ATOM   11183 C  CD   . LYS A 1 4  ? 6.372  -2.813  -4.415  1.00 0.00 ? 4  LYS A CD   15 
ATOM   11184 C  CE   . LYS A 1 4  ? 6.386  -4.313  -4.727  1.00 0.00 ? 4  LYS A CE   15 
ATOM   11185 N  NZ   . LYS A 1 4  ? 6.515  -5.116  -3.497  1.00 0.00 ? 4  LYS A NZ   15 
ATOM   11186 H  H    . LYS A 1 4  ? 6.580  1.946   -5.135  1.00 0.00 ? 4  LYS A H    15 
ATOM   11187 H  HA   . LYS A 1 4  ? 4.399  0.157   -5.581  1.00 0.00 ? 4  LYS A HA   15 
ATOM   11188 H  HB2  . LYS A 1 4  ? 6.630  -0.082  -6.518  1.00 0.00 ? 4  LYS A HB2  15 
ATOM   11189 H  HB3  . LYS A 1 4  ? 7.325  -0.338  -4.912  1.00 0.00 ? 4  LYS A HB3  15 
ATOM   11190 H  HG2  . LYS A 1 4  ? 5.184  -2.160  -6.109  1.00 0.00 ? 4  LYS A HG2  15 
ATOM   11191 H  HG3  . LYS A 1 4  ? 6.911  -2.355  -6.432  1.00 0.00 ? 4  LYS A HG3  15 
ATOM   11192 H  HD2  . LYS A 1 4  ? 7.316  -2.535  -3.944  1.00 0.00 ? 4  LYS A HD2  15 
ATOM   11193 H  HD3  . LYS A 1 4  ? 5.553  -2.622  -3.723  1.00 0.00 ? 4  LYS A HD3  15 
ATOM   11194 H  HE2  . LYS A 1 4  ? 5.458  -4.587  -5.229  1.00 0.00 ? 4  LYS A HE2  15 
ATOM   11195 H  HE3  . LYS A 1 4  ? 7.225  -4.542  -5.386  1.00 0.00 ? 4  LYS A HE3  15 
ATOM   11196 H  HZ1  . LYS A 1 4  ? 7.376  -4.880  -3.024  1.00 0.00 ? 4  LYS A HZ1  15 
ATOM   11197 H  HZ2  . LYS A 1 4  ? 5.734  -4.929  -2.885  1.00 0.00 ? 4  LYS A HZ2  15 
ATOM   11198 H  HZ3  . LYS A 1 4  ? 6.525  -6.098  -3.734  1.00 0.00 ? 4  LYS A HZ3  15 
ATOM   11199 N  N    . VAL A 1 5  ? 5.826  0.062   -2.580  1.00 0.00 ? 5  VAL A N    15 
ATOM   11200 C  CA   . VAL A 1 5  ? 5.784  -0.474  -1.225  1.00 0.00 ? 5  VAL A CA   15 
ATOM   11201 C  C    . VAL A 1 5  ? 4.547  0.019   -0.471  1.00 0.00 ? 5  VAL A C    15 
ATOM   11202 O  O    . VAL A 1 5  ? 3.596  -0.741  -0.299  1.00 0.00 ? 5  VAL A O    15 
ATOM   11203 C  CB   . VAL A 1 5  ? 7.102  -0.149  -0.497  1.00 0.00 ? 5  VAL A CB   15 
ATOM   11204 C  CG1  . VAL A 1 5  ? 7.109  -0.639  0.957   1.00 0.00 ? 5  VAL A CG1  15 
ATOM   11205 C  CG2  . VAL A 1 5  ? 8.288  -0.793  -1.225  1.00 0.00 ? 5  VAL A CG2  15 
ATOM   11206 H  H    . VAL A 1 5  ? 6.665  0.539   -2.871  1.00 0.00 ? 5  VAL A H    15 
ATOM   11207 H  HA   . VAL A 1 5  ? 5.715  -1.559  -1.298  1.00 0.00 ? 5  VAL A HA   15 
ATOM   11208 H  HB   . VAL A 1 5  ? 7.250  0.929   -0.492  1.00 0.00 ? 5  VAL A HB   15 
ATOM   11209 H  HG11 . VAL A 1 5  ? 8.073  -0.405  1.410   1.00 0.00 ? 5  VAL A HG11 15 
ATOM   11210 H  HG12 . VAL A 1 5  ? 6.334  -0.142  1.539   1.00 0.00 ? 5  VAL A HG12 15 
ATOM   11211 H  HG13 . VAL A 1 5  ? 6.949  -1.717  0.988   1.00 0.00 ? 5  VAL A HG13 15 
ATOM   11212 H  HG21 . VAL A 1 5  ? 9.205  -0.595  -0.671  1.00 0.00 ? 5  VAL A HG21 15 
ATOM   11213 H  HG22 . VAL A 1 5  ? 8.145  -1.872  -1.297  1.00 0.00 ? 5  VAL A HG22 15 
ATOM   11214 H  HG23 . VAL A 1 5  ? 8.391  -0.378  -2.227  1.00 0.00 ? 5  VAL A HG23 15 
ATOM   11215 N  N    . CYS A 1 6  ? 4.559  1.274   -0.004  1.00 0.00 ? 6  CYS A N    15 
ATOM   11216 C  CA   . CYS A 1 6  ? 3.468  1.816   0.796   1.00 0.00 ? 6  CYS A CA   15 
ATOM   11217 C  C    . CYS A 1 6  ? 2.266  2.159   -0.084  1.00 0.00 ? 6  CYS A C    15 
ATOM   11218 O  O    . CYS A 1 6  ? 1.130  1.901   0.310   1.00 0.00 ? 6  CYS A O    15 
ATOM   11219 C  CB   . CYS A 1 6  ? 3.934  3.020   1.622   1.00 0.00 ? 6  CYS A CB   15 
ATOM   11220 S  SG   . CYS A 1 6  ? 4.608  4.433   0.710   1.00 0.00 ? 6  CYS A SG   15 
ATOM   11221 H  H    . CYS A 1 6  ? 5.362  1.860   -0.179  1.00 0.00 ? 6  CYS A H    15 
ATOM   11222 H  HA   . CYS A 1 6  ? 3.151  1.054   1.511   1.00 0.00 ? 6  CYS A HA   15 
ATOM   11223 H  HB2  . CYS A 1 6  ? 3.082  3.378   2.200   1.00 0.00 ? 6  CYS A HB2  15 
ATOM   11224 H  HB3  . CYS A 1 6  ? 4.698  2.686   2.326   1.00 0.00 ? 6  CYS A HB3  15 
ATOM   11225 N  N    . ARG A 1 7  ? 2.518  2.743   -1.264  1.00 0.00 ? 7  ARG A N    15 
ATOM   11226 C  CA   . ARG A 1 7  ? 1.492  3.237   -2.174  1.00 0.00 ? 7  ARG A CA   15 
ATOM   11227 C  C    . ARG A 1 7  ? 0.560  4.219   -1.455  1.00 0.00 ? 7  ARG A C    15 
