data_1F6A
# 
_entry.id   1F6A 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F6A         
RCSB  RCSB011295   
WWPDB D_1000011295 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1F2Q 
_pdbx_database_related.details        '1F2Q contains the human high-affinity IgE receptor Fc(epsilon)RI(alpha)' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F6A 
_pdbx_database_status.recvd_initial_deposition_date   2000-06-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Garman, S.C.'       1 
'Wurzburg, B.A.'     2 
'Tarchevskaya, S.S.' 3 
'Kinet, J.P.'        4 
'Jardetzky, T.S.'    5 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Fc fragment of human IgE bound to its high-affinity receptor Fc (epsilon) RI (alpha).' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            406 
_citation.page_first                259 
_citation.page_last                 266 
_citation.year                      2000 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10917520 
_citation.pdbx_database_id_DOI      10.1038/35018500 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Garman, S.C.'       1 
primary 'Wurzburg, B.A.'     2 
primary 'Tarchevskaya, S.S.' 3 
primary 'Kinet, J.P.'        4 
primary 'Jardetzky, T.S.'    5 
# 
_cell.entry_id           1F6A 
_cell.length_a           192.800 
_cell.length_b           192.800 
_cell.length_c           302.400 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              36 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1F6A 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR ALPHA-SUBUNIT' 20318.611 1  ? N74A,N135A,T142A,V143A 
'EXTRACELLULAR DOMAIN'            ? 
2 polymer     man 'IG EPSILON CHAIN C REGION'                                   24821.018 2  ? ?                      
'C(EPSILON)3-C(EPSILON)4 DOMAINS' ? 
3 non-polymer man N-ACETYL-D-GLUCOSAMINE                                        221.208   10 ? ?                      ? ? 
4 non-polymer man ALPHA-D-MANNOSE                                               180.156   9  ? ?                      ? ? 
5 non-polymer man ALPHA-L-FUCOSE                                                164.156   2  ? ?                      ? ? 
6 non-polymer syn 'SULFATE ION'                                                 96.063    5  ? ?                      ? ? 
7 non-polymer syn '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE'   614.877   5  ? ?                      ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HIGH AFFINITY IGE-FC RECEPTOR, FC(EPSILON)RI(ALPHA)' 
2 IGE-FC                                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVAESEPVY
LEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHAISITNAAAEDSGTYYCTGKVWQLDY
ESEPLNITVIKAPREK
;
;VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVAESEPVY
LEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHAISITNAAAEDSGTYYCTGKVWQLDY
ESEPLNITVIKAPREK
;
A   ? 
2 'polypeptide(L)' no no 
;ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPV
GTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQL
PDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK
;
;ADPCDSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPV
GTRDWIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQL
PDARHSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   PRO n 
1 3   GLN n 
1 4   LYS n 
1 5   PRO n 
1 6   LYS n 
1 7   VAL n 
1 8   SER n 
1 9   LEU n 
1 10  ASN n 
1 11  PRO n 
1 12  PRO n 
1 13  TRP n 
1 14  ASN n 
1 15  ARG n 
1 16  ILE n 
1 17  PHE n 
1 18  LYS n 
1 19  GLY n 
1 20  GLU n 
1 21  ASN n 
1 22  VAL n 
1 23  THR n 
1 24  LEU n 
1 25  THR n 
1 26  CYS n 
1 27  ASN n 
1 28  GLY n 
1 29  ASN n 
1 30  ASN n 
1 31  PHE n 
1 32  PHE n 
1 33  GLU n 
1 34  VAL n 
1 35  SER n 
1 36  SER n 
1 37  THR n 
1 38  LYS n 
1 39  TRP n 
1 40  PHE n 
1 41  HIS n 
1 42  ASN n 
1 43  GLY n 
1 44  SER n 
1 45  LEU n 
1 46  SER n 
1 47  GLU n 
1 48  GLU n 
1 49  THR n 
1 50  ASN n 
1 51  SER n 
1 52  SER n 
1 53  LEU n 
1 54  ASN n 
1 55  ILE n 
1 56  VAL n 
1 57  ASN n 
1 58  ALA n 
1 59  LYS n 
1 60  PHE n 
1 61  GLU n 
1 62  ASP n 
1 63  SER n 
1 64  GLY n 
1 65  GLU n 
1 66  TYR n 
1 67  LYS n 
1 68  CYS n 
1 69  GLN n 
1 70  HIS n 
1 71  GLN n 
1 72  GLN n 
1 73  VAL n 
1 74  ALA n 
1 75  GLU n 
1 76  SER n 
1 77  GLU n 
1 78  PRO n 
1 79  VAL n 
1 80  TYR n 
1 81  LEU n 
1 82  GLU n 
1 83  VAL n 
1 84  PHE n 
1 85  SER n 
1 86  ASP n 
1 87  TRP n 
1 88  LEU n 
1 89  LEU n 
1 90  LEU n 
1 91  GLN n 
1 92  ALA n 
1 93  SER n 
1 94  ALA n 
1 95  GLU n 
1 96  VAL n 
1 97  VAL n 
1 98  MET n 
1 99  GLU n 
1 100 GLY n 
1 101 GLN n 
1 102 PRO n 
1 103 LEU n 
1 104 PHE n 
1 105 LEU n 
1 106 ARG n 
1 107 CYS n 
1 108 HIS n 
1 109 GLY n 
1 110 TRP n 
1 111 ARG n 
1 112 ASN n 
1 113 TRP n 
1 114 ASP n 
1 115 VAL n 
1 116 TYR n 
1 117 LYS n 
1 118 VAL n 
1 119 ILE n 
1 120 TYR n 
1 121 TYR n 
1 122 LYS n 
1 123 ASP n 
1 124 GLY n 
1 125 GLU n 
1 126 ALA n 
1 127 LEU n 
1 128 LYS n 
1 129 TYR n 
1 130 TRP n 
1 131 TYR n 
1 132 GLU n 
1 133 ASN n 
1 134 HIS n 
1 135 ALA n 
1 136 ILE n 
1 137 SER n 
1 138 ILE n 
1 139 THR n 
1 140 ASN n 
1 141 ALA n 
1 142 ALA n 
1 143 ALA n 
1 144 GLU n 
1 145 ASP n 
1 146 SER n 
1 147 GLY n 
1 148 THR n 
1 149 TYR n 
1 150 TYR n 
1 151 CYS n 
1 152 THR n 
1 153 GLY n 
1 154 LYS n 
1 155 VAL n 
1 156 TRP n 
1 157 GLN n 
1 158 LEU n 
1 159 ASP n 
1 160 TYR n 
1 161 GLU n 
1 162 SER n 
1 163 GLU n 
1 164 PRO n 
1 165 LEU n 
1 166 ASN n 
1 167 ILE n 
1 168 THR n 
1 169 VAL n 
1 170 ILE n 
1 171 LYS n 
1 172 ALA n 
1 173 PRO n 
1 174 ARG n 
1 175 GLU n 
1 176 LYS n 
2 1   ALA n 
2 2   ASP n 
2 3   PRO n 
2 4   CYS n 
2 5   ASP n 
2 6   SER n 
2 7   ASN n 
2 8   PRO n 
2 9   ARG n 
2 10  GLY n 
2 11  VAL n 
2 12  SER n 
2 13  ALA n 
2 14  TYR n 
2 15  LEU n 
2 16  SER n 
2 17  ARG n 
2 18  PRO n 
2 19  SER n 
2 20  PRO n 
2 21  PHE n 
2 22  ASP n 
2 23  LEU n 
2 24  PHE n 
2 25  ILE n 
2 26  ARG n 
2 27  LYS n 
2 28  SER n 
2 29  PRO n 
2 30  THR n 
2 31  ILE n 
2 32  THR n 
2 33  CYS n 
2 34  LEU n 
2 35  VAL n 
2 36  VAL n 
2 37  ASP n 
2 38  LEU n 
2 39  ALA n 
2 40  PRO n 
2 41  SER n 
2 42  LYS n 
2 43  GLY n 
2 44  THR n 
2 45  VAL n 
2 46  ASN n 
2 47  LEU n 
2 48  THR n 
2 49  TRP n 
2 50  SER n 
2 51  ARG n 
2 52  ALA n 
2 53  SER n 
2 54  GLY n 
2 55  LYS n 
2 56  PRO n 
2 57  VAL n 
2 58  ASN n 
2 59  HIS n 
2 60  SER n 
2 61  THR n 
2 62  ARG n 
2 63  LYS n 
2 64  GLU n 
2 65  GLU n 
2 66  LYS n 
2 67  GLN n 
2 68  ARG n 
2 69  ASN n 
2 70  GLY n 
2 71  THR n 
2 72  LEU n 
2 73  THR n 
2 74  VAL n 
2 75  THR n 
2 76  SER n 
2 77  THR n 
2 78  LEU n 
2 79  PRO n 
2 80  VAL n 
2 81  GLY n 
2 82  THR n 
2 83  ARG n 
2 84  ASP n 
2 85  TRP n 
2 86  ILE n 
2 87  GLU n 
2 88  GLY n 
2 89  GLU n 
2 90  THR n 
2 91  TYR n 
2 92  GLN n 
2 93  CYS n 
2 94  ARG n 
2 95  VAL n 
2 96  THR n 
2 97  HIS n 
2 98  PRO n 
2 99  HIS n 
2 100 LEU n 
2 101 PRO n 
2 102 ARG n 
2 103 ALA n 
2 104 LEU n 
2 105 MET n 
2 106 ARG n 
2 107 SER n 
2 108 THR n 
2 109 THR n 
2 110 LYS n 
2 111 THR n 
2 112 SER n 
2 113 GLY n 
2 114 PRO n 
2 115 ARG n 
2 116 ALA n 
2 117 ALA n 
2 118 PRO n 
2 119 GLU n 
2 120 VAL n 
2 121 TYR n 
2 122 ALA n 
2 123 PHE n 
2 124 ALA n 
2 125 THR n 
2 126 PRO n 
2 127 GLU n 
2 128 TRP n 
2 129 PRO n 
2 130 GLY n 
2 131 SER n 
2 132 ARG n 
2 133 ASP n 
2 134 LYS n 
2 135 ARG n 
2 136 THR n 
2 137 LEU n 
2 138 ALA n 
2 139 CYS n 
2 140 LEU n 
2 141 ILE n 
2 142 GLN n 
2 143 ASN n 
2 144 PHE n 
2 145 MET n 
2 146 PRO n 
2 147 GLU n 
2 148 ASP n 
2 149 ILE n 
2 150 SER n 
2 151 VAL n 
2 152 GLN n 
2 153 TRP n 
2 154 LEU n 
2 155 HIS n 
2 156 ASN n 
2 157 GLU n 
2 158 VAL n 
2 159 GLN n 
2 160 LEU n 
2 161 PRO n 
2 162 ASP n 
2 163 ALA n 
2 164 ARG n 
2 165 HIS n 
2 166 SER n 
2 167 THR n 
2 168 THR n 
2 169 GLN n 
2 170 PRO n 
2 171 ARG n 
2 172 LYS n 
2 173 THR n 
2 174 LYS n 
2 175 GLY n 
2 176 SER n 
2 177 GLY n 
2 178 PHE n 
2 179 PHE n 
2 180 VAL n 
2 181 PHE n 
2 182 SER n 
2 183 ARG n 
2 184 LEU n 
2 185 GLU n 
2 186 VAL n 
2 187 THR n 
2 188 ARG n 
2 189 ALA n 
2 190 GLU n 
2 191 TRP n 
2 192 GLU n 
2 193 GLN n 
2 194 LYS n 
2 195 ASP n 
2 196 GLU n 
2 197 PHE n 
2 198 ILE n 
2 199 CYS n 
2 200 ARG n 
2 201 ALA n 
2 202 VAL n 
2 203 HIS n 
2 204 GLU n 
2 205 ALA n 
2 206 ALA n 
2 207 SER n 
2 208 PRO n 
2 209 SER n 
2 210 GLN n 
2 211 THR n 
2 212 VAL n 
2 213 GLN n 
2 214 ARG n 
2 215 ALA n 
2 216 VAL n 
2 217 SER n 
2 218 VAL n 
2 219 ASN n 
2 220 PRO n 
2 221 GLY n 
2 222 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'HI-5 INSECT CELLS' 'HI-5 INSECT CELLS' ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? PVL1392 ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'HI-5 INSECT CELLS' 'HI-5 INSECT CELLS' ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? BACULOVIRUS ? ? ? PVL1392 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP FCEA_HUMAN P12319 1 
;VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVY
LEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDY
ESEPLNITVIKAPREK
;
26  ? 
2 UNP EPC_HUMAN  P01854 2 
;DSNPRGVSAYLSRPSPFDLFIRKSPTITCLVVDLAPSKGTVNLTWSRASGKPVNHSTRKEEKQRNGTLTVTSTLPVGTRD
WIEGETYQCRVTHPHLPRALMRSTTKTSGPRAAPEVYAFATPEWPGSRDKRTLACLIQNFMPEDISVQWLHNEVQLPDAR
HSTTQPRKTKGSGFFVFSRLEVTRAEWEQKDEFICRAVHEAASPSQTVQRAVSVNPGK
;
211 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1F6A A 1 ? 176 ? P12319 26  ? 201 ? 1   176 
2 2 1F6A B 5 ? 222 ? P01854 211 ? 428 ? 330 547 
3 2 1F6A D 5 ? 222 ? P01854 211 ? 428 ? 330 547 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1F6A ALA A 74  ? UNP P12319 ASN 99  ENGINEERED         74  1  
1 1F6A ALA A 135 ? UNP P12319 ASN 160 ENGINEERED         135 2  
1 1F6A ALA A 142 ? UNP P12319 THR 167 ENGINEERED         142 3  
1 1F6A ALA A 143 ? UNP P12319 VAL 168 'CLONING ARTIFACT' 143 4  
2 1F6A ALA B 1   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 326 5  
2 1F6A ASP B 2   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 327 6  
2 1F6A PRO B 3   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 328 7  
2 1F6A CYS B 4   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 329 8  
3 1F6A ALA D 1   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 326 9  
3 1F6A ASP D 2   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 327 10 
3 1F6A PRO D 3   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 328 11 
3 1F6A CYS D 4   ? UNP P01854 ?   ?   'CLONING ARTIFACT' 329 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                     ?     'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                    ?     'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                  ?     'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                             ?     'C4 H7 N O4'      133.103 
CPS non-polymer         . '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CHAPS 'C32 H58 N2 O7 S' 614.877 
CYS 'L-peptide linking' y CYSTEINE                                                    ?     'C3 H7 N O2 S'    121.158 
FUC saccharide          . ALPHA-L-FUCOSE                                              ?     'C6 H12 O5'       164.156 
GLN 'L-peptide linking' y GLUTAMINE                                                   ?     'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                             ?     'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                     ?     'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                   ?     'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                  ?     'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                     ?     'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                      ?     'C6 H15 N2 O2 1'  147.195 
MAN D-saccharide        . ALPHA-D-MANNOSE                                             ?     'C6 H12 O6'       180.156 
MET 'L-peptide linking' y METHIONINE                                                  ?     'C5 H11 N O2 S'   149.211 
NAG D-saccharide        . N-ACETYL-D-GLUCOSAMINE                                      ?     'C8 H15 N O6'     221.208 
PHE 'L-peptide linking' y PHENYLALANINE                                               ?     'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                     ?     'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                      ?     'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                               ?     'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                   ?     'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                  ?     'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                    ?     'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                      ?     'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1F6A 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   80.0 
_exptl_crystal.density_Matthews      7.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    'Ammonium Sulfate, Tris, CHAPS, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 296K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 113 ? 1 
2 113 ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD MARRESEARCH      1999-11-04 ? 
2 CCD 'ADSC QUANTUM 4' 1999-09-17 ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.034 1.0 
2 1.200 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'APS BEAMLINE 5ID-B' 1.034 APS 5ID-B ? 
2 SYNCHROTRON 'ALS BEAMLINE 5.0.2' 1.200 ALS 5.0.2 ? 
# 
_reflns.entry_id                     1F6A 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             40. 
_reflns.d_resolution_high            3.5 
_reflns.number_obs                   27411 
_reflns.number_all                   27510 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.091 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.0 
_reflns.B_iso_Wilson_estimate        100.5 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.5 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           0.461 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.number_unique_all      2704 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1F6A 
_refine.ls_number_reflns_obs                     27411 
_refine.ls_number_reflns_all                     27510 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               5879235.76 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             36.87 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    99.6 
_refine.ls_R_factor_obs                          0.254 
_refine.ls_R_factor_all                          0.254 
_refine.ls_R_factor_R_work                       0.254 
_refine.ls_R_factor_R_free                       0.273 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1418 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               89.2 
_refine.aniso_B[1][1]                            12.20 
_refine.aniso_B[2][2]                            12.20 
_refine.aniso_B[3][3]                            -24.40 
_refine.aniso_B[1][2]                            17.22 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.260 
_refine.solvent_model_param_bsol                 72.83 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            SHELLS 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1F6A 
_refine_analyze.Luzzati_coordinate_error_obs    0.42 
_refine_analyze.Luzzati_sigma_a_obs             0.61 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.49 
_refine_analyze.Luzzati_sigma_a_free            0.80 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4821 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         430 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               5251 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        36.87 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 25.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.23  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        10.46 4.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       15.79 6.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        16.86 6.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       23.32 7.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_number 
1 RESTRAINTS 0.04 300 ? 2 . . 1 'X-RAY DIFFRACTION' 1 ? 
2 ?          0.08 300 ? 2 . . 2 'X-RAY DIFFRACTION' 2 ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.50 
_refine_ls_shell.d_res_low                        3.72 
_refine_ls_shell.number_reflns_R_work             4236 
_refine_ls_shell.R_factor_R_work                  0.306 
_refine_ls_shell.percent_reflns_obs               99.7 
_refine_ls_shell.R_factor_R_free                  0.349 
_refine_ls_shell.R_factor_R_free_error            0.021 
_refine_ls_shell.percent_reflns_R_free            5.9 
_refine_ls_shell.number_reflns_R_free             265 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 CARBOHYDRATE.PARAM CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
3 ION.PARAM          ION.TOP          'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 2 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                  1F6A 
_struct.title                     'Structure of the human ige-fc bound to its high affinity receptor fc(epsilon)ri(alpha)' 
_struct.pdbx_descriptor           'IGE-FC BOUND TO FC(EPSILON)RI(ALPHA)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F6A 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
'IMMUNOGLOBULIN FOLD, GLYCOPROTEIN, RECEPTOR, IGE-BINDING PROTEIN, IGE ANTIBODY, IGE-FC, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 4 ? 
G  N N 5 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 3 ? 
N  N N 3 ? 
O  N N 5 ? 
P  N N 6 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 4 ? 
EA N N 6 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is the receptor chain A bound to the dimeric antibody chains B and D' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 59  ? SER A 63  ? LYS A 59  SER A 63  5 ? 5 
HELX_P HELX_P2  2  ARG A 111 ? TRP A 113 ? ARG A 111 TRP A 113 5 ? 3 
HELX_P HELX_P3  3  ASN B 7   ? VAL B 11  ? ASN B 332 VAL B 336 5 ? 5 
HELX_P HELX_P4  4  SER B 19  ? ILE B 25  ? SER B 344 ILE B 350 1 ? 7 
HELX_P HELX_P5  5  GLY B 81  ? GLU B 87  ? GLY B 406 GLU B 412 1 ? 7 
HELX_P HELX_P6  6  PRO B 161 ? HIS B 165 ? PRO B 486 HIS B 490 5 ? 5 
HELX_P HELX_P7  7  ARG B 188 ? LYS B 194 ? ARG B 513 LYS B 519 1 ? 7 
HELX_P HELX_P8  8  SER C 19  ? ILE C 25  ? SER D 344 ILE D 350 1 ? 7 
HELX_P HELX_P9  9  GLY C 81  ? GLU C 87  ? GLY D 406 GLU D 412 1 ? 7 
HELX_P HELX_P10 10 PRO C 161 ? HIS C 165 ? PRO D 486 HIS D 490 5 ? 5 
HELX_P HELX_P11 11 ARG C 188 ? LYS C 194 ? ARG D 513 LYS D 519 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A  CYS 26  SG  ? ? ? 1_555 A  CYS 68  SG  ? ? A CYS 26  A CYS 68  1_555 ? ? ? ? ? ? ? 2.050 ? 
disulf2  disulf ? ? A  CYS 107 SG  ? ? ? 1_555 A  CYS 151 SG  ? ? A CYS 107 A CYS 151 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf3  disulf ? ? B  CYS 4   SG  ? ? ? 1_555 C  CYS 4   SG  ? ? B CYS 329 D CYS 329 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4  disulf ? ? B  CYS 33  SG  ? ? ? 1_555 B  CYS 93  SG  ? ? B CYS 358 B CYS 418 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5  disulf ? ? B  CYS 139 SG  ? ? ? 1_555 B  CYS 199 SG  ? ? B CYS 464 B CYS 524 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf6  disulf ? ? C  CYS 33  SG  ? ? ? 1_555 C  CYS 93  SG  ? ? D CYS 358 D CYS 418 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf7  disulf ? ? C  CYS 139 SG  ? ? ? 1_555 C  CYS 199 SG  ? ? D CYS 464 D CYS 524 1_555 ? ? ? ? ? ? ? 2.040 ? 
covale1  covale ? ? E  NAG .   C1  ? ? ? 1_555 D  NAG .   O4  ? ? A NAG 222 A NAG 221 1_555 ? ? ? ? ? ? ? 1.379 ? 
covale2  covale ? ? U  MAN .   C1  ? ? ? 1_555 T  NAG .   O4  ? ? B MAN 696 B NAG 695 1_555 ? ? ? ? ? ? ? 1.383 ? 
covale3  covale ? ? T  NAG .   C1  ? ? ? 1_555 S  NAG .   O4  ? ? B NAG 695 B NAG 694 1_555 ? ? ? ? ? ? ? 1.383 ? 
covale4  covale ? ? F  MAN .   C1  ? ? ? 1_555 E  NAG .   O4  ? ? A MAN 223 A NAG 222 1_555 ? ? ? ? ? ? ? 1.383 ? 
covale5  covale ? ? I  NAG .   O4  ? ? ? 1_555 J  MAN .   C1  ? ? A NAG 243 A MAN 244 1_555 ? ? ? ? ? ? ? 1.384 ? 
covale6  covale ? ? I  NAG .   C1  ? ? ? 1_555 H  NAG .   O4  ? ? A NAG 243 A NAG 242 1_555 ? ? ? ? ? ? ? 1.386 ? 
covale7  covale ? ? M  NAG .   O4  ? ? ? 1_555 N  NAG .   C1  ? ? A NAG 366 A NAG 367 1_555 ? ? ? ? ? ? ? 1.389 ? 
covale8  covale ? ? CA NAG .   O4  ? ? ? 1_555 DA MAN .   C1  ? ? D NAG 695 D MAN 696 1_555 ? ? ? ? ? ? ? 1.392 ? 
covale9  covale ? ? U  MAN .   O3  ? ? ? 1_555 W  MAN .   C1  ? ? B MAN 696 B MAN 698 1_555 ? ? ? ? ? ? ? 1.397 ? 
covale10 covale ? ? BA NAG .   O4  ? ? ? 1_555 CA NAG .   C1  ? ? D NAG 694 D NAG 695 1_555 ? ? ? ? ? ? ? 1.398 ? 
covale11 covale ? ? O  FUC .   C1  ? ? ? 1_555 M  NAG .   O6  ? ? A FUC 369 A NAG 366 1_555 ? ? ? ? ? ? ? 1.402 ? 
covale12 covale ? ? K  MAN .   C1  ? ? ? 1_555 J  MAN .   O3  ? ? A MAN 245 A MAN 244 1_555 ? ? ? ? ? ? ? 1.405 ? 
covale13 covale ? ? G  FUC .   C1  ? ? ? 1_555 D  NAG .   O6  ? ? A FUC 224 A NAG 221 1_555 ? ? ? ? ? ? ? 1.406 ? 
covale14 covale ? ? V  MAN .   O2  ? ? ? 1_555 X  MAN .   C1  ? ? B MAN 697 B MAN 699 1_555 ? ? ? ? ? ? ? 1.407 ? 
covale15 covale ? ? J  MAN .   O6  ? ? ? 1_555 L  MAN .   C1  ? ? A MAN 244 A MAN 246 1_555 ? ? ? ? ? ? ? 1.408 ? 
covale16 covale ? ? U  MAN .   O6  ? ? ? 1_555 V  MAN .   C1  ? ? B MAN 696 B MAN 697 1_555 ? ? ? ? ? ? ? 1.418 ? 
covale17 covale ? ? B  ASN 69  ND2 ? ? ? 1_555 S  NAG .   C1  ? ? B ASN 394 B NAG 694 1_555 ? ? ? ? ? ? ? 1.449 ? 
covale18 covale ? ? M  NAG .   C1  ? ? ? 1_555 A  ASN 166 ND2 ? ? A NAG 366 A ASN 166 1_555 ? ? ? ? ? ? ? 1.449 ? 
covale19 covale ? ? H  NAG .   C1  ? ? ? 1_555 A  ASN 42  ND2 ? ? A NAG 242 A ASN 42  1_555 ? ? ? ? ? ? ? 1.450 ? 
covale20 covale ? ? D  NAG .   C1  ? ? ? 1_555 A  ASN 21  ND2 ? ? A NAG 221 A ASN 21  1_555 ? ? ? ? ? ? ? 1.450 ? 
covale21 covale ? ? BA NAG .   C1  ? ? ? 1_555 C  ASN 69  ND2 ? ? D NAG 694 D ASN 394 1_555 ? ? ? ? ? ? ? 1.455 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 10  A . ? ASN 10  A PRO 11  A ? PRO 11  A 1 -0.08 
2 MET 145 B . ? MET 470 B PRO 146 B ? PRO 471 B 1 -2.45 
3 SER 207 B . ? SER 532 B PRO 208 B ? PRO 533 B 1 0.16  
4 MET 145 C . ? MET 470 D PRO 146 C ? PRO 471 D 1 -0.11 
5 SER 207 C . ? SER 532 D PRO 208 C ? PRO 533 D 1 -0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 5 ? 
C ? 3 ? 
D ? 4 ? 
E ? 5 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
I ? 4 ? 
J ? 3 ? 
K ? 2 ? 
L ? 4 ? 
M ? 3 ? 
N ? 4 ? 
O ? 4 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 7   ? ASN A 10  ? VAL A 7   ASN A 10  
A 2 VAL A 22  ? CYS A 26  ? VAL A 22  CYS A 26  
A 3 SER A 52  ? ILE A 55  ? SER A 52  ILE A 55  
B 1 ARG A 15  ? PHE A 17  ? ARG A 15  PHE A 17  
B 2 VAL A 79  ? PHE A 84  ? VAL A 79  PHE A 84  
B 3 GLY A 64  ? GLN A 69  ? GLY A 64  GLN A 69  
B 4 LYS A 38  ? HIS A 41  ? LYS A 38  HIS A 41  
B 5 SER A 44  ? LEU A 45  ? SER A 44  LEU A 45  
C 1 LEU A 88  ? ALA A 92  ? LEU A 88  ALA A 92  
C 2 LEU A 103 ? GLY A 109 ? LEU A 103 GLY A 109 
D 1 GLU A 125 ? TRP A 130 ? GLU A 125 TRP A 130 
D 2 TYR A 116 ? LYS A 122 ? TYR A 116 LYS A 122 
D 3 GLY A 147 ? VAL A 155 ? GLY A 147 VAL A 155 
D 4 LEU A 158 ? GLU A 161 ? LEU A 158 GLU A 161 
E 1 GLU A 125 ? TRP A 130 ? GLU A 125 TRP A 130 
E 2 TYR A 116 ? LYS A 122 ? TYR A 116 LYS A 122 
E 3 GLY A 147 ? VAL A 155 ? GLY A 147 VAL A 155 
E 4 LEU A 165 ? VAL A 169 ? LEU A 165 VAL A 169 
E 5 VAL A 96  ? VAL A 97  ? VAL A 96  VAL A 97  
F 1 ALA B 13  ? SER B 16  ? ALA B 338 SER B 341 
F 2 THR B 30  ? LEU B 38  ? THR B 355 LEU B 363 
F 3 LEU B 72  ? PRO B 79  ? LEU B 397 PRO B 404 
F 4 LYS B 63  ? LYS B 66  ? LYS B 388 LYS B 391 
G 1 THR B 48  ? ARG B 51  ? THR B 373 ARG B 376 
G 2 THR B 90  ? VAL B 95  ? THR B 415 VAL B 420 
G 3 LEU B 104 ? THR B 109 ? LEU B 429 THR B 434 
H 1 GLU B 119 ? ALA B 124 ? GLU B 444 ALA B 449 
H 2 LYS B 134 ? PHE B 144 ? LYS B 459 PHE B 469 
H 3 PHE B 178 ? THR B 187 ? PHE B 503 THR B 512 
H 4 SER B 166 ? THR B 167 ? SER B 491 THR B 492 
I 1 GLU B 119 ? ALA B 124 ? GLU B 444 ALA B 449 
I 2 LYS B 134 ? PHE B 144 ? LYS B 459 PHE B 469 
I 3 PHE B 178 ? THR B 187 ? PHE B 503 THR B 512 
I 4 ARG B 171 ? LYS B 172 ? ARG B 496 LYS B 497 
J 1 SER B 150 ? VAL B 151 ? SER B 475 VAL B 476 
J 2 ALA B 201 ? VAL B 202 ? ALA B 526 VAL B 527 
J 3 THR B 211 ? VAL B 212 ? THR B 536 VAL B 537 
K 1 PHE B 197 ? ILE B 198 ? PHE B 522 ILE B 523 
K 2 ALA B 215 ? VAL B 216 ? ALA B 540 VAL B 541 
L 1 SER C 12  ? SER C 16  ? SER D 337 SER D 341 
L 2 THR C 30  ? LEU C 38  ? THR D 355 LEU D 363 
L 3 LEU C 72  ? PRO C 79  ? LEU D 397 PRO D 404 
L 4 LYS C 63  ? LYS C 66  ? LYS D 388 LYS D 391 
M 1 LEU C 47  ? ARG C 51  ? LEU D 372 ARG D 376 
M 2 THR C 90  ? VAL C 95  ? THR D 415 VAL D 420 
M 3 LEU C 104 ? THR C 109 ? LEU D 429 THR D 434 
N 1 GLU C 119 ? ALA C 124 ? GLU D 444 ALA D 449 
N 2 LYS C 134 ? PHE C 144 ? LYS D 459 PHE D 469 
N 3 PHE C 178 ? THR C 187 ? PHE D 503 THR D 512 
N 4 SER C 166 ? THR C 167 ? SER D 491 THR D 492 
O 1 GLU C 119 ? ALA C 124 ? GLU D 444 ALA D 449 
O 2 LYS C 134 ? PHE C 144 ? LYS D 459 PHE D 469 
O 3 PHE C 178 ? THR C 187 ? PHE D 503 THR D 512 
O 4 ARG C 171 ? LYS C 172 ? ARG D 496 LYS D 497 
P 1 SER C 150 ? VAL C 151 ? SER D 475 VAL D 476 
P 2 PHE C 197 ? VAL C 202 ? PHE D 522 VAL D 527 
P 3 THR C 211 ? VAL C 216 ? THR D 536 VAL D 541 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ASN A 10  ? N ASN A 10  O THR A 23  ? O THR A 23  
A 2 3 O LEU A 24  ? O LEU A 24  N LEU A 53  ? N LEU A 53  
B 1 2 N ILE A 16  ? N ILE A 16  O GLU A 82  ? O GLU A 82  
B 2 3 N LEU A 81  ? N LEU A 81  O GLY A 64  ? O GLY A 64  
B 3 4 N GLN A 69  ? N GLN A 69  O LYS A 38  ? O LYS A 38  
B 4 5 N HIS A 41  ? N HIS A 41  O SER A 44  ? O SER A 44  
C 1 2 N GLN A 91  ? N GLN A 91  O ARG A 106 ? O ARG A 106 
D 1 2 N TRP A 130 ? N TRP A 130 O VAL A 118 ? O VAL A 118 
D 2 3 N TYR A 121 ? N TYR A 121 O TYR A 150 ? O TYR A 150 
D 3 4 N VAL A 155 ? N VAL A 155 O LEU A 158 ? O LEU A 158 
E 1 2 N TRP A 130 ? N TRP A 130 O VAL A 118 ? O VAL A 118 
E 2 3 N TYR A 121 ? N TYR A 121 O TYR A 150 ? O TYR A 150 
E 3 4 N TYR A 149 ? N TYR A 149 O LEU A 165 ? O LEU A 165 
E 4 5 O THR A 168 ? O THR A 168 N VAL A 97  ? N VAL A 97  
F 1 2 N SER B 16  ? N SER B 341 O THR B 32  ? O THR B 357 
F 2 3 N LEU B 38  ? N LEU B 363 O LEU B 72  ? O LEU B 397 
F 3 4 O THR B 75  ? O THR B 400 N LYS B 63  ? N LYS B 388 
G 1 2 O SER B 50  ? O SER B 375 N GLN B 92  ? N GLN B 417 
G 2 3 O VAL B 95  ? O VAL B 420 N LEU B 104 ? N LEU B 429 
H 1 2 N PHE B 123 ? N PHE B 448 O ALA B 138 ? O ALA B 463 
H 2 3 O PHE B 144 ? O PHE B 469 N PHE B 178 ? N PHE B 503 
H 3 4 O ARG B 183 ? O ARG B 508 N SER B 166 ? N SER B 491 
I 1 2 N PHE B 123 ? N PHE B 448 O ALA B 138 ? O ALA B 463 
I 2 3 O PHE B 144 ? O PHE B 469 N PHE B 178 ? N PHE B 503 
I 3 4 N PHE B 179 ? N PHE B 504 O ARG B 171 ? O ARG B 496 
J 1 2 O SER B 150 ? O SER B 475 N VAL B 202 ? N VAL B 527 
J 2 3 O ALA B 201 ? O ALA B 526 N VAL B 212 ? N VAL B 537 
K 1 2 N PHE B 197 ? N PHE B 522 O VAL B 216 ? O VAL B 541 
L 1 2 N SER C 16  ? N SER D 341 O THR C 32  ? O THR D 357 
L 2 3 N LEU C 38  ? N LEU D 363 O LEU C 72  ? O LEU D 397 
L 3 4 O THR C 75  ? O THR D 400 N LYS C 63  ? N LYS D 388 
M 1 2 O SER C 50  ? O SER D 375 N GLN C 92  ? N GLN D 417 
M 2 3 N VAL C 95  ? N VAL D 420 O LEU C 104 ? O LEU D 429 
N 1 2 N PHE C 123 ? N PHE D 448 O ALA C 138 ? O ALA D 463 
N 2 3 O PHE C 144 ? O PHE D 469 N PHE C 178 ? N PHE D 503 
N 3 4 O ARG C 183 ? O ARG D 508 N SER C 166 ? N SER D 491 
O 1 2 N PHE C 123 ? N PHE D 448 O ALA C 138 ? O ALA D 463 
O 2 3 O PHE C 144 ? O PHE D 469 N PHE C 178 ? N PHE D 503 
O 3 4 N PHE C 179 ? N PHE D 504 O ARG C 171 ? O ARG D 496 
P 1 2 O SER C 150 ? O SER D 475 N VAL C 202 ? N VAL D 527 
P 2 3 O ALA C 201 ? O ALA D 526 N VAL C 212 ? N VAL D 537 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NAG A 221' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NAG A 222' 
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MAN A 223' 
AC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE FUC A 224' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG A 242' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG A 243' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MAN A 244' 
AC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MAN A 245' 
AC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MAN A 246' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NAG A 366' 
BC2 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NAG A 367' 
BC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE FUC A 369' 
BC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG B 694' 
BC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG B 695' 
BC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MAN B 696' 
BC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MAN B 697' 
BC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MAN B 698' 
BC9 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MAN B 699' 
CC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NAG D 694' 
CC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NAG D 695' 
CC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE MAN D 696' 
CC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 201' 
CC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 202' 
CC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 A 203' 
CC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 204' 
CC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 D 205' 
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CPS A 370' 
DC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE CPS A 371' 
DC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CPS D 103' 
DC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CPS D 104' 
DC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CPS D 105' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3 ASN A  21  ? ASN A 21  . ? 1_555 ? 
2   AC1 3 NAG E  .   ? NAG A 222 . ? 1_555 ? 
3   AC1 3 FUC G  .   ? FUC A 224 . ? 1_555 ? 
4   AC2 3 NAG D  .   ? NAG A 221 . ? 1_555 ? 
5   AC2 3 MAN F  .   ? MAN A 223 . ? 1_555 ? 
6   AC2 3 FUC G  .   ? FUC A 224 . ? 1_555 ? 
7   AC3 1 NAG E  .   ? NAG A 222 . ? 1_555 ? 
8   AC4 2 NAG D  .   ? NAG A 221 . ? 1_555 ? 
9   AC4 2 NAG E  .   ? NAG A 222 . ? 1_555 ? 
10  AC5 4 ASN A  42  ? ASN A 42  . ? 1_555 ? 
11  AC5 4 GLU A  61  ? GLU A 61  . ? 1_555 ? 
12  AC5 4 SER A  63  ? SER A 63  . ? 1_555 ? 
13  AC5 4 NAG I  .   ? NAG A 243 . ? 1_555 ? 
14  AC6 4 GLU A  61  ? GLU A 61  . ? 1_555 ? 
15  AC6 4 SER A  63  ? SER A 63  . ? 1_555 ? 
16  AC6 4 NAG H  .   ? NAG A 242 . ? 1_555 ? 
17  AC6 4 MAN J  .   ? MAN A 244 . ? 1_555 ? 
18  AC7 4 PHE A  60  ? PHE A 60  . ? 1_555 ? 
19  AC7 4 NAG I  .   ? NAG A 243 . ? 1_555 ? 
20  AC7 4 MAN K  .   ? MAN A 245 . ? 1_555 ? 
21  AC7 4 MAN L  .   ? MAN A 246 . ? 1_555 ? 
22  AC8 1 MAN J  .   ? MAN A 244 . ? 1_555 ? 
23  AC9 2 MAN J  .   ? MAN A 244 . ? 1_555 ? 
24  AC9 2 ARG C  102 ? ARG D 427 . ? 1_555 ? 
25  BC1 3 ASN A  166 ? ASN A 166 . ? 1_555 ? 
26  BC1 3 NAG N  .   ? NAG A 367 . ? 1_555 ? 
27  BC1 3 FUC O  .   ? FUC A 369 . ? 1_555 ? 
28  BC2 2 NAG M  .   ? NAG A 366 . ? 1_555 ? 
29  BC2 2 FUC O  .   ? FUC A 369 . ? 1_555 ? 
30  BC3 2 NAG M  .   ? NAG A 366 . ? 1_555 ? 
31  BC3 2 NAG N  .   ? NAG A 367 . ? 1_555 ? 
32  BC4 4 ASP B  37  ? ASP B 362 . ? 1_555 ? 
33  BC4 4 GLN B  67  ? GLN B 392 . ? 1_555 ? 
34  BC4 4 ASN B  69  ? ASN B 394 . ? 1_555 ? 
35  BC4 4 NAG T  .   ? NAG B 695 . ? 1_555 ? 
36  BC5 4 TYR B  14  ? TYR B 339 . ? 1_555 ? 
37  BC5 4 GLN B  67  ? GLN B 392 . ? 1_555 ? 
38  BC5 4 NAG S  .   ? NAG B 694 . ? 1_555 ? 
39  BC5 4 MAN U  .   ? MAN B 696 . ? 1_555 ? 
40  BC6 4 TYR B  14  ? TYR B 339 . ? 1_555 ? 
41  BC6 4 NAG T  .   ? NAG B 695 . ? 1_555 ? 
42  BC6 4 MAN V  .   ? MAN B 697 . ? 1_555 ? 
43  BC6 4 MAN W  .   ? MAN B 698 . ? 1_555 ? 
44  BC7 2 MAN U  .   ? MAN B 696 . ? 1_555 ? 
45  BC7 2 MAN X  .   ? MAN B 699 . ? 1_555 ? 
46  BC8 1 MAN U  .   ? MAN B 696 . ? 1_555 ? 
47  BC9 2 GLN B  169 ? GLN B 494 . ? 1_555 ? 
48  BC9 2 MAN V  .   ? MAN B 697 . ? 1_555 ? 
49  CC1 5 ASP C  37  ? ASP D 362 . ? 1_555 ? 
50  CC1 5 GLN C  67  ? GLN D 392 . ? 1_555 ? 
51  CC1 5 ASN C  69  ? ASN D 394 . ? 1_555 ? 
52  CC1 5 THR C  71  ? THR D 396 . ? 1_555 ? 
53  CC1 5 NAG CA .   ? NAG D 695 . ? 1_555 ? 
54  CC2 4 TYR C  14  ? TYR D 339 . ? 1_555 ? 
55  CC2 4 GLN C  67  ? GLN D 392 . ? 1_555 ? 
56  CC2 4 NAG BA .   ? NAG D 694 . ? 1_555 ? 
57  CC2 4 MAN DA .   ? MAN D 696 . ? 1_555 ? 
58  CC3 1 NAG CA .   ? NAG D 695 . ? 1_555 ? 
59  CC4 4 PRO A  2   ? PRO A 2   . ? 2_665 ? 
60  CC4 4 GLN A  72  ? GLN A 72  . ? 2_665 ? 
61  CC4 4 TRP A  130 ? TRP A 130 . ? 1_555 ? 
62  CC4 4 ARG B  9   ? ARG B 334 . ? 1_555 ? 
63  CC5 3 SER B  41  ? SER B 366 . ? 1_555 ? 
64  CC5 3 LYS B  42  ? LYS B 367 . ? 1_555 ? 
65  CC5 3 HIS B  99  ? HIS B 424 . ? 1_555 ? 
66  CC6 2 THR A  139 ? THR A 139 . ? 1_555 ? 
67  CC6 2 ASN A  140 ? ASN A 140 . ? 1_555 ? 
68  CC7 6 THR B  168 ? THR B 493 . ? 1_555 ? 
69  CC7 6 GLN B  169 ? GLN B 494 . ? 1_555 ? 
70  CC7 6 ARG B  171 ? ARG B 496 . ? 1_555 ? 
71  CC7 6 THR C  168 ? THR D 493 . ? 1_555 ? 
72  CC7 6 GLN C  169 ? GLN D 494 . ? 1_555 ? 
73  CC7 6 ARG C  171 ? ARG D 496 . ? 1_555 ? 
74  CC8 2 LEU C  104 ? LEU D 429 . ? 1_555 ? 
75  CC8 2 ARG C  106 ? ARG D 431 . ? 1_555 ? 
76  CC9 6 SER A  36  ? SER A 36  . ? 2_665 ? 
77  CC9 6 LYS A  38  ? LYS A 38  . ? 2_665 ? 
78  CC9 6 ARG A  111 ? ARG A 111 . ? 1_555 ? 
79  CC9 6 TRP A  113 ? TRP A 113 . ? 1_555 ? 
80  CC9 6 CPS R  .   ? CPS A 371 . ? 1_555 ? 
81  CC9 6 CPS HA .   ? CPS D 105 . ? 1_555 ? 
82  DC1 8 LYS A  38  ? LYS A 38  . ? 2_665 ? 
83  DC1 8 GLN A  69  ? GLN A 69  . ? 2_665 ? 
84  DC1 8 GLN A  71  ? GLN A 71  . ? 2_665 ? 
85  DC1 8 GLN A  72  ? GLN A 72  . ? 2_665 ? 
86  DC1 8 TYR A  116 ? TYR A 116 . ? 1_555 ? 
87  DC1 8 CPS Q  .   ? CPS A 370 . ? 1_555 ? 
88  DC1 8 ARG B  102 ? ARG B 427 . ? 1_555 ? 
89  DC1 8 SER C  6   ? SER D 331 . ? 1_555 ? 
90  DC2 4 TRP A  156 ? TRP A 156 . ? 1_555 ? 
91  DC2 4 CPS GA .   ? CPS D 104 . ? 1_555 ? 
92  DC2 4 ALA C  39  ? ALA D 364 . ? 1_555 ? 
93  DC2 4 HIS C  99  ? HIS D 424 . ? 1_555 ? 
94  DC3 4 LEU A  45  ? LEU A 45  . ? 2_665 ? 
95  DC3 4 GLU A  47  ? GLU A 47  . ? 2_665 ? 
96  DC3 4 CPS FA .   ? CPS D 103 . ? 1_555 ? 
97  DC3 4 CPS HA .   ? CPS D 105 . ? 1_555 ? 
98  DC4 4 CPS Q  .   ? CPS A 370 . ? 1_555 ? 
99  DC4 4 CPS GA .   ? CPS D 104 . ? 1_555 ? 
100 DC4 4 LYS C  42  ? LYS D 367 . ? 1_555 ? 
101 DC4 4 HIS C  99  ? HIS D 424 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F6A 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F6A 
_atom_sites.fract_transf_matrix[1][1]   0.005187 
_atom_sites.fract_transf_matrix[1][2]   0.002995 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005989 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003307 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . VAL A  1 1   ? -3.255  78.193  159.967 1.00 150.41 ? 1   VAL A N   1 
ATOM   2    C CA  . VAL A  1 1   ? -2.715  78.740  158.688 1.00 162.49 ? 1   VAL A CA  1 
ATOM   3    C C   . VAL A  1 1   ? -2.948  80.258  158.492 1.00 164.24 ? 1   VAL A C   1 
ATOM   4    O O   . VAL A  1 1   ? -2.487  80.838  157.504 1.00 171.89 ? 1   VAL A O   1 
ATOM   5    C CB  . VAL A  1 1   ? -3.308  77.955  157.480 1.00 159.64 ? 1   VAL A CB  1 
ATOM   6    C CG1 . VAL A  1 1   ? -2.631  78.371  156.184 1.00 162.49 ? 1   VAL A CG1 1 
ATOM   7    C CG2 . VAL A  1 1   ? -3.131  76.460  157.704 1.00 156.53 ? 1   VAL A CG2 1 
ATOM   8    N N   . PRO A  1 2   ? -3.652  80.926  159.432 1.00 155.13 ? 2   PRO A N   1 
ATOM   9    C CA  . PRO A  1 2   ? -3.883  82.370  159.264 1.00 151.85 ? 2   PRO A CA  1 
ATOM   10   C C   . PRO A  1 2   ? -2.659  83.238  159.588 1.00 150.25 ? 2   PRO A C   1 
ATOM   11   O O   . PRO A  1 2   ? -1.561  82.723  159.805 1.00 148.75 ? 2   PRO A O   1 
ATOM   12   C CB  . PRO A  1 2   ? -5.040  82.635  160.223 1.00 147.57 ? 2   PRO A CB  1 
ATOM   13   C CG  . PRO A  1 2   ? -4.741  81.687  161.341 1.00 131.92 ? 2   PRO A CG  1 
ATOM   14   C CD  . PRO A  1 2   ? -4.400  80.420  160.599 1.00 134.02 ? 2   PRO A CD  1 
ATOM   15   N N   . GLN A  1 3   ? -2.850  84.557  159.604 1.00 146.51 ? 3   GLN A N   1 
ATOM   16   C CA  . GLN A  1 3   ? -1.767  85.480  159.940 1.00 123.15 ? 3   GLN A CA  1 
ATOM   17   C C   . GLN A  1 3   ? -1.604  85.479  161.457 1.00 107.40 ? 3   GLN A C   1 
ATOM   18   O O   . GLN A  1 3   ? -2.582  85.634  162.192 1.00 91.70  ? 3   GLN A O   1 
ATOM   19   C CB  . GLN A  1 3   ? -2.084  86.902  159.460 1.00 119.23 ? 3   GLN A CB  1 
ATOM   20   C CG  . GLN A  1 3   ? -1.705  87.173  158.009 1.00 144.87 ? 3   GLN A CG  1 
ATOM   21   C CD  . GLN A  1 3   ? -2.117  88.561  157.535 1.00 151.87 ? 3   GLN A CD  1 
ATOM   22   O OE1 . GLN A  1 3   ? -1.725  89.570  158.120 1.00 140.36 ? 3   GLN A OE1 1 
ATOM   23   N NE2 . GLN A  1 3   ? -2.908  88.616  156.462 1.00 150.69 ? 3   GLN A NE2 1 
ATOM   24   N N   . LYS A  1 4   ? -0.370  85.284  161.916 1.00 96.05  ? 4   LYS A N   1 
ATOM   25   C CA  . LYS A  1 4   ? -0.062  85.264  163.344 1.00 77.79  ? 4   LYS A CA  1 
ATOM   26   C C   . LYS A  1 4   ? 0.069   86.705  163.805 1.00 62.59  ? 4   LYS A C   1 
ATOM   27   O O   . LYS A  1 4   ? 0.179   87.615  162.990 1.00 83.66  ? 4   LYS A O   1 
ATOM   28   C CB  . LYS A  1 4   ? 1.263   84.535  163.607 1.00 91.78  ? 4   LYS A CB  1 
ATOM   29   C CG  . LYS A  1 4   ? 1.320   83.103  163.084 1.00 140.39 ? 4   LYS A CG  1 
ATOM   30   C CD  . LYS A  1 4   ? 2.645   82.417  163.434 1.00 151.52 ? 4   LYS A CD  1 
ATOM   31   C CE  . LYS A  1 4   ? 2.670   80.974  162.925 1.00 162.11 ? 4   LYS A CE  1 
ATOM   32   N NZ  . LYS A  1 4   ? 3.932   80.256  163.268 1.00 147.44 ? 4   LYS A NZ  1 
ATOM   33   N N   . PRO A  1 5   ? 0.051   86.938  165.121 1.00 43.02  ? 5   PRO A N   1 
ATOM   34   C CA  . PRO A  1 5   ? 0.176   88.304  165.632 1.00 52.49  ? 5   PRO A CA  1 
ATOM   35   C C   . PRO A  1 5   ? 1.638   88.734  165.804 1.00 67.76  ? 5   PRO A C   1 
ATOM   36   O O   . PRO A  1 5   ? 2.469   87.967  166.293 1.00 69.57  ? 5   PRO A O   1 
ATOM   37   C CB  . PRO A  1 5   ? -0.576  88.231  166.949 1.00 42.40  ? 5   PRO A CB  1 
ATOM   38   C CG  . PRO A  1 5   ? -0.226  86.882  167.417 1.00 37.30  ? 5   PRO A CG  1 
ATOM   39   C CD  . PRO A  1 5   ? -0.398  86.034  166.189 1.00 38.97  ? 5   PRO A CD  1 
ATOM   40   N N   . LYS A  1 6   ? 1.944   89.961  165.388 1.00 76.48  ? 6   LYS A N   1 
ATOM   41   C CA  . LYS A  1 6   ? 3.304   90.497  165.470 1.00 78.70  ? 6   LYS A CA  1 
ATOM   42   C C   . LYS A  1 6   ? 3.467   91.461  166.658 1.00 69.23  ? 6   LYS A C   1 
ATOM   43   O O   . LYS A  1 6   ? 2.486   92.000  167.156 1.00 41.51  ? 6   LYS A O   1 
ATOM   44   C CB  . LYS A  1 6   ? 3.647   91.212  164.151 1.00 84.74  ? 6   LYS A CB  1 
ATOM   45   C CG  . LYS A  1 6   ? 5.083   91.745  164.040 1.00 133.15 ? 6   LYS A CG  1 
ATOM   46   C CD  . LYS A  1 6   ? 6.120   90.634  163.856 1.00 155.38 ? 6   LYS A CD  1 
ATOM   47   C CE  . LYS A  1 6   ? 7.533   91.195  163.662 1.00 165.86 ? 6   LYS A CE  1 
ATOM   48   N NZ  . LYS A  1 6   ? 7.695   91.956  162.385 1.00 169.49 ? 6   LYS A NZ  1 
ATOM   49   N N   . VAL A  1 7   ? 4.706   91.655  167.118 1.00 68.84  ? 7   VAL A N   1 
ATOM   50   C CA  . VAL A  1 7   ? 5.010   92.561  168.234 1.00 43.54  ? 7   VAL A CA  1 
ATOM   51   C C   . VAL A  1 7   ? 5.970   93.614  167.743 1.00 46.07  ? 7   VAL A C   1 
ATOM   52   O O   . VAL A  1 7   ? 6.960   93.293  167.084 1.00 70.78  ? 7   VAL A O   1 
ATOM   53   C CB  . VAL A  1 7   ? 5.718   91.859  169.380 1.00 30.10  ? 7   VAL A CB  1 
ATOM   54   C CG1 . VAL A  1 7   ? 4.920   92.017  170.651 1.00 29.10  ? 7   VAL A CG1 1 
ATOM   55   C CG2 . VAL A  1 7   ? 5.937   90.401  169.033 1.00 64.66  ? 7   VAL A CG2 1 
ATOM   56   N N   . SER A  1 8   ? 5.680   94.867  168.065 1.00 37.06  ? 8   SER A N   1 
ATOM   57   C CA  . SER A  1 8   ? 6.527   95.968  167.652 1.00 50.21  ? 8   SER A CA  1 
ATOM   58   C C   . SER A  1 8   ? 7.100   96.651  168.898 1.00 58.39  ? 8   SER A C   1 
ATOM   59   O O   . SER A  1 8   ? 6.467   96.688  169.957 1.00 59.32  ? 8   SER A O   1 
ATOM   60   C CB  . SER A  1 8   ? 5.721   96.962  166.816 1.00 53.62  ? 8   SER A CB  1 
ATOM   61   O OG  . SER A  1 8   ? 4.731   97.609  167.600 1.00 90.69  ? 8   SER A OG  1 
ATOM   62   N N   . LEU A  1 9   ? 8.311   97.173  168.772 1.00 45.96  ? 9   LEU A N   1 
ATOM   63   C CA  . LEU A  1 9   ? 8.962   97.844  169.877 1.00 29.92  ? 9   LEU A CA  1 
ATOM   64   C C   . LEU A  1 9   ? 9.127   99.312  169.564 1.00 35.58  ? 9   LEU A C   1 
ATOM   65   O O   . LEU A  1 9   ? 9.420   99.680  168.438 1.00 55.59  ? 9   LEU A O   1 
ATOM   66   C CB  . LEU A  1 9   ? 10.335  97.254  170.082 1.00 29.32  ? 9   LEU A CB  1 
ATOM   67   C CG  . LEU A  1 9   ? 10.470  95.929  170.799 1.00 4.74   ? 9   LEU A CG  1 
ATOM   68   C CD1 . LEU A  1 9   ? 11.720  95.218  170.359 1.00 49.71  ? 9   LEU A CD1 1 
ATOM   69   C CD2 . LEU A  1 9   ? 10.552  96.200  172.244 1.00 37.87  ? 9   LEU A CD2 1 
ATOM   70   N N   . ASN A  1 10  ? 8.948   100.161 170.558 1.00 35.21  ? 10  ASN A N   1 
ATOM   71   C CA  . ASN A  1 10  ? 9.130   101.576 170.325 1.00 32.41  ? 10  ASN A CA  1 
ATOM   72   C C   . ASN A  1 10  ? 9.683   102.237 171.567 1.00 37.30  ? 10  ASN A C   1 
ATOM   73   O O   . ASN A  1 10  ? 8.989   102.372 172.570 1.00 46.50  ? 10  ASN A O   1 
ATOM   74   C CB  . ASN A  1 10  ? 7.815   102.221 169.923 1.00 55.16  ? 10  ASN A CB  1 
ATOM   75   C CG  . ASN A  1 10  ? 7.972   103.675 169.566 1.00 68.41  ? 10  ASN A CG  1 
ATOM   76   O OD1 . ASN A  1 10  ? 7.555   104.551 170.319 1.00 76.53  ? 10  ASN A OD1 1 
ATOM   77   N ND2 . ASN A  1 10  ? 8.588   103.946 168.419 1.00 70.17  ? 10  ASN A ND2 1 
ATOM   78   N N   . PRO A  1 11  ? 10.952  102.661 171.513 1.00 34.32  ? 11  PRO A N   1 
ATOM   79   C CA  . PRO A  1 11  ? 11.852  102.543 170.367 1.00 28.55  ? 11  PRO A CA  1 
ATOM   80   C C   . PRO A  1 11  ? 12.331  101.123 170.053 1.00 31.52  ? 11  PRO A C   1 
ATOM   81   O O   . PRO A  1 11  ? 12.575  100.322 170.964 1.00 33.51  ? 11  PRO A O   1 
ATOM   82   C CB  . PRO A  1 11  ? 12.980  103.476 170.747 1.00 39.15  ? 11  PRO A CB  1 
ATOM   83   C CG  . PRO A  1 11  ? 12.266  104.514 171.534 1.00 44.19  ? 11  PRO A CG  1 
ATOM   84   C CD  . PRO A  1 11  ? 11.474  103.662 172.446 1.00 33.64  ? 11  PRO A CD  1 
ATOM   85   N N   . PRO A  1 12  ? 12.530  100.832 168.752 1.00 18.38  ? 12  PRO A N   1 
ATOM   86   C CA  . PRO A  1 12  ? 12.961  99.600  168.075 1.00 18.95  ? 12  PRO A CA  1 
ATOM   87   C C   . PRO A  1 12  ? 13.858  98.688  168.875 1.00 37.30  ? 12  PRO A C   1 
ATOM   88   O O   . PRO A  1 12  ? 13.653  97.480  168.946 1.00 56.64  ? 12  PRO A O   1 
ATOM   89   C CB  . PRO A  1 12  ? 13.691  100.118 166.845 1.00 20.14  ? 12  PRO A CB  1 
ATOM   90   C CG  . PRO A  1 12  ? 13.032  101.395 166.573 1.00 36.76  ? 12  PRO A CG  1 
ATOM   91   C CD  . PRO A  1 12  ? 12.912  101.992 167.931 1.00 4.74   ? 12  PRO A CD  1 
ATOM   92   N N   . TRP A  1 13  ? 14.881  99.297  169.445 1.00 42.05  ? 13  TRP A N   1 
ATOM   93   C CA  . TRP A  1 13  ? 15.898  98.623  170.226 1.00 32.28  ? 13  TRP A CA  1 
ATOM   94   C C   . TRP A  1 13  ? 15.357  97.588  171.200 1.00 44.57  ? 13  TRP A C   1 
ATOM   95   O O   . TRP A  1 13  ? 14.615  97.929  172.116 1.00 48.22  ? 13  TRP A O   1 
ATOM   96   C CB  . TRP A  1 13  ? 16.675  99.690  170.966 1.00 27.45  ? 13  TRP A CB  1 
ATOM   97   C CG  . TRP A  1 13  ? 16.638  100.993 170.234 1.00 19.69  ? 13  TRP A CG  1 
ATOM   98   C CD1 . TRP A  1 13  ? 16.310  102.211 170.749 1.00 44.90  ? 13  TRP A CD1 1 
ATOM   99   C CD2 . TRP A  1 13  ? 16.993  101.221 168.870 1.00 19.72  ? 13  TRP A CD2 1 
ATOM   100  N NE1 . TRP A  1 13  ? 16.446  103.183 169.797 1.00 17.63  ? 13  TRP A NE1 1 
ATOM   101  C CE2 . TRP A  1 13  ? 16.869  102.602 168.631 1.00 19.16  ? 13  TRP A CE2 1 
ATOM   102  C CE3 . TRP A  1 13  ? 17.413  100.392 167.826 1.00 28.17  ? 13  TRP A CE3 1 
ATOM   103  C CZ2 . TRP A  1 13  ? 17.158  103.178 167.391 1.00 25.03  ? 13  TRP A CZ2 1 
ATOM   104  C CZ3 . TRP A  1 13  ? 17.698  100.965 166.596 1.00 29.72  ? 13  TRP A CZ3 1 
ATOM   105  C CH2 . TRP A  1 13  ? 17.572  102.346 166.393 1.00 32.36  ? 13  TRP A CH2 1 
ATOM   106  N N   . ASN A  1 14  ? 15.726  96.326  171.003 1.00 36.78  ? 14  ASN A N   1 
ATOM   107  C CA  . ASN A  1 14  ? 15.272  95.289  171.905 1.00 46.46  ? 14  ASN A CA  1 
ATOM   108  C C   . ASN A  1 14  ? 16.328  95.017  172.956 1.00 45.77  ? 14  ASN A C   1 
ATOM   109  O O   . ASN A  1 14  ? 16.232  94.049  173.704 1.00 60.03  ? 14  ASN A O   1 
ATOM   110  C CB  . ASN A  1 14  ? 14.910  94.012  171.148 1.00 58.28  ? 14  ASN A CB  1 
ATOM   111  C CG  . ASN A  1 14  ? 15.994  93.556  170.225 1.00 57.13  ? 14  ASN A CG  1 
ATOM   112  O OD1 . ASN A  1 14  ? 17.116  93.309  170.653 1.00 33.92  ? 14  ASN A OD1 1 
ATOM   113  N ND2 . ASN A  1 14  ? 15.668  93.437  168.940 1.00 84.09  ? 14  ASN A ND2 1 
ATOM   114  N N   . ARG A  1 15  ? 17.344  95.876  172.992 1.00 41.70  ? 15  ARG A N   1 
ATOM   115  C CA  . ARG A  1 15  ? 18.420  95.815  173.989 1.00 36.85  ? 15  ARG A CA  1 
ATOM   116  C C   . ARG A  1 15  ? 18.581  97.235  174.499 1.00 25.29  ? 15  ARG A C   1 
ATOM   117  O O   . ARG A  1 15  ? 18.822  98.147  173.725 1.00 15.82  ? 15  ARG A O   1 
ATOM   118  C CB  . ARG A  1 15  ? 19.738  95.306  173.392 1.00 34.00  ? 15  ARG A CB  1 
ATOM   119  C CG  . ARG A  1 15  ? 20.077  95.790  172.006 1.00 44.44  ? 15  ARG A CG  1 
ATOM   120  C CD  . ARG A  1 15  ? 21.494  95.348  171.646 1.00 59.48  ? 15  ARG A CD  1 
ATOM   121  N NE  . ARG A  1 15  ? 21.733  93.931  171.916 1.00 41.86  ? 15  ARG A NE  1 
ATOM   122  C CZ  . ARG A  1 15  ? 22.922  93.426  172.230 1.00 58.68  ? 15  ARG A CZ  1 
ATOM   123  N NH1 . ARG A  1 15  ? 23.985  94.212  172.321 1.00 35.30  ? 15  ARG A NH1 1 
ATOM   124  N NH2 . ARG A  1 15  ? 23.050  92.129  172.455 1.00 94.33  ? 15  ARG A NH2 1 
ATOM   125  N N   . ILE A  1 16  ? 18.440  97.420  175.802 1.00 20.96  ? 16  ILE A N   1 
ATOM   126  C CA  . ILE A  1 16  ? 18.502  98.752  176.385 1.00 25.39  ? 16  ILE A CA  1 
ATOM   127  C C   . ILE A  1 16  ? 19.170  98.826  177.745 1.00 30.68  ? 16  ILE A C   1 
ATOM   128  O O   . ILE A  1 16  ? 19.175  97.854  178.495 1.00 47.32  ? 16  ILE A O   1 
ATOM   129  C CB  . ILE A  1 16  ? 17.101  99.298  176.601 1.00 32.85  ? 16  ILE A CB  1 
ATOM   130  C CG1 . ILE A  1 16  ? 16.283  98.250  177.349 1.00 18.15  ? 16  ILE A CG1 1 
ATOM   131  C CG2 . ILE A  1 16  ? 16.463  99.668  175.286 1.00 45.23  ? 16  ILE A CG2 1 
ATOM   132  C CD1 . ILE A  1 16  ? 14.931  98.711  177.716 1.00 36.80  ? 16  ILE A CD1 1 
ATOM   133  N N   . PHE A  1 17  ? 19.693  100.003 178.070 1.00 24.10  ? 17  PHE A N   1 
ATOM   134  C CA  . PHE A  1 17  ? 20.332  100.224 179.361 1.00 29.99  ? 17  PHE A CA  1 
ATOM   135  C C   . PHE A  1 17  ? 19.282  100.153 180.456 1.00 21.39  ? 17  PHE A C   1 
ATOM   136  O O   . PHE A  1 17  ? 18.146  100.564 180.256 1.00 8.49   ? 17  PHE A O   1 
ATOM   137  C CB  . PHE A  1 17  ? 20.977  101.603 179.405 1.00 37.12  ? 17  PHE A CB  1 
ATOM   138  C CG  . PHE A  1 17  ? 22.216  101.709 178.604 1.00 39.29  ? 17  PHE A CG  1 
ATOM   139  C CD1 . PHE A  1 17  ? 22.493  102.868 177.889 1.00 55.30  ? 17  PHE A CD1 1 
ATOM   140  C CD2 . PHE A  1 17  ? 23.105  100.649 178.544 1.00 16.79  ? 17  PHE A CD2 1 
ATOM   141  C CE1 . PHE A  1 17  ? 23.633  102.972 177.121 1.00 45.31  ? 17  PHE A CE1 1 
ATOM   142  C CE2 . PHE A  1 17  ? 24.246  100.739 177.782 1.00 47.57  ? 17  PHE A CE2 1 
ATOM   143  C CZ  . PHE A  1 17  ? 24.513  101.904 177.065 1.00 64.58  ? 17  PHE A CZ  1 
ATOM   144  N N   . LYS A  1 18  ? 19.661  99.662  181.624 1.00 11.16  ? 18  LYS A N   1 
ATOM   145  C CA  . LYS A  1 18  ? 18.702  99.583  182.696 1.00 22.25  ? 18  LYS A CA  1 
ATOM   146  C C   . LYS A  1 18  ? 18.213  100.972 183.034 1.00 15.87  ? 18  LYS A C   1 
ATOM   147  O O   . LYS A  1 18  ? 18.976  101.919 183.006 1.00 6.21   ? 18  LYS A O   1 
ATOM   148  C CB  . LYS A  1 18  ? 19.318  98.921  183.931 1.00 17.12  ? 18  LYS A CB  1 
ATOM   149  C CG  . LYS A  1 18  ? 19.768  99.862  185.000 1.00 30.69  ? 18  LYS A CG  1 
ATOM   150  C CD  . LYS A  1 18  ? 20.290  99.109  186.226 1.00 50.20  ? 18  LYS A CD  1 
ATOM   151  C CE  . LYS A  1 18  ? 19.181  98.710  187.181 1.00 63.33  ? 18  LYS A CE  1 
ATOM   152  N NZ  . LYS A  1 18  ? 19.692  98.586  188.585 1.00 75.34  ? 18  LYS A NZ  1 
ATOM   153  N N   . GLY A  1 19  ? 16.928  101.071 183.353 1.00 33.10  ? 19  GLY A N   1 
ATOM   154  C CA  . GLY A  1 19  ? 16.338  102.342 183.702 1.00 30.24  ? 19  GLY A CA  1 
ATOM   155  C C   . GLY A  1 19  ? 15.760  103.020 182.487 1.00 33.80  ? 19  GLY A C   1 
ATOM   156  O O   . GLY A  1 19  ? 15.196  104.106 182.580 1.00 54.20  ? 19  GLY A O   1 
ATOM   157  N N   . GLU A  1 20  ? 15.916  102.389 181.332 1.00 30.98  ? 20  GLU A N   1 
ATOM   158  C CA  . GLU A  1 20  ? 15.390  102.959 180.101 1.00 41.12  ? 20  GLU A CA  1 
ATOM   159  C C   . GLU A  1 20  ? 13.950  102.532 179.893 1.00 49.16  ? 20  GLU A C   1 
ATOM   160  O O   . GLU A  1 20  ? 13.449  101.624 180.565 1.00 31.11  ? 20  GLU A O   1 
ATOM   161  C CB  . GLU A  1 20  ? 16.245  102.547 178.901 1.00 69.55  ? 20  GLU A CB  1 
ATOM   162  C CG  . GLU A  1 20  ? 17.645  103.141 178.937 1.00 75.48  ? 20  GLU A CG  1 
ATOM   163  C CD  . GLU A  1 20  ? 18.374  103.073 177.608 1.00 78.09  ? 20  GLU A CD  1 
ATOM   164  O OE1 . GLU A  1 20  ? 19.490  103.620 177.537 1.00 67.18  ? 20  GLU A OE1 1 
ATOM   165  O OE2 . GLU A  1 20  ? 17.847  102.483 176.639 1.00 74.74  ? 20  GLU A OE2 1 
ATOM   166  N N   . ASN A  1 21  ? 13.280  103.200 178.964 1.00 49.53  ? 21  ASN A N   1 
ATOM   167  C CA  . ASN A  1 21  ? 11.885  102.910 178.692 1.00 46.93  ? 21  ASN A CA  1 
ATOM   168  C C   . ASN A  1 21  ? 11.653  102.271 177.340 1.00 48.54  ? 21  ASN A C   1 
ATOM   169  O O   . ASN A  1 21  ? 12.362  102.554 176.384 1.00 66.59  ? 21  ASN A O   1 
ATOM   170  C CB  . ASN A  1 21  ? 11.057  104.195 178.786 1.00 49.18  ? 21  ASN A CB  1 
ATOM   171  C CG  . ASN A  1 21  ? 11.008  104.762 180.191 1.00 48.46  ? 21  ASN A CG  1 
ATOM   172  O OD1 . ASN A  1 21  ? 10.954  104.009 181.164 1.00 30.27  ? 21  ASN A OD1 1 
ATOM   173  N ND2 . ASN A  1 21  ? 11.002  106.089 180.298 1.00 66.40  ? 21  ASN A ND2 1 
ATOM   174  N N   . VAL A  1 22  ? 10.651  101.405 177.270 1.00 45.81  ? 22  VAL A N   1 
ATOM   175  C CA  . VAL A  1 22  ? 10.305  100.748 176.023 1.00 45.72  ? 22  VAL A CA  1 
ATOM   176  C C   . VAL A  1 22  ? 8.861   100.308 176.057 1.00 49.34  ? 22  VAL A C   1 
ATOM   177  O O   . VAL A  1 22  ? 8.299   100.143 177.134 1.00 52.92  ? 22  VAL A O   1 
ATOM   178  C CB  . VAL A  1 22  ? 11.168  99.525  175.769 1.00 30.42  ? 22  VAL A CB  1 
ATOM   179  C CG1 . VAL A  1 22  ? 10.880  98.461  176.789 1.00 29.02  ? 22  VAL A CG1 1 
ATOM   180  C CG2 . VAL A  1 22  ? 10.896  99.013  174.395 1.00 12.43  ? 22  VAL A CG2 1 
ATOM   181  N N   . THR A  1 23  ? 8.273   100.106 174.879 1.00 46.75  ? 23  THR A N   1 
ATOM   182  C CA  . THR A  1 23  ? 6.876   99.689  174.758 1.00 39.57  ? 23  THR A CA  1 
ATOM   183  C C   . THR A  1 23  ? 6.638   98.564  173.758 1.00 36.29  ? 23  THR A C   1 
ATOM   184  O O   . THR A  1 23  ? 7.121   98.601  172.629 1.00 40.22  ? 23  THR A O   1 
ATOM   185  C CB  . THR A  1 23  ? 5.982   100.883 174.356 1.00 35.18  ? 23  THR A CB  1 
ATOM   186  O OG1 . THR A  1 23  ? 5.325   101.397 175.515 1.00 47.24  ? 23  THR A OG1 1 
ATOM   187  C CG2 . THR A  1 23  ? 4.944   100.470 173.342 1.00 55.87  ? 23  THR A CG2 1 
ATOM   188  N N   . LEU A  1 24  ? 5.869   97.567  174.170 1.00 47.13  ? 24  LEU A N   1 
ATOM   189  C CA  . LEU A  1 24  ? 5.565   96.463  173.278 1.00 48.80  ? 24  LEU A CA  1 
ATOM   190  C C   . LEU A  1 24  ? 4.128   96.607  172.822 1.00 51.85  ? 24  LEU A C   1 
ATOM   191  O O   . LEU A  1 24  ? 3.248   96.866  173.635 1.00 50.10  ? 24  LEU A O   1 
ATOM   192  C CB  . LEU A  1 24  ? 5.754   95.119  173.987 1.00 47.92  ? 24  LEU A CB  1 
ATOM   193  C CG  . LEU A  1 24  ? 7.072   94.939  174.739 1.00 24.69  ? 24  LEU A CG  1 
ATOM   194  C CD1 . LEU A  1 24  ? 7.381   93.488  174.933 1.00 19.74  ? 24  LEU A CD1 1 
ATOM   195  C CD2 . LEU A  1 24  ? 8.159   95.572  173.969 1.00 4.74   ? 24  LEU A CD2 1 
ATOM   196  N N   . THR A  1 25  ? 3.895   96.444  171.523 1.00 52.50  ? 25  THR A N   1 
ATOM   197  C CA  . THR A  1 25  ? 2.554   96.550  170.965 1.00 43.80  ? 25  THR A CA  1 
ATOM   198  C C   . THR A  1 25  ? 2.233   95.282  170.174 1.00 46.63  ? 25  THR A C   1 
ATOM   199  O O   . THR A  1 25  ? 3.120   94.707  169.542 1.00 52.23  ? 25  THR A O   1 
ATOM   200  C CB  . THR A  1 25  ? 2.454   97.761  170.049 1.00 36.94  ? 25  THR A CB  1 
ATOM   201  O OG1 . THR A  1 25  ? 3.088   98.884  170.673 1.00 61.45  ? 25  THR A OG1 1 
ATOM   202  C CG2 . THR A  1 25  ? 1.016   98.098  169.807 1.00 55.23  ? 25  THR A CG2 1 
ATOM   203  N N   . CYS A  1 26  ? 0.970   94.852  170.215 1.00 52.75  ? 26  CYS A N   1 
ATOM   204  C CA  . CYS A  1 26  ? 0.520   93.642  169.525 1.00 44.02  ? 26  CYS A CA  1 
ATOM   205  C C   . CYS A  1 26  ? -0.343  94.009  168.318 1.00 61.30  ? 26  CYS A C   1 
ATOM   206  O O   . CYS A  1 26  ? -1.322  94.734  168.447 1.00 65.28  ? 26  CYS A O   1 
ATOM   207  C CB  . CYS A  1 26  ? -0.256  92.757  170.514 1.00 33.81  ? 26  CYS A CB  1 
ATOM   208  S SG  . CYS A  1 26  ? -0.296  90.939  170.208 1.00 101.97 ? 26  CYS A SG  1 
ATOM   209  N N   . ASN A  1 27  ? 0.083   93.514  167.154 1.00 87.89  ? 27  ASN A N   1 
ATOM   210  C CA  . ASN A  1 27  ? -0.506  93.677  165.805 1.00 103.47 ? 27  ASN A CA  1 
ATOM   211  C C   . ASN A  1 27  ? -1.717  94.563  165.469 1.00 87.11  ? 27  ASN A C   1 
ATOM   212  O O   . ASN A  1 27  ? -2.604  94.788  166.278 1.00 96.43  ? 27  ASN A O   1 
ATOM   213  C CB  . ASN A  1 27  ? -0.765  92.286  165.217 1.00 126.32 ? 27  ASN A CB  1 
ATOM   214  C CG  . ASN A  1 27  ? -0.588  92.249  163.708 1.00 156.37 ? 27  ASN A CG  1 
ATOM   215  O OD1 . ASN A  1 27  ? -0.071  93.196  163.106 1.00 167.16 ? 27  ASN A OD1 1 
ATOM   216  N ND2 . ASN A  1 27  ? -0.999  91.145  163.090 1.00 172.86 ? 27  ASN A ND2 1 
ATOM   217  N N   . GLY A  1 28  ? -1.737  95.043  164.228 1.00 77.81  ? 28  GLY A N   1 
ATOM   218  C CA  . GLY A  1 28  ? -2.818  95.887  163.752 1.00 60.31  ? 28  GLY A CA  1 
ATOM   219  C C   . GLY A  1 28  ? -3.811  95.070  162.949 1.00 76.90  ? 28  GLY A C   1 
ATOM   220  O O   . GLY A  1 28  ? -4.658  95.611  162.243 1.00 82.69  ? 28  GLY A O   1 
ATOM   221  N N   . ASN A  1 29  ? -3.686  93.752  163.064 1.00 95.77  ? 29  ASN A N   1 
ATOM   222  C CA  . ASN A  1 29  ? -4.550  92.783  162.388 1.00 88.27  ? 29  ASN A CA  1 
ATOM   223  C C   . ASN A  1 29  ? -5.658  92.466  163.405 1.00 81.17  ? 29  ASN A C   1 
ATOM   224  O O   . ASN A  1 29  ? -6.252  91.389  163.421 1.00 84.48  ? 29  ASN A O   1 
ATOM   225  C CB  . ASN A  1 29  ? -3.729  91.533  162.062 1.00 113.18 ? 29  ASN A CB  1 
ATOM   226  C CG  . ASN A  1 29  ? -4.164  90.852  160.783 1.00 134.94 ? 29  ASN A CG  1 
ATOM   227  O OD1 . ASN A  1 29  ? -4.247  91.480  159.727 1.00 144.54 ? 29  ASN A OD1 1 
ATOM   228  N ND2 . ASN A  1 29  ? -4.428  89.550  160.868 1.00 151.59 ? 29  ASN A ND2 1 
ATOM   229  N N   . ASN A  1 30  ? -5.886  93.448  164.265 1.00 54.27  ? 30  ASN A N   1 
ATOM   230  C CA  . ASN A  1 30  ? -6.878  93.432  165.332 1.00 70.13  ? 30  ASN A CA  1 
ATOM   231  C C   . ASN A  1 30  ? -7.041  94.917  165.623 1.00 68.98  ? 30  ASN A C   1 
ATOM   232  O O   . ASN A  1 30  ? -6.772  95.363  166.729 1.00 51.58  ? 30  ASN A O   1 
ATOM   233  C CB  . ASN A  1 30  ? -6.317  92.689  166.558 1.00 76.42  ? 30  ASN A CB  1 
ATOM   234  C CG  . ASN A  1 30  ? -7.040  93.041  167.875 1.00 80.36  ? 30  ASN A CG  1 
ATOM   235  O OD1 . ASN A  1 30  ? -8.256  92.883  168.011 1.00 86.57  ? 30  ASN A OD1 1 
ATOM   236  N ND2 . ASN A  1 30  ? -6.272  93.507  168.851 1.00 30.74  ? 30  ASN A ND2 1 
ATOM   237  N N   . PHE A  1 31  ? -7.493  95.667  164.617 1.00 77.08  ? 31  PHE A N   1 
ATOM   238  C CA  . PHE A  1 31  ? -7.629  97.125  164.709 1.00 84.11  ? 31  PHE A CA  1 
ATOM   239  C C   . PHE A  1 31  ? -8.585  97.783  165.707 1.00 81.46  ? 31  PHE A C   1 
ATOM   240  O O   . PHE A  1 31  ? -8.131  98.494  166.601 1.00 92.78  ? 31  PHE A O   1 
ATOM   241  C CB  . PHE A  1 31  ? -7.900  97.716  163.320 1.00 95.01  ? 31  PHE A CB  1 
ATOM   242  C CG  . PHE A  1 31  ? -7.680  99.211  163.242 1.00 103.40 ? 31  PHE A CG  1 
ATOM   243  C CD1 . PHE A  1 31  ? -6.403  99.745  163.398 1.00 110.57 ? 31  PHE A CD1 1 
ATOM   244  C CD2 . PHE A  1 31  ? -8.746  100.083 163.023 1.00 104.11 ? 31  PHE A CD2 1 
ATOM   245  C CE1 . PHE A  1 31  ? -6.190  101.121 163.339 1.00 99.13  ? 31  PHE A CE1 1 
ATOM   246  C CE2 . PHE A  1 31  ? -8.544  101.460 162.962 1.00 65.71  ? 31  PHE A CE2 1 
ATOM   247  C CZ  . PHE A  1 31  ? -7.262  101.978 163.122 1.00 98.15  ? 31  PHE A CZ  1 
ATOM   248  N N   . PHE A  1 32  ? -9.894  97.596  165.564 1.00 77.60  ? 32  PHE A N   1 
ATOM   249  C CA  . PHE A  1 32  ? -10.818 98.248  166.500 1.00 83.44  ? 32  PHE A CA  1 
ATOM   250  C C   . PHE A  1 32  ? -10.673 97.618  167.867 1.00 83.30  ? 32  PHE A C   1 
ATOM   251  O O   . PHE A  1 32  ? -11.305 98.050  168.838 1.00 83.65  ? 32  PHE A O   1 
ATOM   252  C CB  . PHE A  1 32  ? -12.272 98.103  166.052 1.00 95.02  ? 32  PHE A CB  1 
ATOM   253  C CG  . PHE A  1 32  ? -12.504 98.467  164.625 1.00 94.92  ? 32  PHE A CG  1 
ATOM   254  C CD1 . PHE A  1 32  ? -12.136 97.591  163.600 1.00 91.44  ? 32  PHE A CD1 1 
ATOM   255  C CD2 . PHE A  1 32  ? -13.064 99.693  164.298 1.00 82.05  ? 32  PHE A CD2 1 
ATOM   256  C CE1 . PHE A  1 32  ? -12.320 97.933  162.268 1.00 88.10  ? 32  PHE A CE1 1 
ATOM   257  C CE2 . PHE A  1 32  ? -13.251 100.044 162.974 1.00 101.62 ? 32  PHE A CE2 1 
ATOM   258  C CZ  . PHE A  1 32  ? -12.877 99.160  161.953 1.00 108.22 ? 32  PHE A CZ  1 
ATOM   259  N N   . GLU A  1 33  ? -9.827  96.593  167.918 1.00 72.96  ? 33  GLU A N   1 
ATOM   260  C CA  . GLU A  1 33  ? -9.567  95.837  169.127 1.00 61.82  ? 33  GLU A CA  1 
ATOM   261  C C   . GLU A  1 33  ? -10.807 95.038  169.458 1.00 56.68  ? 33  GLU A C   1 
ATOM   262  O O   . GLU A  1 33  ? -11.670 95.489  170.207 1.00 72.62  ? 33  GLU A O   1 
ATOM   263  C CB  . GLU A  1 33  ? -9.193  96.766  170.287 1.00 50.54  ? 33  GLU A CB  1 
ATOM   264  C CG  . GLU A  1 33  ? -7.709  97.116  170.319 1.00 104.91 ? 33  GLU A CG  1 
ATOM   265  C CD  . GLU A  1 33  ? -7.302  97.846  171.583 1.00 131.65 ? 33  GLU A CD  1 
ATOM   266  O OE1 . GLU A  1 33  ? -7.822  97.498  172.666 1.00 153.68 ? 33  GLU A OE1 1 
ATOM   267  O OE2 . GLU A  1 33  ? -6.450  98.757  171.494 1.00 143.48 ? 33  GLU A OE2 1 
ATOM   268  N N   . VAL A  1 34  ? -10.889 93.849  168.874 1.00 45.34  ? 34  VAL A N   1 
ATOM   269  C CA  . VAL A  1 34  ? -12.018 92.963  169.092 1.00 57.55  ? 34  VAL A CA  1 
ATOM   270  C C   . VAL A  1 34  ? -11.691 91.960  170.185 1.00 60.12  ? 34  VAL A C   1 
ATOM   271  O O   . VAL A  1 34  ? -12.584 91.300  170.719 1.00 76.42  ? 34  VAL A O   1 
ATOM   272  C CB  . VAL A  1 34  ? -12.369 92.212  167.815 1.00 38.22  ? 34  VAL A CB  1 
ATOM   273  C CG1 . VAL A  1 34  ? -12.724 93.199  166.743 1.00 51.53  ? 34  VAL A CG1 1 
ATOM   274  C CG2 . VAL A  1 34  ? -11.194 91.350  167.382 1.00 59.89  ? 34  VAL A CG2 1 
ATOM   275  N N   . SER A  1 35  ? -10.411 91.840  170.518 1.00 41.40  ? 35  SER A N   1 
ATOM   276  C CA  . SER A  1 35  ? -10.027 90.913  171.568 1.00 67.42  ? 35  SER A CA  1 
ATOM   277  C C   . SER A  1 35  ? -8.991  91.484  172.530 1.00 73.63  ? 35  SER A C   1 
ATOM   278  O O   . SER A  1 35  ? -8.097  92.242  172.139 1.00 77.69  ? 35  SER A O   1 
ATOM   279  C CB  . SER A  1 35  ? -9.460  89.642  170.974 1.00 58.81  ? 35  SER A CB  1 
ATOM   280  O OG  . SER A  1 35  ? -8.107  89.851  170.650 1.00 49.43  ? 35  SER A OG  1 
ATOM   281  N N   . SER A  1 36  ? -9.127  91.112  173.798 1.00 68.36  ? 36  SER A N   1 
ATOM   282  C CA  . SER A  1 36  ? -8.195  91.539  174.819 1.00 49.87  ? 36  SER A CA  1 
ATOM   283  C C   . SER A  1 36  ? -6.879  90.929  174.408 1.00 49.97  ? 36  SER A C   1 
ATOM   284  O O   . SER A  1 36  ? -6.857  89.930  173.702 1.00 40.56  ? 36  SER A O   1 
ATOM   285  C CB  . SER A  1 36  ? -8.600  90.956  176.156 1.00 70.72  ? 36  SER A CB  1 
ATOM   286  O OG  . SER A  1 36  ? -8.593  89.547  176.089 1.00 55.03  ? 36  SER A OG  1 
ATOM   287  N N   . THR A  1 37  ? -5.780  91.517  174.854 1.00 50.40  ? 37  THR A N   1 
ATOM   288  C CA  . THR A  1 37  ? -4.466  90.996  174.516 1.00 38.24  ? 37  THR A CA  1 
ATOM   289  C C   . THR A  1 37  ? -3.890  90.283  175.710 1.00 45.31  ? 37  THR A C   1 
ATOM   290  O O   . THR A  1 37  ? -4.159  90.662  176.848 1.00 47.57  ? 37  THR A O   1 
ATOM   291  C CB  . THR A  1 37  ? -3.501  92.113  174.181 1.00 29.48  ? 37  THR A CB  1 
ATOM   292  O OG1 . THR A  1 37  ? -4.074  92.965  173.182 1.00 71.57  ? 37  THR A OG1 1 
ATOM   293  C CG2 . THR A  1 37  ? -2.211  91.537  173.682 1.00 50.44  ? 37  THR A CG2 1 
ATOM   294  N N   . LYS A  1 38  ? -3.109  89.241  175.469 1.00 42.26  ? 38  LYS A N   1 
ATOM   295  C CA  . LYS A  1 38  ? -2.491  88.551  176.588 1.00 65.38  ? 38  LYS A CA  1 
ATOM   296  C C   . LYS A  1 38  ? -0.990  88.454  176.381 1.00 68.39  ? 38  LYS A C   1 
ATOM   297  O O   . LYS A  1 38  ? -0.523  87.805  175.444 1.00 56.07  ? 38  LYS A O   1 
ATOM   298  C CB  . LYS A  1 38  ? -3.111  87.179  176.799 1.00 53.69  ? 38  LYS A CB  1 
ATOM   299  C CG  . LYS A  1 38  ? -3.818  86.631  175.615 1.00 48.19  ? 38  LYS A CG  1 
ATOM   300  C CD  . LYS A  1 38  ? -5.098  85.965  176.076 1.00 68.47  ? 38  LYS A CD  1 
ATOM   301  C CE  . LYS A  1 38  ? -6.234  86.958  176.203 1.00 44.82  ? 38  LYS A CE  1 
ATOM   302  N NZ  . LYS A  1 38  ? -7.146  86.806  175.029 1.00 5.23   ? 38  LYS A NZ  1 
ATOM   303  N N   . TRP A  1 39  ? -0.256  89.130  177.268 1.00 60.47  ? 39  TRP A N   1 
ATOM   304  C CA  . TRP A  1 39  ? 1.198   89.204  177.230 1.00 37.57  ? 39  TRP A CA  1 
ATOM   305  C C   . TRP A  1 39  ? 1.847   88.166  178.109 1.00 42.89  ? 39  TRP A C   1 
ATOM   306  O O   . TRP A  1 39  ? 1.417   87.945  179.236 1.00 40.69  ? 39  TRP A O   1 
ATOM   307  C CB  . TRP A  1 39  ? 1.656   90.574  177.704 1.00 48.90  ? 39  TRP A CB  1 
ATOM   308  C CG  . TRP A  1 39  ? 1.180   91.696  176.875 1.00 37.68  ? 39  TRP A CG  1 
ATOM   309  C CD1 . TRP A  1 39  ? 0.069   92.473  177.082 1.00 30.65  ? 39  TRP A CD1 1 
ATOM   310  C CD2 . TRP A  1 39  ? 1.763   92.144  175.661 1.00 32.13  ? 39  TRP A CD2 1 
ATOM   311  N NE1 . TRP A  1 39  ? -0.072  93.374  176.060 1.00 19.66  ? 39  TRP A NE1 1 
ATOM   312  C CE2 . TRP A  1 39  ? 0.957   93.195  175.175 1.00 36.32  ? 39  TRP A CE2 1 
ATOM   313  C CE3 . TRP A  1 39  ? 2.889   91.757  174.930 1.00 17.26  ? 39  TRP A CE3 1 
ATOM   314  C CZ2 . TRP A  1 39  ? 1.247   93.864  173.990 1.00 41.31  ? 39  TRP A CZ2 1 
ATOM   315  C CZ3 . TRP A  1 39  ? 3.177   92.419  173.751 1.00 30.08  ? 39  TRP A CZ3 1 
ATOM   316  C CH2 . TRP A  1 39  ? 2.360   93.463  173.293 1.00 49.09  ? 39  TRP A CH2 1 
ATOM   317  N N   . PHE A  1 40  ? 2.916   87.566  177.604 1.00 34.28  ? 40  PHE A N   1 
ATOM   318  C CA  . PHE A  1 40  ? 3.640   86.538  178.331 1.00 35.29  ? 40  PHE A CA  1 
ATOM   319  C C   . PHE A  1 40  ? 5.112   86.889  178.522 1.00 48.23  ? 40  PHE A C   1 
ATOM   320  O O   . PHE A  1 40  ? 5.835   87.108  177.546 1.00 65.42  ? 40  PHE A O   1 
ATOM   321  C CB  . PHE A  1 40  ? 3.527   85.229  177.574 1.00 59.67  ? 40  PHE A CB  1 
ATOM   322  C CG  . PHE A  1 40  ? 2.137   84.682  177.528 1.00 61.67  ? 40  PHE A CG  1 
ATOM   323  C CD1 . PHE A  1 40  ? 1.608   84.205  176.338 1.00 58.04  ? 40  PHE A CD1 1 
ATOM   324  C CD2 . PHE A  1 40  ? 1.367   84.614  178.680 1.00 44.99  ? 40  PHE A CD2 1 
ATOM   325  C CE1 . PHE A  1 40  ? 0.341   83.673  176.300 1.00 67.34  ? 40  PHE A CE1 1 
ATOM   326  C CE2 . PHE A  1 40  ? 0.105   84.083  178.646 1.00 42.19  ? 40  PHE A CE2 1 
ATOM   327  C CZ  . PHE A  1 40  ? -0.414  83.611  177.459 1.00 66.36  ? 40  PHE A CZ  1 
ATOM   328  N N   . HIS A  1 41  ? 5.549   86.924  179.780 1.00 47.54  ? 41  HIS A N   1 
ATOM   329  C CA  . HIS A  1 41  ? 6.929   87.243  180.121 1.00 45.91  ? 41  HIS A CA  1 
ATOM   330  C C   . HIS A  1 41  ? 7.671   86.006  180.630 1.00 65.98  ? 41  HIS A C   1 
ATOM   331  O O   . HIS A  1 41  ? 7.413   85.511  181.729 1.00 52.46  ? 41  HIS A O   1 
ATOM   332  C CB  . HIS A  1 41  ? 6.950   88.359  181.166 1.00 57.72  ? 41  HIS A CB  1 
ATOM   333  C CG  . HIS A  1 41  ? 8.325   88.832  181.529 1.00 79.51  ? 41  HIS A CG  1 
ATOM   334  N ND1 . HIS A  1 41  ? 9.361   88.901  180.618 1.00 54.72  ? 41  HIS A ND1 1 
ATOM   335  C CD2 . HIS A  1 41  ? 8.822   89.302  182.698 1.00 76.91  ? 41  HIS A CD2 1 
ATOM   336  C CE1 . HIS A  1 41  ? 10.433  89.389  181.213 1.00 72.08  ? 41  HIS A CE1 1 
ATOM   337  N NE2 . HIS A  1 41  ? 10.133  89.642  182.475 1.00 76.43  ? 41  HIS A NE2 1 
ATOM   338  N N   . ASN A  1 42  ? 8.594   85.513  179.806 1.00 85.76  ? 42  ASN A N   1 
ATOM   339  C CA  . ASN A  1 42  ? 9.383   84.329  180.122 1.00 89.24  ? 42  ASN A CA  1 
ATOM   340  C C   . ASN A  1 42  ? 8.464   83.156  180.421 1.00 80.22  ? 42  ASN A C   1 
ATOM   341  O O   . ASN A  1 42  ? 8.923   82.037  180.657 1.00 96.82  ? 42  ASN A O   1 
ATOM   342  C CB  . ASN A  1 42  ? 10.313  84.601  181.315 1.00 74.18  ? 42  ASN A CB  1 
ATOM   343  C CG  . ASN A  1 42  ? 11.573  85.360  180.915 1.00 79.61  ? 42  ASN A CG  1 
ATOM   344  O OD1 . ASN A  1 42  ? 11.498  86.390  180.243 1.00 85.36  ? 42  ASN A OD1 1 
ATOM   345  N ND2 . ASN A  1 42  ? 12.732  84.857  181.333 1.00 87.32  ? 42  ASN A ND2 1 
ATOM   346  N N   . GLY A  1 43  ? 7.162   83.418  180.389 1.00 52.29  ? 43  GLY A N   1 
ATOM   347  C CA  . GLY A  1 43  ? 6.201   82.378  180.662 1.00 35.59  ? 43  GLY A CA  1 
ATOM   348  C C   . GLY A  1 43  ? 4.909   82.844  181.300 1.00 39.69  ? 43  GLY A C   1 
ATOM   349  O O   . GLY A  1 43  ? 3.855   82.683  180.707 1.00 53.38  ? 43  GLY A O   1 
ATOM   350  N N   . SER A  1 44  ? 4.971   83.412  182.499 1.00 48.81  ? 44  SER A N   1 
ATOM   351  C CA  . SER A  1 44  ? 3.760   83.860  183.181 1.00 63.33  ? 44  SER A CA  1 
ATOM   352  C C   . SER A  1 44  ? 2.933   84.859  182.407 1.00 54.76  ? 44  SER A C   1 
ATOM   353  O O   . SER A  1 44  ? 3.443   85.594  181.569 1.00 48.03  ? 44  SER A O   1 
ATOM   354  C CB  . SER A  1 44  ? 4.090   84.455  184.553 1.00 98.88  ? 44  SER A CB  1 
ATOM   355  O OG  . SER A  1 44  ? 4.024   83.466  185.572 1.00 131.82 ? 44  SER A OG  1 
ATOM   356  N N   . LEU A  1 45  ? 1.639   84.871  182.708 1.00 64.26  ? 45  LEU A N   1 
ATOM   357  C CA  . LEU A  1 45  ? 0.698   85.769  182.062 1.00 54.40  ? 45  LEU A CA  1 
ATOM   358  C C   . LEU A  1 45  ? 0.755   87.134  182.731 1.00 55.45  ? 45  LEU A C   1 
ATOM   359  O O   . LEU A  1 45  ? 0.531   87.243  183.928 1.00 48.94  ? 45  LEU A O   1 
ATOM   360  C CB  . LEU A  1 45  ? -0.728  85.215  182.177 1.00 40.89  ? 45  LEU A CB  1 
