data_1F9E
# 
_entry.id   1F9E 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1F9E         
RCSB  RCSB011405   
WWPDB D_1000011405 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1QDU 'Caspase-8 in complex with the tripeptide inhibitor, Z-EVD-dcbmk' unspecified 
PDB 1QTN Caspase-8-ACE-IETD-cho                                            unspecified 
PDB 1PAU Caspase-3-ACE-DEVD-cho                                            unspecified 
PDB 1CP3 Caspase-3-Ac-DQMD-fmk                                             unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1F9E 
_pdbx_database_status.recvd_initial_deposition_date   2000-07-10 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Blanchard, H.'   1 
'Donepudi, M.'    2 
'Tschopp, M.'     3 
'Kodandapani, L.' 4 
'Wu, J.C.'        5 
'Grutter, M.G.'   6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Caspase-8 specificity probed at subsite S(4): crystal structure of the caspase-8-Z-DEVD-cho complex.' J.Mol.Biol. 302 9 
16   2000 JMOBAK UK 0022-2836 0070 ? 10964557 10.1006/jmbi.2000.4041          
1       'The three-dimensional structure of caspase-8: an initiator enzyme in apoptosis'                       Structure   7   
1125 1133 1999 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(99)80179-8' 
2       'The atomic-resolution of human caspase-8, a key activator of apoptosis.'                              Structure   7   
1135 1143 1999 STRUE6 UK 0969-2126 2005 ? ?        '10.1016/S0969-2126(99)80180-4' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Blanchard, H.'    1  
primary 'Donepudi, M.'     2  
primary 'Tschopp, M.'      3  
primary 'Kodandapani, L.'  4  
primary 'Wu, J.C.'         5  
primary 'Grutter, M.G.'    6  
1       'Blanchard, H.'    7  
1       'Kodandapani, L.'  8  
1       'Mittl, P.R.E.'    9  
1       'Marco, S.D.'      10 
1       'Krebs, J.F.'      11 
1       'Wu, J.C.'         12 
1       'Tomaselli, K.J.'  13 
1       'Gruetter, M.G.'   14 
2       'Watt, W.'         15 
2       'Koeplinger, K.A.' 16 
2       'Mildner, A.M.'    17 
2       'Heinrikson, R.L.' 18 
2       'Tomasselli, A.G.' 19 
2       'Watenpaugh, K.D.' 20 
# 
_cell.entry_id           1F9E 
_cell.length_a           98.029 
_cell.length_b           188.748 
_cell.length_c           209.802 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1F9E 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'CASPASE-8 ALPHA CHAIN' 17416.957 6  3.4.22.- ? ? ? 
2 polymer man 'CASPASE-8 BETA CHAIN'  10273.719 6  ?        ? ? ? 
3 polymer syn '(PHQ)DEVD'             613.013   6  ?        ? ? ? 
4 water   nat water                   18.015    47 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHHDCTVEQIYEILKIYQL
MDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
;
;LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHHDCTVEQIYEILKIYQL
MDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD
;
A,C,E,G,I,K ? 
2 'polypeptide(L)' no no  
;TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFT
LRKKLVFPS
;
;TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFT
LRKKLVFPS
;
B,D,F,H,J,L ? 
3 'polypeptide(L)' no yes '(PHQ)DEV(ASA)' XDEVD Q,R,S,T,U,V ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   ASP n 
1 3   LYS n 
1 4   VAL n 
1 5   TYR n 
1 6   GLN n 
1 7   MET n 
1 8   LYS n 
1 9   SER n 
1 10  LYS n 
1 11  PRO n 
1 12  ARG n 
1 13  GLY n 
1 14  TYR n 
1 15  CYS n 
1 16  LEU n 
1 17  ILE n 
1 18  ILE n 
1 19  ASN n 
1 20  ASN n 
1 21  HIS n 
1 22  ASN n 
1 23  PHE n 
1 24  ALA n 
1 25  LYS n 
1 26  ALA n 
1 27  ARG n 
1 28  GLU n 
1 29  LYS n 
1 30  VAL n 
1 31  PRO n 
1 32  LYS n 
1 33  LEU n 
1 34  HIS n 
1 35  SER n 
1 36  ILE n 
1 37  ARG n 
1 38  ASP n 
1 39  ARG n 
1 40  ASN n 
1 41  GLY n 
1 42  THR n 
1 43  HIS n 
1 44  LEU n 
1 45  ASP n 
1 46  ALA n 
1 47  GLY n 
1 48  ALA n 
1 49  LEU n 
1 50  THR n 
1 51  THR n 
1 52  THR n 
1 53  PHE n 
1 54  GLU n 
1 55  GLU n 
1 56  LEU n 
1 57  HIS n 
1 58  PHE n 
1 59  GLU n 
1 60  ILE n 
1 61  LYS n 
1 62  PRO n 
1 63  HIS n 
1 64  HIS n 
1 65  ASP n 
1 66  CYS n 
1 67  THR n 
1 68  VAL n 
1 69  GLU n 
1 70  GLN n 
1 71  ILE n 
1 72  TYR n 
1 73  GLU n 
1 74  ILE n 
1 75  LEU n 
1 76  LYS n 
1 77  ILE n 
1 78  TYR n 
1 79  GLN n 
1 80  LEU n 
1 81  MET n 
1 82  ASP n 
1 83  HIS n 
1 84  SER n 
1 85  ASN n 
1 86  MET n 
1 87  ASP n 
1 88  CYS n 
1 89  PHE n 
1 90  ILE n 
1 91  CYS n 
1 92  CYS n 
1 93  ILE n 
1 94  LEU n 
1 95  SER n 
1 96  HIS n 
1 97  GLY n 
1 98  ASP n 
1 99  LYS n 
1 100 GLY n 
1 101 ILE n 
1 102 ILE n 
1 103 TYR n 
1 104 GLY n 
1 105 THR n 
1 106 ASP n 
1 107 GLY n 
1 108 GLN n 
1 109 GLU n 
1 110 ALA n 
1 111 PRO n 
1 112 ILE n 
1 113 TYR n 
1 114 GLU n 
1 115 LEU n 
1 116 THR n 
1 117 SER n 
1 118 GLN n 
1 119 PHE n 
1 120 THR n 
1 121 GLY n 
1 122 LEU n 
1 123 LYS n 
1 124 CYS n 
1 125 PRO n 
1 126 SER n 
1 127 LEU n 
1 128 ALA n 
1 129 GLY n 
1 130 LYS n 
1 131 PRO n 
1 132 LYS n 
1 133 VAL n 
1 134 PHE n 
1 135 PHE n 
1 136 ILE n 
1 137 GLN n 
1 138 ALA n 
1 139 CYS n 
1 140 GLN n 
1 141 GLY n 
1 142 ASP n 
1 143 ASN n 
1 144 TYR n 
1 145 GLN n 
1 146 LYS n 
1 147 GLY n 
1 148 ILE n 
1 149 PRO n 
1 150 VAL n 
1 151 GLU n 
1 152 THR n 
1 153 ASP n 
2 1   THR n 
2 2   ARG n 
2 3   TYR n 
2 4   ILE n 
2 5   PRO n 
2 6   ASP n 
2 7   GLU n 
2 8   ALA n 
2 9   ASP n 
2 10  PHE n 
2 11  LEU n 
2 12  LEU n 
2 13  GLY n 
2 14  MET n 
2 15  ALA n 
2 16  THR n 
2 17  VAL n 
2 18  ASN n 
2 19  ASN n 
2 20  CYS n 
2 21  VAL n 
2 22  SER n 
2 23  TYR n 
2 24  ARG n 
2 25  ASN n 
2 26  PRO n 
2 27  ALA n 
2 28  GLU n 
2 29  GLY n 
2 30  THR n 
2 31  TRP n 
2 32  TYR n 
2 33  ILE n 
2 34  GLN n 
2 35  SER n 
2 36  LEU n 
2 37  CYS n 
2 38  GLN n 
2 39  SER n 
2 40  LEU n 
2 41  ARG n 
2 42  GLU n 
2 43  ARG n 
2 44  CYS n 
2 45  PRO n 
2 46  ARG n 
2 47  GLY n 
2 48  ASP n 
2 49  ASP n 
2 50  ILE n 
2 51  LEU n 
2 52  THR n 
2 53  ILE n 
2 54  LEU n 
2 55  THR n 
2 56  GLU n 
2 57  VAL n 
2 58  ASN n 
2 59  TYR n 
2 60  GLU n 
2 61  VAL n 
2 62  SER n 
2 63  ASN n 
2 64  LYS n 
2 65  ASP n 
2 66  ASP n 
2 67  LYS n 
2 68  LYS n 
2 69  ASN n 
2 70  MET n 
2 71  GLY n 
2 72  LYS n 
2 73  GLN n 
2 74  MET n 
2 75  PRO n 
2 76  GLN n 
2 77  PRO n 
2 78  THR n 
2 79  PHE n 
2 80  THR n 
2 81  LEU n 
2 82  ARG n 
2 83  LYS n 
2 84  LYS n 
2 85  LEU n 
2 86  VAL n 
2 87  PHE n 
2 88  PRO n 
2 89  SER n 
3 1   PHQ n 
3 2   ASP n 
3 3   GLU n 
3 4   VAL n 
3 5   ASA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? PLASMID ? ? ? PET21B ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? PLASMID ? ? ? PET21B ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 AAC50645   GB  1 1401352 ? ? ? 
2 ICE8_HUMAN UNP 2 Q14790  ? ? ? 
3 1F9E       PDB 3 1F9E    ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1F9E A 1 ? 153 ? 1401352 239  ? 391  ? 149  299  
2  1 1F9E C 1 ? 153 ? 401352  239  ? 391  ? 149  299  
3  1 1F9E E 1 ? 153 ? 401352  239  ? 391  ? 149  299  
4  1 1F9E G 1 ? 153 ? 401352  239  ? 391  ? 149  299  
5  1 1F9E I 1 ? 153 ? 401352  239  ? 391  ? 149  299  
6  1 1F9E K 1 ? 153 ? 401352  239  ? 391  ? 149  299  
7  2 1F9E B 1 ? 89  ? Q14790  390  ? 478  ? 318  402  
8  2 1F9E D 1 ? 89  ? Q14790  390  ? 478  ? 318  402  
9  2 1F9E F 1 ? 89  ? Q14790  390  ? 478  ? 318  402  
10 2 1F9E J 1 ? 89  ? Q14790  390  ? 478  ? 318  402  
11 2 1F9E L 1 ? 89  ? Q14790  390  ? 478  ? 318  402  
12 3 1F9E Q 1 ? 5   ? 1F9E    4100 ? 4104 ? 4100 4104 
13 3 1F9E R 1 ? 5   ? 1F9E    4200 ? 4204 ? 4200 4204 
14 3 1F9E S 1 ? 5   ? 1F9E    4300 ? 4304 ? 4300 4304 
15 3 1F9E T 1 ? 5   ? 1F9E    4400 ? 4404 ? 4400 4404 
16 3 1F9E U 1 ? 5   ? 1F9E    4500 ? 4504 ? 4500 4504 
17 3 1F9E V 1 ? 5   ? 1F9E    4600 ? 4604 ? 4600 4604 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ? 'C6 H15 N4 O2 1' 175.209 
ASA 'L-peptide linking' n 'ASPARTIC ALDEHYDE'      ? 'C4 H7 N O3'     117.103 
ASN 'L-peptide linking' y ASPARAGINE               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ? 'C9 H11 N O2'    165.189 
PHQ non-polymer         . 'benzyl chlorocarbonate' ? 'C8 H7 Cl O2'    170.593 
PRO 'L-peptide linking' y PROLINE                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1F9E 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.96 
_exptl_crystal.density_Matthews      2.86 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;1-propanol, sodium citrate, MES 
, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 4.0K, temperature 277K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-11-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.934 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_wavelength             0.934 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1F9E 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20.0 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   42872 
_reflns.number_all                   42891 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.0850000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        18.6 
_reflns.B_iso_Wilson_estimate        65.2 
_reflns.pdbx_redundancy              5.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.90 
_reflns_shell.d_res_low              2.97 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.5370000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        4.5 
_reflns_shell.number_unique_all      2839 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1F9E 
_refine.ls_number_reflns_obs                     42872 
_refine.ls_number_reflns_all                     43103 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             19.94 
_refine.ls_d_res_high                            2.9 
_refine.ls_percent_reflns_obs                    98.5 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2410000 
_refine.ls_R_factor_R_free                       0.2890000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  4318 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       
;CNS_TOPPAR:protein_rep.param     
CNS_TOPPAR:water_rep.param     
CNS_TOPPAR:protein.top     
CNS_TOPPAR:water.top     
topology.pro (inhibitor topology)     
parameter.pro (inhibitor parameters)
;
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11879 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             47 
_refine_hist.number_atoms_total               11926 
_refine_hist.d_res_high                       2.9 
_refine_hist.d_res_low                        19.94 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_torsion_deg      23.1  ? ? ? 'X-RAY DIFFRACTION' ? 
c_torsion_impr_deg 1.83  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1F9E 
_struct.title                     'CASPASE-8 SPECIFICITY PROBED AT SUBSITE S4: CRYSTAL STRUCTURE OF THE CASPASE-8-Z-DEVD-CHO' 
_struct.pdbx_descriptor           'CASPASE-8 (E.C.3.4.22.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1F9E 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'CYSTEINE PROTEASE, CASPASE-8, FLICE, MCH5, MACH, APOPTOSIS, HYDROLASE-HYDROLASE INHIBITOR COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 1 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 1 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 
;Each caspase-8 molecule is a tetramer 
consisting of 2(p18/p12) chains.
;
? 
2 ?                                                                         ? 
3 ?                                                                         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  3  GLY A 41  ? LEU A 56  ? GLY A 181 LEU A 196 1 ? 16 
HELX_P HELX_P2  4  THR A 67  ? MET A 81  ? THR A 207 MET A 221 1 ? 15 
HELX_P HELX_P3  5  ILE A 112 ? SER A 117 ? ILE A 258 SER A 263 1 ? 6  
HELX_P HELX_P4  6  GLN A 118 ? THR A 120 ? GLN A 264 THR A 266 5 ? 3  
HELX_P HELX_P5  7  CYS A 124 ? ALA A 128 ? CYS A 270 ALA A 274 5 ? 5  
HELX_P HELX_P6  8  TRP B 31  ? CYS B 44  ? TRP B 348 CYS B 361 1 ? 14 
HELX_P HELX_P7  9  PRO B 45  ? GLY B 47  ? PRO B 362 GLY B 363 5 ? 3  
HELX_P HELX_P8  10 ASP B 49  ? LYS B 64  ? ASP B 365 LYS B 381 1 ? 16 
HELX_P HELX_P9  12 GLY D 41  ? LEU D 56  ? GLY C 181 LEU C 196 1 ? 16 
HELX_P HELX_P10 13 THR D 67  ? MET D 81  ? THR C 207 MET C 221 1 ? 15 
HELX_P HELX_P11 14 ILE D 112 ? SER D 117 ? ILE C 258 SER C 263 1 ? 6  
HELX_P HELX_P12 15 GLN D 118 ? THR D 120 ? GLN C 264 THR C 266 5 ? 3  
HELX_P HELX_P13 16 CYS D 124 ? ALA D 128 ? CYS C 270 ALA C 274 5 ? 5  
HELX_P HELX_P14 17 TRP E 31  ? CYS E 44  ? TRP D 348 CYS D 361 1 ? 14 
HELX_P HELX_P15 18 PRO E 45  ? GLY E 47  ? PRO D 362 GLY D 363 5 ? 3  
HELX_P HELX_P16 19 ASP E 49  ? LYS E 64  ? ASP D 365 LYS D 381 1 ? 16 
HELX_P HELX_P17 22 GLY G 41  ? LEU G 56  ? GLY E 181 LEU E 196 1 ? 16 
HELX_P HELX_P18 23 THR G 67  ? MET G 81  ? THR E 207 MET E 221 1 ? 15 
HELX_P HELX_P19 24 ILE G 112 ? SER G 117 ? ILE E 258 SER E 263 1 ? 6  
HELX_P HELX_P20 25 GLN G 118 ? THR G 120 ? GLN E 264 THR E 266 5 ? 3  
HELX_P HELX_P21 26 CYS G 124 ? ALA G 128 ? CYS E 270 ALA E 274 5 ? 5  
HELX_P HELX_P22 27 TRP H 31  ? CYS H 44  ? TRP F 348 CYS F 361 1 ? 14 
HELX_P HELX_P23 28 PRO H 45  ? GLY H 47  ? PRO F 362 GLY F 363 5 ? 3  
HELX_P HELX_P24 29 ASP H 49  ? LYS H 64  ? ASP F 365 LYS F 381 1 ? 16 
HELX_P HELX_P25 32 GLY J 41  ? LEU J 56  ? GLY G 181 LEU G 196 1 ? 16 
HELX_P HELX_P26 33 THR J 67  ? MET J 81  ? THR G 207 MET G 221 1 ? 15 
HELX_P HELX_P27 34 ILE J 112 ? SER J 117 ? ILE G 258 SER G 263 1 ? 6  
HELX_P HELX_P28 35 GLN J 118 ? THR J 120 ? GLN G 264 THR G 266 5 ? 3  
HELX_P HELX_P29 36 CYS J 124 ? ALA J 128 ? CYS G 270 ALA G 274 5 ? 5  
HELX_P HELX_P30 37 TRP K 31  ? CYS K 44  ? TRP H 348 CYS H 361 1 ? 14 
HELX_P HELX_P31 38 PRO K 45  ? GLY K 47  ? PRO H 362 GLY H 363 5 ? 3  
HELX_P HELX_P32 39 ASP K 49  ? LYS K 64  ? ASP H 365 LYS H 381 1 ? 16 
HELX_P HELX_P33 42 GLY M 41  ? LEU M 56  ? GLY I 181 LEU I 196 1 ? 16 
HELX_P HELX_P34 43 THR M 67  ? MET M 81  ? THR I 207 MET I 221 1 ? 15 
HELX_P HELX_P35 44 ILE M 112 ? SER M 117 ? ILE I 258 SER I 263 1 ? 6  
HELX_P HELX_P36 45 GLN M 118 ? THR M 120 ? GLN I 264 THR I 266 5 ? 3  
HELX_P HELX_P37 46 CYS M 124 ? ALA M 128 ? CYS I 270 ALA I 274 5 ? 5  
HELX_P HELX_P38 47 TRP N 31  ? CYS N 44  ? TRP J 348 CYS J 361 1 ? 14 
HELX_P HELX_P39 48 PRO N 45  ? GLY N 47  ? PRO J 362 GLY J 363 5 ? 3  
HELX_P HELX_P40 49 ASP N 49  ? LYS N 64  ? ASP J 365 LYS J 381 1 ? 16 
HELX_P HELX_P41 51 GLY P 41  ? LEU P 56  ? GLY K 181 LEU K 196 1 ? 16 
HELX_P HELX_P42 52 THR P 67  ? MET P 81  ? THR K 207 MET K 221 1 ? 15 
HELX_P HELX_P43 53 ILE P 112 ? SER P 117 ? ILE K 258 SER K 263 1 ? 6  
HELX_P HELX_P44 54 GLN P 118 ? THR P 120 ? GLN K 264 THR K 266 5 ? 3  
HELX_P HELX_P45 55 CYS P 124 ? ALA P 128 ? CYS K 270 ALA K 274 5 ? 5  
HELX_P HELX_P46 56 TRP Q 31  ? CYS Q 44  ? TRP L 348 CYS L 361 1 ? 14 
HELX_P HELX_P47 57 PRO Q 45  ? GLY Q 47  ? PRO L 362 GLY L 363 5 ? 3  
HELX_P HELX_P48 58 ASP Q 49  ? LYS Q 64  ? ASP L 365 LYS L 381 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? C PHQ 1   C1 ? ? ? 1_555 C ASP 2 N ? ? Q PHQ 4100 Q ASP 4101 1_555 ? ? ? ? ? ? ? 1.269 ? 
covale2  covale ? ? F PHQ 1   C1 ? ? ? 1_555 F ASP 2 N ? ? R PHQ 4200 R ASP 4201 1_555 ? ? ? ? ? ? ? 1.316 ? 
covale3  covale ? ? I PHQ 1   C1 ? ? ? 1_555 I ASP 2 N ? ? S PHQ 4300 S ASP 4301 1_555 ? ? ? ? ? ? ? 1.290 ? 
covale4  covale ? ? L PHQ 1   C1 ? ? ? 1_555 L ASP 2 N ? ? T PHQ 4400 T ASP 4401 1_555 ? ? ? ? ? ? ? 1.237 ? 
covale5  covale ? ? O PHQ 1   C1 ? ? ? 1_555 O ASP 2 N ? ? U PHQ 4500 U ASP 4501 1_555 ? ? ? ? ? ? ? 1.302 ? 
covale6  covale ? ? R PHQ 1   C1 ? ? ? 1_555 R ASP 2 N ? ? V PHQ 4600 V ASP 4601 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7  covale ? ? C VAL 4   C  ? ? ? 1_555 C ASA 5 N ? ? Q VAL 4103 Q ASA 4104 1_555 ? ? ? ? ? ? ? 1.269 ? 
covale8  covale ? ? F VAL 4   C  ? ? ? 1_555 F ASA 5 N ? ? R VAL 4203 R ASA 4204 1_555 ? ? ? ? ? ? ? 1.204 ? 
covale9  covale ? ? I VAL 4   C  ? ? ? 1_555 I ASA 5 N ? ? S VAL 4303 S ASA 4304 1_555 ? ? ? ? ? ? ? 1.213 ? 
covale10 covale ? ? L VAL 4   C  ? ? ? 1_555 L ASA 5 N ? ? T VAL 4403 T ASA 4404 1_555 ? ? ? ? ? ? ? 1.203 ? 
covale11 covale ? ? O VAL 4   C  ? ? ? 1_555 O ASA 5 N ? ? U VAL 4503 U ASA 4504 1_555 ? ? ? ? ? ? ? 1.204 ? 
covale12 covale ? ? M CYS 139 SG ? ? ? 1_555 O ASA 5 C ? ? I CYS 285  U ASA 4504 1_555 ? ? ? ? ? ? ? 1.785 ? 
covale13 covale ? ? D CYS 139 SG ? ? ? 1_555 F ASA 5 C ? ? C CYS 285  R ASA 4204 1_555 ? ? ? ? ? ? ? 1.835 ? 
covale14 covale ? ? J CYS 139 SG ? ? ? 1_555 L ASA 5 C ? ? G CYS 285  T ASA 4404 1_555 ? ? ? ? ? ? ? 1.839 ? 
covale15 covale ? ? A CYS 139 SG ? ? ? 1_555 C ASA 5 C ? ? A CYS 285  Q ASA 4104 1_555 ? ? ? ? ? ? ? 1.852 ? 
covale16 covale ? ? P CYS 139 SG ? ? ? 1_555 R ASA 5 C ? ? K CYS 285  V ASA 4604 1_555 ? ? ? ? ? ? ? 1.858 ? 
covale17 covale ? ? G CYS 139 SG ? ? ? 1_555 I ASA 5 C ? ? E CYS 285  S ASA 4304 1_555 ? ? ? ? ? ? ? 1.909 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 6 ? 
G ? 3 ? 
H ? 3 ? 
I ? 6 ? 
J ? 3 ? 
K ? 2 ? 
L ? 3 ? 
M ? 2 ? 
N ? 6 ? 
O ? 3 ? 
P ? 2 ? 
Q ? 6 ? 
R ? 3 ? 
S ? 2 ? 
T ? 2 ? 
U ? 2 ? 
V ? 6 ? 
W ? 3 ? 
X ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? parallel      
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? parallel      
I 3 4 ? parallel      
I 4 5 ? parallel      
I 5 6 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? parallel      
N 3 4 ? parallel      
N 4 5 ? parallel      
N 5 6 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? parallel      
Q 3 4 ? parallel      
Q 4 5 ? parallel      
Q 5 6 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
S 1 2 ? anti-parallel 
T 1 2 ? anti-parallel 
U 1 2 ? anti-parallel 
V 1 2 ? parallel      
V 2 3 ? parallel      
V 3 4 ? parallel      
V 4 5 ? parallel      
V 5 6 ? anti-parallel 
W 1 2 ? anti-parallel 
W 2 3 ? anti-parallel 
X 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 59  ? HIS A 64  ? GLU A 199  HIS A 204  
A 2 TYR A 14  ? ASN A 19  ? TYR A 164  ASN A 169  
A 3 PHE A 89  ? LEU A 94  ? PHE A 230  LEU A 235  
A 4 LYS A 132 ? GLN A 137 ? LYS A 278  GLN A 283  
A 5 PHE B 10  ? MET B 14  ? PHE B 327  MET B 331  
A 6 GLN B 76  ? PHE B 79  ? GLN B 388  PHE B 392  
B 1 GLY A 97  ? ASP A 98  ? GLY A 238  ASP A 239  
B 2 ILE A 101 ? TYR A 103 ? ILE A 242  TYR A 244  
B 3 GLU A 109 ? PRO A 111 ? GLU A 255  PRO A 257  
C 1 GLY A 147 ? PRO A 149 ? GLY A 293  PRO A 295  
C 2 TYR E 3   ? PRO E 5   ? TYR D 320  PRO D 322  
D 1 TYR B 3   ? PRO B 5   ? TYR B 320  PRO B 322  
D 2 GLY D 147 ? PRO D 149 ? GLY C 293  PRO C 295  
E 1 ARG B 24  ? ASN B 25  ? ARG B 341  ASN B 342  
E 2 GLY B 29  ? THR B 30  ? GLY B 346  THR B 347  
F 1 GLU D 59  ? HIS D 64  ? GLU C 199  HIS C 204  
F 2 TYR D 14  ? ASN D 19  ? TYR C 164  ASN C 169  
F 3 PHE D 89  ? LEU D 94  ? PHE C 230  LEU C 235  
F 4 LYS D 132 ? GLN D 137 ? LYS C 278  GLN C 283  
F 5 PHE E 10  ? MET E 14  ? PHE D 327  MET D 331  
F 6 GLN E 76  ? PHE E 79  ? GLN D 388  PHE D 392  
G 1 GLY D 97  ? ASP D 98  ? GLY C 238  ASP C 239  
G 2 ILE D 101 ? TYR D 103 ? ILE C 242  TYR C 244  
G 3 GLU D 109 ? PRO D 111 ? GLU C 255  PRO C 257  
H 1 GLY E 29  ? THR E 30  ? GLY D 346  THR D 347  
H 2 TYR E 23  ? ASN E 25  ? TYR D 340  ASN D 342  
H 3 GLU F 3   ? VAL F 4   ? GLU R 4202 VAL R 4203 
I 1 GLU G 59  ? HIS G 64  ? GLU E 199  HIS E 204  
I 2 TYR G 14  ? ASN G 19  ? TYR E 164  ASN E 169  
I 3 PHE G 89  ? LEU G 94  ? PHE E 230  LEU E 235  
I 4 LYS G 132 ? GLN G 137 ? LYS E 278  GLN E 283  
I 5 PHE H 10  ? MET H 14  ? PHE F 327  MET F 331  
I 6 GLN H 76  ? PHE H 79  ? GLN F 388  PHE F 392  
J 1 GLY G 97  ? ASP G 98  ? GLY E 238  ASP E 239  
J 2 ILE G 101 ? TYR G 103 ? ILE E 242  TYR E 244  
J 3 GLU G 109 ? PRO G 111 ? GLU E 255  PRO E 257  
K 1 GLY G 147 ? PRO G 149 ? GLY E 293  PRO E 295  
K 2 TYR K 3   ? PRO K 5   ? TYR H 320  PRO H 322  
L 1 TYR H 3   ? PRO H 5   ? TYR F 320  PRO F 322  
L 2 GLN J 145 ? PRO J 149 ? GLN G 291  PRO G 295  
L 3 GLY K 71  ? LYS K 72  ? GLY H 383  LYS H 384  
M 1 ARG H 24  ? ASN H 25  ? ARG F 341  ASN F 342  
M 2 GLY H 29  ? THR H 30  ? GLY F 346  THR F 347  
N 1 GLU J 59  ? HIS J 64  ? GLU G 199  HIS G 204  
N 2 TYR J 14  ? ASN J 19  ? TYR G 164  ASN G 169  
N 3 PHE J 89  ? LEU J 94  ? PHE G 230  LEU G 235  
N 4 LYS J 132 ? GLN J 137 ? LYS G 278  GLN G 283  
N 5 PHE K 10  ? MET K 14  ? PHE H 327  MET H 331  
N 6 GLN K 76  ? PHE K 79  ? GLN H 388  PHE H 392  
O 1 GLY J 97  ? ASP J 98  ? GLY G 238  ASP G 239  
O 2 ILE J 101 ? TYR J 103 ? ILE G 242  TYR G 244  
O 3 GLU J 109 ? PRO J 111 ? GLU G 255  PRO G 257  
P 1 ARG K 24  ? ASN K 25  ? ARG H 341  ASN H 342  
P 2 GLY K 29  ? THR K 30  ? GLY H 346  THR H 347  
Q 1 GLU M 59  ? HIS M 64  ? GLU I 199  HIS I 204  
Q 2 TYR M 14  ? ASN M 19  ? TYR I 164  ASN I 169  
Q 3 PHE M 89  ? LEU M 94  ? PHE I 230  LEU I 235  
Q 4 LYS M 132 ? GLN M 137 ? LYS I 278  GLN I 283  
Q 5 PHE N 10  ? MET N 14  ? PHE J 327  MET J 331  
Q 6 GLN N 76  ? PHE N 79  ? GLN J 388  PHE J 392  
R 1 GLY M 97  ? ASP M 98  ? GLY I 238  ASP I 239  
R 2 ILE M 101 ? TYR M 103 ? ILE I 242  TYR I 244  
R 3 GLU M 109 ? PRO M 111 ? GLU I 255  PRO I 257  
S 1 GLY M 147 ? PRO M 149 ? GLY I 293  PRO I 295  
S 2 TYR Q 3   ? PRO Q 5   ? TYR L 320  PRO L 322  
T 1 ARG N 2   ? PRO N 5   ? ARG J 319  PRO J 322  
T 2 GLY P 147 ? VAL P 150 ? GLY K 293  VAL K 296  
U 1 ARG N 24  ? ASN N 25  ? ARG J 341  ASN J 342  
U 2 GLY N 29  ? THR N 30  ? GLY J 346  THR J 347  
V 1 GLU P 59  ? HIS P 64  ? GLU K 199  HIS K 204  
V 2 TYR P 14  ? ASN P 19  ? TYR K 164  ASN K 169  
V 3 PHE P 89  ? LEU P 94  ? PHE K 230  LEU K 235  
V 4 LYS P 132 ? GLN P 137 ? LYS K 278  GLN K 283  
V 5 PHE Q 10  ? MET Q 14  ? PHE L 327  MET L 331  
V 6 GLN Q 76  ? PHE Q 79  ? GLN L 388  PHE L 392  
W 1 GLY P 97  ? ASP P 98  ? GLY K 238  ASP K 239  
W 2 ILE P 101 ? TYR P 103 ? ILE K 242  TYR K 244  
W 3 GLU P 109 ? PRO P 111 ? GLU K 255  PRO K 257  
X 1 ARG Q 24  ? ASN Q 25  ? ARG L 341  ASN L 342  
X 2 GLY Q 29  ? THR Q 30  ? GLY L 346  THR L 347  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 61  ? N LYS A 201 O CYS A 15  ? O CYS A 165  
A 2 3 O TYR A 14  ? O TYR A 164 N ILE A 90  ? N ILE A 231  
A 3 4 O PHE A 89  ? O PHE A 230 N VAL A 133 ? N VAL A 279  
A 4 5 N PHE A 134 ? N PHE A 280 O LEU B 11  ? O LEU B 328  
A 5 6 O MET B 14  ? O MET B 331 N GLN B 76  ? N GLN B 388  
B 1 2 O ASP A 98  ? O ASP A 239 N ILE A 101 ? N ILE A 242  
B 2 3 O ILE A 102 ? O ILE A 243 N ALA A 110 ? N ALA A 256  
C 1 2 N ILE A 148 ? N ILE A 294 O ILE E 4   ? O ILE D 321  
D 1 2 O ILE B 4   ? O ILE B 321 N ILE D 148 ? N ILE C 294  
E 1 2 N ASN B 25  ? N ASN B 342 O GLY B 29  ? O GLY B 346  
F 1 2 N LYS D 61  ? N LYS C 201 O CYS D 15  ? O CYS C 165  
F 2 3 O TYR D 14  ? O TYR C 164 N ILE D 90  ? N ILE C 231  
F 3 4 O PHE D 89  ? O PHE C 230 N VAL D 133 ? N VAL C 279  
F 4 5 N PHE D 134 ? N PHE C 280 O LEU E 11  ? O LEU D 328  
F 5 6 O MET E 14  ? O MET D 331 N GLN E 76  ? N GLN D 388  
G 1 2 O ASP D 98  ? O ASP C 239 N ILE D 101 ? N ILE C 242  
G 2 3 O ILE D 102 ? O ILE C 243 N ALA D 110 ? N ALA C 256  
H 1 2 N GLY E 29  ? N GLY D 346 O ASN E 25  ? O ASN D 342  
H 2 3 N ARG E 24  ? N ARG D 341 O GLU F 3   ? O GLU R 4202 
I 1 2 N LYS G 61  ? N LYS E 201 O CYS G 15  ? O CYS E 165  
I 2 3 O TYR G 14  ? O TYR E 164 N ILE G 90  ? N ILE E 231  
I 3 4 O PHE G 89  ? O PHE E 230 N VAL G 133 ? N VAL E 279  
I 4 5 N PHE G 134 ? N PHE E 280 O LEU H 11  ? O LEU F 328  
I 5 6 O MET H 14  ? O MET F 331 N GLN H 76  ? N GLN F 388  
J 1 2 O ASP G 98  ? O ASP E 239 N ILE G 101 ? N ILE E 242  
J 2 3 O ILE G 102 ? O ILE E 243 N ALA G 110 ? N ALA E 256  
K 1 2 N ILE G 148 ? N ILE E 294 O ILE K 4   ? O ILE H 321  
L 1 2 O ILE H 4   ? O ILE F 321 N ILE J 148 ? N ILE G 294  
L 2 3 O GLN J 145 ? O GLN G 291 N LYS K 72  ? N LYS H 384  
M 1 2 O ASN H 25  ? O ASN F 342 N GLY H 29  ? N GLY F 346  
N 1 2 N LYS J 61  ? N LYS G 201 O CYS J 15  ? O CYS G 165  
N 2 3 O TYR J 14  ? O TYR G 164 N ILE J 90  ? N ILE G 231  
N 3 4 O PHE J 89  ? O PHE G 230 N VAL J 133 ? N VAL G 279  
N 4 5 N PHE J 134 ? N PHE G 280 O LEU K 11  ? O LEU H 328  
N 5 6 O MET K 14  ? O MET H 331 N GLN K 76  ? N GLN H 388  
O 1 2 O ASP J 98  ? O ASP G 239 N ILE J 101 ? N ILE G 242  
O 2 3 O ILE J 102 ? O ILE G 243 N ALA J 110 ? N ALA G 256  
P 1 2 O ASN K 25  ? O ASN H 342 N GLY K 29  ? N GLY H 346  
Q 1 2 N LYS M 61  ? N LYS I 201 O CYS M 15  ? O CYS I 165  
Q 2 3 N LEU M 16  ? N LEU I 166 O ILE M 90  ? O ILE I 231  
Q 3 4 O PHE M 89  ? O PHE I 230 N VAL M 133 ? N VAL I 279  
Q 4 5 N PHE M 134 ? N PHE I 280 O LEU N 11  ? O LEU J 328  
Q 5 6 O MET N 14  ? O MET J 331 N GLN N 76  ? N GLN J 388  
R 1 2 O ASP M 98  ? O ASP I 239 N ILE M 101 ? N ILE I 242  
R 2 3 O ILE M 102 ? O ILE I 243 N ALA M 110 ? N ALA I 256  
S 1 2 N ILE M 148 ? N ILE I 294 O ILE Q 4   ? O ILE L 321  
T 1 2 O ILE N 4   ? O ILE J 321 N ILE P 148 ? N ILE K 294  
U 1 2 O ASN N 25  ? O ASN J 342 N GLY N 29  ? N GLY J 346  
V 1 2 N LYS P 61  ? N LYS K 201 O CYS P 15  ? O CYS K 165  
V 2 3 O TYR P 14  ? O TYR K 164 N ILE P 90  ? N ILE K 231  
V 3 4 O PHE P 89  ? O PHE K 230 N VAL P 133 ? N VAL K 279  
V 4 5 N PHE P 134 ? N PHE K 280 O LEU Q 11  ? O LEU L 328  
V 5 6 O MET Q 14  ? O MET L 331 N GLN Q 76  ? N GLN L 388  
W 1 2 O ASP P 98  ? O ASP K 239 N ILE P 101 ? N ILE K 242  
W 2 3 O ILE P 102 ? O ILE K 243 N ALA P 110 ? N ALA K 256  
X 1 2 O ASN Q 25  ? O ASN L 342 N GLY Q 29  ? N GLY L 346  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR CHAIN Q OF (PHQ)DEVD' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR CHAIN R OF (PHQ)DEVD' 
AC3 Software ? ? ? ? 12 'BINDING SITE FOR CHAIN S OF (PHQ)DEVD' 
AC4 Software ? ? ? ? 17 'BINDING SITE FOR CHAIN T OF (PHQ)DEVD' 
AC5 Software ? ? ? ? 13 'BINDING SITE FOR CHAIN U OF (PHQ)DEVD' 
AC6 Software ? ? ? ? 13 'BINDING SITE FOR CHAIN V OF (PHQ)DEVD' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ARG A 39  ? ARG A 179 . ? 1_555 ? 
2  AC1 13 HIS A 96  ? HIS A 237 . ? 1_555 ? 
3  AC1 13 GLY A 97  ? GLY A 238 . ? 1_555 ? 
4  AC1 13 GLN A 137 ? GLN A 283 . ? 1_555 ? 
5  AC1 13 CYS A 139 ? CYS A 285 . ? 1_555 ? 
6  AC1 13 SER B 22  ? SER B 339 . ? 1_555 ? 
7  AC1 13 TYR B 23  ? TYR B 340 . ? 1_555 ? 
8  AC1 13 ARG B 24  ? ARG B 341 . ? 1_555 ? 
9  AC1 13 ASN B 25  ? ASN B 342 . ? 1_555 ? 
10 AC1 13 PRO B 26  ? PRO B 343 . ? 1_555 ? 
11 AC1 13 ALA B 27  ? ALA B 344 . ? 1_555 ? 
12 AC1 13 THR B 30  ? THR B 347 . ? 1_555 ? 
13 AC1 13 TRP B 31  ? TRP B 348 . ? 1_555 ? 
14 AC2 14 ARG D 39  ? ARG C 179 . ? 1_555 ? 
15 AC2 14 HIS D 96  ? HIS C 237 . ? 1_555 ? 
16 AC2 14 GLY D 97  ? GLY C 238 . ? 1_555 ? 
17 AC2 14 GLN D 137 ? GLN C 283 . ? 1_555 ? 
18 AC2 14 CYS D 139 ? CYS C 285 . ? 1_555 ? 
19 AC2 14 SER E 22  ? SER D 339 . ? 1_555 ? 
20 AC2 14 ARG E 24  ? ARG D 341 . ? 1_555 ? 
21 AC2 14 ASN E 25  ? ASN D 342 . ? 1_555 ? 
22 AC2 14 PRO E 26  ? PRO D 343 . ? 1_555 ? 
23 AC2 14 ALA E 27  ? ALA D 344 . ? 1_555 ? 
24 AC2 14 TRP E 31  ? TRP D 348 . ? 1_555 ? 
25 AC2 14 ASP E 66  B ASP D 381 . ? 1_555 ? 
26 AC2 14 LYS E 67  C LYS D 381 . ? 1_555 ? 
27 AC2 14 ALA H 27  ? ALA F 344 . ? 7_545 ? 
28 AC3 12 ARG G 37  ? ARG E 177 . ? 1_555 ? 
29 AC3 12 ARG G 39  ? ARG E 179 . ? 1_555 ? 
30 AC3 12 HIS G 96  ? HIS E 237 . ? 1_555 ? 
31 AC3 12 GLN G 137 ? GLN E 283 . ? 1_555 ? 
32 AC3 12 CYS G 139 ? CYS E 285 . ? 1_555 ? 
33 AC3 12 SER H 22  ? SER F 339 . ? 1_555 ? 
34 AC3 12 TYR H 23  ? TYR F 340 . ? 1_555 ? 
35 AC3 12 ARG H 24  ? ARG F 341 . ? 1_555 ? 
36 AC3 12 ASN H 25  ? ASN F 342 . ? 1_555 ? 
37 AC3 12 PRO H 26  ? PRO F 343 . ? 1_555 ? 
38 AC3 12 TRP H 31  ? TRP F 348 . ? 1_555 ? 
39 AC3 12 LYS H 67  C LYS F 381 . ? 1_555 ? 
40 AC4 17 LEU A 44  ? LEU A 184 . ? 4_565 ? 
41 AC4 17 GLY A 47  ? GLY A 187 . ? 4_565 ? 
42 AC4 17 THR A 51  ? THR A 191 . ? 4_565 ? 
43 AC4 17 ARG J 37  ? ARG G 177 . ? 1_555 ? 
44 AC4 17 ARG J 39  ? ARG G 179 . ? 1_555 ? 
45 AC4 17 HIS J 96  ? HIS G 237 . ? 1_555 ? 
46 AC4 17 GLY J 97  ? GLY G 238 . ? 1_555 ? 
47 AC4 17 GLN J 137 ? GLN G 283 . ? 1_555 ? 
48 AC4 17 CYS J 139 ? CYS G 285 . ? 1_555 ? 
49 AC4 17 SER K 22  ? SER H 339 . ? 1_555 ? 
50 AC4 17 TYR K 23  ? TYR H 340 . ? 1_555 ? 
51 AC4 17 ARG K 24  ? ARG H 341 . ? 1_555 ? 
52 AC4 17 ASN K 25  ? ASN H 342 . ? 1_555 ? 
53 AC4 17 PRO K 26  ? PRO H 343 . ? 1_555 ? 
54 AC4 17 ALA K 27  ? ALA H 344 . ? 1_555 ? 
55 AC4 17 THR K 30  ? THR H 347 . ? 1_555 ? 
56 AC4 17 TRP K 31  ? TRP H 348 . ? 1_555 ? 
57 AC5 13 ARG M 37  ? ARG I 177 . ? 1_555 ? 
58 AC5 13 ARG M 39  ? ARG I 179 . ? 1_555 ? 
59 AC5 13 HIS M 96  ? HIS I 237 . ? 1_555 ? 
60 AC5 13 GLY M 97  ? GLY I 238 . ? 1_555 ? 
61 AC5 13 GLN M 137 ? GLN I 283 . ? 1_555 ? 
62 AC5 13 CYS M 139 ? CYS I 285 . ? 1_555 ? 
63 AC5 13 VAL N 21  ? VAL J 338 . ? 1_555 ? 
64 AC5 13 SER N 22  ? SER J 339 . ? 1_555 ? 
65 AC5 13 TYR N 23  ? TYR J 340 . ? 1_555 ? 
66 AC5 13 ARG N 24  ? ARG J 341 . ? 1_555 ? 
67 AC5 13 ASN N 25  ? ASN J 342 . ? 1_555 ? 
68 AC5 13 PRO N 26  ? PRO J 343 . ? 1_555 ? 
69 AC5 13 TRP N 31  ? TRP J 348 . ? 1_555 ? 
70 AC6 13 ARG P 37  ? ARG K 177 . ? 1_555 ? 
71 AC6 13 ARG P 39  ? ARG K 179 . ? 1_555 ? 
72 AC6 13 HIS P 96  ? HIS K 237 . ? 1_555 ? 
73 AC6 13 GLY P 97  ? GLY K 238 . ? 1_555 ? 
74 AC6 13 GLN P 137 ? GLN K 283 . ? 1_555 ? 
75 AC6 13 CYS P 139 ? CYS K 285 . ? 1_555 ? 
76 AC6 13 SER Q 22  ? SER L 339 . ? 1_555 ? 
77 AC6 13 TYR Q 23  ? TYR L 340 . ? 1_555 ? 
78 AC6 13 ARG Q 24  ? ARG L 341 . ? 1_555 ? 
79 AC6 13 ASN Q 25  ? ASN L 342 . ? 1_555 ? 
80 AC6 13 PRO Q 26  ? PRO L 343 . ? 1_555 ? 
81 AC6 13 TRP Q 31  ? TRP L 348 . ? 1_555 ? 
82 AC6 13 LYS Q 67  C LYS L 381 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1F9E 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1F9E 
_atom_sites.fract_transf_matrix[1][1]   0.010201 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005298 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004766 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . LEU A  1 1   ? 15.450  42.069  13.533  1.00 96.27  ? 149  LEU A N   1 
ATOM   2     C CA  . LEU A  1 1   ? 14.615  41.854  14.752  1.00 94.87  ? 149  LEU A CA  1 
ATOM   3     C C   . LEU A  1 1   ? 15.160  42.674  15.933  1.00 94.00  ? 149  LEU A C   1 
ATOM   4     O O   . LEU A  1 1   ? 14.880  42.372  17.098  1.00 92.04  ? 149  LEU A O   1 
ATOM   5     C CB  . LEU A  1 1   ? 14.577  40.354  15.100  1.00 90.65  ? 149  LEU A CB  1 
ATOM   6     C CG  . LEU A  1 1   ? 13.689  39.896  16.262  1.00 89.50  ? 149  LEU A CG  1 
ATOM   7     C CD1 . LEU A  1 1   ? 12.258  40.347  16.026  1.00 86.41  ? 149  LEU A CD1 1 
ATOM   8     C CD2 . LEU A  1 1   ? 13.768  38.383  16.403  1.00 87.00  ? 149  LEU A CD2 1 
ATOM   9     N N   . ASP A  1 2   ? 15.942  43.708  15.622  1.00 91.22  ? 150  ASP A N   1 
ATOM   10    C CA  . ASP A  1 2   ? 16.501  44.582  16.651  1.00 90.30  ? 150  ASP A CA  1 
ATOM   11    C C   . ASP A  1 2   ? 15.540  45.746  16.855  1.00 88.18  ? 150  ASP A C   1 
ATOM   12    O O   . ASP A  1 2   ? 15.002  46.278  15.883  1.00 87.21  ? 150  ASP A O   1 
ATOM   13    C CB  . ASP A  1 2   ? 17.853  45.171  16.226  1.00 93.65  ? 150  ASP A CB  1 
ATOM   14    C CG  . ASP A  1 2   ? 18.832  44.126  15.735  1.00 96.55  ? 150  ASP A CG  1 
ATOM   15    O OD1 . ASP A  1 2   ? 18.968  43.070  16.391  1.00 100.00 ? 150  ASP A OD1 1 
ATOM   16    O OD2 . ASP A  1 2   ? 19.477  44.375  14.693  1.00 93.71  ? 150  ASP A OD2 1 
ATOM   17    N N   . LYS A  1 3   ? 15.326  46.144  18.109  1.00 84.64  ? 151  LYS A N   1 
ATOM   18    C CA  . LYS A  1 3   ? 14.442  47.275  18.405  1.00 77.57  ? 151  LYS A CA  1 
ATOM   19    C C   . LYS A  1 3   ? 15.036  48.533  17.749  1.00 73.44  ? 151  LYS A C   1 
ATOM   20    O O   . LYS A  1 3   ? 16.254  48.689  17.655  1.00 74.44  ? 151  LYS A O   1 
ATOM   21    C CB  . LYS A  1 3   ? 14.345  47.501  19.920  1.00 77.44  ? 151  LYS A CB  1 
ATOM   22    C CG  . LYS A  1 3   ? 13.968  46.274  20.741  1.00 79.69  ? 151  LYS A CG  1 
ATOM   23    C CD  . LYS A  1 3   ? 12.486  45.984  20.671  1.00 86.07  ? 151  LYS A CD  1 
ATOM   24    C CE  . LYS A  1 3   ? 12.109  44.808  21.558  1.00 87.86  ? 151  LYS A CE  1 
ATOM   25    N NZ  . LYS A  1 3   ? 10.642  44.514  21.532  1.00 93.77  ? 151  LYS A NZ  1 
ATOM   26    N N   . VAL A  1 4   ? 14.177  49.427  17.286  1.00 69.09  ? 152  VAL A N   1 
ATOM   27    C CA  . VAL A  1 4   ? 14.644  50.658  16.662  1.00 55.42  ? 152  VAL A CA  1 
ATOM   28    C C   . VAL A  1 4   ? 13.798  51.851  17.091  1.00 58.12  ? 152  VAL A C   1 
ATOM   29    O O   . VAL A  1 4   ? 12.606  51.731  17.363  1.00 62.66  ? 152  VAL A O   1 
ATOM   30    C CB  . VAL A  1 4   ? 14.604  50.566  15.135  1.00 38.45  ? 152  VAL A CB  1 
ATOM   31    C CG1 . VAL A  1 4   ? 15.045  51.857  14.539  1.00 33.86  ? 152  VAL A CG1 1 
ATOM   32    C CG2 . VAL A  1 4   ? 15.482  49.457  14.665  1.00 30.52  ? 152  VAL A CG2 1 
ATOM   33    N N   . TYR A  1 5   ? 14.429  53.006  17.179  1.00 58.80  ? 153  TYR A N   1 
ATOM   34    C CA  . TYR A  1 5   ? 13.714  54.198  17.544  1.00 56.74  ? 153  TYR A CA  1 
ATOM   35    C C   . TYR A  1 5   ? 12.856  54.595  16.357  1.00 64.35  ? 153  TYR A C   1 
ATOM   36    O O   . TYR A  1 5   ? 13.316  54.647  15.207  1.00 67.20  ? 153  TYR A O   1 
ATOM   37    C CB  . TYR A  1 5   ? 14.690  55.319  17.871  1.00 55.61  ? 153  TYR A CB  1 
ATOM   38    C CG  . TYR A  1 5   ? 15.315  55.193  19.221  1.00 53.62  ? 153  TYR A CG  1 
ATOM   39    C CD1 . TYR A  1 5   ? 14.532  55.033  20.344  1.00 46.10  ? 153  TYR A CD1 1 
ATOM   40    C CD2 . TYR A  1 5   ? 16.694  55.268  19.386  1.00 58.94  ? 153  TYR A CD2 1 
ATOM   41    C CE1 . TYR A  1 5   ? 15.098  54.957  21.608  1.00 49.77  ? 153  TYR A CE1 1 
ATOM   42    C CE2 . TYR A  1 5   ? 17.274  55.187  20.654  1.00 56.91  ? 153  TYR A CE2 1 
ATOM   43    C CZ  . TYR A  1 5   ? 16.467  55.037  21.759  1.00 49.29  ? 153  TYR A CZ  1 
ATOM   44    O OH  . TYR A  1 5   ? 17.025  55.021  23.013  1.00 49.11  ? 153  TYR A OH  1 
ATOM   45    N N   . GLN A  1 6   ? 11.592  54.861  16.640  1.00 69.29  ? 154  GLN A N   1 
ATOM   46    C CA  . GLN A  1 6   ? 10.662  55.294  15.614  1.00 68.43  ? 154  GLN A CA  1 
ATOM   47    C C   . GLN A  1 6   ? 11.133  56.653  15.074  1.00 64.44  ? 154  GLN A C   1 
ATOM   48    O O   . GLN A  1 6   ? 11.549  57.529  15.848  1.00 46.14  ? 154  GLN A O   1 
ATOM   49    C CB  . GLN A  1 6   ? 9.270   55.422  16.226  1.00 70.53  ? 154  GLN A CB  1 
ATOM   50    C CG  . GLN A  1 6   ? 8.170   55.689  15.227  1.00 79.72  ? 154  GLN A CG  1 
ATOM   51    C CD  . GLN A  1 6   ? 6.808   55.809  15.883  1.00 79.76  ? 154  GLN A CD  1 
ATOM   52    O OE1 . GLN A  1 6   ? 6.540   56.762  16.616  1.00 80.52  ? 154  GLN A OE1 1 
ATOM   53    N NE2 . GLN A  1 6   ? 5.942   54.836  15.627  1.00 76.91  ? 154  GLN A NE2 1 
ATOM   54    N N   . MET A  1 7   ? 11.070  56.811  13.752  1.00 67.41  ? 155  MET A N   1 
ATOM   55    C CA  . MET A  1 7   ? 11.482  58.052  13.098  1.00 68.53  ? 155  MET A CA  1 
ATOM   56    C C   . MET A  1 7   ? 10.659  58.378  11.859  1.00 70.31  ? 155  MET A C   1 
ATOM   57    O O   . MET A  1 7   ? 11.184  58.401  10.740  1.00 69.00  ? 155  MET A O   1 
ATOM   58    C CB  . MET A  1 7   ? 12.961  57.983  12.709  1.00 65.16  ? 155  MET A CB  1 
ATOM   59    C CG  . MET A  1 7   ? 13.904  58.111  13.872  1.00 65.16  ? 155  MET A CG  1 
ATOM   60    S SD  . MET A  1 7   ? 13.863  59.768  14.561  1.00 58.19  ? 155  MET A SD  1 
ATOM   61    C CE  . MET A  1 7   ? 14.720  60.592  13.339  1.00 57.04  ? 155  MET A CE  1 
ATOM   62    N N   . LYS A  1 8   ? 9.369   58.632  12.058  1.00 71.51  ? 156  LYS A N   1 
ATOM   63    C CA  . LYS A  1 8   ? 8.482   58.977  10.945  1.00 73.15  ? 156  LYS A CA  1 
ATOM   64    C C   . LYS A  1 8   ? 8.037   60.430  11.085  1.00 69.21  ? 156  LYS A C   1 
ATOM   65    O O   . LYS A  1 8   ? 8.023   61.169  10.111  1.00 73.18  ? 156  LYS A O   1 
ATOM   66    C CB  . LYS A  1 8   ? 7.269   58.042  10.919  1.00 76.38  ? 156  LYS A CB  1 
ATOM   67    C CG  . LYS A  1 8   ? 6.432   58.068  12.194  1.00 88.75  ? 156  LYS A CG  1 
ATOM   68    C CD  . LYS A  1 8   ? 6.145   56.667  12.739  1.00 92.36  ? 156  LYS A CD  1 
ATOM   69    C CE  . LYS A  1 8   ? 5.394   55.778  11.749  1.00 96.45  ? 156  LYS A CE  1 
ATOM   70    N NZ  . LYS A  1 8   ? 6.241   55.335  10.598  1.00 97.22  ? 156  LYS A NZ  1 
ATOM   71    N N   . SER A  1 9   ? 7.702   60.829  12.310  1.00 66.01  ? 157  SER A N   1 
ATOM   72    C CA  . SER A  1 9   ? 7.264   62.182  12.642  1.00 59.11  ? 157  SER A CA  1 
ATOM   73    C C   . SER A  1 9   ? 7.484   63.283  11.606  1.00 65.65  ? 157  SER A C   1 
ATOM   74    O O   . SER A  1 9   ? 8.608   63.555  11.192  1.00 63.71  ? 157  SER A O   1 
ATOM   75    C CB  . SER A  1 9   ? 7.913   62.603  13.941  1.00 55.78  ? 157  SER A CB  1 
ATOM   76    O OG  . SER A  1 9   ? 8.007   64.008  14.000  1.00 71.50  ? 157  SER A OG  1 
ATOM   77    N N   . LYS A  1 10  ? 6.381   63.936  11.236  1.00 77.79  ? 160  LYS A N   1 
ATOM   78    C CA  . LYS A  1 10  ? 6.327   65.029  10.256  1.00 79.65  ? 160  LYS A CA  1 
ATOM   79    C C   . LYS A  1 10  ? 7.557   65.902  10.259  1.00 80.37  ? 160  LYS A C   1 
ATOM   80    O O   . LYS A  1 10  ? 8.181   66.064  9.226   1.00 88.67  ? 160  LYS A O   1 
ATOM   81    C CB  . LYS A  1 10  ? 5.075   65.884  10.495  1.00 85.20  ? 160  LYS A CB  1 
ATOM   82    C CG  . LYS A  1 10  ? 3.788   65.064  10.532  1.00 92.56  ? 160  LYS A CG  1 
ATOM   83    C CD  . LYS A  1 10  ? 2.552   65.933  10.613  1.00 94.92  ? 160  LYS A CD  1 
ATOM   84    C CE  . LYS A  1 10  ? 1.303   65.083  10.433  1.00 98.00  ? 160  LYS A CE  1 
ATOM   85    N NZ  . LYS A  1 10  ? 0.049   65.885  10.439  1.00 99.72  ? 160  LYS A NZ  1 
ATOM   86    N N   . PRO A  1 11  ? 7.889   66.534  11.398  1.00 79.52  ? 161  PRO A N   1 
ATOM   87    C CA  . PRO A  1 11  ? 9.104   67.353  11.348  1.00 75.04  ? 161  PRO A CA  1 
ATOM   88    C C   . PRO A  1 11  ? 10.251  66.628  12.071  1.00 75.77  ? 161  PRO A C   1 
ATOM   89    O O   . PRO A  1 11  ? 11.330  67.208  12.245  1.00 83.41  ? 161  PRO A O   1 
ATOM   90    C CB  . PRO A  1 11  ? 8.702   68.649  12.067  1.00 65.54  ? 161  PRO A CB  1 
ATOM   91    C CG  . PRO A  1 11  ? 7.187   68.554  12.193  1.00 76.27  ? 161  PRO A CG  1 
ATOM   92    C CD  . PRO A  1 11  ? 6.970   67.090  12.400  1.00 80.99  ? 161  PRO A CD  1 
ATOM   93    N N   . ARG A  1 12  ? 10.025  65.371  12.478  1.00 63.75  ? 162  ARG A N   1 
ATOM   94    C CA  . ARG A  1 12  ? 11.046  64.580  13.207  1.00 59.13  ? 162  ARG A CA  1 
ATOM   95    C C   . ARG A  1 12  ? 11.322  65.154  14.599  1.00 54.58  ? 162  ARG A C   1 
ATOM   96    O O   . ARG A  1 12  ? 11.164  64.477  15.604  1.00 62.30  ? 162  ARG A O   1 
ATOM   97    C CB  . ARG A  1 12  ? 12.374  64.548  12.463  1.00 56.73  ? 162  ARG A CB  1 
ATOM   98    C CG  . ARG A  1 12  ? 12.399  63.695  11.236  1.00 57.37  ? 162  ARG A CG  1 
ATOM   99    C CD  . ARG A  1 12  ? 12.528  62.259  11.576  1.00 51.62  ? 162  ARG A CD  1 
ATOM   100   N NE  . ARG A  1 12  ? 12.747  61.470  10.371  1.00 62.60  ? 162  ARG A NE  1 
ATOM   101   C CZ  . ARG A  1 12  ? 11.808  61.212  9.468   1.00 60.30  ? 162  ARG A CZ  1 
ATOM   102   N NH1 . ARG A  1 12  ? 10.589  61.683  9.646   1.00 58.61  ? 162  ARG A NH1 1 
ATOM   103   N NH2 . ARG A  1 12  ? 12.086  60.486  8.391   1.00 64.75  ? 162  ARG A NH2 1 
ATOM   104   N N   . GLY A  1 13  ? 11.758  66.402  14.644  1.00 40.95  ? 163  GLY A N   1 
ATOM   105   C CA  . GLY A  1 13  ? 12.026  67.048  15.905  1.00 39.68  ? 163  GLY A CA  1 
ATOM   106   C C   . GLY A  1 13  ? 12.897  68.262  15.645  1.00 44.91  ? 163  GLY A C   1 
ATOM   107   O O   . GLY A  1 13  ? 13.323  68.483  14.509  1.00 42.47  ? 163  GLY A O   1 
ATOM   108   N N   . TYR A  1 14  ? 13.160  69.062  16.675  1.00 41.82  ? 164  TYR A N   1 
ATOM   109   C CA  . TYR A  1 14  ? 14.000  70.217  16.478  1.00 43.11  ? 164  TYR A CA  1 
ATOM   110   C C   . TYR A  1 14  ? 15.469  69.813  16.498  1.00 50.99  ? 164  TYR A C   1 
ATOM   111   O O   . TYR A  1 14  ? 15.836  68.752  17.011  1.00 54.58  ? 164  TYR A O   1 
ATOM   112   C CB  . TYR A  1 14  ? 13.746  71.246  17.560  1.00 49.09  ? 164  TYR A CB  1 
ATOM   113   C CG  . TYR A  1 14  ? 12.315  71.702  17.620  1.00 64.43  ? 164  TYR A CG  1 
ATOM   114   C CD1 . TYR A  1 14  ? 11.841  72.696  16.761  1.00 69.47  ? 164  TYR A CD1 1 
ATOM   115   C CD2 . TYR A  1 14  ? 11.418  71.111  18.498  1.00 68.20  ? 164  TYR A CD2 1 
ATOM   116   C CE1 . TYR A  1 14  ? 10.505  73.084  16.772  1.00 70.68  ? 164  TYR A CE1 1 
ATOM   117   C CE2 . TYR A  1 14  ? 10.083  71.492  18.520  1.00 72.01  ? 164  TYR A CE2 1 
ATOM   118   C CZ  . TYR A  1 14  ? 9.631   72.477  17.652  1.00 73.19  ? 164  TYR A CZ  1 
ATOM   119   O OH  . TYR A  1 14  ? 8.299   72.836  17.657  1.00 77.91  ? 164  TYR A OH  1 
ATOM   120   N N   . CYS A  1 15  ? 16.305  70.659  15.912  1.00 46.29  ? 165  CYS A N   1 
ATOM   121   C CA  . CYS A  1 15  ? 17.730  70.427  15.883  1.00 36.67  ? 165  CYS A CA  1 
ATOM   122   C C   . CYS A  1 15  ? 18.397  71.757  16.164  1.00 37.33  ? 165  CYS A C   1 
ATOM   123   O O   . CYS A  1 15  ? 18.677  72.510  15.247  1.00 44.04  ? 165  CYS A O   1 
ATOM   124   C CB  . CYS A  1 15  ? 18.171  69.891  14.519  1.00 36.66  ? 165  CYS A CB  1 
ATOM   125   S SG  . CYS A  1 15  ? 20.001  69.725  14.333  1.00 39.67  ? 165  CYS A SG  1 
ATOM   126   N N   . LEU A  1 16  ? 18.636  72.067  17.432  1.00 36.29  ? 166  LEU A N   1 
ATOM   127   C CA  . LEU A  1 16  ? 19.281  73.325  17.757  1.00 39.40  ? 166  LEU A CA  1 
ATOM   128   C C   . LEU A  1 16  ? 20.682  73.329  17.205  1.00 41.72  ? 166  LEU A C   1 
ATOM   129   O O   . LEU A  1 16  ? 21.213  72.296  16.843  1.00 53.26  ? 166  LEU A O   1 
ATOM   130   C CB  . LEU A  1 16  ? 19.416  73.520  19.253  1.00 42.71  ? 166  LEU A CB  1 
ATOM   131   C CG  . LEU A  1 16  ? 18.230  73.322  20.153  1.00 48.92  ? 166  LEU A CG  1 
ATOM   132   C CD1 . LEU A  1 16  ? 18.545  73.971  21.503  1.00 45.76  ? 166  LEU A CD1 1 
ATOM   133   C CD2 . LEU A  1 16  ? 17.012  73.936  19.516  1.00 53.84  ? 166  LEU A CD2 1 
ATOM   134   N N   . ILE A  1 17  ? 21.282  74.507  17.167  1.00 39.43  ? 167  ILE A N   1 
ATOM   135   C CA  . ILE A  1 17  ? 22.641  74.664  16.716  1.00 31.79  ? 167  ILE A CA  1 
ATOM   136   C C   . ILE A  1 17  ? 23.174  75.912  17.369  1.00 34.53  ? 167  ILE A C   1 
ATOM   137   O O   . ILE A  1 17  ? 22.965  76.994  16.868  1.00 37.64  ? 167  ILE A O   1 
ATOM   138   C CB  . ILE A  1 17  ? 22.741  74.861  15.210  1.00 28.73  ? 167  ILE A CB  1 
ATOM   139   C CG1 . ILE A  1 17  ? 22.225  73.632  14.467  1.00 24.38  ? 167  ILE A CG1 1 
ATOM   140   C CG2 . ILE A  1 17  ? 24.191  75.123  14.838  1.00 26.33  ? 167  ILE A CG2 1 
ATOM   141   C CD1 . ILE A  1 17  ? 22.572  73.608  12.981  1.00 13.77  ? 167  ILE A CD1 1 
ATOM   142   N N   . ILE A  1 18  ? 23.813  75.779  18.516  1.00 37.35  ? 168  ILE A N   1 
ATOM   143   C CA  . ILE A  1 18  ? 24.376  76.947  19.158  1.00 42.36  ? 168  ILE A CA  1 
ATOM   144   C C   . ILE A  1 18  ? 25.688  77.083  18.417  1.00 46.83  ? 168  ILE A C   1 
ATOM   145   O O   . ILE A  1 18  ? 26.554  76.234  18.536  1.00 53.47  ? 168  ILE A O   1 
ATOM   146   C CB  . ILE A  1 18  ? 24.673  76.712  20.643  1.00 43.41  ? 168  ILE A CB  1 
ATOM   147   C CG1 . ILE A  1 18  ? 23.425  76.193  21.340  1.00 42.58  ? 168  ILE A CG1 1 
ATOM   148   C CG2 . ILE A  1 18  ? 25.157  77.991  21.287  1.00 39.95  ? 168  ILE A CG2 1 
ATOM   149   C CD1 . ILE A  1 18  ? 22.179  76.919  20.981  1.00 48.10  ? 168  ILE A CD1 1 
ATOM   150   N N   . ASN A  1 19  ? 25.820  78.146  17.632  1.00 48.73  ? 169  ASN A N   1 
ATOM   151   C CA  . ASN A  1 19  ? 27.008  78.398  16.830  1.00 36.86  ? 169  ASN A CA  1 
ATOM   152   C C   . ASN A  1 19  ? 27.761  79.593  17.374  1.00 32.92  ? 169  ASN A C   1 
ATOM   153   O O   . ASN A  1 19  ? 27.369  80.719  17.145  1.00 42.10  ? 169  ASN A O   1 
ATOM   154   C CB  . ASN A  1 19  ? 26.578  78.670  15.391  1.00 38.89  ? 169  ASN A CB  1 
ATOM   155   C CG  . ASN A  1 19  ? 27.730  79.053  14.503  1.00 45.81  ? 169  ASN A CG  1 
ATOM   156   O OD1 . ASN A  1 19  ? 28.526  79.905  14.844  1.00 53.15  ? 169  ASN A OD1 1 
ATOM   157   N ND2 . ASN A  1 19  ? 27.816  78.434  13.354  1.00 50.58  ? 169  ASN A ND2 1 
ATOM   158   N N   . ASN A  1 20  ? 28.847  79.362  18.089  1.00 33.60  ? 170  ASN A N   1 
ATOM   159   C CA  . ASN A  1 20  ? 29.612  80.460  18.658  1.00 36.06  ? 170  ASN A CA  1 
ATOM   160   C C   . ASN A  1 20  ? 30.822  80.753  17.820  1.00 43.01  ? 170  ASN A C   1 
ATOM   161   O O   . ASN A  1 20  ? 31.640  79.871  17.566  1.00 50.79  ? 170  ASN A O   1 
ATOM   162   C CB  . ASN A  1 20  ? 30.044  80.135  20.087  1.00 33.61  ? 170  ASN A CB  1 
ATOM   163   C CG  . ASN A  1 20  ? 28.923  80.251  21.075  1.00 30.87  ? 170  ASN A CG  1 
ATOM   164   O OD1 . ASN A  1 20  ? 27.763  80.396  20.707  1.00 40.55  ? 170  ASN A OD1 1 
ATOM   165   N ND2 . ASN A  1 20  ? 29.259  80.182  22.345  1.00 39.92  ? 170  ASN A ND2 1 
ATOM   166   N N   . HIS A  1 21  ? 30.937  82.006  17.401  1.00 48.56  ? 171  HIS A N   1 
ATOM   167   C CA  . HIS A  1 21  ? 32.049  82.446  16.570  1.00 53.49  ? 171  HIS A CA  1 
ATOM   168   C C   . HIS A  1 21  ? 32.852  83.596  17.164  1.00 54.81  ? 171  HIS A C   1 
ATOM   169   O O   . HIS A  1 21  ? 34.037  83.463  17.405  1.00 57.59  ? 171  HIS A O   1 
ATOM   170   C CB  . HIS A  1 21  ? 31.523  82.873  15.201  1.00 59.23  ? 171  HIS A CB  1 
ATOM   171   C CG  . HIS A  1 21  ? 32.477  83.730  14.429  1.00 63.34  ? 171  HIS A CG  1 
ATOM   172   N ND1 . HIS A  1 21  ? 33.558  83.219  13.747  1.00 68.16  ? 171  HIS A ND1 1 
ATOM   173   C CD2 . HIS A  1 21  ? 32.541  85.073  14.280  1.00 61.97  ? 171  HIS A CD2 1 
ATOM   174   C CE1 . HIS A  1 21  ? 34.250  84.208  13.215  1.00 59.28  ? 171  HIS A CE1 1 
ATOM   175   N NE2 . HIS A  1 21  ? 33.655  85.343  13.526  1.00 61.68  ? 171  HIS A NE2 1 
ATOM   176   N N   . ASN A  1 22  ? 32.192  84.726  17.388  1.00 57.64  ? 172  ASN A N   1 
ATOM   177   C CA  . ASN A  1 22  ? 32.836  85.930  17.899  1.00 59.97  ? 172  ASN A CA  1 
ATOM   178   C C   . ASN A  1 22  ? 33.062  85.956  19.397  1.00 58.12  ? 172  ASN A C   1 
ATOM   179   O O   . ASN A  1 22  ? 32.217  86.421  20.150  1.00 64.09  ? 172  ASN A O   1 
ATOM   180   C CB  . ASN A  1 22  ? 32.017  87.161  17.463  1.00 66.20  ? 172  ASN A CB  1 
ATOM   181   C CG  . ASN A  1 22  ? 32.561  88.471  18.026  1.00 67.55  ? 172  ASN A CG  1 
ATOM   182   O OD1 . ASN A  1 22  ? 33.774  88.716  18.038  1.00 61.36  ? 172  ASN A OD1 1 
ATOM   183   N ND2 . ASN A  1 22  ? 31.654  89.329  18.477  1.00 68.57  ? 172  ASN A ND2 1 
ATOM   184   N N   . PHE A  1 23  ? 34.223  85.490  19.832  1.00 57.34  ? 173  PHE A N   1 
ATOM   185   C CA  . PHE A  1 23  ? 34.517  85.463  21.257  1.00 57.21  ? 173  PHE A CA  1 
ATOM   186   C C   . PHE A  1 23  ? 35.163  86.734  21.758  1.00 56.03  ? 173  PHE A C   1 
ATOM   187   O O   . PHE A  1 23  ? 35.990  86.690  22.656  1.00 54.80  ? 173  PHE A O   1 
ATOM   188   C CB  . PHE A  1 23  ? 35.412  84.262  21.599  1.00 53.48  ? 173  PHE A CB  1 
ATOM   189   C CG  . PHE A  1 23  ? 34.695  82.957  21.555  1.00 47.94  ? 173  PHE A CG  1 
ATOM   190   C CD1 . PHE A  1 23  ? 34.388  82.367  20.338  1.00 50.34  ? 173  PHE A CD1 1 
ATOM   191   C CD2 . PHE A  1 23  ? 34.218  82.374  22.727  1.00 45.63  ? 173  PHE A CD2 1 
ATOM   192   C CE1 . PHE A  1 23  ? 33.604  81.220  20.275  1.00 51.25  ? 173  PHE A CE1 1 
ATOM   193   C CE2 . PHE A  1 23  ? 33.436  81.226  22.683  1.00 47.92  ? 173  PHE A CE2 1 
ATOM   194   C CZ  . PHE A  1 23  ? 33.125  80.648  21.450  1.00 53.91  ? 173  PHE A CZ  1 
ATOM   195   N N   . ALA A  1 24  ? 34.826  87.879  21.186  1.00 58.74  ? 174  ALA A N   1 
ATOM   196   C CA  . ALA A  1 24  ? 35.462  89.112  21.663  1.00 58.40  ? 174  ALA A CA  1 
ATOM   197   C C   . ALA A  1 24  ? 35.081  89.455  23.111  1.00 58.82  ? 174  ALA A C   1 
ATOM   198   O O   . ALA A  1 24  ? 35.944  89.803  23.916  1.00 57.49  ? 174  ALA A O   1 
ATOM   199   C CB  . ALA A  1 24  ? 35.118  90.264  20.745  1.00 57.17  ? 174  ALA A CB  1 
ATOM   200   N N   . LYS A  1 25  ? 33.796  89.347  23.449  1.00 59.56  ? 175  LYS A N   1 
ATOM   201   C CA  . LYS A  1 25  ? 33.340  89.661  24.809  1.00 67.10  ? 175  LYS A CA  1 
ATOM   202   C C   . LYS A  1 25  ? 34.121  88.818  25.817  1.00 68.55  ? 175  LYS A C   1 
ATOM   203   O O   . LYS A  1 25  ? 34.649  89.319  26.817  1.00 60.66  ? 175  LYS A O   1 
ATOM   204   C CB  . LYS A  1 25  ? 31.834  89.368  24.953  1.00 74.36  ? 175  LYS A CB  1 
ATOM   205   C CG  . LYS A  1 25  ? 31.023  90.411  25.774  1.00 79.32  ? 175  LYS A CG  1 
ATOM   206   C CD  . LYS A  1 25  ? 31.371  90.424  27.265  1.00 81.32  ? 175  LYS A CD  1 
ATOM   207   C CE  . LYS A  1 25  ? 30.391  91.283  28.075  1.00 81.14  ? 175  LYS A CE  1 
ATOM   208   N NZ  . LYS A  1 25  ? 30.433  90.959  29.547  1.00 76.97  ? 175  LYS A NZ  1 
ATOM   209   N N   . ALA A  1 26  A 34.183  87.522  25.539  1.00 70.46  ? 175  ALA A N   1 
ATOM   210   C CA  . ALA A  1 26  A 34.894  86.610  26.402  1.00 61.82  ? 175  ALA A CA  1 
ATOM   211   C C   . ALA A  1 26  A 36.329  87.080  26.594  1.00 59.77  ? 175  ALA A C   1 
ATOM   212   O O   . ALA A  1 26  A 36.872  86.929  27.679  1.00 62.49  ? 175  ALA A O   1 
ATOM   213   C CB  . ALA A  1 26  A 34.866  85.247  25.809  1.00 57.68  ? 175  ALA A CB  1 
ATOM   214   N N   . ARG A  1 27  B 36.947  87.658  25.562  1.00 54.05  ? 175  ARG A N   1 
ATOM   215   C CA  . ARG A  1 27  B 38.329  88.123  25.705  1.00 55.81  ? 175  ARG A CA  1 
ATOM   216   C C   . ARG A  1 27  B 38.409  89.257  26.722  1.00 63.19  ? 175  ARG A C   1 
ATOM   217   O O   . ARG A  1 27  B 39.261  89.243  27.631  1.00 62.15  ? 175  ARG A O   1 
ATOM   218   C CB  . ARG A  1 27  B 38.916  88.574  24.356  1.00 45.47  ? 175  ARG A CB  1 
ATOM   219   C CG  . ARG A  1 27  B 39.152  87.406  23.382  1.00 60.38  ? 175  ARG A CG  1 
ATOM   220   C CD  . ARG A  1 27  B 40.116  87.699  22.213  1.00 46.09  ? 175  ARG A CD  1 
ATOM   221   N NE  . ARG A  1 27  B 39.500  88.430  21.113  1.00 46.13  ? 175  ARG A NE  1 
ATOM   222   C CZ  . ARG A  1 27  B 38.469  87.996  20.402  1.00 48.59  ? 175  ARG A CZ  1 
ATOM   223   N NH1 . ARG A  1 27  B 37.913  86.825  20.658  1.00 58.58  ? 175  ARG A NH1 1 
ATOM   224   N NH2 . ARG A  1 27  B 38.000  88.734  19.418  1.00 50.52  ? 175  ARG A NH2 1 
ATOM   225   N N   . GLU A  1 28  C 37.497  90.217  26.575  1.00 65.39  ? 175  GLU A N   1 
ATOM   226   C CA  . GLU A  1 28  C 37.413  91.376  27.450  1.00 66.03  ? 175  GLU A CA  1 
ATOM   227   C C   . GLU A  1 28  C 37.224  90.999  28.934  1.00 65.01  ? 175  GLU A C   1 
ATOM   228   O O   . GLU A  1 28  C 38.079  91.287  29.771  1.00 63.97  ? 175  GLU A O   1 
ATOM   229   C CB  . GLU A  1 28  C 36.259  92.273  26.970  1.00 74.43  ? 175  GLU A CB  1 
ATOM   230   C CG  . GLU A  1 28  C 36.007  93.555  27.796  1.00 86.96  ? 175  GLU A CG  1 
ATOM   231   C CD  . GLU A  1 28  C 34.742  94.323  27.367  1.00 93.40  ? 175  GLU A CD  1 
ATOM   232   O OE1 . GLU A  1 28  C 34.436  95.373  27.987  1.00 96.30  ? 175  GLU A OE1 1 
ATOM   233   O OE2 . GLU A  1 28  C 34.054  93.876  26.415  1.00 95.03  ? 175  GLU A OE2 1 
ATOM   234   N N   . LYS A  1 29  D 36.120  90.321  29.242  1.00 63.75  ? 175  LYS A N   1 
ATOM   235   C CA  . LYS A  1 29  D 35.772  89.943  30.615  1.00 65.48  ? 175  LYS A CA  1 
ATOM   236   C C   . LYS A  1 29  D 36.589  88.873  31.339  1.00 62.71  ? 175  LYS A C   1 
ATOM   237   O O   . LYS A  1 29  D 36.801  88.989  32.538  1.00 54.31  ? 175  LYS A O   1 
ATOM   238   C CB  . LYS A  1 29  D 34.293  89.534  30.681  1.00 71.85  ? 175  LYS A CB  1 
ATOM   239   C CG  . LYS A  1 29  D 33.326  90.505  29.992  1.00 81.37  ? 175  LYS A CG  1 
ATOM   240   C CD  . LYS A  1 29  D 33.277  91.888  30.665  1.00 92.13  ? 175  LYS A CD  1 
ATOM   241   C CE  . LYS A  1 29  D 32.400  92.873  29.878  1.00 94.79  ? 175  LYS A CE  1 
ATOM   242   N NZ  . LYS A  1 29  D 32.265  94.211  30.521  1.00 100.00 ? 175  LYS A NZ  1 
ATOM   243   N N   . VAL A  1 30  E 37.030  87.833  30.629  1.00 67.57  ? 175  VAL A N   1 
ATOM   244   C CA  . VAL A  1 30  E 37.787  86.734  31.245  1.00 62.11  ? 175  VAL A CA  1 
ATOM   245   C C   . VAL A  1 30  E 39.268  86.770  30.947  1.00 61.99  ? 175  VAL A C   1 
ATOM   246   O O   . VAL A  1 30  E 39.708  86.457  29.853  1.00 59.50  ? 175  VAL A O   1 
ATOM   247   C CB  . VAL A  1 30  E 37.262  85.371  30.808  1.00 62.85  ? 175  VAL A CB  1 
ATOM   248   C CG1 . VAL A  1 30  E 37.999  84.281  31.572  1.00 66.90  ? 175  VAL A CG1 1 
ATOM   249   C CG2 . VAL A  1 30  E 35.747  85.288  31.035  1.00 62.30  ? 175  VAL A CG2 1 
ATOM   250   N N   . PRO A  1 31  F 40.061  87.126  31.952  1.00 66.27  ? 175  PRO A N   1 
ATOM   251   C CA  . PRO A  1 31  F 41.517  87.233  31.863  1.00 63.41  ? 175  PRO A CA  1 
ATOM   252   C C   . PRO A  1 31  F 42.238  85.976  31.390  1.00 61.81  ? 175  PRO A C   1 
ATOM   253   O O   . PRO A  1 31  F 43.115  86.046  30.533  1.00 55.97  ? 175  PRO A O   1 
ATOM   254   C CB  . PRO A  1 31  F 41.910  87.619  33.285  1.00 66.05  ? 175  PRO A CB  1 
ATOM   255   C CG  . PRO A  1 31  F 40.677  88.341  33.803  1.00 64.80  ? 175  PRO A CG  1 
ATOM   256   C CD  . PRO A  1 31  F 39.595  87.433  33.317  1.00 62.15  ? 175  PRO A CD  1 
ATOM   257   N N   . LYS A  1 32  G 41.874  84.826  31.948  1.00 62.17  ? 175  LYS A N   1 
ATOM   258   C CA  . LYS A  1 32  G 42.549  83.590  31.573  1.00 58.61  ? 175  LYS A CA  1 
ATOM   259   C C   . LYS A  1 32  G 42.295  83.271  30.116  1.00 56.82  ? 175  LYS A C   1 
ATOM   260   O O   . LYS A  1 32  G 42.882  82.331  29.577  1.00 57.10  ? 175  LYS A O   1 
ATOM   261   C CB  . LYS A  1 32  G 42.105  82.411  32.461  1.00 55.42  ? 175  LYS A CB  1 
ATOM   262   C CG  . LYS A  1 32  G 40.846  81.671  32.012  1.00 58.41  ? 175  LYS A CG  1 
ATOM   263   C CD  . LYS A  1 32  G 40.500  80.528  32.974  1.00 59.18  ? 175  LYS A CD  1 
ATOM   264   C CE  . LYS A  1 32  G 39.142  79.898  32.677  1.00 59.55  ? 175  LYS A CE  1 
ATOM   265   N NZ  . LYS A  1 32  G 38.640  79.053  33.809  1.00 57.62  ? 175  LYS A NZ  1 
ATOM   266   N N   . LEU A  1 33  H 41.430  84.065  29.486  1.00 47.58  ? 175  LEU A N   1 
ATOM   267   C CA  . LEU A  1 33  H 41.084  83.874  28.080  1.00 48.21  ? 175  LEU A CA  1 
ATOM   268   C C   . LEU A  1 33  H 41.514  85.080  27.227  1.00 52.26  ? 175  LEU A C   1 
ATOM   269   O O   . LEU A  1 33  H 40.928  85.357  26.166  1.00 43.97  ? 175  LEU A O   1 
ATOM   270   C CB  . LEU A  1 33  H 39.563  83.671  27.927  1.00 37.05  ? 175  LEU A CB  1 
ATOM   271   C CG  . LEU A  1 33  H 38.807  82.626  28.756  1.00 39.03  ? 175  LEU A CG  1 
ATOM   272   C CD1 . LEU A  1 33  H 37.328  82.504  28.303  1.00 27.88  ? 175  LEU A CD1 1 
ATOM   273   C CD2 . LEU A  1 33  H 39.520  81.300  28.638  1.00 39.94  ? 175  LEU A CD2 1 
ATOM   274   N N   . HIS A  1 34  I 42.541  85.792  27.676  1.00 57.50  ? 175  HIS A N   1 
ATOM   275   C CA  . HIS A  1 34  I 42.972  86.981  26.952  1.00 63.20  ? 175  HIS A CA  1 
ATOM   276   C C   . HIS A  1 34  I 43.263  86.719  25.484  1.00 62.80  ? 175  HIS A C   1 
ATOM   277   O O   . HIS A  1 34  I 43.520  87.655  24.733  1.00 67.22  ? 175  HIS A O   1 
ATOM   278   C CB  . HIS A  1 34  I 44.210  87.605  27.608  1.00 64.21  ? 175  HIS A CB  1 
ATOM   279   C CG  . HIS A  1 34  I 45.446  86.770  27.481  1.00 76.60  ? 175  HIS A CG  1 
ATOM   280   N ND1 . HIS A  1 34  I 45.506  85.459  27.909  1.00 79.44  ? 175  HIS A ND1 1 
ATOM   281   C CD2 . HIS A  1 34  I 46.673  87.062  26.985  1.00 76.07  ? 175  HIS A CD2 1 
ATOM   282   C CE1 . HIS A  1 34  I 46.719  84.982  27.684  1.00 82.00  ? 175  HIS A CE1 1 
ATOM   283   N NE2 . HIS A  1 34  I 47.446  85.934  27.124  1.00 79.44  ? 175  HIS A NE2 1 
ATOM   284   N N   . SER A  1 35  J 43.207  85.461  25.058  1.00 62.12  ? 175  SER A N   1 
ATOM   285   C CA  . SER A  1 35  J 43.529  85.170  23.669  1.00 53.92  ? 175  SER A CA  1 
ATOM   286   C C   . SER A  1 35  J 42.684  84.180  22.867  1.00 48.76  ? 175  SER A C   1 
ATOM   287   O O   . SER A  1 35  J 42.999  83.891  21.706  1.00 48.70  ? 175  SER A O   1 
ATOM   288   C CB  . SER A  1 35  J 45.000  84.790  23.587  1.00 52.35  ? 175  SER A CB  1 
ATOM   289   O OG  . SER A  1 35  J 45.787  85.941  23.839  1.00 52.81  ? 175  SER A OG  1 
ATOM   290   N N   . ILE A  1 36  ? 41.626  83.648  23.462  1.00 35.34  ? 176  ILE A N   1 
ATOM   291   C CA  . ILE A  1 36  ? 40.779  82.764  22.702  1.00 36.85  ? 176  ILE A CA  1 
ATOM   292   C C   . ILE A  1 36  ? 40.557  83.507  21.372  1.00 43.44  ? 176  ILE A C   1 
ATOM   293   O O   . ILE A  1 36  ? 40.177  84.678  21.357  1.00 43.05  ? 176  ILE A O   1 
ATOM   294   C CB  . ILE A  1 36  ? 39.436  82.629  23.367  1.00 44.08  ? 176  ILE A CB  1 
ATOM   295   C CG1 . ILE A  1 36  ? 39.432  83.491  24.610  1.00 55.47  ? 176  ILE A CG1 1 
ATOM   296   C CG2 . ILE A  1 36  ? 39.122  81.207  23.702  1.00 33.66  ? 176  ILE A CG2 1 
ATOM   297   C CD1 . ILE A  1 36  ? 38.066  83.642  25.190  1.00 73.52  ? 176  ILE A CD1 1 
ATOM   298   N N   . ARG A  1 37  ? 40.814  82.845  20.256  1.00 47.55  ? 177  ARG A N   1 
ATOM   299   C CA  . ARG A  1 37  ? 40.595  83.470  18.963  1.00 48.74  ? 177  ARG A CA  1 
ATOM   300   C C   . ARG A  1 37  ? 39.188  83.141  18.479  1.00 45.39  ? 177  ARG A C   1 
ATOM   301   O O   . ARG A  1 37  ? 38.563  82.222  18.964  1.00 43.04  ? 177  ARG A O   1 
ATOM   302   C CB  . ARG A  1 37  ? 41.620  82.973  17.957  1.00 49.11  ? 177  ARG A CB  1 
ATOM   303   C CG  . ARG A  1 37  ? 43.028  83.286  18.355  1.00 53.23  ? 177  ARG A CG  1 
ATOM   304   C CD  . ARG A  1 37  ? 43.992  82.845  17.277  1.00 67.12  ? 177  ARG A CD  1 
ATOM   305   N NE  . ARG A  1 37  ? 45.351  82.745  17.802  1.00 84.24  ? 177  ARG A NE  1 
ATOM   306   C CZ  . ARG A  1 37  ? 46.339  82.098  17.190  1.00 91.77  ? 177  ARG A CZ  1 
ATOM   307   N NH1 . ARG A  1 37  ? 46.114  81.496  16.022  1.00 94.15  ? 177  ARG A NH1 1 
ATOM   308   N NH2 . ARG A  1 37  ? 47.543  82.033  17.752  1.00 91.00  ? 177  ARG A NH2 1 
ATOM   309   N N   . ASP A  1 38  ? 38.679  83.905  17.534  1.00 49.34  ? 178  ASP A N   1 
ATOM   310   C CA  . ASP A  1 38  ? 37.343  83.646  17.051  1.00 55.76  ? 178  ASP A CA  1 
ATOM   311   C C   . ASP A  1 38  ? 37.354  82.353  16.268  1.00 51.51  ? 178  ASP A C   1 
ATOM   312   O O   . ASP A  1 38  ? 38.328  82.044  15.580  1.00 54.21  ? 178  ASP A O   1 
ATOM   313   C CB  . ASP A  1 38  ? 36.849  84.808  16.191  1.00 62.95  ? 178  ASP A CB  1 
ATOM   314   C CG  . ASP A  1 38  ? 36.723  86.099  16.981  1.00 72.57  ? 178  ASP A CG  1 
ATOM   315   O OD1 . ASP A  1 38  ? 36.249  86.054  18.142  1.00 69.00  ? 178  ASP A OD1 1 
ATOM   316   O OD2 . ASP A  1 38  ? 37.090  87.163  16.438  1.00 83.00  ? 178  ASP A OD2 1 
ATOM   317   N N   . ARG A  1 39  ? 36.258  81.609  16.361  1.00 44.06  ? 179  ARG A N   1 
ATOM   318   C CA  . ARG A  1 39  ? 36.160  80.324  15.705  1.00 46.06  ? 179  ARG A CA  1 
ATOM   319   C C   . ARG A  1 39  ? 35.846  80.406  14.220  1.00 41.40  ? 179  ARG A C   1 
ATOM   320   O O   . ARG A  1 39  ? 34.816  79.944  13.752  1.00 39.50  ? 179  ARG A O   1 
ATOM   321   C CB  . ARG A  1 39  ? 35.147  79.442  16.463  1.00 47.49  ? 179  ARG A CB  1 
ATOM   322   C CG  . ARG A  1 39  ? 35.492  79.286  17.956  1.00 42.03  ? 179  ARG A CG  1 
ATOM   323   C CD  . ARG A  1 39  ? 34.607  78.308  18.680  1.00 41.46  ? 179  ARG A CD  1 
ATOM   324   N NE  . ARG A  1 39  ? 34.686  77.006  18.053  1.00 42.52  ? 179  ARG A NE  1 
ATOM   325   C CZ  . ARG A  1 39  ? 33.866  76.583  17.104  1.00 34.12  ? 179  ARG A CZ  1 
ATOM   326   N NH1 . ARG A  1 39  ? 32.886  77.357  16.674  1.00 22.25  ? 179  ARG A NH1 1 
ATOM   327   N NH2 . ARG A  1 39  ? 34.047  75.385  16.583  1.00 34.67  ? 179  ARG A NH2 1 
ATOM   328   N N   . ASN A  1 40  ? 36.776  80.970  13.469  1.00 45.45  ? 180  ASN A N   1 
ATOM   329   C CA  . ASN A  1 40  ? 36.598  81.109  12.035  1.00 50.49  ? 180  ASN A CA  1 
ATOM   330   C C   . ASN A  1 40  ? 36.352  79.773  11.344  1.00 41.44  ? 180  ASN A C   1 
ATOM   331   O O   . ASN A  1 40  ? 37.215  78.914  11.321  1.00 41.57  ? 180  ASN A O   1 
ATOM   332   C CB  . ASN A  1 40  ? 37.831  81.776  11.416  1.00 61.73  ? 180  ASN A CB  1 
ATOM   333   C CG  . ASN A  1 40  ? 37.954  83.242  11.773  1.00 61.45  ? 180  ASN A CG  1 
ATOM   334   O OD1 . ASN A  1 40  ? 39.003  83.843  11.565  1.00 69.72  ? 180  ASN A OD1 1 
ATOM   335   N ND2 . ASN A  1 40  ? 36.885  83.827  12.296  1.00 56.32  ? 180  ASN A ND2 1 
ATOM   336   N N   . GLY A  1 41  ? 35.171  79.613  10.770  1.00 42.22  ? 181  GLY A N   1 
ATOM   337   C CA  . GLY A  1 41  ? 34.856  78.393  10.067  1.00 33.26  ? 181  GLY A CA  1 
ATOM   338   C C   . GLY A  1 41  ? 33.580  77.757  10.560  1.00 39.45  ? 181  GLY A C   1 
ATOM   339   O O   . GLY A  1 41  ? 32.959  76.989  9.819   1.00 40.98  ? 181  GLY A O   1 
ATOM   340   N N   . THR A  1 42  ? 33.181  78.087  11.790  1.00 41.29  ? 182  THR A N   1 
ATOM   341   C CA  . THR A  1 42  ? 31.983  77.500  12.404  1.00 51.36  ? 182  THR A CA  1 
ATOM   342   C C   . THR A  1 42  ? 30.894  77.465  11.383  1.00 52.96  ? 182  THR A C   1 
ATOM   343   O O   . THR A  1 42  ? 30.202  76.453  11.204  1.00 56.85  ? 182  THR A O   1 
ATOM   344   C CB  . THR A  1 42  ? 31.436  78.325  13.563  1.00 50.98  ? 182  THR A CB  1 
ATOM   345   O OG1 . THR A  1 42  ? 32.509  78.977  14.239  1.00 56.94  ? 182  THR A OG1 1 
ATOM   346   C CG2 . THR A  1 42  ? 30.703  77.430  14.530  1.00 49.14  ? 182  THR A CG2 1 
ATOM   347   N N   . HIS A  1 43  ? 30.759  78.613  10.733  1.00 52.14  ? 183  HIS A N   1 
ATOM   348   C CA  . HIS A  1 43  ? 29.782  78.868  9.697   1.00 53.55  ? 183  HIS A CA  1 
ATOM   349   C C   . HIS A  1 43  ? 29.641  77.658  8.800   1.00 46.65  ? 183  HIS A C   1 
ATOM   350   O O   . HIS A  1 43  ? 28.536  77.188  8.552   1.00 44.83  ? 183  HIS A O   1 
ATOM   351   C CB  . HIS A  1 43  ? 30.228  80.092  8.909   1.00 69.66  ? 183  HIS A CB  1 
ATOM   352   C CG  . HIS A  1 43  ? 31.015  81.069  9.736   1.00 95.53  ? 183  HIS A CG  1 
ATOM   353   N ND1 . HIS A  1 43  ? 32.385  80.975  9.895   1.00 98.38  ? 183  HIS A ND1 1 
ATOM   354   C CD2 . HIS A  1 43  ? 30.621  82.125  10.494  1.00 100.00 ? 183  HIS A CD2 1 
ATOM   355   C CE1 . HIS A  1 43  ? 32.799  81.929  10.713  1.00 96.96  ? 183  HIS A CE1 1 
ATOM   356   N NE2 . HIS A  1 43  ? 31.749  82.641  11.091  1.00 100.00 ? 183  HIS A NE2 1 
ATOM   357   N N   . LEU A  1 44  ? 30.762  77.140  8.329   1.00 41.83  ? 184  LEU A N   1 
ATOM   358   C CA  . LEU A  1 44  ? 30.736  75.972  7.482   1.00 36.72  ? 184  LEU A CA  1 
ATOM   359   C C   . LEU A  1 44  ? 30.104  74.753  8.179   1.00 39.46  ? 184  LEU A C   1 
ATOM   360   O O   . LEU A  1 44  ? 29.384  73.974  7.545   1.00 32.79  ? 184  LEU A O   1 
ATOM   361   C CB  . LEU A  1 44  ? 32.153  75.690  7.017   1.00 42.49  ? 184  LEU A CB  1 
ATOM   362   C CG  . LEU A  1 44  ? 32.642  76.450  5.769   1.00 40.22  ? 184  LEU A CG  1 
ATOM   363   C CD1 . LEU A  1 44  ? 31.729  77.595  5.418   1.00 30.11  ? 184  LEU A CD1 1 
ATOM   364   C CD2 . LEU A  1 44  ? 34.060  76.900  6.016   1.00 24.63  ? 184  LEU A CD2 1 
ATOM   365   N N   . ASP A  1 45  ? 30.356  74.597  9.483   1.00 40.35  ? 185  ASP A N   1 
ATOM   366   C CA  . ASP A  1 45  ? 29.778  73.494  10.253  1.00 37.62  ? 185  ASP A CA  1 
ATOM   367   C C   . ASP A  1 45  ? 28.273  73.712  10.296  1.00 34.34  ? 185  ASP A C   1 
ATOM   368   O O   . ASP A  1 45  ? 27.465  72.845  9.905   1.00 20.96  ? 185  ASP A O   1 
ATOM   369   C CB  . ASP A  1 45  ? 30.292  73.479  11.702  1.00 46.93  ? 185  ASP A CB  1 
ATOM   370   C CG  . ASP A  1 45  ? 31.715  72.967  11.834  1.00 49.34  ? 185  ASP A CG  1 
ATOM   371   O OD1 . ASP A  1 45  ? 32.199  72.276  10.911  1.00 42.16  ? 185  ASP A OD1 1 
ATOM   372   O OD2 . ASP A  1 45  ? 32.339  73.260  12.883  1.00 50.16  ? 185  ASP A OD2 1 
ATOM   373   N N   . ALA A  1 46  ? 27.903  74.886  10.794  1.00 25.79  ? 186  ALA A N   1 
ATOM   374   C CA  . ALA A  1 46  ? 26.497  75.252  10.889  1.00 34.32  ? 186  ALA A CA  1 
ATOM   375   C C   . ALA A  1 46  ? 25.789  74.963  9.585   1.00 32.41  ? 186  ALA A C   1 
ATOM   376   O O   . ALA A  1 46  ? 24.736  74.340  9.562   1.00 37.58  ? 186  ALA A O   1 
ATOM   377   C CB  . ALA A  1 46  ? 26.363  76.705  11.224  1.00 27.46  ? 186  ALA A CB  1 
ATOM   378   N N   . GLY A  1 47  ? 26.385  75.417  8.494   1.00 39.28  ? 187  GLY A N   1 
ATOM   379   C CA  . GLY A  1 47  ? 25.805  75.185  7.186   1.00 40.55  ? 187  GLY A CA  1 
ATOM   380   C C   . GLY A  1 47  ? 25.619  73.711  6.909   1.00 38.28  ? 187  GLY A C   1 
ATOM   381   O O   . GLY A  1 47  ? 24.497  73.245  6.649   1.00 39.05  ? 187  GLY A O   1 
ATOM   382   N N   . ALA A  1 48  ? 26.725  72.976  6.982   1.00 35.53  ? 188  ALA A N   1 
ATOM   383   C CA  . ALA A  1 48  ? 26.715  71.534  6.756   1.00 34.90  ? 188  ALA A CA  1 
ATOM   384   C C   . ALA A  1 48  ? 25.676  70.851  7.639   1.00 36.20  ? 188  ALA A C   1 
ATOM   385   O O   . ALA A  1 48  ? 24.895  70.032  7.159   1.00 33.45  ? 188  ALA A O   1 
ATOM   386   C CB  . ALA A  1 48  ? 28.081  70.974  7.030   1.00 34.21  ? 188  ALA A CB  1 