ATOM   11228 O  O    . ARG A 1 7  ? -0.662 4.091   -1.505  1.00 0.00 ? 7  ARG A O    15 
ATOM   11229 C  CB   . ARG A 1 7  ? 0.771  2.046   -2.825  1.00 0.00 ? 7  ARG A CB   15 
ATOM   11230 C  CG   . ARG A 1 7  ? 0.043  2.434   -4.119  1.00 0.00 ? 7  ARG A CG   15 
ATOM   11231 C  CD   . ARG A 1 7  ? -0.612 1.191   -4.730  1.00 0.00 ? 7  ARG A CD   15 
ATOM   11232 N  NE   . ARG A 1 7  ? -1.284 1.509   -5.996  1.00 0.00 ? 7  ARG A NE   15 
ATOM   11233 C  CZ   . ARG A 1 7  ? -1.922 0.612   -6.766  1.00 0.00 ? 7  ARG A CZ   15 
ATOM   11234 N  NH1  . ARG A 1 7  ? -1.997 -0.676  -6.397  1.00 0.00 ? 7  ARG A NH1  15 
ATOM   11235 N  NH2  . ARG A 1 7  ? -2.489 1.007   -7.915  1.00 0.00 ? 7  ARG A NH2  15 
ATOM   11236 H  H    . ARG A 1 7  ? 3.480  2.876   -1.539  1.00 0.00 ? 7  ARG A H    15 
ATOM   11237 H  HA   . ARG A 1 7  ? 2.006  3.799   -2.953  1.00 0.00 ? 7  ARG A HA   15 
ATOM   11238 H  HB2  . ARG A 1 7  ? 1.515  1.290   -3.080  1.00 0.00 ? 7  ARG A HB2  15 
ATOM   11239 H  HB3  . ARG A 1 7  ? 0.063  1.605   -2.122  1.00 0.00 ? 7  ARG A HB3  15 
ATOM   11240 H  HG2  . ARG A 1 7  ? -0.723 3.181   -3.914  1.00 0.00 ? 7  ARG A HG2  15 
ATOM   11241 H  HG3  . ARG A 1 7  ? 0.762  2.845   -4.828  1.00 0.00 ? 7  ARG A HG3  15 
ATOM   11242 H  HD2  . ARG A 1 7  ? 0.160  0.441   -4.913  1.00 0.00 ? 7  ARG A HD2  15 
ATOM   11243 H  HD3  . ARG A 1 7  ? -1.341 0.793   -4.024  1.00 0.00 ? 7  ARG A HD3  15 
ATOM   11244 H  HE   . ARG A 1 7  ? -1.248 2.472   -6.300  1.00 0.00 ? 7  ARG A HE   15 
ATOM   11245 H  HH11 . ARG A 1 7  ? -1.573 -0.977  -5.532  1.00 0.00 ? 7  ARG A HH11 15 
ATOM   11246 H  HH12 . ARG A 1 7  ? -2.476 -1.349  -6.978  1.00 0.00 ? 7  ARG A HH12 15 
ATOM   11247 H  HH21 . ARG A 1 7  ? -2.436 1.974   -8.200  1.00 0.00 ? 7  ARG A HH21 15 
ATOM   11248 H  HH22 . ARG A 1 7  ? -2.969 0.341   -8.502  1.00 0.00 ? 7  ARG A HH22 15 
ATOM   11249 N  N    . LYS A 1 8  ? 1.166  5.197   -0.772  1.00 0.00 ? 8  LYS A N    15 
ATOM   11250 C  CA   . LYS A 1 8  ? 0.499  6.343   -0.167  1.00 0.00 ? 8  LYS A CA   15 
ATOM   11251 C  C    . LYS A 1 8  ? 1.062  7.613   -0.798  1.00 0.00 ? 8  LYS A C    15 
ATOM   11252 O  O    . LYS A 1 8  ? 2.186  7.596   -1.299  1.00 0.00 ? 8  LYS A O    15 
ATOM   11253 C  CB   . LYS A 1 8  ? 0.744  6.345   1.345   1.00 0.00 ? 8  LYS A CB   15 
ATOM   11254 C  CG   . LYS A 1 8  ? 0.068  5.149   2.031   1.00 0.00 ? 8  LYS A CG   15 
ATOM   11255 C  CD   . LYS A 1 8  ? 0.449  5.037   3.512   1.00 0.00 ? 8  LYS A CD   15 
ATOM   11256 C  CE   . LYS A 1 8  ? -0.007 6.248   4.334   1.00 0.00 ? 8  LYS A CE   15 
ATOM   11257 N  NZ   . LYS A 1 8  ? 0.249  6.049   5.771   1.00 0.00 ? 8  LYS A NZ   15 
ATOM   11258 H  H    . LYS A 1 8  ? 2.174  5.222   -0.773  1.00 0.00 ? 8  LYS A H    15 
ATOM   11259 H  HA   . LYS A 1 8  ? -0.575 6.309   -0.344  1.00 0.00 ? 8  LYS A HA   15 
ATOM   11260 H  HB2  . LYS A 1 8  ? 1.819  6.313   1.526   1.00 0.00 ? 8  LYS A HB2  15 
ATOM   11261 H  HB3  . LYS A 1 8  ? 0.338  7.271   1.756   1.00 0.00 ? 8  LYS A HB3  15 
ATOM   11262 H  HG2  . LYS A 1 8  ? -1.015 5.242   1.935   1.00 0.00 ? 8  LYS A HG2  15 
ATOM   11263 H  HG3  . LYS A 1 8  ? 0.377  4.227   1.541   1.00 0.00 ? 8  LYS A HG3  15 
ATOM   11264 H  HD2  . LYS A 1 8  ? -0.024 4.138   3.911   1.00 0.00 ? 8  LYS A HD2  15 
ATOM   11265 H  HD3  . LYS A 1 8  ? 1.531  4.925   3.596   1.00 0.00 ? 8  LYS A HD3  15 
ATOM   11266 H  HE2  . LYS A 1 8  ? 0.533  7.140   4.014   1.00 0.00 ? 8  LYS A HE2  15 
ATOM   11267 H  HE3  . LYS A 1 8  ? -1.076 6.407   4.186   1.00 0.00 ? 8  LYS A HE3  15 
ATOM   11268 H  HZ1  . LYS A 1 8  ? 1.237  5.910   5.924   1.00 0.00 ? 8  LYS A HZ1  15 
ATOM   11269 H  HZ2  . LYS A 1 8  ? -0.058 6.863   6.285   1.00 0.00 ? 8  LYS A HZ2  15 
ATOM   11270 H  HZ3  . LYS A 1 8  ? -0.259 5.239   6.098   1.00 0.00 ? 8  LYS A HZ3  15 
ATOM   11271 N  N    . LYS A 1 9  ? 0.270  8.694   -0.787  1.00 0.00 ? 9  LYS A N    15 
ATOM   11272 C  CA   . LYS A 1 9  ? 0.707  10.024  -1.190  1.00 0.00 ? 9  LYS A CA   15 