ATOM   361  C CG  . LEU A  1 45  ? -1.810  86.048  181.475 1.00 34.71  ? 45  LEU A CG  1 
ATOM   362  C CD1 . LEU A  1 45  ? -1.934  85.532  180.084 1.00 54.93  ? 45  LEU A CD1 1 
ATOM   363  C CD2 . LEU A  1 45  ? -3.171  85.962  182.155 1.00 53.75  ? 45  LEU A CD2 1 
ATOM   364  N N   . SER A  1 46  ? 1.053   88.176  181.964 1.00 51.35  ? 46  SER A N   1 
ATOM   365  C CA  . SER A  1 46  ? 1.100   89.513  182.530 1.00 60.43  ? 46  SER A CA  1 
ATOM   366  C C   . SER A  1 46  ? -0.316  90.006  182.778 1.00 54.24  ? 46  SER A C   1 
ATOM   367  O O   . SER A  1 46  ? -1.245  89.564  182.105 1.00 69.59  ? 46  SER A O   1 
ATOM   368  C CB  . SER A  1 46  ? 1.808   90.469  181.584 1.00 66.92  ? 46  SER A CB  1 
ATOM   369  O OG  . SER A  1 46  ? 1.827   91.769  182.137 1.00 83.39  ? 46  SER A OG  1 
ATOM   370  N N   . GLU A  1 47  ? -0.475  90.927  183.727 1.00 50.21  ? 47  GLU A N   1 
ATOM   371  C CA  . GLU A  1 47  ? -1.794  91.467  184.059 1.00 57.47  ? 47  GLU A CA  1 
ATOM   372  C C   . GLU A  1 47  ? -2.257  92.613  183.169 1.00 60.26  ? 47  GLU A C   1 
ATOM   373  O O   . GLU A  1 47  ? -3.330  93.173  183.399 1.00 64.18  ? 47  GLU A O   1 
ATOM   374  C CB  . GLU A  1 47  ? -1.876  91.906  185.536 1.00 80.22  ? 47  GLU A CB  1 
ATOM   375  C CG  . GLU A  1 47  ? -1.109  93.176  185.915 1.00 127.39 ? 47  GLU A CG  1 
ATOM   376  C CD  . GLU A  1 47  ? -1.380  93.622  187.356 1.00 144.76 ? 47  GLU A CD  1 
ATOM   377  O OE1 . GLU A  1 47  ? -2.558  93.869  187.696 1.00 154.10 ? 47  GLU A OE1 1 
ATOM   378  O OE2 . GLU A  1 47  ? -0.420  93.729  188.151 1.00 156.25 ? 47  GLU A OE2 1 
ATOM   379  N N   . GLU A  1 48  ? -1.459  92.977  182.168 1.00 50.13  ? 48  GLU A N   1 
ATOM   380  C CA  . GLU A  1 48  ? -1.875  94.033  181.255 1.00 59.40  ? 48  GLU A CA  1 
ATOM   381  C C   . GLU A  1 48  ? -2.664  93.332  180.178 1.00 68.07  ? 48  GLU A C   1 
ATOM   382  O O   . GLU A  1 48  ? -2.224  92.303  179.658 1.00 82.13  ? 48  GLU A O   1 
ATOM   383  C CB  . GLU A  1 48  ? -0.689  94.737  180.606 1.00 81.57  ? 48  GLU A CB  1 
ATOM   384  C CG  . GLU A  1 48  ? -1.099  95.797  179.581 1.00 90.69  ? 48  GLU A CG  1 
ATOM   385  C CD  . GLU A  1 48  ? -1.832  96.978  180.201 1.00 113.48 ? 48  GLU A CD  1 
ATOM   386  O OE1 . GLU A  1 48  ? -2.168  96.919  181.403 1.00 136.77 ? 48  GLU A OE1 1 
ATOM   387  O OE2 . GLU A  1 48  ? -2.077  97.968  179.481 1.00 122.86 ? 48  GLU A OE2 1 
ATOM   388  N N   . THR A  1 49  ? -3.827  93.874  179.841 1.00 63.27  ? 49  THR A N   1 
ATOM   389  C CA  . THR A  1 49  ? -4.650  93.249  178.824 1.00 56.47  ? 49  THR A CA  1 
ATOM   390  C C   . THR A  1 49  ? -4.773  94.090  177.570 1.00 47.52  ? 49  THR A C   1 
ATOM   391  O O   . THR A  1 49  ? -5.323  93.620  176.572 1.00 54.95  ? 49  THR A O   1 
ATOM   392  C CB  . THR A  1 49  ? -6.057  92.937  179.361 1.00 55.21  ? 49  THR A CB  1 
ATOM   393  O OG1 . THR A  1 49  ? -6.717  94.152  179.731 1.00 65.20  ? 49  THR A OG1 1 
ATOM   394  C CG2 . THR A  1 49  ? -5.957  92.031  180.574 1.00 72.04  ? 49  THR A CG2 1 
ATOM   395  N N   . ASN A  1 50  ? -4.244  95.316  177.618 1.00 38.73  ? 50  ASN A N   1 
ATOM   396  C CA  . ASN A  1 50  ? -4.308  96.238  176.481 1.00 39.32  ? 50  ASN A CA  1 
ATOM   397  C C   . ASN A  1 50  ? -3.331  95.925  175.343 1.00 43.94  ? 50  ASN A C   1 
ATOM   398  O O   . ASN A  1 50  ? -2.419  95.117  175.484 1.00 36.97  ? 50  ASN A O   1 
ATOM   399  C CB  . ASN A  1 50  ? -4.131  97.680  176.959 1.00 30.07  ? 50  ASN A CB  1 
ATOM   400  C CG  . ASN A  1 50  ? -5.248  98.123  177.888 1.00 74.87  ? 50  ASN A CG  1 
ATOM   401  O OD1 . ASN A  1 50  ? -6.425  97.966  177.566 1.00 90.94  ? 50  ASN A OD1 1 
ATOM   402  N ND2 . ASN A  1 50  ? -4.888  98.684  179.044 1.00 85.33  ? 50  ASN A ND2 1 
ATOM   403  N N   . SER A  1 51  ? -3.545  96.576  174.208 1.00 36.48  ? 51  SER A N   1 
ATOM   404  C CA  . SER A  1 51  ? -2.751  96.358  173.012 1.00 46.39  ? 51  SER A CA  1 
ATOM   405  C C   . SER A  1 51  ? -1.259  96.682  173.121 1.00 46.86  ? 51  SER A C   1 
ATOM   406  O O   . SER A  1 51  ? -0.437  96.164  172.360 1.00 43.01  ? 51  SER A O   1 
ATOM   407  C CB  . SER A  1 51  ? -3.377  97.148  171.867 1.00 75.37  ? 51  SER A CB  1 
ATOM   408  O OG  . SER A  1 51  ? -2.997  96.611  170.612 1.00 125.59 ? 51  SER A OG  1 
ATOM   409  N N   . SER A  1 52  ? -0.896  97.547  174.055 1.00 53.93  ? 52  SER A N   1 
ATOM   410  C CA  . SER A  1 52  ? 0.504   97.893  174.211 1.00 40.04  ? 52  SER A CA  1 
ATOM   411  C C   . SER A  1 52  ? 0.905   97.753  175.661 1.00 30.48  ? 52  SER A C   1 
ATOM   412  O O   . SER A  1 52  ? 0.190   98.183  176.556 1.00 31.12  ? 52  SER A O   1 
ATOM   413  C CB  . SER A  1 52  ? 0.768   99.315  173.715 1.00 16.08  ? 52  SER A CB  1 
ATOM   414  O OG  . SER A  1 52  ? -0.152  100.219 174.304 1.00 81.74  ? 52  SER A OG  1 
ATOM   415  N N   . LEU A  1 53  ? 2.053   97.118  175.870 1.00 39.33  ? 53  LEU A N   1 
ATOM   416  C CA  . LEU A  1 53  ? 2.613   96.882  177.188 1.00 42.81  ? 53  LEU A CA  1 
ATOM   417  C C   . LEU A  1 53  ? 3.811   97.789  177.394 1.00 47.77  ? 53  LEU A C   1 
ATOM   418  O O   . LEU A  1 53  ? 4.693   97.864  176.539 1.00 49.82  ? 53  LEU A O   1 
ATOM   419  C CB  . LEU A  1 53  ? 3.060   95.430  177.306 1.00 32.46  ? 53  LEU A CB  1 
ATOM   420  C CG  . LEU A  1 53  ? 3.830   95.066  178.569 1.00 11.89  ? 53  LEU A CG  1 
ATOM   421  C CD1 . LEU A  1 53  ? 2.999   95.372  179.782 1.00 63.96  ? 53  LEU A CD1 1 
ATOM   422  C CD2 . LEU A  1 53  ? 4.172   93.618  178.534 1.00 8.36   ? 53  LEU A CD2 1 
ATOM   423  N N   . ASN A  1 54  ? 3.841   98.474  178.529 1.00 36.77  ? 54  ASN A N   1 
ATOM   424  C CA  . ASN A  1 54  ? 4.937   99.378  178.841 1.00 41.68  ? 54  ASN A CA  1 
ATOM   425  C C   . ASN A  1 54  ? 5.976   98.749  179.753 1.00 45.29  ? 54  ASN A C   1 
ATOM   426  O O   . ASN A  1 54  ? 5.771   97.691  180.331 1.00 44.40  ? 54  ASN A O   1 
ATOM   427  C CB  . ASN A  1 54  ? 4.403   100.640 179.506 1.00 47.77  ? 54  ASN A CB  1 
ATOM   428  C CG  . ASN A  1 54  ? 3.436   101.383 178.631 1.00 63.10  ? 54  ASN A CG  1 
ATOM   429  O OD1 . ASN A  1 54  ? 3.786   101.807 177.538 1.00 47.22  ? 54  ASN A OD1 1 
ATOM   430  N ND2 . ASN A  1 54  ? 2.207   101.545 179.104 1.00 87.81  ? 54  ASN A ND2 1 
ATOM   431  N N   . ILE A  1 55  ? 7.106   99.422  179.867 1.00 47.09  ? 55  ILE A N   1 
ATOM   432  C CA  . ILE A  1 55  ? 8.189   98.981  180.719 1.00 47.59  ? 55  ILE A CA  1 
ATOM   433  C C   . ILE A  1 55  ? 8.829   100.267 181.189 1.00 59.25  ? 55  ILE A C   1 
ATOM   434  O O   . ILE A  1 55  ? 9.222   101.101 180.371 1.00 69.97  ? 55  ILE A O   1 
ATOM   435  C CB  . ILE A  1 55  ? 9.217   98.157  179.946 1.00 26.98  ? 55  ILE A CB  1 
ATOM   436  C CG1 . ILE A  1 55  ? 8.619   96.807  179.586 1.00 32.63  ? 55  ILE A CG1 1 
ATOM   437  C CG2 . ILE A  1 55  ? 10.449  97.922  180.795 1.00 41.19  ? 55  ILE A CG2 1 
ATOM   438  C CD1 . ILE A  1 55  ? 9.649   95.826  179.074 1.00 32.72  ? 55  ILE A CD1 1 
ATOM   439  N N   . VAL A  1 56  ? 8.923   100.443 182.501 1.00 51.04  ? 56  VAL A N   1 
ATOM   440  C CA  . VAL A  1 56  ? 9.505   101.660 183.024 1.00 48.92  ? 56  VAL A CA  1 
ATOM   441  C C   . VAL A  1 56  ? 10.706  101.421 183.923 1.00 56.09  ? 56  VAL A C   1 
ATOM   442  O O   . VAL A  1 56  ? 10.757  100.422 184.648 1.00 52.07  ? 56  VAL A O   1 
ATOM   443  C CB  . VAL A  1 56  ? 8.444   102.453 183.758 1.00 37.35  ? 56  VAL A CB  1 
ATOM   444  C CG1 . VAL A  1 56  ? 9.046   103.714 184.329 1.00 77.56  ? 56  VAL A CG1 1 
ATOM   445  C CG2 . VAL A  1 56  ? 7.328   102.792 182.789 1.00 26.54  ? 56  VAL A CG2 1 
ATOM   446  N N   . ASN A  1 57  ? 11.664  102.348 183.872 1.00 43.66  ? 57  ASN A N   1 
ATOM   447  C CA  . ASN A  1 57  ? 12.887  102.233 184.656 1.00 58.92  ? 57  ASN A CA  1 
ATOM   448  C C   . ASN A  1 57  ? 13.219  100.756 184.636 1.00 49.23  ? 57  ASN A C   1 
ATOM   449  O O   . ASN A  1 57  ? 13.382  100.110 185.669 1.00 47.41  ? 57  ASN A O   1 
ATOM   450  C CB  . ASN A  1 57  ? 12.673  102.732 186.090 1.00 65.84  ? 57  ASN A CB  1 
ATOM   451  C CG  . ASN A  1 57  ? 12.080  104.137 186.133 1.00 94.72  ? 57  ASN A CG  1 
ATOM   452  O OD1 . ASN A  1 57  ? 12.275  104.939 185.212 1.00 95.35  ? 57  ASN A OD1 1 
ATOM   453  N ND2 . ASN A  1 57  ? 11.359  104.444 187.211 1.00 105.46 ? 57  ASN A ND2 1 
ATOM   454  N N   . ALA A  1 58  ? 13.294  100.237 183.419 1.00 14.05  ? 58  ALA A N   1 
ATOM   455  C CA  . ALA A  1 58  ? 13.562  98.838  183.185 1.00 19.67  ? 58  ALA A CA  1 
ATOM   456  C C   . ALA A  1 58  ? 14.604  98.236  184.083 1.00 30.84  ? 58  ALA A C   1 
ATOM   457  O O   . ALA A  1 58  ? 15.769  98.571  183.983 1.00 31.95  ? 58  ALA A O   1 
ATOM   458  C CB  . ALA A  1 58  ? 13.971  98.636  181.763 1.00 23.80  ? 58  ALA A CB  1 
ATOM   459  N N   . LYS A  1 59  ? 14.182  97.336  184.962 1.00 47.24  ? 59  LYS A N   1 
ATOM   460  C CA  . LYS A  1 59  ? 15.114  96.654  185.838 1.00 47.19  ? 59  LYS A CA  1 
ATOM   461  C C   . LYS A  1 59  ? 15.681  95.481  185.031 1.00 47.65  ? 59  LYS A C   1 
ATOM   462  O O   . LYS A  1 59  ? 15.234  95.229  183.920 1.00 28.04  ? 59  LYS A O   1 
ATOM   463  C CB  . LYS A  1 59  ? 14.388  96.159  187.080 1.00 51.33  ? 59  LYS A CB  1 
ATOM   464  C CG  . LYS A  1 59  ? 15.301  95.437  188.061 1.00 97.51  ? 59  LYS A CG  1 
ATOM   465  C CD  . LYS A  1 59  ? 16.432  96.316  188.603 1.00 94.07  ? 59  LYS A CD  1 
ATOM   466  C CE  . LYS A  1 59  ? 17.313  95.516  189.541 1.00 71.70  ? 59  LYS A CE  1 
ATOM   467  N NZ  . LYS A  1 59  ? 17.864  94.316  188.836 1.00 54.56  ? 59  LYS A NZ  1 
ATOM   468  N N   . PHE A  1 60  ? 16.673  94.771  185.549 1.00 41.66  ? 60  PHE A N   1 
ATOM   469  C CA  . PHE A  1 60  ? 17.207  93.658  184.776 1.00 43.23  ? 60  PHE A CA  1 
ATOM   470  C C   . PHE A  1 60  ? 16.169  92.580  184.653 1.00 54.26  ? 60  PHE A C   1 
ATOM   471  O O   . PHE A  1 60  ? 16.062  91.924  183.617 1.00 45.04  ? 60  PHE A O   1 
ATOM   472  C CB  . PHE A  1 60  ? 18.416  93.052  185.445 1.00 53.88  ? 60  PHE A CB  1 
ATOM   473  C CG  . PHE A  1 60  ? 19.579  93.957  185.491 1.00 62.37  ? 60  PHE A CG  1 
ATOM   474  C CD1 . PHE A  1 60  ? 19.616  95.002  186.399 1.00 68.42  ? 60  PHE A CD1 1 
ATOM   475  C CD2 . PHE A  1 60  ? 20.634  93.787  184.606 1.00 56.82  ? 60  PHE A CD2 1 
ATOM   476  C CE1 . PHE A  1 60  ? 20.691  95.867  186.419 1.00 66.09  ? 60  PHE A CE1 1 
ATOM   477  C CE2 . PHE A  1 60  ? 21.712  94.651  184.621 1.00 38.75  ? 60  PHE A CE2 1 
ATOM   478  C CZ  . PHE A  1 60  ? 21.741  95.689  185.525 1.00 31.78  ? 60  PHE A CZ  1 
ATOM   479  N N   . GLU A  1 61  ? 15.429  92.395  185.742 1.00 43.86  ? 61  GLU A N   1 
ATOM   480  C CA  . GLU A  1 61  ? 14.371  91.406  185.823 1.00 59.16  ? 61  GLU A CA  1 
ATOM   481  C C   . GLU A  1 61  ? 13.468  91.481  184.602 1.00 53.98  ? 61  GLU A C   1 
ATOM   482  O O   . GLU A  1 61  ? 12.846  90.496  184.214 1.00 51.70  ? 61  GLU A O   1 
ATOM   483  C CB  . GLU A  1 61  ? 13.552  91.627  187.104 1.00 79.89  ? 61  GLU A CB  1 
ATOM   484  C CG  . GLU A  1 61  ? 14.214  91.078  188.378 1.00 127.89 ? 61  GLU A CG  1 
ATOM   485  C CD  . GLU A  1 61  ? 15.427  91.882  188.853 1.00 144.12 ? 61  GLU A CD  1 
ATOM   486  O OE1 . GLU A  1 61  ? 15.236  93.016  189.341 1.00 160.30 ? 61  GLU A OE1 1 
ATOM   487  O OE2 . GLU A  1 61  ? 16.573  91.381  188.747 1.00 140.63 ? 61  GLU A OE2 1 
ATOM   488  N N   . ASP A  1 62  ? 13.418  92.657  183.987 1.00 46.40  ? 62  ASP A N   1 
ATOM   489  C CA  . ASP A  1 62  ? 12.589  92.874  182.816 1.00 19.93  ? 62  ASP A CA  1 
ATOM   490  C C   . ASP A  1 62  ? 13.156  92.283  181.519 1.00 28.06  ? 62  ASP A C   1 
ATOM   491  O O   . ASP A  1 62  ? 12.492  92.276  180.483 1.00 29.47  ? 62  ASP A O   1 
ATOM   492  C CB  . ASP A  1 62  ? 12.312  94.371  182.659 1.00 12.23  ? 62  ASP A CB  1 
ATOM   493  C CG  . ASP A  1 62  ? 11.524  94.956  183.850 1.00 68.23  ? 62  ASP A CG  1 
ATOM   494  O OD1 . ASP A  1 62  ? 10.790  94.200  184.540 1.00 75.15  ? 62  ASP A OD1 1 
ATOM   495  O OD2 . ASP A  1 62  ? 11.618  96.182  184.091 1.00 65.70  ? 62  ASP A OD2 1 
ATOM   496  N N   . SER A  1 63  ? 14.378  91.772  181.558 1.00 40.22  ? 63  SER A N   1 
ATOM   497  C CA  . SER A  1 63  ? 14.940  91.174  180.353 1.00 51.80  ? 63  SER A CA  1 
ATOM   498  C C   . SER A  1 63  ? 14.108  89.938  180.092 1.00 41.82  ? 63  SER A C   1 
ATOM   499  O O   . SER A  1 63  ? 13.290  89.573  180.919 1.00 48.38  ? 63  SER A O   1 
ATOM   500  C CB  . SER A  1 63  ? 16.395  90.770  180.579 1.00 55.04  ? 63  SER A CB  1 
ATOM   501  O OG  . SER A  1 63  ? 17.214  91.898  180.813 1.00 71.99  ? 63  SER A OG  1 
ATOM   502  N N   . GLY A  1 64  ? 14.295  89.293  178.949 1.00 37.35  ? 64  GLY A N   1 
ATOM   503  C CA  . GLY A  1 64  ? 13.529  88.085  178.701 1.00 57.21  ? 64  GLY A CA  1 
ATOM   504  C C   . GLY A  1 64  ? 12.703  87.912  177.437 1.00 62.31  ? 64  GLY A C   1 
ATOM   505  O O   . GLY A  1 64  ? 12.738  88.718  176.503 1.00 59.33  ? 64  GLY A O   1 
ATOM   506  N N   . GLU A  1 65  ? 11.947  86.819  177.426 1.00 52.02  ? 65  GLU A N   1 
ATOM   507  C CA  . GLU A  1 65  ? 11.096  86.471  176.303 1.00 54.90  ? 65  GLU A CA  1 
ATOM   508  C C   . GLU A  1 65  ? 9.693   87.030  176.447 1.00 60.71  ? 65  GLU A C   1 
ATOM   509  O O   . GLU A  1 65  ? 9.000   86.742  177.415 1.00 56.97  ? 65  GLU A O   1 
ATOM   510  C CB  . GLU A  1 65  ? 11.022  84.950  176.157 1.00 67.79  ? 65  GLU A CB  1 
ATOM   511  C CG  . GLU A  1 65  ? 9.864   84.452  175.314 1.00 74.02  ? 65  GLU A CG  1 
ATOM   512  C CD  . GLU A  1 65  ? 9.860   82.944  175.145 1.00 95.73  ? 65  GLU A CD  1 
ATOM   513  O OE1 . GLU A  1 65  ? 9.816   82.221  176.165 1.00 116.79 ? 65  GLU A OE1 1 
ATOM   514  O OE2 . GLU A  1 65  ? 9.898   82.480  173.987 1.00 103.21 ? 65  GLU A OE2 1 
ATOM   515  N N   . TYR A  1 66  ? 9.282   87.829  175.468 1.00 57.90  ? 66  TYR A N   1 
ATOM   516  C CA  . TYR A  1 66  ? 7.951   88.414  175.462 1.00 34.99  ? 66  TYR A CA  1 
ATOM   517  C C   . TYR A  1 66  ? 7.135   87.859  174.296 1.00 51.14  ? 66  TYR A C   1 
ATOM   518  O O   . TYR A  1 66  ? 7.653   87.704  173.190 1.00 48.97  ? 66  TYR A O   1 
ATOM   519  C CB  . TYR A  1 66  ? 8.037   89.931  175.342 1.00 39.83  ? 66  TYR A CB  1 
ATOM   520  C CG  . TYR A  1 66  ? 8.495   90.627  176.599 1.00 40.28  ? 66  TYR A CG  1 
ATOM   521  C CD1 . TYR A  1 66  ? 9.844   90.671  176.946 1.00 45.88  ? 66  TYR A CD1 1 
ATOM   522  C CD2 . TYR A  1 66  ? 7.574   91.217  177.456 1.00 30.74  ? 66  TYR A CD2 1 
ATOM   523  C CE1 . TYR A  1 66  ? 10.264  91.287  178.118 1.00 32.91  ? 66  TYR A CE1 1 
ATOM   524  C CE2 . TYR A  1 66  ? 7.978   91.827  178.623 1.00 52.47  ? 66  TYR A CE2 1 
ATOM   525  C CZ  . TYR A  1 66  ? 9.323   91.862  178.952 1.00 59.88  ? 66  TYR A CZ  1 
ATOM   526  O OH  . TYR A  1 66  ? 9.709   92.485  180.115 1.00 73.62  ? 66  TYR A OH  1 
ATOM   527  N N   . LYS A  1 67  ? 5.866   87.548  174.560 1.00 55.01  ? 67  LYS A N   1 
ATOM   528  C CA  . LYS A  1 67  ? 4.946   87.023  173.550 1.00 42.40  ? 67  LYS A CA  1 
ATOM   529  C C   . LYS A  1 67  ? 3.530   87.460  173.867 1.00 53.41  ? 67  LYS A C   1 
ATOM   530  O O   . LYS A  1 67  ? 3.164   87.560  175.038 1.00 52.79  ? 67  LYS A O   1 
ATOM   531  C CB  . LYS A  1 67  ? 4.957   85.504  173.534 1.00 15.60  ? 67  LYS A CB  1 
ATOM   532  C CG  . LYS A  1 67  ? 6.054   84.856  172.724 1.00 58.19  ? 67  LYS A CG  1 
ATOM   533  C CD  . LYS A  1 67  ? 5.918   83.324  172.794 1.00 76.43  ? 67  LYS A CD  1 
ATOM   534  C CE  . LYS A  1 67  ? 5.849   82.829  174.249 1.00 75.20  ? 67  LYS A CE  1 
ATOM   535  N NZ  . LYS A  1 67  ? 5.762   81.347  174.372 1.00 67.87  ? 67  LYS A NZ  1 
ATOM   536  N N   . CYS A  1 68  ? 2.741   87.730  172.830 1.00 48.87  ? 68  CYS A N   1 
ATOM   537  C CA  . CYS A  1 68  ? 1.346   88.113  173.023 1.00 54.98  ? 68  CYS A CA  1 
ATOM   538  C C   . CYS A  1 68  ? 0.522   87.234  172.111 1.00 52.55  ? 68  CYS A C   1 
ATOM   539  O O   . CYS A  1 68  ? 0.992   86.816  171.060 1.00 58.19  ? 68  CYS A O   1 
ATOM   540  C CB  . CYS A  1 68  ? 1.092   89.597  172.678 1.00 60.80  ? 68  CYS A CB  1 
ATOM   541  S SG  . CYS A  1 68  ? 1.419   90.098  170.952 1.00 101.41 ? 68  CYS A SG  1 
ATOM   542  N N   . GLN A  1 69  ? -0.695  86.920  172.525 1.00 58.43  ? 69  GLN A N   1 
ATOM   543  C CA  . GLN A  1 69  ? -1.553  86.119  171.681 1.00 64.86  ? 69  GLN A CA  1 
ATOM   544  C C   . GLN A  1 69  ? -2.951  86.698  171.837 1.00 68.28  ? 69  GLN A C   1 
ATOM   545  O O   . GLN A  1 69  ? -3.259  87.275  172.881 1.00 54.10  ? 69  GLN A O   1 
ATOM   546  C CB  . GLN A  1 69  ? -1.489  84.636  172.081 1.00 57.97  ? 69  GLN A CB  1 
ATOM   547  C CG  . GLN A  1 69  ? -2.425  84.215  173.203 1.00 70.16  ? 69  GLN A CG  1 
ATOM   548  C CD  . GLN A  1 69  ? -2.526  82.705  173.318 1.00 68.28  ? 69  GLN A CD  1 
ATOM   549  O OE1 . GLN A  1 69  ? -2.813  82.023  172.336 1.00 74.99  ? 69  GLN A OE1 1 
ATOM   550  N NE2 . GLN A  1 69  ? -2.294  82.174  174.516 1.00 81.90  ? 69  GLN A NE2 1 
ATOM   551  N N   . HIS A  1 70  ? -3.780  86.569  170.798 1.00 59.10  ? 70  HIS A N   1 
ATOM   552  C CA  . HIS A  1 70  ? -5.135  87.114  170.836 1.00 53.02  ? 70  HIS A CA  1 
ATOM   553  C C   . HIS A  1 70  ? -6.193  86.125  171.279 1.00 57.38  ? 70  HIS A C   1 
ATOM   554  O O   . HIS A  1 70  ? -6.224  85.738  172.448 1.00 62.68  ? 70  HIS A O   1 
ATOM   555  C CB  . HIS A  1 70  ? -5.503  87.695  169.484 1.00 60.63  ? 70  HIS A CB  1 
ATOM   556  C CG  . HIS A  1 70  ? -4.758  88.949  169.156 1.00 61.31  ? 70  HIS A CG  1 
ATOM   557  N ND1 . HIS A  1 70  ? -4.693  90.022  170.019 1.00 30.12  ? 70  HIS A ND1 1 
ATOM   558  C CD2 . HIS A  1 70  ? -4.093  89.321  168.038 1.00 48.55  ? 70  HIS A CD2 1 
ATOM   559  C CE1 . HIS A  1 70  ? -4.025  91.004  169.442 1.00 44.90  ? 70  HIS A CE1 1 
ATOM   560  N NE2 . HIS A  1 70  ? -3.651  90.603  168.240 1.00 46.99  ? 70  HIS A NE2 1 
ATOM   561  N N   . GLN A  1 71  ? -7.103  85.741  170.393 1.00 51.57  ? 71  GLN A N   1 
ATOM   562  C CA  . GLN A  1 71  ? -8.074  84.755  170.836 1.00 62.87  ? 71  GLN A CA  1 
ATOM   563  C C   . GLN A  1 71  ? -7.944  83.483  170.037 1.00 55.24  ? 71  GLN A C   1 
ATOM   564  O O   . GLN A  1 71  ? -8.800  82.610  170.102 1.00 57.69  ? 71  GLN A O   1 
ATOM   565  C CB  . GLN A  1 71  ? -9.521  85.291  170.854 1.00 32.74  ? 71  GLN A CB  1 
ATOM   566  C CG  . GLN A  1 71  ? -9.993  86.007  169.632 1.00 63.53  ? 71  GLN A CG  1 
ATOM   567  C CD  . GLN A  1 71  ? -11.225 86.849  169.901 1.00 67.34  ? 71  GLN A CD  1 
ATOM   568  O OE1 . GLN A  1 71  ? -11.837 86.748  170.965 1.00 51.13  ? 71  GLN A OE1 1 
ATOM   569  N NE2 . GLN A  1 71  ? -11.597 87.690  168.927 1.00 59.84  ? 71  GLN A NE2 1 
ATOM   570  N N   . GLN A  1 72  ? -6.840  83.376  169.302 1.00 50.55  ? 72  GLN A N   1 
ATOM   571  C CA  . GLN A  1 72  ? -6.556  82.167  168.543 1.00 50.02  ? 72  GLN A CA  1 
ATOM   572  C C   . GLN A  1 72  ? -5.573  81.267  169.288 1.00 52.79  ? 72  GLN A C   1 
ATOM   573  O O   . GLN A  1 72  ? -5.373  81.404  170.490 1.00 48.79  ? 72  GLN A O   1 
ATOM   574  C CB  . GLN A  1 72  ? -6.029  82.497  167.153 1.00 55.26  ? 72  GLN A CB  1 
ATOM   575  C CG  . GLN A  1 72  ? -7.084  82.254  166.099 1.00 69.94  ? 72  GLN A CG  1 
ATOM   576  C CD  . GLN A  1 72  ? -6.726  82.827  164.759 1.00 71.71  ? 72  GLN A CD  1 
ATOM   577  O OE1 . GLN A  1 72  ? -5.765  82.397  164.129 1.00 91.37  ? 72  GLN A OE1 1 
ATOM   578  N NE2 . GLN A  1 72  ? -7.500  83.813  164.310 1.00 93.77  ? 72  GLN A NE2 1 
ATOM   579  N N   . VAL A  1 73  ? -4.958  80.337  168.583 1.00 67.55  ? 73  VAL A N   1 
ATOM   580  C CA  . VAL A  1 73  ? -4.054  79.418  169.252 1.00 64.29  ? 73  VAL A CA  1 
ATOM   581  C C   . VAL A  1 73  ? -2.622  79.862  169.121 1.00 67.88  ? 73  VAL A C   1 
ATOM   582  O O   . VAL A  1 73  ? -1.851  79.805  170.077 1.00 59.20  ? 73  VAL A O   1 
ATOM   583  C CB  . VAL A  1 73  ? -4.188  77.998  168.669 1.00 80.34  ? 73  VAL A CB  1 
ATOM   584  C CG1 . VAL A  1 73  ? -3.580  77.944  167.252 1.00 80.13  ? 73  VAL A CG1 1 
ATOM   585  C CG2 . VAL A  1 73  ? -3.536  76.996  169.604 1.00 69.61  ? 73  VAL A CG2 1 
ATOM   586  N N   . ALA A  1 74  ? -2.270  80.292  167.919 1.00 72.50  ? 74  ALA A N   1 
ATOM   587  C CA  . ALA A  1 74  ? -0.924  80.744  167.649 1.00 75.37  ? 74  ALA A CA  1 
ATOM   588  C C   . ALA A  1 74  ? -0.649  82.019  168.418 1.00 77.26  ? 74  ALA A C   1 
ATOM   589  O O   . ALA A  1 74  ? -1.553  82.817  168.681 1.00 84.17  ? 74  ALA A O   1 
ATOM   590  C CB  . ALA A  1 74  ? -0.740  80.981  166.166 1.00 95.12  ? 74  ALA A CB  1 
ATOM   591  N N   . GLU A  1 75  ? 0.616   82.194  168.768 1.00 71.22  ? 75  GLU A N   1 
ATOM   592  C CA  . GLU A  1 75  ? 1.082   83.347  169.516 1.00 52.65  ? 75  GLU A CA  1 
ATOM   593  C C   . GLU A  1 75  ? 2.274   83.945  168.773 1.00 49.05  ? 75  GLU A C   1 
ATOM   594  O O   . GLU A  1 75  ? 3.007   83.243  168.075 1.00 57.66  ? 75  GLU A O   1 
ATOM   595  C CB  . GLU A  1 75  ? 1.465   82.908  170.935 1.00 48.92  ? 75  GLU A CB  1 
ATOM   596  C CG  . GLU A  1 75  ? 2.031   81.485  170.991 1.00 95.90  ? 75  GLU A CG  1 
ATOM   597  C CD  . GLU A  1 75  ? 2.349   81.011  172.398 1.00 113.11 ? 75  GLU A CD  1 
ATOM   598  O OE1 . GLU A  1 75  ? 1.510   81.209  173.305 1.00 122.80 ? 75  GLU A OE1 1 
ATOM   599  O OE2 . GLU A  1 75  ? 3.435   80.426  172.593 1.00 141.52 ? 75  GLU A OE2 1 
ATOM   600  N N   . SER A  1 76  ? 2.445   85.251  168.916 1.00 57.42  ? 76  SER A N   1 
ATOM   601  C CA  . SER A  1 76  ? 3.520   85.981  168.260 1.00 62.43  ? 76  SER A CA  1 
ATOM   602  C C   . SER A  1 76  ? 4.865   85.291  168.375 1.00 63.24  ? 76  SER A C   1 
ATOM   603  O O   . SER A  1 76  ? 5.108   84.573  169.339 1.00 51.33  ? 76  SER A O   1 
ATOM   604  C CB  . SER A  1 76  ? 3.619   87.383  168.864 1.00 80.12  ? 76  SER A CB  1 
ATOM   605  O OG  . SER A  1 76  ? 3.634   87.336  170.287 1.00 74.37  ? 76  SER A OG  1 
ATOM   606  N N   . GLU A  1 77  ? 5.728   85.486  167.379 1.00 71.50  ? 77  GLU A N   1 
ATOM   607  C CA  . GLU A  1 77  ? 7.064   84.906  167.442 1.00 69.04  ? 77  GLU A CA  1 
ATOM   608  C C   . GLU A  1 77  ? 7.579   85.645  168.662 1.00 77.84  ? 77  GLU A C   1 
ATOM   609  O O   . GLU A  1 77  ? 7.229   86.804  168.880 1.00 82.01  ? 77  GLU A O   1 
ATOM   610  C CB  . GLU A  1 77  ? 7.893   85.273  166.211 1.00 79.01  ? 77  GLU A CB  1 
ATOM   611  C CG  . GLU A  1 77  ? 7.364   84.714  164.896 1.00 125.15 ? 77  GLU A CG  1 
ATOM   612  C CD  . GLU A  1 77  ? 7.571   83.215  164.760 1.00 147.88 ? 77  GLU A CD  1 
ATOM   613  O OE1 . GLU A  1 77  ? 8.743   82.773  164.758 1.00 164.45 ? 77  GLU A OE1 1 
ATOM   614  O OE2 . GLU A  1 77  ? 6.566   82.477  164.650 1.00 159.07 ? 77  GLU A OE2 1 
ATOM   615  N N   . PRO A  1 78  ? 8.410   84.999  169.476 1.00 73.49  ? 78  PRO A N   1 
ATOM   616  C CA  . PRO A  1 78  ? 8.902   85.692  170.661 1.00 61.82  ? 78  PRO A CA  1 
ATOM   617  C C   . PRO A  1 78  ? 9.836   86.843  170.322 1.00 67.83  ? 78  PRO A C   1 
ATOM   618  O O   . PRO A  1 78  ? 10.461  86.855  169.263 1.00 67.40  ? 78  PRO A O   1 
ATOM   619  C CB  . PRO A  1 78  ? 9.606   84.583  171.413 1.00 67.20  ? 78  PRO A CB  1 
ATOM   620  C CG  . PRO A  1 78  ? 10.270  83.853  170.283 1.00 84.82  ? 78  PRO A CG  1 
ATOM   621  C CD  . PRO A  1 78  ? 9.153   83.748  169.255 1.00 82.48  ? 78  PRO A CD  1 
ATOM   622  N N   . VAL A  1 79  ? 9.914   87.809  171.231 1.00 60.00  ? 79  VAL A N   1 
ATOM   623  C CA  . VAL A  1 79  ? 10.785  88.963  171.075 1.00 54.43  ? 79  VAL A CA  1 
ATOM   624  C C   . VAL A  1 79  ? 11.649  89.009  172.321 1.00 65.80  ? 79  VAL A C   1 
ATOM   625  O O   . VAL A  1 79  ? 11.119  89.113  173.433 1.00 57.15  ? 79  VAL A O   1 
ATOM   626  C CB  . VAL A  1 79  ? 9.980   90.251  170.992 1.00 43.53  ? 79  VAL A CB  1 
ATOM   627  C CG1 . VAL A  1 79  ? 10.910  91.426  170.825 1.00 72.26  ? 79  VAL A CG1 1 
ATOM   628  C CG2 . VAL A  1 79  ? 9.028   90.171  169.833 1.00 89.97  ? 79  VAL A CG2 1 
ATOM   629  N N   . TYR A  1 80  ? 12.968  88.928  172.142 1.00 59.52  ? 80  TYR A N   1 
ATOM   630  C CA  . TYR A  1 80  ? 13.878  88.944  173.278 1.00 47.26  ? 80  TYR A CA  1 
ATOM   631  C C   . TYR A  1 80  ? 14.390  90.337  173.627 1.00 49.40  ? 80  TYR A C   1 
ATOM   632  O O   . TYR A  1 80  ? 14.892  91.069  172.777 1.00 55.27  ? 80  TYR A O   1 
ATOM   633  C CB  . TYR A  1 80  ? 15.023  87.972  173.020 1.00 63.73  ? 80  TYR A CB  1 
ATOM   634  C CG  . TYR A  1 80  ? 14.516  86.557  172.856 1.00 76.48  ? 80  TYR A CG  1 
ATOM   635  C CD1 . TYR A  1 80  ? 14.499  85.938  171.605 1.00 69.77  ? 80  TYR A CD1 1 
ATOM   636  C CD2 . TYR A  1 80  ? 13.989  85.856  173.947 1.00 77.27  ? 80  TYR A CD2 1 
ATOM   637  C CE1 . TYR A  1 80  ? 13.965  84.657  171.442 1.00 83.19  ? 80  TYR A CE1 1 
ATOM   638  C CE2 . TYR A  1 80  ? 13.451  84.578  173.797 1.00 70.65  ? 80  TYR A CE2 1 
ATOM   639  C CZ  . TYR A  1 80  ? 13.440  83.985  172.542 1.00 84.68  ? 80  TYR A CZ  1 
ATOM   640  O OH  . TYR A  1 80  ? 12.885  82.733  172.385 1.00 89.55  ? 80  TYR A OH  1 
ATOM   641  N N   . LEU A  1 81  ? 14.244  90.689  174.899 1.00 32.88  ? 81  LEU A N   1 
ATOM   642  C CA  . LEU A  1 81  ? 14.628  91.993  175.411 1.00 23.15  ? 81  LEU A CA  1 
ATOM   643  C C   . LEU A  1 81  ? 15.748  91.903  176.441 1.00 40.61  ? 81  LEU A C   1 
ATOM   644  O O   . LEU A  1 81  ? 15.522  91.419  177.549 1.00 45.62  ? 81  LEU A O   1 
ATOM   645  C CB  . LEU A  1 81  ? 13.412  92.635  176.068 1.00 21.54  ? 81  LEU A CB  1 
ATOM   646  C CG  . LEU A  1 81  ? 13.534  94.104  176.437 1.00 48.22  ? 81  LEU A CG  1 
ATOM   647  C CD1 . LEU A  1 81  ? 13.214  94.911  175.209 1.00 66.19  ? 81  LEU A CD1 1 
ATOM   648  C CD2 . LEU A  1 81  ? 12.585  94.468  177.544 1.00 33.04  ? 81  LEU A CD2 1 
ATOM   649  N N   . GLU A  1 82  ? 16.939  92.393  176.098 1.00 46.17  ? 82  GLU A N   1 
ATOM   650  C CA  . GLU A  1 82  ? 18.070  92.348  177.024 1.00 41.60  ? 82  GLU A CA  1 
ATOM   651  C C   . GLU A  1 82  ? 18.361  93.713  177.634 1.00 33.37  ? 82  GLU A C   1 
ATOM   652  O O   . GLU A  1 82  ? 18.443  94.705  176.919 1.00 41.00  ? 82  GLU A O   1 
ATOM   653  C CB  . GLU A  1 82  ? 19.318  91.828  176.307 1.00 63.66  ? 82  GLU A CB  1 
ATOM   654  C CG  . GLU A  1 82  ? 19.115  90.473  175.638 1.00 118.75 ? 82  GLU A CG  1 
ATOM   655  C CD  . GLU A  1 82  ? 20.294  90.041  174.785 1.00 136.78 ? 82  GLU A CD  1 
ATOM   656  O OE1 . GLU A  1 82  ? 21.395  89.842  175.353 1.00 129.10 ? 82  GLU A OE1 1 
ATOM   657  O OE2 . GLU A  1 82  ? 20.112  89.903  173.550 1.00 142.57 ? 82  GLU A OE2 1 
ATOM   658  N N   . VAL A  1 83  ? 18.514  93.756  178.957 1.00 19.25  ? 83  VAL A N   1 
ATOM   659  C CA  . VAL A  1 83  ? 18.800  95.000  179.663 1.00 33.62  ? 83  VAL A CA  1 
ATOM   660  C C   . VAL A  1 83  ? 20.263  95.031  180.108 1.00 44.63  ? 83  VAL A C   1 
ATOM   661  O O   . VAL A  1 83  ? 20.694  94.195  180.901 1.00 66.86  ? 83  VAL A O   1 
ATOM   662  C CB  . VAL A  1 83  ? 17.904  95.144  180.900 1.00 49.16  ? 83  VAL A CB  1 
ATOM   663  C CG1 . VAL A  1 83  ? 18.181  96.457  181.587 1.00 60.44  ? 83  VAL A CG1 1 
ATOM   664  C CG2 . VAL A  1 83  ? 16.457  95.065  180.499 1.00 52.37  ? 83  VAL A CG2 1 
ATOM   665  N N   . PHE A  1 84  ? 21.018  96.007  179.610 1.00 44.45  ? 84  PHE A N   1 
ATOM   666  C CA  . PHE A  1 84  ? 22.439  96.126  179.926 1.00 44.47  ? 84  PHE A CA  1 
ATOM   667  C C   . PHE A  1 84  ? 22.807  97.288  180.825 1.00 46.31  ? 84  PHE A C   1 
ATOM   668  O O   . PHE A  1 84  ? 21.989  98.152  181.116 1.00 38.89  ? 84  PHE A O   1 
ATOM   669  C CB  . PHE A  1 84  ? 23.249  96.308  178.653 1.00 32.89  ? 84  PHE A CB  1 
ATOM   670  C CG  . PHE A  1 84  ? 23.117  95.196  177.675 1.00 36.41  ? 84  PHE A CG  1 
ATOM   671  C CD1 . PHE A  1 84  ? 21.904  94.910  177.096 1.00 37.52  ? 84  PHE A CD1 1 
ATOM   672  C CD2 . PHE A  1 84  ? 24.230  94.459  177.298 1.00 69.60  ? 84  PHE A CD2 1 
ATOM   673  C CE1 . PHE A  1 84  ? 21.797  93.908  176.149 1.00 77.29  ? 84  PHE A CE1 1 
ATOM   674  C CE2 . PHE A  1 84  ? 24.135  93.457  176.353 1.00 83.64  ? 84  PHE A CE2 1 
ATOM   675  C CZ  . PHE A  1 84  ? 22.917  93.179  175.776 1.00 81.54  ? 84  PHE A CZ  1 
ATOM   676  N N   . SER A  1 85  ? 24.075  97.293  181.228 1.00 51.18  ? 85  SER A N   1 
ATOM   677  C CA  . SER A  1 85  ? 24.676  98.342  182.054 1.00 55.12  ? 85  SER A CA  1 
ATOM   678  C C   . SER A  1 85  ? 26.162  98.412  181.760 1.00 44.53  ? 85  SER A C   1 
ATOM   679  O O   . SER A  1 85  ? 26.969  97.836  182.480 1.00 67.11  ? 85  SER A O   1 
ATOM   680  C CB  . SER A  1 85  ? 24.515  98.072  183.537 1.00 62.50  ? 85  SER A CB  1 
ATOM   681  O OG  . SER A  1 85  ? 25.416  98.903  184.249 1.00 52.20  ? 85  SER A OG  1 
ATOM   682  N N   . ASP A  1 86  ? 26.503  99.124  180.694 1.00 39.62  ? 86  ASP A N   1 
ATOM   683  C CA  . ASP A  1 86  ? 27.873  99.290  180.252 1.00 43.74  ? 86  ASP A CA  1 
ATOM   684  C C   . ASP A  1 86  ? 28.036  100.719 179.739 1.00 35.88  ? 86  ASP A C   1 
ATOM   685  O O   . ASP A  1 86  ? 27.162  101.559 179.934 1.00 21.23  ? 86  ASP A O   1 
ATOM   686  C CB  . ASP A  1 86  ? 28.179  98.274  179.158 1.00 58.88  ? 86  ASP A CB  1 
ATOM   687  C CG  . ASP A  1 86  ? 29.651  98.139  178.883 1.00 93.85  ? 86  ASP A CG  1 
ATOM   688  O OD1 . ASP A  1 86  ? 30.251  99.061  178.284 1.00 95.34  ? 86  ASP A OD1 1 
ATOM   689  O OD2 . ASP A  1 86  ? 30.210  97.095  179.277 1.00 119.58 ? 86  ASP A OD2 1 
ATOM   690  N N   . TRP A  1 87  ? 29.143  101.007 179.080 1.00 18.06  ? 87  TRP A N   1 
ATOM   691  C CA  . TRP A  1 87  ? 29.360  102.359 178.621 1.00 13.70  ? 87  TRP A CA  1 
ATOM   692  C C   . TRP A  1 87  ? 28.756  102.597 177.260 1.00 32.85  ? 87  TRP A C   1 
ATOM   693  O O   . TRP A  1 87  ? 28.120  103.633 177.043 1.00 30.17  ? 87  TRP A O   1 
ATOM   694  C CB  . TRP A  1 87  ? 30.850  102.677 178.615 1.00 33.59  ? 87  TRP A CB  1 
ATOM   695  C CG  . TRP A  1 87  ? 31.410  102.892 179.971 1.00 23.15  ? 87  TRP A CG  1 
ATOM   696  C CD1 . TRP A  1 87  ? 31.831  101.934 180.863 1.00 40.55  ? 87  TRP A CD1 1 
ATOM   697  C CD2 . TRP A  1 87  ? 31.589  104.143 180.619 1.00 22.66  ? 87  TRP A CD2 1 
ATOM   698  N NE1 . TRP A  1 87  ? 32.259  102.528 182.026 1.00 37.72  ? 87  TRP A NE1 1 
ATOM   699  C CE2 . TRP A  1 87  ? 32.119  103.885 181.897 1.00 29.40  ? 87  TRP A CE2 1 
ATOM   700  C CE3 . TRP A  1 87  ? 31.356  105.467 180.243 1.00 22.93  ? 87  TRP A CE3 1 
ATOM   701  C CZ2 . TRP A  1 87  ? 32.415  104.901 182.795 1.00 56.08  ? 87  TRP A CZ2 1 
ATOM   702  C CZ3 . TRP A  1 87  ? 31.650  106.465 181.127 1.00 14.66  ? 87  TRP A CZ3 1 
ATOM   703  C CH2 . TRP A  1 87  ? 32.174  106.185 182.389 1.00 67.47  ? 87  TRP A CH2 1 
ATOM   704  N N   . LEU A  1 88  ? 28.962  101.657 176.340 1.00 18.13  ? 88  LEU A N   1 
ATOM   705  C CA  . LEU A  1 88  ? 28.380  101.771 175.005 1.00 26.51  ? 88  LEU A CA  1 
ATOM   706  C C   . LEU A  1 88  ? 27.579  100.530 174.686 1.00 34.28  ? 88  LEU A C   1 
ATOM   707  O O   . LEU A  1 88  ? 27.996  99.411  174.969 1.00 61.98  ? 88  LEU A O   1 
ATOM   708  C CB  . LEU A  1 88  ? 29.448  101.985 173.934 1.00 6.80   ? 88  LEU A CB  1 
ATOM   709  C CG  . LEU A  1 88  ? 30.149  103.334 174.042 1.00 13.91  ? 88  LEU A CG  1 
ATOM   710  C CD1 . LEU A  1 88  ? 30.908  103.647 172.772 1.00 11.11  ? 88  LEU A CD1 1 
ATOM   711  C CD2 . LEU A  1 88  ? 29.107  104.407 174.305 1.00 14.56  ? 88  LEU A CD2 1 
ATOM   712  N N   . LEU A  1 89  ? 26.413  100.743 174.097 1.00 36.01  ? 89  LEU A N   1 
ATOM   713  C CA  . LEU A  1 89  ? 25.514  99.660  173.727 1.00 41.15  ? 89  LEU A CA  1 
ATOM   714  C C   . LEU A  1 89  ? 25.186  99.855  172.258 1.00 49.13  ? 89  LEU A C   1 
ATOM   715  O O   . LEU A  1 89  ? 24.869  100.964 171.825 1.00 50.41  ? 89  LEU A O   1 
ATOM   716  C CB  . LEU A  1 89  ? 24.232  99.746  174.553 1.00 27.51  ? 89  LEU A CB  1 
ATOM   717  C CG  . LEU A  1 89  ? 23.183  98.661  174.363 1.00 32.36  ? 89  LEU A CG  1 
ATOM   718  C CD1 . LEU A  1 89  ? 23.364  97.607  175.406 1.00 32.16  ? 89  LEU A CD1 1 
ATOM   719  C CD2 . LEU A  1 89  ? 21.807  99.251  174.519 1.00 75.39  ? 89  LEU A CD2 1 
ATOM   720  N N   . LEU A  1 90  ? 25.293  98.792  171.477 1.00 36.56  ? 90  LEU A N   1 
ATOM   721  C CA  . LEU A  1 90  ? 24.983  98.911  170.063 1.00 27.41  ? 90  LEU A CA  1 
ATOM   722  C C   . LEU A  1 90  ? 23.587  98.383  169.924 1.00 37.22  ? 90  LEU A C   1 
ATOM   723  O O   . LEU A  1 90  ? 23.330  97.213  170.195 1.00 39.60  ? 90  LEU A O   1 
ATOM   724  C CB  . LEU A  1 90  ? 25.917  98.066  169.229 1.00 19.01  ? 90  LEU A CB  1 
ATOM   725  C CG  . LEU A  1 90  ? 25.566  98.059  167.755 1.00 11.43  ? 90  LEU A CG  1 
ATOM   726  C CD1 . LEU A  1 90  ? 26.146  99.279  167.081 1.00 19.74  ? 90  LEU A CD1 1 
ATOM   727  C CD2 . LEU A  1 90  ? 26.117  96.794  167.137 1.00 27.10  ? 90  LEU A CD2 1 
ATOM   728  N N   . GLN A  1 91  ? 22.681  99.251  169.505 1.00 37.79  ? 91  GLN A N   1 
ATOM   729  C CA  . GLN A  1 91  ? 21.295  98.871  169.354 1.00 29.81  ? 91  GLN A CA  1 
ATOM   730  C C   . GLN A  1 91  ? 20.927  98.713  167.903 1.00 49.14  ? 91  GLN A C   1 
ATOM   731  O O   . GLN A  1 91  ? 21.387  99.472  167.049 1.00 48.11  ? 91  GLN A O   1 
ATOM   732  C CB  . GLN A  1 91  ? 20.401  99.929  169.966 1.00 28.71  ? 91  GLN A CB  1 
ATOM   733  C CG  . GLN A  1 91  ? 20.488  100.046 171.453 1.00 17.43  ? 91  GLN A CG  1 
ATOM   734  C CD  . GLN A  1 91  ? 19.685  101.217 171.942 1.00 38.23  ? 91  GLN A CD  1 
ATOM   735  O OE1 . GLN A  1 91  ? 19.702  102.288 171.325 1.00 33.32  ? 91  GLN A OE1 1 
ATOM   736  N NE2 . GLN A  1 91  ? 18.983  101.036 173.053 1.00 22.30  ? 91  GLN A NE2 1 
ATOM   737  N N   . ALA A  1 92  ? 20.083  97.727  167.624 1.00 44.68  ? 92  ALA A N   1 
ATOM   738  C CA  . ALA A  1 92  ? 19.652  97.509  166.262 1.00 43.38  ? 92  ALA A CA  1 
ATOM   739  C C   . ALA A  1 92  ? 18.147  97.400  166.213 1.00 48.64  ? 92  ALA A C   1 
ATOM   740  O O   . ALA A  1 92  ? 17.518  96.880  167.141 1.00 44.32  ? 92  ALA A O   1 
ATOM   741  C CB  . ALA A  1 92  ? 20.287  96.263  165.698 1.00 44.65  ? 92  ALA A CB  1 
ATOM   742  N N   . SER A  1 93  ? 17.592  97.919  165.121 1.00 47.85  ? 93  SER A N   1 
ATOM   743  C CA  . SER A  1 93  ? 16.163  97.913  164.863 1.00 55.16  ? 93  SER A CA  1 
ATOM   744  C C   . SER A  1 93  ? 15.629  96.478  164.810 1.00 51.56  ? 93  SER A C   1 
ATOM   745  O O   . SER A  1 93  ? 14.493  96.216  165.208 1.00 55.96  ? 93  SER A O   1 
ATOM   746  C CB  . SER A  1 93  ? 15.890  98.616  163.541 1.00 41.94  ? 93  SER A CB  1 
ATOM   747  O OG  . SER A  1 93  ? 16.522  97.916  162.484 1.00 59.31  ? 93  SER A OG  1 
ATOM   748  N N   . ALA A  1 94  ? 16.454  95.560  164.317 1.00 30.00  ? 94  ALA A N   1 
ATOM   749  C CA  . ALA A  1 94  ? 16.084  94.157  164.218 1.00 51.04  ? 94  ALA A CA  1 
ATOM   750  C C   . ALA A  1 94  ? 17.323  93.302  164.028 1.00 56.07  ? 94  ALA A C   1 
ATOM   751  O O   . ALA A  1 94  ? 18.162  93.613  163.198 1.00 60.52  ? 94  ALA A O   1 
ATOM   752  C CB  . ALA A  1 94  ? 15.137  93.958  163.058 1.00 85.84  ? 94  ALA A CB  1 
ATOM   753  N N   . GLU A  1 95  ? 17.433  92.214  164.780 1.00 59.89  ? 95  GLU A N   1 
ATOM   754  C CA  . GLU A  1 95  ? 18.605  91.356  164.667 1.00 64.60  ? 95  GLU A CA  1 
ATOM   755  C C   . GLU A  1 95  ? 18.598  90.494  163.408 1.00 61.45  ? 95  GLU A C   1 
ATOM   756  O O   . GLU A  1 95  ? 19.650  90.135  162.888 1.00 59.21  ? 95  GLU A O   1 
ATOM   757  C CB  . GLU A  1 95  ? 18.722  90.493  165.917 1.00 74.75  ? 95  GLU A CB  1 
ATOM   758  C CG  . GLU A  1 95  ? 18.730  91.321  167.184 1.00 64.21  ? 95  GLU A CG  1 
ATOM   759  C CD  . GLU A  1 95  ? 18.734  90.472  168.427 1.00 105.79 ? 95  GLU A CD  1 
ATOM   760  O OE1 . GLU A  1 95  ? 17.813  89.639  168.582 1.00 128.56 ? 95  GLU A OE1 1 
ATOM   761  O OE2 . GLU A  1 95  ? 19.659  90.640  169.247 1.00 112.19 ? 95  GLU A OE2 1 
ATOM   762  N N   . VAL A  1 96  ? 17.407  90.163  162.926 1.00 68.01  ? 96  VAL A N   1 
ATOM   763  C CA  . VAL A  1 96  ? 17.246  89.377  161.703 1.00 55.83  ? 96  VAL A CA  1 
ATOM   764  C C   . VAL A  1 96  ? 16.348  90.214  160.801 1.00 48.67  ? 96  VAL A C   1 
ATOM   765  O O   . VAL A  1 96  ? 15.182  90.453  161.107 1.00 62.00  ? 96  VAL A O   1 
ATOM   766  C CB  . VAL A  1 96  ? 16.572  88.026  161.974 1.00 60.40  ? 96  VAL A CB  1 
ATOM   767  C CG1 . VAL A  1 96  ? 16.439  87.269  160.687 1.00 67.89  ? 96  VAL A CG1 1 
ATOM   768  C CG2 . VAL A  1 96  ? 17.384  87.219  162.972 1.00 75.19  ? 96  VAL A CG2 1 
ATOM   769  N N   . VAL A  1 97  ? 16.900  90.673  159.692 1.00 29.49  ? 97  VAL A N   1 
ATOM   770  C CA  . VAL A  1 97  ? 16.164  91.532  158.786 1.00 58.11  ? 97  VAL A CA  1 
ATOM   771  C C   . VAL A  1 97  ? 15.894  90.875  157.450 1.00 80.28  ? 97  VAL A C   1 
ATOM   772  O O   . VAL A  1 97  ? 16.828  90.509  156.745 1.00 100.70 ? 97  VAL A O   1 
ATOM   773  C CB  . VAL A  1 97  ? 16.945  92.851  158.561 1.00 50.99  ? 97  VAL A CB  1 
ATOM   774  C CG1 . VAL A  1 97  ? 16.712  93.382  157.165 1.00 81.26  ? 97  VAL A CG1 1 
ATOM   775  C CG2 . VAL A  1 97  ? 16.501  93.882  159.579 1.00 78.61  ? 97  VAL A CG2 1 
ATOM   776  N N   . MET A  1 98  ? 14.615  90.734  157.103 1.00 103.69 ? 98  MET A N   1 
ATOM   777  C CA  . MET A  1 98  ? 14.229  90.126  155.835 1.00 110.29 ? 98  MET A CA  1 
ATOM   778  C C   . MET A  1 98  ? 14.778  90.978  154.699 1.00 101.36 ? 98  MET A C   1 
ATOM   779  O O   . MET A  1 98  ? 14.724  92.203  154.747 1.00 80.82  ? 98  MET A O   1 
ATOM   780  C CB  . MET A  1 98  ? 12.701  90.028  155.717 1.00 139.11 ? 98  MET A CB  1 
ATOM   781  C CG  . MET A  1 98  ? 12.042  89.134  156.758 1.00 167.79 ? 98  MET A CG  1 
ATOM   782  S SD  . MET A  1 98  ? 10.239  89.149  156.658 1.00 193.43 ? 98  MET A SD  1 
ATOM   783  C CE  . MET A  1 98  ? 9.857   90.576  157.704 1.00 192.29 ? 98  MET A CE  1 
ATOM   784  N N   . GLU A  1 99  ? 15.315  90.312  153.684 1.00 115.09 ? 99  GLU A N   1 
ATOM   785  C CA  . GLU A  1 99  ? 15.895  90.956  152.506 1.00 117.40 ? 99  GLU A CA  1 
ATOM   786  C C   . GLU A  1 99  ? 15.083  92.177  152.061 1.00 97.68  ? 99  GLU A C   1 
ATOM   787  O O   . GLU A  1 99  ? 13.856  92.132  152.005 1.00 108.60 ? 99  GLU A O   1 
ATOM   788  C CB  . GLU A  1 99  ? 15.975  89.918  151.373 1.00 148.33 ? 99  GLU A CB  1 
ATOM   789  C CG  . GLU A  1 99  ? 16.759  90.309  150.123 1.00 162.57 ? 99  GLU A CG  1 
ATOM   790  C CD  . GLU A  1 99  ? 16.928  89.132  149.164 1.00 175.25 ? 99  GLU A CD  1 
ATOM   791  O OE1 . GLU A  1 99  ? 15.908  88.496  148.810 1.00 180.59 ? 99  GLU A OE1 1 
ATOM   792  O OE2 . GLU A  1 99  ? 18.079  88.844  148.765 1.00 171.44 ? 99  GLU A OE2 1 
ATOM   793  N N   . GLY A  1 100 ? 15.770  93.271  151.758 1.00 73.29  ? 100 GLY A N   1 
ATOM   794  C CA  . GLY A  1 100 ? 15.080  94.470  151.312 1.00 90.97  ? 100 GLY A CA  1 
ATOM   795  C C   . GLY A  1 100 ? 14.648  95.464  152.380 1.00 102.69 ? 100 GLY A C   1 
ATOM   796  O O   . GLY A  1 100 ? 14.773  96.675  152.180 1.00 115.89 ? 100 GLY A O   1 
ATOM   797  N N   . GLN A  1 101 ? 14.134  94.967  153.505 1.00 93.53  ? 101 GLN A N   1 
ATOM   798  C CA  . GLN A  1 101 ? 13.691  95.830  154.606 1.00 87.97  ? 101 GLN A CA  1 
ATOM   799  C C   . GLN A  1 101 ? 14.821  96.737  155.149 1.00 71.71  ? 101 GLN A C   1 
ATOM   800  O O   . GLN A  1 101 ? 16.007  96.446  154.978 1.00 72.39  ? 101 GLN A O   1 
ATOM   801  C CB  . GLN A  1 101 ? 13.125  94.970  155.749 1.00 105.99 ? 101 GLN A CB  1 
ATOM   802  C CG  . GLN A  1 101 ? 11.942  94.075  155.371 1.00 120.41 ? 101 GLN A CG  1 
ATOM   803  C CD  . GLN A  1 101 ? 10.670  94.847  155.045 1.00 131.02 ? 101 GLN A CD  1 
ATOM   804  O OE1 . GLN A  1 101 ? 10.628  96.072  155.148 1.00 131.30 ? 101 GLN A OE1 1 
ATOM   805  N NE2 . GLN A  1 101 ? 9.622   94.125  154.657 1.00 143.47 ? 101 GLN A NE2 1 
ATOM   806  N N   . PRO A  1 102 ? 14.461  97.854  155.803 1.00 53.04  ? 102 PRO A N   1 
ATOM   807  C CA  . PRO A  1 102 ? 15.446  98.779  156.359 1.00 49.49  ? 102 PRO A CA  1 
ATOM   808  C C   . PRO A  1 102 ? 16.106  98.283  157.645 1.00 54.64  ? 102 PRO A C   1 
ATOM   809  O O   . PRO A  1 102 ? 15.560  97.432  158.365 1.00 37.64  ? 102 PRO A O   1 
ATOM   810  C CB  . PRO A  1 102 ? 14.633  100.039 156.586 1.00 44.81  ? 102 PRO A CB  1 
ATOM   811  C CG  . PRO A  1 102 ? 13.316  99.493  156.982 1.00 40.06  ? 102 PRO A CG  1 
ATOM   812  C CD  . PRO A  1 102 ? 13.105  98.404  155.959 1.00 63.38  ? 102 PRO A CD  1 
ATOM   813  N N   . LEU A  1 103 ? 17.280  98.847  157.924 1.00 47.98  ? 103 LEU A N   1 
ATOM   814  C CA  . LEU A  1 103 ? 18.070  98.496  159.093 1.00 31.75  ? 103 LEU A CA  1 
ATOM   815  C C   . LEU A  1 103 ? 18.656  99.713  159.791 1.00 25.24  ? 103 LEU A C   1 
ATOM   816  O O   . LEU A  1 103 ? 19.091  100.667 159.149 1.00 42.86  ? 103 LEU A O   1 
ATOM   817  C CB  . LEU A  1 103 ? 19.201  97.587  158.673 1.00 27.56  ? 103 LEU A CB  1 
ATOM   818  C CG  . LEU A  1 103 ? 20.077  97.146  159.825 1.00 34.95  ? 103 LEU A CG  1 
ATOM   819  C CD1 . LEU A  1 103 ? 19.245  96.340  160.809 1.00 27.38  ? 103 LEU A CD1 1 
ATOM   820  C CD2 . LEU A  1 103 ? 21.239  96.342  159.271 1.00 32.73  ? 103 LEU A CD2 1 
ATOM   821  N N   . PHE A  1 104 ? 18.690  99.675  161.113 1.00 27.74  ? 104 PHE A N   1 
ATOM   822  C CA  . PHE A  1 104 ? 19.229  100.796 161.853 1.00 34.88  ? 104 PHE A CA  1 
ATOM   823  C C   . PHE A  1 104 ? 20.150  100.419 162.978 1.00 44.55  ? 104 PHE A C   1 
ATOM   824  O O   . PHE A  1 104 ? 19.834  99.593  163.832 1.00 46.36  ? 104 PHE A O   1 
ATOM   825  C CB  . PHE A  1 104 ? 18.107  101.655 162.406 1.00 28.70  ? 104 PHE A CB  1 
ATOM   826  C CG  . PHE A  1 104 ? 17.195  102.171 161.361 1.00 47.11  ? 104 PHE A CG  1 
ATOM   827  C CD1 . PHE A  1 104 ? 15.965  101.566 161.139 1.00 32.54  ? 104 PHE A CD1 1 
ATOM   828  C CD2 . PHE A  1 104 ? 17.569  103.257 160.577 1.00 66.49  ? 104 PHE A CD2 1 
ATOM   829  C CE1 . PHE A  1 104 ? 15.105  102.040 160.146 1.00 48.55  ? 104 PHE A CE1 1 
ATOM   830  C CE2 . PHE A  1 104 ? 16.719  103.743 159.579 1.00 79.57  ? 104 PHE A CE2 1 
ATOM   831  C CZ  . PHE A  1 104 ? 15.481  103.133 159.363 1.00 54.79  ? 104 PHE A CZ  1 
ATOM   832  N N   . LEU A  1 105 ? 21.306  101.049 162.970 1.00 28.81  ? 105 LEU A N   1 
ATOM   833  C CA  . LEU A  1 105 ? 22.277  100.811 163.995 1.00 32.17  ? 105 LEU A CA  1 
ATOM   834  C C   . LEU A  1 105 ? 22.391  102.129 164.720 1.00 39.65  ? 105 LEU A C   1 
ATOM   835  O O   . LEU A  1 105 ? 22.230  103.192 164.123 1.00 48.93  ? 105 LEU A O   1 
ATOM   836  C CB  . LEU A  1 105 ? 23.609  100.437 163.362 1.00 48.03  ? 105 LEU A CB  1 
ATOM   837  C CG  . LEU A  1 105 ? 23.596  99.200  162.464 1.00 41.27  ? 105 LEU A CG  1 
ATOM   838  C CD1 . LEU A  1 105 ? 24.941  99.044  161.777 1.00 71.81  ? 105 LEU A CD1 1 
ATOM   839  C CD2 . LEU A  1 105 ? 23.285  97.976  163.291 1.00 8.69   ? 105 LEU A CD2 1 
ATOM   840  N N   . ARG A  1 106 ? 22.676  102.055 166.010 1.00 34.86  ? 106 ARG A N   1 
ATOM   841  C CA  . ARG A  1 106 ? 22.819  103.239 166.837 1.00 28.13  ? 106 ARG A CA  1 
ATOM   842  C C   . ARG A  1 106 ? 23.838  102.977 167.956 1.00 40.09  ? 106 ARG A C   1 
ATOM   843  O O   . ARG A  1 106 ? 23.716  101.991 168.685 1.00 26.79  ? 106 ARG A O   1 
ATOM   844  C CB  . ARG A  1 106 ? 21.456  103.568 167.438 1.00 26.02  ? 106 ARG A CB  1 
ATOM   845  C CG  . ARG A  1 106 ? 21.448  104.739 168.369 1.00 39.37  ? 106 ARG A CG  1 
ATOM   846  C CD  . ARG A  1 106 ? 20.098  104.857 169.030 1.00 27.77  ? 106 ARG A CD  1 
ATOM   847  N NE  . ARG A  1 106 ? 20.162  105.533 170.318 1.00 38.22  ? 106 ARG A NE  1 
ATOM   848  C CZ  . ARG A  1 106 ? 19.100  105.803 171.065 1.00 43.03  ? 106 ARG A CZ  1 
ATOM   849  N NH1 . ARG A  1 106 ? 17.892  105.459 170.642 1.00 77.36  ? 106 ARG A NH1 1 
ATOM   850  N NH2 . ARG A  1 106 ? 19.240  106.401 172.241 1.00 60.89  ? 106 ARG A NH2 1 
ATOM   851  N N   . CYS A  1 107 ? 24.866  103.815 168.077 1.00 30.52  ? 107 CYS A N   1 
ATOM   852  C CA  . CYS A  1 107 ? 25.807  103.616 169.176 1.00 38.29  ? 107 CYS A CA  1 
ATOM   853  C C   . CYS A  1 107 ? 25.176  104.464 170.251 1.00 33.28  ? 107 CYS A C   1 
ATOM   854  O O   . CYS A  1 107 ? 25.065  105.682 170.102 1.00 34.47  ? 107 CYS A O   1 
ATOM   855  C CB  . CYS A  1 107 ? 27.216  104.119 168.858 1.00 4.74   ? 107 CYS A CB  1 
ATOM   856  S SG  . CYS A  1 107 ? 28.525  103.331 169.872 1.00 71.53  ? 107 CYS A SG  1 
ATOM   857  N N   . HIS A  1 108 ? 24.717  103.804 171.311 1.00 24.32  ? 108 HIS A N   1 
ATOM   858  C CA  . HIS A  1 108 ? 24.045  104.487 172.398 1.00 24.35  ? 108 HIS A CA  1 
ATOM   859  C C   . HIS A  1 108 ? 24.898  104.633 173.634 1.00 41.21  ? 108 HIS A C   1 
ATOM   860  O O   . HIS A  1 108 ? 25.330  103.648 174.220 1.00 24.56  ? 108 HIS A O   1 
ATOM   861  C CB  . HIS A  1 108 ? 22.770  103.755 172.765 1.00 34.19  ? 108 HIS A CB  1 
ATOM   862  C CG  . HIS A  1 108 ? 21.954  104.478 173.783 1.00 51.30  ? 108 HIS A CG  1 
ATOM   863  N ND1 . HIS A  1 108 ? 21.783  105.845 173.750 1.00 52.22  ? 108 HIS A ND1 1 
ATOM   864  C CD2 . HIS A  1 108 ? 21.270  104.037 174.864 1.00 31.49  ? 108 HIS A CD2 1 
ATOM   865  C CE1 . HIS A  1 108 ? 21.030  106.213 174.769 1.00 60.87  ? 108 HIS A CE1 1 
ATOM   866  N NE2 . HIS A  1 108 ? 20.706  105.135 175.460 1.00 54.76  ? 108 HIS A NE2 1 
ATOM   867  N N   . GLY A  1 109 ? 25.122  105.874 174.047 1.00 46.40  ? 109 GLY A N   1 
ATOM   868  C CA  . GLY A  1 109 ? 25.950  106.085 175.212 1.00 33.75  ? 109 GLY A CA  1 
ATOM   869  C C   . GLY A  1 109 ? 25.165  106.142 176.498 1.00 35.55  ? 109 GLY A C   1 
ATOM   870  O O   . GLY A  1 109 ? 24.159  106.838 176.579 1.00 50.71  ? 109 GLY A O   1 
ATOM   871  N N   . TRP A  1 110 ? 25.641  105.412 177.501 1.00 14.23  ? 110 TRP A N   1 
ATOM   872  C CA  . TRP A  1 110 ? 25.033  105.365 178.824 1.00 25.47  ? 110 TRP A CA  1 
ATOM   873  C C   . TRP A  1 110 ? 24.430  106.697 179.304 1.00 32.67  ? 110 TRP A C   1 
ATOM   874  O O   . TRP A  1 110 ? 24.984  107.758 179.042 1.00 41.26  ? 110 TRP A O   1 
ATOM   875  C CB  . TRP A  1 110 ? 26.075  104.901 179.816 1.00 12.39  ? 110 TRP A CB  1 
ATOM   876  C CG  . TRP A  1 110 ? 25.536  104.902 181.182 1.00 49.32  ? 110 TRP A CG  1 
ATOM   877  C CD1 . TRP A  1 110 ? 25.692  105.866 182.129 1.00 45.74  ? 110 TRP A CD1 1 
ATOM   878  C CD2 . TRP A  1 110 ? 24.735  103.879 181.772 1.00 54.04  ? 110 TRP A CD2 1 
ATOM   879  N NE1 . TRP A  1 110 ? 25.039  105.500 183.283 1.00 52.73  ? 110 TRP A NE1 1 
ATOM   880  C CE2 . TRP A  1 110 ? 24.444  104.283 183.085 1.00 28.39  ? 110 TRP A CE2 1 
ATOM   881  C CE3 . TRP A  1 110 ? 24.239  102.654 181.316 1.00 65.71  ? 110 TRP A CE3 1 
ATOM   882  C CZ2 . TRP A  1 110 ? 23.685  103.510 183.944 1.00 46.59  ? 110 TRP A CZ2 1 
ATOM   883  C CZ3 . TRP A  1 110 ? 23.484  101.886 182.176 1.00 60.58  ? 110 TRP A CZ3 1 
ATOM   884  C CH2 . TRP A  1 110 ? 23.216  102.317 183.476 1.00 28.73  ? 110 TRP A CH2 1 
ATOM   885  N N   . ARG A  1 111 ? 23.324  106.639 180.045 1.00 15.74  ? 111 ARG A N   1 
ATOM   886  C CA  . ARG A  1 111 ? 22.640  107.855 180.509 1.00 36.07  ? 111 ARG A CA  1 
ATOM   887  C C   . ARG A  1 111 ? 22.590  108.889 179.383 1.00 30.52  ? 111 ARG A C   1 
ATOM   888  O O   . ARG A  1 111 ? 22.455  110.096 179.584 1.00 42.46  ? 111 ARG A O   1 
ATOM   889  C CB  . ARG A  1 111 ? 23.299  108.434 181.778 1.00 37.09  ? 111 ARG A CB  1 
ATOM   890  C CG  . ARG A  1 111 ? 23.045  107.558 183.026 1.00 83.26  ? 111 ARG A CG  1 
ATOM   891  C CD  . ARG A  1 111 ? 23.274  108.250 184.384 1.00 76.19  ? 111 ARG A CD  1 
ATOM   892  N NE  . ARG A  1 111 ? 22.026  108.704 185.001 1.00 86.52  ? 111 ARG A NE  1 
ATOM   893  C CZ  . ARG A  1 111 ? 21.283  109.706 184.540 1.00 102.20 ? 111 ARG A CZ  1 
ATOM   894  N NH1 . ARG A  1 111 ? 21.659  110.370 183.454 1.00 101.04 ? 111 ARG A NH1 1 
ATOM   895  N NH2 . ARG A  1 111 ? 20.159  110.045 185.159 1.00 114.42 ? 111 ARG A NH2 1 
ATOM   896  N N   . ASN A  1 112 ? 22.668  108.367 178.176 1.00 13.60  ? 112 ASN A N   1 
ATOM   897  C CA  . ASN A  1 112 ? 22.638  109.160 176.979 1.00 26.82  ? 112 ASN A CA  1 
ATOM   898  C C   . ASN A  1 112 ? 23.759  110.186 177.006 1.00 46.05  ? 112 ASN A C   1 
ATOM   899  O O   . ASN A  1 112 ? 23.623  111.301 176.503 1.00 79.96  ? 112 ASN A O   1 
ATOM   900  C CB  . ASN A  1 112 ? 21.259  109.811 176.809 1.00 33.42  ? 112 ASN A CB  1 
ATOM   901  C CG  . ASN A  1 112 ? 20.903  110.048 175.338 1.00 79.28  ? 112 ASN A CG  1 
ATOM   902  O OD1 . ASN A  1 112 ? 21.105  109.180 174.484 1.00 69.12  ? 112 ASN A OD1 1 
ATOM   903  N ND2 . ASN A  1 112 ? 20.363  111.225 175.042 1.00 102.46 ? 112 ASN A ND2 1 
ATOM   904  N N   . TRP A  1 113 ? 24.884  109.793 177.590 1.00 42.26  ? 113 TRP A N   1 
ATOM   905  C CA  . TRP A  1 113 ? 26.034  110.674 177.632 1.00 41.81  ? 113 TRP A CA  1 
ATOM   906  C C   . TRP A  1 113 ? 26.585  110.818 176.232 1.00 47.82  ? 113 TRP A C   1 
ATOM   907  O O   . TRP A  1 113 ? 26.479  109.921 175.397 1.00 61.62  ? 113 TRP A O   1 
ATOM   908  C CB  . TRP A  1 113 ? 27.127  110.128 178.532 1.00 18.83  ? 113 TRP A CB  1 
ATOM   909  C CG  . TRP A  1 113 ? 26.882  110.334 179.969 1.00 13.83  ? 113 TRP A CG  1 
ATOM   910  C CD1 . TRP A  1 113 ? 26.037  111.226 180.528 1.00 39.03  ? 113 TRP A CD1 1 
ATOM   911  C CD2 . TRP A  1 113 ? 27.516  109.646 181.050 1.00 17.09  ? 113 TRP A CD2 1 
ATOM   912  N NE1 . TRP A  1 113 ? 26.095  111.138 181.899 1.00 40.67  ? 113 TRP A NE1 1 
ATOM   913  C CE2 . TRP A  1 113 ? 27.000  110.174 182.242 1.00 14.81  ? 113 TRP A CE2 1 
ATOM   914  C CE3 . TRP A  1 113 ? 28.477  108.636 181.124 1.00 28.87  ? 113 TRP A CE3 1 
ATOM   915  C CZ2 . TRP A  1 113 ? 27.411  109.724 183.501 1.00 34.65  ? 113 TRP A CZ2 1 
ATOM   916  C CZ3 . TRP A  1 113 ? 28.886  108.191 182.375 1.00 6.62   ? 113 TRP A CZ3 1 
ATOM   917  C CH2 . TRP A  1 113 ? 28.355  108.733 183.542 1.00 19.55  ? 113 TRP A CH2 1 
ATOM   918  N N   . ASP A  1 114 ? 27.174  111.970 175.983 1.00 51.97  ? 114 ASP A N   1 
ATOM   919  C CA  . ASP A  1 114 ? 27.749  112.254 174.696 1.00 47.86  ? 114 ASP A CA  1 
ATOM   920  C C   . ASP A  1 114 ? 28.910  111.324 174.393 1.00 49.42  ? 114 ASP A C   1 
ATOM   921  O O   . ASP A  1 114 ? 29.718  111.023 175.268 1.00 41.16  ? 114 ASP A O   1 
ATOM   922  C CB  . ASP A  1 114 ? 28.223  113.698 174.678 1.00 47.61  ? 114 ASP A CB  1 
ATOM   923  C CG  . ASP A  1 114 ? 27.094  114.663 174.860 1.00 47.35  ? 114 ASP A CG  1 
ATOM   924  O OD1 . ASP A  1 114 ? 26.224  114.722 173.964 1.00 62.14  ? 114 ASP A OD1 1 
ATOM   925  O OD2 . ASP A  1 114 ? 27.072  115.349 175.897 1.00 37.10  ? 114 ASP A OD2 1 
ATOM   926  N N   . VAL A  1 115 ? 28.967  110.858 173.148 1.00 33.89  ? 115 VAL A N   1 
ATOM   927  C CA  . VAL A  1 115 ? 30.048  109.990 172.687 1.00 30.16  ? 115 VAL A CA  1 
ATOM   928  C C   . VAL A  1 115 ? 30.623  110.612 171.426 1.00 32.88  ? 115 VAL A C   1 
ATOM   929  O O   . VAL A  1 115 ? 29.931  110.735 170.423 1.00 37.61  ? 115 VAL A O   1 
ATOM   930  C CB  . VAL A  1 115 ? 29.579  108.551 172.316 1.00 19.30  ? 115 VAL A CB  1 
ATOM   931  C CG1 . VAL A  1 115 ? 30.611  107.900 171.442 1.00 44.77  ? 115 VAL A CG1 1 
ATOM   932  C CG2 . VAL A  1 115 ? 29.447  107.693 173.535 1.00 4.74   ? 115 VAL A CG2 1 
ATOM   933  N N   . TYR A  1 116 ? 31.886  111.012 171.465 1.00 29.61  ? 116 TYR A N   1 
ATOM   934  C CA  . TYR A  1 116 ? 32.479  111.602 170.279 1.00 19.60  ? 116 TYR A CA  1 
ATOM   935  C C   . TYR A  1 116 ? 33.391  110.599 169.588 1.00 25.03  ? 116 TYR A C   1 
ATOM   936  O O   . TYR A  1 116 ? 33.850  109.628 170.205 1.00 12.90  ? 116 TYR A O   1 
ATOM   937  C CB  . TYR A  1 116 ? 33.256  112.865 170.637 1.00 44.54  ? 116 TYR A CB  1 
ATOM   938  C CG  . TYR A  1 116 ? 32.427  113.950 171.286 1.00 19.67  ? 116 TYR A CG  1 
ATOM   939  C CD1 . TYR A  1 116 ? 32.051  113.862 172.611 1.00 23.75  ? 116 TYR A CD1 1 
ATOM   940  C CD2 . TYR A  1 116 ? 32.004  115.049 170.560 1.00 34.62  ? 116 TYR A CD2 1 
ATOM   941  C CE1 . TYR A  1 116 ? 31.273  114.839 173.205 1.00 37.81  ? 116 TYR A CE1 1 
ATOM   942  C CE2 . TYR A  1 116 ? 31.227  116.031 171.138 1.00 47.07  ? 116 TYR A CE2 1 
ATOM   943  C CZ  . TYR A  1 116 ? 30.864  115.920 172.460 1.00 49.10  ? 116 TYR A CZ  1 
ATOM   944  O OH  . TYR A  1 116 ? 30.091  116.898 173.033 1.00 66.19  ? 116 TYR A OH  1 
ATOM   945  N N   . LYS A  1 117 ? 33.636  110.842 168.302 1.00 20.31  ? 117 LYS A N   1 
ATOM   946  C CA  . LYS A  1 117 ? 34.479  109.975 167.479 1.00 21.39  ? 117 LYS A CA  1 
ATOM   947  C C   . LYS A  1 117 ? 33.962  108.543 167.472 1.00 29.54  ? 117 LYS A C   1 
ATOM   948  O O   . LYS A  1 117 ? 34.687  107.595 167.749 1.00 45.53  ? 117 LYS A O   1 
ATOM   949  C CB  . LYS A  1 117 ? 35.937  110.034 167.974 1.00 12.63  ? 117 LYS A CB  1 
ATOM   950  C CG  . LYS A  1 117 ? 36.715  111.214 167.404 1.00 11.58  ? 117 LYS A CG  1 
ATOM   951  C CD  . LYS A  1 117 ? 37.800  111.699 168.323 1.00 27.70  ? 117 LYS A CD  1 
ATOM   952  C CE  . LYS A  1 117 ? 38.449  112.977 167.779 1.00 29.01  ? 117 LYS A CE  1 
ATOM   953  N NZ  . LYS A  1 117 ? 39.653  113.406 168.569 1.00 40.49  ? 117 LYS A NZ  1 
ATOM   954  N N   . VAL A  1 118 ? 32.693  108.398 167.136 1.00 29.26  ? 118 VAL A N   1 
ATOM   955  C CA  . VAL A  1 118 ? 32.045  107.102 167.109 1.00 19.71  ? 118 VAL A CA  1 
ATOM   956  C C   . VAL A  1 118 ? 32.404  106.398 165.829 1.00 31.53  ? 118 VAL A C   1 
ATOM   957  O O   . VAL A  1 118 ? 32.314  106.981 164.755 1.00 22.23  ? 118 VAL A O   1 
ATOM   958  C CB  . VAL A  1 118 ? 30.540  107.259 167.103 1.00 20.44  ? 118 VAL A CB  1 
ATOM   959  C CG1 . VAL A  1 118 ? 29.897  105.947 167.298 1.00 10.37  ? 118 VAL A CG1 1 
ATOM   960  C CG2 . VAL A  1 118 ? 30.122  108.227 168.165 1.00 38.60  ? 118 VAL A CG2 1 
ATOM   961  N N   . ILE A  1 119 ? 32.821  105.148 165.939 1.00 29.95  ? 119 ILE A N   1 
ATOM   962  C CA  . ILE A  1 119 ? 33.130  104.369 164.753 1.00 41.18  ? 119 ILE A CA  1 
ATOM   963  C C   . ILE A  1 119 ? 32.391  103.054 164.815 1.00 48.18  ? 119 ILE A C   1 
ATOM   964  O O   . ILE A  1 119 ? 32.403  102.371 165.840 1.00 50.77  ? 119 ILE A O   1 
ATOM   965  C CB  . ILE A  1 119 ? 34.604  104.042 164.634 1.00 27.97  ? 119 ILE A CB  1 
ATOM   966  C CG1 . ILE A  1 119 ? 35.406  105.305 164.379 1.00 36.59  ? 119 ILE A CG1 1 
ATOM   967  C CG2 . ILE A  1 119 ? 34.809  103.093 163.482 1.00 32.42  ? 119 ILE A CG2 1 
ATOM   968  C CD1 . ILE A  1 119 ? 36.855  105.042 164.194 1.00 14.34  ? 119 ILE A CD1 1 
ATOM   969  N N   . TYR A  1 120 ? 31.743  102.698 163.720 1.00 28.46  ? 120 TYR A N   1 
ATOM   970  C CA  . TYR A  1 120 ? 31.023  101.445 163.679 1.00 28.03  ? 120 TYR A CA  1 
ATOM   971  C C   . TYR A  1 120 ? 31.864  100.435 162.917 1.00 47.79  ? 120 TYR A C   1 
ATOM   972  O O   . TYR A  1 120 ? 32.395  100.743 161.850 1.00 42.86  ? 120 TYR A O   1 
ATOM   973  C CB  . TYR A  1 120 ? 29.692  101.622 162.976 1.00 17.17  ? 120 TYR A CB  1 
ATOM   974  C CG  . TYR A  1 120 ? 28.673  102.393 163.755 1.00 18.21  ? 120 TYR A CG  1 
ATOM   975  C CD1 . TYR A  1 120 ? 28.517  103.760 163.585 1.00 4.93   ? 120 TYR A CD1 1 
ATOM   976  C CD2 . TYR A  1 120 ? 27.806  101.737 164.599 1.00 22.67  ? 120 TYR A CD2 1 
ATOM   977  C CE1 . TYR A  1 120 ? 27.509  104.438 164.227 1.00 26.42  ? 120 TYR A CE1 1 
ATOM   978  C CE2 . TYR A  1 120 ? 26.803  102.398 165.243 1.00 11.48  ? 120 TYR A CE2 1 
ATOM   979  C CZ  . TYR A  1 120 ? 26.647  103.740 165.056 1.00 32.66  ? 120 TYR A CZ  1 
ATOM   980  O OH  . TYR A  1 120 ? 25.595  104.357 165.687 1.00 53.71  ? 120 TYR A OH  1 
ATOM   981  N N   . TYR A  1 121 ? 31.991  99.229  163.466 1.00 55.52  ? 121 TYR A N   1 
ATOM   982  C CA  . TYR A  1 121 ? 32.769  98.187  162.811 1.00 43.12  ? 121 TYR A CA  1 
ATOM   983  C C   . TYR A  1 121 ? 31.882  97.078  162.315 1.00 51.28  ? 121 TYR A C   1 
ATOM   984  O O   . TYR A  1 121 ? 30.877  96.730  162.942 1.00 56.28  ? 121 TYR A O   1 
ATOM   985  C CB  . TYR A  1 121 ? 33.826  97.598  163.747 1.00 35.47  ? 121 TYR A CB  1 
ATOM   986  C CG  . TYR A  1 121 ? 34.978  98.529  164.015 1.00 23.61  ? 121 TYR A CG  1 
ATOM   987  C CD1 . TYR A  1 121 ? 34.991  99.343  165.133 1.00 56.44  ? 121 TYR A CD1 1 
ATOM   988  C CD2 . TYR A  1 121 ? 36.022  98.645  163.112 1.00 47.09  ? 121 TYR A CD2 1 
ATOM   989  C CE1 . TYR A  1 121 ? 36.010  100.254 165.343 1.00 62.95  ? 121 TYR A CE1 1 
ATOM   990  C CE2 . TYR A  1 121 ? 37.047  99.558  163.313 1.00 53.76  ? 121 TYR A CE2 1 
ATOM   991  C CZ  . TYR A  1 121 ? 37.031  100.355 164.426 1.00 47.69  ? 121 TYR A CZ  1 
ATOM   992  O OH  . TYR A  1 121 ? 38.023  101.270 164.627 1.00 56.27  ? 121 TYR A OH  1 
ATOM   993  N N   . LYS A  1 122 ? 32.271  96.533  161.171 1.00 52.71  ? 122 LYS A N   1 
ATOM   994  C CA  . LYS A  1 122 ? 31.550  95.452  160.537 1.00 54.07  ? 122 LYS A CA  1 
ATOM   995  C C   . LYS A  1 122 ? 32.575  94.415  160.149 1.00 56.92  ? 122 LYS A C   1 
ATOM   996  O O   . LYS A  1 122 ? 33.377  94.622  159.236 1.00 46.71  ? 122 LYS A O   1 
ATOM   997  C CB  . LYS A  1 122 ? 30.826  95.951  159.290 1.00 65.68  ? 122 LYS A CB  1 
ATOM   998  C CG  . LYS A  1 122 ? 30.100  94.878  158.498 1.00 61.70  ? 122 LYS A CG  1 
ATOM   999  C CD  . LYS A  1 122 ? 29.471  95.512  157.272 1.00 85.61  ? 122 LYS A CD  1 
ATOM   1000 C CE  . LYS A  1 122 ? 28.714  94.519  156.423 1.00 97.35  ? 122 LYS A CE  1 
ATOM   1001 N NZ  . LYS A  1 122 ? 28.074  95.227  155.275 1.00 95.40  ? 122 LYS A NZ  1 
ATOM   1002 N N   . ASP A  1 123 ? 32.544  93.296  160.855 1.00 67.70  ? 123 ASP A N   1 
ATOM   1003 C CA  . ASP A  1 123 ? 33.464  92.205  160.595 1.00 80.64  ? 123 ASP A CA  1 
ATOM   1004 C C   . ASP A  1 123 ? 34.887  92.725  160.633 1.00 68.54  ? 123 ASP A C   1 
ATOM   1005 O O   . ASP A  1 123 ? 35.642  92.572  159.682 1.00 73.65  ? 123 ASP A O   1 
ATOM   1006 C CB  . ASP A  1 123 ? 33.175  91.559  159.230 1.00 94.49  ? 123 ASP A CB  1 
ATOM   1007 C CG  . ASP A  1 123 ? 31.808  90.890  159.170 1.00 99.10  ? 123 ASP A CG  1 
ATOM   1008 O OD1 . ASP A  1 123 ? 31.492  90.097  160.087 1.00 90.28  ? 123 ASP A OD1 1 
ATOM   1009 O OD2 . ASP A  1 123 ? 31.056  91.152  158.201 1.00 96.05  ? 123 ASP A OD2 1 
ATOM   1010 N N   . GLY A  1 124 ? 35.240  93.353  161.741 1.00 56.55  ? 124 GLY A N   1 
ATOM   1011 C CA  . GLY A  1 124 ? 36.585  93.862  161.892 1.00 59.77  ? 124 GLY A CA  1 
ATOM   1012 C C   . GLY A  1 124 ? 36.987  94.991  160.970 1.00 53.51  ? 124 GLY A C   1 
ATOM   1013 O O   . GLY A  1 124 ? 38.117  95.452  161.037 1.00 69.63  ? 124 GLY A O   1 
ATOM   1014 N N   . GLU A  1 125 ? 36.092  95.440  160.102 1.00 54.97  ? 125 GLU A N   1 
ATOM   1015 C CA  . GLU A  1 125 ? 36.434  96.544  159.211 1.00 63.97  ? 125 GLU A CA  1 
ATOM   1016 C C   . GLU A  1 125 ? 35.779  97.823  159.701 1.00 57.36  ? 125 GLU A C   1 
ATOM   1017 O O   . GLU A  1 125 ? 34.723  97.791  160.328 1.00 49.04  ? 125 GLU A O   1 
ATOM   1018 C CB  . GLU A  1 125 ? 35.933  96.298  157.791 1.00 112.52 ? 125 GLU A CB  1 
ATOM   1019 C CG  . GLU A  1 125 ? 36.385  95.024  157.122 1.00 145.13 ? 125 GLU A CG  1 
ATOM   1020 C CD  . GLU A  1 125 ? 35.928  94.972  155.677 1.00 166.93 ? 125 GLU A CD  1 
ATOM   1021 O OE1 . GLU A  1 125 ? 34.704  95.097  155.438 1.00 172.60 ? 125 GLU A OE1 1 
ATOM   1022 O OE2 . GLU A  1 125 ? 36.794  94.814  154.785 1.00 173.63 ? 125 GLU A OE2 1 
ATOM   1023 N N   . ALA A  1 126 ? 36.400  98.953  159.400 1.00 52.35  ? 126 ALA A N   1 
ATOM   1024 C CA  . ALA A  1 126 ? 35.850  100.237 159.793 1.00 39.54  ? 126 ALA A CA  1 
ATOM   1025 C C   . ALA A  1 126 ? 34.775  100.614 158.799 1.00 36.43  ? 126 ALA A C   1 
ATOM   1026 O O   . ALA A  1 126 ? 35.074  100.962 157.660 1.00 45.95  ? 126 ALA A O   1 
ATOM   1027 C CB  . ALA A  1 126 ? 36.928  101.281 159.793 1.00 44.91  ? 126 ALA A CB  1 
ATOM   1028 N N   . LEU A  1 127 ? 33.523  100.557 159.235 1.00 38.91  ? 127 LEU A N   1 
ATOM   1029 C CA  . LEU A  1 127 ? 32.412  100.888 158.365 1.00 39.70  ? 127 LEU A CA  1 
ATOM   1030 C C   . LEU A  1 127 ? 32.226  102.393 158.225 1.00 32.75  ? 127 LEU A C   1 
ATOM   1031 O O   . LEU A  1 127 ? 32.289  102.902 157.118 1.00 55.08  ? 127 LEU A O   1 
ATOM   1032 C CB  . LEU A  1 127 ? 31.141  100.219 158.880 1.00 33.68  ? 127 LEU A CB  1 
ATOM   1033 C CG  . LEU A  1 127 ? 29.869  100.320 158.045 1.00 43.16  ? 127 LEU A CG  1 
ATOM   1034 C CD1 . LEU A  1 127 ? 30.194  100.562 156.587 1.00 49.59  ? 127 LEU A CD1 1 
ATOM   1035 C CD2 . LEU A  1 127 ? 29.077  99.041  158.237 1.00 43.67  ? 127 LEU A CD2 1 
ATOM   1036 N N   . LYS A  1 128 ? 32.014  103.108 159.331 1.00 29.92  ? 128 LYS A N   1 
ATOM   1037 C CA  . LYS A  1 128 ? 31.836  104.566 159.273 1.00 34.63  ? 128 LYS A CA  1 
ATOM   1038 C C   . LYS A  1 128 ? 32.317  105.281 160.530 1.00 45.14  ? 128 LYS A C   1 
ATOM   1039 O O   . LYS A  1 128 ? 32.077  104.819 161.647 1.00 54.22  ? 128 LYS A O   1 
ATOM   1040 C CB  . LYS A  1 128 ? 30.366  104.916 159.041 1.00 32.58  ? 128 LYS A CB  1 
ATOM   1041 C CG  . LYS A  1 128 ? 30.131  106.337 158.560 1.00 44.69  ? 128 LYS A CG  1 
ATOM   1042 C CD  . LYS A  1 128 ? 28.691  106.479 158.073 1.00 97.60  ? 128 LYS A CD  1 
ATOM   1043 C CE  . LYS A  1 128 ? 28.493  107.706 157.188 1.00 108.82 ? 128 LYS A CE  1 
ATOM   1044 N NZ  . LYS A  1 128 ? 27.202  107.663 156.419 1.00 110.35 ? 128 LYS A NZ  1 
ATOM   1045 N N   . TYR A  1 129 ? 33.011  106.401 160.343 1.00 45.78  ? 129 TYR A N   1 
ATOM   1046 C CA  . TYR A  1 129 ? 33.509  107.213 161.459 1.00 31.63  ? 129 TYR A CA  1 
ATOM   1047 C C   . TYR A  1 129 ? 32.942  108.600 161.285 1.00 43.98  ? 129 TYR A C   1 
ATOM   1048 O O   . TYR A  1 129 ? 32.749  109.063 160.160 1.00 57.31  ? 129 TYR A O   1 
ATOM   1049 C CB  . TYR A  1 129 ? 35.037  107.317 161.450 1.00 29.02  ? 129 TYR A CB  1 
ATOM   1050 C CG  . TYR A  1 129 ? 35.608  108.593 162.076 1.00 4.74   ? 129 TYR A CG  1 
ATOM   1051 C CD1 . TYR A  1 129 ? 36.136  108.584 163.348 1.00 34.09  ? 129 TYR A CD1 1 
ATOM   1052 C CD2 . TYR A  1 129 ? 35.619  109.804 161.386 1.00 33.30  ? 129 TYR A CD2 1 
ATOM   1053 C CE1 . TYR A  1 129 ? 36.655  109.734 163.923 1.00 46.42  ? 129 TYR A CE1 1 
ATOM   1054 C CE2 . TYR A  1 129 ? 36.141  110.962 161.959 1.00 6.09   ? 129 TYR A CE2 1 
ATOM   1055 C CZ  . TYR A  1 129 ? 36.653  110.910 163.229 1.00 31.20  ? 129 TYR A CZ  1 
ATOM   1056 O OH  . TYR A  1 129 ? 37.173  112.024 163.828 1.00 20.64  ? 129 TYR A OH  1 
ATOM   1057 N N   . TRP A  1 130 ? 32.696  109.263 162.401 1.00 39.21  ? 130 TRP A N   1 
ATOM   1058 C CA  . TRP A  1 130 ? 32.177  110.612 162.378 1.00 29.34  ? 130 TRP A CA  1 
ATOM   1059 C C   . TRP A  1 130 ? 32.700  111.316 163.628 1.00 35.77  ? 130 TRP A C   1 
ATOM   1060 O O   . TRP A  1 130 ? 32.949  110.683 164.672 1.00 20.16  ? 130 TRP A O   1 
ATOM   1061 C CB  . TRP A  1 130 ? 30.653  110.586 162.363 1.00 29.96  ? 130 TRP A CB  1 
ATOM   1062 C CG  . TRP A  1 130 ? 30.067  111.918 162.139 1.00 51.53  ? 130 TRP A CG  1 
ATOM   1063 C CD1 . TRP A  1 130 ? 29.177  112.571 162.937 1.00 89.41  ? 130 TRP A CD1 1 
ATOM   1064 C CD2 . TRP A  1 130 ? 30.311  112.772 161.028 1.00 28.42  ? 130 TRP A CD2 1 
ATOM   1065 N NE1 . TRP A  1 130 ? 28.849  113.786 162.385 1.00 87.77  ? 130 TRP A NE1 1 
ATOM   1066 C CE2 . TRP A  1 130 ? 29.535  113.931 161.210 1.00 43.64  ? 130 TRP A CE2 1 
ATOM   1067 C CE3 . TRP A  1 130 ? 31.109  112.673 159.893 1.00 32.59  ? 130 TRP A CE3 1 
ATOM   1068 C CZ2 . TRP A  1 130 ? 29.540  114.979 160.298 1.00 58.18  ? 130 TRP A CZ2 1 
ATOM   1069 C CZ3 . TRP A  1 130 ? 31.112  113.715 158.989 1.00 32.54  ? 130 TRP A CZ3 1 
ATOM   1070 C CH2 . TRP A  1 130 ? 30.337  114.847 159.193 1.00 57.42  ? 130 TRP A CH2 1 
ATOM   1071 N N   . TYR A  1 131 ? 32.875  112.625 163.529 1.00 11.83  ? 131 TYR A N   1 
ATOM   1072 C CA  . TYR A  1 131 ? 33.406  113.361 164.664 1.00 26.59  ? 131 TYR A CA  1 
ATOM   1073 C C   . TYR A  1 131 ? 32.535  113.175 165.887 1.00 39.71  ? 131 TYR A C   1 
ATOM   1074 O O   . TYR A  1 131 ? 33.030  113.124 167.015 1.00 27.67  ? 131 TYR A O   1 
ATOM   1075 C CB  . TYR A  1 131 ? 33.533  114.856 164.336 1.00 12.78  ? 131 TYR A CB  1 
ATOM   1076 C CG  . TYR A  1 131 ? 34.068  115.149 162.945 1.00 15.94  ? 131 TYR A CG  1 
ATOM   1077 C CD1 . TYR A  1 131 ? 33.219  115.167 161.850 1.00 38.22  ? 131 TYR A CD1 1 
ATOM   1078 C CD2 . TYR A  1 131 ? 35.422  115.414 162.728 1.00 32.30  ? 131 TYR A CD2 1 
ATOM   1079 C CE1 . TYR A  1 131 ? 33.693  115.445 160.573 1.00 38.64  ? 131 TYR A CE1 1 
ATOM   1080 C CE2 . TYR A  1 131 ? 35.908  115.689 161.455 1.00 18.37  ? 131 TYR A CE2 1 
ATOM   1081 C CZ  . TYR A  1 131 ? 35.034  115.708 160.384 1.00 31.36  ? 131 TYR A CZ  1 
ATOM   1082 O OH  . TYR A  1 131 ? 35.486  116.022 159.126 1.00 47.44  ? 131 TYR A OH  1 
ATOM   1083 N N   . GLU A  1 132 ? 31.232  113.060 165.646 1.00 22.51  ? 132 GLU A N   1 
ATOM   1084 C CA  . GLU A  1 132 ? 30.249  112.914 166.710 1.00 21.55  ? 132 GLU A CA  1 
ATOM   1085 C C   . GLU A  1 132 ? 29.443  111.640 166.590 1.00 26.52  ? 132 GLU A C   1 
ATOM   1086 O O   . GLU A  1 132 ? 29.647  110.866 165.680 1.00 43.96  ? 132 GLU A O   1 
ATOM   1087 C CB  . GLU A  1 132 ? 29.315  114.113 166.691 1.00 9.33   ? 132 GLU A CB  1 
ATOM   1088 C CG  . GLU A  1 132 ? 29.974  115.382 167.187 1.00 45.30  ? 132 GLU A CG  1 
ATOM   1089 C CD  . GLU A  1 132 ? 30.190  116.404 166.099 1.00 57.24  ? 132 GLU A CD  1 
ATOM   1090 O OE1 . GLU A  1 132 ? 29.797  116.117 164.946 1.00 31.77  ? 132 GLU A OE1 1 
ATOM   1091 O OE2 . GLU A  1 132 ? 30.748  117.487 166.408 1.00 44.17  ? 132 GLU A OE2 1 
ATOM   1092 N N   . ASN A  1 133 ? 28.529  111.413 167.518 1.00 30.98  ? 133 ASN A N   1 
ATOM   1093 C CA  . ASN A  1 133 ? 27.708  110.215 167.468 1.00 4.74   ? 133 ASN A CA  1 
ATOM   1094 C C   . ASN A  1 133 ? 26.811  110.371 166.285 1.00 14.15  ? 133 ASN A C   1 
ATOM   1095 O O   . ASN A  1 133 ? 26.539  111.500 165.877 1.00 31.92  ? 133 ASN A O   1 
ATOM   1096 C CB  . ASN A  1 133 ? 26.848  110.093 168.700 1.00 25.90  ? 133 ASN A CB  1 
ATOM   1097 C CG  . ASN A  1 133 ? 26.554  108.677 169.032 1.00 41.63  ? 133 ASN A CG  1 
ATOM   1098 O OD1 . ASN A  1 133 ? 26.285  107.878 168.144 1.00 4.74   ? 133 ASN A OD1 1 
ATOM   1099 N ND2 . ASN A  1 133 ? 26.603  108.344 170.318 1.00 56.65  ? 133 ASN A ND2 1 
ATOM   1100 N N   . HIS A  1 134 ? 26.338  109.252 165.744 1.00 12.14  ? 134 HIS A N   1 
ATOM   1101 C CA  . HIS A  1 134 ? 25.485  109.278 164.559 1.00 27.89  ? 134 HIS A CA  1 
ATOM   1102 C C   . HIS A  1 134 ? 24.864  107.917 164.384 1.00 33.86  ? 134 HIS A C   1 
ATOM   1103 O O   . HIS A  1 134 ? 25.441  106.932 164.821 1.00 43.67  ? 134 HIS A O   1 
ATOM   1104 C CB  . HIS A  1 134 ? 26.317  109.594 163.321 1.00 37.78  ? 134 HIS A CB  1 
ATOM   1105 C CG  . HIS A  1 134 ? 27.435  108.627 163.085 1.00 49.63  ? 134 HIS A CG  1 
ATOM   1106 N ND1 . HIS A  1 134 ? 28.481  108.468 163.965 1.00 45.53  ? 134 HIS A ND1 1 
ATOM   1107 C CD2 . HIS A  1 134 ? 27.659  107.753 162.077 1.00 56.93  ? 134 HIS A CD2 1 