ATOM   387   N N   . LEU A  1 49  ? 25.655  71.206  8.926   1.00 38.03  ? 189  LEU A N   1 
ATOM   388   C CA  . LEU A  1 49  ? 24.707  70.617  9.859   1.00 37.89  ? 189  LEU A CA  1 
ATOM   389   C C   . LEU A  1 49  ? 23.292  70.854  9.362   1.00 37.77  ? 189  LEU A C   1 
ATOM   390   O O   . LEU A  1 49  ? 22.511  69.911  9.168   1.00 35.81  ? 189  LEU A O   1 
ATOM   391   C CB  . LEU A  1 49  ? 24.904  71.219  11.244  1.00 33.46  ? 189  LEU A CB  1 
ATOM   392   C CG  . LEU A  1 49  ? 26.104  70.627  11.975  1.00 29.56  ? 189  LEU A CG  1 
ATOM   393   C CD1 . LEU A  1 49  ? 26.434  71.410  13.228  1.00 26.60  ? 189  LEU A CD1 1 
ATOM   394   C CD2 . LEU A  1 49  ? 25.786  69.192  12.292  1.00 35.83  ? 189  LEU A CD2 1 
ATOM   395   N N   . THR A  1 50  ? 22.983  72.124  9.129   1.00 38.31  ? 190  THR A N   1 
ATOM   396   C CA  . THR A  1 50  ? 21.668  72.527  8.636   1.00 40.86  ? 190  THR A CA  1 
ATOM   397   C C   . THR A  1 50  ? 21.225  71.717  7.433   1.00 37.76  ? 190  THR A C   1 
ATOM   398   O O   . THR A  1 50  ? 20.137  71.146  7.420   1.00 40.82  ? 190  THR A O   1 
ATOM   399   C CB  . THR A  1 50  ? 21.652  73.966  8.211   1.00 32.91  ? 190  THR A CB  1 
ATOM   400   O OG1 . THR A  1 50  ? 22.332  74.751  9.183   1.00 39.21  ? 190  THR A OG1 1 
ATOM   401   C CG2 . THR A  1 50  ? 20.232  74.451  8.119   1.00 35.50  ? 190  THR A CG2 1 
ATOM   402   N N   . THR A  1 51  ? 22.074  71.679  6.423   1.00 30.20  ? 191  THR A N   1 
ATOM   403   C CA  . THR A  1 51  ? 21.780  70.934  5.217   1.00 38.57  ? 191  THR A CA  1 
ATOM   404   C C   . THR A  1 51  ? 21.535  69.468  5.519   1.00 39.27  ? 191  THR A C   1 
ATOM   405   O O   . THR A  1 51  ? 20.533  68.880  5.119   1.00 34.48  ? 191  THR A O   1 
ATOM   406   C CB  . THR A  1 51  ? 22.956  70.988  4.231   1.00 46.22  ? 191  THR A CB  1 
ATOM   407   O OG1 . THR A  1 51  ? 23.331  72.350  3.995   1.00 60.72  ? 191  THR A OG1 1 
ATOM   408   C CG2 . THR A  1 51  ? 22.573  70.334  2.921   1.00 46.26  ? 191  THR A CG2 1 
ATOM   409   N N   . THR A  1 52  ? 22.481  68.876  6.230   1.00 43.02  ? 192  THR A N   1 
ATOM   410   C CA  . THR A  1 52  ? 22.406  67.467  6.559   1.00 49.33  ? 192  THR A CA  1 
ATOM   411   C C   . THR A  1 52  ? 21.149  67.075  7.304   1.00 49.16  ? 192  THR A C   1 
ATOM   412   O O   . THR A  1 52  ? 20.410  66.196  6.860   1.00 48.32  ? 192  THR A O   1 
ATOM   413   C CB  . THR A  1 52  ? 23.605  67.034  7.395   1.00 44.71  ? 192  THR A CB  1 
ATOM   414   O OG1 . THR A  1 52  ? 24.800  67.471  6.760   1.00 48.96  ? 192  THR A OG1 1 
ATOM   415   C CG2 . THR A  1 52  ? 23.643  65.532  7.516   1.00 53.28  ? 192  THR A CG2 1 
ATOM   416   N N   . PHE A  1 53  ? 20.908  67.723  8.438   1.00 46.37  ? 193  PHE A N   1 
ATOM   417   C CA  . PHE A  1 53  ? 19.741  67.387  9.214   1.00 48.83  ? 193  PHE A CA  1 
ATOM   418   C C   . PHE A  1 53  ? 18.449  67.850  8.585   1.00 51.70  ? 193  PHE A C   1 
ATOM   419   O O   . PHE A  1 53  ? 17.393  67.274  8.837   1.00 53.85  ? 193  PHE A O   1 
ATOM   420   C CB  . PHE A  1 53  ? 19.905  67.891  10.637  1.00 45.53  ? 193  PHE A CB  1 
ATOM   421   C CG  . PHE A  1 53  ? 20.843  67.051  11.437  1.00 49.38  ? 193  PHE A CG  1 
ATOM   422   C CD1 . PHE A  1 53  ? 20.493  65.747  11.790  1.00 52.32  ? 193  PHE A CD1 1 
ATOM   423   C CD2 . PHE A  1 53  ? 22.110  67.514  11.768  1.00 50.82  ? 193  PHE A CD2 1 
ATOM   424   C CE1 . PHE A  1 53  ? 21.397  64.909  12.460  1.00 48.19  ? 193  PHE A CE1 1 
ATOM   425   C CE2 . PHE A  1 53  ? 23.018  66.692  12.435  1.00 49.96  ? 193  PHE A CE2 1 
ATOM   426   C CZ  . PHE A  1 53  ? 22.656  65.379  12.781  1.00 48.00  ? 193  PHE A CZ  1 
ATOM   427   N N   . GLU A  1 54  ? 18.535  68.876  7.749   1.00 50.52  ? 194  GLU A N   1 
ATOM   428   C CA  . GLU A  1 54  ? 17.368  69.353  7.054   1.00 49.08  ? 194  GLU A CA  1 
ATOM   429   C C   . GLU A  1 54  ? 16.987  68.197  6.123   1.00 47.06  ? 194  GLU A C   1 
ATOM   430   O O   . GLU A  1 54  ? 15.841  67.777  6.080   1.00 44.92  ? 194  GLU A O   1 
ATOM   431   C CB  . GLU A  1 54  ? 17.709  70.603  6.256   1.00 55.73  ? 194  GLU A CB  1 
ATOM   432   C CG  . GLU A  1 54  ? 16.571  71.634  6.160   1.00 69.77  ? 194  GLU A CG  1 
ATOM   433   C CD  . GLU A  1 54  ? 17.007  72.958  5.529   1.00 74.90  ? 194  GLU A CD  1 
ATOM   434   O OE1 . GLU A  1 54  ? 17.482  72.952  4.366   1.00 78.62  ? 194  GLU A OE1 1 
ATOM   435   O OE2 . GLU A  1 54  ? 16.875  74.006  6.203   1.00 75.05  ? 194  GLU A OE2 1 
ATOM   436   N N   . GLU A  1 55  ? 17.966  67.656  5.407   1.00 51.05  ? 195  GLU A N   1 
ATOM   437   C CA  . GLU A  1 55  ? 17.716  66.537  4.489   1.00 55.89  ? 195  GLU A CA  1 
ATOM   438   C C   . GLU A  1 55  ? 17.161  65.322  5.222   1.00 57.00  ? 195  GLU A C   1 
ATOM   439   O O   . GLU A  1 55  ? 16.515  64.465  4.619   1.00 52.60  ? 195  GLU A O   1 
ATOM   440   C CB  . GLU A  1 55  ? 19.000  66.117  3.764   1.00 56.41  ? 195  GLU A CB  1 
ATOM   441   C CG  . GLU A  1 55  ? 19.682  67.195  2.965   1.00 70.98  ? 195  GLU A CG  1 
ATOM   442   C CD  . GLU A  1 55  ? 20.952  66.709  2.303   1.00 76.41  ? 195  GLU A CD  1 
ATOM   443   O OE1 . GLU A  1 55  ? 21.125  65.480  2.184   1.00 77.26  ? 195  GLU A OE1 1 
ATOM   444   O OE2 . GLU A  1 55  ? 21.777  67.557  1.891   1.00 85.76  ? 195  GLU A OE2 1 
ATOM   445   N N   . LEU A  1 56  ? 17.430  65.245  6.521   1.00 59.99  ? 196  LEU A N   1 
ATOM   446   C CA  . LEU A  1 56  ? 16.958  64.137  7.332   1.00 58.57  ? 196  LEU A CA  1 
ATOM   447   C C   . LEU A  1 56  ? 15.593  64.417  7.939   1.00 61.09  ? 196  LEU A C   1 
ATOM   448   O O   . LEU A  1 56  ? 15.093  63.650  8.766   1.00 62.36  ? 196  LEU A O   1 
ATOM   449   C CB  . LEU A  1 56  ? 17.967  63.840  8.424   1.00 57.01  ? 196  LEU A CB  1 
ATOM   450   C CG  . LEU A  1 56  ? 19.238  63.180  7.900   1.00 48.06  ? 196  LEU A CG  1 
ATOM   451   C CD1 . LEU A  1 56  ? 20.152  62.884  9.066   1.00 48.30  ? 196  LEU A CD1 1 
ATOM   452   C CD2 . LEU A  1 56  ? 18.895  61.905  7.147   1.00 45.08  ? 196  LEU A CD2 1 
ATOM   453   N N   . HIS A  1 57  ? 15.008  65.528  7.505   1.00 60.53  ? 197  HIS A N   1 
ATOM   454   C CA  . HIS A  1 57  ? 13.691  65.986  7.927   1.00 53.08  ? 197  HIS A CA  1 
ATOM   455   C C   . HIS A  1 57  ? 13.622  66.537  9.335   1.00 49.26  ? 197  HIS A C   1 
ATOM   456   O O   . HIS A  1 57  ? 12.681  66.260  10.049  1.00 53.45  ? 197  HIS A O   1 
ATOM   457   C CB  . HIS A  1 57  ? 12.664  64.867  7.756   1.00 55.00  ? 197  HIS A CB  1 
ATOM   458   C CG  . HIS A  1 57  ? 12.658  64.261  6.387   1.00 58.98  ? 197  HIS A CG  1 
ATOM   459   N ND1 . HIS A  1 57  ? 12.643  65.019  5.239   1.00 60.83  ? 197  HIS A ND1 1 
ATOM   460   C CD2 . HIS A  1 57  ? 12.666  62.969  5.984   1.00 64.38  ? 197  HIS A CD2 1 
ATOM   461   C CE1 . HIS A  1 57  ? 12.645  64.220  4.188   1.00 71.09  ? 197  HIS A CE1 1 
ATOM   462   N NE2 . HIS A  1 57  ? 12.659  62.970  4.611   1.00 64.62  ? 197  HIS A NE2 1 
ATOM   463   N N   . PHE A  1 58  ? 14.609  67.332  9.726   1.00 46.49  ? 198  PHE A N   1 
ATOM   464   C CA  . PHE A  1 58  ? 14.636  67.926  11.051  1.00 43.79  ? 198  PHE A CA  1 
ATOM   465   C C   . PHE A  1 58  ? 14.415  69.414  10.905  1.00 43.40  ? 198  PHE A C   1 
ATOM   466   O O   . PHE A  1 58  ? 14.802  69.983  9.886   1.00 54.15  ? 198  PHE A O   1 
ATOM   467   C CB  . PHE A  1 58  ? 15.998  67.679  11.734  1.00 45.29  ? 198  PHE A CB  1 
ATOM   468   C CG  . PHE A  1 58  ? 16.068  66.386  12.495  1.00 41.64  ? 198  PHE A CG  1 
ATOM   469   C CD1 . PHE A  1 58  ? 16.180  65.180  11.824  1.00 39.54  ? 198  PHE A CD1 1 
ATOM   470   C CD2 . PHE A  1 58  ? 15.961  66.374  13.882  1.00 35.90  ? 198  PHE A CD2 1 
ATOM   471   C CE1 . PHE A  1 58  ? 16.182  63.980  12.522  1.00 49.25  ? 198  PHE A CE1 1 
ATOM   472   C CE2 . PHE A  1 58  ? 15.960  65.178  14.583  1.00 43.43  ? 198  PHE A CE2 1 
ATOM   473   C CZ  . PHE A  1 58  ? 16.071  63.976  13.905  1.00 46.48  ? 198  PHE A CZ  1 
ATOM   474   N N   . GLU A  1 59  ? 13.801  70.049  11.902  1.00 35.35  ? 199  GLU A N   1 
ATOM   475   C CA  . GLU A  1 59  ? 13.595  71.489  11.840  1.00 36.83  ? 199  GLU A CA  1 
ATOM   476   C C   . GLU A  1 59  ? 14.757  72.214  12.515  1.00 36.75  ? 199  GLU A C   1 
ATOM   477   O O   . GLU A  1 59  ? 14.821  72.330  13.731  1.00 37.95  ? 199  GLU A O   1 
ATOM   478   C CB  . GLU A  1 59  ? 12.267  71.886  12.481  1.00 41.77  ? 199  GLU A CB  1 
ATOM   479   C CG  . GLU A  1 59  ? 12.016  73.392  12.494  1.00 59.14  ? 199  GLU A CG  1 
ATOM   480   C CD  . GLU A  1 59  ? 10.556  73.757  12.731  1.00 69.50  ? 199  GLU A CD  1 
ATOM   481   O OE1 . GLU A  1 59  ? 9.681   72.940  12.372  1.00 74.70  ? 199  GLU A OE1 1 
ATOM   482   O OE2 . GLU A  1 59  ? 10.282  74.865  13.259  1.00 65.08  ? 199  GLU A OE2 1 
ATOM   483   N N   . ILE A  1 60  ? 15.672  72.723  11.700  1.00 35.83  ? 200  ILE A N   1 
ATOM   484   C CA  . ILE A  1 60  ? 16.847  73.396  12.207  1.00 38.82  ? 200  ILE A CA  1 
ATOM   485   C C   . ILE A  1 60  ? 16.483  74.658  12.956  1.00 37.67  ? 200  ILE A C   1 
ATOM   486   O O   . ILE A  1 60  ? 15.550  75.332  12.590  1.00 45.83  ? 200  ILE A O   1 
ATOM   487   C CB  . ILE A  1 60  ? 17.822  73.735  11.062  1.00 40.45  ? 200  ILE A CB  1 
ATOM   488   C CG1 . ILE A  1 60  ? 17.902  72.565  10.073  1.00 33.74  ? 200  ILE A CG1 1 
ATOM   489   C CG2 . ILE A  1 60  ? 19.211  74.044  11.623  1.00 34.12  ? 200  ILE A CG2 1 
ATOM   490   C CD1 . ILE A  1 60  ? 18.074  71.217  10.702  1.00 34.30  ? 200  ILE A CD1 1 
ATOM   491   N N   . LYS A  1 61  ? 17.234  74.973  14.003  1.00 39.52  ? 201  LYS A N   1 
ATOM   492   C CA  . LYS A  1 61  ? 16.979  76.145  14.822  1.00 36.83  ? 201  LYS A CA  1 
ATOM   493   C C   . LYS A  1 61  ? 18.293  76.753  15.267  1.00 36.53  ? 201  LYS A C   1 
ATOM   494   O O   . LYS A  1 61  ? 18.733  76.559  16.391  1.00 32.08  ? 201  LYS A O   1 
ATOM   495   C CB  . LYS A  1 61  ? 16.147  75.763  16.054  1.00 39.60  ? 201  LYS A CB  1 
ATOM   496   C CG  . LYS A  1 61  ? 14.679  75.457  15.764  1.00 43.66  ? 201  LYS A CG  1 
ATOM   497   C CD  . LYS A  1 61  ? 13.879  76.736  15.529  1.00 45.86  ? 201  LYS A CD  1 
ATOM   498   C CE  . LYS A  1 61  ? 12.490  76.447  14.985  1.00 48.33  ? 201  LYS A CE  1 
ATOM   499   N NZ  . LYS A  1 61  ? 11.721  77.695  14.787  1.00 57.49  ? 201  LYS A NZ  1 
ATOM   500   N N   . PRO A  1 62  ? 18.933  77.518  14.381  1.00 39.94  ? 202  PRO A N   1 
ATOM   501   C CA  . PRO A  1 62  ? 20.213  78.181  14.647  1.00 38.57  ? 202  PRO A CA  1 
ATOM   502   C C   . PRO A  1 62  ? 20.135  79.268  15.690  1.00 41.57  ? 202  PRO A C   1 
ATOM   503   O O   . PRO A  1 62  ? 19.072  79.793  15.972  1.00 46.45  ? 202  PRO A O   1 
ATOM   504   C CB  . PRO A  1 62  ? 20.603  78.739  13.299  1.00 29.85  ? 202  PRO A CB  1 
ATOM   505   C CG  . PRO A  1 62  ? 19.295  79.016  12.679  1.00 40.13  ? 202  PRO A CG  1 
ATOM   506   C CD  . PRO A  1 62  ? 18.479  77.799  13.014  1.00 39.56  ? 202  PRO A CD  1 
ATOM   507   N N   . HIS A  1 63  ? 21.290  79.588  16.251  1.00 44.00  ? 203  HIS A N   1 
ATOM   508   C CA  . HIS A  1 63  ? 21.456  80.607  17.274  1.00 46.35  ? 203  HIS A CA  1 
ATOM   509   C C   . HIS A  1 63  ? 22.925  80.961  17.167  1.00 51.58  ? 203  HIS A C   1 
ATOM   510   O O   . HIS A  1 63  ? 23.764  80.063  17.086  1.00 52.42  ? 203  HIS A O   1 
ATOM   511   C CB  . HIS A  1 63  ? 21.165  80.027  18.653  1.00 47.37  ? 203  HIS A CB  1 
ATOM   512   C CG  . HIS A  1 63  ? 19.717  79.775  18.893  1.00 46.70  ? 203  HIS A CG  1 
ATOM   513   N ND1 . HIS A  1 63  ? 18.862  80.751  19.354  1.00 47.59  ? 203  HIS A ND1 1 
ATOM   514   C CD2 . HIS A  1 63  ? 18.955  78.680  18.672  1.00 50.37  ? 203  HIS A CD2 1 
ATOM   515   C CE1 . HIS A  1 63  ? 17.635  80.268  19.404  1.00 52.80  ? 203  HIS A CE1 1 
ATOM   516   N NE2 . HIS A  1 63  ? 17.662  79.013  18.994  1.00 57.16  ? 203  HIS A NE2 1 
ATOM   517   N N   . HIS A  1 64  ? 23.249  82.252  17.168  1.00 49.94  ? 204  HIS A N   1 
ATOM   518   C CA  . HIS A  1 64  ? 24.641  82.647  17.027  1.00 50.48  ? 204  HIS A CA  1 
ATOM   519   C C   . HIS A  1 64  ? 25.243  83.440  18.169  1.00 51.69  ? 204  HIS A C   1 
ATOM   520   O O   . HIS A  1 64  ? 24.562  84.212  18.846  1.00 48.96  ? 204  HIS A O   1 
ATOM   521   C CB  . HIS A  1 64  ? 24.806  83.412  15.719  1.00 55.06  ? 204  HIS A CB  1 
ATOM   522   C CG  . HIS A  1 64  ? 24.384  82.627  14.514  1.00 60.08  ? 204  HIS A CG  1 
ATOM   523   N ND1 . HIS A  1 64  ? 25.214  81.720  13.888  1.00 62.99  ? 204  HIS A ND1 1 
ATOM   524   C CD2 . HIS A  1 64  ? 23.201  82.572  13.855  1.00 58.19  ? 204  HIS A CD2 1 
ATOM   525   C CE1 . HIS A  1 64  ? 24.559  81.140  12.896  1.00 61.49  ? 204  HIS A CE1 1 
ATOM   526   N NE2 . HIS A  1 64  ? 23.336  81.638  12.854  1.00 58.23  ? 204  HIS A NE2 1 
ATOM   527   N N   . ASP A  1 65  ? 26.540  83.225  18.371  1.00 53.03  ? 205  ASP A N   1 
ATOM   528   C CA  . ASP A  1 65  ? 27.304  83.894  19.407  1.00 54.47  ? 205  ASP A CA  1 
ATOM   529   C C   . ASP A  1 65  ? 26.544  84.030  20.716  1.00 59.10  ? 205  ASP A C   1 
ATOM   530   O O   . ASP A  1 65  ? 26.486  85.105  21.298  1.00 64.43  ? 205  ASP A O   1 
ATOM   531   C CB  . ASP A  1 65  ? 27.730  85.254  18.890  1.00 59.23  ? 205  ASP A CB  1 
ATOM   532   C CG  . ASP A  1 65  ? 28.584  85.149  17.639  1.00 70.99  ? 205  ASP A CG  1 
ATOM   533   O OD1 . ASP A  1 65  ? 29.747  84.722  17.756  1.00 81.02  ? 205  ASP A OD1 1 
ATOM   534   O OD2 . ASP A  1 65  ? 28.102  85.477  16.533  1.00 72.86  ? 205  ASP A OD2 1 
ATOM   535   N N   . CYS A  1 66  ? 25.973  82.922  21.184  1.00 57.94  ? 206  CYS A N   1 
ATOM   536   C CA  . CYS A  1 66  ? 25.215  82.908  22.427  1.00 45.92  ? 206  CYS A CA  1 
ATOM   537   C C   . CYS A  1 66  ? 26.168  82.906  23.615  1.00 47.91  ? 206  CYS A C   1 
ATOM   538   O O   . CYS A  1 66  ? 27.266  82.362  23.531  1.00 49.11  ? 206  CYS A O   1 
ATOM   539   C CB  . CYS A  1 66  ? 24.339  81.661  22.485  1.00 44.91  ? 206  CYS A CB  1 
ATOM   540   S SG  . CYS A  1 66  ? 23.353  81.275  20.989  1.00 39.92  ? 206  CYS A SG  1 
ATOM   541   N N   . THR A  1 67  ? 25.767  83.540  24.711  1.00 51.25  ? 207  THR A N   1 
ATOM   542   C CA  . THR A  1 67  ? 26.589  83.546  25.923  1.00 54.32  ? 207  THR A CA  1 
ATOM   543   C C   . THR A  1 67  ? 26.065  82.394  26.761  1.00 55.70  ? 207  THR A C   1 
ATOM   544   O O   . THR A  1 67  ? 25.043  81.784  26.401  1.00 58.10  ? 207  THR A O   1 
ATOM   545   C CB  . THR A  1 67  ? 26.421  84.826  26.739  1.00 52.32  ? 207  THR A CB  1 
ATOM   546   O OG1 . THR A  1 67  ? 25.086  84.895  27.257  1.00 48.49  ? 207  THR A OG1 1 
ATOM   547   C CG2 . THR A  1 67  ? 26.696  86.021  25.877  1.00 43.75  ? 207  THR A CG2 1 
ATOM   548   N N   . VAL A  1 68  ? 26.742  82.091  27.868  1.00 51.78  ? 208  VAL A N   1 
ATOM   549   C CA  . VAL A  1 68  ? 26.290  80.984  28.711  1.00 56.70  ? 208  VAL A CA  1 
ATOM   550   C C   . VAL A  1 68  ? 24.839  81.249  29.066  1.00 61.13  ? 208  VAL A C   1 
ATOM   551   O O   . VAL A  1 68  ? 23.960  80.384  28.911  1.00 62.15  ? 208  VAL A O   1 
ATOM   552   C CB  . VAL A  1 68  ? 27.114  80.870  30.006  1.00 50.61  ? 208  VAL A CB  1 
ATOM   553   C CG1 . VAL A  1 68  ? 26.417  79.924  30.978  1.00 44.05  ? 208  VAL A CG1 1 
ATOM   554   C CG2 . VAL A  1 68  ? 28.499  80.336  29.692  1.00 48.64  ? 208  VAL A CG2 1 
ATOM   555   N N   . GLU A  1 69  ? 24.608  82.472  29.527  1.00 59.72  ? 209  GLU A N   1 
ATOM   556   C CA  . GLU A  1 69  ? 23.292  82.925  29.907  1.00 57.39  ? 209  GLU A CA  1 
ATOM   557   C C   . GLU A  1 69  ? 22.285  82.551  28.822  1.00 54.02  ? 209  GLU A C   1 
ATOM   558   O O   . GLU A  1 69  ? 21.284  81.846  29.056  1.00 50.80  ? 209  GLU A O   1 
ATOM   559   C CB  . GLU A  1 69  ? 23.332  84.442  30.080  1.00 71.17  ? 209  GLU A CB  1 
ATOM   560   C CG  . GLU A  1 69  ? 22.080  85.039  30.704  1.00 89.98  ? 209  GLU A CG  1 
ATOM   561   C CD  . GLU A  1 69  ? 21.886  84.595  32.148  1.00 100.00 ? 209  GLU A CD  1 
ATOM   562   O OE1 . GLU A  1 69  ? 21.828  83.360  32.393  1.00 100.00 ? 209  GLU A OE1 1 
ATOM   563   O OE2 . GLU A  1 69  ? 21.793  85.481  33.037  1.00 100.00 ? 209  GLU A OE2 1 
ATOM   564   N N   . GLN A  1 70  ? 22.574  83.021  27.618  1.00 50.11  ? 210  GLN A N   1 
ATOM   565   C CA  . GLN A  1 70  ? 21.707  82.787  26.473  1.00 50.99  ? 210  GLN A CA  1 
ATOM   566   C C   . GLN A  1 70  ? 21.495  81.316  26.125  1.00 51.92  ? 210  GLN A C   1 
ATOM   567   O O   . GLN A  1 70  ? 20.401  80.918  25.706  1.00 39.55  ? 210  GLN A O   1 
ATOM   568   C CB  . GLN A  1 70  ? 22.271  83.533  25.273  1.00 52.08  ? 210  GLN A CB  1 
ATOM   569   C CG  . GLN A  1 70  ? 22.511  85.000  25.551  1.00 58.76  ? 210  GLN A CG  1 
ATOM   570   C CD  . GLN A  1 70  ? 23.107  85.739  24.372  1.00 60.34  ? 210  GLN A CD  1 
ATOM   571   O OE1 . GLN A  1 70  ? 22.562  85.727  23.278  1.00 62.02  ? 210  GLN A OE1 1 
ATOM   572   N NE2 . GLN A  1 70  ? 24.234  86.388  24.596  1.00 68.29  ? 210  GLN A NE2 1 
ATOM   573   N N   . ILE A  1 71  ? 22.551  80.519  26.285  1.00 53.07  ? 211  ILE A N   1 
ATOM   574   C CA  . ILE A  1 71  ? 22.477  79.098  25.986  1.00 52.74  ? 211  ILE A CA  1 
ATOM   575   C C   . ILE A  1 71  ? 21.470  78.446  26.914  1.00 52.87  ? 211  ILE A C   1 
ATOM   576   O O   . ILE A  1 71  ? 20.500  77.804  26.470  1.00 46.97  ? 211  ILE A O   1 
ATOM   577   C CB  . ILE A  1 71  ? 23.876  78.428  26.120  1.00 54.02  ? 211  ILE A CB  1 
ATOM   578   C CG1 . ILE A  1 71  ? 24.760  78.892  24.944  1.00 45.60  ? 211  ILE A CG1 1 
ATOM   579   C CG2 . ILE A  1 71  ? 23.745  76.886  26.136  1.00 34.28  ? 211  ILE A CG2 1 
ATOM   580   C CD1 . ILE A  1 71  ? 26.193  78.498  25.054  1.00 31.68  ? 211  ILE A CD1 1 
ATOM   581   N N   . TYR A  1 72  ? 21.685  78.632  28.210  1.00 57.22  ? 212  TYR A N   1 
ATOM   582   C CA  . TYR A  1 72  ? 20.780  78.062  29.193  1.00 58.12  ? 212  TYR A CA  1 
ATOM   583   C C   . TYR A  1 72  ? 19.353  78.450  28.846  1.00 59.92  ? 212  TYR A C   1 
ATOM   584   O O   . TYR A  1 72  ? 18.456  77.599  28.835  1.00 58.06  ? 212  TYR A O   1 
ATOM   585   C CB  . TYR A  1 72  ? 21.163  78.564  30.572  1.00 50.64  ? 212  TYR A CB  1 
ATOM   586   C CG  . TYR A  1 72  ? 22.336  77.828  31.165  1.00 52.74  ? 212  TYR A CG  1 
ATOM   587   C CD1 . TYR A  1 72  ? 22.404  76.433  31.120  1.00 52.76  ? 212  TYR A CD1 1 
ATOM   588   C CD2 . TYR A  1 72  ? 23.346  78.512  31.829  1.00 51.17  ? 212  TYR A CD2 1 
ATOM   589   C CE1 . TYR A  1 72  ? 23.443  75.741  31.728  1.00 51.39  ? 212  TYR A CE1 1 
ATOM   590   C CE2 . TYR A  1 72  ? 24.390  77.829  32.439  1.00 56.43  ? 212  TYR A CE2 1 
ATOM   591   C CZ  . TYR A  1 72  ? 24.430  76.442  32.387  1.00 56.58  ? 212  TYR A CZ  1 
ATOM   592   O OH  . TYR A  1 72  ? 25.452  75.759  33.012  1.00 65.37  ? 212  TYR A OH  1 
ATOM   593   N N   . GLU A  1 73  ? 19.158  79.737  28.553  1.00 59.48  ? 213  GLU A N   1 
ATOM   594   C CA  . GLU A  1 73  ? 17.844  80.254  28.171  1.00 63.80  ? 213  GLU A CA  1 
ATOM   595   C C   . GLU A  1 73  ? 17.225  79.465  27.018  1.00 59.97  ? 213  GLU A C   1 
ATOM   596   O O   . GLU A  1 73  ? 16.059  79.031  27.090  1.00 56.92  ? 213  GLU A O   1 
ATOM   597   C CB  . GLU A  1 73  ? 17.955  81.712  27.739  1.00 73.58  ? 213  GLU A CB  1 
ATOM   598   C CG  . GLU A  1 73  ? 17.896  82.731  28.867  1.00 89.20  ? 213  GLU A CG  1 
ATOM   599   C CD  . GLU A  1 73  ? 18.090  84.163  28.358  1.00 92.75  ? 213  GLU A CD  1 
ATOM   600   O OE1 . GLU A  1 73  ? 17.574  84.470  27.255  1.00 94.76  ? 213  GLU A OE1 1 
ATOM   601   O OE2 . GLU A  1 73  ? 18.747  84.974  29.061  1.00 90.94  ? 213  GLU A OE2 1 
ATOM   602   N N   . ILE A  1 74  ? 18.010  79.298  25.952  1.00 50.14  ? 214  ILE A N   1 
ATOM   603   C CA  . ILE A  1 74  ? 17.562  78.569  24.778  1.00 40.91  ? 214  ILE A CA  1 
ATOM   604   C C   . ILE A  1 74  ? 17.196  77.125  25.091  1.00 40.43  ? 214  ILE A C   1 
ATOM   605   O O   . ILE A  1 74  ? 16.192  76.609  24.594  1.00 40.84  ? 214  ILE A O   1 
ATOM   606   C CB  . ILE A  1 74  ? 18.634  78.586  23.694  1.00 41.81  ? 214  ILE A CB  1 
ATOM   607   C CG1 . ILE A  1 74  ? 19.012  80.033  23.387  1.00 33.30  ? 214  ILE A CG1 1 
ATOM   608   C CG2 . ILE A  1 74  ? 18.134  77.840  22.447  1.00 30.95  ? 214  ILE A CG2 1 
ATOM   609   C CD1 . ILE A  1 74  ? 20.035  80.164  22.315  1.00 45.99  ? 214  ILE A CD1 1 
ATOM   610   N N   . LEU A  1 75  ? 18.004  76.467  25.911  1.00 32.21  ? 215  LEU A N   1 
ATOM   611   C CA  . LEU A  1 75  ? 17.694  75.095  26.260  1.00 41.19  ? 215  LEU A CA  1 
ATOM   612   C C   . LEU A  1 75  ? 16.430  75.037  27.122  1.00 43.89  ? 215  LEU A C   1 
ATOM   613   O O   . LEU A  1 75  ? 15.597  74.133  26.970  1.00 41.24  ? 215  LEU A O   1 
ATOM   614   C CB  . LEU A  1 75  ? 18.881  74.457  26.981  1.00 46.07  ? 215  LEU A CB  1 
ATOM   615   C CG  . LEU A  1 75  ? 20.132  74.358  26.097  1.00 51.22  ? 215  LEU A CG  1 
ATOM   616   C CD1 . LEU A  1 75  ? 21.297  73.823  26.921  1.00 44.04  ? 215  LEU A CD1 1 
ATOM   617   C CD2 . LEU A  1 75  ? 19.856  73.459  24.880  1.00 43.98  ? 215  LEU A CD2 1 
ATOM   618   N N   . LYS A  1 76  ? 16.280  76.016  28.011  1.00 47.31  ? 216  LYS A N   1 
ATOM   619   C CA  . LYS A  1 76  ? 15.113  76.093  28.880  1.00 49.57  ? 216  LYS A CA  1 
ATOM   620   C C   . LYS A  1 76  ? 13.846  76.057  28.035  1.00 46.95  ? 216  LYS A C   1 
ATOM   621   O O   . LYS A  1 76  ? 12.891  75.354  28.355  1.00 46.51  ? 216  LYS A O   1 
ATOM   622   C CB  . LYS A  1 76  ? 15.130  77.387  29.705  1.00 52.82  ? 216  LYS A CB  1 
ATOM   623   C CG  . LYS A  1 76  ? 14.059  77.423  30.811  1.00 58.20  ? 216  LYS A CG  1 
ATOM   624   C CD  . LYS A  1 76  ? 14.231  76.239  31.760  1.00 72.50  ? 216  LYS A CD  1 
ATOM   625   C CE  . LYS A  1 76  ? 13.245  76.248  32.928  1.00 76.95  ? 216  LYS A CE  1 
ATOM   626   N NZ  . LYS A  1 76  ? 13.417  75.025  33.804  1.00 71.61  ? 216  LYS A NZ  1 
ATOM   627   N N   . ILE A  1 77  ? 13.844  76.829  26.957  1.00 44.40  ? 217  ILE A N   1 
ATOM   628   C CA  . ILE A  1 77  ? 12.704  76.876  26.062  1.00 34.34  ? 217  ILE A CA  1 
ATOM   629   C C   . ILE A  1 77  ? 12.392  75.492  25.527  1.00 35.36  ? 217  ILE A C   1 
ATOM   630   O O   . ILE A  1 77  ? 11.269  74.988  25.684  1.00 32.53  ? 217  ILE A O   1 
ATOM   631   C CB  . ILE A  1 77  ? 12.995  77.796  24.872  1.00 43.63  ? 217  ILE A CB  1 
ATOM   632   C CG1 . ILE A  1 77  ? 13.063  79.245  25.345  1.00 52.50  ? 217  ILE A CG1 1 
ATOM   633   C CG2 . ILE A  1 77  ? 11.959  77.604  23.781  1.00 34.00  ? 217  ILE A CG2 1 
ATOM   634   C CD1 . ILE A  1 77  ? 13.499  80.208  24.257  1.00 51.62  ? 217  ILE A CD1 1 
ATOM   635   N N   . TYR A  1 78  ? 13.378  74.861  24.891  1.00 31.78  ? 218  TYR A N   1 
ATOM   636   C CA  . TYR A  1 78  ? 13.115  73.557  24.324  1.00 35.66  ? 218  TYR A CA  1 
ATOM   637   C C   . TYR A  1 78  ? 12.876  72.502  25.401  1.00 41.74  ? 218  TYR A C   1 
ATOM   638   O O   . TYR A  1 78  ? 12.170  71.487  25.184  1.00 29.20  ? 218  TYR A O   1 
ATOM   639   C CB  . TYR A  1 78  ? 14.228  73.165  23.375  1.00 29.06  ? 218  TYR A CB  1 
ATOM   640   C CG  . TYR A  1 78  ? 14.220  74.016  22.139  1.00 34.82  ? 218  TYR A CG  1 
ATOM   641   C CD1 . TYR A  1 78  ? 14.871  75.247  22.123  1.00 34.23  ? 218  TYR A CD1 1 
ATOM   642   C CD2 . TYR A  1 78  ? 13.484  73.637  21.009  1.00 38.05  ? 218  TYR A CD2 1 
ATOM   643   C CE1 . TYR A  1 78  ? 14.787  76.095  21.017  1.00 41.07  ? 218  TYR A CE1 1 
ATOM   644   C CE2 . TYR A  1 78  ? 13.388  74.475  19.884  1.00 35.66  ? 218  TYR A CE2 1 
ATOM   645   C CZ  . TYR A  1 78  ? 14.039  75.710  19.890  1.00 45.06  ? 218  TYR A CZ  1 
ATOM   646   O OH  . TYR A  1 78  ? 13.956  76.571  18.783  1.00 41.16  ? 218  TYR A OH  1 
ATOM   647   N N   . GLN A  1 79  ? 13.444  72.746  26.574  1.00 36.54  ? 219  GLN A N   1 
ATOM   648   C CA  . GLN A  1 79  ? 13.223  71.823  27.656  1.00 43.51  ? 219  GLN A CA  1 
ATOM   649   C C   . GLN A  1 79  ? 11.738  71.822  27.995  1.00 52.09  ? 219  GLN A C   1 
ATOM   650   O O   . GLN A  1 79  ? 11.161  70.768  28.310  1.00 57.23  ? 219  GLN A O   1 
ATOM   651   C CB  . GLN A  1 79  ? 13.977  72.251  28.892  1.00 48.25  ? 219  GLN A CB  1 
ATOM   652   C CG  . GLN A  1 79  ? 13.601  71.408  30.083  1.00 53.65  ? 219  GLN A CG  1 
ATOM   653   C CD  . GLN A  1 79  ? 13.511  72.217  31.345  1.00 57.36  ? 219  GLN A CD  1 
ATOM   654   O OE1 . GLN A  1 79  ? 14.362  73.067  31.614  1.00 55.80  ? 219  GLN A OE1 1 
ATOM   655   N NE2 . GLN A  1 79  ? 12.483  71.953  32.139  1.00 62.01  ? 219  GLN A NE2 1 
ATOM   656   N N   . LEU A  1 80  ? 11.129  73.010  27.928  1.00 49.14  ? 220  LEU A N   1 
ATOM   657   C CA  . LEU A  1 80  ? 9.720   73.191  28.263  1.00 46.52  ? 220  LEU A CA  1 
ATOM   658   C C   . LEU A  1 80  ? 8.749   73.018  27.121  1.00 48.00  ? 220  LEU A C   1 
ATOM   659   O O   . LEU A  1 80  ? 7.545   73.067  27.318  1.00 55.56  ? 220  LEU A O   1 
ATOM   660   C CB  . LEU A  1 80  ? 9.514   74.566  28.887  1.00 43.02  ? 220  LEU A CB  1 
ATOM   661   C CG  . LEU A  1 80  ? 10.269  74.755  30.189  1.00 35.53  ? 220  LEU A CG  1 
ATOM   662   C CD1 . LEU A  1 80  ? 10.142  76.184  30.659  1.00 34.95  ? 220  LEU A CD1 1 
ATOM   663   C CD2 . LEU A  1 80  ? 9.710   73.775  31.215  1.00 44.54  ? 220  LEU A CD2 1 
ATOM   664   N N   . MET A  1 81  ? 9.252   72.836  25.919  1.00 48.61  ? 221  MET A N   1 
ATOM   665   C CA  . MET A  1 81  ? 8.341   72.646  24.811  1.00 55.45  ? 221  MET A CA  1 
ATOM   666   C C   . MET A  1 81  ? 7.653   71.299  24.894  1.00 49.82  ? 221  MET A C   1 
ATOM   667   O O   . MET A  1 81  ? 8.002   70.482  25.725  1.00 57.59  ? 221  MET A O   1 
ATOM   668   C CB  . MET A  1 81  ? 9.090   72.757  23.501  1.00 56.35  ? 221  MET A CB  1 
ATOM   669   C CG  . MET A  1 81  ? 9.341   74.177  23.094  1.00 65.13  ? 221  MET A CG  1 
ATOM   670   S SD  . MET A  1 81  ? 9.427   74.164  21.340  1.00 72.87  ? 221  MET A SD  1 
ATOM   671   C CE  . MET A  1 81  ? 8.041   73.083  20.927  1.00 69.44  ? 221  MET A CE  1 
ATOM   672   N N   . ASP A  1 82  ? 6.661   71.071  24.046  1.00 48.62  ? 222  ASP A N   1 
ATOM   673   C CA  . ASP A  1 82  ? 5.969   69.800  24.050  1.00 46.08  ? 222  ASP A CA  1 
ATOM   674   C C   . ASP A  1 82  ? 6.395   69.102  22.784  1.00 49.21  ? 222  ASP A C   1 
ATOM   675   O O   . ASP A  1 82  ? 6.010   69.499  21.685  1.00 49.99  ? 222  ASP A O   1 
ATOM   676   C CB  . ASP A  1 82  ? 4.447   69.992  24.081  1.00 54.80  ? 222  ASP A CB  1 
ATOM   677   C CG  . ASP A  1 82  ? 3.682   68.666  23.963  1.00 61.03  ? 222  ASP A CG  1 
ATOM   678   O OD1 . ASP A  1 82  ? 4.242   67.698  23.405  1.00 56.97  ? 222  ASP A OD1 1 
ATOM   679   O OD2 . ASP A  1 82  ? 2.515   68.588  24.412  1.00 64.06  ? 222  ASP A OD2 1 
ATOM   680   N N   . HIS A  1 83  ? 7.204   68.061  22.945  1.00 47.45  ? 224  HIS A N   1 
ATOM   681   C CA  . HIS A  1 83  ? 7.712   67.307  21.814  1.00 44.39  ? 224  HIS A CA  1 
ATOM   682   C C   . HIS A  1 83  ? 6.847   66.105  21.475  1.00 49.16  ? 224  HIS A C   1 
ATOM   683   O O   . HIS A  1 83  ? 7.265   65.250  20.705  1.00 54.05  ? 224  HIS A O   1 
ATOM   684   C CB  . HIS A  1 83  ? 9.127   66.835  22.113  1.00 36.10  ? 224  HIS A CB  1 
ATOM   685   C CG  . HIS A  1 83  ? 10.090  67.939  22.415  1.00 33.50  ? 224  HIS A CG  1 
ATOM   686   N ND1 . HIS A  1 83  ? 10.989  68.413  21.486  1.00 33.32  ? 224  HIS A ND1 1 
ATOM   687   C CD2 . HIS A  1 83  ? 10.294  68.667  23.539  1.00 34.47  ? 224  HIS A CD2 1 
ATOM   688   C CE1 . HIS A  1 83  ? 11.705  69.387  22.024  1.00 31.05  ? 224  HIS A CE1 1 
ATOM   689   N NE2 . HIS A  1 83  ? 11.305  69.562  23.271  1.00 20.03  ? 224  HIS A NE2 1 
ATOM   690   N N   . SER A  1 84  ? 5.639   66.049  22.023  1.00 49.68  ? 225  SER A N   1 
ATOM   691   C CA  . SER A  1 84  ? 4.759   64.902  21.807  1.00 51.82  ? 225  SER A CA  1 
ATOM   692   C C   . SER A  1 84  ? 4.618   64.400  20.374  1.00 54.19  ? 225  SER A C   1 
ATOM   693   O O   . SER A  1 84  ? 4.442   63.201  20.140  1.00 60.36  ? 225  SER A O   1 
ATOM   694   C CB  . SER A  1 84  ? 3.369   65.188  22.377  1.00 46.36  ? 225  SER A CB  1 
ATOM   695   O OG  . SER A  1 84  ? 3.412   65.353  23.780  1.00 56.15  ? 225  SER A OG  1 
ATOM   696   N N   . ASN A  1 85  ? 4.693   65.301  19.408  1.00 61.15  ? 226  ASN A N   1 
ATOM   697   C CA  . ASN A  1 85  ? 4.535   64.886  18.020  1.00 67.34  ? 226  ASN A CA  1 
ATOM   698   C C   . ASN A  1 85  ? 5.878   64.811  17.338  1.00 68.30  ? 226  ASN A C   1 
ATOM   699   O O   . ASN A  1 85  ? 5.974   64.858  16.111  1.00 74.85  ? 226  ASN A O   1 
ATOM   700   C CB  . ASN A  1 85  ? 3.629   65.863  17.269  1.00 69.48  ? 226  ASN A CB  1 
ATOM   701   C CG  . ASN A  1 85  ? 2.178   65.768  17.697  1.00 71.44  ? 226  ASN A CG  1 
ATOM   702   O OD1 . ASN A  1 85  ? 1.361   66.605  17.314  1.00 80.95  ? 226  ASN A OD1 1 
ATOM   703   N ND2 . ASN A  1 85  ? 1.845   64.746  18.484  1.00 72.74  ? 226  ASN A ND2 1 
ATOM   704   N N   . MET A  1 86  ? 6.918   64.698  18.149  1.00 63.84  ? 227  MET A N   1 
ATOM   705   C CA  . MET A  1 86  ? 8.275   64.614  17.648  1.00 58.98  ? 227  MET A CA  1 
ATOM   706   C C   . MET A  1 86  ? 8.866   63.255  18.013  1.00 57.14  ? 227  MET A C   1 
ATOM   707   O O   . MET A  1 86  ? 8.563   62.701  19.059  1.00 62.13  ? 227  MET A O   1 
ATOM   708   C CB  . MET A  1 86  ? 9.091   65.755  18.254  1.00 58.99  ? 227  MET A CB  1 
ATOM   709   C CG  . MET A  1 86  ? 8.432   67.109  18.038  1.00 57.93  ? 227  MET A CG  1 
ATOM   710   S SD  . MET A  1 86  ? 8.399   67.586  16.278  1.00 52.31  ? 227  MET A SD  1 
ATOM   711   C CE  . MET A  1 86  ? 9.165   69.194  16.423  1.00 45.02  ? 227  MET A CE  1 
ATOM   712   N N   . ASP A  1 87  ? 9.692   62.710  17.137  1.00 53.78  ? 228  ASP A N   1 
ATOM   713   C CA  . ASP A  1 87  ? 10.301  61.427  17.387  1.00 53.74  ? 228  ASP A CA  1 
ATOM   714   C C   . ASP A  1 87  ? 11.726  61.502  17.918  1.00 58.11  ? 228  ASP A C   1 
ATOM   715   O O   . ASP A  1 87  ? 12.246  60.511  18.451  1.00 66.96  ? 228  ASP A O   1 
ATOM   716   C CB  . ASP A  1 87  ? 10.289  60.595  16.112  1.00 55.33  ? 228  ASP A CB  1 
ATOM   717   C CG  . ASP A  1 87  ? 8.944   59.945  15.853  1.00 64.58  ? 228  ASP A CG  1 
ATOM   718   O OD1 . ASP A  1 87  ? 8.207   59.707  16.835  1.00 68.88  ? 228  ASP A OD1 1 
ATOM   719   O OD2 . ASP A  1 87  ? 8.628   59.650  14.675  1.00 57.94  ? 228  ASP A OD2 1 
ATOM   720   N N   . CYS A  1 88  ? 12.345  62.675  17.806  1.00 51.46  ? 229  CYS A N   1 
ATOM   721   C CA  . CYS A  1 88  ? 13.728  62.835  18.216  1.00 46.89  ? 229  CYS A CA  1 
ATOM   722   C C   . CYS A  1 88  ? 14.034  64.285  18.512  1.00 38.73  ? 229  CYS A C   1 
ATOM   723   O O   . CYS A  1 88  ? 13.282  65.150  18.120  1.00 50.06  ? 229  CYS A O   1 
ATOM   724   C CB  . CYS A  1 88  ? 14.631  62.307  17.083  1.00 43.15  ? 229  CYS A CB  1 
ATOM   725   S SG  . CYS A  1 88  ? 16.382  62.453  17.336  1.00 44.86  ? 229  CYS A SG  1 
ATOM   726   N N   . PHE A  1 89  ? 15.121  64.538  19.232  1.00 34.81  ? 230  PHE A N   1 
ATOM   727   C CA  . PHE A  1 89  ? 15.567  65.888  19.540  1.00 36.06  ? 230  PHE A CA  1 
ATOM   728   C C   . PHE A  1 89  ? 17.086  65.909  19.376  1.00 41.35  ? 230  PHE A C   1 
ATOM   729   O O   . PHE A  1 89  ? 17.766  64.971  19.793  1.00 36.94  ? 230  PHE A O   1 
ATOM   730   C CB  . PHE A  1 89  ? 15.218  66.281  20.961  1.00 35.91  ? 230  PHE A CB  1 
ATOM   731   C CG  . PHE A  1 89  ? 15.829  67.586  21.391  1.00 36.09  ? 230  PHE A CG  1 
ATOM   732   C CD1 . PHE A  1 89  ? 15.369  68.788  20.871  1.00 33.28  ? 230  PHE A CD1 1 
ATOM   733   C CD2 . PHE A  1 89  ? 16.860  67.612  22.326  1.00 35.92  ? 230  PHE A CD2 1 
ATOM   734   C CE1 . PHE A  1 89  ? 15.931  70.012  21.287  1.00 42.95  ? 230  PHE A CE1 1 
ATOM   735   C CE2 . PHE A  1 89  ? 17.424  68.821  22.749  1.00 40.46  ? 230  PHE A CE2 1 
ATOM   736   C CZ  . PHE A  1 89  ? 16.957  70.027  22.229  1.00 38.92  ? 230  PHE A CZ  1 
ATOM   737   N N   . ILE A  1 90  ? 17.616  66.971  18.761  1.00 40.39  ? 231  ILE A N   1 
ATOM   738   C CA  . ILE A  1 90  ? 19.055  67.090  18.549  1.00 29.76  ? 231  ILE A CA  1 
ATOM   739   C C   . ILE A  1 90  ? 19.549  68.465  18.913  1.00 25.80  ? 231  ILE A C   1 
ATOM   740   O O   . ILE A  1 90  ? 18.924  69.454  18.604  1.00 38.53  ? 231  ILE A O   1 
ATOM   741   C CB  . ILE A  1 90  ? 19.437  66.822  17.085  1.00 23.05  ? 231  ILE A CB  1 
ATOM   742   C CG1 . ILE A  1 90  ? 18.975  65.434  16.660  1.00 24.52  ? 231  ILE A CG1 1 
ATOM   743   C CG2 . ILE A  1 90  ? 20.924  66.892  16.922  1.00 21.12  ? 231  ILE A CG2 1 
ATOM   744   C CD1 . ILE A  1 90  ? 19.450  65.060  15.273  1.00 32.64  ? 231  ILE A CD1 1 
ATOM   745   N N   . CYS A  1 91  ? 20.689  68.535  19.570  1.00 29.85  ? 232  CYS A N   1 
ATOM   746   C CA  . CYS A  1 91  ? 21.248  69.818  19.937  1.00 32.14  ? 232  CYS A CA  1 
ATOM   747   C C   . CYS A  1 91  ? 22.734  69.786  19.610  1.00 35.69  ? 232  CYS A C   1 
ATOM   748   O O   . CYS A  1 91  ? 23.454  68.948  20.130  1.00 39.49  ? 232  CYS A O   1 
ATOM   749   C CB  . CYS A  1 91  ? 21.035  70.091  21.421  1.00 20.50  ? 232  CYS A CB  1 
ATOM   750   S SG  . CYS A  1 91  ? 21.989  71.495  22.050  1.00 27.84  ? 232  CYS A SG  1 
ATOM   751   N N   . CYS A  1 92  ? 23.174  70.690  18.734  1.00 35.18  ? 233  CYS A N   1 
ATOM   752   C CA  . CYS A  1 92  ? 24.573  70.769  18.340  1.00 29.63  ? 233  CYS A CA  1 
ATOM   753   C C   . CYS A  1 92  ? 25.162  72.009  18.938  1.00 28.30  ? 233  CYS A C   1 
ATOM   754   O O   . CYS A  1 92  ? 24.538  73.056  18.930  1.00 33.43  ? 233  CYS A O   1 
ATOM   755   C CB  . CYS A  1 92  ? 24.705  70.849  16.827  1.00 23.92  ? 233  CYS A CB  1 
ATOM   756   S SG  . CYS A  1 92  ? 23.815  69.587  15.956  1.00 33.72  ? 233  CYS A SG  1 
ATOM   757   N N   . ILE A  1 93  ? 26.375  71.902  19.444  1.00 28.15  ? 234  ILE A N   1 
ATOM   758   C CA  . ILE A  1 93  ? 27.020  73.051  20.045  1.00 30.27  ? 234  ILE A CA  1 
ATOM   759   C C   . ILE A  1 93  ? 28.413  73.173  19.469  1.00 35.93  ? 234  ILE A C   1 
ATOM   760   O O   . ILE A  1 93  ? 29.223  72.259  19.592  1.00 33.53  ? 234  ILE A O   1 
ATOM   761   C CB  . ILE A  1 93  ? 27.108  72.909  21.559  1.00 22.87  ? 234  ILE A CB  1 
ATOM   762   C CG1 . ILE A  1 93  ? 25.707  72.865  22.130  1.00 32.17  ? 234  ILE A CG1 1 
ATOM   763   C CG2 . ILE A  1 93  ? 27.876  74.048  22.140  1.00 18.61  ? 234  ILE A CG2 1 
ATOM   764   C CD1 . ILE A  1 93  ? 25.677  72.785  23.608  1.00 38.04  ? 234  ILE A CD1 1 
ATOM   765   N N   . LEU A  1 94  ? 28.663  74.314  18.826  1.00 37.58  ? 235  LEU A N   1 
ATOM   766   C CA  . LEU A  1 94  ? 29.925  74.625  18.186  1.00 31.54  ? 235  LEU A CA  1 
ATOM   767   C C   . LEU A  1 94  ? 30.464  75.788  18.970  1.00 31.10  ? 235  LEU A C   1 
ATOM   768   O O   . LEU A  1 94  ? 29.882  76.848  18.950  1.00 38.88  ? 235  LEU A O   1 
ATOM   769   C CB  . LEU A  1 94  ? 29.670  75.040  16.739  1.00 29.24  ? 235  LEU A CB  1 
ATOM   770   C CG  . LEU A  1 94  ? 28.582  74.232  16.025  1.00 27.50  ? 235  LEU A CG  1 
ATOM   771   C CD1 . LEU A  1 94  ? 28.385  74.705  14.604  1.00 34.12  ? 235  LEU A CD1 1 
ATOM   772   C CD2 . LEU A  1 94  ? 28.972  72.788  16.031  1.00 33.35  ? 235  LEU A CD2 1 
ATOM   773   N N   . SER A  1 95  ? 31.574  75.601  19.665  1.00 32.66  ? 236  SER A N   1 
ATOM   774   C CA  . SER A  1 95  ? 32.117  76.678  20.470  1.00 36.27  ? 236  SER A CA  1 
ATOM   775   C C   . SER A  1 95  ? 33.456  76.256  21.024  1.00 38.30  ? 236  SER A C   1 
ATOM   776   O O   . SER A  1 95  ? 33.952  75.209  20.675  1.00 42.04  ? 236  SER A O   1 
ATOM   777   C CB  . SER A  1 95  ? 31.145  76.977  21.630  1.00 36.97  ? 236  SER A CB  1 
ATOM   778   O OG  . SER A  1 95  ? 31.606  77.994  22.510  1.00 35.44  ? 236  SER A OG  1 
ATOM   779   N N   . HIS A  1 96  ? 34.049  77.099  21.862  1.00 41.55  ? 237  HIS A N   1 
ATOM   780   C CA  . HIS A  1 96  ? 35.296  76.780  22.525  1.00 36.42  ? 237  HIS A CA  1 
ATOM   781   C C   . HIS A  1 96  ? 34.880  76.001  23.758  1.00 40.06  ? 237  HIS A C   1 
ATOM   782   O O   . HIS A  1 96  ? 33.711  76.026  24.154  1.00 42.90  ? 237  HIS A O   1 
ATOM   783   C CB  . HIS A  1 96  ? 36.026  78.029  22.986  1.00 30.47  ? 237  HIS A CB  1 
ATOM   784   C CG  . HIS A  1 96  ? 36.881  78.641  21.936  1.00 45.68  ? 237  HIS A CG  1 
ATOM   785   N ND1 . HIS A  1 96  ? 37.731  77.899  21.149  1.00 57.03  ? 237  HIS A ND1 1 
ATOM   786   C CD2 . HIS A  1 96  ? 37.020  79.924  21.535  1.00 51.69  ? 237  HIS A CD2 1 
ATOM   787   C CE1 . HIS A  1 96  ? 38.357  78.699  20.306  1.00 53.90  ? 237  HIS A CE1 1 
ATOM   788   N NE2 . HIS A  1 96  ? 37.943  79.934  20.520  1.00 52.38  ? 237  HIS A NE2 1 
ATOM   789   N N   . GLY A  1 97  ? 35.837  75.313  24.369  1.00 42.23  ? 238  GLY A N   1 
ATOM   790   C CA  . GLY A  1 97  ? 35.530  74.546  25.553  1.00 40.73  ? 238  GLY A CA  1 
ATOM   791   C C   . GLY A  1 97  ? 36.764  74.070  26.266  1.00 43.90  ? 238  GLY A C   1 
ATOM   792   O O   . GLY A  1 97  ? 37.882  74.279  25.792  1.00 42.00  ? 238  GLY A O   1 
ATOM   793   N N   . ASP A  1 98  ? 36.549  73.439  27.418  1.00 49.65  ? 239  ASP A N   1 
ATOM   794   C CA  . ASP A  1 98  ? 37.635  72.908  28.237  1.00 51.23  ? 239  ASP A CA  1 
ATOM   795   C C   . ASP A  1 98  ? 37.130  71.623  28.890  1.00 50.37  ? 239  ASP A C   1 
ATOM   796   O O   . ASP A  1 98  ? 36.044  71.145  28.550  1.00 43.47  ? 239  ASP A O   1 
ATOM   797   C CB  . ASP A  1 98  ? 38.061  73.936  29.283  1.00 46.42  ? 239  ASP A CB  1 
ATOM   798   C CG  . ASP A  1 98  ? 39.459  73.688  29.821  1.00 49.53  ? 239  ASP A CG  1 
ATOM   799   O OD1 . ASP A  1 98  ? 39.932  72.543  29.757  1.00 51.37  ? 239  ASP A OD1 1 
ATOM   800   O OD2 . ASP A  1 98  ? 40.097  74.639  30.323  1.00 46.48  ? 239  ASP A OD2 1 
ATOM   801   N N   . LYS A  1 99  ? 37.908  71.068  29.817  1.00 50.34  ? 240  LYS A N   1 
ATOM   802   C CA  . LYS A  1 99  ? 37.533  69.810  30.466  1.00 49.40  ? 240  LYS A CA  1 
ATOM   803   C C   . LYS A  1 99  ? 36.098  69.804  30.932  1.00 41.67  ? 240  LYS A C   1 
ATOM   804   O O   . LYS A  1 99  ? 35.746  70.504  31.860  1.00 42.84  ? 240  LYS A O   1 
ATOM   805   C CB  . LYS A  1 99  ? 38.441  69.505  31.661  1.00 51.05  ? 240  LYS A CB  1 
ATOM   806   C CG  . LYS A  1 99  ? 39.895  69.302  31.325  1.00 65.66  ? 240  LYS A CG  1 
ATOM   807   C CD  . LYS A  1 99  ? 40.694  69.055  32.590  1.00 79.62  ? 240  LYS A CD  1 
ATOM   808   C CE  . LYS A  1 99  ? 42.163  69.461  32.425  1.00 88.13  ? 240  LYS A CE  1 
ATOM   809   N NZ  . LYS A  1 99  ? 42.956  69.193  33.667  1.00 86.18  ? 240  LYS A NZ  1 
ATOM   810   N N   . GLY A  1 100 ? 35.272  69.010  30.270  1.00 40.72  ? 241  GLY A N   1 
ATOM   811   C CA  . GLY A  1 100 ? 33.880  68.898  30.651  1.00 37.74  ? 241  GLY A CA  1 
ATOM   812   C C   . GLY A  1 100 ? 32.995  70.114  30.459  1.00 41.23  ? 241  GLY A C   1 
ATOM   813   O O   . GLY A  1 100 ? 31.792  70.058  30.717  1.00 42.14  ? 241  GLY A O   1 
ATOM   814   N N   . ILE A  1 101 ? 33.554  71.216  29.991  1.00 37.12  ? 242  ILE A N   1 
ATOM   815   C CA  . ILE A  1 101 ? 32.728  72.379  29.821  1.00 40.69  ? 242  ILE A CA  1 
ATOM   816   C C   . ILE A  1 101 ? 32.694  72.941  28.419  1.00 40.88  ? 242  ILE A C   1 
ATOM   817   O O   . ILE A  1 101 ? 33.433  72.515  27.547  1.00 42.09  ? 242  ILE A O   1 
ATOM   818   C CB  . ILE A  1 101 ? 33.135  73.473  30.830  1.00 44.20  ? 242  ILE A CB  1 
ATOM   819   C CG1 . ILE A  1 101 ? 34.548  73.961  30.551  1.00 43.22  ? 242  ILE A CG1 1 
ATOM   820   C CG2 . ILE A  1 101 ? 33.075  72.909  32.236  1.00 36.43  ? 242  ILE A CG2 1 
ATOM   821   C CD1 . ILE A  1 101 ? 34.623  74.970  29.444  1.00 54.47  ? 242  ILE A CD1 1 
ATOM   822   N N   . ILE A  1 102 ? 31.795  73.896  28.224  1.00 41.25  ? 243  ILE A N   1 
ATOM   823   C CA  . ILE A  1 102 ? 31.602  74.569  26.960  1.00 38.04  ? 243  ILE A CA  1 
ATOM   824   C C   . ILE A  1 102 ? 31.758  76.023  27.304  1.00 45.94  ? 243  ILE A C   1 
ATOM   825   O O   . ILE A  1 102 ? 31.280  76.467  28.340  1.00 57.26  ? 243  ILE A O   1 
ATOM   826   C CB  . ILE A  1 102 ? 30.205  74.319  26.437  1.00 38.68  ? 243  ILE A CB  1 
ATOM   827   C CG1 . ILE A  1 102 ? 30.315  73.611  25.107  1.00 39.80  ? 243  ILE A CG1 1 
ATOM   828   C CG2 . ILE A  1 102 ? 29.412  75.616  26.323  1.00 39.30  ? 243  ILE A CG2 1 
ATOM   829   C CD1 . ILE A  1 102 ? 31.079  72.373  25.206  1.00 29.55  ? 243  ILE A CD1 1 
ATOM   830   N N   . TYR A  1 103 ? 32.440  76.772  26.456  1.00 44.84  ? 244  TYR A N   1 
ATOM   831   C CA  . TYR A  1 103 ? 32.634  78.174  26.738  1.00 39.38  ? 244  TYR A CA  1 
ATOM   832   C C   . TYR A  1 103 ? 31.566  78.994  26.089  1.00 42.88  ? 244  TYR A C   1 
ATOM   833   O O   . TYR A  1 103 ? 31.211  78.779  24.933  1.00 40.29  ? 244  TYR A O   1 
ATOM   834   C CB  . TYR A  1 103 ? 33.983  78.636  26.242  1.00 45.22  ? 244  TYR A CB  1 
ATOM   835   C CG  . TYR A  1 103 ? 35.076  78.496  27.260  1.00 56.68  ? 244  TYR A CG  1 
ATOM   836   C CD1 . TYR A  1 103 ? 35.007  79.179  28.469  1.00 60.02  ? 244  TYR A CD1 1 
ATOM   837   C CD2 . TYR A  1 103 ? 36.183  77.681  27.019  1.00 55.68  ? 244  TYR A CD2 1 
ATOM   838   C CE1 . TYR A  1 103 ? 36.011  79.051  29.413  1.00 65.78  ? 244  TYR A CE1 1 
ATOM   839   C CE2 . TYR A  1 103 ? 37.197  77.546  27.957  1.00 54.87  ? 244  TYR A CE2 1 
ATOM   840   C CZ  . TYR A  1 103 ? 37.106  78.228  29.148  1.00 62.75  ? 244  TYR A CZ  1 
ATOM   841   O OH  . TYR A  1 103 ? 38.097  78.072  30.087  1.00 69.78  ? 244  TYR A OH  1 
ATOM   842   N N   . GLY A  1 104 ? 31.035  79.929  26.856  1.00 48.42  ? 245  GLY A N   1 
ATOM   843   C CA  . GLY A  1 104 ? 30.022  80.811  26.328  1.00 51.08  ? 245  GLY A CA  1 
ATOM   844   C C   . GLY A  1 104 ? 30.746  81.928  25.610  1.00 53.49  ? 245  GLY A C   1 
ATOM   845   O O   . GLY A  1 104 ? 31.867  82.281  25.976  1.00 57.71  ? 245  GLY A O   1 
ATOM   846   N N   . THR A  1 105 ? 30.113  82.488  24.591  1.00 50.72  ? 246  THR A N   1 
ATOM   847   C CA  . THR A  1 105 ? 30.724  83.552  23.808  1.00 51.86  ? 246  THR A CA  1 
ATOM   848   C C   . THR A  1 105 ? 31.259  84.709  24.672  1.00 52.35  ? 246  THR A C   1 
ATOM   849   O O   . THR A  1 105 ? 32.062  85.527  24.223  1.00 43.25  ? 246  THR A O   1 
ATOM   850   C CB  . THR A  1 105 ? 29.717  84.074  22.792  1.00 52.20  ? 246  THR A CB  1 
ATOM   851   O OG1 . THR A  1 105 ? 30.421  84.678  21.707  1.00 52.39  ? 246  THR A OG1 1 
ATOM   852   C CG2 . THR A  1 105 ? 28.775  85.082  23.434  1.00 54.78  ? 246  THR A CG2 1 
ATOM   853   N N   . ASP A  1 106 ? 30.823  84.744  25.927  1.00 57.68  ? 247  ASP A N   1 
ATOM   854   C CA  . ASP A  1 106 ? 31.223  85.774  26.876  1.00 54.23  ? 247  ASP A CA  1 
ATOM   855   C C   . ASP A  1 106 ? 32.290  85.292  27.839  1.00 55.30  ? 247  ASP A C   1 
ATOM   856   O O   . ASP A  1 106 ? 32.644  85.999  28.775  1.00 60.16  ? 247  ASP A O   1 
ATOM   857   C CB  . ASP A  1 106 ? 30.006  86.248  27.671  1.00 62.47  ? 247  ASP A CB  1 
ATOM   858   C CG  . ASP A  1 106 ? 29.395  85.150  28.547  1.00 70.13  ? 247  ASP A CG  1 
ATOM   859   O OD1 . ASP A  1 106 ? 29.056  84.064  28.021  1.00 72.80  ? 247  ASP A OD1 1 
ATOM   860   O OD2 . ASP A  1 106 ? 29.240  85.384  29.766  1.00 69.38  ? 247  ASP A OD2 1 
ATOM   861   N N   . GLY A  1 107 ? 32.790  84.081  27.627  1.00 56.82  ? 248  GLY A N   1 
ATOM   862   C CA  . GLY A  1 107 ? 33.835  83.549  28.492  1.00 55.11  ? 248  GLY A CA  1 
ATOM   863   C C   . GLY A  1 107 ? 33.357  82.698  29.646  1.00 51.77  ? 248  GLY A C   1 
ATOM   864   O O   . GLY A  1 107 ? 34.140  82.007  30.282  1.00 55.96  ? 248  GLY A O   1 
ATOM   865   N N   . GLN A  1 108 ? 32.068  82.741  29.926  1.00 55.91  ? 254  GLN A N   1 
ATOM   866   C CA  . GLN A  1 108 ? 31.539  81.959  31.025  1.00 59.46  ? 254  GLN A CA  1 
ATOM   867   C C   . GLN A  1 108 ? 31.496  80.489  30.679  1.00 58.17  ? 254  GLN A C   1 
ATOM   868   O O   . GLN A  1 108 ? 31.410  80.111  29.512  1.00 60.84  ? 254  GLN A O   1 
ATOM   869   C CB  . GLN A  1 108 ? 30.148  82.450  31.414  1.00 66.91  ? 254  GLN A CB  1 
ATOM   870   C CG  . GLN A  1 108 ? 30.140  83.870  31.946  1.00 72.53  ? 254  GLN A CG  1 
ATOM   871   C CD  . GLN A  1 108 ? 31.150  84.072  33.053  1.00 73.51  ? 254  GLN A CD  1 
ATOM   872   O OE1 . GLN A  1 108 ? 31.059  83.443  34.114  1.00 68.54  ? 254  GLN A OE1 1 
ATOM   873   N NE2 . GLN A  1 108 ? 32.126  84.952  32.812  1.00 73.95  ? 254  GLN A NE2 1 
ATOM   874   N N   . GLU A  1 109 ? 31.543  79.665  31.716  1.00 56.39  ? 255  GLU A N   1 
ATOM   875   C CA  . GLU A  1 109 ? 31.551  78.224  31.562  1.00 52.52  ? 255  GLU A CA  1 
ATOM   876   C C   . GLU A  1 109 ? 30.228  77.504  31.751  1.00 48.73  ? 255  GLU A C   1 
ATOM   877   O O   . GLU A  1 109 ? 29.457  77.783  32.661  1.00 52.39  ? 255  GLU A O   1 
ATOM   878   C CB  . GLU A  1 109 ? 32.591  77.629  32.511  1.00 53.21  ? 255  GLU A CB  1 
ATOM   879   C CG  . GLU A  1 109 ? 34.014  77.819  32.048  1.00 58.97  ? 255  GLU A CG  1 
ATOM   880   C CD  . GLU A  1 109 ? 35.009  77.533  33.143  1.00 65.08  ? 255  GLU A CD  1 
ATOM   881   O OE1 . GLU A  1 109 ? 34.707  76.651  33.984  1.00 63.13  ? 255  GLU A OE1 1 
ATOM   882   O OE2 . GLU A  1 109 ? 36.086  78.184  33.153  1.00 63.06  ? 255  GLU A OE2 1 
ATOM   883   N N   . ALA A  1 110 ? 29.983  76.542  30.880  1.00 50.74  ? 256  ALA A N   1 
ATOM   884   C CA  . ALA A  1 110 ? 28.776  75.742  30.955  1.00 49.44  ? 256  ALA A CA  1 
ATOM   885   C C   . ALA A  1 110 ? 29.149  74.264  30.950  1.00 47.68  ? 256  ALA A C   1 
ATOM   886   O O   . ALA A  1 110 ? 29.664  73.750  29.970  1.00 47.36  ? 256  ALA A O   1 
ATOM   887   C CB  . ALA A  1 110 ? 27.873  76.044  29.785  1.00 52.15  ? 256  ALA A CB  1 
ATOM   888   N N   . PRO A  1 111 ? 28.929  73.577  32.073  1.00 48.09  ? 257  PRO A N   1 
ATOM   889   C CA  . PRO A  1 111 ? 29.232  72.157  32.188  1.00 46.38  ? 257  PRO A CA  1 
ATOM   890   C C   . PRO A  1 111 ? 28.351  71.385  31.210  1.00 48.80  ? 257  PRO A C   1 
ATOM   891   O O   . PRO A  1 111 ? 27.138  71.563  31.169  1.00 53.26  ? 257  PRO A O   1 
ATOM   892   C CB  . PRO A  1 111 ? 28.873  71.857  33.629  1.00 46.00  ? 257  PRO A CB  1 
ATOM   893   C CG  . PRO A  1 111 ? 29.230  73.123  34.306  1.00 46.08  ? 257  PRO A CG  1 
ATOM   894   C CD  . PRO A  1 111 ? 28.645  74.151  33.399  1.00 50.94  ? 257  PRO A CD  1 
ATOM   895   N N   . ILE A  1 112 ? 28.958  70.521  30.421  1.00 42.71  ? 258  ILE A N   1 
ATOM   896   C CA  . ILE A  1 112 ? 28.182  69.775  29.470  1.00 39.45  ? 258  ILE A CA  1 
ATOM   897   C C   . ILE A  1 112 ? 27.095  68.978  30.165  1.00 40.22  ? 258  ILE A C   1 
ATOM   898   O O   . ILE A  1 112 ? 26.047  68.682  29.585  1.00 40.82  ? 258  ILE A O   1 
ATOM   899   C CB  . ILE A  1 112 ? 29.098  68.878  28.671  1.00 37.88  ? 258  ILE A CB  1 
ATOM   900   C CG1 . ILE A  1 112 ? 30.079  69.769  27.903  1.00 38.14  ? 258  ILE A CG1 1 
ATOM   901   C CG2 . ILE A  1 112 ? 28.297  67.972  27.768  1.00 33.96  ? 258  ILE A CG2 1 
ATOM   902   C CD1 . ILE A  1 112 ? 31.042  69.026  27.015  1.00 51.16  ? 258  ILE A CD1 1 
ATOM   903   N N   . TYR A  1 113 ? 27.331  68.651  31.424  1.00 46.10  ? 259  TYR A N   1 
ATOM   904   C CA  . TYR A  1 113 ? 26.348  67.889  32.172  1.00 55.67  ? 259  TYR A CA  1 
ATOM   905   C C   . TYR A  1 113 ? 25.096  68.748  32.376  1.00 51.16  ? 259  TYR A C   1 
ATOM   906   O O   . TYR A  1 113 ? 23.967  68.276  32.210  1.00 45.54  ? 259  TYR A O   1 
ATOM   907   C CB  . TYR A  1 113 ? 26.923  67.457  33.528  1.00 66.91  ? 259  TYR A CB  1 
ATOM   908   C CG  . TYR A  1 113 ? 26.015  66.509  34.285  1.00 81.38  ? 259  TYR A CG  1 
ATOM   909   C CD1 . TYR A  1 113 ? 25.674  65.256  33.748  1.00 85.28  ? 259  TYR A CD1 1 
ATOM   910   C CD2 . TYR A  1 113 ? 25.464  66.874  35.521  1.00 86.48  ? 259  TYR A CD2 1 
ATOM   911   C CE1 . TYR A  1 113 ? 24.802  64.389  34.420  1.00 90.30  ? 259  TYR A CE1 1 
ATOM   912   C CE2 . TYR A  1 113 ? 24.588  66.013  36.202  1.00 91.96  ? 259  TYR A CE2 1 
ATOM   913   C CZ  . TYR A  1 113 ? 24.261  64.775  35.646  1.00 93.43  ? 259  TYR A CZ  1 
ATOM   914   O OH  . TYR A  1 113 ? 23.396  63.929  36.310  1.00 94.95  ? 259  TYR A OH  1 
ATOM   915   N N   . GLU A  1 114 ? 25.302  70.007  32.738  1.00 39.85  ? 260  GLU A N   1 
ATOM   916   C CA  . GLU A  1 114 ? 24.189  70.914  32.945  1.00 49.04  ? 260  GLU A CA  1 
ATOM   917   C C   . GLU A  1 114 ? 23.356  71.009  31.684  1.00 50.22  ? 260  GLU A C   1 
ATOM   918   O O   . GLU A  1 114 ? 22.140  71.136  31.737  1.00 58.73  ? 260  GLU A O   1 
ATOM   919   C CB  . GLU A  1 114 ? 24.702  72.305  33.260  1.00 66.24  ? 260  GLU A CB  1 
ATOM   920   C CG  . GLU A  1 114 ? 25.573  72.382  34.478  1.00 77.95  ? 260  GLU A CG  1 
ATOM   921   C CD  . GLU A  1 114 ? 24.759  72.459  35.733  1.00 78.72  ? 260  GLU A CD  1 
ATOM   922   O OE1 . GLU A  1 114 ? 23.899  71.570  35.937  1.00 81.54  ? 260  GLU A OE1 1 
ATOM   923   O OE2 . GLU A  1 114 ? 24.984  73.411  36.506  1.00 78.55  ? 260  GLU A OE2 1 
ATOM   924   N N   . LEU A  1 115 ? 24.012  70.970  30.538  1.00 48.64  ? 261  LEU A N   1 
ATOM   925   C CA  . LEU A  1 115 ? 23.286  71.061  29.293  1.00 46.97  ? 261  LEU A CA  1 
ATOM   926   C C   . LEU A  1 115 ? 22.431  69.831  29.013  1.00 48.17  ? 261  LEU A C   1 
ATOM   927   O O   . LEU A  1 115 ? 21.214  69.948  28.877  1.00 51.93  ? 261  LEU A O   1 
ATOM   928   C CB  . LEU A  1 115 ? 24.259  71.314  28.145  1.00 49.22  ? 261  LEU A CB  1 
ATOM   929   C CG  . LEU A  1 115 ? 25.209  72.487  28.426  1.00 52.72  ? 261  LEU A CG  1 
ATOM   930   C CD1 . LEU A  1 115 ? 25.946  72.867  27.154  1.00 45.91  ? 261  LEU A CD1 1 
ATOM   931   C CD2 . LEU A  1 115 ? 24.422  73.684  28.957  1.00 54.19  ? 261  LEU A CD2 1 
ATOM   932   N N   . THR A  1 116 ? 23.040  68.649  28.955  1.00 43.83  ? 262  THR A N   1 
ATOM   933   C CA  . THR A  1 116 ? 22.264  67.445  28.658  1.00 46.46  ? 262  THR A CA  1 
ATOM   934   C C   . THR A  1 116 ? 21.265  67.011  29.706  1.00 48.71  ? 262  THR A C   1 
ATOM   935   O O   . THR A  1 116 ? 20.298  66.324  29.382  1.00 48.90  ? 262  THR A O   1 
ATOM   936   C CB  . THR A  1 116 ? 23.140  66.233  28.440  1.00 43.30  ? 262  THR A CB  1 
ATOM   937   O OG1 . THR A  1 116 ? 23.723  65.861  29.690  1.00 46.05  ? 262  THR A OG1 1 
ATOM   938   C CG2 . THR A  1 116 ? 24.218  66.530  27.450  1.00 42.57  ? 262  THR A CG2 1 
ATOM   939   N N   . SER A  1 117 ? 21.501  67.373  30.962  1.00 54.21  ? 263  SER A N   1 
ATOM   940   C CA  . SER A  1 117 ? 20.602  66.956  32.037  1.00 59.80  ? 263  SER A CA  1 
ATOM   941   C C   . SER A  1 117 ? 19.280  67.701  31.982  1.00 58.79  ? 263  SER A C   1 
ATOM   942   O O   . SER A  1 117 ? 18.339  67.400  32.719  1.00 62.80  ? 263  SER A O   1 
ATOM   943   C CB  . SER A  1 117 ? 21.268  67.168  33.401  1.00 63.81  ? 263  SER A CB  1 
ATOM   944   O OG  . SER A  1 117 ? 21.349  68.544  33.730  1.00 71.03  ? 263  SER A OG  1 
ATOM   945   N N   . GLN A  1 118 ? 19.228  68.675  31.089  1.00 56.61  ? 264  GLN A N   1 
ATOM   946   C CA  . GLN A  1 118 ? 18.049  69.491  30.887  1.00 52.32  ? 264  GLN A CA  1 
ATOM   947   C C   . GLN A  1 118 ? 16.952  68.686  30.249  1.00 49.06  ? 264  GLN A C   1 
ATOM   948   O O   . GLN A  1 118 ? 15.789  69.040  30.353  1.00 56.60  ? 264  GLN A O   1 
ATOM   949   C CB  . GLN A  1 118 ? 18.382  70.658  29.966  1.00 54.51  ? 264  GLN A CB  1 
ATOM   950   C CG  . GLN A  1 118 ? 19.191  71.755  30.605  1.00 61.43  ? 264  GLN A CG  1 
ATOM   951   C CD  . GLN A  1 118 ? 18.424  72.415  31.703  1.00 68.29  ? 264  GLN A CD  1 
ATOM   952   O OE1 . GLN A  1 118 ? 18.248  71.838  32.778  1.00 71.41  ? 264  GLN A OE1 1 
ATOM   953   N NE2 . GLN A  1 118 ? 17.928  73.627  31.438  1.00 73.15  ? 264  GLN A NE2 1 
ATOM   954   N N   . PHE A  1 119 ? 17.313  67.584  29.611  1.00 44.40  ? 265  PHE A N   1 
ATOM   955   C CA  . PHE A  1 119 ? 16.330  66.805  28.896  1.00 40.31  ? 265  PHE A CA  1 
ATOM   956   C C   . PHE A  1 119 ? 16.063  65.402  29.369  1.00 45.64  ? 265  PHE A C   1 
ATOM   957   O O   . PHE A  1 119 ? 15.660  64.527  28.571  1.00 40.89  ? 265  PHE A O   1 
ATOM   958   C CB  . PHE A  1 119 ? 16.702  66.806  27.414  1.00 42.26  ? 265  PHE A CB  1 
ATOM   959   C CG  . PHE A  1 119 ? 16.869  68.192  26.845  1.00 40.75  ? 265  PHE A CG  1 
ATOM   960   C CD1 . PHE A  1 119 ? 18.016  68.929  27.103  1.00 39.81  ? 265  PHE A CD1 1 
ATOM   961   C CD2 . PHE A  1 119 ? 15.842  68.791  26.113  1.00 44.43  ? 265  PHE A CD2 1 
ATOM   962   C CE1 . PHE A  1 119 ? 18.143  70.251  26.646  1.00 46.49  ? 265  PHE A CE1 1 
ATOM   963   C CE2 . PHE A  1 119 ? 15.955  70.103  25.656  1.00 38.31  ? 265  PHE A CE2 1 
ATOM   964   C CZ  . PHE A  1 119 ? 17.110  70.837  25.924  1.00 40.53  ? 265  PHE A CZ  1 
ATOM   965   N N   . THR A  1 120 ? 16.247  65.187  30.672  1.00 51.52  ? 266  THR A N   1 
ATOM   966   C CA  . THR A  1 120 ? 16.002  63.869  31.263  1.00 52.11  ? 266  THR A CA  1 
ATOM   967   C C   . THR A  1 120 ? 14.513  63.551  31.096  1.00 57.37  ? 266  THR A C   1 
ATOM   968   O O   . THR A  1 120 ? 13.764  64.301  30.453  1.00 56.47  ? 266  THR A O   1 
ATOM   969   C CB  . THR A  1 120 ? 16.345  63.855  32.747  1.00 45.90  ? 266  THR A CB  1 
ATOM   970   O OG1 . THR A  1 120 ? 15.306  64.510  33.472  1.00 48.62  ? 266  THR A OG1 1 
ATOM   971   C CG2 . THR A  1 120 ? 17.640  64.604  33.000  1.00 42.65  ? 266  THR A CG2 1 
ATOM   972   N N   . GLY A  1 121 ? 14.081  62.436  31.670  1.00 61.30  ? 267  GLY A N   1 
ATOM   973   C CA  . GLY A  1 121 ? 12.683  62.055  31.560  1.00 58.19  ? 267  GLY A CA  1 
ATOM   974   C C   . GLY A  1 121 ? 11.789  62.996  32.344  1.00 60.08  ? 267  GLY A C   1 
ATOM   975   O O   . GLY A  1 121 ? 10.744  63.415  31.862  1.00 58.94  ? 267  GLY A O   1 
ATOM   976   N N   . LEU A  1 122 ? 12.205  63.331  33.560  1.00 56.48  ? 268  LEU A N   1 
ATOM   977   C CA  . LEU A  1 122 ? 11.433  64.221  34.399  1.00 58.61  ? 268  LEU A CA  1 
ATOM   978   C C   . LEU A  1 122 ? 11.424  65.592  33.765  1.00 61.80  ? 268  LEU A C   1 
ATOM   979   O O   . LEU A  1 122 ? 10.370  66.121  33.397  1.00 71.82  ? 268  LEU A O   1 
ATOM   980   C CB  . LEU A  1 122 ? 12.047  64.289  35.799  1.00 52.55  ? 268  LEU A CB  1 
ATOM   981   C CG  . LEU A  1 122 ? 12.291  62.910  36.450  1.00 53.74  ? 268  LEU A CG  1 
ATOM   982   C CD1 . LEU A  1 122 ? 12.629  63.126  37.910  1.00 50.89  ? 268  LEU A CD1 1 
ATOM   983   C CD2 . LEU A  1 122 ? 11.071  61.984  36.314  1.00 29.28  ? 268  LEU A CD2 1 
ATOM   984   N N   . LYS A  1 123 ? 12.613  66.153  33.622  1.00 58.79  ? 269  LYS A N   1 
ATOM   985   C CA  . LYS A  1 123 ? 12.785  67.469  33.031  1.00 53.70  ? 269  LYS A CA  1 
ATOM   986   C C   . LYS A  1 123 ? 11.973  67.736  31.758  1.00 48.91  ? 269  LYS A C   1 
ATOM   987   O O   . LYS A  1 123 ? 11.589  68.877  31.515  1.00 47.32  ? 269  LYS A O   1 
ATOM   988   C CB  . LYS A  1 123 ? 14.270  67.690  32.743  1.00 60.35  ? 269  LYS A CB  1 
ATOM   989   C CG  . LYS A  1 123 ? 15.128  68.013  33.978  1.00 62.08  ? 269  LYS A CG  1 
ATOM   990   C CD  . LYS A  1 123 ? 14.999  69.483  34.350  1.00 64.51  ? 269  LYS A CD  1 
ATOM   991   C CE  . LYS A  1 123 ? 16.106  69.945  35.289  1.00 70.62  ? 269  LYS A CE  1 
ATOM   992   N NZ  . LYS A  1 123 ? 16.140  71.450  35.416  1.00 64.97  ? 269  LYS A NZ  1 
ATOM   993   N N   . CYS A  1 124 ? 11.707  66.703  30.957  1.00 41.65  ? 270  CYS A N   1 
ATOM   994   C CA  . CYS A  1 124 ? 10.970  66.894  29.706  1.00 43.38  ? 270  CYS A CA  1 
ATOM   995   C C   . CYS A  1 124 ? 10.246  65.630  29.225  1.00 40.58  ? 270  CYS A C   1 
ATOM   996   O O   . CYS A  1 124 ? 10.626  64.990  28.233  1.00 34.70  ? 270  CYS A O   1 
ATOM   997   C CB  . CYS A  1 124 ? 11.945  67.403  28.630  1.00 49.42  ? 270  CYS A CB  1 
ATOM   998   S SG  . CYS A  1 124 ? 11.344  67.378  26.928  1.00 52.06  ? 270  CYS A SG  1 
ATOM   999   N N   . PRO A  1 125 ? 9.150   65.285  29.904  1.00 40.24  ? 271  PRO A N   1 
ATOM   1000  C CA  . PRO A  1 125 ? 8.348   64.093  29.582  1.00 36.93  ? 271  PRO A CA  1 
ATOM   1001  C C   . PRO A  1 125 ? 7.953   63.897  28.128  1.00 41.23  ? 271  PRO A C   1 
ATOM   1002  O O   . PRO A  1 125 ? 7.754   62.764  27.697  1.00 33.54  ? 271  PRO A O   1 
ATOM   1003  C CB  . PRO A  1 125 ? 7.137   64.235  30.493  1.00 28.83  ? 271  PRO A CB  1 
ATOM   1004  C CG  . PRO A  1 125 ? 7.701   65.009  31.691  1.00 37.01  ? 271  PRO A CG  1 
ATOM   1005  C CD  . PRO A  1 125 ? 8.576   66.041  31.035  1.00 30.53  ? 271  PRO A CD  1 
ATOM   1006  N N   . SER A  1 126 ? 7.831   64.993  27.376  1.00 49.83  ? 272  SER A N   1 
ATOM   1007  C CA  . SER A  1 126 ? 7.435   64.912  25.968  1.00 47.39  ? 272  SER A CA  1 
ATOM   1008  C C   . SER A  1 126 ? 8.477   64.137  25.166  1.00 55.81  ? 272  SER A C   1 
ATOM   1009  O O   . SER A  1 126 ? 8.172   63.617  24.079  1.00 57.04  ? 272  SER A O   1 
ATOM   1010  C CB  . SER A  1 126 ? 7.279   66.313  25.386  1.00 50.38  ? 272  SER A CB  1 
ATOM   1011  O OG  . SER A  1 126 ? 7.365   67.294  26.415  1.00 53.12  ? 272  SER A OG  1 
ATOM   1012  N N   . LEU A  1 127 ? 9.702   64.051  25.699  1.00 53.15  ? 273  LEU A N   1 
ATOM   1013  C CA  . LEU A  1 127 ? 10.771  63.332  25.010  1.00 49.21  ? 273  LEU A CA  1 
ATOM   1014  C C   . LEU A  1 127 ? 11.078  61.941  25.569  1.00 49.67  ? 273  LEU A C   1 
ATOM   1015  O O   . LEU A  1 127 ? 11.815  61.175  24.953  1.00 49.30  ? 273  LEU A O   1 
ATOM   1016  C CB  . LEU A  1 127 ? 12.032  64.194  24.986  1.00 49.03  ? 273  LEU A CB  1 
ATOM   1017  C CG  . LEU A  1 127 ? 11.984  65.341  23.954  1.00 40.35  ? 273  LEU A CG  1 
ATOM   1018  C CD1 . LEU A  1 127 ? 13.182  66.279  24.095  1.00 31.41  ? 273  LEU A CD1 1 
ATOM   1019  C CD2 . LEU A  1 127 ? 11.962  64.739  22.563  1.00 25.34  ? 273  LEU A CD2 1 
ATOM   1020  N N   . ALA A  1 128 ? 10.492  61.620  26.722  1.00 49.15  ? 274  ALA A N   1 
ATOM   1021  C CA  . ALA A  1 128 ? 10.662  60.322  27.370  1.00 41.09  ? 274  ALA A CA  1 
ATOM   1022  C C   . ALA A  1 128 ? 10.597  59.152  26.392  1.00 43.67  ? 274  ALA A C   1 
ATOM   1023  O O   . ALA A  1 128 ? 9.571   58.952  25.730  1.00 41.10  ? 274  ALA A O   1 
ATOM   1024  C CB  . ALA A  1 128 ? 9.598   60.144  28.412  1.00 32.95  ? 274  ALA A CB  1 
ATOM   1025  N N   . GLY A  1 129 ? 11.683  58.375  26.319  1.00 43.06  ? 275  GLY A N   1 
ATOM   1026  C CA  . GLY A  1 129 ? 11.721  57.229  25.423  1.00 47.12  ? 275  GLY A CA  1 
ATOM   1027  C C   . GLY A  1 129 ? 12.032  57.606  23.982  1.00 50.09  ? 275  GLY A C   1 
ATOM   1028  O O   . GLY A  1 129 ? 11.816  56.826  23.045  1.00 44.91  ? 275  GLY A O   1 
ATOM   1029  N N   . LYS A  1 130 ? 12.532  58.820  23.795  1.00 48.66  ? 276  LYS A N   1 
ATOM   1030  C CA  . LYS A  1 130 ? 12.885  59.274  22.466  1.00 51.48  ? 276  LYS A CA  1 
ATOM   1031  C C   . LYS A  1 130 ? 14.342  59.706  22.456  1.00 46.78  ? 276  LYS A C   1 
ATOM   1032  O O   . LYS A  1 130 ? 14.826  60.344  23.398  1.00 42.23  ? 276  LYS A O   1 
ATOM   1033  C CB  . LYS A  1 130 ? 11.982  60.430  22.031  1.00 59.14  ? 276  LYS A CB  1 
ATOM   1034  C CG  . LYS A  1 130 ? 10.522  60.046  21.837  1.00 67.71  ? 276  LYS A CG  1 
ATOM   1035  C CD  . LYS A  1 130 ? 9.667   61.288  21.613  1.00 75.56  ? 276  LYS A CD  1 
ATOM   1036  C CE  . LYS A  1 130 ? 8.206   60.930  21.375  1.00 71.51  ? 276  LYS A CE  1 
ATOM   1037  N NZ  . LYS A  1 130 ? 7.343   62.145  21.442  1.00 65.05  ? 276  LYS A NZ  1 
ATOM   1038  N N   . PRO A  1 131 ? 15.066  59.358  21.384  1.00 43.62  ? 277  PRO A N   1 
ATOM   1039  C CA  . PRO A  1 131 ? 16.468  59.724  21.286  1.00 38.02  ? 277  PRO A CA  1 
ATOM   1040  C C   . PRO A  1 131 ? 16.717  61.201  21.458  1.00 38.56  ? 277  PRO A C   1 
ATOM   1041  O O   . PRO A  1 131 ? 16.118  62.007  20.777  1.00 39.84  ? 277  PRO A O   1 
ATOM   1042  C CB  . PRO A  1 131 ? 16.852  59.228  19.897  1.00 34.47  ? 277  PRO A CB  1 
ATOM   1043  C CG  . PRO A  1 131 ? 15.594  59.299  19.150  1.00 38.69  ? 277  PRO A CG  1 
ATOM   1044  C CD  . PRO A  1 131 ? 14.622  58.722  20.135  1.00 44.02  ? 277  PRO A CD  1 
ATOM   1045  N N   . LYS A  1 132 ? 17.601  61.536  22.388  1.00 37.73  ? 278  LYS A N   1 
ATOM   1046  C CA  . LYS A  1 132 ? 18.010  62.905  22.634  1.00 39.64  ? 278  LYS A CA  1 
ATOM   1047  C C   . LYS A  1 132 ? 19.518  62.930  22.318  1.00 40.05  ? 278  LYS A C   1 
ATOM   1048  O O   . LYS A  1 132 ? 20.338  62.453  23.102  1.00 40.15  ? 278  LYS A O   1 
ATOM   1049  C CB  . LYS A  1 132 ? 17.740  63.272  24.087  1.00 46.51  ? 278  LYS A CB  1 
ATOM   1050  C CG  . LYS A  1 132 ? 16.275  63.186  24.436  1.00 41.86  ? 278  LYS A CG  1 
ATOM   1051  C CD  . LYS A  1 132 ? 16.051  63.253  25.946  1.00 42.45  ? 278  LYS A CD  1 
ATOM   1052  C CE  . LYS A  1 132 ? 15.933  61.857  26.546  1.00 42.57  ? 278  LYS A CE  1 
ATOM   1053  N NZ  . LYS A  1 132 ? 14.812  61.044  25.938  1.00 34.52  ? 278  LYS A NZ  1 
ATOM   1054  N N   . VAL A  1 133 ? 19.859  63.493  21.159  1.00 34.07  ? 279  VAL A N   1 
ATOM   1055  C CA  . VAL A  1 133 ? 21.228  63.556  20.678  1.00 30.77  ? 279  VAL A CA  1 
ATOM   1056  C C   . VAL A  1 133 ? 21.950  64.868  20.870  1.00 30.26  ? 279  VAL A C   1 
ATOM   1057  O O   . VAL A  1 133 ? 21.410  65.894  20.521  1.00 42.15  ? 279  VAL A O   1 
ATOM   1058  C CB  . VAL A  1 133 ? 21.260  63.271  19.192  1.00 24.70  ? 279  VAL A CB  1 
ATOM   1059  C CG1 . VAL A  1 133 ? 22.693  63.180  18.729  1.00 29.62  ? 279  VAL A CG1 1 
ATOM   1060  C CG2 . VAL A  1 133 ? 20.504  61.988  18.896  1.00 18.43  ? 279  VAL A CG2 1 
ATOM   1061  N N   . PHE A  1 134 ? 23.166  64.846  21.411  1.00 28.40  ? 280  PHE A N   1 
ATOM   1062  C CA  . PHE A  1 134 ? 23.945  66.081  21.552  1.00 33.82  ? 280  PHE A CA  1 
ATOM   1063  C C   . PHE A  1 134 ? 25.307  65.936  20.901  1.00 35.24  ? 280  PHE A C   1 
ATOM   1064  O O   . PHE A  1 134 ? 26.065  65.040  21.248  1.00 34.66  ? 280  PHE A O   1 
ATOM   1065  C CB  . PHE A  1 134 ? 24.208  66.463  22.997  1.00 31.64  ? 280  PHE A CB  1 
ATOM   1066  C CG  . PHE A  1 134 ? 23.009  66.900  23.730  1.00 38.11  ? 280  PHE A CG  1 
ATOM   1067  C CD1 . PHE A  1 134 ? 21.994  65.996  24.029  1.00 43.90  ? 280  PHE A CD1 1 
ATOM   1068  C CD2 . PHE A  1 134 ? 22.907  68.209  24.180  1.00 37.54  ? 280  PHE A CD2 1 
ATOM   1069  C CE1 . PHE A  1 134 ? 20.896  66.391  24.773  1.00 40.04  ? 280  PHE A CE1 1 
ATOM   1070  C CE2 . PHE A  1 134 ? 21.813  68.625  24.927  1.00 33.38  ? 280  PHE A CE2 1 
ATOM   1071  C CZ  . PHE A  1 134 ? 20.805  67.714  25.226  1.00 38.64  ? 280  PHE A CZ  1 
ATOM   1072  N N   . PHE A  1 135 ? 25.613  66.814  19.954  1.00 31.72  ? 281  PHE A N   1 
ATOM   1073  C CA  . PHE A  1 135 ? 26.909  66.804  19.313  1.00 30.60  ? 281  PHE A CA  1 
ATOM   1074  C C   . PHE A  1 135 ? 27.634  68.018  19.834  1.00 29.39  ? 281  PHE A C   1 
ATOM   1075  O O   . PHE A  1 135 ? 27.180  69.135  19.665  1.00 38.59  ? 281  PHE A O   1 
ATOM   1076  C CB  . PHE A  1 135 ? 26.768  66.889  17.806  1.00 19.86  ? 281  PHE A CB  1 
ATOM   1077  C CG  . PHE A  1 135 ? 26.169  65.670  17.205  1.00 21.84  ? 281  PHE A CG  1 
ATOM   1078  C CD1 . PHE A  1 135 ? 26.877  64.486  17.176  1.00 22.67  ? 281  PHE A CD1 1 
ATOM   1079  C CD2 . PHE A  1 135 ? 24.916  65.705  16.632  1.00 21.70  ? 281  PHE A CD2 1 
ATOM   1080  C CE1 . PHE A  1 135 ? 26.341  63.350  16.573  1.00 28.57  ? 281  PHE A CE1 1 
ATOM   1081  C CE2 . PHE A  1 135 ? 24.373  64.570  16.019  1.00 25.77  ? 281  PHE A CE2 1 
ATOM   1082  C CZ  . PHE A  1 135 ? 25.091  63.394  15.991  1.00 20.70  ? 281  PHE A CZ  1 
ATOM   1083  N N   . ILE A  1 136 ? 28.756  67.815  20.491  1.00 25.56  ? 282  ILE A N   1 
ATOM   1084  C CA  . ILE A  1 136 ? 29.499  68.940  20.990  1.00 23.67  ? 282  ILE A CA  1 
ATOM   1085  C C   . ILE A  1 136 ? 30.857  69.032  20.317  1.00 27.47  ? 282  ILE A C   1 
ATOM   1086  O O   . ILE A  1 136 ? 31.673  68.136  20.451  1.00 26.97  ? 282  ILE A O   1 
ATOM   1087  C CB  . ILE A  1 136 ? 29.712  68.820  22.484  1.00 31.25  ? 282  ILE A CB  1 
ATOM   1088  C CG1 . ILE A  1 136 ? 28.375  68.977  23.183  1.00 35.09  ? 282  ILE A CG1 1 
ATOM   1089  C CG2 . ILE A  1 136 ? 30.711  69.866  22.970  1.00 18.24  ? 282  ILE A CG2 1 
ATOM   1090  C CD1 . ILE A  1 136 ? 28.495  69.018  24.676  1.00 34.30  ? 282  ILE A CD1 1 
ATOM   1091  N N   . GLN A  1 137 ? 31.090  70.125  19.599  1.00 31.20  ? 283  GLN A N   1 
ATOM   1092  C CA  . GLN A  1 137 ? 32.350  70.369  18.913  1.00 25.42  ? 283  GLN A CA  1 
ATOM   1093  C C   . GLN A  1 137 ? 33.050  71.518  19.635  1.00 27.77  ? 283  GLN A C   1 