ATOM   11273 C  C    . LYS A 1 9  ? 0.566  11.023  -0.041  1.00 0.00 ? 9  LYS A C    15 
ATOM   11274 O  O    . LYS A 1 9  ? 0.029  10.695  1.016   1.00 0.00 ? 9  LYS A O    15 
ATOM   11275 C  CB   . LYS A 1 9  ? -0.013 10.460  -2.474  1.00 0.00 ? 9  LYS A CB   15 
ATOM   11276 C  CG   . LYS A 1 9  ? -1.421 11.023  -2.239  1.00 0.00 ? 9  LYS A CG   15 
ATOM   11277 C  CD   . LYS A 1 9  ? -2.095 11.451  -3.550  1.00 0.00 ? 9  LYS A CD   15 
ATOM   11278 C  CE   . LYS A 1 9  ? -1.288 12.450  -4.394  1.00 0.00 ? 9  LYS A CE   15 
ATOM   11279 N  NZ   . LYS A 1 9  ? -0.795 13.601  -3.612  1.00 0.00 ? 9  LYS A NZ   15 
ATOM   11280 H  H    . LYS A 1 9  ? -0.632 8.627   -0.339  1.00 0.00 ? 9  LYS A H    15 
ATOM   11281 H  HA   . LYS A 1 9  ? 1.767  9.996   -1.421  1.00 0.00 ? 9  LYS A HA   15 
ATOM   11282 H  HB2  . LYS A 1 9  ? 0.602  11.226  -2.943  1.00 0.00 ? 9  LYS A HB2  15 
ATOM   11283 H  HB3  . LYS A 1 9  ? -0.081 9.609   -3.156  1.00 0.00 ? 9  LYS A HB3  15 
ATOM   11284 H  HG2  . LYS A 1 9  ? -2.034 10.256  -1.764  1.00 0.00 ? 9  LYS A HG2  15 
ATOM   11285 H  HG3  . LYS A 1 9  ? -1.383 11.887  -1.576  1.00 0.00 ? 9  LYS A HG3  15 
ATOM   11286 H  HD2  . LYS A 1 9  ? -2.285 10.563  -4.156  1.00 0.00 ? 9  LYS A HD2  15 
ATOM   11287 H  HD3  . LYS A 1 9  ? -3.058 11.900  -3.302  1.00 0.00 ? 9  LYS A HD3  15 
ATOM   11288 H  HE2  . LYS A 1 9  ? -0.437 11.950  -4.858  1.00 0.00 ? 9  LYS A HE2  15 
ATOM   11289 H  HE3  . LYS A 1 9  ? -1.934 12.823  -5.189  1.00 0.00 ? 9  LYS A HE3  15 
ATOM   11290 H  HZ1  . LYS A 1 9  ? -1.549 14.012  -3.081  1.00 0.00 ? 9  LYS A HZ1  15 
ATOM   11291 H  HZ2  . LYS A 1 9  ? -0.053 13.308  -2.988  1.00 0.00 ? 9  LYS A HZ2  15 
ATOM   11292 H  HZ3  . LYS A 1 9  ? -0.412 14.293  -4.241  1.00 0.00 ? 9  LYS A HZ3  15 
ATOM   11293 N  N    . GLY A 1 10 ? 1.033  12.254  -0.278  1.00 0.00 ? 10 GLY A N    15 
ATOM   11294 C  CA   . GLY A 1 10 ? 1.204  13.287  0.729   1.00 0.00 ? 10 GLY A CA   15 
ATOM   11295 C  C    . GLY A 1 10 ? 2.689  13.618  0.796   1.00 0.00 ? 10 GLY A C    15 
ATOM   11296 O  O    . GLY A 1 10 ? 3.087  14.761  0.583   1.00 0.00 ? 10 GLY A O    15 
ATOM   11297 H  H    . GLY A 1 10 ? 1.416  12.457  -1.195  1.00 0.00 ? 10 GLY A H    15 
ATOM   11298 H  HA2  . GLY A 1 10 ? 0.641  14.173  0.428   1.00 0.00 ? 10 GLY A HA2  15 
ATOM   11299 H  HA3  . GLY A 1 10 ? 0.864  12.960  1.713   1.00 0.00 ? 10 GLY A HA3  15 
ATOM   11300 N  N    . GLU A 1 11 ? 3.507  12.587  1.038   1.00 0.00 ? 11 GLU A N    15 
ATOM   11301 C  CA   . GLU A 1 11 ? 4.961  12.625  0.932   1.00 0.00 ? 11 GLU A CA   15 
ATOM   11302 C  C    . GLU A 1 11 ? 5.423  12.557  -0.534  1.00 0.00 ? 11 GLU A C    15 
ATOM   11303 O  O    . GLU A 1 11 ? 6.332  11.800  -0.879  1.00 0.00 ? 11 GLU A O    15 
ATOM   11304 C  CB   . GLU A 1 11 ? 5.568  11.530  1.832   1.00 0.00 ? 11 GLU A CB   15 
ATOM   11305 C  CG   . GLU A 1 11 ? 5.439  10.070  1.355   1.00 0.00 ? 11 GLU A CG   15 
ATOM   11306 C  CD   . GLU A 1 11 ? 4.126  9.751   0.641   1.00 0.00 ? 11 GLU A CD   15 
ATOM   11307 O  OE1  . GLU A 1 11 ? 3.107  9.632   1.353   1.00 0.00 ? 11 GLU A OE1  15 
ATOM   11308 O  OE2  . GLU A 1 11 ? 4.152  9.673   -0.607  1.00 0.00 ? 11 GLU A OE2  15 
ATOM   11309 H  H    . GLU A 1 11 ? 3.084  11.695  1.260   1.00 0.00 ? 11 GLU A H    15 
ATOM   11310 H  HA   . GLU A 1 11 ? 5.301  13.581  1.334   1.00 0.00 ? 11 GLU A HA   15 
ATOM   11311 H  HB2  . GLU A 1 11 ? 6.632  11.745  1.950   1.00 0.00 ? 11 GLU A HB2  15 
ATOM   11312 H  HB3  . GLU A 1 11 ? 5.100  11.609  2.818   1.00 0.00 ? 11 GLU A HB3  15 
ATOM   11313 H  HG2  . GLU A 1 11 ? 6.271  9.848   0.691   1.00 0.00 ? 11 GLU A HG2  15 
ATOM   11314 H  HG3  . GLU A 1 11 ? 5.536  9.412   2.219   1.00 0.00 ? 11 GLU A HG3  15 
ATOM   11315 N  N    . ASP A 1 12 ? 4.813  13.381  -1.397  1.00 0.00 ? 12 ASP A N    15 
ATOM   11316 C  CA   . ASP A 1 12 ? 5.178  13.539  -2.799  1.00 0.00 ? 12 ASP A CA   15 
ATOM   11317 C  C    . ASP A 1 12 ? 6.424  14.420  -2.895  1.00 0.00 ? 12 ASP A C    15 