ATOM   1108 C CE1 . HIS A  1 134 ? 29.300  107.539 163.512 1.00 32.73  ? 134 HIS A CE1 1 
ATOM   1109 N NE2 . HIS A  1 134 ? 28.823  107.088 162.368 1.00 60.51  ? 134 HIS A NE2 1 
ATOM   1110 N N   . ALA A  1 135 ? 23.706  107.844 163.733 1.00 47.74  ? 135 ALA A N   1 
ATOM   1111 C CA  . ALA A  1 135 ? 23.053  106.550 163.541 1.00 45.46  ? 135 ALA A CA  1 
ATOM   1112 C C   . ALA A  1 135 ? 23.428  106.009 162.188 1.00 46.39  ? 135 ALA A C   1 
ATOM   1113 O O   . ALA A  1 135 ? 23.718  106.776 161.277 1.00 66.79  ? 135 ALA A O   1 
ATOM   1114 C CB  . ALA A  1 135 ? 21.551  106.694 163.647 1.00 27.85  ? 135 ALA A CB  1 
ATOM   1115 N N   . ILE A  1 136 ? 23.448  104.687 162.064 1.00 44.10  ? 136 ILE A N   1 
ATOM   1116 C CA  . ILE A  1 136 ? 23.789  104.039 160.802 1.00 42.24  ? 136 ILE A CA  1 
ATOM   1117 C C   . ILE A  1 136 ? 22.450  103.677 160.245 1.00 49.98  ? 136 ILE A C   1 
ATOM   1118 O O   . ILE A  1 136 ? 21.735  102.876 160.844 1.00 33.55  ? 136 ILE A O   1 
ATOM   1119 C CB  . ILE A  1 136 ? 24.593  102.724 160.998 1.00 49.71  ? 136 ILE A CB  1 
ATOM   1120 C CG1 . ILE A  1 136 ? 25.942  103.004 161.664 1.00 66.62  ? 136 ILE A CG1 1 
ATOM   1121 C CG2 . ILE A  1 136 ? 24.856  102.076 159.664 1.00 20.39  ? 136 ILE A CG2 1 
ATOM   1122 C CD1 . ILE A  1 136 ? 26.878  103.861 160.822 1.00 89.95  ? 136 ILE A CD1 1 
ATOM   1123 N N   . SER A  1 137 ? 22.104  104.274 159.110 1.00 65.91  ? 137 SER A N   1 
ATOM   1124 C CA  . SER A  1 137 ? 20.813  104.022 158.477 1.00 64.35  ? 137 SER A CA  1 
ATOM   1125 C C   . SER A  1 137 ? 20.952  103.301 157.150 1.00 54.42  ? 137 SER A C   1 
ATOM   1126 O O   . SER A  1 137 ? 21.323  103.895 156.137 1.00 55.26  ? 137 SER A O   1 
ATOM   1127 C CB  . SER A  1 137 ? 20.064  105.335 158.248 1.00 77.18  ? 137 SER A CB  1 
ATOM   1128 O OG  . SER A  1 137 ? 19.920  106.070 159.449 1.00 96.75  ? 137 SER A OG  1 
ATOM   1129 N N   . ILE A  1 138 ? 20.650  102.012 157.164 1.00 64.12  ? 138 ILE A N   1 
ATOM   1130 C CA  . ILE A  1 138 ? 20.717  101.202 155.961 1.00 61.08  ? 138 ILE A CA  1 
ATOM   1131 C C   . ILE A  1 138 ? 19.312  101.056 155.375 1.00 73.24  ? 138 ILE A C   1 
ATOM   1132 O O   . ILE A  1 138 ? 18.525  100.208 155.807 1.00 45.15  ? 138 ILE A O   1 
ATOM   1133 C CB  . ILE A  1 138 ? 21.275  99.827  156.270 1.00 47.90  ? 138 ILE A CB  1 
ATOM   1134 C CG1 . ILE A  1 138 ? 22.673  99.965  156.863 1.00 66.87  ? 138 ILE A CG1 1 
ATOM   1135 C CG2 . ILE A  1 138 ? 21.312  98.999  155.015 1.00 68.56  ? 138 ILE A CG2 1 
ATOM   1136 C CD1 . ILE A  1 138 ? 23.230  98.666  157.415 1.00 69.89  ? 138 ILE A CD1 1 
ATOM   1137 N N   . THR A  1 139 ? 19.023  101.907 154.393 1.00 91.10  ? 139 THR A N   1 
ATOM   1138 C CA  . THR A  1 139 ? 17.742  101.970 153.689 1.00 86.14  ? 139 THR A CA  1 
ATOM   1139 C C   . THR A  1 139 ? 17.208  100.663 153.123 1.00 92.06  ? 139 THR A C   1 
ATOM   1140 O O   . THR A  1 139 ? 16.044  100.321 153.342 1.00 80.79  ? 139 THR A O   1 
ATOM   1141 C CB  . THR A  1 139 ? 17.840  102.956 152.539 1.00 87.50  ? 139 THR A CB  1 
ATOM   1142 O OG1 . THR A  1 139 ? 19.147  102.850 151.946 1.00 107.38 ? 139 THR A OG1 1 
ATOM   1143 C CG2 . THR A  1 139 ? 17.596  104.370 153.036 1.00 80.06  ? 139 THR A CG2 1 
ATOM   1144 N N   . ASN A  1 140 ? 18.048  99.955  152.370 1.00 102.69 ? 140 ASN A N   1 
ATOM   1145 C CA  . ASN A  1 140 ? 17.660  98.679  151.769 1.00 95.01  ? 140 ASN A CA  1 
ATOM   1146 C C   . ASN A  1 140 ? 18.691  97.603  152.065 1.00 81.77  ? 140 ASN A C   1 
ATOM   1147 O O   . ASN A  1 140 ? 19.802  97.615  151.527 1.00 87.11  ? 140 ASN A O   1 
ATOM   1148 C CB  . ASN A  1 140 ? 17.495  98.828  150.257 1.00 117.21 ? 140 ASN A CB  1 
ATOM   1149 C CG  . ASN A  1 140 ? 16.465  99.873  149.888 1.00 133.56 ? 140 ASN A CG  1 
ATOM   1150 O OD1 . ASN A  1 140 ? 15.330  99.840  150.365 1.00 143.20 ? 140 ASN A OD1 1 
ATOM   1151 N ND2 . ASN A  1 140 ? 16.855  100.810 149.029 1.00 148.55 ? 140 ASN A ND2 1 
ATOM   1152 N N   . ALA A  1 141 ? 18.308  96.666  152.922 1.00 58.80  ? 141 ALA A N   1 
ATOM   1153 C CA  . ALA A  1 141 ? 19.196  95.588  153.316 1.00 79.72  ? 141 ALA A CA  1 
ATOM   1154 C C   . ALA A  1 141 ? 19.844  94.885  152.126 1.00 89.73  ? 141 ALA A C   1 
ATOM   1155 O O   . ALA A  1 141 ? 19.409  95.042  150.987 1.00 97.85  ? 141 ALA A O   1 
ATOM   1156 C CB  . ALA A  1 141 ? 18.435  94.592  154.164 1.00 55.57  ? 141 ALA A CB  1 
ATOM   1157 N N   . ALA A  1 142 ? 20.889  94.112  152.406 1.00 87.87  ? 142 ALA A N   1 
ATOM   1158 C CA  . ALA A  1 142 ? 21.617  93.374  151.383 1.00 82.85  ? 142 ALA A CA  1 
ATOM   1159 C C   . ALA A  1 142 ? 22.260  92.150  152.022 1.00 86.94  ? 142 ALA A C   1 
ATOM   1160 O O   . ALA A  1 142 ? 21.987  91.843  153.176 1.00 97.01  ? 142 ALA A O   1 
ATOM   1161 C CB  . ALA A  1 142 ? 22.683  94.261  150.761 1.00 100.16 ? 142 ALA A CB  1 
ATOM   1162 N N   . ALA A  1 143 ? 23.114  91.458  151.274 1.00 96.26  ? 143 ALA A N   1 
ATOM   1163 C CA  . ALA A  1 143 ? 23.795  90.262  151.768 1.00 97.54  ? 143 ALA A CA  1 
ATOM   1164 C C   . ALA A  1 143 ? 25.115  90.625  152.440 1.00 101.53 ? 143 ALA A C   1 
ATOM   1165 O O   . ALA A  1 143 ? 25.496  90.038  153.456 1.00 88.51  ? 143 ALA A O   1 
ATOM   1166 C CB  . ALA A  1 143 ? 24.071  89.259  150.609 1.00 114.97 ? 143 ALA A CB  1 
ATOM   1167 N N   . GLU A  1 144 ? 25.813  91.588  151.853 1.00 103.38 ? 144 GLU A N   1 
ATOM   1168 C CA  . GLU A  1 144 ? 27.080  92.049  152.389 1.00 102.82 ? 144 GLU A CA  1 
ATOM   1169 C C   . GLU A  1 144 ? 26.810  92.655  153.756 1.00 96.94  ? 144 GLU A C   1 
ATOM   1170 O O   . GLU A  1 144 ? 27.642  92.564  154.661 1.00 100.31 ? 144 GLU A O   1 
ATOM   1171 C CB  . GLU A  1 144 ? 27.662  93.116  151.474 1.00 116.34 ? 144 GLU A CB  1 
ATOM   1172 C CG  . GLU A  1 144 ? 26.646  94.190  151.126 1.00 126.53 ? 144 GLU A CG  1 
ATOM   1173 C CD  . GLU A  1 144 ? 27.276  95.427  150.535 1.00 144.12 ? 144 GLU A CD  1 
ATOM   1174 O OE1 . GLU A  1 144 ? 28.027  95.290  149.546 1.00 154.86 ? 144 GLU A OE1 1 
ATOM   1175 O OE2 . GLU A  1 144 ? 27.015  96.535  151.056 1.00 138.98 ? 144 GLU A OE2 1 
ATOM   1176 N N   . ASP A  1 145 ? 25.635  93.269  153.891 1.00 78.19  ? 145 ASP A N   1 
ATOM   1177 C CA  . ASP A  1 145 ? 25.231  93.912  155.135 1.00 67.22  ? 145 ASP A CA  1 
ATOM   1178 C C   . ASP A  1 145 ? 25.102  93.000  156.350 1.00 60.33  ? 145 ASP A C   1 
ATOM   1179 O O   . ASP A  1 145 ? 24.774  93.466  157.435 1.00 56.57  ? 145 ASP A O   1 
ATOM   1180 C CB  . ASP A  1 145 ? 23.927  94.699  154.945 1.00 74.34  ? 145 ASP A CB  1 
ATOM   1181 C CG  . ASP A  1 145 ? 24.153  96.053  154.284 1.00 106.74 ? 145 ASP A CG  1 
ATOM   1182 O OD1 . ASP A  1 145 ? 25.187  96.694  154.585 1.00 121.88 ? 145 ASP A OD1 1 
ATOM   1183 O OD2 . ASP A  1 145 ? 23.295  96.481  153.477 1.00 91.09  ? 145 ASP A OD2 1 
ATOM   1184 N N   . SER A  1 146 ? 25.339  91.706  156.189 1.00 61.54  ? 146 SER A N   1 
ATOM   1185 C CA  . SER A  1 146 ? 25.277  90.834  157.347 1.00 60.89  ? 146 SER A CA  1 
ATOM   1186 C C   . SER A  1 146 ? 26.658  90.785  157.969 1.00 69.30  ? 146 SER A C   1 
ATOM   1187 O O   . SER A  1 146 ? 27.594  91.438  157.498 1.00 82.09  ? 146 SER A O   1 
ATOM   1188 C CB  . SER A  1 146 ? 24.848  89.426  156.965 1.00 76.21  ? 146 SER A CB  1 
ATOM   1189 O OG  . SER A  1 146 ? 23.440  89.341  156.889 1.00 95.00  ? 146 SER A OG  1 
ATOM   1190 N N   . GLY A  1 147 ? 26.787  90.000  159.026 1.00 61.54  ? 147 GLY A N   1 
ATOM   1191 C CA  . GLY A  1 147 ? 28.067  89.894  159.693 1.00 74.14  ? 147 GLY A CA  1 
ATOM   1192 C C   . GLY A  1 147 ? 27.921  90.473  161.076 1.00 59.47  ? 147 GLY A C   1 
ATOM   1193 O O   . GLY A  1 147 ? 26.837  90.915  161.439 1.00 66.52  ? 147 GLY A O   1 
ATOM   1194 N N   . THR A  1 148 ? 28.996  90.477  161.852 1.00 54.42  ? 148 THR A N   1 
ATOM   1195 C CA  . THR A  1 148 ? 28.923  91.009  163.199 1.00 50.16  ? 148 THR A CA  1 
ATOM   1196 C C   . THR A  1 148 ? 29.380  92.461  163.255 1.00 53.52  ? 148 THR A C   1 
ATOM   1197 O O   . THR A  1 148 ? 30.388  92.827  162.656 1.00 53.41  ? 148 THR A O   1 
ATOM   1198 C CB  . THR A  1 148 ? 29.784  90.196  164.160 1.00 19.76  ? 148 THR A CB  1 
ATOM   1199 O OG1 . THR A  1 148 ? 31.016  90.882  164.383 1.00 62.15  ? 148 THR A OG1 1 
ATOM   1200 C CG2 . THR A  1 148 ? 30.080  88.841  163.572 1.00 44.81  ? 148 THR A CG2 1 
ATOM   1201 N N   . TYR A  1 149 ? 28.623  93.285  163.976 1.00 45.84  ? 149 TYR A N   1 
ATOM   1202 C CA  . TYR A  1 149 ? 28.950  94.695  164.128 1.00 35.69  ? 149 TYR A CA  1 
ATOM   1203 C C   . TYR A  1 149 ? 29.266  95.050  165.577 1.00 42.34  ? 149 TYR A C   1 
ATOM   1204 O O   . TYR A  1 149 ? 29.000  94.275  166.503 1.00 34.02  ? 149 TYR A O   1 
ATOM   1205 C CB  . TYR A  1 149 ? 27.786  95.584  163.725 1.00 23.94  ? 149 TYR A CB  1 
ATOM   1206 C CG  . TYR A  1 149 ? 27.380  95.588  162.288 1.00 21.27  ? 149 TYR A CG  1 
ATOM   1207 C CD1 . TYR A  1 149 ? 26.653  94.538  161.750 1.00 34.53  ? 149 TYR A CD1 1 
ATOM   1208 C CD2 . TYR A  1 149 ? 27.651  96.686  161.482 1.00 25.77  ? 149 TYR A CD2 1 
ATOM   1209 C CE1 . TYR A  1 149 ? 26.201  94.583  160.445 1.00 46.42  ? 149 TYR A CE1 1 
ATOM   1210 C CE2 . TYR A  1 149 ? 27.206  96.742  160.182 1.00 46.35  ? 149 TYR A CE2 1 
ATOM   1211 C CZ  . TYR A  1 149 ? 26.483  95.688  159.666 1.00 54.35  ? 149 TYR A CZ  1 
ATOM   1212 O OH  . TYR A  1 149 ? 26.063  95.738  158.359 1.00 61.67  ? 149 TYR A OH  1 
ATOM   1213 N N   . TYR A  1 150 ? 29.820  96.244  165.757 1.00 32.05  ? 150 TYR A N   1 
ATOM   1214 C CA  . TYR A  1 150 ? 30.127  96.766  167.078 1.00 46.19  ? 150 TYR A CA  1 
ATOM   1215 C C   . TYR A  1 150 ? 30.667  98.182  166.902 1.00 49.13  ? 150 TYR A C   1 
ATOM   1216 O O   . TYR A  1 150 ? 31.175  98.516  165.836 1.00 48.78  ? 150 TYR A O   1 
ATOM   1217 C CB  . TYR A  1 150 ? 31.126  95.863  167.799 1.00 35.84  ? 150 TYR A CB  1 
ATOM   1218 C CG  . TYR A  1 150 ? 32.540  95.971  167.323 1.00 47.39  ? 150 TYR A CG  1 
ATOM   1219 C CD1 . TYR A  1 150 ? 33.391  96.933  167.837 1.00 32.66  ? 150 TYR A CD1 1 
ATOM   1220 C CD2 . TYR A  1 150 ? 33.038  95.093  166.369 1.00 64.67  ? 150 TYR A CD2 1 
ATOM   1221 C CE1 . TYR A  1 150 ? 34.704  97.018  167.419 1.00 46.29  ? 150 TYR A CE1 1 
ATOM   1222 C CE2 . TYR A  1 150 ? 34.349  95.169  165.943 1.00 63.70  ? 150 TYR A CE2 1 
ATOM   1223 C CZ  . TYR A  1 150 ? 35.177  96.135  166.473 1.00 46.48  ? 150 TYR A CZ  1 
ATOM   1224 O OH  . TYR A  1 150 ? 36.476  96.223  166.049 1.00 62.23  ? 150 TYR A OH  1 
ATOM   1225 N N   . CYS A  1 151 ? 30.517  99.025  167.923 1.00 33.51  ? 151 CYS A N   1 
ATOM   1226 C CA  . CYS A  1 151 ? 30.989  100.393 167.832 1.00 27.22  ? 151 CYS A CA  1 
ATOM   1227 C C   . CYS A  1 151 ? 31.968  100.769 168.914 1.00 43.05  ? 151 CYS A C   1 
ATOM   1228 O O   . CYS A  1 151 ? 32.057  100.120 169.946 1.00 52.10  ? 151 CYS A O   1 
ATOM   1229 C CB  . CYS A  1 151 ? 29.813  101.372 167.856 1.00 37.04  ? 151 CYS A CB  1 
ATOM   1230 S SG  . CYS A  1 151 ? 28.694  101.368 169.294 1.00 74.26  ? 151 CYS A SG  1 
ATOM   1231 N N   . THR A  1 152 ? 32.708  101.835 168.663 1.00 36.26  ? 152 THR A N   1 
ATOM   1232 C CA  . THR A  1 152 ? 33.671  102.341 169.617 1.00 27.13  ? 152 THR A CA  1 
ATOM   1233 C C   . THR A  1 152 ? 33.489  103.840 169.620 1.00 47.16  ? 152 THR A C   1 
ATOM   1234 O O   . THR A  1 152 ? 32.993  104.417 168.645 1.00 39.95  ? 152 THR A O   1 
ATOM   1235 C CB  . THR A  1 152 ? 35.085  102.028 169.185 1.00 37.29  ? 152 THR A CB  1 
ATOM   1236 O OG1 . THR A  1 152 ? 35.335  102.632 167.916 1.00 40.43  ? 152 THR A OG1 1 
ATOM   1237 C CG2 . THR A  1 152 ? 35.276  100.549 169.055 1.00 44.48  ? 152 THR A CG2 1 
ATOM   1238 N N   . GLY A  1 153 ? 33.890  104.471 170.715 1.00 42.75  ? 153 GLY A N   1 
ATOM   1239 C CA  . GLY A  1 153 ? 33.751  105.909 170.812 1.00 32.94  ? 153 GLY A CA  1 
ATOM   1240 C C   . GLY A  1 153 ? 34.368  106.444 172.082 1.00 33.93  ? 153 GLY A C   1 
ATOM   1241 O O   . GLY A  1 153 ? 34.734  105.680 172.984 1.00 26.67  ? 153 GLY A O   1 
ATOM   1242 N N   . LYS A  1 154 ? 34.497  107.762 172.155 1.00 32.08  ? 154 LYS A N   1 
ATOM   1243 C CA  . LYS A  1 154 ? 35.071  108.364 173.336 1.00 27.14  ? 154 LYS A CA  1 
ATOM   1244 C C   . LYS A  1 154 ? 33.937  109.023 174.095 1.00 36.54  ? 154 LYS A C   1 
ATOM   1245 O O   . LYS A  1 154 ? 33.075  109.656 173.498 1.00 37.73  ? 154 LYS A O   1 
ATOM   1246 C CB  . LYS A  1 154 ? 36.150  109.375 172.947 1.00 46.85  ? 154 LYS A CB  1 
ATOM   1247 C CG  . LYS A  1 154 ? 37.401  108.744 172.357 1.00 73.37  ? 154 LYS A CG  1 
ATOM   1248 C CD  . LYS A  1 154 ? 38.459  109.762 171.955 1.00 88.40  ? 154 LYS A CD  1 
ATOM   1249 C CE  . LYS A  1 154 ? 39.759  109.070 171.557 1.00 108.39 ? 154 LYS A CE  1 
ATOM   1250 N NZ  . LYS A  1 154 ? 40.839  110.040 171.221 1.00 109.73 ? 154 LYS A NZ  1 
ATOM   1251 N N   . VAL A  1 155 ? 33.941  108.831 175.411 1.00 22.66  ? 155 VAL A N   1 
ATOM   1252 C CA  . VAL A  1 155 ? 32.935  109.355 176.314 1.00 15.28  ? 155 VAL A CA  1 
ATOM   1253 C C   . VAL A  1 155 ? 33.687  109.997 177.457 1.00 24.42  ? 155 VAL A C   1 
ATOM   1254 O O   . VAL A  1 155 ? 34.312  109.306 178.262 1.00 21.14  ? 155 VAL A O   1 
ATOM   1255 C CB  . VAL A  1 155 ? 32.099  108.223 176.890 1.00 12.47  ? 155 VAL A CB  1 
ATOM   1256 C CG1 . VAL A  1 155 ? 31.048  108.748 177.826 1.00 24.17  ? 155 VAL A CG1 1 
ATOM   1257 C CG2 . VAL A  1 155 ? 31.476  107.478 175.791 1.00 29.79  ? 155 VAL A CG2 1 
ATOM   1258 N N   . TRP A  1 156 ? 33.627  111.314 177.557 1.00 27.14  ? 156 TRP A N   1 
ATOM   1259 C CA  . TRP A  1 156 ? 34.351  111.977 178.633 1.00 49.96  ? 156 TRP A CA  1 
ATOM   1260 C C   . TRP A  1 156 ? 35.834  111.721 178.407 1.00 47.74  ? 156 TRP A C   1 
ATOM   1261 O O   . TRP A  1 156 ? 36.565  111.406 179.334 1.00 28.76  ? 156 TRP A O   1 
ATOM   1262 C CB  . TRP A  1 156 ? 33.966  111.410 179.999 1.00 28.43  ? 156 TRP A CB  1 
ATOM   1263 C CG  . TRP A  1 156 ? 32.519  111.540 180.386 1.00 46.10  ? 156 TRP A CG  1 
ATOM   1264 C CD1 . TRP A  1 156 ? 31.759  110.583 180.991 1.00 55.35  ? 156 TRP A CD1 1 
ATOM   1265 C CD2 . TRP A  1 156 ? 31.672  112.685 180.244 1.00 35.53  ? 156 TRP A CD2 1 
ATOM   1266 N NE1 . TRP A  1 156 ? 30.500  111.052 181.237 1.00 30.76  ? 156 TRP A NE1 1 
ATOM   1267 C CE2 . TRP A  1 156 ? 30.417  112.342 180.786 1.00 46.45  ? 156 TRP A CE2 1 
ATOM   1268 C CE3 . TRP A  1 156 ? 31.847  113.967 179.715 1.00 47.67  ? 156 TRP A CE3 1 
ATOM   1269 C CZ2 . TRP A  1 156 ? 29.348  113.232 180.808 1.00 40.46  ? 156 TRP A CZ2 1 
ATOM   1270 C CZ3 . TRP A  1 156 ? 30.775  114.850 179.744 1.00 29.86  ? 156 TRP A CZ3 1 
ATOM   1271 C CH2 . TRP A  1 156 ? 29.551  114.477 180.284 1.00 25.98  ? 156 TRP A CH2 1 
ATOM   1272 N N   . GLN A  1 157 ? 36.254  111.828 177.154 1.00 43.01  ? 157 GLN A N   1 
ATOM   1273 C CA  . GLN A  1 157 ? 37.647  111.654 176.770 1.00 39.13  ? 157 GLN A CA  1 
ATOM   1274 C C   . GLN A  1 157 ? 38.273  110.271 176.820 1.00 37.69  ? 157 GLN A C   1 
ATOM   1275 O O   . GLN A  1 157 ? 39.389  110.086 176.338 1.00 50.59  ? 157 GLN A O   1 
ATOM   1276 C CB  . GLN A  1 157 ? 38.515  112.648 177.532 1.00 45.90  ? 157 GLN A CB  1 
ATOM   1277 C CG  . GLN A  1 157 ? 38.719  113.952 176.766 1.00 60.83  ? 157 GLN A CG  1 
ATOM   1278 C CD  . GLN A  1 157 ? 38.945  115.134 177.676 1.00 91.29  ? 157 GLN A CD  1 
ATOM   1279 O OE1 . GLN A  1 157 ? 39.737  115.068 178.626 1.00 77.47  ? 157 GLN A OE1 1 
ATOM   1280 N NE2 . GLN A  1 157 ? 38.254  116.237 177.390 1.00 118.23 ? 157 GLN A NE2 1 
ATOM   1281 N N   . LEU A  1 158 ? 37.569  109.299 177.380 1.00 21.70  ? 158 LEU A N   1 
ATOM   1282 C CA  . LEU A  1 158 ? 38.096  107.940 177.410 1.00 36.58  ? 158 LEU A CA  1 
ATOM   1283 C C   . LEU A  1 158 ? 37.525  107.073 176.281 1.00 51.78  ? 158 LEU A C   1 
ATOM   1284 O O   . LEU A  1 158 ? 36.521  107.420 175.653 1.00 40.56  ? 158 LEU A O   1 
ATOM   1285 C CB  . LEU A  1 158 ? 37.826  107.303 178.761 1.00 28.05  ? 158 LEU A CB  1 
ATOM   1286 C CG  . LEU A  1 158 ? 38.450  108.159 179.850 1.00 17.11  ? 158 LEU A CG  1 
ATOM   1287 C CD1 . LEU A  1 158 ? 38.603  107.360 181.127 1.00 37.62  ? 158 LEU A CD1 1 
ATOM   1288 C CD2 . LEU A  1 158 ? 39.806  108.640 179.378 1.00 56.27  ? 158 LEU A CD2 1 
ATOM   1289 N N   . ASP A  1 159 ? 38.163  105.938 176.024 1.00 37.90  ? 159 ASP A N   1 
ATOM   1290 C CA  . ASP A  1 159 ? 37.723  105.088 174.933 1.00 21.43  ? 159 ASP A CA  1 
ATOM   1291 C C   . ASP A  1 159 ? 36.897  103.886 175.355 1.00 32.78  ? 159 ASP A C   1 
ATOM   1292 O O   . ASP A  1 159 ? 37.192  103.224 176.356 1.00 48.27  ? 159 ASP A O   1 
ATOM   1293 C CB  . ASP A  1 159 ? 38.940  104.625 174.126 1.00 48.53  ? 159 ASP A CB  1 
ATOM   1294 C CG  . ASP A  1 159 ? 39.602  105.757 173.350 1.00 61.31  ? 159 ASP A CG  1 
ATOM   1295 O OD1 . ASP A  1 159 ? 38.896  106.450 172.601 1.00 97.23  ? 159 ASP A OD1 1 
ATOM   1296 O OD2 . ASP A  1 159 ? 40.830  105.951 173.470 1.00 89.52  ? 159 ASP A OD2 1 
ATOM   1297 N N   . TYR A  1 160 ? 35.859  103.602 174.577 1.00 28.83  ? 160 TYR A N   1 
ATOM   1298 C CA  . TYR A  1 160 ? 35.006  102.466 174.875 1.00 30.09  ? 160 TYR A CA  1 
ATOM   1299 C C   . TYR A  1 160 ? 34.583  101.703 173.629 1.00 42.81  ? 160 TYR A C   1 
ATOM   1300 O O   . TYR A  1 160 ? 34.549  102.246 172.520 1.00 41.52  ? 160 TYR A O   1 
ATOM   1301 C CB  . TYR A  1 160 ? 33.779  102.923 175.654 1.00 36.94  ? 160 TYR A CB  1 
ATOM   1302 C CG  . TYR A  1 160 ? 34.112  103.527 177.002 1.00 36.91  ? 160 TYR A CG  1 
ATOM   1303 C CD1 . TYR A  1 160 ? 34.388  104.884 177.140 1.00 19.01  ? 160 TYR A CD1 1 
ATOM   1304 C CD2 . TYR A  1 160 ? 34.198  102.725 178.131 1.00 42.51  ? 160 TYR A CD2 1 
ATOM   1305 C CE1 . TYR A  1 160 ? 34.750  105.418 178.371 1.00 40.14  ? 160 TYR A CE1 1 
ATOM   1306 C CE2 . TYR A  1 160 ? 34.551  103.247 179.361 1.00 33.19  ? 160 TYR A CE2 1 
ATOM   1307 C CZ  . TYR A  1 160 ? 34.830  104.587 179.480 1.00 36.74  ? 160 TYR A CZ  1 
ATOM   1308 O OH  . TYR A  1 160 ? 35.206  105.063 180.718 1.00 47.35  ? 160 TYR A OH  1 
ATOM   1309 N N   . GLU A  1 161 ? 34.249  100.435 173.824 1.00 44.44  ? 161 GLU A N   1 
ATOM   1310 C CA  . GLU A  1 161 ? 33.852  99.563  172.727 1.00 34.93  ? 161 GLU A CA  1 
ATOM   1311 C C   . GLU A  1 161 ? 32.617  98.782  173.181 1.00 47.94  ? 161 GLU A C   1 
ATOM   1312 O O   . GLU A  1 161 ? 32.586  98.245  174.284 1.00 70.75  ? 161 GLU A O   1 
ATOM   1313 C CB  . GLU A  1 161 ? 35.018  98.620  172.417 1.00 46.62  ? 161 GLU A CB  1 
ATOM   1314 C CG  . GLU A  1 161 ? 34.882  97.745  171.191 1.00 91.49  ? 161 GLU A CG  1 
ATOM   1315 C CD  . GLU A  1 161 ? 36.108  96.855  170.973 1.00 108.28 ? 161 GLU A CD  1 
ATOM   1316 O OE1 . GLU A  1 161 ? 36.103  96.032  170.030 1.00 119.42 ? 161 GLU A OE1 1 
ATOM   1317 O OE2 . GLU A  1 161 ? 37.079  96.980  171.749 1.00 112.61 ? 161 GLU A OE2 1 
ATOM   1318 N N   . SER A  1 162 ? 31.594  98.741  172.337 1.00 33.26  ? 162 SER A N   1 
ATOM   1319 C CA  . SER A  1 162 ? 30.355  98.038  172.646 1.00 24.00  ? 162 SER A CA  1 
ATOM   1320 C C   . SER A  1 162 ? 30.546  96.549  172.518 1.00 30.36  ? 162 SER A C   1 
ATOM   1321 O O   . SER A  1 162 ? 31.379  96.108  171.739 1.00 37.26  ? 162 SER A O   1 
ATOM   1322 C CB  . SER A  1 162 ? 29.258  98.474  171.679 1.00 52.74  ? 162 SER A CB  1 
ATOM   1323 O OG  . SER A  1 162 ? 29.691  98.382  170.325 1.00 31.31  ? 162 SER A OG  1 
ATOM   1324 N N   . GLU A  1 163 ? 29.828  95.793  173.363 1.00 32.52  ? 163 GLU A N   1 
ATOM   1325 C CA  . GLU A  1 163 ? 29.945  94.371  173.069 1.00 43.22  ? 163 GLU A CA  1 
ATOM   1326 C C   . GLU A  1 163 ? 29.462  94.059  171.657 1.00 47.99  ? 163 GLU A C   1 
ATOM   1327 O O   . GLU A  1 163 ? 28.601  94.902  171.253 1.00 47.86  ? 163 GLU A O   1 
ATOM   1328 C CB  . GLU A  1 163 ? 29.169  93.547  174.097 1.00 61.56  ? 163 GLU A CB  1 
ATOM   1329 C CG  . GLU A  1 163 ? 29.649  93.729  175.527 1.00 118.33 ? 163 GLU A CG  1 
ATOM   1330 C CD  . GLU A  1 163 ? 28.850  92.906  176.519 1.00 137.15 ? 163 GLU A CD  1 
ATOM   1331 O OE1 . GLU A  1 163 ? 27.925  92.187  176.086 1.00 133.06 ? 163 GLU A OE1 1 
ATOM   1332 O OE2 . GLU A  1 163 ? 29.148  92.980  177.729 1.00 165.52 ? 163 GLU A OE2 1 
ATOM   1333 N N   . PRO A  1 164 ? 30.006  93.173  170.942 1.00 52.63  ? 164 PRO A N   1 
ATOM   1334 C CA  . PRO A  1 164 ? 29.650  92.869  169.551 1.00 30.95  ? 164 PRO A CA  1 
ATOM   1335 C C   . PRO A  1 164 ? 28.238  92.378  169.300 1.00 37.49  ? 164 PRO A C   1 
ATOM   1336 O O   . PRO A  1 164 ? 27.605  91.799  170.180 1.00 49.03  ? 164 PRO A O   1 
ATOM   1337 C CB  . PRO A  1 164 ? 30.698  91.847  169.156 1.00 50.00  ? 164 PRO A CB  1 
ATOM   1338 C CG  . PRO A  1 164 ? 30.886  91.089  170.416 1.00 68.38  ? 164 PRO A CG  1 
ATOM   1339 C CD  . PRO A  1 164 ? 30.968  92.184  171.457 1.00 73.82  ? 164 PRO A CD  1 
ATOM   1340 N N   . LEU A  1 165 ? 27.760  92.592  168.077 1.00 36.24  ? 165 LEU A N   1 
ATOM   1341 C CA  . LEU A  1 165 ? 26.402  92.200  167.706 1.00 40.85  ? 165 LEU A CA  1 
ATOM   1342 C C   . LEU A  1 165 ? 26.254  91.591  166.323 1.00 51.00  ? 165 LEU A C   1 
ATOM   1343 O O   . LEU A  1 165 ? 26.696  92.171  165.326 1.00 57.78  ? 165 LEU A O   1 
ATOM   1344 C CB  . LEU A  1 165 ? 25.483  93.404  167.777 1.00 36.20  ? 165 LEU A CB  1 
ATOM   1345 C CG  . LEU A  1 165 ? 24.027  93.057  167.530 1.00 30.81  ? 165 LEU A CG  1 
ATOM   1346 C CD1 . LEU A  1 165 ? 23.591  92.064  168.578 1.00 58.85  ? 165 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A  1 165 ? 23.182  94.310  167.584 1.00 49.02  ? 165 LEU A CD2 1 
ATOM   1348 N N   . ASN A  1 166 ? 25.586  90.441  166.269 1.00 52.62  ? 166 ASN A N   1 
ATOM   1349 C CA  . ASN A  1 166 ? 25.362  89.731  165.018 1.00 55.78  ? 166 ASN A CA  1 
ATOM   1350 C C   . ASN A  1 166 ? 24.079  90.124  164.312 1.00 53.47  ? 166 ASN A C   1 
ATOM   1351 O O   . ASN A  1 166 ? 23.018  90.241  164.919 1.00 65.75  ? 166 ASN A O   1 
ATOM   1352 C CB  . ASN A  1 166 ? 25.362  88.226  165.258 1.00 72.23  ? 166 ASN A CB  1 
ATOM   1353 C CG  . ASN A  1 166 ? 26.748  87.681  165.468 1.00 78.91  ? 166 ASN A CG  1 
ATOM   1354 O OD1 . ASN A  1 166 ? 27.672  88.071  164.756 1.00 48.40  ? 166 ASN A OD1 1 
ATOM   1355 N ND2 . ASN A  1 166 ? 26.900  86.775  166.428 1.00 96.57  ? 166 ASN A ND2 1 
ATOM   1356 N N   . ILE A  1 167 ? 24.195  90.314  163.008 1.00 50.22  ? 167 ILE A N   1 
ATOM   1357 C CA  . ILE A  1 167 ? 23.071  90.689  162.171 1.00 56.86  ? 167 ILE A CA  1 
ATOM   1358 C C   . ILE A  1 167 ? 23.023  89.784  160.944 1.00 74.91  ? 167 ILE A C   1 
ATOM   1359 O O   . ILE A  1 167 ? 24.024  89.605  160.245 1.00 87.63  ? 167 ILE A O   1 
ATOM   1360 C CB  . ILE A  1 167 ? 23.197  92.152  161.735 1.00 48.57  ? 167 ILE A CB  1 
ATOM   1361 C CG1 . ILE A  1 167 ? 22.875  93.055  162.912 1.00 46.51  ? 167 ILE A CG1 1 
ATOM   1362 C CG2 . ILE A  1 167 ? 22.259  92.454  160.598 1.00 41.36  ? 167 ILE A CG2 1 
ATOM   1363 C CD1 . ILE A  1 167 ? 23.061  94.512  162.595 1.00 83.91  ? 167 ILE A CD1 1 
ATOM   1364 N N   . THR A  1 168 ? 21.844  89.226  160.691 1.00 71.31  ? 168 THR A N   1 
ATOM   1365 C CA  . THR A  1 168 ? 21.635  88.318  159.573 1.00 72.17  ? 168 THR A CA  1 
ATOM   1366 C C   . THR A  1 168 ? 20.545  88.797  158.607 1.00 71.20  ? 168 THR A C   1 
ATOM   1367 O O   . THR A  1 168 ? 19.565  89.412  159.024 1.00 72.60  ? 168 THR A O   1 
ATOM   1368 C CB  . THR A  1 168 ? 21.250  86.945  160.109 1.00 81.44  ? 168 THR A CB  1 
ATOM   1369 O OG1 . THR A  1 168 ? 20.149  87.094  161.014 1.00 94.10  ? 168 THR A OG1 1 
ATOM   1370 C CG2 . THR A  1 168 ? 22.416  86.313  160.856 1.00 89.03  ? 168 THR A CG2 1 
ATOM   1371 N N   . VAL A  1 169 ? 20.718  88.502  157.320 1.00 66.30  ? 169 VAL A N   1 
ATOM   1372 C CA  . VAL A  1 169 ? 19.752  88.894  156.291 1.00 75.68  ? 169 VAL A CA  1 
ATOM   1373 C C   . VAL A  1 169 ? 19.382  87.703  155.386 1.00 96.16  ? 169 VAL A C   1 
ATOM   1374 O O   . VAL A  1 169 ? 20.259  86.968  154.931 1.00 107.72 ? 169 VAL A O   1 
ATOM   1375 C CB  . VAL A  1 169 ? 20.320  90.056  155.456 1.00 67.06  ? 169 VAL A CB  1 
ATOM   1376 C CG1 . VAL A  1 169 ? 19.381  90.419  154.335 1.00 78.84  ? 169 VAL A CG1 1 
ATOM   1377 C CG2 . VAL A  1 169 ? 20.529  91.251  156.341 1.00 64.30  ? 169 VAL A CG2 1 
ATOM   1378 N N   . ILE A  1 170 ? 18.081  87.537  155.123 1.00 101.83 ? 170 ILE A N   1 
ATOM   1379 C CA  . ILE A  1 170 ? 17.538  86.422  154.329 1.00 125.61 ? 170 ILE A CA  1 
ATOM   1380 C C   . ILE A  1 170 ? 17.264  86.673  152.835 1.00 141.74 ? 170 ILE A C   1 
ATOM   1381 O O   . ILE A  1 170 ? 17.487  87.768  152.330 1.00 148.81 ? 170 ILE A O   1 
ATOM   1382 C CB  . ILE A  1 170 ? 16.224  85.933  154.969 1.00 118.43 ? 170 ILE A CB  1 
ATOM   1383 C CG1 . ILE A  1 170 ? 16.360  85.966  156.492 1.00 98.63  ? 170 ILE A CG1 1 
ATOM   1384 C CG2 . ILE A  1 170 ? 15.908  84.511  154.513 1.00 140.59 ? 170 ILE A CG2 1 
ATOM   1385 C CD1 . ILE A  1 170 ? 15.077  85.661  157.225 1.00 68.73  ? 170 ILE A CD1 1 
ATOM   1386 N N   . LYS A  1 171 ? 16.781  85.637  152.142 1.00 153.73 ? 171 LYS A N   1 
ATOM   1387 C CA  . LYS A  1 171 ? 16.446  85.699  150.713 1.00 166.42 ? 171 LYS A CA  1 
ATOM   1388 C C   . LYS A  1 171 ? 15.152  84.928  150.430 1.00 179.70 ? 171 LYS A C   1 
ATOM   1389 O O   . LYS A  1 171 ? 14.841  83.961  151.124 1.00 190.30 ? 171 LYS A O   1 
ATOM   1390 C CB  . LYS A  1 171 ? 17.572  85.098  149.861 1.00 158.28 ? 171 LYS A CB  1 
ATOM   1391 C CG  . LYS A  1 171 ? 18.821  85.950  149.771 1.00 158.75 ? 171 LYS A CG  1 
ATOM   1392 C CD  . LYS A  1 171 ? 19.841  85.352  148.814 1.00 160.43 ? 171 LYS A CD  1 
ATOM   1393 C CE  . LYS A  1 171 ? 21.059  86.259  148.692 1.00 163.45 ? 171 LYS A CE  1 
ATOM   1394 N NZ  . LYS A  1 171 ? 22.110  85.721  147.784 1.00 161.19 ? 171 LYS A NZ  1 
ATOM   1395 N N   . ALA A  1 172 ? 14.405  85.349  149.410 1.00 181.78 ? 172 ALA A N   1 
ATOM   1396 C CA  . ALA A  1 172 ? 13.152  84.681  149.047 1.00 177.16 ? 172 ALA A CA  1 
ATOM   1397 C C   . ALA A  1 172 ? 13.055  84.474  147.535 1.00 178.92 ? 172 ALA A C   1 
ATOM   1398 O O   . ALA A  1 172 ? 12.810  85.420  146.788 1.00 176.69 ? 172 ALA A O   1 
ATOM   1399 C CB  . ALA A  1 172 ? 11.960  85.501  149.535 1.00 165.61 ? 172 ALA A CB  1 
ATOM   1400 N N   . PRO A  1 173 ? 13.241  83.227  147.067 1.00 183.50 ? 173 PRO A N   1 
ATOM   1401 C CA  . PRO A  1 173 ? 13.170  82.925  145.632 1.00 183.58 ? 173 PRO A CA  1 
ATOM   1402 C C   . PRO A  1 173 ? 11.765  83.064  145.034 1.00 177.06 ? 173 PRO A C   1 
ATOM   1403 O O   . PRO A  1 173 ? 11.238  82.054  144.522 1.00 170.09 ? 173 PRO A O   1 
ATOM   1404 C CB  . PRO A  1 173 ? 13.702  81.495  145.558 1.00 180.90 ? 173 PRO A CB  1 
ATOM   1405 C CG  . PRO A  1 173 ? 13.235  80.907  146.852 1.00 182.92 ? 173 PRO A CG  1 
ATOM   1406 C CD  . PRO A  1 173 ? 13.548  82.010  147.842 1.00 178.85 ? 173 PRO A CD  1 
ATOM   1407 N N   . PRO B  2 3   ? 42.116  129.063 174.936 1.00 191.53 ? 328 PRO B N   1 
ATOM   1408 C CA  . PRO B  2 3   ? 43.348  128.347 174.529 1.00 193.57 ? 328 PRO B CA  1 
ATOM   1409 C C   . PRO B  2 3   ? 43.060  126.964 173.946 1.00 195.94 ? 328 PRO B C   1 
ATOM   1410 O O   . PRO B  2 3   ? 43.981  126.261 173.518 1.00 186.00 ? 328 PRO B O   1 
ATOM   1411 C CB  . PRO B  2 3   ? 44.233  128.245 175.766 1.00 189.48 ? 328 PRO B CB  1 
ATOM   1412 C CG  . PRO B  2 3   ? 43.202  128.349 176.889 1.00 187.79 ? 328 PRO B CG  1 
ATOM   1413 C CD  . PRO B  2 3   ? 42.170  129.366 176.377 1.00 189.97 ? 328 PRO B CD  1 
ATOM   1414 N N   . CYS B  2 4   ? 41.785  126.575 173.931 1.00 201.28 ? 329 CYS B N   1 
ATOM   1415 C CA  . CYS B  2 4   ? 41.399  125.277 173.386 1.00 197.88 ? 329 CYS B CA  1 
ATOM   1416 C C   . CYS B  2 4   ? 40.595  125.390 172.094 1.00 192.79 ? 329 CYS B C   1 
ATOM   1417 O O   . CYS B  2 4   ? 39.925  124.441 171.686 1.00 188.08 ? 329 CYS B O   1 
ATOM   1418 C CB  . CYS B  2 4   ? 40.596  124.462 174.402 1.00 201.88 ? 329 CYS B CB  1 
ATOM   1419 S SG  . CYS B  2 4   ? 40.352  122.737 173.856 1.00 208.38 ? 329 CYS B SG  1 
ATOM   1420 N N   . ASP B  2 5   ? 40.647  126.557 171.461 1.00 187.32 ? 330 ASP B N   1 
ATOM   1421 C CA  . ASP B  2 5   ? 39.960  126.766 170.189 1.00 177.31 ? 330 ASP B CA  1 
ATOM   1422 C C   . ASP B  2 5   ? 40.978  126.228 169.184 1.00 165.95 ? 330 ASP B C   1 
ATOM   1423 O O   . ASP B  2 5   ? 41.198  126.802 168.117 1.00 172.16 ? 330 ASP B O   1 
ATOM   1424 C CB  . ASP B  2 5   ? 39.714  128.266 169.964 1.00 188.94 ? 330 ASP B CB  1 
ATOM   1425 C CG  . ASP B  2 5   ? 38.919  128.560 168.691 1.00 194.76 ? 330 ASP B CG  1 
ATOM   1426 O OD1 . ASP B  2 5   ? 39.428  128.310 167.577 1.00 195.82 ? 330 ASP B OD1 1 
ATOM   1427 O OD2 . ASP B  2 5   ? 37.778  129.052 168.806 1.00 187.03 ? 330 ASP B OD2 1 
ATOM   1428 N N   . SER B  2 6   ? 41.601  125.110 169.550 1.00 147.52 ? 331 SER B N   1 
ATOM   1429 C CA  . SER B  2 6   ? 42.636  124.492 168.731 1.00 121.65 ? 331 SER B CA  1 
ATOM   1430 C C   . SER B  2 6   ? 42.353  123.073 168.245 1.00 109.09 ? 331 SER B C   1 
ATOM   1431 O O   . SER B  2 6   ? 43.245  122.411 167.724 1.00 119.75 ? 331 SER B O   1 
ATOM   1432 C CB  . SER B  2 6   ? 43.959  124.493 169.509 1.00 122.92 ? 331 SER B CB  1 
ATOM   1433 O OG  . SER B  2 6   ? 43.867  123.728 170.706 1.00 86.65  ? 331 SER B OG  1 
ATOM   1434 N N   . ASN B  2 7   ? 41.129  122.596 168.411 1.00 87.29  ? 332 ASN B N   1 
ATOM   1435 C CA  . ASN B  2 7   ? 40.796  121.246 167.977 1.00 63.16  ? 332 ASN B CA  1 
ATOM   1436 C C   . ASN B  2 7   ? 39.424  121.189 167.336 1.00 45.00  ? 332 ASN B C   1 
ATOM   1437 O O   . ASN B  2 7   ? 38.588  120.357 167.696 1.00 51.79  ? 332 ASN B O   1 
ATOM   1438 C CB  . ASN B  2 7   ? 40.842  120.285 169.162 1.00 85.21  ? 332 ASN B CB  1 
ATOM   1439 C CG  . ASN B  2 7   ? 42.247  119.821 169.484 1.00 81.88  ? 332 ASN B CG  1 
ATOM   1440 O OD1 . ASN B  2 7   ? 43.185  120.617 169.523 1.00 91.47  ? 332 ASN B OD1 1 
ATOM   1441 N ND2 . ASN B  2 7   ? 42.398  118.525 169.735 1.00 70.25  ? 332 ASN B ND2 1 
ATOM   1442 N N   . PRO B  2 8   ? 39.173  122.079 166.373 1.00 20.21  ? 333 PRO B N   1 
ATOM   1443 C CA  . PRO B  2 8   ? 37.889  122.113 165.689 1.00 33.19  ? 333 PRO B CA  1 
ATOM   1444 C C   . PRO B  2 8   ? 37.271  120.738 165.530 1.00 18.89  ? 333 PRO B C   1 
ATOM   1445 O O   . PRO B  2 8   ? 37.932  119.767 165.206 1.00 48.76  ? 333 PRO B O   1 
ATOM   1446 C CB  . PRO B  2 8   ? 38.232  122.764 164.362 1.00 17.85  ? 333 PRO B CB  1 
ATOM   1447 C CG  . PRO B  2 8   ? 39.219  123.787 164.780 1.00 61.57  ? 333 PRO B CG  1 
ATOM   1448 C CD  . PRO B  2 8   ? 40.098  123.063 165.794 1.00 26.18  ? 333 PRO B CD  1 
ATOM   1449 N N   . ARG B  2 9   ? 35.984  120.677 165.788 1.00 35.12  ? 334 ARG B N   1 
ATOM   1450 C CA  . ARG B  2 9   ? 35.235  119.460 165.677 1.00 29.84  ? 334 ARG B CA  1 
ATOM   1451 C C   . ARG B  2 9   ? 36.002  118.225 166.156 1.00 34.13  ? 334 ARG B C   1 
ATOM   1452 O O   . ARG B  2 9   ? 35.615  117.090 165.891 1.00 47.67  ? 334 ARG B O   1 
ATOM   1453 C CB  . ARG B  2 9   ? 34.754  119.322 164.242 1.00 4.74   ? 334 ARG B CB  1 
ATOM   1454 C CG  . ARG B  2 9   ? 33.904  118.112 164.022 1.00 40.40  ? 334 ARG B CG  1 
ATOM   1455 C CD  . ARG B  2 9   ? 32.439  118.403 163.975 1.00 4.74   ? 334 ARG B CD  1 
ATOM   1456 N NE  . ARG B  2 9   ? 31.983  118.450 162.597 1.00 25.77  ? 334 ARG B NE  1 
ATOM   1457 C CZ  . ARG B  2 9   ? 30.763  118.103 162.210 1.00 54.51  ? 334 ARG B CZ  1 
ATOM   1458 N NH1 . ARG B  2 9   ? 29.885  117.676 163.099 1.00 51.68  ? 334 ARG B NH1 1 
ATOM   1459 N NH2 . ARG B  2 9   ? 30.416  118.202 160.936 1.00 51.56  ? 334 ARG B NH2 1 
ATOM   1460 N N   . GLY B  2 10  ? 37.081  118.441 166.896 1.00 28.13  ? 335 GLY B N   1 
ATOM   1461 C CA  . GLY B  2 10  ? 37.832  117.308 167.413 1.00 46.65  ? 335 GLY B CA  1 
ATOM   1462 C C   . GLY B  2 10  ? 39.060  116.972 166.600 1.00 36.85  ? 335 GLY B C   1 
ATOM   1463 O O   . GLY B  2 10  ? 39.953  116.256 167.053 1.00 25.79  ? 335 GLY B O   1 
ATOM   1464 N N   . VAL B  2 11  ? 39.087  117.491 165.381 1.00 38.52  ? 336 VAL B N   1 
ATOM   1465 C CA  . VAL B  2 11  ? 40.196  117.306 164.454 1.00 41.92  ? 336 VAL B CA  1 
ATOM   1466 C C   . VAL B  2 11  ? 41.485  117.947 164.969 1.00 46.65  ? 336 VAL B C   1 
ATOM   1467 O O   . VAL B  2 11  ? 41.596  119.164 164.967 1.00 54.85  ? 336 VAL B O   1 
ATOM   1468 C CB  . VAL B  2 11  ? 39.836  117.952 163.124 1.00 54.32  ? 336 VAL B CB  1 
ATOM   1469 C CG1 . VAL B  2 11  ? 41.025  117.972 162.204 1.00 68.13  ? 336 VAL B CG1 1 
ATOM   1470 C CG2 . VAL B  2 11  ? 38.674  117.213 162.512 1.00 76.95  ? 336 VAL B CG2 1 
ATOM   1471 N N   . SER B  2 12  ? 42.456  117.148 165.404 1.00 43.50  ? 337 SER B N   1 
ATOM   1472 C CA  . SER B  2 12  ? 43.714  117.712 165.900 1.00 47.62  ? 337 SER B CA  1 
ATOM   1473 C C   . SER B  2 12  ? 44.791  117.806 164.809 1.00 53.97  ? 337 SER B C   1 
ATOM   1474 O O   . SER B  2 12  ? 44.673  117.177 163.760 1.00 45.83  ? 337 SER B O   1 
ATOM   1475 C CB  . SER B  2 12  ? 44.232  116.895 167.081 1.00 68.23  ? 337 SER B CB  1 
ATOM   1476 O OG  . SER B  2 12  ? 44.222  115.512 166.795 1.00 63.28  ? 337 SER B OG  1 
ATOM   1477 N N   . ALA B  2 13  ? 45.827  118.612 165.058 1.00 70.31  ? 338 ALA B N   1 
ATOM   1478 C CA  . ALA B  2 13  ? 46.939  118.821 164.107 1.00 66.95  ? 338 ALA B CA  1 
ATOM   1479 C C   . ALA B  2 13  ? 48.260  118.980 164.842 1.00 57.70  ? 338 ALA B C   1 
ATOM   1480 O O   . ALA B  2 13  ? 48.301  119.477 165.968 1.00 73.78  ? 338 ALA B O   1 
ATOM   1481 C CB  . ALA B  2 13  ? 46.705  120.063 163.245 1.00 15.70  ? 338 ALA B CB  1 
ATOM   1482 N N   . TYR B  2 14  ? 49.340  118.555 164.206 1.00 55.61  ? 339 TYR B N   1 
ATOM   1483 C CA  . TYR B  2 14  ? 50.643  118.655 164.823 1.00 56.92  ? 339 TYR B CA  1 
ATOM   1484 C C   . TYR B  2 14  ? 51.610  119.290 163.841 1.00 66.77  ? 339 TYR B C   1 
ATOM   1485 O O   . TYR B  2 14  ? 51.530  119.048 162.640 1.00 52.32  ? 339 TYR B O   1 
ATOM   1486 C CB  . TYR B  2 14  ? 51.122  117.269 165.235 1.00 52.08  ? 339 TYR B CB  1 
ATOM   1487 C CG  . TYR B  2 14  ? 50.150  116.534 166.132 1.00 62.70  ? 339 TYR B CG  1 
ATOM   1488 C CD1 . TYR B  2 14  ? 49.014  115.921 165.614 1.00 53.76  ? 339 TYR B CD1 1 
ATOM   1489 C CD2 . TYR B  2 14  ? 50.347  116.492 167.503 1.00 69.39  ? 339 TYR B CD2 1 
ATOM   1490 C CE1 . TYR B  2 14  ? 48.098  115.288 166.440 1.00 43.43  ? 339 TYR B CE1 1 
ATOM   1491 C CE2 . TYR B  2 14  ? 49.435  115.867 168.340 1.00 84.43  ? 339 TYR B CE2 1 
ATOM   1492 C CZ  . TYR B  2 14  ? 48.310  115.270 167.804 1.00 74.41  ? 339 TYR B CZ  1 
ATOM   1493 O OH  . TYR B  2 14  ? 47.383  114.696 168.648 1.00 95.07  ? 339 TYR B OH  1 
ATOM   1494 N N   . LEU B  2 15  ? 52.515  120.118 164.348 1.00 64.26  ? 340 LEU B N   1 
ATOM   1495 C CA  . LEU B  2 15  ? 53.476  120.776 163.479 1.00 60.75  ? 340 LEU B CA  1 
ATOM   1496 C C   . LEU B  2 15  ? 54.881  120.531 163.988 1.00 71.20  ? 340 LEU B C   1 
ATOM   1497 O O   . LEU B  2 15  ? 55.294  121.133 164.972 1.00 85.27  ? 340 LEU B O   1 
ATOM   1498 C CB  . LEU B  2 15  ? 53.186  122.263 163.438 1.00 25.27  ? 340 LEU B CB  1 
ATOM   1499 C CG  . LEU B  2 15  ? 54.027  123.160 162.544 1.00 47.60  ? 340 LEU B CG  1 
ATOM   1500 C CD1 . LEU B  2 15  ? 53.820  122.802 161.089 1.00 63.60  ? 340 LEU B CD1 1 
ATOM   1501 C CD2 . LEU B  2 15  ? 53.615  124.594 162.770 1.00 75.02  ? 340 LEU B CD2 1 
ATOM   1502 N N   . SER B  2 16  ? 55.612  119.651 163.305 1.00 82.10  ? 341 SER B N   1 
ATOM   1503 C CA  . SER B  2 16  ? 56.964  119.290 163.712 1.00 94.22  ? 341 SER B CA  1 
ATOM   1504 C C   . SER B  2 16  ? 58.023  120.306 163.321 1.00 90.17  ? 341 SER B C   1 
ATOM   1505 O O   . SER B  2 16  ? 57.918  120.956 162.286 1.00 73.68  ? 341 SER B O   1 
ATOM   1506 C CB  . SER B  2 16  ? 57.333  117.925 163.139 1.00 109.42 ? 341 SER B CB  1 
ATOM   1507 O OG  . SER B  2 16  ? 58.517  117.431 163.744 1.00 137.54 ? 341 SER B OG  1 
ATOM   1508 N N   . ARG B  2 17  ? 59.045  120.419 164.168 1.00 90.89  ? 342 ARG B N   1 
ATOM   1509 C CA  . ARG B  2 17  ? 60.165  121.343 163.976 1.00 84.37  ? 342 ARG B CA  1 
ATOM   1510 C C   . ARG B  2 17  ? 61.352  120.635 163.287 1.00 86.59  ? 342 ARG B C   1 
ATOM   1511 O O   . ARG B  2 17  ? 61.582  119.441 163.500 1.00 100.39 ? 342 ARG B O   1 
ATOM   1512 C CB  . ARG B  2 17  ? 60.602  121.890 165.343 1.00 102.90 ? 342 ARG B CB  1 
ATOM   1513 C CG  . ARG B  2 17  ? 60.649  120.808 166.429 1.00 127.09 ? 342 ARG B CG  1 
ATOM   1514 C CD  . ARG B  2 17  ? 61.354  121.239 167.726 1.00 131.55 ? 342 ARG B CD  1 
ATOM   1515 N NE  . ARG B  2 17  ? 60.568  122.139 168.567 1.00 113.85 ? 342 ARG B NE  1 
ATOM   1516 C CZ  . ARG B  2 17  ? 60.430  123.442 168.351 1.00 118.78 ? 342 ARG B CZ  1 
ATOM   1517 N NH1 . ARG B  2 17  ? 61.028  124.015 167.315 1.00 99.77  ? 342 ARG B NH1 1 
ATOM   1518 N NH2 . ARG B  2 17  ? 59.691  124.174 169.173 1.00 131.05 ? 342 ARG B NH2 1 
ATOM   1519 N N   . PRO B  2 18  ? 62.120  121.368 162.457 1.00 67.22  ? 343 PRO B N   1 
ATOM   1520 C CA  . PRO B  2 18  ? 63.281  120.850 161.728 1.00 46.28  ? 343 PRO B CA  1 
ATOM   1521 C C   . PRO B  2 18  ? 64.234  120.174 162.689 1.00 61.67  ? 343 PRO B C   1 
ATOM   1522 O O   . PRO B  2 18  ? 64.518  120.713 163.762 1.00 64.48  ? 343 PRO B O   1 
ATOM   1523 C CB  . PRO B  2 18  ? 63.916  122.104 161.148 1.00 47.76  ? 343 PRO B CB  1 
ATOM   1524 C CG  . PRO B  2 18  ? 62.776  123.035 161.003 1.00 50.63  ? 343 PRO B CG  1 
ATOM   1525 C CD  . PRO B  2 18  ? 62.016  122.823 162.278 1.00 73.87  ? 343 PRO B CD  1 
ATOM   1526 N N   . SER B  2 19  ? 64.737  119.002 162.311 1.00 74.38  ? 344 SER B N   1 
ATOM   1527 C CA  . SER B  2 19  ? 65.671  118.289 163.177 1.00 79.07  ? 344 SER B CA  1 
ATOM   1528 C C   . SER B  2 19  ? 67.024  118.946 163.041 1.00 69.91  ? 344 SER B C   1 
ATOM   1529 O O   . SER B  2 19  ? 67.334  119.517 161.998 1.00 45.30  ? 344 SER B O   1 
ATOM   1530 C CB  . SER B  2 19  ? 65.778  116.812 162.781 1.00 91.98  ? 344 SER B CB  1 
ATOM   1531 O OG  . SER B  2 19  ? 66.324  116.661 161.483 1.00 80.77  ? 344 SER B OG  1 
ATOM   1532 N N   . PRO B  2 20  ? 67.844  118.894 164.104 1.00 75.10  ? 345 PRO B N   1 
ATOM   1533 C CA  . PRO B  2 20  ? 69.183  119.494 164.081 1.00 71.59  ? 345 PRO B CA  1 
ATOM   1534 C C   . PRO B  2 20  ? 69.849  119.065 162.789 1.00 73.21  ? 345 PRO B C   1 
ATOM   1535 O O   . PRO B  2 20  ? 70.233  119.893 161.960 1.00 57.71  ? 345 PRO B O   1 
ATOM   1536 C CB  . PRO B  2 20  ? 69.862  118.867 165.296 1.00 63.56  ? 345 PRO B CB  1 
ATOM   1537 C CG  . PRO B  2 20  ? 68.745  118.694 166.255 1.00 72.12  ? 345 PRO B CG  1 
ATOM   1538 C CD  . PRO B  2 20  ? 67.611  118.184 165.375 1.00 79.50  ? 345 PRO B CD  1 
ATOM   1539 N N   . PHE B  2 21  ? 69.955  117.745 162.642 1.00 68.81  ? 346 PHE B N   1 
ATOM   1540 C CA  . PHE B  2 21  ? 70.542  117.099 161.482 1.00 47.02  ? 346 PHE B CA  1 
ATOM   1541 C C   . PHE B  2 21  ? 70.045  117.721 160.170 1.00 51.63  ? 346 PHE B C   1 
ATOM   1542 O O   . PHE B  2 21  ? 70.796  118.379 159.474 1.00 54.14  ? 346 PHE B O   1 
ATOM   1543 C CB  . PHE B  2 21  ? 70.209  115.611 161.522 1.00 70.97  ? 346 PHE B CB  1 
ATOM   1544 C CG  . PHE B  2 21  ? 70.755  114.839 160.365 1.00 96.26  ? 346 PHE B CG  1 
ATOM   1545 C CD1 . PHE B  2 21  ? 72.119  114.727 160.181 1.00 92.23  ? 346 PHE B CD1 1 
ATOM   1546 C CD2 . PHE B  2 21  ? 69.903  114.239 159.445 1.00 113.38 ? 346 PHE B CD2 1 
ATOM   1547 C CE1 . PHE B  2 21  ? 72.632  114.039 159.104 1.00 97.51  ? 346 PHE B CE1 1 
ATOM   1548 C CE2 . PHE B  2 21  ? 70.410  113.544 158.358 1.00 117.92 ? 346 PHE B CE2 1 
ATOM   1549 C CZ  . PHE B  2 21  ? 71.779  113.445 158.187 1.00 116.48 ? 346 PHE B CZ  1 
ATOM   1550 N N   . ASP B  2 22  ? 68.777  117.524 159.831 1.00 63.53  ? 347 ASP B N   1 
ATOM   1551 C CA  . ASP B  2 22  ? 68.226  118.078 158.592 1.00 73.08  ? 347 ASP B CA  1 
ATOM   1552 C C   . ASP B  2 22  ? 68.509  119.576 158.466 1.00 64.78  ? 347 ASP B C   1 
ATOM   1553 O O   . ASP B  2 22  ? 68.339  120.174 157.401 1.00 54.26  ? 347 ASP B O   1 
ATOM   1554 C CB  . ASP B  2 22  ? 66.703  117.859 158.542 1.00 95.88  ? 347 ASP B CB  1 
ATOM   1555 C CG  . ASP B  2 22  ? 66.318  116.431 158.211 1.00 113.22 ? 347 ASP B CG  1 
ATOM   1556 O OD1 . ASP B  2 22  ? 66.506  116.024 157.046 1.00 126.98 ? 347 ASP B OD1 1 
ATOM   1557 O OD2 . ASP B  2 22  ? 65.826  115.715 159.112 1.00 127.12 ? 347 ASP B OD2 1 
ATOM   1558 N N   . LEU B  2 23  ? 68.969  120.178 159.550 1.00 57.10  ? 348 LEU B N   1 
ATOM   1559 C CA  . LEU B  2 23  ? 69.184  121.613 159.553 1.00 74.24  ? 348 LEU B CA  1 
ATOM   1560 C C   . LEU B  2 23  ? 70.617  122.094 159.396 1.00 77.92  ? 348 LEU B C   1 
ATOM   1561 O O   . LEU B  2 23  ? 70.863  123.165 158.841 1.00 71.42  ? 348 LEU B O   1 
ATOM   1562 C CB  . LEU B  2 23  ? 68.570  122.183 160.837 1.00 72.32  ? 348 LEU B CB  1 
ATOM   1563 C CG  . LEU B  2 23  ? 68.601  123.691 161.101 1.00 84.18  ? 348 LEU B CG  1 
ATOM   1564 C CD1 . LEU B  2 23  ? 68.208  124.482 159.860 1.00 74.99  ? 348 LEU B CD1 1 
ATOM   1565 C CD2 . LEU B  2 23  ? 67.656  123.985 162.246 1.00 88.08  ? 348 LEU B CD2 1 
ATOM   1566 N N   . PHE B  2 24  ? 71.560  121.300 159.877 1.00 80.73  ? 349 PHE B N   1 
ATOM   1567 C CA  . PHE B  2 24  ? 72.964  121.666 159.811 1.00 86.90  ? 349 PHE B CA  1 
ATOM   1568 C C   . PHE B  2 24  ? 73.806  120.800 158.889 1.00 92.24  ? 349 PHE B C   1 
ATOM   1569 O O   . PHE B  2 24  ? 74.633  121.304 158.137 1.00 100.03 ? 349 PHE B O   1 
ATOM   1570 C CB  . PHE B  2 24  ? 73.515  121.657 161.221 1.00 83.88  ? 349 PHE B CB  1 
ATOM   1571 C CG  . PHE B  2 24  ? 72.864  122.665 162.096 1.00 89.39  ? 349 PHE B CG  1 
ATOM   1572 C CD1 . PHE B  2 24  ? 72.745  122.458 163.464 1.00 93.28  ? 349 PHE B CD1 1 
ATOM   1573 C CD2 . PHE B  2 24  ? 72.363  123.837 161.542 1.00 74.53  ? 349 PHE B CD2 1 
ATOM   1574 C CE1 . PHE B  2 24  ? 72.133  123.406 164.274 1.00 79.36  ? 349 PHE B CE1 1 
ATOM   1575 C CE2 . PHE B  2 24  ? 71.754  124.786 162.335 1.00 90.89  ? 349 PHE B CE2 1 
ATOM   1576 C CZ  . PHE B  2 24  ? 71.638  124.572 163.708 1.00 98.96  ? 349 PHE B CZ  1 
ATOM   1577 N N   . ILE B  2 25  ? 73.609  119.494 158.963 1.00 87.83  ? 350 ILE B N   1 
ATOM   1578 C CA  . ILE B  2 25  ? 74.328  118.586 158.098 1.00 66.11  ? 350 ILE B CA  1 
ATOM   1579 C C   . ILE B  2 25  ? 73.672  118.752 156.738 1.00 71.15  ? 350 ILE B C   1 
ATOM   1580 O O   . ILE B  2 25  ? 74.101  119.559 155.928 1.00 82.13  ? 350 ILE B O   1 
ATOM   1581 C CB  . ILE B  2 25  ? 74.145  117.136 158.545 1.00 70.42  ? 350 ILE B CB  1 
ATOM   1582 C CG1 . ILE B  2 25  ? 74.662  116.959 159.972 1.00 66.92  ? 350 ILE B CG1 1 
ATOM   1583 C CG2 . ILE B  2 25  ? 74.830  116.213 157.588 1.00 87.22  ? 350 ILE B CG2 1 
ATOM   1584 C CD1 . ILE B  2 25  ? 76.040  117.471 160.193 1.00 66.39  ? 350 ILE B CD1 1 
ATOM   1585 N N   . ARG B  2 26  ? 72.601  117.998 156.520 1.00 78.37  ? 351 ARG B N   1 
ATOM   1586 C CA  . ARG B  2 26  ? 71.852  118.003 155.261 1.00 86.87  ? 351 ARG B CA  1 
ATOM   1587 C C   . ARG B  2 26  ? 71.563  119.406 154.722 1.00 82.47  ? 351 ARG B C   1 
ATOM   1588 O O   . ARG B  2 26  ? 71.257  119.576 153.546 1.00 72.26  ? 351 ARG B O   1 
ATOM   1589 C CB  . ARG B  2 26  ? 70.544  117.223 155.464 1.00 98.67  ? 351 ARG B CB  1 
ATOM   1590 C CG  . ARG B  2 26  ? 69.978  116.539 154.229 1.00 104.21 ? 351 ARG B CG  1 
ATOM   1591 C CD  . ARG B  2 26  ? 69.081  115.375 154.644 1.00 121.10 ? 351 ARG B CD  1 
ATOM   1592 N NE  . ARG B  2 26  ? 68.530  114.661 153.497 1.00 161.42 ? 351 ARG B NE  1 
ATOM   1593 C CZ  . ARG B  2 26  ? 67.646  115.179 152.650 1.00 180.46 ? 351 ARG B CZ  1 
ATOM   1594 N NH1 . ARG B  2 26  ? 67.210  116.420 152.821 1.00 194.68 ? 351 ARG B NH1 1 
ATOM   1595 N NH2 . ARG B  2 26  ? 67.198  114.456 151.632 1.00 187.43 ? 351 ARG B NH2 1 
ATOM   1596 N N   . LYS B  2 27  ? 71.672  120.401 155.594 1.00 90.95  ? 352 LYS B N   1 
ATOM   1597 C CA  . LYS B  2 27  ? 71.417  121.800 155.249 1.00 109.13 ? 352 LYS B CA  1 
ATOM   1598 C C   . LYS B  2 27  ? 70.162  122.102 154.416 1.00 112.51 ? 352 LYS B C   1 
ATOM   1599 O O   . LYS B  2 27  ? 70.110  123.108 153.709 1.00 106.38 ? 352 LYS B O   1 
ATOM   1600 C CB  . LYS B  2 27  ? 72.641  122.404 154.559 1.00 117.65 ? 352 LYS B CB  1 
ATOM   1601 C CG  . LYS B  2 27  ? 73.881  122.501 155.448 1.00 133.37 ? 352 LYS B CG  1 
ATOM   1602 C CD  . LYS B  2 27  ? 74.894  123.491 154.874 1.00 145.15 ? 352 LYS B CD  1 
ATOM   1603 C CE  . LYS B  2 27  ? 76.217  123.484 155.633 1.00 145.02 ? 352 LYS B CE  1 
ATOM   1604 N NZ  . LYS B  2 27  ? 77.028  122.264 155.354 1.00 159.73 ? 352 LYS B NZ  1 
ATOM   1605 N N   . SER B  2 28  ? 69.160  121.231 154.504 1.00 117.05 ? 353 SER B N   1 
ATOM   1606 C CA  . SER B  2 28  ? 67.884  121.411 153.802 1.00 111.11 ? 353 SER B CA  1 
ATOM   1607 C C   . SER B  2 28  ? 66.811  121.034 154.818 1.00 101.24 ? 353 SER B C   1 
ATOM   1608 O O   . SER B  2 28  ? 66.337  119.897 154.860 1.00 94.35  ? 353 SER B O   1 
ATOM   1609 C CB  . SER B  2 28  ? 67.788  120.501 152.574 1.00 122.76 ? 353 SER B CB  1 
ATOM   1610 O OG  . SER B  2 28  ? 67.784  119.131 152.936 1.00 146.82 ? 353 SER B OG  1 
ATOM   1611 N N   . PRO B  2 29  ? 66.421  121.994 155.661 1.00 89.03  ? 354 PRO B N   1 
ATOM   1612 C CA  . PRO B  2 29  ? 65.415  121.793 156.698 1.00 81.03  ? 354 PRO B CA  1 
ATOM   1613 C C   . PRO B  2 29  ? 63.998  121.894 156.181 1.00 78.63  ? 354 PRO B C   1 
ATOM   1614 O O   . PRO B  2 29  ? 63.722  122.632 155.225 1.00 68.76  ? 354 PRO B O   1 
ATOM   1615 C CB  . PRO B  2 29  ? 65.720  122.910 157.702 1.00 83.10  ? 354 PRO B CB  1 
ATOM   1616 C CG  . PRO B  2 29  ? 67.006  123.540 157.208 1.00 76.84  ? 354 PRO B CG  1 
ATOM   1617 C CD  . PRO B  2 29  ? 66.948  123.357 155.738 1.00 85.85  ? 354 PRO B CD  1 
ATOM   1618 N N   . THR B  2 30  ? 63.108  121.145 156.826 1.00 69.31  ? 355 THR B N   1 
ATOM   1619 C CA  . THR B  2 30  ? 61.696  121.153 156.478 1.00 72.67  ? 355 THR B CA  1 
ATOM   1620 C C   . THR B  2 30  ? 60.837  120.838 157.683 1.00 78.45  ? 355 THR B C   1 
ATOM   1621 O O   . THR B  2 30  ? 61.132  119.924 158.464 1.00 77.88  ? 355 THR B O   1 
ATOM   1622 C CB  . THR B  2 30  ? 61.340  120.121 155.405 1.00 71.81  ? 355 THR B CB  1 
ATOM   1623 O OG1 . THR B  2 30  ? 61.685  118.810 155.876 1.00 71.06  ? 355 THR B OG1 1 
ATOM   1624 C CG2 . THR B  2 30  ? 62.053  120.440 154.098 1.00 95.28  ? 355 THR B CG2 1 
ATOM   1625 N N   . ILE B  2 31  ? 59.765  121.613 157.815 1.00 78.08  ? 356 ILE B N   1 
ATOM   1626 C CA  . ILE B  2 31  ? 58.801  121.449 158.891 1.00 70.24  ? 356 ILE B CA  1 
ATOM   1627 C C   . ILE B  2 31  ? 57.595  120.723 158.311 1.00 73.07  ? 356 ILE B C   1 
ATOM   1628 O O   . ILE B  2 31  ? 57.290  120.849 157.110 1.00 51.43  ? 356 ILE B O   1 
ATOM   1629 C CB  . ILE B  2 31  ? 58.351  122.805 159.441 1.00 67.36  ? 356 ILE B CB  1 
ATOM   1630 C CG1 . ILE B  2 31  ? 57.861  123.691 158.294 1.00 62.39  ? 356 ILE B CG1 1 
ATOM   1631 C CG2 . ILE B  2 31  ? 59.496  123.453 160.194 1.00 76.49  ? 356 ILE B CG2 1 
ATOM   1632 C CD1 . ILE B  2 31  ? 57.478  125.075 158.729 1.00 69.67  ? 356 ILE B CD1 1 
ATOM   1633 N N   . THR B  2 32  ? 56.898  119.978 159.164 1.00 75.06  ? 357 THR B N   1 
ATOM   1634 C CA  . THR B  2 32  ? 55.752  119.215 158.706 1.00 66.95  ? 357 THR B CA  1 
ATOM   1635 C C   . THR B  2 32  ? 54.494  119.395 159.534 1.00 69.21  ? 357 THR B C   1 
ATOM   1636 O O   . THR B  2 32  ? 54.525  119.290 160.762 1.00 68.22  ? 357 THR B O   1 
ATOM   1637 C CB  . THR B  2 32  ? 56.095  117.748 158.697 1.00 78.01  ? 357 THR B CB  1 
ATOM   1638 O OG1 . THR B  2 32  ? 57.388  117.574 158.106 1.00 96.57  ? 357 THR B OG1 1 
ATOM   1639 C CG2 . THR B  2 32  ? 55.066  116.981 157.904 1.00 81.81  ? 357 THR B CG2 1 
ATOM   1640 N N   . CYS B  2 33  ? 53.387  119.639 158.836 1.00 69.29  ? 358 CYS B N   1 
ATOM   1641 C CA  . CYS B  2 33  ? 52.076  119.835 159.453 1.00 67.22  ? 358 CYS B CA  1 
ATOM   1642 C C   . CYS B  2 33  ? 51.260  118.568 159.245 1.00 58.39  ? 358 CYS B C   1 
ATOM   1643 O O   . CYS B  2 33  ? 50.999  118.164 158.117 1.00 62.64  ? 358 CYS B O   1 
ATOM   1644 C CB  . CYS B  2 33  ? 51.372  121.006 158.789 1.00 82.24  ? 358 CYS B CB  1 
ATOM   1645 S SG  . CYS B  2 33  ? 49.884  121.601 159.632 1.00 90.82  ? 358 CYS B SG  1 
ATOM   1646 N N   . LEU B  2 34  ? 50.862  117.934 160.334 1.00 49.19  ? 359 LEU B N   1 
ATOM   1647 C CA  . LEU B  2 34  ? 50.102  116.700 160.248 1.00 35.22  ? 359 LEU B CA  1 
ATOM   1648 C C   . LEU B  2 34  ? 48.703  116.836 160.859 1.00 40.68  ? 359 LEU B C   1 
ATOM   1649 O O   . LEU B  2 34  ? 48.538  117.114 162.044 1.00 52.16  ? 359 LEU B O   1 
ATOM   1650 C CB  . LEU B  2 34  ? 50.884  115.602 160.956 1.00 35.26  ? 359 LEU B CB  1 
ATOM   1651 C CG  . LEU B  2 34  ? 50.116  114.353 161.371 1.00 28.72  ? 359 LEU B CG  1 
ATOM   1652 C CD1 . LEU B  2 34  ? 49.435  113.786 160.175 1.00 49.95  ? 359 LEU B CD1 1 
ATOM   1653 C CD2 . LEU B  2 34  ? 51.037  113.345 162.002 1.00 60.39  ? 359 LEU B CD2 1 
ATOM   1654 N N   . VAL B  2 35  ? 47.692  116.631 160.034 1.00 48.73  ? 360 VAL B N   1 
ATOM   1655 C CA  . VAL B  2 35  ? 46.316  116.727 160.476 1.00 42.61  ? 360 VAL B CA  1 
ATOM   1656 C C   . VAL B  2 35  ? 45.751  115.334 160.628 1.00 45.15  ? 360 VAL B C   1 
ATOM   1657 O O   . VAL B  2 35  ? 45.885  114.501 159.733 1.00 56.38  ? 360 VAL B O   1 
ATOM   1658 C CB  . VAL B  2 35  ? 45.467  117.468 159.452 1.00 44.38  ? 360 VAL B CB  1 
ATOM   1659 C CG1 . VAL B  2 35  ? 44.028  117.436 159.862 1.00 58.58  ? 360 VAL B CG1 1 
ATOM   1660 C CG2 . VAL B  2 35  ? 45.948  118.886 159.328 1.00 35.99  ? 360 VAL B CG2 1 
ATOM   1661 N N   . VAL B  2 36  ? 45.102  115.091 161.759 1.00 26.33  ? 361 VAL B N   1 
ATOM   1662 C CA  . VAL B  2 36  ? 44.520  113.790 162.040 1.00 39.44  ? 361 VAL B CA  1 
ATOM   1663 C C   . VAL B  2 36  ? 43.032  113.828 162.424 1.00 41.49  ? 361 VAL B C   1 
ATOM   1664 O O   . VAL B  2 36  ? 42.504  114.859 162.814 1.00 47.14  ? 361 VAL B O   1 
ATOM   1665 C CB  . VAL B  2 36  ? 45.305  113.117 163.163 1.00 10.53  ? 361 VAL B CB  1 
ATOM   1666 C CG1 . VAL B  2 36  ? 46.626  113.793 163.312 1.00 39.76  ? 361 VAL B CG1 1 
ATOM   1667 C CG2 . VAL B  2 36  ? 44.563  113.194 164.430 1.00 35.20  ? 361 VAL B CG2 1 
ATOM   1668 N N   . ASP B  2 37  ? 42.374  112.680 162.324 1.00 39.09  ? 362 ASP B N   1 
ATOM   1669 C CA  . ASP B  2 37  ? 40.963  112.540 162.657 1.00 35.20  ? 362 ASP B CA  1 
ATOM   1670 C C   . ASP B  2 37  ? 39.978  113.227 161.726 1.00 35.98  ? 362 ASP B C   1 
ATOM   1671 O O   . ASP B  2 37  ? 38.838  113.482 162.112 1.00 27.58  ? 362 ASP B O   1 
ATOM   1672 C CB  . ASP B  2 37  ? 40.697  112.967 164.092 1.00 39.02  ? 362 ASP B CB  1 
ATOM   1673 C CG  . ASP B  2 37  ? 41.283  111.999 165.107 1.00 72.32  ? 362 ASP B CG  1 
ATOM   1674 O OD1 . ASP B  2 37  ? 41.186  110.772 164.910 1.00 62.01  ? 362 ASP B OD1 1 
ATOM   1675 O OD2 . ASP B  2 37  ? 41.832  112.464 166.122 1.00 96.30  ? 362 ASP B OD2 1 
ATOM   1676 N N   . LEU B  2 38  ? 40.410  113.513 160.500 1.00 30.73  ? 363 LEU B N   1 
ATOM   1677 C CA  . LEU B  2 38  ? 39.536  114.118 159.506 1.00 28.69  ? 363 LEU B CA  1 
ATOM   1678 C C   . LEU B  2 38  ? 38.608  113.026 159.049 1.00 38.62  ? 363 LEU B C   1 
ATOM   1679 O O   . LEU B  2 38  ? 38.922  111.859 159.163 1.00 45.91  ? 363 LEU B O   1 
ATOM   1680 C CB  . LEU B  2 38  ? 40.328  114.589 158.298 1.00 33.26  ? 363 LEU B CB  1 
ATOM   1681 C CG  . LEU B  2 38  ? 41.130  115.877 158.418 1.00 50.74  ? 363 LEU B CG  1 
ATOM   1682 C CD1 . LEU B  2 38  ? 42.030  116.037 157.201 1.00 66.86  ? 363 LEU B CD1 1 
ATOM   1683 C CD2 . LEU B  2 38  ? 40.174  117.029 158.514 1.00 40.15  ? 363 LEU B CD2 1 
ATOM   1684 N N   . ALA B  2 39  ? 37.455  113.392 158.533 1.00 44.78  ? 364 ALA B N   1 
ATOM   1685 C CA  . ALA B  2 39  ? 36.541  112.383 158.045 1.00 41.90  ? 364 ALA B CA  1 
ATOM   1686 C C   . ALA B  2 39  ? 36.464  112.500 156.530 1.00 45.62  ? 364 ALA B C   1 
ATOM   1687 O O   . ALA B  2 39  ? 36.529  113.603 155.972 1.00 48.78  ? 364 ALA B O   1 
ATOM   1688 C CB  . ALA B  2 39  ? 35.186  112.587 158.647 1.00 65.83  ? 364 ALA B CB  1 
ATOM   1689 N N   . PRO B  2 40  ? 36.339  111.365 155.837 1.00 31.50  ? 365 PRO B N   1 
ATOM   1690 C CA  . PRO B  2 40  ? 36.255  111.404 154.379 1.00 52.28  ? 365 PRO B CA  1 
ATOM   1691 C C   . PRO B  2 40  ? 35.132  112.340 153.965 1.00 60.13  ? 365 PRO B C   1 
ATOM   1692 O O   . PRO B  2 40  ? 34.127  112.428 154.672 1.00 58.28  ? 365 PRO B O   1 
ATOM   1693 C CB  . PRO B  2 40  ? 35.930  109.963 154.027 1.00 70.35  ? 365 PRO B CB  1 
ATOM   1694 C CG  . PRO B  2 40  ? 35.117  109.531 155.214 1.00 47.47  ? 365 PRO B CG  1 
ATOM   1695 C CD  . PRO B  2 40  ? 35.980  110.033 156.333 1.00 38.12  ? 365 PRO B CD  1 
ATOM   1696 N N   . SER B  2 41  ? 35.303  113.028 152.833 1.00 58.73  ? 366 SER B N   1 
ATOM   1697 C CA  . SER B  2 41  ? 34.292  113.944 152.315 1.00 74.96  ? 366 SER B CA  1 
ATOM   1698 C C   . SER B  2 41  ? 34.515  114.210 150.839 1.00 76.90  ? 366 SER B C   1 
ATOM   1699 O O   . SER B  2 41  ? 35.556  113.866 150.290 1.00 93.77  ? 366 SER B O   1 
ATOM   1700 C CB  . SER B  2 41  ? 34.314  115.271 153.076 1.00 82.53  ? 366 SER B CB  1 
ATOM   1701 O OG  . SER B  2 41  ? 35.515  115.977 152.855 1.00 78.64  ? 366 SER B OG  1 
ATOM   1702 N N   . LYS B  2 42  ? 33.529  114.827 150.198 1.00 86.68  ? 367 LYS B N   1 
ATOM   1703 C CA  . LYS B  2 42  ? 33.600  115.155 148.779 1.00 90.17  ? 367 LYS B CA  1 
ATOM   1704 C C   . LYS B  2 42  ? 34.806  116.040 148.477 1.00 87.44  ? 367 LYS B C   1 
ATOM   1705 O O   . LYS B  2 42  ? 35.562  115.774 147.544 1.00 101.43 ? 367 LYS B O   1 
ATOM   1706 C CB  . LYS B  2 42  ? 32.319  115.878 148.331 1.00 109.71 ? 367 LYS B CB  1 
ATOM   1707 C CG  . LYS B  2 42  ? 31.050  115.020 148.296 1.00 135.34 ? 367 LYS B CG  1 
ATOM   1708 C CD  . LYS B  2 42  ? 29.862  115.815 147.732 1.00 145.45 ? 367 LYS B CD  1 
ATOM   1709 C CE  . LYS B  2 42  ? 28.612  114.952 147.548 1.00 145.07 ? 367 LYS B CE  1 
ATOM   1710 N NZ  . LYS B  2 42  ? 27.489  115.720 146.924 1.00 134.80 ? 367 LYS B NZ  1 
ATOM   1711 N N   . GLY B  2 43  ? 34.986  117.089 149.272 1.00 75.75  ? 368 GLY B N   1 
ATOM   1712 C CA  . GLY B  2 43  ? 36.093  117.999 149.043 1.00 79.36  ? 368 GLY B CA  1 
ATOM   1713 C C   . GLY B  2 43  ? 37.267  117.768 149.965 1.00 76.00  ? 368 GLY B C   1 
ATOM   1714 O O   . GLY B  2 43  ? 37.106  117.247 151.062 1.00 95.39  ? 368 GLY B O   1 
ATOM   1715 N N   . THR B  2 44  ? 38.455  118.154 149.516 1.00 67.80  ? 369 THR B N   1 
ATOM   1716 C CA  . THR B  2 44  ? 39.659  117.986 150.313 1.00 63.03  ? 369 THR B CA  1 
ATOM   1717 C C   . THR B  2 44  ? 39.802  119.215 151.181 1.00 46.98  ? 369 THR B C   1 
ATOM   1718 O O   . THR B  2 44  ? 39.091  120.193 150.985 1.00 60.51  ? 369 THR B O   1 
ATOM   1719 C CB  . THR B  2 44  ? 40.891  117.867 149.416 1.00 75.44  ? 369 THR B CB  1 
ATOM   1720 O OG1 . THR B  2 44  ? 41.072  119.088 148.693 1.00 84.59  ? 369 THR B OG1 1 
ATOM   1721 C CG2 . THR B  2 44  ? 40.710  116.731 148.420 1.00 94.45  ? 369 THR B CG2 1 
ATOM   1722 N N   . VAL B  2 45  ? 40.712  119.183 152.142 1.00 37.29  ? 370 VAL B N   1 
ATOM   1723 C CA  . VAL B  2 45  ? 40.888  120.349 152.999 1.00 39.30  ? 370 VAL B CA  1 
ATOM   1724 C C   . VAL B  2 45  ? 41.552  121.468 152.225 1.00 45.47  ? 370 VAL B C   1 
ATOM   1725 O O   . VAL B  2 45  ? 41.788  121.345 151.027 1.00 72.41  ? 370 VAL B O   1 
ATOM   1726 C CB  . VAL B  2 45  ? 41.744  120.043 154.219 1.00 37.91  ? 370 VAL B CB  1 
ATOM   1727 C CG1 . VAL B  2 45  ? 41.249  118.771 154.883 1.00 29.65  ? 370 VAL B CG1 1 
ATOM   1728 C CG2 . VAL B  2 45  ? 43.201  119.920 153.814 1.00 63.75  ? 370 VAL B CG2 1 
ATOM   1729 N N   . ASN B  2 46  ? 41.866  122.554 152.915 1.00 56.64  ? 371 ASN B N   1 
ATOM   1730 C CA  . ASN B  2 46  ? 42.477  123.715 152.290 1.00 69.69  ? 371 ASN B CA  1 
ATOM   1731 C C   . ASN B  2 46  ? 43.581  124.172 153.235 1.00 70.12  ? 371 ASN B C   1 
ATOM   1732 O O   . ASN B  2 46  ? 43.409  125.079 154.042 1.00 69.36  ? 371 ASN B O   1 
ATOM   1733 C CB  . ASN B  2 46  ? 41.401  124.794 152.091 1.00 85.43  ? 371 ASN B CB  1 
ATOM   1734 C CG  . ASN B  2 46  ? 41.906  126.001 151.353 1.00 117.44 ? 371 ASN B CG  1 
ATOM   1735 O OD1 . ASN B  2 46  ? 43.097  126.127 151.082 1.00 148.57 ? 371 ASN B OD1 1 
ATOM   1736 N ND2 . ASN B  2 46  ? 40.996  126.917 151.034 1.00 125.91 ? 371 ASN B ND2 1 
ATOM   1737 N N   . LEU B  2 47  ? 44.713  123.489 153.130 1.00 71.02  ? 372 LEU B N   1 
ATOM   1738 C CA  . LEU B  2 47  ? 45.903  123.722 153.936 1.00 55.05  ? 372 LEU B CA  1 
ATOM   1739 C C   . LEU B  2 47  ? 46.605  124.937 153.369 1.00 62.86  ? 372 LEU B C   1 
ATOM   1740 O O   . LEU B  2 47  ? 46.702  125.071 152.155 1.00 84.33  ? 372 LEU B O   1 
ATOM   1741 C CB  . LEU B  2 47  ? 46.816  122.511 153.816 1.00 39.41  ? 372 LEU B CB  1 
ATOM   1742 C CG  . LEU B  2 47  ? 47.914  122.228 154.841 1.00 35.09  ? 372 LEU B CG  1 
ATOM   1743 C CD1 . LEU B  2 47  ? 48.335  123.493 155.586 1.00 44.24  ? 372 LEU B CD1 1 
ATOM   1744 C CD2 . LEU B  2 47  ? 47.373  121.176 155.809 1.00 35.49  ? 372 LEU B CD2 1 
ATOM   1745 N N   . THR B  2 48  ? 47.102  125.818 154.228 1.00 52.58  ? 373 THR B N   1 
ATOM   1746 C CA  . THR B  2 48  ? 47.760  127.025 153.748 1.00 45.83  ? 373 THR B CA  1 
ATOM   1747 C C   . THR B  2 48  ? 48.927  127.440 154.633 1.00 65.50  ? 373 THR B C   1 
ATOM   1748 O O   . THR B  2 48  ? 48.768  127.635 155.846 1.00 54.88  ? 373 THR B O   1 
ATOM   1749 C CB  . THR B  2 48  ? 46.741  128.177 153.665 1.00 69.38  ? 373 THR B CB  1 
ATOM   1750 O OG1 . THR B  2 48  ? 45.708  127.832 152.735 1.00 72.74  ? 373 THR B OG1 1 
ATOM   1751 C CG2 . THR B  2 48  ? 47.397  129.452 153.211 1.00 84.72  ? 373 THR B CG2 1 
ATOM   1752 N N   . TRP B  2 49  ? 50.099  127.578 154.010 1.00 77.91  ? 374 TRP B N   1 
ATOM   1753 C CA  . TRP B  2 49  ? 51.325  127.962 154.715 1.00 74.61  ? 374 TRP B CA  1 
ATOM   1754 C C   . TRP B  2 49  ? 51.591  129.457 154.649 1.00 75.95  ? 374 TRP B C   1 
ATOM   1755 O O   . TRP B  2 49  ? 51.341  130.096 153.622 1.00 69.86  ? 374 TRP B O   1 
ATOM   1756 C CB  . TRP B  2 49  ? 52.533  127.246 154.128 1.00 60.92  ? 374 TRP B CB  1 
ATOM   1757 C CG  . TRP B  2 49  ? 52.577  125.801 154.393 1.00 46.19  ? 374 TRP B CG  1 
ATOM   1758 C CD1 . TRP B  2 49  ? 52.195  124.796 153.549 1.00 54.91  ? 374 TRP B CD1 1 
ATOM   1759 C CD2 . TRP B  2 49  ? 53.047  125.173 155.583 1.00 27.18  ? 374 TRP B CD2 1 
ATOM   1760 N NE1 . TRP B  2 49  ? 52.403  123.575 154.149 1.00 39.86  ? 374 TRP B NE1 1 
ATOM   1761 C CE2 . TRP B  2 49  ? 52.925  123.781 155.398 1.00 30.09  ? 374 TRP B CE2 1 
ATOM   1762 C CE3 . TRP B  2 49  ? 53.563  125.650 156.784 1.00 35.76  ? 374 TRP B CE3 1 
ATOM   1763 C CZ2 . TRP B  2 49  ? 53.300  122.866 156.373 1.00 31.42  ? 374 TRP B CZ2 1 
ATOM   1764 C CZ3 . TRP B  2 49  ? 53.940  124.734 157.759 1.00 36.03  ? 374 TRP B CZ3 1 
ATOM   1765 C CH2 . TRP B  2 49  ? 53.804  123.364 157.548 1.00 34.09  ? 374 TRP B CH2 1 
ATOM   1766 N N   . SER B  2 50  ? 52.133  130.003 155.735 1.00 77.01  ? 375 SER B N   1 
ATOM   1767 C CA  . SER B  2 50  ? 52.421  131.428 155.798 1.00 85.87  ? 375 SER B CA  1 
ATOM   1768 C C   . SER B  2 50  ? 53.500  131.793 156.818 1.00 88.89  ? 375 SER B C   1 
ATOM   1769 O O   . SER B  2 50  ? 53.681  131.114 157.844 1.00 61.77  ? 375 SER B O   1 
ATOM   1770 C CB  . SER B  2 50  ? 51.136  132.190 156.128 1.00 98.87  ? 375 SER B CB  1 
ATOM   1771 O OG  . SER B  2 50  ? 50.563  131.725 157.343 1.00 108.67 ? 375 SER B OG  1 
ATOM   1772 N N   . ARG B  2 51  ? 54.215  132.876 156.526 1.00 92.10  ? 376 ARG B N   1 
ATOM   1773 C CA  . ARG B  2 51  ? 55.263  133.366 157.418 1.00 101.32 ? 376 ARG B CA  1 
ATOM   1774 C C   . ARG B  2 51  ? 54.795  134.607 158.167 1.00 113.17 ? 376 ARG B C   1 
ATOM   1775 O O   . ARG B  2 51  ? 53.953  135.367 157.674 1.00 115.63 ? 376 ARG B O   1 
ATOM   1776 C CB  . ARG B  2 51  ? 56.525  133.715 156.631 1.00 111.85 ? 376 ARG B CB  1 
ATOM   1777 C CG  . ARG B  2 51  ? 57.394  132.526 156.294 1.00 125.33 ? 376 ARG B CG  1 
ATOM   1778 C CD  . ARG B  2 51  ? 58.852  132.940 156.133 1.00 126.78 ? 376 ARG B CD  1 
ATOM   1779 N NE  . ARG B  2 51  ? 59.165  133.476 154.812 1.00 116.44 ? 376 ARG B NE  1 
ATOM   1780 C CZ  . ARG B  2 51  ? 60.372  133.898 154.461 1.00 127.35 ? 376 ARG B CZ  1 
ATOM   1781 N NH1 . ARG B  2 51  ? 61.368  133.849 155.337 1.00 121.44 ? 376 ARG B NH1 1 
ATOM   1782 N NH2 . ARG B  2 51  ? 60.588  134.349 153.234 1.00 144.12 ? 376 ARG B NH2 1 
ATOM   1783 N N   . ALA B  2 52  ? 55.344  134.817 159.357 1.00 110.42 ? 377 ALA B N   1 
ATOM   1784 C CA  . ALA B  2 52  ? 54.973  135.981 160.151 1.00 112.52 ? 377 ALA B CA  1 
ATOM   1785 C C   . ALA B  2 52  ? 55.607  137.252 159.593 1.00 111.79 ? 377 ALA B C   1 
ATOM   1786 O O   . ALA B  2 52  ? 55.071  138.345 159.751 1.00 112.65 ? 377 ALA B O   1 
ATOM   1787 C CB  . ALA B  2 52  ? 55.394  135.784 161.583 1.00 99.55  ? 377 ALA B CB  1 
ATOM   1788 N N   . SER B  2 53  ? 56.753  137.105 158.943 1.00 104.08 ? 378 SER B N   1 
ATOM   1789 C CA  . SER B  2 53  ? 57.445  138.242 158.362 1.00 97.68  ? 378 SER B CA  1 
ATOM   1790 C C   . SER B  2 53  ? 56.665  138.786 157.166 1.00 99.90  ? 378 SER B C   1 
ATOM   1791 O O   . SER B  2 53  ? 56.842  139.936 156.769 1.00 117.31 ? 378 SER B O   1 
ATOM   1792 C CB  . SER B  2 53  ? 58.845  137.831 157.902 1.00 103.46 ? 378 SER B CB  1 
ATOM   1793 O OG  . SER B  2 53  ? 58.778  137.003 156.747 1.00 95.90  ? 378 SER B OG  1 
ATOM   1794 N N   . GLY B  2 54  ? 55.807  137.957 156.588 1.00 93.03  ? 379 GLY B N   1 
ATOM   1795 C CA  . GLY B  2 54  ? 55.031  138.392 155.441 1.00 107.28 ? 379 GLY B CA  1 
ATOM   1796 C C   . GLY B  2 54  ? 55.679  137.954 154.143 1.00 120.44 ? 379 GLY B C   1 
ATOM   1797 O O   . GLY B  2 54  ? 55.045  137.946 153.084 1.00 117.20 ? 379 GLY B O   1 
ATOM   1798 N N   . LYS B  2 55  ? 56.950  137.579 154.229 1.00 127.63 ? 380 LYS B N   1 
ATOM   1799 C CA  . LYS B  2 55  ? 57.699  137.136 153.061 1.00 139.92 ? 380 LYS B CA  1 
ATOM   1800 C C   . LYS B  2 55  ? 57.145  135.820 152.513 1.00 140.10 ? 380 LYS B C   1 
ATOM   1801 O O   . LYS B  2 55  ? 56.856  134.897 153.270 1.00 146.73 ? 380 LYS B O   1 
ATOM   1802 C CB  . LYS B  2 55  ? 59.174  136.966 153.428 1.00 149.75 ? 380 LYS B CB  1 
ATOM   1803 C CG  . LYS B  2 55  ? 59.830  138.223 153.989 1.00 157.34 ? 380 LYS B CG  1 
ATOM   1804 C CD  . LYS B  2 55  ? 61.286  137.969 154.360 1.00 162.90 ? 380 LYS B CD  1 
ATOM   1805 C CE  . LYS B  2 55  ? 61.949  139.218 154.922 1.00 162.27 ? 380 LYS B CE  1 
ATOM   1806 N NZ  . LYS B  2 55  ? 63.378  138.976 155.269 1.00 153.65 ? 380 LYS B NZ  1 
ATOM   1807 N N   . PRO B  2 56  ? 56.992  135.724 151.182 1.00 135.54 ? 381 PRO B N   1 
ATOM   1808 C CA  . PRO B  2 56  ? 56.475  134.537 150.493 1.00 129.77 ? 381 PRO B CA  1 
ATOM   1809 C C   . PRO B  2 56  ? 57.085  133.216 150.966 1.00 122.48 ? 381 PRO B C   1 
ATOM   1810 O O   . PRO B  2 56  ? 58.115  133.207 151.647 1.00 106.47 ? 381 PRO B O   1 
ATOM   1811 C CB  . PRO B  2 56  ? 56.787  134.838 149.034 1.00 135.00 ? 381 PRO B CB  1 
ATOM   1812 C CG  . PRO B  2 56  ? 56.572  136.313 148.971 1.00 135.02 ? 381 PRO B CG  1 
ATOM   1813 C CD  . PRO B  2 56  ? 57.285  136.796 150.216 1.00 136.35 ? 381 PRO B CD  1 
ATOM   1814 N N   . VAL B  2 57  ? 56.443  132.109 150.589 1.00 113.57 ? 382 VAL B N   1 
ATOM   1815 C CA  . VAL B  2 57  ? 56.885  130.765 150.975 1.00 109.30 ? 382 VAL B CA  1 
ATOM   1816 C C   . VAL B  2 57  ? 57.020  129.784 149.808 1.00 120.60 ? 382 VAL B C   1 
ATOM   1817 O O   . VAL B  2 57  ? 56.279  129.858 148.817 1.00 121.92 ? 382 VAL B O   1 
ATOM   1818 C CB  . VAL B  2 57  ? 55.908  130.140 151.964 1.00 91.34  ? 382 VAL B CB  1 
ATOM   1819 C CG1 . VAL B  2 57  ? 55.938  130.895 153.273 1.00 109.44 ? 382 VAL B CG1 1 
ATOM   1820 C CG2 . VAL B  2 57  ? 54.511  130.160 151.360 1.00 89.62  ? 382 VAL B CG2 1 
ATOM   1821 N N   . ASN B  2 58  ? 57.958  128.849 149.947 1.00 122.73 ? 383 ASN B N   1 
ATOM   1822 C CA  . ASN B  2 58  ? 58.197  127.845 148.918 1.00 120.63 ? 383 ASN B CA  1 
ATOM   1823 C C   . ASN B  2 58  ? 56.955  126.981 148.730 1.00 105.18 ? 383 ASN B C   1 
ATOM   1824 O O   . ASN B  2 58  ? 56.024  127.038 149.524 1.00 110.21 ? 383 ASN B O   1 
ATOM   1825 C CB  . ASN B  2 58  ? 59.393  126.966 149.309 1.00 127.69 ? 383 ASN B CB  1 
ATOM   1826 C CG  . ASN B  2 58  ? 60.723  127.696 149.189 1.00 134.02 ? 383 ASN B CG  1 
ATOM   1827 O OD1 . ASN B  2 58  ? 61.759  127.196 149.629 1.00 138.79 ? 383 ASN B OD1 1 
ATOM   1828 N ND2 . ASN B  2 58  ? 60.702  128.877 148.582 1.00 134.65 ? 383 ASN B ND2 1 
ATOM   1829 N N   . HIS B  2 59  ? 56.937  126.189 147.668 1.00 96.06  ? 384 HIS B N   1 
ATOM   1830 C CA  . HIS B  2 59  ? 55.806  125.312 147.411 1.00 88.12  ? 384 HIS B CA  1 
ATOM   1831 C C   . HIS B  2 59  ? 55.859  124.145 148.392 1.00 85.29  ? 384 HIS B C   1 
ATOM   1832 O O   . HIS B  2 59  ? 56.936  123.688 148.786 1.00 79.53  ? 384 HIS B O   1 
ATOM   1833 C CB  . HIS B  2 59  ? 55.861  124.821 145.971 1.00 94.75  ? 384 HIS B CB  1 
ATOM   1834 C CG  . HIS B  2 59  ? 55.759  125.923 144.968 1.00 99.85  ? 384 HIS B CG  1 
ATOM   1835 N ND1 . HIS B  2 59  ? 54.551  126.390 144.500 1.00 86.77  ? 384 HIS B ND1 1 
ATOM   1836 C CD2 . HIS B  2 59  ? 56.710  126.691 144.388 1.00 111.87 ? 384 HIS B CD2 1 
ATOM   1837 C CE1 . HIS B  2 59  ? 54.760  127.398 143.676 1.00 106.70 ? 384 HIS B CE1 1 
ATOM   1838 N NE2 . HIS B  2 59  ? 56.063  127.602 143.590 1.00 122.25 ? 384 HIS B NE2 1 
ATOM   1839 N N   . SER B  2 60  ? 54.694  123.665 148.801 1.00 85.65  ? 385 SER B N   1 
ATOM   1840 C CA  . SER B  2 60  ? 54.650  122.571 149.760 1.00 75.02  ? 385 SER B CA  1 
ATOM   1841 C C   . SER B  2 60  ? 54.271  121.242 149.136 1.00 68.83  ? 385 SER B C   1 
ATOM   1842 O O   . SER B  2 60  ? 53.913  121.162 147.955 1.00 67.16  ? 385 SER B O   1 
ATOM   1843 C CB  . SER B  2 60  ? 53.664  122.908 150.880 1.00 80.67  ? 385 SER B CB  1 
ATOM   1844 O OG  . SER B  2 60  ? 52.375  123.192 150.354 1.00 89.83  ? 385 SER B OG  1 
ATOM   1845 N N   . THR B  2 61  ? 54.359  120.210 149.970 1.00 71.09  ? 386 THR B N   1 
ATOM   1846 C CA  . THR B  2 61  ? 54.036  118.826 149.632 1.00 71.49  ? 386 THR B CA  1 
ATOM   1847 C C   . THR B  2 61  ? 52.684  118.468 150.266 1.00 78.00  ? 386 THR B C   1 
ATOM   1848 O O   . THR B  2 61  ? 52.200  119.188 151.139 1.00 99.24  ? 386 THR B O   1 
ATOM   1849 C CB  . THR B  2 61  ? 55.117  117.911 150.210 1.00 86.99  ? 386 THR B CB  1 
ATOM   1850 O OG1 . THR B  2 61  ? 56.193  117.804 149.269 1.00 89.67  ? 386 THR B OG1 1 
ATOM   1851 C CG2 . THR B  2 61  ? 54.552  116.533 150.571 1.00 100.53 ? 386 THR B CG2 1 
ATOM   1852 N N   . ARG B  2 62  ? 52.063  117.377 149.837 1.00 64.39  ? 387 ARG B N   1 
ATOM   1853 C CA  . ARG B  2 62  ? 50.795  117.008 150.437 1.00 58.52  ? 387 ARG B CA  1 
ATOM   1854 C C   . ARG B  2 62  ? 50.347  115.582 150.128 1.00 58.73  ? 387 ARG B C   1 