ATOM   1094  O O   . GLN A  1 137 ? 32.665  72.675  19.526  1.00 29.00  ? 283  GLN A O   1 
ATOM   1095  C CB  . GLN A  1 137 ? 32.085  70.710  17.434  1.00 25.59  ? 283  GLN A CB  1 
ATOM   1096  C CG  . GLN A  1 137 ? 33.201  71.442  16.683  1.00 20.98  ? 283  GLN A CG  1 
ATOM   1097  C CD  . GLN A  1 137 ? 34.550  70.734  16.720  1.00 33.12  ? 283  GLN A CD  1 
ATOM   1098  O OE1 . GLN A  1 137 ? 34.701  69.605  16.249  1.00 41.77  ? 283  GLN A OE1 1 
ATOM   1099  N NE2 . GLN A  1 137 ? 35.545  71.408  17.275  1.00 33.32  ? 283  GLN A NE2 1 
ATOM   1100  N N   . ALA A  1 138 ? 34.080  71.175  20.390  1.00 28.16  ? 284  ALA A N   1 
ATOM   1101  C CA  . ALA A  1 138 ? 34.839  72.150  21.143  1.00 30.99  ? 284  ALA A CA  1 
ATOM   1102  C C   . ALA A  1 138 ? 36.060  71.454  21.717  1.00 34.37  ? 284  ALA A C   1 
ATOM   1103  O O   . ALA A  1 138 ? 36.196  70.249  21.578  1.00 29.70  ? 284  ALA A O   1 
ATOM   1104  C CB  . ALA A  1 138 ? 33.992  72.694  22.267  1.00 5.72   ? 284  ALA A CB  1 
ATOM   1105  N N   . CYS A  1 139 ? 36.953  72.213  22.345  1.00 40.22  ? 285  CYS A N   1 
ATOM   1106  C CA  . CYS A  1 139 ? 38.117  71.614  22.965  1.00 39.22  ? 285  CYS A CA  1 
ATOM   1107  C C   . CYS A  1 139 ? 37.684  71.147  24.340  1.00 39.29  ? 285  CYS A C   1 
ATOM   1108  O O   . CYS A  1 139 ? 36.692  71.618  24.889  1.00 41.69  ? 285  CYS A O   1 
ATOM   1109  C CB  . CYS A  1 139 ? 39.244  72.631  23.113  1.00 40.53  ? 285  CYS A CB  1 
ATOM   1110  S SG  . CYS A  1 139 ? 39.969  73.147  21.531  1.00 46.93  ? 285  CYS A SG  1 
ATOM   1111  N N   . GLN A  1 140 ? 38.423  70.206  24.887  1.00 37.29  ? 286  GLN A N   1 
ATOM   1112  C CA  . GLN A  1 140 ? 38.146  69.692  26.214  1.00 38.16  ? 286  GLN A CA  1 
ATOM   1113  C C   . GLN A  1 140 ? 39.436  69.773  27.015  1.00 36.44  ? 286  GLN A C   1 
ATOM   1114  O O   . GLN A  1 140 ? 39.620  69.063  27.989  1.00 44.90  ? 286  GLN A O   1 
ATOM   1115  C CB  . GLN A  1 140 ? 37.676  68.249  26.126  1.00 40.58  ? 286  GLN A CB  1 
ATOM   1116  C CG  . GLN A  1 140 ? 36.235  68.100  25.726  1.00 47.46  ? 286  GLN A CG  1 
ATOM   1117  C CD  . GLN A  1 140 ? 35.300  68.775  26.717  1.00 48.79  ? 286  GLN A CD  1 
ATOM   1118  O OE1 . GLN A  1 140 ? 34.868  69.903  26.495  1.00 43.24  ? 286  GLN A OE1 1 
ATOM   1119  N NE2 . GLN A  1 140 ? 34.999  68.089  27.826  1.00 44.56  ? 286  GLN A NE2 1 
ATOM   1120  N N   . GLY A  1 141 ? 40.328  70.644  26.574  1.00 37.51  ? 287  GLY A N   1 
ATOM   1121  C CA  . GLY A  1 141 ? 41.610  70.818  27.221  1.00 51.86  ? 287  GLY A CA  1 
ATOM   1122  C C   . GLY A  1 141 ? 42.602  71.409  26.231  1.00 58.76  ? 287  GLY A C   1 
ATOM   1123  O O   . GLY A  1 141 ? 42.291  71.577  25.053  1.00 62.56  ? 287  GLY A O   1 
ATOM   1124  N N   . ASP A  1 142 ? 43.801  71.718  26.703  1.00 62.13  ? 288  ASP A N   1 
ATOM   1125  C CA  . ASP A  1 142 ? 44.822  72.295  25.853  1.00 62.77  ? 288  ASP A CA  1 
ATOM   1126  C C   . ASP A  1 142 ? 45.901  71.297  25.450  1.00 64.19  ? 288  ASP A C   1 
ATOM   1127  O O   . ASP A  1 142 ? 46.919  71.683  24.888  1.00 72.17  ? 288  ASP A O   1 
ATOM   1128  C CB  . ASP A  1 142 ? 45.462  73.474  26.568  1.00 68.06  ? 288  ASP A CB  1 
ATOM   1129  C CG  . ASP A  1 142 ? 45.978  73.107  27.937  1.00 75.71  ? 288  ASP A CG  1 
ATOM   1130  O OD1 . ASP A  1 142 ? 45.164  72.679  28.782  1.00 84.49  ? 288  ASP A OD1 1 
ATOM   1131  O OD2 . ASP A  1 142 ? 47.196  73.242  28.173  1.00 84.87  ? 288  ASP A OD2 1 
ATOM   1132  N N   . ASN A  1 143 ? 45.683  70.018  25.719  1.00 61.64  ? 289  ASN A N   1 
ATOM   1133  C CA  . ASN A  1 143 ? 46.672  69.013  25.373  1.00 57.97  ? 289  ASN A CA  1 
ATOM   1134  C C   . ASN A  1 143 ? 46.474  68.491  23.965  1.00 54.82  ? 289  ASN A C   1 
ATOM   1135  O O   . ASN A  1 143 ? 45.369  68.506  23.442  1.00 39.97  ? 289  ASN A O   1 
ATOM   1136  C CB  . ASN A  1 143 ? 46.616  67.840  26.352  1.00 61.39  ? 289  ASN A CB  1 
ATOM   1137  C CG  . ASN A  1 143 ? 46.898  68.255  27.774  1.00 65.81  ? 289  ASN A CG  1 
ATOM   1138  O OD1 . ASN A  1 143 ? 47.170  69.423  28.055  1.00 73.83  ? 289  ASN A OD1 1 
ATOM   1139  N ND2 . ASN A  1 143 ? 46.834  67.297  28.688  1.00 75.20  ? 289  ASN A ND2 1 
ATOM   1140  N N   . TYR A  1 144 ? 47.566  68.029  23.363  1.00 56.58  ? 290  TYR A N   1 
ATOM   1141  C CA  . TYR A  1 144 ? 47.517  67.480  22.022  1.00 58.83  ? 290  TYR A CA  1 
ATOM   1142  C C   . TYR A  1 144 ? 47.522  65.965  22.080  1.00 57.70  ? 290  TYR A C   1 
ATOM   1143  O O   . TYR A  1 144 ? 48.396  65.363  22.692  1.00 63.49  ? 290  TYR A O   1 
ATOM   1144  C CB  . TYR A  1 144 ? 48.714  67.941  21.204  1.00 58.33  ? 290  TYR A CB  1 
ATOM   1145  C CG  . TYR A  1 144 ? 48.698  69.403  20.839  1.00 66.71  ? 290  TYR A CG  1 
ATOM   1146  C CD1 . TYR A  1 144 ? 49.283  70.358  21.666  1.00 70.02  ? 290  TYR A CD1 1 
ATOM   1147  C CD2 . TYR A  1 144 ? 48.138  69.830  19.633  1.00 72.21  ? 290  TYR A CD2 1 
ATOM   1148  C CE1 . TYR A  1 144 ? 49.320  71.701  21.293  1.00 74.71  ? 290  TYR A CE1 1 
ATOM   1149  C CE2 . TYR A  1 144 ? 48.166  71.168  19.247  1.00 69.17  ? 290  TYR A CE2 1 
ATOM   1150  C CZ  . TYR A  1 144 ? 48.760  72.098  20.076  1.00 76.54  ? 290  TYR A CZ  1 
ATOM   1151  O OH  . TYR A  1 144 ? 48.811  73.418  19.678  1.00 74.70  ? 290  TYR A OH  1 
ATOM   1152  N N   . GLN A  1 145 ? 46.536  65.346  21.455  1.00 53.83  ? 291  GLN A N   1 
ATOM   1153  C CA  . GLN A  1 145 ? 46.475  63.904  21.444  1.00 48.95  ? 291  GLN A CA  1 
ATOM   1154  C C   . GLN A  1 145 ? 47.656  63.487  20.572  1.00 52.66  ? 291  GLN A C   1 
ATOM   1155  O O   . GLN A  1 145 ? 47.761  63.911  19.417  1.00 56.50  ? 291  GLN A O   1 
ATOM   1156  C CB  . GLN A  1 145 ? 45.144  63.451  20.839  1.00 45.94  ? 291  GLN A CB  1 
ATOM   1157  C CG  . GLN A  1 145 ? 44.949  61.948  20.720  1.00 47.85  ? 291  GLN A CG  1 
ATOM   1158  C CD  . GLN A  1 145 ? 44.758  61.255  22.054  1.00 47.52  ? 291  GLN A CD  1 
ATOM   1159  O OE1 . GLN A  1 145 ? 44.655  61.894  23.097  1.00 44.82  ? 291  GLN A OE1 1 
ATOM   1160  N NE2 . GLN A  1 145 ? 44.703  59.931  22.020  1.00 45.70  ? 291  GLN A NE2 1 
ATOM   1161  N N   . LYS A  1 146 ? 48.558  62.681  21.132  1.00 54.16  ? 292  LYS A N   1 
ATOM   1162  C CA  . LYS A  1 146 ? 49.729  62.217  20.392  1.00 52.00  ? 292  LYS A CA  1 
ATOM   1163  C C   . LYS A  1 146 ? 49.377  61.039  19.500  1.00 50.86  ? 292  LYS A C   1 
ATOM   1164  O O   . LYS A  1 146 ? 48.427  60.305  19.763  1.00 49.55  ? 292  LYS A O   1 
ATOM   1165  C CB  . LYS A  1 146 ? 50.847  61.827  21.350  1.00 51.21  ? 292  LYS A CB  1 
ATOM   1166  C CG  . LYS A  1 146 ? 51.159  62.887  22.398  1.00 66.03  ? 292  LYS A CG  1 
ATOM   1167  C CD  . LYS A  1 146 ? 52.299  62.446  23.322  1.00 75.42  ? 292  LYS A CD  1 
ATOM   1168  C CE  . LYS A  1 146 ? 52.232  63.118  24.699  1.00 79.40  ? 292  LYS A CE  1 
ATOM   1169  N NZ  . LYS A  1 146 ? 51.031  62.698  25.503  1.00 77.23  ? 292  LYS A NZ  1 
ATOM   1170  N N   . GLY A  1 147 ? 50.143  60.870  18.432  1.00 50.64  ? 293  GLY A N   1 
ATOM   1171  C CA  . GLY A  1 147 ? 49.888  59.784  17.513  1.00 49.12  ? 293  GLY A CA  1 
ATOM   1172  C C   . GLY A  1 147 ? 50.815  58.606  17.737  1.00 49.35  ? 293  GLY A C   1 
ATOM   1173  O O   . GLY A  1 147 ? 51.927  58.761  18.236  1.00 46.68  ? 293  GLY A O   1 
ATOM   1174  N N   . ILE A  1 148 ? 50.349  57.417  17.374  1.00 48.95  ? 294  ILE A N   1 
ATOM   1175  C CA  . ILE A  1 148 ? 51.140  56.202  17.515  1.00 46.26  ? 294  ILE A CA  1 
ATOM   1176  C C   . ILE A  1 148 ? 51.052  55.450  16.193  1.00 47.58  ? 294  ILE A C   1 
ATOM   1177  O O   . ILE A  1 148 ? 50.013  55.425  15.552  1.00 49.48  ? 294  ILE A O   1 
ATOM   1178  C CB  . ILE A  1 148 ? 50.605  55.304  18.653  1.00 39.51  ? 294  ILE A CB  1 
ATOM   1179  C CG1 . ILE A  1 148 ? 49.282  54.671  18.237  1.00 29.71  ? 294  ILE A CG1 1 
ATOM   1180  C CG2 . ILE A  1 148 ? 50.448  56.120  19.927  1.00 29.04  ? 294  ILE A CG2 1 
ATOM   1181  C CD1 . ILE A  1 148 ? 48.683  53.750  19.262  1.00 47.00  ? 294  ILE A CD1 1 
ATOM   1182  N N   . PRO A  1 149 ? 52.153  54.831  15.767  1.00 51.95  ? 295  PRO A N   1 
ATOM   1183  C CA  . PRO A  1 149 ? 52.236  54.072  14.513  1.00 50.59  ? 295  PRO A CA  1 
ATOM   1184  C C   . PRO A  1 149 ? 51.635  52.685  14.549  1.00 50.17  ? 295  PRO A C   1 
ATOM   1185  O O   . PRO A  1 149 ? 51.709  51.996  15.558  1.00 54.65  ? 295  PRO A O   1 
ATOM   1186  C CB  . PRO A  1 149 ? 53.720  54.014  14.268  1.00 49.25  ? 295  PRO A CB  1 
ATOM   1187  C CG  . PRO A  1 149 ? 54.230  53.832  15.665  1.00 55.45  ? 295  PRO A CG  1 
ATOM   1188  C CD  . PRO A  1 149 ? 53.462  54.871  16.438  1.00 50.16  ? 295  PRO A CD  1 
ATOM   1189  N N   . VAL A  1 150 ? 51.048  52.278  13.436  1.00 48.07  ? 296  VAL A N   1 
ATOM   1190  C CA  . VAL A  1 150 ? 50.456  50.960  13.341  1.00 54.04  ? 296  VAL A CA  1 
ATOM   1191  C C   . VAL A  1 150 ? 50.424  50.505  11.895  1.00 64.78  ? 296  VAL A C   1 
ATOM   1192  O O   . VAL A  1 150 ? 50.920  51.184  10.992  1.00 63.34  ? 296  VAL A O   1 
ATOM   1193  C CB  . VAL A  1 150 ? 49.006  50.931  13.858  1.00 50.78  ? 296  VAL A CB  1 
ATOM   1194  C CG1 . VAL A  1 150 ? 48.968  51.251  15.336  1.00 48.25  ? 296  VAL A CG1 1 
ATOM   1195  C CG2 . VAL A  1 150 ? 48.143  51.903  13.049  1.00 54.41  ? 296  VAL A CG2 1 
ATOM   1196  N N   . GLU A  1 151 ? 49.799  49.351  11.706  1.00 75.85  ? 297  GLU A N   1 
ATOM   1197  C CA  . GLU A  1 151 ? 49.631  48.729  10.410  1.00 86.75  ? 297  GLU A CA  1 
ATOM   1198  C C   . GLU A  1 151 ? 48.324  49.183  9.748   1.00 92.72  ? 297  GLU A C   1 
ATOM   1199  O O   . GLU A  1 151 ? 47.329  49.493  10.422  1.00 93.30  ? 297  GLU A O   1 
ATOM   1200  C CB  . GLU A  1 151 ? 49.619  47.207  10.572  1.00 89.77  ? 297  GLU A CB  1 
ATOM   1201  C CG  . GLU A  1 151 ? 49.864  46.472  9.285   1.00 94.39  ? 297  GLU A CG  1 
ATOM   1202  C CD  . GLU A  1 151 ? 51.163  46.916  8.634   1.00 100.00 ? 297  GLU A CD  1 
ATOM   1203  O OE1 . GLU A  1 151 ? 51.266  48.106  8.249   1.00 100.00 ? 297  GLU A OE1 1 
ATOM   1204  O OE2 . GLU A  1 151 ? 52.082  46.078  8.513   1.00 99.57  ? 297  GLU A OE2 1 
ATOM   1205  N N   . THR A  1 152 ? 48.335  49.208  8.421   1.00 95.84  ? 298  THR A N   1 
ATOM   1206  C CA  . THR A  1 152 ? 47.178  49.612  7.634   1.00 98.12  ? 298  THR A CA  1 
ATOM   1207  C C   . THR A  1 152 ? 45.942  48.710  7.840   1.00 99.92  ? 298  THR A C   1 
ATOM   1208  O O   . THR A  1 152 ? 46.065  47.489  7.975   1.00 100.00 ? 298  THR A O   1 
ATOM   1209  C CB  . THR A  1 152 ? 47.576  49.645  6.165   1.00 97.36  ? 298  THR A CB  1 
ATOM   1210  O OG1 . THR A  1 152 ? 48.533  50.694  5.978   1.00 90.51  ? 298  THR A OG1 1 
ATOM   1211  C CG2 . THR A  1 152 ? 46.365  49.864  5.275   1.00 100.00 ? 298  THR A CG2 1 
ATOM   1212  N N   . ASP A  1 153 ? 44.757  49.322  7.849   1.00 98.87  ? 299  ASP A N   1 
ATOM   1213  C CA  . ASP A  1 153 ? 43.504  48.595  8.073   1.00 99.26  ? 299  ASP A CA  1 
ATOM   1214  C C   . ASP A  1 153 ? 42.782  48.143  6.788   1.00 100.00 ? 299  ASP A C   1 
ATOM   1215  O O   . ASP A  1 153 ? 41.525  48.093  6.794   1.00 99.52  ? 299  ASP A O   1 
ATOM   1216  C CB  . ASP A  1 153 ? 42.570  49.469  8.928   1.00 93.19  ? 299  ASP A CB  1 
ATOM   1217  C CG  . ASP A  1 153 ? 43.214  49.899  10.247  1.00 91.86  ? 299  ASP A CG  1 
ATOM   1218  O OD1 . ASP A  1 153 ? 43.268  49.088  11.198  1.00 88.00  ? 299  ASP A OD1 1 
ATOM   1219  O OD2 . ASP A  1 153 ? 43.682  51.051  10.333  1.00 84.28  ? 299  ASP A OD2 1 
ATOM   1220  O OXT . ASP A  1 153 ? 43.482  47.813  5.797   1.00 100.00 ? 299  ASP A OXT 1 
ATOM   1221  N N   . THR B  2 1   ? 1.855   50.310  29.398  1.00 85.94  ? 318  THR B N   1 
ATOM   1222  C CA  . THR B  2 1   ? 2.961   51.217  29.819  1.00 88.59  ? 318  THR B CA  1 
ATOM   1223  C C   . THR B  2 1   ? 4.224   50.452  30.200  1.00 94.70  ? 318  THR B C   1 
ATOM   1224  O O   . THR B  2 1   ? 4.484   49.372  29.668  1.00 100.00 ? 318  THR B O   1 
ATOM   1225  C CB  . THR B  2 1   ? 2.579   52.070  31.028  1.00 79.85  ? 318  THR B CB  1 
ATOM   1226  O OG1 . THR B  2 1   ? 2.374   51.217  32.154  1.00 79.54  ? 318  THR B OG1 1 
ATOM   1227  C CG2 . THR B  2 1   ? 1.333   52.865  30.744  1.00 83.22  ? 318  THR B CG2 1 
ATOM   1228  N N   . ARG B  2 2   ? 4.991   51.031  31.129  1.00 95.56  ? 319  ARG B N   1 
ATOM   1229  C CA  . ARG B  2 2   ? 6.257   50.479  31.623  1.00 90.51  ? 319  ARG B CA  1 
ATOM   1230  C C   . ARG B  2 2   ? 7.142   51.659  32.002  1.00 87.20  ? 319  ARG B C   1 
ATOM   1231  O O   . ARG B  2 2   ? 6.817   52.813  31.707  1.00 85.18  ? 319  ARG B O   1 
ATOM   1232  C CB  . ARG B  2 2   ? 6.962   49.658  30.534  1.00 88.79  ? 319  ARG B CB  1 
ATOM   1233  C CG  . ARG B  2 2   ? 8.301   49.042  30.936  1.00 94.16  ? 319  ARG B CG  1 
ATOM   1234  C CD  . ARG B  2 2   ? 8.951   48.316  29.748  1.00 99.31  ? 319  ARG B CD  1 
ATOM   1235  N NE  . ARG B  2 2   ? 9.131   49.209  28.596  1.00 100.00 ? 319  ARG B NE  1 
ATOM   1236  C CZ  . ARG B  2 2   ? 9.592   48.851  27.392  1.00 99.73  ? 319  ARG B CZ  1 
ATOM   1237  N NH1 . ARG B  2 2   ? 9.943   47.601  27.126  1.00 88.82  ? 319  ARG B NH1 1 
ATOM   1238  N NH2 . ARG B  2 2   ? 9.708   49.766  26.440  1.00 100.00 ? 319  ARG B NH2 1 
ATOM   1239  N N   . TYR B  2 3   ? 8.252   51.363  32.670  1.00 84.00  ? 320  TYR B N   1 
ATOM   1240  C CA  . TYR B  2 3   ? 9.219   52.385  33.070  1.00 83.26  ? 320  TYR B CA  1 
ATOM   1241  C C   . TYR B  2 3   ? 10.632  52.171  32.525  1.00 79.69  ? 320  TYR B C   1 
ATOM   1242  O O   . TYR B  2 3   ? 11.087  51.034  32.348  1.00 78.11  ? 320  TYR B O   1 
ATOM   1243  C CB  . TYR B  2 3   ? 9.343   52.472  34.587  1.00 85.42  ? 320  TYR B CB  1 
ATOM   1244  C CG  . TYR B  2 3   ? 8.188   53.121  35.284  1.00 91.57  ? 320  TYR B CG  1 
ATOM   1245  C CD1 . TYR B  2 3   ? 6.988   53.360  34.617  1.00 93.43  ? 320  TYR B CD1 1 
ATOM   1246  C CD2 . TYR B  2 3   ? 8.289   53.487  36.628  1.00 95.01  ? 320  TYR B CD2 1 
ATOM   1247  C CE1 . TYR B  2 3   ? 5.912   53.947  35.269  1.00 99.63  ? 320  TYR B CE1 1 
ATOM   1248  C CE2 . TYR B  2 3   ? 7.226   54.075  37.292  1.00 99.25  ? 320  TYR B CE2 1 
ATOM   1249  C CZ  . TYR B  2 3   ? 6.038   54.303  36.609  1.00 100.00 ? 320  TYR B CZ  1 
ATOM   1250  O OH  . TYR B  2 3   ? 4.980   54.890  37.268  1.00 100.00 ? 320  TYR B OH  1 
ATOM   1251  N N   . ILE B  2 4   ? 11.316  53.282  32.262  1.00 71.90  ? 321  ILE B N   1 
ATOM   1252  C CA  . ILE B  2 4   ? 12.698  53.252  31.804  1.00 63.09  ? 321  ILE B CA  1 
ATOM   1253  C C   . ILE B  2 4   ? 13.390  54.303  32.653  1.00 59.60  ? 321  ILE B C   1 
ATOM   1254  O O   . ILE B  2 4   ? 12.743  55.197  33.187  1.00 58.52  ? 321  ILE B O   1 
ATOM   1255  C CB  . ILE B  2 4   ? 12.857  53.605  30.309  1.00 61.70  ? 321  ILE B CB  1 
ATOM   1256  C CG1 . ILE B  2 4   ? 12.469  55.062  30.061  1.00 61.82  ? 321  ILE B CG1 1 
ATOM   1257  C CG2 . ILE B  2 4   ? 12.039  52.644  29.459  1.00 57.84  ? 321  ILE B CG2 1 
ATOM   1258  C CD1 . ILE B  2 4   ? 12.676  55.485  28.618  1.00 63.63  ? 321  ILE B CD1 1 
ATOM   1259  N N   . PRO B  2 5   ? 14.714  54.196  32.815  1.00 56.66  ? 322  PRO B N   1 
ATOM   1260  C CA  . PRO B  2 5   ? 15.391  55.199  33.638  1.00 53.17  ? 322  PRO B CA  1 
ATOM   1261  C C   . PRO B  2 5   ? 15.362  56.644  33.144  1.00 52.93  ? 322  PRO B C   1 
ATOM   1262  O O   . PRO B  2 5   ? 15.322  56.929  31.935  1.00 50.15  ? 322  PRO B O   1 
ATOM   1263  C CB  . PRO B  2 5   ? 16.811  54.627  33.789  1.00 55.46  ? 322  PRO B CB  1 
ATOM   1264  C CG  . PRO B  2 5   ? 16.954  53.654  32.621  1.00 46.37  ? 322  PRO B CG  1 
ATOM   1265  C CD  . PRO B  2 5   ? 15.597  53.047  32.526  1.00 52.42  ? 322  PRO B CD  1 
ATOM   1266  N N   . ASP B  2 6   ? 15.374  57.547  34.120  1.00 51.60  ? 323  ASP B N   1 
ATOM   1267  C CA  . ASP B  2 6   ? 15.356  58.982  33.886  1.00 50.07  ? 323  ASP B CA  1 
ATOM   1268  C C   . ASP B  2 6   ? 16.342  59.392  32.799  1.00 50.50  ? 323  ASP B C   1 
ATOM   1269  O O   . ASP B  2 6   ? 15.982  60.148  31.882  1.00 59.40  ? 323  ASP B O   1 
ATOM   1270  C CB  . ASP B  2 6   ? 15.677  59.714  35.196  1.00 49.79  ? 323  ASP B CB  1 
ATOM   1271  C CG  . ASP B  2 6   ? 15.456  61.217  35.106  1.00 59.57  ? 323  ASP B CG  1 
ATOM   1272  O OD1 . ASP B  2 6   ? 14.578  61.652  34.331  1.00 62.90  ? 323  ASP B OD1 1 
ATOM   1273  O OD2 . ASP B  2 6   ? 16.144  61.971  35.829  1.00 58.06  ? 323  ASP B OD2 1 
ATOM   1274  N N   . GLU B  2 7   ? 17.569  58.872  32.883  1.00 43.50  ? 324  GLU B N   1 
ATOM   1275  C CA  . GLU B  2 7   ? 18.620  59.223  31.925  1.00 44.19  ? 324  GLU B CA  1 
ATOM   1276  C C   . GLU B  2 7   ? 18.769  58.339  30.694  1.00 41.46  ? 324  GLU B C   1 
ATOM   1277  O O   . GLU B  2 7   ? 19.803  58.385  30.015  1.00 47.61  ? 324  GLU B O   1 
ATOM   1278  C CB  . GLU B  2 7   ? 19.978  59.335  32.625  1.00 36.90  ? 324  GLU B CB  1 
ATOM   1279  C CG  . GLU B  2 7   ? 19.971  60.194  33.861  1.00 44.13  ? 324  GLU B CG  1 
ATOM   1280  C CD  . GLU B  2 7   ? 21.375  60.536  34.323  1.00 55.88  ? 324  GLU B CD  1 
ATOM   1281  O OE1 . GLU B  2 7   ? 22.285  60.566  33.465  1.00 63.17  ? 324  GLU B OE1 1 
ATOM   1282  O OE2 . GLU B  2 7   ? 21.572  60.787  35.536  1.00 60.20  ? 324  GLU B OE2 1 
ATOM   1283  N N   . ALA B  2 8   ? 17.751  57.552  30.388  1.00 33.58  ? 325  ALA B N   1 
ATOM   1284  C CA  . ALA B  2 8   ? 17.819  56.703  29.197  1.00 45.21  ? 325  ALA B CA  1 
ATOM   1285  C C   . ALA B  2 8   ? 17.805  57.485  27.869  1.00 47.50  ? 325  ALA B C   1 
ATOM   1286  O O   . ALA B  2 8   ? 17.631  58.705  27.844  1.00 49.80  ? 325  ALA B O   1 
ATOM   1287  C CB  . ALA B  2 8   ? 16.660  55.693  29.205  1.00 32.45  ? 325  ALA B CB  1 
ATOM   1288  N N   . ASP B  2 9   ? 18.002  56.753  26.777  1.00 49.23  ? 326  ASP B N   1 
ATOM   1289  C CA  . ASP B  2 9   ? 17.978  57.296  25.423  1.00 50.98  ? 326  ASP B CA  1 
ATOM   1290  C C   . ASP B  2 9   ? 18.751  58.581  25.132  1.00 50.48  ? 326  ASP B C   1 
ATOM   1291  O O   . ASP B  2 9   ? 18.220  59.513  24.536  1.00 52.45  ? 326  ASP B O   1 
ATOM   1292  C CB  . ASP B  2 9   ? 16.536  57.492  25.017  1.00 50.84  ? 326  ASP B CB  1 
ATOM   1293  C CG  . ASP B  2 9   ? 15.661  56.424  25.552  1.00 50.08  ? 326  ASP B CG  1 
ATOM   1294  O OD1 . ASP B  2 9   ? 15.748  55.302  25.026  1.00 48.12  ? 326  ASP B OD1 1 
ATOM   1295  O OD2 . ASP B  2 9   ? 14.907  56.711  26.506  1.00 52.48  ? 326  ASP B OD2 1 
ATOM   1296  N N   . PHE B  2 10  ? 20.001  58.641  25.553  1.00 49.43  ? 327  PHE B N   1 
ATOM   1297  C CA  . PHE B  2 10  ? 20.827  59.806  25.266  1.00 43.01  ? 327  PHE B CA  1 
ATOM   1298  C C   . PHE B  2 10  ? 21.970  59.379  24.366  1.00 41.05  ? 327  PHE B C   1 
ATOM   1299  O O   . PHE B  2 10  ? 22.378  58.219  24.354  1.00 46.90  ? 327  PHE B O   1 
ATOM   1300  C CB  . PHE B  2 10  ? 21.439  60.394  26.521  1.00 39.44  ? 327  PHE B CB  1 
ATOM   1301  C CG  . PHE B  2 10  ? 20.608  61.436  27.178  1.00 45.37  ? 327  PHE B CG  1 
ATOM   1302  C CD1 . PHE B  2 10  ? 19.604  61.100  28.071  1.00 54.88  ? 327  PHE B CD1 1 
ATOM   1303  C CD2 . PHE B  2 10  ? 20.867  62.769  26.948  1.00 54.36  ? 327  PHE B CD2 1 
ATOM   1304  C CE1 . PHE B  2 10  ? 18.881  62.091  28.726  1.00 53.08  ? 327  PHE B CE1 1 
ATOM   1305  C CE2 . PHE B  2 10  ? 20.148  63.770  27.601  1.00 53.87  ? 327  PHE B CE2 1 
ATOM   1306  C CZ  . PHE B  2 10  ? 19.164  63.431  28.484  1.00 47.49  ? 327  PHE B CZ  1 
ATOM   1307  N N   . LEU B  2 11  ? 22.475  60.331  23.599  1.00 36.67  ? 328  LEU B N   1 
ATOM   1308  C CA  . LEU B  2 11  ? 23.600  60.080  22.730  1.00 35.05  ? 328  LEU B CA  1 
ATOM   1309  C C   . LEU B  2 11  ? 24.395  61.343  22.737  1.00 32.68  ? 328  LEU B C   1 
ATOM   1310  O O   . LEU B  2 11  ? 23.934  62.362  22.253  1.00 45.77  ? 328  LEU B O   1 
ATOM   1311  C CB  . LEU B  2 11  ? 23.163  59.744  21.306  1.00 36.09  ? 328  LEU B CB  1 
ATOM   1312  C CG  . LEU B  2 11  ? 24.340  59.804  20.326  1.00 39.68  ? 328  LEU B CG  1 
ATOM   1313  C CD1 . LEU B  2 11  ? 25.562  59.134  20.926  1.00 29.22  ? 328  LEU B CD1 1 
ATOM   1314  C CD2 . LEU B  2 11  ? 23.971  59.140  19.019  1.00 41.71  ? 328  LEU B CD2 1 
ATOM   1315  N N   . LEU B  2 12  ? 25.578  61.287  23.330  1.00 32.64  ? 329  LEU B N   1 
ATOM   1316  C CA  . LEU B  2 12  ? 26.446  62.447  23.399  1.00 33.03  ? 329  LEU B CA  1 
ATOM   1317  C C   . LEU B  2 12  ? 27.611  62.185  22.483  1.00 30.93  ? 329  LEU B C   1 
ATOM   1318  O O   . LEU B  2 12  ? 28.299  61.201  22.629  1.00 29.26  ? 329  LEU B O   1 
ATOM   1319  C CB  . LEU B  2 12  ? 26.952  62.693  24.822  1.00 22.57  ? 329  LEU B CB  1 
ATOM   1320  C CG  . LEU B  2 12  ? 28.095  63.718  24.879  1.00 37.87  ? 329  LEU B CG  1 
ATOM   1321  C CD1 . LEU B  2 12  ? 27.780  64.938  24.028  1.00 47.10  ? 329  LEU B CD1 1 
ATOM   1322  C CD2 . LEU B  2 12  ? 28.302  64.154  26.288  1.00 33.07  ? 329  LEU B CD2 1 
ATOM   1323  N N   . GLY B  2 13  ? 27.819  63.075  21.527  1.00 36.71  ? 330  GLY B N   1 
ATOM   1324  C CA  . GLY B  2 13  ? 28.919  62.904  20.607  1.00 37.30  ? 330  GLY B CA  1 
ATOM   1325  C C   . GLY B  2 13  ? 29.969  63.974  20.775  1.00 33.17  ? 330  GLY B C   1 
ATOM   1326  O O   . GLY B  2 13  ? 29.813  65.063  20.233  1.00 32.25  ? 330  GLY B O   1 
ATOM   1327  N N   . MET B  2 14  ? 31.019  63.664  21.534  1.00 28.12  ? 331  MET B N   1 
ATOM   1328  C CA  . MET B  2 14  ? 32.119  64.588  21.753  1.00 32.32  ? 331  MET B CA  1 
ATOM   1329  C C   . MET B  2 14  ? 33.090  64.551  20.578  1.00 41.31  ? 331  MET B C   1 
ATOM   1330  O O   . MET B  2 14  ? 33.315  63.497  19.967  1.00 43.56  ? 331  MET B O   1 
ATOM   1331  C CB  . MET B  2 14  ? 32.862  64.223  23.015  1.00 26.83  ? 331  MET B CB  1 
ATOM   1332  C CG  . MET B  2 14  ? 32.011  64.317  24.249  1.00 29.06  ? 331  MET B CG  1 
ATOM   1333  S SD  . MET B  2 14  ? 31.470  65.953  24.488  1.00 35.78  ? 331  MET B SD  1 
ATOM   1334  C CE  . MET B  2 14  ? 32.907  66.737  25.159  1.00 6.73   ? 331  MET B CE  1 
ATOM   1335  N N   . ALA B  2 15  ? 33.670  65.703  20.264  1.00 40.52  ? 332  ALA B N   1 
ATOM   1336  C CA  . ALA B  2 15  ? 34.609  65.795  19.156  1.00 42.45  ? 332  ALA B CA  1 
ATOM   1337  C C   . ALA B  2 15  ? 35.991  65.351  19.584  1.00 42.62  ? 332  ALA B C   1 
ATOM   1338  O O   . ALA B  2 15  ? 36.832  65.031  18.756  1.00 45.43  ? 332  ALA B O   1 
ATOM   1339  C CB  . ALA B  2 15  ? 34.665  67.216  18.636  1.00 33.93  ? 332  ALA B CB  1 
ATOM   1340  N N   . THR B  2 16  ? 36.216  65.324  20.888  1.00 43.85  ? 333  THR B N   1 
ATOM   1341  C CA  . THR B  2 16  ? 37.510  64.935  21.413  1.00 41.87  ? 333  THR B CA  1 
ATOM   1342  C C   . THR B  2 16  ? 37.424  64.314  22.794  1.00 39.14  ? 333  THR B C   1 
ATOM   1343  O O   . THR B  2 16  ? 36.531  64.635  23.568  1.00 48.23  ? 333  THR B O   1 
ATOM   1344  C CB  . THR B  2 16  ? 38.445  66.158  21.511  1.00 36.27  ? 333  THR B CB  1 
ATOM   1345  O OG1 . THR B  2 16  ? 39.633  65.794  22.227  1.00 42.50  ? 333  THR B OG1 1 
ATOM   1346  C CG2 . THR B  2 16  ? 37.759  67.282  22.246  1.00 27.18  ? 333  THR B CG2 1 
ATOM   1347  N N   . VAL B  2 17  ? 38.363  63.431  23.107  1.00 40.03  ? 334  VAL B N   1 
ATOM   1348  C CA  . VAL B  2 17  ? 38.411  62.817  24.432  1.00 38.89  ? 334  VAL B CA  1 
ATOM   1349  C C   . VAL B  2 17  ? 38.719  63.939  25.396  1.00 42.37  ? 334  VAL B C   1 
ATOM   1350  O O   . VAL B  2 17  ? 39.088  65.038  24.979  1.00 47.56  ? 334  VAL B O   1 
ATOM   1351  C CB  . VAL B  2 17  ? 39.532  61.774  24.550  1.00 40.08  ? 334  VAL B CB  1 
ATOM   1352  C CG1 . VAL B  2 17  ? 39.164  60.544  23.750  1.00 38.44  ? 334  VAL B CG1 1 
ATOM   1353  C CG2 . VAL B  2 17  ? 40.875  62.367  24.077  1.00 32.78  ? 334  VAL B CG2 1 
ATOM   1354  N N   . ASN B  2 18  ? 38.602  63.675  26.685  1.00 39.93  ? 335  ASN B N   1 
ATOM   1355  C CA  . ASN B  2 18  ? 38.859  64.729  27.641  1.00 46.45  ? 335  ASN B CA  1 
ATOM   1356  C C   . ASN B  2 18  ? 40.321  65.178  27.650  1.00 45.16  ? 335  ASN B C   1 
ATOM   1357  O O   . ASN B  2 18  ? 41.219  64.420  27.303  1.00 46.27  ? 335  ASN B O   1 
ATOM   1358  C CB  . ASN B  2 18  ? 38.425  64.288  29.038  1.00 48.64  ? 335  ASN B CB  1 
ATOM   1359  C CG  . ASN B  2 18  ? 38.159  65.465  29.961  1.00 59.64  ? 335  ASN B CG  1 
ATOM   1360  O OD1 . ASN B  2 18  ? 38.144  65.320  31.180  1.00 65.92  ? 335  ASN B OD1 1 
ATOM   1361  N ND2 . ASN B  2 18  ? 37.939  66.638  29.380  1.00 60.06  ? 335  ASN B ND2 1 
ATOM   1362  N N   . ASN B  2 19  ? 40.527  66.434  28.029  1.00 44.74  ? 336  ASN B N   1 
ATOM   1363  C CA  . ASN B  2 19  ? 41.843  67.047  28.130  1.00 48.08  ? 336  ASN B CA  1 
ATOM   1364  C C   . ASN B  2 19  ? 42.519  67.438  26.842  1.00 47.45  ? 336  ASN B C   1 
ATOM   1365  O O   . ASN B  2 19  ? 43.597  68.016  26.872  1.00 51.48  ? 336  ASN B O   1 
ATOM   1366  C CB  . ASN B  2 19  ? 42.798  66.155  28.914  1.00 48.56  ? 336  ASN B CB  1 
ATOM   1367  C CG  . ASN B  2 19  ? 42.379  65.982  30.346  1.00 62.01  ? 336  ASN B CG  1 
ATOM   1368  O OD1 . ASN B  2 19  ? 41.622  65.065  30.676  1.00 58.52  ? 336  ASN B OD1 1 
ATOM   1369  N ND2 . ASN B  2 19  ? 42.856  66.876  31.216  1.00 69.63  ? 336  ASN B ND2 1 
ATOM   1370  N N   . CYS B  2 20  ? 41.897  67.150  25.710  1.00 45.08  ? 337  CYS B N   1 
ATOM   1371  C CA  . CYS B  2 20  ? 42.526  67.489  24.446  1.00 44.74  ? 337  CYS B CA  1 
ATOM   1372  C C   . CYS B  2 20  ? 41.824  68.515  23.562  1.00 40.82  ? 337  CYS B C   1 
ATOM   1373  O O   . CYS B  2 20  ? 40.704  68.914  23.811  1.00 43.61  ? 337  CYS B O   1 
ATOM   1374  C CB  . CYS B  2 20  ? 42.756  66.216  23.659  1.00 46.28  ? 337  CYS B CB  1 
ATOM   1375  S SG  . CYS B  2 20  ? 43.703  65.071  24.582  1.00 39.72  ? 337  CYS B SG  1 
ATOM   1376  N N   . VAL B  2 21  ? 42.512  68.930  22.513  1.00 36.28  ? 338  VAL B N   1 
ATOM   1377  C CA  . VAL B  2 21  ? 41.989  69.892  21.582  1.00 28.33  ? 338  VAL B CA  1 
ATOM   1378  C C   . VAL B  2 21  ? 41.318  69.195  20.402  1.00 30.70  ? 338  VAL B C   1 
ATOM   1379  O O   . VAL B  2 21  ? 41.590  68.037  20.126  1.00 24.88  ? 338  VAL B O   1 
ATOM   1380  C CB  . VAL B  2 21  ? 43.131  70.792  21.038  1.00 24.41  ? 338  VAL B CB  1 
ATOM   1381  C CG1 . VAL B  2 21  ? 43.888  71.402  22.186  1.00 22.87  ? 338  VAL B CG1 1 
ATOM   1382  C CG2 . VAL B  2 21  ? 44.082  69.984  20.169  1.00 13.29  ? 338  VAL B CG2 1 
ATOM   1383  N N   . SER B  2 22  ? 40.415  69.913  19.737  1.00 30.49  ? 339  SER B N   1 
ATOM   1384  C CA  . SER B  2 22  ? 39.759  69.430  18.536  1.00 29.68  ? 339  SER B CA  1 
ATOM   1385  C C   . SER B  2 22  ? 40.134  70.485  17.482  1.00 31.73  ? 339  SER B C   1 
ATOM   1386  O O   . SER B  2 22  ? 40.415  71.632  17.835  1.00 32.39  ? 339  SER B O   1 
ATOM   1387  C CB  . SER B  2 22  ? 38.256  69.333  18.721  1.00 30.00  ? 339  SER B CB  1 
ATOM   1388  O OG  . SER B  2 22  ? 37.747  70.509  19.304  1.00 46.27  ? 339  SER B OG  1 
ATOM   1389  N N   . TYR B  2 23  ? 40.162  70.100  16.205  1.00 35.95  ? 340  TYR B N   1 
ATOM   1390  C CA  . TYR B  2 23  ? 40.569  71.010  15.143  1.00 38.02  ? 340  TYR B CA  1 
ATOM   1391  C C   . TYR B  2 23  ? 39.499  71.591  14.243  1.00 41.72  ? 340  TYR B C   1 
ATOM   1392  O O   . TYR B  2 23  ? 38.523  70.925  13.858  1.00 43.29  ? 340  TYR B O   1 
ATOM   1393  C CB  . TYR B  2 23  ? 41.644  70.355  14.279  1.00 42.38  ? 340  TYR B CB  1 
ATOM   1394  C CG  . TYR B  2 23  ? 42.923  70.062  15.020  1.00 45.86  ? 340  TYR B CG  1 
ATOM   1395  C CD1 . TYR B  2 23  ? 43.843  71.069  15.259  1.00 47.51  ? 340  TYR B CD1 1 
ATOM   1396  C CD2 . TYR B  2 23  ? 43.190  68.791  15.528  1.00 45.36  ? 340  TYR B CD2 1 
ATOM   1397  C CE1 . TYR B  2 23  ? 44.996  70.825  15.986  1.00 52.35  ? 340  TYR B CE1 1 
ATOM   1398  C CE2 . TYR B  2 23  ? 44.343  68.536  16.255  1.00 48.90  ? 340  TYR B CE2 1 
ATOM   1399  C CZ  . TYR B  2 23  ? 45.242  69.558  16.481  1.00 53.28  ? 340  TYR B CZ  1 
ATOM   1400  O OH  . TYR B  2 23  ? 46.388  69.318  17.197  1.00 54.29  ? 340  TYR B OH  1 
ATOM   1401  N N   . ARG B  2 24  ? 39.729  72.853  13.898  1.00 42.66  ? 341  ARG B N   1 
ATOM   1402  C CA  . ARG B  2 24  ? 38.847  73.640  13.049  1.00 44.23  ? 341  ARG B CA  1 
ATOM   1403  C C   . ARG B  2 24  ? 39.683  74.286  11.947  1.00 41.50  ? 341  ARG B C   1 
ATOM   1404  O O   . ARG B  2 24  ? 40.661  74.982  12.219  1.00 38.06  ? 341  ARG B O   1 
ATOM   1405  C CB  . ARG B  2 24  ? 38.165  74.713  13.903  1.00 46.50  ? 341  ARG B CB  1 
ATOM   1406  C CG  . ARG B  2 24  ? 37.236  75.681  13.185  1.00 41.74  ? 341  ARG B CG  1 
ATOM   1407  C CD  . ARG B  2 24  ? 37.043  76.923  14.049  1.00 24.41  ? 341  ARG B CD  1 
ATOM   1408  N NE  . ARG B  2 24  ? 38.332  77.574  14.260  1.00 32.74  ? 341  ARG B NE  1 
ATOM   1409  C CZ  . ARG B  2 24  ? 38.778  77.984  15.441  1.00 42.60  ? 341  ARG B CZ  1 
ATOM   1410  N NH1 . ARG B  2 24  ? 38.041  77.819  16.518  1.00 48.64  ? 341  ARG B NH1 1 
ATOM   1411  N NH2 . ARG B  2 24  ? 39.974  78.546  15.558  1.00 55.26  ? 341  ARG B NH2 1 
ATOM   1412  N N   . ASN B  2 25  ? 39.308  74.019  10.706  1.00 40.85  ? 342  ASN B N   1 
ATOM   1413  C CA  . ASN B  2 25  ? 40.000  74.579  9.553   1.00 52.79  ? 342  ASN B CA  1 
ATOM   1414  C C   . ASN B  2 25  ? 39.153  75.755  9.035   1.00 52.06  ? 342  ASN B C   1 
ATOM   1415  O O   . ASN B  2 25  ? 38.037  75.570  8.563   1.00 48.71  ? 342  ASN B O   1 
ATOM   1416  C CB  . ASN B  2 25  ? 40.158  73.508  8.472   1.00 56.83  ? 342  ASN B CB  1 
ATOM   1417  C CG  . ASN B  2 25  ? 40.951  73.995  7.277   1.00 55.75  ? 342  ASN B CG  1 
ATOM   1418  O OD1 . ASN B  2 25  ? 40.413  74.584  6.348   1.00 52.50  ? 342  ASN B OD1 1 
ATOM   1419  N ND2 . ASN B  2 25  ? 42.243  73.747  7.304   1.00 57.43  ? 342  ASN B ND2 1 
ATOM   1420  N N   . PRO B  2 26  ? 39.682  76.984  9.124   1.00 51.79  ? 343  PRO B N   1 
ATOM   1421  C CA  . PRO B  2 26  ? 38.978  78.188  8.678   1.00 48.05  ? 343  PRO B CA  1 
ATOM   1422  C C   . PRO B  2 26  ? 38.324  78.048  7.315   1.00 46.59  ? 343  PRO B C   1 
ATOM   1423  O O   . PRO B  2 26  ? 37.277  78.614  7.061   1.00 45.13  ? 343  PRO B O   1 
ATOM   1424  C CB  . PRO B  2 26  ? 40.074  79.234  8.676   1.00 45.16  ? 343  PRO B CB  1 
ATOM   1425  C CG  . PRO B  2 26  ? 40.940  78.805  9.804   1.00 51.54  ? 343  PRO B CG  1 
ATOM   1426  C CD  . PRO B  2 26  ? 41.045  77.323  9.573   1.00 53.42  ? 343  PRO B CD  1 
ATOM   1427  N N   . ALA B  2 27  ? 38.938  77.270  6.444   1.00 49.99  ? 344  ALA B N   1 
ATOM   1428  C CA  . ALA B  2 27  ? 38.424  77.079  5.103   1.00 51.45  ? 344  ALA B CA  1 
ATOM   1429  C C   . ALA B  2 27  ? 37.422  75.943  4.911   1.00 57.95  ? 344  ALA B C   1 
ATOM   1430  O O   . ALA B  2 27  ? 36.733  75.909  3.901   1.00 53.30  ? 344  ALA B O   1 
ATOM   1431  C CB  . ALA B  2 27  ? 39.581  76.888  4.143   1.00 56.11  ? 344  ALA B CB  1 
ATOM   1432  N N   . GLU B  2 28  ? 37.331  74.997  5.840   1.00 63.63  ? 345  GLU B N   1 
ATOM   1433  C CA  . GLU B  2 28  ? 36.368  73.920  5.632   1.00 62.25  ? 345  GLU B CA  1 
ATOM   1434  C C   . GLU B  2 28  ? 35.624  73.333  6.833   1.00 58.63  ? 345  GLU B C   1 
ATOM   1435  O O   . GLU B  2 28  ? 34.901  72.341  6.682   1.00 57.50  ? 345  GLU B O   1 
ATOM   1436  C CB  . GLU B  2 28  ? 37.021  72.806  4.816   1.00 60.41  ? 345  GLU B CB  1 
ATOM   1437  C CG  . GLU B  2 28  ? 38.445  72.485  5.189   1.00 63.23  ? 345  GLU B CG  1 
ATOM   1438  C CD  . GLU B  2 28  ? 39.121  71.534  4.186   1.00 61.69  ? 345  GLU B CD  1 
ATOM   1439  O OE1 . GLU B  2 28  ? 38.552  70.464  3.882   1.00 68.33  ? 345  GLU B OE1 1 
ATOM   1440  O OE2 . GLU B  2 28  ? 40.225  71.855  3.700   1.00 44.19  ? 345  GLU B OE2 1 
ATOM   1441  N N   . GLY B  2 29  ? 35.777  73.952  8.003   1.00 50.15  ? 346  GLY B N   1 
ATOM   1442  C CA  . GLY B  2 29  ? 35.085  73.483  9.183   1.00 44.42  ? 346  GLY B CA  1 
ATOM   1443  C C   . GLY B  2 29  ? 35.934  72.622  10.094  1.00 45.86  ? 346  GLY B C   1 
ATOM   1444  O O   . GLY B  2 29  ? 37.142  72.460  9.869   1.00 45.48  ? 346  GLY B O   1 
ATOM   1445  N N   . THR B  2 30  ? 35.296  72.060  11.123  1.00 38.80  ? 347  THR B N   1 
ATOM   1446  C CA  . THR B  2 30  ? 35.982  71.228  12.091  1.00 27.64  ? 347  THR B CA  1 
ATOM   1447  C C   . THR B  2 30  ? 36.109  69.820  11.556  1.00 36.16  ? 347  THR B C   1 
ATOM   1448  O O   . THR B  2 30  ? 35.252  69.371  10.790  1.00 33.38  ? 347  THR B O   1 
ATOM   1449  C CB  . THR B  2 30  ? 35.228  71.216  13.435  1.00 28.81  ? 347  THR B CB  1 
ATOM   1450  O OG1 . THR B  2 30  ? 33.897  70.705  13.260  1.00 20.81  ? 347  THR B OG1 1 
ATOM   1451  C CG2 . THR B  2 30  ? 35.175  72.615  14.022  1.00 7.31   ? 347  THR B CG2 1 
ATOM   1452  N N   . TRP B  2 31  ? 37.181  69.125  11.938  1.00 37.66  ? 348  TRP B N   1 
ATOM   1453  C CA  . TRP B  2 31  ? 37.383  67.758  11.471  1.00 38.47  ? 348  TRP B CA  1 
ATOM   1454  C C   . TRP B  2 31  ? 36.165  66.936  11.865  1.00 40.07  ? 348  TRP B C   1 
ATOM   1455  O O   . TRP B  2 31  ? 35.613  66.167  11.069  1.00 49.27  ? 348  TRP B O   1 
ATOM   1456  C CB  . TRP B  2 31  ? 38.608  67.114  12.131  1.00 47.67  ? 348  TRP B CB  1 
ATOM   1457  C CG  . TRP B  2 31  ? 39.947  67.721  11.837  1.00 46.69  ? 348  TRP B CG  1 
ATOM   1458  C CD1 . TRP B  2 31  ? 40.204  68.801  11.064  1.00 47.55  ? 348  TRP B CD1 1 
ATOM   1459  C CD2 . TRP B  2 31  ? 41.214  67.276  12.341  1.00 48.14  ? 348  TRP B CD2 1 
ATOM   1460  N NE1 . TRP B  2 31  ? 41.554  69.069  11.050  1.00 43.98  ? 348  TRP B NE1 1 
ATOM   1461  C CE2 . TRP B  2 31  ? 42.196  68.151  11.828  1.00 48.38  ? 348  TRP B CE2 1 
ATOM   1462  C CE3 . TRP B  2 31  ? 41.612  66.228  13.179  1.00 48.55  ? 348  TRP B CE3 1 
ATOM   1463  C CZ2 . TRP B  2 31  ? 43.557  68.013  12.127  1.00 47.29  ? 348  TRP B CZ2 1 
ATOM   1464  C CZ3 . TRP B  2 31  ? 42.967  66.089  13.478  1.00 48.03  ? 348  TRP B CZ3 1 
ATOM   1465  C CH2 . TRP B  2 31  ? 43.921  66.980  12.952  1.00 48.32  ? 348  TRP B CH2 1 
ATOM   1466  N N   . TYR B  2 32  ? 35.750  67.097  13.108  1.00 33.65  ? 349  TYR B N   1 
ATOM   1467  C CA  . TYR B  2 32  ? 34.630  66.345  13.602  1.00 34.67  ? 349  TYR B CA  1 
ATOM   1468  C C   . TYR B  2 32  ? 33.333  66.571  12.856  1.00 38.32  ? 349  TYR B C   1 
ATOM   1469  O O   . TYR B  2 32  ? 32.804  65.641  12.233  1.00 31.51  ? 349  TYR B O   1 
ATOM   1470  C CB  . TYR B  2 32  ? 34.412  66.627  15.088  1.00 35.01  ? 349  TYR B CB  1 
ATOM   1471  C CG  . TYR B  2 32  ? 33.372  65.733  15.717  1.00 34.00  ? 349  TYR B CG  1 
ATOM   1472  C CD1 . TYR B  2 32  ? 33.420  64.358  15.547  1.00 38.11  ? 349  TYR B CD1 1 
ATOM   1473  C CD2 . TYR B  2 32  ? 32.333  66.255  16.479  1.00 31.35  ? 349  TYR B CD2 1 
ATOM   1474  C CE1 . TYR B  2 32  ? 32.444  63.526  16.116  1.00 41.58  ? 349  TYR B CE1 1 
ATOM   1475  C CE2 . TYR B  2 32  ? 31.367  65.424  17.057  1.00 28.44  ? 349  TYR B CE2 1 
ATOM   1476  C CZ  . TYR B  2 32  ? 31.425  64.071  16.866  1.00 24.64  ? 349  TYR B CZ  1 
ATOM   1477  O OH  . TYR B  2 32  ? 30.460  63.249  17.388  1.00 27.50  ? 349  TYR B OH  1 
ATOM   1478  N N   . ILE B  2 33  ? 32.811  67.798  12.916  1.00 38.41  ? 350  ILE B N   1 
ATOM   1479  C CA  . ILE B  2 33  ? 31.524  68.078  12.281  1.00 36.89  ? 350  ILE B CA  1 
ATOM   1480  C C   . ILE B  2 33  ? 31.477  67.719  10.810  1.00 37.65  ? 350  ILE B C   1 
ATOM   1481  O O   . ILE B  2 33  ? 30.546  67.035  10.369  1.00 36.69  ? 350  ILE B O   1 
ATOM   1482  C CB  . ILE B  2 33  ? 31.109  69.538  12.463  1.00 31.75  ? 350  ILE B CB  1 
ATOM   1483  C CG1 . ILE B  2 33  ? 30.986  69.835  13.937  1.00 35.43  ? 350  ILE B CG1 1 
ATOM   1484  C CG2 . ILE B  2 33  ? 29.753  69.788  11.817  1.00 26.25  ? 350  ILE B CG2 1 
ATOM   1485  C CD1 . ILE B  2 33  ? 29.908  68.982  14.597  1.00 28.13  ? 350  ILE B CD1 1 
ATOM   1486  N N   . GLN B  2 34  ? 32.476  68.169  10.053  1.00 35.97  ? 351  GLN B N   1 
ATOM   1487  C CA  . GLN B  2 34  ? 32.524  67.874  8.629   1.00 38.52  ? 351  GLN B CA  1 
ATOM   1488  C C   . GLN B  2 34  ? 32.402  66.372  8.411   1.00 41.85  ? 351  GLN B C   1 
ATOM   1489  O O   . GLN B  2 34  ? 31.541  65.907  7.657   1.00 40.89  ? 351  GLN B O   1 
ATOM   1490  C CB  . GLN B  2 34  ? 33.812  68.395  8.020   1.00 31.40  ? 351  GLN B CB  1 
ATOM   1491  C CG  . GLN B  2 34  ? 33.794  69.887  7.845   1.00 40.58  ? 351  GLN B CG  1 
ATOM   1492  C CD  . GLN B  2 34  ? 32.497  70.376  7.229   1.00 29.70  ? 351  GLN B CD  1 
ATOM   1493  O OE1 . GLN B  2 34  ? 32.091  69.912  6.180   1.00 31.71  ? 351  GLN B OE1 1 
ATOM   1494  N NE2 . GLN B  2 34  ? 31.851  71.318  7.881   1.00 24.09  ? 351  GLN B NE2 1 
ATOM   1495  N N   . SER B  2 35  ? 33.246  65.616  9.108   1.00 39.18  ? 352  SER B N   1 
ATOM   1496  C CA  . SER B  2 35  ? 33.222  64.177  9.009   1.00 38.38  ? 352  SER B CA  1 
ATOM   1497  C C   . SER B  2 35  ? 31.842  63.634  9.394   1.00 36.77  ? 352  SER B C   1 
ATOM   1498  O O   . SER B  2 35  ? 31.274  62.779  8.707   1.00 36.26  ? 352  SER B O   1 
ATOM   1499  C CB  . SER B  2 35  ? 34.307  63.587  9.908   1.00 39.66  ? 352  SER B CB  1 
ATOM   1500  O OG  . SER B  2 35  ? 34.330  62.173  9.776   1.00 46.78  ? 352  SER B OG  1 
ATOM   1501  N N   . LEU B  2 36  ? 31.294  64.147  10.488  1.00 36.59  ? 353  LEU B N   1 
ATOM   1502  C CA  . LEU B  2 36  ? 29.984  63.711  10.940  1.00 37.95  ? 353  LEU B CA  1 
ATOM   1503  C C   . LEU B  2 36  ? 28.957  63.813  9.820   1.00 38.21  ? 353  LEU B C   1 
ATOM   1504  O O   . LEU B  2 36  ? 28.275  62.838  9.507   1.00 31.70  ? 353  LEU B O   1 
ATOM   1505  C CB  . LEU B  2 36  ? 29.535  64.543  12.149  1.00 33.20  ? 353  LEU B CB  1 
ATOM   1506  C CG  . LEU B  2 36  ? 28.097  64.359  12.676  1.00 34.67  ? 353  LEU B CG  1 
ATOM   1507  C CD1 . LEU B  2 36  ? 27.786  62.906  12.887  1.00 24.41  ? 353  LEU B CD1 1 
ATOM   1508  C CD2 . LEU B  2 36  ? 27.931  65.119  13.974  1.00 38.19  ? 353  LEU B CD2 1 
ATOM   1509  N N   . CYS B  2 37  ? 28.867  64.998  9.216   1.00 43.08  ? 354  CYS B N   1 
ATOM   1510  C CA  . CYS B  2 37  ? 27.916  65.255  8.140   1.00 40.66  ? 354  CYS B CA  1 
ATOM   1511  C C   . CYS B  2 37  ? 28.204  64.401  6.919   1.00 46.65  ? 354  CYS B C   1 
ATOM   1512  O O   . CYS B  2 37  ? 27.290  63.805  6.354   1.00 36.64  ? 354  CYS B O   1 
ATOM   1513  C CB  . CYS B  2 37  ? 27.936  66.733  7.759   1.00 42.00  ? 354  CYS B CB  1 
ATOM   1514  S SG  . CYS B  2 37  ? 27.253  67.871  9.025   1.00 40.32  ? 354  CYS B SG  1 
ATOM   1515  N N   . GLN B  2 38  ? 29.471  64.348  6.508   1.00 50.87  ? 355  GLN B N   1 
ATOM   1516  C CA  . GLN B  2 38  ? 29.851  63.540  5.358   1.00 55.97  ? 355  GLN B CA  1 
ATOM   1517  C C   . GLN B  2 38  ? 29.317  62.136  5.575   1.00 54.13  ? 355  GLN B C   1 
ATOM   1518  O O   . GLN B  2 38  ? 28.561  61.595  4.768   1.00 48.34  ? 355  GLN B O   1 
ATOM   1519  C CB  . GLN B  2 38  ? 31.373  63.430  5.219   1.00 67.70  ? 355  GLN B CB  1 
ATOM   1520  C CG  . GLN B  2 38  ? 32.138  64.707  4.907   1.00 81.67  ? 355  GLN B CG  1 
ATOM   1521  C CD  . GLN B  2 38  ? 33.613  64.431  4.655   1.00 85.28  ? 355  GLN B CD  1 
ATOM   1522  O OE1 . GLN B  2 38  ? 33.956  63.641  3.768   1.00 94.53  ? 355  GLN B OE1 1 
ATOM   1523  N NE2 . GLN B  2 38  ? 34.490  65.072  5.434   1.00 74.27  ? 355  GLN B NE2 1 
ATOM   1524  N N   . SER B  2 39  ? 29.737  61.543  6.683   1.00 55.04  ? 356  SER B N   1 
ATOM   1525  C CA  . SER B  2 39  ? 29.326  60.191  7.008   1.00 55.83  ? 356  SER B CA  1 
ATOM   1526  C C   . SER B  2 39  ? 27.806  60.074  7.071   1.00 47.20  ? 356  SER B C   1 
ATOM   1527  O O   . SER B  2 39  ? 27.216  59.160  6.513   1.00 46.75  ? 356  SER B O   1 
ATOM   1528  C CB  . SER B  2 39  ? 29.956  59.766  8.327   1.00 57.53  ? 356  SER B CB  1 
ATOM   1529  O OG  . SER B  2 39  ? 29.698  58.401  8.568   1.00 61.86  ? 356  SER B OG  1 
ATOM   1530  N N   . LEU B  2 40  ? 27.169  61.011  7.744   1.00 41.58  ? 357  LEU B N   1 
ATOM   1531  C CA  . LEU B  2 40  ? 25.727  60.994  7.835   1.00 43.74  ? 357  LEU B CA  1 
ATOM   1532  C C   . LEU B  2 40  ? 25.050  60.941  6.470   1.00 47.23  ? 357  LEU B C   1 
ATOM   1533  O O   . LEU B  2 40  ? 24.203  60.096  6.224   1.00 44.63  ? 357  LEU B O   1 
ATOM   1534  C CB  . LEU B  2 40  ? 25.245  62.227  8.590   1.00 36.68  ? 357  LEU B CB  1 
ATOM   1535  C CG  . LEU B  2 40  ? 25.237  62.012  10.092  1.00 37.83  ? 357  LEU B CG  1 
ATOM   1536  C CD1 . LEU B  2 40  ? 25.022  63.333  10.804  1.00 37.96  ? 357  LEU B CD1 1 
ATOM   1537  C CD2 . LEU B  2 40  ? 24.144  60.997  10.434  1.00 25.73  ? 357  LEU B CD2 1 
ATOM   1538  N N   . ARG B  2 41  ? 25.439  61.844  5.577   1.00 55.82  ? 358  ARG B N   1 
ATOM   1539  C CA  . ARG B  2 41  ? 24.838  61.913  4.259   1.00 52.46  ? 358  ARG B CA  1 
ATOM   1540  C C   . ARG B  2 41  ? 24.937  60.679  3.405   1.00 55.18  ? 358  ARG B C   1 
ATOM   1541  O O   . ARG B  2 41  ? 23.992  60.380  2.699   1.00 56.91  ? 358  ARG B O   1 
ATOM   1542  C CB  . ARG B  2 41  ? 25.353  63.139  3.506   1.00 57.56  ? 358  ARG B CB  1 
ATOM   1543  C CG  . ARG B  2 41  ? 24.484  64.364  3.769   1.00 74.28  ? 358  ARG B CG  1 
ATOM   1544  C CD  . ARG B  2 41  ? 24.908  65.615  3.000   1.00 88.87  ? 358  ARG B CD  1 
ATOM   1545  N NE  . ARG B  2 41  ? 26.177  66.168  3.479   1.00 99.46  ? 358  ARG B NE  1 
ATOM   1546  C CZ  . ARG B  2 41  ? 26.714  67.306  3.042   1.00 99.29  ? 358  ARG B CZ  1 
ATOM   1547  N NH1 . ARG B  2 41  ? 26.089  68.019  2.109   1.00 100.00 ? 358  ARG B NH1 1 
ATOM   1548  N NH2 . ARG B  2 41  ? 27.877  67.730  3.529   1.00 94.76  ? 358  ARG B NH2 1 
ATOM   1549  N N   . GLU B  2 42  ? 26.045  59.943  3.460   1.00 64.36  ? 359  GLU B N   1 
ATOM   1550  C CA  . GLU B  2 42  ? 26.162  58.732  2.644   1.00 71.54  ? 359  GLU B CA  1 
ATOM   1551  C C   . GLU B  2 42  ? 25.711  57.464  3.375   1.00 73.80  ? 359  GLU B C   1 
ATOM   1552  O O   . GLU B  2 42  ? 25.412  56.458  2.743   1.00 77.48  ? 359  GLU B O   1 
ATOM   1553  C CB  . GLU B  2 42  ? 27.595  58.560  2.142   1.00 71.76  ? 359  GLU B CB  1 
ATOM   1554  C CG  . GLU B  2 42  ? 28.632  58.667  3.247   1.00 94.18  ? 359  GLU B CG  1 
ATOM   1555  C CD  . GLU B  2 42  ? 30.066  58.474  2.752   1.00 100.00 ? 359  GLU B CD  1 
ATOM   1556  O OE1 . GLU B  2 42  ? 30.445  59.141  1.757   1.00 100.00 ? 359  GLU B OE1 1 
ATOM   1557  O OE2 . GLU B  2 42  ? 30.814  57.669  3.367   1.00 95.65  ? 359  GLU B OE2 1 
ATOM   1558  N N   . ARG B  2 43  ? 25.640  57.522  4.700   1.00 73.64  ? 360  ARG B N   1 
ATOM   1559  C CA  . ARG B  2 43  ? 25.241  56.368  5.497   1.00 72.86  ? 360  ARG B CA  1 
ATOM   1560  C C   . ARG B  2 43  ? 23.739  56.239  5.758   1.00 71.64  ? 360  ARG B C   1 
ATOM   1561  O O   . ARG B  2 43  ? 23.141  55.214  5.449   1.00 65.56  ? 360  ARG B O   1 
ATOM   1562  C CB  . ARG B  2 43  ? 25.978  56.393  6.837   1.00 77.94  ? 360  ARG B CB  1 
ATOM   1563  C CG  . ARG B  2 43  ? 27.425  55.964  6.769   1.00 73.99  ? 360  ARG B CG  1 
ATOM   1564  C CD  . ARG B  2 43  ? 27.534  54.470  6.887   1.00 79.09  ? 360  ARG B CD  1 
ATOM   1565  N NE  . ARG B  2 43  ? 28.918  54.009  6.812   1.00 80.06  ? 360  ARG B NE  1 
ATOM   1566  C CZ  . ARG B  2 43  ? 29.288  52.733  6.882   1.00 76.01  ? 360  ARG B CZ  1 
ATOM   1567  N NH1 . ARG B  2 43  ? 28.378  51.777  7.034   1.00 76.60  ? 360  ARG B NH1 1 
ATOM   1568  N NH2 . ARG B  2 43  ? 30.567  52.410  6.783   1.00 70.36  ? 360  ARG B NH2 1 
ATOM   1569  N N   . CYS B  2 44  ? 23.145  57.276  6.345   1.00 72.72  ? 361  CYS B N   1 
ATOM   1570  C CA  . CYS B  2 44  ? 21.722  57.285  6.676   1.00 72.51  ? 361  CYS B CA  1 
ATOM   1571  C C   . CYS B  2 44  ? 20.861  56.788  5.533   1.00 79.63  ? 361  CYS B C   1 
ATOM   1572  O O   . CYS B  2 44  ? 19.930  56.010  5.736   1.00 82.60  ? 361  CYS B O   1 
ATOM   1573  C CB  . CYS B  2 44  ? 21.276  58.688  7.068   1.00 65.10  ? 361  CYS B CB  1 
ATOM   1574  S SG  . CYS B  2 44  ? 21.950  59.264  8.613   1.00 57.81  ? 361  CYS B SG  1 
ATOM   1575  N N   . PRO B  2 45  ? 21.142  57.251  4.310   1.00 81.51  ? 362  PRO B N   1 
ATOM   1576  C CA  . PRO B  2 45  ? 20.357  56.805  3.163   1.00 82.17  ? 362  PRO B CA  1 
ATOM   1577  C C   . PRO B  2 45  ? 20.370  55.284  3.102   1.00 85.06  ? 362  PRO B C   1 
ATOM   1578  O O   . PRO B  2 45  ? 19.340  54.652  2.900   1.00 90.32  ? 362  PRO B O   1 
ATOM   1579  C CB  . PRO B  2 45  ? 21.097  57.428  1.993   1.00 81.91  ? 362  PRO B CB  1 
ATOM   1580  C CG  . PRO B  2 45  ? 21.573  58.718  2.569   1.00 82.64  ? 362  PRO B CG  1 
ATOM   1581  C CD  . PRO B  2 45  ? 22.113  58.280  3.907   1.00 82.38  ? 362  PRO B CD  1 
ATOM   1582  N N   . ARG B  2 46  B 21.550  54.707  3.294   1.00 85.41  ? 362  ARG B N   1 
ATOM   1583  C CA  . ARG B  2 46  B 21.726  53.263  3.264   1.00 83.30  ? 362  ARG B CA  1 
ATOM   1584  C C   . ARG B  2 46  B 21.092  52.560  4.467   1.00 78.68  ? 362  ARG B C   1 
ATOM   1585  O O   . ARG B  2 46  B 21.127  51.335  4.572   1.00 78.17  ? 362  ARG B O   1 
ATOM   1586  C CB  . ARG B  2 46  B 23.220  52.942  3.181   1.00 87.93  ? 362  ARG B CB  1 
ATOM   1587  C CG  . ARG B  2 46  B 23.853  53.343  1.847   1.00 89.75  ? 362  ARG B CG  1 
ATOM   1588  C CD  . ARG B  2 46  B 25.356  53.525  1.974   1.00 94.61  ? 362  ARG B CD  1 
ATOM   1589  N NE  . ARG B  2 46  B 25.990  52.385  2.633   1.00 99.40  ? 362  ARG B NE  1 
ATOM   1590  C CZ  . ARG B  2 46  B 27.257  52.364  3.035   1.00 100.00 ? 362  ARG B CZ  1 
ATOM   1591  N NH1 . ARG B  2 46  B 28.034  53.427  2.847   1.00 99.27  ? 362  ARG B NH1 1 
ATOM   1592  N NH2 . ARG B  2 46  B 27.747  51.279  3.625   1.00 100.00 ? 362  ARG B NH2 1 
ATOM   1593  N N   . GLY B  2 47  ? 20.517  53.339  5.374   1.00 72.91  ? 363  GLY B N   1 
ATOM   1594  C CA  . GLY B  2 47  ? 19.872  52.760  6.538   1.00 68.66  ? 363  GLY B CA  1 
ATOM   1595  C C   . GLY B  2 47  ? 20.777  52.408  7.703   1.00 68.90  ? 363  GLY B C   1 
ATOM   1596  O O   . GLY B  2 47  ? 20.365  51.674  8.599   1.00 67.16  ? 363  GLY B O   1 
ATOM   1597  N N   . ASP B  2 48  ? 22.000  52.934  7.709   1.00 68.69  ? 364  ASP B N   1 
ATOM   1598  C CA  . ASP B  2 48  ? 22.944  52.649  8.780   1.00 58.42  ? 364  ASP B CA  1 
ATOM   1599  C C   . ASP B  2 48  ? 22.577  53.320  10.083  1.00 50.28  ? 364  ASP B C   1 
ATOM   1600  O O   . ASP B  2 48  ? 22.034  54.413  10.084  1.00 45.82  ? 364  ASP B O   1 
ATOM   1601  C CB  . ASP B  2 48  ? 24.350  53.062  8.367   1.00 68.17  ? 364  ASP B CB  1 
ATOM   1602  C CG  . ASP B  2 48  ? 25.012  52.037  7.480   1.00 72.44  ? 364  ASP B CG  1 
ATOM   1603  O OD1 . ASP B  2 48  ? 24.969  50.840  7.838   1.00 76.23  ? 364  ASP B OD1 1 
ATOM   1604  O OD2 . ASP B  2 48  ? 25.578  52.417  6.435   1.00 73.65  ? 364  ASP B OD2 1 
ATOM   1605  N N   . ASP B  2 49  ? 22.878  52.647  11.187  1.00 48.59  ? 365  ASP B N   1 
ATOM   1606  C CA  . ASP B  2 49  ? 22.587  53.158  12.519  1.00 50.81  ? 365  ASP B CA  1 
ATOM   1607  C C   . ASP B  2 49  ? 23.591  54.256  12.943  1.00 50.56  ? 365  ASP B C   1 
ATOM   1608  O O   . ASP B  2 49  ? 24.718  54.326  12.429  1.00 46.24  ? 365  ASP B O   1 
ATOM   1609  C CB  . ASP B  2 49  ? 22.551  51.978  13.500  1.00 52.64  ? 365  ASP B CB  1 
ATOM   1610  C CG  . ASP B  2 49  ? 23.478  52.152  14.653  1.00 58.06  ? 365  ASP B CG  1 
ATOM   1611  O OD1 . ASP B  2 49  ? 24.665  51.799  14.497  1.00 60.20  ? 365  ASP B OD1 1 
ATOM   1612  O OD2 . ASP B  2 49  ? 23.015  52.652  15.704  1.00 53.17  ? 365  ASP B OD2 1 
ATOM   1613  N N   . ILE B  2 50  ? 23.182  55.117  13.872  1.00 42.16  ? 366  ILE B N   1 
ATOM   1614  C CA  . ILE B  2 50  ? 24.034  56.229  14.299  1.00 41.72  ? 366  ILE B CA  1 
ATOM   1615  C C   . ILE B  2 50  ? 25.361  55.816  14.932  1.00 44.63  ? 366  ILE B C   1 
ATOM   1616  O O   . ILE B  2 50  ? 26.394  56.453  14.691  1.00 45.79  ? 366  ILE B O   1 
ATOM   1617  C CB  . ILE B  2 50  ? 23.255  57.197  15.250  1.00 37.26  ? 366  ILE B CB  1 
ATOM   1618  C CG1 . ILE B  2 50  ? 23.649  58.641  14.955  1.00 36.95  ? 366  ILE B CG1 1 
ATOM   1619  C CG2 . ILE B  2 50  ? 23.532  56.883  16.701  1.00 39.61  ? 366  ILE B CG2 1 
ATOM   1620  C CD1 . ILE B  2 50  ? 25.021  58.995  15.350  1.00 46.32  ? 366  ILE B CD1 1 
ATOM   1621  N N   . LEU B  2 51  ? 25.346  54.764  15.745  1.00 39.63  ? 367  LEU B N   1 
ATOM   1622  C CA  . LEU B  2 51  ? 26.586  54.305  16.351  1.00 42.11  ? 367  LEU B CA  1 
ATOM   1623  C C   . LEU B  2 51  ? 27.572  53.870  15.232  1.00 41.41  ? 367  LEU B C   1 
ATOM   1624  O O   . LEU B  2 51  ? 28.764  54.207  15.245  1.00 34.57  ? 367  LEU B O   1 
ATOM   1625  C CB  . LEU B  2 51  ? 26.300  53.159  17.314  1.00 40.40  ? 367  LEU B CB  1 
ATOM   1626  C CG  . LEU B  2 51  ? 25.601  53.590  18.603  1.00 42.00  ? 367  LEU B CG  1 
ATOM   1627  C CD1 . LEU B  2 51  ? 25.373  52.378  19.518  1.00 35.85  ? 367  LEU B CD1 1 
ATOM   1628  C CD2 . LEU B  2 51  ? 26.445  54.629  19.301  1.00 34.90  ? 367  LEU B CD2 1 
ATOM   1629  N N   . THR B  2 52  ? 27.070  53.136  14.251  1.00 32.25  ? 368  THR B N   1 
ATOM   1630  C CA  . THR B  2 52  ? 27.913  52.729  13.148  1.00 32.90  ? 368  THR B CA  1 
ATOM   1631  C C   . THR B  2 52  ? 28.517  53.998  12.554  1.00 38.37  ? 368  THR B C   1 
ATOM   1632  O O   . THR B  2 52  ? 29.722  54.131  12.431  1.00 44.47  ? 368  THR B O   1 
ATOM   1633  C CB  . THR B  2 52  ? 27.094  52.009  12.058  1.00 37.14  ? 368  THR B CB  1 
ATOM   1634  O OG1 . THR B  2 52  ? 26.710  50.712  12.517  1.00 36.02  ? 368  THR B OG1 1 
ATOM   1635  C CG2 . THR B  2 52  ? 27.902  51.874  10.770  1.00 31.08  ? 368  THR B CG2 1 
ATOM   1636  N N   . ILE B  2 53  ? 27.662  54.943  12.194  1.00 42.71  ? 369  ILE B N   1 
ATOM   1637  C CA  . ILE B  2 53  ? 28.108  56.200  11.615  1.00 40.82  ? 369  ILE B CA  1 
ATOM   1638  C C   . ILE B  2 53  ? 29.177  56.854  12.491  1.00 39.05  ? 369  ILE B C   1 
ATOM   1639  O O   . ILE B  2 53  ? 30.237  57.225  12.007  1.00 34.10  ? 369  ILE B O   1 
ATOM   1640  C CB  . ILE B  2 53  ? 26.895  57.140  11.437  1.00 44.08  ? 369  ILE B CB  1 
ATOM   1641  C CG1 . ILE B  2 53  ? 25.863  56.437  10.562  1.00 42.43  ? 369  ILE B CG1 1 
ATOM   1642  C CG2 . ILE B  2 53  ? 27.312  58.471  10.835  1.00 35.95  ? 369  ILE B CG2 1 
ATOM   1643  C CD1 . ILE B  2 53  ? 24.549  57.134  10.539  1.00 59.86  ? 369  ILE B CD1 1 
ATOM   1644  N N   . LEU B  2 54  ? 28.908  56.972  13.787  1.00 38.77  ? 370  LEU B N   1 
ATOM   1645  C CA  . LEU B  2 54  ? 29.863  57.592  14.686  1.00 36.30  ? 370  LEU B CA  1 
ATOM   1646  C C   . LEU B  2 54  ? 31.198  56.860  14.700  1.00 38.57  ? 370  LEU B C   1 
ATOM   1647  O O   . LEU B  2 54  ? 32.261  57.471  14.855  1.00 34.74  ? 370  LEU B O   1 
ATOM   1648  C CB  . LEU B  2 54  ? 29.274  57.677  16.087  1.00 37.17  ? 370  LEU B CB  1 
ATOM   1649  C CG  . LEU B  2 54  ? 28.369  58.897  16.222  1.00 33.93  ? 370  LEU B CG  1 
ATOM   1650  C CD1 . LEU B  2 54  ? 27.623  58.900  17.554  1.00 26.54  ? 370  LEU B CD1 1 
ATOM   1651  C CD2 . LEU B  2 54  ? 29.232  60.123  16.104  1.00 37.11  ? 370  LEU B CD2 1 
ATOM   1652  N N   . THR B  2 55  ? 31.150  55.548  14.529  1.00 39.44  ? 371  THR B N   1 
ATOM   1653  C CA  . THR B  2 55  ? 32.379  54.756  14.505  1.00 47.61  ? 371  THR B CA  1 
ATOM   1654  C C   . THR B  2 55  ? 33.227  55.139  13.292  1.00 46.00  ? 371  THR B C   1 
ATOM   1655  O O   . THR B  2 55  ? 34.461  55.286  13.392  1.00 42.31  ? 371  THR B O   1 
ATOM   1656  C CB  . THR B  2 55  ? 32.082  53.251  14.428  1.00 45.33  ? 371  THR B CB  1 
ATOM   1657  O OG1 . THR B  2 55  ? 31.471  52.820  15.642  1.00 51.71  ? 371  THR B OG1 1 
ATOM   1658  C CG2 . THR B  2 55  ? 33.346  52.480  14.252  1.00 51.07  ? 371  THR B CG2 1 
ATOM   1659  N N   . GLU B  2 56  ? 32.557  55.282  12.147  1.00 37.52  ? 372  GLU B N   1 
ATOM   1660  C CA  . GLU B  2 56  ? 33.228  55.664  10.905  1.00 39.02  ? 372  GLU B CA  1 
ATOM   1661  C C   . GLU B  2 56  ? 33.877  57.022  11.124  1.00 36.84  ? 372  GLU B C   1 
ATOM   1662  O O   . GLU B  2 56  ? 34.976  57.285  10.631  1.00 27.36  ? 372  GLU B O   1 
ATOM   1663  C CB  . GLU B  2 56  ? 32.216  55.748  9.748   1.00 50.30  ? 372  GLU B CB  1 
ATOM   1664  C CG  . GLU B  2 56  ? 32.823  55.909  8.338   1.00 56.35  ? 372  GLU B CG  1 
ATOM   1665  C CD  . GLU B  2 56  ? 31.807  55.681  7.216   1.00 66.55  ? 372  GLU B CD  1 
ATOM   1666  O OE1 . GLU B  2 56  ? 31.032  56.610  6.896   1.00 71.68  ? 372  GLU B OE1 1 
ATOM   1667  O OE2 . GLU B  2 56  ? 31.775  54.560  6.655   1.00 75.46  ? 372  GLU B OE2 1 
ATOM   1668  N N   . VAL B  2 57  ? 33.195  57.882  11.878  1.00 29.87  ? 373  VAL B N   1 
ATOM   1669  C CA  . VAL B  2 57  ? 33.731  59.193  12.161  1.00 25.31  ? 373  VAL B CA  1 
ATOM   1670  C C   . VAL B  2 57  ? 35.003  59.015  12.940  1.00 23.38  ? 373  VAL B C   1 
ATOM   1671  O O   . VAL B  2 57  ? 36.006  59.659  12.660  1.00 26.14  ? 373  VAL B O   1 
ATOM   1672  C CB  . VAL B  2 57  ? 32.761  60.048  12.977  1.00 32.05  ? 373  VAL B CB  1 
ATOM   1673  C CG1 . VAL B  2 57  ? 33.318  61.453  13.165  1.00 17.63  ? 373  VAL B CG1 1 
ATOM   1674  C CG2 . VAL B  2 57  ? 31.419  60.102  12.271  1.00 36.66  ? 373  VAL B CG2 1 
ATOM   1675  N N   . ASN B  2 58  ? 34.969  58.129  13.920  1.00 32.47  ? 374  ASN B N   1 
ATOM   1676  C CA  . ASN B  2 58  ? 36.157  57.875  14.722  1.00 38.79  ? 374  ASN B CA  1 
ATOM   1677  C C   . ASN B  2 58  ? 37.318  57.435  13.844  1.00 38.74  ? 374  ASN B C   1 
ATOM   1678  O O   . ASN B  2 58  ? 38.446  57.912  13.995  1.00 38.08  ? 374  ASN B O   1 
ATOM   1679  C CB  . ASN B  2 58  ? 35.868  56.806  15.770  1.00 41.66  ? 374  ASN B CB  1 
ATOM   1680  C CG  . ASN B  2 58  ? 35.242  57.370  17.009  1.00 38.63  ? 374  ASN B CG  1 
ATOM   1681  O OD1 . ASN B  2 58  ? 35.374  58.555  17.302  1.00 35.94  ? 374  ASN B OD1 1 
ATOM   1682  N ND2 . ASN B  2 58  ? 34.580  56.521  17.761  1.00 30.07  ? 374  ASN B ND2 1 
ATOM   1683  N N   . TYR B  2 59  ? 37.041  56.523  12.923  1.00 35.96  ? 375  TYR B N   1 
ATOM   1684  C CA  . TYR B  2 59  ? 38.080  56.044  12.030  1.00 43.52  ? 375  TYR B CA  1 
ATOM   1685  C C   . TYR B  2 59  ? 38.686  57.232  11.310  1.00 41.33  ? 375  TYR B C   1 
ATOM   1686  O O   . TYR B  2 59  ? 39.847  57.558  11.496  1.00 44.12  ? 375  TYR B O   1 
ATOM   1687  C CB  . TYR B  2 59  ? 37.481  55.071  11.017  1.00 51.70  ? 375  TYR B CB  1 
ATOM   1688  C CG  . TYR B  2 59  ? 38.475  54.407  10.091  1.00 50.62  ? 375  TYR B CG  1 
ATOM   1689  C CD1 . TYR B  2 59  ? 39.326  55.153  9.299   1.00 58.41  ? 375  TYR B CD1 1 
ATOM   1690  C CD2 . TYR B  2 59  ? 38.552  53.021  10.010  1.00 61.32  ? 375  TYR B CD2 1 
ATOM   1691  C CE1 . TYR B  2 59  ? 40.236  54.541  8.447   1.00 66.41  ? 375  TYR B CE1 1 
ATOM   1692  C CE2 . TYR B  2 59  ? 39.454  52.395  9.162   1.00 64.77  ? 375  TYR B CE2 1 
ATOM   1693  C CZ  . TYR B  2 59  ? 40.293  53.163  8.386   1.00 66.90  ? 375  TYR B CZ  1 
ATOM   1694  O OH  . TYR B  2 59  ? 41.204  52.555  7.563   1.00 72.18  ? 375  TYR B OH  1 
ATOM   1695  N N   . GLU B  2 60  ? 37.861  57.883  10.505  1.00 41.70  ? 376  GLU B N   1 
ATOM   1696  C CA  . GLU B  2 60  ? 38.258  59.027  9.710   1.00 39.92  ? 376  GLU B CA  1 
ATOM   1697  C C   . GLU B  2 60  ? 39.020  60.127  10.419  1.00 36.44  ? 376  GLU B C   1 
ATOM   1698  O O   . GLU B  2 60  ? 40.066  60.558  9.950   1.00 39.81  ? 376  GLU B O   1 
ATOM   1699  C CB  . GLU B  2 60  ? 37.027  59.631  9.043   1.00 44.07  ? 376  GLU B CB  1 
ATOM   1700  C CG  . GLU B  2 60  ? 36.354  58.734  8.017   1.00 52.84  ? 376  GLU B CG  1 
ATOM   1701  C CD  . GLU B  2 60  ? 37.240  58.414  6.834   1.00 59.90  ? 376  GLU B CD  1 
ATOM   1702  O OE1 . GLU B  2 60  ? 37.912  59.342  6.332   1.00 71.47  ? 376  GLU B OE1 1 
ATOM   1703  O OE2 . GLU B  2 60  ? 37.257  57.241  6.395   1.00 67.65  ? 376  GLU B OE2 1 
ATOM   1704  N N   . VAL B  2 61  ? 38.497  60.609  11.531  1.00 33.93  ? 377  VAL B N   1 
ATOM   1705  C CA  . VAL B  2 61  ? 39.178  61.680  12.247  1.00 34.08  ? 377  VAL B CA  1 
ATOM   1706  C C   . VAL B  2 61  ? 40.522  61.216  12.803  1.00 36.46  ? 377  VAL B C   1 
ATOM   1707  O O   . VAL B  2 61  ? 41.390  62.026  13.102  1.00 36.51  ? 377  VAL B O   1 
ATOM   1708  C CB  . VAL B  2 61  ? 38.290  62.205  13.394  1.00 37.08  ? 377  VAL B CB  1 
ATOM   1709  C CG1 . VAL B  2 61  ? 38.908  63.439  14.039  1.00 22.62  ? 377  VAL B CG1 1 
ATOM   1710  C CG2 . VAL B  2 61  ? 36.899  62.500  12.860  1.00 34.75  ? 377  VAL B CG2 1 
ATOM   1711  N N   . SER B  2 62  ? 40.697  59.903  12.935  1.00 40.06  ? 378  SER B N   1 
ATOM   1712  C CA  . SER B  2 62  ? 41.943  59.361  13.461  1.00 38.00  ? 378  SER B CA  1 
ATOM   1713  C C   . SER B  2 62  ? 43.068  59.465  12.460  1.00 40.45  ? 378  SER B C   1 
ATOM   1714  O O   . SER B  2 62  ? 44.214  59.689  12.825  1.00 52.46  ? 378  SER B O   1 
ATOM   1715  C CB  . SER B  2 62  ? 41.758  57.917  13.860  1.00 37.68  ? 378  SER B CB  1 
ATOM   1716  O OG  . SER B  2 62  ? 40.888  57.832  14.963  1.00 38.08  ? 378  SER B OG  1 
ATOM   1717  N N   . ASN B  2 63  ? 42.741  59.314  11.188  1.00 44.52  ? 379  ASN B N   1 
ATOM   1718  C CA  . ASN B  2 63  ? 43.732  59.395  10.131  1.00 46.40  ? 379  ASN B CA  1 
ATOM   1719  C C   . ASN B  2 63  ? 44.151  60.830  9.882   1.00 46.46  ? 379  ASN B C   1 
ATOM   1720  O O   . ASN B  2 63  ? 45.181  61.070  9.283   1.00 46.64  ? 379  ASN B O   1 
ATOM   1721  C CB  . ASN B  2 63  ? 43.183  58.766  8.858   1.00 50.11  ? 379  ASN B CB  1 
ATOM   1722  C CG  . ASN B  2 63  ? 42.962  57.273  8.998   1.00 57.19  ? 379  ASN B CG  1 
ATOM   1723  O OD1 . ASN B  2 63  ? 42.347  56.792  9.957   1.00 61.77  ? 379  ASN B OD1 1 
ATOM   1724  N ND2 . ASN B  2 63  ? 43.464  56.528  8.037   1.00 74.71  ? 379  ASN B ND2 1 
ATOM   1725  N N   . LYS B  2 64  ? 43.355  61.785  10.349  1.00 50.96  ? 381  LYS B N   1 
ATOM   1726  C CA  . LYS B  2 64  ? 43.695  63.194  10.182  1.00 53.19  ? 381  LYS B CA  1 
ATOM   1727  C C   . LYS B  2 64  ? 44.799  63.573  11.167  1.00 49.88  ? 381  LYS B C   1 
ATOM   1728  O O   . LYS B  2 64  ? 44.961  62.920  12.200  1.00 44.08  ? 381  LYS B O   1 
ATOM   1729  C CB  . LYS B  2 64  ? 42.476  64.090  10.442  1.00 58.79  ? 381  LYS B CB  1 
ATOM   1730  C CG  . LYS B  2 64  ? 41.355  63.995  9.418   1.00 65.76  ? 381  LYS B CG  1 
ATOM   1731  C CD  . LYS B  2 64  ? 40.327  65.103  9.629   1.00 66.55  ? 381  LYS B CD  1 
ATOM   1732  C CE  . LYS B  2 64  ? 39.259  65.091  8.556   1.00 68.44  ? 381  LYS B CE  1 
ATOM   1733  N NZ  . LYS B  2 64  ? 39.868  65.238  7.205   1.00 72.46  ? 381  LYS B NZ  1 
ATOM   1734  N N   . ASP B  2 65  A 45.553  64.625  10.847  1.00 49.77  ? 381  ASP B N   1 
ATOM   1735  C CA  . ASP B  2 65  A 46.615  65.088  11.731  1.00 54.60  ? 381  ASP B CA  1 
ATOM   1736  C C   . ASP B  2 65  A 47.092  66.500  11.461  1.00 56.82  ? 381  ASP B C   1 
ATOM   1737  O O   . ASP B  2 65  A 47.167  66.939  10.311  1.00 67.71  ? 381  ASP B O   1 
ATOM   1738  C CB  . ASP B  2 65  A 47.809  64.128  11.715  1.00 65.60  ? 381  ASP B CB  1 
ATOM   1739  C CG  . ASP B  2 65  A 48.352  63.869  10.318  1.00 70.52  ? 381  ASP B CG  1 
ATOM   1740  O OD1 . ASP B  2 65  A 48.746  64.835  9.632   1.00 76.90  ? 381  ASP B OD1 1 
ATOM   1741  O OD2 . ASP B  2 65  A 48.395  62.686  9.910   1.00 69.46  ? 381  ASP B OD2 1 
ATOM   1742  N N   . ASP B  2 66  B 47.380  67.219  12.542  1.00 51.07  ? 381  ASP B N   1 
ATOM   1743  C CA  . ASP B  2 66  B 47.856  68.594  12.467  1.00 49.88  ? 381  ASP B CA  1 
ATOM   1744  C C   . ASP B  2 66  B 49.333  68.329  12.477  1.00 52.00  ? 381  ASP B C   1 
ATOM   1745  O O   . ASP B  2 66  B 49.861  67.909  13.488  1.00 55.46  ? 381  ASP B O   1 
ATOM   1746  C CB  . ASP B  2 66  B 47.368  69.360  13.719  1.00 46.62  ? 381  ASP B CB  1 
ATOM   1747  C CG  . ASP B  2 66  B 48.243  70.576  14.096  1.00 52.59  ? 381  ASP B CG  1 
ATOM   1748  O OD1 . ASP B  2 66  B 48.424  71.528  13.291  1.00 44.05  ? 381  ASP B OD1 1 
ATOM   1749  O OD2 . ASP B  2 66  B 48.735  70.584  15.249  1.00 48.13  ? 381  ASP B OD2 1 
ATOM   1750  N N   . LYS B  2 67  C 50.005  68.508  11.346  1.00 56.61  ? 381  LYS B N   1 
ATOM   1751  C CA  . LYS B  2 67  C 51.445  68.227  11.328  1.00 65.20  ? 381  LYS B CA  1 
ATOM   1752  C C   . LYS B  2 67  C 52.281  69.178  12.187  1.00 66.27  ? 381  LYS B C   1 
ATOM   1753  O O   . LYS B  2 67  C 53.143  68.733  12.944  1.00 61.03  ? 381  LYS B O   1 
ATOM   1754  C CB  . LYS B  2 67  C 51.983  68.227  9.898   1.00 66.54  ? 381  LYS B CB  1 
ATOM   1755  C CG  . LYS B  2 67  C 51.582  67.015  9.111   1.00 69.02  ? 381  LYS B CG  1 
ATOM   1756  C CD  . LYS B  2 67  C 52.686  66.578  8.182   1.00 72.51  ? 381  LYS B CD  1 
ATOM   1757  C CE  . LYS B  2 67  C 52.206  65.434  7.317   1.00 77.72  ? 381  LYS B CE  1 
ATOM   1758  N NZ  . LYS B  2 67  C 53.341  64.824  6.583   1.00 86.80  ? 381  LYS B NZ  1 
ATOM   1759  N N   . LYS B  2 68  D 52.019  70.478  12.052  1.00 65.77  ? 381  LYS B N   1 
ATOM   1760  C CA  . LYS B  2 68  D 52.716  71.511  12.810  1.00 67.85  ? 381  LYS B CA  1 
ATOM   1761  C C   . LYS B  2 68  D 52.988  71.066  14.253  1.00 66.68  ? 381  LYS B C   1 
ATOM   1762  O O   . LYS B  2 68  D 54.094  70.668  14.579  1.00 61.56  ? 381  LYS B O   1 
ATOM   1763  C CB  . LYS B  2 68  D 51.876  72.798  12.784  1.00 78.01  ? 381  LYS B CB  1 
ATOM   1764  C CG  . LYS B  2 68  D 52.414  73.978  13.602  1.00 83.26  ? 381  LYS B CG  1 
ATOM   1765  C CD  . LYS B  2 68  D 51.493  75.207  13.473  1.00 90.71  ? 381  LYS B CD  1 
ATOM   1766  C CE  . LYS B  2 68  D 52.041  76.443  14.211  1.00 96.07  ? 381  LYS B CE  1 
ATOM   1767  N NZ  . LYS B  2 68  D 51.188  77.668  14.041  1.00 96.03  ? 381  LYS B NZ  1 
ATOM   1768  N N   . ASN B  2 69  E 51.973  71.130  15.111  1.00 71.29  ? 381  ASN B N   1 
ATOM   1769  C CA  . ASN B  2 69  E 52.092  70.726  16.519  1.00 70.05  ? 381  ASN B CA  1 
ATOM   1770  C C   . ASN B  2 69  E 52.142  69.199  16.680  1.00 71.00  ? 381  ASN B C   1 
ATOM   1771  O O   . ASN B  2 69  E 51.961  68.698  17.795  1.00 68.10  ? 381  ASN B O   1 
ATOM   1772  C CB  . ASN B  2 69  E 50.900  71.273  17.325  1.00 70.02  ? 381  ASN B CB  1 
ATOM   1773  C CG  . ASN B  2 69  E 50.932  72.798  17.482  1.00 72.43  ? 381  ASN B CG  1 
ATOM   1774  O OD1 . ASN B  2 69  E 51.558  73.320  18.405  1.00 71.72  ? 381  ASN B OD1 1 
ATOM   1775  N ND2 . ASN B  2 69  E 50.261  73.513  16.578  1.00 57.41  ? 381  ASN B ND2 1 
ATOM   1776  N N   . MET B  2 70  ? 52.372  68.478  15.568  1.00 71.81  ? 382  MET B N   1 
ATOM   1777  C CA  . MET B  2 70  ? 52.453  67.005  15.538  1.00 65.52  ? 382  MET B CA  1 
ATOM   1778  C C   . MET B  2 70  ? 51.391  66.469  16.489  1.00 67.07  ? 382  MET B C   1 
ATOM   1779  O O   . MET B  2 70  ? 51.714  65.899  17.533  1.00 69.59  ? 382  MET B O   1 
ATOM   1780  C CB  . MET B  2 70  ? 53.853  66.569  15.980  1.00 67.85  ? 382  MET B CB  1 
ATOM   1781  C CG  . MET B  2 70  ? 54.259  65.145  15.658  1.00 74.27  ? 382  MET B CG  1 
ATOM   1782  S SD  . MET B  2 70  ? 56.088  64.930  15.653  1.00 77.15  ? 382  MET B SD  1 
ATOM   1783  C CE  . MET B  2 70  ? 56.455  64.348  17.384  1.00 70.39  ? 382  MET B CE  1 
ATOM   1784  N N   . GLY B  2 71  ? 50.124  66.682  16.115  1.00 67.97  ? 383  GLY B N   1 
ATOM   1785  C CA  . GLY B  2 71  ? 48.987  66.284  16.931  1.00 62.37  ? 383  GLY B CA  1 
ATOM   1786  C C   . GLY B  2 71  ? 47.865  65.586  16.191  1.00 58.41  ? 383  GLY B C   1 
ATOM   1787  O O   . GLY B  2 71  ? 47.827  65.571  14.960  1.00 56.46  ? 383  GLY B O   1 
ATOM   1788  N N   . LYS B  2 72  ? 46.948  65.006  16.961  1.00 52.82  ? 384  LYS B N   1 
ATOM   1789  C CA  . LYS B  2 72  ? 45.826  64.270  16.410  1.00 42.51  ? 384  LYS B CA  1 
ATOM   1790  C C   . LYS B  2 72  ? 44.556  64.523  17.209  1.00 39.99  ? 384  LYS B C   1 
ATOM   1791  O O   . LYS B  2 72  ? 44.595  65.230  18.219  1.00 42.87  ? 384  LYS B O   1 
ATOM   1792  C CB  . LYS B  2 72  ? 46.159  62.785  16.389  1.00 41.03  ? 384  LYS B CB  1 
ATOM   1793  C CG  . LYS B  2 72  ? 47.403  62.491  15.596  1.00 33.72  ? 384  LYS B CG  1 
ATOM   1794  C CD  . LYS B  2 72  ? 47.578  61.030  15.408  1.00 38.07  ? 384  LYS B CD  1 
ATOM   1795  C CE  . LYS B  2 72  ? 46.581  60.476  14.397  1.00 34.00  ? 384  LYS B CE  1 
ATOM   1796  N NZ  . LYS B  2 72  ? 46.873  60.936  13.033  1.00 37.55  ? 384  LYS B NZ  1 
ATOM   1797  N N   . GLN B  2 73  ? 43.438  63.953  16.758  1.00 31.36  ? 385  GLN B N   1 
ATOM   1798  C CA  . GLN B  2 73  ? 42.160  64.153  17.423  1.00 28.82  ? 385  GLN B CA  1 
ATOM   1799  C C   . GLN B  2 73  ? 41.405  62.848  17.582  1.00 38.23  ? 385  GLN B C   1 
ATOM   1800  O O   . GLN B  2 73  ? 41.256  62.097  16.613  1.00 43.33  ? 385  GLN B O   1 
ATOM   1801  C CB  . GLN B  2 73  ? 41.321  65.120  16.605  1.00 28.03  ? 385  GLN B CB  1 