ATOM   11318 O  O    . ASP A 1 12 ? 6.375  15.530  -3.425  1.00 0.00 ? 12 ASP A O    15 
ATOM   11319 C  CB   . ASP A 1 12 ? 3.990  14.129  -3.568  1.00 0.00 ? 12 ASP A CB   15 
ATOM   11320 C  CG   . ASP A 1 12 ? 2.790  13.188  -3.561  1.00 0.00 ? 12 ASP A CG   15 
ATOM   11321 O  OD1  . ASP A 1 12 ? 2.812  12.242  -4.377  1.00 0.00 ? 12 ASP A OD1  15 
ATOM   11322 O  OD2  . ASP A 1 12 ? 1.871  13.424  -2.744  1.00 0.00 ? 12 ASP A OD2  15 
ATOM   11323 H  H    . ASP A 1 12 ? 4.098  14.000  -1.042  1.00 0.00 ? 12 ASP A H    15 
ATOM   11324 H  HA   . ASP A 1 12 ? 5.403  12.566  -3.234  1.00 0.00 ? 12 ASP A HA   15 
ATOM   11325 H  HB2  . ASP A 1 12 ? 3.707  15.081  -3.115  1.00 0.00 ? 12 ASP A HB2  15 
ATOM   11326 H  HB3  . ASP A 1 12 ? 4.284  14.303  -4.605  1.00 0.00 ? 12 ASP A HB3  15 
ATOM   11327 N  N    . ASP A 1 13 ? 7.542  13.899  -2.379  1.00 0.00 ? 13 ASP A N    15 
ATOM   11328 C  CA   . ASP A 1 13 ? 8.783  14.622  -2.155  1.00 0.00 ? 13 ASP A CA   15 
ATOM   11329 C  C    . ASP A 1 13 ? 9.889  14.065  -3.051  1.00 0.00 ? 13 ASP A C    15 
ATOM   11330 O  O    . ASP A 1 13 ? 10.563 14.820  -3.750  1.00 0.00 ? 13 ASP A O    15 
ATOM   11331 C  CB   . ASP A 1 13 ? 9.120  14.519  -0.661  1.00 0.00 ? 13 ASP A CB   15 
ATOM   11332 C  CG   . ASP A 1 13 ? 10.380 15.282  -0.258  1.00 0.00 ? 13 ASP A CG   15 
ATOM   11333 O  OD1  . ASP A 1 13 ? 10.646 16.337  -0.870  1.00 0.00 ? 13 ASP A OD1  15 
ATOM   11334 O  OD2  . ASP A 1 13 ? 11.058 14.786  0.669   1.00 0.00 ? 13 ASP A OD2  15 
ATOM   11335 H  H    . ASP A 1 13 ? 7.478  12.968  -1.991  1.00 0.00 ? 13 ASP A H    15 
ATOM   11336 H  HA   . ASP A 1 13 ? 8.649  15.672  -2.397  1.00 0.00 ? 13 ASP A HA   15 
ATOM   11337 H  HB2  . ASP A 1 13 ? 8.288  14.927  -0.086  1.00 0.00 ? 13 ASP A HB2  15 
ATOM   11338 H  HB3  . ASP A 1 13 ? 9.232  13.469  -0.400  1.00 0.00 ? 13 ASP A HB3  15 
ATOM   11339 N  N    . LYS A 1 14 ? 10.068 12.740  -3.031  1.00 0.00 ? 14 LYS A N    15 
ATOM   11340 C  CA   . LYS A 1 14 ? 11.178 12.060  -3.689  1.00 0.00 ? 14 LYS A CA   15 
ATOM   11341 C  C    . LYS A 1 14 ? 10.818 10.605  -4.005  1.00 0.00 ? 14 LYS A C    15 
ATOM   11342 O  O    . LYS A 1 14 ? 11.292 9.674   -3.354  1.00 0.00 ? 14 LYS A O    15 
ATOM   11343 C  CB   . LYS A 1 14 ? 12.490 12.222  -2.895  1.00 0.00 ? 14 LYS A CB   15 
ATOM   11344 C  CG   . LYS A 1 14 ? 12.360 12.277  -1.364  1.00 0.00 ? 14 LYS A CG   15 
ATOM   11345 C  CD   . LYS A 1 14 ? 11.807 10.995  -0.730  1.00 0.00 ? 14 LYS A CD   15 
ATOM   11346 C  CE   . LYS A 1 14 ? 11.880 11.046  0.801   1.00 0.00 ? 14 LYS A CE   15 
ATOM   11347 N  NZ   . LYS A 1 14 ? 11.008 12.091  1.366   1.00 0.00 ? 14 LYS A NZ   15 
ATOM   11348 H  H    . LYS A 1 14 ? 9.437  12.194  -2.465  1.00 0.00 ? 14 LYS A H    15 
ATOM   11349 H  HA   . LYS A 1 14 ? 11.347 12.533  -4.658  1.00 0.00 ? 14 LYS A HA   15 
ATOM   11350 H  HB2  . LYS A 1 14 ? 13.195 11.435  -3.176  1.00 0.00 ? 14 LYS A HB2  15 
ATOM   11351 H  HB3  . LYS A 1 14 ? 12.926 13.179  -3.192  1.00 0.00 ? 14 LYS A HB3  15 
ATOM   11352 H  HG2  . LYS A 1 14 ? 13.353 12.473  -0.959  1.00 0.00 ? 14 LYS A HG2  15 
ATOM   11353 H  HG3  . LYS A 1 14 ? 11.734 13.120  -1.098  1.00 0.00 ? 14 LYS A HG3  15 
ATOM   11354 H  HD2  . LYS A 1 14 ? 10.773 10.838  -1.037  1.00 0.00 ? 14 LYS A HD2  15 
ATOM   11355 H  HD3  . LYS A 1 14 ? 12.410 10.156  -1.070  1.00 0.00 ? 14 LYS A HD3  15 
ATOM   11356 H  HE2  . LYS A 1 14 ? 11.564 10.082  1.201   1.00 0.00 ? 14 LYS A HE2  15 
ATOM   11357 H  HE3  . LYS A 1 14 ? 12.907 11.233  1.115   1.00 0.00 ? 14 LYS A HE3  15 
ATOM   11358 H  HZ1  . LYS A 1 14 ? 11.101 12.100  2.370   1.00 0.00 ? 14 LYS A HZ1  15 
ATOM   11359 H  HZ2  . LYS A 1 14 ? 11.265 13.006  1.010   1.00 0.00 ? 14 LYS A HZ2  15 
ATOM   11360 H  HZ3  . LYS A 1 14 ? 10.045 11.904  1.123   1.00 0.00 ? 14 LYS A HZ3  15 
ATOM   11361 N  N    . LEU A 1 15 ? 9.984  10.417  -5.036  1.00 0.00 ? 15 LEU A N    15 
ATOM   11362 C  CA   . LEU A 1 15 ? 9.710  9.111   -5.617  1.00 0.00 ? 15 LEU A CA   15 