ATOM   1855 O O   . ARG B  2 62  ? 50.294  115.184 148.963 1.00 68.95  ? 387 ARG B O   1 
ATOM   1856 C CB  . ARG B  2 62  ? 49.720  118.013 150.006 1.00 57.05  ? 387 ARG B CB  1 
ATOM   1857 C CG  . ARG B  2 62  ? 48.321  117.671 150.466 1.00 72.12  ? 387 ARG B CG  1 
ATOM   1858 C CD  . ARG B  2 62  ? 47.403  118.853 150.339 1.00 72.88  ? 387 ARG B CD  1 
ATOM   1859 N NE  . ARG B  2 62  ? 46.030  118.490 150.645 1.00 89.38  ? 387 ARG B NE  1 
ATOM   1860 C CZ  . ARG B  2 62  ? 45.055  119.376 150.780 1.00 103.10 ? 387 ARG B CZ  1 
ATOM   1861 N NH1 . ARG B  2 62  ? 45.318  120.669 150.633 1.00 108.95 ? 387 ARG B NH1 1 
ATOM   1862 N NH2 . ARG B  2 62  ? 43.825  118.971 151.064 1.00 110.91 ? 387 ARG B NH2 1 
ATOM   1863 N N   . LYS B  2 63  ? 50.035  114.816 151.177 1.00 39.95  ? 388 LYS B N   1 
ATOM   1864 C CA  . LYS B  2 63  ? 49.555  113.441 151.016 1.00 48.12  ? 388 LYS B CA  1 
ATOM   1865 C C   . LYS B  2 63  ? 48.290  113.253 151.835 1.00 61.43  ? 388 LYS B C   1 
ATOM   1866 O O   . LYS B  2 63  ? 48.189  113.793 152.938 1.00 73.51  ? 388 LYS B O   1 
ATOM   1867 C CB  . LYS B  2 63  ? 50.560  112.426 151.556 1.00 54.12  ? 388 LYS B CB  1 
ATOM   1868 C CG  . LYS B  2 63  ? 52.019  112.796 151.452 1.00 107.87 ? 388 LYS B CG  1 
ATOM   1869 C CD  . LYS B  2 63  ? 52.864  111.704 152.106 1.00 125.48 ? 388 LYS B CD  1 
ATOM   1870 C CE  . LYS B  2 63  ? 54.353  112.005 152.019 1.00 151.24 ? 388 LYS B CE  1 
ATOM   1871 N NZ  . LYS B  2 63  ? 55.174  110.852 152.491 1.00 158.79 ? 388 LYS B NZ  1 
ATOM   1872 N N   . GLU B  2 64  ? 47.339  112.480 151.324 1.00 49.34  ? 389 GLU B N   1 
ATOM   1873 C CA  . GLU B  2 64  ? 46.120  112.216 152.086 1.00 61.48  ? 389 GLU B CA  1 
ATOM   1874 C C   . GLU B  2 64  ? 45.927  110.715 152.197 1.00 57.35  ? 389 GLU B C   1 
ATOM   1875 O O   . GLU B  2 64  ? 45.401  110.088 151.280 1.00 82.48  ? 389 GLU B O   1 
ATOM   1876 C CB  . GLU B  2 64  ? 44.889  112.865 151.423 1.00 72.80  ? 389 GLU B CB  1 
ATOM   1877 C CG  . GLU B  2 64  ? 44.856  114.388 151.542 1.00 119.65 ? 389 GLU B CG  1 
ATOM   1878 C CD  . GLU B  2 64  ? 43.709  115.017 150.776 1.00 142.36 ? 389 GLU B CD  1 
ATOM   1879 O OE1 . GLU B  2 64  ? 42.548  114.596 150.983 1.00 144.38 ? 389 GLU B OE1 1 
ATOM   1880 O OE2 . GLU B  2 64  ? 43.977  115.938 149.971 1.00 159.95 ? 389 GLU B OE2 1 
ATOM   1881 N N   . GLU B  2 65  ? 46.345  110.143 153.321 1.00 43.32  ? 390 GLU B N   1 
ATOM   1882 C CA  . GLU B  2 65  ? 46.227  108.705 153.522 1.00 64.21  ? 390 GLU B CA  1 
ATOM   1883 C C   . GLU B  2 65  ? 45.000  108.231 154.301 1.00 46.18  ? 390 GLU B C   1 
ATOM   1884 O O   . GLU B  2 65  ? 44.928  108.435 155.504 1.00 51.75  ? 390 GLU B O   1 
ATOM   1885 C CB  . GLU B  2 65  ? 47.466  108.168 154.252 1.00 92.60  ? 390 GLU B CB  1 
ATOM   1886 C CG  . GLU B  2 65  ? 48.812  108.585 153.679 1.00 134.03 ? 390 GLU B CG  1 
ATOM   1887 C CD  . GLU B  2 65  ? 49.982  107.940 154.417 1.00 155.02 ? 390 GLU B CD  1 
ATOM   1888 O OE1 . GLU B  2 65  ? 50.020  108.020 155.666 1.00 162.22 ? 390 GLU B OE1 1 
ATOM   1889 O OE2 . GLU B  2 65  ? 50.866  107.358 153.747 1.00 172.83 ? 390 GLU B OE2 1 
ATOM   1890 N N   . LYS B  2 66  ? 44.046  107.581 153.638 1.00 46.03  ? 391 LYS B N   1 
ATOM   1891 C CA  . LYS B  2 66  ? 42.892  107.033 154.357 1.00 52.96  ? 391 LYS B CA  1 
ATOM   1892 C C   . LYS B  2 66  ? 43.471  106.004 155.342 1.00 52.99  ? 391 LYS B C   1 
ATOM   1893 O O   . LYS B  2 66  ? 44.138  105.064 154.925 1.00 61.20  ? 391 LYS B O   1 
ATOM   1894 C CB  . LYS B  2 66  ? 41.939  106.319 153.392 1.00 71.84  ? 391 LYS B CB  1 
ATOM   1895 C CG  . LYS B  2 66  ? 40.901  105.431 154.103 1.00 94.87  ? 391 LYS B CG  1 
ATOM   1896 C CD  . LYS B  2 66  ? 40.563  104.141 153.322 1.00 124.55 ? 391 LYS B CD  1 
ATOM   1897 C CE  . LYS B  2 66  ? 39.785  104.403 152.029 1.00 135.52 ? 391 LYS B CE  1 
ATOM   1898 N NZ  . LYS B  2 66  ? 39.360  103.133 151.353 1.00 124.19 ? 391 LYS B NZ  1 
ATOM   1899 N N   . GLN B  2 67  ? 43.232  106.173 156.636 1.00 40.75  ? 392 GLN B N   1 
ATOM   1900 C CA  . GLN B  2 67  ? 43.778  105.248 157.617 1.00 57.28  ? 392 GLN B CA  1 
ATOM   1901 C C   . GLN B  2 67  ? 42.876  104.062 157.857 1.00 71.71  ? 392 GLN B C   1 
ATOM   1902 O O   . GLN B  2 67  ? 41.730  104.057 157.421 1.00 54.14  ? 392 GLN B O   1 
ATOM   1903 C CB  . GLN B  2 67  ? 44.026  105.955 158.932 1.00 45.32  ? 392 GLN B CB  1 
ATOM   1904 C CG  . GLN B  2 67  ? 44.910  107.158 158.819 1.00 44.55  ? 392 GLN B CG  1 
ATOM   1905 C CD  . GLN B  2 67  ? 46.307  106.799 158.433 1.00 77.21  ? 392 GLN B CD  1 
ATOM   1906 O OE1 . GLN B  2 67  ? 46.549  106.342 157.315 1.00 114.71 ? 392 GLN B OE1 1 
ATOM   1907 N NE2 . GLN B  2 67  ? 47.251  106.987 159.354 1.00 93.98  ? 392 GLN B NE2 1 
ATOM   1908 N N   . ARG B  2 68  ? 43.396  103.069 158.573 1.00 85.70  ? 393 ARG B N   1 
ATOM   1909 C CA  . ARG B  2 68  ? 42.646  101.853 158.851 1.00 90.41  ? 393 ARG B CA  1 
ATOM   1910 C C   . ARG B  2 68  ? 41.421  102.083 159.704 1.00 81.33  ? 393 ARG B C   1 
ATOM   1911 O O   . ARG B  2 68  ? 40.379  101.483 159.461 1.00 84.70  ? 393 ARG B O   1 
ATOM   1912 C CB  . ARG B  2 68  ? 43.537  100.804 159.528 1.00 111.62 ? 393 ARG B CB  1 
ATOM   1913 C CG  . ARG B  2 68  ? 42.798  99.515  159.903 1.00 132.27 ? 393 ARG B CG  1 
ATOM   1914 C CD  . ARG B  2 68  ? 43.235  98.309  159.074 1.00 148.99 ? 393 ARG B CD  1 
ATOM   1915 N NE  . ARG B  2 68  ? 44.594  97.884  159.395 1.00 159.70 ? 393 ARG B NE  1 
ATOM   1916 C CZ  . ARG B  2 68  ? 45.164  96.782  158.918 1.00 166.33 ? 393 ARG B CZ  1 
ATOM   1917 N NH1 . ARG B  2 68  ? 44.492  95.988  158.094 1.00 166.20 ? 393 ARG B NH1 1 
ATOM   1918 N NH2 . ARG B  2 68  ? 46.408  96.474  159.267 1.00 170.33 ? 393 ARG B NH2 1 
ATOM   1919 N N   . ASN B  2 69  ? 41.532  102.952 160.702 1.00 83.99  ? 394 ASN B N   1 
ATOM   1920 C CA  . ASN B  2 69  ? 40.400  103.198 161.591 1.00 75.67  ? 394 ASN B CA  1 
ATOM   1921 C C   . ASN B  2 69  ? 39.286  104.073 161.044 1.00 59.24  ? 394 ASN B C   1 
ATOM   1922 O O   . ASN B  2 69  ? 38.610  104.750 161.788 1.00 43.20  ? 394 ASN B O   1 
ATOM   1923 C CB  . ASN B  2 69  ? 40.867  103.749 162.953 1.00 70.96  ? 394 ASN B CB  1 
ATOM   1924 C CG  . ASN B  2 69  ? 41.534  105.117 162.866 1.00 50.74  ? 394 ASN B CG  1 
ATOM   1925 O OD1 . ASN B  2 69  ? 41.174  105.955 162.053 1.00 57.06  ? 394 ASN B OD1 1 
ATOM   1926 N ND2 . ASN B  2 69  ? 42.490  105.336 163.761 1.00 52.26  ? 394 ASN B ND2 1 
ATOM   1927 N N   . GLY B  2 70  ? 39.075  104.048 159.740 1.00 66.97  ? 395 GLY B N   1 
ATOM   1928 C CA  . GLY B  2 70  ? 38.004  104.853 159.177 1.00 72.09  ? 395 GLY B CA  1 
ATOM   1929 C C   . GLY B  2 70  ? 38.289  106.338 159.044 1.00 56.91  ? 395 GLY B C   1 
ATOM   1930 O O   . GLY B  2 70  ? 37.619  107.040 158.285 1.00 51.17  ? 395 GLY B O   1 
ATOM   1931 N N   . THR B  2 71  ? 39.286  106.822 159.774 1.00 45.23  ? 396 THR B N   1 
ATOM   1932 C CA  . THR B  2 71  ? 39.642  108.226 159.712 1.00 38.68  ? 396 THR B CA  1 
ATOM   1933 C C   . THR B  2 71  ? 40.296  108.573 158.383 1.00 40.52  ? 396 THR B C   1 
ATOM   1934 O O   . THR B  2 71  ? 40.205  107.818 157.422 1.00 68.63  ? 396 THR B O   1 
ATOM   1935 C CB  . THR B  2 71  ? 40.600  108.599 160.829 1.00 45.29  ? 396 THR B CB  1 
ATOM   1936 O OG1 . THR B  2 71  ? 40.696  110.023 160.904 1.00 105.52 ? 396 THR B OG1 1 
ATOM   1937 C CG2 . THR B  2 71  ? 41.976  108.064 160.557 1.00 79.15  ? 396 THR B CG2 1 
ATOM   1938 N N   . LEU B  2 72  ? 40.965  109.719 158.342 1.00 36.71  ? 397 LEU B N   1 
ATOM   1939 C CA  . LEU B  2 72  ? 41.643  110.210 157.146 1.00 38.65  ? 397 LEU B CA  1 
ATOM   1940 C C   . LEU B  2 72  ? 42.678  111.231 157.579 1.00 47.99  ? 397 LEU B C   1 
ATOM   1941 O O   . LEU B  2 72  ? 42.351  112.181 158.271 1.00 61.51  ? 397 LEU B O   1 
ATOM   1942 C CB  . LEU B  2 72  ? 40.643  110.871 156.211 1.00 42.83  ? 397 LEU B CB  1 
ATOM   1943 C CG  . LEU B  2 72  ? 41.194  111.797 155.133 1.00 55.43  ? 397 LEU B CG  1 
ATOM   1944 C CD1 . LEU B  2 72  ? 42.136  111.032 154.228 1.00 92.34  ? 397 LEU B CD1 1 
ATOM   1945 C CD2 . LEU B  2 72  ? 40.032  112.353 154.322 1.00 94.66  ? 397 LEU B CD2 1 
ATOM   1946 N N   . THR B  2 73  ? 43.925  111.027 157.166 1.00 54.97  ? 398 THR B N   1 
ATOM   1947 C CA  . THR B  2 73  ? 45.033  111.910 157.522 1.00 38.71  ? 398 THR B CA  1 
ATOM   1948 C C   . THR B  2 73  ? 45.524  112.775 156.373 1.00 35.32  ? 398 THR B C   1 
ATOM   1949 O O   . THR B  2 73  ? 45.349  112.449 155.208 1.00 59.51  ? 398 THR B O   1 
ATOM   1950 C CB  . THR B  2 73  ? 46.226  111.106 158.025 1.00 32.89  ? 398 THR B CB  1 
ATOM   1951 O OG1 . THR B  2 73  ? 45.893  110.477 159.258 1.00 48.06  ? 398 THR B OG1 1 
ATOM   1952 C CG2 . THR B  2 73  ? 47.409  111.998 158.248 1.00 59.21  ? 398 THR B CG2 1 
ATOM   1953 N N   . VAL B  2 74  ? 46.156  113.882 156.725 1.00 25.92  ? 399 VAL B N   1 
ATOM   1954 C CA  . VAL B  2 74  ? 46.695  114.800 155.749 1.00 32.22  ? 399 VAL B CA  1 
ATOM   1955 C C   . VAL B  2 74  ? 48.011  115.300 156.268 1.00 44.89  ? 399 VAL B C   1 
ATOM   1956 O O   . VAL B  2 74  ? 48.063  115.809 157.380 1.00 54.73  ? 399 VAL B O   1 
ATOM   1957 C CB  . VAL B  2 74  ? 45.788  116.004 155.569 1.00 23.44  ? 399 VAL B CB  1 
ATOM   1958 C CG1 . VAL B  2 74  ? 46.501  117.089 154.798 1.00 17.94  ? 399 VAL B CG1 1 
ATOM   1959 C CG2 . VAL B  2 74  ? 44.534  115.572 154.853 1.00 26.66  ? 399 VAL B CG2 1 
ATOM   1960 N N   . THR B  2 75  ? 49.082  115.139 155.495 1.00 45.98  ? 400 THR B N   1 
ATOM   1961 C CA  . THR B  2 75  ? 50.377  115.663 155.927 1.00 51.49  ? 400 THR B CA  1 
ATOM   1962 C C   . THR B  2 75  ? 50.862  116.598 154.844 1.00 54.67  ? 400 THR B C   1 
ATOM   1963 O O   . THR B  2 75  ? 50.595  116.382 153.656 1.00 57.21  ? 400 THR B O   1 
ATOM   1964 C CB  . THR B  2 75  ? 51.450  114.598 156.085 1.00 41.25  ? 400 THR B CB  1 
ATOM   1965 O OG1 . THR B  2 75  ? 51.697  114.011 154.813 1.00 90.13  ? 400 THR B OG1 1 
ATOM   1966 C CG2 . THR B  2 75  ? 51.014  113.532 157.036 1.00 47.67  ? 400 THR B CG2 1 
ATOM   1967 N N   . SER B  2 76  ? 51.573  117.637 155.261 1.00 48.80  ? 401 SER B N   1 
ATOM   1968 C CA  . SER B  2 76  ? 52.117  118.610 154.333 1.00 51.08  ? 401 SER B CA  1 
ATOM   1969 C C   . SER B  2 76  ? 53.457  119.052 154.862 1.00 61.00  ? 401 SER B C   1 
ATOM   1970 O O   . SER B  2 76  ? 53.551  119.546 155.993 1.00 44.23  ? 401 SER B O   1 
ATOM   1971 C CB  . SER B  2 76  ? 51.199  119.817 154.209 1.00 42.98  ? 401 SER B CB  1 
ATOM   1972 O OG  . SER B  2 76  ? 51.810  120.856 153.475 1.00 37.42  ? 401 SER B OG  1 
ATOM   1973 N N   . THR B  2 77  ? 54.495  118.859 154.048 1.00 65.98  ? 402 THR B N   1 
ATOM   1974 C CA  . THR B  2 77  ? 55.840  119.241 154.442 1.00 61.59  ? 402 THR B CA  1 
ATOM   1975 C C   . THR B  2 77  ? 56.242  120.481 153.672 1.00 61.70  ? 402 THR B C   1 
ATOM   1976 O O   . THR B  2 77  ? 55.879  120.648 152.496 1.00 52.78  ? 402 THR B O   1 
ATOM   1977 C CB  . THR B  2 77  ? 56.821  118.125 154.152 1.00 63.94  ? 402 THR B CB  1 
ATOM   1978 O OG1 . THR B  2 77  ? 56.295  116.895 154.661 1.00 89.05  ? 402 THR B OG1 1 
ATOM   1979 C CG2 . THR B  2 77  ? 58.157  118.409 154.814 1.00 87.14  ? 402 THR B CG2 1 
ATOM   1980 N N   . LEU B  2 78  ? 56.991  121.354 154.339 1.00 62.53  ? 403 LEU B N   1 
ATOM   1981 C CA  . LEU B  2 78  ? 57.413  122.599 153.719 1.00 69.91  ? 403 LEU B CA  1 
ATOM   1982 C C   . LEU B  2 78  ? 58.912  122.897 153.838 1.00 70.24  ? 403 LEU B C   1 
ATOM   1983 O O   . LEU B  2 78  ? 59.488  122.821 154.932 1.00 50.23  ? 403 LEU B O   1 
ATOM   1984 C CB  . LEU B  2 78  ? 56.613  123.752 154.320 1.00 67.10  ? 403 LEU B CB  1 
ATOM   1985 C CG  . LEU B  2 78  ? 56.909  125.152 153.790 1.00 82.22  ? 403 LEU B CG  1 
ATOM   1986 C CD1 . LEU B  2 78  ? 56.506  125.263 152.324 1.00 91.19  ? 403 LEU B CD1 1 
ATOM   1987 C CD2 . LEU B  2 78  ? 56.167  126.156 154.629 1.00 69.12  ? 403 LEU B CD2 1 
ATOM   1988 N N   . PRO B  2 79  ? 59.556  123.238 152.702 1.00 59.20  ? 404 PRO B N   1 
ATOM   1989 C CA  . PRO B  2 79  ? 60.976  123.560 152.621 1.00 59.84  ? 404 PRO B CA  1 
ATOM   1990 C C   . PRO B  2 79  ? 61.217  124.891 153.310 1.00 74.26  ? 404 PRO B C   1 
ATOM   1991 O O   . PRO B  2 79  ? 60.473  125.843 153.112 1.00 64.34  ? 404 PRO B O   1 
ATOM   1992 C CB  . PRO B  2 79  ? 61.220  123.656 151.121 1.00 84.64  ? 404 PRO B CB  1 
ATOM   1993 C CG  . PRO B  2 79  ? 60.157  122.787 150.539 1.00 81.03  ? 404 PRO B CG  1 
ATOM   1994 C CD  . PRO B  2 79  ? 58.975  123.180 151.351 1.00 57.63  ? 404 PRO B CD  1 
ATOM   1995 N N   . VAL B  2 80  ? 62.282  124.975 154.087 1.00 85.36  ? 405 VAL B N   1 
ATOM   1996 C CA  . VAL B  2 80  ? 62.543  126.198 154.812 1.00 89.68  ? 405 VAL B CA  1 
ATOM   1997 C C   . VAL B  2 80  ? 63.982  126.712 154.754 1.00 104.14 ? 405 VAL B C   1 
ATOM   1998 O O   . VAL B  2 80  ? 64.940  125.951 154.939 1.00 106.67 ? 405 VAL B O   1 
ATOM   1999 C CB  . VAL B  2 80  ? 62.100  126.000 156.269 1.00 69.90  ? 405 VAL B CB  1 
ATOM   2000 C CG1 . VAL B  2 80  ? 63.203  126.416 157.230 1.00 110.66 ? 405 VAL B CG1 1 
ATOM   2001 C CG2 . VAL B  2 80  ? 60.845  126.775 156.513 1.00 87.30  ? 405 VAL B CG2 1 
ATOM   2002 N N   . GLY B  2 81  ? 64.113  128.017 154.509 1.00 104.35 ? 406 GLY B N   1 
ATOM   2003 C CA  . GLY B  2 81  ? 65.427  128.645 154.435 1.00 116.64 ? 406 GLY B CA  1 
ATOM   2004 C C   . GLY B  2 81  ? 66.225  128.509 155.736 1.00 116.11 ? 406 GLY B C   1 
ATOM   2005 O O   . GLY B  2 81  ? 65.896  129.124 156.744 1.00 113.71 ? 406 GLY B O   1 
ATOM   2006 N N   . THR B  2 82  ? 67.292  127.716 155.688 1.00 118.78 ? 407 THR B N   1 
ATOM   2007 C CA  . THR B  2 82  ? 68.143  127.461 156.830 1.00 112.37 ? 407 THR B CA  1 
ATOM   2008 C C   . THR B  2 82  ? 68.488  128.714 157.631 1.00 113.39 ? 407 THR B C   1 
ATOM   2009 O O   . THR B  2 82  ? 68.563  128.679 158.858 1.00 101.64 ? 407 THR B O   1 
ATOM   2010 C CB  . THR B  2 82  ? 69.482  126.859 156.428 1.00 121.02 ? 407 THR B CB  1 
ATOM   2011 O OG1 . THR B  2 82  ? 69.350  126.170 155.184 1.00 136.75 ? 407 THR B OG1 1 
ATOM   2012 C CG2 . THR B  2 82  ? 69.964  125.900 157.521 1.00 95.72  ? 407 THR B CG2 1 
ATOM   2013 N N   . ARG B  2 83  ? 68.734  129.816 156.934 1.00 124.20 ? 408 ARG B N   1 
ATOM   2014 C CA  . ARG B  2 83  ? 69.098  131.063 157.590 1.00 126.21 ? 408 ARG B CA  1 
ATOM   2015 C C   . ARG B  2 83  ? 67.905  131.589 158.374 1.00 116.64 ? 408 ARG B C   1 
ATOM   2016 O O   . ARG B  2 83  ? 67.885  131.590 159.622 1.00 101.11 ? 408 ARG B O   1 
ATOM   2017 C CB  . ARG B  2 83  ? 69.517  132.097 156.546 1.00 137.74 ? 408 ARG B CB  1 
ATOM   2018 C CG  . ARG B  2 83  ? 70.749  131.688 155.715 1.00 152.47 ? 408 ARG B CG  1 
ATOM   2019 C CD  . ARG B  2 83  ? 70.530  130.402 154.906 1.00 145.85 ? 408 ARG B CD  1 
ATOM   2020 N NE  . ARG B  2 83  ? 69.575  130.568 153.813 1.00 132.64 ? 408 ARG B NE  1 
ATOM   2021 C CZ  . ARG B  2 83  ? 69.164  129.575 153.031 1.00 123.84 ? 408 ARG B CZ  1 
ATOM   2022 N NH1 . ARG B  2 83  ? 69.617  128.342 153.226 1.00 100.13 ? 408 ARG B NH1 1 
ATOM   2023 N NH2 . ARG B  2 83  ? 68.314  129.818 152.043 1.00 121.41 ? 408 ARG B NH2 1 
ATOM   2024 N N   . ASP B  2 84  ? 66.897  132.018 157.626 1.00 112.18 ? 409 ASP B N   1 
ATOM   2025 C CA  . ASP B  2 84  ? 65.665  132.577 158.171 1.00 107.42 ? 409 ASP B CA  1 
ATOM   2026 C C   . ASP B  2 84  ? 65.242  131.954 159.503 1.00 99.38  ? 409 ASP B C   1 
ATOM   2027 O O   . ASP B  2 84  ? 64.932  132.667 160.459 1.00 107.97 ? 409 ASP B O   1 
ATOM   2028 C CB  . ASP B  2 84  ? 64.547  132.393 157.129 1.00 111.09 ? 409 ASP B CB  1 
ATOM   2029 C CG  . ASP B  2 84  ? 64.925  132.915 155.743 1.00 122.14 ? 409 ASP B CG  1 
ATOM   2030 O OD1 . ASP B  2 84  ? 64.961  134.151 155.545 1.00 123.75 ? 409 ASP B OD1 1 
ATOM   2031 O OD2 . ASP B  2 84  ? 65.187  132.086 154.841 1.00 119.66 ? 409 ASP B OD2 1 
ATOM   2032 N N   . TRP B  2 85  ? 65.229  130.626 159.553 1.00 87.93  ? 410 TRP B N   1 
ATOM   2033 C CA  . TRP B  2 85  ? 64.836  129.888 160.749 1.00 81.76  ? 410 TRP B CA  1 
ATOM   2034 C C   . TRP B  2 85  ? 65.675  130.226 161.960 1.00 94.05  ? 410 TRP B C   1 
ATOM   2035 O O   . TRP B  2 85  ? 65.141  130.650 162.976 1.00 110.20 ? 410 TRP B O   1 
ATOM   2036 C CB  . TRP B  2 85  ? 64.923  128.385 160.486 1.00 69.89  ? 410 TRP B CB  1 
ATOM   2037 C CG  . TRP B  2 85  ? 64.743  127.540 161.706 1.00 66.21  ? 410 TRP B CG  1 
ATOM   2038 C CD1 . TRP B  2 85  ? 65.711  127.116 162.577 1.00 77.26  ? 410 TRP B CD1 1 
ATOM   2039 C CD2 . TRP B  2 85  ? 63.509  127.028 162.201 1.00 77.83  ? 410 TRP B CD2 1 
ATOM   2040 N NE1 . TRP B  2 85  ? 65.147  126.367 163.587 1.00 70.54  ? 410 TRP B NE1 1 
ATOM   2041 C CE2 . TRP B  2 85  ? 63.796  126.300 163.380 1.00 76.15  ? 410 TRP B CE2 1 
ATOM   2042 C CE3 . TRP B  2 85  ? 62.184  127.117 161.764 1.00 66.96  ? 410 TRP B CE3 1 
ATOM   2043 C CZ2 . TRP B  2 85  ? 62.806  125.668 164.127 1.00 77.28  ? 410 TRP B CZ2 1 
ATOM   2044 C CZ3 . TRP B  2 85  ? 61.203  126.490 162.505 1.00 67.12  ? 410 TRP B CZ3 1 
ATOM   2045 C CH2 . TRP B  2 85  ? 61.517  125.773 163.678 1.00 71.04  ? 410 TRP B CH2 1 
ATOM   2046 N N   . ILE B  2 86  ? 66.985  130.031 161.860 1.00 95.40  ? 411 ILE B N   1 
ATOM   2047 C CA  . ILE B  2 86  ? 67.850  130.306 162.998 1.00 104.93 ? 411 ILE B CA  1 
ATOM   2048 C C   . ILE B  2 86  ? 67.701  131.744 163.459 1.00 114.01 ? 411 ILE B C   1 
ATOM   2049 O O   . ILE B  2 86  ? 67.892  132.055 164.637 1.00 115.00 ? 411 ILE B O   1 
ATOM   2050 C CB  . ILE B  2 86  ? 69.317  130.062 162.670 1.00 108.60 ? 411 ILE B CB  1 
ATOM   2051 C CG1 . ILE B  2 86  ? 69.438  128.905 161.683 1.00 114.45 ? 411 ILE B CG1 1 
ATOM   2052 C CG2 . ILE B  2 86  ? 70.075  129.721 163.955 1.00 99.29  ? 411 ILE B CG2 1 
ATOM   2053 C CD1 . ILE B  2 86  ? 70.843  128.694 161.174 1.00 139.57 ? 411 ILE B CD1 1 
ATOM   2054 N N   . GLU B  2 87  ? 67.359  132.627 162.529 1.00 114.05 ? 412 GLU B N   1 
ATOM   2055 C CA  . GLU B  2 87  ? 67.183  134.023 162.883 1.00 130.22 ? 412 GLU B CA  1 
ATOM   2056 C C   . GLU B  2 87  ? 65.799  134.316 163.458 1.00 135.29 ? 412 GLU B C   1 
ATOM   2057 O O   . GLU B  2 87  ? 65.262  135.411 163.299 1.00 138.94 ? 412 GLU B O   1 
ATOM   2058 C CB  . GLU B  2 87  ? 67.480  134.912 161.677 1.00 139.43 ? 412 GLU B CB  1 
ATOM   2059 C CG  . GLU B  2 87  ? 68.974  135.047 161.407 1.00 156.30 ? 412 GLU B CG  1 
ATOM   2060 C CD  . GLU B  2 87  ? 69.283  136.016 160.288 1.00 169.36 ? 412 GLU B CD  1 
ATOM   2061 O OE1 . GLU B  2 87  ? 68.761  137.150 160.329 1.00 175.60 ? 412 GLU B OE1 1 
ATOM   2062 O OE2 . GLU B  2 87  ? 70.051  135.648 159.374 1.00 173.97 ? 412 GLU B OE2 1 
ATOM   2063 N N   . GLY B  2 88  ? 65.228  133.314 164.121 1.00 141.72 ? 413 GLY B N   1 
ATOM   2064 C CA  . GLY B  2 88  ? 63.931  133.461 164.761 1.00 142.22 ? 413 GLY B CA  1 
ATOM   2065 C C   . GLY B  2 88  ? 62.653  133.570 163.947 1.00 135.37 ? 413 GLY B C   1 
ATOM   2066 O O   . GLY B  2 88  ? 61.592  133.808 164.523 1.00 138.94 ? 413 GLY B O   1 
ATOM   2067 N N   . GLU B  2 89  ? 62.720  133.404 162.631 1.00 123.23 ? 414 GLU B N   1 
ATOM   2068 C CA  . GLU B  2 89  ? 61.509  133.499 161.824 1.00 104.51 ? 414 GLU B CA  1 
ATOM   2069 C C   . GLU B  2 89  ? 60.420  132.622 162.423 1.00 102.83 ? 414 GLU B C   1 
ATOM   2070 O O   . GLU B  2 89  ? 60.687  131.784 163.285 1.00 97.66  ? 414 GLU B O   1 
ATOM   2071 C CB  . GLU B  2 89  ? 61.778  133.066 160.389 1.00 102.56 ? 414 GLU B CB  1 
ATOM   2072 C CG  . GLU B  2 89  ? 60.530  132.974 159.525 1.00 89.01  ? 414 GLU B CG  1 
ATOM   2073 C CD  . GLU B  2 89  ? 59.820  134.291 159.380 1.00 86.99  ? 414 GLU B CD  1 
ATOM   2074 O OE1 . GLU B  2 89  ? 59.242  134.775 160.373 1.00 99.69  ? 414 GLU B OE1 1 
ATOM   2075 O OE2 . GLU B  2 89  ? 59.847  134.849 158.265 1.00 97.86  ? 414 GLU B OE2 1 
ATOM   2076 N N   . THR B  2 90  ? 59.192  132.819 161.960 1.00 109.60 ? 415 THR B N   1 
ATOM   2077 C CA  . THR B  2 90  ? 58.056  132.059 162.458 1.00 111.90 ? 415 THR B CA  1 
ATOM   2078 C C   . THR B  2 90  ? 57.055  131.660 161.366 1.00 110.49 ? 415 THR B C   1 
ATOM   2079 O O   . THR B  2 90  ? 56.517  132.506 160.626 1.00 92.15  ? 415 THR B O   1 
ATOM   2080 C CB  . THR B  2 90  ? 57.348  132.843 163.575 1.00 118.64 ? 415 THR B CB  1 
ATOM   2081 O OG1 . THR B  2 90  ? 55.994  132.403 163.687 1.00 117.61 ? 415 THR B OG1 1 
ATOM   2082 C CG2 . THR B  2 90  ? 57.422  134.334 163.313 1.00 138.35 ? 415 THR B CG2 1 
ATOM   2083 N N   . TYR B  2 91  ? 56.818  130.351 161.282 1.00 104.21 ? 416 TYR B N   1 
ATOM   2084 C CA  . TYR B  2 91  ? 55.922  129.765 160.287 1.00 90.76  ? 416 TYR B CA  1 
ATOM   2085 C C   . TYR B  2 91  ? 54.623  129.255 160.897 1.00 80.06  ? 416 TYR B C   1 
ATOM   2086 O O   . TYR B  2 91  ? 54.604  128.778 162.041 1.00 75.01  ? 416 TYR B O   1 
ATOM   2087 C CB  . TYR B  2 91  ? 56.626  128.606 159.569 1.00 94.22  ? 416 TYR B CB  1 
ATOM   2088 C CG  . TYR B  2 91  ? 57.961  128.956 158.940 1.00 92.49  ? 416 TYR B CG  1 
ATOM   2089 C CD1 . TYR B  2 91  ? 59.155  128.835 159.662 1.00 89.62  ? 416 TYR B CD1 1 
ATOM   2090 C CD2 . TYR B  2 91  ? 58.024  129.446 157.635 1.00 84.76  ? 416 TYR B CD2 1 
ATOM   2091 C CE1 . TYR B  2 91  ? 60.380  129.198 159.099 1.00 83.82  ? 416 TYR B CE1 1 
ATOM   2092 C CE2 . TYR B  2 91  ? 59.231  129.815 157.066 1.00 87.12  ? 416 TYR B CE2 1 
ATOM   2093 C CZ  . TYR B  2 91  ? 60.408  129.693 157.797 1.00 102.11 ? 416 TYR B CZ  1 
ATOM   2094 O OH  . TYR B  2 91  ? 61.601  130.081 157.222 1.00 130.03 ? 416 TYR B OH  1 
ATOM   2095 N N   . GLN B  2 92  ? 53.546  129.322 160.115 1.00 65.58  ? 417 GLN B N   1 
ATOM   2096 C CA  . GLN B  2 92  ? 52.236  128.889 160.592 1.00 68.03  ? 417 GLN B CA  1 
ATOM   2097 C C   . GLN B  2 92  ? 51.457  128.058 159.575 1.00 66.59  ? 417 GLN B C   1 
ATOM   2098 O O   . GLN B  2 92  ? 51.437  128.363 158.381 1.00 62.14  ? 417 GLN B O   1 
ATOM   2099 C CB  . GLN B  2 92  ? 51.411  130.114 160.969 1.00 109.02 ? 417 GLN B CB  1 
ATOM   2100 C CG  . GLN B  2 92  ? 50.127  129.811 161.708 1.00 125.76 ? 417 GLN B CG  1 
ATOM   2101 C CD  . GLN B  2 92  ? 49.282  131.051 161.924 1.00 133.98 ? 417 GLN B CD  1 
ATOM   2102 O OE1 . GLN B  2 92  ? 48.740  131.624 160.971 1.00 119.45 ? 417 GLN B OE1 1 
ATOM   2103 N NE2 . GLN B  2 92  ? 49.167  131.477 163.181 1.00 138.60 ? 417 GLN B NE2 1 
ATOM   2104 N N   . CYS B  2 93  ? 50.796  127.018 160.080 1.00 69.84  ? 418 CYS B N   1 
ATOM   2105 C CA  . CYS B  2 93  ? 49.998  126.095 159.267 1.00 69.14  ? 418 CYS B CA  1 
ATOM   2106 C C   . CYS B  2 93  ? 48.521  126.354 159.532 1.00 61.62  ? 418 CYS B C   1 
ATOM   2107 O O   . CYS B  2 93  ? 48.083  126.288 160.688 1.00 63.38  ? 418 CYS B O   1 
ATOM   2108 C CB  . CYS B  2 93  ? 50.343  124.647 159.636 1.00 82.80  ? 418 CYS B CB  1 
ATOM   2109 S SG  . CYS B  2 93  ? 49.465  123.360 158.682 1.00 118.55 ? 418 CYS B SG  1 
ATOM   2110 N N   . ARG B  2 94  ? 47.756  126.640 158.474 1.00 42.59  ? 419 ARG B N   1 
ATOM   2111 C CA  . ARG B  2 94  ? 46.327  126.928 158.637 1.00 47.13  ? 419 ARG B CA  1 
ATOM   2112 C C   . ARG B  2 94  ? 45.434  125.975 157.868 1.00 43.41  ? 419 ARG B C   1 
ATOM   2113 O O   . ARG B  2 94  ? 45.318  126.081 156.658 1.00 41.10  ? 419 ARG B O   1 
ATOM   2114 C CB  . ARG B  2 94  ? 46.008  128.369 158.211 1.00 76.14  ? 419 ARG B CB  1 
ATOM   2115 C CG  . ARG B  2 94  ? 44.562  128.797 158.483 1.00 99.97  ? 419 ARG B CG  1 
ATOM   2116 C CD  . ARG B  2 94  ? 44.235  130.164 157.902 1.00 100.61 ? 419 ARG B CD  1 
ATOM   2117 N NE  . ARG B  2 94  ? 42.880  130.587 158.248 1.00 104.37 ? 419 ARG B NE  1 
ATOM   2118 C CZ  . ARG B  2 94  ? 42.299  131.685 157.782 1.00 138.95 ? 419 ARG B CZ  1 
ATOM   2119 N NH1 . ARG B  2 94  ? 42.952  132.475 156.945 1.00 169.23 ? 419 ARG B NH1 1 
ATOM   2120 N NH2 . ARG B  2 94  ? 41.067  131.995 158.156 1.00 153.60 ? 419 ARG B NH2 1 
ATOM   2121 N N   . VAL B  2 95  ? 44.777  125.056 158.565 1.00 40.83  ? 420 VAL B N   1 
ATOM   2122 C CA  . VAL B  2 95  ? 43.891  124.107 157.877 1.00 55.11  ? 420 VAL B CA  1 
ATOM   2123 C C   . VAL B  2 95  ? 42.439  124.602 158.000 1.00 57.77  ? 420 VAL B C   1 
ATOM   2124 O O   . VAL B  2 95  ? 42.085  125.213 159.020 1.00 52.29  ? 420 VAL B O   1 
ATOM   2125 C CB  . VAL B  2 95  ? 44.050  122.684 158.466 1.00 52.31  ? 420 VAL B CB  1 
ATOM   2126 C CG1 . VAL B  2 95  ? 45.434  122.539 159.084 1.00 60.35  ? 420 VAL B CG1 1 
ATOM   2127 C CG2 . VAL B  2 95  ? 42.980  122.416 159.517 1.00 73.60  ? 420 VAL B CG2 1 
ATOM   2128 N N   . THR B  2 96  ? 41.636  124.307 156.966 1.00 42.23  ? 421 THR B N   1 
ATOM   2129 C CA  . THR B  2 96  ? 40.259  124.752 156.844 1.00 36.71  ? 421 THR B CA  1 
ATOM   2130 C C   . THR B  2 96  ? 39.294  123.902 156.029 1.00 44.65  ? 421 THR B C   1 
ATOM   2131 O O   . THR B  2 96  ? 39.438  123.788 154.818 1.00 58.84  ? 421 THR B O   1 
ATOM   2132 C CB  . THR B  2 96  ? 40.214  126.119 156.170 1.00 35.01  ? 421 THR B CB  1 
ATOM   2133 O OG1 . THR B  2 96  ? 40.364  127.127 157.168 1.00 99.61  ? 421 THR B OG1 1 
ATOM   2134 C CG2 . THR B  2 96  ? 38.907  126.314 155.393 1.00 50.81  ? 421 THR B CG2 1 
ATOM   2135 N N   . HIS B  2 97  ? 38.259  123.357 156.640 1.00 61.43  ? 422 HIS B N   1 
ATOM   2136 C CA  . HIS B  2 97  ? 37.333  122.547 155.856 1.00 51.21  ? 422 HIS B CA  1 
ATOM   2137 C C   . HIS B  2 97  ? 35.883  122.789 156.278 1.00 52.83  ? 422 HIS B C   1 
ATOM   2138 O O   . HIS B  2 97  ? 35.615  123.100 157.427 1.00 58.19  ? 422 HIS B O   1 
ATOM   2139 C CB  . HIS B  2 97  ? 37.688  121.069 156.046 1.00 58.35  ? 422 HIS B CB  1 
ATOM   2140 C CG  . HIS B  2 97  ? 36.899  120.137 155.186 1.00 71.60  ? 422 HIS B CG  1 
ATOM   2141 N ND1 . HIS B  2 97  ? 36.142  119.123 155.730 1.00 85.87  ? 422 HIS B ND1 1 
ATOM   2142 C CD2 . HIS B  2 97  ? 36.786  120.023 153.852 1.00 88.80  ? 422 HIS B CD2 1 
ATOM   2143 C CE1 . HIS B  2 97  ? 35.595  118.426 154.754 1.00 85.34  ? 422 HIS B CE1 1 
ATOM   2144 N NE2 . HIS B  2 97  ? 35.968  118.950 153.598 1.00 84.96  ? 422 HIS B NE2 1 
ATOM   2145 N N   . PRO B  2 98  ? 34.938  122.661 155.333 1.00 44.17  ? 423 PRO B N   1 
ATOM   2146 C CA  . PRO B  2 98  ? 33.500  122.844 155.563 1.00 58.91  ? 423 PRO B CA  1 
ATOM   2147 C C   . PRO B  2 98  ? 33.024  122.170 156.843 1.00 53.96  ? 423 PRO B C   1 
ATOM   2148 O O   . PRO B  2 98  ? 32.254  122.745 157.604 1.00 77.67  ? 423 PRO B O   1 
ATOM   2149 C CB  . PRO B  2 98  ? 32.892  122.227 154.320 1.00 51.21  ? 423 PRO B CB  1 
ATOM   2150 C CG  . PRO B  2 98  ? 33.833  122.723 153.266 1.00 77.86  ? 423 PRO B CG  1 
ATOM   2151 C CD  . PRO B  2 98  ? 35.231  122.574 153.889 1.00 71.70  ? 423 PRO B CD  1 
ATOM   2152 N N   . HIS B  2 99  ? 33.489  120.951 157.078 1.00 55.29  ? 424 HIS B N   1 
ATOM   2153 C CA  . HIS B  2 99  ? 33.139  120.178 158.262 1.00 52.74  ? 424 HIS B CA  1 
ATOM   2154 C C   . HIS B  2 99  ? 33.562  120.919 159.503 1.00 54.42  ? 424 HIS B C   1 
ATOM   2155 O O   . HIS B  2 99  ? 33.155  120.583 160.614 1.00 50.23  ? 424 HIS B O   1 
ATOM   2156 C CB  . HIS B  2 99  ? 33.886  118.850 158.263 1.00 51.15  ? 424 HIS B CB  1 
ATOM   2157 C CG  . HIS B  2 99  ? 33.378  117.865 157.264 1.00 40.60  ? 424 HIS B CG  1 
ATOM   2158 N ND1 . HIS B  2 99  ? 33.632  116.516 157.368 1.00 16.72  ? 424 HIS B ND1 1 
ATOM   2159 C CD2 . HIS B  2 99  ? 32.613  118.022 156.163 1.00 70.84  ? 424 HIS B CD2 1 
ATOM   2160 C CE1 . HIS B  2 99  ? 33.043  115.883 156.373 1.00 62.30  ? 424 HIS B CE1 1 
ATOM   2161 N NE2 . HIS B  2 99  ? 32.417  116.774 155.626 1.00 76.34  ? 424 HIS B NE2 1 
ATOM   2162 N N   . LEU B  2 100 ? 34.397  121.925 159.310 1.00 38.46  ? 425 LEU B N   1 
ATOM   2163 C CA  . LEU B  2 100 ? 34.907  122.679 160.429 1.00 56.59  ? 425 LEU B CA  1 
ATOM   2164 C C   . LEU B  2 100 ? 34.323  124.059 160.708 1.00 62.93  ? 425 LEU B C   1 
ATOM   2165 O O   . LEU B  2 100 ? 34.105  124.859 159.800 1.00 83.61  ? 425 LEU B O   1 
ATOM   2166 C CB  . LEU B  2 100 ? 36.415  122.774 160.284 1.00 58.40  ? 425 LEU B CB  1 
ATOM   2167 C CG  . LEU B  2 100 ? 37.061  121.393 160.189 1.00 50.17  ? 425 LEU B CG  1 
ATOM   2168 C CD1 . LEU B  2 100 ? 38.563  121.538 160.155 1.00 71.92  ? 425 LEU B CD1 1 
ATOM   2169 C CD2 . LEU B  2 100 ? 36.651  120.562 161.377 1.00 36.92  ? 425 LEU B CD2 1 
ATOM   2170 N N   . PRO B  2 101 ? 34.071  124.348 161.994 1.00 56.60  ? 426 PRO B N   1 
ATOM   2171 C CA  . PRO B  2 101 ? 33.523  125.589 162.550 1.00 56.21  ? 426 PRO B CA  1 
ATOM   2172 C C   . PRO B  2 101 ? 34.576  126.710 162.531 1.00 61.97  ? 426 PRO B C   1 
ATOM   2173 O O   . PRO B  2 101 ? 34.524  127.605 161.692 1.00 72.46  ? 426 PRO B O   1 
ATOM   2174 C CB  . PRO B  2 101 ? 33.167  125.178 163.965 1.00 74.87  ? 426 PRO B CB  1 
ATOM   2175 C CG  . PRO B  2 101 ? 34.270  124.230 164.292 1.00 42.93  ? 426 PRO B CG  1 
ATOM   2176 C CD  . PRO B  2 101 ? 34.288  123.365 163.068 1.00 51.63  ? 426 PRO B CD  1 
ATOM   2177 N N   . ARG B  2 102 ? 35.513  126.657 163.475 1.00 66.45  ? 427 ARG B N   1 
ATOM   2178 C CA  . ARG B  2 102 ? 36.606  127.626 163.550 1.00 76.13  ? 427 ARG B CA  1 
ATOM   2179 C C   . ARG B  2 102 ? 37.709  127.037 162.664 1.00 78.39  ? 427 ARG B C   1 
ATOM   2180 O O   . ARG B  2 102 ? 37.641  125.876 162.279 1.00 46.87  ? 427 ARG B O   1 
ATOM   2181 C CB  . ARG B  2 102 ? 37.101  127.788 165.016 1.00 68.65  ? 427 ARG B CB  1 
ATOM   2182 C CG  . ARG B  2 102 ? 37.494  126.478 165.701 1.00 76.15  ? 427 ARG B CG  1 
ATOM   2183 C CD  . ARG B  2 102 ? 37.021  126.334 167.163 1.00 104.10 ? 427 ARG B CD  1 
ATOM   2184 N NE  . ARG B  2 102 ? 36.476  124.989 167.420 1.00 127.41 ? 427 ARG B NE  1 
ATOM   2185 C CZ  . ARG B  2 102 ? 36.257  124.464 168.627 1.00 129.19 ? 427 ARG B CZ  1 
ATOM   2186 N NH1 . ARG B  2 102 ? 36.543  125.167 169.717 1.00 133.64 ? 427 ARG B NH1 1 
ATOM   2187 N NH2 . ARG B  2 102 ? 35.737  123.236 168.748 1.00 86.18  ? 427 ARG B NH2 1 
ATOM   2188 N N   . ALA B  2 103 ? 38.713  127.824 162.313 1.00 90.79  ? 428 ALA B N   1 
ATOM   2189 C CA  . ALA B  2 103 ? 39.793  127.289 161.495 1.00 75.22  ? 428 ALA B CA  1 
ATOM   2190 C C   . ALA B  2 103 ? 40.782  126.651 162.451 1.00 65.98  ? 428 ALA B C   1 
ATOM   2191 O O   . ALA B  2 103 ? 40.721  126.891 163.651 1.00 73.74  ? 428 ALA B O   1 
ATOM   2192 C CB  . ALA B  2 103 ? 40.458  128.403 160.734 1.00 102.08 ? 428 ALA B CB  1 
ATOM   2193 N N   . LEU B  2 104 ? 41.689  125.836 161.932 1.00 56.83  ? 429 LEU B N   1 
ATOM   2194 C CA  . LEU B  2 104 ? 42.698  125.194 162.769 1.00 57.71  ? 429 LEU B CA  1 
ATOM   2195 C C   . LEU B  2 104 ? 44.041  125.779 162.418 1.00 58.83  ? 429 LEU B C   1 
ATOM   2196 O O   . LEU B  2 104 ? 44.392  125.847 161.247 1.00 47.46  ? 429 LEU B O   1 
ATOM   2197 C CB  . LEU B  2 104 ? 42.750  123.697 162.523 1.00 34.10  ? 429 LEU B CB  1 
ATOM   2198 C CG  . LEU B  2 104 ? 42.661  122.872 163.803 1.00 65.58  ? 429 LEU B CG  1 
ATOM   2199 C CD1 . LEU B  2 104 ? 42.937  121.426 163.444 1.00 54.70  ? 429 LEU B CD1 1 
ATOM   2200 C CD2 . LEU B  2 104 ? 43.645  123.380 164.857 1.00 81.83  ? 429 LEU B CD2 1 
ATOM   2201 N N   . MET B  2 105 ? 44.792  126.186 163.433 1.00 55.40  ? 430 MET B N   1 
ATOM   2202 C CA  . MET B  2 105 ? 46.085  126.789 163.209 1.00 51.15  ? 430 MET B CA  1 
ATOM   2203 C C   . MET B  2 105 ? 47.063  126.286 164.226 1.00 59.65  ? 430 MET B C   1 
ATOM   2204 O O   . MET B  2 105 ? 46.686  125.890 165.335 1.00 58.73  ? 430 MET B O   1 
ATOM   2205 C CB  . MET B  2 105 ? 46.004  128.321 163.336 1.00 65.24  ? 430 MET B CB  1 
ATOM   2206 C CG  . MET B  2 105 ? 45.156  129.011 162.277 1.00 81.84  ? 430 MET B CG  1 
ATOM   2207 S SD  . MET B  2 105 ? 45.247  130.811 162.351 1.00 133.05 ? 430 MET B SD  1 
ATOM   2208 C CE  . MET B  2 105 ? 44.061  131.159 163.665 1.00 138.82 ? 430 MET B CE  1 
ATOM   2209 N N   . ARG B  2 106 ? 48.326  126.285 163.821 1.00 57.40  ? 431 ARG B N   1 
ATOM   2210 C CA  . ARG B  2 106 ? 49.423  125.906 164.696 1.00 65.98  ? 431 ARG B CA  1 
ATOM   2211 C C   . ARG B  2 106 ? 50.627  126.588 164.085 1.00 75.59  ? 431 ARG B C   1 
ATOM   2212 O O   . ARG B  2 106 ? 50.663  126.820 162.869 1.00 59.38  ? 431 ARG B O   1 
ATOM   2213 C CB  . ARG B  2 106 ? 49.602  124.404 164.736 1.00 52.98  ? 431 ARG B CB  1 
ATOM   2214 C CG  . ARG B  2 106 ? 48.302  123.660 164.986 1.00 66.51  ? 431 ARG B CG  1 
ATOM   2215 C CD  . ARG B  2 106 ? 48.510  122.413 165.816 1.00 71.34  ? 431 ARG B CD  1 
ATOM   2216 N NE  . ARG B  2 106 ? 48.125  122.644 167.201 1.00 96.52  ? 431 ARG B NE  1 
ATOM   2217 C CZ  . ARG B  2 106 ? 46.876  122.871 167.585 1.00 104.16 ? 431 ARG B CZ  1 
ATOM   2218 N NH1 . ARG B  2 106 ? 45.907  122.888 166.681 1.00 45.94  ? 431 ARG B NH1 1 
ATOM   2219 N NH2 . ARG B  2 106 ? 46.601  123.088 168.865 1.00 129.19 ? 431 ARG B NH2 1 
ATOM   2220 N N   . SER B  2 107 ? 51.589  126.941 164.928 1.00 76.41  ? 432 SER B N   1 
ATOM   2221 C CA  . SER B  2 107 ? 52.772  127.634 164.457 1.00 78.48  ? 432 SER B CA  1 
ATOM   2222 C C   . SER B  2 107 ? 53.974  127.142 165.224 1.00 82.65  ? 432 SER B C   1 
ATOM   2223 O O   . SER B  2 107 ? 53.831  126.433 166.226 1.00 69.97  ? 432 SER B O   1 
ATOM   2224 C CB  . SER B  2 107 ? 52.625  129.138 164.671 1.00 82.53  ? 432 SER B CB  1 
ATOM   2225 O OG  . SER B  2 107 ? 52.566  129.443 166.058 1.00 101.75 ? 432 SER B OG  1 
ATOM   2226 N N   . THR B  2 108 ? 55.155  127.529 164.749 1.00 87.35  ? 433 THR B N   1 
ATOM   2227 C CA  . THR B  2 108 ? 56.400  127.130 165.384 1.00 88.03  ? 433 THR B CA  1 
ATOM   2228 C C   . THR B  2 108 ? 57.567  127.947 164.891 1.00 90.08  ? 433 THR B C   1 
ATOM   2229 O O   . THR B  2 108 ? 57.576  128.410 163.734 1.00 73.30  ? 433 THR B O   1 
ATOM   2230 C CB  . THR B  2 108 ? 56.722  125.683 165.096 1.00 86.44  ? 433 THR B CB  1 
ATOM   2231 O OG1 . THR B  2 108 ? 57.898  125.303 165.820 1.00 102.66 ? 433 THR B OG1 1 
ATOM   2232 C CG2 . THR B  2 108 ? 56.953  125.506 163.607 1.00 51.71  ? 433 THR B CG2 1 
ATOM   2233 N N   . THR B  2 109 ? 58.546  128.111 165.785 1.00 83.57  ? 434 THR B N   1 
ATOM   2234 C CA  . THR B  2 109 ? 59.786  128.838 165.511 1.00 79.91  ? 434 THR B CA  1 
ATOM   2235 C C   . THR B  2 109 ? 60.880  128.307 166.436 1.00 85.92  ? 434 THR B C   1 
ATOM   2236 O O   . THR B  2 109 ? 60.621  127.548 167.360 1.00 68.45  ? 434 THR B O   1 
ATOM   2237 C CB  . THR B  2 109 ? 59.687  130.335 165.820 1.00 89.60  ? 434 THR B CB  1 
ATOM   2238 O OG1 . THR B  2 109 ? 59.875  130.555 167.229 1.00 117.99 ? 434 THR B OG1 1 
ATOM   2239 C CG2 . THR B  2 109 ? 58.342  130.886 165.421 1.00 80.78  ? 434 THR B CG2 1 
ATOM   2240 N N   . LYS B  2 110 ? 62.095  128.750 166.146 1.00 93.58  ? 435 LYS B N   1 
ATOM   2241 C CA  . LYS B  2 110 ? 63.296  128.401 166.859 1.00 98.31  ? 435 LYS B CA  1 
ATOM   2242 C C   . LYS B  2 110 ? 63.073  128.443 168.369 1.00 93.03  ? 435 LYS B C   1 
ATOM   2243 O O   . LYS B  2 110 ? 62.554  129.421 168.898 1.00 104.05 ? 435 LYS B O   1 
ATOM   2244 C CB  . LYS B  2 110 ? 64.392  129.385 166.468 1.00 110.81 ? 435 LYS B CB  1 
ATOM   2245 C CG  . LYS B  2 110 ? 65.736  129.328 167.181 1.00 144.36 ? 435 LYS B CG  1 
ATOM   2246 C CD  . LYS B  2 110 ? 66.662  130.374 166.492 1.00 156.86 ? 435 LYS B CD  1 
ATOM   2247 C CE  . LYS B  2 110 ? 68.100  130.543 167.040 1.00 169.74 ? 435 LYS B CE  1 
ATOM   2248 N NZ  . LYS B  2 110 ? 68.097  131.005 168.483 1.00 184.79 ? 435 LYS B NZ  1 
ATOM   2249 N N   . THR B  2 111 ? 63.449  127.383 169.070 1.00 89.28  ? 436 THR B N   1 
ATOM   2250 C CA  . THR B  2 111 ? 63.293  127.351 170.526 1.00 101.14 ? 436 THR B CA  1 
ATOM   2251 C C   . THR B  2 111 ? 64.159  128.429 171.186 1.00 121.68 ? 436 THR B C   1 
ATOM   2252 O O   . THR B  2 111 ? 65.294  128.670 170.764 1.00 128.81 ? 436 THR B O   1 
ATOM   2253 C CB  . THR B  2 111 ? 63.710  126.002 171.078 1.00 92.33  ? 436 THR B CB  1 
ATOM   2254 O OG1 . THR B  2 111 ? 63.054  124.968 170.344 1.00 121.43 ? 436 THR B OG1 1 
ATOM   2255 C CG2 . THR B  2 111 ? 63.341  125.879 172.532 1.00 85.92  ? 436 THR B CG2 1 
ATOM   2256 N N   . SER B  2 112 ? 63.639  129.031 172.255 1.00 129.90 ? 437 SER B N   1 
ATOM   2257 C CA  . SER B  2 112 ? 64.341  130.112 172.957 1.00 138.06 ? 437 SER B CA  1 
ATOM   2258 C C   . SER B  2 112 ? 65.157  129.701 174.176 1.00 135.96 ? 437 SER B C   1 
ATOM   2259 O O   . SER B  2 112 ? 65.253  128.518 174.505 1.00 128.02 ? 437 SER B O   1 
ATOM   2260 C CB  . SER B  2 112 ? 63.334  131.187 173.370 1.00 143.46 ? 437 SER B CB  1 
ATOM   2261 O OG  . SER B  2 112 ? 62.326  130.634 174.204 1.00 147.01 ? 437 SER B OG  1 
ATOM   2262 N N   . GLY B  2 113 ? 65.748  130.698 174.834 1.00 129.94 ? 438 GLY B N   1 
ATOM   2263 C CA  . GLY B  2 113 ? 66.544  130.446 176.022 1.00 117.29 ? 438 GLY B CA  1 
ATOM   2264 C C   . GLY B  2 113 ? 68.046  130.551 175.823 1.00 104.78 ? 438 GLY B C   1 
ATOM   2265 O O   . GLY B  2 113 ? 68.511  131.074 174.814 1.00 92.69  ? 438 GLY B O   1 
ATOM   2266 N N   . PRO B  2 114 ? 68.836  130.081 176.796 1.00 109.66 ? 439 PRO B N   1 
ATOM   2267 C CA  . PRO B  2 114 ? 70.299  130.103 176.748 1.00 119.78 ? 439 PRO B CA  1 
ATOM   2268 C C   . PRO B  2 114 ? 70.807  128.876 175.989 1.00 120.43 ? 439 PRO B C   1 
ATOM   2269 O O   . PRO B  2 114 ? 70.310  127.768 176.199 1.00 121.42 ? 439 PRO B O   1 
ATOM   2270 C CB  . PRO B  2 114 ? 70.684  130.075 178.218 1.00 126.76 ? 439 PRO B CB  1 
ATOM   2271 C CG  . PRO B  2 114 ? 69.637  129.177 178.787 1.00 119.41 ? 439 PRO B CG  1 
ATOM   2272 C CD  . PRO B  2 114 ? 68.372  129.693 178.137 1.00 108.38 ? 439 PRO B CD  1 
ATOM   2273 N N   . ARG B  2 115 ? 71.805  129.094 175.127 1.00 108.98 ? 440 ARG B N   1 
ATOM   2274 C CA  . ARG B  2 115 ? 72.374  128.039 174.291 1.00 97.96  ? 440 ARG B CA  1 
ATOM   2275 C C   . ARG B  2 115 ? 73.699  127.481 174.812 1.00 89.32  ? 440 ARG B C   1 
ATOM   2276 O O   . ARG B  2 115 ? 74.753  128.090 174.628 1.00 109.59 ? 440 ARG B O   1 
ATOM   2277 C CB  . ARG B  2 115 ? 72.576  128.565 172.866 1.00 98.53  ? 440 ARG B CB  1 
ATOM   2278 C CG  . ARG B  2 115 ? 71.504  129.538 172.390 1.00 118.28 ? 440 ARG B CG  1 
ATOM   2279 C CD  . ARG B  2 115 ? 70.181  128.851 172.101 1.00 150.85 ? 440 ARG B CD  1 
ATOM   2280 N NE  . ARG B  2 115 ? 69.065  129.796 172.154 1.00 183.58 ? 440 ARG B NE  1 
ATOM   2281 C CZ  . ARG B  2 115 ? 67.972  129.726 171.400 1.00 196.71 ? 440 ARG B CZ  1 
ATOM   2282 N NH1 . ARG B  2 115 ? 67.829  128.750 170.511 1.00 191.71 ? 440 ARG B NH1 1 
ATOM   2283 N NH2 . ARG B  2 115 ? 67.023  130.642 171.541 1.00 209.09 ? 440 ARG B NH2 1 
ATOM   2284 N N   . ALA B  2 116 ? 73.650  126.315 175.450 1.00 78.11  ? 441 ALA B N   1 
ATOM   2285 C CA  . ALA B  2 116 ? 74.869  125.692 175.965 1.00 89.37  ? 441 ALA B CA  1 
ATOM   2286 C C   . ALA B  2 116 ? 75.217  124.441 175.151 1.00 94.89  ? 441 ALA B C   1 
ATOM   2287 O O   . ALA B  2 116 ? 74.409  123.514 175.047 1.00 88.77  ? 441 ALA B O   1 
ATOM   2288 C CB  . ALA B  2 116 ? 74.701  125.340 177.430 1.00 83.13  ? 441 ALA B CB  1 
ATOM   2289 N N   . ALA B  2 117 ? 76.430  124.427 174.595 1.00 107.07 ? 442 ALA B N   1 
ATOM   2290 C CA  . ALA B  2 117 ? 76.938  123.321 173.775 1.00 98.17  ? 442 ALA B CA  1 
ATOM   2291 C C   . ALA B  2 117 ? 76.946  121.954 174.466 1.00 90.14  ? 442 ALA B C   1 
ATOM   2292 O O   . ALA B  2 117 ? 76.879  121.858 175.693 1.00 91.43  ? 442 ALA B O   1 
ATOM   2293 C CB  . ALA B  2 117 ? 78.341  123.654 173.274 1.00 109.71 ? 442 ALA B CB  1 
ATOM   2294 N N   . PRO B  2 118 ? 77.045  120.877 173.670 1.00 79.41  ? 443 PRO B N   1 
ATOM   2295 C CA  . PRO B  2 118 ? 77.057  119.497 174.160 1.00 71.88  ? 443 PRO B CA  1 
ATOM   2296 C C   . PRO B  2 118 ? 78.413  118.970 174.561 1.00 78.08  ? 443 PRO B C   1 
ATOM   2297 O O   . PRO B  2 118 ? 79.442  119.348 174.008 1.00 90.47  ? 443 PRO B O   1 
ATOM   2298 C CB  . PRO B  2 118 ? 76.504  118.696 172.982 1.00 77.06  ? 443 PRO B CB  1 
ATOM   2299 C CG  . PRO B  2 118 ? 76.059  119.745 171.951 1.00 70.85  ? 443 PRO B CG  1 
ATOM   2300 C CD  . PRO B  2 118 ? 76.967  120.894 172.202 1.00 67.26  ? 443 PRO B CD  1 
ATOM   2301 N N   . GLU B  2 119 ? 78.391  118.073 175.529 1.00 83.98  ? 444 GLU B N   1 
ATOM   2302 C CA  . GLU B  2 119 ? 79.594  117.429 176.022 1.00 100.03 ? 444 GLU B CA  1 
ATOM   2303 C C   . GLU B  2 119 ? 79.351  115.976 175.686 1.00 96.72  ? 444 GLU B C   1 
ATOM   2304 O O   . GLU B  2 119 ? 78.357  115.406 176.121 1.00 101.40 ? 444 GLU B O   1 
ATOM   2305 C CB  . GLU B  2 119 ? 79.710  117.589 177.542 1.00 116.18 ? 444 GLU B CB  1 
ATOM   2306 C CG  . GLU B  2 119 ? 80.142  118.972 178.015 1.00 138.26 ? 444 GLU B CG  1 
ATOM   2307 C CD  . GLU B  2 119 ? 79.828  119.211 179.486 1.00 140.39 ? 444 GLU B CD  1 
ATOM   2308 O OE1 . GLU B  2 119 ? 79.978  118.265 180.292 1.00 124.62 ? 444 GLU B OE1 1 
ATOM   2309 O OE2 . GLU B  2 119 ? 79.438  120.349 179.836 1.00 129.02 ? 444 GLU B OE2 1 
ATOM   2310 N N   . VAL B  2 120 ? 80.235  115.375 174.903 1.00 91.86  ? 445 VAL B N   1 
ATOM   2311 C CA  . VAL B  2 120 ? 80.056  113.978 174.543 1.00 81.97  ? 445 VAL B CA  1 
ATOM   2312 C C   . VAL B  2 120 ? 81.230  113.081 174.936 1.00 72.48  ? 445 VAL B C   1 
ATOM   2313 O O   . VAL B  2 120 ? 82.385  113.474 174.820 1.00 76.18  ? 445 VAL B O   1 
ATOM   2314 C CB  . VAL B  2 120 ? 79.787  113.845 173.042 1.00 79.07  ? 445 VAL B CB  1 
ATOM   2315 C CG1 . VAL B  2 120 ? 80.696  114.770 172.266 1.00 55.62  ? 445 VAL B CG1 1 
ATOM   2316 C CG2 . VAL B  2 120 ? 79.983  112.403 172.620 1.00 97.03  ? 445 VAL B CG2 1 
ATOM   2317 N N   . TYR B  2 121 ? 80.917  111.877 175.406 1.00 69.70  ? 446 TYR B N   1 
ATOM   2318 C CA  . TYR B  2 121 ? 81.928  110.913 175.817 1.00 89.21  ? 446 TYR B CA  1 
ATOM   2319 C C   . TYR B  2 121 ? 81.515  109.532 175.325 1.00 93.08  ? 446 TYR B C   1 
ATOM   2320 O O   . TYR B  2 121 ? 80.467  109.032 175.715 1.00 88.10  ? 446 TYR B O   1 
ATOM   2321 C CB  . TYR B  2 121 ? 82.051  110.897 177.344 1.00 108.25 ? 446 TYR B CB  1 
ATOM   2322 C CG  . TYR B  2 121 ? 82.132  112.276 177.967 1.00 124.18 ? 446 TYR B CG  1 
ATOM   2323 C CD1 . TYR B  2 121 ? 81.042  112.826 178.628 1.00 110.82 ? 446 TYR B CD1 1 
ATOM   2324 C CD2 . TYR B  2 121 ? 83.288  113.048 177.854 1.00 145.16 ? 446 TYR B CD2 1 
ATOM   2325 C CE1 . TYR B  2 121 ? 81.091  114.111 179.161 1.00 125.12 ? 446 TYR B CE1 1 
ATOM   2326 C CE2 . TYR B  2 121 ? 83.347  114.338 178.384 1.00 149.50 ? 446 TYR B CE2 1 
ATOM   2327 C CZ  . TYR B  2 121 ? 82.242  114.861 179.034 1.00 139.06 ? 446 TYR B CZ  1 
ATOM   2328 O OH  . TYR B  2 121 ? 82.281  116.137 179.545 1.00 147.52 ? 446 TYR B OH  1 
ATOM   2329 N N   . ALA B  2 122 ? 82.337  108.917 174.476 1.00 96.45  ? 447 ALA B N   1 
ATOM   2330 C CA  . ALA B  2 122 ? 82.035  107.592 173.925 1.00 81.62  ? 447 ALA B CA  1 
ATOM   2331 C C   . ALA B  2 122 ? 82.706  106.451 174.698 1.00 76.01  ? 447 ALA B C   1 
ATOM   2332 O O   . ALA B  2 122 ? 83.836  106.585 175.166 1.00 86.18  ? 447 ALA B O   1 
ATOM   2333 C CB  . ALA B  2 122 ? 82.452  107.548 172.479 1.00 85.88  ? 447 ALA B CB  1 
ATOM   2334 N N   . PHE B  2 123 ? 82.018  105.322 174.823 1.00 61.79  ? 448 PHE B N   1 
ATOM   2335 C CA  . PHE B  2 123 ? 82.569  104.190 175.560 1.00 86.83  ? 448 PHE B CA  1 
ATOM   2336 C C   . PHE B  2 123 ? 82.528  102.867 174.795 1.00 82.33  ? 448 PHE B C   1 
ATOM   2337 O O   . PHE B  2 123 ? 82.229  102.854 173.608 1.00 93.86  ? 448 PHE B O   1 
ATOM   2338 C CB  . PHE B  2 123 ? 81.848  104.064 176.905 1.00 107.53 ? 448 PHE B CB  1 
ATOM   2339 C CG  . PHE B  2 123 ? 81.973  105.292 177.762 1.00 134.50 ? 448 PHE B CG  1 
ATOM   2340 C CD1 . PHE B  2 123 ? 81.192  106.412 177.512 1.00 147.42 ? 448 PHE B CD1 1 
ATOM   2341 C CD2 . PHE B  2 123 ? 82.920  105.353 178.777 1.00 151.94 ? 448 PHE B CD2 1 
ATOM   2342 C CE1 . PHE B  2 123 ? 81.356  107.576 178.258 1.00 159.73 ? 448 PHE B CE1 1 
ATOM   2343 C CE2 . PHE B  2 123 ? 83.091  106.511 179.529 1.00 163.62 ? 448 PHE B CE2 1 
ATOM   2344 C CZ  . PHE B  2 123 ? 82.309  107.625 179.268 1.00 168.47 ? 448 PHE B CZ  1 
ATOM   2345 N N   . ALA B  2 124 ? 82.843  101.761 175.468 1.00 69.97  ? 449 ALA B N   1 
ATOM   2346 C CA  . ALA B  2 124 ? 82.846  100.458 174.814 1.00 54.45  ? 449 ALA B CA  1 
ATOM   2347 C C   . ALA B  2 124 ? 82.959  99.284  175.780 1.00 55.84  ? 449 ALA B C   1 
ATOM   2348 O O   . ALA B  2 124 ? 83.846  99.231  176.623 1.00 65.47  ? 449 ALA B O   1 
ATOM   2349 C CB  . ALA B  2 124 ? 83.970  100.401 173.803 1.00 76.11  ? 449 ALA B CB  1 
ATOM   2350 N N   . THR B  2 125 ? 82.061  98.325  175.619 1.00 55.90  ? 450 THR B N   1 
ATOM   2351 C CA  . THR B  2 125 ? 81.993  97.144  176.467 1.00 79.87  ? 450 THR B CA  1 
ATOM   2352 C C   . THR B  2 125 ? 83.088  96.099  176.252 1.00 91.64  ? 450 THR B C   1 
ATOM   2353 O O   . THR B  2 125 ? 83.677  96.015  175.182 1.00 105.72 ? 450 THR B O   1 
ATOM   2354 C CB  . THR B  2 125 ? 80.626  96.450  176.266 1.00 80.90  ? 450 THR B CB  1 
ATOM   2355 O OG1 . THR B  2 125 ? 79.578  97.340  176.657 1.00 92.79  ? 450 THR B OG1 1 
ATOM   2356 C CG2 . THR B  2 125 ? 80.529  95.176  177.085 1.00 96.10  ? 450 THR B CG2 1 
ATOM   2357 N N   . PRO B  2 126 ? 83.398  95.317  177.298 1.00 93.64  ? 451 PRO B N   1 
ATOM   2358 C CA  . PRO B  2 126 ? 84.401  94.247  177.274 1.00 103.29 ? 451 PRO B CA  1 
ATOM   2359 C C   . PRO B  2 126 ? 83.638  92.976  176.904 1.00 110.89 ? 451 PRO B C   1 
ATOM   2360 O O   . PRO B  2 126 ? 82.434  92.893  177.140 1.00 114.75 ? 451 PRO B O   1 
ATOM   2361 C CB  . PRO B  2 126 ? 84.895  94.197  178.715 1.00 114.13 ? 451 PRO B CB  1 
ATOM   2362 C CG  . PRO B  2 126 ? 84.606  95.567  179.233 1.00 112.29 ? 451 PRO B CG  1 
ATOM   2363 C CD  . PRO B  2 126 ? 83.248  95.823  178.669 1.00 95.08  ? 451 PRO B CD  1 
ATOM   2364 N N   . GLU B  2 127 ? 84.316  91.984  176.339 1.00 125.51 ? 452 GLU B N   1 
ATOM   2365 C CA  . GLU B  2 127 ? 83.619  90.760  175.950 1.00 134.68 ? 452 GLU B CA  1 
ATOM   2366 C C   . GLU B  2 127 ? 82.901  90.097  177.120 1.00 129.23 ? 452 GLU B C   1 
ATOM   2367 O O   . GLU B  2 127 ? 83.117  90.448  178.278 1.00 111.59 ? 452 GLU B O   1 
ATOM   2368 C CB  . GLU B  2 127 ? 84.588  89.759  175.301 1.00 151.14 ? 452 GLU B CB  1 
ATOM   2369 C CG  . GLU B  2 127 ? 85.720  89.279  176.195 1.00 168.30 ? 452 GLU B CG  1 
ATOM   2370 C CD  . GLU B  2 127 ? 86.553  88.193  175.536 1.00 170.94 ? 452 GLU B CD  1 
ATOM   2371 O OE1 . GLU B  2 127 ? 85.996  87.113  175.242 1.00 165.12 ? 452 GLU B OE1 1 
ATOM   2372 O OE2 . GLU B  2 127 ? 87.762  88.420  175.311 1.00 177.78 ? 452 GLU B OE2 1 
ATOM   2373 N N   . TRP B  2 128 ? 82.040  89.138  176.797 1.00 135.94 ? 453 TRP B N   1 
ATOM   2374 C CA  . TRP B  2 128 ? 81.274  88.403  177.793 1.00 155.55 ? 453 TRP B CA  1 
ATOM   2375 C C   . TRP B  2 128 ? 81.111  86.952  177.340 1.00 165.60 ? 453 TRP B C   1 
ATOM   2376 O O   . TRP B  2 128 ? 80.894  86.679  176.161 1.00 166.18 ? 453 TRP B O   1 
ATOM   2377 C CB  . TRP B  2 128 ? 79.909  89.074  177.986 1.00 170.68 ? 453 TRP B CB  1 
ATOM   2378 C CG  . TRP B  2 128 ? 78.970  88.353  178.913 1.00 191.95 ? 453 TRP B CG  1 
ATOM   2379 C CD1 . TRP B  2 128 ? 78.130  87.324  178.595 1.00 194.82 ? 453 TRP B CD1 1 
ATOM   2380 C CD2 . TRP B  2 128 ? 78.780  88.606  180.312 1.00 205.45 ? 453 TRP B CD2 1 
ATOM   2381 N NE1 . TRP B  2 128 ? 77.429  86.920  179.705 1.00 203.03 ? 453 TRP B NE1 1 
ATOM   2382 C CE2 . TRP B  2 128 ? 77.810  87.688  180.773 1.00 208.54 ? 453 TRP B CE2 1 
ATOM   2383 C CE3 . TRP B  2 128 ? 79.338  89.515  181.221 1.00 213.97 ? 453 TRP B CE3 1 
ATOM   2384 C CZ2 . TRP B  2 128 ? 77.382  87.656  182.106 1.00 215.80 ? 453 TRP B CZ2 1 
ATOM   2385 C CZ3 . TRP B  2 128 ? 78.913  89.483  182.547 1.00 218.84 ? 453 TRP B CZ3 1 
ATOM   2386 C CH2 . TRP B  2 128 ? 77.945  88.557  182.975 1.00 221.46 ? 453 TRP B CH2 1 
ATOM   2387 N N   . PRO B  2 129 ? 81.227  86.000  178.277 1.00 170.26 ? 454 PRO B N   1 
ATOM   2388 C CA  . PRO B  2 129 ? 81.101  84.563  178.014 1.00 179.25 ? 454 PRO B CA  1 
ATOM   2389 C C   . PRO B  2 129 ? 79.962  84.171  177.075 1.00 184.79 ? 454 PRO B C   1 
ATOM   2390 O O   . PRO B  2 129 ? 79.983  83.092  176.485 1.00 192.39 ? 454 PRO B O   1 
ATOM   2391 C CB  . PRO B  2 129 ? 80.922  83.982  179.410 1.00 180.14 ? 454 PRO B CB  1 
ATOM   2392 C CG  . PRO B  2 129 ? 81.817  84.854  180.224 1.00 177.24 ? 454 PRO B CG  1 
ATOM   2393 C CD  . PRO B  2 129 ? 81.493  86.244  179.707 1.00 172.47 ? 454 PRO B CD  1 
ATOM   2394 N N   . GLY B  2 130 ? 78.971  85.045  176.945 1.00 186.74 ? 455 GLY B N   1 
ATOM   2395 C CA  . GLY B  2 130 ? 77.842  84.759  176.078 1.00 182.10 ? 455 GLY B CA  1 
ATOM   2396 C C   . GLY B  2 130 ? 78.211  84.739  174.607 1.00 182.02 ? 455 GLY B C   1 
ATOM   2397 O O   . GLY B  2 130 ? 77.762  83.871  173.859 1.00 184.93 ? 455 GLY B O   1 
ATOM   2398 N N   . SER B  2 131 ? 79.029  85.701  174.192 1.00 177.85 ? 456 SER B N   1 
ATOM   2399 C CA  . SER B  2 131 ? 79.463  85.802  172.801 1.00 172.60 ? 456 SER B CA  1 
ATOM   2400 C C   . SER B  2 131 ? 80.824  86.474  172.755 1.00 174.35 ? 456 SER B C   1 
ATOM   2401 O O   . SER B  2 131 ? 81.092  87.397  173.523 1.00 175.25 ? 456 SER B O   1 
ATOM   2402 C CB  . SER B  2 131 ? 78.471  86.631  171.992 1.00 165.27 ? 456 SER B CB  1 
ATOM   2403 O OG  . SER B  2 131 ? 78.452  87.968  172.457 1.00 157.91 ? 456 SER B OG  1 
ATOM   2404 N N   . ARG B  2 132 ? 81.677  86.022  171.844 1.00 178.59 ? 457 ARG B N   1 
ATOM   2405 C CA  . ARG B  2 132 ? 83.016  86.582  171.723 1.00 182.16 ? 457 ARG B CA  1 
ATOM   2406 C C   . ARG B  2 132 ? 83.180  87.431  170.468 1.00 177.39 ? 457 ARG B C   1 
ATOM   2407 O O   . ARG B  2 132 ? 84.282  87.892  170.169 1.00 180.57 ? 457 ARG B O   1 
ATOM   2408 C CB  . ARG B  2 132 ? 84.057  85.452  171.727 1.00 189.54 ? 457 ARG B CB  1 
ATOM   2409 C CG  . ARG B  2 132 ? 83.970  84.538  172.946 1.00 199.78 ? 457 ARG B CG  1 
ATOM   2410 C CD  . ARG B  2 132 ? 85.036  83.449  172.934 1.00 204.48 ? 457 ARG B CD  1 
ATOM   2411 N NE  . ARG B  2 132 ? 84.881  82.538  174.067 1.00 208.39 ? 457 ARG B NE  1 
ATOM   2412 C CZ  . ARG B  2 132 ? 85.704  81.529  174.339 1.00 206.35 ? 457 ARG B CZ  1 
ATOM   2413 N NH1 . ARG B  2 132 ? 86.751  81.296  173.558 1.00 205.00 ? 457 ARG B NH1 1 
ATOM   2414 N NH2 . ARG B  2 132 ? 85.479  80.751  175.391 1.00 197.06 ? 457 ARG B NH2 1 
ATOM   2415 N N   . ASP B  2 133 ? 82.090  87.647  169.737 1.00 174.50 ? 458 ASP B N   1 
ATOM   2416 C CA  . ASP B  2 133 ? 82.161  88.438  168.512 1.00 180.99 ? 458 ASP B CA  1 
ATOM   2417 C C   . ASP B  2 133 ? 81.118  89.543  168.419 1.00 178.59 ? 458 ASP B C   1 
ATOM   2418 O O   . ASP B  2 133 ? 80.827  90.043  167.329 1.00 167.96 ? 458 ASP B O   1 
ATOM   2419 C CB  . ASP B  2 133 ? 82.048  87.527  167.289 1.00 194.83 ? 458 ASP B CB  1 
ATOM   2420 C CG  . ASP B  2 133 ? 83.221  86.575  167.162 1.00 201.43 ? 458 ASP B CG  1 
ATOM   2421 O OD1 . ASP B  2 133 ? 84.377  87.051  167.162 1.00 200.29 ? 458 ASP B OD1 1 
ATOM   2422 O OD2 . ASP B  2 133 ? 82.989  85.352  167.062 1.00 203.87 ? 458 ASP B OD2 1 
ATOM   2423 N N   . LYS B  2 134 ? 80.561  89.920  169.566 1.00 179.17 ? 459 LYS B N   1 
ATOM   2424 C CA  . LYS B  2 134 ? 79.561  90.978  169.629 1.00 172.89 ? 459 LYS B CA  1 
ATOM   2425 C C   . LYS B  2 134 ? 79.886  91.894  170.805 1.00 162.97 ? 459 LYS B C   1 
ATOM   2426 O O   . LYS B  2 134 ? 79.922  91.450  171.953 1.00 162.28 ? 459 LYS B O   1 
ATOM   2427 C CB  . LYS B  2 134 ? 78.155  90.385  169.808 1.00 185.27 ? 459 LYS B CB  1 
ATOM   2428 C CG  . LYS B  2 134 ? 77.680  89.492  168.663 1.00 197.97 ? 459 LYS B CG  1 
ATOM   2429 C CD  . LYS B  2 134 ? 76.254  88.985  168.892 1.00 192.64 ? 459 LYS B CD  1 
ATOM   2430 C CE  . LYS B  2 134 ? 75.783  88.106  167.737 1.00 188.98 ? 459 LYS B CE  1 
ATOM   2431 N NZ  . LYS B  2 134 ? 74.380  87.632  167.911 1.00 173.95 ? 459 LYS B NZ  1 
ATOM   2432 N N   . ARG B  2 135 ? 80.140  93.167  170.515 1.00 150.51 ? 460 ARG B N   1 
ATOM   2433 C CA  . ARG B  2 135 ? 80.444  94.141  171.561 1.00 136.36 ? 460 ARG B CA  1 
ATOM   2434 C C   . ARG B  2 135 ? 79.595  95.410  171.423 1.00 122.01 ? 460 ARG B C   1 
ATOM   2435 O O   . ARG B  2 135 ? 79.384  95.915  170.320 1.00 124.87 ? 460 ARG B O   1 
ATOM   2436 C CB  . ARG B  2 135 ? 81.942  94.468  171.566 1.00 134.57 ? 460 ARG B CB  1 
ATOM   2437 C CG  . ARG B  2 135 ? 82.793  93.307  172.076 1.00 141.50 ? 460 ARG B CG  1 
ATOM   2438 C CD  . ARG B  2 135 ? 84.209  93.727  172.454 1.00 144.62 ? 460 ARG B CD  1 
ATOM   2439 N NE  . ARG B  2 135 ? 84.924  92.645  173.130 1.00 153.34 ? 460 ARG B NE  1 
ATOM   2440 C CZ  . ARG B  2 135 ? 86.106  92.776  173.728 1.00 165.93 ? 460 ARG B CZ  1 
ATOM   2441 N NH1 . ARG B  2 135 ? 86.723  93.949  173.741 1.00 165.94 ? 460 ARG B NH1 1 
ATOM   2442 N NH2 . ARG B  2 135 ? 86.673  91.733  174.320 1.00 177.15 ? 460 ARG B NH2 1 
ATOM   2443 N N   . THR B  2 136 ? 79.124  95.914  172.562 1.00 100.84 ? 461 THR B N   1 
ATOM   2444 C CA  . THR B  2 136 ? 78.240  97.078  172.631 1.00 82.99  ? 461 THR B CA  1 
ATOM   2445 C C   . THR B  2 136 ? 78.845  98.467  172.849 1.00 70.21  ? 461 THR B C   1 
ATOM   2446 O O   . THR B  2 136 ? 79.691  98.647  173.719 1.00 64.70  ? 461 THR B O   1 
ATOM   2447 C CB  . THR B  2 136 ? 77.224  96.860  173.750 1.00 93.29  ? 461 THR B CB  1 
ATOM   2448 O OG1 . THR B  2 136 ? 76.775  95.499  173.711 1.00 103.89 ? 461 THR B OG1 1 
ATOM   2449 C CG2 . THR B  2 136 ? 76.037  97.804  173.597 1.00 84.59  ? 461 THR B CG2 1 
ATOM   2450 N N   . LEU B  2 137 ? 78.385  99.453  172.079 1.00 62.56  ? 462 LEU B N   1 
ATOM   2451 C CA  . LEU B  2 137 ? 78.869  100.827 172.229 1.00 82.25  ? 462 LEU B CA  1 
ATOM   2452 C C   . LEU B  2 137 ? 77.811  101.721 172.867 1.00 93.62  ? 462 LEU B C   1 
ATOM   2453 O O   . LEU B  2 137 ? 76.612  101.466 172.742 1.00 115.21 ? 462 LEU B O   1 
ATOM   2454 C CB  . LEU B  2 137 ? 79.268  101.446 170.885 1.00 76.02  ? 462 LEU B CB  1 
ATOM   2455 C CG  . LEU B  2 137 ? 80.510  100.946 170.147 1.00 74.07  ? 462 LEU B CG  1 
ATOM   2456 C CD1 . LEU B  2 137 ? 81.004  102.049 169.214 1.00 65.00  ? 462 LEU B CD1 1 
ATOM   2457 C CD2 . LEU B  2 137 ? 81.594  100.578 171.134 1.00 65.41  ? 462 LEU B CD2 1 
ATOM   2458 N N   . ALA B  2 138 ? 78.267  102.777 173.538 1.00 83.85  ? 463 ALA B N   1 
ATOM   2459 C CA  . ALA B  2 138 ? 77.385  103.730 174.207 1.00 79.13  ? 463 ALA B CA  1 
ATOM   2460 C C   . ALA B  2 138 ? 77.982  105.115 174.089 1.00 79.02  ? 463 ALA B C   1 
ATOM   2461 O O   . ALA B  2 138 ? 79.197  105.283 174.138 1.00 88.84  ? 463 ALA B O   1 
ATOM   2462 C CB  . ALA B  2 138 ? 77.231  103.369 175.655 1.00 81.78  ? 463 ALA B CB  1 
ATOM   2463 N N   . CYS B  2 139 ? 77.127  106.114 173.950 1.00 76.40  ? 464 CYS B N   1 
ATOM   2464 C CA  . CYS B  2 139 ? 77.599  107.476 173.795 1.00 75.79  ? 464 CYS B CA  1 
ATOM   2465 C C   . CYS B  2 139 ? 76.707  108.413 174.573 1.00 84.22  ? 464 CYS B C   1 
ATOM   2466 O O   . CYS B  2 139 ? 75.511  108.494 174.317 1.00 97.48  ? 464 CYS B O   1 
ATOM   2467 C CB  . CYS B  2 139 ? 77.580  107.839 172.322 1.00 67.89  ? 464 CYS B CB  1 
ATOM   2468 S SG  . CYS B  2 139 ? 78.259  109.457 171.871 1.00 99.49  ? 464 CYS B SG  1 
ATOM   2469 N N   . LEU B  2 140 ? 77.300  109.120 175.526 1.00 85.91  ? 465 LEU B N   1 
ATOM   2470 C CA  . LEU B  2 140 ? 76.568  110.055 176.368 1.00 76.75  ? 465 LEU B CA  1 
ATOM   2471 C C   . LEU B  2 140 ? 76.796  111.517 175.999 1.00 68.19  ? 465 LEU B C   1 
ATOM   2472 O O   . LEU B  2 140 ? 77.918  111.999 175.967 1.00 71.83  ? 465 LEU B O   1 
ATOM   2473 C CB  . LEU B  2 140 ? 76.945  109.819 177.827 1.00 57.16  ? 465 LEU B CB  1 
ATOM   2474 C CG  . LEU B  2 140 ? 76.704  110.946 178.820 1.00 53.40  ? 465 LEU B CG  1 
ATOM   2475 C CD1 . LEU B  2 140 ? 75.332  111.558 178.626 1.00 55.54  ? 465 LEU B CD1 1 
ATOM   2476 C CD2 . LEU B  2 140 ? 76.872  110.378 180.214 1.00 66.60  ? 465 LEU B CD2 1 
ATOM   2477 N N   . ILE B  2 141 ? 75.713  112.220 175.726 1.00 55.26  ? 466 ILE B N   1 
ATOM   2478 C CA  . ILE B  2 141 ? 75.794  113.617 175.367 1.00 66.42  ? 466 ILE B CA  1 
ATOM   2479 C C   . ILE B  2 141 ? 75.029  114.398 176.420 1.00 80.50  ? 466 ILE B C   1 
ATOM   2480 O O   . ILE B  2 141 ? 73.826  114.215 176.575 1.00 82.93  ? 466 ILE B O   1 
ATOM   2481 C CB  . ILE B  2 141 ? 75.174  113.839 173.997 1.00 66.42  ? 466 ILE B CB  1 
ATOM   2482 C CG1 . ILE B  2 141 ? 75.729  112.784 173.042 1.00 40.16  ? 466 ILE B CG1 1 
ATOM   2483 C CG2 . ILE B  2 141 ? 75.447  115.266 173.508 1.00 51.18  ? 466 ILE B CG2 1 
ATOM   2484 C CD1 . ILE B  2 141 ? 75.341  113.005 171.599 1.00 83.04  ? 466 ILE B CD1 1 
ATOM   2485 N N   . GLN B  2 142 ? 75.723  115.271 177.142 1.00 83.49  ? 467 GLN B N   1 
ATOM   2486 C CA  . GLN B  2 142 ? 75.072  116.033 178.195 1.00 71.49  ? 467 GLN B CA  1 
ATOM   2487 C C   . GLN B  2 142 ? 75.318  117.535 178.260 1.00 69.23  ? 467 GLN B C   1 
ATOM   2488 O O   . GLN B  2 142 ? 75.964  118.136 177.400 1.00 62.01  ? 467 GLN B O   1 
ATOM   2489 C CB  . GLN B  2 142 ? 75.418  115.422 179.552 1.00 54.88  ? 467 GLN B CB  1 
ATOM   2490 C CG  . GLN B  2 142 ? 76.895  115.224 179.783 1.00 79.07  ? 467 GLN B CG  1 
ATOM   2491 C CD  . GLN B  2 142 ? 77.217  114.845 181.222 1.00 100.66 ? 467 GLN B CD  1 
ATOM   2492 O OE1 . GLN B  2 142 ? 76.587  113.958 181.809 1.00 82.32  ? 467 GLN B OE1 1 
ATOM   2493 N NE2 . GLN B  2 142 ? 78.213  115.514 181.794 1.00 120.89 ? 467 GLN B NE2 1 
ATOM   2494 N N   . ASN B  2 143 ? 74.751  118.122 179.306 1.00 78.12  ? 468 ASN B N   1 
ATOM   2495 C CA  . ASN B  2 143 ? 74.855  119.537 179.600 1.00 81.34  ? 468 ASN B CA  1 
ATOM   2496 C C   . ASN B  2 143 ? 74.695  120.436 178.395 1.00 78.55  ? 468 ASN B C   1 
ATOM   2497 O O   . ASN B  2 143 ? 75.553  121.266 178.104 1.00 90.05  ? 468 ASN B O   1 
ATOM   2498 C CB  . ASN B  2 143 ? 76.182  119.806 180.295 1.00 96.97  ? 468 ASN B CB  1 
ATOM   2499 C CG  . ASN B  2 143 ? 76.430  118.848 181.444 1.00 117.41 ? 468 ASN B CG  1 
ATOM   2500 O OD1 . ASN B  2 143 ? 75.579  118.677 182.323 1.00 115.70 ? 468 ASN B OD1 1 
ATOM   2501 N ND2 . ASN B  2 143 ? 77.598  118.211 181.442 1.00 124.22 ? 468 ASN B ND2 1 
ATOM   2502 N N   . PHE B  2 144 ? 73.582  120.273 177.696 1.00 67.47  ? 469 PHE B N   1 
ATOM   2503 C CA  . PHE B  2 144 ? 73.314  121.103 176.537 1.00 67.80  ? 469 PHE B CA  1 
ATOM   2504 C C   . PHE B  2 144 ? 71.917  121.672 176.618 1.00 66.70  ? 469 PHE B C   1 
ATOM   2505 O O   . PHE B  2 144 ? 71.106  121.247 177.450 1.00 58.23  ? 469 PHE B O   1 
ATOM   2506 C CB  . PHE B  2 144 ? 73.459  120.295 175.246 1.00 74.52  ? 469 PHE B CB  1 
ATOM   2507 C CG  . PHE B  2 144 ? 72.531  119.107 175.155 1.00 90.33  ? 469 PHE B CG  1 
ATOM   2508 C CD1 . PHE B  2 144 ? 71.424  119.130 174.306 1.00 82.93  ? 469 PHE B CD1 1 
ATOM   2509 C CD2 . PHE B  2 144 ? 72.781  117.952 175.895 1.00 87.91  ? 469 PHE B CD2 1 
ATOM   2510 C CE1 . PHE B  2 144 ? 70.593  118.026 174.192 1.00 88.89  ? 469 PHE B CE1 1 
ATOM   2511 C CE2 . PHE B  2 144 ? 71.946  116.838 175.785 1.00 67.50  ? 469 PHE B CE2 1 
ATOM   2512 C CZ  . PHE B  2 144 ? 70.855  116.877 174.934 1.00 88.19  ? 469 PHE B CZ  1 
ATOM   2513 N N   . MET B  2 145 ? 71.650  122.640 175.748 1.00 50.07  ? 470 MET B N   1 
ATOM   2514 C CA  . MET B  2 145 ? 70.344  123.287 175.681 1.00 60.34  ? 470 MET B CA  1 
ATOM   2515 C C   . MET B  2 145 ? 70.355  124.265 174.524 1.00 60.99  ? 470 MET B C   1 
ATOM   2516 O O   . MET B  2 145 ? 71.359  124.924 174.279 1.00 61.78  ? 470 MET B O   1 
ATOM   2517 C CB  . MET B  2 145 ? 70.018  123.983 177.000 1.00 91.63  ? 470 MET B CB  1 
ATOM   2518 C CG  . MET B  2 145 ? 71.139  124.822 177.586 1.00 115.09 ? 470 MET B CG  1 
ATOM   2519 S SD  . MET B  2 145 ? 71.008  124.868 179.393 1.00 137.45 ? 470 MET B SD  1 
ATOM   2520 C CE  . MET B  2 145 ? 69.604  125.930 179.600 1.00 147.15 ? 470 MET B CE  1 
ATOM   2521 N N   . PRO B  2 146 ? 69.224  124.398 173.803 1.00 73.55  ? 471 PRO B N   1 
ATOM   2522 C CA  . PRO B  2 146 ? 67.936  123.696 173.918 1.00 83.09  ? 471 PRO B CA  1 
ATOM   2523 C C   . PRO B  2 146 ? 68.028  122.180 173.923 1.00 92.01  ? 471 PRO B C   1 
ATOM   2524 O O   . PRO B  2 146 ? 69.116  121.612 173.879 1.00 106.29 ? 471 PRO B O   1 
ATOM   2525 C CB  . PRO B  2 146 ? 67.159  124.210 172.709 1.00 79.90  ? 471 PRO B CB  1 
ATOM   2526 C CG  . PRO B  2 146 ? 67.714  125.581 172.516 1.00 87.48  ? 471 PRO B CG  1 
ATOM   2527 C CD  . PRO B  2 146 ? 69.191  125.344 172.677 1.00 72.75  ? 471 PRO B CD  1 
ATOM   2528 N N   . GLU B  2 147 ? 66.879  121.518 173.962 1.00 93.47  ? 472 GLU B N   1 
ATOM   2529 C CA  . GLU B  2 147 ? 66.873  120.070 173.975 1.00 99.23  ? 472 GLU B CA  1 
ATOM   2530 C C   . GLU B  2 147 ? 66.878  119.472 172.575 1.00 96.12  ? 472 GLU B C   1 
ATOM   2531 O O   . GLU B  2 147 ? 67.002  118.258 172.429 1.00 100.49 ? 472 GLU B O   1 
ATOM   2532 C CB  . GLU B  2 147 ? 65.665  119.551 174.757 1.00 120.05 ? 472 GLU B CB  1 
ATOM   2533 C CG  . GLU B  2 147 ? 64.326  120.100 174.287 1.00 148.25 ? 472 GLU B CG  1 
ATOM   2534 C CD  . GLU B  2 147 ? 63.145  119.321 174.848 1.00 162.69 ? 472 GLU B CD  1 
ATOM   2535 O OE1 . GLU B  2 147 ? 63.088  119.123 176.083 1.00 168.57 ? 472 GLU B OE1 1 
ATOM   2536 O OE2 . GLU B  2 147 ? 62.272  118.908 174.053 1.00 173.92 ? 472 GLU B OE2 1 
ATOM   2537 N N   . ASP B  2 148 ? 66.748  120.310 171.548 1.00 85.26  ? 473 ASP B N   1 
ATOM   2538 C CA  . ASP B  2 148 ? 66.747  119.812 170.168 1.00 94.74  ? 473 ASP B CA  1 
ATOM   2539 C C   . ASP B  2 148 ? 68.118  119.302 169.725 1.00 90.61  ? 473 ASP B C   1 
ATOM   2540 O O   . ASP B  2 148 ? 69.002  120.089 169.380 1.00 78.96  ? 473 ASP B O   1 
ATOM   2541 C CB  . ASP B  2 148 ? 66.278  120.901 169.206 1.00 108.58 ? 473 ASP B CB  1 
ATOM   2542 C CG  . ASP B  2 148 ? 64.829  121.247 169.396 1.00 118.38 ? 473 ASP B CG  1 
ATOM   2543 O OD1 . ASP B  2 148 ? 64.004  120.313 169.448 1.00 138.85 ? 473 ASP B OD1 1 
ATOM   2544 O OD2 . ASP B  2 148 ? 64.511  122.446 169.486 1.00 124.95 ? 473 ASP B OD2 1 
ATOM   2545 N N   . ILE B  2 149 ? 68.283  117.982 169.704 1.00 84.19  ? 474 ILE B N   1 
ATOM   2546 C CA  . ILE B  2 149 ? 69.559  117.388 169.332 1.00 69.02  ? 474 ILE B CA  1 
ATOM   2547 C C   . ILE B  2 149 ? 69.446  116.217 168.360 1.00 77.41  ? 474 ILE B C   1 
ATOM   2548 O O   . ILE B  2 149 ? 68.513  115.412 168.436 1.00 83.74  ? 474 ILE B O   1 
ATOM   2549 C CB  . ILE B  2 149 ? 70.315  116.903 170.597 1.00 68.77  ? 474 ILE B CB  1 
ATOM   2550 C CG1 . ILE B  2 149 ? 71.798  116.740 170.301 1.00 73.36  ? 474 ILE B CG1 1 
ATOM   2551 C CG2 . ILE B  2 149 ? 69.789  115.557 171.052 1.00 52.96  ? 474 ILE B CG2 1 
ATOM   2552 C CD1 . ILE B  2 149 ? 72.587  116.274 171.507 1.00 82.77  ? 474 ILE B CD1 1 
ATOM   2553 N N   . SER B  2 150 ? 70.410  116.134 167.448 1.00 75.51  ? 475 SER B N   1 
ATOM   2554 C CA  . SER B  2 150 ? 70.478  115.057 166.464 1.00 65.47  ? 475 SER B CA  1 
ATOM   2555 C C   . SER B  2 150 ? 71.758  114.239 166.657 1.00 58.95  ? 475 SER B C   1 
ATOM   2556 O O   . SER B  2 150 ? 72.857  114.708 166.371 1.00 71.47  ? 475 SER B O   1 
ATOM   2557 C CB  . SER B  2 150 ? 70.451  115.624 165.044 1.00 50.60  ? 475 SER B CB  1 
ATOM   2558 O OG  . SER B  2 150 ? 69.152  115.552 164.488 1.00 85.65  ? 475 SER B OG  1 
ATOM   2559 N N   . VAL B  2 151 ? 71.611  113.020 167.154 1.00 51.46  ? 476 VAL B N   1 
ATOM   2560 C CA  . VAL B  2 151 ? 72.746  112.127 167.364 1.00 58.56  ? 476 VAL B CA  1 
ATOM   2561 C C   . VAL B  2 151 ? 72.884  111.219 166.133 1.00 84.01  ? 476 VAL B C   1 
ATOM   2562 O O   . VAL B  2 151 ? 71.938  111.062 165.354 1.00 99.97  ? 476 VAL B O   1 
ATOM   2563 C CB  . VAL B  2 151 ? 72.522  111.246 168.605 1.00 56.33  ? 476 VAL B CB  1 
ATOM   2564 C CG1 . VAL B  2 151 ? 73.590  110.197 168.732 1.00 54.47  ? 476 VAL B CG1 1 
ATOM   2565 C CG2 . VAL B  2 151 ? 72.520  112.094 169.816 1.00 88.23  ? 476 VAL B CG2 1 
ATOM   2566 N N   . GLN B  2 152 ? 74.065  110.632 165.961 1.00 85.91  ? 477 GLN B N   1 
ATOM   2567 C CA  . GLN B  2 152 ? 74.340  109.725 164.850 1.00 76.74  ? 477 GLN B CA  1 
ATOM   2568 C C   . GLN B  2 152 ? 75.712  109.077 164.987 1.00 74.88  ? 477 GLN B C   1 
ATOM   2569 O O   . GLN B  2 152 ? 76.433  109.318 165.946 1.00 74.40  ? 477 GLN B O   1 
ATOM   2570 C CB  . GLN B  2 152 ? 74.256  110.474 163.530 1.00 71.34  ? 477 GLN B CB  1 
ATOM   2571 C CG  . GLN B  2 152 ? 75.039  111.750 163.500 1.00 60.64  ? 477 GLN B CG  1 
ATOM   2572 C CD  . GLN B  2 152 ? 74.806  112.507 162.215 1.00 103.61 ? 477 GLN B CD  1 
ATOM   2573 O OE1 . GLN B  2 152 ? 73.664  112.831 161.874 1.00 107.45 ? 477 GLN B OE1 1 
ATOM   2574 N NE2 . GLN B  2 152 ? 75.884  112.792 161.487 1.00 111.59 ? 477 GLN B NE2 1 
ATOM   2575 N N   . TRP B  2 153 ? 76.071  108.231 164.038 1.00 74.28  ? 478 TRP B N   1 
ATOM   2576 C CA  . TRP B  2 153 ? 77.371  107.594 164.114 1.00 68.74  ? 478 TRP B CA  1 
ATOM   2577 C C   . TRP B  2 153 ? 78.063  107.529 162.771 1.00 79.06  ? 478 TRP B C   1 
ATOM   2578 O O   . TRP B  2 153 ? 77.417  107.546 161.726 1.00 102.07 ? 478 TRP B O   1 
ATOM   2579 C CB  . TRP B  2 153 ? 77.254  106.181 164.656 1.00 44.97  ? 478 TRP B CB  1 
ATOM   2580 C CG  . TRP B  2 153 ? 76.687  106.064 166.023 1.00 43.90  ? 478 TRP B CG  1 
ATOM   2581 C CD1 . TRP B  2 153 ? 75.371  106.032 166.355 1.00 57.04  ? 478 TRP B CD1 1 
ATOM   2582 C CD2 . TRP B  2 153 ? 77.409  105.759 167.220 1.00 52.76  ? 478 TRP B CD2 1 
ATOM   2583 N NE1 . TRP B  2 153 ? 75.222  105.702 167.676 1.00 68.47  ? 478 TRP B NE1 1 
ATOM   2584 C CE2 . TRP B  2 153 ? 76.461  105.528 168.231 1.00 62.97  ? 478 TRP B CE2 1 
ATOM   2585 C CE3 . TRP B  2 153 ? 78.767  105.646 167.531 1.00 66.51  ? 478 TRP B CE3 1 
ATOM   2586 C CZ2 . TRP B  2 153 ? 76.824  105.184 169.534 1.00 75.03  ? 478 TRP B CZ2 1 
ATOM   2587 C CZ3 . TRP B  2 153 ? 79.129  105.302 168.828 1.00 76.60  ? 478 TRP B CZ3 1 
ATOM   2588 C CH2 . TRP B  2 153 ? 78.159  105.074 169.812 1.00 70.32  ? 478 TRP B CH2 1 
ATOM   2589 N N   . LEU B  2 154 ? 79.387  107.450 162.811 1.00 70.53  ? 479 LEU B N   1 
ATOM   2590 C CA  . LEU B  2 154 ? 80.171  107.362 161.597 1.00 77.72  ? 479 LEU B CA  1 
ATOM   2591 C C   . LEU B  2 154 ? 81.081  106.160 161.743 1.00 89.47  ? 479 LEU B C   1 
ATOM   2592 O O   . LEU B  2 154 ? 81.316  105.695 162.856 1.00 78.94  ? 479 LEU B O   1 
ATOM   2593 C CB  . LEU B  2 154 ? 80.982  108.634 161.420 1.00 82.35  ? 479 LEU B CB  1 
ATOM   2594 C CG  . LEU B  2 154 ? 80.135  109.894 161.606 1.00 88.16  ? 479 LEU B CG  1 
ATOM   2595 C CD1 . LEU B  2 154 ? 81.024  111.119 161.500 1.00 112.07 ? 479 LEU B CD1 1 
ATOM   2596 C CD2 . LEU B  2 154 ? 79.031  109.939 160.564 1.00 97.32  ? 479 LEU B CD2 1 
ATOM   2597 N N   . HIS B  2 155 ? 81.582  105.652 160.621 1.00 104.75 ? 480 HIS B N   1 
ATOM   2598 C CA  . HIS B  2 155 ? 82.460  104.487 160.635 1.00 103.34 ? 480 HIS B CA  1 
ATOM   2599 C C   . HIS B  2 155 ? 83.186  104.348 159.316 1.00 90.63  ? 480 HIS B C   1 
ATOM   2600 O O   . HIS B  2 155 ? 82.657  103.811 158.351 1.00 84.52  ? 480 HIS B O   1 
ATOM   2601 C CB  . HIS B  2 155 ? 81.646  103.225 160.911 1.00 109.94 ? 480 HIS B CB  1 
ATOM   2602 C CG  . HIS B  2 155 ? 82.423  101.954 160.772 1.00 107.83 ? 480 HIS B CG  1 