ATOM   1802  C CG  . GLN B  2 73  ? 39.985  65.464  17.228  1.00 39.87  ? 385  GLN B CG  1 
ATOM   1803  C CD  . GLN B  2 73  ? 39.239  66.553  16.483  1.00 30.31  ? 385  GLN B CD  1 
ATOM   1804  O OE1 . GLN B  2 73  ? 39.770  67.624  16.249  1.00 46.20  ? 385  GLN B OE1 1 
ATOM   1805  N NE2 . GLN B  2 73  ? 38.004  66.280  16.114  1.00 34.80  ? 385  GLN B NE2 1 
ATOM   1806  N N   . MET B  2 74  ? 40.917  62.579  18.793  1.00 38.69  ? 386  MET B N   1 
ATOM   1807  C CA  . MET B  2 74  ? 40.166  61.341  19.062  1.00 38.15  ? 386  MET B CA  1 
ATOM   1808  C C   . MET B  2 74  ? 38.765  61.621  19.576  1.00 32.75  ? 386  MET B C   1 
ATOM   1809  O O   . MET B  2 74  ? 38.593  62.010  20.720  1.00 33.96  ? 386  MET B O   1 
ATOM   1810  C CB  . MET B  2 74  ? 40.903  60.472  20.092  1.00 38.79  ? 386  MET B CB  1 
ATOM   1811  C CG  . MET B  2 74  ? 40.259  59.120  20.358  1.00 32.82  ? 386  MET B CG  1 
ATOM   1812  S SD  . MET B  2 74  ? 40.355  58.016  18.910  1.00 32.02  ? 386  MET B SD  1 
ATOM   1813  C CE  . MET B  2 74  ? 38.668  57.993  18.360  1.00 48.85  ? 386  MET B CE  1 
ATOM   1814  N N   . PRO B  2 75  ? 37.749  61.449  18.722  1.00 31.29  ? 387  PRO B N   1 
ATOM   1815  C CA  . PRO B  2 75  ? 36.334  61.668  19.043  1.00 36.37  ? 387  PRO B CA  1 
ATOM   1816  C C   . PRO B  2 75  ? 35.860  60.618  20.047  1.00 38.50  ? 387  PRO B C   1 
ATOM   1817  O O   . PRO B  2 75  ? 36.369  59.517  20.071  1.00 39.59  ? 387  PRO B O   1 
ATOM   1818  C CB  . PRO B  2 75  ? 35.659  61.524  17.694  1.00 40.35  ? 387  PRO B CB  1 
ATOM   1819  C CG  . PRO B  2 75  ? 36.715  61.955  16.742  1.00 32.27  ? 387  PRO B CG  1 
ATOM   1820  C CD  . PRO B  2 75  ? 37.918  61.252  17.280  1.00 32.05  ? 387  PRO B CD  1 
ATOM   1821  N N   . GLN B  2 76  ? 34.873  60.947  20.865  1.00 42.10  ? 388  GLN B N   1 
ATOM   1822  C CA  . GLN B  2 76  ? 34.438  59.996  21.870  1.00 39.10  ? 388  GLN B CA  1 
ATOM   1823  C C   . GLN B  2 76  ? 32.957  59.973  22.235  1.00 31.96  ? 388  GLN B C   1 
ATOM   1824  O O   . GLN B  2 76  ? 32.519  60.650  23.164  1.00 30.19  ? 388  GLN B O   1 
ATOM   1825  C CB  . GLN B  2 76  ? 35.247  60.224  23.140  1.00 38.62  ? 388  GLN B CB  1 
ATOM   1826  C CG  . GLN B  2 76  ? 35.073  59.140  24.188  1.00 39.16  ? 388  GLN B CG  1 
ATOM   1827  C CD  . GLN B  2 76  ? 35.523  59.616  25.531  1.00 37.64  ? 388  GLN B CD  1 
ATOM   1828  O OE1 . GLN B  2 76  ? 36.634  60.093  25.684  1.00 45.79  ? 388  GLN B OE1 1 
ATOM   1829  N NE2 . GLN B  2 76  ? 34.661  59.501  26.513  1.00 51.30  ? 388  GLN B NE2 1 
ATOM   1830  N N   . PRO B  2 77  ? 32.179  59.170  21.526  1.00 22.01  ? 389  PRO B N   1 
ATOM   1831  C CA  . PRO B  2 77  ? 30.745  59.091  21.830  1.00 28.84  ? 389  PRO B CA  1 
ATOM   1832  C C   . PRO B  2 77  ? 30.428  58.303  23.112  1.00 30.61  ? 389  PRO B C   1 
ATOM   1833  O O   . PRO B  2 77  ? 31.180  57.418  23.529  1.00 29.79  ? 389  PRO B O   1 
ATOM   1834  C CB  . PRO B  2 77  ? 30.151  58.432  20.581  1.00 33.65  ? 389  PRO B CB  1 
ATOM   1835  C CG  . PRO B  2 77  ? 31.308  57.613  20.019  1.00 33.90  ? 389  PRO B CG  1 
ATOM   1836  C CD  . PRO B  2 77  ? 32.527  58.485  20.270  1.00 18.86  ? 389  PRO B CD  1 
ATOM   1837  N N   . THR B  2 78  ? 29.308  58.642  23.730  1.00 27.54  ? 390  THR B N   1 
ATOM   1838  C CA  . THR B  2 78  ? 28.856  58.000  24.949  1.00 31.76  ? 390  THR B CA  1 
ATOM   1839  C C   . THR B  2 78  ? 27.367  57.881  24.803  1.00 39.76  ? 390  THR B C   1 
ATOM   1840  O O   . THR B  2 78  ? 26.731  58.789  24.283  1.00 45.26  ? 390  THR B O   1 
ATOM   1841  C CB  . THR B  2 78  ? 29.102  58.845  26.158  1.00 32.83  ? 390  THR B CB  1 
ATOM   1842  O OG1 . THR B  2 78  ? 30.472  59.268  26.167  1.00 33.24  ? 390  THR B OG1 1 
ATOM   1843  C CG2 . THR B  2 78  ? 28.776  58.025  27.404  1.00 18.94  ? 390  THR B CG2 1 
ATOM   1844  N N   . PHE B  2 79  ? 26.777  56.795  25.274  1.00 40.46  ? 392  PHE B N   1 
ATOM   1845  C CA  . PHE B  2 79  ? 25.355  56.699  25.052  1.00 40.65  ? 392  PHE B CA  1 
ATOM   1846  C C   . PHE B  2 79  ? 24.569  55.837  25.993  1.00 42.28  ? 392  PHE B C   1 
ATOM   1847  O O   . PHE B  2 79  ? 25.105  54.917  26.598  1.00 46.89  ? 392  PHE B O   1 
ATOM   1848  C CB  . PHE B  2 79  ? 25.125  56.205  23.633  1.00 44.98  ? 392  PHE B CB  1 
ATOM   1849  C CG  . PHE B  2 79  ? 25.564  54.781  23.399  1.00 44.87  ? 392  PHE B CG  1 
ATOM   1850  C CD1 . PHE B  2 79  ? 26.867  54.494  23.018  1.00 48.64  ? 392  PHE B CD1 1 
ATOM   1851  C CD2 . PHE B  2 79  ? 24.660  53.733  23.509  1.00 43.02  ? 392  PHE B CD2 1 
ATOM   1852  C CE1 . PHE B  2 79  ? 27.267  53.185  22.741  1.00 45.80  ? 392  PHE B CE1 1 
ATOM   1853  C CE2 . PHE B  2 79  ? 25.049  52.423  23.230  1.00 44.31  ? 392  PHE B CE2 1 
ATOM   1854  C CZ  . PHE B  2 79  ? 26.355  52.146  22.844  1.00 43.89  ? 392  PHE B CZ  1 
ATOM   1855  N N   . THR B  2 80  ? 23.286  56.161  26.118  1.00 36.51  ? 393  THR B N   1 
ATOM   1856  C CA  . THR B  2 80  ? 22.382  55.383  26.934  1.00 29.02  ? 393  THR B CA  1 
ATOM   1857  C C   . THR B  2 80  ? 21.241  54.932  26.038  1.00 26.52  ? 393  THR B C   1 
ATOM   1858  O O   . THR B  2 80  ? 20.206  54.535  26.515  1.00 31.74  ? 393  THR B O   1 
ATOM   1859  C CB  . THR B  2 80  ? 21.835  56.181  28.146  1.00 26.33  ? 393  THR B CB  1 
ATOM   1860  O OG1 . THR B  2 80  ? 21.175  57.363  27.716  1.00 30.91  ? 393  THR B OG1 1 
ATOM   1861  C CG2 . THR B  2 80  ? 22.954  56.558  29.076  1.00 21.97  ? 393  THR B CG2 1 
ATOM   1862  N N   . LEU B  2 81  ? 21.442  55.007  24.727  1.00 27.57  ? 394  LEU B N   1 
ATOM   1863  C CA  . LEU B  2 81  ? 20.420  54.590  23.766  1.00 39.48  ? 394  LEU B CA  1 
ATOM   1864  C C   . LEU B  2 81  ? 19.996  53.146  24.033  1.00 41.72  ? 394  LEU B C   1 
ATOM   1865  O O   . LEU B  2 81  ? 20.837  52.286  24.262  1.00 49.59  ? 394  LEU B O   1 
ATOM   1866  C CB  . LEU B  2 81  ? 20.957  54.695  22.334  1.00 41.27  ? 394  LEU B CB  1 
ATOM   1867  C CG  . LEU B  2 81  ? 21.479  56.050  21.844  1.00 39.31  ? 394  LEU B CG  1 
ATOM   1868  C CD1 . LEU B  2 81  ? 21.866  55.915  20.392  1.00 30.18  ? 394  LEU B CD1 1 
ATOM   1869  C CD2 . LEU B  2 81  ? 20.426  57.128  22.006  1.00 40.29  ? 394  LEU B CD2 1 
ATOM   1870  N N   . ARG B  2 82  ? 18.696  52.874  24.002  1.00 45.32  ? 395  ARG B N   1 
ATOM   1871  C CA  . ARG B  2 82  ? 18.209  51.515  24.263  1.00 45.77  ? 395  ARG B CA  1 
ATOM   1872  C C   . ARG B  2 82  ? 17.750  50.829  22.997  1.00 50.97  ? 395  ARG B C   1 
ATOM   1873  O O   . ARG B  2 82  ? 17.281  49.696  23.044  1.00 49.89  ? 395  ARG B O   1 
ATOM   1874  C CB  . ARG B  2 82  ? 17.058  51.523  25.266  1.00 37.53  ? 395  ARG B CB  1 
ATOM   1875  C CG  . ARG B  2 82  ? 17.404  52.199  26.572  1.00 50.61  ? 395  ARG B CG  1 
ATOM   1876  C CD  . ARG B  2 82  ? 16.188  52.395  27.457  1.00 55.70  ? 395  ARG B CD  1 
ATOM   1877  N NE  . ARG B  2 82  ? 15.106  53.029  26.720  1.00 58.27  ? 395  ARG B NE  1 
ATOM   1878  C CZ  . ARG B  2 82  ? 14.037  52.390  26.247  1.00 61.61  ? 395  ARG B CZ  1 
ATOM   1879  N NH1 . ARG B  2 82  ? 13.880  51.077  26.436  1.00 59.06  ? 395  ARG B NH1 1 
ATOM   1880  N NH2 . ARG B  2 82  ? 13.131  53.071  25.564  1.00 65.79  ? 395  ARG B NH2 1 
ATOM   1881  N N   . LYS B  2 83  ? 17.867  51.522  21.866  1.00 54.02  ? 396  LYS B N   1 
ATOM   1882  C CA  . LYS B  2 83  ? 17.487  50.937  20.584  1.00 54.61  ? 396  LYS B CA  1 
ATOM   1883  C C   . LYS B  2 83  ? 18.474  51.456  19.574  1.00 54.90  ? 396  LYS B C   1 
ATOM   1884  O O   . LYS B  2 83  ? 19.305  52.307  19.893  1.00 61.16  ? 396  LYS B O   1 
ATOM   1885  C CB  . LYS B  2 83  ? 16.089  51.376  20.140  1.00 61.47  ? 396  LYS B CB  1 
ATOM   1886  C CG  . LYS B  2 83  ? 14.952  51.058  21.086  1.00 64.19  ? 396  LYS B CG  1 
ATOM   1887  C CD  . LYS B  2 83  ? 13.605  51.402  20.462  1.00 58.01  ? 396  LYS B CD  1 
ATOM   1888  C CE  . LYS B  2 83  ? 12.466  51.124  21.424  1.00 55.76  ? 396  LYS B CE  1 
ATOM   1889  N NZ  . LYS B  2 83  ? 11.158  51.116  20.725  1.00 56.42  ? 396  LYS B NZ  1 
ATOM   1890  N N   . LYS B  2 84  ? 18.392  50.939  18.358  1.00 50.58  ? 397  LYS B N   1 
ATOM   1891  C CA  . LYS B  2 84  ? 19.256  51.421  17.313  1.00 51.53  ? 397  LYS B CA  1 
ATOM   1892  C C   . LYS B  2 84  ? 18.645  52.744  16.857  1.00 58.16  ? 397  LYS B C   1 
ATOM   1893  O O   . LYS B  2 84  ? 17.439  52.842  16.646  1.00 65.21  ? 397  LYS B O   1 
ATOM   1894  C CB  . LYS B  2 84  ? 19.286  50.438  16.164  1.00 46.38  ? 397  LYS B CB  1 
ATOM   1895  C CG  . LYS B  2 84  ? 20.210  49.283  16.385  1.00 55.86  ? 397  LYS B CG  1 
ATOM   1896  C CD  . LYS B  2 84  ? 20.767  48.793  15.062  1.00 62.49  ? 397  LYS B CD  1 
ATOM   1897  C CE  . LYS B  2 84  ? 21.888  47.799  15.278  1.00 70.67  ? 397  LYS B CE  1 
ATOM   1898  N NZ  . LYS B  2 84  ? 22.661  47.586  14.023  1.00 79.73  ? 397  LYS B NZ  1 
ATOM   1899  N N   . LEU B  2 85  ? 19.465  53.778  16.744  1.00 59.48  ? 398  LEU B N   1 
ATOM   1900  C CA  . LEU B  2 85  ? 18.967  55.070  16.291  1.00 54.84  ? 398  LEU B CA  1 
ATOM   1901  C C   . LEU B  2 85  ? 19.290  55.209  14.817  1.00 53.30  ? 398  LEU B C   1 
ATOM   1902  O O   . LEU B  2 85  ? 20.454  55.297  14.443  1.00 48.05  ? 398  LEU B O   1 
ATOM   1903  C CB  . LEU B  2 85  ? 19.627  56.211  17.059  1.00 50.88  ? 398  LEU B CB  1 
ATOM   1904  C CG  . LEU B  2 85  ? 19.331  57.613  16.534  1.00 39.97  ? 398  LEU B CG  1 
ATOM   1905  C CD1 . LEU B  2 85  ? 17.841  57.834  16.526  1.00 38.19  ? 398  LEU B CD1 1 
ATOM   1906  C CD2 . LEU B  2 85  ? 20.022  58.657  17.400  1.00 37.57  ? 398  LEU B CD2 1 
ATOM   1907  N N   . VAL B  2 86  ? 18.261  55.207  13.981  1.00 52.21  ? 399  VAL B N   1 
ATOM   1908  C CA  . VAL B  2 86  ? 18.481  55.347  12.564  1.00 51.51  ? 399  VAL B CA  1 
ATOM   1909  C C   . VAL B  2 86  ? 17.690  56.525  12.027  1.00 52.38  ? 399  VAL B C   1 
ATOM   1910  O O   . VAL B  2 86  ? 16.580  56.767  12.475  1.00 56.49  ? 399  VAL B O   1 
ATOM   1911  C CB  . VAL B  2 86  ? 18.086  54.079  11.843  1.00 48.80  ? 399  VAL B CB  1 
ATOM   1912  C CG1 . VAL B  2 86  ? 16.752  53.646  12.329  1.00 56.75  ? 399  VAL B CG1 1 
ATOM   1913  C CG2 . VAL B  2 86  ? 18.083  54.313  10.329  1.00 55.93  ? 399  VAL B CG2 1 
ATOM   1914  N N   . PHE B  2 87  ? 18.281  57.255  11.077  1.00 57.04  ? 400  PHE B N   1 
ATOM   1915  C CA  . PHE B  2 87  ? 17.669  58.435  10.454  1.00 56.64  ? 400  PHE B CA  1 
ATOM   1916  C C   . PHE B  2 87  ? 17.315  58.200  9.004   1.00 63.58  ? 400  PHE B C   1 
ATOM   1917  O O   . PHE B  2 87  ? 18.068  58.570  8.111   1.00 68.51  ? 400  PHE B O   1 
ATOM   1918  C CB  . PHE B  2 87  ? 18.611  59.634  10.521  1.00 49.99  ? 400  PHE B CB  1 
ATOM   1919  C CG  . PHE B  2 87  ? 18.892  60.094  11.909  1.00 48.47  ? 400  PHE B CG  1 
ATOM   1920  C CD1 . PHE B  2 87  ? 17.933  59.964  12.893  1.00 51.32  ? 400  PHE B CD1 1 
ATOM   1921  C CD2 . PHE B  2 87  ? 20.106  60.671  12.232  1.00 46.16  ? 400  PHE B CD2 1 
ATOM   1922  C CE1 . PHE B  2 87  ? 18.169  60.406  14.186  1.00 55.80  ? 400  PHE B CE1 1 
ATOM   1923  C CE2 . PHE B  2 87  ? 20.356  61.113  13.512  1.00 51.50  ? 400  PHE B CE2 1 
ATOM   1924  C CZ  . PHE B  2 87  ? 19.385  60.984  14.497  1.00 57.83  ? 400  PHE B CZ  1 
ATOM   1925  N N   . PRO B  2 88  ? 16.153  57.584  8.748   1.00 70.45  ? 401  PRO B N   1 
ATOM   1926  C CA  . PRO B  2 88  ? 15.699  57.302  7.387   1.00 73.06  ? 401  PRO B CA  1 
ATOM   1927  C C   . PRO B  2 88  ? 15.610  58.570  6.562   1.00 78.39  ? 401  PRO B C   1 
ATOM   1928  O O   . PRO B  2 88  ? 15.349  59.653  7.086   1.00 72.84  ? 401  PRO B O   1 
ATOM   1929  C CB  . PRO B  2 88  ? 14.346  56.649  7.606   1.00 67.22  ? 401  PRO B CB  1 
ATOM   1930  C CG  . PRO B  2 88  ? 13.900  57.240  8.887   1.00 64.37  ? 401  PRO B CG  1 
ATOM   1931  C CD  . PRO B  2 88  ? 15.127  57.189  9.721   1.00 68.57  ? 401  PRO B CD  1 
ATOM   1932  N N   . SER B  2 89  ? 15.833  58.417  5.263   1.00 88.17  ? 402  SER B N   1 
ATOM   1933  C CA  . SER B  2 89  ? 15.823  59.536  4.336   1.00 93.86  ? 402  SER B CA  1 
ATOM   1934  C C   . SER B  2 89  ? 14.722  59.383  3.273   1.00 94.73  ? 402  SER B C   1 
ATOM   1935  O O   . SER B  2 89  ? 13.818  60.251  3.224   1.00 95.20  ? 402  SER B O   1 
ATOM   1936  C CB  . SER B  2 89  ? 17.215  59.647  3.680   1.00 98.09  ? 402  SER B CB  1 
ATOM   1937  O OG  . SER B  2 89  ? 17.305  60.749  2.791   1.00 100.00 ? 402  SER B OG  1 
ATOM   1938  O OXT . SER B  2 89  ? 14.770  58.399  2.501   1.00 95.86  ? 402  SER B OXT 1 
HETATM 1939  C C1  . PHQ C  3 1   ? 45.278  75.066  9.463   1.00 64.67  ? 4100 PHQ Q C1  1 
HETATM 1940  O O1  . PHQ C  3 1   ? 46.397  74.528  9.324   1.00 74.97  ? 4100 PHQ Q O1  1 
HETATM 1941  O O2  . PHQ C  3 1   ? 44.762  76.036  8.614   1.00 64.90  ? 4100 PHQ Q O2  1 
HETATM 1942  C C2  . PHQ C  3 1   ? 45.434  76.538  7.450   1.00 59.09  ? 4100 PHQ Q C2  1 
HETATM 1943  C C3  . PHQ C  3 1   ? 44.479  77.580  6.971   1.00 58.95  ? 4100 PHQ Q C3  1 
HETATM 1944  C C4  . PHQ C  3 1   ? 44.512  78.906  7.547   1.00 62.96  ? 4100 PHQ Q C4  1 
HETATM 1945  C C5  . PHQ C  3 1   ? 43.572  79.909  7.103   1.00 71.46  ? 4100 PHQ Q C5  1 
HETATM 1946  C C6  . PHQ C  3 1   ? 42.587  79.600  6.082   1.00 70.91  ? 4100 PHQ Q C6  1 
HETATM 1947  C C7  . PHQ C  3 1   ? 42.541  78.273  5.498   1.00 65.14  ? 4100 PHQ Q C7  1 
HETATM 1948  C C8  . PHQ C  3 1   ? 43.487  77.266  5.948   1.00 64.21  ? 4100 PHQ Q C8  1 
ATOM   1949  N N   . ASP C  3 2   ? 44.492  74.811  10.426  1.00 52.49  ? 4101 ASP Q N   1 
ATOM   1950  C CA  . ASP C  3 2   ? 44.832  73.913  11.486  1.00 40.96  ? 4101 ASP Q CA  1 
ATOM   1951  C C   . ASP C  3 2   ? 44.785  74.942  12.671  1.00 40.17  ? 4101 ASP Q C   1 
ATOM   1952  O O   . ASP C  3 2   ? 45.629  75.859  12.757  1.00 53.77  ? 4101 ASP Q O   1 
ATOM   1953  C CB  . ASP C  3 2   ? 43.949  72.690  11.607  1.00 36.81  ? 4101 ASP Q CB  1 
ATOM   1954  C CG  . ASP C  3 2   ? 44.091  71.682  10.462  1.00 38.12  ? 4101 ASP Q CG  1 
ATOM   1955  O OD1 . ASP C  3 2   ? 45.238  71.061  10.285  1.00 38.01  ? 4101 ASP Q OD1 1 
ATOM   1956  O OD2 . ASP C  3 2   ? 43.077  71.430  9.689   1.00 33.21  ? 4101 ASP Q OD2 1 
ATOM   1957  N N   . GLU C  3 3   ? 43.726  74.872  13.462  1.00 28.18  ? 4102 GLU Q N   1 
ATOM   1958  C CA  . GLU C  3 3   ? 43.430  75.813  14.591  1.00 25.73  ? 4102 GLU Q CA  1 
ATOM   1959  C C   . GLU C  3 3   ? 42.669  75.002  15.672  1.00 34.18  ? 4102 GLU Q C   1 
ATOM   1960  O O   . GLU C  3 3   ? 41.818  74.137  15.360  1.00 36.55  ? 4102 GLU Q O   1 
ATOM   1961  C CB  . GLU C  3 3   ? 42.547  77.025  14.149  1.00 26.81  ? 4102 GLU Q CB  1 
ATOM   1962  C CG  . GLU C  3 3   ? 43.026  77.803  12.900  1.00 43.63  ? 4102 GLU Q CG  1 
ATOM   1963  C CD  . GLU C  3 3   ? 42.801  79.351  12.877  1.00 50.33  ? 4102 GLU Q CD  1 
ATOM   1964  O OE1 . GLU C  3 3   ? 41.822  79.912  13.530  1.00 47.55  ? 4102 GLU Q OE1 1 
ATOM   1965  O OE2 . GLU C  3 3   ? 43.612  80.101  12.172  1.00 59.91  ? 4102 GLU Q OE2 1 
ATOM   1966  N N   . VAL C  3 4   ? 42.986  75.265  16.938  1.00 30.96  ? 4103 VAL Q N   1 
ATOM   1967  C CA  . VAL C  3 4   ? 42.338  74.534  18.061  1.00 25.65  ? 4103 VAL Q CA  1 
ATOM   1968  C C   . VAL C  3 4   ? 41.148  75.266  18.519  1.00 41.48  ? 4103 VAL Q C   1 
ATOM   1969  O O   . VAL C  3 4   ? 41.066  76.491  18.436  1.00 49.91  ? 4103 VAL Q O   1 
ATOM   1970  C CB  . VAL C  3 4   ? 43.422  74.226  19.104  1.00 28.56  ? 4103 VAL Q CB  1 
ATOM   1971  C CG1 . VAL C  3 4   ? 44.601  73.444  18.522  1.00 13.84  ? 4103 VAL Q CG1 1 
ATOM   1972  C CG2 . VAL C  3 4   ? 44.031  75.484  19.728  1.00 16.30  ? 4103 VAL Q CG2 1 
HETATM 1973  N N   . ASA C  3 5   ? 40.253  74.458  18.915  1.00 48.06  ? 4104 ASA Q N   1 
HETATM 1974  C CA  . ASA C  3 5   ? 39.057  74.924  19.485  1.00 45.89  ? 4104 ASA Q CA  1 
HETATM 1975  C C   . ASA C  3 5   ? 39.229  74.763  21.011  1.00 45.63  ? 4104 ASA Q C   1 
HETATM 1976  O O   . ASA C  3 5   ? 38.391  75.303  21.849  1.00 41.07  ? 4104 ASA Q O   1 
HETATM 1977  C CB  . ASA C  3 5   ? 37.875  74.065  18.997  1.00 42.53  ? 4104 ASA Q CB  1 
HETATM 1978  C CG  . ASA C  3 5   ? 37.112  74.656  17.801  1.00 42.80  ? 4104 ASA Q CG  1 
HETATM 1979  O OD1 . ASA C  3 5   ? 37.321  75.873  17.434  1.00 42.76  ? 4104 ASA Q OD1 1 
HETATM 1980  O OD2 . ASA C  3 5   ? 36.255  73.931  17.159  1.00 42.06  ? 4104 ASA Q OD2 1 
ATOM   1981  N N   . LEU D  1 1   ? 30.972  46.147  3.853   1.00 94.79  ? 149  LEU C N   1 
ATOM   1982  C CA  . LEU D  1 1   ? 32.152  46.969  3.456   1.00 90.94  ? 149  LEU C CA  1 
ATOM   1983  C C   . LEU D  1 1   ? 32.592  47.873  4.608   1.00 85.58  ? 149  LEU C C   1 
ATOM   1984  O O   . LEU D  1 1   ? 33.266  48.880  4.394   1.00 89.10  ? 149  LEU C O   1 
ATOM   1985  C CB  . LEU D  1 1   ? 31.812  47.806  2.204   1.00 91.95  ? 149  LEU C CB  1 
ATOM   1986  C CG  . LEU D  1 1   ? 32.917  48.644  1.545   1.00 90.77  ? 149  LEU C CG  1 
ATOM   1987  C CD1 . LEU D  1 1   ? 34.096  47.752  1.181   1.00 86.91  ? 149  LEU C CD1 1 
ATOM   1988  C CD2 . LEU D  1 1   ? 32.370  49.339  0.308   1.00 88.79  ? 149  LEU C CD2 1 
ATOM   1989  N N   . ASP D  1 2   ? 32.201  47.515  5.830   1.00 80.05  ? 150  ASP C N   1 
ATOM   1990  C CA  . ASP D  1 2   ? 32.585  48.294  7.007   1.00 81.49  ? 150  ASP C CA  1 
ATOM   1991  C C   . ASP D  1 2   ? 33.876  47.705  7.566   1.00 78.98  ? 150  ASP C C   1 
ATOM   1992  O O   . ASP D  1 2   ? 34.033  46.488  7.596   1.00 85.83  ? 150  ASP C O   1 
ATOM   1993  C CB  . ASP D  1 2   ? 31.520  48.227  8.114   1.00 83.84  ? 150  ASP C CB  1 
ATOM   1994  C CG  . ASP D  1 2   ? 30.125  48.548  7.625   1.00 86.23  ? 150  ASP C CG  1 
ATOM   1995  O OD1 . ASP D  1 2   ? 29.948  49.547  6.902   1.00 89.54  ? 150  ASP C OD1 1 
ATOM   1996  O OD2 . ASP D  1 2   ? 29.194  47.801  7.984   1.00 91.18  ? 150  ASP C OD2 1 
ATOM   1997  N N   . LYS D  1 3   ? 34.798  48.555  8.008   1.00 72.11  ? 151  LYS C N   1 
ATOM   1998  C CA  . LYS D  1 3   ? 36.048  48.073  8.581   1.00 60.84  ? 151  LYS C CA  1 
ATOM   1999  C C   . LYS D  1 3   ? 35.715  47.265  9.847   1.00 59.06  ? 151  LYS C C   1 
ATOM   2000  O O   . LYS D  1 3   ? 34.752  47.568  10.563  1.00 47.60  ? 151  LYS C O   1 
ATOM   2001  C CB  . LYS D  1 3   ? 36.950  49.254  8.954   1.00 60.17  ? 151  LYS C CB  1 
ATOM   2002  C CG  . LYS D  1 3   ? 37.214  50.258  7.853   1.00 55.89  ? 151  LYS C CG  1 
ATOM   2003  C CD  . LYS D  1 3   ? 38.258  49.758  6.881   1.00 68.60  ? 151  LYS C CD  1 
ATOM   2004  C CE  . LYS D  1 3   ? 38.570  50.802  5.821   1.00 74.79  ? 151  LYS C CE  1 
ATOM   2005  N NZ  . LYS D  1 3   ? 39.604  50.336  4.848   1.00 76.16  ? 151  LYS C NZ  1 
ATOM   2006  N N   . VAL D  1 4   ? 36.501  46.229  10.123  1.00 58.27  ? 152  VAL C N   1 
ATOM   2007  C CA  . VAL D  1 4   ? 36.265  45.417  11.312  1.00 57.20  ? 152  VAL C CA  1 
ATOM   2008  C C   . VAL D  1 4   ? 37.568  45.040  11.981  1.00 59.34  ? 152  VAL C C   1 
ATOM   2009  O O   . VAL D  1 4   ? 38.595  44.889  11.325  1.00 59.66  ? 152  VAL C O   1 
ATOM   2010  C CB  . VAL D  1 4   ? 35.511  44.121  10.987  1.00 53.35  ? 152  VAL C CB  1 
ATOM   2011  C CG1 . VAL D  1 4   ? 35.313  43.317  12.247  1.00 44.01  ? 152  VAL C CG1 1 
ATOM   2012  C CG2 . VAL D  1 4   ? 34.167  44.440  10.377  1.00 51.45  ? 152  VAL C CG2 1 
ATOM   2013  N N   . TYR D  1 5   ? 37.526  44.905  13.299  1.00 61.62  ? 153  TYR C N   1 
ATOM   2014  C CA  . TYR D  1 5   ? 38.713  44.528  14.039  1.00 59.18  ? 153  TYR C CA  1 
ATOM   2015  C C   . TYR D  1 5   ? 38.964  43.061  13.785  1.00 61.66  ? 153  TYR C C   1 
ATOM   2016  O O   . TYR D  1 5   ? 38.060  42.240  13.889  1.00 65.38  ? 153  TYR C O   1 
ATOM   2017  C CB  . TYR D  1 5   ? 38.515  44.758  15.533  1.00 55.16  ? 153  TYR C CB  1 
ATOM   2018  C CG  . TYR D  1 5   ? 38.644  46.203  15.938  1.00 60.28  ? 153  TYR C CG  1 
ATOM   2019  C CD1 . TYR D  1 5   ? 39.770  46.943  15.587  1.00 55.50  ? 153  TYR C CD1 1 
ATOM   2020  C CD2 . TYR D  1 5   ? 37.657  46.830  16.715  1.00 61.73  ? 153  TYR C CD2 1 
ATOM   2021  C CE1 . TYR D  1 5   ? 39.915  48.264  16.002  1.00 54.35  ? 153  TYR C CE1 1 
ATOM   2022  C CE2 . TYR D  1 5   ? 37.797  48.160  17.136  1.00 49.82  ? 153  TYR C CE2 1 
ATOM   2023  C CZ  . TYR D  1 5   ? 38.925  48.857  16.779  1.00 47.80  ? 153  TYR C CZ  1 
ATOM   2024  O OH  . TYR D  1 5   ? 39.094  50.127  17.232  1.00 44.92  ? 153  TYR C OH  1 
ATOM   2025  N N   . GLN D  1 6   ? 40.198  42.740  13.438  1.00 60.99  ? 154  GLN C N   1 
ATOM   2026  C CA  . GLN D  1 6   ? 40.587  41.371  13.196  1.00 62.28  ? 154  GLN C CA  1 
ATOM   2027  C C   . GLN D  1 6   ? 40.437  40.579  14.492  1.00 61.02  ? 154  GLN C C   1 
ATOM   2028  O O   . GLN D  1 6   ? 40.796  41.050  15.573  1.00 56.88  ? 154  GLN C O   1 
ATOM   2029  C CB  . GLN D  1 6   ? 42.033  41.341  12.724  1.00 71.94  ? 154  GLN C CB  1 
ATOM   2030  C CG  . GLN D  1 6   ? 42.511  39.984  12.268  1.00 85.00  ? 154  GLN C CG  1 
ATOM   2031  C CD  . GLN D  1 6   ? 43.954  40.012  11.793  1.00 90.93  ? 154  GLN C CD  1 
ATOM   2032  O OE1 . GLN D  1 6   ? 44.877  40.195  12.588  1.00 95.19  ? 154  GLN C OE1 1 
ATOM   2033  N NE2 . GLN D  1 6   ? 44.155  39.841  10.489  1.00 96.29  ? 154  GLN C NE2 1 
ATOM   2034  N N   . MET D  1 7   ? 39.893  39.376  14.380  1.00 65.13  ? 155  MET C N   1 
ATOM   2035  C CA  . MET D  1 7   ? 39.695  38.524  15.546  1.00 68.50  ? 155  MET C CA  1 
ATOM   2036  C C   . MET D  1 7   ? 39.857  37.036  15.234  1.00 72.49  ? 155  MET C C   1 
ATOM   2037  O O   . MET D  1 7   ? 38.907  36.262  15.342  1.00 75.51  ? 155  MET C O   1 
ATOM   2038  C CB  . MET D  1 7   ? 38.313  38.767  16.142  1.00 59.08  ? 155  MET C CB  1 
ATOM   2039  C CG  . MET D  1 7   ? 38.191  40.055  16.874  1.00 57.21  ? 155  MET C CG  1 
ATOM   2040  S SD  . MET D  1 7   ? 39.133  40.043  18.378  1.00 65.53  ? 155  MET C SD  1 
ATOM   2041  C CE  . MET D  1 7   ? 38.152  39.000  19.367  1.00 52.40  ? 155  MET C CE  1 
ATOM   2042  N N   . LYS D  1 8   ? 41.064  36.641  14.847  1.00 74.33  ? 156  LYS C N   1 
ATOM   2043  C CA  . LYS D  1 8   ? 41.353  35.250  14.540  1.00 72.80  ? 156  LYS C CA  1 
ATOM   2044  C C   . LYS D  1 8   ? 42.302  34.694  15.607  1.00 72.84  ? 156  LYS C C   1 
ATOM   2045  O O   . LYS D  1 8   ? 42.087  33.607  16.128  1.00 73.81  ? 156  LYS C O   1 
ATOM   2046  C CB  . LYS D  1 8   ? 41.964  35.138  13.140  1.00 71.59  ? 156  LYS C CB  1 
ATOM   2047  C CG  . LYS D  1 8   ? 43.263  35.901  12.956  1.00 81.03  ? 156  LYS C CG  1 
ATOM   2048  C CD  . LYS D  1 8   ? 43.255  36.767  11.695  1.00 84.87  ? 156  LYS C CD  1 
ATOM   2049  C CE  . LYS D  1 8   ? 43.043  35.976  10.409  1.00 86.49  ? 156  LYS C CE  1 
ATOM   2050  N NZ  . LYS D  1 8   ? 41.645  35.475  10.259  1.00 92.59  ? 156  LYS C NZ  1 
ATOM   2051  N N   . SER D  1 9   ? 43.335  35.462  15.937  1.00 72.24  ? 157  SER C N   1 
ATOM   2052  C CA  . SER D  1 9   ? 44.326  35.099  16.948  1.00 72.22  ? 157  SER C CA  1 
ATOM   2053  C C   . SER D  1 9   ? 44.031  33.890  17.840  1.00 74.70  ? 157  SER C C   1 
ATOM   2054  O O   . SER D  1 9   ? 43.017  33.860  18.550  1.00 61.85  ? 157  SER C O   1 
ATOM   2055  C CB  . SER D  1 9   ? 44.600  36.303  17.845  1.00 73.31  ? 157  SER C CB  1 
ATOM   2056  O OG  . SER D  1 9   ? 45.059  35.880  19.116  1.00 82.80  ? 157  SER C OG  1 
ATOM   2057  N N   . LYS D  1 10  ? 44.969  32.930  17.809  1.00 84.04  ? 160  LYS C N   1 
ATOM   2058  C CA  . LYS D  1 10  ? 44.931  31.670  18.570  1.00 86.26  ? 160  LYS C CA  1 
ATOM   2059  C C   . LYS D  1 10  ? 44.272  31.804  19.941  1.00 86.13  ? 160  LYS C C   1 
ATOM   2060  O O   . LYS D  1 10  ? 43.317  31.094  20.239  1.00 92.72  ? 160  LYS C O   1 
ATOM   2061  C CB  . LYS D  1 10  ? 46.347  31.106  18.717  1.00 87.86  ? 160  LYS C CB  1 
ATOM   2062  C CG  . LYS D  1 10  ? 47.073  30.960  17.396  1.00 95.42  ? 160  LYS C CG  1 
ATOM   2063  C CD  . LYS D  1 10  ? 48.418  30.261  17.558  1.00 100.00 ? 160  LYS C CD  1 
ATOM   2064  C CE  . LYS D  1 10  ? 49.012  29.952  16.188  1.00 100.00 ? 160  LYS C CE  1 
ATOM   2065  N NZ  . LYS D  1 10  ? 50.293  29.210  16.262  1.00 99.45  ? 160  LYS C NZ  1 
ATOM   2066  N N   . PRO D  1 11  ? 44.797  32.671  20.815  1.00 82.12  ? 161  PRO C N   1 
ATOM   2067  C CA  . PRO D  1 11  ? 44.105  32.761  22.099  1.00 76.51  ? 161  PRO C CA  1 
ATOM   2068  C C   . PRO D  1 11  ? 43.286  34.064  22.150  1.00 76.55  ? 161  PRO C C   1 
ATOM   2069  O O   . PRO D  1 11  ? 42.710  34.393  23.191  1.00 81.67  ? 161  PRO C O   1 
ATOM   2070  C CB  . PRO D  1 11  ? 45.246  32.759  23.119  1.00 74.76  ? 161  PRO C CB  1 
ATOM   2071  C CG  . PRO D  1 11  ? 46.475  32.365  22.316  1.00 81.51  ? 161  PRO C CG  1 
ATOM   2072  C CD  . PRO D  1 11  ? 46.214  33.004  20.995  1.00 83.45  ? 161  PRO C CD  1 
ATOM   2073  N N   . ARG D  1 12  ? 43.230  34.796  21.030  1.00 67.58  ? 162  ARG C N   1 
ATOM   2074  C CA  . ARG D  1 12  ? 42.493  36.075  20.959  1.00 66.68  ? 162  ARG C CA  1 
ATOM   2075  C C   . ARG D  1 12  ? 43.172  37.159  21.783  1.00 61.67  ? 162  ARG C C   1 
ATOM   2076  O O   . ARG D  1 12  ? 43.553  38.205  21.261  1.00 62.54  ? 162  ARG C O   1 
ATOM   2077  C CB  . ARG D  1 12  ? 41.055  35.937  21.476  1.00 65.94  ? 162  ARG C CB  1 
ATOM   2078  C CG  . ARG D  1 12  ? 40.103  35.210  20.560  1.00 65.01  ? 162  ARG C CG  1 
ATOM   2079  C CD  . ARG D  1 12  ? 39.644  36.077  19.433  1.00 64.17  ? 162  ARG C CD  1 
ATOM   2080  N NE  . ARG D  1 12  ? 38.590  35.413  18.682  1.00 73.64  ? 162  ARG C NE  1 
ATOM   2081  C CZ  . ARG D  1 12  ? 38.801  34.400  17.852  1.00 76.51  ? 162  ARG C CZ  1 
ATOM   2082  N NH1 . ARG D  1 12  ? 40.038  33.943  17.669  1.00 71.11  ? 162  ARG C NH1 1 
ATOM   2083  N NH2 . ARG D  1 12  ? 37.775  33.844  17.217  1.00 75.39  ? 162  ARG C NH2 1 
ATOM   2084  N N   . GLY D  1 13  ? 43.292  36.903  23.082  1.00 53.09  ? 163  GLY C N   1 
ATOM   2085  C CA  . GLY D  1 13  ? 43.928  37.851  23.977  1.00 49.27  ? 163  GLY C CA  1 
ATOM   2086  C C   . GLY D  1 13  ? 43.531  37.520  25.399  1.00 43.25  ? 163  GLY C C   1 
ATOM   2087  O O   . GLY D  1 13  ? 42.696  36.643  25.611  1.00 39.67  ? 163  GLY C O   1 
ATOM   2088  N N   . TYR D  1 14  ? 44.111  38.211  26.372  1.00 37.39  ? 164  TYR C N   1 
ATOM   2089  C CA  . TYR D  1 14  ? 43.775  37.923  27.743  1.00 44.92  ? 164  TYR C CA  1 
ATOM   2090  C C   . TYR D  1 14  ? 42.484  38.608  28.119  1.00 52.04  ? 164  TYR C C   1 
ATOM   2091  O O   . TYR D  1 14  ? 42.066  39.563  27.477  1.00 59.38  ? 164  TYR C O   1 
ATOM   2092  C CB  . TYR D  1 14  ? 44.890  38.382  28.684  1.00 51.71  ? 164  TYR C CB  1 
ATOM   2093  C CG  . TYR D  1 14  ? 46.228  37.746  28.395  1.00 67.54  ? 164  TYR C CG  1 
ATOM   2094  C CD1 . TYR D  1 14  ? 46.541  36.477  28.880  1.00 68.25  ? 164  TYR C CD1 1 
ATOM   2095  C CD2 . TYR D  1 14  ? 47.159  38.385  27.580  1.00 75.57  ? 164  TYR C CD2 1 
ATOM   2096  C CE1 . TYR D  1 14  ? 47.745  35.860  28.552  1.00 74.34  ? 164  TYR C CE1 1 
ATOM   2097  C CE2 . TYR D  1 14  ? 48.366  37.776  27.249  1.00 75.39  ? 164  TYR C CE2 1 
ATOM   2098  C CZ  . TYR D  1 14  ? 48.652  36.513  27.735  1.00 75.22  ? 164  TYR C CZ  1 
ATOM   2099  O OH  . TYR D  1 14  ? 49.836  35.899  27.389  1.00 75.80  ? 164  TYR C OH  1 
ATOM   2100  N N   . CYS D  1 15  ? 41.845  38.103  29.163  1.00 52.78  ? 165  CYS C N   1 
ATOM   2101  C CA  . CYS D  1 15  ? 40.620  38.685  29.661  1.00 47.21  ? 165  CYS C CA  1 
ATOM   2102  C C   . CYS D  1 15  ? 40.725  38.676  31.169  1.00 42.37  ? 165  CYS C C   1 
ATOM   2103  O O   . CYS D  1 15  ? 40.342  37.703  31.803  1.00 48.46  ? 165  CYS C O   1 
ATOM   2104  C CB  . CYS D  1 15  ? 39.411  37.859  29.219  1.00 52.49  ? 165  CYS C CB  1 
ATOM   2105  S SG  . CYS D  1 15  ? 37.820  38.387  29.942  1.00 57.50  ? 165  CYS C SG  1 
ATOM   2106  N N   . LEU D  1 16  ? 41.269  39.736  31.749  1.00 34.74  ? 166  LEU C N   1 
ATOM   2107  C CA  . LEU D  1 16  ? 41.375  39.787  33.201  1.00 39.04  ? 166  LEU C CA  1 
ATOM   2108  C C   . LEU D  1 16  ? 39.988  39.821  33.797  1.00 45.17  ? 166  LEU C C   1 
ATOM   2109  O O   . LEU D  1 16  ? 39.003  40.053  33.094  1.00 47.17  ? 166  LEU C O   1 
ATOM   2110  C CB  . LEU D  1 16  ? 42.077  41.045  33.686  1.00 38.38  ? 166  LEU C CB  1 
ATOM   2111  C CG  . LEU D  1 16  ? 43.376  41.476  33.060  1.00 46.75  ? 166  LEU C CG  1 
ATOM   2112  C CD1 . LEU D  1 16  ? 44.015  42.511  33.965  1.00 52.56  ? 166  LEU C CD1 1 
ATOM   2113  C CD2 . LEU D  1 16  ? 44.272  40.278  32.892  1.00 58.22  ? 166  LEU C CD2 1 
ATOM   2114  N N   . ILE D  1 17  ? 39.925  39.610  35.104  1.00 47.37  ? 167  ILE C N   1 
ATOM   2115  C CA  . ILE D  1 17  ? 38.673  39.668  35.832  1.00 43.78  ? 167  ILE C CA  1 
ATOM   2116  C C   . ILE D  1 17  ? 39.017  39.972  37.269  1.00 48.87  ? 167  ILE C C   1 
ATOM   2117  O O   . ILE D  1 17  ? 39.278  39.075  38.045  1.00 61.02  ? 167  ILE C O   1 
ATOM   2118  C CB  . ILE D  1 17  ? 37.919  38.344  35.815  1.00 37.27  ? 167  ILE C CB  1 
ATOM   2119  C CG1 . ILE D  1 17  ? 37.512  37.975  34.393  1.00 42.75  ? 167  ILE C CG1 1 
ATOM   2120  C CG2 . ILE D  1 17  ? 36.697  38.461  36.695  1.00 41.32  ? 167  ILE C CG2 1 
ATOM   2121  C CD1 . ILE D  1 17  ? 36.499  36.827  34.314  1.00 37.03  ? 167  ILE C CD1 1 
ATOM   2122  N N   . ILE D  1 18  ? 39.076  41.236  37.629  1.00 50.12  ? 168  ILE C N   1 
ATOM   2123  C CA  . ILE D  1 18  ? 39.352  41.554  39.011  1.00 52.13  ? 168  ILE C CA  1 
ATOM   2124  C C   . ILE D  1 18  ? 38.003  41.335  39.653  1.00 60.15  ? 168  ILE C C   1 
ATOM   2125  O O   . ILE D  1 18  ? 37.058  42.067  39.360  1.00 66.80  ? 168  ILE C O   1 
ATOM   2126  C CB  . ILE D  1 18  ? 39.742  43.012  39.189  1.00 50.72  ? 168  ILE C CB  1 
ATOM   2127  C CG1 . ILE D  1 18  ? 40.891  43.357  38.246  1.00 47.23  ? 168  ILE C CG1 1 
ATOM   2128  C CG2 . ILE D  1 18  ? 40.134  43.267  40.611  1.00 48.79  ? 168  ILE C CG2 1 
ATOM   2129  C CD1 . ILE D  1 18  ? 41.944  42.327  38.214  1.00 54.19  ? 168  ILE C CD1 1 
ATOM   2130  N N   . ASN D  1 19  ? 37.904  40.311  40.499  1.00 61.92  ? 169  ASN C N   1 
ATOM   2131  C CA  . ASN D  1 19  ? 36.656  39.972  41.183  1.00 55.85  ? 169  ASN C CA  1 
ATOM   2132  C C   . ASN D  1 19  ? 36.756  40.283  42.679  1.00 54.59  ? 169  ASN C C   1 
ATOM   2133  O O   . ASN D  1 19  ? 37.363  39.529  43.423  1.00 54.96  ? 169  ASN C O   1 
ATOM   2134  C CB  . ASN D  1 19  ? 36.367  38.489  40.971  1.00 52.03  ? 169  ASN C CB  1 
ATOM   2135  C CG  . ASN D  1 19  ? 35.149  38.022  41.718  1.00 58.59  ? 169  ASN C CG  1 
ATOM   2136  O OD1 . ASN D  1 19  ? 35.004  38.298  42.899  1.00 72.02  ? 169  ASN C OD1 1 
ATOM   2137  N ND2 . ASN D  1 19  ? 34.266  37.299  41.039  1.00 51.93  ? 169  ASN C ND2 1 
ATOM   2138  N N   . ASN D  1 20  ? 36.167  41.390  43.115  1.00 51.33  ? 170  ASN C N   1 
ATOM   2139  C CA  . ASN D  1 20  ? 36.203  41.759  44.515  1.00 51.45  ? 170  ASN C CA  1 
ATOM   2140  C C   . ASN D  1 20  ? 34.931  41.371  45.227  1.00 56.68  ? 170  ASN C C   1 
ATOM   2141  O O   . ASN D  1 20  ? 33.841  41.769  44.840  1.00 60.67  ? 170  ASN C O   1 
ATOM   2142  C CB  . ASN D  1 20  ? 36.438  43.253  44.667  1.00 53.55  ? 170  ASN C CB  1 
ATOM   2143  C CG  . ASN D  1 20  ? 37.871  43.630  44.401  1.00 59.99  ? 170  ASN C CG  1 
ATOM   2144  O OD1 . ASN D  1 20  ? 38.650  42.810  43.897  1.00 53.08  ? 170  ASN C OD1 1 
ATOM   2145  N ND2 . ASN D  1 20  ? 38.238  44.873  44.733  1.00 58.67  ? 170  ASN C ND2 1 
ATOM   2146  N N   . HIS D  1 21  ? 35.086  40.590  46.287  1.00 64.86  ? 171  HIS C N   1 
ATOM   2147  C CA  . HIS D  1 21  ? 33.962  40.121  47.087  1.00 63.03  ? 171  HIS C CA  1 
ATOM   2148  C C   . HIS D  1 21  ? 34.047  40.519  48.563  1.00 59.22  ? 171  HIS C C   1 
ATOM   2149  O O   . HIS D  1 21  ? 33.200  41.242  49.061  1.00 59.73  ? 171  HIS C O   1 
ATOM   2150  C CB  . HIS D  1 21  ? 33.874  38.603  46.990  1.00 64.98  ? 171  HIS C CB  1 
ATOM   2151  C CG  . HIS D  1 21  ? 33.056  37.981  48.077  1.00 72.86  ? 171  HIS C CG  1 
ATOM   2152  N ND1 . HIS D  1 21  ? 31.678  37.978  48.066  1.00 78.99  ? 171  HIS C ND1 1 
ATOM   2153  C CD2 . HIS D  1 21  ? 33.422  37.377  49.232  1.00 74.01  ? 171  HIS C CD2 1 
ATOM   2154  C CE1 . HIS D  1 21  ? 31.230  37.401  49.167  1.00 76.87  ? 171  HIS C CE1 1 
ATOM   2155  N NE2 . HIS D  1 21  ? 32.268  37.028  49.892  1.00 76.22  ? 171  HIS C NE2 1 
ATOM   2156  N N   . ASN D  1 22  ? 35.080  40.038  49.245  1.00 59.19  ? 172  ASN C N   1 
ATOM   2157  C CA  . ASN D  1 22  ? 35.281  40.283  50.667  1.00 60.08  ? 172  ASN C CA  1 
ATOM   2158  C C   . ASN D  1 22  ? 35.847  41.646  51.013  1.00 58.52  ? 172  ASN C C   1 
ATOM   2159  O O   . ASN D  1 22  ? 37.058  41.809  51.100  1.00 61.39  ? 172  ASN C O   1 
ATOM   2160  C CB  . ASN D  1 22  ? 36.181  39.173  51.245  1.00 63.77  ? 172  ASN C CB  1 
ATOM   2161  C CG  . ASN D  1 22  ? 36.488  39.363  52.720  1.00 69.85  ? 172  ASN C CG  1 
ATOM   2162  O OD1 . ASN D  1 22  ? 35.612  39.720  53.522  1.00 72.42  ? 172  ASN C OD1 1 
ATOM   2163  N ND2 . ASN D  1 22  ? 37.739  39.106  53.091  1.00 71.70  ? 172  ASN C ND2 1 
ATOM   2164  N N   . PHE D  1 23  ? 34.969  42.620  51.239  1.00 55.33  ? 173  PHE C N   1 
ATOM   2165  C CA  . PHE D  1 23  ? 35.420  43.962  51.590  1.00 60.48  ? 173  PHE C CA  1 
ATOM   2166  C C   . PHE D  1 23  ? 35.677  44.157  53.079  1.00 66.39  ? 173  PHE C C   1 
ATOM   2167  O O   . PHE D  1 23  ? 35.394  45.213  53.658  1.00 60.75  ? 173  PHE C O   1 
ATOM   2168  C CB  . PHE D  1 23  ? 34.432  45.004  51.072  1.00 57.53  ? 173  PHE C CB  1 
ATOM   2169  C CG  . PHE D  1 23  ? 34.500  45.179  49.597  1.00 54.66  ? 173  PHE C CG  1 
ATOM   2170  C CD1 . PHE D  1 23  ? 33.957  44.223  48.751  1.00 61.85  ? 173  PHE C CD1 1 
ATOM   2171  C CD2 . PHE D  1 23  ? 35.227  46.221  49.047  1.00 52.53  ? 173  PHE C CD2 1 
ATOM   2172  C CE1 . PHE D  1 23  ? 34.146  44.291  47.371  1.00 62.26  ? 173  PHE C CE1 1 
ATOM   2173  C CE2 . PHE D  1 23  ? 35.422  46.297  47.673  1.00 61.67  ? 173  PHE C CE2 1 
ATOM   2174  C CZ  . PHE D  1 23  ? 34.879  45.325  46.834  1.00 59.40  ? 173  PHE C CZ  1 
ATOM   2175  N N   . ALA D  1 24  ? 36.256  43.123  53.676  1.00 70.72  ? 174  ALA C N   1 
ATOM   2176  C CA  . ALA D  1 24  ? 36.581  43.107  55.084  1.00 67.63  ? 174  ALA C CA  1 
ATOM   2177  C C   . ALA D  1 24  ? 37.412  44.314  55.488  1.00 67.85  ? 174  ALA C C   1 
ATOM   2178  O O   . ALA D  1 24  ? 36.936  45.148  56.247  1.00 65.50  ? 174  ALA C O   1 
ATOM   2179  C CB  . ALA D  1 24  ? 37.314  41.836  55.402  1.00 70.08  ? 174  ALA C CB  1 
ATOM   2180  N N   . LYS D  1 25  ? 38.644  44.417  54.980  1.00 72.01  ? 175  LYS C N   1 
ATOM   2181  C CA  . LYS D  1 25  ? 39.514  45.546  55.343  1.00 74.74  ? 175  LYS C CA  1 
ATOM   2182  C C   . LYS D  1 25  ? 38.899  46.879  54.946  1.00 73.81  ? 175  LYS C C   1 
ATOM   2183  O O   . LYS D  1 25  ? 39.232  47.936  55.503  1.00 67.59  ? 175  LYS C O   1 
ATOM   2184  C CB  . LYS D  1 25  ? 40.919  45.395  54.736  1.00 76.04  ? 175  LYS C CB  1 
ATOM   2185  C CG  . LYS D  1 25  ? 42.017  45.276  55.825  1.00 83.57  ? 175  LYS C CG  1 
ATOM   2186  C CD  . LYS D  1 25  ? 43.451  45.449  55.301  1.00 89.28  ? 175  LYS C CD  1 
ATOM   2187  C CE  . LYS D  1 25  ? 43.749  46.889  54.866  1.00 87.18  ? 175  LYS C CE  1 
ATOM   2188  N NZ  . LYS D  1 25  ? 45.130  47.041  54.317  1.00 88.58  ? 175  LYS C NZ  1 
ATOM   2189  N N   . ALA D  1 26  A 37.991  46.817  53.980  1.00 74.76  ? 175  ALA C N   1 
ATOM   2190  C CA  . ALA D  1 26  A 37.282  48.000  53.536  1.00 75.93  ? 175  ALA C CA  1 
ATOM   2191  C C   . ALA D  1 26  A 36.602  48.535  54.785  1.00 74.84  ? 175  ALA C C   1 
ATOM   2192  O O   . ALA D  1 26  A 37.052  49.523  55.375  1.00 74.73  ? 175  ALA C O   1 
ATOM   2193  C CB  . ALA D  1 26  A 36.235  47.629  52.495  1.00 75.17  ? 175  ALA C CB  1 
ATOM   2194  N N   . ARG D  1 27  B 35.535  47.840  55.188  1.00 74.80  ? 175  ARG C N   1 
ATOM   2195  C CA  . ARG D  1 27  B 34.733  48.188  56.365  1.00 72.43  ? 175  ARG C CA  1 
ATOM   2196  C C   . ARG D  1 27  B 35.572  48.430  57.598  1.00 72.73  ? 175  ARG C C   1 
ATOM   2197  O O   . ARG D  1 27  B 35.223  49.265  58.437  1.00 78.64  ? 175  ARG C O   1 
ATOM   2198  C CB  . ARG D  1 27  B 33.702  47.095  56.655  1.00 63.75  ? 175  ARG C CB  1 
ATOM   2199  C CG  . ARG D  1 27  B 32.561  47.059  55.645  1.00 65.81  ? 175  ARG C CG  1 
ATOM   2200  C CD  . ARG D  1 27  B 31.743  45.788  55.754  1.00 58.13  ? 175  ARG C CD  1 
ATOM   2201  N NE  . ARG D  1 27  B 32.596  44.619  55.943  1.00 65.14  ? 175  ARG C NE  1 
ATOM   2202  C CZ  . ARG D  1 27  B 32.637  43.566  55.134  1.00 65.19  ? 175  ARG C CZ  1 
ATOM   2203  N NH1 . ARG D  1 27  B 31.872  43.521  54.049  1.00 61.26  ? 175  ARG C NH1 1 
ATOM   2204  N NH2 . ARG D  1 27  B 33.429  42.544  55.432  1.00 66.75  ? 175  ARG C NH2 1 
ATOM   2205  N N   . GLU D  1 28  C 36.687  47.718  57.705  1.00 71.38  ? 175  GLU C N   1 
ATOM   2206  C CA  . GLU D  1 28  C 37.552  47.897  58.851  1.00 71.58  ? 175  GLU C CA  1 
ATOM   2207  C C   . GLU D  1 28  C 38.298  49.228  58.772  1.00 71.49  ? 175  GLU C C   1 
ATOM   2208  O O   . GLU D  1 28  C 38.016  50.149  59.531  1.00 73.15  ? 175  GLU C O   1 
ATOM   2209  C CB  . GLU D  1 28  C 38.561  46.744  58.960  1.00 75.04  ? 175  GLU C CB  1 
ATOM   2210  C CG  . GLU D  1 28  C 39.407  46.774  60.255  1.00 80.60  ? 175  GLU C CG  1 
ATOM   2211  C CD  . GLU D  1 28  C 40.614  45.816  60.238  1.00 82.13  ? 175  GLU C CD  1 
ATOM   2212  O OE1 . GLU D  1 28  C 41.549  46.036  61.050  1.00 81.54  ? 175  GLU C OE1 1 
ATOM   2213  O OE2 . GLU D  1 28  C 40.630  44.852  59.430  1.00 73.12  ? 175  GLU C OE2 1 
ATOM   2214  N N   . LYS D  1 29  D 39.216  49.342  57.823  1.00 67.95  ? 175  LYS C N   1 
ATOM   2215  C CA  . LYS D  1 29  D 40.039  50.531  57.710  1.00 67.69  ? 175  LYS C CA  1 
ATOM   2216  C C   . LYS D  1 29  D 39.437  51.857  57.235  1.00 69.75  ? 175  LYS C C   1 
ATOM   2217  O O   . LYS D  1 29  D 39.920  52.915  57.627  1.00 67.44  ? 175  LYS C O   1 
ATOM   2218  C CB  . LYS D  1 29  D 41.243  50.208  56.834  1.00 73.66  ? 175  LYS C CB  1 
ATOM   2219  C CG  . LYS D  1 29  D 41.977  48.909  57.167  1.00 78.45  ? 175  LYS C CG  1 
ATOM   2220  C CD  . LYS D  1 29  D 42.762  48.965  58.482  1.00 79.56  ? 175  LYS C CD  1 
ATOM   2221  C CE  . LYS D  1 29  D 43.683  47.746  58.609  1.00 80.76  ? 175  LYS C CE  1 
ATOM   2222  N NZ  . LYS D  1 29  D 44.239  47.534  59.980  1.00 80.48  ? 175  LYS C NZ  1 
ATOM   2223  N N   . VAL D  1 30  E 38.403  51.825  56.399  1.00 74.58  ? 175  VAL C N   1 
ATOM   2224  C CA  . VAL D  1 30  E 37.833  53.077  55.873  1.00 81.03  ? 175  VAL C CA  1 
ATOM   2225  C C   . VAL D  1 30  E 36.622  53.622  56.614  1.00 83.85  ? 175  VAL C C   1 
ATOM   2226  O O   . VAL D  1 30  E 35.484  53.207  56.360  1.00 84.13  ? 175  VAL C O   1 
ATOM   2227  C CB  . VAL D  1 30  E 37.409  52.934  54.400  1.00 84.71  ? 175  VAL C CB  1 
ATOM   2228  C CG1 . VAL D  1 30  E 37.318  54.315  53.743  1.00 84.11  ? 175  VAL C CG1 1 
ATOM   2229  C CG2 . VAL D  1 30  E 38.374  52.034  53.669  1.00 86.98  ? 175  VAL C CG2 1 
ATOM   2230  N N   . PRO D  1 31  F 36.843  54.597  57.503  1.00 81.87  ? 175  PRO C N   1 
ATOM   2231  C CA  . PRO D  1 31  F 35.729  55.170  58.258  1.00 79.49  ? 175  PRO C CA  1 
ATOM   2232  C C   . PRO D  1 31  F 34.474  55.292  57.426  1.00 76.73  ? 175  PRO C C   1 
ATOM   2233  O O   . PRO D  1 31  F 33.648  54.381  57.373  1.00 74.41  ? 175  PRO C O   1 
ATOM   2234  C CB  . PRO D  1 31  F 36.270  56.529  58.714  1.00 80.81  ? 175  PRO C CB  1 
ATOM   2235  C CG  . PRO D  1 31  F 37.385  56.816  57.745  1.00 89.22  ? 175  PRO C CG  1 
ATOM   2236  C CD  . PRO D  1 31  F 38.025  55.466  57.576  1.00 84.55  ? 175  PRO C CD  1 
ATOM   2237  N N   . LYS D  1 32  G 34.335  56.425  56.772  1.00 79.57  ? 175  LYS C N   1 
ATOM   2238  C CA  . LYS D  1 32  G 33.174  56.660  55.942  1.00 85.15  ? 175  LYS C CA  1 
ATOM   2239  C C   . LYS D  1 32  G 33.087  55.541  54.894  1.00 88.02  ? 175  LYS C C   1 
ATOM   2240  O O   . LYS D  1 32  G 33.262  55.802  53.702  1.00 94.02  ? 175  LYS C O   1 
ATOM   2241  C CB  . LYS D  1 32  G 33.328  58.022  55.257  1.00 84.56  ? 175  LYS C CB  1 
ATOM   2242  C CG  . LYS D  1 32  G 33.897  59.133  56.144  1.00 80.88  ? 175  LYS C CG  1 
ATOM   2243  C CD  . LYS D  1 32  G 35.396  58.997  56.314  1.00 83.44  ? 175  LYS C CD  1 
ATOM   2244  C CE  . LYS D  1 32  G 35.939  59.998  57.317  1.00 83.06  ? 175  LYS C CE  1 
ATOM   2245  N NZ  . LYS D  1 32  G 37.383  59.738  57.629  1.00 80.65  ? 175  LYS C NZ  1 
ATOM   2246  N N   . LEU D  1 33  H 32.815  54.304  55.312  1.00 85.00  ? 175  LEU C N   1 
ATOM   2247  C CA  . LEU D  1 33  H 32.767  53.216  54.340  1.00 84.74  ? 175  LEU C CA  1 
ATOM   2248  C C   . LEU D  1 33  H 32.543  51.828  54.925  1.00 87.85  ? 175  LEU C C   1 
ATOM   2249  O O   . LEU D  1 33  H 32.613  50.815  54.211  1.00 81.44  ? 175  LEU C O   1 
ATOM   2250  C CB  . LEU D  1 33  H 34.064  53.200  53.544  1.00 85.06  ? 175  LEU C CB  1 
ATOM   2251  C CG  . LEU D  1 33  H 34.019  52.467  52.215  1.00 84.39  ? 175  LEU C CG  1 
ATOM   2252  C CD1 . LEU D  1 33  H 33.003  53.134  51.315  1.00 84.48  ? 175  LEU C CD1 1 
ATOM   2253  C CD2 . LEU D  1 33  H 35.397  52.488  51.585  1.00 82.72  ? 175  LEU C CD2 1 
ATOM   2254  N N   . HIS D  1 34  I 32.306  51.772  56.229  1.00 91.50  ? 175  HIS C N   1 
ATOM   2255  C CA  . HIS D  1 34  I 32.029  50.503  56.894  1.00 92.76  ? 175  HIS C CA  1 
ATOM   2256  C C   . HIS D  1 34  I 30.753  50.061  56.211  1.00 94.47  ? 175  HIS C C   1 
ATOM   2257  O O   . HIS D  1 34  I 30.471  50.466  55.088  1.00 98.01  ? 175  HIS C O   1 
ATOM   2258  C CB  . HIS D  1 34  I 31.723  50.741  58.368  1.00 91.82  ? 175  HIS C CB  1 
ATOM   2259  C CG  . HIS D  1 34  I 30.581  51.688  58.585  1.00 100.00 ? 175  HIS C CG  1 
ATOM   2260  N ND1 . HIS D  1 34  I 30.507  52.919  57.960  1.00 100.00 ? 175  HIS C ND1 1 
ATOM   2261  C CD2 . HIS D  1 34  I 29.460  51.583  59.340  1.00 100.00 ? 175  HIS C CD2 1 
ATOM   2262  C CE1 . HIS D  1 34  I 29.390  53.529  58.320  1.00 100.00 ? 175  HIS C CE1 1 
ATOM   2263  N NE2 . HIS D  1 34  I 28.736  52.741  59.157  1.00 100.00 ? 175  HIS C NE2 1 
ATOM   2264  N N   . SER D  1 35  J 29.968  49.255  56.910  1.00 96.24  ? 175  SER C N   1 
ATOM   2265  C CA  . SER D  1 35  J 28.677  48.772  56.413  1.00 95.84  ? 175  SER C CA  1 
ATOM   2266  C C   . SER D  1 35  J 28.541  48.420  54.911  1.00 91.70  ? 175  SER C C   1 
ATOM   2267  O O   . SER D  1 35  J 27.482  47.945  54.486  1.00 90.88  ? 175  SER C O   1 
ATOM   2268  C CB  . SER D  1 35  J 27.585  49.778  56.811  1.00 94.43  ? 175  SER C CB  1 
ATOM   2269  O OG  . SER D  1 35  J 26.289  49.261  56.570  1.00 99.70  ? 175  SER C OG  1 
ATOM   2270  N N   . ILE D  1 36  ? 29.591  48.635  54.116  1.00 85.57  ? 176  ILE C N   1 
ATOM   2271  C CA  . ILE D  1 36  ? 29.537  48.309  52.694  1.00 76.55  ? 176  ILE C CA  1 
ATOM   2272  C C   . ILE D  1 36  ? 29.636  46.806  52.579  1.00 69.67  ? 176  ILE C C   1 
ATOM   2273  O O   . ILE D  1 36  ? 30.715  46.230  52.658  1.00 65.24  ? 176  ILE C O   1 
ATOM   2274  C CB  . ILE D  1 36  ? 30.683  48.971  51.922  1.00 78.94  ? 176  ILE C CB  1 
ATOM   2275  C CG1 . ILE D  1 36  ? 30.681  50.470  52.224  1.00 85.40  ? 176  ILE C CG1 1 
ATOM   2276  C CG2 . ILE D  1 36  ? 30.508  48.751  50.424  1.00 67.54  ? 176  ILE C CG2 1 
ATOM   2277  C CD1 . ILE D  1 36  ? 29.272  51.099  52.241  1.00 79.27  ? 176  ILE C CD1 1 
ATOM   2278  N N   . ARG D  1 37  ? 28.483  46.183  52.393  1.00 64.66  ? 177  ARG C N   1 
ATOM   2279  C CA  . ARG D  1 37  ? 28.376  44.737  52.312  1.00 64.75  ? 177  ARG C CA  1 
ATOM   2280  C C   . ARG D  1 37  ? 29.342  44.041  51.371  1.00 55.83  ? 177  ARG C C   1 
ATOM   2281  O O   . ARG D  1 37  ? 29.804  44.600  50.400  1.00 55.28  ? 177  ARG C O   1 
ATOM   2282  C CB  . ARG D  1 37  ? 26.947  44.328  51.898  1.00 75.05  ? 177  ARG C CB  1 
ATOM   2283  C CG  . ARG D  1 37  ? 25.792  45.268  52.322  1.00 87.53  ? 177  ARG C CG  1 
ATOM   2284  C CD  . ARG D  1 37  ? 25.411  45.230  53.825  1.00 95.80  ? 177  ARG C CD  1 
ATOM   2285  N NE  . ARG D  1 37  ? 24.977  43.917  54.323  1.00 99.05  ? 177  ARG C NE  1 
ATOM   2286  C CZ  . ARG D  1 37  ? 24.119  43.102  53.709  1.00 97.07  ? 177  ARG C CZ  1 
ATOM   2287  N NH1 . ARG D  1 37  ? 23.575  43.440  52.542  1.00 97.70  ? 177  ARG C NH1 1 
ATOM   2288  N NH2 . ARG D  1 37  ? 23.804  41.942  54.269  1.00 87.87  ? 177  ARG C NH2 1 
ATOM   2289  N N   . ASP D  1 38  ? 29.679  42.811  51.695  1.00 57.23  ? 178  ASP C N   1 
ATOM   2290  C CA  . ASP D  1 38  ? 30.487  42.031  50.785  1.00 60.16  ? 178  ASP C CA  1 
ATOM   2291  C C   . ASP D  1 38  ? 29.591  41.822  49.560  1.00 57.59  ? 178  ASP C C   1 
ATOM   2292  O O   . ASP D  1 38  ? 28.359  41.682  49.659  1.00 52.62  ? 178  ASP C O   1 
ATOM   2293  C CB  . ASP D  1 38  ? 30.872  40.682  51.399  1.00 65.27  ? 178  ASP C CB  1 
ATOM   2294  C CG  . ASP D  1 38  ? 31.813  40.836  52.571  1.00 67.35  ? 178  ASP C CG  1 
ATOM   2295  O OD1 . ASP D  1 38  ? 32.734  41.670  52.481  1.00 69.21  ? 178  ASP C OD1 1 
ATOM   2296  O OD2 . ASP D  1 38  ? 31.641  40.125  53.580  1.00 80.86  ? 178  ASP C OD2 1 
ATOM   2297  N N   . ARG D  1 39  ? 30.225  41.797  48.401  1.00 57.99  ? 179  ARG C N   1 
ATOM   2298  C CA  . ARG D  1 39  ? 29.513  41.670  47.145  1.00 52.23  ? 179  ARG C CA  1 
ATOM   2299  C C   . ARG D  1 39  ? 29.061  40.257  46.837  1.00 52.49  ? 179  ARG C C   1 
ATOM   2300  O O   . ARG D  1 39  ? 29.496  39.649  45.858  1.00 53.14  ? 179  ARG C O   1 
ATOM   2301  C CB  . ARG D  1 39  ? 30.392  42.245  46.024  1.00 52.27  ? 179  ARG C CB  1 
ATOM   2302  C CG  . ARG D  1 39  ? 30.834  43.710  46.299  1.00 51.99  ? 179  ARG C CG  1 
ATOM   2303  C CD  . ARG D  1 39  ? 31.523  44.378  45.123  1.00 42.64  ? 179  ARG C CD  1 
ATOM   2304  N NE  . ARG D  1 39  ? 30.672  44.349  43.939  1.00 41.52  ? 179  ARG C NE  1 
ATOM   2305  C CZ  . ARG D  1 39  ? 30.677  43.380  43.031  1.00 40.35  ? 179  ARG C CZ  1 
ATOM   2306  N NH1 . ARG D  1 39  ? 31.511  42.358  43.164  1.00 40.75  ? 179  ARG C NH1 1 
ATOM   2307  N NH2 . ARG D  1 39  ? 29.824  43.416  42.010  1.00 39.90  ? 179  ARG C NH2 1 
ATOM   2308  N N   . ASN D  1 40  ? 28.152  39.748  47.660  1.00 51.78  ? 180  ASN C N   1 
ATOM   2309  C CA  . ASN D  1 40  ? 27.666  38.391  47.471  1.00 60.89  ? 180  ASN C CA  1 
ATOM   2310  C C   . ASN D  1 40  ? 27.054  38.184  46.102  1.00 57.97  ? 180  ASN C C   1 
ATOM   2311  O O   . ASN D  1 40  ? 26.063  38.811  45.768  1.00 66.56  ? 180  ASN C O   1 
ATOM   2312  C CB  . ASN D  1 40  ? 26.634  38.048  48.540  1.00 75.13  ? 180  ASN C CB  1 
ATOM   2313  C CG  . ASN D  1 40  ? 27.245  37.890  49.923  1.00 81.78  ? 180  ASN C CG  1 
ATOM   2314  O OD1 . ASN D  1 40  ? 26.525  37.895  50.916  1.00 86.91  ? 180  ASN C OD1 1 
ATOM   2315  N ND2 . ASN D  1 40  ? 28.566  37.740  49.993  1.00 80.77  ? 180  ASN C ND2 1 
ATOM   2316  N N   . GLY D  1 41  ? 27.647  37.303  45.309  1.00 56.83  ? 181  GLY C N   1 
ATOM   2317  C CA  . GLY D  1 41  ? 27.116  37.027  43.989  1.00 51.95  ? 181  GLY C CA  1 
ATOM   2318  C C   . GLY D  1 41  ? 28.142  37.212  42.893  1.00 54.41  ? 181  GLY C C   1 
ATOM   2319  O O   . GLY D  1 41  ? 28.016  36.601  41.827  1.00 46.84  ? 181  GLY C O   1 
ATOM   2320  N N   . THR D  1 42  ? 29.161  38.036  43.159  1.00 56.03  ? 182  THR C N   1 
ATOM   2321  C CA  . THR D  1 42  ? 30.201  38.333  42.171  1.00 64.10  ? 182  THR C CA  1 
ATOM   2322  C C   . THR D  1 42  ? 30.568  37.075  41.450  1.00 70.36  ? 182  THR C C   1 
ATOM   2323  O O   . THR D  1 42  ? 30.697  37.046  40.222  1.00 70.70  ? 182  THR C O   1 
ATOM   2324  C CB  . THR D  1 42  ? 31.490  38.824  42.797  1.00 63.33  ? 182  THR C CB  1 
ATOM   2325  O OG1 . THR D  1 42  ? 31.200  39.567  43.982  1.00 64.22  ? 182  THR C OG1 1 
ATOM   2326  C CG2 . THR D  1 42  ? 32.234  39.699  41.807  1.00 62.42  ? 182  THR C CG2 1 
ATOM   2327  N N   . HIS D  1 43  ? 30.753  36.046  42.267  1.00 73.37  ? 183  HIS C N   1 
ATOM   2328  C CA  . HIS D  1 43  ? 31.117  34.705  41.844  1.00 73.84  ? 183  HIS C CA  1 
ATOM   2329  C C   . HIS D  1 43  ? 30.349  34.323  40.598  1.00 70.63  ? 183  HIS C C   1 
ATOM   2330  O O   . HIS D  1 43  ? 30.930  33.861  39.617  1.00 66.96  ? 183  HIS C O   1 
ATOM   2331  C CB  . HIS D  1 43  ? 30.817  33.742  42.987  1.00 80.95  ? 183  HIS C CB  1 
ATOM   2332  C CG  . HIS D  1 43  ? 30.941  34.376  44.340  1.00 96.84  ? 183  HIS C CG  1 
ATOM   2333  N ND1 . HIS D  1 43  ? 29.897  35.045  44.949  1.00 96.17  ? 183  HIS C ND1 1 
ATOM   2334  C CD2 . HIS D  1 43  ? 32.003  34.495  45.176  1.00 100.00 ? 183  HIS C CD2 1 
ATOM   2335  C CE1 . HIS D  1 43  ? 30.311  35.547  46.101  1.00 99.46  ? 183  HIS C CE1 1 
ATOM   2336  N NE2 . HIS D  1 43  ? 31.584  35.228  46.262  1.00 100.00 ? 183  HIS C NE2 1 
ATOM   2337  N N   . LEU D  1 44  ? 29.039  34.531  40.629  1.00 71.05  ? 184  LEU C N   1 
ATOM   2338  C CA  . LEU D  1 44  ? 28.212  34.208  39.471  1.00 70.09  ? 184  LEU C CA  1 
ATOM   2339  C C   . LEU D  1 44  ? 28.621  35.015  38.225  1.00 70.16  ? 184  LEU C C   1 
ATOM   2340  O O   . LEU D  1 44  ? 28.636  34.477  37.107  1.00 68.47  ? 184  LEU C O   1 
ATOM   2341  C CB  . LEU D  1 44  ? 26.737  34.421  39.823  1.00 69.52  ? 184  LEU C CB  1 
ATOM   2342  C CG  . LEU D  1 44  ? 26.024  33.272  40.556  1.00 64.06  ? 184  LEU C CG  1 
ATOM   2343  C CD1 . LEU D  1 44  ? 27.022  32.229  41.043  1.00 61.56  ? 184  LEU C CD1 1 
ATOM   2344  C CD2 . LEU D  1 44  ? 25.219  33.851  41.712  1.00 58.00  ? 184  LEU C CD2 1 
ATOM   2345  N N   . ASP D  1 45  ? 28.965  36.293  38.419  1.00 66.59  ? 185  ASP C N   1 
ATOM   2346  C CA  . ASP D  1 45  ? 29.409  37.146  37.315  1.00 55.86  ? 185  ASP C CA  1 
ATOM   2347  C C   . ASP D  1 45  ? 30.697  36.557  36.757  1.00 51.34  ? 185  ASP C C   1 
ATOM   2348  O O   . ASP D  1 45  ? 30.797  36.242  35.569  1.00 44.69  ? 185  ASP C O   1 
ATOM   2349  C CB  . ASP D  1 45  ? 29.702  38.572  37.801  1.00 62.95  ? 185  ASP C CB  1 
ATOM   2350  C CG  . ASP D  1 45  ? 28.441  39.385  38.087  1.00 60.91  ? 185  ASP C CG  1 
ATOM   2351  O OD1 . ASP D  1 45  ? 27.357  39.027  37.590  1.00 63.98  ? 185  ASP C OD1 1 
ATOM   2352  O OD2 . ASP D  1 45  ? 28.545  40.405  38.801  1.00 52.59  ? 185  ASP C OD2 1 
ATOM   2353  N N   . ALA D  1 46  ? 31.683  36.421  37.643  1.00 52.73  ? 186  ALA C N   1 
ATOM   2354  C CA  . ALA D  1 46  ? 32.987  35.863  37.286  1.00 52.57  ? 186  ALA C CA  1 
ATOM   2355  C C   . ALA D  1 46  ? 32.786  34.559  36.512  1.00 54.24  ? 186  ALA C C   1 
ATOM   2356  O O   . ALA D  1 46  ? 33.385  34.353  35.456  1.00 54.42  ? 186  ALA C O   1 
ATOM   2357  C CB  . ALA D  1 46  ? 33.804  35.611  38.540  1.00 44.33  ? 186  ALA C CB  1 
ATOM   2358  N N   . GLY D  1 47  ? 31.923  33.689  37.029  1.00 52.66  ? 187  GLY C N   1 
ATOM   2359  C CA  . GLY D  1 47  ? 31.672  32.433  36.353  1.00 53.51  ? 187  GLY C CA  1 
ATOM   2360  C C   . GLY D  1 47  ? 31.178  32.678  34.951  1.00 57.31  ? 187  GLY C C   1 
ATOM   2361  O O   . GLY D  1 47  ? 31.788  32.237  33.962  1.00 55.08  ? 187  GLY C O   1 
ATOM   2362  N N   . ALA D  1 48  ? 30.065  33.402  34.876  1.00 58.64  ? 188  ALA C N   1 
ATOM   2363  C CA  . ALA D  1 48  ? 29.440  33.744  33.606  1.00 57.03  ? 188  ALA C CA  1 
ATOM   2364  C C   . ALA D  1 48  ? 30.451  34.374  32.627  1.00 52.96  ? 188  ALA C C   1 
ATOM   2365  O O   . ALA D  1 48  ? 30.552  33.989  31.452  1.00 45.90  ? 188  ALA C O   1 
ATOM   2366  C CB  . ALA D  1 48  ? 28.266  34.694  33.865  1.00 53.22  ? 188  ALA C CB  1 
ATOM   2367  N N   . LEU D  1 49  ? 31.199  35.344  33.120  1.00 46.49  ? 189  LEU C N   1 
ATOM   2368  C CA  . LEU D  1 49  ? 32.192  35.998  32.294  1.00 55.00  ? 189  LEU C CA  1 
ATOM   2369  C C   . LEU D  1 49  ? 33.155  34.961  31.717  1.00 56.52  ? 189  LEU C C   1 
ATOM   2370  O O   . LEU D  1 49  ? 33.332  34.861  30.487  1.00 48.93  ? 189  LEU C O   1 
ATOM   2371  C CB  . LEU D  1 49  ? 32.948  37.037  33.132  1.00 50.34  ? 189  LEU C CB  1 
ATOM   2372  C CG  . LEU D  1 49  ? 32.138  38.316  33.344  1.00 48.84  ? 189  LEU C CG  1 
ATOM   2373  C CD1 . LEU D  1 49  ? 32.796  39.212  34.400  1.00 41.55  ? 189  LEU C CD1 1 
ATOM   2374  C CD2 . LEU D  1 49  ? 32.014  39.012  31.983  1.00 41.58  ? 189  LEU C CD2 1 
ATOM   2375  N N   . THR D  1 50  ? 33.752  34.178  32.620  1.00 59.36  ? 190  THR C N   1 
ATOM   2376  C CA  . THR D  1 50  ? 34.718  33.143  32.259  1.00 55.25  ? 190  THR C CA  1 
ATOM   2377  C C   . THR D  1 50  ? 34.197  32.250  31.161  1.00 57.46  ? 190  THR C C   1 
ATOM   2378  O O   . THR D  1 50  ? 34.858  32.038  30.139  1.00 52.71  ? 190  THR C O   1 
ATOM   2379  C CB  . THR D  1 50  ? 35.034  32.244  33.423  1.00 52.48  ? 190  THR C CB  1 
ATOM   2380  O OG1 . THR D  1 50  ? 35.254  33.032  34.594  1.00 59.66  ? 190  THR C OG1 1 
ATOM   2381  C CG2 . THR D  1 50  ? 36.283  31.446  33.118  1.00 60.59  ? 190  THR C CG2 1 
ATOM   2382  N N   . THR D  1 51  ? 33.008  31.709  31.394  1.00 60.91  ? 191  THR C N   1 
ATOM   2383  C CA  . THR D  1 51  ? 32.365  30.832  30.425  1.00 65.28  ? 191  THR C CA  1 
ATOM   2384  C C   . THR D  1 51  ? 32.187  31.528  29.074  1.00 64.72  ? 191  THR C C   1 
ATOM   2385  O O   . THR D  1 51  ? 32.615  31.034  28.026  1.00 54.87  ? 191  THR C O   1 
ATOM   2386  C CB  . THR D  1 51  ? 30.970  30.421  30.899  1.00 69.53  ? 191  THR C CB  1 
ATOM   2387  O OG1 . THR D  1 51  ? 31.053  29.879  32.223  1.00 71.94  ? 191  THR C OG1 1 
ATOM   2388  C CG2 . THR D  1 51  ? 30.375  29.394  29.932  1.00 73.14  ? 191  THR C CG2 1 
ATOM   2389  N N   . THR D  1 52  ? 31.545  32.688  29.127  1.00 64.11  ? 192  THR C N   1 
ATOM   2390  C CA  . THR D  1 52  ? 31.257  33.454  27.942  1.00 63.76  ? 192  THR C CA  1 
ATOM   2391  C C   . THR D  1 52  ? 32.491  33.789  27.117  1.00 65.55  ? 192  THR C C   1 
ATOM   2392  O O   . THR D  1 52  ? 32.551  33.486  25.922  1.00 63.74  ? 192  THR C O   1 
ATOM   2393  C CB  . THR D  1 52  ? 30.551  34.769  28.298  1.00 66.78  ? 192  THR C CB  1 
ATOM   2394  O OG1 . THR D  1 52  ? 29.468  34.514  29.198  1.00 63.13  ? 192  THR C OG1 1 
ATOM   2395  C CG2 . THR D  1 52  ? 30.012  35.424  27.034  1.00 64.44  ? 192  THR C CG2 1 
ATOM   2396  N N   . PHE D  1 53  ? 33.477  34.416  27.741  1.00 59.42  ? 193  PHE C N   1 
ATOM   2397  C CA  . PHE D  1 53  ? 34.648  34.795  26.984  1.00 60.37  ? 193  PHE C CA  1 
ATOM   2398  C C   . PHE D  1 53  ? 35.532  33.622  26.651  1.00 64.25  ? 193  PHE C C   1 
ATOM   2399  O O   . PHE D  1 53  ? 36.291  33.650  25.675  1.00 55.71  ? 193  PHE C O   1 
ATOM   2400  C CB  . PHE D  1 53  ? 35.410  35.898  27.715  1.00 66.42  ? 193  PHE C CB  1 
ATOM   2401  C CG  . PHE D  1 53  ? 34.753  37.244  27.591  1.00 67.84  ? 193  PHE C CG  1 
ATOM   2402  C CD1 . PHE D  1 53  ? 34.716  37.887  26.355  1.00 59.43  ? 193  PHE C CD1 1 
ATOM   2403  C CD2 . PHE D  1 53  ? 34.097  37.828  28.679  1.00 67.32  ? 193  PHE C CD2 1 
ATOM   2404  C CE1 . PHE D  1 53  ? 34.034  39.078  26.195  1.00 60.93  ? 193  PHE C CE1 1 
ATOM   2405  C CE2 . PHE D  1 53  ? 33.408  39.028  28.527  1.00 67.42  ? 193  PHE C CE2 1 
ATOM   2406  C CZ  . PHE D  1 53  ? 33.376  39.654  27.279  1.00 64.94  ? 193  PHE C CZ  1 
ATOM   2407  N N   . GLU D  1 54  ? 35.418  32.571  27.452  1.00 71.16  ? 194  GLU C N   1 
ATOM   2408  C CA  . GLU D  1 54  ? 36.190  31.373  27.191  1.00 74.57  ? 194  GLU C CA  1 
ATOM   2409  C C   . GLU D  1 54  ? 35.628  30.851  25.860  1.00 74.75  ? 194  GLU C C   1 
ATOM   2410  O O   . GLU D  1 54  ? 36.378  30.562  24.922  1.00 71.91  ? 194  GLU C O   1 
ATOM   2411  C CB  . GLU D  1 54  ? 35.979  30.366  28.315  1.00 78.02  ? 194  GLU C CB  1 
ATOM   2412  C CG  . GLU D  1 54  ? 37.204  29.508  28.620  1.00 90.77  ? 194  GLU C CG  1 
ATOM   2413  C CD  . GLU D  1 54  ? 37.031  28.655  29.878  1.00 99.89  ? 194  GLU C CD  1 
ATOM   2414  O OE1 . GLU D  1 54  ? 36.087  27.824  29.917  1.00 100.00 ? 194  GLU C OE1 1 
ATOM   2415  O OE2 . GLU D  1 54  ? 37.840  28.815  30.826  1.00 100.00 ? 194  GLU C OE2 1 
ATOM   2416  N N   . GLU D  1 55  ? 34.300  30.771  25.775  1.00 72.36  ? 195  GLU C N   1 
ATOM   2417  C CA  . GLU D  1 55  ? 33.639  30.310  24.553  1.00 72.72  ? 195  GLU C CA  1 
ATOM   2418  C C   . GLU D  1 55  ? 33.999  31.189  23.357  1.00 71.43  ? 195  GLU C C   1 
ATOM   2419  O O   . GLU D  1 55  ? 33.905  30.754  22.213  1.00 65.94  ? 195  GLU C O   1 
ATOM   2420  C CB  . GLU D  1 55  ? 32.115  30.322  24.715  1.00 75.13  ? 195  GLU C CB  1 
ATOM   2421  C CG  . GLU D  1 55  ? 31.565  29.482  25.858  1.00 79.43  ? 195  GLU C CG  1 
ATOM   2422  C CD  . GLU D  1 55  ? 30.041  29.568  25.964  1.00 82.48  ? 195  GLU C CD  1 
ATOM   2423  O OE1 . GLU D  1 55  ? 29.386  29.988  24.987  1.00 80.26  ? 195  GLU C OE1 1 
ATOM   2424  O OE2 . GLU D  1 55  ? 29.491  29.211  27.024  1.00 81.24  ? 195  GLU C OE2 1 
ATOM   2425  N N   . LEU D  1 56  ? 34.394  32.432  23.625  1.00 75.64  ? 196  LEU C N   1 
ATOM   2426  C CA  . LEU D  1 56  ? 34.757  33.358  22.555  1.00 75.48  ? 196  LEU C CA  1 
ATOM   2427  C C   . LEU D  1 56  ? 36.236  33.272  22.227  1.00 77.67  ? 196  LEU C C   1 
ATOM   2428  O O   . LEU D  1 56  ? 36.763  34.070  21.429  1.00 80.47  ? 196  LEU C O   1 
ATOM   2429  C CB  . LEU D  1 56  ? 34.381  34.785  22.933  1.00 69.55  ? 196  LEU C CB  1 
ATOM   2430  C CG  . LEU D  1 56  ? 32.882  35.040  22.915  1.00 64.57  ? 196  LEU C CG  1 
ATOM   2431  C CD1 . LEU D  1 56  ? 32.615  36.479  23.307  1.00 68.68  ? 196  LEU C CD1 1 
ATOM   2432  C CD2 . LEU D  1 56  ? 32.335  34.748  21.531  1.00 55.04  ? 196  LEU C CD2 1 
ATOM   2433  N N   . HIS D  1 57  ? 36.884  32.290  22.852  1.00 71.90  ? 197  HIS C N   1 
ATOM   2434  C CA  . HIS D  1 57  ? 38.296  32.001  22.654  1.00 70.49  ? 197  HIS C CA  1 
ATOM   2435  C C   . HIS D  1 57  ? 39.253  32.978  23.316  1.00 67.16  ? 197  HIS C C   1 
ATOM   2436  O O   . HIS D  1 57  ? 40.277  33.333  22.738  1.00 68.64  ? 197  HIS C O   1 
ATOM   2437  C CB  . HIS D  1 57  ? 38.614  31.901  21.152  1.00 76.29  ? 197  HIS C CB  1 
ATOM   2438  C CG  . HIS D  1 57  ? 37.731  30.940  20.406  1.00 87.08  ? 197  HIS C CG  1 
ATOM   2439  N ND1 . HIS D  1 57  ? 37.456  29.669  20.865  1.00 88.46  ? 197  HIS C ND1 1 
ATOM   2440  C CD2 . HIS D  1 57  ? 37.061  31.065  19.235  1.00 90.96  ? 197  HIS C CD2 1 
ATOM   2441  C CE1 . HIS D  1 57  ? 36.655  29.056  20.012  1.00 90.41  ? 197  HIS C CE1 1 
ATOM   2442  N NE2 . HIS D  1 57  ? 36.399  29.881  19.012  1.00 88.60  ? 197  HIS C NE2 1 
ATOM   2443  N N   . PHE D  1 58  ? 38.928  33.404  24.531  1.00 63.74  ? 198  PHE C N   1 
ATOM   2444  C CA  . PHE D  1 58  ? 39.785  34.337  25.265  1.00 62.82  ? 198  PHE C CA  1 
ATOM   2445  C C   . PHE D  1 58  ? 40.420  33.587  26.415  1.00 64.96  ? 198  PHE C C   1 
ATOM   2446  O O   . PHE D  1 58  ? 39.818  32.661  26.952  1.00 69.57  ? 198  PHE C O   1 
ATOM   2447  C CB  . PHE D  1 58  ? 38.974  35.517  25.833  1.00 59.31  ? 198  PHE C CB  1 
ATOM   2448  C CG  . PHE D  1 58  ? 38.808  36.658  24.870  1.00 64.30  ? 198  PHE C CG  1 
ATOM   2449  C CD1 . PHE D  1 58  ? 37.942  36.563  23.781  1.00 62.97  ? 198  PHE C CD1 1 
ATOM   2450  C CD2 . PHE D  1 58  ? 39.563  37.816  25.017  1.00 67.16  ? 198  PHE C CD2 1 
ATOM   2451  C CE1 . PHE D  1 58  ? 37.839  37.600  22.854  1.00 58.31  ? 198  PHE C CE1 1 
ATOM   2452  C CE2 . PHE D  1 58  ? 39.463  38.865  24.092  1.00 62.18  ? 198  PHE C CE2 1 
ATOM   2453  C CZ  . PHE D  1 58  ? 38.602  38.754  23.009  1.00 57.55  ? 198  PHE C CZ  1 
ATOM   2454  N N   . GLU D  1 59  ? 41.631  33.979  26.801  1.00 64.51  ? 199  GLU C N   1 
ATOM   2455  C CA  . GLU D  1 59  ? 42.290  33.321  27.920  1.00 60.71  ? 199  GLU C CA  1 
ATOM   2456  C C   . GLU D  1 59  ? 41.974  34.060  29.210  1.00 55.75  ? 199  GLU C C   1 
ATOM   2457  O O   . GLU D  1 59  ? 42.583  35.084  29.522  1.00 54.57  ? 199  GLU C O   1 
ATOM   2458  C CB  . GLU D  1 59  ? 43.804  33.242  27.700  1.00 65.96  ? 199  GLU C CB  1 
ATOM   2459  C CG  . GLU D  1 59  ? 44.554  32.618  28.878  1.00 76.57  ? 199  GLU C CG  1 
ATOM   2460  C CD  . GLU D  1 59  ? 45.946  32.149  28.507  1.00 83.09  ? 199  GLU C CD  1 
ATOM   2461  O OE1 . GLU D  1 59  ? 46.167  31.847  27.311  1.00 86.13  ? 199  GLU C OE1 1 
ATOM   2462  O OE2 . GLU D  1 59  ? 46.812  32.071  29.414  1.00 87.15  ? 199  GLU C OE2 1 
ATOM   2463  N N   . ILE D  1 60  ? 41.013  33.526  29.956  1.00 48.98  ? 200  ILE C N   1 
ATOM   2464  C CA  . ILE D  1 60  ? 40.586  34.143  31.202  1.00 51.61  ? 200  ILE C CA  1 
ATOM   2465  C C   . ILE D  1 60  ? 41.708  34.211  32.233  1.00 50.98  ? 200  ILE C C   1 
ATOM   2466  O O   . ILE D  1 60  ? 42.541  33.329  32.303  1.00 58.70  ? 200  ILE C O   1 
ATOM   2467  C CB  . ILE D  1 60  ? 39.399  33.382  31.789  1.00 50.64  ? 200  ILE C CB  1 
ATOM   2468  C CG1 . ILE D  1 60  ? 38.447  32.971  30.661  1.00 53.32  ? 200  ILE C CG1 1 
ATOM   2469  C CG2 . ILE D  1 60  ? 38.686  34.249  32.815  1.00 54.00  ? 200  ILE C CG2 1 
ATOM   2470  C CD1 . ILE D  1 60  ? 38.124  34.085  29.676  1.00 56.73  ? 200  ILE C CD1 1 
ATOM   2471  N N   . LYS D  1 61  ? 41.731  35.267  33.028  1.00 47.91  ? 201  LYS C N   1 
ATOM   2472  C CA  . LYS D  1 61  ? 42.766  35.429  34.032  1.00 49.86  ? 201  LYS C CA  1 
ATOM   2473  C C   . LYS D  1 61  ? 42.164  36.062  35.279  1.00 48.22  ? 201  LYS C C   1 
ATOM   2474  O O   . LYS D  1 61  ? 42.294  37.251  35.533  1.00 43.96  ? 201  LYS C O   1 
ATOM   2475  C CB  . LYS D  1 61  ? 43.908  36.305  33.490  1.00 55.98  ? 201  LYS C CB  1 
ATOM   2476  C CG  . LYS D  1 61  ? 44.792  35.633  32.456  1.00 56.02  ? 201  LYS C CG  1 
ATOM   2477  C CD  . LYS D  1 61  ? 45.751  34.660  33.122  1.00 66.12  ? 201  LYS C CD  1 
ATOM   2478  C CE  . LYS D  1 61  ? 46.520  33.810  32.104  1.00 65.30  ? 201  LYS C CE  1 
ATOM   2479  N NZ  . LYS D  1 61  ? 47.513  32.917  32.780  1.00 67.96  ? 201  LYS C NZ  1 
ATOM   2480  N N   . PRO D  1 62  ? 41.492  35.252  36.085  1.00 53.25  ? 202  PRO C N   1 
ATOM   2481  C CA  . PRO D  1 62  ? 40.855  35.717  37.321  1.00 54.13  ? 202  PRO C CA  1 
ATOM   2482  C C   . PRO D  1 62  ? 41.829  36.210  38.375  1.00 54.63  ? 202  PRO C C   1 
ATOM   2483  O O   . PRO D  1 62  ? 43.015  35.884  38.332  1.00 58.74  ? 202  PRO C O   1 
ATOM   2484  C CB  . PRO D  1 62  ? 40.088  34.494  37.788  1.00 50.54  ? 202  PRO C CB  1 
ATOM   2485  C CG  . PRO D  1 62  ? 40.939  33.369  37.286  1.00 52.54  ? 202  PRO C CG  1 
ATOM   2486  C CD  . PRO D  1 62  ? 41.300  33.807  35.900  1.00 52.88  ? 202  PRO C CD  1 
ATOM   2487  N N   . HIS D  1 63  ? 41.301  36.997  39.308  1.00 46.46  ? 203  HIS C N   1 
ATOM   2488  C CA  . HIS D  1 63  ? 42.043  37.570  40.426  1.00 50.56  ? 203  HIS C CA  1 
ATOM   2489  C C   . HIS D  1 63  ? 40.964  37.890  41.437  1.00 56.34  ? 203  HIS C C   1 
ATOM   2490  O O   . HIS D  1 63  ? 39.948  38.476  41.075  1.00 64.33  ? 203  HIS C O   1 
ATOM   2491  C CB  . HIS D  1 63  ? 42.746  38.846  40.006  1.00 50.93  ? 203  HIS C CB  1 
ATOM   2492  C CG  . HIS D  1 63  ? 43.923  38.612  39.122  1.00 60.48  ? 203  HIS C CG  1 
ATOM   2493  N ND1 . HIS D  1 63  ? 45.184  38.354  39.613  1.00 62.26  ? 203  HIS C ND1 1 
ATOM   2494  C CD2 . HIS D  1 63  ? 44.019  38.528  37.774  1.00 68.02  ? 203  HIS C CD2 1 
ATOM   2495  C CE1 . HIS D  1 63  ? 46.007  38.119  38.605  1.00 67.68  ? 203  HIS C CE1 1 
ATOM   2496  N NE2 . HIS D  1 63  ? 45.326  38.217  37.478  1.00 71.17  ? 203  HIS C NE2 1 
ATOM   2497  N N   . HIS D  1 64  ? 41.164  37.520  42.699  1.00 59.23  ? 204  HIS C N   1 
ATOM   2498  C CA  . HIS D  1 64  ? 40.136  37.752  43.700  1.00 52.12  ? 204  HIS C CA  1 
ATOM   2499  C C   . HIS D  1 64  ? 40.521  38.663  44.854  1.00 55.39  ? 204  HIS C C   1 
ATOM   2500  O O   . HIS D  1 64  ? 41.676  38.728  45.277  1.00 51.19  ? 204  HIS C O   1 
ATOM   2501  C CB  . HIS D  1 64  ? 39.660  36.412  44.231  1.00 45.01  ? 204  HIS C CB  1 
ATOM   2502  C CG  . HIS D  1 64  ? 39.126  35.510  43.171  1.00 50.80  ? 204  HIS C CG  1 
ATOM   2503  N ND1 . HIS D  1 64  ? 37.828  35.594  42.710  1.00 61.78  ? 204  HIS C ND1 1 
ATOM   2504  C CD2 . HIS D  1 64  ? 39.724  34.538  42.438  1.00 52.46  ? 204  HIS C CD2 1 
ATOM   2505  C CE1 . HIS D  1 64  ? 37.649  34.713  41.737  1.00 60.25  ? 204  HIS C CE1 1 
ATOM   2506  N NE2 . HIS D  1 64  ? 38.784  34.061  41.552  1.00 55.19  ? 204  HIS C NE2 1 
ATOM   2507  N N   . ASP D  1 65  ? 39.518  39.379  45.342  1.00 61.85  ? 205  ASP C N   1 
ATOM   2508  C CA  . ASP D  1 65  ? 39.666  40.297  46.454  1.00 62.21  ? 205  ASP C CA  1 
ATOM   2509  C C   . ASP D  1 65  ? 40.955  41.097  46.407  1.00 64.28  ? 205  ASP C C   1 