ATOM   11363 C  C    . LEU A 1 15 ? 10.904 8.731   -6.500  1.00 0.00 ? 15 LEU A C    15 
ATOM   11364 O  O    . LEU A 1 15 ? 10.918 9.028   -7.693  1.00 0.00 ? 15 LEU A O    15 
ATOM   11365 C  CB   . LEU A 1 15 ? 8.401  9.141   -6.430  1.00 0.00 ? 15 LEU A CB   15 
ATOM   11366 C  CG   . LEU A 1 15 ? 7.094  9.118   -5.613  1.00 0.00 ? 15 LEU A CG   15 
ATOM   11367 C  CD1  . LEU A 1 15 ? 6.881  7.780   -4.894  1.00 0.00 ? 15 LEU A CD1  15 
ATOM   11368 C  CD2  . LEU A 1 15 ? 6.977  10.284  -4.624  1.00 0.00 ? 15 LEU A CD2  15 
ATOM   11369 H  H    . LEU A 1 15 ? 9.600  11.226  -5.502  1.00 0.00 ? 15 LEU A H    15 
ATOM   11370 H  HA   . LEU A 1 15 ? 9.608  8.371   -4.827  1.00 0.00 ? 15 LEU A HA   15 
ATOM   11371 H  HB2  . LEU A 1 15 ? 8.401  10.029  -7.066  1.00 0.00 ? 15 LEU A HB2  15 
ATOM   11372 H  HB3  . LEU A 1 15 ? 8.385  8.259   -7.075  1.00 0.00 ? 15 LEU A HB3  15 
ATOM   11373 H  HG   . LEU A 1 15 ? 6.277  9.224   -6.327  1.00 0.00 ? 15 LEU A HG   15 
ATOM   11374 H  HD11 . LEU A 1 15 ? 6.939  6.961   -5.610  1.00 0.00 ? 15 LEU A HD11 15 
ATOM   11375 H  HD12 . LEU A 1 15 ? 7.631  7.629   -4.118  1.00 0.00 ? 15 LEU A HD12 15 
ATOM   11376 H  HD13 . LEU A 1 15 ? 5.894  7.771   -4.431  1.00 0.00 ? 15 LEU A HD13 15 
ATOM   11377 H  HD21 . LEU A 1 15 ? 5.971  10.304  -4.209  1.00 0.00 ? 15 LEU A HD21 15 
ATOM   11378 H  HD22 . LEU A 1 15 ? 7.687  10.169  -3.805  1.00 0.00 ? 15 LEU A HD22 15 
ATOM   11379 H  HD23 . LEU A 1 15 ? 7.163  11.226  -5.141  1.00 0.00 ? 15 LEU A HD23 15 
ATOM   11380 N  N    . ILE A 1 16 ? 11.911 8.087   -5.900  1.00 0.00 ? 16 ILE A N    15 
ATOM   11381 C  CA   . ILE A 1 16 ? 13.035 7.493   -6.611  1.00 0.00 ? 16 ILE A CA   15 
ATOM   11382 C  C    . ILE A 1 16 ? 12.562 6.270   -7.401  1.00 0.00 ? 16 ILE A C    15 
ATOM   11383 O  O    . ILE A 1 16 ? 11.997 5.335   -6.835  1.00 0.00 ? 16 ILE A O    15 
ATOM   11384 C  CB   . ILE A 1 16 ? 14.198 7.175   -5.643  1.00 0.00 ? 16 ILE A CB   15 
ATOM   11385 C  CG1  . ILE A 1 16 ? 15.347 6.495   -6.410  1.00 0.00 ? 16 ILE A CG1  15 
ATOM   11386 C  CG2  . ILE A 1 16 ? 13.782 6.324   -4.430  1.00 0.00 ? 16 ILE A CG2  15 
ATOM   11387 C  CD1  . ILE A 1 16 ? 16.683 6.559   -5.659  1.00 0.00 ? 16 ILE A CD1  15 
ATOM   11388 H  H    . ILE A 1 16 ? 11.799 7.855   -4.923  1.00 0.00 ? 16 ILE A H    15 
ATOM   11389 H  HA   . ILE A 1 16 ? 13.408 8.238   -7.315  1.00 0.00 ? 16 ILE A HA   15 
ATOM   11390 H  HB   . ILE A 1 16 ? 14.564 8.129   -5.261  1.00 0.00 ? 16 ILE A HB   15 
ATOM   11391 H  HG12 . ILE A 1 16 ? 15.097 5.449   -6.603  1.00 0.00 ? 16 ILE A HG12 15 
ATOM   11392 H  HG13 . ILE A 1 16 ? 15.488 7.009   -7.363  1.00 0.00 ? 16 ILE A HG13 15 
ATOM   11393 H  HG21 . ILE A 1 16 ? 13.349 5.375   -4.742  1.00 0.00 ? 16 ILE A HG21 15 
ATOM   11394 H  HG22 . ILE A 1 16 ? 14.645 6.107   -3.810  1.00 0.00 ? 16 ILE A HG22 15 
ATOM   11395 H  HG23 . ILE A 1 16 ? 13.069 6.866   -3.811  1.00 0.00 ? 16 ILE A HG23 15 
ATOM   11396 H  HD11 . ILE A 1 16 ? 17.467 6.152   -6.297  1.00 0.00 ? 16 ILE A HD11 15 
ATOM   11397 H  HD12 . ILE A 1 16 ? 16.925 7.595   -5.424  1.00 0.00 ? 16 ILE A HD12 15 
ATOM   11398 H  HD13 . ILE A 1 16 ? 16.652 5.977   -4.741  1.00 0.00 ? 16 ILE A HD13 15 
ATOM   11399 N  N    . LEU A 1 17 ? 12.772 6.286   -8.722  1.00 0.00 ? 17 LEU A N    15 
ATOM   11400 C  CA   . LEU A 1 17 ? 12.584 5.127   -9.578  1.00 0.00 ? 17 LEU A CA   15 
ATOM   11401 C  C    . LEU A 1 17 ? 13.902 4.359   -9.660  1.00 0.00 ? 17 LEU A C    15 
ATOM   11402 O  O    . LEU A 1 17 ? 14.967 4.966   -9.778  1.00 0.00 ? 17 LEU A O    15 
ATOM   11403 C  CB   . LEU A 1 17 ? 12.110 5.567   -10.970 1.00 0.00 ? 17 LEU A CB   15 
ATOM   11404 C  CG   . LEU A 1 17 ? 10.587 5.781   -11.054 1.00 0.00 ? 17 LEU A CG   15 
ATOM   11405 C  CD1  . LEU A 1 17 ? 10.084 6.898   -10.131 1.00 0.00 ? 17 LEU A CD1  15 
ATOM   11406 C  CD2  . LEU A 1 17 ? 10.207 6.117   -12.500 1.00 0.00 ? 17 LEU A CD2  15 
ATOM   11407 H  H    . LEU A 1 17 ? 13.206 7.094   -9.143  1.00 0.00 ? 17 LEU A H    15 