ATOM   2603 N ND1 . HIS B  2 155 ? 83.644  101.759 161.379 1.00 96.60  ? 480 HIS B ND1 1 
ATOM   2604 C CD2 . HIS B  2 155 ? 82.120  100.790 160.152 1.00 114.12 ? 480 HIS B CD2 1 
ATOM   2605 C CE1 . HIS B  2 155 ? 84.057  100.527 161.144 1.00 107.59 ? 480 HIS B CE1 1 
ATOM   2606 N NE2 . HIS B  2 155 ? 83.151  99.917  160.402 1.00 114.08 ? 480 HIS B NE2 1 
ATOM   2607 N N   . ASN B  2 156 ? 84.406  104.846 159.275 1.00 96.09  ? 481 ASN B N   1 
ATOM   2608 C CA  . ASN B  2 156 ? 85.181  104.760 158.059 1.00 102.08 ? 481 ASN B CA  1 
ATOM   2609 C C   . ASN B  2 156 ? 84.527  105.608 156.973 1.00 88.89  ? 481 ASN B C   1 
ATOM   2610 O O   . ASN B  2 156 ? 84.388  105.183 155.836 1.00 85.70  ? 481 ASN B O   1 
ATOM   2611 C CB  . ASN B  2 156 ? 85.276  103.302 157.612 1.00 104.13 ? 481 ASN B CB  1 
ATOM   2612 C CG  . ASN B  2 156 ? 86.518  103.023 156.817 1.00 118.17 ? 481 ASN B CG  1 
ATOM   2613 O OD1 . ASN B  2 156 ? 86.812  101.876 156.498 1.00 118.92 ? 481 ASN B OD1 1 
ATOM   2614 N ND2 . ASN B  2 156 ? 87.262  104.075 156.488 1.00 135.27 ? 481 ASN B ND2 1 
ATOM   2615 N N   . GLU B  2 157 ? 84.126  106.814 157.345 1.00 91.82  ? 482 GLU B N   1 
ATOM   2616 C CA  . GLU B  2 157 ? 83.512  107.746 156.415 1.00 102.74 ? 482 GLU B CA  1 
ATOM   2617 C C   . GLU B  2 157 ? 82.130  107.277 155.969 1.00 92.26  ? 482 GLU B C   1 
ATOM   2618 O O   . GLU B  2 157 ? 81.647  107.661 154.902 1.00 78.35  ? 482 GLU B O   1 
ATOM   2619 C CB  . GLU B  2 157 ? 84.424  107.940 155.198 1.00 110.37 ? 482 GLU B CB  1 
ATOM   2620 C CG  . GLU B  2 157 ? 85.873  108.306 155.542 1.00 129.30 ? 482 GLU B CG  1 
ATOM   2621 C CD  . GLU B  2 157 ? 86.012  109.651 156.248 1.00 148.79 ? 482 GLU B CD  1 
ATOM   2622 O OE1 . GLU B  2 157 ? 85.641  110.686 155.650 1.00 156.23 ? 482 GLU B OE1 1 
ATOM   2623 O OE2 . GLU B  2 157 ? 86.497  109.672 157.401 1.00 151.93 ? 482 GLU B OE2 1 
ATOM   2624 N N   . VAL B  2 158 ? 81.490  106.457 156.795 1.00 85.72  ? 483 VAL B N   1 
ATOM   2625 C CA  . VAL B  2 158 ? 80.164  105.948 156.472 1.00 96.30  ? 483 VAL B CA  1 
ATOM   2626 C C   . VAL B  2 158 ? 79.140  106.250 157.562 1.00 103.31 ? 483 VAL B C   1 
ATOM   2627 O O   . VAL B  2 158 ? 79.184  105.661 158.640 1.00 113.24 ? 483 VAL B O   1 
ATOM   2628 C CB  . VAL B  2 158 ? 80.210  104.427 156.245 1.00 109.19 ? 483 VAL B CB  1 
ATOM   2629 C CG1 . VAL B  2 158 ? 78.813  103.869 156.069 1.00 110.85 ? 483 VAL B CG1 1 
ATOM   2630 C CG2 . VAL B  2 158 ? 81.050  104.125 155.022 1.00 138.58 ? 483 VAL B CG2 1 
ATOM   2631 N N   . GLN B  2 159 ? 78.214  107.164 157.276 1.00 98.60  ? 484 GLN B N   1 
ATOM   2632 C CA  . GLN B  2 159 ? 77.165  107.533 158.231 1.00 77.18  ? 484 GLN B CA  1 
ATOM   2633 C C   . GLN B  2 159 ? 76.177  106.385 158.392 1.00 63.19  ? 484 GLN B C   1 
ATOM   2634 O O   . GLN B  2 159 ? 75.234  106.268 157.616 1.00 77.85  ? 484 GLN B O   1 
ATOM   2635 C CB  . GLN B  2 159 ? 76.416  108.768 157.735 1.00 94.30  ? 484 GLN B CB  1 
ATOM   2636 C CG  . GLN B  2 159 ? 75.352  109.285 158.681 1.00 95.86  ? 484 GLN B CG  1 
ATOM   2637 C CD  . GLN B  2 159 ? 74.564  110.423 158.077 1.00 105.02 ? 484 GLN B CD  1 
ATOM   2638 O OE1 . GLN B  2 159 ? 75.132  111.338 157.474 1.00 92.61  ? 484 GLN B OE1 1 
ATOM   2639 N NE2 . GLN B  2 159 ? 73.248  110.378 158.238 1.00 113.84 ? 484 GLN B NE2 1 
ATOM   2640 N N   . LEU B  2 160 ? 76.386  105.553 159.408 1.00 43.85  ? 485 LEU B N   1 
ATOM   2641 C CA  . LEU B  2 160 ? 75.529  104.401 159.636 1.00 58.11  ? 485 LEU B CA  1 
ATOM   2642 C C   . LEU B  2 160 ? 74.025  104.629 159.534 1.00 73.75  ? 485 LEU B C   1 
ATOM   2643 O O   . LEU B  2 160 ? 73.537  105.746 159.679 1.00 83.17  ? 485 LEU B O   1 
ATOM   2644 C CB  . LEU B  2 160 ? 75.859  103.754 160.976 1.00 64.48  ? 485 LEU B CB  1 
ATOM   2645 C CG  . LEU B  2 160 ? 77.220  103.068 161.101 1.00 60.74  ? 485 LEU B CG  1 
ATOM   2646 C CD1 . LEU B  2 160 ? 77.171  102.084 162.246 1.00 44.82  ? 485 LEU B CD1 1 
ATOM   2647 C CD2 . LEU B  2 160 ? 77.554  102.325 159.813 1.00 91.95  ? 485 LEU B CD2 1 
ATOM   2648 N N   . PRO B  2 161 ? 73.271  103.551 159.266 1.00 79.71  ? 486 PRO B N   1 
ATOM   2649 C CA  . PRO B  2 161 ? 71.819  103.570 159.127 1.00 85.48  ? 486 PRO B CA  1 
ATOM   2650 C C   . PRO B  2 161 ? 71.154  103.952 160.433 1.00 88.39  ? 486 PRO B C   1 
ATOM   2651 O O   . PRO B  2 161 ? 71.429  103.370 161.481 1.00 80.87  ? 486 PRO B O   1 
ATOM   2652 C CB  . PRO B  2 161 ? 71.492  102.137 158.712 1.00 103.16 ? 486 PRO B CB  1 
ATOM   2653 C CG  . PRO B  2 161 ? 72.729  101.692 158.018 1.00 115.49 ? 486 PRO B CG  1 
ATOM   2654 C CD  . PRO B  2 161 ? 73.794  102.217 158.934 1.00 103.93 ? 486 PRO B CD  1 
ATOM   2655 N N   . ASP B  2 162 ? 70.268  104.932 160.359 1.00 88.49  ? 487 ASP B N   1 
ATOM   2656 C CA  . ASP B  2 162 ? 69.560  105.398 161.533 1.00 87.13  ? 487 ASP B CA  1 
ATOM   2657 C C   . ASP B  2 162 ? 69.014  104.240 162.374 1.00 71.78  ? 487 ASP B C   1 
ATOM   2658 O O   . ASP B  2 162 ? 69.085  104.269 163.596 1.00 75.49  ? 487 ASP B O   1 
ATOM   2659 C CB  . ASP B  2 162 ? 68.424  106.329 161.097 1.00 113.51 ? 487 ASP B CB  1 
ATOM   2660 C CG  . ASP B  2 162 ? 68.070  107.347 162.155 1.00 136.02 ? 487 ASP B CG  1 
ATOM   2661 O OD1 . ASP B  2 162 ? 67.549  106.946 163.217 1.00 150.09 ? 487 ASP B OD1 1 
ATOM   2662 O OD2 . ASP B  2 162 ? 68.322  108.549 161.926 1.00 144.93 ? 487 ASP B OD2 1 
ATOM   2663 N N   . ALA B  2 163 ? 68.492  103.210 161.721 1.00 70.52  ? 488 ALA B N   1 
ATOM   2664 C CA  . ALA B  2 163 ? 67.910  102.073 162.432 1.00 79.23  ? 488 ALA B CA  1 
ATOM   2665 C C   . ALA B  2 163 ? 68.921  101.189 163.143 1.00 69.51  ? 488 ALA B C   1 
ATOM   2666 O O   . ALA B  2 163 ? 68.563  100.164 163.722 1.00 69.94  ? 488 ALA B O   1 
ATOM   2667 C CB  . ALA B  2 163 ? 67.073  101.232 161.463 1.00 98.84  ? 488 ALA B CB  1 
ATOM   2668 N N   . ARG B  2 164 ? 70.180  101.599 163.122 1.00 61.29  ? 489 ARG B N   1 
ATOM   2669 C CA  . ARG B  2 164 ? 71.245  100.817 163.739 1.00 77.35  ? 489 ARG B CA  1 
ATOM   2670 C C   . ARG B  2 164 ? 71.432  101.066 165.219 1.00 77.89  ? 489 ARG B C   1 
ATOM   2671 O O   . ARG B  2 164 ? 71.773  100.153 165.972 1.00 73.99  ? 489 ARG B O   1 
ATOM   2672 C CB  . ARG B  2 164 ? 72.562  101.088 163.014 1.00 96.15  ? 489 ARG B CB  1 
ATOM   2673 C CG  . ARG B  2 164 ? 72.771  100.227 161.785 1.00 105.59 ? 489 ARG B CG  1 
ATOM   2674 C CD  . ARG B  2 164 ? 73.469  98.935  162.162 1.00 103.18 ? 489 ARG B CD  1 
ATOM   2675 N NE  . ARG B  2 164 ? 74.904  99.013  161.904 1.00 101.49 ? 489 ARG B NE  1 
ATOM   2676 C CZ  . ARG B  2 164 ? 75.803  98.212  162.459 1.00 103.35 ? 489 ARG B CZ  1 
ATOM   2677 N NH1 . ARG B  2 164 ? 75.418  97.273  163.311 1.00 96.03  ? 489 ARG B NH1 1 
ATOM   2678 N NH2 . ARG B  2 164 ? 77.084  98.345  162.157 1.00 95.32  ? 489 ARG B NH2 1 
ATOM   2679 N N   . HIS B  2 165 ? 71.205  102.308 165.631 1.00 83.88  ? 490 HIS B N   1 
ATOM   2680 C CA  . HIS B  2 165 ? 71.377  102.703 167.023 1.00 77.38  ? 490 HIS B CA  1 
ATOM   2681 C C   . HIS B  2 165 ? 70.086  103.134 167.690 1.00 84.03  ? 490 HIS B C   1 
ATOM   2682 O O   . HIS B  2 165 ? 69.136  103.545 167.028 1.00 78.27  ? 490 HIS B O   1 
ATOM   2683 C CB  . HIS B  2 165 ? 72.359  103.863 167.106 1.00 57.15  ? 490 HIS B CB  1 
ATOM   2684 C CG  . HIS B  2 165 ? 71.883  105.094 166.405 1.00 51.79  ? 490 HIS B CG  1 
ATOM   2685 N ND1 . HIS B  2 165 ? 72.493  105.592 165.276 1.00 66.61  ? 490 HIS B ND1 1 
ATOM   2686 C CD2 . HIS B  2 165 ? 70.847  105.924 166.669 1.00 73.07  ? 490 HIS B CD2 1 
ATOM   2687 C CE1 . HIS B  2 165 ? 71.855  106.678 164.874 1.00 78.35  ? 490 HIS B CE1 1 
ATOM   2688 N NE2 . HIS B  2 165 ? 70.852  106.901 165.703 1.00 92.48  ? 490 HIS B NE2 1 
ATOM   2689 N N   . SER B  2 166 ? 70.072  103.056 169.017 1.00 97.26  ? 491 SER B N   1 
ATOM   2690 C CA  . SER B  2 166 ? 68.915  103.461 169.801 1.00 96.03  ? 491 SER B CA  1 
ATOM   2691 C C   . SER B  2 166 ? 69.295  104.683 170.624 1.00 84.37  ? 491 SER B C   1 
ATOM   2692 O O   . SER B  2 166 ? 70.209  104.630 171.439 1.00 68.71  ? 491 SER B O   1 
ATOM   2693 C CB  . SER B  2 166 ? 68.477  102.333 170.737 1.00 93.44  ? 491 SER B CB  1 
ATOM   2694 O OG  . SER B  2 166 ? 67.305  102.703 171.444 1.00 124.17 ? 491 SER B OG  1 
ATOM   2695 N N   . THR B  2 167 ? 68.600  105.790 170.402 1.00 92.18  ? 492 THR B N   1 
ATOM   2696 C CA  . THR B  2 167 ? 68.874  107.011 171.149 1.00 92.00  ? 492 THR B CA  1 
ATOM   2697 C C   . THR B  2 167 ? 67.666  107.370 172.002 1.00 96.05  ? 492 THR B C   1 
ATOM   2698 O O   . THR B  2 167 ? 66.532  107.352 171.523 1.00 106.82 ? 492 THR B O   1 
ATOM   2699 C CB  . THR B  2 167 ? 69.182  108.171 170.208 1.00 98.64  ? 492 THR B CB  1 
ATOM   2700 O OG1 . THR B  2 167 ? 70.431  107.927 169.553 1.00 98.62  ? 492 THR B OG1 1 
ATOM   2701 C CG2 . THR B  2 167 ? 69.260  109.473 170.978 1.00 95.79  ? 492 THR B CG2 1 
ATOM   2702 N N   . THR B  2 168 ? 67.907  107.702 173.266 1.00 82.43  ? 493 THR B N   1 
ATOM   2703 C CA  . THR B  2 168 ? 66.809  108.036 174.159 1.00 81.90  ? 493 THR B CA  1 
ATOM   2704 C C   . THR B  2 168 ? 66.315  109.457 173.978 1.00 84.53  ? 493 THR B C   1 
ATOM   2705 O O   . THR B  2 168 ? 66.765  110.190 173.102 1.00 69.99  ? 493 THR B O   1 
ATOM   2706 C CB  . THR B  2 168 ? 67.188  107.882 175.635 1.00 80.53  ? 493 THR B CB  1 
ATOM   2707 O OG1 . THR B  2 168 ? 68.008  108.984 176.019 1.00 61.16  ? 493 THR B OG1 1 
ATOM   2708 C CG2 . THR B  2 168 ? 67.929  106.576 175.874 1.00 85.22  ? 493 THR B CG2 1 
ATOM   2709 N N   . GLN B  2 169 ? 65.365  109.834 174.820 1.00 95.53  ? 494 GLN B N   1 
ATOM   2710 C CA  . GLN B  2 169 ? 64.806  111.166 174.769 1.00 93.57  ? 494 GLN B CA  1 
ATOM   2711 C C   . GLN B  2 169 ? 65.498  112.012 175.833 1.00 93.41  ? 494 GLN B C   1 
ATOM   2712 O O   . GLN B  2 169 ? 65.869  111.509 176.900 1.00 100.61 ? 494 GLN B O   1 
ATOM   2713 C CB  . GLN B  2 169 ? 63.296  111.115 175.033 1.00 101.82 ? 494 GLN B CB  1 
ATOM   2714 C CG  . GLN B  2 169 ? 62.486  110.334 174.005 1.00 124.19 ? 494 GLN B CG  1 
ATOM   2715 C CD  . GLN B  2 169 ? 62.660  110.860 172.584 1.00 138.25 ? 494 GLN B CD  1 
ATOM   2716 O OE1 . GLN B  2 169 ? 62.652  112.070 172.350 1.00 137.49 ? 494 GLN B OE1 1 
ATOM   2717 N NE2 . GLN B  2 169 ? 62.804  109.947 171.627 1.00 144.62 ? 494 GLN B NE2 1 
ATOM   2718 N N   . PRO B  2 170 ? 65.697  113.309 175.547 1.00 80.13  ? 495 PRO B N   1 
ATOM   2719 C CA  . PRO B  2 170 ? 66.342  114.240 176.470 1.00 69.21  ? 495 PRO B CA  1 
ATOM   2720 C C   . PRO B  2 170 ? 65.742  114.186 177.867 1.00 83.87  ? 495 PRO B C   1 
ATOM   2721 O O   . PRO B  2 170 ? 64.558  113.914 178.039 1.00 97.33  ? 495 PRO B O   1 
ATOM   2722 C CB  . PRO B  2 170 ? 66.109  115.583 175.802 1.00 52.95  ? 495 PRO B CB  1 
ATOM   2723 C CG  . PRO B  2 170 ? 66.235  115.239 174.363 1.00 55.49  ? 495 PRO B CG  1 
ATOM   2724 C CD  . PRO B  2 170 ? 65.416  113.972 174.261 1.00 70.30  ? 495 PRO B CD  1 
ATOM   2725 N N   . ARG B  2 171 ? 66.580  114.437 178.862 1.00 99.99  ? 496 ARG B N   1 
ATOM   2726 C CA  . ARG B  2 171 ? 66.166  114.445 180.257 1.00 111.97 ? 496 ARG B CA  1 
ATOM   2727 C C   . ARG B  2 171 ? 66.963  115.549 180.944 1.00 113.63 ? 496 ARG B C   1 
ATOM   2728 O O   . ARG B  2 171 ? 68.121  115.798 180.597 1.00 107.68 ? 496 ARG B O   1 
ATOM   2729 C CB  . ARG B  2 171 ? 66.434  113.080 180.902 1.00 118.32 ? 496 ARG B CB  1 
ATOM   2730 C CG  . ARG B  2 171 ? 65.366  112.031 180.599 1.00 133.60 ? 496 ARG B CG  1 
ATOM   2731 C CD  . ARG B  2 171 ? 65.774  110.643 181.091 1.00 150.62 ? 496 ARG B CD  1 
ATOM   2732 N NE  . ARG B  2 171 ? 64.643  109.715 181.137 1.00 174.86 ? 496 ARG B NE  1 
ATOM   2733 C CZ  . ARG B  2 171 ? 63.715  109.707 182.092 1.00 181.16 ? 496 ARG B CZ  1 
ATOM   2734 N NH1 . ARG B  2 171 ? 63.779  110.578 183.092 1.00 184.73 ? 496 ARG B NH1 1 
ATOM   2735 N NH2 . ARG B  2 171 ? 62.717  108.832 182.044 1.00 178.98 ? 496 ARG B NH2 1 
ATOM   2736 N N   . LYS B  2 172 ? 66.341  116.220 181.907 1.00 116.17 ? 497 LYS B N   1 
ATOM   2737 C CA  . LYS B  2 172 ? 66.999  117.318 182.601 1.00 111.31 ? 497 LYS B CA  1 
ATOM   2738 C C   . LYS B  2 172 ? 68.005  116.876 183.649 1.00 109.88 ? 497 LYS B C   1 
ATOM   2739 O O   . LYS B  2 172 ? 67.966  115.743 184.129 1.00 102.49 ? 497 LYS B O   1 
ATOM   2740 C CB  . LYS B  2 172 ? 65.955  118.224 183.252 1.00 117.30 ? 497 LYS B CB  1 
ATOM   2741 C CG  . LYS B  2 172 ? 64.939  118.793 182.278 1.00 130.07 ? 497 LYS B CG  1 
ATOM   2742 C CD  . LYS B  2 172 ? 63.952  119.718 182.976 1.00 143.61 ? 497 LYS B CD  1 
ATOM   2743 C CE  . LYS B  2 172 ? 62.907  120.251 182.003 1.00 148.14 ? 497 LYS B CE  1 
ATOM   2744 N NZ  . LYS B  2 172 ? 61.957  121.204 182.648 1.00 142.56 ? 497 LYS B NZ  1 
ATOM   2745 N N   . THR B  2 173 ? 68.906  117.792 183.993 1.00 120.18 ? 498 THR B N   1 
ATOM   2746 C CA  . THR B  2 173 ? 69.940  117.543 184.989 1.00 131.66 ? 498 THR B CA  1 
ATOM   2747 C C   . THR B  2 173 ? 69.995  118.681 186.008 1.00 142.83 ? 498 THR B C   1 
ATOM   2748 O O   . THR B  2 173 ? 69.507  119.788 185.754 1.00 131.31 ? 498 THR B O   1 
ATOM   2749 C CB  . THR B  2 173 ? 71.330  117.388 184.326 1.00 126.39 ? 498 THR B CB  1 
ATOM   2750 O OG1 . THR B  2 173 ? 71.571  118.479 183.426 1.00 104.11 ? 498 THR B OG1 1 
ATOM   2751 C CG2 . THR B  2 173 ? 71.398  116.094 183.555 1.00 133.05 ? 498 THR B CG2 1 
ATOM   2752 N N   . LYS B  2 174 ? 70.589  118.405 187.164 1.00 149.72 ? 499 LYS B N   1 
ATOM   2753 C CA  . LYS B  2 174 ? 70.701  119.410 188.212 1.00 166.57 ? 499 LYS B CA  1 
ATOM   2754 C C   . LYS B  2 174 ? 71.677  120.509 187.780 1.00 171.32 ? 499 LYS B C   1 
ATOM   2755 O O   . LYS B  2 174 ? 72.200  121.257 188.606 1.00 179.58 ? 499 LYS B O   1 
ATOM   2756 C CB  . LYS B  2 174 ? 71.167  118.755 189.520 1.00 175.72 ? 499 LYS B CB  1 
ATOM   2757 C CG  . LYS B  2 174 ? 70.993  119.632 190.759 1.00 182.83 ? 499 LYS B CG  1 
ATOM   2758 C CD  . LYS B  2 174 ? 71.224  118.849 192.051 1.00 179.89 ? 499 LYS B CD  1 
ATOM   2759 C CE  . LYS B  2 174 ? 70.926  119.704 193.283 1.00 174.51 ? 499 LYS B CE  1 
ATOM   2760 N NZ  . LYS B  2 174 ? 71.031  118.937 194.562 1.00 160.77 ? 499 LYS B NZ  1 
ATOM   2761 N N   . GLY B  2 175 ? 71.910  120.597 186.473 1.00 171.39 ? 500 GLY B N   1 
ATOM   2762 C CA  . GLY B  2 175 ? 72.811  121.601 185.936 1.00 166.50 ? 500 GLY B CA  1 
ATOM   2763 C C   . GLY B  2 175 ? 72.141  122.406 184.837 1.00 166.41 ? 500 GLY B C   1 
ATOM   2764 O O   . GLY B  2 175 ? 72.813  122.959 183.965 1.00 169.55 ? 500 GLY B O   1 
ATOM   2765 N N   . SER B  2 176 ? 70.810  122.456 184.884 1.00 158.49 ? 501 SER B N   1 
ATOM   2766 C CA  . SER B  2 176 ? 69.989  123.189 183.919 1.00 154.94 ? 501 SER B CA  1 
ATOM   2767 C C   . SER B  2 176 ? 70.164  122.762 182.458 1.00 148.57 ? 501 SER B C   1 
ATOM   2768 O O   . SER B  2 176 ? 69.620  123.395 181.549 1.00 145.73 ? 501 SER B O   1 
ATOM   2769 C CB  . SER B  2 176 ? 70.242  124.698 184.044 1.00 163.45 ? 501 SER B CB  1 
ATOM   2770 O OG  . SER B  2 176 ? 71.556  125.048 183.642 1.00 175.97 ? 501 SER B OG  1 
ATOM   2771 N N   . GLY B  2 177 ? 70.916  121.691 182.230 1.00 139.28 ? 502 GLY B N   1 
ATOM   2772 C CA  . GLY B  2 177 ? 71.116  121.218 180.873 1.00 116.28 ? 502 GLY B CA  1 
ATOM   2773 C C   . GLY B  2 177 ? 70.507  119.842 180.705 1.00 108.06 ? 502 GLY B C   1 
ATOM   2774 O O   . GLY B  2 177 ? 70.114  119.219 181.689 1.00 104.02 ? 502 GLY B O   1 
ATOM   2775 N N   . PHE B  2 178 ? 70.421  119.358 179.469 1.00 98.25  ? 503 PHE B N   1 
ATOM   2776 C CA  . PHE B  2 178 ? 69.850  118.035 179.231 1.00 89.59  ? 503 PHE B CA  1 
ATOM   2777 C C   . PHE B  2 178 ? 70.909  116.995 178.911 1.00 83.24  ? 503 PHE B C   1 
ATOM   2778 O O   . PHE B  2 178 ? 72.074  117.326 178.682 1.00 72.63  ? 503 PHE B O   1 
ATOM   2779 C CB  . PHE B  2 178 ? 68.868  118.051 178.071 1.00 84.22  ? 503 PHE B CB  1 
ATOM   2780 C CG  . PHE B  2 178 ? 67.813  119.092 178.173 1.00 80.97  ? 503 PHE B CG  1 
ATOM   2781 C CD1 . PHE B  2 178 ? 68.002  120.346 177.604 1.00 89.81  ? 503 PHE B CD1 1 
ATOM   2782 C CD2 . PHE B  2 178 ? 66.605  118.803 178.782 1.00 71.24  ? 503 PHE B CD2 1 
ATOM   2783 C CE1 . PHE B  2 178 ? 66.990  121.300 177.635 1.00 108.11 ? 503 PHE B CE1 1 
ATOM   2784 C CE2 . PHE B  2 178 ? 65.587  119.749 178.819 1.00 102.43 ? 503 PHE B CE2 1 
ATOM   2785 C CZ  . PHE B  2 178 ? 65.779  121.001 178.243 1.00 111.69 ? 503 PHE B CZ  1 
ATOM   2786 N N   . PHE B  2 179 ? 70.474  115.737 178.867 1.00 77.00  ? 504 PHE B N   1 
ATOM   2787 C CA  . PHE B  2 179 ? 71.354  114.618 178.578 1.00 76.24  ? 504 PHE B CA  1 
ATOM   2788 C C   . PHE B  2 179 ? 70.627  113.477 177.864 1.00 85.87  ? 504 PHE B C   1 
ATOM   2789 O O   . PHE B  2 179 ? 69.534  113.078 178.262 1.00 92.00  ? 504 PHE B O   1 
ATOM   2790 C CB  . PHE B  2 179 ? 71.965  114.102 179.879 1.00 71.16  ? 504 PHE B CB  1 
ATOM   2791 C CG  . PHE B  2 179 ? 71.102  113.121 180.617 1.00 66.02  ? 504 PHE B CG  1 
ATOM   2792 C CD1 . PHE B  2 179 ? 71.121  111.776 180.286 1.00 71.13  ? 504 PHE B CD1 1 
ATOM   2793 C CD2 . PHE B  2 179 ? 70.308  113.532 181.672 1.00 83.64  ? 504 PHE B CD2 1 
ATOM   2794 C CE1 . PHE B  2 179 ? 70.367  110.853 181.003 1.00 91.40  ? 504 PHE B CE1 1 
ATOM   2795 C CE2 . PHE B  2 179 ? 69.551  112.614 182.394 1.00 99.77  ? 504 PHE B CE2 1 
ATOM   2796 C CZ  . PHE B  2 179 ? 69.583  111.271 182.057 1.00 100.08 ? 504 PHE B CZ  1 
ATOM   2797 N N   . VAL B  2 180 ? 71.240  112.949 176.809 1.00 90.41  ? 505 VAL B N   1 
ATOM   2798 C CA  . VAL B  2 180 ? 70.652  111.844 176.061 1.00 82.03  ? 505 VAL B CA  1 
ATOM   2799 C C   . VAL B  2 180 ? 71.669  110.722 175.888 1.00 71.35  ? 505 VAL B C   1 
ATOM   2800 O O   . VAL B  2 180 ? 72.859  110.973 175.798 1.00 69.43  ? 505 VAL B O   1 
ATOM   2801 C CB  . VAL B  2 180 ? 70.169  112.299 174.672 1.00 67.22  ? 505 VAL B CB  1 
ATOM   2802 C CG1 . VAL B  2 180 ? 71.345  112.676 173.807 1.00 26.59  ? 505 VAL B CG1 1 
ATOM   2803 C CG2 . VAL B  2 180 ? 69.357  111.195 174.029 1.00 91.72  ? 505 VAL B CG2 1 
ATOM   2804 N N   . PHE B  2 181 ? 71.187  109.487 175.841 1.00 69.78  ? 506 PHE B N   1 
ATOM   2805 C CA  . PHE B  2 181 ? 72.035  108.311 175.685 1.00 61.95  ? 506 PHE B CA  1 
ATOM   2806 C C   . PHE B  2 181 ? 71.816  107.605 174.357 1.00 80.22  ? 506 PHE B C   1 
ATOM   2807 O O   . PHE B  2 181 ? 70.699  107.567 173.845 1.00 102.11 ? 506 PHE B O   1 
ATOM   2808 C CB  . PHE B  2 181 ? 71.733  107.331 176.792 1.00 61.49  ? 506 PHE B CB  1 
ATOM   2809 C CG  . PHE B  2 181 ? 72.585  107.497 178.006 1.00 75.56  ? 506 PHE B CG  1 
ATOM   2810 C CD1 . PHE B  2 181 ? 72.100  107.129 179.255 1.00 82.83  ? 506 PHE B CD1 1 
ATOM   2811 C CD2 . PHE B  2 181 ? 73.900  107.921 177.902 1.00 87.94  ? 506 PHE B CD2 1 
ATOM   2812 C CE1 . PHE B  2 181 ? 72.904  107.168 180.385 1.00 73.27  ? 506 PHE B CE1 1 
ATOM   2813 C CE2 . PHE B  2 181 ? 74.721  107.965 179.032 1.00 101.76 ? 506 PHE B CE2 1 
ATOM   2814 C CZ  . PHE B  2 181 ? 74.218  107.584 180.275 1.00 93.26  ? 506 PHE B CZ  1 
ATOM   2815 N N   . SER B  2 182 ? 72.883  107.036 173.803 1.00 74.22  ? 507 SER B N   1 
ATOM   2816 C CA  . SER B  2 182 ? 72.801  106.312 172.533 1.00 65.53  ? 507 SER B CA  1 
ATOM   2817 C C   . SER B  2 182 ? 73.480  104.962 172.635 1.00 56.55  ? 507 SER B C   1 
ATOM   2818 O O   . SER B  2 182 ? 74.493  104.821 173.310 1.00 57.34  ? 507 SER B O   1 
ATOM   2819 C CB  . SER B  2 182 ? 73.454  107.090 171.405 1.00 39.80  ? 507 SER B CB  1 
ATOM   2820 O OG  . SER B  2 182 ? 73.355  106.340 170.220 1.00 46.73  ? 507 SER B OG  1 
ATOM   2821 N N   . ARG B  2 183 ? 72.924  103.967 171.958 1.00 61.06  ? 508 ARG B N   1 
ATOM   2822 C CA  . ARG B  2 183 ? 73.476  102.616 172.002 1.00 60.39  ? 508 ARG B CA  1 
ATOM   2823 C C   . ARG B  2 183 ? 73.541  102.032 170.601 1.00 77.31  ? 508 ARG B C   1 
ATOM   2824 O O   . ARG B  2 183 ? 72.555  102.020 169.864 1.00 81.80  ? 508 ARG B O   1 
ATOM   2825 C CB  . ARG B  2 183 ? 72.623  101.735 172.911 1.00 53.25  ? 508 ARG B CB  1 
ATOM   2826 C CG  . ARG B  2 183 ? 72.985  100.277 172.923 1.00 48.01  ? 508 ARG B CG  1 
ATOM   2827 C CD  . ARG B  2 183 ? 72.144  99.540  173.949 1.00 65.49  ? 508 ARG B CD  1 
ATOM   2828 N NE  . ARG B  2 183 ? 72.340  98.093  173.925 1.00 76.15  ? 508 ARG B NE  1 
ATOM   2829 C CZ  . ARG B  2 183 ? 71.855  97.291  172.984 1.00 100.10 ? 508 ARG B CZ  1 
ATOM   2830 N NH1 . ARG B  2 183 ? 71.147  97.796  171.984 1.00 121.93 ? 508 ARG B NH1 1 
ATOM   2831 N NH2 . ARG B  2 183 ? 72.064  95.983  173.054 1.00 104.85 ? 508 ARG B NH2 1 
ATOM   2832 N N   . LEU B  2 184 ? 74.718  101.531 170.248 1.00 89.85  ? 509 LEU B N   1 
ATOM   2833 C CA  . LEU B  2 184 ? 74.962  100.979 168.925 1.00 84.75  ? 509 LEU B CA  1 
ATOM   2834 C C   . LEU B  2 184 ? 75.656  99.623  168.930 1.00 80.64  ? 509 LEU B C   1 
ATOM   2835 O O   . LEU B  2 184 ? 76.871  99.577  168.926 1.00 70.82  ? 509 LEU B O   1 
ATOM   2836 C CB  . LEU B  2 184 ? 75.820  101.966 168.140 1.00 62.99  ? 509 LEU B CB  1 
ATOM   2837 C CG  . LEU B  2 184 ? 76.358  101.480 166.804 1.00 59.85  ? 509 LEU B CG  1 
ATOM   2838 C CD1 . LEU B  2 184 ? 75.215  100.940 165.972 1.00 86.96  ? 509 LEU B CD1 1 
ATOM   2839 C CD2 . LEU B  2 184 ? 77.045  102.618 166.093 1.00 43.22  ? 509 LEU B CD2 1 
ATOM   2840 N N   . GLU B  2 185 ? 74.902  98.526  168.928 1.00 95.95  ? 510 GLU B N   1 
ATOM   2841 C CA  . GLU B  2 185 ? 75.513  97.191  168.921 1.00 103.32 ? 510 GLU B CA  1 
ATOM   2842 C C   . GLU B  2 185 ? 76.445  97.095  167.708 1.00 109.69 ? 510 GLU B C   1 
ATOM   2843 O O   . GLU B  2 185 ? 76.171  97.705  166.671 1.00 104.68 ? 510 GLU B O   1 
ATOM   2844 C CB  . GLU B  2 185 ? 74.427  96.107  168.847 1.00 112.64 ? 510 GLU B CB  1 
ATOM   2845 C CG  . GLU B  2 185 ? 73.491  96.056  170.061 1.00 133.41 ? 510 GLU B CG  1 
ATOM   2846 C CD  . GLU B  2 185 ? 72.349  95.050  169.905 1.00 144.56 ? 510 GLU B CD  1 
ATOM   2847 O OE1 . GLU B  2 185 ? 71.488  95.247  169.018 1.00 156.97 ? 510 GLU B OE1 1 
ATOM   2848 O OE2 . GLU B  2 185 ? 72.309  94.061  170.673 1.00 140.65 ? 510 GLU B OE2 1 
ATOM   2849 N N   . VAL B  2 186 ? 77.540  96.339  167.834 1.00 108.93 ? 511 VAL B N   1 
ATOM   2850 C CA  . VAL B  2 186 ? 78.512  96.196  166.741 1.00 115.95 ? 511 VAL B CA  1 
ATOM   2851 C C   . VAL B  2 186 ? 78.981  94.760  166.461 1.00 136.79 ? 511 VAL B C   1 
ATOM   2852 O O   . VAL B  2 186 ? 78.941  93.899  167.343 1.00 148.05 ? 511 VAL B O   1 
ATOM   2853 C CB  . VAL B  2 186 ? 79.763  97.091  166.993 1.00 85.10  ? 511 VAL B CB  1 
ATOM   2854 C CG1 . VAL B  2 186 ? 80.823  96.827  165.953 1.00 114.39 ? 511 VAL B CG1 1 
ATOM   2855 C CG2 . VAL B  2 186 ? 79.373  98.544  166.915 1.00 102.17 ? 511 VAL B CG2 1 
ATOM   2856 N N   . THR B  2 187 ? 79.428  94.522  165.225 1.00 142.72 ? 512 THR B N   1 
ATOM   2857 C CA  . THR B  2 187 ? 79.908  93.212  164.786 1.00 135.10 ? 512 THR B CA  1 
ATOM   2858 C C   . THR B  2 187 ? 81.427  93.180  164.604 1.00 122.91 ? 512 THR B C   1 
ATOM   2859 O O   . THR B  2 187 ? 82.018  94.132  164.093 1.00 105.17 ? 512 THR B O   1 
ATOM   2860 C CB  . THR B  2 187 ? 79.252  92.806  163.446 1.00 145.02 ? 512 THR B CB  1 
ATOM   2861 O OG1 . THR B  2 187 ? 77.826  92.831  163.583 1.00 149.38 ? 512 THR B OG1 1 
ATOM   2862 C CG2 . THR B  2 187 ? 79.691  91.403  163.034 1.00 159.29 ? 512 THR B CG2 1 
ATOM   2863 N N   . ARG B  2 188 ? 82.042  92.071  165.017 1.00 124.03 ? 513 ARG B N   1 
ATOM   2864 C CA  . ARG B  2 188 ? 83.488  91.879  164.910 1.00 125.96 ? 513 ARG B CA  1 
ATOM   2865 C C   . ARG B  2 188 ? 84.028  92.345  163.566 1.00 113.24 ? 513 ARG B C   1 
ATOM   2866 O O   . ARG B  2 188 ? 84.945  93.157  163.504 1.00 103.56 ? 513 ARG B O   1 
ATOM   2867 C CB  . ARG B  2 188 ? 83.853  90.401  165.116 1.00 143.33 ? 513 ARG B CB  1 
ATOM   2868 C CG  . ARG B  2 188 ? 85.357  90.120  165.061 1.00 162.51 ? 513 ARG B CG  1 
ATOM   2869 C CD  . ARG B  2 188 ? 85.684  88.632  165.174 1.00 188.13 ? 513 ARG B CD  1 
ATOM   2870 N NE  . ARG B  2 188 ? 87.125  88.379  165.106 1.00 213.42 ? 513 ARG B NE  1 
ATOM   2871 C CZ  . ARG B  2 188 ? 87.683  87.170  165.129 1.00 222.58 ? 513 ARG B CZ  1 
ATOM   2872 N NH1 . ARG B  2 188 ? 86.926  86.085  165.219 1.00 224.25 ? 513 ARG B NH1 1 
ATOM   2873 N NH2 . ARG B  2 188 ? 89.003  87.045  165.060 1.00 225.26 ? 513 ARG B NH2 1 
ATOM   2874 N N   . ALA B  2 189 ? 83.450  91.824  162.492 1.00 108.20 ? 514 ALA B N   1 
ATOM   2875 C CA  . ALA B  2 189 ? 83.868  92.174  161.147 1.00 109.49 ? 514 ALA B CA  1 
ATOM   2876 C C   . ALA B  2 189 ? 84.167  93.657  160.992 1.00 109.40 ? 514 ALA B C   1 
ATOM   2877 O O   . ALA B  2 189 ? 85.169  94.038  160.389 1.00 115.54 ? 514 ALA B O   1 
ATOM   2878 C CB  . ALA B  2 189 ? 82.798  91.766  160.171 1.00 115.97 ? 514 ALA B CB  1 
ATOM   2879 N N   . GLU B  2 190 ? 83.303  94.493  161.550 1.00 104.82 ? 515 GLU B N   1 
ATOM   2880 C CA  . GLU B  2 190 ? 83.461  95.936  161.440 1.00 104.32 ? 515 GLU B CA  1 
ATOM   2881 C C   . GLU B  2 190 ? 84.637  96.589  162.164 1.00 102.03 ? 515 GLU B C   1 
ATOM   2882 O O   . GLU B  2 190 ? 85.189  97.567  161.664 1.00 93.22  ? 515 GLU B O   1 
ATOM   2883 C CB  . GLU B  2 190 ? 82.162  96.623  161.855 1.00 95.83  ? 515 GLU B CB  1 
ATOM   2884 C CG  . GLU B  2 190 ? 81.038  96.378  160.880 1.00 128.09 ? 515 GLU B CG  1 
ATOM   2885 C CD  . GLU B  2 190 ? 79.733  96.989  161.327 1.00 133.79 ? 515 GLU B CD  1 
ATOM   2886 O OE1 . GLU B  2 190 ? 79.234  96.590  162.401 1.00 129.45 ? 515 GLU B OE1 1 
ATOM   2887 O OE2 . GLU B  2 190 ? 79.210  97.862  160.600 1.00 141.41 ? 515 GLU B OE2 1 
ATOM   2888 N N   . TRP B  2 191 ? 85.034  96.082  163.327 1.00 96.96  ? 516 TRP B N   1 
ATOM   2889 C CA  . TRP B  2 191 ? 86.146  96.723  164.007 1.00 101.97 ? 516 TRP B CA  1 
ATOM   2890 C C   . TRP B  2 191 ? 87.493  96.250  163.505 1.00 119.02 ? 516 TRP B C   1 
ATOM   2891 O O   . TRP B  2 191 ? 88.524  96.836  163.833 1.00 132.14 ? 516 TRP B O   1 
ATOM   2892 C CB  . TRP B  2 191 ? 86.035  96.570  165.523 1.00 101.41 ? 516 TRP B CB  1 
ATOM   2893 C CG  . TRP B  2 191 ? 86.442  95.275  166.113 1.00 96.05  ? 516 TRP B CG  1 
ATOM   2894 C CD1 . TRP B  2 191 ? 87.708  94.795  166.243 1.00 117.82 ? 516 TRP B CD1 1 
ATOM   2895 C CD2 . TRP B  2 191 ? 85.591  94.349  166.786 1.00 99.74  ? 516 TRP B CD2 1 
ATOM   2896 N NE1 . TRP B  2 191 ? 87.702  93.630  166.968 1.00 123.27 ? 516 TRP B NE1 1 
ATOM   2897 C CE2 . TRP B  2 191 ? 86.411  93.335  167.314 1.00 114.76 ? 516 TRP B CE2 1 
ATOM   2898 C CE3 . TRP B  2 191 ? 84.211  94.281  166.999 1.00 93.23  ? 516 TRP B CE3 1 
ATOM   2899 C CZ2 . TRP B  2 191 ? 85.896  92.262  168.043 1.00 128.54 ? 516 TRP B CZ2 1 
ATOM   2900 C CZ3 . TRP B  2 191 ? 83.698  93.218  167.722 1.00 92.67  ? 516 TRP B CZ3 1 
ATOM   2901 C CH2 . TRP B  2 191 ? 84.539  92.222  168.236 1.00 122.30 ? 516 TRP B CH2 1 
ATOM   2902 N N   . GLU B  2 192 ? 87.484  95.191  162.703 1.00 125.49 ? 517 GLU B N   1 
ATOM   2903 C CA  . GLU B  2 192 ? 88.715  94.681  162.120 1.00 121.43 ? 517 GLU B CA  1 
ATOM   2904 C C   . GLU B  2 192 ? 88.923  95.495  160.848 1.00 117.16 ? 517 GLU B C   1 
ATOM   2905 O O   . GLU B  2 192 ? 90.047  95.697  160.396 1.00 129.56 ? 517 GLU B O   1 
ATOM   2906 C CB  . GLU B  2 192 ? 88.586  93.193  161.804 1.00 125.80 ? 517 GLU B CB  1 
ATOM   2907 C CG  . GLU B  2 192 ? 88.437  92.331  163.045 1.00 148.73 ? 517 GLU B CG  1 
ATOM   2908 C CD  . GLU B  2 192 ? 88.603  90.854  162.756 1.00 168.29 ? 517 GLU B CD  1 
ATOM   2909 O OE1 . GLU B  2 192 ? 87.847  90.322  161.915 1.00 185.02 ? 517 GLU B OE1 1 
ATOM   2910 O OE2 . GLU B  2 192 ? 89.490  90.226  163.373 1.00 171.43 ? 517 GLU B OE2 1 
ATOM   2911 N N   . GLN B  2 193 ? 87.817  95.976  160.289 1.00 106.20 ? 518 GLN B N   1 
ATOM   2912 C CA  . GLN B  2 193 ? 87.840  96.803  159.093 1.00 109.32 ? 518 GLN B CA  1 
ATOM   2913 C C   . GLN B  2 193 ? 88.500  98.116  159.504 1.00 108.16 ? 518 GLN B C   1 
ATOM   2914 O O   . GLN B  2 193 ? 89.196  98.743  158.710 1.00 96.60  ? 518 GLN B O   1 
ATOM   2915 C CB  . GLN B  2 193 ? 86.407  97.051  158.611 1.00 131.57 ? 518 GLN B CB  1 
ATOM   2916 C CG  . GLN B  2 193 ? 86.285  97.795  157.287 1.00 141.72 ? 518 GLN B CG  1 
ATOM   2917 C CD  . GLN B  2 193 ? 84.834  98.105  156.921 1.00 141.03 ? 518 GLN B CD  1 
ATOM   2918 O OE1 . GLN B  2 193 ? 83.989  97.206  156.851 1.00 119.28 ? 518 GLN B OE1 1 
ATOM   2919 N NE2 . GLN B  2 193 ? 84.544  99.382  156.686 1.00 135.44 ? 518 GLN B NE2 1 
ATOM   2920 N N   . LYS B  2 194 ? 88.260  98.509  160.758 1.00 109.75 ? 519 LYS B N   1 
ATOM   2921 C CA  . LYS B  2 194 ? 88.818  99.719  161.375 1.00 108.17 ? 519 LYS B CA  1 
ATOM   2922 C C   . LYS B  2 194 ? 88.370  99.789  162.835 1.00 107.50 ? 519 LYS B C   1 
ATOM   2923 O O   . LYS B  2 194 ? 87.399  99.145  163.209 1.00 104.29 ? 519 LYS B O   1 
ATOM   2924 C CB  . LYS B  2 194 ? 88.367  100.990 160.643 1.00 92.27  ? 519 LYS B CB  1 
ATOM   2925 C CG  . LYS B  2 194 ? 89.179  102.223 161.053 1.00 91.86  ? 519 LYS B CG  1 
ATOM   2926 C CD  . LYS B  2 194 ? 89.180  103.305 159.981 1.00 106.69 ? 519 LYS B CD  1 
ATOM   2927 C CE  . LYS B  2 194 ? 90.255  104.358 160.255 1.00 118.18 ? 519 LYS B CE  1 
ATOM   2928 N NZ  . LYS B  2 194 ? 90.332  105.388 159.175 1.00 130.92 ? 519 LYS B NZ  1 
ATOM   2929 N N   . ASP B  2 195 ? 89.086  100.555 163.656 1.00 118.82 ? 520 ASP B N   1 
ATOM   2930 C CA  . ASP B  2 195 ? 88.752  100.712 165.075 1.00 113.09 ? 520 ASP B CA  1 
ATOM   2931 C C   . ASP B  2 195 ? 88.026  102.029 165.323 1.00 115.78 ? 520 ASP B C   1 
ATOM   2932 O O   . ASP B  2 195 ? 87.179  102.115 166.201 1.00 122.46 ? 520 ASP B O   1 
ATOM   2933 C CB  . ASP B  2 195 ? 90.013  100.687 165.939 1.00 131.35 ? 520 ASP B CB  1 
ATOM   2934 C CG  . ASP B  2 195 ? 90.474  99.285  166.259 1.00 147.30 ? 520 ASP B CG  1 
ATOM   2935 O OD1 . ASP B  2 195 ? 89.710  98.566  166.935 1.00 142.26 ? 520 ASP B OD1 1 
ATOM   2936 O OD2 . ASP B  2 195 ? 91.593  98.907  165.843 1.00 156.79 ? 520 ASP B OD2 1 
ATOM   2937 N N   . GLU B  2 196 ? 88.367  103.055 164.552 1.00 117.87 ? 521 GLU B N   1 
ATOM   2938 C CA  . GLU B  2 196 ? 87.745  104.369 164.690 1.00 116.52 ? 521 GLU B CA  1 
ATOM   2939 C C   . GLU B  2 196 ? 86.236  104.373 164.495 1.00 109.80 ? 521 GLU B C   1 
ATOM   2940 O O   . GLU B  2 196 ? 85.750  104.213 163.377 1.00 105.75 ? 521 GLU B O   1 
ATOM   2941 C CB  . GLU B  2 196 ? 88.335  105.364 163.686 1.00 137.78 ? 521 GLU B CB  1 
ATOM   2942 C CG  . GLU B  2 196 ? 89.404  106.294 164.229 1.00 143.09 ? 521 GLU B CG  1 
ATOM   2943 C CD  . GLU B  2 196 ? 89.685  107.446 163.278 1.00 145.38 ? 521 GLU B CD  1 
ATOM   2944 O OE1 . GLU B  2 196 ? 88.761  108.254 163.051 1.00 129.26 ? 521 GLU B OE1 1 
ATOM   2945 O OE2 . GLU B  2 196 ? 90.818  107.542 162.754 1.00 153.07 ? 521 GLU B OE2 1 
ATOM   2946 N N   . PHE B  2 197 ? 85.506  104.574 165.588 1.00 108.28 ? 522 PHE B N   1 
ATOM   2947 C CA  . PHE B  2 197 ? 84.052  104.669 165.563 1.00 86.07  ? 522 PHE B CA  1 
ATOM   2948 C C   . PHE B  2 197 ? 83.737  106.065 166.062 1.00 82.37  ? 522 PHE B C   1 
ATOM   2949 O O   . PHE B  2 197 ? 84.219  106.486 167.113 1.00 81.53  ? 522 PHE B O   1 
ATOM   2950 C CB  . PHE B  2 197 ? 83.424  103.654 166.495 1.00 62.73  ? 522 PHE B CB  1 
ATOM   2951 C CG  . PHE B  2 197 ? 83.252  102.307 165.892 1.00 89.88  ? 522 PHE B CG  1 
ATOM   2952 C CD1 . PHE B  2 197 ? 84.291  101.701 165.210 1.00 100.52 ? 522 PHE B CD1 1 
ATOM   2953 C CD2 . PHE B  2 197 ? 82.051  101.625 166.026 1.00 103.46 ? 522 PHE B CD2 1 
ATOM   2954 C CE1 . PHE B  2 197 ? 84.137  100.430 164.671 1.00 115.32 ? 522 PHE B CE1 1 
ATOM   2955 C CE2 . PHE B  2 197 ? 81.887  100.353 165.491 1.00 98.00  ? 522 PHE B CE2 1 
ATOM   2956 C CZ  . PHE B  2 197 ? 82.929  99.756  164.814 1.00 101.48 ? 522 PHE B CZ  1 
ATOM   2957 N N   . ILE B  2 198 ? 82.937  106.797 165.313 1.00 71.07  ? 523 ILE B N   1 
ATOM   2958 C CA  . ILE B  2 198 ? 82.619  108.140 165.731 1.00 79.42  ? 523 ILE B CA  1 
ATOM   2959 C C   . ILE B  2 198 ? 81.152  108.304 166.076 1.00 89.21  ? 523 ILE B C   1 
ATOM   2960 O O   . ILE B  2 198 ? 80.276  107.800 165.371 1.00 92.71  ? 523 ILE B O   1 
ATOM   2961 C CB  . ILE B  2 198 ? 83.006  109.136 164.638 1.00 72.60  ? 523 ILE B CB  1 
ATOM   2962 C CG1 . ILE B  2 198 ? 84.483  108.963 164.309 1.00 81.09  ? 523 ILE B CG1 1 
ATOM   2963 C CG2 . ILE B  2 198 ? 82.726  110.554 165.093 1.00 71.30  ? 523 ILE B CG2 1 
ATOM   2964 C CD1 . ILE B  2 198 ? 85.004  109.946 163.268 1.00 121.18 ? 523 ILE B CD1 1 
ATOM   2965 N N   . CYS B  2 199 ? 80.903  108.998 167.183 1.00 89.14  ? 524 CYS B N   1 
ATOM   2966 C CA  . CYS B  2 199 ? 79.551  109.286 167.642 1.00 83.81  ? 524 CYS B CA  1 
ATOM   2967 C C   . CYS B  2 199 ? 79.358  110.792 167.558 1.00 69.45  ? 524 CYS B C   1 
ATOM   2968 O O   . CYS B  2 199 ? 79.589  111.496 168.514 1.00 56.16  ? 524 CYS B O   1 
ATOM   2969 C CB  . CYS B  2 199 ? 79.363  108.835 169.082 1.00 89.07  ? 524 CYS B CB  1 
ATOM   2970 S SG  . CYS B  2 199 ? 77.896  109.575 169.868 1.00 103.27 ? 524 CYS B SG  1 
ATOM   2971 N N   . ARG B  2 200 ? 78.939  111.272 166.397 1.00 71.71  ? 525 ARG B N   1 
ATOM   2972 C CA  . ARG B  2 200 ? 78.740  112.694 166.166 1.00 47.54  ? 525 ARG B CA  1 
ATOM   2973 C C   . ARG B  2 200 ? 77.501  113.197 166.880 1.00 69.71  ? 525 ARG B C   1 
ATOM   2974 O O   . ARG B  2 200 ? 76.714  112.411 167.406 1.00 78.58  ? 525 ARG B O   1 
ATOM   2975 C CB  . ARG B  2 200 ? 78.613  112.956 164.664 1.00 53.27  ? 525 ARG B CB  1 
ATOM   2976 C CG  . ARG B  2 200 ? 78.750  114.395 164.270 1.00 53.48  ? 525 ARG B CG  1 
ATOM   2977 C CD  . ARG B  2 200 ? 79.294  114.553 162.852 1.00 87.65  ? 525 ARG B CD  1 
ATOM   2978 N NE  . ARG B  2 200 ? 78.328  114.264 161.795 1.00 96.01  ? 525 ARG B NE  1 
ATOM   2979 C CZ  . ARG B  2 200 ? 78.518  114.587 160.517 1.00 123.82 ? 525 ARG B CZ  1 
ATOM   2980 N NH1 . ARG B  2 200 ? 79.633  115.211 160.143 1.00 130.93 ? 525 ARG B NH1 1 
ATOM   2981 N NH2 . ARG B  2 200 ? 77.598  114.280 159.610 1.00 126.03 ? 525 ARG B NH2 1 
ATOM   2982 N N   . ALA B  2 201 ? 77.344  114.517 166.897 1.00 74.04  ? 526 ALA B N   1 
ATOM   2983 C CA  . ALA B  2 201 ? 76.209  115.177 167.538 1.00 58.31  ? 526 ALA B CA  1 
ATOM   2984 C C   . ALA B  2 201 ? 76.003  116.527 166.881 1.00 54.29  ? 526 ALA B C   1 
ATOM   2985 O O   . ALA B  2 201 ? 76.957  117.256 166.609 1.00 70.73  ? 526 ALA B O   1 
ATOM   2986 C CB  . ALA B  2 201 ? 76.469  115.358 169.025 1.00 35.44  ? 526 ALA B CB  1 
ATOM   2987 N N   . VAL B  2 202 ? 74.753  116.858 166.616 1.00 38.15  ? 527 VAL B N   1 
ATOM   2988 C CA  . VAL B  2 202 ? 74.446  118.123 165.984 1.00 53.74  ? 527 VAL B CA  1 
ATOM   2989 C C   . VAL B  2 202 ? 73.583  118.949 166.912 1.00 71.69  ? 527 VAL B C   1 
ATOM   2990 O O   . VAL B  2 202 ? 72.494  118.525 167.296 1.00 90.99  ? 527 VAL B O   1 
ATOM   2991 C CB  . VAL B  2 202 ? 73.702  117.900 164.683 1.00 56.31  ? 527 VAL B CB  1 
ATOM   2992 C CG1 . VAL B  2 202 ? 73.434  119.222 164.005 1.00 64.46  ? 527 VAL B CG1 1 
ATOM   2993 C CG2 . VAL B  2 202 ? 74.512  116.984 163.798 1.00 62.66  ? 527 VAL B CG2 1 
ATOM   2994 N N   . HIS B  2 203 ? 74.075  120.123 167.290 1.00 84.30  ? 528 HIS B N   1 
ATOM   2995 C CA  . HIS B  2 203 ? 73.324  121.009 168.177 1.00 76.34  ? 528 HIS B CA  1 
ATOM   2996 C C   . HIS B  2 203 ? 73.405  122.421 167.644 1.00 82.10  ? 528 HIS B C   1 
ATOM   2997 O O   . HIS B  2 203 ? 74.322  122.745 166.877 1.00 91.58  ? 528 HIS B O   1 
ATOM   2998 C CB  . HIS B  2 203 ? 73.883  120.954 169.599 1.00 57.64  ? 528 HIS B CB  1 
ATOM   2999 C CG  . HIS B  2 203 ? 73.000  121.603 170.619 1.00 81.99  ? 528 HIS B CG  1 
ATOM   3000 N ND1 . HIS B  2 203 ? 72.530  120.932 171.727 1.00 94.95  ? 528 HIS B ND1 1 
ATOM   3001 C CD2 . HIS B  2 203 ? 72.544  122.873 170.730 1.00 92.04  ? 528 HIS B CD2 1 
ATOM   3002 C CE1 . HIS B  2 203 ? 71.828  121.761 172.479 1.00 99.73  ? 528 HIS B CE1 1 
ATOM   3003 N NE2 . HIS B  2 203 ? 71.822  122.946 171.896 1.00 114.81 ? 528 HIS B NE2 1 
ATOM   3004 N N   . GLU B  2 204 ? 72.439  123.246 168.040 1.00 84.50  ? 529 GLU B N   1 
ATOM   3005 C CA  . GLU B  2 204 ? 72.388  124.630 167.603 1.00 103.89 ? 529 GLU B CA  1 
ATOM   3006 C C   . GLU B  2 204 ? 73.552  125.453 168.173 1.00 100.48 ? 529 GLU B C   1 
ATOM   3007 O O   . GLU B  2 204 ? 73.915  126.492 167.625 1.00 93.95  ? 529 GLU B O   1 
ATOM   3008 C CB  . GLU B  2 204 ? 71.056  125.236 168.007 1.00 129.34 ? 529 GLU B CB  1 
ATOM   3009 C CG  . GLU B  2 204 ? 70.885  126.632 167.550 1.00 174.83 ? 529 GLU B CG  1 
ATOM   3010 C CD  . GLU B  2 204 ? 69.576  127.233 168.045 1.00 195.96 ? 529 GLU B CD  1 
ATOM   3011 O OE1 . GLU B  2 204 ? 69.275  128.356 168.100 1.00 214.54 ? 529 GLU B OE1 1 
ATOM   3012 O OE2 . GLU B  2 204 ? 68.633  126.689 168.465 1.00 211.54 ? 529 GLU B OE2 1 
ATOM   3013 N N   . ALA B  2 205 ? 74.184  124.942 169.228 1.00 106.69 ? 530 ALA B N   1 
ATOM   3014 C CA  . ALA B  2 205 ? 75.301  125.633 169.882 1.00 123.58 ? 530 ALA B CA  1 
ATOM   3015 C C   . ALA B  2 205 ? 76.657  125.298 169.285 1.00 141.60 ? 530 ALA B C   1 
ATOM   3016 O O   . ALA B  2 205 ? 77.105  125.948 168.341 1.00 148.62 ? 530 ALA B O   1 
ATOM   3017 C CB  . ALA B  2 205 ? 75.312  125.312 171.383 1.00 108.38 ? 530 ALA B CB  1 
ATOM   3018 N N   . ALA B  2 206 ? 77.296  124.287 169.868 1.00 145.64 ? 531 ALA B N   1 
ATOM   3019 C CA  . ALA B  2 206 ? 78.608  123.796 169.457 1.00 154.66 ? 531 ALA B CA  1 
ATOM   3020 C C   . ALA B  2 206 ? 79.240  124.461 168.235 1.00 162.42 ? 531 ALA B C   1 
ATOM   3021 O O   . ALA B  2 206 ? 78.602  124.634 167.193 1.00 163.10 ? 531 ALA B O   1 
ATOM   3022 C CB  . ALA B  2 206 ? 78.530  122.299 169.233 1.00 153.37 ? 531 ALA B CB  1 
ATOM   3023 N N   . SER B  2 207 ? 80.513  124.816 168.369 1.00 158.15 ? 532 SER B N   1 
ATOM   3024 C CA  . SER B  2 207 ? 81.245  125.437 167.279 1.00 146.40 ? 532 SER B CA  1 
ATOM   3025 C C   . SER B  2 207 ? 82.270  124.459 166.721 1.00 141.17 ? 532 SER B C   1 
ATOM   3026 O O   . SER B  2 207 ? 82.606  123.460 167.359 1.00 138.30 ? 532 SER B O   1 
ATOM   3027 C CB  . SER B  2 207 ? 81.945  126.707 167.764 1.00 147.13 ? 532 SER B CB  1 
ATOM   3028 O OG  . SER B  2 207 ? 81.012  127.751 167.971 1.00 142.29 ? 532 SER B OG  1 
ATOM   3029 N N   . PRO B  2 208 ? 82.789  124.741 165.522 1.00 142.36 ? 533 PRO B N   1 
ATOM   3030 C CA  . PRO B  2 208 ? 82.446  125.915 164.718 1.00 139.14 ? 533 PRO B CA  1 
ATOM   3031 C C   . PRO B  2 208 ? 81.477  125.558 163.605 1.00 134.44 ? 533 PRO B C   1 
ATOM   3032 O O   . PRO B  2 208 ? 80.902  126.440 162.963 1.00 127.47 ? 533 PRO B O   1 
ATOM   3033 C CB  . PRO B  2 208 ? 83.793  126.336 164.170 1.00 150.03 ? 533 PRO B CB  1 
ATOM   3034 C CG  . PRO B  2 208 ? 84.400  124.997 163.830 1.00 153.55 ? 533 PRO B CG  1 
ATOM   3035 C CD  . PRO B  2 208 ? 84.018  124.105 165.014 1.00 147.31 ? 533 PRO B CD  1 
ATOM   3036 N N   . SER B  2 209 ? 81.320  124.256 163.383 1.00 130.82 ? 534 SER B N   1 
ATOM   3037 C CA  . SER B  2 209 ? 80.452  123.734 162.335 1.00 123.42 ? 534 SER B CA  1 
ATOM   3038 C C   . SER B  2 209 ? 79.150  123.167 162.880 1.00 109.80 ? 534 SER B C   1 
ATOM   3039 O O   . SER B  2 209 ? 78.478  122.386 162.208 1.00 96.75  ? 534 SER B O   1 
ATOM   3040 C CB  . SER B  2 209 ? 81.191  122.649 161.552 1.00 140.16 ? 534 SER B CB  1 
ATOM   3041 O OG  . SER B  2 209 ? 81.699  121.659 162.433 1.00 147.81 ? 534 SER B OG  1 
ATOM   3042 N N   . GLN B  2 210 ? 78.797  123.562 164.097 1.00 99.60  ? 535 GLN B N   1 
ATOM   3043 C CA  . GLN B  2 210 ? 77.567  123.100 164.729 1.00 84.48  ? 535 GLN B CA  1 
ATOM   3044 C C   . GLN B  2 210 ? 77.588  121.590 164.945 1.00 80.64  ? 535 GLN B C   1 
ATOM   3045 O O   . GLN B  2 210 ? 76.565  120.977 165.244 1.00 76.70  ? 535 GLN B O   1 
ATOM   3046 C CB  . GLN B  2 210 ? 76.364  123.514 163.874 1.00 43.31  ? 535 GLN B CB  1 
ATOM   3047 C CG  . GLN B  2 210 ? 76.251  125.023 163.741 1.00 73.88  ? 535 GLN B CG  1 
ATOM   3048 C CD  . GLN B  2 210 ? 76.192  125.485 162.297 1.00 98.29  ? 535 GLN B CD  1 
ATOM   3049 O OE1 . GLN B  2 210 ? 76.935  124.993 161.445 1.00 114.12 ? 535 GLN B OE1 1 
ATOM   3050 N NE2 . GLN B  2 210 ? 75.317  126.449 162.017 1.00 114.79 ? 535 GLN B NE2 1 
ATOM   3051 N N   . THR B  2 211 ? 78.772  121.005 164.809 1.00 74.85  ? 536 THR B N   1 
ATOM   3052 C CA  . THR B  2 211 ? 78.960  119.571 164.983 1.00 72.87  ? 536 THR B CA  1 
ATOM   3053 C C   . THR B  2 211 ? 79.825  119.321 166.200 1.00 75.17  ? 536 THR B C   1 
ATOM   3054 O O   . THR B  2 211 ? 80.514  120.215 166.672 1.00 90.85  ? 536 THR B O   1 
ATOM   3055 C CB  . THR B  2 211 ? 79.677  118.967 163.771 1.00 86.36  ? 536 THR B CB  1 
ATOM   3056 O OG1 . THR B  2 211 ? 78.861  119.117 162.604 1.00 111.58 ? 536 THR B OG1 1 
ATOM   3057 C CG2 . THR B  2 211 ? 79.973  117.509 164.005 1.00 89.05  ? 536 THR B CG2 1 
ATOM   3058 N N   . VAL B  2 212 ? 79.798  118.095 166.694 1.00 68.18  ? 537 VAL B N   1 
ATOM   3059 C CA  . VAL B  2 212 ? 80.600  117.708 167.847 1.00 76.01  ? 537 VAL B CA  1 
ATOM   3060 C C   . VAL B  2 212 ? 80.723  116.195 167.904 1.00 91.25  ? 537 VAL B C   1 
ATOM   3061 O O   . VAL B  2 212 ? 79.719  115.495 167.960 1.00 105.01 ? 537 VAL B O   1 
ATOM   3062 C CB  . VAL B  2 212 ? 79.969  118.190 169.146 1.00 55.57  ? 537 VAL B CB  1 
ATOM   3063 C CG1 . VAL B  2 212 ? 80.474  117.351 170.311 1.00 58.90  ? 537 VAL B CG1 1 
ATOM   3064 C CG2 . VAL B  2 212 ? 80.317  119.645 169.366 1.00 86.91  ? 537 VAL B CG2 1 
ATOM   3065 N N   . GLN B  2 213 ? 81.947  115.685 167.904 1.00 92.32  ? 538 GLN B N   1 
ATOM   3066 C CA  . GLN B  2 213 ? 82.128  114.242 167.931 1.00 86.67  ? 538 GLN B CA  1 
ATOM   3067 C C   . GLN B  2 213 ? 83.238  113.781 168.859 1.00 79.04  ? 538 GLN B C   1 
ATOM   3068 O O   . GLN B  2 213 ? 84.090  114.568 169.262 1.00 85.87  ? 538 GLN B O   1 
ATOM   3069 C CB  . GLN B  2 213 ? 82.389  113.741 166.508 1.00 82.88  ? 538 GLN B CB  1 
ATOM   3070 C CG  . GLN B  2 213 ? 83.519  114.462 165.790 1.00 82.71  ? 538 GLN B CG  1 
ATOM   3071 C CD  . GLN B  2 213 ? 83.524  114.199 164.292 1.00 94.83  ? 538 GLN B CD  1 
ATOM   3072 O OE1 . GLN B  2 213 ? 82.734  114.776 163.543 1.00 88.82  ? 538 GLN B OE1 1 
ATOM   3073 N NE2 . GLN B  2 213 ? 84.410  113.314 163.850 1.00 102.26 ? 538 GLN B NE2 1 
ATOM   3074 N N   . ARG B  2 214 ? 83.206  112.500 169.206 1.00 66.76  ? 539 ARG B N   1 
ATOM   3075 C CA  . ARG B  2 214 ? 84.215  111.907 170.074 1.00 91.11  ? 539 ARG B CA  1 
ATOM   3076 C C   . ARG B  2 214 ? 84.493  110.512 169.547 1.00 100.62 ? 539 ARG B C   1 
ATOM   3077 O O   . ARG B  2 214 ? 83.580  109.700 169.426 1.00 96.84  ? 539 ARG B O   1 
ATOM   3078 C CB  . ARG B  2 214 ? 83.719  111.803 171.517 1.00 100.80 ? 539 ARG B CB  1 
ATOM   3079 C CG  . ARG B  2 214 ? 84.820  111.481 172.533 1.00 126.50 ? 539 ARG B CG  1 
ATOM   3080 C CD  . ARG B  2 214 ? 85.250  112.726 173.313 1.00 138.17 ? 539 ARG B CD  1 
ATOM   3081 N NE  . ARG B  2 214 ? 85.363  113.903 172.451 1.00 145.03 ? 539 ARG B NE  1 
ATOM   3082 C CZ  . ARG B  2 214 ? 85.663  115.127 172.880 1.00 139.02 ? 539 ARG B CZ  1 
ATOM   3083 N NH1 . ARG B  2 214 ? 85.887  115.344 174.170 1.00 144.62 ? 539 ARG B NH1 1 
ATOM   3084 N NH2 . ARG B  2 214 ? 85.726  116.136 172.017 1.00 124.66 ? 539 ARG B NH2 1 
ATOM   3085 N N   . ALA B  2 215 ? 85.753  110.236 169.234 1.00 104.53 ? 540 ALA B N   1 
ATOM   3086 C CA  . ALA B  2 215 ? 86.136  108.933 168.712 1.00 91.86  ? 540 ALA B CA  1 
ATOM   3087 C C   . ALA B  2 215 ? 86.100  107.866 169.796 1.00 78.08  ? 540 ALA B C   1 
ATOM   3088 O O   . ALA B  2 215 ? 86.009  108.171 170.980 1.00 83.57  ? 540 ALA B O   1 
ATOM   3089 C CB  . ALA B  2 215 ? 87.531  109.015 168.111 1.00 108.47 ? 540 ALA B CB  1 
ATOM   3090 N N   . VAL B  2 216 ? 86.173  106.612 169.376 1.00 57.92  ? 541 VAL B N   1 
ATOM   3091 C CA  . VAL B  2 216 ? 86.179  105.491 170.303 1.00 79.21  ? 541 VAL B CA  1 
ATOM   3092 C C   . VAL B  2 216 ? 86.786  104.283 169.597 1.00 102.21 ? 541 VAL B C   1 
ATOM   3093 O O   . VAL B  2 216 ? 87.163  104.375 168.430 1.00 126.80 ? 541 VAL B O   1 
ATOM   3094 C CB  . VAL B  2 216 ? 84.770  105.139 170.724 1.00 72.93  ? 541 VAL B CB  1 
ATOM   3095 C CG1 . VAL B  2 216 ? 84.005  104.682 169.512 1.00 77.68  ? 541 VAL B CG1 1 
ATOM   3096 C CG2 . VAL B  2 216 ? 84.785  104.059 171.807 1.00 60.63  ? 541 VAL B CG2 1 
ATOM   3097 N N   . SER B  2 217 ? 86.882  103.159 170.306 1.00 105.18 ? 542 SER B N   1 
ATOM   3098 C CA  . SER B  2 217 ? 87.426  101.922 169.748 1.00 97.45  ? 542 SER B CA  1 
ATOM   3099 C C   . SER B  2 217 ? 87.713  100.893 170.829 1.00 91.84  ? 542 SER B C   1 
ATOM   3100 O O   . SER B  2 217 ? 87.935  101.248 171.987 1.00 109.15 ? 542 SER B O   1 
ATOM   3101 C CB  . SER B  2 217 ? 88.722  102.199 168.975 1.00 111.77 ? 542 SER B CB  1 
ATOM   3102 O OG  . SER B  2 217 ? 89.682  102.852 169.791 1.00 124.66 ? 542 SER B OG  1 
ATOM   3103 N N   . VAL B  2 218 ? 87.710  99.618  170.452 1.00 87.12  ? 543 VAL B N   1 
ATOM   3104 C CA  . VAL B  2 218 ? 88.017  98.550  171.401 1.00 103.71 ? 543 VAL B CA  1 
ATOM   3105 C C   . VAL B  2 218 ? 89.530  98.308  171.372 1.00 125.33 ? 543 VAL B C   1 
ATOM   3106 O O   . VAL B  2 218 ? 90.183  98.571  170.361 1.00 129.67 ? 543 VAL B O   1 
ATOM   3107 C CB  . VAL B  2 218 ? 87.339  97.221  171.023 1.00 91.76  ? 543 VAL B CB  1 
ATOM   3108 C CG1 . VAL B  2 218 ? 87.101  96.404  172.285 1.00 66.36  ? 543 VAL B CG1 1 
ATOM   3109 C CG2 . VAL B  2 218 ? 86.055  97.470  170.223 1.00 36.89  ? 543 VAL B CG2 1 
ATOM   3110 N N   . ASN B  2 219 ? 90.079  97.799  172.472 1.00 132.02 ? 544 ASN B N   1 
ATOM   3111 C CA  . ASN B  2 219 ? 91.511  97.522  172.561 1.00 135.79 ? 544 ASN B CA  1 
ATOM   3112 C C   . ASN B  2 219 ? 92.336  98.814  172.498 1.00 137.24 ? 544 ASN B C   1 
ATOM   3113 O O   . ASN B  2 219 ? 93.135  99.041  173.435 1.00 141.36 ? 544 ASN B O   1 
ATOM   3114 C CB  . ASN B  2 219 ? 91.944  96.576  171.431 1.00 135.12 ? 544 ASN B CB  1 
ATOM   3115 C CG  . ASN B  2 219 ? 91.163  95.267  171.423 1.00 135.01 ? 544 ASN B CG  1 
ATOM   3116 O OD1 . ASN B  2 219 ? 91.128  94.541  172.417 1.00 133.95 ? 544 ASN B OD1 1 
ATOM   3117 N ND2 . ASN B  2 219 ? 90.540  94.958  170.289 1.00 111.98 ? 544 ASN B ND2 1 
ATOM   3118 N N   . CYS C  2 4   ? 40.558  119.454 177.703 1.00 212.70 ? 329 CYS D N   1 
ATOM   3119 C CA  . CYS C  2 4   ? 41.438  120.654 177.662 1.00 212.74 ? 329 CYS D CA  1 
ATOM   3120 C C   . CYS C  2 4   ? 40.977  121.748 178.634 1.00 209.33 ? 329 CYS D C   1 
ATOM   3121 O O   . CYS C  2 4   ? 41.782  122.273 179.404 1.00 204.72 ? 329 CYS D O   1 
ATOM   3122 C CB  . CYS C  2 4   ? 41.494  121.206 176.231 1.00 217.91 ? 329 CYS D CB  1 
ATOM   3123 S SG  . CYS C  2 4   ? 39.884  121.730 175.555 1.00 235.46 ? 329 CYS D SG  1 
ATOM   3124 N N   . ASP C  2 5   ? 39.687  122.084 178.603 1.00 205.92 ? 330 ASP D N   1 
ATOM   3125 C CA  . ASP C  2 5   ? 39.131  123.119 179.482 1.00 196.05 ? 330 ASP D CA  1 
ATOM   3126 C C   . ASP C  2 5   ? 37.854  122.657 180.187 1.00 189.85 ? 330 ASP D C   1 
ATOM   3127 O O   . ASP C  2 5   ? 37.908  122.095 181.282 1.00 181.42 ? 330 ASP D O   1 
ATOM   3128 C CB  . ASP C  2 5   ? 38.840  124.395 178.679 1.00 199.82 ? 330 ASP D CB  1 
ATOM   3129 C CG  . ASP C  2 5   ? 38.321  125.535 179.549 1.00 202.62 ? 330 ASP D CG  1 
ATOM   3130 O OD1 . ASP C  2 5   ? 37.203  125.420 180.100 1.00 194.97 ? 330 ASP D OD1 1 
ATOM   3131 O OD2 . ASP C  2 5   ? 39.037  126.552 179.681 1.00 205.61 ? 330 ASP D OD2 1 
ATOM   3132 N N   . SER C  2 6   ? 36.707  122.905 179.557 1.00 181.30 ? 331 SER D N   1 
ATOM   3133 C CA  . SER C  2 6   ? 35.419  122.512 180.123 1.00 160.04 ? 331 SER D CA  1 
ATOM   3134 C C   . SER C  2 6   ? 35.242  120.995 180.068 1.00 155.18 ? 331 SER D C   1 
ATOM   3135 O O   . SER C  2 6   ? 34.998  120.366 181.098 1.00 160.19 ? 331 SER D O   1 
ATOM   3136 C CB  . SER C  2 6   ? 34.266  123.184 179.364 1.00 153.54 ? 331 SER D CB  1 
ATOM   3137 O OG  . SER C  2 6   ? 34.055  122.582 178.092 1.00 118.76 ? 331 SER D OG  1 
ATOM   3138 N N   . ASN C  2 7   ? 35.368  120.419 178.869 1.00 139.83 ? 332 ASN D N   1 
ATOM   3139 C CA  . ASN C  2 7   ? 35.214  118.978 178.678 1.00 119.63 ? 332 ASN D CA  1 
ATOM   3140 C C   . ASN C  2 7   ? 35.874  118.205 179.816 1.00 97.38  ? 332 ASN D C   1 
ATOM   3141 O O   . ASN C  2 7   ? 37.091  118.207 179.975 1.00 100.38 ? 332 ASN D O   1 
ATOM   3142 C CB  . ASN C  2 7   ? 35.786  118.530 177.325 1.00 147.06 ? 332 ASN D CB  1 
ATOM   3143 C CG  . ASN C  2 7   ? 37.269  118.836 177.170 1.00 164.31 ? 332 ASN D CG  1 
ATOM   3144 O OD1 . ASN C  2 7   ? 37.916  119.341 178.087 1.00 189.92 ? 332 ASN D OD1 1 
ATOM   3145 N ND2 . ASN C  2 7   ? 37.816  118.520 175.998 1.00 179.60 ? 332 ASN D ND2 1 
ATOM   3146 N N   . PRO C  2 8   ? 35.064  117.539 180.644 1.00 72.64  ? 333 PRO D N   1 
ATOM   3147 C CA  . PRO C  2 8   ? 35.595  116.778 181.771 1.00 51.77  ? 333 PRO D CA  1 
ATOM   3148 C C   . PRO C  2 8   ? 36.222  115.480 181.314 1.00 43.12  ? 333 PRO D C   1 
ATOM   3149 O O   . PRO C  2 8   ? 35.858  114.951 180.272 1.00 43.97  ? 333 PRO D O   1 
ATOM   3150 C CB  . PRO C  2 8   ? 34.363  116.548 182.633 1.00 59.49  ? 333 PRO D CB  1 
ATOM   3151 C CG  . PRO C  2 8   ? 33.402  117.622 182.204 1.00 73.61  ? 333 PRO D CG  1 
ATOM   3152 C CD  . PRO C  2 8   ? 33.600  117.604 180.724 1.00 72.03  ? 333 PRO D CD  1 
ATOM   3153 N N   . ARG C  2 9   ? 37.160  114.976 182.107 1.00 40.39  ? 334 ARG D N   1 
ATOM   3154 C CA  . ARG C  2 9   ? 37.866  113.731 181.813 1.00 36.09  ? 334 ARG D CA  1 
ATOM   3155 C C   . ARG C  2 9   ? 37.378  112.727 182.841 1.00 14.58  ? 334 ARG D C   1 
ATOM   3156 O O   . ARG C  2 9   ? 37.095  113.087 183.979 1.00 32.22  ? 334 ARG D O   1 
ATOM   3157 C CB  . ARG C  2 9   ? 39.389  113.936 181.935 1.00 56.81  ? 334 ARG D CB  1 
ATOM   3158 C CG  . ARG C  2 9   ? 40.245  112.697 181.633 1.00 51.32  ? 334 ARG D CG  1 
ATOM   3159 C CD  . ARG C  2 9   ? 41.745  112.986 181.457 1.00 74.70  ? 334 ARG D CD  1 
ATOM   3160 N NE  . ARG C  2 9   ? 42.377  112.028 180.545 1.00 79.76  ? 334 ARG D NE  1 
ATOM   3161 C CZ  . ARG C  2 9   ? 42.757  112.326 179.306 1.00 89.01  ? 334 ARG D CZ  1 
ATOM   3162 N NH1 . ARG C  2 9   ? 42.575  113.553 178.841 1.00 87.67  ? 334 ARG D NH1 1 
ATOM   3163 N NH2 . ARG C  2 9   ? 43.299  111.401 178.525 1.00 104.84 ? 334 ARG D NH2 1 
ATOM   3164 N N   . GLY C  2 10  ? 37.273  111.473 182.444 1.00 11.69  ? 335 GLY D N   1 
ATOM   3165 C CA  . GLY C  2 10  ? 36.759  110.464 183.343 1.00 33.91  ? 335 GLY D CA  1 
ATOM   3166 C C   . GLY C  2 10  ? 37.790  109.753 184.165 1.00 30.42  ? 335 GLY D C   1 
ATOM   3167 O O   . GLY C  2 10  ? 38.979  109.833 183.880 1.00 34.17  ? 335 GLY D O   1 
ATOM   3168 N N   . VAL C  2 11  ? 37.326  109.034 185.179 1.00 23.24  ? 336 VAL D N   1 
ATOM   3169 C CA  . VAL C  2 11  ? 38.220  108.307 186.063 1.00 30.25  ? 336 VAL D CA  1 
ATOM   3170 C C   . VAL C  2 11  ? 39.053  107.302 185.328 1.00 38.55  ? 336 VAL D C   1 
ATOM   3171 O O   . VAL C  2 11  ? 38.554  106.584 184.463 1.00 45.84  ? 336 VAL D O   1 
ATOM   3172 C CB  . VAL C  2 11  ? 37.470  107.553 187.153 1.00 21.18  ? 336 VAL D CB  1 
ATOM   3173 C CG1 . VAL C  2 11  ? 38.326  106.455 187.693 1.00 47.87  ? 336 VAL D CG1 1 
ATOM   3174 C CG2 . VAL C  2 11  ? 37.136  108.471 188.264 1.00 39.32  ? 336 VAL D CG2 1 
ATOM   3175 N N   . SER C  2 12  ? 40.325  107.252 185.712 1.00 36.15  ? 337 SER D N   1 
ATOM   3176 C CA  . SER C  2 12  ? 41.306  106.342 185.141 1.00 42.72  ? 337 SER D CA  1 
ATOM   3177 C C   . SER C  2 12  ? 41.904  105.601 186.321 1.00 37.51  ? 337 SER D C   1 
ATOM   3178 O O   . SER C  2 12  ? 41.957  106.143 187.413 1.00 33.32  ? 337 SER D O   1 
ATOM   3179 C CB  . SER C  2 12  ? 42.393  107.149 184.445 1.00 47.36  ? 337 SER D CB  1 
ATOM   3180 O OG  . SER C  2 12  ? 41.836  108.240 183.724 1.00 69.89  ? 337 SER D OG  1 
ATOM   3181 N N   . ALA C  2 13  ? 42.330  104.361 186.128 1.00 40.25  ? 338 ALA D N   1 
ATOM   3182 C CA  . ALA C  2 13  ? 42.942  103.622 187.234 1.00 35.14  ? 338 ALA D CA  1 
ATOM   3183 C C   . ALA C  2 13  ? 44.176  102.928 186.739 1.00 40.03  ? 338 ALA D C   1 
ATOM   3184 O O   . ALA C  2 13  ? 44.243  102.514 185.591 1.00 65.07  ? 338 ALA D O   1 
ATOM   3185 C CB  . ALA C  2 13  ? 42.005  102.619 187.813 1.00 15.02  ? 338 ALA D CB  1 
ATOM   3186 N N   . TYR C  2 14  ? 45.148  102.798 187.626 1.00 42.60  ? 339 TYR D N   1 
ATOM   3187 C CA  . TYR C  2 14  ? 46.417  102.195 187.298 1.00 35.96  ? 339 TYR D CA  1 
ATOM   3188 C C   . TYR C  2 14  ? 46.835  101.285 188.439 1.00 48.33  ? 339 TYR D C   1 
ATOM   3189 O O   . TYR C  2 14  ? 46.362  101.445 189.558 1.00 62.35  ? 339 TYR D O   1 
ATOM   3190 C CB  . TYR C  2 14  ? 47.422  103.306 187.101 1.00 29.13  ? 339 TYR D CB  1 
ATOM   3191 C CG  . TYR C  2 14  ? 46.976  104.376 186.120 1.00 11.97  ? 339 TYR D CG  1 
ATOM   3192 C CD1 . TYR C  2 14  ? 46.755  105.677 186.536 1.00 45.42  ? 339 TYR D CD1 1 
ATOM   3193 C CD2 . TYR C  2 14  ? 46.873  104.104 184.765 1.00 46.21  ? 339 TYR D CD2 1 
ATOM   3194 C CE1 . TYR C  2 14  ? 46.456  106.687 185.625 1.00 64.43  ? 339 TYR D CE1 1 
ATOM   3195 C CE2 . TYR C  2 14  ? 46.575  105.104 183.851 1.00 51.64  ? 339 TYR D CE2 1 
ATOM   3196 C CZ  . TYR C  2 14  ? 46.373  106.396 184.287 1.00 53.77  ? 339 TYR D CZ  1 
ATOM   3197 O OH  . TYR C  2 14  ? 46.134  107.408 183.379 1.00 77.29  ? 339 TYR D OH  1 
ATOM   3198 N N   . LEU C  2 15  ? 47.730  100.345 188.175 1.00 54.77  ? 340 LEU D N   1 
ATOM   3199 C CA  . LEU C  2 15  ? 48.140  99.410  189.213 1.00 53.10  ? 340 LEU D CA  1 
ATOM   3200 C C   . LEU C  2 15  ? 49.597  99.023  189.051 1.00 70.51  ? 340 LEU D C   1 
ATOM   3201 O O   . LEU C  2 15  ? 49.935  98.238  188.174 1.00 86.39  ? 340 LEU D O   1 
ATOM   3202 C CB  . LEU C  2 15  ? 47.263  98.177  189.122 1.00 4.74   ? 340 LEU D CB  1 
ATOM   3203 C CG  . LEU C  2 15  ? 47.443  97.047  190.119 1.00 30.37  ? 340 LEU D CG  1 
ATOM   3204 C CD1 . LEU C  2 15  ? 47.122  97.518  191.509 1.00 54.76  ? 340 LEU D CD1 1 
ATOM   3205 C CD2 . LEU C  2 15  ? 46.525  95.915  189.742 1.00 62.43  ? 340 LEU D CD2 1 
ATOM   3206 N N   . SER C  2 16  ? 50.456  99.560  189.912 1.00 77.88  ? 341 SER D N   1 
ATOM   3207 C CA  . SER C  2 16  ? 51.886  99.302  189.822 1.00 86.95  ? 341 SER D CA  1 
ATOM   3208 C C   . SER C  2 16  ? 52.304  97.947  190.358 1.00 82.67  ? 341 SER D C   1 
ATOM   3209 O O   . SER C  2 16  ? 51.698  97.429  191.277 1.00 74.32  ? 341 SER D O   1 
ATOM   3210 C CB  . SER C  2 16  ? 52.656  100.405 190.549 1.00 106.68 ? 341 SER D CB  1 
ATOM   3211 O OG  . SER C  2 16  ? 54.041  100.346 190.248 1.00 137.75 ? 341 SER D OG  1 
ATOM   3212 N N   . ARG C  2 17  ? 53.355  97.388  189.766 1.00 90.17  ? 342 ARG D N   1 
ATOM   3213 C CA  . ARG C  2 17  ? 53.912  96.091  190.150 1.00 79.67  ? 342 ARG D CA  1 
ATOM   3214 C C   . ARG C  2 17  ? 55.100  96.277  191.117 1.00 80.08  ? 342 ARG D C   1 
ATOM   3215 O O   . ARG C  2 17  ? 55.835  97.267  191.044 1.00 89.34  ? 342 ARG D O   1 
ATOM   3216 C CB  . ARG C  2 17  ? 54.380  95.361  188.892 1.00 103.47 ? 342 ARG D CB  1 
ATOM   3217 C CG  . ARG C  2 17  ? 55.115  96.289  187.906 1.00 128.40 ? 342 ARG D CG  1 
ATOM   3218 C CD  . ARG C  2 17  ? 55.845  95.557  186.765 1.00 133.64 ? 342 ARG D CD  1 
ATOM   3219 N NE  . ARG C  2 17  ? 54.964  95.031  185.722 1.00 118.92 ? 342 ARG D NE  1 
ATOM   3220 C CZ  . ARG C  2 17  ? 54.265  93.904  185.823 1.00 123.41 ? 342 ARG D CZ  1 
ATOM   3221 N NH1 . ARG C  2 17  ? 54.337  93.159  186.925 1.00 102.98 ? 342 ARG D NH1 1 
ATOM   3222 N NH2 . ARG C  2 17  ? 53.479  93.525  184.823 1.00 133.25 ? 342 ARG D NH2 1 
ATOM   3223 N N   . PRO C  2 18  ? 55.309  95.312  192.025 1.00 57.21  ? 343 PRO D N   1 
ATOM   3224 C CA  . PRO C  2 18  ? 56.390  95.336  193.017 1.00 49.41  ? 343 PRO D CA  1 
ATOM   3225 C C   . PRO C  2 18  ? 57.728  95.556  192.357 1.00 57.34  ? 343 PRO D C   1 
ATOM   3226 O O   . PRO C  2 18  ? 58.023  94.920  191.352 1.00 83.82  ? 343 PRO D O   1 
ATOM   3227 C CB  . PRO C  2 18  ? 56.323  93.946  193.638 1.00 49.70  ? 343 PRO D CB  1 
ATOM   3228 C CG  . PRO C  2 18  ? 54.925  93.534  193.435 1.00 47.56  ? 343 PRO D CG  1 
ATOM   3229 C CD  . PRO C  2 18  ? 54.613  94.020  192.055 1.00 52.06  ? 343 PRO D CD  1 
ATOM   3230 N N   . SER C  2 19  ? 58.555  96.430  192.906 1.00 59.46  ? 344 SER D N   1 
ATOM   3231 C CA  . SER C  2 19  ? 59.859  96.648  192.298 1.00 78.56  ? 344 SER D CA  1 
ATOM   3232 C C   . SER C  2 19  ? 60.764  95.480  192.681 1.00 78.29  ? 344 SER D C   1 
ATOM   3233 O O   . SER C  2 19  ? 60.571  94.858  193.730 1.00 64.44  ? 344 SER D O   1 
ATOM   3234 C CB  . SER C  2 19  ? 60.476  97.969  192.781 1.00 85.19  ? 344 SER D CB  1 
ATOM   3235 O OG  . SER C  2 19  ? 60.734  97.939  194.173 1.00 85.78  ? 344 SER D OG  1 
ATOM   3236 N N   . PRO C  2 20  ? 61.744  95.149  191.822 1.00 77.54  ? 345 PRO D N   1 
ATOM   3237 C CA  . PRO C  2 20  ? 62.673  94.054  192.096 1.00 74.00  ? 345 PRO D CA  1 
ATOM   3238 C C   . PRO C  2 20  ? 63.162  94.234  193.523 1.00 76.06  ? 345 PRO D C   1 
ATOM   3239 O O   . PRO C  2 20  ? 63.009  93.356  194.382 1.00 74.53  ? 345 PRO D O   1 
ATOM   3240 C CB  . PRO C  2 20  ? 63.792  94.311  191.101 1.00 68.18  ? 345 PRO D CB  1 
ATOM   3241 C CG  . PRO C  2 20  ? 63.078  94.883  189.947 1.00 65.34  ? 345 PRO D CG  1 
ATOM   3242 C CD  . PRO C  2 20  ? 62.114  95.844  190.579 1.00 72.85  ? 345 PRO D CD  1 
ATOM   3243 N N   . PHE C  2 21  ? 63.745  95.408  193.750 1.00 54.25  ? 346 PHE D N   1 
ATOM   3244 C CA  . PHE C  2 21  ? 64.270  95.788  195.044 1.00 53.48  ? 346 PHE D CA  1 
ATOM   3245 C C   . PHE C  2 21  ? 63.300  95.463  196.180 1.00 53.06  ? 346 PHE D C   1 
ATOM   3246 O O   . PHE C  2 21  ? 63.557  94.562  196.976 1.00 58.24  ? 346 PHE D O   1 
ATOM   3247 C CB  . PHE C  2 21  ? 64.603  97.279  195.036 1.00 69.91  ? 346 PHE D CB  1 
ATOM   3248 C CG  . PHE C  2 21  ? 65.157  97.779  196.334 1.00 90.08  ? 346 PHE D CG  1 
ATOM   3249 C CD1 . PHE C  2 21  ? 66.368  97.309  196.814 1.00 88.21  ? 346 PHE D CD1 1 
ATOM   3250 C CD2 . PHE C  2 21  ? 64.459  98.712  197.085 1.00 107.91 ? 346 PHE D CD2 1 
ATOM   3251 C CE1 . PHE C  2 21  ? 66.874  97.759  198.016 1.00 107.96 ? 346 PHE D CE1 1 
ATOM   3252 C CE2 . PHE C  2 21  ? 64.958  99.170  198.294 1.00 114.49 ? 346 PHE D CE2 1 
ATOM   3253 C CZ  . PHE C  2 21  ? 66.167  98.693  198.761 1.00 121.51 ? 346 PHE D CZ  1 
ATOM   3254 N N   . ASP C  2 22  ? 62.186  96.182  196.250 1.00 51.13  ? 347 ASP D N   1 
ATOM   3255 C CA  . ASP C  2 22  ? 61.199  95.958  197.302 1.00 75.52  ? 347 ASP D CA  1 
ATOM   3256 C C   . ASP C  2 22  ? 60.791  94.494  197.407 1.00 77.63  ? 347 ASP D C   1 
ATOM   3257 O O   . ASP C  2 22  ? 60.144  94.086  198.373 1.00 78.27  ? 347 ASP D O   1 
ATOM   3258 C CB  . ASP C  2 22  ? 59.939  96.792  197.044 1.00 97.07  ? 347 ASP D CB  1 
ATOM   3259 C CG  . ASP C  2 22  ? 60.121  98.260  197.380 1.00 116.01 ? 347 ASP D CG  1 
ATOM   3260 O OD1 . ASP C  2 22  ? 60.197  98.590  198.583 1.00 131.97 ? 347 ASP D OD1 1 
ATOM   3261 O OD2 . ASP C  2 22  ? 60.189  99.084  196.443 1.00 125.77 ? 347 ASP D OD2 1 
ATOM   3262 N N   . LEU C  2 23  ? 61.191  93.697  196.427 1.00 68.91  ? 348 LEU D N   1 
ATOM   3263 C CA  . LEU C  2 23  ? 60.791  92.304  196.400 1.00 67.93  ? 348 LEU D CA  1 
ATOM   3264 C C   . LEU C  2 23  ? 61.823  91.287  196.838 1.00 77.13  ? 348 LEU D C   1 
ATOM   3265 O O   . LEU C  2 23  ? 61.456  90.240  197.381 1.00 68.66  ? 348 LEU D O   1 
ATOM   3266 C CB  . LEU C  2 23  ? 60.293  91.977  194.991 1.00 56.92  ? 348 LEU D CB  1 
ATOM   3267 C CG  . LEU C  2 23  ? 59.764  90.586  194.663 1.00 75.63  ? 348 LEU D CG  1 
ATOM   3268 C CD1 . LEU C  2 23  ? 58.851  90.063  195.737 1.00 67.80  ? 348 LEU D CD1 1 
ATOM   3269 C CD2 . LEU C  2 23  ? 59.041  90.673  193.342 1.00 90.13  ? 348 LEU D CD2 1 
ATOM   3270 N N   . PHE C  2 24  ? 63.103  91.596  196.617 1.00 91.21  ? 349 PHE D N   1 
ATOM   3271 C CA  . PHE C  2 24  ? 64.195  90.681  196.959 1.00 95.62  ? 349 PHE D CA  1 
ATOM   3272 C C   . PHE C  2 24  ? 65.098  91.150  198.076 1.00 95.48  ? 349 PHE D C   1 
ATOM   3273 O O   . PHE C  2 24  ? 65.470  90.369  198.955 1.00 97.51  ? 349 PHE D O   1 
ATOM   3274 C CB  . PHE C  2 24  ? 64.993  90.401  195.706 1.00 85.85  ? 349 PHE D CB  1 
ATOM   3275 C CG  . PHE C  2 24  ? 64.191  89.710  194.656 1.00 91.35  ? 349 PHE D CG  1 
ATOM   3276 C CD1 . PHE C  2 24  ? 64.403  89.967  193.315 1.00 87.04  ? 349 PHE D CD1 1 
ATOM   3277 C CD2 . PHE C  2 24  ? 63.194  88.804  195.021 1.00 81.90  ? 349 PHE D CD2 1 
ATOM   3278 C CE1 . PHE C  2 24  ? 63.633  89.339  192.352 1.00 79.88  ? 349 PHE D CE1 1 
ATOM   3279 C CE2 . PHE C  2 24  ? 62.420  88.171  194.061 1.00 88.78  ? 349 PHE D CE2 1 
ATOM   3280 C CZ  . PHE C  2 24  ? 62.639  88.439  192.724 1.00 89.44  ? 349 PHE D CZ  1 
ATOM   3281 N N   . ILE C  2 25  ? 65.464  92.422  198.033 1.00 90.72  ? 350 ILE D N   1 
ATOM   3282 C CA  . ILE C  2 25  ? 66.276  92.993  199.088 1.00 83.27  ? 350 ILE D CA  1 
ATOM   3283 C C   . ILE C  2 25  ? 65.337  93.162  200.286 1.00 90.42  ? 350 ILE D C   1 
ATOM   3284 O O   . ILE C  2 25  ? 65.229  92.277  201.143 1.00 93.40  ? 350 ILE D O   1 
ATOM   3285 C CB  . ILE C  2 25  ? 66.804  94.381  198.700 1.00 72.44  ? 350 ILE D CB  1 
ATOM   3286 C CG1 . ILE C  2 25  ? 67.638  94.282  197.428 1.00 58.85  ? 350 ILE D CG1 1 
ATOM   3287 C CG2 . ILE C  2 25  ? 67.594  94.970  199.850 1.00 86.24  ? 350 ILE D CG2 1 
ATOM   3288 C CD1 . ILE C  2 25  ? 68.682  93.207  197.474 1.00 83.58  ? 350 ILE D CD1 1 
ATOM   3289 N N   . ARG C  2 26  ? 64.639  94.299  200.302 1.00 82.41  ? 351 ARG D N   1 
ATOM   3290 C CA  . ARG C  2 26  ? 63.696  94.661  201.356 1.00 84.19  ? 351 ARG D CA  1 
ATOM   3291 C C   . ARG C  2 26  ? 62.738  93.529  201.737 1.00 82.72  ? 351 ARG D C   1 
ATOM   3292 O O   . ARG C  2 26  ? 62.129  93.558  202.807 1.00 82.71  ? 351 ARG D O   1 
ATOM   3293 C CB  . ARG C  2 26  ? 62.908  95.894  200.909 1.00 86.67  ? 351 ARG D CB  1 
ATOM   3294 C CG  . ARG C  2 26  ? 62.429  96.796  202.033 1.00 107.96 ? 351 ARG D CG  1 
ATOM   3295 C CD  . ARG C  2 26  ? 62.218  98.216  201.513 1.00 120.74 ? 351 ARG D CD  1 
ATOM   3296 N NE  . ARG C  2 26  ? 61.772  99.135  202.556 1.00 160.85 ? 351 ARG D NE  1 
ATOM   3297 C CZ  . ARG C  2 26  ? 60.594  99.057  203.165 1.00 181.16 ? 351 ARG D CZ  1 
ATOM   3298 N NH1 . ARG C  2 26  ? 59.738  98.100  202.835 1.00 195.90 ? 351 ARG D NH1 1 
ATOM   3299 N NH2 . ARG C  2 26  ? 60.271  99.937  204.105 1.00 188.57 ? 351 ARG D NH2 1 
ATOM   3300 N N   . LYS C  2 27  ? 62.620  92.536  200.860 1.00 84.39  ? 352 LYS D N   1 
ATOM   3301 C CA  . LYS C  2 27  ? 61.754  91.375  201.066 1.00 102.53 ? 352 LYS D CA  1 
ATOM   3302 C C   . LYS C  2 27  ? 60.339  91.659  201.587 1.00 111.39 ? 352 LYS D C   1 
ATOM   3303 O O   . LYS C  2 27  ? 59.714  90.793  202.198 1.00 112.89 ? 352 LYS D O   1 
ATOM   3304 C CB  . LYS C  2 27  ? 62.443  90.351  201.977 1.00 114.69 ? 352 LYS D CB  1 
ATOM   3305 C CG  . LYS C  2 27  ? 63.695  89.710  201.380 1.00 129.39 ? 352 LYS D CG  1 
ATOM   3306 C CD  . LYS C  2 27  ? 64.045  88.410  202.099 1.00 143.11 ? 352 LYS D CD  1 
ATOM   3307 C CE  . LYS C  2 27  ? 65.381  87.834  201.642 1.00 144.23 ? 352 LYS D CE  1 
ATOM   3308 N NZ  . LYS C  2 27  ? 66.539  88.623  202.153 1.00 158.93 ? 352 LYS D NZ  1 
ATOM   3309 N N   . SER C  2 28  ? 59.841  92.869  201.344 1.00 115.34 ? 353 SER D N   1 
ATOM   3310 C CA  . SER C  2 28  ? 58.484  93.265  201.740 1.00 110.55 ? 353 SER D CA  1 
ATOM   3311 C C   . SER C  2 28  ? 57.907  94.012  200.534 1.00 98.44  ? 353 SER D C   1 
ATOM   3312 O O   . SER C  2 28  ? 57.957  95.243  200.446 1.00 86.81  ? 353 SER D O   1 
ATOM   3313 C CB  . SER C  2 28  ? 58.506  94.174  202.975 1.00 122.16 ? 353 SER D CB  1 
ATOM   3314 O OG  . SER C  2 28  ? 59.158  95.404  202.707 1.00 145.95 ? 353 SER D OG  1 
ATOM   3315 N N   . PRO C  2 29  ? 57.350  93.261  199.578 1.00 88.95  ? 354 PRO D N   1 
ATOM   3316 C CA  . PRO C  2 29  ? 56.770  93.816  198.361 1.00 80.66  ? 354 PRO D CA  1 
ATOM   3317 C C   . PRO C  2 29  ? 55.367  94.332  198.547 1.00 80.26  ? 354 PRO D C   1 
ATOM   3318 O O   . PRO C  2 29  ? 54.605  93.797  199.350 1.00 78.11  ? 354 PRO D O   1 
ATOM   3319 C CB  . PRO C  2 29  ? 56.785  92.630  197.393 1.00 79.55  ? 354 PRO D CB  1 
ATOM   3320 C CG  . PRO C  2 29  ? 57.526  91.526  198.127 1.00 84.32  ? 354 PRO D CG  1 
ATOM   3321 C CD  . PRO C  2 29  ? 57.251  91.797  199.555 1.00 87.91  ? 354 PRO D CD  1 
ATOM   3322 N N   . THR C  2 30  ? 55.033  95.366  197.781 1.00 69.81  ? 355 THR D N   1 
ATOM   3323 C CA  . THR C  2 30  ? 53.706  95.957  197.813 1.00 63.68  ? 355 THR D CA  1 
ATOM   3324 C C   . THR C  2 30  ? 53.328  96.554  196.475 1.00 71.87  ? 355 THR D C   1 
ATOM   3325 O O   . THR C  2 30  ? 54.123  97.269  195.852 1.00 72.13  ? 355 THR D O   1 
ATOM   3326 C CB  . THR C  2 30  ? 53.598  97.082  198.827 1.00 64.93  ? 355 THR D CB  1 
ATOM   3327 O OG1 . THR C  2 30  ? 54.557  98.101  198.513 1.00 64.97  ? 355 THR D OG1 1 
ATOM   3328 C CG2 . THR C  2 30  ? 53.816  96.551  200.232 1.00 99.49  ? 355 THR D CG2 1 
ATOM   3329 N N   . ILE C  2 31  ? 52.100  96.261  196.054 1.00 70.57  ? 356 ILE D N   1 
ATOM   3330 C CA  . ILE C  2 31  ? 51.550  96.771  194.809 1.00 62.52  ? 356 ILE D CA  1 
ATOM   3331 C C   . ILE C  2 31  ? 50.660  97.956  195.140 1.00 54.00  ? 356 ILE D C   1 
ATOM   3332 O O   . ILE C  2 31  ? 50.092  98.020  196.214 1.00 48.95  ? 356 ILE D O   1 
ATOM   3333 C CB  . ILE C  2 31  ? 50.725  95.712  194.105 1.00 52.12  ? 356 ILE D CB  1 
ATOM   3334 C CG1 . ILE C  2 31  ? 49.693  95.138  195.059 1.00 61.07  ? 356 ILE D CG1 1 
ATOM   3335 C CG2 . ILE C  2 31  ? 51.621  94.618  193.613 1.00 73.34  ? 356 ILE D CG2 1 
ATOM   3336 C CD1 . ILE C  2 31  ? 48.895  93.992  194.466 1.00 64.11  ? 356 ILE D CD1 1 
ATOM   3337 N N   . THR C  2 32  ? 50.527  98.886  194.210 1.00 59.04  ? 357 THR D N   1 
ATOM   3338 C CA  . THR C  2 32  ? 49.738  100.075 194.453 1.00 59.61  ? 357 THR D CA  1 
ATOM   3339 C C   . THR C  2 32  ? 48.719  100.390 193.367 1.00 62.37  ? 357 THR D C   1 
ATOM   3340 O O   . THR C  2 32  ? 49.043  100.408 192.182 1.00 62.43  ? 357 THR D O   1 
ATOM   3341 C CB  . THR C  2 32  ? 50.661  101.268 194.609 1.00 61.82  ? 357 THR D CB  1 
ATOM   3342 O OG1 . THR C  2 32  ? 51.732  100.908 195.484 1.00 86.07  ? 357 THR D OG1 1 
ATOM   3343 C CG2 . THR C  2 32  ? 49.919  102.440 195.180 1.00 73.74  ? 357 THR D CG2 1 
ATOM   3344 N N   . CYS C  2 33  ? 47.487  100.656 193.794 1.00 65.25  ? 358 CYS D N   1 
ATOM   3345 C CA  . CYS C  2 33  ? 46.388  100.989 192.898 1.00 61.42  ? 358 CYS D CA  1 
ATOM   3346 C C   . CYS C  2 33  ? 46.155  102.478 192.983 1.00 55.15  ? 358 CYS D C   1 
ATOM   3347 O O   . CYS C  2 33  ? 45.867  102.993 194.054 1.00 70.28  ? 358 CYS D O   1 
ATOM   3348 C CB  . CYS C  2 33  ? 45.135  100.263 193.341 1.00 74.08  ? 358 CYS D CB  1 
ATOM   3349 S SG  . CYS C  2 33  ? 43.775  100.299 192.140 1.00 73.47  ? 358 CYS D SG  1 