ATOM   2510  O O   . ASP D  1 65  ? 41.678  41.184  47.399  1.00 64.13  ? 205  ASP C O   1 
ATOM   2511  C CB  . ASP D  1 65  ? 39.570  39.507  47.745  1.00 67.25  ? 205  ASP C CB  1 
ATOM   2512  C CG  . ASP D  1 65  ? 38.236  38.788  47.882  1.00 71.60  ? 205  ASP C CG  1 
ATOM   2513  O OD1 . ASP D  1 65  ? 37.215  39.467  48.095  1.00 79.23  ? 205  ASP C OD1 1 
ATOM   2514  O OD2 . ASP D  1 65  ? 38.200  37.549  47.770  1.00 71.49  ? 205  ASP C OD2 1 
ATOM   2515  N N   . CYS D  1 66  ? 41.226  41.694  45.247  1.00 62.46  ? 206  CYS C N   1 
ATOM   2516  C CA  . CYS D  1 66  ? 42.429  42.490  45.059  1.00 59.92  ? 206  CYS C CA  1 
ATOM   2517  C C   . CYS D  1 66  ? 42.260  43.862  45.705  1.00 60.48  ? 206  CYS C C   1 
ATOM   2518  O O   . CYS D  1 66  ? 41.155  44.395  45.760  1.00 62.80  ? 206  CYS C O   1 
ATOM   2519  C CB  . CYS D  1 66  ? 42.707  42.659  43.564  1.00 58.20  ? 206  CYS C CB  1 
ATOM   2520  S SG  . CYS D  1 66  ? 42.578  41.147  42.547  1.00 63.16  ? 206  CYS C SG  1 
ATOM   2521  N N   . THR D  1 67  ? 43.347  44.426  46.218  1.00 59.97  ? 207  THR C N   1 
ATOM   2522  C CA  . THR D  1 67  ? 43.282  45.760  46.808  1.00 60.36  ? 207  THR C CA  1 
ATOM   2523  C C   . THR D  1 67  ? 43.684  46.705  45.686  1.00 62.43  ? 207  THR C C   1 
ATOM   2524  O O   . THR D  1 67  ? 44.085  46.254  44.610  1.00 60.45  ? 207  THR C O   1 
ATOM   2525  C CB  . THR D  1 67  ? 44.282  45.938  47.968  1.00 60.39  ? 207  THR C CB  1 
ATOM   2526  O OG1 . THR D  1 67  ? 45.627  45.883  47.474  1.00 57.42  ? 207  THR C OG1 1 
ATOM   2527  C CG2 . THR D  1 67  ? 44.083  44.865  48.993  1.00 55.15  ? 207  THR C CG2 1 
ATOM   2528  N N   . VAL D  1 68  ? 43.581  48.008  45.921  1.00 63.61  ? 208  VAL C N   1 
ATOM   2529  C CA  . VAL D  1 68  ? 43.961  48.963  44.889  1.00 62.98  ? 208  VAL C CA  1 
ATOM   2530  C C   . VAL D  1 68  ? 45.377  48.642  44.472  1.00 62.11  ? 208  VAL C C   1 
ATOM   2531  O O   . VAL D  1 68  ? 45.678  48.499  43.283  1.00 61.33  ? 208  VAL C O   1 
ATOM   2532  C CB  . VAL D  1 68  ? 43.909  50.405  45.408  1.00 60.82  ? 208  VAL C CB  1 
ATOM   2533  C CG1 . VAL D  1 68  ? 44.619  51.336  44.455  1.00 51.75  ? 208  VAL C CG1 1 
ATOM   2534  C CG2 . VAL D  1 68  ? 42.468  50.827  45.551  1.00 61.92  ? 208  VAL C CG2 1 
ATOM   2535  N N   . GLU D  1 69  ? 46.236  48.518  45.477  1.00 63.51  ? 209  GLU C N   1 
ATOM   2536  C CA  . GLU D  1 69  ? 47.646  48.198  45.281  1.00 60.65  ? 209  GLU C CA  1 
ATOM   2537  C C   . GLU D  1 69  ? 47.770  47.043  44.302  1.00 55.21  ? 209  GLU C C   1 
ATOM   2538  O O   . GLU D  1 69  ? 48.405  47.145  43.264  1.00 48.11  ? 209  GLU C O   1 
ATOM   2539  C CB  . GLU D  1 69  ? 48.260  47.791  46.624  1.00 72.45  ? 209  GLU C CB  1 
ATOM   2540  C CG  . GLU D  1 69  ? 49.777  47.653  46.628  1.00 87.07  ? 209  GLU C CG  1 
ATOM   2541  C CD  . GLU D  1 69  ? 50.477  48.983  46.389  1.00 96.64  ? 209  GLU C CD  1 
ATOM   2542  O OE1 . GLU D  1 69  ? 50.182  49.633  45.356  1.00 100.00 ? 209  GLU C OE1 1 
ATOM   2543  O OE2 . GLU D  1 69  ? 51.319  49.375  47.232  1.00 92.34  ? 209  GLU C OE2 1 
ATOM   2544  N N   . GLN D  1 70  ? 47.124  45.943  44.652  1.00 56.97  ? 210  GLN C N   1 
ATOM   2545  C CA  . GLN D  1 70  ? 47.149  44.732  43.856  1.00 59.55  ? 210  GLN C CA  1 
ATOM   2546  C C   . GLN D  1 70  ? 46.615  44.903  42.444  1.00 57.47  ? 210  GLN C C   1 
ATOM   2547  O O   . GLN D  1 70  ? 47.143  44.312  41.496  1.00 56.46  ? 210  GLN C O   1 
ATOM   2548  C CB  . GLN D  1 70  ? 46.371  43.643  44.589  1.00 62.78  ? 210  GLN C CB  1 
ATOM   2549  C CG  . GLN D  1 70  ? 46.878  43.404  46.006  1.00 72.58  ? 210  GLN C CG  1 
ATOM   2550  C CD  . GLN D  1 70  ? 46.079  42.351  46.744  1.00 77.79  ? 210  GLN C CD  1 
ATOM   2551  O OE1 . GLN D  1 70  ? 45.958  41.215  46.283  1.00 80.76  ? 210  GLN C OE1 1 
ATOM   2552  N NE2 . GLN D  1 70  ? 45.529  42.720  47.898  1.00 77.64  ? 210  GLN C NE2 1 
ATOM   2553  N N   . ILE D  1 71  ? 45.565  45.702  42.306  1.00 57.18  ? 211  ILE C N   1 
ATOM   2554  C CA  . ILE D  1 71  ? 44.963  45.929  41.001  1.00 58.30  ? 211  ILE C CA  1 
ATOM   2555  C C   . ILE D  1 71  ? 45.981  46.600  40.094  1.00 60.50  ? 211  ILE C C   1 
ATOM   2556  O O   . ILE D  1 71  ? 46.294  46.098  39.004  1.00 61.40  ? 211  ILE C O   1 
ATOM   2557  C CB  . ILE D  1 71  ? 43.682  46.795  41.124  1.00 59.43  ? 211  ILE C CB  1 
ATOM   2558  C CG1 . ILE D  1 71  ? 42.574  45.964  41.766  1.00 55.25  ? 211  ILE C CG1 1 
ATOM   2559  C CG2 . ILE D  1 71  ? 43.223  47.288  39.746  1.00 52.50  ? 211  ILE C CG2 1 
ATOM   2560  C CD1 . ILE D  1 71  ? 41.345  46.747  42.093  1.00 50.26  ? 211  ILE C CD1 1 
ATOM   2561  N N   . TYR D  1 72  ? 46.511  47.728  40.549  1.00 56.06  ? 212  TYR C N   1 
ATOM   2562  C CA  . TYR D  1 72  ? 47.501  48.433  39.764  1.00 56.29  ? 212  TYR C CA  1 
ATOM   2563  C C   . TYR D  1 72  ? 48.601  47.471  39.343  1.00 59.68  ? 212  TYR C C   1 
ATOM   2564  O O   . TYR D  1 72  ? 48.986  47.435  38.172  1.00 63.28  ? 212  TYR C O   1 
ATOM   2565  C CB  . TYR D  1 72  ? 48.070  49.581  40.577  1.00 54.69  ? 212  TYR C CB  1 
ATOM   2566  C CG  . TYR D  1 72  ? 47.167  50.781  40.627  1.00 60.78  ? 212  TYR C CG  1 
ATOM   2567  C CD1 . TYR D  1 72  ? 46.569  51.266  39.469  1.00 69.37  ? 212  TYR C CD1 1 
ATOM   2568  C CD2 . TYR D  1 72  ? 46.958  51.478  41.815  1.00 63.25  ? 212  TYR C CD2 1 
ATOM   2569  C CE1 . TYR D  1 72  ? 45.791  52.419  39.485  1.00 67.80  ? 212  TYR C CE1 1 
ATOM   2570  C CE2 . TYR D  1 72  ? 46.184  52.630  41.844  1.00 65.77  ? 212  TYR C CE2 1 
ATOM   2571  C CZ  . TYR D  1 72  ? 45.605  53.094  40.675  1.00 67.82  ? 212  TYR C CZ  1 
ATOM   2572  O OH  . TYR D  1 72  ? 44.844  54.233  40.704  1.00 74.98  ? 212  TYR C OH  1 
ATOM   2573  N N   . GLU D  1 73  ? 49.087  46.681  40.302  1.00 63.48  ? 213  GLU C N   1 
ATOM   2574  C CA  . GLU D  1 73  ? 50.138  45.688  40.052  1.00 62.89  ? 213  GLU C CA  1 
ATOM   2575  C C   . GLU D  1 73  ? 49.769  44.760  38.896  1.00 59.63  ? 213  GLU C C   1 
ATOM   2576  O O   . GLU D  1 73  ? 50.556  44.551  37.972  1.00 58.30  ? 213  GLU C O   1 
ATOM   2577  C CB  . GLU D  1 73  ? 50.368  44.839  41.297  1.00 67.27  ? 213  GLU C CB  1 
ATOM   2578  C CG  . GLU D  1 73  ? 51.339  45.415  42.326  1.00 82.89  ? 213  GLU C CG  1 
ATOM   2579  C CD  . GLU D  1 73  ? 51.442  44.531  43.581  1.00 90.94  ? 213  GLU C CD  1 
ATOM   2580  O OE1 . GLU D  1 73  ? 51.419  43.280  43.437  1.00 96.49  ? 213  GLU C OE1 1 
ATOM   2581  O OE2 . GLU D  1 73  ? 51.552  45.083  44.704  1.00 84.21  ? 213  GLU C OE2 1 
ATOM   2582  N N   . ILE D  1 74  ? 48.564  44.204  38.966  1.00 52.92  ? 214  ILE C N   1 
ATOM   2583  C CA  . ILE D  1 74  ? 48.080  43.295  37.945  1.00 49.56  ? 214  ILE C CA  1 
ATOM   2584  C C   . ILE D  1 74  ? 48.013  43.954  36.579  1.00 51.26  ? 214  ILE C C   1 
ATOM   2585  O O   . ILE D  1 74  ? 48.382  43.362  35.563  1.00 51.84  ? 214  ILE C O   1 
ATOM   2586  C CB  . ILE D  1 74  ? 46.683  42.756  38.310  1.00 45.81  ? 214  ILE C CB  1 
ATOM   2587  C CG1 . ILE D  1 74  ? 46.762  42.076  39.677  1.00 45.71  ? 214  ILE C CG1 1 
ATOM   2588  C CG2 . ILE D  1 74  ? 46.176  41.794  37.217  1.00 33.22  ? 214  ILE C CG2 1 
ATOM   2589  C CD1 . ILE D  1 74  ? 45.472  41.446  40.141  1.00 43.11  ? 214  ILE C CD1 1 
ATOM   2590  N N   . LEU D  1 75  ? 47.541  45.186  36.546  1.00 51.43  ? 215  LEU C N   1 
ATOM   2591  C CA  . LEU D  1 75  ? 47.444  45.868  35.279  1.00 52.82  ? 215  LEU C CA  1 
ATOM   2592  C C   . LEU D  1 75  ? 48.842  46.173  34.762  1.00 54.37  ? 215  LEU C C   1 
ATOM   2593  O O   . LEU D  1 75  ? 49.092  46.093  33.555  1.00 63.93  ? 215  LEU C O   1 
ATOM   2594  C CB  . LEU D  1 75  ? 46.613  47.140  35.437  1.00 52.80  ? 215  LEU C CB  1 
ATOM   2595  C CG  . LEU D  1 75  ? 45.150  46.880  35.815  1.00 38.65  ? 215  LEU C CG  1 
ATOM   2596  C CD1 . LEU D  1 75  ? 44.461  48.204  36.031  1.00 41.59  ? 215  LEU C CD1 1 
ATOM   2597  C CD2 . LEU D  1 75  ? 44.453  46.079  34.731  1.00 36.54  ? 215  LEU C CD2 1 
ATOM   2598  N N   . LYS D  1 76  ? 49.754  46.502  35.670  1.00 46.24  ? 216  LYS C N   1 
ATOM   2599  C CA  . LYS D  1 76  ? 51.129  46.805  35.277  1.00 49.31  ? 216  LYS C CA  1 
ATOM   2600  C C   . LYS D  1 76  ? 51.705  45.635  34.484  1.00 52.32  ? 216  LYS C C   1 
ATOM   2601  O O   . LYS D  1 76  ? 52.358  45.802  33.448  1.00 57.05  ? 216  LYS C O   1 
ATOM   2602  C CB  . LYS D  1 76  ? 52.003  47.064  36.510  1.00 39.59  ? 216  LYS C CB  1 
ATOM   2603  C CG  . LYS D  1 76  ? 53.406  47.611  36.192  1.00 29.85  ? 216  LYS C CG  1 
ATOM   2604  C CD  . LYS D  1 76  ? 53.300  48.889  35.373  1.00 54.40  ? 216  LYS C CD  1 
ATOM   2605  C CE  . LYS D  1 76  ? 54.642  49.545  35.096  1.00 59.27  ? 216  LYS C CE  1 
ATOM   2606  N NZ  . LYS D  1 76  ? 54.477  50.789  34.272  1.00 57.68  ? 216  LYS C NZ  1 
ATOM   2607  N N   . ILE D  1 77  ? 51.458  44.440  34.983  1.00 49.82  ? 217  ILE C N   1 
ATOM   2608  C CA  . ILE D  1 77  ? 51.935  43.243  34.323  1.00 49.55  ? 217  ILE C CA  1 
ATOM   2609  C C   . ILE D  1 77  ? 51.422  43.168  32.892  1.00 46.27  ? 217  ILE C C   1 
ATOM   2610  O O   . ILE D  1 77  ? 52.201  43.075  31.944  1.00 45.27  ? 217  ILE C O   1 
ATOM   2611  C CB  . ILE D  1 77  ? 51.448  41.987  35.076  1.00 52.66  ? 217  ILE C CB  1 
ATOM   2612  C CG1 . ILE D  1 77  ? 52.167  41.892  36.416  1.00 44.31  ? 217  ILE C CG1 1 
ATOM   2613  C CG2 . ILE D  1 77  ? 51.624  40.747  34.216  1.00 41.43  ? 217  ILE C CG2 1 
ATOM   2614  C CD1 . ILE D  1 77  ? 51.638  40.802  37.262  1.00 51.08  ? 217  ILE C CD1 1 
ATOM   2615  N N   . TYR D  1 78  ? 50.106  43.195  32.732  1.00 40.10  ? 218  TYR C N   1 
ATOM   2616  C CA  . TYR D  1 78  ? 49.568  43.090  31.399  1.00 43.10  ? 218  TYR C CA  1 
ATOM   2617  C C   . TYR D  1 78  ? 49.912  44.299  30.550  1.00 47.67  ? 218  TYR C C   1 
ATOM   2618  O O   . TYR D  1 78  ? 50.004  44.212  29.312  1.00 43.63  ? 218  TYR C O   1 
ATOM   2619  C CB  . TYR D  1 78  ? 48.072  42.837  31.468  1.00 41.13  ? 218  TYR C CB  1 
ATOM   2620  C CG  . TYR D  1 78  ? 47.787  41.461  32.004  1.00 45.72  ? 218  TYR C CG  1 
ATOM   2621  C CD1 . TYR D  1 78  ? 47.691  41.237  33.380  1.00 48.25  ? 218  TYR C CD1 1 
ATOM   2622  C CD2 . TYR D  1 78  ? 47.694  40.354  31.138  1.00 45.90  ? 218  TYR C CD2 1 
ATOM   2623  C CE1 . TYR D  1 78  ? 47.517  39.948  33.893  1.00 46.15  ? 218  TYR C CE1 1 
ATOM   2624  C CE2 . TYR D  1 78  ? 47.517  39.056  31.634  1.00 41.89  ? 218  TYR C CE2 1 
ATOM   2625  C CZ  . TYR D  1 78  ? 47.430  38.862  33.016  1.00 49.14  ? 218  TYR C CZ  1 
ATOM   2626  O OH  . TYR D  1 78  ? 47.250  37.592  33.526  1.00 52.48  ? 218  TYR C OH  1 
ATOM   2627  N N   . GLN D  1 79  ? 50.136  45.426  31.212  1.00 49.15  ? 219  GLN C N   1 
ATOM   2628  C CA  . GLN D  1 79  ? 50.501  46.622  30.480  1.00 51.45  ? 219  GLN C CA  1 
ATOM   2629  C C   . GLN D  1 79  ? 51.835  46.366  29.805  1.00 49.90  ? 219  GLN C C   1 
ATOM   2630  O O   . GLN D  1 79  ? 52.059  46.782  28.671  1.00 50.74  ? 219  GLN C O   1 
ATOM   2631  C CB  . GLN D  1 79  ? 50.671  47.801  31.414  1.00 48.55  ? 219  GLN C CB  1 
ATOM   2632  C CG  . GLN D  1 79  ? 51.233  48.995  30.685  1.00 53.64  ? 219  GLN C CG  1 
ATOM   2633  C CD  . GLN D  1 79  ? 52.210  49.782  31.523  1.00 62.75  ? 219  GLN C CD  1 
ATOM   2634  O OE1 . GLN D  1 79  ? 51.980  50.036  32.714  1.00 70.74  ? 219  GLN C OE1 1 
ATOM   2635  N NE2 . GLN D  1 79  ? 53.307  50.188  30.905  1.00 57.70  ? 219  GLN C NE2 1 
ATOM   2636  N N   . LEU D  1 80  ? 52.707  45.667  30.527  1.00 46.31  ? 220  LEU C N   1 
ATOM   2637  C CA  . LEU D  1 80  ? 54.050  45.355  30.063  1.00 45.00  ? 220  LEU C CA  1 
ATOM   2638  C C   . LEU D  1 80  ? 54.204  44.078  29.277  1.00 42.88  ? 220  LEU C C   1 
ATOM   2639  O O   . LEU D  1 80  ? 55.292  43.772  28.819  1.00 41.78  ? 220  LEU C O   1 
ATOM   2640  C CB  . LEU D  1 80  ? 55.019  45.306  31.244  1.00 38.19  ? 220  LEU C CB  1 
ATOM   2641  C CG  . LEU D  1 80  ? 55.153  46.639  31.969  1.00 44.67  ? 220  LEU C CG  1 
ATOM   2642  C CD1 . LEU D  1 80  ? 56.012  46.462  33.199  1.00 31.63  ? 220  LEU C CD1 1 
ATOM   2643  C CD2 . LEU D  1 80  ? 55.742  47.699  31.011  1.00 44.35  ? 220  LEU C CD2 1 
ATOM   2644  N N   . MET D  1 81  ? 53.140  43.312  29.143  1.00 39.56  ? 221  MET C N   1 
ATOM   2645  C CA  . MET D  1 81  ? 53.244  42.105  28.367  1.00 45.63  ? 221  MET C CA  1 
ATOM   2646  C C   . MET D  1 81  ? 53.324  42.419  26.881  1.00 47.87  ? 221  MET C C   1 
ATOM   2647  O O   . MET D  1 81  ? 53.115  43.553  26.472  1.00 52.62  ? 221  MET C O   1 
ATOM   2648  C CB  . MET D  1 81  ? 52.048  41.229  28.627  1.00 50.97  ? 221  MET C CB  1 
ATOM   2649  C CG  . MET D  1 81  ? 52.146  40.476  29.917  1.00 61.27  ? 221  MET C CG  1 
ATOM   2650  S SD  . MET D  1 81  ? 51.166  39.020  29.693  1.00 79.24  ? 221  MET C SD  1 
ATOM   2651  C CE  . MET D  1 81  ? 51.688  38.523  27.952  1.00 82.76  ? 221  MET C CE  1 
ATOM   2652  N N   . ASP D  1 82  ? 53.650  41.418  26.076  1.00 50.74  ? 222  ASP C N   1 
ATOM   2653  C CA  . ASP D  1 82  ? 53.724  41.607  24.637  1.00 49.78  ? 222  ASP C CA  1 
ATOM   2654  C C   . ASP D  1 82  ? 52.495  40.920  24.049  1.00 50.60  ? 222  ASP C C   1 
ATOM   2655  O O   . ASP D  1 82  ? 52.393  39.687  24.036  1.00 39.71  ? 222  ASP C O   1 
ATOM   2656  C CB  . ASP D  1 82  ? 55.011  41.001  24.062  1.00 52.03  ? 222  ASP C CB  1 
ATOM   2657  C CG  . ASP D  1 82  ? 55.076  41.090  22.535  1.00 55.84  ? 222  ASP C CG  1 
ATOM   2658  O OD1 . ASP D  1 82  ? 54.011  41.170  21.896  1.00 63.19  ? 222  ASP C OD1 1 
ATOM   2659  O OD2 . ASP D  1 82  ? 56.182  41.073  21.959  1.00 54.48  ? 222  ASP C OD2 1 
ATOM   2660  N N   . HIS D  1 83  ? 51.561  41.740  23.573  1.00 49.21  ? 224  HIS C N   1 
ATOM   2661  C CA  . HIS D  1 83  ? 50.319  41.248  22.999  1.00 47.79  ? 224  HIS C CA  1 
ATOM   2662  C C   . HIS D  1 83  ? 50.410  41.104  21.491  1.00 47.21  ? 224  HIS C C   1 
ATOM   2663  O O   . HIS D  1 83  ? 49.391  40.954  20.833  1.00 49.65  ? 224  HIS C O   1 
ATOM   2664  C CB  . HIS D  1 83  ? 49.169  42.207  23.336  1.00 43.97  ? 224  HIS C CB  1 
ATOM   2665  C CG  . HIS D  1 83  ? 48.952  42.409  24.801  1.00 37.65  ? 224  HIS C CG  1 
ATOM   2666  N ND1 . HIS D  1 83  ? 47.975  41.735  25.505  1.00 30.95  ? 224  HIS C ND1 1 
ATOM   2667  C CD2 . HIS D  1 83  ? 49.623  43.167  25.706  1.00 33.70  ? 224  HIS C CD2 1 
ATOM   2668  C CE1 . HIS D  1 83  ? 48.061  42.068  26.786  1.00 38.86  ? 224  HIS C CE1 1 
ATOM   2669  N NE2 . HIS D  1 83  ? 49.052  42.933  26.936  1.00 26.24  ? 224  HIS C NE2 1 
ATOM   2670  N N   . SER D  1 84  ? 51.618  41.123  20.947  1.00 43.74  ? 225  SER C N   1 
ATOM   2671  C CA  . SER D  1 84  ? 51.791  41.043  19.503  1.00 48.41  ? 225  SER C CA  1 
ATOM   2672  C C   . SER D  1 84  ? 51.018  39.960  18.769  1.00 49.89  ? 225  SER C C   1 
ATOM   2673  O O   . SER D  1 84  ? 50.596  40.164  17.621  1.00 56.12  ? 225  SER C O   1 
ATOM   2674  C CB  . SER D  1 84  ? 53.269  40.933  19.154  1.00 42.00  ? 225  SER C CB  1 
ATOM   2675  O OG  . SER D  1 84  ? 53.973  42.088  19.576  1.00 33.37  ? 225  SER C OG  1 
ATOM   2676  N N   . ASN D  1 85  ? 50.815  38.822  19.416  1.00 54.11  ? 226  ASN C N   1 
ATOM   2677  C CA  . ASN D  1 85  ? 50.094  37.719  18.775  1.00 59.91  ? 226  ASN C CA  1 
ATOM   2678  C C   . ASN D  1 85  ? 48.674  37.635  19.273  1.00 57.59  ? 226  ASN C C   1 
ATOM   2679  O O   . ASN D  1 85  ? 48.029  36.602  19.179  1.00 57.29  ? 226  ASN C O   1 
ATOM   2680  C CB  . ASN D  1 85  ? 50.797  36.388  19.034  1.00 67.02  ? 226  ASN C CB  1 
ATOM   2681  C CG  . ASN D  1 85  ? 52.129  36.275  18.312  1.00 69.02  ? 226  ASN C CG  1 
ATOM   2682  O OD1 . ASN D  1 85  ? 52.901  35.358  18.573  1.00 77.63  ? 226  ASN C OD1 1 
ATOM   2683  N ND2 . ASN D  1 85  ? 52.400  37.201  17.399  1.00 66.42  ? 226  ASN C ND2 1 
ATOM   2684  N N   . MET D  1 86  ? 48.200  38.744  19.806  1.00 57.73  ? 227  MET C N   1 
ATOM   2685  C CA  . MET D  1 86  ? 46.856  38.836  20.318  1.00 52.99  ? 227  MET C CA  1 
ATOM   2686  C C   . MET D  1 86  ? 46.076  39.885  19.500  1.00 56.25  ? 227  MET C C   1 
ATOM   2687  O O   . MET D  1 86  ? 46.628  40.888  19.049  1.00 55.90  ? 227  MET C O   1 
ATOM   2688  C CB  . MET D  1 86  ? 46.932  39.219  21.784  1.00 56.46  ? 227  MET C CB  1 
ATOM   2689  C CG  . MET D  1 86  ? 47.878  38.340  22.550  1.00 43.20  ? 227  MET C CG  1 
ATOM   2690  S SD  . MET D  1 86  ? 47.177  36.748  22.679  1.00 65.56  ? 227  MET C SD  1 
ATOM   2691  C CE  . MET D  1 86  ? 47.186  36.504  24.514  1.00 45.62  ? 227  MET C CE  1 
ATOM   2692  N N   . ASP D  1 87  ? 44.788  39.642  19.302  1.00 57.67  ? 228  ASP C N   1 
ATOM   2693  C CA  . ASP D  1 87  ? 43.960  40.557  18.536  1.00 53.88  ? 228  ASP C CA  1 
ATOM   2694  C C   . ASP D  1 87  ? 43.117  41.499  19.385  1.00 53.88  ? 228  ASP C C   1 
ATOM   2695  O O   . ASP D  1 87  ? 42.607  42.508  18.878  1.00 54.42  ? 228  ASP C O   1 
ATOM   2696  C CB  . ASP D  1 87  ? 43.042  39.769  17.606  1.00 54.38  ? 228  ASP C CB  1 
ATOM   2697  C CG  . ASP D  1 87  ? 43.753  39.299  16.362  1.00 58.43  ? 228  ASP C CG  1 
ATOM   2698  O OD1 . ASP D  1 87  ? 44.719  39.975  15.967  1.00 55.93  ? 228  ASP C OD1 1 
ATOM   2699  O OD2 . ASP D  1 87  ? 43.347  38.278  15.771  1.00 57.64  ? 228  ASP C OD2 1 
ATOM   2700  N N   . CYS D  1 88  ? 42.979  41.181  20.670  1.00 45.16  ? 229  CYS C N   1 
ATOM   2701  C CA  . CYS D  1 88  ? 42.163  41.982  21.555  1.00 43.90  ? 229  CYS C CA  1 
ATOM   2702  C C   . CYS D  1 88  ? 42.583  41.796  22.999  1.00 45.30  ? 229  CYS C C   1 
ATOM   2703  O O   . CYS D  1 88  ? 43.274  40.847  23.312  1.00 51.98  ? 229  CYS C O   1 
ATOM   2704  C CB  . CYS D  1 88  ? 40.699  41.576  21.389  1.00 45.98  ? 229  CYS C CB  1 
ATOM   2705  S SG  . CYS D  1 88  ? 39.519  42.453  22.486  1.00 41.91  ? 229  CYS C SG  1 
ATOM   2706  N N   . PHE D  1 89  ? 42.182  42.721  23.868  1.00 45.42  ? 230  PHE C N   1 
ATOM   2707  C CA  . PHE D  1 89  ? 42.479  42.667  25.298  1.00 40.13  ? 230  PHE C CA  1 
ATOM   2708  C C   . PHE D  1 89  ? 41.206  43.078  26.031  1.00 45.32  ? 230  PHE C C   1 
ATOM   2709  O O   . PHE D  1 89  ? 40.534  44.023  25.632  1.00 50.07  ? 230  PHE C O   1 
ATOM   2710  C CB  . PHE D  1 89  ? 43.601  43.632  25.677  1.00 33.82  ? 230  PHE C CB  1 
ATOM   2711  C CG  . PHE D  1 89  ? 43.805  43.758  27.164  1.00 42.08  ? 230  PHE C CG  1 
ATOM   2712  C CD1 . PHE D  1 89  ? 44.325  42.698  27.900  1.00 45.33  ? 230  PHE C CD1 1 
ATOM   2713  C CD2 . PHE D  1 89  ? 43.485  44.942  27.834  1.00 40.32  ? 230  PHE C CD2 1 
ATOM   2714  C CE1 . PHE D  1 89  ? 44.531  42.813  29.290  1.00 44.95  ? 230  PHE C CE1 1 
ATOM   2715  C CE2 . PHE D  1 89  ? 43.685  45.078  29.219  1.00 36.76  ? 230  PHE C CE2 1 
ATOM   2716  C CZ  . PHE D  1 89  ? 44.212  44.008  29.951  1.00 43.65  ? 230  PHE C CZ  1 
ATOM   2717  N N   . ILE D  1 90  ? 40.872  42.370  27.101  1.00 45.12  ? 231  ILE C N   1 
ATOM   2718  C CA  . ILE D  1 90  ? 39.665  42.674  27.854  1.00 39.40  ? 231  ILE C CA  1 
ATOM   2719  C C   . ILE D  1 90  ? 39.949  42.656  29.333  1.00 44.20  ? 231  ILE C C   1 
ATOM   2720  O O   . ILE D  1 90  ? 40.649  41.776  29.818  1.00 56.65  ? 231  ILE C O   1 
ATOM   2721  C CB  . ILE D  1 90  ? 38.548  41.642  27.595  1.00 30.51  ? 231  ILE C CB  1 
ATOM   2722  C CG1 . ILE D  1 90  ? 38.188  41.606  26.117  1.00 33.53  ? 231  ILE C CG1 1 
ATOM   2723  C CG2 . ILE D  1 90  ? 37.318  42.005  28.387  1.00 25.87  ? 231  ILE C CG2 1 
ATOM   2724  C CD1 . ILE D  1 90  ? 36.977  40.760  25.829  1.00 23.82  ? 231  ILE C CD1 1 
ATOM   2725  N N   . CYS D  1 91  ? 39.401  43.624  30.052  1.00 41.45  ? 232  CYS C N   1 
ATOM   2726  C CA  . CYS D  1 91  ? 39.582  43.686  31.487  1.00 40.78  ? 232  CYS C CA  1 
ATOM   2727  C C   . CYS D  1 91  ? 38.239  43.963  32.152  1.00 47.06  ? 232  CYS C C   1 
ATOM   2728  O O   . CYS D  1 91  ? 37.619  45.002  31.916  1.00 41.09  ? 232  CYS C O   1 
ATOM   2729  C CB  . CYS D  1 91  ? 40.575  44.776  31.843  1.00 34.41  ? 232  CYS C CB  1 
ATOM   2730  S SG  . CYS D  1 91  ? 40.625  45.174  33.601  1.00 47.74  ? 232  CYS C SG  1 
ATOM   2731  N N   . CYS D  1 92  ? 37.782  43.018  32.971  1.00 50.52  ? 233  CYS C N   1 
ATOM   2732  C CA  . CYS D  1 92  ? 36.513  43.168  33.686  1.00 46.23  ? 233  CYS C CA  1 
ATOM   2733  C C   . CYS D  1 92  ? 36.806  43.435  35.141  1.00 43.14  ? 233  CYS C C   1 
ATOM   2734  O O   . CYS D  1 92  ? 37.678  42.813  35.737  1.00 46.30  ? 233  CYS C O   1 
ATOM   2735  C CB  . CYS D  1 92  ? 35.673  41.900  33.592  1.00 41.62  ? 233  CYS C CB  1 
ATOM   2736  S SG  . CYS D  1 92  ? 35.475  41.265  31.938  1.00 49.64  ? 233  CYS C SG  1 
ATOM   2737  N N   . ILE D  1 93  ? 36.073  44.366  35.716  1.00 43.65  ? 234  ILE C N   1 
ATOM   2738  C CA  . ILE D  1 93  ? 36.266  44.685  37.112  1.00 44.95  ? 234  ILE C CA  1 
ATOM   2739  C C   . ILE D  1 93  ? 34.925  44.658  37.820  1.00 47.99  ? 234  ILE C C   1 
ATOM   2740  O O   . ILE D  1 93  ? 34.010  45.402  37.462  1.00 47.13  ? 234  ILE C O   1 
ATOM   2741  C CB  . ILE D  1 93  ? 36.900  46.045  37.272  1.00 39.86  ? 234  ILE C CB  1 
ATOM   2742  C CG1 . ILE D  1 93  ? 38.283  46.026  36.627  1.00 34.27  ? 234  ILE C CG1 1 
ATOM   2743  C CG2 . ILE D  1 93  ? 36.989  46.401  38.738  1.00 28.70  ? 234  ILE C CG2 1 
ATOM   2744  C CD1 . ILE D  1 93  ? 38.988  47.353  36.725  1.00 35.70  ? 234  ILE C CD1 1 
ATOM   2745  N N   . LEU D  1 94  ? 34.822  43.762  38.799  1.00 41.38  ? 235  LEU C N   1 
ATOM   2746  C CA  . LEU D  1 94  ? 33.624  43.583  39.584  1.00 37.03  ? 235  LEU C CA  1 
ATOM   2747  C C   . LEU D  1 94  ? 33.999  44.032  40.966  1.00 40.06  ? 235  LEU C C   1 
ATOM   2748  O O   . LEU D  1 94  ? 34.820  43.402  41.610  1.00 51.82  ? 235  LEU C O   1 
ATOM   2749  C CB  . LEU D  1 94  ? 33.252  42.109  39.592  1.00 43.35  ? 235  LEU C CB  1 
ATOM   2750  C CG  . LEU D  1 94  ? 33.442  41.388  38.247  1.00 43.13  ? 235  LEU C CG  1 
ATOM   2751  C CD1 . LEU D  1 94  ? 33.038  39.942  38.372  1.00 44.74  ? 235  LEU C CD1 1 
ATOM   2752  C CD2 . LEU D  1 94  ? 32.609  42.041  37.186  1.00 36.74  ? 235  LEU C CD2 1 
ATOM   2753  N N   . SER D  1 95  ? 33.419  45.123  41.437  1.00 40.86  ? 236  SER C N   1 
ATOM   2754  C CA  . SER D  1 95  ? 33.760  45.600  42.765  1.00 39.14  ? 236  SER C CA  1 
ATOM   2755  C C   . SER D  1 95  ? 32.829  46.722  43.151  1.00 38.36  ? 236  SER C C   1 
ATOM   2756  O O   . SER D  1 95  ? 31.878  46.990  42.447  1.00 37.02  ? 236  SER C O   1 
ATOM   2757  C CB  . SER D  1 95  ? 35.205  46.084  42.757  1.00 31.73  ? 236  SER C CB  1 
ATOM   2758  O OG  . SER D  1 95  ? 35.578  46.648  43.998  1.00 41.33  ? 236  SER C OG  1 
ATOM   2759  N N   . HIS D  1 96  ? 33.085  47.345  44.292  1.00 47.50  ? 237  HIS C N   1 
ATOM   2760  C CA  . HIS D  1 96  ? 32.289  48.472  44.727  1.00 55.89  ? 237  HIS C CA  1 
ATOM   2761  C C   . HIS D  1 96  ? 32.926  49.656  44.067  1.00 57.45  ? 237  HIS C C   1 
ATOM   2762  O O   . HIS D  1 96  ? 34.062  49.570  43.626  1.00 59.74  ? 237  HIS C O   1 
ATOM   2763  C CB  . HIS D  1 96  ? 32.378  48.672  46.233  1.00 63.57  ? 237  HIS C CB  1 
ATOM   2764  C CG  . HIS D  1 96  ? 31.408  47.843  47.006  1.00 70.86  ? 237  HIS C CG  1 
ATOM   2765  N ND1 . HIS D  1 96  ? 30.077  47.747  46.663  1.00 69.35  ? 237  HIS C ND1 1 
ATOM   2766  C CD2 . HIS D  1 96  ? 31.570  47.086  48.114  1.00 72.37  ? 237  HIS C CD2 1 
ATOM   2767  C CE1 . HIS D  1 96  ? 29.461  46.963  47.528  1.00 73.98  ? 237  HIS C CE1 1 
ATOM   2768  N NE2 . HIS D  1 96  ? 30.344  46.550  48.419  1.00 77.18  ? 237  HIS C NE2 1 
ATOM   2769  N N   . GLY D  1 97  ? 32.203  50.766  44.013  1.00 65.61  ? 238  GLY C N   1 
ATOM   2770  C CA  . GLY D  1 97  ? 32.752  51.965  43.412  1.00 69.26  ? 238  GLY C CA  1 
ATOM   2771  C C   . GLY D  1 97  ? 31.961  53.215  43.729  1.00 67.11  ? 238  GLY C C   1 
ATOM   2772  O O   . GLY D  1 97  ? 30.921  53.158  44.371  1.00 72.35  ? 238  GLY C O   1 
ATOM   2773  N N   . ASP D  1 98  ? 32.463  54.347  43.263  1.00 67.73  ? 239  ASP C N   1 
ATOM   2774  C CA  . ASP D  1 98  ? 31.811  55.626  43.466  1.00 69.23  ? 239  ASP C CA  1 
ATOM   2775  C C   . ASP D  1 98  ? 32.052  56.468  42.211  1.00 69.02  ? 239  ASP C C   1 
ATOM   2776  O O   . ASP D  1 98  ? 32.567  55.960  41.211  1.00 68.11  ? 239  ASP C O   1 
ATOM   2777  C CB  . ASP D  1 98  ? 32.388  56.308  44.705  1.00 71.14  ? 239  ASP C CB  1 
ATOM   2778  C CG  . ASP D  1 98  ? 31.469  57.369  45.269  1.00 77.94  ? 239  ASP C CG  1 
ATOM   2779  O OD1 . ASP D  1 98  ? 30.602  57.880  44.521  1.00 82.08  ? 239  ASP C OD1 1 
ATOM   2780  O OD2 . ASP D  1 98  ? 31.617  57.696  46.467  1.00 83.25  ? 239  ASP C OD2 1 
ATOM   2781  N N   . LYS D  1 99  ? 31.686  57.745  42.258  1.00 67.59  ? 240  LYS C N   1 
ATOM   2782  C CA  . LYS D  1 99  ? 31.851  58.622  41.103  1.00 62.84  ? 240  LYS C CA  1 
ATOM   2783  C C   . LYS D  1 99  ? 33.229  58.502  40.485  1.00 56.42  ? 240  LYS C C   1 
ATOM   2784  O O   . LYS D  1 99  ? 34.223  58.911  41.089  1.00 52.61  ? 240  LYS C O   1 
ATOM   2785  C CB  . LYS D  1 99  ? 31.610  60.085  41.478  1.00 67.76  ? 240  LYS C CB  1 
ATOM   2786  C CG  . LYS D  1 99  ? 30.206  60.407  41.948  1.00 76.33  ? 240  LYS C CG  1 
ATOM   2787  C CD  . LYS D  1 99  ? 30.110  61.881  42.322  1.00 85.04  ? 240  LYS C CD  1 
ATOM   2788  C CE  . LYS D  1 99  ? 29.021  62.124  43.348  1.00 89.02  ? 240  LYS C CE  1 
ATOM   2789  N NZ  . LYS D  1 99  ? 28.926  63.571  43.686  1.00 89.49  ? 240  LYS C NZ  1 
ATOM   2790  N N   . GLY D  1 100 ? 33.268  57.933  39.280  1.00 51.30  ? 241  GLY C N   1 
ATOM   2791  C CA  . GLY D  1 100 ? 34.510  57.782  38.547  1.00 46.57  ? 241  GLY C CA  1 
ATOM   2792  C C   . GLY D  1 100 ? 35.573  56.862  39.121  1.00 49.67  ? 241  GLY C C   1 
ATOM   2793  O O   . GLY D  1 100 ? 36.641  56.690  38.523  1.00 47.17  ? 241  GLY C O   1 
ATOM   2794  N N   . ILE D  1 101 ? 35.304  56.253  40.268  1.00 51.51  ? 242  ILE C N   1 
ATOM   2795  C CA  . ILE D  1 101 ? 36.305  55.389  40.849  1.00 47.20  ? 242  ILE C CA  1 
ATOM   2796  C C   . ILE D  1 101 ? 35.845  53.973  41.098  1.00 48.89  ? 242  ILE C C   1 
ATOM   2797  O O   . ILE D  1 101 ? 34.676  53.633  40.939  1.00 47.58  ? 242  ILE C O   1 
ATOM   2798  C CB  . ILE D  1 101 ? 36.859  56.002  42.142  1.00 49.94  ? 242  ILE C CB  1 
ATOM   2799  C CG1 . ILE D  1 101 ? 35.767  56.094  43.205  1.00 50.62  ? 242  ILE C CG1 1 
ATOM   2800  C CG2 . ILE D  1 101 ? 37.395  57.406  41.848  1.00 44.60  ? 242  ILE C CG2 1 
ATOM   2801  C CD1 . ILE D  1 101 ? 35.538  54.818  43.966  1.00 52.83  ? 242  ILE C CD1 1 
ATOM   2802  N N   . ILE D  1 102 ? 36.808  53.142  41.450  1.00 48.75  ? 243  ILE C N   1 
ATOM   2803  C CA  . ILE D  1 102 ? 36.574  51.749  41.741  1.00 49.51  ? 243  ILE C CA  1 
ATOM   2804  C C   . ILE D  1 102 ? 37.146  51.585  43.122  1.00 57.21  ? 243  ILE C C   1 
ATOM   2805  O O   . ILE D  1 102 ? 38.199  52.154  43.439  1.00 59.23  ? 243  ILE C O   1 
ATOM   2806  C CB  . ILE D  1 102 ? 37.338  50.849  40.751  1.00 51.33  ? 243  ILE C CB  1 
ATOM   2807  C CG1 . ILE D  1 102 ? 36.339  49.994  39.996  1.00 48.50  ? 243  ILE C CG1 1 
ATOM   2808  C CG2 . ILE D  1 102 ? 38.380  49.992  41.462  1.00 38.36  ? 243  ILE C CG2 1 
ATOM   2809  C CD1 . ILE D  1 102 ? 35.301  50.834  39.310  1.00 51.77  ? 243  ILE C CD1 1 
ATOM   2810  N N   . TYR D  1 103 ? 36.456  50.831  43.960  1.00 60.29  ? 244  TYR C N   1 
ATOM   2811  C CA  . TYR D  1 103 ? 36.945  50.615  45.306  1.00 63.30  ? 244  TYR C CA  1 
ATOM   2812  C C   . TYR D  1 103 ? 37.792  49.366  45.396  1.00 67.12  ? 244  TYR C C   1 
ATOM   2813  O O   . TYR D  1 103 ? 37.438  48.310  44.862  1.00 64.88  ? 244  TYR C O   1 
ATOM   2814  C CB  . TYR D  1 103 ? 35.788  50.507  46.277  1.00 61.03  ? 244  TYR C CB  1 
ATOM   2815  C CG  . TYR D  1 103 ? 35.385  51.834  46.834  1.00 65.34  ? 244  TYR C CG  1 
ATOM   2816  C CD1 . TYR D  1 103 ? 36.291  52.596  47.579  1.00 62.34  ? 244  TYR C CD1 1 
ATOM   2817  C CD2 . TYR D  1 103 ? 34.104  52.337  46.620  1.00 59.07  ? 244  TYR C CD2 1 
ATOM   2818  C CE1 . TYR D  1 103 ? 35.931  53.830  48.096  1.00 64.29  ? 244  TYR C CE1 1 
ATOM   2819  C CE2 . TYR D  1 103 ? 33.732  53.565  47.132  1.00 64.48  ? 244  TYR C CE2 1 
ATOM   2820  C CZ  . TYR D  1 103 ? 34.648  54.311  47.870  1.00 65.92  ? 244  TYR C CZ  1 
ATOM   2821  O OH  . TYR D  1 103 ? 34.284  55.540  48.380  1.00 71.16  ? 244  TYR C OH  1 
ATOM   2822  N N   . GLY D  1 104 ? 38.928  49.502  46.064  1.00 68.33  ? 245  GLY C N   1 
ATOM   2823  C CA  . GLY D  1 104 ? 39.798  48.364  46.235  1.00 73.87  ? 245  GLY C CA  1 
ATOM   2824  C C   . GLY D  1 104 ? 39.252  47.601  47.421  1.00 76.01  ? 245  GLY C C   1 
ATOM   2825  O O   . GLY D  1 104 ? 38.661  48.186  48.331  1.00 75.17  ? 245  GLY C O   1 
ATOM   2826  N N   . THR D  1 105 ? 39.447  46.292  47.418  1.00 76.80  ? 246  THR C N   1 
ATOM   2827  C CA  . THR D  1 105 ? 38.967  45.452  48.505  1.00 71.39  ? 246  THR C CA  1 
ATOM   2828  C C   . THR D  1 105 ? 39.397  45.986  49.884  1.00 67.42  ? 246  THR C C   1 
ATOM   2829  O O   . THR D  1 105 ? 38.827  45.614  50.906  1.00 69.76  ? 246  THR C O   1 
ATOM   2830  C CB  . THR D  1 105 ? 39.471  44.008  48.303  1.00 67.86  ? 246  THR C CB  1 
ATOM   2831  O OG1 . THR D  1 105 ? 38.585  43.103  48.967  1.00 66.37  ? 246  THR C OG1 1 
ATOM   2832  C CG2 . THR D  1 105 ? 40.905  43.851  48.833  1.00 60.27  ? 246  THR C CG2 1 
ATOM   2833  N N   . ASP D  1 106 ? 40.386  46.877  49.894  1.00 63.69  ? 247  ASP C N   1 
ATOM   2834  C CA  . ASP D  1 106 ? 40.903  47.460  51.122  1.00 63.78  ? 247  ASP C CA  1 
ATOM   2835  C C   . ASP D  1 106 ? 40.352  48.853  51.394  1.00 60.58  ? 247  ASP C C   1 
ATOM   2836  O O   . ASP D  1 106 ? 40.794  49.541  52.315  1.00 63.16  ? 247  ASP C O   1 
ATOM   2837  C CB  . ASP D  1 106 ? 42.433  47.517  51.061  1.00 70.60  ? 247  ASP C CB  1 
ATOM   2838  C CG  . ASP D  1 106 ? 42.950  48.437  49.956  1.00 72.02  ? 247  ASP C CG  1 
ATOM   2839  O OD1 . ASP D  1 106 ? 42.565  48.248  48.781  1.00 66.64  ? 247  ASP C OD1 1 
ATOM   2840  O OD2 . ASP D  1 106 ? 43.754  49.343  50.262  1.00 73.25  ? 247  ASP C OD2 1 
ATOM   2841  N N   . GLY D  1 107 ? 39.403  49.277  50.577  1.00 55.46  ? 248  GLY C N   1 
ATOM   2842  C CA  . GLY D  1 107 ? 38.812  50.584  50.766  1.00 62.21  ? 248  GLY C CA  1 
ATOM   2843  C C   . GLY D  1 107 ? 39.460  51.718  49.988  1.00 67.97  ? 248  GLY C C   1 
ATOM   2844  O O   . GLY D  1 107 ? 38.903  52.821  49.887  1.00 71.26  ? 248  GLY C O   1 
ATOM   2845  N N   . GLN D  1 108 ? 40.637  51.471  49.431  1.00 67.57  ? 254  GLN C N   1 
ATOM   2846  C CA  . GLN D  1 108 ? 41.310  52.513  48.678  1.00 65.09  ? 254  GLN C CA  1 
ATOM   2847  C C   . GLN D  1 108 ? 40.636  52.733  47.342  1.00 65.42  ? 254  GLN C C   1 
ATOM   2848  O O   . GLN D  1 108 ? 39.983  51.833  46.798  1.00 63.94  ? 254  GLN C O   1 
ATOM   2849  C CB  . GLN D  1 108 ? 42.779  52.170  48.480  1.00 70.91  ? 254  GLN C CB  1 
ATOM   2850  C CG  . GLN D  1 108 ? 43.559  52.101  49.781  1.00 75.98  ? 254  GLN C CG  1 
ATOM   2851  C CD  . GLN D  1 108 ? 43.391  53.349  50.622  1.00 76.48  ? 254  GLN C CD  1 
ATOM   2852  O OE1 . GLN D  1 108 ? 43.760  54.451  50.204  1.00 70.74  ? 254  GLN C OE1 1 
ATOM   2853  N NE2 . GLN D  1 108 ? 42.828  53.183  51.817  1.00 76.62  ? 254  GLN C NE2 1 
ATOM   2854  N N   . GLU D  1 109 ? 40.809  53.941  46.820  1.00 64.79  ? 255  GLU C N   1 
ATOM   2855  C CA  . GLU D  1 109 ? 40.196  54.336  45.566  1.00 62.73  ? 255  GLU C CA  1 
ATOM   2856  C C   . GLU D  1 109 ? 41.071  54.287  44.333  1.00 61.70  ? 255  GLU C C   1 
ATOM   2857  O O   . GLU D  1 109 ? 42.235  54.691  44.344  1.00 60.96  ? 255  GLU C O   1 
ATOM   2858  C CB  . GLU D  1 109 ? 39.626  55.740  45.711  1.00 67.37  ? 255  GLU C CB  1 
ATOM   2859  C CG  . GLU D  1 109 ? 38.342  55.791  46.503  1.00 72.36  ? 255  GLU C CG  1 
ATOM   2860  C CD  . GLU D  1 109 ? 37.983  57.194  46.911  1.00 77.02  ? 255  GLU C CD  1 
ATOM   2861  O OE1 . GLU D  1 109 ? 38.301  58.132  46.145  1.00 81.30  ? 255  GLU C OE1 1 
ATOM   2862  O OE2 . GLU D  1 109 ? 37.374  57.353  47.995  1.00 82.66  ? 255  GLU C OE2 1 
ATOM   2863  N N   . ALA D  1 110 ? 40.482  53.797  43.253  1.00 59.45  ? 256  ALA C N   1 
ATOM   2864  C CA  . ALA D  1 110 ? 41.183  53.713  41.984  1.00 56.29  ? 256  ALA C CA  1 
ATOM   2865  C C   . ALA D  1 110 ? 40.349  54.383  40.887  1.00 51.35  ? 256  ALA C C   1 
ATOM   2866  O O   . ALA D  1 110 ? 39.261  53.914  40.528  1.00 48.70  ? 256  ALA C O   1 
ATOM   2867  C CB  . ALA D  1 110 ? 41.452  52.252  41.617  1.00 51.01  ? 256  ALA C CB  1 
ATOM   2868  N N   . PRO D  1 111 ? 40.832  55.519  40.373  1.00 44.61  ? 257  PRO C N   1 
ATOM   2869  C CA  . PRO D  1 111 ? 40.135  56.244  39.306  1.00 38.72  ? 257  PRO C CA  1 
ATOM   2870  C C   . PRO D  1 111 ? 40.069  55.359  38.069  1.00 38.74  ? 257  PRO C C   1 
ATOM   2871  O O   . PRO D  1 111 ? 41.063  54.788  37.630  1.00 41.28  ? 257  PRO C O   1 
ATOM   2872  C CB  . PRO D  1 111 ? 41.020  57.447  39.085  1.00 35.78  ? 257  PRO C CB  1 
ATOM   2873  C CG  . PRO D  1 111 ? 41.564  57.709  40.459  1.00 43.44  ? 257  PRO C CG  1 
ATOM   2874  C CD  . PRO D  1 111 ? 41.922  56.331  40.945  1.00 40.94  ? 257  PRO C CD  1 
ATOM   2875  N N   . ILE D  1 112 ? 38.893  55.230  37.500  1.00 36.60  ? 258  ILE C N   1 
ATOM   2876  C CA  . ILE D  1 112 ? 38.770  54.395  36.340  1.00 36.34  ? 258  ILE C CA  1 
ATOM   2877  C C   . ILE D  1 112 ? 39.703  54.878  35.242  1.00 43.36  ? 258  ILE C C   1 
ATOM   2878  O O   . ILE D  1 112 ? 40.177  54.097  34.423  1.00 48.87  ? 258  ILE C O   1 
ATOM   2879  C CB  . ILE D  1 112 ? 37.332  54.385  35.880  1.00 24.69  ? 258  ILE C CB  1 
ATOM   2880  C CG1 . ILE D  1 112 ? 36.487  53.753  36.996  1.00 43.64  ? 258  ILE C CG1 1 
ATOM   2881  C CG2 . ILE D  1 112 ? 37.203  53.614  34.590  1.00 26.30  ? 258  ILE C CG2 1 
ATOM   2882  C CD1 . ILE D  1 112 ? 34.997  53.586  36.707  1.00 43.01  ? 258  ILE C CD1 1 
ATOM   2883  N N   . TYR D  1 113 ? 39.990  56.170  35.236  1.00 47.66  ? 259  TYR C N   1 
ATOM   2884  C CA  . TYR D  1 113 ? 40.868  56.726  34.226  1.00 48.62  ? 259  TYR C CA  1 
ATOM   2885  C C   . TYR D  1 113 ? 42.268  56.128  34.370  1.00 47.54  ? 259  TYR C C   1 
ATOM   2886  O O   . TYR D  1 113 ? 42.902  55.752  33.395  1.00 39.78  ? 259  TYR C O   1 
ATOM   2887  C CB  . TYR D  1 113 ? 40.926  58.246  34.365  1.00 59.73  ? 259  TYR C CB  1 
ATOM   2888  C CG  . TYR D  1 113 ? 41.665  58.906  33.229  1.00 78.85  ? 259  TYR C CG  1 
ATOM   2889  C CD1 . TYR D  1 113 ? 41.220  58.770  31.905  1.00 85.32  ? 259  TYR C CD1 1 
ATOM   2890  C CD2 . TYR D  1 113 ? 42.834  59.640  33.461  1.00 84.75  ? 259  TYR C CD2 1 
ATOM   2891  C CE1 . TYR D  1 113 ? 41.929  59.348  30.837  1.00 89.01  ? 259  TYR C CE1 1 
ATOM   2892  C CE2 . TYR D  1 113 ? 43.549  60.224  32.400  1.00 85.93  ? 259  TYR C CE2 1 
ATOM   2893  C CZ  . TYR D  1 113 ? 43.090  60.071  31.096  1.00 89.68  ? 259  TYR C CZ  1 
ATOM   2894  O OH  . TYR D  1 113 ? 43.791  60.636  30.057  1.00 94.88  ? 259  TYR C OH  1 
ATOM   2895  N N   . GLU D  1 114 ? 42.751  56.055  35.601  1.00 54.20  ? 260  GLU C N   1 
ATOM   2896  C CA  . GLU D  1 114 ? 44.068  55.490  35.883  1.00 51.58  ? 260  GLU C CA  1 
ATOM   2897  C C   . GLU D  1 114 ? 44.136  54.064  35.370  1.00 48.80  ? 260  GLU C C   1 
ATOM   2898  O O   . GLU D  1 114 ? 45.172  53.606  34.913  1.00 55.27  ? 260  GLU C O   1 
ATOM   2899  C CB  . GLU D  1 114 ? 44.311  55.452  37.384  1.00 59.27  ? 260  GLU C CB  1 
ATOM   2900  C CG  . GLU D  1 114 ? 44.233  56.788  38.060  1.00 67.03  ? 260  GLU C CG  1 
ATOM   2901  C CD  . GLU D  1 114 ? 45.513  57.536  37.936  1.00 70.67  ? 260  GLU C CD  1 
ATOM   2902  O OE1 . GLU D  1 114 ? 45.959  57.728  36.787  1.00 77.17  ? 260  GLU C OE1 1 
ATOM   2903  O OE2 . GLU D  1 114 ? 46.070  57.926  38.984  1.00 76.66  ? 260  GLU C OE2 1 
ATOM   2904  N N   . LEU D  1 115 ? 43.034  53.347  35.466  1.00 40.18  ? 261  LEU C N   1 
ATOM   2905  C CA  . LEU D  1 115 ? 43.048  51.985  35.010  1.00 42.75  ? 261  LEU C CA  1 
ATOM   2906  C C   . LEU D  1 115 ? 43.147  51.890  33.500  1.00 40.42  ? 261  LEU C C   1 
ATOM   2907  O O   . LEU D  1 115 ? 44.084  51.326  32.987  1.00 46.70  ? 261  LEU C O   1 
ATOM   2908  C CB  . LEU D  1 115 ? 41.805  51.256  35.518  1.00 48.27  ? 261  LEU C CB  1 
ATOM   2909  C CG  . LEU D  1 115 ? 41.623  51.413  37.038  1.00 49.95  ? 261  LEU C CG  1 
ATOM   2910  C CD1 . LEU D  1 115 ? 40.554  50.437  37.519  1.00 43.85  ? 261  LEU C CD1 1 
ATOM   2911  C CD2 . LEU D  1 115 ? 42.949  51.152  37.761  1.00 44.17  ? 261  LEU C CD2 1 
ATOM   2912  N N   . THR D  1 116 ? 42.205  52.467  32.779  1.00 41.59  ? 262  THR C N   1 
ATOM   2913  C CA  . THR D  1 116 ? 42.229  52.368  31.332  1.00 36.98  ? 262  THR C CA  1 
ATOM   2914  C C   . THR D  1 116 ? 43.376  53.050  30.641  1.00 36.21  ? 262  THR C C   1 
ATOM   2915  O O   . THR D  1 116 ? 43.745  52.640  29.540  1.00 35.15  ? 262  THR C O   1 
ATOM   2916  C CB  . THR D  1 116 ? 40.977  52.956  30.694  1.00 38.33  ? 262  THR C CB  1 
ATOM   2917  O OG1 . THR D  1 116 ? 40.988  54.379  30.850  1.00 17.38  ? 262  THR C OG1 1 
ATOM   2918  C CG2 . THR D  1 116 ? 39.755  52.393  31.318  1.00 31.55  ? 262  THR C CG2 1 
ATOM   2919  N N   . SER D  1 117 ? 43.915  54.100  31.249  1.00 35.74  ? 263  SER C N   1 
ATOM   2920  C CA  . SER D  1 117 ? 45.004  54.854  30.616  1.00 44.10  ? 263  SER C CA  1 
ATOM   2921  C C   . SER D  1 117 ? 46.299  54.070  30.587  1.00 41.70  ? 263  SER C C   1 
ATOM   2922  O O   . SER D  1 117 ? 47.282  54.482  29.957  1.00 37.11  ? 263  SER C O   1 
ATOM   2923  C CB  . SER D  1 117 ? 45.219  56.203  31.314  1.00 41.52  ? 263  SER C CB  1 
ATOM   2924  O OG  . SER D  1 117 ? 45.837  56.042  32.571  1.00 53.88  ? 263  SER C OG  1 
ATOM   2925  N N   . GLN D  1 118 ? 46.269  52.928  31.269  1.00 48.09  ? 264  GLN C N   1 
ATOM   2926  C CA  . GLN D  1 118 ? 47.406  52.014  31.360  1.00 48.33  ? 264  GLN C CA  1 
ATOM   2927  C C   . GLN D  1 118 ? 47.669  51.350  30.020  1.00 44.68  ? 264  GLN C C   1 
ATOM   2928  O O   . GLN D  1 118 ? 48.772  50.895  29.774  1.00 44.57  ? 264  GLN C O   1 
ATOM   2929  C CB  . GLN D  1 118 ? 47.113  50.923  32.385  1.00 50.03  ? 264  GLN C CB  1 
ATOM   2930  C CG  . GLN D  1 118 ? 47.177  51.377  33.801  1.00 58.84  ? 264  GLN C CG  1 
ATOM   2931  C CD  . GLN D  1 118 ? 48.562  51.793  34.154  1.00 69.72  ? 264  GLN C CD  1 
ATOM   2932  O OE1 . GLN D  1 118 ? 49.020  52.857  33.736  1.00 69.49  ? 264  GLN C OE1 1 
ATOM   2933  N NE2 . GLN D  1 118 ? 49.266  50.942  34.911  1.00 80.38  ? 264  GLN C NE2 1 
ATOM   2934  N N   . PHE D  1 119 ? 46.659  51.319  29.152  1.00 36.67  ? 265  PHE C N   1 
ATOM   2935  C CA  . PHE D  1 119 ? 46.793  50.649  27.883  1.00 34.74  ? 265  PHE C CA  1 
ATOM   2936  C C   . PHE D  1 119 ? 46.698  51.494  26.623  1.00 37.89  ? 265  PHE C C   1 
ATOM   2937  O O   . PHE D  1 119 ? 46.270  51.012  25.568  1.00 42.78  ? 265  PHE C O   1 
ATOM   2938  C CB  . PHE D  1 119 ? 45.790  49.507  27.840  1.00 34.20  ? 265  PHE C CB  1 
ATOM   2939  C CG  . PHE D  1 119 ? 45.904  48.590  29.019  1.00 45.23  ? 265  PHE C CG  1 
ATOM   2940  C CD1 . PHE D  1 119 ? 45.394  48.967  30.257  1.00 48.35  ? 265  PHE C CD1 1 
ATOM   2941  C CD2 . PHE D  1 119 ? 46.585  47.376  28.919  1.00 46.06  ? 265  PHE C CD2 1 
ATOM   2942  C CE1 . PHE D  1 119 ? 45.562  48.149  31.383  1.00 56.86  ? 265  PHE C CE1 1 
ATOM   2943  C CE2 . PHE D  1 119 ? 46.760  46.551  30.034  1.00 44.59  ? 265  PHE C CE2 1 
ATOM   2944  C CZ  . PHE D  1 119 ? 46.251  46.934  31.267  1.00 55.73  ? 265  PHE C CZ  1 
ATOM   2945  N N   . THR D  1 120 ? 47.115  52.749  26.721  1.00 34.71  ? 266  THR C N   1 
ATOM   2946  C CA  . THR D  1 120 ? 47.117  53.637  25.578  1.00 30.46  ? 266  THR C CA  1 
ATOM   2947  C C   . THR D  1 120 ? 48.109  53.060  24.556  1.00 41.02  ? 266  THR C C   1 
ATOM   2948  O O   . THR D  1 120 ? 48.649  51.977  24.744  1.00 48.42  ? 266  THR C O   1 
ATOM   2949  C CB  . THR D  1 120 ? 47.602  55.020  25.983  1.00 39.00  ? 266  THR C CB  1 
ATOM   2950  O OG1 . THR D  1 120 ? 49.022  54.998  26.178  1.00 39.88  ? 266  THR C OG1 1 
ATOM   2951  C CG2 . THR D  1 120 ? 46.982  55.431  27.286  1.00 44.69  ? 266  THR C CG2 1 
ATOM   2952  N N   . GLY D  1 121 ? 48.351  53.786  23.473  1.00 45.56  ? 267  GLY C N   1 
ATOM   2953  C CA  . GLY D  1 121 ? 49.271  53.322  22.449  1.00 36.99  ? 267  GLY C CA  1 
ATOM   2954  C C   . GLY D  1 121 ? 50.712  53.339  22.932  1.00 47.22  ? 267  GLY C C   1 
ATOM   2955  O O   . GLY D  1 121 ? 51.464  52.402  22.692  1.00 45.90  ? 267  GLY C O   1 
ATOM   2956  N N   . LEU D  1 122 ? 51.109  54.409  23.609  1.00 45.90  ? 268  LEU C N   1 
ATOM   2957  C CA  . LEU D  1 122 ? 52.464  54.515  24.120  1.00 46.82  ? 268  LEU C CA  1 
ATOM   2958  C C   . LEU D  1 122 ? 52.665  53.478  25.221  1.00 50.22  ? 268  LEU C C   1 
ATOM   2959  O O   . LEU D  1 122 ? 53.521  52.611  25.134  1.00 59.62  ? 268  LEU C O   1 
ATOM   2960  C CB  . LEU D  1 122 ? 52.696  55.918  24.683  1.00 44.83  ? 268  LEU C CB  1 
ATOM   2961  C CG  . LEU D  1 122 ? 52.297  57.072  23.756  1.00 45.79  ? 268  LEU C CG  1 
ATOM   2962  C CD1 . LEU D  1 122 ? 52.824  58.369  24.320  1.00 46.94  ? 268  LEU C CD1 1 
ATOM   2963  C CD2 . LEU D  1 122 ? 52.853  56.849  22.355  1.00 46.77  ? 268  LEU C CD2 1 
ATOM   2964  N N   . LYS D  1 123 ? 51.845  53.570  26.254  1.00 51.34  ? 269  LYS C N   1 
ATOM   2965  C CA  . LYS D  1 123 ? 51.901  52.665  27.380  1.00 39.89  ? 269  LYS C CA  1 
ATOM   2966  C C   . LYS D  1 123 ? 52.023  51.181  27.001  1.00 40.01  ? 269  LYS C C   1 
ATOM   2967  O O   . LYS D  1 123 ? 52.622  50.421  27.744  1.00 38.91  ? 269  LYS C O   1 
ATOM   2968  C CB  . LYS D  1 123 ? 50.656  52.884  28.244  1.00 39.85  ? 269  LYS C CB  1 
ATOM   2969  C CG  . LYS D  1 123 ? 50.681  54.134  29.113  1.00 45.99  ? 269  LYS C CG  1 
ATOM   2970  C CD  . LYS D  1 123 ? 51.510  53.891  30.370  1.00 66.07  ? 269  LYS C CD  1 
ATOM   2971  C CE  . LYS D  1 123 ? 51.272  54.936  31.465  1.00 66.93  ? 269  LYS C CE  1 
ATOM   2972  N NZ  . LYS D  1 123 ? 51.851  54.496  32.789  1.00 67.36  ? 269  LYS C NZ  1 
ATOM   2973  N N   . CYS D  1 124 ? 51.477  50.768  25.857  1.00 36.36  ? 270  CYS C N   1 
ATOM   2974  C CA  . CYS D  1 124 ? 51.508  49.360  25.474  1.00 35.90  ? 270  CYS C CA  1 
ATOM   2975  C C   . CYS D  1 124 ? 51.373  49.143  23.963  1.00 35.89  ? 270  CYS C C   1 
ATOM   2976  O O   . CYS D  1 124 ? 50.340  48.673  23.449  1.00 36.15  ? 270  CYS C O   1 
ATOM   2977  C CB  . CYS D  1 124 ? 50.396  48.613  26.236  1.00 39.56  ? 270  CYS C CB  1 
ATOM   2978  S SG  . CYS D  1 124 ? 50.043  46.920  25.718  1.00 46.46  ? 270  CYS C SG  1 
ATOM   2979  N N   . PRO D  1 125 ? 52.447  49.444  23.230  1.00 35.54  ? 271  PRO C N   1 
ATOM   2980  C CA  . PRO D  1 125 ? 52.500  49.306  21.766  1.00 34.03  ? 271  PRO C CA  1 
ATOM   2981  C C   . PRO D  1 125 ? 52.031  47.973  21.182  1.00 36.23  ? 271  PRO C C   1 
ATOM   2982  O O   . PRO D  1 125 ? 51.564  47.913  20.050  1.00 36.59  ? 271  PRO C O   1 
ATOM   2983  C CB  . PRO D  1 125 ? 53.961  49.595  21.445  1.00 24.96  ? 271  PRO C CB  1 
ATOM   2984  C CG  . PRO D  1 125 ? 54.383  50.526  22.548  1.00 23.96  ? 271  PRO C CG  1 
ATOM   2985  C CD  . PRO D  1 125 ? 53.736  49.913  23.772  1.00 27.36  ? 271  PRO C CD  1 
ATOM   2986  N N   . SER D  1 126 ? 52.154  46.900  21.948  1.00 42.40  ? 272  SER C N   1 
ATOM   2987  C CA  . SER D  1 126 ? 51.717  45.592  21.468  1.00 43.13  ? 272  SER C CA  1 
ATOM   2988  C C   . SER D  1 126 ? 50.213  45.571  21.180  1.00 44.95  ? 272  SER C C   1 
ATOM   2989  O O   . SER D  1 126 ? 49.733  44.716  20.434  1.00 47.36  ? 272  SER C O   1 
ATOM   2990  C CB  . SER D  1 126 ? 52.047  44.530  22.511  1.00 41.88  ? 272  SER C CB  1 
ATOM   2991  O OG  . SER D  1 126 ? 52.885  45.086  23.519  1.00 47.09  ? 272  SER C OG  1 
ATOM   2992  N N   . LEU D  1 127 ? 49.472  46.508  21.770  1.00 42.75  ? 273  LEU C N   1 
ATOM   2993  C CA  . LEU D  1 127 ? 48.030  46.554  21.574  1.00 40.10  ? 273  LEU C CA  1 
ATOM   2994  C C   . LEU D  1 127 ? 47.567  47.643  20.630  1.00 36.45  ? 273  LEU C C   1 
ATOM   2995  O O   . LEU D  1 127 ? 46.405  47.678  20.254  1.00 35.87  ? 273  LEU C O   1 
ATOM   2996  C CB  . LEU D  1 127 ? 47.319  46.684  22.926  1.00 38.65  ? 273  LEU C CB  1 
ATOM   2997  C CG  . LEU D  1 127 ? 47.299  45.381  23.725  1.00 29.92  ? 273  LEU C CG  1 
ATOM   2998  C CD1 . LEU D  1 127 ? 46.746  45.588  25.115  1.00 26.91  ? 273  LEU C CD1 1 
ATOM   2999  C CD2 . LEU D  1 127 ? 46.464  44.390  22.972  1.00 33.18  ? 273  LEU C CD2 1 
ATOM   3000  N N   . ALA D  1 128 ? 48.483  48.519  20.241  1.00 36.41  ? 274  ALA C N   1 
ATOM   3001  C CA  . ALA D  1 128 ? 48.180  49.616  19.313  1.00 36.83  ? 274  ALA C CA  1 
ATOM   3002  C C   . ALA D  1 128 ? 47.325  49.170  18.129  1.00 37.03  ? 274  ALA C C   1 
ATOM   3003  O O   . ALA D  1 128 ? 47.721  48.287  17.370  1.00 28.50  ? 274  ALA C O   1 
ATOM   3004  C CB  . ALA D  1 128 ? 49.467  50.240  18.792  1.00 20.44  ? 274  ALA C CB  1 
ATOM   3005  N N   . GLY D  1 129 ? 46.152  49.787  17.981  1.00 39.51  ? 275  GLY C N   1 
ATOM   3006  C CA  . GLY D  1 129 ? 45.270  49.445  16.880  1.00 36.73  ? 275  GLY C CA  1 
ATOM   3007  C C   . GLY D  1 129 ? 44.437  48.208  17.134  1.00 40.34  ? 275  GLY C C   1 
ATOM   3008  O O   . GLY D  1 129 ? 43.831  47.637  16.223  1.00 47.25  ? 275  GLY C O   1 
ATOM   3009  N N   . LYS D  1 130 ? 44.402  47.780  18.385  1.00 39.28  ? 276  LYS C N   1 
ATOM   3010  C CA  . LYS D  1 130 ? 43.631  46.614  18.739  1.00 39.37  ? 276  LYS C CA  1 
ATOM   3011  C C   . LYS D  1 130 ? 42.632  46.980  19.826  1.00 41.92  ? 276  LYS C C   1 
ATOM   3012  O O   . LYS D  1 130 ? 42.939  47.728  20.771  1.00 36.60  ? 276  LYS C O   1 
ATOM   3013  C CB  . LYS D  1 130 ? 44.554  45.497  19.226  1.00 45.12  ? 276  LYS C CB  1 
ATOM   3014  C CG  . LYS D  1 130 ? 45.487  44.942  18.164  1.00 54.40  ? 276  LYS C CG  1 
ATOM   3015  C CD  . LYS D  1 130 ? 46.491  43.973  18.774  1.00 58.42  ? 276  LYS C CD  1 
ATOM   3016  C CE  . LYS D  1 130 ? 47.417  43.388  17.727  1.00 55.90  ? 276  LYS C CE  1 
ATOM   3017  N NZ  . LYS D  1 130 ? 48.576  42.682  18.346  1.00 49.35  ? 276  LYS C NZ  1 
ATOM   3018  N N   . PRO D  1 131 ? 41.410  46.457  19.707  1.00 39.02  ? 277  PRO C N   1 
ATOM   3019  C CA  . PRO D  1 131 ? 40.390  46.754  20.701  1.00 39.11  ? 277  PRO C CA  1 
ATOM   3020  C C   . PRO D  1 131 ? 40.814  46.445  22.129  1.00 39.87  ? 277  PRO C C   1 
ATOM   3021  O O   . PRO D  1 131 ? 41.249  45.344  22.431  1.00 33.23  ? 277  PRO C O   1 
ATOM   3022  C CB  . PRO D  1 131 ? 39.214  45.895  20.241  1.00 42.92  ? 277  PRO C CB  1 
ATOM   3023  C CG  . PRO D  1 131 ? 39.885  44.759  19.553  1.00 43.03  ? 277  PRO C CG  1 
ATOM   3024  C CD  . PRO D  1 131 ? 40.927  45.455  18.750  1.00 34.43  ? 277  PRO C CD  1 
ATOM   3025  N N   . LYS D  1 132 ? 40.697  47.445  22.991  1.00 43.96  ? 278  LYS C N   1 
ATOM   3026  C CA  . LYS D  1 132 ? 40.992  47.310  24.416  1.00 44.06  ? 278  LYS C CA  1 
ATOM   3027  C C   . LYS D  1 132 ? 39.648  47.589  25.126  1.00 44.72  ? 278  LYS C C   1 
ATOM   3028  O O   . LYS D  1 132 ? 39.211  48.727  25.234  1.00 52.27  ? 278  LYS C O   1 
ATOM   3029  C CB  . LYS D  1 132 ? 42.043  48.331  24.810  1.00 41.80  ? 278  LYS C CB  1 
ATOM   3030  C CG  . LYS D  1 132 ? 43.336  48.123  24.069  1.00 39.47  ? 278  LYS C CG  1 
ATOM   3031  C CD  . LYS D  1 132 ? 44.292  49.286  24.251  1.00 38.47  ? 278  LYS C CD  1 
ATOM   3032  C CE  . LYS D  1 132 ? 44.166  50.260  23.096  1.00 49.95  ? 278  LYS C CE  1 
ATOM   3033  N NZ  . LYS D  1 132 ? 44.463  49.638  21.757  1.00 48.15  ? 278  LYS C NZ  1 
ATOM   3034  N N   . VAL D  1 133 ? 39.000  46.529  25.585  1.00 34.78  ? 279  VAL C N   1 
ATOM   3035  C CA  . VAL D  1 133 ? 37.700  46.599  26.231  1.00 29.30  ? 279  VAL C CA  1 
ATOM   3036  C C   . VAL D  1 133 ? 37.694  46.554  27.758  1.00 30.27  ? 279  VAL C C   1 
ATOM   3037  O O   . VAL D  1 133 ? 38.299  45.678  28.348  1.00 40.45  ? 279  VAL C O   1 
ATOM   3038  C CB  . VAL D  1 133 ? 36.836  45.407  25.767  1.00 27.05  ? 279  VAL C CB  1 
ATOM   3039  C CG1 . VAL D  1 133 ? 35.446  45.533  26.336  1.00 25.06  ? 279  VAL C CG1 1 
ATOM   3040  C CG2 . VAL D  1 133 ? 36.827  45.322  24.249  1.00 24.29  ? 279  VAL C CG2 1 
ATOM   3041  N N   . PHE D  1 134 ? 37.002  47.473  28.409  1.00 25.48  ? 280  PHE C N   1 
ATOM   3042  C CA  . PHE D  1 134 ? 36.907  47.411  29.860  1.00 31.48  ? 280  PHE C CA  1 
ATOM   3043  C C   . PHE D  1 134 ? 35.460  47.390  30.295  1.00 35.66  ? 280  PHE C C   1 
ATOM   3044  O O   . PHE D  1 134 ? 34.721  48.284  29.950  1.00 36.21  ? 280  PHE C O   1 
ATOM   3045  C CB  . PHE D  1 134 ? 37.534  48.603  30.536  1.00 28.38  ? 280  PHE C CB  1 
ATOM   3046  C CG  . PHE D  1 134 ? 38.997  48.645  30.438  1.00 41.30  ? 280  PHE C CG  1 
ATOM   3047  C CD1 . PHE D  1 134 ? 39.614  48.877  29.218  1.00 47.67  ? 280  PHE C CD1 1 
ATOM   3048  C CD2 . PHE D  1 134 ? 39.781  48.498  31.579  1.00 42.20  ? 280  PHE C CD2 1 
ATOM   3049  C CE1 . PHE D  1 134 ? 41.007  48.972  29.139  1.00 52.03  ? 280  PHE C CE1 1 
ATOM   3050  C CE2 . PHE D  1 134 ? 41.169  48.585  31.517  1.00 41.32  ? 280  PHE C CE2 1 
ATOM   3051  C CZ  . PHE D  1 134 ? 41.785  48.825  30.298  1.00 43.95  ? 280  PHE C CZ  1 
ATOM   3052  N N   . PHE D  1 135 ? 35.058  46.370  31.048  1.00 39.96  ? 281  PHE C N   1 
ATOM   3053  C CA  . PHE D  1 135 ? 33.704  46.285  31.569  1.00 32.06  ? 281  PHE C CA  1 
ATOM   3054  C C   . PHE D  1 135 ? 33.830  46.547  33.054  1.00 38.29  ? 281  PHE C C   1 
ATOM   3055  O O   . PHE D  1 135 ? 34.523  45.828  33.753  1.00 49.66  ? 281  PHE C O   1 
ATOM   3056  C CB  . PHE D  1 135 ? 33.120  44.905  31.361  1.00 27.95  ? 281  PHE C CB  1 
ATOM   3057  C CG  . PHE D  1 135 ? 32.823  44.586  29.946  1.00 28.98  ? 281  PHE C CG  1 
ATOM   3058  C CD1 . PHE D  1 135 ? 31.842  45.284  29.263  1.00 32.64  ? 281  PHE C CD1 1 
ATOM   3059  C CD2 . PHE D  1 135 ? 33.529  43.593  29.278  1.00 30.17  ? 281  PHE C CD2 1 
ATOM   3060  C CE1 . PHE D  1 135 ? 31.566  44.998  27.911  1.00 44.29  ? 281  PHE C CE1 1 
ATOM   3061  C CE2 . PHE D  1 135 ? 33.266  43.291  27.933  1.00 34.29  ? 281  PHE C CE2 1 
ATOM   3062  C CZ  . PHE D  1 135 ? 32.285  43.996  27.243  1.00 35.84  ? 281  PHE C CZ  1 
ATOM   3063  N N   . ILE D  1 136 ? 33.187  47.590  33.546  1.00 38.82  ? 282  ILE C N   1 
ATOM   3064  C CA  . ILE D  1 136 ? 33.267  47.886  34.957  1.00 36.08  ? 282  ILE C CA  1 
ATOM   3065  C C   . ILE D  1 136 ? 31.899  47.771  35.591  1.00 44.09  ? 282  ILE C C   1 
ATOM   3066  O O   . ILE D  1 136 ? 30.977  48.482  35.223  1.00 48.85  ? 282  ILE C O   1 
ATOM   3067  C CB  . ILE D  1 136 ? 33.783  49.274  35.188  1.00 36.87  ? 282  ILE C CB  1 
ATOM   3068  C CG1 . ILE D  1 136 ? 35.244  49.332  34.771  1.00 46.06  ? 282  ILE C CG1 1 
ATOM   3069  C CG2 . ILE D  1 136 ? 33.582  49.668  36.639  1.00 16.97  ? 282  ILE C CG2 1 
ATOM   3070  C CD1 . ILE D  1 136 ? 35.893  50.679  35.072  1.00 52.62  ? 282  ILE C CD1 1 
ATOM   3071  N N   . GLN D  1 137 ? 31.772  46.850  36.542  1.00 51.48  ? 283  GLN C N   1 
ATOM   3072  C CA  . GLN D  1 137 ? 30.522  46.627  37.258  1.00 46.56  ? 283  GLN C CA  1 
ATOM   3073  C C   . GLN D  1 137 ? 30.724  47.085  38.699  1.00 46.30  ? 283  GLN C C   1 
ATOM   3074  O O   . GLN D  1 137 ? 31.381  46.424  39.491  1.00 49.79  ? 283  GLN C O   1 
ATOM   3075  C CB  . GLN D  1 137 ? 30.133  45.138  37.179  1.00 38.30  ? 283  GLN C CB  1 
ATOM   3076  C CG  . GLN D  1 137 ? 29.139  44.643  38.228  1.00 48.57  ? 283  GLN C CG  1 
ATOM   3077  C CD  . GLN D  1 137 ? 27.828  45.401  38.273  1.00 49.51  ? 283  GLN C CD  1 
ATOM   3078  O OE1 . GLN D  1 137 ? 27.078  45.426  37.290  1.00 46.82  ? 283  GLN C OE1 1 
ATOM   3079  N NE2 . GLN D  1 137 ? 27.533  46.013  39.430  1.00 46.24  ? 283  GLN C NE2 1 
ATOM   3080  N N   . ALA D  1 138 ? 30.174  48.244  39.020  1.00 43.74  ? 284  ALA C N   1 
ATOM   3081  C CA  . ALA D  1 138 ? 30.282  48.801  40.358  1.00 50.36  ? 284  ALA C CA  1 
ATOM   3082  C C   . ALA D  1 138 ? 29.347  49.993  40.455  1.00 55.99  ? 284  ALA C C   1 
ATOM   3083  O O   . ALA D  1 138 ? 28.702  50.362  39.474  1.00 59.66  ? 284  ALA C O   1 
ATOM   3084  C CB  . ALA D  1 138 ? 31.692  49.241  40.619  1.00 40.99  ? 284  ALA C CB  1 
ATOM   3085  N N   . CYS D  1 139 ? 29.259  50.594  41.632  1.00 59.96  ? 285  CYS C N   1 
ATOM   3086  C CA  . CYS D  1 139 ? 28.402  51.759  41.779  1.00 63.49  ? 285  CYS C CA  1 
ATOM   3087  C C   . CYS D  1 139 ? 29.243  52.939  41.381  1.00 62.48  ? 285  CYS C C   1 
ATOM   3088  O O   . CYS D  1 139 ? 30.465  52.859  41.400  1.00 59.82  ? 285  CYS C O   1 
ATOM   3089  C CB  . CYS D  1 139 ? 27.935  51.945  43.229  1.00 66.81  ? 285  CYS C CB  1 
ATOM   3090  S SG  . CYS D  1 139 ? 26.754  50.685  43.780  1.00 73.31  ? 285  CYS C SG  1 
ATOM   3091  N N   . GLN D  1 140 ? 28.580  54.029  41.021  1.00 66.12  ? 286  GLN C N   1 
ATOM   3092  C CA  . GLN D  1 140 ? 29.256  55.258  40.634  1.00 64.80  ? 286  GLN C CA  1 
ATOM   3093  C C   . GLN D  1 140 ? 28.680  56.385  41.473  1.00 68.02  ? 286  GLN C C   1 
ATOM   3094  O O   . GLN D  1 140 ? 28.807  57.557  41.136  1.00 72.70  ? 286  GLN C O   1 
ATOM   3095  C CB  . GLN D  1 140 ? 29.034  55.523  39.147  1.00 59.22  ? 286  GLN C CB  1 
ATOM   3096  C CG  . GLN D  1 140 ? 29.946  54.706  38.238  1.00 54.81  ? 286  GLN C CG  1 
ATOM   3097  C CD  . GLN D  1 140 ? 31.410  54.993  38.524  1.00 56.62  ? 286  GLN C CD  1 
ATOM   3098  O OE1 . GLN D  1 140 ? 32.067  54.243  39.240  1.00 64.84  ? 286  GLN C OE1 1 
ATOM   3099  N NE2 . GLN D  1 140 ? 31.921  56.098  37.988  1.00 44.38  ? 286  GLN C NE2 1 
ATOM   3100  N N   . GLY D  1 141 ? 28.050  56.005  42.583  1.00 72.96  ? 287  GLY C N   1 
ATOM   3101  C CA  . GLY D  1 141 ? 27.427  56.968  43.473  1.00 70.98  ? 287  GLY C CA  1 
ATOM   3102  C C   . GLY D  1 141 ? 26.360  56.256  44.281  1.00 71.29  ? 287  GLY C C   1 
ATOM   3103  O O   . GLY D  1 141 ? 26.079  55.075  44.061  1.00 65.89  ? 287  GLY C O   1 
ATOM   3104  N N   . ASP D  1 142 ? 25.752  56.982  45.210  1.00 76.68  ? 288  ASP C N   1 
ATOM   3105  C CA  . ASP D  1 142 ? 24.728  56.416  46.078  1.00 77.44  ? 288  ASP C CA  1 
ATOM   3106  C C   . ASP D  1 142 ? 23.311  56.828  45.686  1.00 77.66  ? 288  ASP C C   1 
ATOM   3107  O O   . ASP D  1 142 ? 22.362  56.569  46.426  1.00 84.00  ? 288  ASP C O   1 
ATOM   3108  C CB  . ASP D  1 142 ? 25.007  56.833  47.529  1.00 79.98  ? 288  ASP C CB  1 
ATOM   3109  C CG  . ASP D  1 142 ? 25.150  58.343  47.686  1.00 83.68  ? 288  ASP C CG  1 
ATOM   3110  O OD1 . ASP D  1 142 ? 26.070  58.920  47.066  1.00 88.01  ? 288  ASP C OD1 1 
ATOM   3111  O OD2 . ASP D  1 142 ? 24.347  58.955  48.425  1.00 81.95  ? 288  ASP C OD2 1 
ATOM   3112  N N   . ASN D  1 143 ? 23.155  57.466  44.532  1.00 72.39  ? 289  ASN C N   1 
ATOM   3113  C CA  . ASN D  1 143 ? 21.831  57.896  44.104  1.00 65.23  ? 289  ASN C CA  1 
ATOM   3114  C C   . ASN D  1 143 ? 21.114  56.808  43.341  1.00 66.83  ? 289  ASN C C   1 
ATOM   3115  O O   . ASN D  1 143 ? 21.738  55.925  42.746  1.00 65.70  ? 289  ASN C O   1 
ATOM   3116  C CB  . ASN D  1 143 ? 21.922  59.138  43.228  1.00 65.99  ? 289  ASN C CB  1 
ATOM   3117  C CG  . ASN D  1 143 ? 22.587  60.299  43.933  1.00 64.66  ? 289  ASN C CG  1 
ATOM   3118  O OD1 . ASN D  1 143 ? 22.947  60.202  45.100  1.00 64.46  ? 289  ASN C OD1 1 
ATOM   3119  N ND2 . ASN D  1 143 ? 22.755  61.408  43.222  1.00 62.76  ? 289  ASN C ND2 1 
ATOM   3120  N N   . TYR D  1 144 ? 19.790  56.871  43.367  1.00 69.32  ? 290  TYR C N   1 
ATOM   3121  C CA  . TYR D  1 144 ? 18.983  55.890  42.669  1.00 69.77  ? 290  TYR C CA  1 
ATOM   3122  C C   . TYR D  1 144 ? 18.478  56.481  41.382  1.00 65.84  ? 290  TYR C C   1 
ATOM   3123  O O   . TYR D  1 144 ? 17.901  57.564  41.369  1.00 67.32  ? 290  TYR C O   1 
ATOM   3124  C CB  . TYR D  1 144 ? 17.789  55.464  43.523  1.00 81.20  ? 290  TYR C CB  1 
ATOM   3125  C CG  . TYR D  1 144 ? 18.138  54.606  44.728  1.00 90.16  ? 290  TYR C CG  1 
ATOM   3126  C CD1 . TYR D  1 144 ? 18.438  55.186  45.970  1.00 90.08  ? 290  TYR C CD1 1 
ATOM   3127  C CD2 . TYR D  1 144 ? 18.130  53.206  44.633  1.00 88.31  ? 290  TYR C CD2 1 
ATOM   3128  C CE1 . TYR D  1 144 ? 18.708  54.391  47.087  1.00 90.05  ? 290  TYR C CE1 1 
ATOM   3129  C CE2 . TYR D  1 144 ? 18.400  52.405  45.736  1.00 89.76  ? 290  TYR C CE2 1 
ATOM   3130  C CZ  . TYR D  1 144 ? 18.684  53.000  46.959  1.00 92.30  ? 290  TYR C CZ  1 
ATOM   3131  O OH  . TYR D  1 144 ? 18.918  52.195  48.052  1.00 97.38  ? 290  TYR C OH  1 
ATOM   3132  N N   . GLN D  1 145 ? 18.708  55.778  40.288  1.00 61.18  ? 291  GLN C N   1 
ATOM   3133  C CA  . GLN D  1 145 ? 18.223  56.264  39.018  1.00 64.10  ? 291  GLN C CA  1 
ATOM   3134  C C   . GLN D  1 145 ? 16.699  56.098  39.092  1.00 65.43  ? 291  GLN C C   1 
ATOM   3135  O O   . GLN D  1 145 ? 16.206  54.979  39.295  1.00 55.72  ? 291  GLN C O   1 
ATOM   3136  C CB  . GLN D  1 145 ? 18.807  55.424  37.875  1.00 66.76  ? 291  GLN C CB  1 
ATOM   3137  C CG  . GLN D  1 145 ? 18.350  55.810  36.448  1.00 57.36  ? 291  GLN C CG  1 
ATOM   3138  C CD  . GLN D  1 145 ? 18.916  57.136  35.966  1.00 59.28  ? 291  GLN C CD  1 
ATOM   3139  O OE1 . GLN D  1 145 ? 19.746  57.765  36.630  1.00 58.92  ? 291  GLN C OE1 1 
ATOM   3140  N NE2 . GLN D  1 145 ? 18.468  57.566  34.800  1.00 64.52  ? 291  GLN C NE2 1 
ATOM   3141  N N   . LYS D  1 146 ? 15.966  57.210  38.949  1.00 64.73  ? 292  LYS C N   1 
ATOM   3142  C CA  . LYS D  1 146 ? 14.510  57.185  39.001  1.00 61.83  ? 292  LYS C CA  1 
ATOM   3143  C C   . LYS D  1 146 ? 13.934  56.717  37.670  1.00 64.48  ? 292  LYS C C   1 
ATOM   3144  O O   . LYS D  1 146 ? 14.563  56.848  36.614  1.00 67.34  ? 292  LYS C O   1 
ATOM   3145  C CB  . LYS D  1 146 ? 13.967  58.572  39.348  1.00 63.88  ? 292  LYS C CB  1 
ATOM   3146  C CG  . LYS D  1 146 ? 14.619  59.209  40.577  1.00 74.98  ? 292  LYS C CG  1 
ATOM   3147  C CD  . LYS D  1 146 ? 13.998  60.571  40.912  1.00 80.38  ? 292  LYS C CD  1 
ATOM   3148  C CE  . LYS D  1 146 ? 14.973  61.486  41.670  1.00 84.05  ? 292  LYS C CE  1 
ATOM   3149  N NZ  . LYS D  1 146 ? 16.169  61.894  40.850  1.00 81.09  ? 292  LYS C NZ  1 
ATOM   3150  N N   . GLY D  1 147 ? 12.733  56.158  37.726  1.00 66.76  ? 293  GLY C N   1 
ATOM   3151  C CA  . GLY D  1 147 ? 12.086  55.672  36.520  1.00 64.88  ? 293  GLY C CA  1 
ATOM   3152  C C   . GLY D  1 147 ? 11.028  56.635  36.010  1.00 65.18  ? 293  GLY C C   1 
ATOM   3153  O O   . GLY D  1 147 ? 10.457  57.420  36.770  1.00 64.97  ? 293  GLY C O   1 
ATOM   3154  N N   . ILE D  1 148 ? 10.781  56.587  34.709  1.00 63.02  ? 294  ILE C N   1 
ATOM   3155  C CA  . ILE D  1 148 ? 9.784   57.444  34.083  1.00 60.22  ? 294  ILE C CA  1 
ATOM   3156  C C   . ILE D  1 148 ? 8.935   56.552  33.179  1.00 64.18  ? 294  ILE C C   1 
ATOM   3157  O O   . ILE D  1 148 ? 9.440   55.634  32.525  1.00 67.89  ? 294  ILE C O   1 
ATOM   3158  C CB  . ILE D  1 148 ? 10.435  58.555  33.244  1.00 60.84  ? 294  ILE C CB  1 
ATOM   3159  C CG1 . ILE D  1 148 ? 11.037  57.954  31.967  1.00 69.09  ? 294  ILE C CG1 1 
ATOM   3160  C CG2 . ILE D  1 148 ? 11.503  59.285  34.079  1.00 48.40  ? 294  ILE C CG2 1 
ATOM   3161  C CD1 . ILE D  1 148 ? 11.684  58.966  31.029  1.00 78.09  ? 294  ILE C CD1 1 
ATOM   3162  N N   . PRO D  1 149 ? 7.629   56.811  33.129  1.00 63.93  ? 295  PRO C N   1 
ATOM   3163  C CA  . PRO D  1 149 ? 6.674   56.039  32.321  1.00 62.09  ? 295  PRO C CA  1 
ATOM   3164  C C   . PRO D  1 149 ? 6.661   56.358  30.836  1.00 63.80  ? 295  PRO C C   1 
ATOM   3165  O O   . PRO D  1 149 ? 6.835   57.512  30.437  1.00 66.33  ? 295  PRO C O   1 
ATOM   3166  C CB  . PRO D  1 149 ? 5.353   56.381  32.967  1.00 61.07  ? 295  PRO C CB  1 
ATOM   3167  C CG  . PRO D  1 149 ? 5.560   57.858  33.291  1.00 66.96  ? 295  PRO C CG  1 
ATOM   3168  C CD  . PRO D  1 149 ? 6.948   57.878  33.887  1.00 63.74  ? 295  PRO C CD  1 
ATOM   3169  N N   . VAL D  1 150 ? 6.437   55.334  30.020  1.00 63.05  ? 296  VAL C N   1 
ATOM   3170  C CA  . VAL D  1 150 ? 6.381   55.505  28.573  1.00 66.09  ? 296  VAL C CA  1 
ATOM   3171  C C   . VAL D  1 150 ? 5.519   54.405  27.982  1.00 73.79  ? 296  VAL C C   1 
ATOM   3172  O O   . VAL D  1 150 ? 4.984   53.585  28.706  1.00 71.00  ? 296  VAL C O   1 
ATOM   3173  C CB  . VAL D  1 150 ? 7.778   55.414  27.928  1.00 66.98  ? 296  VAL C CB  1 
ATOM   3174  C CG1 . VAL D  1 150 ? 8.659   56.556  28.431  1.00 65.32  ? 296  VAL C CG1 1 
ATOM   3175  C CG2 . VAL D  1 150 ? 8.409   54.053  28.222  1.00 55.15  ? 296  VAL C CG2 1 
ATOM   3176  N N   . GLU D  1 151 ? 5.380   54.363  26.667  1.00 85.02  ? 297  GLU C N   1 
ATOM   3177  C CA  . GLU D  1 151 ? 4.561   53.321  26.049  1.00 90.51  ? 297  GLU C CA  1 
ATOM   3178  C C   . GLU D  1 151 ? 5.328   51.999  25.979  1.00 89.91  ? 297  GLU C C   1 
ATOM   3179  O O   . GLU D  1 151 ? 6.263   51.778  26.746  1.00 89.69  ? 297  GLU C O   1 
ATOM   3180  C CB  . GLU D  1 151 ? 4.125   53.770  24.649  1.00 93.87  ? 297  GLU C CB  1 
ATOM   3181  C CG  . GLU D  1 151 ? 3.334   55.082  24.651  1.00 97.78  ? 297  GLU C CG  1 
ATOM   3182  C CD  . GLU D  1 151 ? 3.160   55.681  23.255  1.00 100.00 ? 297  GLU C CD  1 
ATOM   3183  O OE1 . GLU D  1 151 ? 2.677   54.955  22.354  1.00 100.00 ? 297  GLU C OE1 1 
ATOM   3184  O OE2 . GLU D  1 151 ? 3.500   56.875  23.058  1.00 99.10  ? 297  GLU C OE2 1 
ATOM   3185  N N   . THR D  1 152 ? 4.923   51.122  25.067  1.00 91.95  ? 298  THR C N   1 
ATOM   3186  C CA  . THR D  1 152 ? 5.581   49.828  24.902  1.00 96.91  ? 298  THR C CA  1 
ATOM   3187  C C   . THR D  1 152 ? 6.611   49.844  23.775  1.00 100.00 ? 298  THR C C   1 
ATOM   3188  O O   . THR D  1 152 ? 6.249   49.742  22.593  1.00 100.00 ? 298  THR C O   1 
ATOM   3189  C CB  . THR D  1 152 ? 4.556   48.698  24.607  1.00 96.05  ? 298  THR C CB  1 
ATOM   3190  O OG1 . THR D  1 152 ? 3.829   48.392  25.803  1.00 95.91  ? 298  THR C OG1 1 
ATOM   3191  C CG2 . THR D  1 152 ? 5.266   47.433  24.104  1.00 91.93  ? 298  THR C CG2 1 
ATOM   3192  N N   . ASP D  1 153 ? 7.888   49.968  24.143  1.00 100.00 ? 299  ASP C N   1 
ATOM   3193  C CA  . ASP D  1 153 ? 8.983   49.980  23.166  1.00 100.00 ? 299  ASP C CA  1 
ATOM   3194  C C   . ASP D  1 153 ? 9.099   48.609  22.470  1.00 100.00 ? 299  ASP C C   1 
ATOM   3195  O O   . ASP D  1 153 ? 10.211  48.047  22.495  1.00 100.00 ? 299  ASP C O   1 
ATOM   3196  C CB  . ASP D  1 153 ? 10.328  50.320  23.856  1.00 100.00 ? 299  ASP C CB  1 
ATOM   3197  C CG  . ASP D  1 153 ? 10.440  51.795  24.280  1.00 100.00 ? 299  ASP C CG  1 
ATOM   3198  O OD1 . ASP D  1 153 ? 9.985   52.124  25.404  1.00 100.00 ? 299  ASP C OD1 1 
ATOM   3199  O OD2 . ASP D  1 153 ? 10.983  52.622  23.494  1.00 98.80  ? 299  ASP C OD2 1 
ATOM   3200  O OXT . ASP D  1 153 ? 8.095   48.106  21.911  1.00 99.70  ? 299  ASP C OXT 1 
ATOM   3201  N N   . THR E  2 1   ? 51.318  51.720  7.094   1.00 99.18  ? 318  THR D N   1 
ATOM   3202  C CA  . THR E  2 1   ? 52.087  52.096  8.320   1.00 99.28  ? 318  THR D CA  1 
ATOM   3203  C C   . THR E  2 1   ? 51.806  53.564  8.692   1.00 96.40  ? 318  THR D C   1 
ATOM   3204  O O   . THR E  2 1   ? 52.716  54.403  8.709   1.00 96.04  ? 318  THR D O   1 
ATOM   3205  C CB  . THR E  2 1   ? 53.619  51.897  8.097   1.00 100.00 ? 318  THR D CB  1 
ATOM   3206  O OG1 . THR E  2 1   ? 53.840  50.793  7.198   1.00 100.00 ? 318  THR D OG1 1 
ATOM   3207  C CG2 . THR E  2 1   ? 54.328  51.608  9.439   1.00 96.08  ? 318  THR D CG2 1 
ATOM   3208  N N   . ARG E  2 2   ? 50.535  53.848  8.989   1.00 90.43  ? 319  ARG D N   1 
ATOM   3209  C CA  . ARG E  2 2   ? 50.054  55.185  9.358   1.00 81.53  ? 319  ARG D CA  1 
ATOM   3210  C C   . ARG E  2 2   ? 49.891  55.376  10.877  1.00 77.57  ? 319  ARG D C   1 
ATOM   3211  O O   . ARG E  2 2   ? 50.148  54.464  11.666  1.00 80.19  ? 319  ARG D O   1 
ATOM   3212  C CB  . ARG E  2 2   ? 48.713  55.429  8.665   1.00 82.59  ? 319  ARG D CB  1 
ATOM   3213  C CG  . ARG E  2 2   ? 47.811  54.187  8.650   1.00 90.94  ? 319  ARG D CG  1 
ATOM   3214  C CD  . ARG E  2 2   ? 46.409  54.466  8.085   1.00 98.08  ? 319  ARG D CD  1 
ATOM   3215  N NE  . ARG E  2 2   ? 46.037  53.534  7.013   1.00 100.00 ? 319  ARG D NE  1 
ATOM   3216  C CZ  . ARG E  2 2   ? 44.845  53.501  6.409   1.00 100.00 ? 319  ARG D CZ  1 
ATOM   3217  N NH1 . ARG E  2 2   ? 43.888  54.343  6.770   1.00 100.00 ? 319  ARG D NH1 1 