ATOM   11408 H  HA   . LEU A 1 17 ? 11.826 4.467   -9.161  1.00 0.00 ? 17 LEU A HA   15 
ATOM   11409 H  HB2  . LEU A 1 17 ? 12.636 6.477   -11.271 1.00 0.00 ? 17 LEU A HB2  15 
ATOM   11410 H  HB3  . LEU A 1 17 ? 12.365 4.773   -11.673 1.00 0.00 ? 17 LEU A HB3  15 
ATOM   11411 H  HG   . LEU A 1 17 ? 10.084 4.852   -10.783 1.00 0.00 ? 17 LEU A HG   15 
ATOM   11412 H  HD11 . LEU A 1 17 ? 9.028  7.086   -10.325 1.00 0.00 ? 17 LEU A HD11 15 
ATOM   11413 H  HD12 . LEU A 1 17 ? 10.187 6.606   -9.088  1.00 0.00 ? 17 LEU A HD12 15 
ATOM   11414 H  HD13 . LEU A 1 17 ? 10.647 7.815   -10.312 1.00 0.00 ? 17 LEU A HD13 15 
ATOM   11415 H  HD21 . LEU A 1 17 ? 9.125  6.225   -12.584 1.00 0.00 ? 17 LEU A HD21 15 
ATOM   11416 H  HD22 . LEU A 1 17 ? 10.685 7.047   -12.807 1.00 0.00 ? 17 LEU A HD22 15 
ATOM   11417 H  HD23 . LEU A 1 17 ? 10.529 5.313   -13.161 1.00 0.00 ? 17 LEU A HD23 15 
ATOM   11418 N  N    . CYS A 1 18 ? 13.828 3.024   -9.602  1.00 0.00 ? 18 CYS A N    15 
ATOM   11419 C  CA   . CYS A 1 18 ? 14.963 2.160   -9.881  1.00 0.00 ? 18 CYS A CA   15 
ATOM   11420 C  C    . CYS A 1 18 ? 15.294 2.222   -11.370 1.00 0.00 ? 18 CYS A C    15 
ATOM   11421 O  O    . CYS A 1 18 ? 14.441 1.910   -12.198 1.00 0.00 ? 18 CYS A O    15 
ATOM   11422 C  CB   . CYS A 1 18 ? 14.639 0.726   -9.455  1.00 0.00 ? 18 CYS A CB   15 
ATOM   11423 S  SG   . CYS A 1 18 ? 15.901 -0.491  -9.915  1.00 0.00 ? 18 CYS A SG   15 
ATOM   11424 H  H    . CYS A 1 18 ? 12.930 2.591   -9.422  1.00 0.00 ? 18 CYS A H    15 
ATOM   11425 H  HA   . CYS A 1 18 ? 15.820 2.499   -9.300  1.00 0.00 ? 18 CYS A HA   15 
ATOM   11426 H  HB2  . CYS A 1 18 ? 14.525 0.715   -8.372  1.00 0.00 ? 18 CYS A HB2  15 
ATOM   11427 H  HB3  . CYS A 1 18 ? 13.695 0.409   -9.900  1.00 0.00 ? 18 CYS A HB3  15 
ATOM   11428 N  N    . ASP A 1 19 ? 16.534 2.596   -11.707 1.00 0.00 ? 19 ASP A N    15 
ATOM   11429 C  CA   . ASP A 1 19 ? 16.997 2.721   -13.085 1.00 0.00 ? 19 ASP A CA   15 
ATOM   11430 C  C    . ASP A 1 19 ? 16.793 1.416   -13.857 1.00 0.00 ? 19 ASP A C    15 
ATOM   11431 O  O    . ASP A 1 19 ? 16.303 1.429   -14.984 1.00 0.00 ? 19 ASP A O    15 
ATOM   11432 C  CB   . ASP A 1 19 ? 18.480 3.124   -13.110 1.00 0.00 ? 19 ASP A CB   15 
ATOM   11433 C  CG   . ASP A 1 19 ? 18.750 4.555   -12.640 1.00 0.00 ? 19 ASP A CG   15 
ATOM   11434 O  OD1  . ASP A 1 19 ? 17.816 5.188   -12.101 1.00 0.00 ? 19 ASP A OD1  15 
ATOM   11435 O  OD2  . ASP A 1 19 ? 19.903 4.996   -12.835 1.00 0.00 ? 19 ASP A OD2  15 
ATOM   11436 H  H    . ASP A 1 19 ? 17.179 2.870   -10.976 1.00 0.00 ? 19 ASP A H    15 
ATOM   11437 H  HA   . ASP A 1 19 ? 16.413 3.494   -13.582 1.00 0.00 ? 19 ASP A HA   15 
ATOM   11438 H  HB2  . ASP A 1 19 ? 19.057 2.436   -12.492 1.00 0.00 ? 19 ASP A HB2  15 
ATOM   11439 H  HB3  . ASP A 1 19 ? 18.841 3.046   -14.136 1.00 0.00 ? 19 ASP A HB3  15 
ATOM   11440 N  N    . GLU A 1 20 ? 17.166 0.295   -13.233 1.00 0.00 ? 20 GLU A N    15 
ATOM   11441 C  CA   . GLU A 1 20 ? 17.253 -1.010  -13.864 1.00 0.00 ? 20 GLU A CA   15 
ATOM   11442 C  C    . GLU A 1 20 ? 15.875 -1.505  -14.308 1.00 0.00 ? 20 GLU A C    15 
ATOM   11443 O  O    . GLU A 1 20 ? 15.665 -1.742  -15.496 1.00 0.00 ? 20 GLU A O    15 
ATOM   11444 C  CB   . GLU A 1 20 ? 17.919 -1.994  -12.895 1.00 0.00 ? 20 GLU A CB   15 
ATOM   11445 C  CG   . GLU A 1 20 ? 19.364 -1.587  -12.579 1.00 0.00 ? 20 GLU A CG   15 
ATOM   11446 C  CD   . GLU A 1 20 ? 19.983 -2.538  -11.564 1.00 0.00 ? 20 GLU A CD   15 
ATOM   11447 O  OE1  . GLU A 1 20 ? 19.600 -2.418  -10.381 1.00 0.00 ? 20 GLU A OE1  15 
ATOM   11448 O  OE2  . GLU A 1 20 ? 20.816 -3.369  -11.986 1.00 0.00 ? 20 GLU A OE2  15 
ATOM   11449 H  H    . GLU A 1 20 ? 17.524 0.376   -12.294 1.00 0.00 ? 20 GLU A H    15 
ATOM   11450 H  HA   . GLU A 1 20 ? 17.888 -0.924  -14.749 1.00 0.00 ? 20 GLU A HA   15 
ATOM   11451 H  HB2  . GLU A 1 20 ? 17.349 -2.043  -11.965 1.00 0.00 ? 20 GLU A HB2  15 
ATOM   11452 H  HB3  . GLU A 1 20 ? 17.933 -2.984  -13.349 1.00 0.00 ? 20 GLU A HB3  15 