ATOM   3350 N N   . LEU C  2 34  ? 46.272  103.174 191.864 1.00 39.65  ? 359 LEU D N   1 
ATOM   3351 C CA  . LEU C  2 34  ? 46.105  104.616 191.868 1.00 37.22  ? 359 LEU D CA  1 
ATOM   3352 C C   . LEU C  2 34  ? 44.954  105.063 190.986 1.00 43.89  ? 359 LEU D C   1 
ATOM   3353 O O   . LEU C  2 34  ? 44.956  104.830 189.784 1.00 60.90  ? 359 LEU D O   1 
ATOM   3354 C CB  . LEU C  2 34  ? 47.404  105.279 191.410 1.00 43.57  ? 359 LEU D CB  1 
ATOM   3355 C CG  . LEU C  2 34  ? 47.322  106.716 190.905 1.00 27.63  ? 359 LEU D CG  1 
ATOM   3356 C CD1 . LEU C  2 34  ? 46.716  107.566 191.963 1.00 53.51  ? 359 LEU D CD1 1 
ATOM   3357 C CD2 . LEU C  2 34  ? 48.703  107.229 190.549 1.00 73.74  ? 359 LEU D CD2 1 
ATOM   3358 N N   . VAL C  2 35  ? 43.971  105.715 191.591 1.00 46.78  ? 360 VAL D N   1 
ATOM   3359 C CA  . VAL C  2 35  ? 42.821  106.193 190.853 1.00 40.07  ? 360 VAL D CA  1 
ATOM   3360 C C   . VAL C  2 35  ? 42.927  107.681 190.661 1.00 36.35  ? 360 VAL D C   1 
ATOM   3361 O O   . VAL C  2 35  ? 43.209  108.404 191.601 1.00 48.62  ? 360 VAL D O   1 
ATOM   3362 C CB  . VAL C  2 35  ? 41.539  105.909 191.602 1.00 32.99  ? 360 VAL D CB  1 
ATOM   3363 C CG1 . VAL C  2 35  ? 40.388  106.459 190.821 1.00 50.37  ? 360 VAL D CG1 1 
ATOM   3364 C CG2 . VAL C  2 35  ? 41.365  104.422 191.810 1.00 28.78  ? 360 VAL D CG2 1 
ATOM   3365 N N   . VAL C  2 36  ? 42.677  108.146 189.450 1.00 29.71  ? 361 VAL D N   1 
ATOM   3366 C CA  . VAL C  2 36  ? 42.771  109.574 189.156 1.00 35.67  ? 361 VAL D CA  1 
ATOM   3367 C C   . VAL C  2 36  ? 41.525  110.131 188.458 1.00 38.71  ? 361 VAL D C   1 
ATOM   3368 O O   . VAL C  2 36  ? 40.695  109.389 187.937 1.00 43.46  ? 361 VAL D O   1 
ATOM   3369 C CB  . VAL C  2 36  ? 44.007  109.853 188.272 1.00 26.61  ? 361 VAL D CB  1 
ATOM   3370 C CG1 . VAL C  2 36  ? 44.974  108.690 188.387 1.00 48.57  ? 361 VAL D CG1 1 
ATOM   3371 C CG2 . VAL C  2 36  ? 43.595  110.013 186.820 1.00 45.42  ? 361 VAL D CG2 1 
ATOM   3372 N N   . ASP C  2 37  ? 41.422  111.452 188.433 1.00 35.18  ? 362 ASP D N   1 
ATOM   3373 C CA  . ASP C  2 37  ? 40.308  112.142 187.804 1.00 39.83  ? 362 ASP D CA  1 
ATOM   3374 C C   . ASP C  2 37  ? 38.945  111.946 188.458 1.00 44.42  ? 362 ASP D C   1 
ATOM   3375 O O   . ASP C  2 37  ? 37.914  112.146 187.816 1.00 51.21  ? 362 ASP D O   1 
ATOM   3376 C CB  . ASP C  2 37  ? 40.227  111.794 186.324 1.00 55.81  ? 362 ASP D CB  1 
ATOM   3377 C CG  . ASP C  2 37  ? 41.377  112.380 185.527 1.00 82.22  ? 362 ASP D CG  1 
ATOM   3378 O OD1 . ASP C  2 37  ? 41.751  113.542 185.804 1.00 64.24  ? 362 ASP D OD1 1 
ATOM   3379 O OD2 . ASP C  2 37  ? 41.893  111.684 184.620 1.00 99.85  ? 362 ASP D OD2 1 
ATOM   3380 N N   . LEU C  2 38  ? 38.943  111.554 189.730 1.00 27.84  ? 363 LEU D N   1 
ATOM   3381 C CA  . LEU C  2 38  ? 37.709  111.405 190.496 1.00 30.55  ? 363 LEU D CA  1 
ATOM   3382 C C   . LEU C  2 38  ? 37.243  112.814 190.820 1.00 61.06  ? 363 LEU D C   1 
ATOM   3383 O O   . LEU C  2 38  ? 38.045  113.751 190.805 1.00 54.00  ? 363 LEU D O   1 
ATOM   3384 C CB  . LEU C  2 38  ? 37.964  110.712 191.820 1.00 13.82  ? 363 LEU D CB  1 
ATOM   3385 C CG  . LEU C  2 38  ? 38.139  109.208 191.819 1.00 38.32  ? 363 LEU D CG  1 
ATOM   3386 C CD1 . LEU C  2 38  ? 38.611  108.750 193.177 1.00 48.76  ? 363 LEU D CD1 1 
ATOM   3387 C CD2 . LEU C  2 38  ? 36.839  108.553 191.480 1.00 33.54  ? 363 LEU D CD2 1 
ATOM   3388 N N   . ALA C  2 39  ? 35.962  112.974 191.142 1.00 96.43  ? 364 ALA D N   1 
ATOM   3389 C CA  . ALA C  2 39  ? 35.443  114.297 191.475 1.00 108.94 ? 364 ALA D CA  1 
ATOM   3390 C C   . ALA C  2 39  ? 34.498  114.228 192.656 1.00 115.79 ? 364 ALA D C   1 
ATOM   3391 O O   . ALA C  2 39  ? 33.729  113.273 192.797 1.00 127.22 ? 364 ALA D O   1 
ATOM   3392 C CB  . ALA C  2 39  ? 34.731  114.906 190.280 1.00 101.62 ? 364 ALA D CB  1 
ATOM   3393 N N   . PRO C  2 40  ? 34.548  115.252 193.524 1.00 112.63 ? 365 PRO D N   1 
ATOM   3394 C CA  . PRO C  2 40  ? 33.710  115.360 194.723 1.00 103.65 ? 365 PRO D CA  1 
ATOM   3395 C C   . PRO C  2 40  ? 32.323  114.734 194.549 1.00 101.12 ? 365 PRO D C   1 
ATOM   3396 O O   . PRO C  2 40  ? 31.436  115.298 193.916 1.00 77.39  ? 365 PRO D O   1 
ATOM   3397 C CB  . PRO C  2 40  ? 33.666  116.860 194.958 1.00 95.02  ? 365 PRO D CB  1 
ATOM   3398 C CG  . PRO C  2 40  ? 35.087  117.254 194.616 1.00 85.22  ? 365 PRO D CG  1 
ATOM   3399 C CD  . PRO C  2 40  ? 35.391  116.455 193.354 1.00 76.20  ? 365 PRO D CD  1 
ATOM   3400 N N   . SER C  2 41  ? 32.162  113.542 195.107 1.00 120.33 ? 366 SER D N   1 
ATOM   3401 C CA  . SER C  2 41  ? 30.904  112.816 195.033 1.00 130.75 ? 366 SER D CA  1 
ATOM   3402 C C   . SER C  2 41  ? 30.313  112.752 196.438 1.00 153.98 ? 366 SER D C   1 
ATOM   3403 O O   . SER C  2 41  ? 31.031  112.918 197.428 1.00 152.14 ? 366 SER D O   1 
ATOM   3404 C CB  . SER C  2 41  ? 31.149  111.400 194.503 1.00 120.00 ? 366 SER D CB  1 
ATOM   3405 O OG  . SER C  2 41  ? 32.105  110.710 195.302 1.00 109.66 ? 366 SER D OG  1 
ATOM   3406 N N   . LYS C  2 42  ? 29.007  112.523 196.524 1.00 164.86 ? 367 LYS D N   1 
ATOM   3407 C CA  . LYS C  2 42  ? 28.341  112.430 197.819 1.00 168.01 ? 367 LYS D CA  1 
ATOM   3408 C C   . LYS C  2 42  ? 28.355  110.982 198.274 1.00 160.69 ? 367 LYS D C   1 
ATOM   3409 O O   . LYS C  2 42  ? 28.021  110.677 199.416 1.00 160.02 ? 367 LYS D O   1 
ATOM   3410 C CB  . LYS C  2 42  ? 26.896  112.910 197.720 1.00 174.77 ? 367 LYS D CB  1 
ATOM   3411 C CG  . LYS C  2 42  ? 26.739  114.334 197.233 1.00 189.10 ? 367 LYS D CG  1 
ATOM   3412 C CD  . LYS C  2 42  ? 27.059  115.373 198.291 1.00 187.96 ? 367 LYS D CD  1 
ATOM   3413 C CE  . LYS C  2 42  ? 26.738  116.763 197.760 1.00 189.34 ? 367 LYS D CE  1 
ATOM   3414 N NZ  . LYS C  2 42  ? 26.913  117.823 198.784 1.00 185.66 ? 367 LYS D NZ  1 
ATOM   3415 N N   . GLY C  2 43  ? 28.735  110.093 197.365 1.00 155.66 ? 368 GLY D N   1 
ATOM   3416 C CA  . GLY C  2 43  ? 28.791  108.685 197.696 1.00 151.20 ? 368 GLY D CA  1 
ATOM   3417 C C   . GLY C  2 43  ? 30.217  108.220 197.912 1.00 155.98 ? 368 GLY D C   1 
ATOM   3418 O O   . GLY C  2 43  ? 31.174  108.928 197.582 1.00 160.11 ? 368 GLY D O   1 
ATOM   3419 N N   . THR C  2 44  ? 30.355  107.023 198.476 1.00 150.93 ? 369 THR D N   1 
ATOM   3420 C CA  . THR C  2 44  ? 31.661  106.424 198.740 1.00 142.91 ? 369 THR D CA  1 
ATOM   3421 C C   . THR C  2 44  ? 32.375  106.253 197.396 1.00 127.52 ? 369 THR D C   1 
ATOM   3422 O O   . THR C  2 44  ? 31.908  106.754 196.380 1.00 134.94 ? 369 THR D O   1 
ATOM   3423 C CB  . THR C  2 44  ? 31.492  105.030 199.398 1.00 149.29 ? 369 THR D CB  1 
ATOM   3424 O OG1 . THR C  2 44  ? 30.447  105.089 200.378 1.00 153.60 ? 369 THR D OG1 1 
ATOM   3425 C CG2 . THR C  2 44  ? 32.788  104.590 200.079 1.00 153.41 ? 369 THR D CG2 1 
ATOM   3426 N N   . VAL C  2 45  ? 33.514  105.566 197.397 1.00 108.35 ? 370 VAL D N   1 
ATOM   3427 C CA  . VAL C  2 45  ? 34.254  105.306 196.166 1.00 65.18  ? 370 VAL D CA  1 
ATOM   3428 C C   . VAL C  2 45  ? 34.955  103.979 196.320 1.00 53.43  ? 370 VAL D C   1 
ATOM   3429 O O   . VAL C  2 45  ? 36.068  103.773 195.862 1.00 45.37  ? 370 VAL D O   1 
ATOM   3430 C CB  . VAL C  2 45  ? 35.273  106.414 195.851 1.00 64.40  ? 370 VAL D CB  1 
ATOM   3431 C CG1 . VAL C  2 45  ? 35.805  106.246 194.401 1.00 13.06  ? 370 VAL D CG1 1 
ATOM   3432 C CG2 . VAL C  2 45  ? 34.616  107.793 196.044 1.00 58.05  ? 370 VAL D CG2 1 
ATOM   3433 N N   . ASN C  2 46  ? 34.256  103.075 196.988 1.00 61.26  ? 371 ASN D N   1 
ATOM   3434 C CA  . ASN C  2 46  ? 34.734  101.724 197.243 1.00 69.58  ? 371 ASN D CA  1 
ATOM   3435 C C   . ASN C  2 46  ? 35.958  101.252 196.469 1.00 70.99  ? 371 ASN D C   1 
ATOM   3436 O O   . ASN C  2 46  ? 35.988  101.271 195.234 1.00 44.26  ? 371 ASN D O   1 
ATOM   3437 C CB  . ASN C  2 46  ? 33.595  100.719 196.996 1.00 74.52  ? 371 ASN D CB  1 
ATOM   3438 C CG  . ASN C  2 46  ? 32.950  100.229 198.274 1.00 98.85  ? 371 ASN D CG  1 
ATOM   3439 O OD1 . ASN C  2 46  ? 32.407  101.025 199.043 1.00 104.20 ? 371 ASN D OD1 1 
ATOM   3440 N ND2 . ASN C  2 46  ? 32.979  98.919  198.497 1.00 112.65 ? 371 ASN D ND2 1 
ATOM   3441 N N   . LEU C  2 47  ? 36.972  100.847 197.218 1.00 75.54  ? 372 LEU D N   1 
ATOM   3442 C CA  . LEU C  2 47  ? 38.168  100.270 196.635 1.00 52.82  ? 372 LEU D CA  1 
ATOM   3443 C C   . LEU C  2 47  ? 38.164  98.893  197.302 1.00 68.56  ? 372 LEU D C   1 
ATOM   3444 O O   . LEU C  2 47  ? 37.925  98.774  198.504 1.00 91.70  ? 372 LEU D O   1 
ATOM   3445 C CB  . LEU C  2 47  ? 39.399  101.036 197.078 1.00 44.95  ? 372 LEU D CB  1 
ATOM   3446 C CG  . LEU C  2 47  ? 40.698  100.819 196.321 1.00 37.02  ? 372 LEU D CG  1 
ATOM   3447 C CD1 . LEU C  2 47  ? 40.673  99.475  195.610 1.00 54.45  ? 372 LEU D CD1 1 
ATOM   3448 C CD2 . LEU C  2 47  ? 40.854  101.961 195.344 1.00 18.82  ? 372 LEU D CD2 1 
ATOM   3449 N N   . THR C  2 48  ? 38.398  97.852  196.524 1.00 49.16  ? 373 THR D N   1 
ATOM   3450 C CA  . THR C  2 48  ? 38.367  96.516  197.078 1.00 48.89  ? 373 THR D CA  1 
ATOM   3451 C C   . THR C  2 48  ? 39.435  95.613  196.478 1.00 64.82  ? 373 THR D C   1 
ATOM   3452 O O   . THR C  2 48  ? 39.493  95.440  195.262 1.00 62.61  ? 373 THR D O   1 
ATOM   3453 C CB  . THR C  2 48  ? 36.958  95.894  196.859 1.00 69.69  ? 373 THR D CB  1 
ATOM   3454 O OG1 . THR C  2 48  ? 35.980  96.704  197.523 1.00 78.26  ? 373 THR D OG1 1 
ATOM   3455 C CG2 . THR C  2 48  ? 36.905  94.478  197.408 1.00 92.83  ? 373 THR D CG2 1 
ATOM   3456 N N   . TRP C  2 49  ? 40.273  95.032  197.335 1.00 65.26  ? 374 TRP D N   1 
ATOM   3457 C CA  . TRP C  2 49  ? 41.343  94.148  196.885 1.00 59.59  ? 374 TRP D CA  1 
ATOM   3458 C C   . TRP C  2 49  ? 40.954  92.681  196.910 1.00 67.89  ? 374 TRP D C   1 
ATOM   3459 O O   . TRP C  2 49  ? 40.261  92.236  197.822 1.00 79.72  ? 374 TRP D O   1 
ATOM   3460 C CB  . TRP C  2 49  ? 42.566  94.309  197.769 1.00 56.34  ? 374 TRP D CB  1 
ATOM   3461 C CG  . TRP C  2 49  ? 43.280  95.595  197.614 1.00 46.55  ? 374 TRP D CG  1 
ATOM   3462 C CD1 . TRP C  2 49  ? 43.176  96.697  198.410 1.00 55.39  ? 374 TRP D CD1 1 
ATOM   3463 C CD2 . TRP C  2 49  ? 44.219  95.924  196.593 1.00 35.93  ? 374 TRP D CD2 1 
ATOM   3464 N NE1 . TRP C  2 49  ? 44.000  97.697  197.944 1.00 33.46  ? 374 TRP D NE1 1 
ATOM   3465 C CE2 . TRP C  2 49  ? 44.648  97.244  196.827 1.00 31.68  ? 374 TRP D CE2 1 
ATOM   3466 C CE3 . TRP C  2 49  ? 44.740  95.229  195.500 1.00 36.93  ? 374 TRP D CE3 1 
ATOM   3467 C CZ2 . TRP C  2 49  ? 45.570  97.881  196.006 1.00 36.22  ? 374 TRP D CZ2 1 
ATOM   3468 C CZ3 . TRP C  2 49  ? 45.658  95.864  194.684 1.00 31.97  ? 374 TRP D CZ3 1 
ATOM   3469 C CH2 . TRP C  2 49  ? 46.064  97.175  194.939 1.00 34.85  ? 374 TRP D CH2 1 
ATOM   3470 N N   . SER C  2 50  ? 41.434  91.916  195.936 1.00 66.39  ? 375 SER D N   1 
ATOM   3471 C CA  . SER C  2 50  ? 41.110  90.496  195.878 1.00 82.67  ? 375 SER D CA  1 
ATOM   3472 C C   . SER C  2 50  ? 42.135  89.659  195.114 1.00 90.73  ? 375 SER D C   1 
ATOM   3473 O O   . SER C  2 50  ? 42.802  90.157  194.202 1.00 70.54  ? 375 SER D O   1 
ATOM   3474 C CB  . SER C  2 50  ? 39.737  90.325  195.236 1.00 97.44  ? 375 SER D CB  1 
ATOM   3475 O OG  . SER C  2 50  ? 39.703  90.935  193.956 1.00 102.72 ? 375 SER D OG  1 
ATOM   3476 N N   . ARG C  2 51  ? 42.253  88.386  195.493 1.00 93.34  ? 376 ARG D N   1 
ATOM   3477 C CA  . ARG C  2 51  ? 43.174  87.466  194.831 1.00 99.73  ? 376 ARG D CA  1 
ATOM   3478 C C   . ARG C  2 51  ? 42.420  86.499  193.927 1.00 108.22 ? 376 ARG D C   1 
ATOM   3479 O O   . ARG C  2 51  ? 41.260  86.168  194.186 1.00 107.21 ? 376 ARG D O   1 
ATOM   3480 C CB  . ARG C  2 51  ? 43.974  86.665  195.854 1.00 103.45 ? 376 ARG D CB  1 
ATOM   3481 C CG  . ARG C  2 51  ? 45.158  87.402  196.423 1.00 115.11 ? 376 ARG D CG  1 
ATOM   3482 C CD  . ARG C  2 51  ? 46.249  86.437  196.863 1.00 124.01 ? 376 ARG D CD  1 
ATOM   3483 N NE  . ARG C  2 51  ? 46.021  85.871  198.187 1.00 118.38 ? 376 ARG D NE  1 
ATOM   3484 C CZ  . ARG C  2 51  ? 46.833  84.992  198.763 1.00 126.98 ? 376 ARG D CZ  1 
ATOM   3485 N NH1 . ARG C  2 51  ? 47.920  84.580  198.128 1.00 122.65 ? 376 ARG D NH1 1 
ATOM   3486 N NH2 . ARG C  2 51  ? 46.567  84.534  199.978 1.00 143.12 ? 376 ARG D NH2 1 
ATOM   3487 N N   . ALA C  2 52  ? 43.082  86.039  192.871 1.00 109.62 ? 377 ALA D N   1 
ATOM   3488 C CA  . ALA C  2 52  ? 42.453  85.109  191.944 1.00 115.43 ? 377 ALA D CA  1 
ATOM   3489 C C   . ALA C  2 52  ? 42.355  83.715  192.550 1.00 112.57 ? 377 ALA D C   1 
ATOM   3490 O O   . ALA C  2 52  ? 41.454  82.940  192.218 1.00 106.31 ? 377 ALA D O   1 
ATOM   3491 C CB  . ALA C  2 52  ? 43.235  85.059  190.659 1.00 107.15 ? 377 ALA D CB  1 
ATOM   3492 N N   . SER C  2 53  ? 43.288  83.400  193.441 1.00 108.14 ? 378 SER D N   1 
ATOM   3493 C CA  . SER C  2 53  ? 43.299  82.102  194.096 1.00 102.64 ? 378 SER D CA  1 
ATOM   3494 C C   . SER C  2 53  ? 42.119  81.973  195.060 1.00 100.09 ? 378 SER D C   1 
ATOM   3495 O O   . SER C  2 53  ? 41.716  80.868  195.415 1.00 115.54 ? 378 SER D O   1 
ATOM   3496 C CB  . SER C  2 53  ? 44.607  81.910  194.863 1.00 101.78 ? 378 SER D CB  1 
ATOM   3497 O OG  . SER C  2 53  ? 44.639  82.730  196.015 1.00 94.29  ? 378 SER D OG  1 
ATOM   3498 N N   . GLY C  2 54  ? 41.569  83.105  195.478 1.00 91.75  ? 379 GLY D N   1 
ATOM   3499 C CA  . GLY C  2 54  ? 40.452  83.080  196.403 1.00 103.06 ? 379 GLY D CA  1 
ATOM   3500 C C   . GLY C  2 54  ? 40.922  83.261  197.835 1.00 113.53 ? 379 GLY D C   1 
ATOM   3501 O O   . GLY C  2 54  ? 40.135  83.578  198.733 1.00 103.98 ? 379 GLY D O   1 
ATOM   3502 N N   . LYS C  2 55  ? 42.218  83.064  198.047 1.00 127.15 ? 380 LYS D N   1 
ATOM   3503 C CA  . LYS C  2 55  ? 42.805  83.202  199.373 1.00 140.03 ? 380 LYS D CA  1 
ATOM   3504 C C   . LYS C  2 55  ? 42.737  84.654  199.854 1.00 140.95 ? 380 LYS D C   1 
ATOM   3505 O O   . LYS C  2 55  ? 43.016  85.582  199.096 1.00 144.06 ? 380 LYS D O   1 
ATOM   3506 C CB  . LYS C  2 55  ? 44.260  82.727  199.348 1.00 149.43 ? 380 LYS D CB  1 
ATOM   3507 C CG  . LYS C  2 55  ? 44.446  81.293  198.871 1.00 153.82 ? 380 LYS D CG  1 
ATOM   3508 C CD  . LYS C  2 55  ? 45.922  80.912  198.838 1.00 162.31 ? 380 LYS D CD  1 
ATOM   3509 C CE  . LYS C  2 55  ? 46.121  79.480  198.365 1.00 164.27 ? 380 LYS D CE  1 
ATOM   3510 N NZ  . LYS C  2 55  ? 47.562  79.099  198.345 1.00 158.35 ? 380 LYS D NZ  1 
ATOM   3511 N N   . PRO C  2 56  ? 42.360  84.863  201.126 1.00 138.35 ? 381 PRO D N   1 
ATOM   3512 C CA  . PRO C  2 56  ? 42.240  86.184  201.757 1.00 129.78 ? 381 PRO D CA  1 
ATOM   3513 C C   . PRO C  2 56  ? 43.428  87.119  201.507 1.00 119.28 ? 381 PRO D C   1 
ATOM   3514 O O   . PRO C  2 56  ? 44.490  86.675  201.074 1.00 110.74 ? 381 PRO D O   1 
ATOM   3515 C CB  . PRO C  2 56  ? 42.074  85.834  203.231 1.00 132.74 ? 381 PRO D CB  1 
ATOM   3516 C CG  . PRO C  2 56  ? 41.264  84.578  203.163 1.00 132.68 ? 381 PRO D CG  1 
ATOM   3517 C CD  . PRO C  2 56  ? 41.968  83.800  202.069 1.00 137.46 ? 381 PRO D CD  1 
ATOM   3518 N N   . VAL C  2 57  ? 43.239  88.410  201.793 1.00 104.66 ? 382 VAL D N   1 
ATOM   3519 C CA  . VAL C  2 57  ? 44.279  89.429  201.584 1.00 104.06 ? 382 VAL D CA  1 
ATOM   3520 C C   . VAL C  2 57  ? 44.553  90.305  202.791 1.00 115.89 ? 382 VAL D C   1 
ATOM   3521 O O   . VAL C  2 57  ? 43.654  90.583  203.581 1.00 131.65 ? 382 VAL D O   1 
ATOM   3522 C CB  . VAL C  2 57  ? 43.901  90.375  200.458 1.00 86.25  ? 382 VAL D CB  1 
ATOM   3523 C CG1 . VAL C  2 57  ? 43.890  89.629  199.140 1.00 113.77 ? 382 VAL D CG1 1 
ATOM   3524 C CG2 . VAL C  2 57  ? 42.530  90.963  200.739 1.00 88.91  ? 382 VAL D CG2 1 
ATOM   3525 N N   . ASN C  2 58  ? 45.796  90.764  202.913 1.00 117.36 ? 383 ASN D N   1 
ATOM   3526 C CA  . ASN C  2 58  ? 46.189  91.618  204.033 1.00 118.42 ? 383 ASN D CA  1 
ATOM   3527 C C   . ASN C  2 58  ? 45.411  92.928  203.998 1.00 103.22 ? 383 ASN D C   1 
ATOM   3528 O O   . ASN C  2 58  ? 44.731  93.223  203.021 1.00 105.32 ? 383 ASN D O   1 
ATOM   3529 C CB  . ASN C  2 58  ? 47.694  91.910  203.982 1.00 129.47 ? 383 ASN D CB  1 
ATOM   3530 C CG  . ASN C  2 58  ? 48.543  90.699  204.346 1.00 137.85 ? 383 ASN D CG  1 
ATOM   3531 O OD1 . ASN C  2 58  ? 49.767  90.707  204.178 1.00 135.80 ? 383 ASN D OD1 1 
ATOM   3532 N ND2 . ASN C  2 58  ? 47.897  89.654  204.857 1.00 142.89 ? 383 ASN D ND2 1 
ATOM   3533 N N   . HIS C  2 59  ? 45.510  93.708  205.068 1.00 95.35  ? 384 HIS D N   1 
ATOM   3534 C CA  . HIS C  2 59  ? 44.810  94.985  205.142 1.00 88.81  ? 384 HIS D CA  1 
ATOM   3535 C C   . HIS C  2 59  ? 45.538  95.996  204.281 1.00 73.89  ? 384 HIS D C   1 
ATOM   3536 O O   . HIS C  2 59  ? 46.757  96.000  204.219 1.00 62.13  ? 384 HIS D O   1 
ATOM   3537 C CB  . HIS C  2 59  ? 44.747  95.464  206.594 1.00 101.05 ? 384 HIS D CB  1 
ATOM   3538 C CG  . HIS C  2 59  ? 43.971  94.546  207.492 1.00 112.89 ? 384 HIS D CG  1 
ATOM   3539 N ND1 . HIS C  2 59  ? 42.602  94.630  207.639 1.00 109.56 ? 384 HIS D ND1 1 
ATOM   3540 C CD2 . HIS C  2 59  ? 44.367  93.491  208.244 1.00 112.23 ? 384 HIS D CD2 1 
ATOM   3541 C CE1 . HIS C  2 59  ? 42.189  93.665  208.443 1.00 117.70 ? 384 HIS D CE1 1 
ATOM   3542 N NE2 . HIS C  2 59  ? 43.239  92.960  208.823 1.00 122.54 ? 384 HIS D NE2 1 
ATOM   3543 N N   . SER C  2 60  ? 44.787  96.859  203.617 1.00 71.79  ? 385 SER D N   1 
ATOM   3544 C CA  . SER C  2 60  ? 45.396  97.845  202.748 1.00 57.55  ? 385 SER D CA  1 
ATOM   3545 C C   . SER C  2 60  ? 45.467  99.247  203.338 1.00 56.74  ? 385 SER D C   1 
ATOM   3546 O O   . SER C  2 60  ? 44.928  99.529  204.404 1.00 74.92  ? 385 SER D O   1 
ATOM   3547 C CB  . SER C  2 60  ? 44.638  97.893  201.424 1.00 66.98  ? 385 SER D CB  1 
ATOM   3548 O OG  . SER C  2 60  ? 43.265  98.161  201.638 1.00 87.44  ? 385 SER D OG  1 
ATOM   3549 N N   . THR C  2 61  ? 46.130  100.119 202.601 1.00 43.31  ? 386 THR D N   1 
ATOM   3550 C CA  . THR C  2 61  ? 46.341  101.507 202.949 1.00 44.35  ? 386 THR D CA  1 
ATOM   3551 C C   . THR C  2 61  ? 45.416  102.332 202.086 1.00 58.63  ? 386 THR D C   1 
ATOM   3552 O O   . THR C  2 61  ? 44.858  101.819 201.124 1.00 71.90  ? 386 THR D O   1 
ATOM   3553 C CB  . THR C  2 61  ? 47.810  101.868 202.631 1.00 70.97  ? 386 THR D CB  1 
ATOM   3554 O OG1 . THR C  2 61  ? 48.625  101.545 203.761 1.00 110.90 ? 386 THR D OG1 1 
ATOM   3555 C CG2 . THR C  2 61  ? 47.973  103.333 202.247 1.00 85.77  ? 386 THR D CG2 1 
ATOM   3556 N N   . ARG C  2 62  ? 45.240  103.608 202.412 1.00 63.20  ? 387 ARG D N   1 
ATOM   3557 C CA  . ARG C  2 62  ? 44.399  104.459 201.569 1.00 56.53  ? 387 ARG D CA  1 
ATOM   3558 C C   . ARG C  2 62  ? 44.528  105.952 201.834 1.00 50.18  ? 387 ARG D C   1 
ATOM   3559 O O   . ARG C  2 62  ? 44.421  106.373 202.977 1.00 73.83  ? 387 ARG D O   1 
ATOM   3560 C CB  . ARG C  2 62  ? 42.956  104.032 201.709 1.00 51.50  ? 387 ARG D CB  1 
ATOM   3561 C CG  . ARG C  2 62  ? 41.990  104.919 200.996 1.00 61.68  ? 387 ARG D CG  1 
ATOM   3562 C CD  . ARG C  2 62  ? 40.661  104.219 200.838 1.00 63.98  ? 387 ARG D CD  1 
ATOM   3563 N NE  . ARG C  2 62  ? 39.669  105.097 200.233 1.00 87.45  ? 387 ARG D NE  1 
ATOM   3564 C CZ  . ARG C  2 62  ? 38.472  104.694 199.827 1.00 104.11 ? 387 ARG D CZ  1 
ATOM   3565 N NH1 . ARG C  2 62  ? 38.125  103.418 199.965 1.00 113.11 ? 387 ARG D NH1 1 
ATOM   3566 N NH2 . ARG C  2 62  ? 37.627  105.564 199.282 1.00 101.91 ? 387 ARG D NH2 1 
ATOM   3567 N N   . LYS C  2 63  ? 44.759  106.743 200.784 1.00 21.39  ? 388 LYS D N   1 
ATOM   3568 C CA  . LYS C  2 63  ? 44.909  108.195 200.915 1.00 34.86  ? 388 LYS D CA  1 
ATOM   3569 C C   . LYS C  2 63  ? 44.068  108.854 199.854 1.00 47.34  ? 388 LYS D C   1 
ATOM   3570 O O   . LYS C  2 63  ? 44.011  108.358 198.735 1.00 58.88  ? 388 LYS D O   1 
ATOM   3571 C CB  . LYS C  2 63  ? 46.349  108.672 200.653 1.00 46.68  ? 388 LYS D CB  1 
ATOM   3572 C CG  . LYS C  2 63  ? 47.490  107.749 201.074 1.00 109.16 ? 388 LYS D CG  1 
ATOM   3573 C CD  . LYS C  2 63  ? 48.839  108.366 200.675 1.00 123.11 ? 388 LYS D CD  1 
ATOM   3574 C CE  . LYS C  2 63  ? 50.016  107.483 201.069 1.00 147.34 ? 388 LYS D CE  1 
ATOM   3575 N NZ  . LYS C  2 63  ? 51.321  108.173 200.844 1.00 153.06 ? 388 LYS D NZ  1 
ATOM   3576 N N   . GLU C  2 64  ? 43.425  109.971 200.183 1.00 40.85  ? 389 GLU D N   1 
ATOM   3577 C CA  . GLU C  2 64  ? 42.645  110.713 199.183 1.00 51.69  ? 389 GLU D CA  1 
ATOM   3578 C C   . GLU C  2 64  ? 43.118  112.159 199.147 1.00 52.92  ? 389 GLU D C   1 
ATOM   3579 O O   . GLU C  2 64  ? 42.719  112.969 199.973 1.00 70.59  ? 389 GLU D O   1 
ATOM   3580 C CB  . GLU C  2 64  ? 41.143  110.672 199.478 1.00 60.46  ? 389 GLU D CB  1 
ATOM   3581 C CG  . GLU C  2 64  ? 40.520  109.280 199.334 1.00 124.74 ? 389 GLU D CG  1 
ATOM   3582 C CD  . GLU C  2 64  ? 39.070  109.211 199.796 1.00 145.67 ? 389 GLU D CD  1 
ATOM   3583 O OE1 . GLU C  2 64  ? 38.263  110.060 199.354 1.00 144.45 ? 389 GLU D OE1 1 
ATOM   3584 O OE2 . GLU C  2 64  ? 38.741  108.300 200.594 1.00 160.14 ? 389 GLU D OE2 1 
ATOM   3585 N N   . GLU C  2 65  ? 43.966  112.478 198.178 1.00 45.56  ? 390 GLU D N   1 
ATOM   3586 C CA  . GLU C  2 65  ? 44.525  113.817 198.052 1.00 62.06  ? 390 GLU D CA  1 
ATOM   3587 C C   . GLU C  2 65  ? 43.826  114.727 197.055 1.00 43.13  ? 390 GLU D C   1 
ATOM   3588 O O   . GLU C  2 65  ? 43.939  114.519 195.855 1.00 60.67  ? 390 GLU D O   1 
ATOM   3589 C CB  . GLU C  2 65  ? 46.005  113.748 197.638 1.00 98.73  ? 390 GLU D CB  1 
ATOM   3590 C CG  . GLU C  2 65  ? 46.901  112.828 198.462 1.00 136.12 ? 390 GLU D CG  1 
ATOM   3591 C CD  . GLU C  2 65  ? 48.363  112.896 198.028 1.00 153.46 ? 390 GLU D CD  1 
ATOM   3592 O OE1 . GLU C  2 65  ? 48.638  112.760 196.814 1.00 167.09 ? 390 GLU D OE1 1 
ATOM   3593 O OE2 . GLU C  2 65  ? 49.237  113.080 198.903 1.00 166.91 ? 390 GLU D OE2 1 
ATOM   3594 N N   . LYS C  2 66  ? 43.126  115.746 197.535 1.00 49.50  ? 391 LYS D N   1 
ATOM   3595 C CA  . LYS C  2 66  ? 42.485  116.689 196.620 1.00 66.24  ? 391 LYS D CA  1 
ATOM   3596 C C   . LYS C  2 66  ? 43.652  117.317 195.856 1.00 63.39  ? 391 LYS D C   1 
ATOM   3597 O O   . LYS C  2 66  ? 44.550  117.872 196.476 1.00 56.03  ? 391 LYS D O   1 
ATOM   3598 C CB  . LYS C  2 66  ? 41.731  117.794 197.388 1.00 76.67  ? 391 LYS D CB  1 
ATOM   3599 C CG  . LYS C  2 66  ? 41.324  118.992 196.519 1.00 92.64  ? 391 LYS D CG  1 
ATOM   3600 C CD  . LYS C  2 66  ? 41.375  120.325 197.271 1.00 110.15 ? 391 LYS D CD  1 
ATOM   3601 C CE  . LYS C  2 66  ? 40.285  120.453 198.331 1.00 134.84 ? 391 LYS D CE  1 
ATOM   3602 N NZ  . LYS C  2 66  ? 40.286  121.807 198.979 1.00 123.55 ? 391 LYS D NZ  1 
ATOM   3603 N N   . GLN C  2 67  ? 43.649  117.218 194.526 1.00 65.32  ? 392 GLN D N   1 
ATOM   3604 C CA  . GLN C  2 67  ? 44.730  117.787 193.725 1.00 69.59  ? 392 GLN D CA  1 
ATOM   3605 C C   . GLN C  2 67  ? 44.461  119.237 193.368 1.00 82.22  ? 392 GLN D C   1 
ATOM   3606 O O   . GLN C  2 67  ? 43.348  119.743 193.559 1.00 65.67  ? 392 GLN D O   1 
ATOM   3607 C CB  . GLN C  2 67  ? 44.920  116.991 192.448 1.00 62.17  ? 392 GLN D CB  1 
ATOM   3608 C CG  . GLN C  2 67  ? 45.169  115.537 192.684 1.00 54.77  ? 392 GLN D CG  1 
ATOM   3609 C CD  . GLN C  2 67  ? 46.454  115.307 193.399 1.00 63.29  ? 392 GLN D CD  1 
ATOM   3610 O OE1 . GLN C  2 67  ? 46.604  115.681 194.556 1.00 98.86  ? 392 GLN D OE1 1 
ATOM   3611 N NE2 . GLN C  2 67  ? 47.412  114.693 192.712 1.00 91.91  ? 392 GLN D NE2 1 
ATOM   3612 N N   . ARG C  2 68  ? 45.487  119.896 192.835 1.00 91.81  ? 393 ARG D N   1 
ATOM   3613 C CA  . ARG C  2 68  ? 45.381  121.299 192.463 1.00 100.92 ? 393 ARG D CA  1 
ATOM   3614 C C   . ARG C  2 68  ? 44.382  121.561 191.351 1.00 94.65  ? 393 ARG D C   1 
ATOM   3615 O O   . ARG C  2 68  ? 43.633  122.543 191.414 1.00 94.04  ? 393 ARG D O   1 
ATOM   3616 C CB  . ARG C  2 68  ? 46.747  121.855 192.045 1.00 117.48 ? 393 ARG D CB  1 
ATOM   3617 C CG  . ARG C  2 68  ? 46.697  123.320 191.590 1.00 137.58 ? 393 ARG D CG  1 
ATOM   3618 C CD  . ARG C  2 68  ? 47.397  124.271 192.559 1.00 149.86 ? 393 ARG D CD  1 
ATOM   3619 N NE  . ARG C  2 68  ? 48.846  124.077 192.564 1.00 160.11 ? 393 ARG D NE  1 
ATOM   3620 C CZ  . ARG C  2 68  ? 49.702  124.859 193.212 1.00 162.50 ? 393 ARG D CZ  1 
ATOM   3621 N NH1 . ARG C  2 68  ? 49.257  125.894 193.913 1.00 168.10 ? 393 ARG D NH1 1 
ATOM   3622 N NH2 . ARG C  2 68  ? 51.004  124.606 193.160 1.00 160.81 ? 393 ARG D NH2 1 
ATOM   3623 N N   . ASN C  2 69  ? 44.357  120.694 190.338 1.00 92.58  ? 394 ASN D N   1 
ATOM   3624 C CA  . ASN C  2 69  ? 43.437  120.897 189.219 1.00 87.64  ? 394 ASN D CA  1 
ATOM   3625 C C   . ASN C  2 69  ? 41.952  120.583 189.479 1.00 78.98  ? 394 ASN D C   1 
ATOM   3626 O O   . ASN C  2 69  ? 41.227  120.189 188.572 1.00 66.64  ? 394 ASN D O   1 
ATOM   3627 C CB  . ASN C  2 69  ? 43.924  120.138 187.969 1.00 75.79  ? 394 ASN D CB  1 
ATOM   3628 C CG  . ASN C  2 69  ? 43.957  118.632 188.154 1.00 55.91  ? 394 ASN D CG  1 
ATOM   3629 O OD1 . ASN C  2 69  ? 43.110  118.070 188.828 1.00 62.20  ? 394 ASN D OD1 1 
ATOM   3630 N ND2 . ASN C  2 69  ? 44.927  117.982 187.516 1.00 57.70  ? 394 ASN D ND2 1 
ATOM   3631 N N   . GLY C  2 70  ? 41.494  120.775 190.710 1.00 77.24  ? 395 GLY D N   1 
ATOM   3632 C CA  . GLY C  2 70  ? 40.099  120.509 191.008 1.00 77.71  ? 395 GLY D CA  1 
ATOM   3633 C C   . GLY C  2 70  ? 39.724  119.038 191.108 1.00 75.11  ? 395 GLY D C   1 
ATOM   3634 O O   . GLY C  2 70  ? 38.677  118.700 191.669 1.00 77.61  ? 395 GLY D O   1 
ATOM   3635 N N   . THR C  2 71  ? 40.564  118.157 190.574 1.00 64.66  ? 396 THR D N   1 
ATOM   3636 C CA  . THR C  2 71  ? 40.274  116.730 190.626 1.00 61.50  ? 396 THR D CA  1 
ATOM   3637 C C   . THR C  2 71  ? 40.436  116.198 192.048 1.00 56.99  ? 396 THR D C   1 
ATOM   3638 O O   . THR C  2 71  ? 40.495  116.964 193.001 1.00 67.20  ? 396 THR D O   1 
ATOM   3639 C CB  . THR C  2 71  ? 41.206  115.932 189.705 1.00 67.27  ? 396 THR D CB  1 
ATOM   3640 O OG1 . THR C  2 71  ? 40.702  114.600 189.558 1.00 108.83 ? 396 THR D OG1 1 
ATOM   3641 C CG2 . THR C  2 71  ? 42.599  115.848 190.305 1.00 83.34  ? 396 THR D CG2 1 
ATOM   3642 N N   . LEU C  2 72  ? 40.520  114.878 192.171 1.00 54.33  ? 397 LEU D N   1 
ATOM   3643 C CA  . LEU C  2 72  ? 40.655  114.203 193.454 1.00 46.41  ? 397 LEU D CA  1 
ATOM   3644 C C   . LEU C  2 72  ? 41.232  112.809 193.198 1.00 52.11  ? 397 LEU D C   1 
ATOM   3645 O O   . LEU C  2 72  ? 40.675  112.039 192.417 1.00 68.47  ? 397 LEU D O   1 
ATOM   3646 C CB  . LEU C  2 72  ? 39.281  114.097 194.110 1.00 45.53  ? 397 LEU D CB  1 
ATOM   3647 C CG  . LEU C  2 72  ? 39.121  113.074 195.221 1.00 67.51  ? 397 LEU D CG  1 
ATOM   3648 C CD1 . LEU C  2 72  ? 40.080  113.397 196.345 1.00 96.53  ? 397 LEU D CD1 1 
ATOM   3649 C CD2 . LEU C  2 72  ? 37.685  113.061 195.710 1.00 90.11  ? 397 LEU D CD2 1 
ATOM   3650 N N   . THR C  2 73  ? 42.337  112.493 193.868 1.00 37.68  ? 398 THR D N   1 
ATOM   3651 C CA  . THR C  2 73  ? 43.020  111.224 193.706 1.00 21.88  ? 398 THR D CA  1 
ATOM   3652 C C   . THR C  2 73  ? 42.844  110.303 194.865 1.00 28.40  ? 398 THR D C   1 
ATOM   3653 O O   . THR C  2 73  ? 42.586  110.737 195.973 1.00 56.80  ? 398 THR D O   1 
ATOM   3654 C CB  . THR C  2 73  ? 44.512  111.441 193.543 1.00 28.63  ? 398 THR D CB  1 
ATOM   3655 O OG1 . THR C  2 73  ? 44.756  112.125 192.315 1.00 63.24  ? 398 THR D OG1 1 
ATOM   3656 C CG2 . THR C  2 73  ? 45.246  110.136 193.527 1.00 60.42  ? 398 THR D CG2 1 
ATOM   3657 N N   . VAL C  2 74  ? 43.008  109.015 194.602 1.00 36.23  ? 399 VAL D N   1 
ATOM   3658 C CA  . VAL C  2 74  ? 42.909  107.980 195.628 1.00 43.14  ? 399 VAL D CA  1 
ATOM   3659 C C   . VAL C  2 74  ? 43.973  106.932 195.385 1.00 40.61  ? 399 VAL D C   1 
ATOM   3660 O O   . VAL C  2 74  ? 44.031  106.372 194.293 1.00 50.80  ? 399 VAL D O   1 
ATOM   3661 C CB  . VAL C  2 74  ? 41.574  107.254 195.564 1.00 37.04  ? 399 VAL D CB  1 
ATOM   3662 C CG1 . VAL C  2 74  ? 41.609  106.041 196.480 1.00 25.86  ? 399 VAL D CG1 1 
ATOM   3663 C CG2 . VAL C  2 74  ? 40.476  108.176 195.946 1.00 27.88  ? 399 VAL D CG2 1 
ATOM   3664 N N   . THR C  2 75  ? 44.818  106.664 196.375 1.00 35.30  ? 400 THR D N   1 
ATOM   3665 C CA  . THR C  2 75  ? 45.834  105.625 196.202 1.00 42.05  ? 400 THR D CA  1 
ATOM   3666 C C   . THR C  2 75  ? 45.648  104.626 197.309 1.00 38.17  ? 400 THR D C   1 
ATOM   3667 O O   . THR C  2 75  ? 45.223  104.968 198.404 1.00 49.80  ? 400 THR D O   1 
ATOM   3668 C CB  . THR C  2 75  ? 47.270  106.128 196.319 1.00 32.44  ? 400 THR D CB  1 
ATOM   3669 O OG1 . THR C  2 75  ? 47.494  106.558 197.655 1.00 93.83  ? 400 THR D OG1 1 
ATOM   3670 C CG2 . THR C  2 75  ? 47.526  107.280 195.375 1.00 45.02  ? 400 THR D CG2 1 
ATOM   3671 N N   . SER C  2 76  ? 45.969  103.382 197.016 1.00 35.35  ? 401 SER D N   1 
ATOM   3672 C CA  . SER C  2 76  ? 45.840  102.318 197.990 1.00 42.40  ? 401 SER D CA  1 
ATOM   3673 C C   . SER C  2 76  ? 46.946  101.344 197.735 1.00 49.80  ? 401 SER D C   1 
ATOM   3674 O O   . SER C  2 76  ? 47.042  100.807 196.641 1.00 50.54  ? 401 SER D O   1 
ATOM   3675 C CB  . SER C  2 76  ? 44.515  101.584 197.833 1.00 56.87  ? 401 SER D CB  1 
ATOM   3676 O OG  . SER C  2 76  ? 44.482  100.421 198.643 1.00 43.00  ? 401 SER D OG  1 
ATOM   3677 N N   . THR C  2 77  ? 47.779  101.118 198.742 1.00 56.39  ? 402 THR D N   1 
ATOM   3678 C CA  . THR C  2 77  ? 48.894  100.196 198.624 1.00 53.30  ? 402 THR D CA  1 
ATOM   3679 C C   . THR C  2 77  ? 48.571  98.928  199.394 1.00 55.17  ? 402 THR D C   1 
ATOM   3680 O O   . THR C  2 77  ? 47.951  98.978  200.447 1.00 75.48  ? 402 THR D O   1 
ATOM   3681 C CB  . THR C  2 77  ? 50.150  100.813 199.187 1.00 54.16  ? 402 THR D CB  1 
ATOM   3682 O OG1 . THR C  2 77  ? 50.322  102.117 198.630 1.00 67.72  ? 402 THR D OG1 1 
ATOM   3683 C CG2 . THR C  2 77  ? 51.345  99.975  198.836 1.00 89.11  ? 402 THR D CG2 1 
ATOM   3684 N N   . LEU C  2 78  ? 48.995  97.790  198.872 1.00 52.02  ? 403 LEU D N   1 
ATOM   3685 C CA  . LEU C  2 78  ? 48.701  96.520  199.510 1.00 54.92  ? 403 LEU D CA  1 
ATOM   3686 C C   . LEU C  2 78  ? 49.919  95.624  199.684 1.00 62.75  ? 403 LEU D C   1 
ATOM   3687 O O   . LEU C  2 78  ? 50.684  95.411  198.741 1.00 59.45  ? 403 LEU D O   1 
ATOM   3688 C CB  . LEU C  2 78  ? 47.648  95.785  198.689 1.00 58.92  ? 403 LEU D CB  1 
ATOM   3689 C CG  . LEU C  2 78  ? 47.239  94.398  199.166 1.00 75.69  ? 403 LEU D CG  1 
ATOM   3690 C CD1 . LEU C  2 78  ? 46.519  94.506  200.492 1.00 101.12 ? 403 LEU D CD1 1 
ATOM   3691 C CD2 . LEU C  2 78  ? 46.339  93.757  198.140 1.00 62.75  ? 403 LEU D CD2 1 
ATOM   3692 N N   . PRO C  2 79  ? 50.113  95.090  200.901 1.00 58.07  ? 404 PRO D N   1 
ATOM   3693 C CA  . PRO C  2 79  ? 51.215  94.203  201.270 1.00 66.20  ? 404 PRO D CA  1 
ATOM   3694 C C   . PRO C  2 79  ? 51.030  92.861  200.573 1.00 79.01  ? 404 PRO D C   1 
ATOM   3695 O O   . PRO C  2 79  ? 49.926  92.321  200.528 1.00 66.02  ? 404 PRO D O   1 
ATOM   3696 C CB  . PRO C  2 79  ? 51.070  94.080  202.784 1.00 85.76  ? 404 PRO D CB  1 
ATOM   3697 C CG  . PRO C  2 79  ? 50.390  95.345  203.168 1.00 87.37  ? 404 PRO D CG  1 
ATOM   3698 C CD  . PRO C  2 79  ? 49.349  95.460  202.098 1.00 74.42  ? 404 PRO D CD  1 
ATOM   3699 N N   . VAL C  2 80  ? 52.116  92.304  200.055 1.00 86.26  ? 405 VAL D N   1 
ATOM   3700 C CA  . VAL C  2 80  ? 52.015  91.056  199.330 1.00 87.33  ? 405 VAL D CA  1 
ATOM   3701 C C   . VAL C  2 80  ? 53.063  90.002  199.661 1.00 101.77 ? 405 VAL D C   1 
ATOM   3702 O O   . VAL C  2 80  ? 54.263  90.289  199.721 1.00 104.97 ? 405 VAL D O   1 
ATOM   3703 C CB  . VAL C  2 80  ? 52.032  91.358  197.832 1.00 76.78  ? 405 VAL D CB  1 
ATOM   3704 C CG1 . VAL C  2 80  ? 53.051  90.497  197.120 1.00 113.21 ? 405 VAL D CG1 1 
ATOM   3705 C CG2 . VAL C  2 80  ? 50.651  91.145  197.266 1.00 94.83  ? 405 VAL D CG2 1 
ATOM   3706 N N   . GLY C  2 81  ? 52.584  88.772  199.849 1.00 102.79 ? 406 GLY D N   1 
ATOM   3707 C CA  . GLY C  2 81  ? 53.459  87.656  200.171 1.00 115.38 ? 406 GLY D CA  1 
ATOM   3708 C C   . GLY C  2 81  ? 54.503  87.396  199.084 1.00 114.07 ? 406 GLY D C   1 
ATOM   3709 O O   . GLY C  2 81  ? 54.170  86.932  197.995 1.00 110.85 ? 406 GLY D O   1 
ATOM   3710 N N   . THR C  2 82  ? 55.763  87.675  199.410 1.00 117.19 ? 407 THR D N   1 
ATOM   3711 C CA  . THR C  2 82  ? 56.880  87.505  198.508 1.00 110.65 ? 407 THR D CA  1 
ATOM   3712 C C   . THR C  2 82  ? 56.852  86.189  197.741 1.00 110.53 ? 407 THR D C   1 
ATOM   3713 O O   . THR C  2 82  ? 57.225  86.126  196.572 1.00 105.07 ? 407 THR D O   1 
ATOM   3714 C CB  . THR C  2 82  ? 58.220  87.513  199.231 1.00 123.00 ? 407 THR D CB  1 
ATOM   3715 O OG1 . THR C  2 82  ? 58.109  88.244  200.452 1.00 138.51 ? 407 THR D OG1 1 
ATOM   3716 C CG2 . THR C  2 82  ? 59.289  88.139  198.329 1.00 104.23 ? 407 THR D CG2 1 
ATOM   3717 N N   . ARG C  2 83  ? 56.441  85.123  198.408 1.00 116.44 ? 408 ARG D N   1 
ATOM   3718 C CA  . ARG C  2 83  ? 56.399  83.820  197.772 1.00 124.06 ? 408 ARG D CA  1 
ATOM   3719 C C   . ARG C  2 83  ? 55.302  83.805  196.723 1.00 117.98 ? 408 ARG D C   1 
ATOM   3720 O O   . ARG C  2 83  ? 55.556  83.753  195.505 1.00 108.77 ? 408 ARG D O   1 
ATOM   3721 C CB  . ARG C  2 83  ? 56.112  82.750  198.816 1.00 136.92 ? 408 ARG D CB  1 
ATOM   3722 C CG  . ARG C  2 83  ? 57.188  82.649  199.914 1.00 154.75 ? 408 ARG D CG  1 
ATOM   3723 C CD  . ARG C  2 83  ? 57.344  83.945  200.730 1.00 147.97 ? 408 ARG D CD  1 
ATOM   3724 N NE  . ARG C  2 83  ? 56.196  84.229  201.588 1.00 133.57 ? 408 ARG D NE  1 
ATOM   3725 C CZ  . ARG C  2 83  ? 56.079  85.320  202.337 1.00 121.68 ? 408 ARG D CZ  1 
ATOM   3726 N NH1 . ARG C  2 83  ? 57.038  86.240  202.332 1.00 93.47  ? 408 ARG D NH1 1 
ATOM   3727 N NH2 . ARG C  2 83  ? 55.013  85.480  203.107 1.00 113.66 ? 408 ARG D NH2 1 
ATOM   3728 N N   . ASP C  2 84  ? 54.070  83.869  197.211 1.00 114.54 ? 409 ASP D N   1 
ATOM   3729 C CA  . ASP C  2 84  ? 52.874  83.849  196.382 1.00 107.86 ? 409 ASP D CA  1 
ATOM   3730 C C   . ASP C  2 84  ? 53.053  84.546  195.032 1.00 100.54 ? 409 ASP D C   1 
ATOM   3731 O O   . ASP C  2 84  ? 52.675  84.000  193.990 1.00 113.71 ? 409 ASP D O   1 
ATOM   3732 C CB  . ASP C  2 84  ? 51.731  84.516  197.160 1.00 110.48 ? 409 ASP D CB  1 
ATOM   3733 C CG  . ASP C  2 84  ? 51.541  83.939  198.559 1.00 123.09 ? 409 ASP D CG  1 
ATOM   3734 O OD1 . ASP C  2 84  ? 51.021  82.808  198.688 1.00 126.22 ? 409 ASP D OD1 1 
ATOM   3735 O OD2 . ASP C  2 84  ? 51.909  84.625  199.539 1.00 118.51 ? 409 ASP D OD2 1 
ATOM   3736 N N   . TRP C  2 85  ? 53.622  85.749  195.061 1.00 81.35  ? 410 TRP D N   1 
ATOM   3737 C CA  . TRP C  2 85  ? 53.836  86.534  193.853 1.00 77.43  ? 410 TRP D CA  1 
ATOM   3738 C C   . TRP C  2 85  ? 54.684  85.829  192.825 1.00 94.38  ? 410 TRP D C   1 
ATOM   3739 O O   . TRP C  2 85  ? 54.246  85.630  191.693 1.00 105.61 ? 410 TRP D O   1 
ATOM   3740 C CB  . TRP C  2 85  ? 54.487  87.863  194.209 1.00 56.44  ? 410 TRP D CB  1 
ATOM   3741 C CG  . TRP C  2 85  ? 54.924  88.660  193.025 1.00 64.59  ? 410 TRP D CG  1 
ATOM   3742 C CD1 . TRP C  2 85  ? 56.145  88.636  192.423 1.00 79.00  ? 410 TRP D CD1 1 
ATOM   3743 C CD2 . TRP C  2 85  ? 54.138  89.608  192.297 1.00 76.35  ? 410 TRP D CD2 1 
ATOM   3744 N NE1 . TRP C  2 85  ? 56.174  89.515  191.365 1.00 72.40  ? 410 TRP D NE1 1 
ATOM   3745 C CE2 . TRP C  2 85  ? 54.954  90.123  191.266 1.00 77.43  ? 410 TRP D CE2 1 
ATOM   3746 C CE3 . TRP C  2 85  ? 52.822  90.071  192.416 1.00 67.42  ? 410 TRP D CE3 1 
ATOM   3747 C CZ2 . TRP C  2 85  ? 54.498  91.083  190.357 1.00 89.86  ? 410 TRP D CZ2 1 
ATOM   3748 C CZ3 . TRP C  2 85  ? 52.369  91.020  191.518 1.00 73.24  ? 410 TRP D CZ3 1 
ATOM   3749 C CH2 . TRP C  2 85  ? 53.208  91.520  190.496 1.00 80.40  ? 410 TRP D CH2 1 
ATOM   3750 N N   . ILE C  2 86  ? 55.900  85.458  193.215 1.00 100.94 ? 411 ILE D N   1 
ATOM   3751 C CA  . ILE C  2 86  ? 56.807  84.797  192.283 1.00 107.18 ? 411 ILE D CA  1 
ATOM   3752 C C   . ILE C  2 86  ? 56.182  83.539  191.713 1.00 113.98 ? 411 ILE D C   1 
ATOM   3753 O O   . ILE C  2 86  ? 56.470  83.146  190.585 1.00 115.22 ? 411 ILE D O   1 
ATOM   3754 C CB  . ILE C  2 86  ? 58.125  84.422  192.943 1.00 99.49  ? 411 ILE D CB  1 
ATOM   3755 C CG1 . ILE C  2 86  ? 58.504  85.477  193.973 1.00 108.69 ? 411 ILE D CG1 1 
ATOM   3756 C CG2 . ILE C  2 86  ? 59.219  84.374  191.890 1.00 100.96 ? 411 ILE D CG2 1 
ATOM   3757 C CD1 . ILE C  2 86  ? 59.713  85.112  194.782 1.00 136.11 ? 411 ILE D CD1 1 
ATOM   3758 N N   . GLU C  2 87  ? 55.322  82.903  192.497 1.00 112.27 ? 412 GLU D N   1 
ATOM   3759 C CA  . GLU C  2 87  ? 54.655  81.704  192.031 1.00 125.87 ? 412 GLU D CA  1 
ATOM   3760 C C   . GLU C  2 87  ? 53.428  81.997  191.162 1.00 134.53 ? 412 GLU D C   1 
ATOM   3761 O O   . GLU C  2 87  ? 52.457  81.236  191.149 1.00 136.13 ? 412 GLU D O   1 
ATOM   3762 C CB  . GLU C  2 87  ? 54.287  80.823  193.216 1.00 136.25 ? 412 GLU D CB  1 
ATOM   3763 C CG  . GLU C  2 87  ? 55.489  80.102  193.793 1.00 155.28 ? 412 GLU D CG  1 
ATOM   3764 C CD  . GLU C  2 87  ? 55.112  79.134  194.888 1.00 169.91 ? 412 GLU D CD  1 
ATOM   3765 O OE1 . GLU C  2 87  ? 54.194  78.315  194.668 1.00 174.99 ? 412 GLU D OE1 1 
ATOM   3766 O OE2 . GLU C  2 87  ? 55.738  79.187  195.967 1.00 178.98 ? 412 GLU D OE2 1 
ATOM   3767 N N   . GLY C  2 88  ? 53.485  83.118  190.446 1.00 146.13 ? 413 GLY D N   1 
ATOM   3768 C CA  . GLY C  2 88  ? 52.417  83.501  189.535 1.00 145.38 ? 413 GLY D CA  1 
ATOM   3769 C C   . GLY C  2 88  ? 51.059  83.957  190.041 1.00 135.51 ? 413 GLY D C   1 
ATOM   3770 O O   . GLY C  2 88  ? 50.144  84.149  189.237 1.00 134.49 ? 413 GLY D O   1 
ATOM   3771 N N   . GLU C  2 89  ? 50.903  84.135  191.347 1.00 121.07 ? 414 GLU D N   1 
ATOM   3772 C CA  . GLU C  2 89  ? 49.620  84.580  191.869 1.00 105.42 ? 414 GLU D CA  1 
ATOM   3773 C C   . GLU C  2 89  ? 49.146  85.803  191.098 1.00 102.60 ? 414 GLU D C   1 
ATOM   3774 O O   . GLU C  2 89  ? 49.917  86.424  190.368 1.00 102.15 ? 414 GLU D O   1 
ATOM   3775 C CB  . GLU C  2 89  ? 49.731  84.925  193.349 1.00 105.11 ? 414 GLU D CB  1 
ATOM   3776 C CG  . GLU C  2 89  ? 48.471  85.542  193.936 1.00 96.16  ? 414 GLU D CG  1 
ATOM   3777 C CD  . GLU C  2 89  ? 47.256  84.634  193.834 1.00 94.31  ? 414 GLU D CD  1 
ATOM   3778 O OE1 . GLU C  2 89  ? 46.758  84.399  192.709 1.00 101.85 ? 414 GLU D OE1 1 
ATOM   3779 O OE2 . GLU C  2 89  ? 46.802  84.152  194.891 1.00 90.64  ? 414 GLU D OE2 1 
ATOM   3780 N N   . THR C  2 90  ? 47.876  86.149  191.266 1.00 107.95 ? 415 THR D N   1 
ATOM   3781 C CA  . THR C  2 90  ? 47.303  87.291  190.574 1.00 112.81 ? 415 THR D CA  1 
ATOM   3782 C C   . THR C  2 90  ? 46.348  88.115  191.442 1.00 110.12 ? 415 THR D C   1 
ATOM   3783 O O   . THR C  2 90  ? 45.360  87.595  191.982 1.00 97.45  ? 415 THR D O   1 
ATOM   3784 C CB  . THR C  2 90  ? 46.590  86.825  189.295 1.00 119.16 ? 415 THR D CB  1 
ATOM   3785 O OG1 . THR C  2 90  ? 45.583  87.773  188.933 1.00 120.48 ? 415 THR D OG1 1 
ATOM   3786 C CG2 . THR C  2 90  ? 45.993  85.452  189.487 1.00 134.15 ? 415 THR D CG2 1 
ATOM   3787 N N   . TYR C  2 91  ? 46.664  89.407  191.559 1.00 100.94 ? 416 TYR D N   1 
ATOM   3788 C CA  . TYR C  2 91  ? 45.899  90.360  192.366 1.00 86.80  ? 416 TYR D CA  1 
ATOM   3789 C C   . TYR C  2 91  ? 45.089  91.342  191.521 1.00 83.38  ? 416 TYR D C   1 
ATOM   3790 O O   . TYR C  2 91  ? 45.521  91.745  190.438 1.00 89.99  ? 416 TYR D O   1 
ATOM   3791 C CB  . TYR C  2 91  ? 46.846  91.150  193.276 1.00 88.65  ? 416 TYR D CB  1 
ATOM   3792 C CG  . TYR C  2 91  ? 47.732  90.297  194.155 1.00 89.46  ? 416 TYR D CG  1 
ATOM   3793 C CD1 . TYR C  2 91  ? 48.988  89.875  193.724 1.00 99.18  ? 416 TYR D CD1 1 
ATOM   3794 C CD2 . TYR C  2 91  ? 47.298  89.877  195.406 1.00 90.04  ? 416 TYR D CD2 1 
ATOM   3795 C CE1 . TYR C  2 91  ? 49.787  89.049  194.524 1.00 85.60  ? 416 TYR D CE1 1 
ATOM   3796 C CE2 . TYR C  2 91  ? 48.086  89.054  196.210 1.00 87.14  ? 416 TYR D CE2 1 
ATOM   3797 C CZ  . TYR C  2 91  ? 49.321  88.645  195.766 1.00 93.68  ? 416 TYR D CZ  1 
ATOM   3798 O OH  . TYR C  2 91  ? 50.081  87.831  196.571 1.00 125.60 ? 416 TYR D OH  1 
ATOM   3799 N N   . GLN C  2 92  ? 43.931  91.752  192.037 1.00 68.47  ? 417 GLN D N   1 
ATOM   3800 C CA  . GLN C  2 92  ? 43.050  92.668  191.319 1.00 67.81  ? 417 GLN D CA  1 
ATOM   3801 C C   . GLN C  2 92  ? 42.484  93.795  192.191 1.00 68.57  ? 417 GLN D C   1 
ATOM   3802 O O   . GLN C  2 92  ? 42.091  93.579  193.338 1.00 68.75  ? 417 GLN D O   1 
ATOM   3803 C CB  . GLN C  2 92  ? 41.897  91.876  190.709 1.00 101.02 ? 417 GLN D CB  1 
ATOM   3804 C CG  . GLN C  2 92  ? 41.057  92.649  189.718 1.00 125.35 ? 417 GLN D CG  1 
ATOM   3805 C CD  . GLN C  2 92  ? 39.854  91.857  189.256 1.00 133.34 ? 417 GLN D CD  1 
ATOM   3806 O OE1 . GLN C  2 92  ? 38.942  91.590  190.037 1.00 121.00 ? 417 GLN D OE1 1 
ATOM   3807 N NE2 . GLN C  2 92  ? 39.848  91.469  187.985 1.00 142.88 ? 417 GLN D NE2 1 
ATOM   3808 N N   . CYS C  2 93  ? 42.426  94.992  191.614 1.00 69.92  ? 418 CYS D N   1 
ATOM   3809 C CA  . CYS C  2 93  ? 41.930  96.191  192.286 1.00 58.66  ? 418 CYS D CA  1 
ATOM   3810 C C   . CYS C  2 93  ? 40.585  96.549  191.670 1.00 53.45  ? 418 CYS D C   1 
ATOM   3811 O O   . CYS C  2 93  ? 40.496  96.739  190.465 1.00 55.66  ? 418 CYS D O   1 
ATOM   3812 C CB  . CYS C  2 93  ? 42.927  97.336  192.079 1.00 63.33  ? 418 CYS D CB  1 
ATOM   3813 S SG  . CYS C  2 93  ? 42.483  98.904  192.868 1.00 92.20  ? 418 CYS D SG  1 
ATOM   3814 N N   . ARG C  2 94  ? 39.541  96.638  192.490 1.00 50.57  ? 419 ARG D N   1 
ATOM   3815 C CA  . ARG C  2 94  ? 38.201  96.969  191.992 1.00 45.85  ? 419 ARG D CA  1 
ATOM   3816 C C   . ARG C  2 94  ? 37.661  98.255  192.610 1.00 51.06  ? 419 ARG D C   1 
ATOM   3817 O O   . ARG C  2 94  ? 37.299  98.287  193.797 1.00 56.29  ? 419 ARG D O   1 
ATOM   3818 C CB  . ARG C  2 94  ? 37.226  95.822  192.284 1.00 72.18  ? 419 ARG D CB  1 
ATOM   3819 C CG  . ARG C  2 94  ? 35.835  96.025  191.697 1.00 95.06  ? 419 ARG D CG  1 
ATOM   3820 C CD  . ARG C  2 94  ? 34.860  94.941  192.125 1.00 103.63 ? 419 ARG D CD  1 
ATOM   3821 N NE  . ARG C  2 94  ? 33.561  95.099  191.473 1.00 112.05 ? 419 ARG D NE  1 
ATOM   3822 C CZ  . ARG C  2 94  ? 32.495  94.354  191.738 1.00 144.94 ? 419 ARG D CZ  1 
ATOM   3823 N NH1 . ARG C  2 94  ? 32.566  93.394  192.649 1.00 172.55 ? 419 ARG D NH1 1 
ATOM   3824 N NH2 . ARG C  2 94  ? 31.359  94.565  191.090 1.00 155.45 ? 419 ARG D NH2 1 
ATOM   3825 N N   . VAL C  2 95  ? 37.597  99.315  191.809 1.00 23.48  ? 420 VAL D N   1 
ATOM   3826 C CA  . VAL C  2 95  ? 37.074  100.578 192.324 1.00 51.09  ? 420 VAL D CA  1 
ATOM   3827 C C   . VAL C  2 95  ? 35.665  100.745 191.782 1.00 43.46  ? 420 VAL D C   1 
ATOM   3828 O O   . VAL C  2 95  ? 35.385  100.297 190.700 1.00 36.83  ? 420 VAL D O   1 
ATOM   3829 C CB  . VAL C  2 95  ? 37.934  101.774 191.866 1.00 48.04  ? 420 VAL D CB  1 
ATOM   3830 C CG1 . VAL C  2 95  ? 39.318  101.315 191.544 1.00 48.87  ? 420 VAL D CG1 1 
ATOM   3831 C CG2 . VAL C  2 95  ? 37.327  102.441 190.689 1.00 33.53  ? 420 VAL D CG2 1 
ATOM   3832 N N   . THR C  2 96  ? 34.772  101.395 192.502 1.00 56.69  ? 421 THR D N   1 
ATOM   3833 C CA  . THR C  2 96  ? 33.425  101.562 191.982 1.00 44.47  ? 421 THR D CA  1 
ATOM   3834 C C   . THR C  2 96  ? 32.981  102.971 192.327 1.00 49.47  ? 421 THR D C   1 
ATOM   3835 O O   . THR C  2 96  ? 33.240  103.446 193.427 1.00 53.52  ? 421 THR D O   1 
ATOM   3836 C CB  . THR C  2 96  ? 32.465  100.554 192.642 1.00 52.57  ? 421 THR D CB  1 
ATOM   3837 O OG1 . THR C  2 96  ? 32.418  100.794 194.052 1.00 72.77  ? 421 THR D OG1 1 
ATOM   3838 C CG2 . THR C  2 96  ? 32.941  99.141  192.431 1.00 38.94  ? 421 THR D CG2 1 
ATOM   3839 N N   . HIS C  2 97  ? 32.334  103.649 191.389 1.00 46.96  ? 422 HIS D N   1 
ATOM   3840 C CA  . HIS C  2 97  ? 31.840  105.009 191.627 1.00 50.37  ? 422 HIS D CA  1 
ATOM   3841 C C   . HIS C  2 97  ? 30.344  105.008 191.319 1.00 58.40  ? 422 HIS D C   1 
ATOM   3842 O O   . HIS C  2 97  ? 29.920  104.610 190.236 1.00 55.23  ? 422 HIS D O   1 
ATOM   3843 C CB  . HIS C  2 97  ? 32.559  106.002 190.718 1.00 7.65   ? 422 HIS D CB  1 
ATOM   3844 C CG  . HIS C  2 97  ? 32.154  107.422 190.931 1.00 34.95  ? 422 HIS D CG  1 
ATOM   3845 N ND1 . HIS C  2 97  ? 31.052  107.779 191.675 1.00 50.97  ? 422 HIS D ND1 1 
ATOM   3846 C CD2 . HIS C  2 97  ? 32.698  108.580 190.485 1.00 63.07  ? 422 HIS D CD2 1 
ATOM   3847 C CE1 . HIS C  2 97  ? 30.935  109.095 191.681 1.00 85.66  ? 422 HIS D CE1 1 
ATOM   3848 N NE2 . HIS C  2 97  ? 31.922  109.606 190.966 1.00 87.03  ? 422 HIS D NE2 1 
ATOM   3849 N N   . PRO C  2 98  ? 29.523  105.465 192.265 1.00 59.84  ? 423 PRO D N   1 
ATOM   3850 C CA  . PRO C  2 98  ? 28.076  105.492 192.059 1.00 66.37  ? 423 PRO D CA  1 
ATOM   3851 C C   . PRO C  2 98  ? 27.619  105.884 190.654 1.00 67.08  ? 423 PRO D C   1 
ATOM   3852 O O   . PRO C  2 98  ? 26.833  105.173 190.028 1.00 86.01  ? 423 PRO D O   1 
ATOM   3853 C CB  . PRO C  2 98  ? 27.608  106.488 193.108 1.00 67.12  ? 423 PRO D CB  1 
ATOM   3854 C CG  . PRO C  2 98  ? 28.588  106.285 194.211 1.00 68.91  ? 423 PRO D CG  1 
ATOM   3855 C CD  . PRO C  2 98  ? 29.888  106.227 193.469 1.00 51.77  ? 423 PRO D CD  1 
ATOM   3856 N N   . HIS C  2 99  ? 28.123  107.005 190.157 1.00 43.25  ? 424 HIS D N   1 
ATOM   3857 C CA  . HIS C  2 99  ? 27.730  107.502 188.848 1.00 48.17  ? 424 HIS D CA  1 
ATOM   3858 C C   . HIS C  2 99  ? 28.388  106.814 187.654 1.00 44.27  ? 424 HIS D C   1 
ATOM   3859 O O   . HIS C  2 99  ? 28.568  107.433 186.612 1.00 58.83  ? 424 HIS D O   1 
ATOM   3860 C CB  . HIS C  2 99  ? 28.010  108.999 188.754 1.00 43.59  ? 424 HIS D CB  1 
ATOM   3861 C CG  . HIS C  2 99  ? 27.748  109.743 190.019 1.00 60.19  ? 424 HIS D CG  1 
ATOM   3862 N ND1 . HIS C  2 99  ? 28.068  111.072 190.174 1.00 79.04  ? 424 HIS D ND1 1 
ATOM   3863 C CD2 . HIS C  2 99  ? 27.244  109.336 191.207 1.00 96.80  ? 424 HIS D CD2 1 
ATOM   3864 C CE1 . HIS C  2 99  ? 27.778  111.452 191.406 1.00 114.32 ? 424 HIS D CE1 1 
ATOM   3865 N NE2 . HIS C  2 99  ? 27.277  110.417 192.054 1.00 123.45 ? 424 HIS D NE2 1 
ATOM   3866 N N   . LEU C  2 100 ? 28.758  105.548 187.776 1.00 35.89  ? 425 LEU D N   1 
ATOM   3867 C CA  . LEU C  2 100 ? 29.371  104.884 186.632 1.00 41.21  ? 425 LEU D CA  1 
ATOM   3868 C C   . LEU C  2 100 ? 28.680  103.584 186.237 1.00 36.19  ? 425 LEU D C   1 
ATOM   3869 O O   . LEU C  2 100 ? 28.161  102.858 187.077 1.00 58.48  ? 425 LEU D O   1 
ATOM   3870 C CB  . LEU C  2 100 ? 30.857  104.611 186.893 1.00 43.52  ? 425 LEU D CB  1 
ATOM   3871 C CG  . LEU C  2 100 ? 31.771  105.825 187.067 1.00 39.93  ? 425 LEU D CG  1 
ATOM   3872 C CD1 . LEU C  2 100 ? 33.179  105.368 187.366 1.00 49.63  ? 425 LEU D CD1 1 
ATOM   3873 C CD2 . LEU C  2 100 ? 31.746  106.677 185.827 1.00 28.33  ? 425 LEU D CD2 1 
ATOM   3874 N N   . PRO C  2 101 ? 28.660  103.287 184.936 1.00 28.74  ? 426 PRO D N   1 
ATOM   3875 C CA  . PRO C  2 101 ? 28.053  102.088 184.376 1.00 24.68  ? 426 PRO D CA  1 
ATOM   3876 C C   . PRO C  2 101 ? 28.735  100.834 184.912 1.00 41.48  ? 426 PRO D C   1 
ATOM   3877 O O   . PRO C  2 101 ? 28.315  100.289 185.916 1.00 51.71  ? 426 PRO D O   1 
ATOM   3878 C CB  . PRO C  2 101 ? 28.260  102.281 182.885 1.00 41.64  ? 426 PRO D CB  1 
ATOM   3879 C CG  . PRO C  2 101 ? 28.215  103.739 182.734 1.00 65.23  ? 426 PRO D CG  1 
ATOM   3880 C CD  . PRO C  2 101 ? 29.067  104.203 183.862 1.00 56.05  ? 426 PRO D CD  1 
ATOM   3881 N N   . ARG C  2 102 ? 29.785  100.369 184.249 1.00 63.64  ? 427 ARG D N   1 
ATOM   3882 C CA  . ARG C  2 102 ? 30.472  99.182  184.725 1.00 68.50  ? 427 ARG D CA  1 
ATOM   3883 C C   . ARG C  2 102 ? 31.532  99.618  185.751 1.00 72.95  ? 427 ARG D C   1 
ATOM   3884 O O   . ARG C  2 102 ? 31.880  100.800 185.828 1.00 33.90  ? 427 ARG D O   1 
ATOM   3885 C CB  . ARG C  2 102 ? 31.083  98.404  183.541 1.00 59.36  ? 427 ARG D CB  1 
ATOM   3886 C CG  . ARG C  2 102 ? 30.616  96.941  183.493 1.00 67.97  ? 427 ARG D CG  1 
ATOM   3887 C CD  . ARG C  2 102 ? 31.214  96.127  182.354 1.00 87.58  ? 427 ARG D CD  1 
ATOM   3888 N NE  . ARG C  2 102 ? 31.336  94.711  182.718 1.00 126.83 ? 427 ARG D NE  1 
ATOM   3889 C CZ  . ARG C  2 102 ? 31.878  93.762  181.953 1.00 141.03 ? 427 ARG D CZ  1 
ATOM   3890 N NH1 . ARG C  2 102 ? 32.363  94.046  180.749 1.00 130.14 ? 427 ARG D NH1 1 
ATOM   3891 N NH2 . ARG C  2 102 ? 31.951  92.516  182.405 1.00 151.24 ? 427 ARG D NH2 1 
ATOM   3892 N N   . ALA C  2 103 ? 32.013  98.674  186.559 1.00 74.41  ? 428 ALA D N   1 
ATOM   3893 C CA  . ALA C  2 103 ? 33.005  98.970  187.595 1.00 47.30  ? 428 ALA D CA  1 
ATOM   3894 C C   . ALA C  2 103 ? 34.400  99.058  187.028 1.00 35.54  ? 428 ALA D C   1 
ATOM   3895 O O   . ALA C  2 103 ? 34.674  98.543  185.958 1.00 52.67  ? 428 ALA D O   1 
ATOM   3896 C CB  . ALA C  2 103 ? 32.956  97.912  188.669 1.00 80.10  ? 428 ALA D CB  1 
ATOM   3897 N N   . LEU C  2 104 ? 35.291  99.721  187.744 1.00 52.73  ? 429 LEU D N   1 
ATOM   3898 C CA  . LEU C  2 104 ? 36.641  99.848  187.242 1.00 36.58  ? 429 LEU D CA  1 
ATOM   3899 C C   . LEU C  2 104 ? 37.484  98.785  187.887 1.00 53.48  ? 429 LEU D C   1 
ATOM   3900 O O   . LEU C  2 104 ? 37.496  98.631  189.117 1.00 57.56  ? 429 LEU D O   1 
ATOM   3901 C CB  . LEU C  2 104 ? 37.222  101.217 187.556 1.00 30.56  ? 429 LEU D CB  1 
ATOM   3902 C CG  . LEU C  2 104 ? 37.745  101.978 186.364 1.00 37.05  ? 429 LEU D CG  1 
ATOM   3903 C CD1 . LEU C  2 104 ? 38.458  103.214 186.845 1.00 40.04  ? 429 LEU D CD1 1 
ATOM   3904 C CD2 . LEU C  2 104 ? 38.672  101.084 185.569 1.00 76.80  ? 429 LEU D CD2 1 
ATOM   3905 N N   . MET C  2 105 ? 38.184  98.040  187.043 1.00 59.06  ? 430 MET D N   1 
ATOM   3906 C CA  . MET C  2 105 ? 39.057  96.962  187.494 1.00 62.69  ? 430 MET D CA  1 
ATOM   3907 C C   . MET C  2 105 ? 40.366  96.986  186.745 1.00 61.78  ? 430 MET D C   1 
ATOM   3908 O O   . MET C  2 105 ? 40.448  97.480  185.612 1.00 62.55  ? 430 MET D O   1 
ATOM   3909 C CB  . MET C  2 105 ? 38.412  95.594  187.284 1.00 50.51  ? 430 MET D CB  1 
ATOM   3910 C CG  . MET C  2 105 ? 37.179  95.375  188.128 1.00 85.42  ? 430 MET D CG  1 
ATOM   3911 S SD  . MET C  2 105 ? 36.525  93.713  187.975 1.00 124.64 ? 430 MET D SD  1 
ATOM   3912 C CE  . MET C  2 105 ? 35.574  93.859  186.419 1.00 138.98 ? 430 MET D CE  1 
ATOM   3913 N N   . ARG C  2 106 ? 41.392  96.466  187.407 1.00 52.98  ? 431 ARG D N   1 
ATOM   3914 C CA  . ARG C  2 106 ? 42.719  96.379  186.841 1.00 60.85  ? 431 ARG D CA  1 
ATOM   3915 C C   . ARG C  2 106 ? 43.363  95.299  187.666 1.00 70.21  ? 431 ARG D C   1 
ATOM   3916 O O   . ARG C  2 106 ? 43.050  95.151  188.839 1.00 64.69  ? 431 ARG D O   1 
ATOM   3917 C CB  . ARG C  2 106 ? 43.464  97.696  186.993 1.00 43.15  ? 431 ARG D CB  1 
ATOM   3918 C CG  . ARG C  2 106 ? 42.683  98.900  186.503 1.00 49.21  ? 431 ARG D CG  1 
ATOM   3919 C CD  . ARG C  2 106 ? 43.552  99.896  185.806 1.00 59.41  ? 431 ARG D CD  1 
ATOM   3920 N NE  . ARG C  2 106 ? 43.438  99.788  184.355 1.00 92.02  ? 431 ARG D NE  1 
ATOM   3921 C CZ  . ARG C  2 106 ? 42.328  100.067 183.679 1.00 102.42 ? 431 ARG D CZ  1 
ATOM   3922 N NH1 . ARG C  2 106 ? 41.245  100.468 184.330 1.00 41.74  ? 431 ARG D NH1 1 
ATOM   3923 N NH2 . ARG C  2 106 ? 42.300  99.949  182.355 1.00 127.74 ? 431 ARG D NH2 1 
ATOM   3924 N N   . SER C  2 107 ? 44.240  94.527  187.046 1.00 75.41  ? 432 SER D N   1 
ATOM   3925 C CA  . SER C  2 107 ? 44.897  93.431  187.734 1.00 72.57  ? 432 SER D CA  1 
ATOM   3926 C C   . SER C  2 107 ? 46.343  93.350  187.291 1.00 78.40  ? 432 SER D C   1 
ATOM   3927 O O   . SER C  2 107 ? 46.754  94.039  186.355 1.00 80.16  ? 432 SER D O   1 
ATOM   3928 C CB  . SER C  2 107 ? 44.192  92.118  187.410 1.00 71.12  ? 432 SER D CB  1 
ATOM   3929 O OG  . SER C  2 107 ? 44.290  91.820  186.027 1.00 91.51  ? 432 SER D OG  1 
ATOM   3930 N N   . THR C  2 108 ? 47.112  92.507  187.969 1.00 77.15  ? 433 THR D N   1 
ATOM   3931 C CA  . THR C  2 108 ? 48.519  92.339  187.647 1.00 85.05  ? 433 THR D CA  1 
ATOM   3932 C C   . THR C  2 108 ? 49.110  91.140  188.340 1.00 91.88  ? 433 THR D C   1 
ATOM   3933 O O   . THR C  2 108 ? 48.687  90.772  189.450 1.00 67.80  ? 433 THR D O   1 
ATOM   3934 C CB  . THR C  2 108 ? 49.341  93.538  188.076 1.00 88.18  ? 433 THR D CB  1 
ATOM   3935 O OG1 . THR C  2 108 ? 50.696  93.368  187.640 1.00 109.32 ? 433 THR D OG1 1 
ATOM   3936 C CG2 . THR C  2 108 ? 49.314  93.664  189.589 1.00 52.68  ? 433 THR D CG2 1 
ATOM   3937 N N   . THR C  2 109 ? 50.101  90.543  187.673 1.00 93.99  ? 434 THR D N   1 
ATOM   3938 C CA  . THR C  2 109 ? 50.835  89.377  188.176 1.00 80.85  ? 434 THR D CA  1 
ATOM   3939 C C   . THR C  2 109 ? 52.219  89.389  187.548 1.00 87.64  ? 434 THR D C   1 
ATOM   3940 O O   . THR C  2 109 ? 52.500  90.185  186.661 1.00 70.99  ? 434 THR D O   1 
ATOM   3941 C CB  . THR C  2 109 ? 50.212  88.050  187.757 1.00 81.39  ? 434 THR D CB  1 
ATOM   3942 O OG1 . THR C  2 109 ? 50.604  87.723  186.414 1.00 107.67 ? 434 THR D OG1 1 
ATOM   3943 C CG2 . THR C  2 109 ? 48.713  88.120  187.813 1.00 84.16  ? 434 THR D CG2 1 
ATOM   3944 N N   . LYS C  2 110 ? 53.052  88.481  188.041 1.00 100.41 ? 435 LYS D N   1 
ATOM   3945 C CA  . LYS C  2 110 ? 54.425  88.280  187.620 1.00 105.08 ? 435 LYS D CA  1 
ATOM   3946 C C   . LYS C  2 110 ? 54.554  88.263  186.100 1.00 99.68  ? 435 LYS D C   1 
ATOM   3947 O O   . LYS C  2 110 ? 53.814  87.555  185.412 1.00 106.50 ? 435 LYS D O   1 
ATOM   3948 C CB  . LYS C  2 110 ? 54.913  86.952  188.190 1.00 116.04 ? 435 LYS D CB  1 
ATOM   3949 C CG  . LYS C  2 110 ? 56.289  86.406  187.805 1.00 144.38 ? 435 LYS D CG  1 
ATOM   3950 C CD  . LYS C  2 110 ? 56.494  85.099  188.627 1.00 154.16 ? 435 LYS D CD  1 
ATOM   3951 C CE  . LYS C  2 110 ? 57.777  84.278  188.369 1.00 166.29 ? 435 LYS D CE  1 
ATOM   3952 N NZ  . LYS C  2 110 ? 57.958  83.976  186.919 1.00 184.88 ? 435 LYS D NZ  1 
ATOM   3953 N N   . THR C  2 111 ? 55.489  89.042  185.566 1.00 88.63  ? 436 THR D N   1 
ATOM   3954 C CA  . THR C  2 111 ? 55.677  89.079  184.118 1.00 100.62 ? 436 THR D CA  1 
ATOM   3955 C C   . THR C  2 111 ? 56.132  87.718  183.594 1.00 116.70 ? 436 THR D C   1 
ATOM   3956 O O   . THR C  2 111 ? 56.943  87.046  184.224 1.00 127.41 ? 436 THR D O   1 
ATOM   3957 C CB  . THR C  2 111 ? 56.715  90.111  183.748 1.00 92.63  ? 436 THR D CB  1 
ATOM   3958 O OG1 . THR C  2 111 ? 56.400  91.352  184.383 1.00 119.70 ? 436 THR D OG1 1 
ATOM   3959 C CG2 . THR C  2 111 ? 56.746  90.317  182.254 1.00 85.25  ? 436 THR D CG2 1 
ATOM   3960 N N   . SER C  2 112 ? 55.651  87.344  182.413 1.00 122.88 ? 437 SER D N   1 
ATOM   3961 C CA  . SER C  2 112 ? 55.976  86.043  181.824 1.00 131.88 ? 437 SER D CA  1 
ATOM   3962 C C   . SER C  2 112 ? 57.136  86.032  180.844 1.00 130.34 ? 437 SER D C   1 
ATOM   3963 O O   . SER C  2 112 ? 57.791  87.049  180.633 1.00 125.73 ? 437 SER D O   1 
ATOM   3964 C CB  . SER C  2 112 ? 54.732  85.467  181.140 1.00 142.35 ? 437 SER D CB  1 
ATOM   3965 O OG  . SER C  2 112 ? 54.249  86.345  180.132 1.00 148.52 ? 437 SER D OG  1 
ATOM   3966 N N   . GLY C  2 113 ? 57.385  84.861  180.261 1.00 133.35 ? 438 GLY D N   1 
ATOM   3967 C CA  . GLY C  2 113 ? 58.455  84.708  179.289 1.00 121.31 ? 438 GLY D CA  1 
ATOM   3968 C C   . GLY C  2 113 ? 59.692  83.989  179.804 1.00 109.60 ? 438 GLY D C   1 
ATOM   3969 O O   . GLY C  2 113 ? 59.641  83.339  180.849 1.00 92.46  ? 438 GLY D O   1 
ATOM   3970 N N   . PRO C  2 114 ? 60.814  84.057  179.066 1.00 104.48 ? 439 PRO D N   1 
ATOM   3971 C CA  . PRO C  2 114 ? 62.088  83.431  179.427 1.00 110.26 ? 439 PRO D CA  1 
ATOM   3972 C C   . PRO C  2 114 ? 62.861  84.406  180.312 1.00 109.17 ? 439 PRO D C   1 
ATOM   3973 O O   . PRO C  2 114 ? 62.881  85.600  180.044 1.00 117.00 ? 439 PRO D O   1 
ATOM   3974 C CB  . PRO C  2 114 ? 62.754  83.224  178.079 1.00 127.01 ? 439 PRO D CB  1 
ATOM   3975 C CG  . PRO C  2 114 ? 62.322  84.442  177.338 1.00 123.37 ? 439 PRO D CG  1 
ATOM   3976 C CD  . PRO C  2 114 ? 60.853  84.528  177.672 1.00 109.50 ? 439 PRO D CD  1 
ATOM   3977 N N   . ARG C  2 115 ? 63.503  83.905  181.357 1.00 101.16 ? 440 ARG D N   1 
ATOM   3978 C CA  . ARG C  2 115 ? 64.231  84.774  182.276 1.00 100.32 ? 440 ARG D CA  1 
ATOM   3979 C C   . ARG C  2 115 ? 65.726  84.853  181.978 1.00 89.02  ? 440 ARG D C   1 
ATOM   3980 O O   . ARG C  2 115 ? 66.468  83.937  182.310 1.00 104.51 ? 440 ARG D O   1 
ATOM   3981 C CB  . ARG C  2 115 ? 64.025  84.289  183.711 1.00 105.62 ? 440 ARG D CB  1 
ATOM   3982 C CG  . ARG C  2 115 ? 62.627  83.749  184.002 1.00 122.30 ? 440 ARG D CG  1 
ATOM   3983 C CD  . ARG C  2 115 ? 61.579  84.849  184.102 1.00 153.49 ? 440 ARG D CD  1 
ATOM   3984 N NE  . ARG C  2 115 ? 60.232  84.332  183.856 1.00 184.12 ? 440 ARG D NE  1 
ATOM   3985 C CZ  . ARG C  2 115 ? 59.122  84.806  184.410 1.00 197.11 ? 440 ARG D CZ  1 
ATOM   3986 N NH1 . ARG C  2 115 ? 59.180  85.822  185.260 1.00 194.18 ? 440 ARG D NH1 1 
ATOM   3987 N NH2 . ARG C  2 115 ? 57.954  84.257  184.108 1.00 208.91 ? 440 ARG D NH2 1 
ATOM   3988 N N   . ALA C  2 116 ? 66.172  85.951  181.372 1.00 77.80  ? 441 ALA D N   1 
ATOM   3989 C CA  . ALA C  2 116 ? 67.589  86.119  181.054 1.00 81.34  ? 441 ALA D CA  1 
ATOM   3990 C C   . ALA C  2 116 ? 68.222  87.195  181.922 1.00 80.31  ? 441 ALA D C   1 
ATOM   3991 O O   . ALA C  2 116 ? 67.781  88.340  181.908 1.00 80.45  ? 441 ALA D O   1 
ATOM   3992 C CB  . ALA C  2 116 ? 67.753  86.473  179.593 1.00 92.56  ? 441 ALA D CB  1 
ATOM   3993 N N   . ALA C  2 117 ? 69.267  86.818  182.659 1.00 90.68  ? 442 ALA D N   1 
ATOM   3994 C CA  . ALA C  2 117 ? 69.993  87.722  183.560 1.00 88.40  ? 442 ALA D CA  1 
ATOM   3995 C C   . ALA C  2 117 ? 70.561  88.989  182.906 1.00 82.90  ? 442 ALA D C   1 
ATOM   3996 O O   . ALA C  2 117 ? 70.706  89.070  181.687 1.00 90.97  ? 442 ALA D O   1 
ATOM   3997 C CB  . ALA C  2 117 ? 71.104  86.959  184.254 1.00 100.08 ? 442 ALA D CB  1 
ATOM   3998 N N   . PRO C  2 118 ? 70.904  89.993  183.725 1.00 73.51  ? 443 PRO D N   1 
ATOM   3999 C CA  . PRO C  2 118 ? 71.449  91.273  183.272 1.00 71.91  ? 443 PRO D CA  1 
ATOM   4000 C C   . PRO C  2 118 ? 72.943  91.293  183.088 1.00 79.92  ? 443 PRO D C   1 
ATOM   4001 O O   . PRO C  2 118 ? 73.682  90.606  183.789 1.00 91.17  ? 443 PRO D O   1 
ATOM   4002 C CB  . PRO C  2 118 ? 71.044  92.255  184.377 1.00 62.55  ? 443 PRO D CB  1 
ATOM   4003 C CG  . PRO C  2 118 ? 70.143  91.467  185.294 1.00 72.73  ? 443 PRO D CG  1 
ATOM   4004 C CD  . PRO C  2 118 ? 70.625  90.055  185.162 1.00 69.67  ? 443 PRO D CD  1 
ATOM   4005 N N   . GLU C  2 119 ? 73.376  92.113  182.145 1.00 79.18  ? 444 GLU D N   1 
ATOM   4006 C CA  . GLU C  2 119 ? 74.782  92.292  181.855 1.00 92.01  ? 444 GLU D CA  1 
ATOM   4007 C C   . GLU C  2 119 ? 74.992  93.747  182.180 1.00 82.05  ? 444 GLU D C   1 
ATOM   4008 O O   . GLU C  2 119 ? 74.317  94.602  181.616 1.00 86.28  ? 444 GLU D O   1 
ATOM   4009 C CB  . GLU C  2 119 ? 75.063  92.051  180.370 1.00 114.69 ? 444 GLU D CB  1 
ATOM   4010 C CG  . GLU C  2 119 ? 75.062  90.591  179.943 1.00 134.83 ? 444 GLU D CG  1 
ATOM   4011 C CD  . GLU C  2 119 ? 74.905  90.425  178.443 1.00 133.50 ? 444 GLU D CD  1 
ATOM   4012 O OE1 . GLU C  2 119 ? 75.481  91.243  177.693 1.00 109.42 ? 444 GLU D OE1 1 
ATOM   4013 O OE2 . GLU C  2 119 ? 74.210  89.475  178.018 1.00 123.92 ? 444 GLU D OE2 1 
ATOM   4014 N N   . VAL C  2 120 ? 75.902  94.043  183.097 1.00 79.43  ? 445 VAL D N   1 
ATOM   4015 C CA  . VAL C  2 120 ? 76.152  95.433  183.453 1.00 79.50  ? 445 VAL D CA  1 
ATOM   4016 C C   . VAL C  2 120 ? 77.599  95.863  183.264 1.00 79.80  ? 445 VAL D C   1 
ATOM   4017 O O   . VAL C  2 120 ? 78.520  95.096  183.545 1.00 85.86  ? 445 VAL D O   1 
ATOM   4018 C CB  . VAL C  2 120 ? 75.736  95.706  184.897 1.00 81.16  ? 445 VAL D CB  1 
ATOM   4019 C CG1 . VAL C  2 120 ? 76.170  94.563  185.778 1.00 68.70  ? 445 VAL D CG1 1 
ATOM   4020 C CG2 . VAL C  2 120 ? 76.333  97.020  185.366 1.00 88.40  ? 445 VAL D CG2 1 
ATOM   4021 N N   . TYR C  2 121 ? 77.791  97.090  182.783 1.00 77.17  ? 446 TYR D N   1 
ATOM   4022 C CA  . TYR C  2 121 ? 79.128  97.633  182.546 1.00 92.54  ? 446 TYR D CA  1 
ATOM   4023 C C   . TYR C  2 121 ? 79.143  99.086  182.995 1.00 94.27  ? 446 TYR D C   1 
ATOM   4024 O O   . TYR C  2 121 ? 78.386  99.896  182.470 1.00 94.79  ? 446 TYR D O   1 
ATOM   4025 C CB  . TYR C  2 121 ? 79.483  97.555  181.054 1.00 111.21 ? 446 TYR D CB  1 
ATOM   4026 C CG  . TYR C  2 121 ? 79.187  96.214  180.416 1.00 125.93 ? 446 TYR D CG  1 
ATOM   4027 C CD1 . TYR C  2 121 ? 78.088  96.048  179.579 1.00 114.73 ? 446 TYR D CD1 1 
ATOM   4028 C CD2 . TYR C  2 121 ? 79.975  95.097  180.692 1.00 142.68 ? 446 TYR D CD2 1 
ATOM   4029 C CE1 . TYR C  2 121 ? 77.774  94.803  179.036 1.00 131.10 ? 446 TYR D CE1 1 
ATOM   4030 C CE2 . TYR C  2 121 ? 79.671  93.845  180.153 1.00 144.25 ? 446 TYR D CE2 1 
ATOM   4031 C CZ  . TYR C  2 121 ? 78.568  93.707  179.329 1.00 139.55 ? 446 TYR D CZ  1 
ATOM   4032 O OH  . TYR C  2 121 ? 78.246  92.473  178.813 1.00 147.52 ? 446 TYR D OH  1 
ATOM   4033 N N   . ALA C  2 122 ? 80.005  99.415  183.956 1.00 97.98  ? 447 ALA D N   1 
ATOM   4034 C CA  . ALA C  2 122 ? 80.100  100.782 184.484 1.00 87.74  ? 447 ALA D CA  1 
ATOM   4035 C C   . ALA C  2 122 ? 81.211  101.615 183.841 1.00 80.33  ? 447 ALA D C   1 
ATOM   4036 O O   . ALA C  2 122 ? 82.290  101.102 183.544 1.00 85.74  ? 447 ALA D O   1 
ATOM   4037 C CB  . ALA C  2 122 ? 80.300  100.730 185.984 1.00 89.63  ? 447 ALA D CB  1 
ATOM   4038 N N   . PHE C  2 123 ? 80.957  102.906 183.642 1.00 60.60  ? 448 PHE D N   1 
ATOM   4039 C CA  . PHE C  2 123 ? 81.955  103.767 183.018 1.00 81.45  ? 448 PHE D CA  1 
ATOM   4040 C C   . PHE C  2 123 ? 82.240  105.047 183.799 1.00 77.06  ? 448 PHE D C   1 
ATOM   4041 O O   . PHE C  2 123 ? 81.778  105.196 184.921 1.00 82.69  ? 448 PHE D O   1 
ATOM   4042 C CB  . PHE C  2 123 ? 81.528  104.081 181.583 1.00 105.04 ? 448 PHE D CB  1 
ATOM   4043 C CG  . PHE C  2 123 ? 81.356  102.852 180.729 1.00 133.00 ? 448 PHE D CG  1 
ATOM   4044 C CD1 . PHE C  2 123 ? 80.213  102.073 180.831 1.00 141.29 ? 448 PHE D CD1 1 
ATOM   4045 C CD2 . PHE C  2 123 ? 82.368  102.438 179.872 1.00 154.48 ? 448 PHE D CD2 1 
ATOM   4046 C CE1 . PHE C  2 123 ? 80.080  100.901 180.100 1.00 151.25 ? 448 PHE D CE1 1 
ATOM   4047 C CE2 . PHE C  2 123 ? 82.246  101.267 179.135 1.00 166.48 ? 448 PHE D CE2 1 
ATOM   4048 C CZ  . PHE C  2 123 ? 81.099  100.497 179.250 1.00 168.73 ? 448 PHE D CZ  1 
ATOM   4049 N N   . ALA C  2 124 ? 83.011  105.963 183.216 1.00 78.55  ? 449 ALA D N   1 
ATOM   4050 C CA  . ALA C  2 124 ? 83.363  107.210 183.901 1.00 62.02  ? 449 ALA D CA  1 
ATOM   4051 C C   . ALA C  2 124 ? 84.019  108.243 182.987 1.00 64.18  ? 449 ALA D C   1 
ATOM   4052 O O   . ALA C  2 124 ? 85.007  107.964 182.302 1.00 80.98  ? 449 ALA D O   1 
ATOM   4053 C CB  . ALA C  2 124 ? 84.286  106.910 185.063 1.00 78.34  ? 449 ALA D CB  1 
ATOM   4054 N N   . THR C  2 125 ? 83.478  109.452 183.017 1.00 56.78  ? 450 THR D N   1 
ATOM   4055 C CA  . THR C  2 125 ? 83.953  110.551 182.182 1.00 86.03  ? 450 THR D CA  1 
ATOM   4056 C C   . THR C  2 125 ? 85.298  111.169 182.568 1.00 91.87  ? 450 THR D C   1 
ATOM   4057 O O   . THR C  2 125 ? 85.722  111.083 183.711 1.00 104.70 ? 450 THR D O   1 
ATOM   4058 C CB  . THR C  2 125 ? 82.895  111.677 182.176 1.00 83.14  ? 450 THR D CB  1 
ATOM   4059 O OG1 . THR C  2 125 ? 81.684  111.176 181.611 1.00 95.47  ? 450 THR D OG1 1 
ATOM   4060 C CG2 . THR C  2 125 ? 83.355  112.870 181.373 1.00 93.81  ? 450 THR D CG2 1 
ATOM   4061 N N   . PRO C  2 126 ? 86.004  111.760 181.590 1.00 96.19  ? 451 PRO D N   1 
ATOM   4062 C CA  . PRO C  2 126 ? 87.298  112.421 181.800 1.00 107.24 ? 451 PRO D CA  1 
ATOM   4063 C C   . PRO C  2 126 ? 86.971  113.891 182.083 1.00 113.26 ? 451 PRO D C   1 
ATOM   4064 O O   . PRO C  2 126 ? 85.922  114.375 181.670 1.00 117.38 ? 451 PRO D O   1 
ATOM   4065 C CB  . PRO C  2 126 ? 87.997  112.253 180.450 1.00 117.64 ? 451 PRO D CB  1 
ATOM   4066 C CG  . PRO C  2 126 ? 87.335  111.052 179.859 1.00 112.84 ? 451 PRO D CG  1 
ATOM   4067 C CD  . PRO C  2 126 ? 85.899  111.307 180.196 1.00 92.73  ? 451 PRO D CD  1 
ATOM   4068 N N   . GLU C  2 127 ? 87.850  114.611 182.768 1.00 118.55 ? 452 GLU D N   1 
ATOM   4069 C CA  . GLU C  2 127 ? 87.560  116.009 183.060 1.00 126.33 ? 452 GLU D CA  1 
ATOM   4070 C C   . GLU C  2 127 ? 87.294  116.834 181.801 1.00 124.79 ? 452 GLU D C   1 
ATOM   4071 O O   . GLU C  2 127 ? 87.544  116.392 180.677 1.00 110.69 ? 452 GLU D O   1 
ATOM   4072 C CB  . GLU C  2 127 ? 88.700  116.645 183.863 1.00 146.84 ? 452 GLU D CB  1 
ATOM   4073 C CG  . GLU C  2 127 ? 90.046  116.683 183.155 1.00 168.84 ? 452 GLU D CG  1 
ATOM   4074 C CD  . GLU C  2 127 ? 91.097  117.446 183.947 1.00 174.23 ? 452 GLU D CD  1 
ATOM   4075 O OE1 . GLU C  2 127 ? 90.906  118.663 184.170 1.00 169.26 ? 452 GLU D OE1 1 
ATOM   4076 O OE2 . GLU C  2 127 ? 92.110  116.830 184.347 1.00 179.86 ? 452 GLU D OE2 1 
ATOM   4077 N N   . TRP C  2 128 ? 86.776  118.039 182.007 1.00 138.58 ? 453 TRP D N   1 
ATOM   4078 C CA  . TRP C  2 128 ? 86.462  118.953 180.916 1.00 159.10 ? 453 TRP D CA  1 
ATOM   4079 C C   . TRP C  2 128 ? 86.731  120.387 181.372 1.00 168.98 ? 453 TRP D C   1 
ATOM   4080 O O   . TRP C  2 128 ? 86.448  120.748 182.517 1.00 168.43 ? 453 TRP D O   1 
ATOM   4081 C CB  . TRP C  2 128 ? 84.992  118.777 180.504 1.00 172.49 ? 453 TRP D CB  1 
ATOM   4082 C CG  . TRP C  2 128 ? 84.500  119.744 179.459 1.00 192.86 ? 453 TRP D CG  1 
ATOM   4083 C CD1 . TRP C  2 128 ? 84.022  121.006 179.668 1.00 196.81 ? 453 TRP D CD1 1 
ATOM   4084 C CD2 . TRP C  2 128 ? 84.449  119.528 178.042 1.00 206.06 ? 453 TRP D CD2 1 
ATOM   4085 N NE1 . TRP C  2 128 ? 83.675  121.589 178.471 1.00 205.67 ? 453 TRP D NE1 1 
ATOM   4086 C CE2 . TRP C  2 128 ? 83.925  120.703 177.457 1.00 209.02 ? 453 TRP D CE2 1 
ATOM   4087 C CE3 . TRP C  2 128 ? 84.792  118.453 177.210 1.00 214.57 ? 453 TRP D CE3 1 
ATOM   4088 C CZ2 . TRP C  2 128 ? 83.741  120.838 176.076 1.00 213.97 ? 453 TRP D CZ2 1 
ATOM   4089 C CZ3 . TRP C  2 128 ? 84.609  118.587 175.834 1.00 219.70 ? 453 TRP D CZ3 1 
ATOM   4090 C CH2 . TRP C  2 128 ? 84.086  119.772 175.284 1.00 220.59 ? 453 TRP D CH2 1 
ATOM   4091 N N   . PRO C  2 129 ? 87.295  121.221 180.480 1.00 177.17 ? 454 PRO D N   1 
ATOM   4092 C CA  . PRO C  2 129 ? 87.624  122.628 180.746 1.00 184.72 ? 454 PRO D CA  1 
ATOM   4093 C C   . PRO C  2 129 ? 86.558  123.418 181.509 1.00 189.20 ? 454 PRO D C   1 
ATOM   4094 O O   . PRO C  2 129 ? 86.855  124.447 182.116 1.00 192.26 ? 454 PRO D O   1 
ATOM   4095 C CB  . PRO C  2 129 ? 87.864  123.187 179.348 1.00 181.25 ? 454 PRO D CB  1 
ATOM   4096 C CG  . PRO C  2 129 ? 88.523  122.033 178.664 1.00 180.39 ? 454 PRO D CG  1 