ATOM   3218  N NH2 . ARG E  2 2   ? 44.611  52.638  5.423   1.00 100.00 ? 319  ARG D NH2 1 
ATOM   3219  N N   . TYR E  2 3   ? 49.462  56.565  11.282  1.00 72.67  ? 320  TYR D N   1 
ATOM   3220  C CA  . TYR E  2 3   ? 49.250  56.882  12.698  1.00 65.52  ? 320  TYR D CA  1 
ATOM   3221  C C   . TYR E  2 3   ? 47.797  57.022  13.123  1.00 59.40  ? 320  TYR D C   1 
ATOM   3222  O O   . TYR E  2 3   ? 46.955  57.490  12.356  1.00 62.06  ? 320  TYR D O   1 
ATOM   3223  C CB  . TYR E  2 3   ? 49.925  58.187  13.063  1.00 69.07  ? 320  TYR D CB  1 
ATOM   3224  C CG  . TYR E  2 3   ? 51.417  58.133  13.136  1.00 76.76  ? 320  TYR D CG  1 
ATOM   3225  C CD1 . TYR E  2 3   ? 52.120  57.039  12.670  1.00 81.58  ? 320  TYR D CD1 1 
ATOM   3226  C CD2 . TYR E  2 3   ? 52.130  59.185  13.693  1.00 84.97  ? 320  TYR D CD2 1 
ATOM   3227  C CE1 . TYR E  2 3   ? 53.503  56.986  12.759  1.00 90.31  ? 320  TYR D CE1 1 
ATOM   3228  C CE2 . TYR E  2 3   ? 53.509  59.147  13.788  1.00 92.54  ? 320  TYR D CE2 1 
ATOM   3229  C CZ  . TYR E  2 3   ? 54.191  58.041  13.319  1.00 91.94  ? 320  TYR D CZ  1 
ATOM   3230  O OH  . TYR E  2 3   ? 55.559  57.982  13.411  1.00 95.84  ? 320  TYR D OH  1 
ATOM   3231  N N   . ILE E  2 4   ? 47.517  56.613  14.356  1.00 48.85  ? 321  ILE D N   1 
ATOM   3232  C CA  . ILE E  2 4   ? 46.187  56.742  14.934  1.00 44.88  ? 321  ILE D CA  1 
ATOM   3233  C C   . ILE E  2 4   ? 46.424  57.346  16.303  1.00 40.75  ? 321  ILE D C   1 
ATOM   3234  O O   . ILE E  2 4   ? 47.528  57.265  16.829  1.00 45.37  ? 321  ILE D O   1 
ATOM   3235  C CB  . ILE E  2 4   ? 45.455  55.394  15.092  1.00 44.20  ? 321  ILE D CB  1 
ATOM   3236  C CG1 . ILE E  2 4   ? 46.177  54.501  16.088  1.00 43.78  ? 321  ILE D CG1 1 
ATOM   3237  C CG2 . ILE E  2 4   ? 45.331  54.715  13.756  1.00 42.15  ? 321  ILE D CG2 1 
ATOM   3238  C CD1 . ILE E  2 4   ? 45.456  53.213  16.339  1.00 42.41  ? 321  ILE D CD1 1 
ATOM   3239  N N   . PRO E  2 5   ? 45.412  57.986  16.892  1.00 39.26  ? 322  PRO D N   1 
ATOM   3240  C CA  . PRO E  2 5   ? 45.633  58.579  18.219  1.00 41.70  ? 322  PRO D CA  1 
ATOM   3241  C C   . PRO E  2 5   ? 45.929  57.624  19.378  1.00 37.19  ? 322  PRO D C   1 
ATOM   3242  O O   . PRO E  2 5   ? 45.437  56.492  19.428  1.00 29.03  ? 322  PRO D O   1 
ATOM   3243  C CB  . PRO E  2 5   ? 44.369  59.423  18.451  1.00 38.63  ? 322  PRO D CB  1 
ATOM   3244  C CG  . PRO E  2 5   ? 43.357  58.819  17.537  1.00 42.34  ? 322  PRO D CG  1 
ATOM   3245  C CD  . PRO E  2 5   ? 44.154  58.465  16.304  1.00 40.55  ? 322  PRO D CD  1 
ATOM   3246  N N   . ASP E  2 6   ? 46.744  58.122  20.300  1.00 34.93  ? 323  ASP D N   1 
ATOM   3247  C CA  . ASP E  2 6   ? 47.163  57.401  21.496  1.00 38.74  ? 323  ASP D CA  1 
ATOM   3248  C C   . ASP E  2 6   ? 46.010  56.691  22.184  1.00 35.35  ? 323  ASP D C   1 
ATOM   3249  O O   . ASP E  2 6   ? 46.126  55.524  22.548  1.00 41.45  ? 323  ASP D O   1 
ATOM   3250  C CB  . ASP E  2 6   ? 47.836  58.384  22.476  1.00 46.83  ? 323  ASP D CB  1 
ATOM   3251  C CG  . ASP E  2 6   ? 48.522  57.691  23.646  1.00 42.85  ? 323  ASP D CG  1 
ATOM   3252  O OD1 . ASP E  2 6   ? 49.002  56.556  23.485  1.00 51.20  ? 323  ASP D OD1 1 
ATOM   3253  O OD2 . ASP E  2 6   ? 48.615  58.295  24.724  1.00 36.67  ? 323  ASP D OD2 1 
ATOM   3254  N N   . GLU E  2 7   ? 44.887  57.389  22.339  1.00 33.63  ? 324  GLU D N   1 
ATOM   3255  C CA  . GLU E  2 7   ? 43.716  56.825  23.001  1.00 24.33  ? 324  GLU D CA  1 
ATOM   3256  C C   . GLU E  2 7   ? 42.665  56.172  22.111  1.00 28.83  ? 324  GLU D C   1 
ATOM   3257  O O   . GLU E  2 7   ? 41.515  56.010  22.520  1.00 30.25  ? 324  GLU D O   1 
ATOM   3258  C CB  . GLU E  2 7   ? 43.040  57.882  23.855  1.00 26.31  ? 324  GLU D CB  1 
ATOM   3259  C CG  . GLU E  2 7   ? 43.966  58.646  24.774  1.00 36.91  ? 324  GLU D CG  1 
ATOM   3260  C CD  . GLU E  2 7   ? 43.214  59.439  25.814  1.00 39.55  ? 324  GLU D CD  1 
ATOM   3261  O OE1 . GLU E  2 7   ? 42.100  59.009  26.191  1.00 46.01  ? 324  GLU D OE1 1 
ATOM   3262  O OE2 . GLU E  2 7   ? 43.746  60.479  26.264  1.00 42.02  ? 324  GLU D OE2 1 
ATOM   3263  N N   . ALA E  2 8   ? 43.043  55.784  20.898  1.00 31.10  ? 325  ALA D N   1 
ATOM   3264  C CA  . ALA E  2 8   ? 42.090  55.124  20.004  1.00 28.05  ? 325  ALA D CA  1 
ATOM   3265  C C   . ALA E  2 8   ? 41.749  53.700  20.457  1.00 30.34  ? 325  ALA D C   1 
ATOM   3266  O O   . ALA E  2 8   ? 42.333  53.162  21.399  1.00 33.87  ? 325  ALA D O   1 
ATOM   3267  C CB  . ALA E  2 8   ? 42.644  55.093  18.606  1.00 12.34  ? 325  ALA D CB  1 
ATOM   3268  N N   . ASP E  2 9   ? 40.793  53.102  19.765  1.00 37.37  ? 326  ASP D N   1 
ATOM   3269  C CA  . ASP E  2 9   ? 40.348  51.735  20.015  1.00 38.84  ? 326  ASP D CA  1 
ATOM   3270  C C   . ASP E  2 9   ? 40.058  51.317  21.463  1.00 40.45  ? 326  ASP D C   1 
ATOM   3271  O O   . ASP E  2 9   ? 40.518  50.274  21.930  1.00 53.48  ? 326  ASP D O   1 
ATOM   3272  C CB  . ASP E  2 9   ? 41.352  50.766  19.398  1.00 29.76  ? 326  ASP D CB  1 
ATOM   3273  C CG  . ASP E  2 9   ? 41.929  51.288  18.127  1.00 39.35  ? 326  ASP D CG  1 
ATOM   3274  O OD1 . ASP E  2 9   ? 41.211  51.282  17.111  1.00 36.33  ? 326  ASP D OD1 1 
ATOM   3275  O OD2 . ASP E  2 9   ? 43.101  51.723  18.151  1.00 38.43  ? 326  ASP D OD2 1 
ATOM   3276  N N   . PHE E  2 10  ? 39.294  52.117  22.180  1.00 35.07  ? 327  PHE D N   1 
ATOM   3277  C CA  . PHE E  2 10  ? 38.914  51.744  23.528  1.00 37.58  ? 327  PHE D CA  1 
ATOM   3278  C C   . PHE E  2 10  ? 37.407  51.542  23.577  1.00 41.66  ? 327  PHE D C   1 
ATOM   3279  O O   . PHE E  2 10  ? 36.650  52.114  22.778  1.00 42.40  ? 327  PHE D O   1 
ATOM   3280  C CB  . PHE E  2 10  ? 39.253  52.823  24.525  1.00 40.11  ? 327  PHE D CB  1 
ATOM   3281  C CG  . PHE E  2 10  ? 40.612  52.699  25.125  1.00 54.22  ? 327  PHE D CG  1 
ATOM   3282  C CD1 . PHE E  2 10  ? 41.730  53.241  24.490  1.00 55.32  ? 327  PHE D CD1 1 
ATOM   3283  C CD2 . PHE E  2 10  ? 40.777  52.076  26.357  1.00 54.02  ? 327  PHE D CD2 1 
ATOM   3284  C CE1 . PHE E  2 10  ? 42.994  53.165  25.083  1.00 44.29  ? 327  PHE D CE1 1 
ATOM   3285  C CE2 . PHE E  2 10  ? 42.032  51.997  26.958  1.00 55.23  ? 327  PHE D CE2 1 
ATOM   3286  C CZ  . PHE E  2 10  ? 43.142  52.545  26.317  1.00 49.15  ? 327  PHE D CZ  1 
ATOM   3287  N N   . LEU E  2 11  ? 36.977  50.715  24.520  1.00 37.92  ? 328  LEU D N   1 
ATOM   3288  C CA  . LEU E  2 11  ? 35.573  50.458  24.723  1.00 33.50  ? 328  LEU D CA  1 
ATOM   3289  C C   . LEU E  2 11  ? 35.390  50.285  26.196  1.00 36.75  ? 328  LEU D C   1 
ATOM   3290  O O   . LEU E  2 11  ? 35.848  49.295  26.756  1.00 48.32  ? 328  LEU D O   1 
ATOM   3291  C CB  . LEU E  2 11  ? 35.116  49.198  24.010  1.00 31.09  ? 328  LEU D CB  1 
ATOM   3292  C CG  . LEU E  2 11  ? 33.726  48.760  24.484  1.00 38.44  ? 328  LEU D CG  1 
ATOM   3293  C CD1 . LEU E  2 11  ? 32.804  49.967  24.632  1.00 34.31  ? 328  LEU D CD1 1 
ATOM   3294  C CD2 . LEU E  2 11  ? 33.137  47.743  23.518  1.00 38.28  ? 328  LEU D CD2 1 
ATOM   3295  N N   . LEU E  2 12  ? 34.749  51.262  26.831  1.00 36.62  ? 329  LEU D N   1 
ATOM   3296  C CA  . LEU E  2 12  ? 34.500  51.209  28.265  1.00 34.62  ? 329  LEU D CA  1 
ATOM   3297  C C   . LEU E  2 12  ? 33.047  50.950  28.462  1.00 37.39  ? 329  LEU D C   1 
ATOM   3298  O O   . LEU E  2 12  ? 32.226  51.675  27.952  1.00 49.96  ? 329  LEU D O   1 
ATOM   3299  C CB  . LEU E  2 12  ? 34.853  52.512  28.938  1.00 23.72  ? 329  LEU D CB  1 
ATOM   3300  C CG  . LEU E  2 12  ? 34.377  52.596  30.385  1.00 31.76  ? 329  LEU D CG  1 
ATOM   3301  C CD1 . LEU E  2 12  ? 34.659  51.303  31.116  1.00 43.52  ? 329  LEU D CD1 1 
ATOM   3302  C CD2 . LEU E  2 12  ? 35.090  53.737  31.097  1.00 22.10  ? 329  LEU D CD2 1 
ATOM   3303  N N   . GLY E  2 13  ? 32.727  49.908  29.204  1.00 41.80  ? 330  GLY D N   1 
ATOM   3304  C CA  . GLY E  2 13  ? 31.339  49.577  29.427  1.00 45.17  ? 330  GLY D CA  1 
ATOM   3305  C C   . GLY E  2 13  ? 30.988  49.698  30.877  1.00 45.42  ? 330  GLY D C   1 
ATOM   3306  O O   . GLY E  2 13  ? 31.254  48.794  31.657  1.00 45.44  ? 330  GLY D O   1 
ATOM   3307  N N   . MET E  2 14  ? 30.400  50.832  31.233  1.00 52.49  ? 331  MET D N   1 
ATOM   3308  C CA  . MET E  2 14  ? 29.985  51.083  32.604  1.00 52.79  ? 331  MET D CA  1 
ATOM   3309  C C   . MET E  2 14  ? 28.625  50.435  32.855  1.00 55.98  ? 331  MET D C   1 
ATOM   3310  O O   . MET E  2 14  ? 27.786  50.360  31.953  1.00 47.99  ? 331  MET D O   1 
ATOM   3311  C CB  . MET E  2 14  ? 29.890  52.572  32.845  1.00 45.32  ? 331  MET D CB  1 
ATOM   3312  C CG  . MET E  2 14  ? 31.196  53.264  32.718  1.00 31.90  ? 331  MET D CG  1 
ATOM   3313  S SD  . MET E  2 14  ? 32.283  52.603  33.935  1.00 47.94  ? 331  MET D SD  1 
ATOM   3314  C CE  . MET E  2 14  ? 31.868  53.528  35.433  1.00 31.69  ? 331  MET D CE  1 
ATOM   3315  N N   . ALA E  2 15  ? 28.419  49.960  34.081  1.00 62.15  ? 332  ALA D N   1 
ATOM   3316  C CA  . ALA E  2 15  ? 27.161  49.316  34.449  1.00 62.92  ? 332  ALA D CA  1 
ATOM   3317  C C   . ALA E  2 15  ? 26.118  50.368  34.827  1.00 59.64  ? 332  ALA D C   1 
ATOM   3318  O O   . ALA E  2 15  ? 24.921  50.102  34.809  1.00 56.24  ? 332  ALA D O   1 
ATOM   3319  C CB  . ALA E  2 15  ? 27.383  48.364  35.609  1.00 66.10  ? 332  ALA D CB  1 
ATOM   3320  N N   . THR E  2 16  ? 26.582  51.566  35.157  1.00 52.54  ? 333  THR D N   1 
ATOM   3321  C CA  . THR E  2 16  ? 25.676  52.635  35.526  1.00 52.17  ? 333  THR D CA  1 
ATOM   3322  C C   . THR E  2 16  ? 26.206  54.023  35.157  1.00 54.45  ? 333  THR D C   1 
ATOM   3323  O O   . THR E  2 16  ? 27.422  54.240  35.107  1.00 51.94  ? 333  THR D O   1 
ATOM   3324  C CB  . THR E  2 16  ? 25.424  52.632  37.025  1.00 43.80  ? 333  THR D CB  1 
ATOM   3325  O OG1 . THR E  2 16  ? 24.710  53.815  37.389  1.00 41.18  ? 333  THR D OG1 1 
ATOM   3326  C CG2 . THR E  2 16  ? 26.731  52.633  37.768  1.00 44.36  ? 333  THR D CG2 1 
ATOM   3327  N N   . VAL E  2 17  ? 25.289  54.960  34.902  1.00 54.40  ? 334  VAL D N   1 
ATOM   3328  C CA  . VAL E  2 17  ? 25.677  56.332  34.593  1.00 46.57  ? 334  VAL D CA  1 
ATOM   3329  C C   . VAL E  2 17  ? 26.309  56.847  35.857  1.00 45.11  ? 334  VAL D C   1 
ATOM   3330  O O   . VAL E  2 17  ? 26.190  56.221  36.907  1.00 50.82  ? 334  VAL D O   1 
ATOM   3331  C CB  . VAL E  2 17  ? 24.471  57.220  34.273  1.00 49.50  ? 334  VAL D CB  1 
ATOM   3332  C CG1 . VAL E  2 17  ? 23.907  56.850  32.922  1.00 53.12  ? 334  VAL D CG1 1 
ATOM   3333  C CG2 . VAL E  2 17  ? 23.410  57.064  35.351  1.00 53.57  ? 334  VAL D CG2 1 
ATOM   3334  N N   . ASN E  2 18  ? 26.970  57.988  35.776  1.00 42.38  ? 335  ASN D N   1 
ATOM   3335  C CA  . ASN E  2 18  ? 27.607  58.530  36.956  1.00 44.94  ? 335  ASN D CA  1 
ATOM   3336  C C   . ASN E  2 18  ? 26.604  58.921  38.060  1.00 49.52  ? 335  ASN D C   1 
ATOM   3337  O O   . ASN E  2 18  ? 25.449  59.257  37.798  1.00 50.81  ? 335  ASN D O   1 
ATOM   3338  C CB  . ASN E  2 18  ? 28.457  59.738  36.586  1.00 41.57  ? 335  ASN D CB  1 
ATOM   3339  C CG  . ASN E  2 18  ? 29.531  60.022  37.619  1.00 56.91  ? 335  ASN D CG  1 
ATOM   3340  O OD1 . ASN E  2 18  ? 30.083  61.117  37.688  1.00 67.24  ? 335  ASN D OD1 1 
ATOM   3341  N ND2 . ASN E  2 18  ? 29.847  59.022  38.423  1.00 67.44  ? 335  ASN D ND2 1 
ATOM   3342  N N   . ASN E  2 19  ? 27.076  58.860  39.300  1.00 58.34  ? 336  ASN D N   1 
ATOM   3343  C CA  . ASN E  2 19  ? 26.315  59.206  40.504  1.00 59.02  ? 336  ASN D CA  1 
ATOM   3344  C C   . ASN E  2 19  ? 25.279  58.214  40.959  1.00 55.31  ? 336  ASN D C   1 
ATOM   3345  O O   . ASN E  2 19  ? 24.647  58.433  41.973  1.00 54.45  ? 336  ASN D O   1 
ATOM   3346  C CB  . ASN E  2 19  ? 25.634  60.557  40.347  1.00 66.06  ? 336  ASN D CB  1 
ATOM   3347  C CG  . ASN E  2 19  ? 26.620  61.686  40.204  1.00 71.50  ? 336  ASN D CG  1 
ATOM   3348  O OD1 . ASN E  2 19  ? 27.034  62.025  39.095  1.00 74.03  ? 336  ASN D OD1 1 
ATOM   3349  N ND2 . ASN E  2 19  ? 27.018  62.268  41.327  1.00 68.99  ? 336  ASN D ND2 1 
ATOM   3350  N N   . CYS E  2 20  ? 25.106  57.120  40.232  1.00 56.59  ? 337  CYS D N   1 
ATOM   3351  C CA  . CYS E  2 20  ? 24.097  56.144  40.621  1.00 61.21  ? 337  CYS D CA  1 
ATOM   3352  C C   . CYS E  2 20  ? 24.597  54.760  41.027  1.00 59.12  ? 337  CYS D C   1 
ATOM   3353  O O   . CYS E  2 20  ? 25.768  54.432  40.872  1.00 63.45  ? 337  CYS D O   1 
ATOM   3354  C CB  . CYS E  2 20  ? 23.072  56.006  39.497  1.00 61.07  ? 337  CYS D CB  1 
ATOM   3355  S SG  . CYS E  2 20  ? 22.315  57.573  39.083  1.00 72.82  ? 337  CYS D SG  1 
ATOM   3356  N N   . VAL E  2 21  ? 23.681  53.955  41.544  1.00 52.73  ? 338  VAL D N   1 
ATOM   3357  C CA  . VAL E  2 21  ? 24.003  52.608  41.965  1.00 55.75  ? 338  VAL D CA  1 
ATOM   3358  C C   . VAL E  2 21  ? 23.685  51.595  40.866  1.00 55.38  ? 338  VAL D C   1 
ATOM   3359  O O   . VAL E  2 21  ? 22.879  51.858  39.968  1.00 49.20  ? 338  VAL D O   1 
ATOM   3360  C CB  . VAL E  2 21  ? 23.187  52.224  43.219  1.00 58.16  ? 338  VAL D CB  1 
ATOM   3361  C CG1 . VAL E  2 21  ? 23.368  53.295  44.294  1.00 54.28  ? 338  VAL D CG1 1 
ATOM   3362  C CG2 . VAL E  2 21  ? 21.705  52.068  42.860  1.00 53.40  ? 338  VAL D CG2 1 
ATOM   3363  N N   . SER E  2 22  ? 24.342  50.441  40.937  1.00 55.44  ? 339  SER D N   1 
ATOM   3364  C CA  . SER E  2 22  ? 24.085  49.350  40.003  1.00 56.41  ? 339  SER D CA  1 
ATOM   3365  C C   . SER E  2 22  ? 23.670  48.208  40.926  1.00 60.97  ? 339  SER D C   1 
ATOM   3366  O O   . SER E  2 22  ? 24.044  48.186  42.108  1.00 58.09  ? 339  SER D O   1 
ATOM   3367  C CB  . SER E  2 22  ? 25.329  48.980  39.200  1.00 50.93  ? 339  SER D CB  1 
ATOM   3368  O OG  . SER E  2 22  ? 26.453  48.869  40.047  1.00 69.83  ? 339  SER D OG  1 
ATOM   3369  N N   . TYR E  2 23  ? 22.895  47.266  40.400  1.00 65.89  ? 340  TYR D N   1 
ATOM   3370  C CA  . TYR E  2 23  ? 22.391  46.170  41.216  1.00 66.43  ? 340  TYR D CA  1 
ATOM   3371  C C   . TYR E  2 23  ? 23.017  44.795  41.054  1.00 68.83  ? 340  TYR D C   1 
ATOM   3372  O O   . TYR E  2 23  ? 23.363  44.355  39.947  1.00 62.09  ? 340  TYR D O   1 
ATOM   3373  C CB  . TYR E  2 23  ? 20.870  46.055  41.045  1.00 67.40  ? 340  TYR D CB  1 
ATOM   3374  C CG  . TYR E  2 23  ? 20.116  47.266  41.551  1.00 65.82  ? 340  TYR D CG  1 
ATOM   3375  C CD1 . TYR E  2 23  ? 19.891  47.445  42.917  1.00 54.50  ? 340  TYR D CD1 1 
ATOM   3376  C CD2 . TYR E  2 23  ? 19.679  48.260  40.669  1.00 67.29  ? 340  TYR D CD2 1 
ATOM   3377  C CE1 . TYR E  2 23  ? 19.255  48.578  43.395  1.00 66.48  ? 340  TYR D CE1 1 
ATOM   3378  C CE2 . TYR E  2 23  ? 19.037  49.404  41.137  1.00 68.09  ? 340  TYR D CE2 1 
ATOM   3379  C CZ  . TYR E  2 23  ? 18.831  49.554  42.504  1.00 70.43  ? 340  TYR D CZ  1 
ATOM   3380  O OH  . TYR E  2 23  ? 18.217  50.676  42.996  1.00 71.84  ? 340  TYR D OH  1 
ATOM   3381  N N   . ARG E  2 24  ? 23.125  44.121  42.200  1.00 73.33  ? 341  ARG D N   1 
ATOM   3382  C CA  . ARG E  2 24  ? 23.690  42.778  42.317  1.00 69.04  ? 341  ARG D CA  1 
ATOM   3383  C C   . ARG E  2 24  ? 22.719  41.910  43.124  1.00 65.54  ? 341  ARG D C   1 
ATOM   3384  O O   . ARG E  2 24  ? 22.333  42.256  44.249  1.00 60.13  ? 341  ARG D O   1 
ATOM   3385  C CB  . ARG E  2 24  ? 25.038  42.870  43.030  1.00 70.27  ? 341  ARG D CB  1 
ATOM   3386  C CG  . ARG E  2 24  ? 25.754  41.561  43.286  1.00 65.17  ? 341  ARG D CG  1 
ATOM   3387  C CD  . ARG E  2 24  ? 26.762  41.793  44.396  1.00 59.25  ? 341  ARG D CD  1 
ATOM   3388  N NE  . ARG E  2 24  ? 26.082  42.235  45.611  1.00 66.84  ? 341  ARG D NE  1 
ATOM   3389  C CZ  . ARG E  2 24  ? 26.466  43.263  46.364  1.00 73.04  ? 341  ARG D CZ  1 
ATOM   3390  N NH1 . ARG E  2 24  ? 27.531  43.971  46.031  1.00 69.12  ? 341  ARG D NH1 1 
ATOM   3391  N NH2 . ARG E  2 24  ? 25.790  43.582  47.465  1.00 82.37  ? 341  ARG D NH2 1 
ATOM   3392  N N   . ASN E  2 25  ? 22.315  40.797  42.525  1.00 66.60  ? 342  ASN D N   1 
ATOM   3393  C CA  . ASN E  2 25  ? 21.389  39.850  43.154  1.00 71.19  ? 342  ASN D CA  1 
ATOM   3394  C C   . ASN E  2 25  ? 22.222  38.675  43.656  1.00 70.92  ? 342  ASN D C   1 
ATOM   3395  O O   . ASN E  2 25  ? 22.791  37.912  42.860  1.00 66.56  ? 342  ASN D O   1 
ATOM   3396  C CB  . ASN E  2 25  ? 20.353  39.366  42.134  1.00 74.18  ? 342  ASN D CB  1 
ATOM   3397  C CG  . ASN E  2 25  ? 19.304  38.471  42.744  1.00 69.38  ? 342  ASN D CG  1 
ATOM   3398  O OD1 . ASN E  2 25  ? 19.476  37.257  42.823  1.00 62.92  ? 342  ASN D OD1 1 
ATOM   3399  N ND2 . ASN E  2 25  ? 18.202  39.074  43.180  1.00 67.52  ? 342  ASN D ND2 1 
ATOM   3400  N N   . PRO E  2 26  ? 22.299  38.513  44.989  1.00 69.95  ? 343  PRO D N   1 
ATOM   3401  C CA  . PRO E  2 26  ? 23.069  37.439  45.612  1.00 70.28  ? 343  PRO D CA  1 
ATOM   3402  C C   . PRO E  2 26  ? 22.866  36.091  44.948  1.00 73.44  ? 343  PRO D C   1 
ATOM   3403  O O   . PRO E  2 26  ? 23.789  35.280  44.868  1.00 73.18  ? 343  PRO D O   1 
ATOM   3404  C CB  . PRO E  2 26  ? 22.575  37.463  47.052  1.00 67.04  ? 343  PRO D CB  1 
ATOM   3405  C CG  . PRO E  2 26  ? 22.346  38.917  47.284  1.00 63.47  ? 343  PRO D CG  1 
ATOM   3406  C CD  . PRO E  2 26  ? 21.610  39.310  46.018  1.00 69.98  ? 343  PRO D CD  1 
ATOM   3407  N N   . ALA E  2 27  ? 21.662  35.871  44.441  1.00 73.52  ? 344  ALA D N   1 
ATOM   3408  C CA  . ALA E  2 27  ? 21.336  34.603  43.818  1.00 74.77  ? 344  ALA D CA  1 
ATOM   3409  C C   . ALA E  2 27  ? 21.638  34.467  42.332  1.00 79.70  ? 344  ALA D C   1 
ATOM   3410  O O   . ALA E  2 27  ? 21.656  33.349  41.813  1.00 80.25  ? 344  ALA D O   1 
ATOM   3411  C CB  . ALA E  2 27  ? 19.866  34.281  44.071  1.00 70.70  ? 344  ALA D CB  1 
ATOM   3412  N N   . GLU E  2 28  ? 21.866  35.566  41.622  1.00 82.93  ? 345  GLU D N   1 
ATOM   3413  C CA  . GLU E  2 28  ? 22.128  35.395  40.197  1.00 83.86  ? 345  GLU D CA  1 
ATOM   3414  C C   . GLU E  2 28  ? 23.090  36.366  39.530  1.00 83.66  ? 345  GLU D C   1 
ATOM   3415  O O   . GLU E  2 28  ? 23.253  36.330  38.305  1.00 83.87  ? 345  GLU D O   1 
ATOM   3416  C CB  . GLU E  2 28  ? 20.793  35.334  39.428  1.00 86.57  ? 345  GLU D CB  1 
ATOM   3417  C CG  . GLU E  2 28  ? 19.728  36.332  39.899  1.00 96.06  ? 345  GLU D CG  1 
ATOM   3418  C CD  . GLU E  2 28  ? 18.365  36.081  39.263  1.00 99.42  ? 345  GLU D CD  1 
ATOM   3419  O OE1 . GLU E  2 28  ? 18.291  36.016  38.012  1.00 100.00 ? 345  GLU D OE1 1 
ATOM   3420  O OE2 . GLU E  2 28  ? 17.370  35.957  40.016  1.00 97.90  ? 345  GLU D OE2 1 
ATOM   3421  N N   . GLY E  2 29  ? 23.745  37.216  40.322  1.00 79.67  ? 346  GLY D N   1 
ATOM   3422  C CA  . GLY E  2 29  ? 24.693  38.154  39.740  1.00 75.02  ? 346  GLY D CA  1 
ATOM   3423  C C   . GLY E  2 29  ? 24.165  39.561  39.559  1.00 72.70  ? 346  GLY D C   1 
ATOM   3424  O O   . GLY E  2 29  ? 23.047  39.878  39.978  1.00 72.28  ? 346  GLY D O   1 
ATOM   3425  N N   . THR E  2 30  ? 24.974  40.409  38.932  1.00 67.37  ? 347  THR D N   1 
ATOM   3426  C CA  . THR E  2 30  ? 24.593  41.798  38.706  1.00 62.53  ? 347  THR D CA  1 
ATOM   3427  C C   . THR E  2 30  ? 23.714  41.891  37.467  1.00 60.12  ? 347  THR D C   1 
ATOM   3428  O O   . THR E  2 30  ? 23.836  41.067  36.542  1.00 52.86  ? 347  THR D O   1 
ATOM   3429  C CB  . THR E  2 30  ? 25.846  42.699  38.529  1.00 65.65  ? 347  THR D CB  1 
ATOM   3430  O OG1 . THR E  2 30  ? 26.629  42.230  37.418  1.00 63.34  ? 347  THR D OG1 1 
ATOM   3431  C CG2 . THR E  2 30  ? 26.694  42.697  39.811  1.00 54.98  ? 347  THR D CG2 1 
ATOM   3432  N N   . TRP E  2 31  ? 22.821  42.883  37.448  1.00 57.33  ? 348  TRP D N   1 
ATOM   3433  C CA  . TRP E  2 31  ? 21.921  43.047  36.304  1.00 56.10  ? 348  TRP D CA  1 
ATOM   3434  C C   . TRP E  2 31  ? 22.764  43.226  35.059  1.00 52.03  ? 348  TRP D C   1 
ATOM   3435  O O   . TRP E  2 31  ? 22.512  42.616  34.002  1.00 34.36  ? 348  TRP D O   1 
ATOM   3436  C CB  . TRP E  2 31  ? 21.041  44.285  36.450  1.00 60.87  ? 348  TRP D CB  1 
ATOM   3437  C CG  . TRP E  2 31  ? 20.045  44.281  37.577  1.00 78.45  ? 348  TRP D CG  1 
ATOM   3438  C CD1 . TRP E  2 31  ? 19.853  43.306  38.518  1.00 78.79  ? 348  TRP D CD1 1 
ATOM   3439  C CD2 . TRP E  2 31  ? 19.129  45.341  37.904  1.00 83.17  ? 348  TRP D CD2 1 
ATOM   3440  N NE1 . TRP E  2 31  ? 18.881  43.697  39.412  1.00 81.66  ? 348  TRP D NE1 1 
ATOM   3441  C CE2 . TRP E  2 31  ? 18.421  44.940  39.059  1.00 81.87  ? 348  TRP D CE2 1 
ATOM   3442  C CE3 . TRP E  2 31  ? 18.844  46.591  37.333  1.00 80.77  ? 348  TRP D CE3 1 
ATOM   3443  C CZ2 . TRP E  2 31  ? 17.444  45.746  39.657  1.00 78.35  ? 348  TRP D CZ2 1 
ATOM   3444  C CZ3 . TRP E  2 31  ? 17.875  47.389  37.925  1.00 80.90  ? 348  TRP D CZ3 1 
ATOM   3445  C CH2 . TRP E  2 31  ? 17.186  46.962  39.078  1.00 80.31  ? 348  TRP D CH2 1 
ATOM   3446  N N   . TYR E  2 32  ? 23.781  44.072  35.203  1.00 49.29  ? 349  TYR D N   1 
ATOM   3447  C CA  . TYR E  2 32  ? 24.645  44.374  34.087  1.00 46.20  ? 349  TYR D CA  1 
ATOM   3448  C C   . TYR E  2 32  ? 25.382  43.185  33.511  1.00 48.20  ? 349  TYR D C   1 
ATOM   3449  O O   . TYR E  2 32  ? 25.156  42.810  32.352  1.00 40.31  ? 349  TYR D O   1 
ATOM   3450  C CB  . TYR E  2 32  ? 25.650  45.468  34.464  1.00 48.28  ? 349  TYR D CB  1 
ATOM   3451  C CG  . TYR E  2 32  ? 26.462  45.952  33.273  1.00 49.18  ? 349  TYR D CG  1 
ATOM   3452  C CD1 . TYR E  2 32  ? 25.833  46.324  32.085  1.00 48.00  ? 349  TYR D CD1 1 
ATOM   3453  C CD2 . TYR E  2 32  ? 27.849  46.032  33.333  1.00 48.62  ? 349  TYR D CD2 1 
ATOM   3454  C CE1 . TYR E  2 32  ? 26.568  46.757  30.990  1.00 55.28  ? 349  TYR D CE1 1 
ATOM   3455  C CE2 . TYR E  2 32  ? 28.593  46.469  32.248  1.00 53.38  ? 349  TYR D CE2 1 
ATOM   3456  C CZ  . TYR E  2 32  ? 27.952  46.831  31.072  1.00 54.19  ? 349  TYR D CZ  1 
ATOM   3457  O OH  . TYR E  2 32  ? 28.686  47.273  29.983  1.00 48.11  ? 349  TYR D OH  1 
ATOM   3458  N N   . ILE E  2 33  ? 26.258  42.586  34.317  1.00 50.61  ? 350  ILE D N   1 
ATOM   3459  C CA  . ILE E  2 33  ? 27.067  41.474  33.838  1.00 48.62  ? 350  ILE D CA  1 
ATOM   3460  C C   . ILE E  2 33  ? 26.262  40.322  33.275  1.00 52.38  ? 350  ILE D C   1 
ATOM   3461  O O   . ILE E  2 33  ? 26.551  39.825  32.173  1.00 47.67  ? 350  ILE D O   1 
ATOM   3462  C CB  . ILE E  2 33  ? 28.002  40.952  34.922  1.00 42.94  ? 350  ILE D CB  1 
ATOM   3463  C CG1 . ILE E  2 33  ? 28.959  42.063  35.359  1.00 48.73  ? 350  ILE D CG1 1 
ATOM   3464  C CG2 . ILE E  2 33  ? 28.833  39.803  34.364  1.00 48.63  ? 350  ILE D CG2 1 
ATOM   3465  C CD1 . ILE E  2 33  ? 29.862  42.560  34.237  1.00 39.98  ? 350  ILE D CD1 1 
ATOM   3466  N N   . GLN E  2 34  ? 25.245  39.901  34.023  1.00 55.16  ? 351  GLN D N   1 
ATOM   3467  C CA  . GLN E  2 34  ? 24.396  38.796  33.583  1.00 51.99  ? 351  GLN D CA  1 
ATOM   3468  C C   . GLN E  2 34  ? 23.841  39.091  32.202  1.00 49.12  ? 351  GLN D C   1 
ATOM   3469  O O   . GLN E  2 34  ? 23.970  38.295  31.265  1.00 41.32  ? 351  GLN D O   1 
ATOM   3470  C CB  . GLN E  2 34  ? 23.268  38.573  34.585  1.00 48.92  ? 351  GLN D CB  1 
ATOM   3471  C CG  . GLN E  2 34  ? 23.746  37.859  35.843  1.00 58.90  ? 351  GLN D CG  1 
ATOM   3472  C CD  . GLN E  2 34  ? 24.644  36.663  35.523  1.00 58.32  ? 351  GLN D CD  1 
ATOM   3473  O OE1 . GLN E  2 34  ? 24.294  35.809  34.706  1.00 56.42  ? 351  GLN D OE1 1 
ATOM   3474  N NE2 . GLN E  2 34  ? 25.808  36.607  36.163  1.00 59.93  ? 351  GLN D NE2 1 
ATOM   3475  N N   . SER E  2 35  ? 23.240  40.264  32.078  1.00 51.45  ? 352  SER D N   1 
ATOM   3476  C CA  . SER E  2 35  ? 22.686  40.696  30.809  1.00 49.29  ? 352  SER D CA  1 
ATOM   3477  C C   . SER E  2 35  ? 23.786  40.736  29.736  1.00 45.76  ? 352  SER D C   1 
ATOM   3478  O O   . SER E  2 35  ? 23.583  40.260  28.611  1.00 38.69  ? 352  SER D O   1 
ATOM   3479  C CB  . SER E  2 35  ? 22.046  42.077  30.975  1.00 59.93  ? 352  SER D CB  1 
ATOM   3480  O OG  . SER E  2 35  ? 21.459  42.498  29.755  1.00 60.63  ? 352  SER D OG  1 
ATOM   3481  N N   . LEU E  2 36  ? 24.951  41.293  30.089  1.00 35.33  ? 353  LEU D N   1 
ATOM   3482  C CA  . LEU E  2 36  ? 26.054  41.359  29.154  1.00 40.36  ? 353  LEU D CA  1 
ATOM   3483  C C   . LEU E  2 36  ? 26.353  39.983  28.553  1.00 48.53  ? 353  LEU D C   1 
ATOM   3484  O O   . LEU E  2 36  ? 26.381  39.804  27.324  1.00 44.58  ? 353  LEU D O   1 
ATOM   3485  C CB  . LEU E  2 36  ? 27.301  41.923  29.844  1.00 38.78  ? 353  LEU D CB  1 
ATOM   3486  C CG  . LEU E  2 36  ? 28.639  41.920  29.059  1.00 48.89  ? 353  LEU D CG  1 
ATOM   3487  C CD1 . LEU E  2 36  ? 28.485  42.498  27.654  1.00 51.46  ? 353  LEU D CD1 1 
ATOM   3488  C CD2 . LEU E  2 36  ? 29.668  42.717  29.842  1.00 44.20  ? 353  LEU D CD2 1 
ATOM   3489  N N   . CYS E  2 37  ? 26.554  39.007  29.435  1.00 56.67  ? 354  CYS D N   1 
ATOM   3490  C CA  . CYS E  2 37  ? 26.865  37.648  29.025  1.00 56.39  ? 354  CYS D CA  1 
ATOM   3491  C C   . CYS E  2 37  ? 25.729  37.026  28.228  1.00 58.84  ? 354  CYS D C   1 
ATOM   3492  O O   . CYS E  2 37  ? 25.960  36.433  27.163  1.00 57.38  ? 354  CYS D O   1 
ATOM   3493  C CB  . CYS E  2 37  ? 27.175  36.796  30.254  1.00 56.56  ? 354  CYS D CB  1 
ATOM   3494  S SG  . CYS E  2 37  ? 28.737  37.168  31.080  1.00 53.41  ? 354  CYS D SG  1 
ATOM   3495  N N   . GLN E  2 38  ? 24.507  37.150  28.742  1.00 58.19  ? 355  GLN D N   1 
ATOM   3496  C CA  . GLN E  2 38  ? 23.347  36.590  28.047  1.00 67.12  ? 355  GLN D CA  1 
ATOM   3497  C C   . GLN E  2 38  ? 23.373  37.085  26.616  1.00 63.48  ? 355  GLN D C   1 
ATOM   3498  O O   . GLN E  2 38  ? 23.409  36.307  25.662  1.00 58.68  ? 355  GLN D O   1 
ATOM   3499  C CB  . GLN E  2 38  ? 22.024  37.061  28.662  1.00 76.00  ? 355  GLN D CB  1 
ATOM   3500  C CG  . GLN E  2 38  ? 21.728  36.619  30.088  1.00 93.27  ? 355  GLN D CG  1 
ATOM   3501  C CD  . GLN E  2 38  ? 20.324  37.043  30.534  1.00 96.57  ? 355  GLN D CD  1 
ATOM   3502  O OE1 . GLN E  2 38  ? 19.331  36.690  29.891  1.00 95.56  ? 355  GLN D OE1 1 
ATOM   3503  N NE2 . GLN E  2 38  ? 20.241  37.803  31.631  1.00 96.21  ? 355  GLN D NE2 1 
ATOM   3504  N N   . SER E  2 39  ? 23.368  38.404  26.484  1.00 61.61  ? 356  SER D N   1 
ATOM   3505  C CA  . SER E  2 39  ? 23.361  39.021  25.178  1.00 58.92  ? 356  SER D CA  1 
ATOM   3506  C C   . SER E  2 39  ? 24.542  38.577  24.342  1.00 53.37  ? 356  SER D C   1 
ATOM   3507  O O   . SER E  2 39  ? 24.398  38.245  23.171  1.00 47.09  ? 356  SER D O   1 
ATOM   3508  C CB  . SER E  2 39  ? 23.361  40.530  25.323  1.00 65.18  ? 356  SER D CB  1 
ATOM   3509  O OG  . SER E  2 39  ? 23.210  41.136  24.055  1.00 76.48  ? 356  SER D OG  1 
ATOM   3510  N N   . LEU E  2 40  ? 25.720  38.567  24.946  1.00 53.29  ? 357  LEU D N   1 
ATOM   3511  C CA  . LEU E  2 40  ? 26.913  38.138  24.230  1.00 55.84  ? 357  LEU D CA  1 
ATOM   3512  C C   . LEU E  2 40  ? 26.769  36.748  23.636  1.00 59.47  ? 357  LEU D C   1 
ATOM   3513  O O   . LEU E  2 40  ? 27.034  36.544  22.444  1.00 49.34  ? 357  LEU D O   1 
ATOM   3514  C CB  . LEU E  2 40  ? 28.112  38.162  25.167  1.00 55.40  ? 357  LEU D CB  1 
ATOM   3515  C CG  . LEU E  2 40  ? 28.778  39.529  25.211  1.00 57.40  ? 357  LEU D CG  1 
ATOM   3516  C CD1 . LEU E  2 40  ? 29.764  39.626  26.370  1.00 56.61  ? 357  LEU D CD1 1 
ATOM   3517  C CD2 . LEU E  2 40  ? 29.453  39.741  23.866  1.00 42.35  ? 357  LEU D CD2 1 
ATOM   3518  N N   . ARG E  2 41  ? 26.329  35.803  24.471  1.00 66.69  ? 358  ARG D N   1 
ATOM   3519  C CA  . ARG E  2 41  ? 26.182  34.424  24.041  1.00 73.79  ? 358  ARG D CA  1 
ATOM   3520  C C   . ARG E  2 41  ? 25.230  34.164  22.879  1.00 75.04  ? 358  ARG D C   1 
ATOM   3521  O O   . ARG E  2 41  ? 25.520  33.321  22.029  1.00 74.36  ? 358  ARG D O   1 
ATOM   3522  C CB  . ARG E  2 41  ? 25.857  33.528  25.243  1.00 77.19  ? 358  ARG D CB  1 
ATOM   3523  C CG  . ARG E  2 41  ? 27.141  32.966  25.895  1.00 84.41  ? 358  ARG D CG  1 
ATOM   3524  C CD  . ARG E  2 41  ? 26.875  31.998  27.040  1.00 89.95  ? 358  ARG D CD  1 
ATOM   3525  N NE  . ARG E  2 41  ? 26.297  32.673  28.203  1.00 100.00 ? 358  ARG D NE  1 
ATOM   3526  C CZ  . ARG E  2 41  ? 26.063  32.083  29.376  1.00 100.00 ? 358  ARG D CZ  1 
ATOM   3527  N NH1 . ARG E  2 41  ? 26.360  30.799  29.538  1.00 100.00 ? 358  ARG D NH1 1 
ATOM   3528  N NH2 . ARG E  2 41  ? 25.538  32.776  30.387  1.00 100.00 ? 358  ARG D NH2 1 
ATOM   3529  N N   . GLU E  2 42  ? 24.116  34.883  22.808  1.00 77.83  ? 359  GLU D N   1 
ATOM   3530  C CA  . GLU E  2 42  ? 23.188  34.670  21.702  1.00 81.51  ? 359  GLU D CA  1 
ATOM   3531  C C   . GLU E  2 42  ? 23.444  35.590  20.510  1.00 86.07  ? 359  GLU D C   1 
ATOM   3532  O O   . GLU E  2 42  ? 22.993  35.303  19.402  1.00 87.84  ? 359  GLU D O   1 
ATOM   3533  C CB  . GLU E  2 42  ? 21.750  34.840  22.176  1.00 81.79  ? 359  GLU D CB  1 
ATOM   3534  C CG  . GLU E  2 42  ? 21.514  36.116  22.950  1.00 92.05  ? 359  GLU D CG  1 
ATOM   3535  C CD  . GLU E  2 42  ? 20.070  36.267  23.408  1.00 100.00 ? 359  GLU D CD  1 
ATOM   3536  O OE1 . GLU E  2 42  ? 19.532  35.310  24.017  1.00 100.00 ? 359  GLU D OE1 1 
ATOM   3537  O OE2 . GLU E  2 42  ? 19.479  37.347  23.166  1.00 100.00 ? 359  GLU D OE2 1 
ATOM   3538  N N   . ARG E  2 43  ? 24.182  36.679  20.734  1.00 85.85  ? 360  ARG D N   1 
ATOM   3539  C CA  . ARG E  2 43  ? 24.479  37.645  19.681  1.00 80.93  ? 360  ARG D CA  1 
ATOM   3540  C C   . ARG E  2 43  ? 25.741  37.362  18.880  1.00 84.20  ? 360  ARG D C   1 
ATOM   3541  O O   . ARG E  2 43  ? 25.683  37.242  17.651  1.00 84.51  ? 360  ARG D O   1 
ATOM   3542  C CB  . ARG E  2 43  ? 24.574  39.045  20.275  1.00 80.71  ? 360  ARG D CB  1 
ATOM   3543  C CG  . ARG E  2 43  ? 23.240  39.686  20.588  1.00 85.81  ? 360  ARG D CG  1 
ATOM   3544  C CD  . ARG E  2 43  ? 22.646  40.340  19.360  1.00 82.26  ? 360  ARG D CD  1 
ATOM   3545  N NE  . ARG E  2 43  ? 21.348  40.939  19.638  1.00 82.22  ? 360  ARG D NE  1 
ATOM   3546  C CZ  . ARG E  2 43  ? 20.633  41.602  18.740  1.00 82.78  ? 360  ARG D CZ  1 
ATOM   3547  N NH1 . ARG E  2 43  ? 21.101  41.750  17.508  1.00 78.91  ? 360  ARG D NH1 1 
ATOM   3548  N NH2 . ARG E  2 43  ? 19.445  42.102  19.066  1.00 83.46  ? 360  ARG D NH2 1 
ATOM   3549  N N   . CYS E  2 44  ? 26.880  37.273  19.572  1.00 86.18  ? 361  CYS D N   1 
ATOM   3550  C CA  . CYS E  2 44  ? 28.177  37.026  18.926  1.00 86.89  ? 361  CYS D CA  1 
ATOM   3551  C C   . CYS E  2 44  ? 28.123  35.912  17.893  1.00 87.38  ? 361  CYS D C   1 
ATOM   3552  O O   . CYS E  2 44  ? 28.693  36.027  16.805  1.00 84.12  ? 361  CYS D O   1 
ATOM   3553  C CB  . CYS E  2 44  ? 29.238  36.696  19.971  1.00 84.88  ? 361  CYS D CB  1 
ATOM   3554  S SG  . CYS E  2 44  ? 29.601  38.057  21.077  1.00 92.87  ? 361  CYS D SG  1 
ATOM   3555  N N   . PRO E  2 45  ? 27.456  34.801  18.232  1.00 91.17  ? 362  PRO D N   1 
ATOM   3556  C CA  . PRO E  2 45  ? 27.351  33.691  17.287  1.00 90.33  ? 362  PRO D CA  1 
ATOM   3557  C C   . PRO E  2 45  ? 26.765  34.200  15.972  1.00 89.17  ? 362  PRO D C   1 
ATOM   3558  O O   . PRO E  2 45  ? 27.270  33.889  14.894  1.00 88.60  ? 362  PRO D O   1 
ATOM   3559  C CB  . PRO E  2 45  ? 26.413  32.729  18.007  1.00 90.10  ? 362  PRO D CB  1 
ATOM   3560  C CG  . PRO E  2 45  ? 26.790  32.920  19.434  1.00 93.38  ? 362  PRO D CG  1 
ATOM   3561  C CD  . PRO E  2 45  ? 26.862  34.433  19.531  1.00 94.62  ? 362  PRO D CD  1 
ATOM   3562  N N   . ARG E  2 46  B 25.705  35.000  16.081  1.00 88.86  ? 362  ARG D N   1 
ATOM   3563  C CA  . ARG E  2 46  B 25.025  35.568  14.925  1.00 84.83  ? 362  ARG D CA  1 
ATOM   3564  C C   . ARG E  2 46  B 25.861  36.615  14.199  1.00 84.91  ? 362  ARG D C   1 
ATOM   3565  O O   . ARG E  2 46  B 25.442  37.150  13.175  1.00 87.55  ? 362  ARG D O   1 
ATOM   3566  C CB  . ARG E  2 46  B 23.692  36.165  15.370  1.00 86.14  ? 362  ARG D CB  1 
ATOM   3567  C CG  . ARG E  2 46  B 22.681  35.109  15.820  1.00 92.88  ? 362  ARG D CG  1 
ATOM   3568  C CD  . ARG E  2 46  B 21.619  35.696  16.738  1.00 97.11  ? 362  ARG D CD  1 
ATOM   3569  N NE  . ARG E  2 46  B 21.024  36.914  16.181  1.00 100.00 ? 362  ARG D NE  1 
ATOM   3570  C CZ  . ARG E  2 46  B 20.200  37.727  16.843  1.00 100.00 ? 362  ARG D CZ  1 
ATOM   3571  N NH1 . ARG E  2 46  B 19.861  37.459  18.104  1.00 100.00 ? 362  ARG D NH1 1 
ATOM   3572  N NH2 . ARG E  2 46  B 19.715  38.814  16.243  1.00 100.00 ? 362  ARG D NH2 1 
ATOM   3573  N N   . GLY E  2 47  ? 27.046  36.905  14.730  1.00 86.12  ? 363  GLY D N   1 
ATOM   3574  C CA  . GLY E  2 47  ? 27.934  37.877  14.107  1.00 80.36  ? 363  GLY D CA  1 
ATOM   3575  C C   . GLY E  2 47  ? 27.662  39.335  14.428  1.00 76.76  ? 363  GLY D C   1 
ATOM   3576  O O   . GLY E  2 47  ? 28.153  40.213  13.724  1.00 73.07  ? 363  GLY D O   1 
ATOM   3577  N N   . ASP E  2 48  ? 26.886  39.594  15.482  1.00 74.43  ? 364  ASP D N   1 
ATOM   3578  C CA  . ASP E  2 48  ? 26.555  40.956  15.872  1.00 69.35  ? 364  ASP D CA  1 
ATOM   3579  C C   . ASP E  2 48  ? 27.734  41.697  16.475  1.00 66.45  ? 364  ASP D C   1 
ATOM   3580  O O   . ASP E  2 48  ? 28.570  41.108  17.154  1.00 66.84  ? 364  ASP D O   1 
ATOM   3581  C CB  . ASP E  2 48  ? 25.383  40.965  16.853  1.00 67.91  ? 364  ASP D CB  1 
ATOM   3582  C CG  . ASP E  2 48  ? 24.052  40.814  16.157  1.00 73.38  ? 364  ASP D CG  1 
ATOM   3583  O OD1 . ASP E  2 48  ? 23.843  41.515  15.146  1.00 77.81  ? 364  ASP D OD1 1 
ATOM   3584  O OD2 . ASP E  2 48  ? 23.212  40.007  16.612  1.00 75.12  ? 364  ASP D OD2 1 
ATOM   3585  N N   . ASP E  2 49  ? 27.790  42.999  16.212  1.00 66.09  ? 365  ASP D N   1 
ATOM   3586  C CA  . ASP E  2 49  ? 28.853  43.859  16.718  1.00 59.53  ? 365  ASP D CA  1 
ATOM   3587  C C   . ASP E  2 49  ? 28.653  44.187  18.217  1.00 54.33  ? 365  ASP D C   1 
ATOM   3588  O O   . ASP E  2 49  ? 27.539  44.152  18.740  1.00 45.67  ? 365  ASP D O   1 
ATOM   3589  C CB  . ASP E  2 49  ? 28.939  45.121  15.828  1.00 60.33  ? 365  ASP D CB  1 
ATOM   3590  C CG  . ASP E  2 49  ? 28.816  46.399  16.602  1.00 60.46  ? 365  ASP D CG  1 
ATOM   3591  O OD1 . ASP E  2 49  ? 27.660  46.787  16.884  1.00 47.27  ? 365  ASP D OD1 1 
ATOM   3592  O OD2 . ASP E  2 49  ? 29.877  46.997  16.929  1.00 59.16  ? 365  ASP D OD2 1 
ATOM   3593  N N   . ILE E  2 50  ? 29.743  44.490  18.911  1.00 49.40  ? 366  ILE D N   1 
ATOM   3594  C CA  . ILE E  2 50  ? 29.681  44.765  20.346  1.00 48.13  ? 366  ILE D CA  1 
ATOM   3595  C C   . ILE E  2 50  ? 28.784  45.934  20.745  1.00 48.57  ? 366  ILE D C   1 
ATOM   3596  O O   . ILE E  2 50  ? 28.083  45.853  21.760  1.00 44.69  ? 366  ILE D O   1 
ATOM   3597  C CB  . ILE E  2 50  ? 31.128  44.958  20.933  1.00 51.63  ? 366  ILE D CB  1 
ATOM   3598  C CG1 . ILE E  2 50  ? 31.207  44.332  22.327  1.00 45.38  ? 366  ILE D CG1 1 
ATOM   3599  C CG2 . ILE E  2 50  ? 31.517  46.437  20.982  1.00 47.03  ? 366  ILE D CG2 1 
ATOM   3600  C CD1 . ILE E  2 50  ? 30.444  45.064  23.375  1.00 40.73  ? 366  ILE D CD1 1 
ATOM   3601  N N   . LEU E  2 51  ? 28.813  47.018  19.962  1.00 52.02  ? 367  LEU D N   1 
ATOM   3602  C CA  . LEU E  2 51  ? 27.975  48.185  20.244  1.00 49.92  ? 367  LEU D CA  1 
ATOM   3603  C C   . LEU E  2 51  ? 26.503  47.767  20.188  1.00 50.55  ? 367  LEU D C   1 
ATOM   3604  O O   . LEU E  2 51  ? 25.707  48.131  21.070  1.00 44.68  ? 367  LEU D O   1 
ATOM   3605  C CB  . LEU E  2 51  ? 28.275  49.308  19.250  1.00 44.33  ? 367  LEU D CB  1 
ATOM   3606  C CG  . LEU E  2 51  ? 29.624  50.011  19.483  1.00 44.22  ? 367  LEU D CG  1 
ATOM   3607  C CD1 . LEU E  2 51  ? 29.810  51.154  18.496  1.00 41.84  ? 367  LEU D CD1 1 
ATOM   3608  C CD2 . LEU E  2 51  ? 29.681  50.557  20.906  1.00 32.01  ? 367  LEU D CD2 1 
ATOM   3609  N N   . THR E  2 52  ? 26.152  46.988  19.163  1.00 49.55  ? 368  THR D N   1 
ATOM   3610  C CA  . THR E  2 52  ? 24.792  46.478  19.038  1.00 49.23  ? 368  THR D CA  1 
ATOM   3611  C C   . THR E  2 52  ? 24.460  45.723  20.327  1.00 47.06  ? 368  THR D C   1 
ATOM   3612  O O   . THR E  2 52  ? 23.458  45.993  20.981  1.00 46.91  ? 368  THR D O   1 
ATOM   3613  C CB  . THR E  2 52  ? 24.659  45.499  17.851  1.00 48.64  ? 368  THR D CB  1 
ATOM   3614  O OG1 . THR E  2 52  ? 24.724  46.222  16.618  1.00 50.65  ? 368  THR D OG1 1 
ATOM   3615  C CG2 . THR E  2 52  ? 23.346  44.729  17.932  1.00 38.23  ? 368  THR D CG2 1 
ATOM   3616  N N   . ILE E  2 53  ? 25.330  44.790  20.690  1.00 48.63  ? 369  ILE D N   1 
ATOM   3617  C CA  . ILE E  2 53  ? 25.150  43.983  21.890  1.00 49.05  ? 369  ILE D CA  1 
ATOM   3618  C C   . ILE E  2 53  ? 24.970  44.871  23.109  1.00 46.87  ? 369  ILE D C   1 
ATOM   3619  O O   . ILE E  2 53  ? 24.025  44.693  23.885  1.00 41.95  ? 369  ILE D O   1 
ATOM   3620  C CB  . ILE E  2 53  ? 26.360  43.050  22.076  1.00 53.71  ? 369  ILE D CB  1 
ATOM   3621  C CG1 . ILE E  2 53  ? 26.485  42.158  20.832  1.00 61.43  ? 369  ILE D CG1 1 
ATOM   3622  C CG2 . ILE E  2 53  ? 26.220  42.217  23.332  1.00 41.00  ? 369  ILE D CG2 1 
ATOM   3623  C CD1 . ILE E  2 53  ? 27.791  41.393  20.742  1.00 68.28  ? 369  ILE D CD1 1 
ATOM   3624  N N   . LEU E  2 54  ? 25.862  45.840  23.269  1.00 44.34  ? 370  LEU D N   1 
ATOM   3625  C CA  . LEU E  2 54  ? 25.773  46.746  24.400  1.00 45.37  ? 370  LEU D CA  1 
ATOM   3626  C C   . LEU E  2 54  ? 24.463  47.525  24.442  1.00 47.57  ? 370  LEU D C   1 
ATOM   3627  O O   . LEU E  2 54  ? 23.958  47.841  25.516  1.00 49.83  ? 370  LEU D O   1 
ATOM   3628  C CB  . LEU E  2 54  ? 26.962  47.690  24.377  1.00 45.86  ? 370  LEU D CB  1 
ATOM   3629  C CG  . LEU E  2 54  ? 28.169  47.021  25.005  1.00 43.94  ? 370  LEU D CG  1 
ATOM   3630  C CD1 . LEU E  2 54  ? 29.401  47.870  24.838  1.00 46.29  ? 370  LEU D CD1 1 
ATOM   3631  C CD2 . LEU E  2 54  ? 27.861  46.804  26.497  1.00 49.74  ? 370  LEU D CD2 1 
ATOM   3632  N N   . THR E  2 55  ? 23.925  47.845  23.270  1.00 47.60  ? 371  THR D N   1 
ATOM   3633  C CA  . THR E  2 55  ? 22.658  48.553  23.184  1.00 50.16  ? 371  THR D CA  1 
ATOM   3634  C C   . THR E  2 55  ? 21.542  47.672  23.746  1.00 51.10  ? 371  THR D C   1 
ATOM   3635  O O   . THR E  2 55  ? 20.701  48.136  24.524  1.00 48.20  ? 371  THR D O   1 
ATOM   3636  C CB  . THR E  2 55  ? 22.315  48.893  21.732  1.00 50.20  ? 371  THR D CB  1 
ATOM   3637  O OG1 . THR E  2 55  ? 23.258  49.845  21.246  1.00 55.26  ? 371  THR D OG1 1 
ATOM   3638  C CG2 . THR E  2 55  ? 20.929  49.489  21.635  1.00 51.17  ? 371  THR D CG2 1 
ATOM   3639  N N   . GLU E  2 56  ? 21.539  46.403  23.338  1.00 45.87  ? 372  GLU D N   1 
ATOM   3640  C CA  . GLU E  2 56  ? 20.541  45.445  23.806  1.00 50.11  ? 372  GLU D CA  1 
ATOM   3641  C C   . GLU E  2 56  ? 20.639  45.366  25.325  1.00 50.09  ? 372  GLU D C   1 
ATOM   3642  O O   . GLU E  2 56  ? 19.633  45.253  26.021  1.00 54.29  ? 372  GLU D O   1 
ATOM   3643  C CB  . GLU E  2 56  ? 20.784  44.063  23.179  1.00 53.96  ? 372  GLU D CB  1 
ATOM   3644  C CG  . GLU E  2 56  ? 19.679  43.025  23.409  1.00 60.36  ? 372  GLU D CG  1 
ATOM   3645  C CD  . GLU E  2 56  ? 19.856  41.766  22.545  1.00 74.23  ? 372  GLU D CD  1 
ATOM   3646  O OE1 . GLU E  2 56  ? 20.642  40.861  22.915  1.00 80.90  ? 372  GLU D OE1 1 
ATOM   3647  O OE2 . GLU E  2 56  ? 19.207  41.681  21.480  1.00 79.12  ? 372  GLU D OE2 1 
ATOM   3648  N N   . VAL E  2 57  ? 21.856  45.439  25.844  1.00 42.63  ? 373  VAL D N   1 
ATOM   3649  C CA  . VAL E  2 57  ? 22.026  45.392  27.280  1.00 38.63  ? 373  VAL D CA  1 
ATOM   3650  C C   . VAL E  2 57  ? 21.333  46.595  27.877  1.00 37.97  ? 373  VAL D C   1 
ATOM   3651  O O   . VAL E  2 57  ? 20.640  46.482  28.866  1.00 43.50  ? 373  VAL D O   1 
ATOM   3652  C CB  . VAL E  2 57  ? 23.506  45.426  27.670  1.00 42.81  ? 373  VAL D CB  1 
ATOM   3653  C CG1 . VAL E  2 57  ? 23.659  45.270  29.195  1.00 32.47  ? 373  VAL D CG1 1 
ATOM   3654  C CG2 . VAL E  2 57  ? 24.247  44.327  26.923  1.00 42.94  ? 373  VAL D CG2 1 
ATOM   3655  N N   . ASN E  2 58  ? 21.518  47.754  27.263  1.00 47.33  ? 374  ASN D N   1 
ATOM   3656  C CA  . ASN E  2 58  ? 20.899  48.970  27.762  1.00 53.21  ? 374  ASN D CA  1 
ATOM   3657  C C   . ASN E  2 58  ? 19.385  48.804  27.824  1.00 55.16  ? 374  ASN D C   1 
ATOM   3658  O O   . ASN E  2 58  ? 18.743  49.176  28.812  1.00 47.05  ? 374  ASN D O   1 
ATOM   3659  C CB  . ASN E  2 58  ? 21.257  50.160  26.861  1.00 54.80  ? 374  ASN D CB  1 
ATOM   3660  C CG  . ASN E  2 58  ? 22.585  50.788  27.223  1.00 57.24  ? 374  ASN D CG  1 
ATOM   3661  O OD1 . ASN E  2 58  ? 23.081  50.645  28.342  1.00 46.08  ? 374  ASN D OD1 1 
ATOM   3662  N ND2 . ASN E  2 58  ? 23.156  51.518  26.282  1.00 62.92  ? 374  ASN D ND2 1 
ATOM   3663  N N   . TYR E  2 59  ? 18.817  48.245  26.759  1.00 60.82  ? 375  TYR D N   1 
ATOM   3664  C CA  . TYR E  2 59  ? 17.377  48.033  26.696  1.00 63.78  ? 375  TYR D CA  1 
ATOM   3665  C C   . TYR E  2 59  ? 16.972  47.202  27.902  1.00 64.50  ? 375  TYR D C   1 
ATOM   3666  O O   . TYR E  2 59  ? 16.269  47.681  28.796  1.00 68.73  ? 375  TYR D O   1 
ATOM   3667  C CB  . TYR E  2 59  ? 17.012  47.299  25.405  1.00 62.79  ? 375  TYR D CB  1 
ATOM   3668  C CG  . TYR E  2 59  ? 15.529  47.117  25.175  1.00 69.15  ? 375  TYR D CG  1 
ATOM   3669  C CD1 . TYR E  2 59  ? 14.728  46.485  26.117  1.00 69.66  ? 375  TYR D CD1 1 
ATOM   3670  C CD2 . TYR E  2 59  ? 14.928  47.563  23.998  1.00 71.77  ? 375  TYR D CD2 1 
ATOM   3671  C CE1 . TYR E  2 59  ? 13.372  46.305  25.897  1.00 71.02  ? 375  TYR D CE1 1 
ATOM   3672  C CE2 . TYR E  2 59  ? 13.572  47.383  23.770  1.00 70.31  ? 375  TYR D CE2 1 
ATOM   3673  C CZ  . TYR E  2 59  ? 12.805  46.756  24.725  1.00 70.72  ? 375  TYR D CZ  1 
ATOM   3674  O OH  . TYR E  2 59  ? 11.465  46.596  24.517  1.00 80.40  ? 375  TYR D OH  1 
ATOM   3675  N N   . GLU E  2 60  ? 17.452  45.962  27.921  1.00 61.82  ? 376  GLU D N   1 
ATOM   3676  C CA  . GLU E  2 60  ? 17.163  45.007  28.983  1.00 52.04  ? 376  GLU D CA  1 
ATOM   3677  C C   . GLU E  2 60  ? 17.321  45.519  30.410  1.00 43.35  ? 376  GLU D C   1 
ATOM   3678  O O   . GLU E  2 60  ? 16.423  45.372  31.216  1.00 48.60  ? 376  GLU D O   1 
ATOM   3679  C CB  . GLU E  2 60  ? 18.030  43.765  28.800  1.00 57.32  ? 376  GLU D CB  1 
ATOM   3680  C CG  . GLU E  2 60  ? 17.752  42.974  27.526  1.00 63.95  ? 376  GLU D CG  1 
ATOM   3681  C CD  . GLU E  2 60  ? 16.354  42.412  27.494  1.00 66.83  ? 376  GLU D CD  1 
ATOM   3682  O OE1 . GLU E  2 60  ? 15.906  41.896  28.535  1.00 79.97  ? 376  GLU D OE1 1 
ATOM   3683  O OE2 . GLU E  2 60  ? 15.703  42.471  26.437  1.00 65.44  ? 376  GLU D OE2 1 
ATOM   3684  N N   . VAL E  2 61  ? 18.452  46.116  30.732  1.00 33.87  ? 377  VAL D N   1 
ATOM   3685  C CA  . VAL E  2 61  ? 18.665  46.591  32.089  1.00 41.33  ? 377  VAL D CA  1 
ATOM   3686  C C   . VAL E  2 61  ? 17.722  47.721  32.448  1.00 45.77  ? 377  VAL D C   1 
ATOM   3687  O O   . VAL E  2 61  ? 17.505  48.024  33.628  1.00 40.54  ? 377  VAL D O   1 
ATOM   3688  C CB  . VAL E  2 61  ? 20.131  47.048  32.284  1.00 44.68  ? 377  VAL D CB  1 
ATOM   3689  C CG1 . VAL E  2 61  ? 20.419  47.371  33.758  1.00 33.13  ? 377  VAL D CG1 1 
ATOM   3690  C CG2 . VAL E  2 61  ? 21.065  45.939  31.789  1.00 47.05  ? 377  VAL D CG2 1 
ATOM   3691  N N   . SER E  2 62  ? 17.157  48.349  31.424  1.00 54.29  ? 378  SER D N   1 
ATOM   3692  C CA  . SER E  2 62  ? 16.234  49.459  31.642  1.00 60.87  ? 378  SER D CA  1 
ATOM   3693  C C   . SER E  2 62  ? 14.887  48.967  32.144  1.00 65.30  ? 378  SER D C   1 
ATOM   3694  O O   . SER E  2 62  ? 14.238  49.607  32.974  1.00 67.22  ? 378  SER D O   1 
ATOM   3695  C CB  . SER E  2 62  ? 16.045  50.242  30.351  1.00 52.49  ? 378  SER D CB  1 
ATOM   3696  O OG  . SER E  2 62  ? 17.249  50.902  30.028  1.00 62.92  ? 378  SER D OG  1 
ATOM   3697  N N   . ASN E  2 63  ? 14.472  47.816  31.641  1.00 68.28  ? 379  ASN D N   1 
ATOM   3698  C CA  . ASN E  2 63  ? 13.204  47.242  32.038  1.00 74.78  ? 379  ASN D CA  1 
ATOM   3699  C C   . ASN E  2 63  ? 13.269  46.663  33.437  1.00 78.00  ? 379  ASN D C   1 
ATOM   3700  O O   . ASN E  2 63  ? 12.230  46.432  34.055  1.00 84.35  ? 379  ASN D O   1 
ATOM   3701  C CB  . ASN E  2 63  ? 12.784  46.171  31.036  1.00 76.22  ? 379  ASN D CB  1 
ATOM   3702  C CG  . ASN E  2 63  ? 12.481  46.754  29.670  1.00 82.53  ? 379  ASN D CG  1 
ATOM   3703  O OD1 . ASN E  2 63  ? 13.264  47.537  29.113  1.00 85.48  ? 379  ASN D OD1 1 
ATOM   3704  N ND2 . ASN E  2 63  ? 11.338  46.379  29.121  1.00 90.36  ? 379  ASN D ND2 1 
ATOM   3705  N N   . LYS E  2 64  ? 14.480  46.423  33.940  1.00 76.48  ? 381  LYS D N   1 
ATOM   3706  C CA  . LYS E  2 64  ? 14.635  45.889  35.292  1.00 74.91  ? 381  LYS D CA  1 
ATOM   3707  C C   . LYS E  2 64  ? 14.372  47.002  36.309  1.00 75.57  ? 381  LYS D C   1 
ATOM   3708  O O   . LYS E  2 64  ? 14.485  48.194  35.989  1.00 70.71  ? 381  LYS D O   1 
ATOM   3709  C CB  . LYS E  2 64  ? 16.050  45.340  35.516  1.00 73.83  ? 381  LYS D CB  1 
ATOM   3710  C CG  . LYS E  2 64  ? 16.390  44.092  34.726  1.00 80.52  ? 381  LYS D CG  1 
ATOM   3711  C CD  . LYS E  2 64  ? 17.718  43.497  35.205  1.00 83.82  ? 381  LYS D CD  1 
ATOM   3712  C CE  . LYS E  2 64  ? 18.038  42.193  34.485  1.00 81.36  ? 381  LYS D CE  1 
ATOM   3713  N NZ  . LYS E  2 64  ? 16.965  41.192  34.710  1.00 81.81  ? 381  LYS D NZ  1 
ATOM   3714  N N   . ASP E  2 65  A 14.010  46.613  37.529  1.00 78.48  ? 381  ASP D N   1 
ATOM   3715  C CA  . ASP E  2 65  A 13.772  47.589  38.582  1.00 82.12  ? 381  ASP D CA  1 
ATOM   3716  C C   . ASP E  2 65  A 13.785  47.022  39.994  1.00 82.04  ? 381  ASP D C   1 
ATOM   3717  O O   . ASP E  2 65  A 13.325  45.905  40.256  1.00 79.42  ? 381  ASP D O   1 
ATOM   3718  C CB  . ASP E  2 65  A 12.467  48.362  38.338  1.00 89.14  ? 381  ASP D CB  1 
ATOM   3719  C CG  . ASP E  2 65  A 11.259  47.453  38.169  1.00 93.22  ? 381  ASP D CG  1 
ATOM   3720  O OD1 . ASP E  2 65  A 10.968  46.668  39.093  1.00 99.79  ? 381  ASP D OD1 1 
ATOM   3721  O OD2 . ASP E  2 65  A 10.594  47.532  37.110  1.00 93.70  ? 381  ASP D OD2 1 
ATOM   3722  N N   . ASP E  2 66  B 14.366  47.823  40.883  1.00 85.40  ? 381  ASP D N   1 
ATOM   3723  C CA  . ASP E  2 66  B 14.496  47.515  42.291  1.00 83.54  ? 381  ASP D CA  1 
ATOM   3724  C C   . ASP E  2 66  B 13.216  47.980  42.934  1.00 85.83  ? 381  ASP D C   1 
ATOM   3725  O O   . ASP E  2 66  B 13.094  49.128  43.344  1.00 85.15  ? 381  ASP D O   1 
ATOM   3726  C CB  . ASP E  2 66  B 15.695  48.259  42.888  1.00 80.48  ? 381  ASP D CB  1 
ATOM   3727  C CG  . ASP E  2 66  B 15.734  48.204  44.406  1.00 85.08  ? 381  ASP D CG  1 
ATOM   3728  O OD1 . ASP E  2 66  B 15.639  47.098  44.988  1.00 84.62  ? 381  ASP D OD1 1 
ATOM   3729  O OD2 . ASP E  2 66  B 15.876  49.279  45.024  1.00 83.15  ? 381  ASP D OD2 1 
ATOM   3730  N N   . LYS E  2 67  C 12.260  47.061  42.974  1.00 91.22  ? 381  LYS D N   1 
ATOM   3731  C CA  . LYS E  2 67  C 10.935  47.257  43.566  1.00 93.77  ? 381  LYS D CA  1 
ATOM   3732  C C   . LYS E  2 67  C 11.000  47.913  44.955  1.00 91.91  ? 381  LYS D C   1 
ATOM   3733  O O   . LYS E  2 67  C 10.232  48.832  45.259  1.00 90.11  ? 381  LYS D O   1 
ATOM   3734  C CB  . LYS E  2 67  C 10.216  45.890  43.646  1.00 95.87  ? 381  LYS D CB  1 
ATOM   3735  C CG  . LYS E  2 67  C 11.101  44.711  44.118  1.00 92.28  ? 381  LYS D CG  1 
ATOM   3736  C CD  . LYS E  2 67  C 12.129  44.299  43.055  1.00 92.97  ? 381  LYS D CD  1 
ATOM   3737  C CE  . LYS E  2 67  C 13.427  43.780  43.684  1.00 91.44  ? 381  LYS D CE  1 
ATOM   3738  N NZ  . LYS E  2 67  C 14.143  44.810  44.513  1.00 83.24  ? 381  LYS D NZ  1 
ATOM   3739  N N   . LYS E  2 68  D 11.917  47.429  45.789  1.00 86.92  ? 381  LYS D N   1 
ATOM   3740  C CA  . LYS E  2 68  D 12.108  47.962  47.127  1.00 84.48  ? 381  LYS D CA  1 
ATOM   3741  C C   . LYS E  2 68  D 12.167  49.491  47.089  1.00 83.48  ? 381  LYS D C   1 
ATOM   3742  O O   . LYS E  2 68  D 11.292  50.181  47.610  1.00 71.39  ? 381  LYS D O   1 
ATOM   3743  C CB  . LYS E  2 68  D 13.412  47.401  47.712  1.00 89.47  ? 381  LYS D CB  1 
ATOM   3744  C CG  . LYS E  2 68  D 13.689  47.820  49.147  1.00 95.19  ? 381  LYS D CG  1 
ATOM   3745  C CD  . LYS E  2 68  D 12.478  47.518  50.041  1.00 100.00 ? 381  LYS D CD  1 
ATOM   3746  C CE  . LYS E  2 68  D 12.601  48.123  51.449  1.00 100.00 ? 381  LYS D CE  1 
ATOM   3747  N NZ  . LYS E  2 68  D 11.323  48.038  52.237  1.00 97.98  ? 381  LYS D NZ  1 
ATOM   3748  N N   . ASN E  2 69  E 13.208  50.001  46.439  1.00 91.29  ? 381  ASN D N   1 
ATOM   3749  C CA  . ASN E  2 69  E 13.455  51.439  46.313  1.00 95.53  ? 381  ASN D CA  1 
ATOM   3750  C C   . ASN E  2 69  E 12.806  52.066  45.078  1.00 92.64  ? 381  ASN D C   1 
ATOM   3751  O O   . ASN E  2 69  E 12.924  53.273  44.855  1.00 90.87  ? 381  ASN D O   1 
ATOM   3752  C CB  . ASN E  2 69  E 14.974  51.695  46.266  1.00 99.79  ? 381  ASN D CB  1 
ATOM   3753  C CG  . ASN E  2 69  E 15.698  51.237  47.539  1.00 100.00 ? 381  ASN D CG  1 
ATOM   3754  O OD1 . ASN E  2 69  E 15.574  51.868  48.596  1.00 100.00 ? 381  ASN D OD1 1 
ATOM   3755  N ND2 . ASN E  2 69  E 16.453  50.134  47.439  1.00 97.21  ? 381  ASN D ND2 1 
ATOM   3756  N N   . MET E  2 70  ? 12.122  51.245  44.286  1.00 93.41  ? 382  MET D N   1 
ATOM   3757  C CA  . MET E  2 70  ? 11.478  51.704  43.055  1.00 93.83  ? 382  MET D CA  1 
ATOM   3758  C C   . MET E  2 70  ? 12.518  52.196  42.049  1.00 93.15  ? 382  MET D C   1 
ATOM   3759  O O   . MET E  2 70  ? 12.178  52.695  40.980  1.00 93.77  ? 382  MET D O   1 
ATOM   3760  C CB  . MET E  2 70  ? 10.507  52.843  43.342  1.00 92.29  ? 382  MET D CB  1 
ATOM   3761  C CG  . MET E  2 70  ? 9.114   52.417  43.733  1.00 94.99  ? 382  MET D CG  1 
ATOM   3762  S SD  . MET E  2 70  ? 8.003   53.810  43.482  1.00 95.21  ? 382  MET D SD  1 
ATOM   3763  C CE  . MET E  2 70  ? 8.919   55.125  44.398  1.00 95.11  ? 382  MET D CE  1 
ATOM   3764  N N   . GLY E  2 71  ? 13.784  52.038  42.414  1.00 90.22  ? 383  GLY D N   1 
ATOM   3765  C CA  . GLY E  2 71  ? 14.907  52.471  41.601  1.00 83.79  ? 383  GLY D CA  1 
ATOM   3766  C C   . GLY E  2 71  ? 15.168  51.693  40.324  1.00 82.35  ? 383  GLY D C   1 
ATOM   3767  O O   . GLY E  2 71  ? 14.584  50.626  40.084  1.00 79.56  ? 383  GLY D O   1 
ATOM   3768  N N   . LYS E  2 72  ? 16.055  52.242  39.493  1.00 77.77  ? 384  LYS D N   1 
ATOM   3769  C CA  . LYS E  2 72  ? 16.399  51.620  38.220  1.00 68.40  ? 384  LYS D CA  1 
ATOM   3770  C C   . LYS E  2 72  ? 17.889  51.755  37.939  1.00 67.00  ? 384  LYS D C   1 
ATOM   3771  O O   . LYS E  2 72  ? 18.623  52.384  38.710  1.00 68.50  ? 384  LYS D O   1 
ATOM   3772  C CB  . LYS E  2 72  ? 15.584  52.253  37.095  1.00 54.57  ? 384  LYS D CB  1 
ATOM   3773  C CG  . LYS E  2 72  ? 14.106  52.127  37.327  1.00 47.65  ? 384  LYS D CG  1 
ATOM   3774  C CD  . LYS E  2 72  ? 13.332  52.565  36.131  1.00 49.92  ? 384  LYS D CD  1 
ATOM   3775  C CE  . LYS E  2 72  ? 13.438  51.542  35.028  1.00 41.35  ? 384  LYS D CE  1 
ATOM   3776  N NZ  . LYS E  2 72  ? 12.716  50.306  35.369  1.00 33.55  ? 384  LYS D NZ  1 
ATOM   3777  N N   . GLN E  2 73  ? 18.332  51.173  36.829  1.00 62.40  ? 385  GLN D N   1 
ATOM   3778  C CA  . GLN E  2 73  ? 19.746  51.203  36.479  1.00 60.22  ? 385  GLN D CA  1 
ATOM   3779  C C   . GLN E  2 73  ? 19.938  51.541  35.021  1.00 56.65  ? 385  GLN D C   1 
ATOM   3780  O O   . GLN E  2 73  ? 19.295  50.929  34.167  1.00 57.06  ? 385  GLN D O   1 
ATOM   3781  C CB  . GLN E  2 73  ? 20.374  49.832  36.764  1.00 63.79  ? 385  GLN D CB  1 
ATOM   3782  C CG  . GLN E  2 73  ? 21.865  49.761  36.525  1.00 67.28  ? 385  GLN D CG  1 
ATOM   3783  C CD  . GLN E  2 73  ? 22.472  48.459  36.990  1.00 70.48  ? 385  GLN D CD  1 
ATOM   3784  O OE1 . GLN E  2 73  ? 22.343  48.092  38.154  1.00 74.11  ? 385  GLN D OE1 1 
ATOM   3785  N NE2 . GLN E  2 73  ? 23.146  47.754  36.084  1.00 74.18  ? 385  GLN D NE2 1 
ATOM   3786  N N   . MET E  2 74  ? 20.828  52.499  34.741  1.00 56.31  ? 386  MET D N   1 
ATOM   3787  C CA  . MET E  2 74  ? 21.117  52.909  33.361  1.00 49.48  ? 386  MET D CA  1 
ATOM   3788  C C   . MET E  2 74  ? 22.590  52.723  32.989  1.00 47.71  ? 386  MET D C   1 
ATOM   3789  O O   . MET E  2 74  ? 23.450  53.500  33.409  1.00 42.61  ? 386  MET D O   1 
ATOM   3790  C CB  . MET E  2 74  ? 20.731  54.385  33.145  1.00 51.36  ? 386  MET D CB  1 
ATOM   3791  C CG  . MET E  2 74  ? 20.860  54.872  31.701  1.00 34.33  ? 386  MET D CG  1 
ATOM   3792  S SD  . MET E  2 74  ? 19.725  54.013  30.607  1.00 47.36  ? 386  MET D SD  1 
ATOM   3793  C CE  . MET E  2 74  ? 20.764  52.935  29.682  1.00 58.03  ? 386  MET D CE  1 
ATOM   3794  N N   . PRO E  2 75  ? 22.899  51.678  32.206  1.00 48.72  ? 387  PRO D N   1 
ATOM   3795  C CA  . PRO E  2 75  ? 24.261  51.356  31.746  1.00 53.88  ? 387  PRO D CA  1 
ATOM   3796  C C   . PRO E  2 75  ? 24.730  52.431  30.757  1.00 54.20  ? 387  PRO D C   1 
ATOM   3797  O O   . PRO E  2 75  ? 23.912  53.012  30.046  1.00 53.49  ? 387  PRO D O   1 
ATOM   3798  C CB  . PRO E  2 75  ? 24.090  50.000  31.063  1.00 57.06  ? 387  PRO D CB  1 
ATOM   3799  C CG  . PRO E  2 75  ? 22.912  49.406  31.771  1.00 54.75  ? 387  PRO D CG  1 
ATOM   3800  C CD  . PRO E  2 75  ? 21.972  50.585  31.869  1.00 55.62  ? 387  PRO D CD  1 
ATOM   3801  N N   . GLN E  2 76  ? 26.037  52.667  30.675  1.00 51.18  ? 388  GLN D N   1 
ATOM   3802  C CA  . GLN E  2 76  ? 26.540  53.717  29.805  1.00 31.42  ? 388  GLN D CA  1 
ATOM   3803  C C   . GLN E  2 76  ? 27.876  53.488  29.141  1.00 30.16  ? 388  GLN D C   1 
ATOM   3804  O O   . GLN E  2 76  ? 28.937  53.864  29.658  1.00 38.03  ? 388  GLN D O   1 
ATOM   3805  C CB  . GLN E  2 76  ? 26.627  54.998  30.604  1.00 35.90  ? 388  GLN D CB  1 
ATOM   3806  C CG  . GLN E  2 76  ? 26.889  56.213  29.785  1.00 41.27  ? 388  GLN D CG  1 
ATOM   3807  C CD  . GLN E  2 76  ? 27.357  57.365  30.639  1.00 45.22  ? 388  GLN D CD  1 
ATOM   3808  O OE1 . GLN E  2 76  ? 26.710  57.752  31.617  1.00 32.67  ? 388  GLN D OE1 1 
ATOM   3809  N NE2 . GLN E  2 76  ? 28.491  57.927  30.271  1.00 59.24  ? 388  GLN D NE2 1 
ATOM   3810  N N   . PRO E  2 77  ? 27.854  52.901  27.962  1.00 20.33  ? 389  PRO D N   1 
ATOM   3811  C CA  . PRO E  2 77  ? 29.112  52.658  27.262  1.00 28.29  ? 389  PRO D CA  1 
ATOM   3812  C C   . PRO E  2 77  ? 29.710  53.928  26.645  1.00 32.55  ? 389  PRO D C   1 
ATOM   3813  O O   . PRO E  2 77  ? 28.999  54.878  26.315  1.00 44.20  ? 389  PRO D O   1 
ATOM   3814  C CB  . PRO E  2 77  ? 28.729  51.602  26.212  1.00 25.19  ? 389  PRO D CB  1 
ATOM   3815  C CG  . PRO E  2 77  ? 27.285  51.848  25.963  1.00 26.72  ? 389  PRO D CG  1 
ATOM   3816  C CD  . PRO E  2 77  ? 26.733  52.197  27.335  1.00 29.53  ? 389  PRO D CD  1 
ATOM   3817  N N   . THR E  2 78  ? 31.028  53.936  26.504  1.00 35.24  ? 390  THR D N   1 
ATOM   3818  C CA  . THR E  2 78  ? 31.769  55.043  25.897  1.00 35.04  ? 390  THR D CA  1 
ATOM   3819  C C   . THR E  2 78  ? 32.817  54.411  25.021  1.00 37.86  ? 390  THR D C   1 
ATOM   3820  O O   . THR E  2 78  ? 33.387  53.400  25.401  1.00 49.12  ? 390  THR D O   1 
ATOM   3821  C CB  . THR E  2 78  ? 32.474  55.846  26.925  1.00 19.89  ? 390  THR D CB  1 
ATOM   3822  O OG1 . THR E  2 78  ? 31.523  56.216  27.923  1.00 38.22  ? 390  THR D OG1 1 
ATOM   3823  C CG2 . THR E  2 78  ? 33.048  57.070  26.302  1.00 15.67  ? 390  THR D CG2 1 
ATOM   3824  N N   . PHE E  2 79  ? 33.107  54.977  23.864  1.00 37.29  ? 392  PHE D N   1 
ATOM   3825  C CA  . PHE E  2 79  ? 34.089  54.296  23.047  1.00 35.18  ? 392  PHE D CA  1 
ATOM   3826  C C   . PHE E  2 79  ? 34.879  55.126  22.063  1.00 39.43  ? 392  PHE D C   1 
ATOM   3827  O O   . PHE E  2 79  ? 34.423  56.184  21.624  1.00 45.84  ? 392  PHE D O   1 
ATOM   3828  C CB  . PHE E  2 79  ? 33.392  53.197  22.297  1.00 30.57  ? 392  PHE D CB  1 
ATOM   3829  C CG  . PHE E  2 79  ? 32.409  53.690  21.265  1.00 31.92  ? 392  PHE D CG  1 
ATOM   3830  C CD1 . PHE E  2 79  ? 31.093  53.952  21.602  1.00 31.22  ? 392  PHE D CD1 1 
ATOM   3831  C CD2 . PHE E  2 79  ? 32.790  53.832  19.939  1.00 40.25  ? 392  PHE D CD2 1 
ATOM   3832  C CE1 . PHE E  2 79  ? 30.161  54.344  20.628  1.00 33.76  ? 392  PHE D CE1 1 
ATOM   3833  C CE2 . PHE E  2 79  ? 31.869  54.219  18.959  1.00 37.83  ? 392  PHE D CE2 1 
ATOM   3834  C CZ  . PHE E  2 79  ? 30.556  54.473  19.308  1.00 41.65  ? 392  PHE D CZ  1 
ATOM   3835  N N   . THR E  2 80  ? 36.075  54.641  21.738  1.00 27.94  ? 393  THR D N   1 
ATOM   3836  C CA  . THR E  2 80  ? 36.908  55.305  20.768  1.00 26.80  ? 393  THR D CA  1 
ATOM   3837  C C   . THR E  2 80  ? 37.220  54.285  19.687  1.00 33.45  ? 393  THR D C   1 
ATOM   3838  O O   . THR E  2 80  ? 38.140  54.468  18.899  1.00 41.26  ? 393  THR D O   1 
ATOM   3839  C CB  . THR E  2 80  ? 38.202  55.861  21.359  1.00 17.11  ? 393  THR D CB  1 
ATOM   3840  O OG1 . THR E  2 80  ? 38.927  54.829  22.014  1.00 39.03  ? 393  THR D OG1 1 
ATOM   3841  C CG2 . THR E  2 80  ? 37.900  56.940  22.347  1.00 26.29  ? 393  THR D CG2 1 
ATOM   3842  N N   . LEU E  2 81  ? 36.434  53.212  19.641  1.00 26.48  ? 394  LEU D N   1 
ATOM   3843  C CA  . LEU E  2 81  ? 36.612  52.184  18.624  1.00 31.95  ? 394  LEU D CA  1 
ATOM   3844  C C   . LEU E  2 81  ? 36.558  52.796  17.217  1.00 33.24  ? 394  LEU D C   1 
ATOM   3845  O O   . LEU E  2 81  ? 35.702  53.623  16.925  1.00 37.61  ? 394  LEU D O   1 
ATOM   3846  C CB  . LEU E  2 81  ? 35.513  51.117  18.748  1.00 36.00  ? 394  LEU D CB  1 
ATOM   3847  C CG  . LEU E  2 81  ? 35.337  50.407  20.101  1.00 38.76  ? 394  LEU D CG  1 
ATOM   3848  C CD1 . LEU E  2 81  ? 34.262  49.353  19.979  1.00 32.15  ? 394  LEU D CD1 1 
ATOM   3849  C CD2 . LEU E  2 81  ? 36.650  49.763  20.532  1.00 42.57  ? 394  LEU D CD2 1 
ATOM   3850  N N   . ARG E  2 82  ? 37.461  52.391  16.336  1.00 35.50  ? 395  ARG D N   1 
ATOM   3851  C CA  . ARG E  2 82  ? 37.476  52.929  14.984  1.00 34.68  ? 395  ARG D CA  1 
ATOM   3852  C C   . ARG E  2 82  ? 36.952  51.933  13.974  1.00 38.75  ? 395  ARG D C   1 
ATOM   3853  O O   . ARG E  2 82  ? 36.902  52.220  12.781  1.00 42.98  ? 395  ARG D O   1 
ATOM   3854  C CB  . ARG E  2 82  ? 38.882  53.355  14.591  1.00 28.77  ? 395  ARG D CB  1 
ATOM   3855  C CG  . ARG E  2 82  ? 39.490  54.358  15.545  1.00 35.25  ? 395  ARG D CG  1 
ATOM   3856  C CD  . ARG E  2 82  ? 40.963  54.606  15.234  1.00 49.11  ? 395  ARG D CD  1 
ATOM   3857  N NE  . ARG E  2 82  ? 41.711  53.359  15.144  1.00 51.33  ? 395  ARG D NE  1 
ATOM   3858  C CZ  . ARG E  2 82  ? 42.120  52.817  14.006  1.00 53.92  ? 395  ARG D CZ  1 
ATOM   3859  N NH1 . ARG E  2 82  ? 41.869  53.414  12.844  1.00 60.45  ? 395  ARG D NH1 1 
ATOM   3860  N NH2 . ARG E  2 82  ? 42.757  51.660  14.035  1.00 56.58  ? 395  ARG D NH2 1 
ATOM   3861  N N   . LYS E  2 83  ? 36.555  50.762  14.450  1.00 39.54  ? 396  LYS D N   1 
ATOM   3862  C CA  . LYS E  2 83  ? 36.027  49.735  13.564  1.00 42.24  ? 396  LYS D CA  1 
ATOM   3863  C C   . LYS E  2 83  ? 34.933  49.047  14.332  1.00 40.81  ? 396  LYS D C   1 
ATOM   3864  O O   . LYS E  2 83  ? 34.703  49.353  15.508  1.00 35.23  ? 396  LYS D O   1 
ATOM   3865  C CB  . LYS E  2 83  ? 37.093  48.678  13.215  1.00 49.34  ? 396  LYS D CB  1 
ATOM   3866  C CG  . LYS E  2 83  ? 38.365  49.184  12.542  1.00 53.77  ? 396  LYS D CG  1 
ATOM   3867  C CD  . LYS E  2 83  ? 39.250  48.037  12.058  1.00 57.57  ? 396  LYS D CD  1 
ATOM   3868  C CE  . LYS E  2 83  ? 40.519  48.558  11.397  1.00 56.27  ? 396  LYS D CE  1 
ATOM   3869  N NZ  . LYS E  2 83  ? 41.227  47.511  10.620  1.00 68.50  ? 396  LYS D NZ  1 
ATOM   3870  N N   . LYS E  2 84  ? 34.257  48.119  13.668  1.00 43.98  ? 397  LYS D N   1 
ATOM   3871  C CA  . LYS E  2 84  ? 33.226  47.359  14.335  1.00 50.35  ? 397  LYS D CA  1 
ATOM   3872  C C   . LYS E  2 84  ? 33.962  46.267  15.095  1.00 49.15  ? 397  LYS D C   1 
ATOM   3873  O O   . LYS E  2 84  ? 34.850  45.611  14.550  1.00 51.63  ? 397  LYS D O   1 
ATOM   3874  C CB  . LYS E  2 84  ? 32.266  46.746  13.325  1.00 56.18  ? 397  LYS D CB  1 
ATOM   3875  C CG  . LYS E  2 84  ? 31.215  47.701  12.821  1.00 62.53  ? 397  LYS D CG  1 
ATOM   3876  C CD  . LYS E  2 84  ? 29.936  46.953  12.496  1.00 67.95  ? 397  LYS D CD  1 
ATOM   3877  C CE  . LYS E  2 84  ? 28.800  47.917  12.222  1.00 69.90  ? 397  LYS D CE  1 
ATOM   3878  N NZ  . LYS E  2 84  ? 27.497  47.213  12.223  1.00 76.62  ? 397  LYS D NZ  1 
ATOM   3879  N N   . LEU E  2 85  ? 33.626  46.100  16.366  1.00 46.90  ? 398  LEU D N   1 
ATOM   3880  C CA  . LEU E  2 85  ? 34.271  45.078  17.161  1.00 49.32  ? 398  LEU D CA  1 
ATOM   3881  C C   . LEU E  2 85  ? 33.349  43.887  17.221  1.00 53.30  ? 398  LEU D C   1 
ATOM   3882  O O   . LEU E  2 85  ? 32.284  43.949  17.827  1.00 53.55  ? 398  LEU D O   1 
ATOM   3883  C CB  . LEU E  2 85  ? 34.537  45.579  18.577  1.00 53.09  ? 398  LEU D CB  1 
ATOM   3884  C CG  . LEU E  2 85  ? 35.005  44.506  19.564  1.00 52.28  ? 398  LEU D CG  1 
ATOM   3885  C CD1 . LEU E  2 85  ? 36.269  43.859  19.051  1.00 52.67  ? 398  LEU D CD1 1 
ATOM   3886  C CD2 . LEU E  2 85  ? 35.247  45.127  20.924  1.00 52.81  ? 398  LEU D CD2 1 
ATOM   3887  N N   . VAL E  2 86  ? 33.743  42.800  16.579  1.00 59.17  ? 399  VAL D N   1 
ATOM   3888  C CA  . VAL E  2 86  ? 32.918  41.602  16.589  1.00 63.20  ? 399  VAL D CA  1 
ATOM   3889  C C   . VAL E  2 86  ? 33.709  40.408  17.128  1.00 65.57  ? 399  VAL D C   1 
ATOM   3890  O O   . VAL E  2 86  ? 34.902  40.277  16.859  1.00 66.91  ? 399  VAL D O   1 
ATOM   3891  C CB  . VAL E  2 86  ? 32.406  41.291  15.188  1.00 59.08  ? 399  VAL D CB  1 
ATOM   3892  C CG1 . VAL E  2 86  ? 33.552  41.368  14.217  1.00 67.02  ? 399  VAL D CG1 1 
ATOM   3893  C CG2 . VAL E  2 86  ? 31.757  39.910  15.163  1.00 68.40  ? 399  VAL D CG2 1 
ATOM   3894  N N   . PHE E  2 87  ? 33.031  39.555  17.898  1.00 67.89  ? 400  PHE D N   1 
ATOM   3895  C CA  . PHE E  2 87  ? 33.634  38.374  18.507  1.00 63.98  ? 400  PHE D CA  1 
ATOM   3896  C C   . PHE E  2 87  ? 33.122  37.084  17.905  1.00 70.07  ? 400  PHE D C   1 
ATOM   3897  O O   . PHE E  2 87  ? 32.228  36.445  18.459  1.00 74.01  ? 400  PHE D O   1 
ATOM   3898  C CB  . PHE E  2 87  ? 33.333  38.364  19.988  1.00 54.99  ? 400  PHE D CB  1 
ATOM   3899  C CG  . PHE E  2 87  ? 33.978  39.473  20.731  1.00 56.34  ? 400  PHE D CG  1 
ATOM   3900  C CD1 . PHE E  2 87  ? 35.174  40.017  20.288  1.00 54.33  ? 400  PHE D CD1 1 
ATOM   3901  C CD2 . PHE E  2 87  ? 33.403  39.968  21.899  1.00 62.12  ? 400  PHE D CD2 1 
ATOM   3902  C CE1 . PHE E  2 87  ? 35.794  41.044  20.999  1.00 60.77  ? 400  PHE D CE1 1 
ATOM   3903  C CE2 . PHE E  2 87  ? 34.009  40.996  22.620  1.00 60.05  ? 400  PHE D CE2 1 
ATOM   3904  C CZ  . PHE E  2 87  ? 35.206  41.536  22.171  1.00 59.83  ? 400  PHE D CZ  1 
ATOM   3905  N N   . PRO E  2 88  ? 33.689  36.677  16.764  1.00 73.85  ? 401  PRO D N   1 
ATOM   3906  C CA  . PRO E  2 88  ? 33.277  35.447  16.092  1.00 78.67  ? 401  PRO D CA  1 
ATOM   3907  C C   . PRO E  2 88  ? 33.402  34.252  17.012  1.00 82.34  ? 401  PRO D C   1 
ATOM   3908  O O   . PRO E  2 88  ? 34.263  34.226  17.897  1.00 78.31  ? 401  PRO D O   1 
ATOM   3909  C CB  . PRO E  2 88  ? 34.221  35.375  14.899  1.00 75.98  ? 401  PRO D CB  1 
ATOM   3910  C CG  . PRO E  2 88  ? 35.429  36.091  15.384  1.00 76.27  ? 401  PRO D CG  1 
ATOM   3911  C CD  . PRO E  2 88  ? 34.837  37.279  16.077  1.00 74.69  ? 401  PRO D CD  1 
ATOM   3912  N N   . SER E  2 89  ? 32.528  33.273  16.791  1.00 91.35  ? 402  SER D N   1 
ATOM   3913  C CA  . SER E  2 89  ? 32.488  32.051  17.593  1.00 98.50  ? 402  SER D CA  1 
ATOM   3914  C C   . SER E  2 89  ? 32.785  30.777  16.770  1.00 100.00 ? 402  SER D C   1 
ATOM   3915  O O   . SER E  2 89  ? 33.802  30.094  17.066  1.00 98.80  ? 402  SER D O   1 
ATOM   3916  C CB  . SER E  2 89  ? 31.110  31.945  18.264  1.00 98.34  ? 402  SER D CB  1 
ATOM   3917  O OG  . SER E  2 89  ? 31.034  30.812  19.111  1.00 100.00 ? 402  SER D OG  1 
ATOM   3918  O OXT . SER E  2 89  ? 31.996  30.480  15.838  1.00 100.00 ? 402  SER D OXT 1 
HETATM 3919  C C1  . PHQ F  3 1   ? 17.604  42.197  45.789  1.00 100.00 ? 4200 PHQ R C1  1 
HETATM 3920  O O1  . PHQ F  3 1   ? 18.867  42.255  45.623  1.00 100.00 ? 4200 PHQ R O1  1 
HETATM 3921  O O2  . PHQ F  3 1   ? 17.054  40.978  46.192  1.00 100.00 ? 4200 PHQ R O2  1 
HETATM 3922  C C2  . PHQ F  3 1   ? 18.215  40.181  46.265  1.00 100.00 ? 4200 PHQ R C2  1 
HETATM 3923  C C3  . PHQ F  3 1   ? 18.278  38.787  46.655  1.00 100.00 ? 4200 PHQ R C3  1 
HETATM 3924  C C4  . PHQ F  3 1   ? 17.759  37.679  45.876  1.00 100.00 ? 4200 PHQ R C4  1 
HETATM 3925  C C5  . PHQ F  3 1   ? 17.969  36.345  46.379  1.00 100.00 ? 4200 PHQ R C5  1 