ATOM   11453 H  HG2  . GLU A 1 20 ? 19.952 -1.599  -13.497 1.00 0.00 ? 20 GLU A HG2  15 
ATOM   11454 H  HG3  . GLU A 1 20 ? 19.395 -0.582  -12.159 1.00 0.00 ? 20 GLU A HG3  15 
ATOM   11455 N  N    . CYS A 1 21 ? 14.947 -1.671  -13.355 1.00 0.00 ? 21 CYS A N    15 
ATOM   11456 C  CA   . CYS A 1 21 ? 13.663 -2.334  -13.577 1.00 0.00 ? 21 CYS A CA   15 
ATOM   11457 C  C    . CYS A 1 21 ? 12.466 -1.377  -13.500 1.00 0.00 ? 21 CYS A C    15 
ATOM   11458 O  O    . CYS A 1 21 ? 11.331 -1.832  -13.628 1.00 0.00 ? 21 CYS A O    15 
ATOM   11459 C  CB   . CYS A 1 21 ? 13.515 -3.525  -12.618 1.00 0.00 ? 21 CYS A CB   15 
ATOM   11460 S  SG   . CYS A 1 21 ? 13.588 -3.162  -10.844 1.00 0.00 ? 21 CYS A SG   15 
ATOM   11461 H  H    . CYS A 1 21 ? 15.169 -1.379  -12.415 1.00 0.00 ? 21 CYS A H    15 
ATOM   11462 H  HA   . CYS A 1 21 ? 13.639 -2.759  -14.582 1.00 0.00 ? 21 CYS A HA   15 
ATOM   11463 H  HB2  . CYS A 1 21 ? 12.561 -4.015  -12.818 1.00 0.00 ? 21 CYS A HB2  15 
ATOM   11464 H  HB3  . CYS A 1 21 ? 14.314 -4.238  -12.836 1.00 0.00 ? 21 CYS A HB3  15 
ATOM   11465 N  N    . ASN A 1 22 ? 12.700 -0.069  -13.316 1.00 0.00 ? 22 ASN A N    15 
ATOM   11466 C  CA   . ASN A 1 22 ? 11.686 0.975   -13.438 1.00 0.00 ? 22 ASN A CA   15 
ATOM   11467 C  C    . ASN A 1 22 ? 10.559 0.783   -12.417 1.00 0.00 ? 22 ASN A C    15 
ATOM   11468 O  O    . ASN A 1 22 ? 9.394  0.646   -12.783 1.00 0.00 ? 22 ASN A O    15 
ATOM   11469 C  CB   . ASN A 1 22 ? 11.192 1.066   -14.891 1.00 0.00 ? 22 ASN A CB   15 
ATOM   11470 C  CG   . ASN A 1 22 ? 10.399 2.347   -15.148 1.00 0.00 ? 22 ASN A CG   15 
ATOM   11471 O  OD1  . ASN A 1 22 ? 9.182  2.309   -15.312 1.00 0.00 ? 22 ASN A OD1  15 
ATOM   11472 N  ND2  . ASN A 1 22 ? 11.091 3.485   -15.202 1.00 0.00 ? 22 ASN A ND2  15 
ATOM   11473 H  H    . ASN A 1 22 ? 13.646 0.246   -13.148 1.00 0.00 ? 22 ASN A H    15 
ATOM   11474 H  HA   . ASN A 1 22 ? 12.165 1.924   -13.209 1.00 0.00 ? 22 ASN A HA   15 
ATOM   11475 H  HB2  . ASN A 1 22 ? 12.056 1.064   -15.559 1.00 0.00 ? 22 ASN A HB2  15 
ATOM   11476 H  HB3  . ASN A 1 22 ? 10.568 0.203   -15.125 1.00 0.00 ? 22 ASN A HB3  15 
ATOM   11477 H  HD21 . ASN A 1 22 ? 12.095 3.473   -15.067 1.00 0.00 ? 22 ASN A HD21 15 
ATOM   11478 H  HD22 . ASN A 1 22 ? 10.606 4.353   -15.390 1.00 0.00 ? 22 ASN A HD22 15 
ATOM   11479 N  N    . LYS A 1 23 ? 10.920 0.774   -11.127 1.00 0.00 ? 23 LYS A N    15 
ATOM   11480 C  CA   . LYS A 1 23 ? 10.018 0.560   -10.012 1.00 0.00 ? 23 LYS A CA   15 
ATOM   11481 C  C    . LYS A 1 23 ? 10.107 1.757   -9.068  1.00 0.00 ? 23 LYS A C    15 
ATOM   11482 O  O    . LYS A 1 23 ? 11.189 2.074   -8.572  1.00 0.00 ? 23 LYS A O    15 
ATOM   11483 C  CB   . LYS A 1 23 ? 10.421 -0.732  -9.295  1.00 0.00 ? 23 LYS A CB   15 
ATOM   11484 C  CG   . LYS A 1 23 ? 10.297 -1.992  -10.166 1.00 0.00 ? 23 LYS A CG   15 
ATOM   11485 C  CD   . LYS A 1 23 ? 8.849  -2.341  -10.545 1.00 0.00 ? 23 LYS A CD   15 
ATOM   11486 C  CE   . LYS A 1 23 ? 8.784  -3.478  -11.572 1.00 0.00 ? 23 LYS A CE   15 
ATOM   11487 N  NZ   . LYS A 1 23 ? 9.413  -4.718  -11.087 1.00 0.00 ? 23 LYS A NZ   15 
ATOM   11488 H  H    . LYS A 1 23 ? 11.896 0.830   -10.881 1.00 0.00 ? 23 LYS A H    15 
ATOM   11489 H  HA   . LYS A 1 23 ? 8.986  0.482   -10.353 1.00 0.00 ? 23 LYS A HA   15 
ATOM   11490 H  HB2  . LYS A 1 23 ? 11.461 -0.645  -8.971  1.00 0.00 ? 23 LYS A HB2  15 
ATOM   11491 H  HB3  . LYS A 1 23 ? 9.794  -0.836  -8.416  1.00 0.00 ? 23 LYS A HB3  15 
ATOM   11492 H  HG2  . LYS A 1 23 ? 10.886 -1.859  -11.071 1.00 0.00 ? 23 LYS A HG2  15 
ATOM   11493 H  HG3  . LYS A 1 23 ? 10.722 -2.822  -9.601  1.00 0.00 ? 23 LYS A HG3  15 
ATOM   11494 H  HD2  . LYS A 1 23 ? 8.294  -2.615  -9.647  1.00 0.00 ? 23 LYS A HD2  15 
ATOM   11495 H  HD3  . LYS A 1 23 ? 8.363  -1.480  -11.003 1.00 0.00 ? 23 LYS A HD3  15 
ATOM   11496 H  HE2  . LYS A 1 23 ? 7.737  -3.683  -11.801 1.00 0.00 ? 23 LYS A HE2  15 
ATOM   11497 H  HE3  . LYS A 1 23 ? 9.280  -3.164  -12.491 1.00 0.00 ? 23 LYS A HE3  15 