ATOM   4097 C CD  . PRO C  2 129 ? 87.673  120.851 179.102 1.00 175.13 ? 454 PRO D CD  1 
ATOM   4098 N N   . GLY C  2 130 ? 85.321  122.934 181.474 1.00 186.87 ? 455 GLY D N   1 
ATOM   4099 C CA  . GLY C  2 130 ? 84.239  123.613 182.165 1.00 182.51 ? 455 GLY D CA  1 
ATOM   4100 C C   . GLY C  2 130 ? 84.373  123.555 183.674 1.00 182.65 ? 455 GLY D C   1 
ATOM   4101 O O   . GLY C  2 130 ? 84.142  124.550 184.362 1.00 184.62 ? 455 GLY D O   1 
ATOM   4102 N N   . SER C  2 131 ? 84.746  122.388 184.189 1.00 180.73 ? 456 SER D N   1 
ATOM   4103 C CA  . SER C  2 131 ? 84.913  122.193 185.625 1.00 174.03 ? 456 SER D CA  1 
ATOM   4104 C C   . SER C  2 131 ? 85.943  121.101 185.858 1.00 175.73 ? 456 SER D C   1 
ATOM   4105 O O   . SER C  2 131 ? 85.996  120.122 185.114 1.00 175.85 ? 456 SER D O   1 
ATOM   4106 C CB  . SER C  2 131 ? 83.591  121.774 186.261 1.00 164.16 ? 456 SER D CB  1 
ATOM   4107 O OG  . SER C  2 131 ? 83.188  120.511 185.764 1.00 156.27 ? 456 SER D OG  1 
ATOM   4108 N N   . ARG C  2 132 ? 86.751  121.264 186.899 1.00 178.28 ? 457 ARG D N   1 
ATOM   4109 C CA  . ARG C  2 132 ? 87.787  120.288 187.213 1.00 182.54 ? 457 ARG D CA  1 
ATOM   4110 C C   . ARG C  2 132 ? 87.468  119.472 188.464 1.00 178.57 ? 457 ARG D C   1 
ATOM   4111 O O   . ARG C  2 132 ? 88.291  118.675 188.915 1.00 180.62 ? 457 ARG D O   1 
ATOM   4112 C CB  . ARG C  2 132 ? 89.137  121.000 187.387 1.00 191.01 ? 457 ARG D CB  1 
ATOM   4113 C CG  . ARG C  2 132 ? 89.546  121.846 186.184 1.00 202.11 ? 457 ARG D CG  1 
ATOM   4114 C CD  . ARG C  2 132 ? 90.908  122.507 186.373 1.00 208.07 ? 457 ARG D CD  1 
ATOM   4115 N NE  . ARG C  2 132 ? 91.246  123.379 185.247 1.00 209.40 ? 457 ARG D NE  1 
ATOM   4116 C CZ  . ARG C  2 132 ? 92.393  124.041 185.125 1.00 205.57 ? 457 ARG D CZ  1 
ATOM   4117 N NH1 . ARG C  2 132 ? 93.328  123.937 186.060 1.00 205.07 ? 457 ARG D NH1 1 
ATOM   4118 N NH2 . ARG C  2 132 ? 92.603  124.814 184.068 1.00 195.22 ? 457 ARG D NH2 1 
ATOM   4119 N N   . ASP C  2 133 ? 86.274  119.660 189.018 1.00 178.97 ? 458 ASP D N   1 
ATOM   4120 C CA  . ASP C  2 133 ? 85.890  118.934 190.226 1.00 182.95 ? 458 ASP D CA  1 
ATOM   4121 C C   . ASP C  2 133 ? 84.531  118.249 190.137 1.00 179.01 ? 458 ASP D C   1 
ATOM   4122 O O   . ASP C  2 133 ? 83.930  117.904 191.158 1.00 167.80 ? 458 ASP D O   1 
ATOM   4123 C CB  . ASP C  2 133 ? 85.908  119.875 191.434 1.00 194.59 ? 458 ASP D CB  1 
ATOM   4124 C CG  . ASP C  2 133 ? 87.300  120.382 191.754 1.00 200.49 ? 458 ASP D CG  1 
ATOM   4125 O OD1 . ASP C  2 133 ? 88.212  119.544 191.919 1.00 200.50 ? 458 ASP D OD1 1 
ATOM   4126 O OD2 . ASP C  2 133 ? 87.480  121.615 191.843 1.00 201.68 ? 458 ASP D OD2 1 
ATOM   4127 N N   . LYS C  2 134 ? 84.055  118.053 188.912 1.00 183.61 ? 459 LYS D N   1 
ATOM   4128 C CA  . LYS C  2 134 ? 82.773  117.395 188.672 1.00 177.37 ? 459 LYS D CA  1 
ATOM   4129 C C   . LYS C  2 134 ? 82.932  116.382 187.538 1.00 168.29 ? 459 LYS D C   1 
ATOM   4130 O O   . LYS C  2 134 ? 83.276  116.748 186.410 1.00 165.15 ? 459 LYS D O   1 
ATOM   4131 C CB  . LYS C  2 134 ? 81.697  118.424 188.295 1.00 188.32 ? 459 LYS D CB  1 
ATOM   4132 C CG  . LYS C  2 134 ? 81.395  119.467 189.373 1.00 202.07 ? 459 LYS D CG  1 
ATOM   4133 C CD  . LYS C  2 134 ? 80.275  120.423 188.944 1.00 197.94 ? 459 LYS D CD  1 
ATOM   4134 C CE  . LYS C  2 134 ? 79.958  121.446 190.038 1.00 192.45 ? 459 LYS D CE  1 
ATOM   4135 N NZ  . LYS C  2 134 ? 78.840  122.362 189.668 1.00 176.36 ? 459 LYS D NZ  1 
ATOM   4136 N N   . ARG C  2 135 ? 82.697  115.109 187.843 1.00 155.17 ? 460 ARG D N   1 
ATOM   4137 C CA  . ARG C  2 135 ? 82.804  114.051 186.841 1.00 141.41 ? 460 ARG D CA  1 
ATOM   4138 C C   . ARG C  2 135 ? 81.561  113.141 186.828 1.00 129.90 ? 460 ARG D C   1 
ATOM   4139 O O   . ARG C  2 135 ? 81.033  112.758 187.876 1.00 126.58 ? 460 ARG D O   1 
ATOM   4140 C CB  . ARG C  2 135 ? 84.095  113.244 187.058 1.00 140.88 ? 460 ARG D CB  1 
ATOM   4141 C CG  . ARG C  2 135 ? 85.358  114.037 186.706 1.00 145.20 ? 460 ARG D CG  1 
ATOM   4142 C CD  . ARG C  2 135 ? 86.588  113.151 186.537 1.00 145.62 ? 460 ARG D CD  1 
ATOM   4143 N NE  . ARG C  2 135 ? 87.717  113.902 185.989 1.00 151.82 ? 460 ARG D NE  1 
ATOM   4144 C CZ  . ARG C  2 135 ? 88.857  113.355 185.572 1.00 164.89 ? 460 ARG D CZ  1 
ATOM   4145 N NH1 . ARG C  2 135 ? 89.037  112.042 185.634 1.00 165.69 ? 460 ARG D NH1 1 
ATOM   4146 N NH2 . ARG C  2 135 ? 89.824  114.124 185.090 1.00 174.77 ? 460 ARG D NH2 1 
ATOM   4147 N N   . THR C  2 136 ? 81.116  112.794 185.623 1.00 107.50 ? 461 THR D N   1 
ATOM   4148 C CA  . THR C  2 136 ? 79.912  111.998 185.408 1.00 82.39  ? 461 THR D CA  1 
ATOM   4149 C C   . THR C  2 136 ? 80.058  110.484 185.278 1.00 69.93  ? 461 THR D C   1 
ATOM   4150 O O   . THR C  2 136 ? 80.940  110.002 184.571 1.00 68.90  ? 461 THR D O   1 
ATOM   4151 C CB  . THR C  2 136 ? 79.214  112.496 184.135 1.00 87.85  ? 461 THR D CB  1 
ATOM   4152 O OG1 . THR C  2 136 ? 79.268  113.928 184.100 1.00 92.56  ? 461 THR D OG1 1 
ATOM   4153 C CG2 . THR C  2 136 ? 77.771  112.026 184.092 1.00 75.37  ? 461 THR D CG2 1 
ATOM   4154 N N   . LEU C  2 137 ? 79.174  109.739 185.941 1.00 68.48  ? 462 LEU D N   1 
ATOM   4155 C CA  . LEU C  2 137 ? 79.176  108.269 185.838 1.00 83.35  ? 462 LEU D CA  1 
ATOM   4156 C C   . LEU C  2 137 ? 77.991  107.767 185.029 1.00 87.39  ? 462 LEU D C   1 
ATOM   4157 O O   . LEU C  2 137 ? 76.949  108.418 184.974 1.00 110.62 ? 462 LEU D O   1 
ATOM   4158 C CB  . LEU C  2 137 ? 79.119  107.581 187.202 1.00 70.66  ? 462 LEU D CB  1 
ATOM   4159 C CG  . LEU C  2 137 ? 80.338  107.682 188.115 1.00 81.92  ? 462 LEU D CG  1 
ATOM   4160 C CD1 . LEU C  2 137 ? 80.306  106.517 189.095 1.00 69.81  ? 462 LEU D CD1 1 
ATOM   4161 C CD2 . LEU C  2 137 ? 81.621  107.639 187.305 1.00 76.03  ? 462 LEU D CD2 1 
ATOM   4162 N N   . ALA C  2 138 ? 78.158  106.600 184.416 1.00 85.16  ? 463 ALA D N   1 
ATOM   4163 C CA  . ALA C  2 138 ? 77.117  105.982 183.597 1.00 84.71  ? 463 ALA D CA  1 
ATOM   4164 C C   . ALA C  2 138 ? 77.176  104.476 183.773 1.00 76.41  ? 463 ALA D C   1 
ATOM   4165 O O   . ALA C  2 138 ? 78.250  103.897 183.916 1.00 86.82  ? 463 ALA D O   1 
ATOM   4166 C CB  . ALA C  2 138 ? 77.311  106.345 182.132 1.00 84.45  ? 463 ALA D CB  1 
ATOM   4167 N N   . CYS C  2 139 ? 76.021  103.837 183.750 1.00 68.29  ? 464 CYS D N   1 
ATOM   4168 C CA  . CYS C  2 139 ? 75.980  102.407 183.946 1.00 74.11  ? 464 CYS D CA  1 
ATOM   4169 C C   . CYS C  2 139 ? 74.947  101.799 183.022 1.00 81.23  ? 464 CYS D C   1 
ATOM   4170 O O   . CYS C  2 139 ? 73.769  102.144 183.080 1.00 93.16  ? 464 CYS D O   1 
ATOM   4171 C CB  . CYS C  2 139 ? 75.636  102.132 185.398 1.00 69.06  ? 464 CYS D CB  1 
ATOM   4172 S SG  . CYS C  2 139 ? 75.624  100.393 185.919 1.00 101.91 ? 464 CYS D SG  1 
ATOM   4173 N N   . LEU C  2 140 ? 75.400  100.890 182.167 1.00 77.21  ? 465 LEU D N   1 
ATOM   4174 C CA  . LEU C  2 140 ? 74.530  100.233 181.207 1.00 67.95  ? 465 LEU D CA  1 
ATOM   4175 C C   . LEU C  2 140 ? 74.198  98.791  181.565 1.00 61.32  ? 465 LEU D C   1 
ATOM   4176 O O   . LEU C  2 140 ? 75.083  97.957  181.726 1.00 55.34  ? 465 LEU D O   1 
ATOM   4177 C CB  . LEU C  2 140 ? 75.167  100.288 179.824 1.00 62.71  ? 465 LEU D CB  1 
ATOM   4178 C CG  . LEU C  2 140 ? 74.700  99.281  178.772 1.00 67.91  ? 465 LEU D CG  1 
ATOM   4179 C CD1 . LEU C  2 140 ? 73.187  99.193  178.728 1.00 65.25  ? 465 LEU D CD1 1 
ATOM   4180 C CD2 . LEU C  2 140 ? 75.254  99.711  177.427 1.00 73.81  ? 465 LEU D CD2 1 
ATOM   4181 N N   . ILE C  2 141 ? 72.906  98.509  181.669 1.00 55.77  ? 466 ILE D N   1 
ATOM   4182 C CA  . ILE C  2 141 ? 72.437  97.182  182.007 1.00 62.26  ? 466 ILE D CA  1 
ATOM   4183 C C   . ILE C  2 141 ? 71.624  96.670  180.837 1.00 80.05  ? 466 ILE D C   1 
ATOM   4184 O O   . ILE C  2 141 ? 70.586  97.243  180.502 1.00 84.16  ? 466 ILE D O   1 
ATOM   4185 C CB  . ILE C  2 141 ? 71.567  97.232  183.254 1.00 61.10  ? 466 ILE D CB  1 
ATOM   4186 C CG1 . ILE C  2 141 ? 72.281  98.066  184.316 1.00 49.42  ? 466 ILE D CG1 1 
ATOM   4187 C CG2 . ILE C  2 141 ? 71.276  95.823  183.747 1.00 55.79  ? 466 ILE D CG2 1 
ATOM   4188 C CD1 . ILE C  2 141 ? 71.633  98.043  185.670 1.00 76.67  ? 466 ILE D CD1 1 
ATOM   4189 N N   . GLN C  2 142 ? 72.087  95.590  180.215 1.00 77.65  ? 467 GLN D N   1 
ATOM   4190 C CA  . GLN C  2 142 ? 71.385  95.063  179.060 1.00 63.35  ? 467 GLN D CA  1 
ATOM   4191 C C   . GLN C  2 142 ? 71.124  93.570  178.994 1.00 60.35  ? 467 GLN D C   1 
ATOM   4192 O O   . GLN C  2 142 ? 71.414  92.816  179.917 1.00 51.33  ? 467 GLN D O   1 
ATOM   4193 C CB  . GLN C  2 142 ? 72.115  95.487  177.796 1.00 50.86  ? 467 GLN D CB  1 
ATOM   4194 C CG  . GLN C  2 142 ? 73.590  95.168  177.789 1.00 78.34  ? 467 GLN D CG  1 
ATOM   4195 C CD  . GLN C  2 142 ? 74.224  95.357  176.419 1.00 100.09 ? 467 GLN D CD  1 
ATOM   4196 O OE1 . GLN C  2 142 ? 74.035  96.388  175.759 1.00 78.62  ? 467 GLN D OE1 1 
ATOM   4197 N NE2 . GLN C  2 142 ? 74.989  94.359  175.986 1.00 123.11 ? 467 GLN D NE2 1 
ATOM   4198 N N   . ASN C  2 143 ? 70.542  93.175  177.868 1.00 73.58  ? 468 ASN D N   1 
ATOM   4199 C CA  . ASN C  2 143 ? 70.204  91.797  177.562 1.00 80.57  ? 468 ASN D CA  1 
ATOM   4200 C C   . ASN C  2 143 ? 69.571  91.050  178.709 1.00 79.77  ? 468 ASN D C   1 
ATOM   4201 O O   . ASN C  2 143 ? 70.049  89.988  179.113 1.00 93.06  ? 468 ASN D O   1 
ATOM   4202 C CB  . ASN C  2 143 ? 71.448  91.071  177.072 1.00 96.99  ? 468 ASN D CB  1 
ATOM   4203 C CG  . ASN C  2 143 ? 72.167  91.847  175.992 1.00 113.20 ? 468 ASN D CG  1 
ATOM   4204 O OD1 . ASN C  2 143 ? 71.557  92.267  175.000 1.00 107.68 ? 468 ASN D OD1 1 
ATOM   4205 N ND2 . ASN C  2 143 ? 73.467  92.052  176.179 1.00 118.21 ? 468 ASN D ND2 1 
ATOM   4206 N N   . PHE C  2 144 ? 68.487  91.609  179.236 1.00 68.69  ? 469 PHE D N   1 
ATOM   4207 C CA  . PHE C  2 144 ? 67.783  90.960  180.327 1.00 69.31  ? 469 PHE D CA  1 
ATOM   4208 C C   . PHE C  2 144 ? 66.308  90.888  180.020 1.00 64.60  ? 469 PHE D C   1 
ATOM   4209 O O   . PHE C  2 144 ? 65.834  91.535  179.083 1.00 55.24  ? 469 PHE D O   1 
ATOM   4210 C CB  . PHE C  2 144 ? 68.001  91.710  181.643 1.00 69.48  ? 469 PHE D CB  1 
ATOM   4211 C CG  . PHE C  2 144 ? 67.537  93.134  181.619 1.00 82.23  ? 469 PHE D CG  1 
ATOM   4212 C CD1 . PHE C  2 144 ? 66.376  93.509  182.276 1.00 82.27  ? 469 PHE D CD1 1 
ATOM   4213 C CD2 . PHE C  2 144 ? 68.280  94.110  180.968 1.00 84.77  ? 469 PHE D CD2 1 
ATOM   4214 C CE1 . PHE C  2 144 ? 65.962  94.836  182.290 1.00 93.72  ? 469 PHE D CE1 1 
ATOM   4215 C CE2 . PHE C  2 144 ? 67.877  95.441  180.978 1.00 65.71  ? 469 PHE D CE2 1 
ATOM   4216 C CZ  . PHE C  2 144 ? 66.716  95.804  181.639 1.00 90.19  ? 469 PHE D CZ  1 
ATOM   4217 N N   . MET C  2 145 ? 65.600  90.078  180.805 1.00 46.64  ? 470 MET D N   1 
ATOM   4218 C CA  . MET C  2 145 ? 64.158  89.910  180.673 1.00 65.47  ? 470 MET D CA  1 
ATOM   4219 C C   . MET C  2 145 ? 63.637  89.020  181.785 1.00 67.44  ? 470 MET D C   1 
ATOM   4220 O O   . MET C  2 145 ? 64.295  88.068  182.173 1.00 70.47  ? 470 MET D O   1 
ATOM   4221 C CB  . MET C  2 145 ? 63.814  89.320  179.308 1.00 93.64  ? 470 MET D CB  1 
ATOM   4222 C CG  . MET C  2 145 ? 64.665  88.140  178.901 1.00 109.71 ? 470 MET D CG  1 
ATOM   4223 S SD  . MET C  2 145 ? 64.817  88.077  177.103 1.00 136.10 ? 470 MET D SD  1 
ATOM   4224 C CE  . MET C  2 145 ? 63.162  87.566  176.645 1.00 152.86 ? 470 MET D CE  1 
ATOM   4225 N N   . PRO C  2 146 ? 62.445  89.328  182.328 1.00 68.91  ? 471 PRO D N   1 
ATOM   4226 C CA  . PRO C  2 146 ? 61.500  90.415  182.042 1.00 73.33  ? 471 PRO D CA  1 
ATOM   4227 C C   . PRO C  2 146 ? 62.108  91.805  182.094 1.00 79.76  ? 471 PRO D C   1 
ATOM   4228 O O   . PRO C  2 146 ? 63.298  91.962  182.323 1.00 86.27  ? 471 PRO D O   1 
ATOM   4229 C CB  . PRO C  2 146 ? 60.443  90.228  183.117 1.00 84.10  ? 471 PRO D CB  1 
ATOM   4230 C CG  . PRO C  2 146 ? 60.456  88.748  183.334 1.00 87.98  ? 471 PRO D CG  1 
ATOM   4231 C CD  . PRO C  2 146 ? 61.921  88.464  183.393 1.00 74.23  ? 471 PRO D CD  1 
ATOM   4232 N N   . GLU C  2 147 ? 61.280  92.819  181.886 1.00 89.87  ? 472 GLU D N   1 
ATOM   4233 C CA  . GLU C  2 147 ? 61.768  94.188  181.907 1.00 95.42  ? 472 GLU D CA  1 
ATOM   4234 C C   . GLU C  2 147 ? 61.770  94.796  183.304 1.00 96.52  ? 472 GLU D C   1 
ATOM   4235 O O   . GLU C  2 147 ? 62.261  95.906  183.487 1.00 99.30  ? 472 GLU D O   1 
ATOM   4236 C CB  . GLU C  2 147 ? 60.933  95.063  180.969 1.00 115.93 ? 472 GLU D CB  1 
ATOM   4237 C CG  . GLU C  2 147 ? 59.432  95.001  181.206 1.00 143.95 ? 472 GLU D CG  1 
ATOM   4238 C CD  . GLU C  2 147 ? 58.686  96.116  180.490 1.00 157.06 ? 472 GLU D CD  1 
ATOM   4239 O OE1 . GLU C  2 147 ? 58.879  96.275  179.267 1.00 160.13 ? 472 GLU D OE1 1 
ATOM   4240 O OE2 . GLU C  2 147 ? 57.904  96.834  181.149 1.00 172.52 ? 472 GLU D OE2 1 
ATOM   4241 N N   . ASP C  2 148 ? 61.233  94.077  184.288 1.00 82.41  ? 473 ASP D N   1 
ATOM   4242 C CA  . ASP C  2 148 ? 61.187  94.593  185.649 1.00 85.73  ? 473 ASP D CA  1 
ATOM   4243 C C   . ASP C  2 148 ? 62.564  94.620  186.291 1.00 78.37  ? 473 ASP D C   1 
ATOM   4244 O O   . ASP C  2 148 ? 63.061  93.592  186.742 1.00 56.80  ? 473 ASP D O   1 
ATOM   4245 C CB  . ASP C  2 148 ? 60.234  93.756  186.504 1.00 113.23 ? 473 ASP D CB  1 
ATOM   4246 C CG  . ASP C  2 148 ? 58.789  93.929  186.094 1.00 123.50 ? 473 ASP D CG  1 
ATOM   4247 O OD1 . ASP C  2 148 ? 58.358  95.090  185.944 1.00 135.69 ? 473 ASP D OD1 1 
ATOM   4248 O OD2 . ASP C  2 148 ? 58.086  92.910  185.927 1.00 133.10 ? 473 ASP D OD2 1 
ATOM   4249 N N   . ILE C  2 149 ? 63.163  95.805  186.359 1.00 74.24  ? 474 ILE D N   1 
ATOM   4250 C CA  . ILE C  2 149 ? 64.493  95.947  186.935 1.00 66.43  ? 474 ILE D CA  1 
ATOM   4251 C C   . ILE C  2 149 ? 64.646  97.117  187.900 1.00 76.43  ? 474 ILE D C   1 
ATOM   4252 O O   . ILE C  2 149 ? 64.083  98.194  187.689 1.00 87.44  ? 474 ILE D O   1 
ATOM   4253 C CB  . ILE C  2 149 ? 65.541  96.119  185.823 1.00 74.52  ? 474 ILE D CB  1 
ATOM   4254 C CG1 . ILE C  2 149 ? 66.933  95.793  186.346 1.00 75.87  ? 474 ILE D CG1 1 
ATOM   4255 C CG2 . ILE C  2 149 ? 65.559  97.554  185.331 1.00 64.13  ? 474 ILE D CG2 1 
ATOM   4256 C CD1 . ILE C  2 149 ? 68.003  95.929  185.283 1.00 72.09  ? 474 ILE D CD1 1 
ATOM   4257 N N   . SER C  2 150 ? 65.427  96.893  188.952 1.00 65.36  ? 475 SER D N   1 
ATOM   4258 C CA  . SER C  2 150 ? 65.698  97.914  189.957 1.00 65.51  ? 475 SER D CA  1 
ATOM   4259 C C   . SER C  2 150 ? 67.188  98.261  189.979 1.00 59.52  ? 475 SER D C   1 
ATOM   4260 O O   . SER C  2 150 ? 68.017  97.470  190.419 1.00 63.11  ? 475 SER D O   1 
ATOM   4261 C CB  . SER C  2 150 ? 65.258  97.429  191.351 1.00 66.08  ? 475 SER D CB  1 
ATOM   4262 O OG  . SER C  2 150 ? 63.999  97.964  191.727 1.00 88.01  ? 475 SER D OG  1 
ATOM   4263 N N   . VAL C  2 151 ? 67.521  99.448  189.499 1.00 53.18  ? 476 VAL D N   1 
ATOM   4264 C CA  . VAL C  2 151 ? 68.902  99.906  189.483 1.00 59.87  ? 476 VAL D CA  1 
ATOM   4265 C C   . VAL C  2 151 ? 69.166  100.749 190.728 1.00 75.28  ? 476 VAL D C   1 
ATOM   4266 O O   . VAL C  2 151 ? 68.232  101.248 191.346 1.00 97.76  ? 476 VAL D O   1 
ATOM   4267 C CB  . VAL C  2 151 ? 69.166  100.775 188.240 1.00 68.66  ? 476 VAL D CB  1 
ATOM   4268 C CG1 . VAL C  2 151 ? 70.539  101.424 188.313 1.00 68.51  ? 476 VAL D CG1 1 
ATOM   4269 C CG2 . VAL C  2 151 ? 69.062  99.927  187.005 1.00 95.64  ? 476 VAL D CG2 1 
ATOM   4270 N N   . GLN C  2 152 ? 70.436  100.908 191.085 1.00 84.54  ? 477 GLN D N   1 
ATOM   4271 C CA  . GLN C  2 152 ? 70.840  101.706 192.242 1.00 76.18  ? 477 GLN D CA  1 
ATOM   4272 C C   . GLN C  2 152 ? 72.355  101.845 192.331 1.00 80.67  ? 477 GLN D C   1 
ATOM   4273 O O   . GLN C  2 152 ? 73.095  101.333 191.489 1.00 87.52  ? 477 GLN D O   1 
ATOM   4274 C CB  . GLN C  2 152 ? 70.317  101.076 193.526 1.00 70.56  ? 477 GLN D CB  1 
ATOM   4275 C CG  . GLN C  2 152 ? 70.614  99.603  193.661 1.00 68.88  ? 477 GLN D CG  1 
ATOM   4276 C CD  . GLN C  2 152 ? 69.958  99.013  194.889 1.00 105.16 ? 477 GLN D CD  1 
ATOM   4277 O OE1 . GLN C  2 152 ? 68.738  99.086  195.044 1.00 117.33 ? 477 GLN D OE1 1 
ATOM   4278 N NE2 . GLN C  2 152 ? 70.761  98.429  195.775 1.00 109.64 ? 477 GLN D NE2 1 
ATOM   4279 N N   . TRP C  2 153 ? 72.829  102.546 193.349 1.00 80.52  ? 478 TRP D N   1 
ATOM   4280 C CA  . TRP C  2 153 ? 74.264  102.706 193.495 1.00 81.48  ? 478 TRP D CA  1 
ATOM   4281 C C   . TRP C  2 153 ? 74.723  102.569 194.938 1.00 83.62  ? 478 TRP D C   1 
ATOM   4282 O O   . TRP C  2 153 ? 73.959  102.797 195.866 1.00 104.80 ? 478 TRP D O   1 
ATOM   4283 C CB  . TRP C  2 153 ? 74.714  104.068 192.967 1.00 53.95  ? 478 TRP D CB  1 
ATOM   4284 C CG  . TRP C  2 153 ? 74.440  104.322 191.529 1.00 52.24  ? 478 TRP D CG  1 
ATOM   4285 C CD1 . TRP C  2 153 ? 73.285  104.799 191.002 1.00 65.82  ? 478 TRP D CD1 1 
ATOM   4286 C CD2 . TRP C  2 153 ? 75.397  104.315 190.457 1.00 61.89  ? 478 TRP D CD2 1 
ATOM   4287 N NE1 . TRP C  2 153 ? 73.461  105.120 189.676 1.00 76.08  ? 478 TRP D NE1 1 
ATOM   4288 C CE2 . TRP C  2 153 ? 74.751  104.834 189.318 1.00 73.67  ? 478 TRP D CE2 1 
ATOM   4289 C CE3 . TRP C  2 153 ? 76.742  103.930 190.355 1.00 73.15  ? 478 TRP D CE3 1 
ATOM   4290 C CZ2 . TRP C  2 153 ? 75.402  104.985 188.088 1.00 84.50  ? 478 TRP D CZ2 1 
ATOM   4291 C CZ3 . TRP C  2 153 ? 77.391  104.080 189.132 1.00 80.24  ? 478 TRP D CZ3 1 
ATOM   4292 C CH2 . TRP C  2 153 ? 76.719  104.606 188.016 1.00 78.50  ? 478 TRP D CH2 1 
ATOM   4293 N N   . LEU C  2 154 ? 75.982  102.200 195.113 1.00 74.58  ? 479 LEU D N   1 
ATOM   4294 C CA  . LEU C  2 154 ? 76.560  102.055 196.428 1.00 77.09  ? 479 LEU D CA  1 
ATOM   4295 C C   . LEU C  2 154 ? 77.834  102.878 196.431 1.00 98.55  ? 479 LEU D C   1 
ATOM   4296 O O   . LEU C  2 154 ? 78.361  103.209 195.371 1.00 99.06  ? 479 LEU D O   1 
ATOM   4297 C CB  . LEU C  2 154 ? 76.867  100.593 196.694 1.00 77.83  ? 479 LEU D CB  1 
ATOM   4298 C CG  . LEU C  2 154 ? 75.686  99.688  196.347 1.00 86.23  ? 479 LEU D CG  1 
ATOM   4299 C CD1 . LEU C  2 154 ? 76.079  98.229  196.566 1.00 110.62 ? 479 LEU D CD1 1 
ATOM   4300 C CD2 . LEU C  2 154 ? 74.497  100.046 197.202 1.00 95.91  ? 479 LEU D CD2 1 
ATOM   4301 N N   . HIS C  2 155 ? 78.323  103.214 197.619 1.00 113.53 ? 480 HIS D N   1 
ATOM   4302 C CA  . HIS C  2 155 ? 79.537  104.013 197.746 1.00 108.22 ? 480 HIS D CA  1 
ATOM   4303 C C   . HIS C  2 155 ? 80.068  103.931 199.157 1.00 94.42  ? 480 HIS D C   1 
ATOM   4304 O O   . HIS C  2 155 ? 79.612  104.647 200.049 1.00 84.33  ? 480 HIS D O   1 
ATOM   4305 C CB  . HIS C  2 155 ? 79.249  105.474 197.383 1.00 113.54 ? 480 HIS D CB  1 
ATOM   4306 C CG  . HIS C  2 155 ? 80.387  106.413 197.658 1.00 114.91 ? 480 HIS D CG  1 
ATOM   4307 N ND1 . HIS C  2 155 ? 81.683  106.156 197.264 1.00 109.19 ? 480 HIS D ND1 1 
ATOM   4308 C CD2 . HIS C  2 155 ? 80.407  107.644 198.226 1.00 112.60 ? 480 HIS D CD2 1 
ATOM   4309 C CE1 . HIS C  2 155 ? 82.449  107.187 197.572 1.00 108.10 ? 480 HIS D CE1 1 
ATOM   4310 N NE2 . HIS C  2 155 ? 81.698  108.104 198.156 1.00 107.62 ? 480 HIS D NE2 1 
ATOM   4311 N N   . ASN C  2 156 ? 81.028  103.043 199.362 1.00 98.69  ? 481 ASN D N   1 
ATOM   4312 C CA  . ASN C  2 156 ? 81.609  102.894 200.677 1.00 106.57 ? 481 ASN D CA  1 
ATOM   4313 C C   . ASN C  2 156 ? 80.546  102.355 201.630 1.00 93.95  ? 481 ASN D C   1 
ATOM   4314 O O   . ASN C  2 156 ? 80.382  102.854 202.746 1.00 92.45  ? 481 ASN D O   1 
ATOM   4315 C CB  . ASN C  2 156 ? 82.125  104.254 201.160 1.00 113.74 ? 481 ASN D CB  1 
ATOM   4316 C CG  . ASN C  2 156 ? 83.258  104.126 202.145 1.00 126.76 ? 481 ASN D CG  1 
ATOM   4317 O OD1 . ASN C  2 156 ? 83.876  105.120 202.522 1.00 129.19 ? 481 ASN D OD1 1 
ATOM   4318 N ND2 . ASN C  2 156 ? 83.542  102.897 202.570 1.00 133.50 ? 481 ASN D ND2 1 
ATOM   4319 N N   . GLU C  2 157 ? 79.817  101.342 201.169 1.00 90.24  ? 482 GLU D N   1 
ATOM   4320 C CA  . GLU C  2 157 ? 78.776  100.706 201.975 1.00 108.19 ? 482 GLU D CA  1 
ATOM   4321 C C   . GLU C  2 157 ? 77.575  101.627 202.215 1.00 104.03 ? 482 GLU D C   1 
ATOM   4322 O O   . GLU C  2 157 ? 76.820  101.447 203.175 1.00 96.14  ? 482 GLU D O   1 
ATOM   4323 C CB  . GLU C  2 157 ? 79.365  100.258 203.324 1.00 120.84 ? 482 GLU D CB  1 
ATOM   4324 C CG  . GLU C  2 157 ? 80.643  99.421  203.217 1.00 136.91 ? 482 GLU D CG  1 
ATOM   4325 C CD  . GLU C  2 157 ? 80.427  98.088  202.517 1.00 150.56 ? 482 GLU D CD  1 
ATOM   4326 O OE1 . GLU C  2 157 ? 79.638  97.265  203.030 1.00 152.77 ? 482 GLU D OE1 1 
ATOM   4327 O OE2 . GLU C  2 157 ? 81.047  97.863  201.455 1.00 154.52 ? 482 GLU D OE2 1 
ATOM   4328 N N   . VAL C  2 158 ? 77.392  102.605 201.336 1.00 96.94  ? 483 VAL D N   1 
ATOM   4329 C CA  . VAL C  2 158 ? 76.287  103.551 201.477 1.00 105.20 ? 483 VAL D CA  1 
ATOM   4330 C C   . VAL C  2 158 ? 75.392  103.588 200.243 1.00 105.08 ? 483 VAL D C   1 
ATOM   4331 O O   . VAL C  2 158 ? 75.779  104.119 199.202 1.00 114.99 ? 483 VAL D O   1 
ATOM   4332 C CB  . VAL C  2 158 ? 76.815  104.983 201.744 1.00 111.10 ? 483 VAL D CB  1 
ATOM   4333 C CG1 . VAL C  2 158 ? 75.669  105.986 201.713 1.00 107.42 ? 483 VAL D CG1 1 
ATOM   4334 C CG2 . VAL C  2 158 ? 77.519  105.028 203.088 1.00 132.32 ? 483 VAL D CG2 1 
ATOM   4335 N N   . GLN C  2 159 ? 74.193  103.027 200.365 1.00 92.25  ? 484 GLN D N   1 
ATOM   4336 C CA  . GLN C  2 159 ? 73.244  103.003 199.258 1.00 72.93  ? 484 GLN D CA  1 
ATOM   4337 C C   . GLN C  2 159 ? 72.750  104.413 198.969 1.00 64.76  ? 484 GLN D C   1 
ATOM   4338 O O   . GLN C  2 159 ? 71.799  104.874 199.588 1.00 94.64  ? 484 GLN D O   1 
ATOM   4339 C CB  . GLN C  2 159 ? 72.062  102.112 199.617 1.00 89.76  ? 484 GLN D CB  1 
ATOM   4340 C CG  . GLN C  2 159 ? 71.037  101.964 198.510 1.00 101.79 ? 484 GLN D CG  1 
ATOM   4341 C CD  . GLN C  2 159 ? 69.823  101.181 198.969 1.00 118.29 ? 484 GLN D CD  1 
ATOM   4342 O OE1 . GLN C  2 159 ? 69.946  100.156 199.659 1.00 103.24 ? 484 GLN D OE1 1 
ATOM   4343 N NE2 . GLN C  2 159 ? 68.639  101.654 198.587 1.00 125.13 ? 484 GLN D NE2 1 
ATOM   4344 N N   . LEU C  2 160 ? 73.377  105.098 198.024 1.00 46.85  ? 485 LEU D N   1 
ATOM   4345 C CA  . LEU C  2 160 ? 72.991  106.471 197.711 1.00 62.31  ? 485 LEU D CA  1 
ATOM   4346 C C   . LEU C  2 160 ? 71.504  106.758 197.579 1.00 75.91  ? 485 LEU D C   1 
ATOM   4347 O O   . LEU C  2 160 ? 70.698  105.854 197.350 1.00 80.02  ? 485 LEU D O   1 
ATOM   4348 C CB  . LEU C  2 160 ? 73.698  106.961 196.447 1.00 72.49  ? 485 LEU D CB  1 
ATOM   4349 C CG  . LEU C  2 160 ? 75.216  107.146 196.541 1.00 82.82  ? 485 LEU D CG  1 
ATOM   4350 C CD1 . LEU C  2 160 ? 75.661  108.084 195.431 1.00 66.71  ? 485 LEU D CD1 1 
ATOM   4351 C CD2 . LEU C  2 160 ? 75.604  107.739 197.885 1.00 91.72  ? 485 LEU D CD2 1 
ATOM   4352 N N   . PRO C  2 161 ? 71.127  108.040 197.735 1.00 87.22  ? 486 PRO D N   1 
ATOM   4353 C CA  . PRO C  2 161 ? 69.749  108.532 197.646 1.00 95.71  ? 486 PRO D CA  1 
ATOM   4354 C C   . PRO C  2 161 ? 69.179  108.380 196.244 1.00 90.91  ? 486 PRO D C   1 
ATOM   4355 O O   . PRO C  2 161 ? 69.756  108.858 195.264 1.00 75.45  ? 486 PRO D O   1 
ATOM   4356 C CB  . PRO C  2 161 ? 69.876  110.004 198.038 1.00 113.85 ? 486 PRO D CB  1 
ATOM   4357 C CG  . PRO C  2 161 ? 71.086  110.026 198.916 1.00 115.24 ? 486 PRO D CG  1 
ATOM   4358 C CD  . PRO C  2 161 ? 72.025  109.127 198.161 1.00 104.60 ? 486 PRO D CD  1 
ATOM   4359 N N   . ASP C  2 162 ? 68.027  107.731 196.163 1.00 89.51  ? 487 ASP D N   1 
ATOM   4360 C CA  . ASP C  2 162 ? 67.380  107.504 194.888 1.00 94.90  ? 487 ASP D CA  1 
ATOM   4361 C C   . ASP C  2 162 ? 67.383  108.752 193.995 1.00 84.58  ? 487 ASP D C   1 
ATOM   4362 O O   . ASP C  2 162 ? 67.617  108.660 192.791 1.00 91.37  ? 487 ASP D O   1 
ATOM   4363 C CB  . ASP C  2 162 ? 65.947  107.016 195.124 1.00 121.18 ? 487 ASP D CB  1 
ATOM   4364 C CG  . ASP C  2 162 ? 65.437  106.130 193.996 1.00 143.03 ? 487 ASP D CG  1 
ATOM   4365 O OD1 . ASP C  2 162 ? 65.248  106.640 192.869 1.00 154.14 ? 487 ASP D OD1 1 
ATOM   4366 O OD2 . ASP C  2 162 ? 65.232  104.918 194.235 1.00 147.65 ? 487 ASP D OD2 1 
ATOM   4367 N N   . ALA C  2 163 ? 67.149  109.920 194.583 1.00 77.18  ? 488 ALA D N   1 
ATOM   4368 C CA  . ALA C  2 163 ? 67.100  111.162 193.812 1.00 82.04  ? 488 ALA D CA  1 
ATOM   4369 C C   . ALA C  2 163 ? 68.455  111.622 193.277 1.00 78.63  ? 488 ALA D C   1 
ATOM   4370 O O   . ALA C  2 163 ? 68.559  112.683 192.647 1.00 78.01  ? 488 ALA D O   1 
ATOM   4371 C CB  . ALA C  2 163 ? 66.474  112.268 194.656 1.00 98.70  ? 488 ALA D CB  1 
ATOM   4372 N N   . ARG C  2 164 ? 69.489  110.822 193.520 1.00 68.73  ? 489 ARG D N   1 
ATOM   4373 C CA  . ARG C  2 164 ? 70.837  111.159 193.065 1.00 87.34  ? 489 ARG D CA  1 
ATOM   4374 C C   . ARG C  2 164 ? 71.146  110.806 191.606 1.00 90.35  ? 489 ARG D C   1 
ATOM   4375 O O   . ARG C  2 164 ? 71.879  111.526 190.920 1.00 84.73  ? 489 ARG D O   1 
ATOM   4376 C CB  . ARG C  2 164 ? 71.856  110.474 193.974 1.00 100.20 ? 489 ARG D CB  1 
ATOM   4377 C CG  . ARG C  2 164 ? 72.159  111.254 195.231 1.00 110.60 ? 489 ARG D CG  1 
ATOM   4378 C CD  . ARG C  2 164 ? 73.301  112.214 194.975 1.00 109.61 ? 489 ARG D CD  1 
ATOM   4379 N NE  . ARG C  2 164 ? 74.572  111.660 195.432 1.00 110.23 ? 489 ARG D NE  1 
ATOM   4380 C CZ  . ARG C  2 164 ? 75.764  112.102 195.042 1.00 108.97 ? 489 ARG D CZ  1 
ATOM   4381 N NH1 . ARG C  2 164 ? 75.858  113.107 194.175 1.00 90.41  ? 489 ARG D NH1 1 
ATOM   4382 N NH2 . ARG C  2 164 ? 76.863  111.548 195.532 1.00 104.03 ? 489 ARG D NH2 1 
ATOM   4383 N N   . HIS C  2 165 ? 70.579  109.699 191.138 1.00 87.33  ? 490 HIS D N   1 
ATOM   4384 C CA  . HIS C  2 165 ? 70.810  109.230 189.784 1.00 77.12  ? 490 HIS D CA  1 
ATOM   4385 C C   . HIS C  2 165 ? 69.567  109.238 188.925 1.00 78.11  ? 490 HIS D C   1 
ATOM   4386 O O   . HIS C  2 165 ? 68.455  109.193 189.431 1.00 77.59  ? 490 HIS D O   1 
ATOM   4387 C CB  . HIS C  2 165 ? 71.330  107.809 189.831 1.00 58.97  ? 490 HIS D CB  1 
ATOM   4388 C CG  . HIS C  2 165 ? 70.361  106.847 190.429 1.00 53.07  ? 490 HIS D CG  1 
ATOM   4389 N ND1 . HIS C  2 165 ? 70.600  106.198 191.622 1.00 71.13  ? 490 HIS D ND1 1 
ATOM   4390 C CD2 . HIS C  2 165 ? 69.154  106.414 189.998 1.00 66.58  ? 490 HIS D CD2 1 
ATOM   4391 C CE1 . HIS C  2 165 ? 69.582  105.403 191.899 1.00 83.68  ? 490 HIS D CE1 1 
ATOM   4392 N NE2 . HIS C  2 165 ? 68.691  105.516 190.929 1.00 93.26  ? 490 HIS D NE2 1 
ATOM   4393 N N   . SER C  2 166 ? 69.773  109.267 187.616 1.00 94.56  ? 491 SER D N   1 
ATOM   4394 C CA  . SER C  2 166 ? 68.676  109.246 186.663 1.00 99.63  ? 491 SER D CA  1 
ATOM   4395 C C   . SER C  2 166 ? 68.731  107.937 185.879 1.00 89.98  ? 491 SER D C   1 
ATOM   4396 O O   . SER C  2 166 ? 69.712  107.647 185.204 1.00 77.08  ? 491 SER D O   1 
ATOM   4397 C CB  . SER C  2 166 ? 68.783  110.424 185.696 1.00 100.02 ? 491 SER D CB  1 
ATOM   4398 O OG  . SER C  2 166 ? 67.681  110.437 184.802 1.00 124.69 ? 491 SER D OG  1 
ATOM   4399 N N   . THR C  2 167 ? 67.678  107.140 185.974 1.00 94.18  ? 492 THR D N   1 
ATOM   4400 C CA  . THR C  2 167 ? 67.638  105.879 185.254 1.00 92.68  ? 492 THR D CA  1 
ATOM   4401 C C   . THR C  2 167 ? 66.529  105.932 184.216 1.00 96.81  ? 492 THR D C   1 
ATOM   4402 O O   . THR C  2 167 ? 65.418  106.361 184.520 1.00 113.20 ? 492 THR D O   1 
ATOM   4403 C CB  . THR C  2 167 ? 67.385  104.714 186.217 1.00 96.24  ? 492 THR D CB  1 
ATOM   4404 O OG1 . THR C  2 167 ? 68.540  104.532 187.044 1.00 93.75  ? 492 THR D OG1 1 
ATOM   4405 C CG2 . THR C  2 167 ? 67.093  103.435 185.453 1.00 88.69  ? 492 THR D CG2 1 
ATOM   4406 N N   . THR C  2 168 ? 66.826  105.501 182.993 1.00 81.27  ? 493 THR D N   1 
ATOM   4407 C CA  . THR C  2 168 ? 65.820  105.527 181.936 1.00 82.63  ? 493 THR D CA  1 
ATOM   4408 C C   . THR C  2 168 ? 64.856  104.354 182.017 1.00 89.14  ? 493 THR D C   1 
ATOM   4409 O O   . THR C  2 168 ? 64.911  103.529 182.941 1.00 76.39  ? 493 THR D O   1 
ATOM   4410 C CB  . THR C  2 168 ? 66.444  105.482 180.543 1.00 87.90  ? 493 THR D CB  1 
ATOM   4411 O OG1 . THR C  2 168 ? 66.925  104.157 180.285 1.00 69.26  ? 493 THR D OG1 1 
ATOM   4412 C CG2 . THR C  2 168 ? 67.587  106.470 180.445 1.00 89.76  ? 493 THR D CG2 1 
ATOM   4413 N N   . GLN C  2 169 ? 63.964  104.296 181.036 1.00 91.27  ? 494 GLN D N   1 
ATOM   4414 C CA  . GLN C  2 169 ? 62.988  103.229 180.976 1.00 91.22  ? 494 GLN D CA  1 
ATOM   4415 C C   . GLN C  2 169 ? 63.500  102.163 180.014 1.00 91.82  ? 494 GLN D C   1 
ATOM   4416 O O   . GLN C  2 169 ? 64.174  102.473 179.029 1.00 105.09 ? 494 GLN D O   1 
ATOM   4417 C CB  . GLN C  2 169 ? 61.641  103.773 180.491 1.00 100.97 ? 494 GLN D CB  1 
ATOM   4418 C CG  . GLN C  2 169 ? 61.002  104.821 181.399 1.00 126.86 ? 494 GLN D CG  1 
ATOM   4419 C CD  . GLN C  2 169 ? 60.761  104.317 182.821 1.00 140.72 ? 494 GLN D CD  1 
ATOM   4420 O OE1 . GLN C  2 169 ? 60.297  103.194 183.027 1.00 139.77 ? 494 GLN D OE1 1 
ATOM   4421 N NE2 . GLN C  2 169 ? 61.064  105.158 183.806 1.00 144.62 ? 494 GLN D NE2 1 
ATOM   4422 N N   . PRO C  2 170 ? 63.204  100.889 180.301 1.00 75.68  ? 495 PRO D N   1 
ATOM   4423 C CA  . PRO C  2 170 ? 63.620  99.765  179.469 1.00 64.64  ? 495 PRO D CA  1 
ATOM   4424 C C   . PRO C  2 170 ? 63.295  99.968  177.996 1.00 82.20  ? 495 PRO D C   1 
ATOM   4425 O O   . PRO C  2 170 ? 62.317  100.621 177.647 1.00 91.98  ? 495 PRO D O   1 
ATOM   4426 C CB  . PRO C  2 170 ? 62.844  98.607  180.069 1.00 48.45  ? 495 PRO D CB  1 
ATOM   4427 C CG  . PRO C  2 170 ? 62.886  98.927  181.501 1.00 58.02  ? 495 PRO D CG  1 
ATOM   4428 C CD  . PRO C  2 170 ? 62.540  100.401 181.518 1.00 69.34  ? 495 PRO D CD  1 
ATOM   4429 N N   . ARG C  2 171 ? 64.136  99.410  177.138 1.00 98.76  ? 496 ARG D N   1 
ATOM   4430 C CA  . ARG C  2 171 ? 63.956  99.496  175.697 1.00 110.26 ? 496 ARG D CA  1 
ATOM   4431 C C   . ARG C  2 171 ? 64.426  98.170  175.119 1.00 110.22 ? 496 ARG D C   1 
ATOM   4432 O O   . ARG C  2 171 ? 65.365  97.568  175.630 1.00 104.37 ? 496 ARG D O   1 
ATOM   4433 C CB  . ARG C  2 171 ? 64.765  100.668 175.128 1.00 117.74 ? 496 ARG D CB  1 
ATOM   4434 C CG  . ARG C  2 171 ? 64.080  102.027 175.280 1.00 131.47 ? 496 ARG D CG  1 
ATOM   4435 C CD  . ARG C  2 171 ? 65.003  103.174 174.882 1.00 148.24 ? 496 ARG D CD  1 
ATOM   4436 N NE  . ARG C  2 171 ? 64.275  104.427 174.686 1.00 171.87 ? 496 ARG D NE  1 
ATOM   4437 C CZ  . ARG C  2 171 ? 63.560  104.716 173.603 1.00 179.83 ? 496 ARG D CZ  1 
ATOM   4438 N NH1 . ARG C  2 171 ? 63.477  103.842 172.608 1.00 183.27 ? 496 ARG D NH1 1 
ATOM   4439 N NH2 . ARG C  2 171 ? 62.923  105.877 173.515 1.00 178.77 ? 496 ARG D NH2 1 
ATOM   4440 N N   . LYS C  2 172 ? 63.767  97.707  174.063 1.00 113.46 ? 497 LYS D N   1 
ATOM   4441 C CA  . LYS C  2 172 ? 64.114  96.427  173.459 1.00 106.70 ? 497 LYS D CA  1 
ATOM   4442 C C   . LYS C  2 172 ? 65.360  96.466  172.594 1.00 105.47 ? 497 LYS D C   1 
ATOM   4443 O O   . LYS C  2 172 ? 65.804  97.525  172.155 1.00 96.81  ? 497 LYS D O   1 
ATOM   4444 C CB  . LYS C  2 172 ? 62.936  95.900  172.636 1.00 111.71 ? 497 LYS D CB  1 
ATOM   4445 C CG  . LYS C  2 172 ? 61.645  95.750  173.428 1.00 129.30 ? 497 LYS D CG  1 
ATOM   4446 C CD  . LYS C  2 172 ? 60.515  95.187  172.575 1.00 141.41 ? 497 LYS D CD  1 
ATOM   4447 C CE  . LYS C  2 172 ? 59.221  95.078  173.374 1.00 145.04 ? 497 LYS D CE  1 
ATOM   4448 N NZ  . LYS C  2 172 ? 58.111  94.478  172.579 1.00 143.21 ? 497 LYS D NZ  1 
ATOM   4449 N N   . THR C  2 173 ? 65.919  95.287  172.358 1.00 113.74 ? 498 THR D N   1 
ATOM   4450 C CA  . THR C  2 173 ? 67.108  95.144  171.536 1.00 126.01 ? 498 THR D CA  1 
ATOM   4451 C C   . THR C  2 173 ? 66.928  94.020  170.520 1.00 135.08 ? 498 THR D C   1 
ATOM   4452 O O   . THR C  2 173 ? 66.064  93.148  170.677 1.00 118.50 ? 498 THR D O   1 
ATOM   4453 C CB  . THR C  2 173 ? 68.350  94.851  172.400 1.00 123.77 ? 498 THR D CB  1 
ATOM   4454 O OG1 . THR C  2 173 ? 68.079  93.769  173.302 1.00 99.26  ? 498 THR D OG1 1 
ATOM   4455 C CG2 . THR C  2 173 ? 68.724  96.073  173.194 1.00 129.36 ? 498 THR D CG2 1 
ATOM   4456 N N   . LYS C  2 174 ? 67.746  94.045  169.473 1.00 146.08 ? 499 LYS D N   1 
ATOM   4457 C CA  . LYS C  2 174 ? 67.665  93.030  168.436 1.00 166.42 ? 499 LYS D CA  1 
ATOM   4458 C C   . LYS C  2 174 ? 68.131  91.685  168.993 1.00 173.65 ? 499 LYS D C   1 
ATOM   4459 O O   . LYS C  2 174 ? 68.477  90.773  168.243 1.00 184.55 ? 499 LYS D O   1 
ATOM   4460 C CB  . LYS C  2 174 ? 68.518  93.442  167.227 1.00 174.33 ? 499 LYS D CB  1 
ATOM   4461 C CG  . LYS C  2 174 ? 68.240  92.635  165.953 1.00 183.45 ? 499 LYS D CG  1 
ATOM   4462 C CD  . LYS C  2 174 ? 68.915  93.247  164.723 1.00 181.28 ? 499 LYS D CD  1 
ATOM   4463 C CE  . LYS C  2 174 ? 68.530  92.509  163.439 1.00 173.42 ? 499 LYS D CE  1 
ATOM   4464 N NZ  . LYS C  2 174 ? 69.080  93.166  162.212 1.00 154.17 ? 499 LYS D NZ  1 
ATOM   4465 N N   . GLY C  2 175 ? 68.132  91.570  170.318 1.00 169.18 ? 500 GLY D N   1 
ATOM   4466 C CA  . GLY C  2 175 ? 68.549  90.339  170.963 1.00 165.26 ? 500 GLY D CA  1 
ATOM   4467 C C   . GLY C  2 175 ? 67.489  89.841  171.925 1.00 163.75 ? 500 GLY D C   1 
ATOM   4468 O O   . GLY C  2 175 ? 67.796  89.121  172.875 1.00 166.24 ? 500 GLY D O   1 
ATOM   4469 N N   . SER C  2 176 ? 66.244  90.244  171.674 1.00 157.20 ? 501 SER D N   1 
ATOM   4470 C CA  . SER C  2 176 ? 65.086  89.863  172.485 1.00 154.56 ? 501 SER D CA  1 
ATOM   4471 C C   . SER C  2 176 ? 65.171  90.255  173.960 1.00 146.60 ? 501 SER D C   1 
ATOM   4472 O O   . SER C  2 176 ? 64.317  89.871  174.758 1.00 145.66 ? 501 SER D O   1 
ATOM   4473 C CB  . SER C  2 176 ? 64.828  88.355  172.379 1.00 162.82 ? 501 SER D CB  1 
ATOM   4474 O OG  . SER C  2 176 ? 65.865  87.601  172.983 1.00 175.13 ? 501 SER D OG  1 
ATOM   4475 N N   . GLY C  2 177 ? 66.194  91.018  174.322 1.00 139.02 ? 502 GLY D N   1 
ATOM   4476 C CA  . GLY C  2 177 ? 66.334  91.439  175.703 1.00 116.46 ? 502 GLY D CA  1 
ATOM   4477 C C   . GLY C  2 177 ? 66.210  92.943  175.805 1.00 111.17 ? 502 GLY D C   1 
ATOM   4478 O O   . GLY C  2 177 ? 66.192  93.629  174.781 1.00 104.79 ? 502 GLY D O   1 
ATOM   4479 N N   . PHE C  2 178 ? 66.121  93.465  177.027 1.00 100.38 ? 503 PHE D N   1 
ATOM   4480 C CA  . PHE C  2 178 ? 66.005  94.906  177.208 1.00 87.13  ? 503 PHE D CA  1 
ATOM   4481 C C   . PHE C  2 178 ? 67.293  95.543  177.700 1.00 79.15  ? 503 PHE D C   1 
ATOM   4482 O O   . PHE C  2 178 ? 68.236  94.851  178.074 1.00 70.86  ? 503 PHE D O   1 
ATOM   4483 C CB  . PHE C  2 178 ? 64.911  95.253  178.201 1.00 73.36  ? 503 PHE D CB  1 
ATOM   4484 C CG  . PHE C  2 178 ? 63.595  94.625  177.908 1.00 72.22  ? 503 PHE D CG  1 
ATOM   4485 C CD1 . PHE C  2 178 ? 63.264  93.397  178.453 1.00 80.85  ? 503 PHE D CD1 1 
ATOM   4486 C CD2 . PHE C  2 178 ? 62.658  95.290  177.144 1.00 75.19  ? 503 PHE D CD2 1 
ATOM   4487 C CE1 . PHE C  2 178 ? 62.015  92.845  178.250 1.00 96.21  ? 503 PHE D CE1 1 
ATOM   4488 C CE2 . PHE C  2 178 ? 61.404  94.747  176.932 1.00 105.51 ? 503 PHE D CE2 1 
ATOM   4489 C CZ  . PHE C  2 178 ? 61.081  93.520  177.490 1.00 107.94 ? 503 PHE D CZ  1 
ATOM   4490 N N   . PHE C  2 179 ? 67.304  96.874  177.720 1.00 75.17  ? 504 PHE D N   1 
ATOM   4491 C CA  . PHE C  2 179 ? 68.463  97.628  178.160 1.00 70.17  ? 504 PHE D CA  1 
ATOM   4492 C C   . PHE C  2 179 ? 68.066  98.962  178.779 1.00 80.93  ? 504 PHE D C   1 
ATOM   4493 O O   . PHE C  2 179 ? 67.236  99.690  178.233 1.00 90.84  ? 504 PHE D O   1 
ATOM   4494 C CB  . PHE C  2 179 ? 69.399  97.867  176.972 1.00 71.75  ? 504 PHE D CB  1 
ATOM   4495 C CG  . PHE C  2 179 ? 69.039  99.068  176.119 1.00 69.08  ? 504 PHE D CG  1 
ATOM   4496 C CD1 . PHE C  2 179 ? 69.470  100.338 176.467 1.00 67.02  ? 504 PHE D CD1 1 
ATOM   4497 C CD2 . PHE C  2 179 ? 68.314  98.916  174.948 1.00 87.30  ? 504 PHE D CD2 1 
ATOM   4498 C CE1 . PHE C  2 179 ? 69.192  101.431 175.665 1.00 80.96  ? 504 PHE D CE1 1 
ATOM   4499 C CE2 . PHE C  2 179 ? 68.030  100.006 174.138 1.00 99.15  ? 504 PHE D CE2 1 
ATOM   4500 C CZ  . PHE C  2 179 ? 68.474  101.266 174.498 1.00 97.16  ? 504 PHE D CZ  1 
ATOM   4501 N N   . VAL C  2 180 ? 68.662  99.283  179.920 1.00 81.13  ? 505 VAL D N   1 
ATOM   4502 C CA  . VAL C  2 180 ? 68.376  100.546 180.583 1.00 81.15  ? 505 VAL D CA  1 
ATOM   4503 C C   . VAL C  2 180 ? 69.672  101.266 180.936 1.00 72.65  ? 505 VAL D C   1 
ATOM   4504 O O   . VAL C  2 180 ? 70.685  100.634 181.212 1.00 62.49  ? 505 VAL D O   1 
ATOM   4505 C CB  . VAL C  2 180 ? 67.554  100.339 181.865 1.00 68.85  ? 505 VAL D CB  1 
ATOM   4506 C CG1 . VAL C  2 180 ? 68.374  99.626  182.909 1.00 41.03  ? 505 VAL D CG1 1 
ATOM   4507 C CG2 . VAL C  2 180 ? 67.089  101.683 182.388 1.00 93.47  ? 505 VAL D CG2 1 
ATOM   4508 N N   . PHE C  2 181 ? 69.629  102.592 180.924 1.00 72.32  ? 506 PHE D N   1 
ATOM   4509 C CA  . PHE C  2 181 ? 70.796  103.414 181.227 1.00 72.17  ? 506 PHE D CA  1 
ATOM   4510 C C   . PHE C  2 181 ? 70.632  104.203 182.525 1.00 87.20  ? 506 PHE D C   1 
ATOM   4511 O O   . PHE C  2 181 ? 69.530  104.648 182.857 1.00 102.91 ? 506 PHE D O   1 
ATOM   4512 C CB  . PHE C  2 181 ? 71.026  104.405 180.096 1.00 75.31  ? 506 PHE D CB  1 
ATOM   4513 C CG  . PHE C  2 181 ? 71.958  103.925 179.028 1.00 83.27  ? 506 PHE D CG  1 
ATOM   4514 C CD1 . PHE C  2 181 ? 71.821  104.396 177.728 1.00 90.14  ? 506 PHE D CD1 1 
ATOM   4515 C CD2 . PHE C  2 181 ? 73.015  103.082 179.321 1.00 85.78  ? 506 PHE D CD2 1 
ATOM   4516 C CE1 . PHE C  2 181 ? 72.715  104.046 176.741 1.00 78.60  ? 506 PHE D CE1 1 
ATOM   4517 C CE2 . PHE C  2 181 ? 73.920  102.723 178.335 1.00 94.34  ? 506 PHE D CE2 1 
ATOM   4518 C CZ  . PHE C  2 181 ? 73.770  103.207 177.044 1.00 89.45  ? 506 PHE D CZ  1 
ATOM   4519 N N   . SER C  2 182 ? 71.736  104.387 183.248 1.00 86.72  ? 507 SER D N   1 
ATOM   4520 C CA  . SER C  2 182 ? 71.722  105.144 184.500 1.00 78.23  ? 507 SER D CA  1 
ATOM   4521 C C   . SER C  2 182 ? 72.833  106.187 184.516 1.00 68.83  ? 507 SER D C   1 
ATOM   4522 O O   . SER C  2 182 ? 73.925  105.945 184.012 1.00 70.52  ? 507 SER D O   1 
ATOM   4523 C CB  . SER C  2 182 ? 71.894  104.219 185.700 1.00 49.40  ? 507 SER D CB  1 
ATOM   4524 O OG  . SER C  2 182 ? 71.868  104.985 186.887 1.00 59.17  ? 507 SER D OG  1 
ATOM   4525 N N   . ARG C  2 183 ? 72.550  107.342 185.105 1.00 66.01  ? 508 ARG D N   1 
ATOM   4526 C CA  . ARG C  2 183 ? 73.517  108.428 185.175 1.00 65.73  ? 508 ARG D CA  1 
ATOM   4527 C C   . ARG C  2 183 ? 73.579  108.999 186.586 1.00 84.54  ? 508 ARG D C   1 
ATOM   4528 O O   . ARG C  2 183 ? 72.559  109.381 187.162 1.00 96.21  ? 508 ARG D O   1 
ATOM   4529 C CB  . ARG C  2 183 ? 73.139  109.517 184.167 1.00 60.52  ? 508 ARG D CB  1 
ATOM   4530 C CG  . ARG C  2 183 ? 73.977  110.781 184.239 1.00 61.70  ? 508 ARG D CG  1 
ATOM   4531 C CD  . ARG C  2 183 ? 73.595  111.707 183.087 1.00 67.42  ? 508 ARG D CD  1 
ATOM   4532 N NE  . ARG C  2 183 ? 74.244  113.013 183.150 1.00 81.55  ? 508 ARG D NE  1 
ATOM   4533 C CZ  . ARG C  2 183 ? 73.940  113.952 184.042 1.00 106.49 ? 508 ARG D CZ  1 
ATOM   4534 N NH1 . ARG C  2 183 ? 72.994  113.730 184.947 1.00 125.77 ? 508 ARG D NH1 1 
ATOM   4535 N NH2 . ARG C  2 183 ? 74.574  115.118 184.028 1.00 115.19 ? 508 ARG D NH2 1 
ATOM   4536 N N   . LEU C  2 184 ? 74.792  109.076 187.123 1.00 96.11  ? 509 LEU D N   1 
ATOM   4537 C CA  . LEU C  2 184 ? 75.009  109.556 188.479 1.00 89.51  ? 509 LEU D CA  1 
ATOM   4538 C C   . LEU C  2 184 ? 76.108  110.609 188.620 1.00 80.36  ? 509 LEU D C   1 
ATOM   4539 O O   . LEU C  2 184 ? 77.252  110.253 188.843 1.00 70.84  ? 509 LEU D O   1 
ATOM   4540 C CB  . LEU C  2 184 ? 75.349  108.353 189.361 1.00 66.58  ? 509 LEU D CB  1 
ATOM   4541 C CG  . LEU C  2 184 ? 75.820  108.672 190.775 1.00 76.89  ? 509 LEU D CG  1 
ATOM   4542 C CD1 . LEU C  2 184 ? 74.814  109.609 191.434 1.00 97.24  ? 509 LEU D CD1 1 
ATOM   4543 C CD2 . LEU C  2 184 ? 75.980  107.383 191.571 1.00 49.44  ? 509 LEU D CD2 1 
ATOM   4544 N N   . GLU C  2 185 ? 75.774  111.893 188.504 1.00 93.08  ? 510 GLU D N   1 
ATOM   4545 C CA  . GLU C  2 185 ? 76.793  112.943 188.641 1.00 105.45 ? 510 GLU D CA  1 
ATOM   4546 C C   . GLU C  2 185 ? 77.516  112.757 189.981 1.00 112.81 ? 510 GLU D C   1 
ATOM   4547 O O   . GLU C  2 185 ? 76.906  112.303 190.949 1.00 112.53 ? 510 GLU D O   1 
ATOM   4548 C CB  . GLU C  2 185 ? 76.143  114.333 188.575 1.00 111.99 ? 510 GLU D CB  1 
ATOM   4549 C CG  . GLU C  2 185 ? 75.472  114.649 187.240 1.00 133.45 ? 510 GLU D CG  1 
ATOM   4550 C CD  . GLU C  2 185 ? 74.727  115.982 187.233 1.00 146.32 ? 510 GLU D CD  1 
ATOM   4551 O OE1 . GLU C  2 185 ? 73.731  116.114 187.978 1.00 160.44 ? 510 GLU D OE1 1 
ATOM   4552 O OE2 . GLU C  2 185 ? 75.133  116.898 186.481 1.00 142.13 ? 510 GLU D OE2 1 
ATOM   4553 N N   . VAL C  2 186 ? 78.808  113.095 190.036 1.00 117.26 ? 511 VAL D N   1 
ATOM   4554 C CA  . VAL C  2 186 ? 79.599  112.937 191.268 1.00 124.53 ? 511 VAL D CA  1 
ATOM   4555 C C   . VAL C  2 186 ? 80.483  114.145 191.640 1.00 143.89 ? 511 VAL D C   1 
ATOM   4556 O O   . VAL C  2 186 ? 80.869  114.943 190.776 1.00 147.23 ? 511 VAL D O   1 
ATOM   4557 C CB  . VAL C  2 186 ? 80.495  111.658 191.193 1.00 93.92  ? 511 VAL D CB  1 
ATOM   4558 C CG1 . VAL C  2 186 ? 81.422  111.579 192.387 1.00 114.80 ? 511 VAL D CG1 1 
ATOM   4559 C CG2 . VAL C  2 186 ? 79.622  110.425 191.171 1.00 102.75 ? 511 VAL D CG2 1 
ATOM   4560 N N   . THR C  2 187 ? 80.795  114.261 192.936 1.00 148.33 ? 512 THR D N   1 
ATOM   4561 C CA  . THR C  2 187 ? 81.622  115.346 193.472 1.00 142.16 ? 512 THR D CA  1 
ATOM   4562 C C   . THR C  2 187 ? 83.020  114.866 193.889 1.00 131.84 ? 512 THR D C   1 
ATOM   4563 O O   . THR C  2 187 ? 83.171  113.781 194.468 1.00 113.90 ? 512 THR D O   1 
ATOM   4564 C CB  . THR C  2 187 ? 80.946  116.001 194.700 1.00 148.19 ? 512 THR D CB  1 
ATOM   4565 O OG1 . THR C  2 187 ? 79.636  116.460 194.340 1.00 150.95 ? 512 THR D OG1 1 
ATOM   4566 C CG2 . THR C  2 187 ? 81.773  117.182 195.203 1.00 161.62 ? 512 THR D CG2 1 
ATOM   4567 N N   . ARG C  2 188 ? 84.029  115.691 193.598 1.00 129.54 ? 513 ARG D N   1 
ATOM   4568 C CA  . ARG C  2 188 ? 85.423  115.383 193.919 1.00 132.34 ? 513 ARG D CA  1 
ATOM   4569 C C   . ARG C  2 188 ? 85.580  114.803 195.315 1.00 120.49 ? 513 ARG D C   1 
ATOM   4570 O O   . ARG C  2 188 ? 86.170  113.737 195.499 1.00 104.15 ? 513 ARG D O   1 
ATOM   4571 C CB  . ARG C  2 188 ? 86.296  116.640 193.794 1.00 147.94 ? 513 ARG D CB  1 
ATOM   4572 C CG  . ARG C  2 188 ? 87.780  116.393 194.082 1.00 163.72 ? 513 ARG D CG  1 
ATOM   4573 C CD  . ARG C  2 188 ? 88.601  117.679 194.049 1.00 186.70 ? 513 ARG D CD  1 
ATOM   4574 N NE  . ARG C  2 188 ? 90.013  117.433 194.340 1.00 210.70 ? 513 ARG D NE  1 
ATOM   4575 C CZ  . ARG C  2 188 ? 90.943  118.383 194.427 1.00 221.70 ? 513 ARG D CZ  1 
ATOM   4576 N NH1 . ARG C  2 188 ? 90.620  119.656 194.244 1.00 223.68 ? 513 ARG D NH1 1 
ATOM   4577 N NH2 . ARG C  2 188 ? 92.201  118.059 194.699 1.00 226.30 ? 513 ARG D NH2 1 
ATOM   4578 N N   . ALA C  2 189 ? 85.050  115.520 196.295 1.00 117.30 ? 514 ALA D N   1 
ATOM   4579 C CA  . ALA C  2 189 ? 85.120  115.095 197.682 1.00 120.00 ? 514 ALA D CA  1 
ATOM   4580 C C   . ALA C  2 189 ? 84.881  113.594 197.847 1.00 116.88 ? 514 ALA D C   1 
ATOM   4581 O O   . ALA C  2 189 ? 85.618  112.909 198.559 1.00 115.00 ? 514 ALA D O   1 
ATOM   4582 C CB  . ALA C  2 189 ? 84.105  115.872 198.496 1.00 122.91 ? 514 ALA D CB  1 
ATOM   4583 N N   . GLU C  2 190 ? 83.860  113.086 197.165 1.00 111.89 ? 515 GLU D N   1 
ATOM   4584 C CA  . GLU C  2 190 ? 83.502  111.677 197.265 1.00 110.82 ? 515 GLU D CA  1 
ATOM   4585 C C   . GLU C  2 190 ? 84.480  110.641 196.718 1.00 107.88 ? 515 GLU D C   1 
ATOM   4586 O O   . GLU C  2 190 ? 84.593  109.548 197.282 1.00 94.33  ? 515 GLU D O   1 
ATOM   4587 C CB  . GLU C  2 190 ? 82.120  111.454 196.648 1.00 104.93 ? 515 GLU D CB  1 
ATOM   4588 C CG  . GLU C  2 190 ? 81.013  112.106 197.450 1.00 128.28 ? 515 GLU D CG  1 
ATOM   4589 C CD  . GLU C  2 190 ? 79.656  111.961 196.806 1.00 138.23 ? 515 GLU D CD  1 
ATOM   4590 O OE1 . GLU C  2 190 ? 79.475  112.477 195.680 1.00 136.79 ? 515 GLU D OE1 1 
ATOM   4591 O OE2 . GLU C  2 190 ? 78.773  111.334 197.431 1.00 145.21 ? 515 GLU D OE2 1 
ATOM   4592 N N   . TRP C  2 191 ? 85.188  110.948 195.635 1.00 104.80 ? 516 TRP D N   1 
ATOM   4593 C CA  . TRP C  2 191 ? 86.111  109.943 195.117 1.00 112.14 ? 516 TRP D CA  1 
ATOM   4594 C C   . TRP C  2 191 ? 87.452  109.954 195.824 1.00 122.02 ? 516 TRP D C   1 
ATOM   4595 O O   . TRP C  2 191 ? 88.268  109.049 195.640 1.00 126.67 ? 516 TRP D O   1 
ATOM   4596 C CB  . TRP C  2 191 ? 86.285  110.065 193.596 1.00 112.21 ? 516 TRP D CB  1 
ATOM   4597 C CG  . TRP C  2 191 ? 87.195  111.132 193.088 1.00 109.65 ? 516 TRP D CG  1 
ATOM   4598 C CD1 . TRP C  2 191 ? 88.556  111.159 193.168 1.00 124.32 ? 516 TRP D CD1 1 
ATOM   4599 C CD2 . TRP C  2 191 ? 86.815  112.276 192.315 1.00 105.09 ? 516 TRP D CD2 1 
ATOM   4600 N NE1 . TRP C  2 191 ? 89.050  112.243 192.483 1.00 126.98 ? 516 TRP D NE1 1 
ATOM   4601 C CE2 . TRP C  2 191 ? 88.002  112.945 191.949 1.00 116.12 ? 516 TRP D CE2 1 
ATOM   4602 C CE3 . TRP C  2 191 ? 85.585  112.796 191.892 1.00 97.64  ? 516 TRP D CE3 1 
ATOM   4603 C CZ2 . TRP C  2 191 ? 87.996  114.115 191.178 1.00 124.07 ? 516 TRP D CZ2 1 
ATOM   4604 C CZ3 . TRP C  2 191 ? 85.578  113.960 191.125 1.00 100.24 ? 516 TRP D CZ3 1 
ATOM   4605 C CH2 . TRP C  2 191 ? 86.779  114.604 190.775 1.00 118.44 ? 516 TRP D CH2 1 
ATOM   4606 N N   . GLU C  2 192 ? 87.676  110.982 196.636 1.00 125.69 ? 517 GLU D N   1 
ATOM   4607 C CA  . GLU C  2 192 ? 88.906  111.068 197.400 1.00 126.39 ? 517 GLU D CA  1 
ATOM   4608 C C   . GLU C  2 192 ? 88.632  110.271 198.668 1.00 123.23 ? 517 GLU D C   1 
ATOM   4609 O O   . GLU C  2 192 ? 89.549  109.710 199.278 1.00 132.11 ? 517 GLU D O   1 
ATOM   4610 C CB  . GLU C  2 192 ? 89.239  112.523 197.722 1.00 136.15 ? 517 GLU D CB  1 
ATOM   4611 C CG  . GLU C  2 192 ? 89.577  113.349 196.490 1.00 151.43 ? 517 GLU D CG  1 
ATOM   4612 C CD  . GLU C  2 192 ? 90.194  114.688 196.834 1.00 169.64 ? 517 GLU D CD  1 
ATOM   4613 O OE1 . GLU C  2 192 ? 89.548  115.475 197.559 1.00 185.57 ? 517 GLU D OE1 1 
ATOM   4614 O OE2 . GLU C  2 192 ? 91.328  114.952 196.380 1.00 170.54 ? 517 GLU D OE2 1 
ATOM   4615 N N   . GLN C  2 193 ? 87.352  110.217 199.041 1.00 113.58 ? 518 GLN D N   1 
ATOM   4616 C CA  . GLN C  2 193 ? 86.906  109.467 200.211 1.00 117.85 ? 518 GLN D CA  1 
ATOM   4617 C C   . GLN C  2 193 ? 87.136  107.988 199.890 1.00 116.70 ? 518 GLN D C   1 
ATOM   4618 O O   . GLN C  2 193 ? 87.433  107.182 200.778 1.00 106.04 ? 518 GLN D O   1 
ATOM   4619 C CB  . GLN C  2 193 ? 85.419  109.731 200.463 1.00 130.94 ? 518 GLN D CB  1 
ATOM   4620 C CG  . GLN C  2 193 ? 84.866  109.115 201.744 1.00 143.72 ? 518 GLN D CG  1 
ATOM   4621 C CD  . GLN C  2 193 ? 83.365  109.327 201.897 1.00 142.26 ? 518 GLN D CD  1 
ATOM   4622 O OE1 . GLN C  2 193 ? 82.879  110.461 201.875 1.00 124.33 ? 518 GLN D OE1 1 
ATOM   4623 N NE2 . GLN C  2 193 ? 82.624  108.233 202.053 1.00 135.85 ? 518 GLN D NE2 1 
ATOM   4624 N N   . LYS C  2 194 ? 86.987  107.660 198.605 1.00 115.24 ? 519 LYS D N   1 
ATOM   4625 C CA  . LYS C  2 194 ? 87.195  106.314 198.065 1.00 113.05 ? 519 LYS D CA  1 
ATOM   4626 C C   . LYS C  2 194 ? 86.960  106.353 196.560 1.00 117.26 ? 519 LYS D C   1 
ATOM   4627 O O   . LYS C  2 194 ? 86.313  107.271 196.063 1.00 113.28 ? 519 LYS D O   1 
ATOM   4628 C CB  . LYS C  2 194 ? 86.243  105.295 198.698 1.00 96.02  ? 519 LYS D CB  1 
ATOM   4629 C CG  . LYS C  2 194 ? 86.644  103.852 198.402 1.00 94.30  ? 519 LYS D CG  1 
ATOM   4630 C CD  . LYS C  2 194 ? 86.097  102.873 199.431 1.00 110.35 ? 519 LYS D CD  1 
ATOM   4631 C CE  . LYS C  2 194 ? 86.781  101.513 199.312 1.00 121.51 ? 519 LYS D CE  1 
ATOM   4632 N NZ  . LYS C  2 194 ? 86.331  100.555 200.365 1.00 136.25 ? 519 LYS D NZ  1 
ATOM   4633 N N   . ASP C  2 195 ? 87.494  105.364 195.840 1.00 123.68 ? 520 ASP D N   1 
ATOM   4634 C CA  . ASP C  2 195 ? 87.334  105.277 194.383 1.00 117.52 ? 520 ASP D CA  1 
ATOM   4635 C C   . ASP C  2 195 ? 86.240  104.292 193.999 1.00 115.18 ? 520 ASP D C   1 
ATOM   4636 O O   . ASP C  2 195 ? 85.540  104.494 193.015 1.00 115.71 ? 520 ASP D O   1 
ATOM   4637 C CB  . ASP C  2 195 ? 88.642  104.843 193.718 1.00 132.93 ? 520 ASP D CB  1 
ATOM   4638 C CG  . ASP C  2 195 ? 89.593  105.997 193.499 1.00 150.53 ? 520 ASP D CG  1 
ATOM   4639 O OD1 . ASP C  2 195 ? 89.228  106.917 192.737 1.00 146.76 ? 520 ASP D OD1 1 
ATOM   4640 O OD2 . ASP C  2 195 ? 90.698  105.982 194.086 1.00 158.86 ? 520 ASP D OD2 1 
ATOM   4641 N N   . GLU C  2 196 ? 86.104  103.225 194.783 1.00 124.28 ? 521 GLU D N   1 
ATOM   4642 C CA  . GLU C  2 196 ? 85.096  102.196 194.535 1.00 122.83 ? 521 GLU D CA  1 
ATOM   4643 C C   . GLU C  2 196 ? 83.661  102.715 194.504 1.00 114.43 ? 521 GLU D C   1 
ATOM   4644 O O   . GLU C  2 196 ? 83.099  103.086 195.534 1.00 106.95 ? 521 GLU D O   1 
ATOM   4645 C CB  . GLU C  2 196 ? 85.165  101.093 195.599 1.00 138.05 ? 521 GLU D CB  1 
ATOM   4646 C CG  . GLU C  2 196 ? 85.922  99.836  195.206 1.00 142.00 ? 521 GLU D CG  1 
ATOM   4647 C CD  . GLU C  2 196 ? 85.646  98.680  196.162 1.00 148.47 ? 521 GLU D CD  1 
ATOM   4648 O OE1 . GLU C  2 196 ? 84.480  98.228  196.228 1.00 133.09 ? 521 GLU D OE1 1 
ATOM   4649 O OE2 . GLU C  2 196 ? 86.587  98.228  196.850 1.00 152.56 ? 521 GLU D OE2 1 
ATOM   4650 N N   . PHE C  2 197 ? 83.078  102.726 193.312 1.00 112.16 ? 522 PHE D N   1 
ATOM   4651 C CA  . PHE C  2 197 ? 81.692  103.137 193.112 1.00 94.24  ? 522 PHE D CA  1 
ATOM   4652 C C   . PHE C  2 197 ? 80.989  101.915 192.556 1.00 87.04  ? 522 PHE D C   1 
ATOM   4653 O O   . PHE C  2 197 ? 81.450  101.315 191.587 1.00 89.58  ? 522 PHE D O   1 
ATOM   4654 C CB  . PHE C  2 197 ? 81.596  104.278 192.104 1.00 74.76  ? 522 PHE D CB  1 
ATOM   4655 C CG  . PHE C  2 197 ? 81.809  105.627 192.700 1.00 93.69  ? 522 PHE D CG  1 
ATOM   4656 C CD1 . PHE C  2 197 ? 82.876  105.862 193.553 1.00 101.24 ? 522 PHE D CD1 1 
ATOM   4657 C CD2 . PHE C  2 197 ? 80.950  106.672 192.392 1.00 102.09 ? 522 PHE D CD2 1 
ATOM   4658 C CE1 . PHE C  2 197 ? 83.080  107.123 194.087 1.00 121.51 ? 522 PHE D CE1 1 
ATOM   4659 C CE2 . PHE C  2 197 ? 81.146  107.935 192.919 1.00 94.54  ? 522 PHE D CE2 1 
ATOM   4660 C CZ  . PHE C  2 197 ? 82.208  108.163 193.765 1.00 105.51 ? 522 PHE D CZ  1 
ATOM   4661 N N   . ILE C  2 198 ? 79.879  101.532 193.159 1.00 67.35  ? 523 ILE D N   1 
ATOM   4662 C CA  . ILE C  2 198 ? 79.199  100.360 192.670 1.00 82.70  ? 523 ILE D CA  1 
ATOM   4663 C C   . ILE C  2 198 ? 77.839  100.700 192.098 1.00 87.58  ? 523 ILE D C   1 
ATOM   4664 O O   . ILE C  2 198 ? 77.110  101.506 192.654 1.00 94.63  ? 523 ILE D O   1 
ATOM   4665 C CB  . ILE C  2 198 ? 79.059  99.315  193.791 1.00 81.56  ? 523 ILE D CB  1 
ATOM   4666 C CG1 . ILE C  2 198 ? 80.448  98.994  194.353 1.00 85.67  ? 523 ILE D CG1 1 
ATOM   4667 C CG2 . ILE C  2 198 ? 78.386  98.043  193.261 1.00 64.90  ? 523 ILE D CG2 1 
ATOM   4668 C CD1 . ILE C  2 198 ? 80.448  97.914  195.426 1.00 118.21 ? 523 ILE D CD1 1 
ATOM   4669 N N   . CYS C  2 199 ? 77.521  100.095 190.961 1.00 92.26  ? 524 CYS D N   1 
ATOM   4670 C CA  . CYS C  2 199 ? 76.236  100.283 190.304 1.00 81.42  ? 524 CYS D CA  1 
ATOM   4671 C C   . CYS C  2 199 ? 75.553  98.922  190.326 1.00 80.55  ? 524 CYS D C   1 
ATOM   4672 O O   . CYS C  2 199 ? 75.712  98.128  189.406 1.00 74.20  ? 524 CYS D O   1 
ATOM   4673 C CB  . CYS C  2 199 ? 76.425  100.739 188.861 1.00 81.71  ? 524 CYS D CB  1 
ATOM   4674 S SG  . CYS C  2 199 ? 74.938  100.516 187.836 1.00 110.96 ? 524 CYS D SG  1 
ATOM   4675 N N   . ARG C  2 200 ? 74.809  98.655  191.395 1.00 83.75  ? 525 ARG D N   1 
ATOM   4676 C CA  . ARG C  2 200 ? 74.107  97.387  191.569 1.00 61.75  ? 525 ARG D CA  1 
ATOM   4677 C C   . ARG C  2 200 ? 72.890  97.286  190.665 1.00 68.77  ? 525 ARG D C   1 
ATOM   4678 O O   . ARG C  2 200 ? 72.477  98.264  190.048 1.00 77.27  ? 525 ARG D O   1 
ATOM   4679 C CB  . ARG C  2 200 ? 73.679  97.234  193.029 1.00 61.20  ? 525 ARG D CB  1 
ATOM   4680 C CG  . ARG C  2 200 ? 73.283  95.825  193.416 1.00 64.10  ? 525 ARG D CG  1 
ATOM   4681 C CD  . ARG C  2 200 ? 73.547  95.533  194.901 1.00 89.66  ? 525 ARG D CD  1 
ATOM   4682 N NE  . ARG C  2 200 ? 72.599  96.177  195.808 1.00 102.82 ? 525 ARG D NE  1 
ATOM   4683 C CZ  . ARG C  2 200 ? 72.458  95.846  197.088 1.00 122.88 ? 525 ARG D CZ  1 
ATOM   4684 N NH1 . ARG C  2 200 ? 73.206  94.878  197.608 1.00 125.22 ? 525 ARG D NH1 1 
ATOM   4685 N NH2 . ARG C  2 200 ? 71.568  96.475  197.847 1.00 130.54 ? 525 ARG D NH2 1 
ATOM   4686 N N   . ALA C  2 201 ? 72.325  96.089  190.590 1.00 66.02  ? 526 ALA D N   1 
ATOM   4687 C CA  . ALA C  2 201 ? 71.152  95.837  189.770 1.00 53.61  ? 526 ALA D CA  1 
ATOM   4688 C C   . ALA C  2 201 ? 70.393  94.661  190.359 1.00 52.25  ? 526 ALA D C   1 
ATOM   4689 O O   . ALA C  2 201 ? 70.982  93.665  190.776 1.00 58.94  ? 526 ALA D O   1 
ATOM   4690 C CB  . ALA C  2 201 ? 71.564  95.534  188.356 1.00 27.62  ? 526 ALA D CB  1 
ATOM   4691 N N   . VAL C  2 202 ? 69.078  94.783  190.403 1.00 42.55  ? 527 VAL D N   1 
ATOM   4692 C CA  . VAL C  2 202 ? 68.265  93.721  190.958 1.00 61.14  ? 527 VAL D CA  1 
ATOM   4693 C C   . VAL C  2 202 ? 67.326  93.199  189.894 1.00 62.61  ? 527 VAL D C   1 
ATOM   4694 O O   . VAL C  2 202 ? 66.520  93.949  189.356 1.00 83.53  ? 527 VAL D O   1 
ATOM   4695 C CB  . VAL C  2 202 ? 67.445  94.234  192.147 1.00 66.22  ? 527 VAL D CB  1 
ATOM   4696 C CG1 . VAL C  2 202 ? 66.648  93.095  192.766 1.00 71.63  ? 527 VAL D CG1 1 
ATOM   4697 C CG2 . VAL C  2 202 ? 68.373  94.871  193.163 1.00 67.81  ? 527 VAL D CG2 1 
ATOM   4698 N N   . HIS C  2 203 ? 67.443  91.914  189.584 1.00 61.11  ? 528 HIS D N   1 
ATOM   4699 C CA  . HIS C  2 203 ? 66.588  91.301  188.581 1.00 59.33  ? 528 HIS D CA  1 
ATOM   4700 C C   . HIS C  2 203 ? 66.106  89.963  189.080 1.00 71.49  ? 528 HIS D C   1 
ATOM   4701 O O   . HIS C  2 203 ? 66.741  89.363  189.953 1.00 76.94  ? 528 HIS D O   1 
ATOM   4702 C CB  . HIS C  2 203 ? 67.337  91.112  187.275 1.00 52.57  ? 528 HIS D CB  1 
ATOM   4703 C CG  . HIS C  2 203 ? 66.459  90.762  186.118 1.00 72.89  ? 528 HIS D CG  1 
ATOM   4704 N ND1 . HIS C  2 203 ? 66.402  91.528  184.973 1.00 90.32  ? 528 HIS D ND1 1 
ATOM   4705 C CD2 . HIS C  2 203 ? 65.631  89.713  185.908 1.00 82.61  ? 528 HIS D CD2 1 
ATOM   4706 C CE1 . HIS C  2 203 ? 65.580  90.963  184.107 1.00 98.48  ? 528 HIS D CE1 1 
ATOM   4707 N NE2 . HIS C  2 203 ? 65.099  89.860  184.651 1.00 112.30 ? 528 HIS D NE2 1 
ATOM   4708 N N   . GLU C  2 204 ? 64.979  89.512  188.533 1.00 79.45  ? 529 GLU D N   1 
ATOM   4709 C CA  . GLU C  2 204 ? 64.388  88.250  188.933 1.00 101.72 ? 529 GLU D CA  1 
ATOM   4710 C C   . GLU C  2 204 ? 65.266  87.069  188.541 1.00 103.16 ? 529 GLU D C   1 
ATOM   4711 O O   . GLU C  2 204 ? 65.146  85.986  189.117 1.00 99.89  ? 529 GLU D O   1 
ATOM   4712 C CB  . GLU C  2 204 ? 63.007  88.110  188.318 1.00 125.18 ? 529 GLU D CB  1 
ATOM   4713 C CG  . GLU C  2 204 ? 62.316  86.852  188.709 1.00 172.90 ? 529 GLU D CG  1 
ATOM   4714 C CD  . GLU C  2 204 ? 60.964  86.726  188.018 1.00 193.76 ? 529 GLU D CD  1 
ATOM   4715 O OE1 . GLU C  2 204 ? 60.677  87.124  186.972 1.00 208.74 ? 529 GLU D OE1 1 
ATOM   4716 O OE2 . GLU C  2 204 ? 59.987  86.193  188.379 1.00 211.60 ? 529 GLU D OE2 1 
ATOM   4717 N N   . ALA C  2 205 ? 66.198  87.305  187.616 1.00 107.10 ? 530 ALA D N   1 
ATOM   4718 C CA  . ALA C  2 205 ? 67.094  86.252  187.128 1.00 123.60 ? 530 ALA D CA  1 
ATOM   4719 C C   . ALA C  2 205 ? 68.381  86.118  187.923 1.00 138.54 ? 530 ALA D C   1 
ATOM   4720 O O   . ALA C  2 205 ? 68.445  85.370  188.898 1.00 146.56 ? 530 ALA D O   1 
ATOM   4721 C CB  . ALA C  2 205 ? 67.429  86.491  185.653 1.00 115.24 ? 530 ALA D CB  1 
ATOM   4722 N N   . ALA C  2 206 ? 69.398  86.844  187.473 1.00 147.43 ? 531 ALA D N   1 
ATOM   4723 C CA  . ALA C  2 206 ? 70.724  86.868  188.083 1.00 157.72 ? 531 ALA D CA  1 
ATOM   4724 C C   . ALA C  2 206 ? 70.905  86.066  189.370 1.00 163.02 ? 531 ALA D C   1 
ATOM   4725 O O   . ALA C  2 206 ? 70.099  86.152  190.298 1.00 161.77 ? 531 ALA D O   1 
ATOM   4726 C CB  . ALA C  2 206 ? 71.135  88.308  188.325 1.00 153.11 ? 531 ALA D CB  1 
ATOM   4727 N N   . SER C  2 207 ? 71.985  85.294  189.421 1.00 163.24 ? 532 SER D N   1 
ATOM   4728 C CA  . SER C  2 207 ? 72.294  84.494  190.596 1.00 152.78 ? 532 SER D CA  1 
ATOM   4729 C C   . SER C  2 207 ? 73.494  85.093  191.329 1.00 143.71 ? 532 SER D C   1 
ATOM   4730 O O   . SER C  2 207 ? 74.236  85.909  190.775 1.00 135.58 ? 532 SER D O   1 
ATOM   4731 C CB  . SER C  2 207 ? 72.587  83.041  190.197 1.00 151.42 ? 532 SER D CB  1 
ATOM   4732 O OG  . SER C  2 207 ? 71.402  82.364  189.812 1.00 141.89 ? 532 SER D OG  1 
ATOM   4733 N N   . PRO C  2 208 ? 73.700  84.687  192.588 1.00 141.41 ? 533 PRO D N   1 
ATOM   4734 C CA  . PRO C  2 208 ? 72.863  83.723  193.308 1.00 139.50 ? 533 PRO D CA  1 
ATOM   4735 C C   . PRO C  2 208 ? 71.913  84.426  194.272 1.00 134.65 ? 533 PRO D C   1 
ATOM   4736 O O   . PRO C  2 208 ? 70.971  83.824  194.796 1.00 122.74 ? 533 PRO D O   1 
ATOM   4737 C CB  . PRO C  2 208 ? 73.891  82.890  194.044 1.00 151.36 ? 533 PRO D CB  1 
ATOM   4738 C CG  . PRO C  2 208 ? 74.856  83.964  194.501 1.00 156.31 ? 533 PRO D CG  1 
ATOM   4739 C CD  . PRO C  2 208 ? 74.977  84.898  193.295 1.00 148.28 ? 533 PRO D CD  1 
ATOM   4740 N N   . SER C  2 209 ? 72.180  85.709  194.496 1.00 135.78 ? 534 SER D N   1 
ATOM   4741 C CA  . SER C  2 209 ? 71.391  86.530  195.406 1.00 124.78 ? 534 SER D CA  1 
ATOM   4742 C C   . SER C  2 209 ? 70.454  87.488  194.679 1.00 110.98 ? 534 SER D C   1 
ATOM   4743 O O   . SER C  2 209 ? 70.006  88.477  195.250 1.00 94.75  ? 534 SER D O   1 
ATOM   4744 C CB  . SER C  2 209 ? 72.330  87.327  196.311 1.00 142.22 ? 534 SER D CB  1 
ATOM   4745 O OG  . SER C  2 209 ? 73.274  88.055  195.538 1.00 153.61 ? 534 SER D OG  1 
ATOM   4746 N N   . GLN C  2 210 ? 70.162  87.192  193.419 1.00 101.65 ? 535 GLN D N   1 
ATOM   4747 C CA  . GLN C  2 210 ? 69.280  88.032  192.618 1.00 84.68  ? 535 GLN D CA  1 
ATOM   4748 C C   . GLN C  2 210 ? 69.834  89.450  192.454 1.00 77.53  ? 535 GLN D C   1 
ATOM   4749 O O   . GLN C  2 210 ? 69.127  90.369  192.039 1.00 58.18  ? 535 GLN D O   1 
ATOM   4750 C CB  . GLN C  2 210 ? 67.887  88.057  193.244 1.00 25.71  ? 535 GLN D CB  1 
ATOM   4751 C CG  . GLN C  2 210 ? 67.263  86.683  193.338 1.00 58.22  ? 535 GLN D CG  1 
ATOM   4752 C CD  . GLN C  2 210 ? 66.841  86.320  194.746 1.00 92.78  ? 535 GLN D CD  1 
ATOM   4753 O OE1 . GLN C  2 210 ? 67.579  86.550  195.703 1.00 109.05 ? 535 GLN D OE1 1 
ATOM   4754 N NE2 . GLN C  2 210 ? 65.654  85.735  194.881 1.00 114.58 ? 535 GLN D NE2 1 
ATOM   4755 N N   . THR C  2 211 ? 71.117  89.603  192.769 1.00 77.46  ? 536 THR D N   1 
ATOM   4756 C CA  . THR C  2 211 ? 71.818  90.876  192.651 1.00 80.28  ? 536 THR D CA  1 
ATOM   4757 C C   . THR C  2 211 ? 72.908  90.769  191.583 1.00 88.50  ? 536 THR D C   1 
ATOM   4758 O O   . THR C  2 211 ? 73.332  89.672  191.225 1.00 102.24 ? 536 THR D O   1 
ATOM   4759 C CB  . THR C  2 211 ? 72.502  91.241  193.964 1.00 93.09  ? 536 THR D CB  1 
ATOM   4760 O OG1 . THR C  2 211 ? 71.513  91.416  194.980 1.00 110.98 ? 536 THR D OG1 1 
ATOM   4761 C CG2 . THR C  2 211 ? 73.313  92.511  193.812 1.00 92.57  ? 536 THR D CG2 1 
ATOM   4762 N N   . VAL C  2 212 ? 73.368  91.914  191.092 1.00 82.25  ? 537 VAL D N   1 
ATOM   4763 C CA  . VAL C  2 212 ? 74.415  91.965  190.078 1.00 78.44  ? 537 VAL D CA  1 
ATOM   4764 C C   . VAL C  2 212 ? 75.041  93.348  190.075 1.00 87.23  ? 537 VAL D C   1 
ATOM   4765 O O   . VAL C  2 212 ? 74.349  94.346  189.894 1.00 93.98  ? 537 VAL D O   1 
ATOM   4766 C CB  . VAL C  2 212 ? 73.851  91.681  188.687 1.00 63.67  ? 537 VAL D CB  1 
ATOM   4767 C CG1 . VAL C  2 212 ? 74.764  92.252  187.629 1.00 61.71  ? 537 VAL D CG1 1 
ATOM   4768 C CG2 . VAL C  2 212 ? 73.701  90.191  188.490 1.00 85.99  ? 537 VAL D CG2 1 
ATOM   4769 N N   . GLN C  2 213 ? 76.350  93.415  190.263 1.00 88.01  ? 538 GLN D N   1 
ATOM   4770 C CA  . GLN C  2 213 ? 77.004  94.713  190.296 1.00 86.16  ? 538 GLN D CA  1 
ATOM   4771 C C   . GLN C  2 213 ? 78.329  94.733  189.554 1.00 80.31  ? 538 GLN D C   1 
ATOM   4772 O O   . GLN C  2 213 ? 78.903  93.684  189.271 1.00 86.46  ? 538 GLN D O   1 
ATOM   4773 C CB  . GLN C  2 213 ? 77.204  95.139  191.756 1.00 88.29  ? 538 GLN D CB  1 
ATOM   4774 C CG  . GLN C  2 213 ? 77.904  94.094  192.622 1.00 91.00  ? 538 GLN D CG  1 
ATOM   4775 C CD  . GLN C  2 213 ? 77.775  94.382  194.105 1.00 101.71 ? 538 GLN D CD  1 
ATOM   4776 O OE1 . GLN C  2 213 ? 76.736  94.108  194.715 1.00 95.94  ? 538 GLN D OE1 1 
ATOM   4777 N NE2 . GLN C  2 213 ? 78.829  94.950  194.695 1.00 104.87 ? 538 GLN D NE2 1 
ATOM   4778 N N   . ARG C  2 214 ? 78.794  95.936  189.229 1.00 63.83  ? 539 ARG D N   1 
ATOM   4779 C CA  . ARG C  2 214 ? 80.060  96.120  188.539 1.00 89.37  ? 539 ARG D CA  1 
ATOM   4780 C C   . ARG C  2 214 ? 80.713  97.352  189.131 1.00 94.86  ? 539 ARG D C   1 
ATOM   4781 O O   . ARG C  2 214 ? 80.119  98.424  189.130 1.00 86.12  ? 539 ARG D O   1 
ATOM   4782 C CB  . ARG C  2 214 ? 79.846  96.340  187.042 1.00 105.93 ? 539 ARG D CB  1 
ATOM   4783 C CG  . ARG C  2 214 ? 81.128  96.234  186.207 1.00 127.24 ? 539 ARG D CG  1 
ATOM   4784 C CD  . ARG C  2 214 ? 81.220  94.892  185.479 1.00 136.73 ? 539 ARG D CD  1 
ATOM   4785 N NE  . ARG C  2 214 ? 80.795  93.779  186.324 1.00 138.14 ? 539 ARG D NE  1 
ATOM   4786 C CZ  . ARG C  2 214 ? 80.719  92.516  185.921 1.00 134.05 ? 539 ARG D CZ  1 
ATOM   4787 N NH1 . ARG C  2 214 ? 81.046  92.195  184.678 1.00 147.34 ? 539 ARG D NH1 1 
ATOM   4788 N NH2 . ARG C  2 214 ? 80.302  91.578  186.760 1.00 118.85 ? 539 ARG D NH2 1 
ATOM   4789 N N   . ALA C  2 215 ? 81.933  97.195  189.634 1.00 100.50 ? 540 ALA D N   1 
ATOM   4790 C CA  . ALA C  2 215 ? 82.664  98.303  190.232 1.00 92.60  ? 540 ALA D CA  1 
ATOM   4791 C C   . ALA C  2 215 ? 83.155  99.291  189.179 1.00 85.72  ? 540 ALA D C   1 
ATOM   4792 O O   . ALA C  2 215 ? 83.133  99.004  187.988 1.00 100.26 ? 540 ALA D O   1 
ATOM   4793 C CB  . ALA C  2 215 ? 83.843  97.768  191.030 1.00 104.41 ? 540 ALA D CB  1 
ATOM   4794 N N   . VAL C  2 216 ? 83.596  100.459 189.629 1.00 70.58  ? 541 VAL D N   1 
ATOM   4795 C CA  . VAL C  2 216 ? 84.107  101.491 188.735 1.00 87.18  ? 541 VAL D CA  1 
ATOM   4796 C C   . VAL C  2 216 ? 84.979  102.443 189.547 1.00 107.03 ? 541 VAL D C   1 
ATOM   4797 O O   . VAL C  2 216 ? 85.129  102.267 190.755 1.00 129.24 ? 541 VAL D O   1 
ATOM   4798 C CB  . VAL C  2 216 ? 82.963  102.295 188.111 1.00 75.69  ? 541 VAL D CB  1 
ATOM   4799 C CG1 . VAL C  2 216 ? 82.228  103.037 189.197 1.00 77.64  ? 541 VAL D CG1 1 
ATOM   4800 C CG2 . VAL C  2 216 ? 83.498  103.274 187.069 1.00 63.98  ? 541 VAL D CG2 1 
ATOM   4801 N N   . SER C  2 217 ? 85.550  103.446 188.882 1.00 110.37 ? 542 SER D N   1 
ATOM   4802 C CA  . SER C  2 217 ? 86.397  104.444 189.533 1.00 103.42 ? 542 SER D CA  1 
ATOM   4803 C C   . SER C  2 217 ? 87.169  105.273 188.516 1.00 94.17  ? 542 SER D C   1 
ATOM   4804 O O   . SER C  2 217 ? 87.411  104.831 187.395 1.00 105.43 ? 542 SER D O   1 
ATOM   4805 C CB  . SER C  2 217 ? 87.392  103.773 190.490 1.00 111.13 ? 542 SER D CB  1 
ATOM   4806 O OG  . SER C  2 217 ? 88.174  102.799 189.819 1.00 122.16 ? 542 SER D OG  1 
ATOM   4807 N N   . VAL C  2 218 ? 87.548  106.481 188.909 1.00 90.63  ? 543 VAL D N   1 
ATOM   4808 C CA  . VAL C  2 218 ? 88.325  107.348 188.034 1.00 103.02 ? 543 VAL D CA  1 
ATOM   4809 C C   . VAL C  2 218 ? 89.805  107.068 188.309 1.00 125.93 ? 543 VAL D C   1 
ATOM   4810 O O   . VAL C  2 218 ? 90.167  106.634 189.406 1.00 131.67 ? 543 VAL D O   1 
ATOM   4811 C CB  . VAL C  2 218 ? 88.073  108.846 188.322 1.00 99.52  ? 543 VAL D CB  1 
ATOM   4812 C CG1 . VAL C  2 218 ? 88.348  109.653 187.057 1.00 69.02  ? 543 VAL D CG1 1 
ATOM   4813 C CG2 . VAL C  2 218 ? 86.642  109.072 188.868 1.00 43.91  ? 543 VAL D CG2 1 
ATOM   4814 N N   . ASN C  2 219 ? 90.655  107.326 187.320 1.00 130.11 ? 544 ASN D N   1 
ATOM   4815 C CA  . ASN C  2 219 ? 92.091  107.096 187.461 1.00 134.45 ? 544 ASN D CA  1 
ATOM   4816 C C   . ASN C  2 219 ? 92.415  105.605 187.627 1.00 134.27 ? 544 ASN D C   1 
ATOM   4817 O O   . ASN C  2 219 ? 93.206  105.090 186.810 1.00 140.53 ? 544 ASN D O   1 
ATOM   4818 C CB  . ASN C  2 219 ? 92.644  107.880 188.658 1.00 134.23 ? 544 ASN D CB  1 
ATOM   4819 C CG  . ASN C  2 219 ? 92.354  109.369 188.568 1.00 135.68 ? 544 ASN D CG  1 
ATOM   4820 O OD1 . ASN C  2 219 ? 92.701  110.027 187.586 1.00 136.34 ? 544 ASN D OD1 1 
ATOM   4821 N ND2 . ASN C  2 219 ? 91.716  109.907 189.600 1.00 119.43 ? 544 ASN D ND2 1 
HETATM 4822 C C1  . NAG D  3 .   ? 11.009  106.713 181.607 1.00 92.31  ? 221 NAG A C1  1 
HETATM 4823 C C2  . NAG D  3 .   ? 11.997  107.878 181.655 1.00 116.13 ? 221 NAG A C2  1 
HETATM 4824 C C3  . NAG D  3 .   ? 12.062  108.405 183.087 1.00 132.65 ? 221 NAG A C3  1 
HETATM 4825 C C4  . NAG D  3 .   ? 10.653  108.784 183.562 1.00 134.30 ? 221 NAG A C4  1 
HETATM 4826 C C5  . NAG D  3 .   ? 9.653   107.645 183.321 1.00 122.59 ? 221 NAG A C5  1 
HETATM 4827 C C6  . NAG D  3 .   ? 8.220   108.040 183.621 1.00 137.19 ? 221 NAG A C6  1 
HETATM 4828 C C7  . NAG D  3 .   ? 13.976  108.256 180.361 1.00 133.21 ? 221 NAG A C7  1 
HETATM 4829 C C8  . NAG D  3 .   ? 14.971  109.233 180.966 1.00 152.38 ? 221 NAG A C8  1 
HETATM 4830 N N2  . NAG D  3 .   ? 13.311  107.471 181.201 1.00 112.11 ? 221 NAG A N2  1 
HETATM 4831 O O3  . NAG D  3 .   ? 12.916  109.541 183.151 1.00 147.48 ? 221 NAG A O3  1 
HETATM 4832 O O4  . NAG D  3 .   ? 10.688  109.080 184.970 1.00 148.17 ? 221 NAG A O4  1 
HETATM 4833 O O5  . NAG D  3 .   ? 9.707   107.189 181.953 1.00 85.16  ? 221 NAG A O5  1 
HETATM 4834 O O6  . NAG D  3 .   ? 7.694   108.868 182.567 1.00 149.86 ? 221 NAG A O6  1 
HETATM 4835 O O7  . NAG D  3 .   ? 13.803  108.231 179.142 1.00 142.36 ? 221 NAG A O7  1 
HETATM 4836 C C1  . NAG E  3 .   ? 10.235  110.337 185.310 1.00 155.96 ? 222 NAG A C1  1 
HETATM 4837 C C2  . NAG E  3 .   ? 9.719   110.337 186.759 1.00 163.25 ? 222 NAG A C2  1 
HETATM 4838 C C3  . NAG E  3 .   ? 9.316   111.762 187.139 1.00 172.09 ? 222 NAG A C3  1 
HETATM 4839 C C4  . NAG E  3 .   ? 10.521  112.683 186.929 1.00 175.07 ? 222 NAG A C4  1 
HETATM 4840 C C5  . NAG E  3 .   ? 10.970  112.600 185.466 1.00 162.85 ? 222 NAG A C5  1 
HETATM 4841 C C6  . NAG E  3 .   ? 12.167  113.462 185.127 1.00 162.80 ? 222 NAG A C6  1 
HETATM 4842 C C7  . NAG E  3 .   ? 8.427   108.704 187.977 1.00 155.52 ? 222 NAG A C7  1 
HETATM 4843 C C8  . NAG E  3 .   ? 7.395   109.174 188.991 1.00 157.69 ? 222 NAG A C8  1 
HETATM 4844 N N2  . NAG E  3 .   ? 8.580   109.445 186.884 1.00 157.80 ? 222 NAG A N2  1 