HETATM 3926  C C6  . PHQ F  3 1   ? 18.685  36.151  47.618  1.00 100.00 ? 4200 PHQ R C6  1 
HETATM 3927  C C7  . PHQ F  3 1   ? 19.193  37.257  48.399  1.00 100.00 ? 4200 PHQ R C7  1 
HETATM 3928  C C8  . PHQ F  3 1   ? 18.981  38.565  47.899  1.00 100.00 ? 4200 PHQ R C8  1 
ATOM   3929  N N   . ASP F  3 2   ? 16.918  43.296  45.556  1.00 93.62  ? 4201 ASP R N   1 
ATOM   3930  C CA  . ASP F  3 2   ? 17.862  44.355  45.108  1.00 80.52  ? 4201 ASP R CA  1 
ATOM   3931  C C   . ASP F  3 2   ? 18.903  44.996  46.203  1.00 81.63  ? 4201 ASP R C   1 
ATOM   3932  O O   . ASP F  3 2   ? 18.510  45.666  47.203  1.00 75.66  ? 4201 ASP R O   1 
ATOM   3933  C CB  . ASP F  3 2   ? 18.367  44.069  43.643  1.00 64.31  ? 4201 ASP R CB  1 
ATOM   3934  C CG  . ASP F  3 2   ? 17.305  43.375  42.722  1.00 56.83  ? 4201 ASP R CG  1 
ATOM   3935  O OD1 . ASP F  3 2   ? 16.155  43.930  42.511  1.00 63.39  ? 4201 ASP R OD1 1 
ATOM   3936  O OD2 . ASP F  3 2   ? 17.558  42.195  42.197  1.00 41.10  ? 4201 ASP R OD2 1 
ATOM   3937  N N   . GLU F  3 3   ? 20.229  44.610  45.939  1.00 83.77  ? 4202 GLU R N   1 
ATOM   3938  C CA  . GLU F  3 3   ? 21.517  44.900  46.713  1.00 82.78  ? 4202 GLU R CA  1 
ATOM   3939  C C   . GLU F  3 3   ? 22.477  45.815  45.872  1.00 82.80  ? 4202 GLU R C   1 
ATOM   3940  O O   . GLU F  3 3   ? 23.053  45.404  44.822  1.00 68.34  ? 4202 GLU R O   1 
ATOM   3941  C CB  . GLU F  3 3   ? 22.255  43.567  47.058  1.00 89.42  ? 4202 GLU R CB  1 
ATOM   3942  C CG  . GLU F  3 3   ? 22.672  43.419  48.549  1.00 92.90  ? 4202 GLU R CG  1 
ATOM   3943  C CD  . GLU F  3 3   ? 22.869  41.948  49.009  1.00 94.61  ? 4202 GLU R CD  1 
ATOM   3944  O OE1 . GLU F  3 3   ? 21.875  41.283  49.489  1.00 91.98  ? 4202 GLU R OE1 1 
ATOM   3945  O OE2 . GLU F  3 3   ? 24.021  41.368  48.910  1.00 96.91  ? 4202 GLU R OE2 1 
ATOM   3946  N N   . VAL F  3 4   ? 22.629  47.078  46.365  1.00 78.96  ? 4203 VAL R N   1 
ATOM   3947  C CA  . VAL F  3 4   ? 23.487  48.163  45.748  1.00 75.90  ? 4203 VAL R CA  1 
ATOM   3948  C C   . VAL F  3 4   ? 24.995  47.956  45.865  1.00 78.56  ? 4203 VAL R C   1 
ATOM   3949  O O   . VAL F  3 4   ? 25.385  46.953  46.406  1.00 85.16  ? 4203 VAL R O   1 
ATOM   3950  C CB  . VAL F  3 4   ? 23.125  49.499  46.408  1.00 69.75  ? 4203 VAL R CB  1 
ATOM   3951  C CG1 . VAL F  3 4   ? 21.636  49.796  46.301  1.00 77.75  ? 4203 VAL R CG1 1 
ATOM   3952  C CG2 . VAL F  3 4   ? 23.419  49.542  47.916  1.00 67.47  ? 4203 VAL R CG2 1 
HETATM 3953  N N   . ASA F  3 5   ? 25.487  48.247  44.805  1.00 80.43  ? 4204 ASA R N   1 
HETATM 3954  C CA  . ASA F  3 5   ? 26.966  48.170  44.674  1.00 71.46  ? 4204 ASA R CA  1 
HETATM 3955  C C   . ASA F  3 5   ? 27.577  49.544  44.958  1.00 69.65  ? 4204 ASA R C   1 
HETATM 3956  O O   . ASA F  3 5   ? 28.878  49.492  44.927  1.00 65.18  ? 4204 ASA R O   1 
HETATM 3957  C CB  . ASA F  3 5   ? 27.372  47.703  43.262  1.00 63.83  ? 4204 ASA R CB  1 
HETATM 3958  C CG  . ASA F  3 5   ? 27.945  46.291  43.248  1.00 65.10  ? 4204 ASA R CG  1 
HETATM 3959  O OD1 . ASA F  3 5   ? 28.742  45.963  44.161  1.00 72.00  ? 4204 ASA R OD1 1 
HETATM 3960  O OD2 . ASA F  3 5   ? 27.594  45.505  42.321  1.00 60.67  ? 4204 ASA R OD2 1 
ATOM   3961  N N   . LEU G  1 1   ? 38.059  140.962 15.858  1.00 95.10  ? 149  LEU E N   1 
ATOM   3962  C CA  . LEU G  1 1   ? 37.179  140.669 14.689  1.00 92.13  ? 149  LEU E CA  1 
ATOM   3963  C C   . LEU G  1 1   ? 36.396  139.369 14.907  1.00 90.33  ? 149  LEU E C   1 
ATOM   3964  O O   . LEU G  1 1   ? 35.917  138.751 13.958  1.00 90.19  ? 149  LEU E O   1 
ATOM   3965  C CB  . LEU G  1 1   ? 38.030  140.581 13.413  1.00 94.04  ? 149  LEU E CB  1 
ATOM   3966  C CG  . LEU G  1 1   ? 37.322  140.389 12.065  1.00 93.82  ? 149  LEU E CG  1 
ATOM   3967  C CD1 . LEU G  1 1   ? 36.306  141.497 11.859  1.00 93.33  ? 149  LEU E CD1 1 
ATOM   3968  C CD2 . LEU G  1 1   ? 38.348  140.374 10.936  1.00 92.19  ? 149  LEU E CD2 1 
ATOM   3969  N N   . ASP G  1 2   ? 36.275  138.956 16.165  1.00 89.65  ? 150  ASP E N   1 
ATOM   3970  C CA  . ASP G  1 2   ? 35.534  137.740 16.503  1.00 90.81  ? 150  ASP E CA  1 
ATOM   3971  C C   . ASP G  1 2   ? 34.089  138.134 16.795  1.00 87.56  ? 150  ASP E C   1 
ATOM   3972  O O   . ASP G  1 2   ? 33.844  139.150 17.440  1.00 93.01  ? 150  ASP E O   1 
ATOM   3973  C CB  . ASP G  1 2   ? 36.093  137.054 17.767  1.00 92.10  ? 150  ASP E CB  1 
ATOM   3974  C CG  . ASP G  1 2   ? 37.590  136.832 17.718  1.00 90.57  ? 150  ASP E CG  1 
ATOM   3975  O OD1 . ASP G  1 2   ? 38.090  136.371 16.675  1.00 84.69  ? 150  ASP E OD1 1 
ATOM   3976  O OD2 . ASP G  1 2   ? 38.260  137.107 18.739  1.00 93.68  ? 150  ASP E OD2 1 
ATOM   3977  N N   . LYS G  1 3   ? 33.135  137.332 16.335  1.00 80.37  ? 151  LYS E N   1 
ATOM   3978  C CA  . LYS G  1 3   ? 31.731  137.615 16.590  1.00 67.50  ? 151  LYS E CA  1 
ATOM   3979  C C   . LYS G  1 3   ? 31.511  137.565 18.104  1.00 65.58  ? 151  LYS E C   1 
ATOM   3980  O O   . LYS G  1 3   ? 32.159  136.798 18.820  1.00 61.82  ? 151  LYS E O   1 
ATOM   3981  C CB  . LYS G  1 3   ? 30.836  136.569 15.911  1.00 63.39  ? 151  LYS E CB  1 
ATOM   3982  C CG  . LYS G  1 3   ? 31.080  136.356 14.427  1.00 64.47  ? 151  LYS E CG  1 
ATOM   3983  C CD  . LYS G  1 3   ? 30.461  137.448 13.590  1.00 75.09  ? 151  LYS E CD  1 
ATOM   3984  C CE  . LYS G  1 3   ? 30.663  137.183 12.102  1.00 85.33  ? 151  LYS E CE  1 
ATOM   3985  N NZ  . LYS G  1 3   ? 30.043  138.241 11.231  1.00 93.21  ? 151  LYS E NZ  1 
ATOM   3986  N N   . VAL G  1 4   ? 30.609  138.399 18.601  1.00 68.43  ? 152  VAL E N   1 
ATOM   3987  C CA  . VAL G  1 4   ? 30.301  138.400 20.025  1.00 65.87  ? 152  VAL E CA  1 
ATOM   3988  C C   . VAL G  1 4   ? 28.800  138.542 20.272  1.00 64.49  ? 152  VAL E C   1 
ATOM   3989  O O   . VAL G  1 4   ? 28.067  139.135 19.471  1.00 60.62  ? 152  VAL E O   1 
ATOM   3990  C CB  . VAL G  1 4   ? 31.026  139.534 20.752  1.00 65.25  ? 152  VAL E CB  1 
ATOM   3991  C CG1 . VAL G  1 4   ? 30.660  139.517 22.231  1.00 58.94  ? 152  VAL E CG1 1 
ATOM   3992  C CG2 . VAL G  1 4   ? 32.517  139.378 20.575  1.00 63.53  ? 152  VAL E CG2 1 
ATOM   3993  N N   . TYR G  1 5   ? 28.342  137.968 21.374  1.00 61.76  ? 153  TYR E N   1 
ATOM   3994  C CA  . TYR G  1 5   ? 26.943  138.061 21.718  1.00 62.19  ? 153  TYR E CA  1 
ATOM   3995  C C   . TYR G  1 5   ? 26.691  139.454 22.239  1.00 64.39  ? 153  TYR E C   1 
ATOM   3996  O O   . TYR G  1 5   ? 27.419  139.939 23.107  1.00 63.09  ? 153  TYR E O   1 
ATOM   3997  C CB  . TYR G  1 5   ? 26.592  137.047 22.800  1.00 62.05  ? 153  TYR E CB  1 
ATOM   3998  C CG  . TYR G  1 5   ? 26.407  135.647 22.274  1.00 69.59  ? 153  TYR E CG  1 
ATOM   3999  C CD1 . TYR G  1 5   ? 25.587  135.396 21.181  1.00 67.70  ? 153  TYR E CD1 1 
ATOM   4000  C CD2 . TYR G  1 5   ? 27.038  134.566 22.883  1.00 72.95  ? 153  TYR E CD2 1 
ATOM   4001  C CE1 . TYR G  1 5   ? 25.401  134.102 20.711  1.00 71.09  ? 153  TYR E CE1 1 
ATOM   4002  C CE2 . TYR G  1 5   ? 26.855  133.268 22.418  1.00 68.87  ? 153  TYR E CE2 1 
ATOM   4003  C CZ  . TYR G  1 5   ? 26.037  133.043 21.340  1.00 66.51  ? 153  TYR E CZ  1 
ATOM   4004  O OH  . TYR G  1 5   ? 25.834  131.754 20.915  1.00 65.65  ? 153  TYR E OH  1 
ATOM   4005  N N   . GLN G  1 6   ? 25.660  140.093 21.700  1.00 66.00  ? 154  GLN E N   1 
ATOM   4006  C CA  . GLN G  1 6   ? 25.282  141.425 22.126  1.00 67.10  ? 154  GLN E CA  1 
ATOM   4007  C C   . GLN G  1 6   ? 24.870  141.377 23.596  1.00 61.44  ? 154  GLN E C   1 
ATOM   4008  O O   . GLN G  1 6   ? 24.175  140.459 24.023  1.00 52.93  ? 154  GLN E O   1 
ATOM   4009  C CB  . GLN G  1 6   ? 24.124  141.923 21.269  1.00 73.90  ? 154  GLN E CB  1 
ATOM   4010  C CG  . GLN G  1 6   ? 23.766  143.375 21.498  1.00 86.35  ? 154  GLN E CG  1 
ATOM   4011  C CD  . GLN G  1 6   ? 22.621  143.821 20.618  1.00 92.91  ? 154  GLN E CD  1 
ATOM   4012  O OE1 . GLN G  1 6   ? 21.482  143.379 20.792  1.00 95.55  ? 154  GLN E OE1 1 
ATOM   4013  N NE2 . GLN G  1 6   ? 22.916  144.695 19.655  1.00 98.52  ? 154  GLN E NE2 1 
ATOM   4014  N N   . MET G  1 7   ? 25.316  142.361 24.370  1.00 65.66  ? 155  MET E N   1 
ATOM   4015  C CA  . MET G  1 7   ? 24.999  142.419 25.792  1.00 71.86  ? 155  MET E CA  1 
ATOM   4016  C C   . MET G  1 7   ? 24.849  143.836 26.317  1.00 81.34  ? 155  MET E C   1 
ATOM   4017  O O   . MET G  1 7   ? 25.613  144.253 27.191  1.00 90.04  ? 155  MET E O   1 
ATOM   4018  C CB  . MET G  1 7   ? 26.069  141.704 26.611  1.00 63.68  ? 155  MET E CB  1 
ATOM   4019  C CG  . MET G  1 7   ? 26.001  140.210 26.496  1.00 69.01  ? 155  MET E CG  1 
ATOM   4020  S SD  . MET G  1 7   ? 24.536  139.564 27.278  1.00 73.19  ? 155  MET E SD  1 
ATOM   4021  C CE  . MET G  1 7   ? 24.994  139.755 28.971  1.00 64.50  ? 155  MET E CE  1 
ATOM   4022  N N   . LYS G  1 8   ? 23.868  144.573 25.791  1.00 85.08  ? 156  LYS E N   1 
ATOM   4023  C CA  . LYS G  1 8   ? 23.608  145.952 26.225  1.00 82.18  ? 156  LYS E CA  1 
ATOM   4024  C C   . LYS G  1 8   ? 22.292  146.000 27.001  1.00 82.37  ? 156  LYS E C   1 
ATOM   4025  O O   . LYS G  1 8   ? 22.217  146.614 28.056  1.00 83.46  ? 156  LYS E O   1 
ATOM   4026  C CB  . LYS G  1 8   ? 23.559  146.890 25.017  1.00 78.80  ? 156  LYS E CB  1 
ATOM   4027  C CG  . LYS G  1 8   ? 22.494  146.545 23.989  1.00 86.78  ? 156  LYS E CG  1 
ATOM   4028  C CD  . LYS G  1 8   ? 23.050  146.476 22.560  1.00 90.49  ? 156  LYS E CD  1 
ATOM   4029  C CE  . LYS G  1 8   ? 23.674  147.784 22.096  1.00 92.86  ? 156  LYS E CE  1 
ATOM   4030  N NZ  . LYS G  1 8   ? 24.989  148.063 22.754  1.00 100.00 ? 156  LYS E NZ  1 
ATOM   4031  N N   . SER G  1 9   ? 21.274  145.324 26.473  1.00 83.05  ? 157  SER E N   1 
ATOM   4032  C CA  . SER G  1 9   ? 19.943  145.233 27.080  1.00 78.04  ? 157  SER E CA  1 
ATOM   4033  C C   . SER G  1 9   ? 19.787  145.730 28.520  1.00 78.00  ? 157  SER E C   1 
ATOM   4034  O O   . SER G  1 9   ? 20.450  145.236 29.432  1.00 67.67  ? 157  SER E O   1 
ATOM   4035  C CB  . SER G  1 9   ? 19.449  143.790 27.010  1.00 72.08  ? 157  SER E CB  1 
ATOM   4036  O OG  . SER G  1 9   ? 18.502  143.544 28.032  1.00 73.07  ? 157  SER E OG  1 
ATOM   4037  N N   . LYS G  1 10  ? 18.868  146.688 28.688  1.00 84.80  ? 160  LYS E N   1 
ATOM   4038  C CA  . LYS G  1 10  ? 18.523  147.326 29.965  1.00 87.77  ? 160  LYS E CA  1 
ATOM   4039  C C   . LYS G  1 10  ? 18.619  146.393 31.168  1.00 88.84  ? 160  LYS E C   1 
ATOM   4040  O O   . LYS G  1 10  ? 19.316  146.703 32.138  1.00 86.79  ? 160  LYS E O   1 
ATOM   4041  C CB  . LYS G  1 10  ? 17.112  147.924 29.877  1.00 92.13  ? 160  LYS E CB  1 
ATOM   4042  C CG  . LYS G  1 10  ? 16.929  148.854 28.691  1.00 98.09  ? 160  LYS E CG  1 
ATOM   4043  C CD  . LYS G  1 10  ? 15.589  149.563 28.722  1.00 100.00 ? 160  LYS E CD  1 
ATOM   4044  C CE  . LYS G  1 10  ? 15.541  150.635 27.634  1.00 100.00 ? 160  LYS E CE  1 
ATOM   4045  N NZ  . LYS G  1 10  ? 14.267  151.412 27.636  1.00 100.00 ? 160  LYS E NZ  1 
ATOM   4046  N N   . PRO G  1 11  ? 17.868  145.275 31.158  1.00 87.60  ? 161  PRO E N   1 
ATOM   4047  C CA  . PRO G  1 11  ? 18.017  144.407 32.326  1.00 84.20  ? 161  PRO E CA  1 
ATOM   4048  C C   . PRO G  1 11  ? 18.854  143.169 31.946  1.00 82.36  ? 161  PRO E C   1 
ATOM   4049  O O   . PRO G  1 11  ? 19.010  142.253 32.762  1.00 88.19  ? 161  PRO E O   1 
ATOM   4050  C CB  . PRO G  1 11  ? 16.574  144.030 32.680  1.00 80.94  ? 161  PRO E CB  1 
ATOM   4051  C CG  . PRO G  1 11  ? 15.721  144.970 31.850  1.00 86.35  ? 161  PRO E CG  1 
ATOM   4052  C CD  . PRO G  1 11  ? 16.521  145.106 30.596  1.00 85.00  ? 161  PRO E CD  1 
ATOM   4053  N N   . ARG G  1 12  ? 19.391  143.146 30.720  1.00 70.34  ? 162  ARG E N   1 
ATOM   4054  C CA  . ARG G  1 12  ? 20.193  142.004 30.226  1.00 66.96  ? 162  ARG E CA  1 
ATOM   4055  C C   . ARG G  1 12  ? 19.324  140.762 30.010  1.00 60.31  ? 162  ARG E C   1 
ATOM   4056  O O   . ARG G  1 12  ? 19.219  140.236 28.891  1.00 52.80  ? 162  ARG E O   1 
ATOM   4057  C CB  . ARG G  1 12  ? 21.311  141.624 31.207  1.00 66.42  ? 162  ARG E CB  1 
ATOM   4058  C CG  . ARG G  1 12  ? 22.479  142.572 31.263  1.00 71.09  ? 162  ARG E CG  1 
ATOM   4059  C CD  . ARG G  1 12  ? 23.392  142.386 30.096  1.00 72.54  ? 162  ARG E CD  1 
ATOM   4060  N NE  . ARG G  1 12  ? 24.592  143.196 30.260  1.00 77.09  ? 162  ARG E NE  1 
ATOM   4061  C CZ  . ARG G  1 12  ? 24.631  144.512 30.096  1.00 69.12  ? 162  ARG E CZ  1 
ATOM   4062  N NH1 . ARG G  1 12  ? 23.538  145.167 29.758  1.00 65.57  ? 162  ARG E NH1 1 
ATOM   4063  N NH2 . ARG G  1 12  ? 25.761  145.171 30.274  1.00 71.61  ? 162  ARG E NH2 1 
ATOM   4064  N N   . GLY G  1 13  ? 18.727  140.287 31.100  1.00 45.81  ? 163  GLY E N   1 
ATOM   4065  C CA  . GLY G  1 13  ? 17.866  139.128 31.029  1.00 45.73  ? 163  GLY E CA  1 
ATOM   4066  C C   . GLY G  1 13  ? 17.644  138.610 32.427  1.00 48.94  ? 163  GLY E C   1 
ATOM   4067  O O   . GLY G  1 13  ? 18.244  139.117 33.370  1.00 50.10  ? 163  GLY E O   1 
ATOM   4068  N N   . TYR G  1 14  ? 16.782  137.616 32.584  1.00 50.13  ? 164  TYR E N   1 
ATOM   4069  C CA  . TYR G  1 14  ? 16.556  137.079 33.909  1.00 52.55  ? 164  TYR E CA  1 
ATOM   4070  C C   . TYR G  1 14  ? 17.668  136.100 34.268  1.00 61.65  ? 164  TYR E C   1 
ATOM   4071  O O   . TYR G  1 14  ? 18.375  135.577 33.399  1.00 65.70  ? 164  TYR E O   1 
ATOM   4072  C CB  . TYR G  1 14  ? 15.212  136.358 33.971  1.00 56.23  ? 164  TYR E CB  1 
ATOM   4073  C CG  . TYR G  1 14  ? 14.052  137.245 33.612  1.00 71.26  ? 164  TYR E CG  1 
ATOM   4074  C CD1 . TYR G  1 14  ? 13.478  138.095 34.564  1.00 71.21  ? 164  TYR E CD1 1 
ATOM   4075  C CD2 . TYR G  1 14  ? 13.560  137.284 32.307  1.00 76.13  ? 164  TYR E CD2 1 
ATOM   4076  C CE1 . TYR G  1 14  ? 12.448  138.965 34.225  1.00 69.81  ? 164  TYR E CE1 1 
ATOM   4077  C CE2 . TYR G  1 14  ? 12.523  138.150 31.956  1.00 76.30  ? 164  TYR E CE2 1 
ATOM   4078  C CZ  . TYR G  1 14  ? 11.971  138.990 32.918  1.00 75.21  ? 164  TYR E CZ  1 
ATOM   4079  O OH  . TYR G  1 14  ? 10.944  139.848 32.561  1.00 67.05  ? 164  TYR E OH  1 
ATOM   4080  N N   . CYS G  1 15  ? 17.826  135.864 35.561  1.00 60.27  ? 165  CYS E N   1 
ATOM   4081  C CA  . CYS G  1 15  ? 18.809  134.926 36.051  1.00 54.01  ? 165  CYS E CA  1 
ATOM   4082  C C   . CYS G  1 15  ? 18.142  134.146 37.172  1.00 52.39  ? 165  CYS E C   1 
ATOM   4083  O O   . CYS G  1 15  ? 18.199  134.544 38.326  1.00 54.35  ? 165  CYS E O   1 
ATOM   4084  C CB  . CYS G  1 15  ? 20.032  135.663 36.583  1.00 60.64  ? 165  CYS E CB  1 
ATOM   4085  S SG  . CYS G  1 15  ? 21.239  134.592 37.399  1.00 72.69  ? 165  CYS E SG  1 
ATOM   4086  N N   . LEU G  1 16  ? 17.478  133.050 36.836  1.00 50.36  ? 166  LEU E N   1 
ATOM   4087  C CA  . LEU G  1 16  ? 16.838  132.246 37.867  1.00 50.40  ? 166  LEU E CA  1 
ATOM   4088  C C   . LEU G  1 16  ? 17.891  131.694 38.809  1.00 52.90  ? 166  LEU E C   1 
ATOM   4089  O O   . LEU G  1 16  ? 19.085  131.724 38.526  1.00 58.17  ? 166  LEU E O   1 
ATOM   4090  C CB  . LEU G  1 16  ? 16.120  131.039 37.270  1.00 58.01  ? 166  LEU E CB  1 
ATOM   4091  C CG  . LEU G  1 16  ? 15.185  131.212 36.092  1.00 62.38  ? 166  LEU E CG  1 
ATOM   4092  C CD1 . LEU G  1 16  ? 14.330  129.957 35.987  1.00 65.58  ? 166  LEU E CD1 1 
ATOM   4093  C CD2 . LEU G  1 16  ? 14.318  132.429 36.302  1.00 66.78  ? 166  LEU E CD2 1 
ATOM   4094  N N   . ILE G  1 17  ? 17.430  131.162 39.926  1.00 46.70  ? 167  ILE E N   1 
ATOM   4095  C CA  . ILE G  1 17  ? 18.307  130.555 40.892  1.00 43.33  ? 167  ILE E CA  1 
ATOM   4096  C C   . ILE G  1 17  ? 17.472  129.595 41.694  1.00 49.85  ? 167  ILE E C   1 
ATOM   4097  O O   . ILE G  1 17  ? 16.877  129.989 42.680  1.00 52.91  ? 167  ILE E O   1 
ATOM   4098  C CB  . ILE G  1 17  ? 18.906  131.567 41.865  1.00 39.51  ? 167  ILE E CB  1 
ATOM   4099  C CG1 . ILE G  1 17  ? 19.813  132.548 41.114  1.00 40.96  ? 167  ILE E CG1 1 
ATOM   4100  C CG2 . ILE G  1 17  ? 19.688  130.829 42.953  1.00 42.73  ? 167  ILE E CG2 1 
ATOM   4101  C CD1 . ILE G  1 17  ? 20.717  133.367 42.024  1.00 44.25  ? 167  ILE E CD1 1 
ATOM   4102  N N   . ILE G  1 18  ? 17.386  128.343 41.261  1.00 57.70  ? 168  ILE E N   1 
ATOM   4103  C CA  . ILE G  1 18  ? 16.629  127.364 42.026  1.00 56.17  ? 168  ILE E CA  1 
ATOM   4104  C C   . ILE G  1 18  ? 17.616  126.985 43.108  1.00 63.38  ? 168  ILE E C   1 
ATOM   4105  O O   . ILE G  1 18  ? 18.643  126.378 42.828  1.00 66.88  ? 168  ILE E O   1 
ATOM   4106  C CB  . ILE G  1 18  ? 16.309  126.120 41.217  1.00 50.77  ? 168  ILE E CB  1 
ATOM   4107  C CG1 . ILE G  1 18  ? 15.641  126.512 39.908  1.00 46.85  ? 168  ILE E CG1 1 
ATOM   4108  C CG2 . ILE G  1 18  ? 15.413  125.215 42.014  1.00 47.26  ? 168  ILE E CG2 1 
ATOM   4109  C CD1 . ILE G  1 18  ? 14.587  127.536 40.065  1.00 40.32  ? 168  ILE E CD1 1 
ATOM   4110  N N   . ASN G  1 19  ? 17.312  127.374 44.339  1.00 68.25  ? 169  ASN E N   1 
ATOM   4111  C CA  . ASN G  1 19  ? 18.173  127.111 45.488  1.00 64.15  ? 169  ASN E CA  1 
ATOM   4112  C C   . ASN G  1 19  ? 17.539  126.072 46.417  1.00 60.61  ? 169  ASN E C   1 
ATOM   4113  O O   . ASN G  1 19  ? 16.647  126.390 47.196  1.00 58.86  ? 169  ASN E O   1 
ATOM   4114  C CB  . ASN G  1 19  ? 18.399  128.426 46.240  1.00 63.27  ? 169  ASN E CB  1 
ATOM   4115  C CG  . ASN G  1 19  ? 19.197  128.247 47.497  1.00 67.05  ? 169  ASN E CG  1 
ATOM   4116  O OD1 . ASN G  1 19  ? 18.893  127.369 48.313  1.00 71.14  ? 169  ASN E OD1 1 
ATOM   4117  N ND2 . ASN G  1 19  ? 20.223  129.086 47.678  1.00 59.69  ? 169  ASN E ND2 1 
ATOM   4118  N N   . ASN G  1 20  ? 17.993  124.831 46.331  1.00 59.99  ? 170  ASN E N   1 
ATOM   4119  C CA  . ASN G  1 20  ? 17.452  123.785 47.183  1.00 65.01  ? 170  ASN E CA  1 
ATOM   4120  C C   . ASN G  1 20  ? 18.329  123.545 48.395  1.00 72.52  ? 170  ASN E C   1 
ATOM   4121  O O   . ASN G  1 20  ? 19.529  123.285 48.282  1.00 70.37  ? 170  ASN E O   1 
ATOM   4122  C CB  . ASN G  1 20  ? 17.282  122.493 46.400  1.00 58.43  ? 170  ASN E CB  1 
ATOM   4123  C CG  . ASN G  1 20  ? 16.091  122.538 45.492  1.00 63.45  ? 170  ASN E CG  1 
ATOM   4124  O OD1 . ASN G  1 20  ? 15.510  123.600 45.279  1.00 64.49  ? 170  ASN E OD1 1 
ATOM   4125  N ND2 . ASN G  1 20  ? 15.712  121.393 44.946  1.00 60.88  ? 170  ASN E ND2 1 
ATOM   4126  N N   . HIS G  1 21  ? 17.712  123.633 49.566  1.00 79.98  ? 171  HIS E N   1 
ATOM   4127  C CA  . HIS G  1 21  ? 18.416  123.445 50.828  1.00 80.65  ? 171  HIS E CA  1 
ATOM   4128  C C   . HIS G  1 21  ? 17.808  122.349 51.704  1.00 76.16  ? 171  HIS E C   1 
ATOM   4129  O O   . HIS G  1 21  ? 18.454  121.349 51.988  1.00 80.42  ? 171  HIS E O   1 
ATOM   4130  C CB  . HIS G  1 21  ? 18.435  124.766 51.612  1.00 84.65  ? 171  HIS E CB  1 
ATOM   4131  C CG  . HIS G  1 21  ? 18.733  124.596 53.069  1.00 85.94  ? 171  HIS E CG  1 
ATOM   4132  N ND1 . HIS G  1 21  ? 20.010  124.404 53.552  1.00 86.56  ? 171  HIS E ND1 1 
ATOM   4133  C CD2 . HIS G  1 21  ? 17.911  124.522 54.140  1.00 85.39  ? 171  HIS E CD2 1 
ATOM   4134  C CE1 . HIS G  1 21  ? 19.962  124.217 54.857  1.00 84.27  ? 171  HIS E CE1 1 
ATOM   4135  N NE2 . HIS G  1 21  ? 18.700  124.283 55.239  1.00 91.81  ? 171  HIS E NE2 1 
ATOM   4136  N N   . ASN G  1 22  ? 16.567  122.550 52.126  1.00 71.91  ? 172  ASN E N   1 
ATOM   4137  C CA  . ASN G  1 22  ? 15.875  121.620 53.007  1.00 71.97  ? 172  ASN E CA  1 
ATOM   4138  C C   . ASN G  1 22  ? 15.320  120.378 52.328  1.00 68.71  ? 172  ASN E C   1 
ATOM   4139  O O   . ASN G  1 22  ? 14.173  120.361 51.882  1.00 70.12  ? 172  ASN E O   1 
ATOM   4140  C CB  . ASN G  1 22  ? 14.754  122.376 53.741  1.00 79.76  ? 172  ASN E CB  1 
ATOM   4141  C CG  . ASN G  1 22  ? 13.908  121.473 54.636  1.00 86.81  ? 172  ASN E CG  1 
ATOM   4142  O OD1 . ASN G  1 22  ? 14.431  120.614 55.349  1.00 86.89  ? 172  ASN E OD1 1 
ATOM   4143  N ND2 . ASN G  1 22  ? 12.589  121.683 54.614  1.00 85.18  ? 172  ASN E ND2 1 
ATOM   4144  N N   . PHE G  1 23  ? 16.119  119.318 52.281  1.00 68.85  ? 173  PHE E N   1 
ATOM   4145  C CA  . PHE G  1 23  ? 15.660  118.093 51.634  1.00 77.30  ? 173  PHE E CA  1 
ATOM   4146  C C   . PHE G  1 23  ? 14.840  117.191 52.524  1.00 79.11  ? 173  PHE E C   1 
ATOM   4147  O O   . PHE G  1 23  ? 14.998  115.963 52.533  1.00 78.67  ? 173  PHE E O   1 
ATOM   4148  C CB  . PHE G  1 23  ? 16.835  117.341 51.010  1.00 73.76  ? 173  PHE E CB  1 
ATOM   4149  C CG  . PHE G  1 23  ? 17.345  117.998 49.767  1.00 69.18  ? 173  PHE E CG  1 
ATOM   4150  C CD1 . PHE G  1 23  ? 18.133  119.148 49.848  1.00 69.90  ? 173  PHE E CD1 1 
ATOM   4151  C CD2 . PHE G  1 23  ? 16.946  117.540 48.515  1.00 67.60  ? 173  PHE E CD2 1 
ATOM   4152  C CE1 . PHE G  1 23  ? 18.509  119.838 48.702  1.00 72.44  ? 173  PHE E CE1 1 
ATOM   4153  C CE2 . PHE G  1 23  ? 17.316  118.221 47.354  1.00 70.90  ? 173  PHE E CE2 1 
ATOM   4154  C CZ  . PHE G  1 23  ? 18.097  119.373 47.446  1.00 75.23  ? 173  PHE E CZ  1 
ATOM   4155  N N   . ALA G  1 24  ? 13.895  117.848 53.191  1.00 82.46  ? 174  ALA E N   1 
ATOM   4156  C CA  . ALA G  1 24  ? 12.958  117.229 54.109  1.00 88.62  ? 174  ALA E CA  1 
ATOM   4157  C C   . ALA G  1 24  ? 12.162  116.074 53.508  1.00 89.99  ? 174  ALA E C   1 
ATOM   4158  O O   . ALA G  1 24  ? 12.635  114.938 53.523  1.00 90.45  ? 174  ALA E O   1 
ATOM   4159  C CB  . ALA G  1 24  ? 12.013  118.287 54.645  1.00 94.28  ? 174  ALA E CB  1 
ATOM   4160  N N   . LYS G  1 25  ? 10.963  116.354 52.984  1.00 93.16  ? 175  LYS E N   1 
ATOM   4161  C CA  . LYS G  1 25  ? 10.123  115.292 52.413  1.00 98.22  ? 175  LYS E CA  1 
ATOM   4162  C C   . LYS G  1 25  ? 10.977  114.362 51.564  1.00 99.63  ? 175  LYS E C   1 
ATOM   4163  O O   . LYS G  1 25  ? 10.611  113.198 51.332  1.00 93.23  ? 175  LYS E O   1 
ATOM   4164  C CB  . LYS G  1 25  ? 8.948   115.857 51.572  1.00 98.81  ? 175  LYS E CB  1 
ATOM   4165  C CG  . LYS G  1 25  ? 7.550   115.729 52.259  1.00 99.17  ? 175  LYS E CG  1 
ATOM   4166  C CD  . LYS G  1 25  ? 6.356   115.671 51.274  1.00 94.97  ? 175  LYS E CD  1 
ATOM   4167  C CE  . LYS G  1 25  ? 5.019   115.389 52.002  1.00 89.20  ? 175  LYS E CE  1 
ATOM   4168  N NZ  . LYS G  1 25  ? 3.849   115.118 51.091  1.00 74.06  ? 175  LYS E NZ  1 
ATOM   4169  N N   . ALA G  1 26  A 12.117  114.893 51.113  1.00 100.00 ? 175  ALA E N   1 
ATOM   4170  C CA  . ALA G  1 26  A 13.062  114.130 50.313  1.00 99.40  ? 175  ALA E CA  1 
ATOM   4171  C C   . ALA G  1 26  A 13.400  112.915 51.161  1.00 100.00 ? 175  ALA E C   1 
ATOM   4172  O O   . ALA G  1 26  A 12.896  111.807 50.908  1.00 100.00 ? 175  ALA E O   1 
ATOM   4173  C CB  . ALA G  1 26  A 14.318  114.960 50.034  1.00 96.85  ? 175  ALA E CB  1 
ATOM   4174  N N   . ARG G  1 27  B 14.227  113.143 52.185  1.00 97.99  ? 175  ARG E N   1 
ATOM   4175  C CA  . ARG G  1 27  B 14.646  112.091 53.112  1.00 93.57  ? 175  ARG E CA  1 
ATOM   4176  C C   . ARG G  1 27  B 13.460  111.232 53.512  1.00 92.24  ? 175  ARG E C   1 
ATOM   4177  O O   . ARG G  1 27  B 13.554  110.002 53.561  1.00 90.70  ? 175  ARG E O   1 
ATOM   4178  C CB  . ARG G  1 27  B 15.284  112.708 54.354  1.00 83.77  ? 175  ARG E CB  1 
ATOM   4179  C CG  . ARG G  1 27  B 16.660  113.268 54.077  1.00 83.06  ? 175  ARG E CG  1 
ATOM   4180  C CD  . ARG G  1 27  B 17.271  113.822 55.326  1.00 79.89  ? 175  ARG E CD  1 
ATOM   4181  N NE  . ARG G  1 27  B 16.617  115.053 55.748  1.00 82.03  ? 175  ARG E NE  1 
ATOM   4182  C CZ  . ARG G  1 27  B 16.951  116.262 55.311  1.00 82.76  ? 175  ARG E CZ  1 
ATOM   4183  N NH1 . ARG G  1 27  B 17.934  116.412 54.431  1.00 83.48  ? 175  ARG E NH1 1 
ATOM   4184  N NH2 . ARG G  1 27  B 16.310  117.322 55.770  1.00 78.82  ? 175  ARG E NH2 1 
ATOM   4185  N N   . GLU G  1 28  C 12.340  111.902 53.765  1.00 90.11  ? 175  GLU E N   1 
ATOM   4186  C CA  . GLU G  1 28  C 11.104  111.254 54.158  1.00 89.12  ? 175  GLU E CA  1 
ATOM   4187  C C   . GLU G  1 28  C 10.461  110.367 53.103  1.00 90.63  ? 175  GLU E C   1 
ATOM   4188  O O   . GLU G  1 28  C 10.031  109.253 53.398  1.00 89.83  ? 175  GLU E O   1 
ATOM   4189  C CB  . GLU G  1 28  C 10.054  112.292 54.558  1.00 87.96  ? 175  GLU E CB  1 
ATOM   4190  C CG  . GLU G  1 28  C 8.640   111.683 54.613  1.00 95.60  ? 175  GLU E CG  1 
ATOM   4191  C CD  . GLU G  1 28  C 7.507   112.709 54.607  1.00 100.00 ? 175  GLU E CD  1 
ATOM   4192  O OE1 . GLU G  1 28  C 6.326   112.290 54.481  1.00 100.00 ? 175  GLU E OE1 1 
ATOM   4193  O OE2 . GLU G  1 28  C 7.791   113.925 54.730  1.00 100.00 ? 175  GLU E OE2 1 
ATOM   4194  N N   . LYS G  1 29  D 10.380  110.861 51.876  1.00 90.96  ? 175  LYS E N   1 
ATOM   4195  C CA  . LYS G  1 29  D 9.687   110.121 50.834  1.00 91.20  ? 175  LYS E CA  1 
ATOM   4196  C C   . LYS G  1 29  D 10.416  109.053 50.042  1.00 88.01  ? 175  LYS E C   1 
ATOM   4197  O O   . LYS G  1 29  D 9.812   108.056 49.631  1.00 76.24  ? 175  LYS E O   1 
ATOM   4198  C CB  . LYS G  1 29  D 9.046   111.125 49.872  1.00 96.10  ? 175  LYS E CB  1 
ATOM   4199  C CG  . LYS G  1 29  D 7.823   111.833 50.449  1.00 95.62  ? 175  LYS E CG  1 
ATOM   4200  C CD  . LYS G  1 29  D 6.776   110.796 50.830  1.00 98.68  ? 175  LYS E CD  1 
ATOM   4201  C CE  . LYS G  1 29  D 5.557   111.426 51.466  1.00 100.00 ? 175  LYS E CE  1 
ATOM   4202  N NZ  . LYS G  1 29  D 4.684   110.380 52.080  1.00 100.00 ? 175  LYS E NZ  1 
ATOM   4203  N N   . VAL G  1 30  E 11.711  109.246 49.836  1.00 89.43  ? 175  VAL E N   1 
ATOM   4204  C CA  . VAL G  1 30  E 12.456  108.291 49.036  1.00 96.17  ? 175  VAL E CA  1 
ATOM   4205  C C   . VAL G  1 30  E 13.399  107.341 49.750  1.00 96.21  ? 175  VAL E C   1 
ATOM   4206  O O   . VAL G  1 30  E 14.194  107.740 50.610  1.00 96.08  ? 175  VAL E O   1 
ATOM   4207  C CB  . VAL G  1 30  E 13.281  109.003 47.944  1.00 99.95  ? 175  VAL E CB  1 
ATOM   4208  C CG1 . VAL G  1 30  E 13.823  107.975 46.949  1.00 100.00 ? 175  VAL E CG1 1 
ATOM   4209  C CG2 . VAL G  1 30  E 12.431  110.056 47.243  1.00 100.00 ? 175  VAL E CG2 1 
ATOM   4210  N N   . PRO G  1 31  F 13.315  106.056 49.386  1.00 94.17  ? 175  PRO E N   1 
ATOM   4211  C CA  . PRO G  1 31  F 14.145  104.997 49.946  1.00 92.69  ? 175  PRO E CA  1 
ATOM   4212  C C   . PRO G  1 31  F 15.597  105.444 49.950  1.00 93.74  ? 175  PRO E C   1 
ATOM   4213  O O   . PRO G  1 31  F 16.003  106.231 50.800  1.00 93.21  ? 175  PRO E O   1 
ATOM   4214  C CB  . PRO G  1 31  F 13.890  103.845 48.992  1.00 91.58  ? 175  PRO E CB  1 
ATOM   4215  C CG  . PRO G  1 31  F 12.421  103.997 48.736  1.00 92.38  ? 175  PRO E CG  1 
ATOM   4216  C CD  . PRO G  1 31  F 12.266  105.491 48.516  1.00 91.93  ? 175  PRO E CD  1 
ATOM   4217  N N   . LYS G  1 32  G 16.366  104.955 48.985  1.00 91.82  ? 175  LYS E N   1 
ATOM   4218  C CA  . LYS G  1 32  G 17.779  105.290 48.871  1.00 93.93  ? 175  LYS E CA  1 
ATOM   4219  C C   . LYS G  1 32  G 18.161  106.683 49.397  1.00 96.14  ? 175  LYS E C   1 
ATOM   4220  O O   . LYS G  1 32  G 19.278  106.889 49.889  1.00 94.10  ? 175  LYS E O   1 
ATOM   4221  C CB  . LYS G  1 32  G 18.214  105.180 47.405  1.00 97.05  ? 175  LYS E CB  1 
ATOM   4222  C CG  . LYS G  1 32  G 17.481  106.150 46.464  1.00 100.00 ? 175  LYS E CG  1 
ATOM   4223  C CD  . LYS G  1 32  G 18.051  106.182 45.030  1.00 100.00 ? 175  LYS E CD  1 
ATOM   4224  C CE  . LYS G  1 32  G 17.313  107.217 44.167  1.00 100.00 ? 175  LYS E CE  1 
ATOM   4225  N NZ  . LYS G  1 32  G 17.920  107.426 42.820  1.00 98.21  ? 175  LYS E NZ  1 
ATOM   4226  N N   . LEU G  1 33  H 17.232  107.630 49.298  1.00 97.79  ? 175  LEU E N   1 
ATOM   4227  C CA  . LEU G  1 33  H 17.475  109.016 49.713  1.00 99.47  ? 175  LEU E CA  1 
ATOM   4228  C C   . LEU G  1 33  H 17.399  109.293 51.209  1.00 99.95  ? 175  LEU E C   1 
ATOM   4229  O O   . LEU G  1 33  H 17.705  110.403 51.672  1.00 93.75  ? 175  LEU E O   1 
ATOM   4230  C CB  . LEU G  1 33  H 16.508  109.930 48.964  1.00 99.21  ? 175  LEU E CB  1 
ATOM   4231  C CG  . LEU G  1 33  H 16.759  109.890 47.455  1.00 99.08  ? 175  LEU E CG  1 
ATOM   4232  C CD1 . LEU G  1 33  H 15.657  110.593 46.701  1.00 98.12  ? 175  LEU E CD1 1 
ATOM   4233  C CD2 . LEU G  1 33  H 18.108  110.532 47.168  1.00 100.00 ? 175  LEU E CD2 1 
ATOM   4234  N N   . HIS G  1 34  I 16.998  108.269 51.954  1.00 100.00 ? 175  HIS E N   1 
ATOM   4235  C CA  . HIS G  1 34  I 16.856  108.343 53.402  1.00 96.61  ? 175  HIS E CA  1 
ATOM   4236  C C   . HIS G  1 34  I 17.856  109.250 54.116  1.00 91.63  ? 175  HIS E C   1 
ATOM   4237  O O   . HIS G  1 34  I 17.563  109.741 55.192  1.00 91.77  ? 175  HIS E O   1 
ATOM   4238  C CB  . HIS G  1 34  I 16.939  106.934 54.007  1.00 96.90  ? 175  HIS E CB  1 
ATOM   4239  C CG  . HIS G  1 34  I 18.303  106.312 53.925  1.00 100.00 ? 175  HIS E CG  1 
ATOM   4240  N ND1 . HIS G  1 34  I 18.983  106.149 52.733  1.00 100.00 ? 175  HIS E ND1 1 
ATOM   4241  C CD2 . HIS G  1 34  I 19.106  105.795 54.887  1.00 100.00 ? 175  HIS E CD2 1 
ATOM   4242  C CE1 . HIS G  1 34  I 20.144  105.559 52.965  1.00 100.00 ? 175  HIS E CE1 1 
ATOM   4243  N NE2 . HIS G  1 34  I 20.243  105.334 54.264  1.00 100.00 ? 175  HIS E NE2 1 
ATOM   4244  N N   . SER G  1 35  J 19.024  109.495 53.536  1.00 88.13  ? 175  SER E N   1 
ATOM   4245  C CA  . SER G  1 35  J 19.993  110.325 54.239  1.00 90.68  ? 175  SER E CA  1 
ATOM   4246  C C   . SER G  1 35  J 20.600  111.520 53.523  1.00 91.27  ? 175  SER E C   1 
ATOM   4247  O O   . SER G  1 35  J 21.657  112.023 53.929  1.00 86.00  ? 175  SER E O   1 
ATOM   4248  C CB  . SER G  1 35  J 21.117  109.447 54.773  1.00 92.68  ? 175  SER E CB  1 
ATOM   4249  O OG  . SER G  1 35  J 20.630  108.605 55.801  1.00 99.99  ? 175  SER E OG  1 
ATOM   4250  N N   . ILE G  1 36  ? 19.950  111.989 52.467  1.00 91.37  ? 176  ILE E N   1 
ATOM   4251  C CA  . ILE G  1 36  ? 20.496  113.144 51.780  1.00 91.62  ? 176  ILE E CA  1 
ATOM   4252  C C   . ILE G  1 36  ? 20.545  114.240 52.845  1.00 89.51  ? 176  ILE E C   1 
ATOM   4253  O O   . ILE G  1 36  ? 19.554  114.508 53.533  1.00 83.76  ? 176  ILE E O   1 
ATOM   4254  C CB  . ILE G  1 36  ? 19.598  113.608 50.610  1.00 94.27  ? 176  ILE E CB  1 
ATOM   4255  C CG1 . ILE G  1 36  ? 18.698  112.464 50.144  1.00 93.92  ? 176  ILE E CG1 1 
ATOM   4256  C CG2 . ILE G  1 36  ? 20.464  114.042 49.438  1.00 84.17  ? 176  ILE E CG2 1 
ATOM   4257  C CD1 . ILE G  1 36  ? 17.642  112.911 49.157  1.00 99.51  ? 176  ILE E CD1 1 
ATOM   4258  N N   . ARG G  1 37  ? 21.710  114.850 52.993  1.00 88.35  ? 177  ARG E N   1 
ATOM   4259  C CA  . ARG G  1 37  ? 21.905  115.911 53.974  1.00 89.14  ? 177  ARG E CA  1 
ATOM   4260  C C   . ARG G  1 37  ? 21.448  117.286 53.469  1.00 85.09  ? 177  ARG E C   1 
ATOM   4261  O O   . ARG G  1 37  ? 21.688  117.637 52.316  1.00 86.37  ? 177  ARG E O   1 
ATOM   4262  C CB  . ARG G  1 37  ? 23.387  115.964 54.362  1.00 92.34  ? 177  ARG E CB  1 
ATOM   4263  C CG  . ARG G  1 37  ? 24.373  115.975 53.185  1.00 93.74  ? 177  ARG E CG  1 
ATOM   4264  C CD  . ARG G  1 37  ? 25.781  116.163 53.712  1.00 96.81  ? 177  ARG E CD  1 
ATOM   4265  N NE  . ARG G  1 37  ? 25.791  117.251 54.691  1.00 100.00 ? 177  ARG E NE  1 
ATOM   4266  C CZ  . ARG G  1 37  ? 26.245  117.150 55.942  1.00 100.00 ? 177  ARG E CZ  1 
ATOM   4267  N NH1 . ARG G  1 37  ? 26.745  115.999 56.380  1.00 100.00 ? 177  ARG E NH1 1 
ATOM   4268  N NH2 . ARG G  1 37  ? 26.175  118.197 56.767  1.00 100.00 ? 177  ARG E NH2 1 
ATOM   4269  N N   . ASP G  1 38  ? 20.786  118.074 54.311  1.00 78.52  ? 178  ASP E N   1 
ATOM   4270  C CA  . ASP G  1 38  ? 20.378  119.382 53.821  1.00 75.25  ? 178  ASP E CA  1 
ATOM   4271  C C   . ASP G  1 38  ? 21.638  120.073 53.327  1.00 72.88  ? 178  ASP E C   1 
ATOM   4272  O O   . ASP G  1 38  ? 22.717  119.950 53.918  1.00 70.39  ? 178  ASP E O   1 
ATOM   4273  C CB  . ASP G  1 38  ? 19.696  120.224 54.907  1.00 79.12  ? 178  ASP E CB  1 
ATOM   4274  C CG  . ASP G  1 38  ? 18.385  119.625 55.360  1.00 80.86  ? 178  ASP E CG  1 
ATOM   4275  O OD1 . ASP G  1 38  ? 17.636  119.114 54.492  1.00 82.51  ? 178  ASP E OD1 1 
ATOM   4276  O OD2 . ASP G  1 38  ? 18.107  119.667 56.579  1.00 80.40  ? 178  ASP E OD2 1 
ATOM   4277  N N   . ARG G  1 39  ? 21.490  120.800 52.234  1.00 67.04  ? 179  ARG E N   1 
ATOM   4278  C CA  . ARG G  1 39  ? 22.616  121.465 51.621  1.00 66.80  ? 179  ARG E CA  1 
ATOM   4279  C C   . ARG G  1 39  ? 23.041  122.747 52.323  1.00 67.70  ? 179  ARG E C   1 
ATOM   4280  O O   . ARG G  1 39  ? 22.971  123.846 51.762  1.00 69.75  ? 179  ARG E O   1 
ATOM   4281  C CB  . ARG G  1 39  ? 22.300  121.707 50.139  1.00 70.97  ? 179  ARG E CB  1 
ATOM   4282  C CG  . ARG G  1 39  ? 21.898  120.412 49.401  1.00 70.79  ? 179  ARG E CG  1 
ATOM   4283  C CD  . ARG G  1 39  ? 21.765  120.591 47.903  1.00 61.95  ? 179  ARG E CD  1 
ATOM   4284  N NE  . ARG G  1 39  ? 22.994  121.119 47.314  1.00 57.44  ? 179  ARG E NE  1 
ATOM   4285  C CZ  . ARG G  1 39  ? 23.254  122.412 47.152  1.00 52.92  ? 179  ARG E CZ  1 
ATOM   4286  N NH1 . ARG G  1 39  ? 22.367  123.316 47.530  1.00 43.25  ? 179  ARG E NH1 1 
ATOM   4287  N NH2 . ARG G  1 39  ? 24.407  122.799 46.620  1.00 56.55  ? 179  ARG E NH2 1 
ATOM   4288  N N   . ASN G  1 40  ? 23.516  122.597 53.552  1.00 65.76  ? 180  ASN E N   1 
ATOM   4289  C CA  . ASN G  1 40  ? 23.958  123.749 54.325  1.00 68.62  ? 180  ASN E CA  1 
ATOM   4290  C C   . ASN G  1 40  ? 25.027  124.553 53.618  1.00 62.91  ? 180  ASN E C   1 
ATOM   4291  O O   . ASN G  1 40  ? 26.121  124.067 53.386  1.00 70.52  ? 180  ASN E O   1 
ATOM   4292  C CB  . ASN G  1 40  ? 24.490  123.293 55.684  1.00 77.60  ? 180  ASN E CB  1 
ATOM   4293  C CG  . ASN G  1 40  ? 23.382  122.794 56.610  1.00 87.70  ? 180  ASN E CG  1 
ATOM   4294  O OD1 . ASN G  1 40  ? 23.656  122.173 57.641  1.00 92.16  ? 180  ASN E OD1 1 
ATOM   4295  N ND2 . ASN G  1 40  ? 22.128  123.073 56.252  1.00 87.24  ? 180  ASN E ND2 1 
ATOM   4296  N N   . GLY G  1 41  ? 24.706  125.790 53.276  1.00 62.77  ? 181  GLY E N   1 
ATOM   4297  C CA  . GLY G  1 41  ? 25.681  126.646 52.622  1.00 67.24  ? 181  GLY E CA  1 
ATOM   4298  C C   . GLY G  1 41  ? 25.187  127.229 51.314  1.00 70.86  ? 181  GLY E C   1 
ATOM   4299  O O   . GLY G  1 41  ? 25.687  128.277 50.862  1.00 65.68  ? 181  GLY E O   1 
ATOM   4300  N N   . THR G  1 42  ? 24.201  126.555 50.710  1.00 70.38  ? 182  THR E N   1 
ATOM   4301  C CA  . THR G  1 42  ? 23.641  126.982 49.425  1.00 71.43  ? 182  THR E CA  1 
ATOM   4302  C C   . THR G  1 42  ? 23.501  128.471 49.444  1.00 74.89  ? 182  THR E C   1 
ATOM   4303  O O   . THR G  1 42  ? 23.890  129.170 48.504  1.00 72.71  ? 182  THR E O   1 
ATOM   4304  C CB  . THR G  1 42  ? 22.236  126.452 49.186  1.00 69.22  ? 182  THR E CB  1 
ATOM   4305  O OG1 . THR G  1 42  ? 22.074  125.170 49.802  1.00 70.09  ? 182  THR E OG1 1 
ATOM   4306  C CG2 . THR G  1 42  ? 21.994  126.351 47.685  1.00 76.63  ? 182  THR E CG2 1 
ATOM   4307  N N   . HIS G  1 43  ? 22.906  128.919 50.546  1.00 77.40  ? 183  HIS E N   1 
ATOM   4308  C CA  . HIS G  1 43  ? 22.639  130.310 50.824  1.00 76.02  ? 183  HIS E CA  1 
ATOM   4309  C C   . HIS G  1 43  ? 23.807  131.181 50.360  1.00 72.06  ? 183  HIS E C   1 
ATOM   4310  O O   . HIS G  1 43  ? 23.620  132.176 49.645  1.00 61.10  ? 183  HIS E O   1 
ATOM   4311  C CB  . HIS G  1 43  ? 22.404  130.451 52.319  1.00 86.89  ? 183  HIS E CB  1 
ATOM   4312  C CG  . HIS G  1 43  ? 21.813  129.228 52.948  1.00 96.95  ? 183  HIS E CG  1 
ATOM   4313  N ND1 . HIS G  1 43  ? 22.589  128.189 53.417  1.00 100.00 ? 183  HIS E ND1 1 
ATOM   4314  C CD2 . HIS G  1 43  ? 20.522  128.855 53.143  1.00 99.81  ? 183  HIS E CD2 1 
ATOM   4315  C CE1 . HIS G  1 43  ? 21.803  127.227 53.873  1.00 100.00 ? 183  HIS E CE1 1 
ATOM   4316  N NE2 . HIS G  1 43  ? 20.544  127.606 53.718  1.00 100.00 ? 183  HIS E NE2 1 
ATOM   4317  N N   . LEU G  1 44  ? 25.016  130.791 50.742  1.00 71.28  ? 184  LEU E N   1 
ATOM   4318  C CA  . LEU G  1 44  ? 26.192  131.551 50.348  1.00 74.18  ? 184  LEU E CA  1 
ATOM   4319  C C   . LEU G  1 44  ? 26.354  131.601 48.826  1.00 76.19  ? 184  LEU E C   1 
ATOM   4320  O O   . LEU G  1 44  ? 26.761  132.638 48.266  1.00 73.87  ? 184  LEU E O   1 
ATOM   4321  C CB  . LEU G  1 44  ? 27.437  130.970 51.023  1.00 70.71  ? 184  LEU E CB  1 
ATOM   4322  C CG  . LEU G  1 44  ? 27.719  131.455 52.460  1.00 69.13  ? 184  LEU E CG  1 
ATOM   4323  C CD1 . LEU G  1 44  ? 26.518  132.225 53.059  1.00 59.04  ? 184  LEU E CD1 1 
ATOM   4324  C CD2 . LEU G  1 44  ? 28.064  130.237 53.312  1.00 68.86  ? 184  LEU E CD2 1 
ATOM   4325  N N   . ASP G  1 45  ? 26.031  130.490 48.154  1.00 75.96  ? 185  ASP E N   1 
ATOM   4326  C CA  . ASP G  1 45  ? 26.110  130.439 46.682  1.00 71.98  ? 185  ASP E CA  1 
ATOM   4327  C C   . ASP G  1 45  ? 25.083  131.432 46.114  1.00 67.76  ? 185  ASP E C   1 
ATOM   4328  O O   . ASP G  1 45  ? 25.417  132.348 45.329  1.00 53.12  ? 185  ASP E O   1 
ATOM   4329  C CB  . ASP G  1 45  ? 25.763  129.035 46.145  1.00 75.15  ? 185  ASP E CB  1 
ATOM   4330  C CG  . ASP G  1 45  ? 26.878  128.022 46.346  1.00 74.72  ? 185  ASP E CG  1 
ATOM   4331  O OD1 . ASP G  1 45  ? 28.049  128.437 46.529  1.00 73.10  ? 185  ASP E OD1 1 
ATOM   4332  O OD2 . ASP G  1 45  ? 26.570  126.806 46.298  1.00 65.89  ? 185  ASP E OD2 1 
ATOM   4333  N N   . ALA G  1 46  ? 23.828  131.218 46.519  1.00 62.64  ? 186  ALA E N   1 
ATOM   4334  C CA  . ALA G  1 46  ? 22.718  132.067 46.104  1.00 63.37  ? 186  ALA E CA  1 
ATOM   4335  C C   . ALA G  1 46  ? 23.114  133.535 46.290  1.00 62.27  ? 186  ALA E C   1 
ATOM   4336  O O   . ALA G  1 46  ? 22.972  134.353 45.372  1.00 61.82  ? 186  ALA E O   1 
ATOM   4337  C CB  . ALA G  1 46  ? 21.469  131.738 46.930  1.00 50.39  ? 186  ALA E CB  1 
ATOM   4338  N N   . GLY G  1 47  ? 23.629  133.861 47.472  1.00 54.64  ? 187  GLY E N   1 
ATOM   4339  C CA  . GLY G  1 47  ? 24.030  135.228 47.718  1.00 53.42  ? 187  GLY E CA  1 
ATOM   4340  C C   . GLY G  1 47  ? 25.043  135.700 46.689  1.00 55.68  ? 187  GLY E C   1 
ATOM   4341  O O   . GLY G  1 47  ? 24.825  136.698 45.962  1.00 42.22  ? 187  GLY E O   1 
ATOM   4342  N N   . ALA G  1 48  ? 26.154  134.962 46.634  1.00 57.87  ? 188  ALA E N   1 
ATOM   4343  C CA  . ALA G  1 48  ? 27.254  135.252 45.723  1.00 57.27  ? 188  ALA E CA  1 
ATOM   4344  C C   . ALA G  1 48  ? 26.757  135.391 44.277  1.00 58.04  ? 188  ALA E C   1 
ATOM   4345  O O   . ALA G  1 48  ? 27.127  136.331 43.552  1.00 48.37  ? 188  ALA E O   1 
ATOM   4346  C CB  . ALA G  1 48  ? 28.298  134.151 45.830  1.00 55.24  ? 188  ALA E CB  1 
ATOM   4347  N N   . LEU G  1 49  ? 25.919  134.448 43.858  1.00 55.16  ? 189  LEU E N   1 
ATOM   4348  C CA  . LEU G  1 49  ? 25.377  134.491 42.516  1.00 57.65  ? 189  LEU E CA  1 
ATOM   4349  C C   . LEU G  1 49  ? 24.617  135.796 42.307  1.00 60.22  ? 189  LEU E C   1 
ATOM   4350  O O   . LEU G  1 49  ? 24.893  136.563 41.361  1.00 57.46  ? 189  LEU E O   1 
ATOM   4351  C CB  . LEU G  1 49  ? 24.456  133.297 42.302  1.00 62.74  ? 189  LEU E CB  1 
ATOM   4352  C CG  . LEU G  1 49  ? 25.213  131.994 42.039  1.00 60.12  ? 189  LEU E CG  1 
ATOM   4353  C CD1 . LEU G  1 49  ? 24.268  130.783 42.091  1.00 53.08  ? 189  LEU E CD1 1 
ATOM   4354  C CD2 . LEU G  1 49  ? 25.887  132.123 40.687  1.00 48.09  ? 189  LEU E CD2 1 
ATOM   4355  N N   . THR G  1 50  ? 23.675  136.049 43.214  1.00 60.13  ? 190  THR E N   1 
ATOM   4356  C CA  . THR G  1 50  ? 22.852  137.251 43.162  1.00 62.95  ? 190  THR E CA  1 
ATOM   4357  C C   . THR G  1 50  ? 23.691  138.504 43.005  1.00 61.23  ? 190  THR E C   1 
ATOM   4358  O O   . THR G  1 50  ? 23.459  139.321 42.106  1.00 58.62  ? 190  THR E O   1 
ATOM   4359  C CB  . THR G  1 50  ? 22.034  137.430 44.432  1.00 63.22  ? 190  THR E CB  1 
ATOM   4360  O OG1 . THR G  1 50  ? 21.429  136.187 44.798  1.00 65.92  ? 190  THR E OG1 1 
ATOM   4361  C CG2 . THR G  1 50  ? 20.939  138.448 44.192  1.00 68.30  ? 190  THR E CG2 1 
ATOM   4362  N N   . THR G  1 51  ? 24.655  138.654 43.906  1.00 60.18  ? 191  THR E N   1 
ATOM   4363  C CA  . THR G  1 51  ? 25.545  139.811 43.879  1.00 64.01  ? 191  THR E CA  1 
ATOM   4364  C C   . THR G  1 51  ? 26.271  139.925 42.546  1.00 64.96  ? 191  THR E C   1 
ATOM   4365  O O   . THR G  1 51  ? 26.232  140.958 41.878  1.00 60.75  ? 191  THR E O   1 
ATOM   4366  C CB  . THR G  1 51  ? 26.624  139.706 44.961  1.00 64.19  ? 191  THR E CB  1 
ATOM   4367  O OG1 . THR G  1 51  ? 26.009  139.467 46.238  1.00 68.48  ? 191  THR E OG1 1 
ATOM   4368  C CG2 . THR G  1 51  ? 27.459  140.988 44.985  1.00 51.66  ? 191  THR E CG2 1 
ATOM   4369  N N   . THR G  1 52  ? 26.931  138.834 42.175  1.00 67.68  ? 192  THR E N   1 
ATOM   4370  C CA  . THR G  1 52  ? 27.706  138.779 40.959  1.00 65.89  ? 192  THR E CA  1 
ATOM   4371  C C   . THR G  1 52  ? 26.908  139.123 39.718  1.00 66.76  ? 192  THR E C   1 
ATOM   4372  O O   . THR G  1 52  ? 27.288  140.020 38.961  1.00 62.76  ? 192  THR E O   1 
ATOM   4373  C CB  . THR G  1 52  ? 28.314  137.390 40.761  1.00 69.42  ? 192  THR E CB  1 
ATOM   4374  O OG1 . THR G  1 52  ? 28.957  136.966 41.967  1.00 66.51  ? 192  THR E OG1 1 
ATOM   4375  C CG2 . THR G  1 52  ? 29.337  137.432 39.642  1.00 68.32  ? 192  THR E CG2 1 
ATOM   4376  N N   . PHE G  1 53  ? 25.805  138.416 39.498  1.00 64.92  ? 193  PHE E N   1 
ATOM   4377  C CA  . PHE G  1 53  ? 25.033  138.683 38.298  1.00 68.71  ? 193  PHE E CA  1 
ATOM   4378  C C   . PHE G  1 53  ? 24.259  139.974 38.364  1.00 68.12  ? 193  PHE E C   1 
ATOM   4379  O O   . PHE G  1 53  ? 23.940  140.576 37.333  1.00 63.03  ? 193  PHE E O   1 
ATOM   4380  C CB  . PHE G  1 53  ? 24.135  137.490 37.974  1.00 70.58  ? 193  PHE E CB  1 
ATOM   4381  C CG  . PHE G  1 53  ? 24.892  136.339 37.370  1.00 70.31  ? 193  PHE E CG  1 
ATOM   4382  C CD1 . PHE G  1 53  ? 25.438  136.458 36.089  1.00 65.86  ? 193  PHE E CD1 1 
ATOM   4383  C CD2 . PHE G  1 53  ? 25.139  135.176 38.108  1.00 67.50  ? 193  PHE E CD2 1 
ATOM   4384  C CE1 . PHE G  1 53  ? 26.222  135.442 35.556  1.00 63.66  ? 193  PHE E CE1 1 
ATOM   4385  C CE2 . PHE G  1 53  ? 25.922  134.154 37.584  1.00 58.11  ? 193  PHE E CE2 1 
ATOM   4386  C CZ  . PHE G  1 53  ? 26.465  134.289 36.303  1.00 60.38  ? 193  PHE E CZ  1 
ATOM   4387  N N   . GLU G  1 54  ? 23.980  140.413 39.584  1.00 71.01  ? 194  GLU E N   1 
ATOM   4388  C CA  . GLU G  1 54  ? 23.278  141.663 39.769  1.00 72.17  ? 194  GLU E CA  1 
ATOM   4389  C C   . GLU G  1 54  ? 24.263  142.709 39.242  1.00 71.83  ? 194  GLU E C   1 
ATOM   4390  O O   . GLU G  1 54  ? 23.908  143.545 38.406  1.00 68.52  ? 194  GLU E O   1 
ATOM   4391  C CB  . GLU G  1 54  ? 22.976  141.880 41.253  1.00 75.78  ? 194  GLU E CB  1 
ATOM   4392  C CG  . GLU G  1 54  ? 21.664  142.619 41.532  1.00 82.36  ? 194  GLU E CG  1 
ATOM   4393  C CD  . GLU G  1 54  ? 21.287  142.632 43.019  1.00 85.21  ? 194  GLU E CD  1 
ATOM   4394  O OE1 . GLU G  1 54  ? 22.076  143.155 43.840  1.00 83.48  ? 194  GLU E OE1 1 
ATOM   4395  O OE2 . GLU G  1 54  ? 20.201  142.119 43.370  1.00 79.21  ? 194  GLU E OE2 1 
ATOM   4396  N N   . GLU G  1 55  ? 25.512  142.629 39.703  1.00 71.60  ? 195  GLU E N   1 
ATOM   4397  C CA  . GLU G  1 55  ? 26.559  143.559 39.258  1.00 74.46  ? 195  GLU E CA  1 
ATOM   4398  C C   . GLU G  1 55  ? 26.753  143.524 37.731  1.00 76.74  ? 195  GLU E C   1 
ATOM   4399  O O   . GLU G  1 55  ? 27.242  144.487 37.129  1.00 72.20  ? 195  GLU E O   1 
ATOM   4400  C CB  . GLU G  1 55  ? 27.903  143.232 39.926  1.00 72.12  ? 195  GLU E CB  1 
ATOM   4401  C CG  . GLU G  1 55  ? 27.904  143.245 41.443  1.00 78.96  ? 195  GLU E CG  1 
ATOM   4402  C CD  . GLU G  1 55  ? 29.263  142.880 42.021  1.00 87.66  ? 195  GLU E CD  1 
ATOM   4403  O OE1 . GLU G  1 55  ? 30.270  142.937 41.278  1.00 91.30  ? 195  GLU E OE1 1 
ATOM   4404  O OE2 . GLU G  1 55  ? 29.328  142.540 43.223  1.00 91.99  ? 195  GLU E OE2 1 
ATOM   4405  N N   . LEU G  1 56  ? 26.383  142.403 37.110  1.00 81.28  ? 196  LEU E N   1 
ATOM   4406  C CA  . LEU G  1 56  ? 26.521  142.251 35.666  1.00 77.92  ? 196  LEU E CA  1 
ATOM   4407  C C   . LEU G  1 56  ? 25.276  142.728 34.940  1.00 78.95  ? 196  LEU E C   1 
ATOM   4408  O O   . LEU G  1 56  ? 25.148  142.568 33.718  1.00 76.21  ? 196  LEU E O   1 
ATOM   4409  C CB  . LEU G  1 56  ? 26.809  140.799 35.323  1.00 75.68  ? 196  LEU E CB  1 
ATOM   4410  C CG  . LEU G  1 56  ? 28.221  140.376 35.711  1.00 72.54  ? 196  LEU E CG  1 
ATOM   4411  C CD1 . LEU G  1 56  ? 28.426  138.931 35.308  1.00 79.05  ? 196  LEU E CD1 1 
ATOM   4412  C CD2 . LEU G  1 56  ? 29.238  141.280 35.016  1.00 72.08  ? 196  LEU E CD2 1 
ATOM   4413  N N   . HIS G  1 57  ? 24.369  143.314 35.720  1.00 77.19  ? 197  HIS E N   1 
ATOM   4414  C CA  . HIS G  1 57  ? 23.116  143.875 35.229  1.00 75.89  ? 197  HIS E CA  1 
ATOM   4415  C C   . HIS G  1 57  ? 22.046  142.851 34.859  1.00 70.98  ? 197  HIS E C   1 
ATOM   4416  O O   . HIS G  1 57  ? 21.345  143.015 33.862  1.00 66.60  ? 197  HIS E O   1 
ATOM   4417  C CB  . HIS G  1 57  ? 23.388  144.799 34.030  1.00 80.92  ? 197  HIS E CB  1 
ATOM   4418  C CG  . HIS G  1 57  ? 24.404  145.867 34.312  1.00 93.94  ? 197  HIS E CG  1 
ATOM   4419  N ND1 . HIS G  1 57  ? 24.389  146.633 35.461  1.00 97.35  ? 197  HIS E ND1 1 
ATOM   4420  C CD2 . HIS G  1 57  ? 25.472  146.293 33.594  1.00 94.28  ? 197  HIS E CD2 1 
ATOM   4421  C CE1 . HIS G  1 57  ? 25.405  147.480 35.439  1.00 97.18  ? 197  HIS E CE1 1 
ATOM   4422  N NE2 . HIS G  1 57  ? 26.077  147.295 34.317  1.00 94.62  ? 197  HIS E NE2 1 
ATOM   4423  N N   . PHE G  1 58  ? 21.913  141.807 35.672  1.00 65.74  ? 198  PHE E N   1 
ATOM   4424  C CA  . PHE G  1 58  ? 20.921  140.762 35.424  1.00 66.27  ? 198  PHE E CA  1 
ATOM   4425  C C   . PHE G  1 58  ? 19.839  140.856 36.470  1.00 64.98  ? 198  PHE E C   1 
ATOM   4426  O O   . PHE G  1 58  ? 20.119  141.223 37.600  1.00 73.98  ? 198  PHE E O   1 
ATOM   4427  C CB  . PHE G  1 58  ? 21.564  139.356 35.498  1.00 72.55  ? 198  PHE E CB  1 
ATOM   4428  C CG  . PHE G  1 58  ? 22.171  138.881 34.185  1.00 72.60  ? 198  PHE E CG  1 
ATOM   4429  C CD1 . PHE G  1 58  ? 23.371  139.421 33.713  1.00 65.38  ? 198  PHE E CD1 1 
ATOM   4430  C CD2 . PHE G  1 58  ? 21.492  137.952 33.384  1.00 66.35  ? 198  PHE E CD2 1 
ATOM   4431  C CE1 . PHE G  1 58  ? 23.871  139.051 32.469  1.00 63.25  ? 198  PHE E CE1 1 
ATOM   4432  C CE2 . PHE G  1 58  ? 21.993  137.579 32.135  1.00 59.34  ? 198  PHE E CE2 1 
ATOM   4433  C CZ  . PHE G  1 58  ? 23.181  138.130 31.676  1.00 61.63  ? 198  PHE E CZ  1 
ATOM   4434  N N   . GLU G  1 59  ? 18.606  140.520 36.109  1.00 64.90  ? 199  GLU E N   1 
ATOM   4435  C CA  . GLU G  1 59  ? 17.523  140.576 37.076  1.00 64.88  ? 199  GLU E CA  1 
ATOM   4436  C C   . GLU G  1 59  ? 17.380  139.227 37.755  1.00 62.05  ? 199  GLU E C   1 
ATOM   4437  O O   . GLU G  1 59  ? 16.777  138.301 37.210  1.00 62.04  ? 199  GLU E O   1 
ATOM   4438  C CB  . GLU G  1 59  ? 16.207  140.983 36.405  1.00 66.40  ? 199  GLU E CB  1 
ATOM   4439  C CG  . GLU G  1 59  ? 15.027  140.997 37.372  1.00 80.19  ? 199  GLU E CG  1 
ATOM   4440  C CD  . GLU G  1 59  ? 13.846  141.783 36.847  1.00 83.52  ? 199  GLU E CD  1 
ATOM   4441  O OE1 . GLU G  1 59  ? 14.067  142.705 36.031  1.00 82.40  ? 199  GLU E OE1 1 
ATOM   4442  O OE2 . GLU G  1 59  ? 12.702  141.484 37.264  1.00 90.28  ? 199  GLU E OE2 1 
ATOM   4443  N N   . ILE G  1 60  ? 17.936  139.132 38.957  1.00 54.35  ? 200  ILE E N   1 
ATOM   4444  C CA  . ILE G  1 60  ? 17.906  137.888 39.713  1.00 56.03  ? 200  ILE E CA  1 
ATOM   4445  C C   . ILE G  1 60  ? 16.483  137.467 40.050  1.00 54.34  ? 200  ILE E C   1 
ATOM   4446  O O   . ILE G  1 60  ? 15.631  138.303 40.282  1.00 62.37  ? 200  ILE E O   1 
ATOM   4447  C CB  . ILE G  1 60  ? 18.732  138.020 41.006  1.00 52.09  ? 200  ILE E CB  1 
ATOM   4448  C CG1 . ILE G  1 60  ? 20.030  138.785 40.715  1.00 55.51  ? 200  ILE E CG1 1 
ATOM   4449  C CG2 . ILE G  1 60  ? 19.048  136.648 41.572  1.00 53.82  ? 200  ILE E CG2 1 
ATOM   4450  C CD1 . ILE G  1 60  ? 20.774  138.336 39.468  1.00 48.16  ? 200  ILE E CD1 1 
ATOM   4451  N N   . LYS G  1 61  ? 16.234  136.165 40.072  1.00 55.60  ? 201  LYS E N   1 
ATOM   4452  C CA  . LYS G  1 61  ? 14.911  135.643 40.369  1.00 59.26  ? 201  LYS E CA  1 
ATOM   4453  C C   . LYS G  1 61  ? 15.031  134.370 41.182  1.00 58.54  ? 201  LYS E C   1 
ATOM   4454  O O   . LYS G  1 61  ? 14.886  133.268 40.657  1.00 62.48  ? 201  LYS E O   1 
ATOM   4455  C CB  . LYS G  1 61  ? 14.138  135.359 39.072  1.00 61.68  ? 201  LYS E CB  1 
ATOM   4456  C CG  . LYS G  1 61  ? 13.656  136.603 38.336  1.00 65.30  ? 201  LYS E CG  1 
ATOM   4457  C CD  . LYS G  1 61  ? 12.443  137.201 39.049  1.00 72.76  ? 201  LYS E CD  1 
ATOM   4458  C CE  . LYS G  1 61  ? 12.065  138.571 38.479  1.00 73.78  ? 201  LYS E CE  1 
ATOM   4459  N NZ  . LYS G  1 61  ? 10.841  139.119 39.142  1.00 72.65  ? 201  LYS E NZ  1 
ATOM   4460  N N   . PRO G  1 62  ? 15.287  134.508 42.486  1.00 55.50  ? 202  PRO E N   1 
ATOM   4461  C CA  . PRO G  1 62  ? 15.431  133.369 43.397  1.00 54.47  ? 202  PRO E CA  1 
ATOM   4462  C C   . PRO G  1 62  ? 14.178  132.545 43.574  1.00 53.43  ? 202  PRO E C   1 
ATOM   4463  O O   . PRO G  1 62  ? 13.081  133.004 43.297  1.00 58.96  ? 202  PRO E O   1 
ATOM   4464  C CB  . PRO G  1 62  ? 15.867  134.023 44.704  1.00 58.45  ? 202  PRO E CB  1 
ATOM   4465  C CG  . PRO G  1 62  ? 15.197  135.353 44.639  1.00 56.07  ? 202  PRO E CG  1 
ATOM   4466  C CD  . PRO G  1 62  ? 15.448  135.779 43.208  1.00 53.37  ? 202  PRO E CD  1 
ATOM   4467  N N   . HIS G  1 63  ? 14.372  131.323 44.046  1.00 56.02  ? 203  HIS E N   1 
ATOM   4468  C CA  . HIS G  1 63  ? 13.307  130.359 44.323  1.00 60.70  ? 203  HIS E CA  1 
ATOM   4469  C C   . HIS G  1 63  ? 13.959  129.397 45.303  1.00 66.08  ? 203  HIS E C   1 
ATOM   4470  O O   . HIS G  1 63  ? 15.090  128.973 45.083  1.00 70.73  ? 203  HIS E O   1 
ATOM   4471  C CB  . HIS G  1 63  ? 12.903  129.616 43.058  1.00 57.96  ? 203  HIS E CB  1 
ATOM   4472  C CG  . HIS G  1 63  ? 12.151  130.463 42.091  1.00 60.87  ? 203  HIS E CG  1 
ATOM   4473  N ND1 . HIS G  1 63  ? 10.782  130.610 42.150  1.00 61.92  ? 203  HIS E ND1 1 
ATOM   4474  C CD2 . HIS G  1 63  ? 12.576  131.259 41.082  1.00 60.58  ? 203  HIS E CD2 1 
ATOM   4475  C CE1 . HIS G  1 63  ? 10.396  131.462 41.218  1.00 59.45  ? 203  HIS E CE1 1 
ATOM   4476  N NE2 . HIS G  1 63  ? 11.466  131.871 40.556  1.00 65.17  ? 203  HIS E NE2 1 
ATOM   4477  N N   . HIS G  1 64  ? 13.265  129.049 46.381  1.00 67.92  ? 204  HIS E N   1 
ATOM   4478  C CA  . HIS G  1 64  ? 13.855  128.170 47.373  1.00 63.95  ? 204  HIS E CA  1 
ATOM   4479  C C   . HIS G  1 64  ? 13.135  126.864 47.601  1.00 66.66  ? 204  HIS E C   1 
ATOM   4480  O O   . HIS G  1 64  ? 11.912  126.770 47.479  1.00 69.17  ? 204  HIS E O   1 
ATOM   4481  C CB  . HIS G  1 64  ? 13.982  128.925 48.686  1.00 61.74  ? 204  HIS E CB  1 
ATOM   4482  C CG  . HIS G  1 64  ? 14.819  130.155 48.576  1.00 70.09  ? 204  HIS E CG  1 
ATOM   4483  N ND1 . HIS G  1 64  ? 16.197  130.128 48.639  1.00 73.42  ? 204  HIS E ND1 1 
ATOM   4484  C CD2 . HIS G  1 64  ? 14.478  131.446 48.345  1.00 73.28  ? 204  HIS E CD2 1 
ATOM   4485  C CE1 . HIS G  1 64  ? 16.669  131.348 48.452  1.00 76.29  ? 204  HIS E CE1 1 
ATOM   4486  N NE2 . HIS G  1 64  ? 15.647  132.167 48.271  1.00 81.16  ? 204  HIS E NE2 1 
ATOM   4487  N N   . ASP G  1 65  ? 13.928  125.851 47.922  1.00 68.91  ? 205  ASP E N   1 
ATOM   4488  C CA  . ASP G  1 65  ? 13.420  124.518 48.211  1.00 75.85  ? 205  ASP E CA  1 
ATOM   4489  C C   . ASP G  1 65  ? 12.298  124.077 47.280  1.00 72.99  ? 205  ASP E C   1 
ATOM   4490  O O   . ASP G  1 65  ? 11.247  123.594 47.719  1.00 72.27  ? 205  ASP E O   1 
ATOM   4491  C CB  . ASP G  1 65  ? 12.959  124.466 49.670  1.00 81.50  ? 205  ASP E CB  1 
ATOM   4492  C CG  . ASP G  1 65  ? 14.082  124.791 50.639  1.00 89.00  ? 205  ASP E CG  1 
ATOM   4493  O OD1 . ASP G  1 65  ? 14.989  123.945 50.792  1.00 98.72  ? 205  ASP E OD1 1 
ATOM   4494  O OD2 . ASP G  1 65  ? 14.069  125.893 51.235  1.00 91.17  ? 205  ASP E OD2 1 
ATOM   4495  N N   . CYS G  1 66  ? 12.538  124.237 45.986  1.00 70.83  ? 206  CYS E N   1 
ATOM   4496  C CA  . CYS G  1 66  ? 11.557  123.853 44.980  1.00 71.73  ? 206  CYS E CA  1 
ATOM   4497  C C   . CYS G  1 66  ? 11.575  122.329 44.789  1.00 70.05  ? 206  CYS E C   1 
ATOM   4498  O O   . CYS G  1 66  ? 12.627  121.688 44.934  1.00 70.87  ? 206  CYS E O   1 
ATOM   4499  C CB  . CYS G  1 66  ? 11.885  124.545 43.644  1.00 62.17  ? 206  CYS E CB  1 
ATOM   4500  S SG  . CYS G  1 66  ? 12.237  126.333 43.776  1.00 76.20  ? 206  CYS E SG  1 
ATOM   4501  N N   . THR G  1 67  ? 10.416  121.750 44.498  1.00 60.17  ? 207  THR E N   1 
ATOM   4502  C CA  . THR G  1 67  ? 10.348  120.328 44.222  1.00 61.72  ? 207  THR E CA  1 
ATOM   4503  C C   . THR G  1 67  ? 10.472  120.193 42.703  1.00 65.69  ? 207  THR E C   1 
ATOM   4504  O O   . THR G  1 67  ? 10.467  121.196 41.992  1.00 70.15  ? 207  THR E O   1 
ATOM   4505  C CB  . THR G  1 67  ? 9.011   119.722 44.637  1.00 63.24  ? 207  THR E CB  1 
ATOM   4506  O OG1 . THR G  1 67  ? 7.963   120.230 43.800  1.00 59.30  ? 207  THR E OG1 1 
ATOM   4507  C CG2 . THR G  1 67  ? 8.733   120.046 46.076  1.00 62.94  ? 207  THR E CG2 1 
ATOM   4508  N N   . VAL G  1 68  ? 10.588  118.968 42.203  1.00 65.43  ? 208  VAL E N   1 
ATOM   4509  C CA  . VAL G  1 68  ? 10.702  118.776 40.773  1.00 67.09  ? 208  VAL E CA  1 
ATOM   4510  C C   . VAL G  1 68  ? 9.530   119.482 40.126  1.00 71.19  ? 208  VAL E C   1 
ATOM   4511  O O   . VAL G  1 68  ? 9.701   120.294 39.206  1.00 73.01  ? 208  VAL E O   1 
ATOM   4512  C CB  . VAL G  1 68  ? 10.659  117.294 40.411  1.00 68.26  ? 208  VAL E CB  1 
ATOM   4513  C CG1 . VAL G  1 68  ? 10.426  117.125 38.913  1.00 70.15  ? 208  VAL E CG1 1 
ATOM   4514  C CG2 . VAL G  1 68  ? 11.976  116.653 40.804  1.00 64.51  ? 208  VAL E CG2 1 
ATOM   4515  N N   . GLU G  1 69  ? 8.343   119.168 40.635  1.00 71.31  ? 209  GLU E N   1 
ATOM   4516  C CA  . GLU G  1 69  ? 7.095   119.754 40.160  1.00 67.97  ? 209  GLU E CA  1 
ATOM   4517  C C   . GLU G  1 69  ? 7.263   121.262 40.015  1.00 66.73  ? 209  GLU E C   1 
ATOM   4518  O O   . GLU G  1 69  ? 7.063   121.840 38.945  1.00 64.80  ? 209  GLU E O   1 
ATOM   4519  C CB  . GLU G  1 69  ? 5.994   119.475 41.179  1.00 74.93  ? 209  GLU E CB  1 
ATOM   4520  C CG  . GLU G  1 69  ? 4.604   119.825 40.720  1.00 87.55  ? 209  GLU E CG  1 
ATOM   4521  C CD  . GLU G  1 69  ? 4.156   118.948 39.564  1.00 100.00 ? 209  GLU E CD  1 
ATOM   4522  O OE1 . GLU G  1 69  ? 4.872   118.921 38.532  1.00 100.00 ? 209  GLU E OE1 1 
ATOM   4523  O OE2 . GLU G  1 69  ? 3.092   118.287 39.687  1.00 100.00 ? 209  GLU E OE2 1 
ATOM   4524  N N   . GLN G  1 70  ? 7.651   121.888 41.116  1.00 63.69  ? 210  GLN E N   1 
ATOM   4525  C CA  . GLN G  1 70  ? 7.834   123.324 41.161  1.00 63.03  ? 210  GLN E CA  1 
ATOM   4526  C C   . GLN G  1 70  ? 8.879   123.855 40.179  1.00 63.84  ? 210  GLN E C   1 
ATOM   4527  O O   . GLN G  1 70  ? 8.707   124.931 39.587  1.00 61.26  ? 210  GLN E O   1 
ATOM   4528  C CB  . GLN G  1 70  ? 8.193   123.720 42.593  1.00 64.57  ? 210  GLN E CB  1 
ATOM   4529  C CG  . GLN G  1 70  ? 7.164   123.245 43.621  1.00 65.47  ? 210  GLN E CG  1 
ATOM   4530  C CD  . GLN G  1 70  ? 7.545   123.612 45.039  1.00 65.28  ? 210  GLN E CD  1 
ATOM   4531  O OE1 . GLN G  1 70  ? 7.761   124.777 45.350  1.00 67.38  ? 210  GLN E OE1 1 
ATOM   4532  N NE2 . GLN G  1 70  ? 7.635   122.618 45.903  1.00 68.50  ? 210  GLN E NE2 1 
ATOM   4533  N N   . ILE G  1 71  ? 9.961   123.100 40.009  1.00 62.76  ? 211  ILE E N   1 
ATOM   4534  C CA  . ILE G  1 71  ? 11.028  123.514 39.116  1.00 61.23  ? 211  ILE E CA  1 
ATOM   4535  C C   . ILE G  1 71  ? 10.492  123.595 37.710  1.00 62.01  ? 211  ILE E C   1 
ATOM   4536  O O   . ILE G  1 71  ? 10.591  124.635 37.046  1.00 63.48  ? 211  ILE E O   1 
ATOM   4537  C CB  . ILE G  1 71  ? 12.216  122.539 39.186  1.00 61.80  ? 211  ILE E CB  1 
ATOM   4538  C CG1 . ILE G  1 71  ? 12.937  122.726 40.525  1.00 67.06  ? 211  ILE E CG1 1 
ATOM   4539  C CG2 . ILE G  1 71  ? 13.195  122.803 38.046  1.00 57.99  ? 211  ILE E CG2 1 
ATOM   4540  C CD1 . ILE G  1 71  ? 14.009  121.708 40.795  1.00 62.31  ? 211  ILE E CD1 1 
ATOM   4541  N N   . TYR G  1 72  ? 9.905   122.501 37.259  1.00 57.55  ? 212  TYR E N   1 
ATOM   4542  C CA  . TYR G  1 72  ? 9.344   122.477 35.924  1.00 62.45  ? 212  TYR E CA  1 
ATOM   4543  C C   . TYR G  1 72  ? 8.420   123.662 35.724  1.00 64.02  ? 212  TYR E C   1 
ATOM   4544  O O   . TYR G  1 72  ? 8.497   124.350 34.698  1.00 60.81  ? 212  TYR E O   1 
ATOM   4545  C CB  . TYR G  1 72  ? 8.595   121.174 35.710  1.00 65.00  ? 212  TYR E CB  1 
ATOM   4546  C CG  . TYR G  1 72  ? 9.504   120.012 35.394  1.00 68.38  ? 212  TYR E CG  1 
ATOM   4547  C CD1 . TYR G  1 72  ? 10.534  120.142 34.460  1.00 66.26  ? 212  TYR E CD1 1 
ATOM   4548  C CD2 . TYR G  1 72  ? 9.300   118.768 35.983  1.00 71.85  ? 212  TYR E CD2 1 
ATOM   4549  C CE1 . TYR G  1 72  ? 11.333  119.063 34.116  1.00 75.65  ? 212  TYR E CE1 1 
ATOM   4550  C CE2 . TYR G  1 72  ? 10.094  117.678 35.648  1.00 78.73  ? 212  TYR E CE2 1 
ATOM   4551  C CZ  . TYR G  1 72  ? 11.109  117.831 34.711  1.00 79.53  ? 212  TYR E CZ  1 
ATOM   4552  O OH  . TYR G  1 72  ? 11.895  116.751 34.366  1.00 84.36  ? 212  TYR E OH  1 
ATOM   4553  N N   . GLU G  1 73  ? 7.556   123.891 36.715  1.00 67.30  ? 213  GLU E N   1 
ATOM   4554  C CA  . GLU G  1 73  ? 6.608   125.006 36.694  1.00 66.21  ? 213  GLU E CA  1 
ATOM   4555  C C   . GLU G  1 73  ? 7.327   126.327 36.460  1.00 58.81  ? 213  GLU E C   1 
ATOM   4556  O O   . GLU G  1 73  ? 6.960   127.095 35.575  1.00 60.26  ? 213  GLU E O   1 
ATOM   4557  C CB  . GLU G  1 73  ? 5.857   125.096 38.021  1.00 75.53  ? 213  GLU E CB  1 
ATOM   4558  C CG  . GLU G  1 73  ? 4.605   124.223 38.136  1.00 88.59  ? 213  GLU E CG  1 
ATOM   4559  C CD  . GLU G  1 73  ? 3.960   124.316 39.526  1.00 95.39  ? 213  GLU E CD  1 
ATOM   4560  O OE1 . GLU G  1 73  ? 3.932   125.435 40.104  1.00 95.65  ? 213  GLU E OE1 1 
ATOM   4561  O OE2 . GLU G  1 73  ? 3.476   123.275 40.037  1.00 96.23  ? 213  GLU E OE2 1 
ATOM   4562  N N   . ILE G  1 74  ? 8.353   126.583 37.261  1.00 48.60  ? 214  ILE E N   1 
ATOM   4563  C CA  . ILE G  1 74  ? 9.111   127.817 37.148  1.00 47.47  ? 214  ILE E CA  1 
ATOM   4564  C C   . ILE G  1 74  ? 9.745   128.001 35.773  1.00 55.66  ? 214  ILE E C   1 
ATOM   4565  O O   . ILE G  1 74  ? 9.733   129.109 35.205  1.00 52.71  ? 214  ILE E O   1 
ATOM   4566  C CB  . ILE G  1 74  ? 10.208  127.871 38.210  1.00 42.64  ? 214  ILE E CB  1 
ATOM   4567  C CG1 . ILE G  1 74  ? 9.570   127.700 39.587  1.00 39.97  ? 214  ILE E CG1 1 
ATOM   4568  C CG2 . ILE G  1 74  ? 11.007  129.159 38.074  1.00 24.86  ? 214  ILE E CG2 1 
ATOM   4569  C CD1 . ILE G  1 74  ? 10.543  127.770 40.737  1.00 45.65  ? 214  ILE E CD1 1 
ATOM   4570  N N   . LEU G  1 75  ? 10.305  126.919 35.234  1.00 58.86  ? 215  LEU E N   1 
ATOM   4571  C CA  . LEU G  1 75  ? 10.935  126.999 33.925  1.00 54.25  ? 215  LEU E CA  1 
ATOM   4572  C C   . LEU G  1 75  ? 9.872   127.236 32.861  1.00 54.61  ? 215  LEU E C   1 
ATOM   4573  O O   . LEU G  1 75  ? 10.104  127.989 31.917  1.00 51.20  ? 215  LEU E O   1 
ATOM   4574  C CB  . LEU G  1 75  ? 11.721  125.723 33.647  1.00 51.30  ? 215  LEU E CB  1 
ATOM   4575  C CG  . LEU G  1 75  ? 12.891  125.516 34.607  1.00 44.48  ? 215  LEU E CG  1 
ATOM   4576  C CD1 . LEU G  1 75  ? 13.559  124.189 34.298  1.00 49.24  ? 215  LEU E CD1 1 
ATOM   4577  C CD2 . LEU G  1 75  ? 13.885  126.662 34.463  1.00 48.00  ? 215  LEU E CD2 1 
ATOM   4578  N N   . LYS G  1 76  ? 8.705   126.608 33.030  1.00 56.74  ? 216  LYS E N   1 
ATOM   4579  C CA  . LYS G  1 76  ? 7.591   126.770 32.088  1.00 54.02  ? 216  LYS E CA  1 
ATOM   4580  C C   . LYS G  1 76  ? 7.261   128.244 31.927  1.00 51.91  ? 216  LYS E C   1 
ATOM   4581  O O   . LYS G  1 76  ? 7.057   128.721 30.813  1.00 49.76  ? 216  LYS E O   1 
ATOM   4582  C CB  . LYS G  1 76  ? 6.345   126.041 32.587  1.00 51.42  ? 216  LYS E CB  1 
ATOM   4583  C CG  . LYS G  1 76  ? 5.228   125.969 31.552  1.00 59.70  ? 216  LYS E CG  1 
ATOM   4584  C CD  . LYS G  1 76  ? 5.714   125.277 30.286  1.00 73.14  ? 216  LYS E CD  1 
ATOM   4585  C CE  . LYS G  1 76  ? 4.616   125.094 29.239  1.00 80.28  ? 216  LYS E CE  1 
ATOM   4586  N NZ  . LYS G  1 76  ? 5.162   124.460 27.983  1.00 84.09  ? 216  LYS E NZ  1 
ATOM   4587  N N   . ILE G  1 77  ? 7.210   128.954 33.052  1.00 49.40  ? 217  ILE E N   1 
ATOM   4588  C CA  . ILE G  1 77  ? 6.930   130.377 33.055  1.00 41.52  ? 217  ILE E CA  1 
ATOM   4589  C C   . ILE G  1 77  ? 7.950   131.130 32.205  1.00 42.80  ? 217  ILE E C   1 
ATOM   4590  O O   . ILE G  1 77  ? 7.600   131.844 31.267  1.00 36.57  ? 217  ILE E O   1 
ATOM   4591  C CB  . ILE G  1 77  ? 6.999   130.934 34.473  1.00 42.36  ? 217  ILE E CB  1 
ATOM   4592  C CG1 . ILE G  1 77  ? 5.819   130.422 35.287  1.00 38.11  ? 217  ILE E CG1 1 
ATOM   4593  C CG2 . ILE G  1 77  ? 7.038   132.447 34.436  1.00 38.22  ? 217  ILE E CG2 1 
ATOM   4594  C CD1 . ILE G  1 77  ? 5.914   130.807 36.738  1.00 45.27  ? 217  ILE E CD1 1 
ATOM   4595  N N   . TYR G  1 78  ? 9.224   130.975 32.529  1.00 40.75  ? 218  TYR E N   1 
ATOM   4596  C CA  . TYR G  1 78  ? 10.213  131.691 31.759  1.00 41.89  ? 218  TYR E CA  1 
ATOM   4597  C C   . TYR G  1 78  ? 10.297  131.178 30.339  1.00 38.74  ? 218  TYR E C   1 
ATOM   4598  O O   . TYR G  1 78  ? 10.661  131.902 29.415  1.00 32.15  ? 218  TYR E O   1 
ATOM   4599  C CB  . TYR G  1 78  ? 11.564  131.652 32.476  1.00 43.85  ? 218  TYR E CB  1 
ATOM   4600  C CG  . TYR G  1 78  ? 11.521  132.464 33.753  1.00 45.83  ? 218  TYR E CG  1 
ATOM   4601  C CD1 . TYR G  1 78  ? 11.049  131.909 34.939  1.00 44.34  ? 218  TYR E CD1 1 
ATOM   4602  C CD2 . TYR G  1 78  ? 11.857  133.817 33.748  1.00 45.28  ? 218  TYR E CD2 1 
ATOM   4603  C CE1 . TYR G  1 78  ? 10.908  132.684 36.093  1.00 49.46  ? 218  TYR E CE1 1 
ATOM   4604  C CE2 . TYR G  1 78  ? 11.719  134.607 34.897  1.00 43.41  ? 218  TYR E CE2 1 
ATOM   4605  C CZ  . TYR G  1 78  ? 11.245  134.033 36.068  1.00 49.00  ? 218  TYR E CZ  1 
ATOM   4606  O OH  . TYR G  1 78  ? 11.128  134.788 37.225  1.00 48.57  ? 218  TYR E OH  1 
ATOM   4607  N N   . GLN G  1 79  ? 9.932   129.924 30.152  1.00 44.58  ? 219  GLN E N   1 
ATOM   4608  C CA  . GLN G  1 79  ? 9.973   129.372 28.817  1.00 52.25  ? 219  GLN E CA  1 
ATOM   4609  C C   . GLN G  1 79  ? 8.987   130.138 27.963  1.00 54.64  ? 219  GLN E C   1 
ATOM   4610  O O   . GLN G  1 79  ? 9.246   130.407 26.785  1.00 56.85  ? 219  GLN E O   1 
ATOM   4611  C CB  . GLN G  1 79  ? 9.558   127.914 28.811  1.00 49.78  ? 219  GLN E CB  1 
ATOM   4612  C CG  . GLN G  1 79  ? 9.417   127.386 27.401  1.00 48.49  ? 219  GLN E CG  1 
ATOM   4613  C CD  . GLN G  1 79  ? 8.260   126.450 27.257  1.00 52.40  ? 219  GLN E CD  1 
ATOM   4614  O OE1 . GLN G  1 79  ? 8.057   125.559 28.085  1.00 61.37  ? 219  GLN E OE1 1 
ATOM   4615  N NE2 . GLN G  1 79  ? 7.493   126.631 26.196  1.00 52.10  ? 219  GLN E NE2 1 
ATOM   4616  N N   . LEU G  1 80  ? 7.853   130.472 28.575  1.00 51.19  ? 220  LEU E N   1 
ATOM   4617  C CA  . LEU G  1 80  ? 6.773   131.182 27.900  1.00 51.82  ? 220  LEU E CA  1 
ATOM   4618  C C   . LEU G  1 80  ? 6.848   132.703 27.930  1.00 52.09  ? 220  LEU E C   1 
ATOM   4619  O O   . LEU G  1 80  ? 6.033   133.377 27.312  1.00 52.88  ? 220  LEU E O   1 
ATOM   4620  C CB  . LEU G  1 80  ? 5.426   130.748 28.471  1.00 39.65  ? 220  LEU E CB  1 
ATOM   4621  C CG  . LEU G  1 80  ? 5.131   129.277 28.246  1.00 49.66  ? 220  LEU E CG  1 
ATOM   4622  C CD1 . LEU G  1 80  ? 3.840   128.908 28.950  1.00 39.72  ? 220  LEU E CD1 1 
ATOM   4623  C CD2 . LEU G  1 80  ? 5.045   128.995 26.739  1.00 50.27  ? 220  LEU E CD2 1 
ATOM   4624  N N   . MET G  1 81  ? 7.803   133.254 28.656  1.00 48.07  ? 221  MET E N   1 
ATOM   4625  C CA  . MET G  1 81  ? 7.903   134.691 28.683  1.00 47.05  ? 221  MET E CA  1 
ATOM   4626  C C   . MET G  1 81  ? 8.407   135.213 27.365  1.00 41.93  ? 221  MET E C   1 
ATOM   4627  O O   . MET G  1 81  ? 8.799   134.446 26.502  1.00 45.41  ? 221  MET E O   1 
ATOM   4628  C CB  . MET G  1 81  ? 8.827   135.131 29.791  1.00 53.29  ? 221  MET E CB  1 
ATOM   4629  C CG  . MET G  1 81  ? 8.174   135.105 31.143  1.00 62.17  ? 221  MET E CG  1 
ATOM   4630  S SD  . MET G  1 81  ? 9.016   136.319 32.105  1.00 80.68  ? 221  MET E SD  1 
ATOM   4631  C CE  . MET G  1 81  ? 9.203   137.654 30.906  1.00 79.01  ? 221  MET E CE  1 
ATOM   4632  N N   . ASP G  1 82  ? 8.362   136.524 27.197  1.00 46.90  ? 222  ASP E N   1 
ATOM   4633  C CA  . ASP G  1 82  ? 8.848   137.143 25.976  1.00 51.21  ? 222  ASP E CA  1 