ATOM   11498 H  HZ1  . LYS A 1 23 ? 8.960  -5.020  -10.237 1.00 0.00 ? 23 LYS A HZ1  15 
ATOM   11499 H  HZ2  . LYS A 1 23 ? 9.319  -5.438  -11.790 1.00 0.00 ? 23 LYS A HZ2  15 
ATOM   11500 H  HZ3  . LYS A 1 23 ? 10.393 -4.556  -10.909 1.00 0.00 ? 23 LYS A HZ3  15 
ATOM   11501 N  N    . ALA A 1 24 ? 8.967  2.418   -8.834  1.00 0.00 ? 24 ALA A N    15 
ATOM   11502 C  CA   . ALA A 1 24 ? 8.872  3.632   -8.040  1.00 0.00 ? 24 ALA A CA   15 
ATOM   11503 C  C    . ALA A 1 24 ? 8.867  3.300   -6.548  1.00 0.00 ? 24 ALA A C    15 
ATOM   11504 O  O    . ALA A 1 24 ? 8.170  2.385   -6.111  1.00 0.00 ? 24 ALA A O    15 
ATOM   11505 C  CB   . ALA A 1 24 ? 7.608  4.396   -8.437  1.00 0.00 ? 24 ALA A CB   15 
ATOM   11506 H  H    . ALA A 1 24 ? 8.115  2.075   -9.253  1.00 0.00 ? 24 ALA A H    15 
ATOM   11507 H  HA   . ALA A 1 24 ? 9.724  4.273   -8.263  1.00 0.00 ? 24 ALA A HA   15 
ATOM   11508 H  HB1  . ALA A 1 24 ? 6.741  3.750   -8.308  1.00 0.00 ? 24 ALA A HB1  15 
ATOM   11509 H  HB2  . ALA A 1 24 ? 7.499  5.285   -7.814  1.00 0.00 ? 24 ALA A HB2  15 
ATOM   11510 H  HB3  . ALA A 1 24 ? 7.674  4.699   -9.482  1.00 0.00 ? 24 ALA A HB3  15 
ATOM   11511 N  N    . PHE A 1 25 ? 9.656  4.053   -5.779  1.00 0.00 ? 25 PHE A N    15 
ATOM   11512 C  CA   . PHE A 1 25 ? 9.982  3.810   -4.382  1.00 0.00 ? 25 PHE A CA   15 
ATOM   11513 C  C    . PHE A 1 25 ? 10.253 5.163   -3.727  1.00 0.00 ? 25 PHE A C    15 
ATOM   11514 O  O    . PHE A 1 25 ? 10.656 6.098   -4.410  1.00 0.00 ? 25 PHE A O    15 
ATOM   11515 C  CB   . PHE A 1 25 ? 11.258 2.949   -4.292  1.00 0.00 ? 25 PHE A CB   15 
ATOM   11516 C  CG   . PHE A 1 25 ? 11.034 1.459   -4.108  1.00 0.00 ? 25 PHE A CG   15 
ATOM   11517 C  CD1  . PHE A 1 25 ? 10.660 0.652   -5.199  1.00 0.00 ? 25 PHE A CD1  15 
ATOM   11518 C  CD2  . PHE A 1 25 ? 11.303 0.860   -2.862  1.00 0.00 ? 25 PHE A CD2  15 
ATOM   11519 C  CE1  . PHE A 1 25 ? 10.487 -0.732  -5.029  1.00 0.00 ? 25 PHE A CE1  15 
ATOM   11520 C  CE2  . PHE A 1 25 ? 11.184 -0.531  -2.707  1.00 0.00 ? 25 PHE A CE2  15 
ATOM   11521 C  CZ   . PHE A 1 25 ? 10.753 -1.325  -3.782  1.00 0.00 ? 25 PHE A CZ   15 
ATOM   11522 H  H    . PHE A 1 25 ? 10.183 4.796   -6.220  1.00 0.00 ? 25 PHE A H    15 
ATOM   11523 H  HA   . PHE A 1 25 ? 9.157  3.318   -3.867  1.00 0.00 ? 25 PHE A HA   15 
ATOM   11524 H  HB2  . PHE A 1 25 ? 11.864 3.101   -5.190  1.00 0.00 ? 25 PHE A HB2  15 
ATOM   11525 H  HB3  . PHE A 1 25 ? 11.852 3.296   -3.443  1.00 0.00 ? 25 PHE A HB3  15 
ATOM   11526 H  HD1  . PHE A 1 25 ? 10.516 1.088   -6.174  1.00 0.00 ? 25 PHE A HD1  15 
ATOM   11527 H  HD2  . PHE A 1 25 ? 11.616 1.462   -2.021  1.00 0.00 ? 25 PHE A HD2  15 
ATOM   11528 H  HE1  . PHE A 1 25 ? 10.173 -1.344  -5.863  1.00 0.00 ? 25 PHE A HE1  15 
ATOM   11529 H  HE2  . PHE A 1 25 ? 11.417 -0.988  -1.756  1.00 0.00 ? 25 PHE A HE2  15 
ATOM   11530 H  HZ   . PHE A 1 25 ? 10.640 -2.392  -3.655  1.00 0.00 ? 25 PHE A HZ   15 
ATOM   11531 N  N    . HIS A 1 26 ? 10.014 5.286   -2.418  1.00 0.00 ? 26 HIS A N    15 
ATOM   11532 C  CA   . HIS A 1 26 ? 10.483 6.444   -1.664  1.00 0.00 ? 26 HIS A CA   15 
ATOM   11533 C  C    . HIS A 1 26 ? 11.881 6.110   -1.156  1.00 0.00 ? 26 HIS A C    15 
ATOM   11534 O  O    . HIS A 1 26 ? 12.224 4.937   -1.021  1.00 0.00 ? 26 HIS A O    15 
ATOM   11535 C  CB   . HIS A 1 26 ? 9.570  6.752   -0.476  1.00 0.00 ? 26 HIS A CB   15 
ATOM   11536 C  CG   . HIS A 1 26 ? 8.198  7.215   -0.872  1.00 0.00 ? 26 HIS A CG   15 
ATOM   11537 N  ND1  . HIS A 1 26 ? 7.043  6.439   -0.803  1.00 0.00 ? 26 HIS A ND1  15 
ATOM   11538 C  CD2  . HIS A 1 26 ? 7.888  8.471   -1.307  1.00 0.00 ? 26 HIS A CD2  15 
ATOM   11539 C  CE1  . HIS A 1 26 ? 6.052  7.255   -1.191  1.00 0.00 ? 26 HIS A CE1  15 
ATOM   11540 N  NE2  . HIS A 1 26 ? 6.528  8.472   -1.508  1.00 0.00 ? 26 HIS A NE2  15 
ATOM   11541 H  H    . HIS A 1 26 ? 9.635  4.506   -1.903  1.00 0.00 ? 26 HIS A H    15 
ATOM   11542 H  HA   . HIS A 1 26 ? 10.531 7.333   -2.294  1.00 0.00 ? 26 HIS A HA   15 
ATOM   11543 H  HB2  . HIS A 1 26 ? 9.483  5.86