HETATM 4845 O O3  . NAG E  3 .   ? 8.887   111.804 188.493 1.00 175.79 ? 222 NAG A O3  1 
HETATM 4846 O O4  . NAG E  3 .   ? 10.184  114.036 187.276 1.00 189.19 ? 222 NAG A O4  1 
HETATM 4847 O O5  . NAG E  3 .   ? 11.333  111.244 185.156 1.00 153.42 ? 222 NAG A O5  1 
HETATM 4848 O O6  . NAG E  3 .   ? 12.730  113.081 183.879 1.00 155.73 ? 222 NAG A O6  1 
HETATM 4849 O O7  . NAG E  3 .   ? 9.078   107.677 188.190 1.00 138.57 ? 222 NAG A O7  1 
HETATM 4850 C C1  . MAN F  4 .   ? 10.805  114.503 188.420 1.00 195.52 ? 223 MAN A C1  1 
HETATM 4851 C C2  . MAN F  4 .   ? 10.910  116.025 188.373 1.00 195.35 ? 223 MAN A C2  1 
HETATM 4852 C C3  . MAN F  4 .   ? 11.524  116.542 189.677 1.00 202.62 ? 223 MAN A C3  1 
HETATM 4853 C C4  . MAN F  4 .   ? 10.787  115.976 190.907 1.00 208.93 ? 223 MAN A C4  1 
HETATM 4854 C C5  . MAN F  4 .   ? 10.646  114.450 190.805 1.00 201.56 ? 223 MAN A C5  1 
HETATM 4855 C C6  . MAN F  4 .   ? 9.793   113.860 191.919 1.00 193.17 ? 223 MAN A C6  1 
HETATM 4856 O O2  . MAN F  4 .   ? 9.623   116.596 188.179 1.00 184.23 ? 223 MAN A O2  1 
HETATM 4857 O O3  . MAN F  4 .   ? 11.463  117.961 189.691 1.00 207.95 ? 223 MAN A O3  1 
HETATM 4858 O O4  . MAN F  4 .   ? 11.500  116.305 192.093 1.00 206.56 ? 223 MAN A O4  1 
HETATM 4859 O O5  . MAN F  4 .   ? 10.026  114.090 189.551 1.00 202.53 ? 223 MAN A O5  1 
HETATM 4860 O O6  . MAN F  4 .   ? 8.598   113.277 191.412 1.00 168.92 ? 223 MAN A O6  1 
HETATM 4861 C C1  . FUC G  5 .   ? 7.359   110.170 182.978 1.00 159.30 ? 224 FUC A C1  1 
HETATM 4862 C C2  . FUC G  5 .   ? 6.361   110.756 181.982 1.00 155.63 ? 224 FUC A C2  1 
HETATM 4863 C C3  . FUC G  5 .   ? 5.059   109.950 182.059 1.00 157.53 ? 224 FUC A C3  1 
HETATM 4864 C C4  . FUC G  5 .   ? 4.509   109.992 183.492 1.00 171.34 ? 224 FUC A C4  1 
HETATM 4865 C C5  . FUC G  5 .   ? 5.573   109.491 184.480 1.00 174.72 ? 224 FUC A C5  1 
HETATM 4866 C C6  . FUC G  5 .   ? 5.158   109.661 185.932 1.00 161.47 ? 224 FUC A C6  1 
HETATM 4867 O O2  . FUC G  5 .   ? 6.901   110.689 180.670 1.00 140.51 ? 224 FUC A O2  1 
HETATM 4868 O O3  . FUC G  5 .   ? 4.101   110.474 181.149 1.00 127.91 ? 224 FUC A O3  1 
HETATM 4869 O O4  . FUC G  5 .   ? 4.136   111.323 183.829 1.00 185.52 ? 224 FUC A O4  1 
HETATM 4870 O O5  . FUC G  5 .   ? 6.810   110.224 184.301 1.00 171.96 ? 224 FUC A O5  1 
HETATM 4871 C C1  . NAG H  3 .   ? 13.815  85.747  181.704 1.00 54.94  ? 242 NAG A C1  1 
HETATM 4872 C C2  . NAG H  3 .   ? 13.676  86.167  183.149 1.00 39.10  ? 242 NAG A C2  1 
HETATM 4873 C C3  . NAG H  3 .   ? 14.703  87.257  183.411 1.00 51.99  ? 242 NAG A C3  1 
HETATM 4874 C C4  . NAG H  3 .   ? 16.114  86.722  183.109 1.00 61.57  ? 242 NAG A C4  1 
HETATM 4875 C C5  . NAG H  3 .   ? 16.181  86.065  181.715 1.00 49.87  ? 242 NAG A C5  1 
HETATM 4876 C C6  . NAG H  3 .   ? 17.467  85.288  181.499 1.00 88.19  ? 242 NAG A C6  1 
HETATM 4877 C C7  . NAG H  3 .   ? 11.817  86.468  184.631 1.00 78.04  ? 242 NAG A C7  1 
HETATM 4878 C C8  . NAG H  3 .   ? 11.482  87.721  185.427 1.00 54.07  ? 242 NAG A C8  1 
HETATM 4879 N N2  . NAG H  3 .   ? 12.332  86.630  183.415 1.00 34.60  ? 242 NAG A N2  1 
HETATM 4880 O O3  . NAG H  3 .   ? 14.623  87.699  184.764 1.00 44.23  ? 242 NAG A O3  1 
HETATM 4881 O O4  . NAG H  3 .   ? 17.042  87.825  183.150 1.00 78.33  ? 242 NAG A O4  1 
HETATM 4882 O O5  . NAG H  3 .   ? 15.096  85.134  181.520 1.00 48.86  ? 242 NAG A O5  1 
HETATM 4883 O O6  . NAG H  3 .   ? 17.381  83.969  182.022 1.00 122.11 ? 242 NAG A O6  1 
HETATM 4884 O O7  . NAG H  3 .   ? 11.620  85.356  185.127 1.00 90.93  ? 242 NAG A O7  1 
HETATM 4885 C C1  . NAG I  3 .   ? 18.183  87.704  183.928 1.00 70.54  ? 243 NAG A C1  1 
HETATM 4886 C C2  . NAG I  3 .   ? 19.362  88.235  183.120 1.00 60.90  ? 243 NAG A C2  1 
HETATM 4887 C C3  . NAG I  3 .   ? 20.625  88.312  183.964 1.00 75.33  ? 243 NAG A C3  1 
HETATM 4888 C C4  . NAG I  3 .   ? 20.364  89.143  185.212 1.00 76.40  ? 243 NAG A C4  1 
HETATM 4889 C C5  . NAG I  3 .   ? 19.170  88.509  185.959 1.00 86.97  ? 243 NAG A C5  1 
HETATM 4890 C C6  . NAG I  3 .   ? 18.782  89.210  187.244 1.00 99.03  ? 243 NAG A C6  1 
HETATM 4891 C C7  . NAG I  3 .   ? 19.577  87.863  180.768 1.00 68.85  ? 243 NAG A C7  1 
HETATM 4892 C C8  . NAG I  3 .   ? 19.805  86.892  179.623 1.00 65.60  ? 243 NAG A C8  1 
HETATM 4893 N N2  . NAG I  3 .   ? 19.591  87.363  181.993 1.00 68.97  ? 243 NAG A N2  1 
HETATM 4894 O O3  . NAG I  3 .   ? 21.674  88.894  183.208 1.00 75.78  ? 243 NAG A O3  1 
HETATM 4895 O O4  . NAG I  3 .   ? 21.549  89.126  186.040 1.00 86.52  ? 243 NAG A O4  1 
HETATM 4896 O O5  . NAG I  3 .   ? 17.998  88.494  185.115 1.00 60.67  ? 243 NAG A O5  1 
HETATM 4897 O O6  . NAG I  3 .   ? 17.997  88.358  188.067 1.00 120.14 ? 243 NAG A O6  1 
HETATM 4898 O O7  . NAG I  3 .   ? 19.393  89.057  180.540 1.00 93.97  ? 243 NAG A O7  1 
HETATM 4899 C C1  . MAN J  4 .   ? 22.078  90.350  186.412 1.00 78.10  ? 244 MAN A C1  1 
HETATM 4900 C C2  . MAN J  4 .   ? 22.728  90.214  187.783 1.00 89.36  ? 244 MAN A C2  1 
HETATM 4901 C C3  . MAN J  4 .   ? 23.402  91.540  188.186 1.00 108.09 ? 244 MAN A C3  1 
HETATM 4902 C C4  . MAN J  4 .   ? 24.351  92.024  187.075 1.00 117.93 ? 244 MAN A C4  1 
HETATM 4903 C C5  . MAN J  4 .   ? 23.633  92.031  185.713 1.00 85.43  ? 244 MAN A C5  1 
HETATM 4904 C C6  . MAN J  4 .   ? 24.504  92.436  184.513 1.00 70.38  ? 244 MAN A C6  1 
HETATM 4905 O O2  . MAN J  4 .   ? 23.684  89.161  187.744 1.00 80.51  ? 244 MAN A O2  1 
HETATM 4906 O O3  . MAN J  4 .   ? 24.150  91.370  189.413 1.00 124.24 ? 244 MAN A O3  1 
HETATM 4907 O O4  . MAN J  4 .   ? 24.813  93.333  187.385 1.00 145.24 ? 244 MAN A O4  1 
HETATM 4908 O O5  . MAN J  4 .   ? 23.067  90.728  185.441 1.00 75.53  ? 244 MAN A O5  1 
HETATM 4909 O O6  . MAN J  4 .   ? 25.641  91.560  184.352 1.00 75.46  ? 244 MAN A O6  1 
HETATM 4910 C C1  . MAN K  4 .   ? 23.427  91.459  190.614 1.00 132.50 ? 245 MAN A C1  1 
HETATM 4911 C C2  . MAN K  4 .   ? 24.400  91.435  191.803 1.00 129.98 ? 245 MAN A C2  1 
HETATM 4912 C C3  . MAN K  4 .   ? 25.063  90.050  191.951 1.00 123.14 ? 245 MAN A C3  1 
HETATM 4913 C C4  . MAN K  4 .   ? 24.043  88.898  191.885 1.00 124.39 ? 245 MAN A C4  1 
HETATM 4914 C C5  . MAN K  4 .   ? 23.061  89.079  190.719 1.00 135.45 ? 245 MAN A C5  1 
HETATM 4915 C C6  . MAN K  4 .   ? 21.918  88.081  190.747 1.00 129.95 ? 245 MAN A C6  1 
HETATM 4916 O O2  . MAN K  4 .   ? 23.715  91.778  193.000 1.00 113.18 ? 245 MAN A O2  1 
HETATM 4917 O O3  . MAN K  4 .   ? 25.754  89.986  193.192 1.00 100.12 ? 245 MAN A O3  1 
HETATM 4918 O O4  . MAN K  4 .   ? 24.736  87.669  191.714 1.00 74.36  ? 245 MAN A O4  1 
HETATM 4919 O O5  . MAN K  4 .   ? 22.479  90.403  190.751 1.00 143.86 ? 245 MAN A O5  1 
HETATM 4920 O O6  . MAN K  4 .   ? 20.800  88.600  191.453 1.00 138.19 ? 245 MAN A O6  1 
HETATM 4921 C C1  . MAN L  4 .   ? 26.745  92.247  183.813 1.00 88.17  ? 246 MAN A C1  1 
HETATM 4922 C C2  . MAN L  4 .   ? 27.492  91.359  182.813 1.00 94.58  ? 246 MAN A C2  1 
HETATM 4923 C C3  . MAN L  4 .   ? 28.223  90.227  183.536 1.00 100.23 ? 246 MAN A C3  1 
HETATM 4924 C C4  . MAN L  4 .   ? 29.139  90.790  184.628 1.00 98.20  ? 246 MAN A C4  1 
HETATM 4925 C C5  . MAN L  4 .   ? 28.338  91.709  185.566 1.00 100.39 ? 246 MAN A C5  1 
HETATM 4926 C C6  . MAN L  4 .   ? 29.187  92.408  186.620 1.00 106.59 ? 246 MAN A C6  1 
HETATM 4927 O O2  . MAN L  4 .   ? 28.434  92.147  182.107 1.00 85.54  ? 246 MAN A O2  1 
HETATM 4928 O O3  . MAN L  4 .   ? 28.995  89.485  182.603 1.00 114.57 ? 246 MAN A O3  1 
HETATM 4929 O O4  . MAN L  4 .   ? 29.701  89.712  185.368 1.00 69.19  ? 246 MAN A O4  1 
HETATM 4930 O O5  . MAN L  4 .   ? 27.651  92.738  184.808 1.00 80.38  ? 246 MAN A O5  1 
HETATM 4931 O O6  . MAN L  4 .   ? 30.118  93.314  186.037 1.00 131.02 ? 246 MAN A O6  1 
HETATM 4932 C C1  . NAG M  3 .   ? 28.056  85.901  166.422 1.00 122.76 ? 366 NAG A C1  1 
HETATM 4933 C C2  . NAG M  3 .   ? 27.711  84.597  167.109 1.00 140.44 ? 366 NAG A C2  1 
HETATM 4934 C C3  . NAG M  3 .   ? 28.966  83.736  167.196 1.00 146.65 ? 366 NAG A C3  1 
HETATM 4935 C C4  . NAG M  3 .   ? 29.556  83.514  165.790 1.00 147.26 ? 366 NAG A C4  1 
HETATM 4936 C C5  . NAG M  3 .   ? 29.712  84.852  165.035 1.00 129.41 ? 366 NAG A C5  1 
HETATM 4937 C C6  . NAG M  3 .   ? 30.057  84.664  163.560 1.00 132.83 ? 366 NAG A C6  1 
HETATM 4938 C C7  . NAG M  3 .   ? 26.706  83.827  169.147 1.00 173.37 ? 366 NAG A C7  1 
HETATM 4939 C C8  . NAG M  3 .   ? 25.255  83.418  168.931 1.00 169.66 ? 366 NAG A C8  1 
HETATM 4940 N N2  . NAG M  3 .   ? 27.168  84.844  168.429 1.00 152.93 ? 366 NAG A N2  1 
HETATM 4941 O O3  . NAG M  3 .   ? 28.630  82.485  167.776 1.00 170.21 ? 366 NAG A O3  1 
HETATM 4942 O O4  . NAG M  3 .   ? 30.849  82.871  165.890 1.00 170.74 ? 366 NAG A O4  1 
HETATM 4943 O O5  . NAG M  3 .   ? 28.487  85.621  165.083 1.00 128.82 ? 366 NAG A O5  1 
HETATM 4944 O O6  . NAG M  3 .   ? 29.035  83.880  162.905 1.00 161.28 ? 366 NAG A O6  1 
HETATM 4945 O O7  . NAG M  3 .   ? 27.404  83.211  169.952 1.00 186.44 ? 366 NAG A O7  1 
HETATM 4946 C C1  . NAG N  3 .   ? 30.856  81.509  166.161 1.00 177.82 ? 367 NAG A C1  1 
HETATM 4947 C C2  . NAG N  3 .   ? 32.125  80.858  165.606 1.00 175.72 ? 367 NAG A C2  1 
HETATM 4948 C C3  . NAG N  3 .   ? 32.134  79.368  165.981 1.00 176.53 ? 367 NAG A C3  1 
HETATM 4949 C C4  . NAG N  3 .   ? 31.925  79.180  167.489 1.00 179.21 ? 367 NAG A C4  1 
HETATM 4950 C C5  . NAG N  3 .   ? 30.683  79.946  167.949 1.00 177.43 ? 367 NAG A C5  1 
HETATM 4951 C C6  . NAG N  3 .   ? 30.463  79.898  169.448 1.00 175.26 ? 367 NAG A C6  1 
HETATM 4952 C C7  . NAG N  3 .   ? 33.110  81.749  163.590 1.00 180.46 ? 367 NAG A C7  1 
HETATM 4953 C C8  . NAG N  3 .   ? 33.703  81.229  162.288 1.00 175.39 ? 367 NAG A C8  1 
HETATM 4954 N N2  . NAG N  3 .   ? 32.162  81.012  164.163 1.00 179.95 ? 367 NAG A N2  1 
HETATM 4955 O O3  . NAG N  3 .   ? 33.372  78.785  165.603 1.00 182.62 ? 367 NAG A O3  1 
HETATM 4956 O O4  . NAG N  3 .   ? 31.768  77.799  167.780 1.00 179.92 ? 367 NAG A O4  1 
HETATM 4957 O O5  . NAG N  3 .   ? 30.802  81.334  167.581 1.00 183.40 ? 367 NAG A O5  1 
HETATM 4958 O O6  . NAG N  3 .   ? 29.081  79.771  169.756 1.00 163.49 ? 367 NAG A O6  1 
HETATM 4959 O O7  . NAG N  3 .   ? 33.517  82.807  164.072 1.00 170.62 ? 367 NAG A O7  1 
HETATM 4960 C C1  . FUC O  5 .   ? 29.475  83.367  161.677 1.00 174.40 ? 369 FUC A C1  1 
HETATM 4961 C C2  . FUC O  5 .   ? 28.873  81.974  161.447 1.00 174.53 ? 369 FUC A C2  1 
HETATM 4962 C C3  . FUC O  5 .   ? 27.373  82.084  161.176 1.00 176.12 ? 369 FUC A C3  1 
HETATM 4963 C C4  . FUC O  5 .   ? 27.145  83.010  159.982 1.00 184.01 ? 369 FUC A C4  1 
HETATM 4964 C C5  . FUC O  5 .   ? 27.765  84.381  160.283 1.00 183.23 ? 369 FUC A C5  1 
HETATM 4965 C C6  . FUC O  5 .   ? 27.641  85.357  159.126 1.00 164.35 ? 369 FUC A C6  1 
HETATM 4966 O O2  . FUC O  5 .   ? 29.095  81.158  162.587 1.00 163.52 ? 369 FUC A O2  1 
HETATM 4967 O O3  . FUC O  5 .   ? 26.837  80.797  160.906 1.00 147.74 ? 369 FUC A O3  1 
HETATM 4968 O O4  . FUC O  5 .   ? 27.752  82.452  158.825 1.00 197.80 ? 369 FUC A O4  1 
HETATM 4969 O O5  . FUC O  5 .   ? 29.175  84.233  160.576 1.00 184.18 ? 369 FUC A O5  1 
HETATM 4970 S S   . SO4 P  6 .   ? 21.641  101.569 151.307 1.00 173.70 ? 203 SO4 A S   1 
HETATM 4971 O O1  . SO4 P  6 .   ? 22.530  100.415 151.659 1.00 175.67 ? 203 SO4 A O1  1 
HETATM 4972 O O2  . SO4 P  6 .   ? 21.490  102.482 152.472 1.00 179.28 ? 203 SO4 A O2  1 
HETATM 4973 O O3  . SO4 P  6 .   ? 22.255  102.282 150.149 1.00 174.63 ? 203 SO4 A O3  1 
HETATM 4974 O O4  . SO4 P  6 .   ? 20.304  101.049 150.949 1.00 167.06 ? 203 SO4 A O4  1 
HETATM 4975 C C1  . CPS Q  7 .   ? 26.312  116.112 182.219 1.00 23.80  ? 370 CPS A C1  1 
HETATM 4976 C C2  . CPS Q  7 .   ? 25.430  116.494 183.392 1.00 26.94  ? 370 CPS A C2  1 
HETATM 4977 C C3  . CPS Q  7 .   ? 25.569  114.197 184.531 1.00 24.01  ? 370 CPS A C3  1 
HETATM 4978 C C4  . CPS Q  7 .   ? 25.066  112.803 185.246 1.00 40.20  ? 370 CPS A C4  1 
HETATM 4979 C C5  . CPS Q  7 .   ? 24.092  113.131 186.307 1.00 39.95  ? 370 CPS A C5  1 
HETATM 4980 C C6  . CPS Q  7 .   ? 23.154  114.241 185.856 1.00 37.38  ? 370 CPS A C6  1 
HETATM 4981 C C7  . CPS Q  7 .   ? 22.219  114.521 186.964 1.00 41.69  ? 370 CPS A C7  1 
HETATM 4982 C C8  . CPS Q  7 .   ? 22.186  113.112 187.776 1.00 39.76  ? 370 CPS A C8  1 
HETATM 4983 C C9  . CPS Q  7 .   ? 23.212  112.183 186.927 1.00 20.12  ? 370 CPS A C9  1 
HETATM 4984 C C10 . CPS Q  7 .   ? 25.033  113.895 187.520 1.00 7.69   ? 370 CPS A C10 1 
HETATM 4985 C C11 . CPS Q  7 .   ? 26.201  117.156 184.612 1.00 23.29  ? 370 CPS A C11 1 
HETATM 4986 C C12 . CPS Q  7 .   ? 25.595  115.700 180.948 1.00 68.58  ? 370 CPS A C12 1 
HETATM 4987 C C13 . CPS Q  7 .   ? 24.630  116.690 180.447 1.00 56.65  ? 370 CPS A C13 1 
HETATM 4988 C C14 . CPS Q  7 .   ? 23.589  117.028 181.573 1.00 46.75  ? 370 CPS A C14 1 
HETATM 4989 C C15 . CPS Q  7 .   ? 24.383  117.491 182.865 1.00 29.85  ? 370 CPS A C15 1 
HETATM 4990 C C16 . CPS Q  7 .   ? 23.421  117.851 183.910 1.00 37.29  ? 370 CPS A C16 1 
HETATM 4991 C C17 . CPS Q  7 .   ? 22.681  116.741 184.654 1.00 35.66  ? 370 CPS A C17 1 
HETATM 4992 C C18 . CPS Q  7 .   ? 23.637  115.556 185.273 1.00 14.60  ? 370 CPS A C18 1 
HETATM 4993 C C19 . CPS Q  7 .   ? 24.660  115.277 183.985 1.00 18.03  ? 370 CPS A C19 1 
HETATM 4994 C C20 . CPS Q  7 .   ? 23.634  111.029 187.910 1.00 21.70  ? 370 CPS A C20 1 
HETATM 4995 C C21 . CPS Q  7 .   ? 24.712  110.080 187.465 1.00 49.00  ? 370 CPS A C21 1 
HETATM 4996 C C22 . CPS Q  7 .   ? 22.307  110.241 188.314 1.00 55.33  ? 370 CPS A C22 1 
HETATM 4997 C C23 . CPS Q  7 .   ? 22.401  109.119 189.237 1.00 31.83  ? 370 CPS A C23 1 
HETATM 4998 O O2  . CPS Q  7 .   ? 23.891  116.247 179.167 1.00 53.88  ? 370 CPS A O2  1 
HETATM 4999 O O3  . CPS Q  7 .   ? 21.848  116.073 183.892 1.00 54.62  ? 370 CPS A O3  1 
HETATM 5000 O O4  . CPS Q  7 .   ? 24.411  112.252 184.392 1.00 65.78  ? 370 CPS A O4  1 
HETATM 5001 C C1  . CPS R  7 .   ? 30.571  120.398 183.552 1.00 42.60  ? 371 CPS A C1  1 
HETATM 5002 C C2  . CPS R  7 .   ? 29.242  120.684 182.888 1.00 56.60  ? 371 CPS A C2  1 
HETATM 5003 C C3  . CPS R  7 .   ? 29.937  119.971 180.493 1.00 43.86  ? 371 CPS A C3  1 
HETATM 5004 C C4  . CPS R  7 .   ? 30.147  120.094 178.872 1.00 75.20  ? 371 CPS A C4  1 
HETATM 5005 C C5  . CPS R  7 .   ? 28.897  120.605 178.213 1.00 69.77  ? 371 CPS A C5  1 
HETATM 5006 C C6  . CPS R  7 .   ? 28.229  121.675 179.021 1.00 74.01  ? 371 CPS A C6  1 
HETATM 5007 C C7  . CPS R  7 .   ? 26.980  122.039 178.248 1.00 78.18  ? 371 CPS A C7  1 
HETATM 5008 C C8  . CPS R  7 .   ? 27.381  121.634 176.691 1.00 74.21  ? 371 CPS A C8  1 
HETATM 5009 C C9  . CPS R  7 .   ? 28.901  121.114 176.903 1.00 69.12  ? 371 CPS A C9  1 
HETATM 5010 C C10 . CPS R  7 .   ? 27.749  119.285 178.280 1.00 21.92  ? 371 CPS A C10 1 
HETATM 5011 C C11 . CPS R  7 .   ? 28.267  119.446 182.992 1.00 40.97  ? 371 CPS A C11 1 
HETATM 5012 C C12 . CPS R  7 .   ? 31.535  121.559 183.535 1.00 72.34  ? 371 CPS A C12 1 
HETATM 5013 C C13 . CPS R  7 .   ? 30.993  122.776 184.198 1.00 73.17  ? 371 CPS A C13 1 
HETATM 5014 C C14 . CPS R  7 .   ? 29.633  123.185 183.544 1.00 80.29  ? 371 CPS A C14 1 
HETATM 5015 C C15 . CPS R  7 .   ? 28.656  121.927 183.565 1.00 69.57  ? 371 CPS A C15 1 
HETATM 5016 C C16 . CPS R  7 .   ? 27.376  122.335 182.971 1.00 80.60  ? 371 CPS A C16 1 
HETATM 5017 C C17 . CPS R  7 .   ? 27.284  122.605 181.471 1.00 77.93  ? 371 CPS A C17 1 
HETATM 5018 C C18 . CPS R  7 .   ? 27.951  121.457 180.505 1.00 58.23  ? 371 CPS A C18 1 
HETATM 5019 C C19 . CPS R  7 .   ? 29.357  121.047 181.357 1.00 54.75  ? 371 CPS A C19 1 
HETATM 5020 C C20 . CPS R  7 .   ? 29.354  120.263 175.642 1.00 74.79  ? 371 CPS A C20 1 
HETATM 5021 C C21 . CPS R  7 .   ? 30.739  119.670 175.679 1.00 124.86 ? 371 CPS A C21 1 
HETATM 5022 C C22 . CPS R  7 .   ? 29.222  121.128 174.334 1.00 72.31  ? 371 CPS A C22 1 
HETATM 5023 C C23 . CPS R  7 .   ? 29.659  120.461 173.118 1.00 50.64  ? 371 CPS A C23 1 
HETATM 5024 C C24 . CPS R  7 .   ? 30.764  121.056 172.497 1.00 67.93  ? 371 CPS A C24 1 
HETATM 5025 C C25 . CPS R  7 .   ? 32.445  120.862 170.437 1.00 141.82 ? 371 CPS A C25 1 
HETATM 5026 C C26 . CPS R  7 .   ? 33.914  120.983 171.018 1.00 151.82 ? 371 CPS A C26 1 
HETATM 5027 C C27 . CPS R  7 .   ? 34.656  119.945 171.768 1.00 142.43 ? 371 CPS A C27 1 
HETATM 5028 C C28 . CPS R  7 .   ? 33.451  118.618 173.454 1.00 89.97  ? 371 CPS A C28 1 
HETATM 5029 C C29 . CPS R  7 .   ? 33.480  117.862 171.121 1.00 137.77 ? 371 CPS A C29 1 
HETATM 5030 C C30 . CPS R  7 .   ? 35.508  117.674 172.417 1.00 118.74 ? 371 CPS A C30 1 
HETATM 5031 C C31 . CPS R  7 .   ? 35.546  116.292 172.907 1.00 133.79 ? 371 CPS A C31 1 
HETATM 5032 C C32 . CPS R  7 .   ? 36.956  115.688 172.994 1.00 157.41 ? 371 CPS A C32 1 
HETATM 5033 N N1  . CPS R  7 .   ? 31.167  120.410 171.415 1.00 100.47 ? 371 CPS A N1  1 
HETATM 5034 N N2  . CPS R  7 .   ? 34.247  118.529 172.191 1.00 118.44 ? 371 CPS A N2  1 
HETATM 5035 O O1  . CPS R  7 .   ? 31.346  122.079 172.856 1.00 87.21  ? 371 CPS A O1  1 
HETATM 5036 O O2  . CPS R  7 .   ? 31.922  124.006 184.181 1.00 94.33  ? 371 CPS A O2  1 
HETATM 5037 O O3  . CPS R  7 .   ? 27.912  123.713 181.098 1.00 74.58  ? 371 CPS A O3  1 
HETATM 5038 O O4  . CPS R  7 .   ? 30.938  121.017 178.775 1.00 67.51  ? 371 CPS A O4  1 
HETATM 5039 O O2S . CPS R  7 .   ? 36.237  113.444 173.110 1.00 142.40 ? 371 CPS A O2S 1 
HETATM 5040 O O3S . CPS R  7 .   ? 36.839  114.348 171.019 1.00 161.81 ? 371 CPS A O3S 1 
HETATM 5041 O O1S . CPS R  7 .   ? 38.477  113.949 172.653 1.00 156.35 ? 371 CPS A O1S 1 
HETATM 5042 S S   . CPS R  7 .   ? 37.058  114.252 172.445 1.00 159.51 ? 371 CPS A S   1 
HETATM 5043 C C1  . NAG S  3 .   ? 43.351  106.499 163.692 1.00 49.31  ? 694 NAG B C1  1 
HETATM 5044 C C2  . NAG S  3 .   ? 43.324  107.210 165.050 1.00 68.81  ? 694 NAG B C2  1 
HETATM 5045 C C3  . NAG S  3 .   ? 44.367  108.326 165.119 1.00 60.63  ? 694 NAG B C3  1 
HETATM 5046 C C4  . NAG S  3 .   ? 45.745  107.860 164.653 1.00 57.66  ? 694 NAG B C4  1 
HETATM 5047 C C5  . NAG S  3 .   ? 45.633  107.121 163.324 1.00 56.75  ? 694 NAG B C5  1 
HETATM 5048 C C6  . NAG S  3 .   ? 46.944  106.492 162.896 1.00 98.22  ? 694 NAG B C6  1 
HETATM 5049 C C7  . NAG S  3 .   ? 41.107  107.072 166.005 1.00 53.65  ? 694 NAG B C7  1 
HETATM 5050 C C8  . NAG S  3 .   ? 39.876  107.819 166.449 1.00 34.96  ? 694 NAG B C8  1 
HETATM 5051 N N2  . NAG S  3 .   ? 42.009  107.764 165.311 1.00 54.16  ? 694 NAG B N2  1 
HETATM 5052 O O3  . NAG S  3 .   ? 44.468  108.774 166.459 1.00 89.78  ? 694 NAG B O3  1 
HETATM 5053 O O4  . NAG S  3 .   ? 46.595  109.009 164.472 1.00 78.58  ? 694 NAG B O4  1 
HETATM 5054 O O5  . NAG S  3 .   ? 44.683  106.052 163.418 1.00 43.08  ? 694 NAG B O5  1 
HETATM 5055 O O6  . NAG S  3 .   ? 46.718  105.307 162.144 1.00 122.12 ? 694 NAG B O6  1 
HETATM 5056 O O7  . NAG S  3 .   ? 41.224  105.878 166.283 1.00 65.23  ? 694 NAG B O7  1 
HETATM 5057 C C1  . NAG T  3 .   ? 47.667  109.149 165.334 1.00 92.07  ? 695 NAG B C1  1 
HETATM 5058 C C2  . NAG T  3 .   ? 48.912  109.587 164.537 1.00 88.03  ? 695 NAG B C2  1 
HETATM 5059 C C3  . NAG T  3 .   ? 50.062  110.046 165.456 1.00 85.20  ? 695 NAG B C3  1 
HETATM 5060 C C4  . NAG T  3 .   ? 49.530  111.028 166.523 1.00 88.13  ? 695 NAG B C4  1 
HETATM 5061 C C5  . NAG T  3 .   ? 48.357  110.377 167.236 1.00 97.88  ? 695 NAG B C5  1 
HETATM 5062 C C6  . NAG T  3 .   ? 47.797  111.249 168.331 1.00 116.69 ? 695 NAG B C6  1 
HETATM 5063 C C7  . NAG T  3 .   ? 49.909  108.731 162.516 1.00 109.91 ? 695 NAG B C7  1 
HETATM 5064 C C8  . NAG T  3 .   ? 48.960  108.985 161.349 1.00 70.10  ? 695 NAG B C8  1 
HETATM 5065 N N2  . NAG T  3 .   ? 49.357  108.488 163.700 1.00 102.28 ? 695 NAG B N2  1 
HETATM 5066 O O3  . NAG T  3 .   ? 51.051  110.680 164.656 1.00 95.41  ? 695 NAG B O3  1 
HETATM 5067 O O4  . NAG T  3 .   ? 50.546  111.348 167.496 1.00 87.01  ? 695 NAG B O4  1 
HETATM 5068 O O5  . NAG T  3 .   ? 47.306  110.143 166.294 1.00 85.65  ? 695 NAG B O5  1 
HETATM 5069 O O6  . NAG T  3 .   ? 46.422  110.979 168.540 1.00 96.63  ? 695 NAG B O6  1 
HETATM 5070 O O7  . NAG T  3 .   ? 51.131  108.754 162.340 1.00 119.06 ? 695 NAG B O7  1 
HETATM 5071 C C1  . MAN U  4 .   ? 51.371  112.429 167.246 1.00 84.81  ? 696 MAN B C1  1 
HETATM 5072 C C2  . MAN U  4 .   ? 51.896  112.953 168.555 1.00 95.79  ? 696 MAN B C2  1 
HETATM 5073 C C3  . MAN U  4 .   ? 52.858  114.113 168.311 1.00 115.39 ? 696 MAN B C3  1 
HETATM 5074 C C4  . MAN U  4 .   ? 53.939  113.688 167.318 1.00 122.89 ? 696 MAN B C4  1 
HETATM 5075 C C5  . MAN U  4 .   ? 53.376  112.998 166.077 1.00 119.65 ? 696 MAN B C5  1 
HETATM 5076 C C6  . MAN U  4 .   ? 54.495  112.437 165.214 1.00 134.11 ? 696 MAN B C6  1 
HETATM 5077 O O2  . MAN U  4 .   ? 52.572  111.906 169.203 1.00 84.87  ? 696 MAN B O2  1 
HETATM 5078 O O3  . MAN U  4 .   ? 53.494  114.526 169.543 1.00 139.22 ? 696 MAN B O3  1 
HETATM 5079 O O4  . MAN U  4 .   ? 54.644  114.828 166.907 1.00 131.70 ? 696 MAN B O4  1 
HETATM 5080 O O5  . MAN U  4 .   ? 52.478  111.940 166.480 1.00 108.97 ? 696 MAN B O5  1 
HETATM 5081 O O6  . MAN U  4 .   ? 54.271  111.063 164.855 1.00 161.14 ? 696 MAN B O6  1 
HETATM 5082 C C1  . MAN V  4 .   ? 55.439  110.276 165.023 1.00 160.64 ? 697 MAN B C1  1 
HETATM 5083 C C2  . MAN V  4 .   ? 56.117  110.375 166.417 1.00 160.10 ? 697 MAN B C2  1 
HETATM 5084 C C3  . MAN V  4 .   ? 56.937  111.658 166.557 1.00 151.25 ? 697 MAN B C3  1 
HETATM 5085 C C4  . MAN V  4 .   ? 57.782  111.951 165.323 1.00 152.80 ? 697 MAN B C4  1 
HETATM 5086 C C5  . MAN V  4 .   ? 57.018  111.797 164.042 1.00 157.75 ? 697 MAN B C5  1 
HETATM 5087 C C6  . MAN V  4 .   ? 57.919  111.862 162.860 1.00 172.24 ? 697 MAN B C6  1 
HETATM 5088 O O2  . MAN V  4 .   ? 57.047  109.270 166.517 1.00 160.57 ? 697 MAN B O2  1 
HETATM 5089 O O3  . MAN V  4 .   ? 57.844  111.476 167.629 1.00 123.89 ? 697 MAN B O3  1 
HETATM 5090 O O4  . MAN V  4 .   ? 58.361  113.247 165.387 1.00 150.49 ? 697 MAN B O4  1 
HETATM 5091 O O5  . MAN V  4 .   ? 56.422  110.499 164.016 1.00 160.35 ? 697 MAN B O5  1 
HETATM 5092 O O6  . MAN V  4 .   ? 57.262  111.446 161.673 1.00 183.38 ? 697 MAN B O6  1 
HETATM 5093 C C1  . MAN W  4 .   ? 52.693  115.215 170.457 1.00 148.42 ? 698 MAN B C1  1 
HETATM 5094 C C2  . MAN W  4 .   ? 53.464  116.407 171.056 1.00 154.88 ? 698 MAN B C2  1 
HETATM 5095 C C3  . MAN W  4 .   ? 54.563  115.916 172.016 1.00 152.88 ? 698 MAN B C3  1 
HETATM 5096 C C4  . MAN W  4 .   ? 53.964  114.962 173.060 1.00 148.07 ? 698 MAN B C4  1 
HETATM 5097 C C5  . MAN W  4 .   ? 53.231  113.819 172.351 1.00 147.97 ? 698 MAN B C5  1 
HETATM 5098 C C6  . MAN W  4 .   ? 52.553  112.858 173.311 1.00 147.16 ? 698 MAN B C6  1 
HETATM 5099 O O2  . MAN W  4 .   ? 52.557  117.261 171.748 1.00 144.94 ? 698 MAN B O2  1 
HETATM 5100 O O3  . MAN W  4 .   ? 55.188  117.024 172.657 1.00 142.67 ? 698 MAN B O3  1 
HETATM 5101 O O4  . MAN W  4 .   ? 54.992  114.436 173.885 1.00 133.27 ? 698 MAN B O4  1 
HETATM 5102 O O5  . MAN W  4 .   ? 52.208  114.363 171.491 1.00 146.65 ? 698 MAN B O5  1 
HETATM 5103 O O6  . MAN W  4 .   ? 51.158  112.769 173.056 1.00 151.10 ? 698 MAN B O6  1 
HETATM 5104 C C1  . MAN X  4 .   ? 56.966  108.431 167.643 1.00 165.46 ? 699 MAN B C1  1 
HETATM 5105 C C2  . MAN X  4 .   ? 58.038  108.848 168.676 1.00 168.68 ? 699 MAN B C2  1 
HETATM 5106 C C3  . MAN X  4 .   ? 59.464  108.512 168.172 1.00 171.76 ? 699 MAN B C3  1 
HETATM 5107 C C4  . MAN X  4 .   ? 59.578  107.043 167.743 1.00 181.49 ? 699 MAN B C4  1 
HETATM 5108 C C5  . MAN X  4 .   ? 58.427  106.645 166.780 1.00 185.05 ? 699 MAN B C5  1 
HETATM 5109 C C6  . MAN X  4 .   ? 58.378  105.138 166.486 1.00 189.78 ? 699 MAN B C6  1 
HETATM 5110 O O2  . MAN X  4 .   ? 57.797  108.220 169.928 1.00 155.59 ? 699 MAN B O2  1 
HETATM 5111 O O3  . MAN X  4 .   ? 60.421  108.765 169.197 1.00 151.03 ? 699 MAN B O3  1 
HETATM 5112 O O4  . MAN X  4 .   ? 60.851  106.815 167.127 1.00 175.07 ? 699 MAN B O4  1 
HETATM 5113 O O5  . MAN X  4 .   ? 57.110  107.042 167.306 1.00 172.25 ? 699 MAN B O5  1 
HETATM 5114 O O6  . MAN X  4 .   ? 58.826  104.348 167.584 1.00 197.35 ? 699 MAN B O6  1 
HETATM 5115 S S   . SO4 Y  6 .   ? 26.461  117.594 160.481 1.00 172.14 ? 201 SO4 B S   1 
HETATM 5116 O O1  . SO4 Y  6 .   ? 26.028  117.364 161.888 1.00 164.88 ? 201 SO4 B O1  1 
HETATM 5117 O O2  . SO4 Y  6 .   ? 25.645  118.674 159.871 1.00 169.79 ? 201 SO4 B O2  1 
HETATM 5118 O O3  . SO4 Y  6 .   ? 27.889  117.990 160.442 1.00 160.93 ? 201 SO4 B O3  1 
HETATM 5119 O O4  . SO4 Y  6 .   ? 26.264  116.346 159.701 1.00 168.34 ? 201 SO4 B O4  1 
HETATM 5120 S S   . SO4 Z  6 .   ? 30.691  115.815 152.464 1.00 87.48  ? 202 SO4 B S   1 
HETATM 5121 O O1  . SO4 Z  6 .   ? 31.425  115.760 153.735 1.00 77.10  ? 202 SO4 B O1  1 
HETATM 5122 O O2  . SO4 Z  6 .   ? 30.165  117.185 152.282 1.00 101.60 ? 202 SO4 B O2  1 
HETATM 5123 O O3  . SO4 Z  6 .   ? 31.591  115.536 151.339 1.00 108.87 ? 202 SO4 B O3  1 
HETATM 5124 O O4  . SO4 Z  6 .   ? 29.608  114.799 152.483 1.00 75.31  ? 202 SO4 B O4  1 
HETATM 5125 S S   . SO4 AA 6 .   ? 63.588  107.320 177.755 1.00 133.88 ? 204 SO4 B S   1 
HETATM 5126 O O1  . SO4 AA 6 .   ? 64.167  105.957 177.946 1.00 128.24 ? 204 SO4 B O1  1 
HETATM 5127 O O2  . SO4 AA 6 .   ? 63.018  107.748 179.075 1.00 109.82 ? 204 SO4 B O2  1 
HETATM 5128 O O3  . SO4 AA 6 .   ? 64.623  108.285 177.316 1.00 134.05 ? 204 SO4 B O3  1 
HETATM 5129 O O4  . SO4 AA 6 .   ? 62.568  107.276 176.668 1.00 124.23 ? 204 SO4 B O4  1 
HETATM 5130 C C1  . NAG BA 3 .   ? 45.181  116.572 187.768 1.00 64.84  ? 694 NAG D C1  1 
HETATM 5131 C C2  . NAG BA 3 .   ? 45.182  115.814 186.435 1.00 68.77  ? 694 NAG D C2  1 
HETATM 5132 C C3  . NAG BA 3 .   ? 45.516  114.334 186.657 1.00 76.08  ? 694 NAG D C3  1 
HETATM 5133 C C4  . NAG BA 3 .   ? 46.845  114.203 187.408 1.00 96.94  ? 694 NAG D C4  1 
HETATM 5134 C C5  . NAG BA 3 .   ? 46.776  115.015 188.712 1.00 96.48  ? 694 NAG D C5  1 
HETATM 5135 C C6  . NAG BA 3 .   ? 48.102  115.016 189.457 1.00 117.85 ? 694 NAG D C6  1 
HETATM 5136 C C7  . NAG BA 3 .   ? 43.803  116.134 184.485 1.00 83.76  ? 694 NAG D C7  1 
HETATM 5137 C C8  . NAG BA 3 .   ? 43.455  117.540 184.026 1.00 76.78  ? 694 NAG D C8  1 
HETATM 5138 N N2  . NAG BA 3 .   ? 43.887  115.931 185.794 1.00 77.58  ? 694 NAG D N2  1 
HETATM 5139 O O3  . NAG BA 3 .   ? 45.596  113.666 185.403 1.00 75.16  ? 694 NAG D O3  1 
HETATM 5140 O O4  . NAG BA 3 .   ? 47.134  112.810 187.695 1.00 125.60 ? 694 NAG D O4  1 
HETATM 5141 O O5  . NAG BA 3 .   ? 46.445  116.403 188.432 1.00 81.57  ? 694 NAG D O5  1 
HETATM 5142 O O6  . NAG BA 3 .   ? 49.101  115.734 188.742 1.00 143.07 ? 694 NAG D O6  1 
HETATM 5143 O O7  . NAG BA 3 .   ? 43.995  115.243 183.656 1.00 84.20  ? 694 NAG D O7  1 
HETATM 5144 C C1  . NAG CA 3 .   ? 48.197  112.221 187.004 1.00 153.06 ? 695 NAG D C1  1 
HETATM 5145 C C2  . NAG CA 3 .   ? 49.047  111.359 187.959 1.00 161.69 ? 695 NAG D C2  1 
HETATM 5146 C C3  . NAG CA 3 .   ? 50.146  110.631 187.168 1.00 160.68 ? 695 NAG D C3  1 
HETATM 5147 C C4  . NAG CA 3 .   ? 49.521  109.804 186.043 1.00 158.75 ? 695 NAG D C4  1 
HETATM 5148 C C5  . NAG CA 3 .   ? 48.678  110.741 185.160 1.00 163.45 ? 695 NAG D C5  1 
HETATM 5149 C C6  . NAG CA 3 .   ? 47.969  110.032 184.022 1.00 162.55 ? 695 NAG D C6  1 
HETATM 5150 C C7  . NAG CA 3 .   ? 49.835  111.675 190.216 1.00 160.76 ? 695 NAG D C7  1 
HETATM 5151 C C8  . NAG CA 3 .   ? 48.769  111.953 191.265 1.00 139.41 ? 695 NAG D C8  1 
HETATM 5152 N N2  . NAG CA 3 .   ? 49.643  112.180 188.999 1.00 167.85 ? 695 NAG D N2  1 
HETATM 5153 O O3  . NAG CA 3 .   ? 50.894  109.785 188.028 1.00 158.79 ? 695 NAG D O3  1 
HETATM 5154 O O4  . NAG CA 3 .   ? 50.565  109.173 185.262 1.00 159.31 ? 695 NAG D O4  1 
HETATM 5155 O O5  . NAG CA 3 .   ? 47.654  111.397 185.953 1.00 154.54 ? 695 NAG D O5  1 
HETATM 5156 O O6  . NAG CA 3 .   ? 47.105  110.920 183.327 1.00 158.35 ? 695 NAG D O6  1 
HETATM 5157 O O7  . NAG CA 3 .   ? 50.822  111.000 190.511 1.00 163.41 ? 695 NAG D O7  1 
HETATM 5158 C C1  . MAN DA 4 .   ? 50.684  107.790 185.360 1.00 161.31 ? 696 MAN D C1  1 
HETATM 5159 C C2  . MAN DA 4 .   ? 51.539  107.258 184.202 1.00 174.68 ? 696 MAN D C2  1 
HETATM 5160 C C3  . MAN DA 4 .   ? 51.725  105.743 184.350 1.00 170.22 ? 696 MAN D C3  1 
HETATM 5161 C C4  . MAN DA 4 .   ? 52.308  105.414 185.732 1.00 161.27 ? 696 MAN D C4  1 
HETATM 5162 C C5  . MAN DA 4 .   ? 51.437  106.043 186.831 1.00 143.56 ? 696 MAN D C5  1 
HETATM 5163 C C6  . MAN DA 4 .   ? 51.972  105.838 188.246 1.00 121.10 ? 696 MAN D C6  1 
HETATM 5164 O O2  . MAN DA 4 .   ? 52.807  107.901 184.205 1.00 189.01 ? 696 MAN D O2  1 
HETATM 5165 O O3  . MAN DA 4 .   ? 52.588  105.259 183.329 1.00 167.32 ? 696 MAN D O3  1 
HETATM 5166 O O4  . MAN DA 4 .   ? 52.356  104.004 185.908 1.00 163.79 ? 696 MAN D O4  1 
HETATM 5167 O O5  . MAN DA 4 .   ? 51.309  107.471 186.616 1.00 150.53 ? 696 MAN D O5  1 
HETATM 5168 O O6  . MAN DA 4 .   ? 53.387  105.694 188.271 1.00 105.06 ? 696 MAN D O6  1 
HETATM 5169 S S   . SO4 EA 6 .   ? 38.290  100.112 181.573 1.00 169.65 ? 205 SO4 D S   1 
HETATM 5170 O O1  . SO4 EA 6 .   ? 39.110  99.271  182.495 1.00 141.74 ? 205 SO4 D O1  1 
HETATM 5171 O O2  . SO4 EA 6 .   ? 36.859  99.943  181.952 1.00 156.59 ? 205 SO4 D O2  1 
HETATM 5172 O O3  . SO4 EA 6 .   ? 38.642  101.562 181.681 1.00 147.33 ? 205 SO4 D O3  1 
HETATM 5173 O O4  . SO4 EA 6 .   ? 38.529  99.646  180.172 1.00 151.67 ? 205 SO4 D O4  1 
HETATM 5174 C C1  . CPS FA 7 .   ? 32.216  113.269 184.109 1.00 67.59  ? 103 CPS D C1  1 
HETATM 5175 C C2  . CPS FA 7 .   ? 30.907  113.504 184.849 1.00 67.83  ? 103 CPS D C2  1 
HETATM 5176 C C3  . CPS FA 7 .   ? 31.645  115.680 185.963 1.00 43.48  ? 103 CPS D C3  1 
HETATM 5177 C C4  . CPS FA 7 .   ? 31.940  116.766 187.130 1.00 77.25  ? 103 CPS D C4  1 
HETATM 5178 C C5  . CPS FA 7 .   ? 30.773  116.851 188.064 1.00 74.48  ? 103 CPS D C5  1 
HETATM 5179 C C6  . CPS FA 7 .   ? 30.148  115.491 188.287 1.00 53.39  ? 103 CPS D C6  1 
HETATM 5180 C C7  . CPS FA 7 .   ? 29.007  115.648 189.227 1.00 40.78  ? 103 CPS D C7  1 
HETATM 5181 C C8  . CPS FA 7 .   ? 29.435  116.990 190.053 1.00 89.41  ? 103 CPS D C8  1 
HETATM 5182 C C9  . CPS FA 7 .   ? 30.861  117.406 189.365 1.00 99.04  ? 103 CPS D C9  1 
HETATM 5183 C C10 . CPS FA 7 .   ? 29.523  117.654 187.165 1.00 46.36  ? 103 CPS D C10 1 
HETATM 5184 C C11 . CPS FA 7 .   ? 29.830  114.271 183.974 1.00 70.42  ? 103 CPS D C11 1 
HETATM 5185 C C12 . CPS FA 7 .   ? 33.215  112.383 184.837 1.00 50.81  ? 103 CPS D C12 1 
HETATM 5186 C C13 . CPS FA 7 .   ? 32.685  111.063 185.227 1.00 55.66  ? 103 CPS D C13 1 
HETATM 5187 C C14 . CPS FA 7 .   ? 31.396  111.225 186.094 1.00 60.60  ? 103 CPS D C14 1 
HETATM 5188 C C15 . CPS FA 7 .   ? 30.372  112.125 185.283 1.00 60.14  ? 103 CPS D C15 1 
HETATM 5189 C C16 . CPS FA 7 .   ? 29.149  112.239 186.070 1.00 52.93  ? 103 CPS D C16 1 
HETATM 5190 C C17 . CPS FA 7 .   ? 29.099  113.110 187.300 1.00 47.34  ? 103 CPS D C17 1 
HETATM 5191 C C18 . CPS FA 7 .   ? 29.746  114.600 187.134 1.00 27.86  ? 103 CPS D C18 1 
HETATM 5192 C C19 . CPS FA 7 .   ? 31.088  114.294 186.172 1.00 50.09  ? 103 CPS D C19 1 
HETATM 5193 C C20 . CPS FA 7 .   ? 31.120  118.945 189.692 1.00 132.44 ? 103 CPS D C20 1 
HETATM 5194 C C21 . CPS FA 7 .   ? 32.295  119.650 189.055 1.00 161.02 ? 103 CPS D C21 1 
HETATM 5195 C C22 . CPS FA 7 .   ? 31.182  119.088 191.263 1.00 143.44 ? 103 CPS D C22 1 
HETATM 5196 C C23 . CPS FA 7 .   ? 31.415  120.407 191.794 1.00 161.12 ? 103 CPS D C23 1 
HETATM 5197 O O2  . CPS FA 7 .   ? 33.678  110.186 185.988 1.00 88.93  ? 103 CPS D O2  1 
HETATM 5198 O O3  . CPS FA 7 .   ? 29.754  112.603 188.293 1.00 45.30  ? 103 CPS D O3  1 
HETATM 5199 O O4  . CPS FA 7 .   ? 32.821  116.237 187.761 1.00 106.27 ? 103 CPS D O4  1 
HETATM 5200 C C1  . CPS GA 7 .   ? 20.969  119.198 190.086 1.00 113.30 ? 104 CPS D C1  1 
HETATM 5201 C C2  . CPS GA 7 .   ? 21.575  119.457 188.703 1.00 69.83  ? 104 CPS D C2  1 
HETATM 5202 C C3  . CPS GA 7 .   ? 23.879  120.110 189.583 1.00 56.00  ? 104 CPS D C3  1 
HETATM 5203 C C4  . CPS GA 7 .   ? 25.238  120.987 189.816 1.00 93.03  ? 104 CPS D C4  1 
HETATM 5204 C C5  . CPS GA 7 .   ? 25.780  121.443 188.506 1.00 84.89  ? 104 CPS D C5  1 
HETATM 5205 C C6  . CPS GA 7 .   ? 24.660  121.867 187.572 1.00 56.14  ? 104 CPS D C6  1 
HETATM 5206 C C7  . CPS GA 7 .   ? 25.269  122.326 186.286 1.00 59.44  ? 104 CPS D C7  1 
HETATM 5207 C C8  . CPS GA 7 .   ? 26.760  122.793 186.764 1.00 84.48  ? 104 CPS D C8  1 
HETATM 5208 C C9  . CPS GA 7 .   ? 26.767  122.465 188.375 1.00 91.03  ? 104 CPS D C9  1 
HETATM 5209 C C10 . CPS GA 7 .   ? 26.370  119.995 187.748 1.00 67.07  ? 104 CPS D C10 1 
HETATM 5210 C C11 . CPS GA 7 .   ? 22.163  118.151 188.039 1.00 67.97  ? 104 CPS D C11 1 
HETATM 5211 C C12 . CPS GA 7 .   ? 20.228  120.384 190.698 1.00 154.56 ? 104 CPS D C12 1 
HETATM 5212 C C13 . CPS GA 7 .   ? 19.160  120.964 189.834 1.00 145.36 ? 104 CPS D C13 1 
HETATM 5213 C C14 . CPS GA 7 .   ? 19.732  121.345 188.421 1.00 109.36 ? 104 CPS D C14 1 
HETATM 5214 C C15 . CPS GA 7 .   ? 20.460  120.068 187.809 1.00 70.16  ? 104 CPS D C15 1 
HETATM 5215 C C16 . CPS GA 7 .   ? 20.958  120.428 186.479 1.00 73.41  ? 104 CPS D C16 1 
HETATM 5216 C C17 . CPS GA 7 .   ? 22.157  121.368 186.362 1.00 70.39  ? 104 CPS D C17 1 
HETATM 5217 C C18 . CPS GA 7 .   ? 23.461  120.969 187.291 1.00 46.66  ? 104 CPS D C18 1 
HETATM 5218 C C19 . CPS GA 7 .   ? 22.712  120.523 188.734 1.00 60.44  ? 104 CPS D C19 1 
HETATM 5219 C C20 . CPS GA 7 .   ? 28.295  122.305 188.812 1.00 91.05  ? 104 CPS D C20 1 
HETATM 5220 C C21 . CPS GA 7 .   ? 28.602  121.819 190.202 1.00 57.53  ? 104 CPS D C21 1 
HETATM 5221 C C22 . CPS GA 7 .   ? 29.033  123.678 188.532 1.00 93.20  ? 104 CPS D C22 1 
HETATM 5222 C C23 . CPS GA 7 .   ? 30.441  123.753 188.854 1.00 86.45  ? 104 CPS D C23 1 
HETATM 5223 O O2  . CPS GA 7 .   ? 18.441  122.194 190.434 1.00 149.18 ? 104 CPS D O2  1 
HETATM 5224 O O3  . CPS GA 7 .   ? 21.885  122.594 186.735 1.00 98.66  ? 104 CPS D O3  1 
HETATM 5225 O O4  . CPS GA 7 .   ? 24.841  121.994 190.360 1.00 118.20 ? 104 CPS D O4  1 
HETATM 5226 C C1  . CPS HA 7 .   ? 23.987  110.282 194.190 1.00 162.56 ? 105 CPS D C1  1 
HETATM 5227 C C2  . CPS HA 7 .   ? 23.504  111.201 193.051 1.00 175.99 ? 105 CPS D C2  1 
HETATM 5228 C C3  . CPS HA 7 .   ? 25.048  113.150 193.677 1.00 167.36 ? 105 CPS D C3  1 
HETATM 5229 C C4  . CPS HA 7 .   ? 25.528  114.656 194.049 1.00 156.52 ? 105 CPS D C4  1 
HETATM 5230 C C5  . CPS HA 7 .   ? 24.986  115.634 193.073 1.00 147.22 ? 105 CPS D C5  1 
HETATM 5231 C C6  . CPS HA 7 .   ? 23.542  115.307 192.719 1.00 149.04 ? 105 CPS D C6  1 
HETATM 5232 C C7  . CPS HA 7 .   ? 23.086  116.345 191.744 1.00 146.22 ? 105 CPS D C7  1 
HETATM 5233 C C8  . CPS HA 7 .   ? 24.069  117.613 192.103 1.00 141.72 ? 105 CPS D C8  1 
HETATM 5234 C C9  . CPS HA 7 .   ? 25.016  117.025 193.307 1.00 140.31 ? 105 CPS D C9  1 
HETATM 5235 C C10 . CPS HA 7 .   ? 25.809  115.351 191.555 1.00 112.09 ? 105 CPS D C10 1 
HETATM 5236 C C11 . CPS HA 7 .   ? 24.253  110.935 191.681 1.00 184.11 ? 105 CPS D C11 1 
HETATM 5237 C C12 . CPS HA 7 .   ? 23.199  110.388 195.482 1.00 168.40 ? 105 CPS D C12 1 
HETATM 5238 C C13 . CPS HA 7 .   ? 21.738  110.182 195.325 1.00 169.69 ? 105 CPS D C13 1 
HETATM 5239 C C14 . CPS HA 7 .   ? 21.142  111.149 194.226 1.00 174.73 ? 105 CPS D C14 1 
HETATM 5240 C C15 . CPS HA 7 .   ? 21.981  110.976 192.870 1.00 177.32 ? 105 CPS D C15 1 
HETATM 5241 C C16 . CPS HA 7 .   ? 21.395  111.864 191.831 1.00 173.23 ? 105 CPS D C16 1 
HETATM 5242 C C17 . CPS HA 7 .   ? 21.590  113.385 191.907 1.00 166.01 ? 105 CPS D C17 1 
HETATM 5243 C C18 . CPS HA 7 .   ? 23.124  113.895 192.254 1.00 159.88 ? 105 CPS D C18 1 
HETATM 5244 C C19 . CPS HA 7 .   ? 23.632  112.728 193.398 1.00 171.14 ? 105 CPS D C19 1 
HETATM 5245 C C20 . CPS HA 7 .   ? 26.373  117.881 193.364 1.00 128.39 ? 105 CPS D C20 1 
HETATM 5246 C C21 . CPS HA 7 .   ? 27.491  117.441 194.289 1.00 94.90  ? 105 CPS D C21 1 
HETATM 5247 C C22 . CPS HA 7 .   ? 26.007  119.377 193.665 1.00 134.59 ? 105 CPS D C22 1 
HETATM 5248 C C23 . CPS HA 7 .   ? 27.114  120.298 193.745 1.00 141.67 ? 105 CPS D C23 1 
HETATM 5249 O O2  . CPS HA 7 .   ? 20.934  110.337 196.634 1.00 155.95 ? 105 CPS D O2  1 
HETATM 5250 O O3  . CPS HA 7 .   ? 20.861  113.951 192.840 1.00 166.05 ? 105 CPS D O3  1 
HETATM 5251 O O4  . CPS HA 7 .   ? 24.940  114.899 195.082 1.00 171.26 ? 105 CPS D O4  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   VAL 1   1   1   VAL VAL A . n 
A 1 2   PRO 2   2   2   PRO PRO A . n 
A 1 3   GLN 3   3   3   GLN GLN A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   PRO 5   5   5   PRO PRO A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  PRO 11  11  11  PRO PRO A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  TRP 13  13  13  TRP TRP A . n 
A 1 14  ASN 14  14  14  ASN ASN A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  ILE 16  16  16  ILE ILE A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  GLY 19  19  19  GLY GLY A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  ASN 21  21  21  ASN ASN A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  THR 23  23  23  THR THR A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  THR 25  25  25  THR THR A . n 
A 1 26  CYS 26  26  26  CYS CYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLY 28  28  28  GLY GLY A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ASN 30  30  30  ASN ASN A . n 
A 1 31  PHE 31  31  31  PHE PHE A . n 
A 1 32  PHE 32  32  32  PHE PHE A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  VAL 34  34  34  VAL VAL A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  SER 36  36  36  SER SER A . n 
A 1 37  THR 37  37  37  THR THR A . n 
A 1 38  LYS 38  38  38  LYS LYS A . n 
A 1 39  TRP 39  39  39  TRP TRP A . n 
A 1 40  PHE 40  40  40  PHE PHE A . n 
A 1 41  HIS 41  41  41  HIS HIS A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  SER 46  46  46  SER SER A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  GLU 48  48  48  GLU GLU A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  ASN 50  50  50  ASN ASN A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  ASN 54  54  54  ASN ASN A . n 
A 1 55  ILE 55  55  55  ILE ILE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  ALA 58  58  58  ALA ALA A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  GLU 61  61  61  GLU GLU A . n 
A 1 62  ASP 62  62  62  ASP ASP A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  LYS 67  67  67  LYS LYS A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  PHE 84  84  84  PHE PHE A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  TRP 87  87  87  TRP TRP A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLN 91  91  91  GLN GLN A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  GLU 95  95  95  GLU GLU A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  VAL 97  97  97  VAL VAL A . n 
A 1 98  MET 98  98  98  MET MET A . n 
A 1 99  GLU 99  99  99  GLU GLU A . n 
A 1 100 GLY 100 100 100 GLY GLY A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 PHE 104 104 104 PHE PHE A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 ARG 106 106 106 ARG ARG A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 TRP 110 110 110 TRP TRP A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ASN 112 112 112 ASN ASN A . n 
A 1 113 TRP 113 113 113 TRP TRP A . n 
A 1 114 ASP 114 114 114 ASP ASP A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 LYS 117 117 117 LYS LYS A . n 
A 1 118 VAL 118 118 118 VAL VAL A . n 
A 1 119 ILE 119 119 119 ILE ILE A . n 
A 1 120 TYR 120 120 120 TYR TYR A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 LYS 122 122 122 LYS LYS A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 TYR 129 129 129 TYR TYR A . n 
A 1 130 TRP 130 130 130 TRP TRP A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 ASN 133 133 133 ASN ASN A . n 
A 1 134 HIS 134 134 134 HIS HIS A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ILE 136 136 136 ILE ILE A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 ASN 140 140 140 ASN ASN A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ASP 145 145 145 ASP ASP A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 GLY 147 147 147 GLY GLY A . n 
A 1 148 THR 148 148 148 THR THR A . n 
A 1 149 TYR 149 149 149 TYR TYR A . n 
A 1 150 TYR 150 150 150 TYR TYR A . n 
A 1 151 CYS 151 151 151 CYS CYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 GLY 153 153 153 GLY GLY A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 VAL 155 155 155 VAL VAL A . n 
A 1 156 TRP 156 156 156 TRP TRP A . n 
A 1 157 GLN 157 157 157 GLN GLN A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ASP 159 159 159 ASP ASP A . n 
A 1 160 TYR 160 160 160 TYR TYR A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 SER 162 162 162 SER SER A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 PRO 164 164 164 PRO PRO A . n 
A 1 165 LEU 165 165 165 LEU LEU A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 ILE 167 167 167 ILE ILE A . n 
A 1 168 THR 168 168 168 THR THR A . n 
A 1 169 VAL 169 169 169 VAL VAL A . n 
A 1 170 ILE 170 170 170 ILE ILE A . n 
A 1 171 LYS 171 171 171 LYS LYS A . n 
A 1 172 ALA 172 172 172 ALA ALA A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 ARG 174 174 ?   ?   ?   A . n 
A 1 175 GLU 175 175 ?   ?   ?   A . n 
A 1 176 LYS 176 176 ?   ?   ?   A . n 
B 2 1   ALA 1   326 ?   ?   ?   B . n 
B 2 2   ASP 2   327 ?   ?   ?   B . n 
B 2 3   PRO 3   328 328 PRO PRO B . n 
B 2 4   CYS 4   329 329 CYS CYS B . n 
B 2 5   ASP 5   330 330 ASP ASP B . n 
B 2 6   SER 6   331 331 SER SER B . n 
B 2 7   ASN 7   332 332 ASN ASN B . n 
B 2 8   PRO 8   333 333 PRO PRO B . n 
B 2 9   ARG 9   334 334 ARG ARG B . n 
B 2 10  GLY 10  335 335 GLY GLY B . n 
B 2 11  VAL 11  336 336 VAL VAL B . n 
B 2 12  SER 12  337 337 SER SER B . n 
B 2 13  ALA 13  338 338 ALA ALA B . n 
B 2 14  TYR 14  339 339 TYR TYR B . n 
B 2 15  LEU 15  340 340 LEU LEU B . n 
B 2 16  SER 16  341 341 SER SER B . n 
B 2 17  ARG 17  342 342 ARG ARG B . n 
B 2 18  PRO 18  343 343 PRO PRO B . n 
B 2 19  SER 19  344 344 SER SER B . n 
B 2 20  PRO 20  345 345 PRO PRO B . n 
B 2 21  PHE 21  346 346 PHE PHE B . n 
B 2 22  ASP 22  347 347 ASP ASP B . n 
B 2 23  LEU 23  348 348 LEU LEU B . n 
B 2 24  PHE 24  349 349 PHE PHE B . n 
B 2 25  ILE 25  350 350 ILE ILE B . n 
B 2 26  ARG 26  351 351 ARG ARG B . n 
B 2 27  LYS 27  352 352 LYS LYS B . n 
B 2 28  SER 28  353 353 SER SER B . n 
B 2 29  PRO 29  354 354 PRO PRO B . n 
B 2 30  THR 30  355 355 THR THR B . n 
B 2 31  ILE 31  356 356 ILE ILE B . n 
B 2 32  THR 32  357 357 THR THR B . n 
B 2 33  CYS 33  358 358 CYS CYS B . n 
B 2 34  LEU 34  359 359 LEU LEU B . n 
B 2 35  VAL 35  360 360 VAL VAL B . n 
B 2 36  VAL 36  361 361 VAL VAL B . n 
B 2 37  ASP 37  362 362 ASP ASP B . n 
B 2 38  LEU 38  363 363 LEU LEU B . n 
B 2 39  ALA 39  364 364 ALA ALA B . n 
B 2 40  PRO 40  365 365 PRO PRO B . n 
B 2 41  SER 41  366 366 SER SER B . n 
B 2 42  LYS 42  367 367 LYS LYS B . n 
B 2 43  GLY 43  368 368 GLY GLY B . n 
B 2 44  THR 44  369 369 THR THR B . n 
B 2 45  VAL 45  370 370 VAL VAL B . n 
B 2 46  ASN 46  371 371 ASN ASN B . n 
B 2 47  LEU 47  372 372 LEU LEU B . n 
B 2 48  THR 48  373 373 THR THR B . n 
B 2 49  TRP 49  374 374 TRP TRP B . n 
B 2 50  SER 50  375 375 SER SER B . n 
B 2 51  ARG 51  376 376 ARG ARG B . n 
B 2 52  ALA 52  377 377 ALA ALA B . n 
B 2 53  SER 53  378 378 SER SER B . n 
B 2 54  GLY 54  379 379 GLY GLY B . n 
B 2 55  LYS 55  380 380 LYS LYS B . n 
B 2 56  PRO 56  381 381 PRO PRO B . n 
B 2 57  VAL 57  382 382 VAL VAL B . n 
B 2 58  ASN 58  383 383 ASN ASN B . n 
B 2 59  HIS 59  384 384 HIS HIS B . n 
B 2 60  SER 60  385 385 SER SER B . n 
B 2 61  THR 61  386 386 THR THR B . n 
B 2 62  ARG 62  387 387 ARG ARG B . n 
B 2 63  LYS 63  388 388 LYS LYS B . n 
B 2 64  GLU 64  389 389 GLU GLU B . n 
B 2 65  GLU 65  390 390 GLU GLU B . n 
B 2 66  LYS 66  391 391 LYS LYS B . n 
B 2 67  GLN 67  392 392 GLN GLN B . n 
B 2 68  ARG 68  393 393 ARG ARG B . n 
B 2 69  ASN 69  394 394 ASN ASN B . n 
B 2 70  GLY 70  395 395 GLY GLY B . n 
B 2 71  THR 71  396 396 THR THR B . n 
B 2 72  LEU 72  397 397 LEU LEU B . n 
B 2 73  THR 73  398 398 THR THR B . n 
B 2 74  VAL 74  399 399 VAL VAL B . n 
B 2 75  THR 75  400 400 THR THR B . n 
B 2 76  SER 76  401 401 SER SER B . n 
B 2 77  THR 77  402 402 THR THR B . n 
B 2 78  LEU 78  403 403 LEU LEU B . n 
B 2 79  PRO 79  404 404 PRO PRO B . n 
B 2 80  VAL 80  405 405 VAL VAL B . n 
B 2 81  GLY 81  406 406 GLY GLY B . n 
B 2 82  THR 82  407 407 THR THR B . n 
B 2 83  ARG 83  408 408 ARG ARG B . n 
B 2 84  ASP 84  409 409 ASP ASP B . n 
B 2 85  TRP 85  410 410 TRP TRP B . n 
B 2 86  ILE 86  411 411 ILE ILE B . n 
B 2 87  GLU 87  412 412 GLU GLU B . n 
B 2 88  GLY 88  413 413 GLY GLY B . n 
B 2 89  GLU 89  414 414 GLU GLU B . n 
B 2 90  THR 90  415 415 THR THR B . n 
B 2 91  TYR 91  416 416 TYR TYR B . n 
B 2 92  GLN 92  417 417 GLN GLN B . n 
B 2 93  CYS 93  418 418 CYS CYS B . n 
B 2 94  ARG 94  419 419 ARG ARG B . n 
B 2 95  VAL 95  420 420 VAL VAL B . n 
B 2 96  THR 96  421 421 THR THR B . n 
B 2 97  HIS 97  422 422 HIS HIS B . n 
B 2 98  PRO 98  423 423 PRO PRO B . n 
B 2 99  HIS 99  424 424 HIS HIS B . n 
B 2 100 LEU 100 425 425 LEU LEU B . n 
B 2 101 PRO 101 426 426 PRO PRO B . n 
B 2 102 ARG 102 427 427 ARG ARG B . n 
B 2 103 ALA 103 428 428 ALA ALA B . n 
B 2 104 LEU 104 429 429 LEU LEU B . n 
B 2 105 MET 105 430 430 MET MET B . n 
B 2 106 ARG 106 431 431 ARG ARG B . n 
B 2 107 SER 107 432 432 SER SER B . n 
B 2 108 THR 108 433 433 THR THR B . n 
B 2 109 THR 109 434 434 THR THR B . n 
B 2 110 LYS 110 435 435 LYS LYS B . n 
B 2 111 THR 111 436 436 THR THR B . n 
B 2 112 SER 112 437 437 SER SER B . n 
B 2 113 GLY 113 438 438 GLY GLY B . n 
B 2 114 PRO 114 439 439 PRO PRO B . n 
B 2 115 ARG 115 440 440 ARG ARG B . n 
B 2 116 ALA 116 441 441 ALA ALA B . n 
B 2 117 ALA 117 442 442 ALA ALA B . n 
B 2 118 PRO 118 443 443 PRO PRO B . n 
B 2 119 GLU 119 444 444 GLU GLU B . n 
B 2 120 VAL 120 445 445 VAL VAL B . n 
B 2 121 TYR 121 446 446 TYR TYR B . n 
B 2 122 ALA 122 447 447 ALA ALA B . n 
B 2 123 PHE 123 448 448 PHE PHE B . n 
B 2 124 ALA 124 449 449 ALA ALA B . n 
B 2 125 THR 125 450 450 THR THR B . n 
B 2 126 PRO 126 451 451 PRO PRO B . n 
B 2 127 GLU 127 452 452 GLU GLU B . n 
B 2 128 TRP 128 453 453 TRP TRP B . n 
B 2 129 PRO 129 454 454 PRO PRO B . n 
B 2 130 GLY 130 455 455 GLY GLY B . n 
B 2 131 SER 131 456 456 SER SER B . n 
B 2 132 ARG 132 457 457 ARG ARG B . n 
B 2 133 ASP 133 458 458 ASP ASP B . n 
B 2 134 LYS 134 459 459 LYS LYS B . n 
B 2 135 ARG 135 460 460 ARG ARG B . n 
B 2 136 THR 136 461 461 THR THR B . n 
B 2 137 LEU 137 462 462 LEU LEU B . n 
B 2 138 ALA 138 463 463 ALA ALA B . n 
B 2 139 CYS 139 464 464 CYS CYS B . n 
B 2 140 LEU 140 465 465 LEU LEU B . n 
B 2 141 ILE 141 466 466 ILE ILE B . n 
B 2 142 GLN 142 467 467 GLN GLN B . n 
B 2 143 ASN 143 468 468 ASN ASN B . n 
B 2 144 PHE 144 469 469 PHE PHE B . n 
B 2 145 MET 145 470 470 MET MET B . n 
B 2 146 PRO 146 471 471 PRO PRO B . n 
B 2 147 GLU 147 472 472 GLU GLU B . n 
B 2 148 ASP 148 473 473 ASP ASP B . n 
B 2 149 ILE 149 474 474 ILE ILE B . n 
B 2 150 SER 150 475 475 SER SER B . n 
B 2 151 VAL 151 476 476 VAL VAL B . n 
B 2 152 GLN 152 477 477 GLN GLN B . n 
B 2 153 TRP 153 478 478 TRP TRP B . n 
B 2 154 LEU 154 479 479 LEU LEU B . n 
B 2 155 HIS 155 480 480 HIS HIS B . n 
B 2 156 ASN 156 481 481 ASN ASN B . n 
B 2 157 GLU 157 482 482 GLU GLU B . n 
B 2 158 VAL 158 483 483 VAL VAL B . n 
B 2 159 GLN 159 484 484 GLN GLN B . n 
B 2 160 LEU 160 485 485 LEU LEU B . n 
B 2 161 PRO 161 486 486 PRO PRO B . n 
B 2 162 ASP 162 487 487 ASP ASP B . n 
B 2 163 ALA 163 488 488 ALA ALA B . n 
B 2 164 ARG 164 489 489 ARG ARG B . n 
B 2 165 HIS 165 490 490 HIS HIS B . n 
B 2 166 SER 166 491 491 SER SER B . n 
B 2 167 THR 167 492 492 THR THR B . n 
B 2 168 THR 168 493 493 THR THR B . n 
B 2 169 GLN 169 494 494 GLN GLN B . n 
B 2 170 PRO 170 495 495 PRO PRO B . n 
B 2 171 ARG 171 496 496 ARG ARG B . n 
B 2 172 LYS 172 497 497 LYS LYS B . n 
B 2 173 THR 173 498 498 THR THR B . n 
B 2 174 LYS 174 499 499 LYS LYS B . n 
B 2 175 GLY 175 500 500 GLY GLY B . n 
B 2 176 SER 176 501 501 SER SER B . n 
B 2 177 GLY 177 502 502 GLY GLY B . n 
B 2 178 PHE 178 503 503 PHE PHE B . n 
B 2 179 PHE 179 504 504 PHE PHE B . n 
B 2 180 VAL 180 505 505 VAL VAL B . n 
B 2 181 PHE 181 506 506 PHE PHE B . n 
B 2 182 SER 182 507 507 SER SER B . n 
B 2 183 ARG 183 508 508 ARG ARG B . n 
B 2 184 LEU 184 509 509 LEU LEU B . n 
B 2 185 GLU 185 510 510 GLU GLU B . n 
B 2 186 VAL 186 511 511 VAL VAL B . n 
B 2 187 THR 187 512 512 THR THR B . n 
B 2 188 ARG 188 513 513 ARG ARG B . n 
B 2 189 ALA 189 514 514 ALA ALA B . n 
B 2 190 GLU 190 515 515 GLU GLU B . n 
B 2 191 TRP 191 516 516 TRP TRP B . n 
B 2 192 GLU 192 517 517 GLU GLU B . n 
B 2 193 GLN 193 518 518 GLN GLN B . n 
B 2 194 LYS 194 519 519 LYS LYS B . n 
B 2 195 ASP 195 520 520 ASP ASP B . n 
B 2 196 GLU 196 521 521 GLU GLU B . n 
B 2 197 PHE 197 522 522 PHE PHE B . n 
B 2 198 ILE 198 523 523 ILE ILE B . n 
B 2 199 CYS 199 524 524 CYS CYS B . n 
B 2 200 ARG 200 525 525 ARG ARG B . n 
B 2 201 ALA 201 526 526 ALA ALA B . n 
B 2 202 VAL 202 527 527 VAL VAL B . n 
B 2 203 HIS 203 528 528 HIS HIS B . n 
B 2 204 GLU 204 529 529 GLU GLU B . n 
B 2 205 ALA 205 530 530 ALA ALA B . n 
B 2 206 ALA 206 531 531 ALA ALA B . n 
B 2 207 SER 207 532 532 SER SER B . n 
B 2 208 PRO 208 533 533 PRO PRO B . n 
B 2 209 SER 209 534 534 SER SER B . n 
B 2 210 GLN 210 535 535 GLN GLN B . n 
B 2 211 THR 211 536 536 THR THR B . n 
B 2 212 VAL 212 537 537 VAL VAL B . n 
B 2 213 GLN 213 538 538 GLN GLN B . n 
B 2 214 ARG 214 539 539 ARG ARG B . n 
B 2 215 ALA 215 540 540 ALA ALA B . n 
B 2 216 VAL 216 541 541 VAL VAL B . n 
B 2 217 SER 217 542 542 SER SER B . n 
B 2 218 VAL 218 543 543 VAL VAL B . n 
B 2 219 ASN 219 544 544 ASN ASN B . n 
B 2 220 PRO 220 545 ?   ?   ?   B . n 
B 2 221 GLY 221 546 ?   ?   ?   B . n 
B 2 222 LYS 222 547 ?   ?   ?   B . n 
C 2 1   ALA 1   326 ?   ?   ?   D . n 
C 2 2   ASP 2   327 ?   ?   ?   D . n 
C 2 3   PRO 3   328 ?   ?   ?   D . n 
C 2 4   CYS 4   329 329 CYS CYS D . n 
C 2 5   ASP 5   330 330 ASP ASP D . n 
C 2 6   SER 6   331 331 SER SER D . n 
C 2 7   ASN 7   332 332 ASN ASN D . n 
C 2 8   PRO 8   333 333 PRO PRO D . n 
C 2 9   ARG 9   334 334 ARG ARG D . n 
C 2 10  GLY 10  335 335 GLY GLY D . n 
C 2 11  VAL 11  336 336 VAL VAL D . n 
C 2 12  SER 12  337 337 SER SER D . n 
C 2 13  ALA 13  338 338 ALA ALA D . n 
C 2 14  TYR 14  339 339 TYR TYR D . n 
C 2 15  LEU 15  340 340 LEU LEU D . n 
C 2 16  SER 16  341 341 SER SER D . n 
C 2 17  ARG 17  342 342 ARG ARG D . n 
C 2 18  PRO 18  343 343 PRO PRO D . n 
C 2 19  SER 19  344 344 SER SER D . n 
C 2 20  PRO 20  345 345 PRO PRO D . n 
C 2 21  PHE 21  346 346 PHE PHE D . n 
C 2 22  ASP 22  347 347 ASP ASP D . n 
C 2 23  LEU 23  348 348 LEU LEU D . n 
C 2 24  PHE 24  349 349 PHE PHE D . n 
C 2 25  ILE 25  350 350 ILE ILE D . n 
C 2 26  ARG 26  351 351 ARG ARG D . n 
C 2 27  LYS 27  352 352 LYS LYS D . n 
C 2 28  SER 28  353 353 SER SER D . n 
C 2 29  PRO 29  354 354 PRO PRO D . n 
C 2 30  THR 30  355 355 THR THR D . n 
C 2 31  ILE 31  356 356 ILE ILE D . n 
C 2 32  THR 32  357 357 THR THR D . n 
C 2 33  CYS 33  358 358 CYS CYS D . n 
C 2 34  LEU 34  359 359 LEU LEU D . n 
C 2 35  VAL 35  360 360 VAL VAL D . n 
C 2 36  VAL 36  361 361 VAL VAL D . n 
C 2 37  ASP 37  362 362 ASP ASP D . n 
C 2 38  LEU 38  363 363 LEU LEU D . n 
C 2 39  ALA 39  364 364 ALA ALA D . n 
C 2 40  PRO 40  365 365 PRO PRO D . n 
C 2 41  SER 41  366 366 SER SER D . n 
C 2 42  LYS 42  367 367 LYS LYS D . n 
C 2 43  GLY 43  368 368 GLY GLY D . n 
C 2 44  THR 44  369 369 THR THR D . n 
C 2 45  VAL 45  370 370 VAL VAL D . n 
C 2 46  ASN 46  371 371 ASN ASN D . n 
C 2 47  LEU 47  372 372 LEU LEU D . n 
C 2 48  THR 48  373 373 THR THR D . n 
C 2 49  TRP 49  374 374 TRP TRP D . n 
C 2 50  SER 50  375 375 SER SER D . n 
C 2 51  ARG 51  376 376 ARG ARG D . n 
C 2 52  ALA 52  377 377 ALA ALA D . n 
C 2 53  SER 53  378 378 SER SER D . n 
C 2 54  GLY 54  379 379 GLY GLY D . n 
C 2 55  LYS 55  380 380 LYS LYS D . n 
C 2 56  PRO 56  381 381 PRO PRO D . n 
C 2 57  VAL 57  382 382 VAL VAL D . n 
C 2 58  ASN 58  383 383 ASN ASN D . n 
C 2 59  HIS 59  384 384 HIS HIS D . n 
C 2 60  SER 60  385 385 SER SER D . n 
C 2 61  THR 61  386 386 THR THR D . n 
C 2 62  ARG 62  387 387 ARG ARG D . n 
C 2 63  LYS 63  388 388 LYS LYS D . n 
C 2 64  GLU 64  389 389 GLU GLU D . n 
C 2 65  GLU 65  390 390 GLU GLU D . n 
C 2 66  LYS 66  391 391 LYS LYS D . n 
C 2 67  GLN 67  392 392 GLN GLN D . n 
C 2 68  ARG 68  393 393 ARG ARG D . n 
C 2 69  ASN 69  394 394 ASN ASN D . n 
C 2 70  GLY 70  395 395 GLY GLY D . n 
C 2 71  THR 71  396 396 THR THR D . n 
C 2 72  LEU 72  397 397 LEU LEU D . n 
C 2 73  THR 73  398 398 THR THR D . n 
C 2 74  VAL 74  399 399 VAL VAL D . n 
C 2 75  THR 75  400 400 THR THR D . n 
C 2 76  SER 76  401 401 SER SER D . n 
C 2 77  THR 77  402 402 THR THR D . n 
C 2 78  LEU 78  403 403 LEU LEU D . n 
C 2 79  PRO 79  404 404 PRO PRO D . n 
C 2 80  VAL 80  405 405 VAL VAL D . n 
C 2 81  GLY 81  406 406 GLY GLY D . n 
C 2 82  THR 82  407 407 THR THR D . n 
C 2 83  ARG 83  408 408 ARG ARG D . n 
C 2 84  ASP 84  409 409 ASP ASP D . n 
C 2 85  TRP 85  410 410 TRP TRP D . n 
C 2 86  ILE 86  411 411 ILE ILE D . n 
C 2 87  GLU 87  412 412 GLU GLU D . n 
C 2 88  GLY 88  413 413 GLY GLY D . n 
C 2 89  GLU 89  414 414 GLU GLU D . n 
C 2 90  THR 90  415 415 THR THR D . n 
C 2 91  TYR 91  416 416 TYR TYR D . n 
C 2 92  GLN 92  417 417 GLN GLN D . n 
C 2 93  CYS 93  418 418 CYS CYS D . n 
C 2 94  ARG 94  419 419 ARG ARG D . n 
C 2 95  VAL 95  420 420 VAL VAL D . n 
C 2 96  THR 96  421 421 THR THR D . n 
C 2 97  HIS 97  422 422 HIS HIS D . n 
C 2 98  PRO 98  423 423 PRO PRO D . n 
C 2 99  HIS 99  424 424 HIS HIS D . n 
C 2 100 LEU 100 425 425 LEU LEU D . n 
C 2 101 PRO 101 426 426 PRO PRO D . n 
C 2 102 ARG 102 427 427 ARG ARG D . n 
C 2 103 ALA 103 428 428 ALA ALA D . n 
C 2 104 LEU 104 429 429 LEU LEU D . n 
C 2 105 MET 105 430 430 MET MET D . n 
C 2 106 ARG 106 431 431 ARG ARG D . n 
C 2 107 SER 107 432 432 SER SER D . n 
C 2 108 THR 108 433 433 THR THR D . n 
C 2 109 THR 109 434 434 THR THR D . n 
C 2 110 LYS 110 435 435 LYS LYS D . n 
C 2 111 THR 111 436 436 THR THR D . n 
C 2 112 SER 112 437 437 SER SER D . n 
C 2 113 GLY 113 438 438 GLY GLY D . n 
C 2 114 PRO 114 439 439 PRO PRO D . n 
C 2 115 ARG 115 440 440 ARG ARG D . n 
C 2 116 ALA 116 441 441 ALA ALA D . n 
C 2 117 ALA 117 442 442 ALA ALA D . n 
C 2 118 PRO 118 443 443 PRO PRO D . n 
C 2 119 GLU 119 444 444 GLU GLU D . n 
C 2 120 VAL 120 445 445 VAL VAL D . n 
C 2 121 TYR 121 446 446 TYR TYR D . n 
C 2 122 ALA 122 447 447 ALA ALA D . n 
C 2 123 PHE 123 448 448 PHE PHE D . n 
C 2 124 ALA 124 449 449 ALA ALA D . n 
C 2 125 THR 125 450 450 THR THR D . n 
C 2 126 PRO 126 451 451 PRO PRO D . n 
C 2 127 GLU 127 452 452 GLU GLU D . n 
C 2 128 TRP 128 453 453 TRP TRP D . n 
C 2 129 PRO 129 454 454 PRO PRO D . n 
C 2 130 GLY 130 455 455 GLY GLY D . n 
C 2 131 SER 131 456 456 SER SER D . n 
C 2 132 ARG 132 457 457 ARG ARG D . n 
C 2 133 ASP 133 458 458 ASP ASP D . n 
C 2 134 LYS 134 459 459 LYS LYS D . n 
C 2 135 ARG 135 460 460 ARG ARG D . n 
C 2 136 THR 136 461 461 THR THR D . n 
C 2 137 LEU 137 462 462 LEU LEU D . n 
C 2 138 ALA 138 463 463 ALA ALA D . n 
C 2 139 CYS 139 464 464 CYS CYS D . n 
C 2 140 LEU 140 465 465 LEU LEU D . n 
C 2 141 ILE 141 466 466 ILE ILE D . n 
C 2 142 GLN 142 467 467 GLN GLN D . n 
C 2 143 ASN 143 468 468 ASN ASN D . n 
C 2 144 PHE 144 469 469 PHE PHE D . n 
C 2 145 MET 145 470 470 MET MET D . n 
C 2 146 PRO 146 471 471 PRO PRO D . n 
C 2 147 GLU 147 472 472 GLU GLU D . n 
C 2 148 ASP 148 473 473 ASP ASP D . n 
C 2 149 ILE 149 474 474 ILE ILE D . n 
C 2 150 SER 150 475 475 SER SER D . n 
C 2 151 VAL 151 476 476 VAL VAL D . n 
C 2 152 GLN 152 477 477 GLN GLN D . n 
C 2 153 TRP 153 478 478 TRP TRP D . n 
C 2 154 LEU 154 479 479 LEU LEU D . n 
C 2 155 HIS 155 480 480 HIS HIS D . n 
C 2 156 ASN 156 481 481 ASN ASN D . n 
C 2 157 GLU 157 482 482 GLU GLU D . n 
C 2 158 VAL 158 483 483 VAL VAL D . n 
C 2 159 GLN 159 484 484 GLN GLN D . n 
C 2 160 LEU 160 485 485 LEU LEU D . n 
C 2 161 PRO 161 486 486 PRO PRO D . n 
C 2 162 ASP 162 487 487 ASP ASP D . n 
C 2 163 ALA 163 488 488 ALA ALA D . n 
C 2 164 ARG 164 489 489 ARG ARG D . n 
C 2 165 HIS 165 490 490 HIS HIS D . n 
C 2 166 SER 166 491 491 SER SER D . n 
C 2 167 THR 167 492 492 THR THR D . n 
C 2 168 THR 168 493 493 THR THR D . n 
C 2 169 GLN 169 494 494 GLN GLN D . n 
C 2 170 PRO 170 495 495 PRO PRO D . n 
C 2 171 ARG 171 496 496 ARG ARG D . n 
C 2 172 LYS 172 497 497 LYS LYS D . n 
C 2 173 THR 173 498 498 THR THR D . n 
C 2 174 LYS 174 499 499 LYS LYS D . n 
C 2 175 GLY 175 500 500 GLY GLY D . n 
C 2 176 SER 176 501 501 SER SER D . n 
C 2 177 GLY 177 502 502 GLY GLY D . n 
C 2 178 PHE 178 503 503 PHE PHE D . n 
C 2 179 PHE 179 504 504 PHE PHE D . n 
C 2 180 VAL 180 505 505 VAL VAL D . n 
C 2 181 PHE 181 506 506 PHE PHE D . n 
C 2 182 SER 182 507 507 SER SER D . n 
C 2 183 ARG 183 508 508 ARG ARG D . n 
C 2 184 LEU 184 509 509 LEU LEU D . n 
C 2 185 GLU 185 510 510 GLU GLU D . n 
C 2 186 VAL 186 511 511 VAL VAL D . n 
C 2 187 THR 187 512 512 THR THR D . n 
C 2 188 ARG 188 513 513 ARG ARG D . n 
C 2 189 ALA 189 514 514 ALA ALA D . n 
C 2 190 GLU 190 515 515 GLU GLU D . n 
C 2 191 TRP 191 516 516 TRP TRP D . n 
C 2 192 GLU 192 517 517 GLU GLU D . n 
C 2 193 GLN 193 518 518 GLN GLN D . n 
C 2 194 LYS 194 519 519 LYS LYS D . n 
C 2 195 ASP 195 520 520 ASP ASP D . n 
C 2 196 GLU 196 521 521 GLU GLU D . n 
C 2 197 PHE 197 522 522 PHE PHE D . n 
C 2 198 ILE 198 523 523 ILE ILE D . n 
C 2 199 CYS 199 524 524 CYS CYS D . n 
C 2 200 ARG 200 525 525 ARG ARG D . n 
C 2 201 ALA 201 526 526 ALA ALA D . n 
C 2 202 VAL 202 527 527 VAL VAL D . n 
C 2 203 HIS 203 528 528 HIS HIS D . n 
C 2 204 GLU 204 529 529 GLU GLU D . n 
C 2 205 ALA 205 530 530 ALA ALA D . n 
C 2 206 ALA 206 531 531 ALA ALA D . n 
C 2 207 SER 207 532 532 SER SER D . n 
C 2 208 PRO 208 533 533 PRO PRO D . n 
C 2 209 SER 209 534 534 SER SER D . n 
C 2 210 GLN 210 535 535 GLN GLN D . n 
C 2 211 THR 211 536 536 THR THR D . n 
C 2 212 VAL 212 537 537 VAL VAL D . n 
C 2 213 GLN 213 538 538 GLN GLN D . n 
C 2 214 ARG 214 539 539 ARG ARG D . n 
C 2 215 ALA 215 540 540 ALA ALA D . n 
C 2 216 VAL 216 541 541 VAL VAL D . n 
C 2 217 SER 217 542 542 SER SER D . n 
C 2 218 VAL 218 543 543 VAL VAL D . n 
C 2 219 ASN 219 544 544 ASN ASN D . n 
C 2 220 PRO 220 545 ?   ?   ?   D . n 
C 2 221 GLY 221 546 ?   ?   ?   D . n 
C 2 222 LYS 222 547 ?   ?   ?   D . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 B ASN 69  B ASN 394 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 166 A ASN 166 ? ASN 'GLYCOSYLATION SITE' 
3 A ASN 42  A ASN 42  ? ASN 'GLYCOSYLATION SITE' 
4 A ASN 21  A ASN 21  ? ASN 'GLYCOSYLATION SITE' 
5 C ASN 69  D ASN 394 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-07-20 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       0.9 ? 4 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 OE1 D GLN 518 ? ? 1_555 OE1 D GLN 518 ? ? 11_566 1.79 
2 1 NH2 B ARG 351 ? ? 1_555 NH2 B ARG 351 ? ? 4_556  2.12 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CD B GLU 529 ? ? OE1 B GLU 529 ? ? 1.164 1.252 -0.088 0.011 N 
2 1 CD B GLU 529 ? ? OE2 B GLU 529 ? ? 1.167 1.252 -0.085 0.011 N 
3 1 CD D GLU 529 ? ? OE1 D GLU 529 ? ? 1.155 1.252 -0.097 0.011 N 
4 1 CD D GLU 529 ? ? OE2 D GLU 529 ? ? 1.170 1.252 -0.082 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C   A PRO 11  ? ? N  A PRO 12  ? ? CA  A PRO 12  ? ? 131.96 119.30 12.66  1.50 Y 
2 1 C   A PRO 11  ? ? N  A PRO 12  ? ? CD  A PRO 12  ? ? 113.99 128.40 -14.41 2.10 Y 
3 1 OE1 B GLU 529 ? ? CD B GLU 529 ? ? OE2 B GLU 529 ? ? 102.93 123.30 -20.37 1.20 N 
4 1 OE1 D GLU 529 ? ? CD D GLU 529 ? ? OE2 D GLU 529 ? ? 103.23 123.30 -20.07 1.20 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 12  ? ? -28.95  -49.04  
2  1 ASN A 27  ? ? 4.53    151.56  
3  1 ASN A 30  ? ? -160.12 61.69   
4  1 GLU A 33  ? ? 69.64   87.07   
5  1 ASN A 42  ? ? 56.10   -2.19   
6  1 ASN A 57  ? ? 37.29   54.04   
7  1 HIS A 70  ? ? -94.06  -113.18 
8  1 SER A 76  ? ? -45.88  150.11  
9  1 SER A 85  ? ? -152.38 82.98   
10 1 GLU A 99  ? ? -38.89  134.84  
11 1 TRP A 110 ? ? -35.91  144.96  
12 1 ARG A 111 ? ? 42.29   24.36   
13 1 ALA A 141 ? ? -49.91  164.87  
14 1 GLN A 157 ? ? 70.59   -8.58   
15 1 ASP B 330 ? ? -84.57  40.87   
16 1 PRO B 333 ? ? -33.77  136.61  
17 1 ARG B 334 ? ? 38.51   16.03   
18 1 ILE B 350 ? ? -74.43  -86.35  
19 1 ARG B 351 ? ? -45.81  -18.16  
20 1 LYS B 352 ? ? 44.92   25.42   
21 1 PRO B 381 ? ? -45.98  165.62  
22 1 ASN B 394 ? ? -76.58  30.13   
23 1 THR B 396 ? ? -70.90  -163.25 
24 1 GLU B 412 ? ? -83.09  30.31   
25 1 PRO B 426 ? ? -74.00  -77.15  
26 1 MET B 470 ? ? -176.02 143.23  
27 1 PRO B 471 ? ? -52.15  -176.93 
28 1 HIS B 480 ? ? -164.24 96.85   
29 1 LEU B 485 ? ? -45.11  156.90  
30 1 LYS B 499 ? ? -69.18  19.68   
31 1 SER B 501 ? ? 58.40   7.16    
32 1 GLU B 521 ? ? -59.02  108.98  
33 1 ALA B 530 ? ? -88.75  -92.29  
34 1 ALA B 531 ? ? -2.90   132.92  
35 1 SER B 542 ? ? 167.23  155.00  
36 1 ASP D 330 ? ? -131.47 -90.39  
37 1 ILE D 350 ? ? -74.15  -85.86  
38 1 ARG D 351 ? ? -46.53  -17.92  
39 1 LYS D 352 ? ? 45.05   24.33   
40 1 PRO D 365 ? ? -32.47  102.37  
41 1 THR D 369 ? ? -61.20  -171.64 
42 1 VAL D 370 ? ? -148.61 36.81   
43 1 ASN D 371 ? ? -12.69  123.11  
44 1 PRO D 381 ? ? -46.58  165.29  
45 1 ASN D 394 ? ? -74.74  31.18   
46 1 THR D 396 ? ? -71.46  -164.20 
47 1 GLU D 412 ? ? -82.31  30.71   
48 1 HIS D 424 ? ? -78.66  28.90   
49 1 PRO D 426 ? ? -61.59  -88.96  
50 1 MET D 470 ? ? -175.06 141.89  
51 1 PRO D 471 ? ? -53.69  -177.82 
52 1 GLN D 477 ? ? -173.73 -179.71 
53 1 HIS D 480 ? ? -164.67 96.76   
54 1 GLN D 484 ? ? -68.46  94.69   
55 1 LEU D 485 ? ? -45.34  158.67  
56 1 LYS D 499 ? ? -68.96  19.15   
57 1 SER D 501 ? ? 58.65   7.27    
58 1 GLU D 521 ? ? -57.89  109.25  
59 1 ALA D 530 ? ? -89.81  -91.10  
60 1 ALA D 531 ? ? -3.92   133.08  
61 1 SER D 542 ? ? 166.90  155.20  
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 1 C1 ? A MAN 223 ? 'WRONG HAND' . 
2 1 C1 ? A MAN 244 ? 'WRONG HAND' . 
3 1 C1 ? B MAN 696 ? 'WRONG HAND' . 
4 1 C1 ? D MAN 696 ? 'WRONG HAND' . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A CPS 370 ? C24 ? Q  CPS 1 C24 
2  1 N 1 A CPS 370 ? C25 ? Q  CPS 1 C25 
3  1 N 1 A CPS 370 ? C26 ? Q  CPS 1 C26 
4  1 N 1 A CPS 370 ? C27 ? Q  CPS 1 C27 
5  1 N 1 A CPS 370 ? C28 ? Q  CPS 1 C28 
6  1 N 1 A CPS 370 ? C29 ? Q  CPS 1 C29 
7  1 N 1 A CPS 370 ? C30 ? Q  CPS 1 C30 
8  1 N 1 A CPS 370 ? C31 ? Q  CPS 1 C31 
9  1 N 1 A CPS 370 ? C32 ? Q  CPS 1 C32 
10 1 N 1 A CPS 370 ? N1  ? Q  CPS 1 N1  
11 1 N 1 A CPS 370 ? N2  ? Q  CPS 1 N2  
12 1 N 1 A CPS 370 ? O1  ? Q  CPS 1 O1  
13 1 N 1 A CPS 370 ? O2S ? Q  CPS 1 O2S 
14 1 N 1 A CPS 370 ? O3S ? Q  CPS 1 O3S 
15 1 N 1 A CPS 370 ? O1S ? Q  CPS 1 O1S 
16 1 N 1 A CPS 370 ? S   ? Q  CPS 1 S   
17 1 N 1 D CPS 103 ? C24 ? FA CPS 1 C24 
18 1 N 1 D CPS 103 ? C25 ? FA CPS 1 C25 
19 1 N 1 D CPS 103 ? C26 ? FA CPS 1 C26 
20 1 N 1 D CPS 103 ? C27 ? FA CPS 1 C27 
21 1 N 1 D CPS 103 ? C28 ? FA CPS 1 C28 
22 1 N 1 D CPS 103 ? C29 ? FA CPS 1 C29 
23 1 N 1 D CPS 103 ? C30 ? FA CPS 1 C30 
24 1 N 1 D CPS 103 ? C31 ? FA CPS 1 C31 
25 1 N 1 D CPS 103 ? C32 ? FA CPS 1 C32 
26 1 N 1 D CPS 103 ? N1  ? FA CPS 1 N1  
27 1 N 1 D CPS 103 ? N2  ? FA CPS 1 N2  
28 1 N 1 D CPS 103 ? O1  ? FA CPS 1 O1  
29 1 N 1 D CPS 103 ? O2S ? FA CPS 1 O2S 
30 1 N 1 D CPS 103 ? O3S ? FA CPS 1 O3S 
31 1 N 1 D CPS 103 ? O1S ? FA CPS 1 O1S 
32 1 N 1 D CPS 103 ? S   ? FA CPS 1 S   
33 1 N 1 D CPS 104 ? C24 ? GA CPS 1 C24 
34 1 N 1 D CPS 104 ? C25 ? GA CPS 1 C25 
35 1 N 1 D CPS 104 ? C26 ? GA CPS 1 C26 
36 1 N 1 D CPS 104 ? C27 ? GA CPS 1 C27 
37 1 N 1 D CPS 104 ? C28 ? GA CPS 1 C28 
38 1 N 1 D CPS 104 ? C29 ? GA CPS 1 C29 
39 1 N 1 D CPS 104 ? C30 ? GA CPS 1 C30 
40 1 N 1 D CPS 104 ? C31 ? GA CPS 1 C31 
41 1 N 1 D CPS 104 ? C32 ? GA CPS 1 C32 
42 1 N 1 D CPS 104 ? N1  ? GA CPS 1 N1  
43 1 N 1 D CPS 104 ? N2  ? GA CPS 1 N2  
44 1 N 1 D CPS 104 ? O1  ? GA CPS 1 O1  
45 1 N 1 D CPS 104 ? O2S ? GA CPS 1 O2S 
46 1 N 1 D CPS 104 ? O3S ? GA CPS 1 O3S 
47 1 N 1 D CPS 104 ? O1S ? GA CPS 1 O1S 
48 1 N 1 D CPS 104 ? S   ? GA CPS 1 S   
49 1 N 1 D CPS 105 ? C24 ? HA CPS 1 C24 
50 1 N 1 D CPS 105 ? C25 ? HA CPS 1 C25 
51 1 N 1 D CPS 105 ? C26 ? HA CPS 1 C26 
52 1 N 1 D CPS 105 ? C27 ? HA CPS 1 C27 
53 1 N 1 D CPS 105 ? C28 ? HA CPS 1 C28 
54 1 N 1 D CPS 105 ? C29 ? HA CPS 1 C29 
55 1 N 1 D CPS 105 ? C30 ? HA CPS 1 C30 
56 1 N 1 D CPS 105 ? C31 ? HA CPS 1 C31 
57 1 N 1 D CPS 105 ? C32 ? HA CPS 1 C32 
58 1 N 1 D CPS 105 ? N1  ? HA CPS 1 N1  
59 1 N 1 D CPS 105 ? N2  ? HA CPS 1 N2  
60 1 N 1 D CPS 105 ? O1  ? HA CPS 1 O1  
61 1 N 1 D CPS 105 ? O2S ? HA CPS 1 O2S 
62 1 N 1 D CPS 105 ? O3S ? HA CPS 1 O3S 
63 1 N 1 D CPS 105 ? O1S ? HA CPS 1 O1S 
64 1 N 1 D CPS 105 ? S   ? HA CPS 1 S   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 174 ? A ARG 174 
2  1 Y 1 A GLU 175 ? A GLU 175 
3  1 Y 1 A LYS 176 ? A LYS 176 
4  1 Y 1 B ALA 326 ? B ALA 1   
5  1 Y 1 B ASP 327 ? B ASP 2   
6  1 Y 1 B PRO 545 ? B PRO 220 
7  1 Y 1 B GLY 546 ? B GLY 221 
8  1 Y 1 B LYS 547 ? B LYS 222 
9  1 Y 1 D ALA 326 ? C ALA 1   
10 1 Y 1 D ASP 327 ? C ASP 2   
11 1 Y 1 D PRO 328 ? C PRO 3   
12 1 Y 1 D PRO 545 ? C PRO 220 
13 1 Y 1 D GLY 546 ? C GLY 221 
14 1 Y 1 D LYS 547 ? C LYS 222 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 N-ACETYL-D-GLUCOSAMINE                                      NAG 
4 ALPHA-D-MANNOSE                                             MAN 
5 ALPHA-L-FUCOSE                                              FUC 
6 'SULFATE ION'                                               SO4 
7 '3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-PROPANESULFONATE' CPS 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D  3 NAG 1 221 221 NAG NAG A . 
E  3 NAG 2 222 222 NAG NAG A . 
F  4 MAN 3 223 223 MAN MAN A . 
G  5 FUC 4 224 224 FUC FUC A . 
H  3 NAG 1 242 242 NAG NAG A . 
I  3 NAG 2 243 243 NAG NAG A . 
J  4 MAN 3 244 244 MAN MAN A . 
K  4 MAN 4 245 245 MAN MAN A . 
L  4 MAN 5 246 246 MAN MAN A . 
M  3 NAG 1 366 366 NAG NAG A . 
N  3 NAG 2 367 367 NAG NAG A . 
O  5 FUC 3 369 369 FUC FUC A . 
P  6 SO4 1 203 103 SO4 SO4 A . 
Q  7 CPS 1 370 101 CPS CPS A . 
R  7 CPS 1 371 102 CPS CPS A . 
S  3 NAG 1 694 694 NAG NAG B . 
T  3 NAG 2 695 695 NAG NAG B . 
U  4 MAN 3 696 696 MAN MAN B . 
V  4 MAN 4 697 697 MAN MAN B . 
W  4 MAN 5 698 698 MAN MAN B . 
X  4 MAN 6 699 699 MAN MAN B . 
Y  6 SO4 1 201 101 SO4 SO4 B . 
Z  6 SO4 1 202 102 SO4 SO4 B . 
AA 6 SO4 1 204 104 SO4 SO4 B . 
BA 3 NAG 1 694 694 NAG NAG D . 
CA 3 NAG 2 695 695 NAG NAG D . 
DA 4 MAN 3 696 696 MAN MAN D . 
EA 6 SO4 1 205 105 SO4 SO4 D . 
FA 7 CPS 1 103 103 CPS CPS D . 
GA 7 CPS 1 104 104 CPS CPS D . 
HA 7 CPS 1 105 105 CPS CPS D . 
#