ATOM   4634  C C   . ASP G  1 82  ? 10.153  137.832 26.335  1.00 52.97  ? 222  ASP E C   1 
ATOM   4635  O O   . ASP G  1 82  ? 10.165  138.844 27.037  1.00 52.17  ? 222  ASP E O   1 
ATOM   4636  C CB  . ASP G  1 82  ? 7.837   138.150 25.414  1.00 47.98  ? 222  ASP E CB  1 
ATOM   4637  C CG  . ASP G  1 82  ? 8.360   138.870 24.180  1.00 54.89  ? 222  ASP E CG  1 
ATOM   4638  O OD1 . ASP G  1 82  ? 9.593   138.964 24.040  1.00 59.55  ? 222  ASP E OD1 1 
ATOM   4639  O OD2 . ASP G  1 82  ? 7.558   139.353 23.350  1.00 57.40  ? 222  ASP E OD2 1 
ATOM   4640  N N   . HIS G  1 83  ? 11.251  137.260 25.858  1.00 50.97  ? 224  HIS E N   1 
ATOM   4641  C CA  . HIS G  1 83  ? 12.570  137.793 26.141  1.00 54.70  ? 224  HIS E CA  1 
ATOM   4642  C C   . HIS G  1 83  ? 13.055  138.747 25.058  1.00 58.87  ? 224  HIS E C   1 
ATOM   4643  O O   . HIS G  1 83  ? 14.236  139.075 25.015  1.00 69.14  ? 224  HIS E O   1 
ATOM   4644  C CB  . HIS G  1 83  ? 13.562  136.631 26.270  1.00 44.49  ? 224  HIS E CB  1 
ATOM   4645  C CG  . HIS G  1 83  ? 13.219  135.662 27.355  1.00 37.49  ? 224  HIS E CG  1 
ATOM   4646  N ND1 . HIS G  1 83  ? 13.814  135.690 28.600  1.00 36.60  ? 224  HIS E ND1 1 
ATOM   4647  C CD2 . HIS G  1 83  ? 12.315  134.655 27.394  1.00 33.59  ? 224  HIS E CD2 1 
ATOM   4648  C CE1 . HIS G  1 83  ? 13.290  134.742 29.360  1.00 32.79  ? 224  HIS E CE1 1 
ATOM   4649  N NE2 . HIS G  1 83  ? 12.378  134.100 28.651  1.00 25.07  ? 224  HIS E NE2 1 
ATOM   4650  N N   . SER G  1 84  ? 12.153  139.211 24.201  1.00 54.17  ? 225  SER E N   1 
ATOM   4651  C CA  . SER G  1 84  ? 12.544  140.067 23.087  1.00 49.02  ? 225  SER E CA  1 
ATOM   4652  C C   . SER G  1 84  ? 13.442  141.243 23.406  1.00 52.45  ? 225  SER E C   1 
ATOM   4653  O O   . SER G  1 84  ? 14.269  141.641 22.578  1.00 60.12  ? 225  SER E O   1 
ATOM   4654  C CB  . SER G  1 84  ? 11.311  140.559 22.345  1.00 45.49  ? 225  SER E CB  1 
ATOM   4655  O OG  . SER G  1 84  ? 10.626  139.484 21.714  1.00 43.03  ? 225  SER E OG  1 
ATOM   4656  N N   . ASN G  1 85  ? 13.303  141.808 24.596  1.00 53.96  ? 226  ASN E N   1 
ATOM   4657  C CA  . ASN G  1 85  ? 14.131  142.956 24.953  1.00 55.05  ? 226  ASN E CA  1 
ATOM   4658  C C   . ASN G  1 85  ? 15.245  142.543 25.870  1.00 56.29  ? 226  ASN E C   1 
ATOM   4659  O O   . ASN G  1 85  ? 15.798  143.360 26.604  1.00 61.95  ? 226  ASN E O   1 
ATOM   4660  C CB  . ASN G  1 85  ? 13.289  144.033 25.638  1.00 63.49  ? 226  ASN E CB  1 
ATOM   4661  C CG  . ASN G  1 85  ? 12.323  144.722 24.686  1.00 60.50  ? 226  ASN E CG  1 
ATOM   4662  O OD1 . ASN G  1 85  ? 11.435  145.449 25.116  1.00 70.37  ? 226  ASN E OD1 1 
ATOM   4663  N ND2 . ASN G  1 85  ? 12.498  144.502 23.393  1.00 65.02  ? 226  ASN E ND2 1 
ATOM   4664  N N   . MET G  1 86  ? 15.563  141.259 25.831  1.00 60.73  ? 227  MET E N   1 
ATOM   4665  C CA  . MET G  1 86  ? 16.616  140.693 26.660  1.00 57.90  ? 227  MET E CA  1 
ATOM   4666  C C   . MET G  1 86  ? 17.717  140.146 25.758  1.00 59.11  ? 227  MET E C   1 
ATOM   4667  O O   . MET G  1 86  ? 17.453  139.655 24.667  1.00 52.68  ? 227  MET E O   1 
ATOM   4668  C CB  . MET G  1 86  ? 16.025  139.598 27.535  1.00 55.25  ? 227  MET E CB  1 
ATOM   4669  C CG  . MET G  1 86  ? 14.791  140.073 28.289  1.00 56.89  ? 227  MET E CG  1 
ATOM   4670  S SD  . MET G  1 86  ? 15.165  141.345 29.527  1.00 65.00  ? 227  MET E SD  1 
ATOM   4671  C CE  . MET G  1 86  ? 14.512  140.541 31.032  1.00 43.40  ? 227  MET E CE  1 
ATOM   4672  N N   . ASP G  1 87  ? 18.958  140.256 26.210  1.00 63.06  ? 228  ASP E N   1 
ATOM   4673  C CA  . ASP G  1 87  ? 20.078  139.785 25.422  1.00 61.91  ? 228  ASP E CA  1 
ATOM   4674  C C   . ASP G  1 87  ? 20.598  138.415 25.845  1.00 64.83  ? 228  ASP E C   1 
ATOM   4675  O O   . ASP G  1 87  ? 21.323  137.755 25.093  1.00 67.61  ? 228  ASP E O   1 
ATOM   4676  C CB  . ASP G  1 87  ? 21.208  140.800 25.486  1.00 58.67  ? 228  ASP E CB  1 
ATOM   4677  C CG  . ASP G  1 87  ? 20.988  141.955 24.556  1.00 61.76  ? 228  ASP E CG  1 
ATOM   4678  O OD1 . ASP G  1 87  ? 20.297  141.755 23.539  1.00 54.38  ? 228  ASP E OD1 1 
ATOM   4679  O OD2 . ASP G  1 87  ? 21.517  143.052 24.823  1.00 70.73  ? 228  ASP E OD2 1 
ATOM   4680  N N   . CYS G  1 88  ? 20.206  137.974 27.032  1.00 58.20  ? 229  CYS E N   1 
ATOM   4681  C CA  . CYS G  1 88  ? 20.693  136.705 27.538  1.00 58.42  ? 229  CYS E CA  1 
ATOM   4682  C C   . CYS G  1 88  ? 19.739  136.146 28.580  1.00 55.40  ? 229  CYS E C   1 
ATOM   4683  O O   . CYS G  1 88  ? 18.899  136.866 29.099  1.00 63.28  ? 229  CYS E O   1 
ATOM   4684  C CB  . CYS G  1 88  ? 22.088  136.934 28.147  1.00 65.30  ? 229  CYS E CB  1 
ATOM   4685  S SG  . CYS G  1 88  ? 22.850  135.527 28.971  1.00 76.49  ? 229  CYS E SG  1 
ATOM   4686  N N   . PHE G  1 89  ? 19.859  134.854 28.866  1.00 51.93  ? 230  PHE E N   1 
ATOM   4687  C CA  . PHE G  1 89  ? 19.042  134.196 29.880  1.00 48.12  ? 230  PHE E CA  1 
ATOM   4688  C C   . PHE G  1 89  ? 19.968  133.285 30.675  1.00 48.64  ? 230  PHE E C   1 
ATOM   4689  O O   . PHE G  1 89  ? 20.814  132.622 30.089  1.00 53.27  ? 230  PHE E O   1 
ATOM   4690  C CB  . PHE G  1 89  ? 17.946  133.352 29.241  1.00 44.95  ? 230  PHE E CB  1 
ATOM   4691  C CG  . PHE G  1 89  ? 17.191  132.498 30.231  1.00 51.50  ? 230  PHE E CG  1 
ATOM   4692  C CD1 . PHE G  1 89  ? 16.352  133.074 31.189  1.00 58.74  ? 230  PHE E CD1 1 
ATOM   4693  C CD2 . PHE G  1 89  ? 17.313  131.120 30.209  1.00 46.16  ? 230  PHE E CD2 1 
ATOM   4694  C CE1 . PHE G  1 89  ? 15.645  132.276 32.109  1.00 55.41  ? 230  PHE E CE1 1 
ATOM   4695  C CE2 . PHE G  1 89  ? 16.612  130.312 31.120  1.00 43.40  ? 230  PHE E CE2 1 
ATOM   4696  C CZ  . PHE G  1 89  ? 15.778  130.894 32.069  1.00 51.78  ? 230  PHE E CZ  1 
ATOM   4697  N N   . ILE G  1 90  ? 19.819  133.252 31.996  1.00 43.89  ? 231  ILE E N   1 
ATOM   4698  C CA  . ILE G  1 90  ? 20.664  132.410 32.841  1.00 34.65  ? 231  ILE E CA  1 
ATOM   4699  C C   . ILE G  1 90  ? 19.841  131.685 33.872  1.00 40.91  ? 231  ILE E C   1 
ATOM   4700  O O   . ILE G  1 90  ? 18.944  132.259 34.474  1.00 54.69  ? 231  ILE E O   1 
ATOM   4701  C CB  . ILE G  1 90  ? 21.713  133.223 33.597  1.00 26.56  ? 231  ILE E CB  1 
ATOM   4702  C CG1 . ILE G  1 90  ? 22.625  133.960 32.617  1.00 36.65  ? 231  ILE E CG1 1 
ATOM   4703  C CG2 . ILE G  1 90  ? 22.548  132.327 34.453  1.00 36.23  ? 231  ILE E CG2 1 
ATOM   4704  C CD1 . ILE G  1 90  ? 23.777  134.691 33.300  1.00 30.87  ? 231  ILE E CD1 1 
ATOM   4705  N N   . CYS G  1 91  ? 20.140  130.413 34.077  1.00 44.10  ? 232  CYS E N   1 
ATOM   4706  C CA  . CYS G  1 91  ? 19.427  129.626 35.067  1.00 43.43  ? 232  CYS E CA  1 
ATOM   4707  C C   . CYS G  1 91  ? 20.441  128.846 35.904  1.00 48.85  ? 232  CYS E C   1 
ATOM   4708  O O   . CYS G  1 91  ? 21.190  128.030 35.377  1.00 50.85  ? 232  CYS E O   1 
ATOM   4709  C CB  . CYS G  1 91  ? 18.458  128.671 34.380  1.00 33.66  ? 232  CYS E CB  1 
ATOM   4710  S SG  . CYS G  1 91  ? 17.700  127.431 35.479  1.00 31.89  ? 232  CYS E SG  1 
ATOM   4711  N N   . CYS G  1 92  ? 20.475  129.123 37.205  1.00 49.21  ? 233  CYS E N   1 
ATOM   4712  C CA  . CYS G  1 92  ? 21.383  128.438 38.115  1.00 44.41  ? 233  CYS E CA  1 
ATOM   4713  C C   . CYS G  1 92  ? 20.595  127.475 38.963  1.00 46.05  ? 233  CYS E C   1 
ATOM   4714  O O   . CYS G  1 92  ? 19.518  127.799 39.447  1.00 52.35  ? 233  CYS E O   1 
ATOM   4715  C CB  . CYS G  1 92  ? 22.084  129.434 39.022  1.00 31.35  ? 233  CYS E CB  1 
ATOM   4716  S SG  . CYS G  1 92  ? 22.901  130.765 38.093  1.00 50.44  ? 233  CYS E SG  1 
ATOM   4717  N N   . ILE G  1 93  ? 21.125  126.281 39.145  1.00 45.47  ? 234  ILE E N   1 
ATOM   4718  C CA  . ILE G  1 93  ? 20.441  125.306 39.954  1.00 49.15  ? 234  ILE E CA  1 
ATOM   4719  C C   . ILE G  1 93  ? 21.397  124.758 40.984  1.00 54.25  ? 234  ILE E C   1 
ATOM   4720  O O   . ILE G  1 93  ? 22.421  124.187 40.630  1.00 63.96  ? 234  ILE E O   1 
ATOM   4721  C CB  . ILE G  1 93  ? 19.902  124.184 39.111  1.00 40.57  ? 234  ILE E CB  1 
ATOM   4722  C CG1 . ILE G  1 93  ? 18.863  124.749 38.158  1.00 35.48  ? 234  ILE E CG1 1 
ATOM   4723  C CG2 . ILE G  1 93  ? 19.283  123.130 40.002  1.00 30.64  ? 234  ILE E CG2 1 
ATOM   4724  C CD1 . ILE G  1 93  ? 18.255  123.714 37.285  1.00 44.13  ? 234  ILE E CD1 1 
ATOM   4725  N N   . LEU G  1 94  ? 21.055  124.962 42.255  1.00 49.69  ? 235  LEU E N   1 
ATOM   4726  C CA  . LEU G  1 94  ? 21.850  124.519 43.384  1.00 44.44  ? 235  LEU E CA  1 
ATOM   4727  C C   . LEU G  1 94  ? 21.004  123.468 44.056  1.00 48.84  ? 235  LEU E C   1 
ATOM   4728  O O   . LEU G  1 94  ? 19.952  123.782 44.599  1.00 51.23  ? 235  LEU E O   1 
ATOM   4729  C CB  . LEU G  1 94  ? 22.074  125.683 44.337  1.00 39.04  ? 235  LEU E CB  1 
ATOM   4730  C CG  . LEU G  1 94  ? 22.336  127.027 43.626  1.00 38.94  ? 235  LEU E CG  1 
ATOM   4731  C CD1 . LEU G  1 94  ? 22.547  128.141 44.623  1.00 34.96  ? 235  LEU E CD1 1 
ATOM   4732  C CD2 . LEU G  1 94  ? 23.537  126.898 42.754  1.00 37.32  ? 235  LEU E CD2 1 
ATOM   4733  N N   . SER G  1 95  ? 21.444  122.216 44.018  1.00 48.67  ? 236  SER E N   1 
ATOM   4734  C CA  . SER G  1 95  ? 20.664  121.165 44.642  1.00 47.45  ? 236  SER E CA  1 
ATOM   4735  C C   . SER G  1 95  ? 21.472  119.890 44.641  1.00 47.07  ? 236  SER E C   1 
ATOM   4736  O O   . SER G  1 95  ? 22.643  119.919 44.290  1.00 31.50  ? 236  SER E O   1 
ATOM   4737  C CB  . SER G  1 95  ? 19.355  120.977 43.867  1.00 45.45  ? 236  SER E CB  1 
ATOM   4738  O OG  . SER G  1 95  ? 18.575  119.906 44.377  1.00 45.84  ? 236  SER E OG  1 
ATOM   4739  N N   . HIS G  1 96  ? 20.848  118.795 45.082  1.00 54.52  ? 237  HIS E N   1 
ATOM   4740  C CA  . HIS G  1 96  ? 21.486  117.491 45.072  1.00 66.22  ? 237  HIS E CA  1 
ATOM   4741  C C   . HIS G  1 96  ? 21.234  116.944 43.684  1.00 73.10  ? 237  HIS E C   1 
ATOM   4742  O O   . HIS G  1 96  ? 20.331  117.407 42.988  1.00 75.78  ? 237  HIS E O   1 
ATOM   4743  C CB  . HIS G  1 96  ? 20.844  116.535 46.070  1.00 72.40  ? 237  HIS E CB  1 
ATOM   4744  C CG  . HIS G  1 96  ? 21.385  116.657 47.452  1.00 74.84  ? 237  HIS E CG  1 
ATOM   4745  N ND1 . HIS G  1 96  ? 22.735  116.723 47.716  1.00 75.73  ? 237  HIS E ND1 1 
ATOM   4746  C CD2 . HIS G  1 96  ? 20.758  116.727 48.648  1.00 76.59  ? 237  HIS E CD2 1 
ATOM   4747  C CE1 . HIS G  1 96  ? 22.916  116.830 49.020  1.00 80.22  ? 237  HIS E CE1 1 
ATOM   4748  N NE2 . HIS G  1 96  ? 21.733  116.832 49.608  1.00 82.65  ? 237  HIS E NE2 1 
ATOM   4749  N N   . GLY G  1 97  ? 22.020  115.951 43.289  1.00 79.18  ? 238  GLY E N   1 
ATOM   4750  C CA  . GLY G  1 97  ? 21.841  115.367 41.977  1.00 78.22  ? 238  GLY E CA  1 
ATOM   4751  C C   . GLY G  1 97  ? 22.556  114.045 41.816  1.00 76.49  ? 238  GLY E C   1 
ATOM   4752  O O   . GLY G  1 97  ? 23.285  113.605 42.702  1.00 77.53  ? 238  GLY E O   1 
ATOM   4753  N N   . ASP G  1 98  ? 22.341  113.414 40.669  1.00 75.14  ? 239  ASP E N   1 
ATOM   4754  C CA  . ASP G  1 98  ? 22.959  112.140 40.367  1.00 71.61  ? 239  ASP E CA  1 
ATOM   4755  C C   . ASP G  1 98  ? 23.286  112.144 38.884  1.00 67.92  ? 239  ASP E C   1 
ATOM   4756  O O   . ASP G  1 98  ? 23.165  113.177 38.237  1.00 66.60  ? 239  ASP E O   1 
ATOM   4757  C CB  . ASP G  1 98  ? 21.998  111.002 40.725  1.00 70.87  ? 239  ASP E CB  1 
ATOM   4758  C CG  . ASP G  1 98  ? 22.716  109.669 40.904  1.00 83.25  ? 239  ASP E CG  1 
ATOM   4759  O OD1 . ASP G  1 98  ? 23.849  109.508 40.369  1.00 79.13  ? 239  ASP E OD1 1 
ATOM   4760  O OD2 . ASP G  1 98  ? 22.142  108.778 41.580  1.00 85.93  ? 239  ASP E OD2 1 
ATOM   4761  N N   . LYS G  1 99  ? 23.698  111.001 38.343  1.00 70.34  ? 240  LYS E N   1 
ATOM   4762  C CA  . LYS G  1 99  ? 24.050  110.907 36.924  1.00 67.08  ? 240  LYS E CA  1 
ATOM   4763  C C   . LYS G  1 99  ? 23.011  111.541 36.019  1.00 59.85  ? 240  LYS E C   1 
ATOM   4764  O O   . LYS G  1 99  ? 21.904  111.015 35.886  1.00 54.23  ? 240  LYS E O   1 
ATOM   4765  C CB  . LYS G  1 99  ? 24.230  109.448 36.492  1.00 73.97  ? 240  LYS E CB  1 
ATOM   4766  C CG  . LYS G  1 99  ? 25.353  108.707 37.181  1.00 78.39  ? 240  LYS E CG  1 
ATOM   4767  C CD  . LYS G  1 99  ? 25.397  107.264 36.692  1.00 84.24  ? 240  LYS E CD  1 
ATOM   4768  C CE  . LYS G  1 99  ? 26.039  106.347 37.729  1.00 86.47  ? 240  LYS E CE  1 
ATOM   4769  N NZ  . LYS G  1 99  ? 26.120  104.942 37.248  1.00 86.46  ? 240  LYS E NZ  1 
ATOM   4770  N N   . GLY G  1 100 ? 23.387  112.668 35.409  1.00 52.89  ? 241  GLY E N   1 
ATOM   4771  C CA  . GLY G  1 100 ? 22.503  113.375 34.499  1.00 55.21  ? 241  GLY E CA  1 
ATOM   4772  C C   . GLY G  1 100 ? 21.220  113.989 35.053  1.00 56.78  ? 241  GLY E C   1 
ATOM   4773  O O   . GLY G  1 100 ? 20.447  114.608 34.309  1.00 54.71  ? 241  GLY E O   1 
ATOM   4774  N N   . ILE G  1 101 ? 20.977  113.837 36.349  1.00 56.60  ? 242  ILE E N   1 
ATOM   4775  C CA  . ILE G  1 101 ? 19.769  114.397 36.910  1.00 53.66  ? 242  ILE E CA  1 
ATOM   4776  C C   . ILE G  1 101 ? 20.002  115.372 38.048  1.00 55.50  ? 242  ILE E C   1 
ATOM   4777  O O   . ILE G  1 101 ? 21.122  115.548 38.536  1.00 56.10  ? 242  ILE E O   1 
ATOM   4778  C CB  . ILE G  1 101 ? 18.814  113.291 37.357  1.00 48.68  ? 242  ILE E CB  1 
ATOM   4779  C CG1 . ILE G  1 101 ? 19.422  112.488 38.504  1.00 56.68  ? 242  ILE E CG1 1 
ATOM   4780  C CG2 . ILE G  1 101 ? 18.527  112.384 36.190  1.00 43.05  ? 242  ILE E CG2 1 
ATOM   4781  C CD1 . ILE G  1 101 ? 19.279  113.128 39.860  1.00 53.63  ? 242  ILE E CD1 1 
ATOM   4782  N N   . ILE G  1 102 ? 18.916  116.028 38.429  1.00 53.12  ? 243  ILE E N   1 
ATOM   4783  C CA  . ILE G  1 102 ? 18.912  117.001 39.491  1.00 48.48  ? 243  ILE E CA  1 
ATOM   4784  C C   . ILE G  1 102 ? 17.848  116.493 40.416  1.00 52.02  ? 243  ILE E C   1 
ATOM   4785  O O   . ILE G  1 102 ? 16.805  115.996 39.972  1.00 50.63  ? 243  ILE E O   1 
ATOM   4786  C CB  . ILE G  1 102 ? 18.528  118.395 38.956  1.00 52.67  ? 243  ILE E CB  1 
ATOM   4787  C CG1 . ILE G  1 102 ? 19.670  119.355 39.210  1.00 48.37  ? 243  ILE E CG1 1 
ATOM   4788  C CG2 . ILE G  1 102 ? 17.252  118.915 39.610  1.00 55.05  ? 243  ILE E CG2 1 
ATOM   4789  C CD1 . ILE G  1 102 ? 20.956  118.889 38.613  1.00 48.07  ? 243  ILE E CD1 1 
ATOM   4790  N N   . TYR G  1 103 ? 18.110  116.593 41.706  1.00 54.81  ? 244  TYR E N   1 
ATOM   4791  C CA  . TYR G  1 103 ? 17.138  116.128 42.660  1.00 59.69  ? 244  TYR E CA  1 
ATOM   4792  C C   . TYR G  1 103 ? 16.236  117.248 43.102  1.00 58.49  ? 244  TYR E C   1 
ATOM   4793  O O   . TYR G  1 103 ? 16.694  118.352 43.385  1.00 51.96  ? 244  TYR E O   1 
ATOM   4794  C CB  . TYR G  1 103 ? 17.839  115.520 43.868  1.00 66.34  ? 244  TYR E CB  1 
ATOM   4795  C CG  . TYR G  1 103 ? 18.091  114.044 43.724  1.00 68.86  ? 244  TYR E CG  1 
ATOM   4796  C CD1 . TYR G  1 103 ? 17.023  113.144 43.562  1.00 65.68  ? 244  TYR E CD1 1 
ATOM   4797  C CD2 . TYR G  1 103 ? 19.386  113.544 43.739  1.00 65.45  ? 244  TYR E CD2 1 
ATOM   4798  C CE1 . TYR G  1 103 ? 17.248  111.789 43.416  1.00 67.16  ? 244  TYR E CE1 1 
ATOM   4799  C CE2 . TYR G  1 103 ? 19.626  112.185 43.597  1.00 68.27  ? 244  TYR E CE2 1 
ATOM   4800  C CZ  . TYR G  1 103 ? 18.557  111.314 43.434  1.00 72.30  ? 244  TYR E CZ  1 
ATOM   4801  O OH  . TYR G  1 103 ? 18.801  109.964 43.266  1.00 83.16  ? 244  TYR E OH  1 
ATOM   4802  N N   . GLY G  1 104 ? 14.943  116.955 43.129  1.00 63.17  ? 245  GLY E N   1 
ATOM   4803  C CA  . GLY G  1 104 ? 13.978  117.933 43.581  1.00 68.75  ? 245  GLY E CA  1 
ATOM   4804  C C   . GLY G  1 104 ? 13.963  117.851 45.099  1.00 75.22  ? 245  GLY E C   1 
ATOM   4805  O O   . GLY G  1 104 ? 14.194  116.785 45.679  1.00 77.75  ? 245  GLY E O   1 
ATOM   4806  N N   . THR G  1 105 ? 13.699  118.975 45.753  1.00 76.86  ? 246  THR E N   1 
ATOM   4807  C CA  . THR G  1 105 ? 13.671  119.027 47.205  1.00 71.06  ? 246  THR E CA  1 
ATOM   4808  C C   . THR G  1 105 ? 12.792  117.918 47.809  1.00 71.48  ? 246  THR E C   1 
ATOM   4809  O O   . THR G  1 105 ? 12.898  117.605 48.995  1.00 75.37  ? 246  THR E O   1 
ATOM   4810  C CB  . THR G  1 105 ? 13.174  120.406 47.650  1.00 66.13  ? 246  THR E CB  1 
ATOM   4811  O OG1 . THR G  1 105 ? 13.642  120.670 48.969  1.00 70.25  ? 246  THR E OG1 1 
ATOM   4812  C CG2 . THR G  1 105 ? 11.648  120.473 47.618  1.00 65.86  ? 246  THR E CG2 1 
ATOM   4813  N N   . ASP G  1 106 ? 11.949  117.313 46.976  1.00 69.77  ? 247  ASP E N   1 
ATOM   4814  C CA  . ASP G  1 106 ? 11.040  116.251 47.404  1.00 72.92  ? 247  ASP E CA  1 
ATOM   4815  C C   . ASP G  1 106 ? 11.549  114.859 47.036  1.00 72.92  ? 247  ASP E C   1 
ATOM   4816  O O   . ASP G  1 106 ? 10.839  113.853 47.190  1.00 71.50  ? 247  ASP E O   1 
ATOM   4817  C CB  . ASP G  1 106 ? 9.652   116.466 46.776  1.00 78.98  ? 247  ASP E CB  1 
ATOM   4818  C CG  . ASP G  1 106 ? 9.664   116.345 45.250  1.00 79.47  ? 247  ASP E CG  1 
ATOM   4819  O OD1 . ASP G  1 106 ? 10.460  117.045 44.592  1.00 85.07  ? 247  ASP E OD1 1 
ATOM   4820  O OD2 . ASP G  1 106 ? 8.868   115.553 44.706  1.00 79.55  ? 247  ASP E OD2 1 
ATOM   4821  N N   . GLY G  1 107 ? 12.772  114.800 46.526  1.00 73.76  ? 248  GLY E N   1 
ATOM   4822  C CA  . GLY G  1 107 ? 13.341  113.516 46.153  1.00 77.33  ? 248  GLY E CA  1 
ATOM   4823  C C   . GLY G  1 107 ? 13.124  113.085 44.714  1.00 75.78  ? 248  GLY E C   1 
ATOM   4824  O O   . GLY G  1 107 ? 13.772  112.152 44.237  1.00 76.85  ? 248  GLY E O   1 
ATOM   4825  N N   . GLN G  1 108 ? 12.217  113.754 44.014  1.00 74.31  ? 254  GLN E N   1 
ATOM   4826  C CA  . GLN G  1 108 ? 11.965  113.393 42.635  1.00 70.68  ? 254  GLN E CA  1 
ATOM   4827  C C   . GLN G  1 108 ? 13.124  113.810 41.748  1.00 70.98  ? 254  GLN E C   1 
ATOM   4828  O O   . GLN G  1 108 ? 13.882  114.746 42.066  1.00 65.91  ? 254  GLN E O   1 
ATOM   4829  C CB  . GLN G  1 108 ? 10.665  114.020 42.150  1.00 75.47  ? 254  GLN E CB  1 
ATOM   4830  C CG  . GLN G  1 108 ? 9.447   113.510 42.880  1.00 81.32  ? 254  GLN E CG  1 
ATOM   4831  C CD  . GLN G  1 108 ? 9.385   111.999 42.904  1.00 85.34  ? 254  GLN E CD  1 
ATOM   4832  O OE1 . GLN G  1 108 ? 9.279   111.349 41.860  1.00 79.58  ? 254  GLN E OE1 1 
ATOM   4833  N NE2 . GLN G  1 108 ? 9.454   111.428 44.105  1.00 90.43  ? 254  GLN E NE2 1 
ATOM   4834  N N   . GLU G  1 109 ? 13.249  113.104 40.626  1.00 69.44  ? 255  GLU E N   1 
ATOM   4835  C CA  . GLU G  1 109 ? 14.323  113.353 39.671  1.00 69.14  ? 255  GLU E CA  1 
ATOM   4836  C C   . GLU G  1 109 ? 13.991  114.193 38.440  1.00 63.30  ? 255  GLU E C   1 
ATOM   4837  O O   . GLU G  1 109 ? 12.948  114.029 37.796  1.00 55.14  ? 255  GLU E O   1 
ATOM   4838  C CB  . GLU G  1 109 ? 14.895  112.023 39.223  1.00 74.52  ? 255  GLU E CB  1 
ATOM   4839  C CG  . GLU G  1 109 ? 15.781  111.378 40.256  1.00 82.20  ? 255  GLU E CG  1 
ATOM   4840  C CD  . GLU G  1 109 ? 16.072  109.933 39.926  1.00 90.58  ? 255  GLU E CD  1 
ATOM   4841  O OE1 . GLU G  1 109 ? 16.150  109.606 38.717  1.00 92.23  ? 255  GLU E OE1 1 
ATOM   4842  O OE2 . GLU G  1 109 ? 16.230  109.131 40.879  1.00 90.79  ? 255  GLU E OE2 1 
ATOM   4843  N N   . ALA G  1 110 ? 14.909  115.088 38.112  1.00 54.96  ? 256  ALA E N   1 
ATOM   4844  C CA  . ALA G  1 110 ? 14.726  115.943 36.965  1.00 54.57  ? 256  ALA E CA  1 
ATOM   4845  C C   . ALA G  1 110 ? 15.950  115.835 36.059  1.00 52.10  ? 256  ALA E C   1 
ATOM   4846  O O   . ALA G  1 110 ? 17.052  116.239 36.434  1.00 56.45  ? 256  ALA E O   1 
ATOM   4847  C CB  . ALA G  1 110 ? 14.523  117.387 37.415  1.00 50.29  ? 256  ALA E CB  1 
ATOM   4848  N N   . PRO G  1 111 ? 15.775  115.259 34.861  1.00 42.80  ? 257  PRO E N   1 
ATOM   4849  C CA  . PRO G  1 111 ? 16.875  115.114 33.915  1.00 40.02  ? 257  PRO E CA  1 
ATOM   4850  C C   . PRO G  1 111 ? 17.347  116.488 33.477  1.00 41.51  ? 257  PRO E C   1 
ATOM   4851  O O   . PRO G  1 111 ? 16.552  117.321 33.062  1.00 46.70  ? 257  PRO E O   1 
ATOM   4852  C CB  . PRO G  1 111 ? 16.236  114.342 32.777  1.00 38.39  ? 257  PRO E CB  1 
ATOM   4853  C CG  . PRO G  1 111 ? 15.244  113.496 33.468  1.00 32.53  ? 257  PRO E CG  1 
ATOM   4854  C CD  . PRO G  1 111 ? 14.618  114.454 34.433  1.00 41.44  ? 257  PRO E CD  1 
ATOM   4855  N N   . ILE G  1 112 ? 18.638  116.737 33.573  1.00 38.56  ? 258  ILE E N   1 
ATOM   4856  C CA  . ILE G  1 112 ? 19.138  118.025 33.181  1.00 38.00  ? 258  ILE E CA  1 
ATOM   4857  C C   . ILE G  1 112 ? 18.745  118.341 31.753  1.00 45.40  ? 258  ILE E C   1 
ATOM   4858  O O   . ILE G  1 112 ? 18.586  119.498 31.395  1.00 50.33  ? 258  ILE E O   1 
ATOM   4859  C CB  . ILE G  1 112 ? 20.637  118.055 33.354  1.00 37.35  ? 258  ILE E CB  1 
ATOM   4860  C CG1 . ILE G  1 112 ? 20.943  117.872 34.844  1.00 48.14  ? 258  ILE E CG1 1 
ATOM   4861  C CG2 . ILE G  1 112 ? 21.205  119.335 32.821  1.00 31.63  ? 258  ILE E CG2 1 
ATOM   4862  C CD1 . ILE G  1 112 ? 22.422  117.944 35.225  1.00 47.83  ? 258  ILE E CD1 1 
ATOM   4863  N N   . TYR G  1 113 ? 18.565  117.309 30.939  1.00 54.31  ? 259  TYR E N   1 
ATOM   4864  C CA  . TYR G  1 113 ? 18.187  117.507 29.549  1.00 54.82  ? 259  TYR E CA  1 
ATOM   4865  C C   . TYR G  1 113 ? 16.791  118.129 29.489  1.00 53.98  ? 259  TYR E C   1 
ATOM   4866  O O   . TYR G  1 113 ? 16.551  119.061 28.726  1.00 49.01  ? 259  TYR E O   1 
ATOM   4867  C CB  . TYR G  1 113 ? 18.204  116.175 28.797  1.00 66.86  ? 259  TYR E CB  1 
ATOM   4868  C CG  . TYR G  1 113 ? 18.004  116.333 27.308  1.00 82.81  ? 259  TYR E CG  1 
ATOM   4869  C CD1 . TYR G  1 113 ? 18.910  117.083 26.537  1.00 88.16  ? 259  TYR E CD1 1 
ATOM   4870  C CD2 . TYR G  1 113 ? 16.888  115.777 26.669  1.00 88.44  ? 259  TYR E CD2 1 
ATOM   4871  C CE1 . TYR G  1 113 ? 18.708  117.281 25.159  1.00 93.47  ? 259  TYR E CE1 1 
ATOM   4872  C CE2 . TYR G  1 113 ? 16.673  115.968 25.291  1.00 94.98  ? 259  TYR E CE2 1 
ATOM   4873  C CZ  . TYR G  1 113 ? 17.586  116.722 24.546  1.00 97.64  ? 259  TYR E CZ  1 
ATOM   4874  O OH  . TYR G  1 113 ? 17.373  116.919 23.197  1.00 100.00 ? 259  TYR E OH  1 
ATOM   4875  N N   . GLU G  1 114 ? 15.871  117.603 30.289  1.00 52.86  ? 260  GLU E N   1 
ATOM   4876  C CA  . GLU G  1 114 ? 14.510  118.127 30.343  1.00 51.66  ? 260  GLU E CA  1 
ATOM   4877  C C   . GLU G  1 114 ? 14.536  119.604 30.710  1.00 48.52  ? 260  GLU E C   1 
ATOM   4878  O O   . GLU G  1 114 ? 13.719  120.387 30.251  1.00 49.92  ? 260  GLU E O   1 
ATOM   4879  C CB  . GLU G  1 114 ? 13.714  117.408 31.412  1.00 58.33  ? 260  GLU E CB  1 
ATOM   4880  C CG  . GLU G  1 114 ? 13.627  115.939 31.215  1.00 68.38  ? 260  GLU E CG  1 
ATOM   4881  C CD  . GLU G  1 114 ? 12.559  115.583 30.253  1.00 68.98  ? 260  GLU E CD  1 
ATOM   4882  O OE1 . GLU G  1 114 ? 12.605  116.109 29.124  1.00 72.20  ? 260  GLU E OE1 1 
ATOM   4883  O OE2 . GLU G  1 114 ? 11.677  114.781 30.631  1.00 78.88  ? 260  GLU E OE2 1 
ATOM   4884  N N   . LEU G  1 115 ? 15.466  119.985 31.564  1.00 45.78  ? 261  LEU E N   1 
ATOM   4885  C CA  . LEU G  1 115 ? 15.537  121.370 31.961  1.00 48.79  ? 261  LEU E CA  1 
ATOM   4886  C C   . LEU G  1 115 ? 16.017  122.274 30.833  1.00 45.65  ? 261  LEU E C   1 
ATOM   4887  O O   . LEU G  1 115 ? 15.314  123.174 30.432  1.00 55.15  ? 261  LEU E O   1 
ATOM   4888  C CB  . LEU G  1 115 ? 16.431  121.519 33.194  1.00 46.05  ? 261  LEU E CB  1 
ATOM   4889  C CG  . LEU G  1 115 ? 16.038  120.553 34.310  1.00 43.57  ? 261  LEU E CG  1 
ATOM   4890  C CD1 . LEU G  1 115 ? 16.763  120.934 35.559  1.00 36.63  ? 261  LEU E CD1 1 
ATOM   4891  C CD2 . LEU G  1 115 ? 14.528  120.584 34.533  1.00 48.23  ? 261  LEU E CD2 1 
ATOM   4892  N N   . THR G  1 116 ? 17.196  122.027 30.293  1.00 44.45  ? 262  THR E N   1 
ATOM   4893  C CA  . THR G  1 116 ? 17.715  122.889 29.240  1.00 45.09  ? 262  THR E CA  1 
ATOM   4894  C C   . THR G  1 116 ? 16.980  122.856 27.922  1.00 47.39  ? 262  THR E C   1 
ATOM   4895  O O   . THR G  1 116 ? 17.071  123.812 27.160  1.00 43.19  ? 262  THR E O   1 
ATOM   4896  C CB  . THR G  1 116 ? 19.162  122.562 28.878  1.00 43.81  ? 262  THR E CB  1 
ATOM   4897  O OG1 . THR G  1 116 ? 19.205  121.302 28.195  1.00 39.52  ? 262  THR E OG1 1 
ATOM   4898  C CG2 . THR G  1 116 ? 20.007  122.505 30.106  1.00 40.03  ? 262  THR E CG2 1 
ATOM   4899  N N   . SER G  1 117 ? 16.303  121.750 27.622  1.00 52.34  ? 263  SER E N   1 
ATOM   4900  C CA  . SER G  1 117 ? 15.601  121.621 26.340  1.00 53.04  ? 263  SER E CA  1 
ATOM   4901  C C   . SER G  1 117 ? 14.349  122.490 26.315  1.00 55.49  ? 263  SER E C   1 
ATOM   4902  O O   . SER G  1 117 ? 13.678  122.634 25.285  1.00 60.25  ? 263  SER E O   1 
ATOM   4903  C CB  . SER G  1 117 ? 15.237  120.154 26.063  1.00 46.97  ? 263  SER E CB  1 
ATOM   4904  O OG  . SER G  1 117 ? 14.189  119.705 26.908  1.00 47.38  ? 263  SER E OG  1 
ATOM   4905  N N   . GLN G  1 118 ? 14.047  123.072 27.469  1.00 51.51  ? 264  GLN E N   1 
ATOM   4906  C CA  . GLN G  1 118 ? 12.901  123.949 27.630  1.00 48.72  ? 264  GLN E CA  1 
ATOM   4907  C C   . GLN G  1 118 ? 13.110  125.254 26.887  1.00 47.52  ? 264  GLN E C   1 
ATOM   4908  O O   . GLN G  1 118 ? 12.157  125.927 26.560  1.00 54.91  ? 264  GLN E O   1 
ATOM   4909  C CB  . GLN G  1 118 ? 12.712  124.269 29.109  1.00 48.67  ? 264  GLN E CB  1 
ATOM   4910  C CG  . GLN G  1 118 ? 12.139  123.145 29.921  1.00 55.08  ? 264  GLN E CG  1 
ATOM   4911  C CD  . GLN G  1 118 ? 10.753  122.821 29.455  1.00 66.82  ? 264  GLN E CD  1 
ATOM   4912  O OE1 . GLN G  1 118 ? 10.566  122.243 28.382  1.00 67.45  ? 264  GLN E OE1 1 
ATOM   4913  N NE2 . GLN G  1 118 ? 9.758   123.227 30.241  1.00 75.58  ? 264  GLN E NE2 1 
ATOM   4914  N N   . PHE G  1 119 ? 14.362  125.601 26.610  1.00 42.52  ? 265  PHE E N   1 
ATOM   4915  C CA  . PHE G  1 119 ? 14.668  126.851 25.964  1.00 29.21  ? 265  PHE E CA  1 
ATOM   4916  C C   . PHE G  1 119 ? 15.283  126.789 24.583  1.00 36.55  ? 265  PHE E C   1 
ATOM   4917  O O   . PHE G  1 119 ? 16.029  127.688 24.187  1.00 35.81  ? 265  PHE E O   1 
ATOM   4918  C CB  . PHE G  1 119 ? 15.535  127.663 26.899  1.00 30.74  ? 265  PHE E CB  1 
ATOM   4919  C CG  . PHE G  1 119 ? 14.933  127.826 28.261  1.00 45.83  ? 265  PHE E CG  1 
ATOM   4920  C CD1 . PHE G  1 119 ? 14.978  126.786 29.180  1.00 44.84  ? 265  PHE E CD1 1 
ATOM   4921  C CD2 . PHE G  1 119 ? 14.240  128.989 28.599  1.00 46.34  ? 265  PHE E CD2 1 
ATOM   4922  C CE1 . PHE G  1 119 ? 14.337  126.892 30.417  1.00 52.87  ? 265  PHE E CE1 1 
ATOM   4923  C CE2 . PHE G  1 119 ? 13.598  129.106 29.824  1.00 48.55  ? 265  PHE E CE2 1 
ATOM   4924  C CZ  . PHE G  1 119 ? 13.644  128.052 30.739  1.00 57.06  ? 265  PHE E CZ  1 
ATOM   4925  N N   . THR G  1 120 ? 14.943  125.750 23.825  1.00 40.03  ? 266  THR E N   1 
ATOM   4926  C CA  . THR G  1 120 ? 15.455  125.623 22.463  1.00 45.87  ? 266  THR E CA  1 
ATOM   4927  C C   . THR G  1 120 ? 14.900  126.787 21.645  1.00 49.01  ? 266  THR E C   1 
ATOM   4928  O O   . THR G  1 120 ? 14.253  127.692 22.190  1.00 54.75  ? 266  THR E O   1 
ATOM   4929  C CB  . THR G  1 120 ? 14.995  124.320 21.818  1.00 47.04  ? 266  THR E CB  1 
ATOM   4930  O OG1 . THR G  1 120 ? 13.613  124.424 21.454  1.00 60.74  ? 266  THR E OG1 1 
ATOM   4931  C CG2 . THR G  1 120 ? 15.124  123.190 22.799  1.00 53.05  ? 266  THR E CG2 1 
ATOM   4932  N N   . GLY G  1 121 ? 15.143  126.765 20.338  1.00 48.01  ? 267  GLY E N   1 
ATOM   4933  C CA  . GLY G  1 121 ? 14.658  127.839 19.483  1.00 47.68  ? 267  GLY E CA  1 
ATOM   4934  C C   . GLY G  1 121 ? 13.154  127.817 19.339  1.00 49.70  ? 267  GLY E C   1 
ATOM   4935  O O   . GLY G  1 121 ? 12.498  128.848 19.421  1.00 53.50  ? 267  GLY E O   1 
ATOM   4936  N N   . LEU G  1 122 ? 12.604  126.631 19.118  1.00 47.27  ? 268  LEU E N   1 
ATOM   4937  C CA  . LEU G  1 122 ? 11.172  126.481 18.971  1.00 46.87  ? 268  LEU E CA  1 
ATOM   4938  C C   . LEU G  1 122 ? 10.507  126.798 20.301  1.00 48.53  ? 268  LEU E C   1 
ATOM   4939  O O   . LEU G  1 122 ? 9.697   127.707 20.400  1.00 55.39  ? 268  LEU E O   1 
ATOM   4940  C CB  . LEU G  1 122 ? 10.846  125.055 18.544  1.00 43.20  ? 268  LEU E CB  1 
ATOM   4941  C CG  . LEU G  1 122 ? 11.634  124.551 17.335  1.00 50.12  ? 268  LEU E CG  1 
ATOM   4942  C CD1 . LEU G  1 122 ? 11.037  123.214 16.901  1.00 58.14  ? 268  LEU E CD1 1 
ATOM   4943  C CD2 . LEU G  1 122 ? 11.598  125.566 16.174  1.00 18.80  ? 268  LEU E CD2 1 
ATOM   4944  N N   . LYS G  1 123 ? 10.874  126.045 21.325  1.00 50.95  ? 269  LYS E N   1 
ATOM   4945  C CA  . LYS G  1 123 ? 10.337  126.217 22.660  1.00 49.59  ? 269  LYS E CA  1 
ATOM   4946  C C   . LYS G  1 123 ? 10.254  127.668 23.160  1.00 47.59  ? 269  LYS E C   1 
ATOM   4947  O O   . LYS G  1 123 ? 9.365   128.001 23.942  1.00 41.47  ? 269  LYS E O   1 
ATOM   4948  C CB  . LYS G  1 123 ? 11.170  125.388 23.642  1.00 57.35  ? 269  LYS E CB  1 
ATOM   4949  C CG  . LYS G  1 123 ? 10.885  123.882 23.628  1.00 69.02  ? 269  LYS E CG  1 
ATOM   4950  C CD  . LYS G  1 123 ? 9.621   123.547 24.423  1.00 71.07  ? 269  LYS E CD  1 
ATOM   4951  C CE  . LYS G  1 123 ? 9.516   122.057 24.749  1.00 79.36  ? 269  LYS E CE  1 
ATOM   4952  N NZ  . LYS G  1 123 ? 8.451   121.793 25.768  1.00 79.43  ? 269  LYS E NZ  1 
ATOM   4953  N N   . CYS G  1 124 ? 11.168  128.533 22.723  1.00 43.13  ? 270  CYS E N   1 
ATOM   4954  C CA  . CYS G  1 124 ? 11.163  129.923 23.187  1.00 37.92  ? 270  CYS E CA  1 
ATOM   4955  C C   . CYS G  1 124 ? 11.832  130.881 22.199  1.00 34.95  ? 270  CYS E C   1 
ATOM   4956  O O   . CYS G  1 124 ? 12.920  131.390 22.434  1.00 36.19  ? 270  CYS E O   1 
ATOM   4957  C CB  . CYS G  1 124 ? 11.845  129.978 24.552  1.00 34.61  ? 270  CYS E CB  1 
ATOM   4958  S SG  . CYS G  1 124 ? 12.274  131.612 25.201  1.00 42.19  ? 270  CYS E SG  1 
ATOM   4959  N N   . PRO G  1 125 ? 11.148  131.179 21.094  1.00 37.09  ? 271  PRO E N   1 
ATOM   4960  C CA  . PRO G  1 125 ? 11.667  132.068 20.044  1.00 37.08  ? 271  PRO E CA  1 
ATOM   4961  C C   . PRO G  1 125 ? 12.222  133.408 20.483  1.00 37.94  ? 271  PRO E C   1 
ATOM   4962  O O   . PRO G  1 125 ? 13.079  133.969 19.814  1.00 36.02  ? 271  PRO E O   1 
ATOM   4963  C CB  . PRO G  1 125 ? 10.488  132.204 19.095  1.00 36.19  ? 271  PRO E CB  1 
ATOM   4964  C CG  . PRO G  1 125 ? 9.745   130.882 19.273  1.00 35.74  ? 271  PRO E CG  1 
ATOM   4965  C CD  . PRO G  1 125 ? 9.791   130.700 20.771  1.00 30.05  ? 271  PRO E CD  1 
ATOM   4966  N N   . SER G  1 126 ? 11.737  133.925 21.604  1.00 42.36  ? 272  SER E N   1 
ATOM   4967  C CA  . SER G  1 126 ? 12.202  135.216 22.105  1.00 37.99  ? 272  SER E CA  1 
ATOM   4968  C C   . SER G  1 126 ? 13.685  135.157 22.443  1.00 44.35  ? 272  SER E C   1 
ATOM   4969  O O   . SER G  1 126 ? 14.342  136.195 22.527  1.00 52.35  ? 272  SER E O   1 
ATOM   4970  C CB  . SER G  1 126 ? 11.408  135.613 23.357  1.00 41.73  ? 272  SER E CB  1 
ATOM   4971  O OG  . SER G  1 126 ? 10.295  134.739 23.560  1.00 48.90  ? 272  SER E OG  1 
ATOM   4972  N N   . LEU G  1 127 ? 14.216  133.948 22.646  1.00 41.56  ? 273  LEU E N   1 
ATOM   4973  C CA  . LEU G  1 127 ? 15.630  133.803 22.991  1.00 37.88  ? 273  LEU E CA  1 
ATOM   4974  C C   . LEU G  1 127 ? 16.496  133.334 21.832  1.00 37.09  ? 273  LEU E C   1 
ATOM   4975  O O   . LEU G  1 127 ? 17.711  133.354 21.928  1.00 42.65  ? 273  LEU E O   1 
ATOM   4976  C CB  . LEU G  1 127 ? 15.784  132.865 24.196  1.00 31.33  ? 273  LEU E CB  1 
ATOM   4977  C CG  . LEU G  1 127 ? 15.404  133.518 25.519  1.00 24.60  ? 273  LEU E CG  1 
ATOM   4978  C CD1 . LEU G  1 127 ? 15.404  132.522 26.650  1.00 27.95  ? 273  LEU E CD1 1 
ATOM   4979  C CD2 . LEU G  1 127 ? 16.397  134.611 25.806  1.00 28.39  ? 273  LEU E CD2 1 
ATOM   4980  N N   . ALA G  1 128 ? 15.867  132.926 20.731  1.00 38.81  ? 274  ALA E N   1 
ATOM   4981  C CA  . ALA G  1 128 ? 16.588  132.456 19.545  1.00 37.57  ? 274  ALA E CA  1 
ATOM   4982  C C   . ALA G  1 128 ? 17.790  133.327 19.200  1.00 41.37  ? 274  ALA E C   1 
ATOM   4983  O O   . ALA G  1 128 ? 17.657  134.525 18.984  1.00 39.42  ? 274  ALA E O   1 
ATOM   4984  C CB  . ALA G  1 128 ? 15.659  132.402 18.364  1.00 34.32  ? 274  ALA E CB  1 
ATOM   4985  N N   . GLY G  1 129 ? 18.966  132.714 19.152  1.00 47.64  ? 275  GLY E N   1 
ATOM   4986  C CA  . GLY G  1 129 ? 20.165  133.458 18.816  1.00 48.47  ? 275  GLY E CA  1 
ATOM   4987  C C   . GLY G  1 129 ? 20.737  134.229 19.990  1.00 47.19  ? 275  GLY E C   1 
ATOM   4988  O O   . GLY G  1 129 ? 21.588  135.103 19.817  1.00 50.09  ? 275  GLY E O   1 
ATOM   4989  N N   . LYS G  1 130 ? 20.275  133.910 21.190  1.00 42.40  ? 276  LYS E N   1 
ATOM   4990  C CA  . LYS G  1 130 ? 20.771  134.580 22.379  1.00 42.06  ? 276  LYS E CA  1 
ATOM   4991  C C   . LYS G  1 130 ? 21.292  133.560 23.366  1.00 41.36  ? 276  LYS E C   1 
ATOM   4992  O O   . LYS G  1 130 ? 20.689  132.506 23.602  1.00 36.19  ? 276  LYS E O   1 
ATOM   4993  C CB  . LYS G  1 130 ? 19.666  135.411 23.035  1.00 56.68  ? 276  LYS E CB  1 
ATOM   4994  C CG  . LYS G  1 130 ? 19.141  136.556 22.180  1.00 60.80  ? 276  LYS E CG  1 
ATOM   4995  C CD  . LYS G  1 130 ? 17.917  137.191 22.815  1.00 67.92  ? 276  LYS E CD  1 
ATOM   4996  C CE  . LYS G  1 130 ? 17.408  138.386 22.000  1.00 65.91  ? 276  LYS E CE  1 
ATOM   4997  N NZ  . LYS G  1 130 ? 16.045  138.842 22.428  1.00 55.73  ? 276  LYS E NZ  1 
ATOM   4998  N N   . PRO G  1 131 ? 22.431  133.864 23.976  1.00 45.42  ? 277  PRO E N   1 
ATOM   4999  C CA  . PRO G  1 131 ? 23.013  132.939 24.937  1.00 47.96  ? 277  PRO E CA  1 
ATOM   5000  C C   . PRO G  1 131 ? 22.073  132.492 26.030  1.00 46.57  ? 277  PRO E C   1 
ATOM   5001  O O   . PRO G  1 131 ? 21.492  133.316 26.728  1.00 47.33  ? 277  PRO E O   1 
ATOM   5002  C CB  . PRO G  1 131 ? 24.208  133.720 25.483  1.00 49.77  ? 277  PRO E CB  1 
ATOM   5003  C CG  . PRO G  1 131 ? 23.759  135.132 25.363  1.00 49.34  ? 277  PRO E CG  1 
ATOM   5004  C CD  . PRO G  1 131 ? 23.168  135.131 23.977  1.00 44.79  ? 277  PRO E CD  1 
ATOM   5005  N N   . LYS G  1 132 ? 21.927  131.179 26.155  1.00 43.86  ? 278  LYS E N   1 
ATOM   5006  C CA  . LYS G  1 132 ? 21.117  130.583 27.206  1.00 46.56  ? 278  LYS E CA  1 
ATOM   5007  C C   . LYS G  1 132 ? 22.104  129.788 28.093  1.00 48.58  ? 278  LYS E C   1 
ATOM   5008  O O   . LYS G  1 132 ? 22.565  128.716 27.713  1.00 57.34  ? 278  LYS E O   1 
ATOM   5009  C CB  . LYS G  1 132 ? 20.058  129.684 26.584  1.00 40.80  ? 278  LYS E CB  1 
ATOM   5010  C CG  . LYS G  1 132 ? 19.146  130.452 25.665  1.00 43.55  ? 278  LYS E CG  1 
ATOM   5011  C CD  . LYS G  1 132 ? 18.292  129.532 24.819  1.00 49.67  ? 278  LYS E CD  1 
ATOM   5012  C CE  . LYS G  1 132 ? 18.924  129.290 23.449  1.00 45.75  ? 278  LYS E CE  1 
ATOM   5013  N NZ  . LYS G  1 132 ? 19.091  130.562 22.680  1.00 44.05  ? 278  LYS E NZ  1 
ATOM   5014  N N   . VAL G  1 133 ? 22.430  130.336 29.265  1.00 39.46  ? 279  VAL E N   1 
ATOM   5015  C CA  . VAL G  1 133 ? 23.378  129.744 30.189  1.00 33.14  ? 279  VAL E CA  1 
ATOM   5016  C C   . VAL G  1 133 ? 22.803  128.985 31.364  1.00 37.05  ? 279  VAL E C   1 
ATOM   5017  O O   . VAL G  1 133 ? 21.956  129.500 32.053  1.00 41.03  ? 279  VAL E O   1 
ATOM   5018  C CB  . VAL G  1 133 ? 24.255  130.823 30.789  1.00 30.73  ? 279  VAL E CB  1 
ATOM   5019  C CG1 . VAL G  1 133 ? 25.327  130.190 31.639  1.00 45.48  ? 279  VAL E CG1 1 
ATOM   5020  C CG2 . VAL G  1 133 ? 24.877  131.680 29.684  1.00 36.84  ? 279  VAL E CG2 1 
ATOM   5021  N N   . PHE G  1 134 ? 23.264  127.762 31.605  1.00 41.08  ? 280  PHE E N   1 
ATOM   5022  C CA  . PHE G  1 134 ? 22.800  127.011 32.775  1.00 45.85  ? 280  PHE E CA  1 
ATOM   5023  C C   . PHE G  1 134 ? 23.977  126.567 33.631  1.00 50.70  ? 280  PHE E C   1 
ATOM   5024  O O   . PHE G  1 134 ? 24.881  125.895 33.152  1.00 53.62  ? 280  PHE E O   1 
ATOM   5025  C CB  . PHE G  1 134 ? 22.040  125.750 32.415  1.00 39.17  ? 280  PHE E CB  1 
ATOM   5026  C CG  . PHE G  1 134 ? 20.731  125.994 31.783  1.00 46.73  ? 280  PHE E CG  1 
ATOM   5027  C CD1 . PHE G  1 134 ? 20.647  126.545 30.504  1.00 51.28  ? 280  PHE E CD1 1 
ATOM   5028  C CD2 . PHE G  1 134 ? 19.566  125.601 32.431  1.00 43.38  ? 280  PHE E CD2 1 
ATOM   5029  C CE1 . PHE G  1 134 ? 19.411  126.686 29.881  1.00 50.28  ? 280  PHE E CE1 1 
ATOM   5030  C CE2 . PHE G  1 134 ? 18.321  125.736 31.824  1.00 35.61  ? 280  PHE E CE2 1 
ATOM   5031  C CZ  . PHE G  1 134 ? 18.238  126.274 30.549  1.00 42.15  ? 280  PHE E CZ  1 
ATOM   5032  N N   . PHE G  1 135 ? 23.966  126.948 34.900  1.00 49.22  ? 281  PHE E N   1 
ATOM   5033  C CA  . PHE G  1 135 ? 25.010  126.536 35.811  1.00 41.16  ? 281  PHE E CA  1 
ATOM   5034  C C   . PHE G  1 135 ? 24.354  125.546 36.740  1.00 45.39  ? 281  PHE E C   1 
ATOM   5035  O O   . PHE G  1 135 ? 23.400  125.876 37.420  1.00 52.95  ? 281  PHE E O   1 
ATOM   5036  C CB  . PHE G  1 135 ? 25.538  127.716 36.609  1.00 31.36  ? 281  PHE E CB  1 
ATOM   5037  C CG  . PHE G  1 135 ? 26.323  128.685 35.792  1.00 26.29  ? 281  PHE E CG  1 
ATOM   5038  C CD1 . PHE G  1 135 ? 27.531  128.325 35.250  1.00 27.66  ? 281  PHE E CD1 1 
ATOM   5039  C CD2 . PHE G  1 135 ? 25.856  129.955 35.565  1.00 28.48  ? 281  PHE E CD2 1 
ATOM   5040  C CE1 . PHE G  1 135 ? 28.274  129.228 34.487  1.00 35.93  ? 281  PHE E CE1 1 
ATOM   5041  C CE2 . PHE G  1 135 ? 26.583  130.868 34.805  1.00 32.24  ? 281  PHE E CE2 1 
ATOM   5042  C CZ  . PHE G  1 135 ? 27.795  130.504 34.267  1.00 35.52  ? 281  PHE E CZ  1 
ATOM   5043  N N   . ILE G  1 136 ? 24.845  124.319 36.766  1.00 48.41  ? 282  ILE E N   1 
ATOM   5044  C CA  . ILE G  1 136 ? 24.261  123.332 37.638  1.00 45.79  ? 282  ILE E CA  1 
ATOM   5045  C C   . ILE G  1 136 ? 25.277  122.884 38.663  1.00 53.63  ? 282  ILE E C   1 
ATOM   5046  O O   . ILE G  1 136 ? 26.316  122.341 38.303  1.00 60.09  ? 282  ILE E O   1 
ATOM   5047  C CB  . ILE G  1 136 ? 23.804  122.124 36.855  1.00 45.54  ? 282  ILE E CB  1 
ATOM   5048  C CG1 . ILE G  1 136 ? 22.615  122.517 35.985  1.00 50.05  ? 282  ILE E CG1 1 
ATOM   5049  C CG2 . ILE G  1 136 ? 23.448  120.979 37.807  1.00 42.77  ? 282  ILE E CG2 1 
ATOM   5050  C CD1 . ILE G  1 136 ? 21.983  121.339 35.270  1.00 51.55  ? 282  ILE E CD1 1 
ATOM   5051  N N   . GLN G  1 137 ? 24.973  123.125 39.939  1.00 56.16  ? 283  GLN E N   1 
ATOM   5052  C CA  . GLN G  1 137 ? 25.833  122.739 41.059  1.00 50.40  ? 283  GLN E CA  1 
ATOM   5053  C C   . GLN G  1 137 ? 25.130  121.628 41.840  1.00 48.93  ? 283  GLN E C   1 
ATOM   5054  O O   . GLN G  1 137 ? 24.183  121.862 42.583  1.00 53.55  ? 283  GLN E O   1 
ATOM   5055  C CB  . GLN G  1 137 ? 26.118  123.964 41.952  1.00 48.73  ? 283  GLN E CB  1 
ATOM   5056  C CG  . GLN G  1 137 ? 26.577  123.664 43.372  1.00 52.26  ? 283  GLN E CG  1 
ATOM   5057  C CD  . GLN G  1 137 ? 27.829  122.786 43.453  1.00 60.05  ? 283  GLN E CD  1 
ATOM   5058  O OE1 . GLN G  1 137 ? 28.903  123.140 42.935  1.00 52.67  ? 283  GLN E OE1 1 
ATOM   5059  N NE2 . GLN G  1 137 ? 27.697  121.638 44.125  1.00 54.44  ? 283  GLN E NE2 1 
ATOM   5060  N N   . ALA G  1 138 ? 25.601  120.409 41.648  1.00 50.50  ? 284  ALA E N   1 
ATOM   5061  C CA  . ALA G  1 138 ? 25.038  119.242 42.314  1.00 58.74  ? 284  ALA E CA  1 
ATOM   5062  C C   . ALA G  1 138 ? 25.960  118.055 42.063  1.00 65.13  ? 284  ALA E C   1 
ATOM   5063  O O   . ALA G  1 138 ? 26.956  118.169 41.346  1.00 68.38  ? 284  ALA E O   1 
ATOM   5064  C CB  . ALA G  1 138 ? 23.654  118.935 41.758  1.00 48.21  ? 284  ALA E CB  1 
ATOM   5065  N N   . CYS G  1 139 ? 25.637  116.913 42.654  1.00 68.81  ? 285  CYS E N   1 
ATOM   5066  C CA  . CYS G  1 139 ? 26.450  115.733 42.423  1.00 69.62  ? 285  CYS E CA  1 
ATOM   5067  C C   . CYS G  1 139 ? 25.904  115.075 41.181  1.00 67.42  ? 285  CYS E C   1 
ATOM   5068  O O   . CYS G  1 139 ? 24.749  115.283 40.814  1.00 64.83  ? 285  CYS E O   1 
ATOM   5069  C CB  . CYS G  1 139 ? 26.346  114.754 43.584  1.00 73.64  ? 285  CYS E CB  1 
ATOM   5070  S SG  . CYS G  1 139 ? 27.135  115.362 45.104  1.00 91.52  ? 285  CYS E SG  1 
ATOM   5071  N N   . GLN G  1 140 ? 26.745  114.280 40.539  1.00 68.62  ? 286  GLN E N   1 
ATOM   5072  C CA  . GLN G  1 140 ? 26.355  113.557 39.339  1.00 66.88  ? 286  GLN E CA  1 
ATOM   5073  C C   . GLN G  1 140 ? 26.663  112.081 39.551  1.00 70.31  ? 286  GLN E C   1 
ATOM   5074  O O   . GLN G  1 140 ? 26.770  111.307 38.608  1.00 73.97  ? 286  GLN E O   1 
ATOM   5075  C CB  . GLN G  1 140 ? 27.131  114.097 38.143  1.00 63.54  ? 286  GLN E CB  1 
ATOM   5076  C CG  . GLN G  1 140 ? 26.578  115.401 37.578  1.00 54.15  ? 286  GLN E CG  1 
ATOM   5077  C CD  . GLN G  1 140 ? 25.153  115.247 37.118  1.00 55.51  ? 286  GLN E CD  1 
ATOM   5078  O OE1 . GLN G  1 140 ? 24.220  115.593 37.844  1.00 67.05  ? 286  GLN E OE1 1 
ATOM   5079  N NE2 . GLN G  1 140 ? 24.967  114.696 35.916  1.00 49.28  ? 286  GLN E NE2 1 
ATOM   5080  N N   . GLY G  1 141 ? 26.802  111.706 40.815  1.00 75.21  ? 287  GLY E N   1 
ATOM   5081  C CA  . GLY G  1 141 ? 27.107  110.336 41.176  1.00 74.94  ? 287  GLY E CA  1 
ATOM   5082  C C   . GLY G  1 141 ? 27.726  110.325 42.557  1.00 76.74  ? 287  GLY E C   1 
ATOM   5083  O O   . GLY G  1 141 ? 27.998  111.381 43.135  1.00 79.27  ? 287  GLY E O   1 
ATOM   5084  N N   . ASP G  1 142 ? 27.965  109.133 43.085  1.00 78.57  ? 288  ASP E N   1 
ATOM   5085  C CA  . ASP G  1 142 ? 28.538  108.993 44.416  1.00 81.71  ? 288  ASP E CA  1 
ATOM   5086  C C   . ASP G  1 142 ? 30.024  108.641 44.408  1.00 80.18  ? 288  ASP E C   1 
ATOM   5087  O O   . ASP G  1 142 ? 30.590  108.315 45.446  1.00 87.99  ? 288  ASP E O   1 
ATOM   5088  C CB  . ASP G  1 142 ? 27.770  107.926 45.189  1.00 82.00  ? 288  ASP E CB  1 
ATOM   5089  C CG  . ASP G  1 142 ? 27.699  106.624 44.441  1.00 83.03  ? 288  ASP E CG  1 
ATOM   5090  O OD1 . ASP G  1 142 ? 27.141  106.611 43.326  1.00 92.09  ? 288  ASP E OD1 1 
ATOM   5091  O OD2 . ASP G  1 142 ? 28.204  105.615 44.962  1.00 89.06  ? 288  ASP E OD2 1 
ATOM   5092  N N   . ASN G  1 143 ? 30.662  108.711 43.249  1.00 74.77  ? 289  ASN E N   1 
ATOM   5093  C CA  . ASN G  1 143 ? 32.078  108.386 43.165  1.00 70.90  ? 289  ASN E CA  1 
ATOM   5094  C C   . ASN G  1 143 ? 32.951  109.592 43.425  1.00 71.50  ? 289  ASN E C   1 
ATOM   5095  O O   . ASN G  1 143 ? 32.549  110.736 43.203  1.00 67.08  ? 289  ASN E O   1 
ATOM   5096  C CB  . ASN G  1 143 ? 32.425  107.828 41.792  1.00 73.59  ? 289  ASN E CB  1 
ATOM   5097  C CG  . ASN G  1 143 ? 31.637  106.584 41.460  1.00 76.56  ? 289  ASN E CG  1 
ATOM   5098  O OD1 . ASN G  1 143 ? 30.867  106.085 42.281  1.00 81.63  ? 289  ASN E OD1 1 
ATOM   5099  N ND2 . ASN G  1 143 ? 31.824  106.072 40.252  1.00 81.65  ? 289  ASN E ND2 1 
ATOM   5100  N N   . TYR G  1 144 ? 34.160  109.321 43.893  1.00 72.80  ? 290  TYR E N   1 
ATOM   5101  C CA  . TYR G  1 144 ? 35.105  110.383 44.186  1.00 73.89  ? 290  TYR E CA  1 
ATOM   5102  C C   . TYR G  1 144 ? 36.119  110.494 43.073  1.00 67.94  ? 290  TYR E C   1 
ATOM   5103  O O   . TYR G  1 144 ? 36.765  109.525 42.714  1.00 65.43  ? 290  TYR E O   1 
ATOM   5104  C CB  . TYR G  1 144 ? 35.847  110.120 45.503  1.00 74.24  ? 290  TYR E CB  1 
ATOM   5105  C CG  . TYR G  1 144 ? 35.007  110.249 46.750  1.00 78.40  ? 290  TYR E CG  1 
ATOM   5106  C CD1 . TYR G  1 144 ? 34.294  109.153 47.259  1.00 82.31  ? 290  TYR E CD1 1 
ATOM   5107  C CD2 . TYR G  1 144 ? 34.958  111.459 47.452  1.00 80.17  ? 290  TYR E CD2 1 
ATOM   5108  C CE1 . TYR G  1 144 ? 33.557  109.260 48.453  1.00 88.48  ? 290  TYR E CE1 1 
ATOM   5109  C CE2 . TYR G  1 144 ? 34.228  111.582 48.641  1.00 88.64  ? 290  TYR E CE2 1 
ATOM   5110  C CZ  . TYR G  1 144 ? 33.532  110.480 49.140  1.00 92.35  ? 290  TYR E CZ  1 
ATOM   5111  O OH  . TYR G  1 144 ? 32.836  110.605 50.328  1.00 89.63  ? 290  TYR E OH  1 
ATOM   5112  N N   . GLN G  1 145 ? 36.250  111.684 42.519  1.00 70.39  ? 291  GLN E N   1 
ATOM   5113  C CA  . GLN G  1 145 ? 37.222  111.895 41.465  1.00 69.09  ? 291  GLN E CA  1 
ATOM   5114  C C   . GLN G  1 145 ? 38.579  111.759 42.156  1.00 70.52  ? 291  GLN E C   1 
ATOM   5115  O O   . GLN G  1 145 ? 38.874  112.497 43.104  1.00 74.11  ? 291  GLN E O   1 
ATOM   5116  C CB  . GLN G  1 145 ? 37.051  113.301 40.871  1.00 66.28  ? 291  GLN E CB  1 
ATOM   5117  C CG  . GLN G  1 145 ? 38.029  113.675 39.763  1.00 64.58  ? 291  GLN E CG  1 
ATOM   5118  C CD  . GLN G  1 145 ? 37.802  112.894 38.471  1.00 72.59  ? 291  GLN E CD  1 
ATOM   5119  O OE1 . GLN G  1 145 ? 36.827  112.143 38.331  1.00 71.94  ? 291  GLN E OE1 1 
ATOM   5120  N NE2 . GLN G  1 145 ? 38.703  113.078 37.516  1.00 71.60  ? 291  GLN E NE2 1 
ATOM   5121  N N   . LYS G  1 146 ? 39.390  110.808 41.695  1.00 69.28  ? 292  LYS E N   1 
ATOM   5122  C CA  . LYS G  1 146 ? 40.701  110.582 42.282  1.00 66.60  ? 292  LYS E CA  1 
ATOM   5123  C C   . LYS G  1 146 ? 41.704  111.587 41.742  1.00 68.11  ? 292  LYS E C   1 
ATOM   5124  O O   . LYS G  1 146 ? 41.534  112.128 40.650  1.00 68.03  ? 292  LYS E O   1 
ATOM   5125  C CB  . LYS G  1 146 ? 41.167  109.159 41.993  1.00 67.82  ? 292  LYS E CB  1 
ATOM   5126  C CG  . LYS G  1 146 ? 40.141  108.081 42.356  1.00 64.97  ? 292  LYS E CG  1 
ATOM   5127  C CD  . LYS G  1 146 ? 40.684  106.690 42.077  1.00 73.91  ? 292  LYS E CD  1 
ATOM   5128  C CE  . LYS G  1 146 ? 39.577  105.683 41.808  1.00 85.04  ? 292  LYS E CE  1 
ATOM   5129  N NZ  . LYS G  1 146 ? 38.814  105.967 40.544  1.00 90.12  ? 292  LYS E NZ  1 
ATOM   5130  N N   . GLY G  1 147 ? 42.743  111.850 42.526  1.00 71.22  ? 293  GLY E N   1 
ATOM   5131  C CA  . GLY G  1 147 ? 43.756  112.800 42.105  1.00 75.27  ? 293  GLY E CA  1 
ATOM   5132  C C   . GLY G  1 147 ? 45.001  112.107 41.573  1.00 78.58  ? 293  GLY E C   1 
ATOM   5133  O O   . GLY G  1 147 ? 45.299  110.954 41.929  1.00 79.10  ? 293  GLY E O   1 
ATOM   5134  N N   . ILE G  1 148 ? 45.723  112.809 40.705  1.00 73.54  ? 294  ILE E N   1 
ATOM   5135  C CA  . ILE G  1 148 ? 46.945  112.281 40.116  1.00 67.70  ? 294  ILE E CA  1 
ATOM   5136  C C   . ILE G  1 148 ? 48.007  113.375 40.224  1.00 70.98  ? 294  ILE E C   1 
ATOM   5137  O O   . ILE G  1 148 ? 47.727  114.561 40.047  1.00 74.08  ? 294  ILE E O   1 
ATOM   5138  C CB  . ILE G  1 148 ? 46.745  111.901 38.631  1.00 58.74  ? 294  ILE E CB  1 
ATOM   5139  C CG1 . ILE G  1 148 ? 46.633  113.176 37.784  1.00 57.39  ? 294  ILE E CG1 1 
ATOM   5140  C CG2 . ILE G  1 148 ? 45.505  111.031 38.488  1.00 35.75  ? 294  ILE E CG2 1 
ATOM   5141  C CD1 . ILE G  1 148 ? 46.479  112.943 36.306  1.00 68.92  ? 294  ILE E CD1 1 
ATOM   5142  N N   . PRO G  1 149 ? 49.245  112.984 40.513  1.00 70.42  ? 295  PRO E N   1 
ATOM   5143  C CA  . PRO G  1 149 ? 50.371  113.910 40.658  1.00 67.90  ? 295  PRO E CA  1 
ATOM   5144  C C   . PRO G  1 149 ? 50.961  114.441 39.358  1.00 67.51  ? 295  PRO E C   1 
ATOM   5145  O O   . PRO G  1 149 ? 51.018  113.731 38.358  1.00 67.03  ? 295  PRO E O   1 
ATOM   5146  C CB  . PRO G  1 149 ? 51.375  113.074 41.423  1.00 69.93  ? 295  PRO E CB  1 
ATOM   5147  C CG  . PRO G  1 149 ? 51.171  111.715 40.796  1.00 66.41  ? 295  PRO E CG  1 
ATOM   5148  C CD  . PRO G  1 149 ? 49.664  111.595 40.778  1.00 65.55  ? 295  PRO E CD  1 
ATOM   5149  N N   . VAL G  1 150 ? 51.418  115.686 39.383  1.00 66.22  ? 296  VAL E N   1 
ATOM   5150  C CA  . VAL G  1 150 ? 52.032  116.286 38.208  1.00 70.11  ? 296  VAL E CA  1 
ATOM   5151  C C   . VAL G  1 150 ? 52.957  117.403 38.634  1.00 74.33  ? 296  VAL E C   1 
ATOM   5152  O O   . VAL G  1 150 ? 53.169  117.623 39.825  1.00 70.84  ? 296  VAL E O   1 
ATOM   5153  C CB  . VAL G  1 150 ? 50.991  116.904 37.264  1.00 72.87  ? 296  VAL E CB  1 
ATOM   5154  C CG1 . VAL G  1 150 ? 50.087  115.829 36.720  1.00 73.90  ? 296  VAL E CG1 1 
ATOM   5155  C CG2 . VAL G  1 150 ? 50.180  117.965 38.001  1.00 70.96  ? 296  VAL E CG2 1 
ATOM   5156  N N   . GLU G  1 151 ? 53.466  118.131 37.641  1.00 83.04  ? 297  GLU E N   1 
ATOM   5157  C CA  . GLU G  1 151 ? 54.348  119.263 37.890  1.00 89.30  ? 297  GLU E CA  1 
ATOM   5158  C C   . GLU G  1 151 ? 53.675  120.638 37.675  1.00 96.12  ? 297  GLU E C   1 
ATOM   5159  O O   . GLU G  1 151 ? 52.838  120.804 36.779  1.00 98.27  ? 297  GLU E O   1 
ATOM   5160  C CB  . GLU G  1 151 ? 55.595  119.167 37.023  1.00 88.33  ? 297  GLU E CB  1 
ATOM   5161  C CG  . GLU G  1 151 ? 56.616  120.233 37.370  1.00 97.31  ? 297  GLU E CG  1 
ATOM   5162  C CD  . GLU G  1 151 ? 57.043  120.199 38.851  1.00 100.00 ? 297  GLU E CD  1 
ATOM   5163  O OE1 . GLU G  1 151 ? 56.166  120.259 39.754  1.00 100.00 ? 297  GLU E OE1 1 
ATOM   5164  O OE2 . GLU G  1 151 ? 58.268  120.124 39.116  1.00 100.00 ? 297  GLU E OE2 1 
ATOM   5165  N N   . THR G  1 152 ? 54.075  121.598 38.519  1.00 100.00 ? 298  THR E N   1 
ATOM   5166  C CA  . THR G  1 152 ? 53.607  123.004 38.596  1.00 100.00 ? 298  THR E CA  1 
ATOM   5167  C C   . THR G  1 152 ? 53.138  123.826 37.368  1.00 100.00 ? 298  THR E C   1 
ATOM   5168  O O   . THR G  1 152 ? 53.960  124.368 36.612  1.00 100.00 ? 298  THR E O   1 
ATOM   5169  C CB  . THR G  1 152 ? 54.671  123.838 39.335  1.00 97.86  ? 298  THR E CB  1 
ATOM   5170  O OG1 . THR G  1 152 ? 54.784  123.363 40.686  1.00 97.96  ? 298  THR E OG1 1 
ATOM   5171  C CG2 . THR G  1 152 ? 54.312  125.316 39.319  1.00 95.48  ? 298  THR E CG2 1 
ATOM   5172  N N   . ASP G  1 153 ? 51.808  123.964 37.247  1.00 100.00 ? 299  ASP E N   1 
ATOM   5173  C CA  . ASP G  1 153 ? 51.098  124.685 36.168  1.00 99.37  ? 299  ASP E CA  1 
ATOM   5174  C C   . ASP G  1 153 ? 51.475  126.160 35.914  1.00 97.97  ? 299  ASP E C   1 
ATOM   5175  O O   . ASP G  1 153 ? 51.680  126.538 34.736  1.00 93.72  ? 299  ASP E O   1 
ATOM   5176  C CB  . ASP G  1 153 ? 49.591  124.599 36.433  1.00 99.45  ? 299  ASP E CB  1 
ATOM   5177  C CG  . ASP G  1 153 ? 49.062  123.162 36.396  1.00 100.00 ? 299  ASP E CG  1 
ATOM   5178  O OD1 . ASP G  1 153 ? 48.855  122.637 35.270  1.00 100.00 ? 299  ASP E OD1 1 
ATOM   5179  O OD2 . ASP G  1 153 ? 48.859  122.565 37.489  1.00 100.00 ? 299  ASP E OD2 1 
ATOM   5180  O OXT . ASP G  1 153 ? 51.533  126.935 36.889  1.00 98.01  ? 299  ASP E OXT 1 
ATOM   5181  N N   . THR H  2 1   ? 17.495  137.784 7.042   1.00 92.40  ? 318  THR F N   1 
ATOM   5182  C CA  . THR H  2 1   ? 17.419  136.777 8.158   1.00 97.00  ? 318  THR F CA  1 
ATOM   5183  C C   . THR H  2 1   ? 17.747  135.313 7.732   1.00 95.76  ? 318  THR F C   1 
ATOM   5184  O O   . THR H  2 1   ? 17.192  134.767 6.761   1.00 93.06  ? 318  THR F O   1 
ATOM   5185  C CB  . THR H  2 1   ? 16.000  136.838 8.878   1.00 98.01  ? 318  THR F CB  1 
ATOM   5186  O OG1 . THR H  2 1   ? 15.277  135.617 8.662   1.00 95.77  ? 318  THR F OG1 1 
ATOM   5187  C CG2 . THR H  2 1   ? 15.162  138.027 8.357   1.00 94.87  ? 318  THR F CG2 1 
ATOM   5188  N N   . ARG H  2 2   ? 18.669  134.688 8.460   1.00 89.80  ? 319  ARG F N   1 
ATOM   5189  C CA  . ARG H  2 2   ? 19.059  133.316 8.165   1.00 81.86  ? 319  ARG F CA  1 
ATOM   5190  C C   . ARG H  2 2   ? 18.617  132.392 9.310   1.00 79.71  ? 319  ARG F C   1 
ATOM   5191  O O   . ARG H  2 2   ? 17.976  132.822 10.276  1.00 77.74  ? 319  ARG F O   1 
ATOM   5192  C CB  . ARG H  2 2   ? 20.577  133.224 8.000   1.00 80.19  ? 319  ARG F CB  1 
ATOM   5193  C CG  . ARG H  2 2   ? 21.219  134.231 7.055   1.00 82.41  ? 319  ARG F CG  1 
ATOM   5194  C CD  . ARG H  2 2   ? 22.686  134.443 7.463   1.00 92.31  ? 319  ARG F CD  1 
ATOM   5195  N NE  . ARG H  2 2   ? 22.794  134.801 8.890   1.00 98.13  ? 319  ARG F NE  1 
ATOM   5196  C CZ  . ARG H  2 2   ? 23.932  134.868 9.590   1.00 94.11  ? 319  ARG F CZ  1 
ATOM   5197  N NH1 . ARG H  2 2   ? 25.097  134.604 9.003   1.00 91.77  ? 319  ARG F NH1 1 
ATOM   5198  N NH2 . ARG H  2 2   ? 23.905  135.188 10.887  1.00 78.01  ? 319  ARG F NH2 1 
ATOM   5199  N N   . TYR H  2 3   ? 18.980  131.120 9.189   1.00 76.64  ? 320  TYR F N   1 
ATOM   5200  C CA  . TYR H  2 3   ? 18.658  130.083 10.175  1.00 69.90  ? 320  TYR F CA  1 
ATOM   5201  C C   . TYR H  2 3   ? 19.847  129.525 10.953  1.00 62.66  ? 320  TYR F C   1 
ATOM   5202  O O   . TYR H  2 3   ? 20.955  129.425 10.437  1.00 62.55  ? 320  TYR F O   1 
ATOM   5203  C CB  . TYR H  2 3   ? 17.991  128.894 9.498   1.00 71.35  ? 320  TYR F CB  1 
ATOM   5204  C CG  . TYR H  2 3   ? 16.578  129.124 9.052   1.00 82.99  ? 320  TYR F CG  1 
ATOM   5205  C CD1 . TYR H  2 3   ? 16.022  130.396 9.045   1.00 89.18  ? 320  TYR F CD1 1 
ATOM   5206  C CD2 . TYR H  2 3   ? 15.788  128.060 8.640   1.00 89.71  ? 320  TYR F CD2 1 
ATOM   5207  C CE1 . TYR H  2 3   ? 14.714  130.603 8.641   1.00 93.32  ? 320  TYR F CE1 1 
ATOM   5208  C CE2 . TYR H  2 3   ? 14.480  128.255 8.235   1.00 94.91  ? 320  TYR F CE2 1 
ATOM   5209  C CZ  . TYR H  2 3   ? 13.949  129.529 8.239   1.00 93.28  ? 320  TYR F CZ  1 
ATOM   5210  O OH  . TYR H  2 3   ? 12.647  129.727 7.843   1.00 98.57  ? 320  TYR F OH  1 
ATOM   5211  N N   . ILE H  2 4   ? 19.599  129.160 12.203  1.00 52.60  ? 321  ILE F N   1 
ATOM   5212  C CA  . ILE H  2 4   ? 20.613  128.550 13.034  1.00 43.67  ? 321  ILE F CA  1 
ATOM   5213  C C   . ILE H  2 4   ? 19.900  127.364 13.652  1.00 45.31  ? 321  ILE F C   1 
ATOM   5214  O O   . ILE H  2 4   ? 18.676  127.339 13.700  1.00 31.73  ? 321  ILE F O   1 
ATOM   5215  C CB  . ILE H  2 4   ? 21.125  129.468 14.159  1.00 35.08  ? 321  ILE F CB  1 
ATOM   5216  C CG1 . ILE H  2 4   ? 20.023  129.767 15.152  1.00 36.69  ? 321  ILE F CG1 1 
ATOM   5217  C CG2 . ILE H  2 4   ? 21.693  130.711 13.584  1.00 38.87  ? 321  ILE F CG2 1 
ATOM   5218  C CD1 . ILE H  2 4   ? 20.486  130.621 16.319  1.00 40.76  ? 321  ILE F CD1 1 
ATOM   5219  N N   . PRO H  2 5   ? 20.655  126.344 14.100  1.00 50.34  ? 322  PRO F N   1 
ATOM   5220  C CA  . PRO H  2 5   ? 20.002  125.180 14.707  1.00 47.04  ? 322  PRO F CA  1 
ATOM   5221  C C   . PRO H  2 5   ? 19.213  125.408 15.994  1.00 44.11  ? 322  PRO F C   1 
ATOM   5222  O O   . PRO H  2 5   ? 19.556  126.253 16.820  1.00 48.16  ? 322  PRO F O   1 
ATOM   5223  C CB  . PRO H  2 5   ? 21.149  124.181 14.890  1.00 48.13  ? 322  PRO F CB  1 
ATOM   5224  C CG  . PRO H  2 5   ? 22.398  125.023 14.862  1.00 50.14  ? 322  PRO F CG  1 
ATOM   5225  C CD  . PRO H  2 5   ? 22.083  126.069 13.833  1.00 52.59  ? 322  PRO F CD  1 
ATOM   5226  N N   . ASP H  2 6   ? 18.145  124.626 16.130  1.00 36.44  ? 323  ASP F N   1 
ATOM   5227  C CA  . ASP H  2 6   ? 17.256  124.665 17.270  1.00 33.17  ? 323  ASP F CA  1 
ATOM   5228  C C   . ASP H  2 6   ? 18.007  124.733 18.592  1.00 38.38  ? 323  ASP F C   1 
ATOM   5229  O O   . ASP H  2 6   ? 17.673  125.557 19.455  1.00 39.48  ? 323  ASP F O   1 
ATOM   5230  C CB  . ASP H  2 6   ? 16.345  123.435 17.239  1.00 31.74  ? 323  ASP F CB  1 
ATOM   5231  C CG  . ASP H  2 6   ? 15.235  123.495 18.275  1.00 37.88  ? 323  ASP F CG  1 
ATOM   5232  O OD1 . ASP H  2 6   ? 14.803  124.604 18.612  1.00 51.14  ? 323  ASP F OD1 1 
ATOM   5233  O OD2 . ASP H  2 6   ? 14.773  122.439 18.752  1.00 45.10  ? 323  ASP F OD2 1 
ATOM   5234  N N   . GLU H  2 7   ? 19.033  123.892 18.738  1.00 37.42  ? 324  GLU F N   1 
ATOM   5235  C CA  . GLU H  2 7   ? 19.816  123.833 19.981  1.00 38.84  ? 324  GLU F CA  1 
ATOM   5236  C C   . GLU H  2 7   ? 21.079  124.709 20.048  1.00 38.00  ? 324  GLU F C   1 
ATOM   5237  O O   . GLU H  2 7   ? 21.981  124.465 20.859  1.00 34.23  ? 324  GLU F O   1 
ATOM   5238  C CB  . GLU H  2 7   ? 20.203  122.383 20.293  1.00 40.93  ? 324  GLU F CB  1 
ATOM   5239  C CG  . GLU H  2 7   ? 19.058  121.400 20.252  1.00 42.20  ? 324  GLU F CG  1 
ATOM   5240  C CD  . GLU H  2 7   ? 19.408  120.088 20.909  1.00 51.67  ? 324  GLU F CD  1 
ATOM   5241  O OE1 . GLU H  2 7   ? 20.264  120.088 21.825  1.00 55.47  ? 324  GLU F OE1 1 
ATOM   5242  O OE2 . GLU H  2 7   ? 18.820  119.056 20.516  1.00 61.13  ? 324  GLU F OE2 1 
ATOM   5243  N N   . ALA H  2 8   ? 21.147  125.732 19.208  1.00 30.32  ? 325  ALA F N   1 
ATOM   5244  C CA  . ALA H  2 8   ? 22.308  126.596 19.231  1.00 32.70  ? 325  ALA F CA  1 
ATOM   5245  C C   . ALA H  2 8   ? 22.354  127.499 20.489  1.00 35.01  ? 325  ALA F C   1 
ATOM   5246  O O   . ALA H  2 8   ? 21.448  127.510 21.329  1.00 24.93  ? 325  ALA F O   1 
ATOM   5247  C CB  . ALA H  2 8   ? 22.344  127.445 17.954  1.00 14.69  ? 325  ALA F CB  1 
ATOM   5248  N N   . ASP H  2 9   ? 23.449  128.241 20.605  1.00 41.04  ? 326  ASP F N   1 
ATOM   5249  C CA  . ASP H  2 9   ? 23.679  129.169 21.698  1.00 39.86  ? 326  ASP F CA  1 
ATOM   5250  C C   . ASP H  2 9   ? 23.383  128.713 23.126  1.00 42.74  ? 326  ASP F C   1 
ATOM   5251  O O   . ASP H  2 9   ? 22.730  129.423 23.875  1.00 47.00  ? 326  ASP F O   1 
ATOM   5252  C CB  . ASP H  2 9   ? 22.919  130.430 21.401  1.00 34.57  ? 326  ASP F CB  1 
ATOM   5253  C CG  . ASP H  2 9   ? 22.914  130.749 19.936  1.00 37.08  ? 326  ASP F CG  1 
ATOM   5254  O OD1 . ASP H  2 9   ? 23.943  131.175 19.400  1.00 34.95  ? 326  ASP F OD1 1 
ATOM   5255  O OD2 . ASP H  2 9   ? 21.868  130.555 19.302  1.00 44.72  ? 326  ASP F OD2 1 
ATOM   5256  N N   . PHE H  2 10  ? 23.871  127.541 23.506  1.00 42.49  ? 327  PHE F N   1 
ATOM   5257  C CA  . PHE H  2 10  ? 23.685  127.069 24.864  1.00 41.46  ? 327  PHE F CA  1 
ATOM   5258  C C   . PHE H  2 10  ? 25.039  126.984 25.546  1.00 43.79  ? 327  PHE F C   1 
ATOM   5259  O O   . PHE H  2 10  ? 26.086  126.841 24.890  1.00 42.91  ? 327  PHE F O   1 
ATOM   5260  C CB  . PHE H  2 10  ? 23.061  125.687 24.905  1.00 39.30  ? 327  PHE F CB  1 
ATOM   5261  C CG  . PHE H  2 10  ? 21.578  125.692 24.949  1.00 44.50  ? 327  PHE F CG  1 
ATOM   5262  C CD1 . PHE H  2 10  ? 20.836  125.755 23.778  1.00 54.29  ? 327  PHE F CD1 1 
ATOM   5263  C CD2 . PHE H  2 10  ? 20.915  125.560 26.165  1.00 44.19  ? 327  PHE F CD2 1 
ATOM   5264  C CE1 . PHE H  2 10  ? 19.448  125.675 23.818  1.00 57.05  ? 327  PHE F CE1 1 
ATOM   5265  C CE2 . PHE H  2 10  ? 19.533  125.481 26.223  1.00 43.17  ? 327  PHE F CE2 1 
ATOM   5266  C CZ  . PHE H  2 10  ? 18.797  125.536 25.051  1.00 54.02  ? 327  PHE F CZ  1 
ATOM   5267  N N   . LEU H  2 11  ? 25.006  127.086 26.870  1.00 35.01  ? 328  LEU F N   1 
ATOM   5268  C CA  . LEU H  2 11  ? 26.200  126.977 27.672  1.00 36.71  ? 328  LEU F CA  1 
ATOM   5269  C C   . LEU H  2 11  ? 25.782  126.303 28.964  1.00 37.14  ? 328  LEU F C   1 
ATOM   5270  O O   . LEU H  2 11  ? 25.045  126.865 29.749  1.00 42.63  ? 328  LEU F O   1 
ATOM   5271  C CB  . LEU H  2 11  ? 26.828  128.336 27.956  1.00 34.10  ? 328  LEU F CB  1 
ATOM   5272  C CG  . LEU H  2 11  ? 27.872  128.233 29.073  1.00 45.65  ? 328  LEU F CG  1 
ATOM   5273  C CD1 . LEU H  2 11  ? 28.763  127.020 28.867  1.00 44.76  ? 328  LEU F CD1 1 
ATOM   5274  C CD2 . LEU H  2 11  ? 28.707  129.495 29.110  1.00 56.19  ? 328  LEU F CD2 1 
ATOM   5275  N N   . LEU H  2 12  ? 26.230  125.071 29.155  1.00 36.76  ? 329  LEU F N   1 
ATOM   5276  C CA  . LEU H  2 12  ? 25.899  124.315 30.336  1.00 35.81  ? 329  LEU F CA  1 
ATOM   5277  C C   . LEU H  2 12  ? 27.163  124.207 31.131  1.00 43.26  ? 329  LEU F C   1 
ATOM   5278  O O   . LEU H  2 12  ? 28.171  123.744 30.630  1.00 50.55  ? 329  LEU F O   1 
ATOM   5279  C CB  . LEU H  2 12  ? 25.411  122.914 29.985  1.00 28.53  ? 329  LEU F CB  1 
ATOM   5280  C CG  . LEU H  2 12  ? 25.337  121.985 31.204  1.00 35.45  ? 329  LEU F CG  1 
ATOM   5281  C CD1 . LEU H  2 12  ? 24.700  122.681 32.376  1.00 43.35  ? 329  LEU F CD1 1 
ATOM   5282  C CD2 . LEU H  2 12  ? 24.526  120.766 30.863  1.00 34.94  ? 329  LEU F CD2 1 
ATOM   5283  N N   . GLY H  2 13  ? 27.104  124.638 32.383  1.00 50.02  ? 330  GLY F N   1 
ATOM   5284  C CA  . GLY H  2 13  ? 28.274  124.593 33.237  1.00 49.14  ? 330  GLY F CA  1 
ATOM   5285  C C   . GLY H  2 13  ? 28.060  123.655 34.398  1.00 49.98  ? 330  GLY F C   1 
ATOM   5286  O O   . GLY H  2 13  ? 27.469  124.024 35.405  1.00 50.93  ? 330  GLY F O   1 
ATOM   5287  N N   . MET H  2 14  ? 28.536  122.428 34.250  1.00 55.18  ? 331  MET F N   1 
ATOM   5288  C CA  . MET H  2 14  ? 28.413  121.426 35.293  1.00 56.26  ? 331  MET F CA  1 
ATOM   5289  C C   . MET H  2 14  ? 29.526  121.630 36.315  1.00 64.19  ? 331  MET F C   1 
ATOM   5290  O O   . MET H  2 14  ? 30.647  122.045 35.969  1.00 61.97  ? 331  MET F O   1 
ATOM   5291  C CB  . MET H  2 14  ? 28.526  120.029 34.692  1.00 52.36  ? 331  MET F CB  1 
ATOM   5292  C CG  . MET H  2 14  ? 27.417  119.686 33.753  1.00 40.54  ? 331  MET F CG  1 
ATOM   5293  S SD  . MET H  2 14  ? 25.885  119.757 34.628  1.00 43.70  ? 331  MET F SD  1 
ATOM   5294  C CE  . MET H  2 14  ? 25.792  118.194 35.452  1.00 24.03  ? 331  MET F CE  1 
ATOM   5295  N N   . ALA H  2 15  ? 29.215  121.333 37.573  1.00 68.43  ? 332  ALA F N   1 
ATOM   5296  C CA  . ALA H  2 15  ? 30.189  121.483 38.646  1.00 71.72  ? 332  ALA F CA  1 
ATOM   5297  C C   . ALA H  2 15  ? 31.100  120.257 38.714  1.00 72.28  ? 332  ALA F C   1 
ATOM   5298  O O   . ALA H  2 15  ? 32.202  120.318 39.261  1.00 73.59  ? 332  ALA F O   1 
ATOM   5299  C CB  . ALA H  2 15  ? 29.468  121.679 39.984  1.00 72.12  ? 332  ALA F CB  1 
ATOM   5300  N N   . THR H  2 16  ? 30.640  119.147 38.148  1.00 65.87  ? 333  THR F N   1 
ATOM   5301  C CA  . THR H  2 16  ? 31.415  117.920 38.175  1.00 60.75  ? 333  THR F CA  1 
ATOM   5302  C C   . THR H  2 16  ? 31.171  117.036 36.962  1.00 63.32  ? 333  THR F C   1 
ATOM   5303  O O   . THR H  2 16  ? 30.076  117.043 36.388  1.00 69.86  ? 333  THR F O   1 
ATOM   5304  C CB  . THR H  2 16  ? 31.058  117.092 39.408  1.00 54.54  ? 333  THR F CB  1 
ATOM   5305  O OG1 . THR H  2 16  ? 31.662  115.797 39.300  1.00 62.89  ? 333  THR F OG1 1 
ATOM   5306  C CG2 . THR H  2 16  ? 29.568  116.917 39.507  1.00 41.35  ? 333  THR F CG2 1 
ATOM   5307  N N   . VAL H  2 17  ? 32.185  116.271 36.571  1.00 57.14  ? 334  VAL F N   1 
ATOM   5308  C CA  . VAL H  2 17  ? 32.030  115.346 35.448  1.00 55.70  ? 334  VAL F CA  1 
ATOM   5309  C C   . VAL H  2 17  ? 31.004  114.333 35.899  1.00 56.12  ? 334  VAL F C   1 
ATOM   5310  O O   . VAL H  2 17  ? 30.658  114.278 37.078  1.00 56.60  ? 334  VAL F O   1 
ATOM   5311  C CB  . VAL H  2 17  ? 33.316  114.585 35.135  1.00 54.92  ? 334  VAL F CB  1 
ATOM   5312  C CG1 . VAL H  2 17  ? 34.318  115.528 34.527  1.00 56.47  ? 334  VAL F CG1 1 
ATOM   5313  C CG2 . VAL H  2 17  ? 33.871  113.938 36.412  1.00 58.10  ? 334  VAL F CG2 1 
ATOM   5314  N N   . ASN H  2 18  ? 30.525  113.515 34.975  1.00 60.25  ? 335  ASN F N   1 
ATOM   5315  C CA  . ASN H  2 18  ? 29.519  112.534 35.346  1.00 63.98  ? 335  ASN F CA  1 
ATOM   5316  C C   . ASN H  2 18  ? 30.040  111.477 36.333  1.00 65.10  ? 335  ASN F C   1 
ATOM   5317  O O   . ASN H  2 18  ? 31.236  111.179 36.381  1.00 63.22  ? 335  ASN F O   1 
ATOM   5318  C CB  . ASN H  2 18  ? 28.957  111.855 34.093  1.00 61.48  ? 335  ASN F CB  1 
ATOM   5319  C CG  . ASN H  2 18  ? 27.576  111.245 34.330  1.00 65.17  ? 335  ASN F CG  1 
ATOM   5320  O OD1 . ASN H  2 18  ? 27.108  110.405 33.560  1.00 71.99  ? 335  ASN F OD1 1 
ATOM   5321  N ND2 . ASN H  2 18  ? 26.916  111.677 35.391  1.00 61.72  ? 335  ASN F ND2 1 
ATOM   5322  N N   . ASN H  2 19  ? 29.117  110.937 37.125  1.00 68.25  ? 336  ASN F N   1 
ATOM   5323  C CA  . ASN H  2 19  ? 29.387  109.900 38.122  1.00 71.21  ? 336  ASN F CA  1 
ATOM   5324  C C   . ASN H  2 19  ? 30.096  110.329 39.382  1.00 69.93  ? 336  ASN F C   1 
ATOM   5325  O O   . ASN H  2 19  ? 30.301  109.505 40.260  1.00 71.59  ? 336  ASN F O   1 
ATOM   5326  C CB  . ASN H  2 19  ? 30.177  108.751 37.514  1.00 73.00  ? 336  ASN F CB  1 
ATOM   5327  C CG  . ASN H  2 19  ? 29.408  108.033 36.440  1.00 75.65  ? 336  ASN F CG  1 
ATOM   5328  O OD1 . ASN H  2 19  ? 29.461  108.401 35.267  1.00 80.27  ? 336  ASN F OD1 1 
ATOM   5329  N ND2 . ASN H  2 19  ? 28.673  107.006 36.835  1.00 73.36  ? 336  ASN F ND2 1 
ATOM   5330  N N   . CYS H  2 20  ? 30.456  111.601 39.492  1.00 67.74  ? 337  CYS F N   1 
ATOM   5331  C CA  . CYS H  2 20  ? 31.164  112.050 40.681  1.00 68.56  ? 337  CYS F CA  1 
ATOM   5332  C C   . CYS H  2 20  ? 30.438  113.065 41.556  1.00 69.15  ? 337  CYS F C   1 
ATOM   5333  O O   . CYS H  2 20  ? 29.385  113.599 41.201  1.00 67.15  ? 337  CYS F O   1 
ATOM   5334  C CB  . CYS H  2 20  ? 32.525  112.605 40.282  1.00 68.90  ? 337  CYS F CB  1 
ATOM   5335  S SG  . CYS H  2 20  ? 33.492  111.407 39.389  1.00 78.26  ? 337  CYS F SG  1 
ATOM   5336  N N   . VAL H  2 21  ? 31.032  113.328 42.710  1.00 65.42  ? 338  VAL F N   1 
ATOM   5337  C CA  . VAL H  2 21  ? 30.473  114.262 43.658  1.00 62.55  ? 338  VAL F CA  1 
ATOM   5338  C C   . VAL H  2 21  ? 31.098  115.635 43.492  1.00 65.44  ? 338  VAL F C   1 
ATOM   5339  O O   . VAL H  2 21  ? 32.197  115.765 42.944  1.00 67.60  ? 338  VAL F O   1 
ATOM   5340  C CB  . VAL H  2 21  ? 30.738  113.795 45.104  1.00 63.06  ? 338  VAL F CB  1 
ATOM   5341  C CG1 . VAL H  2 21  ? 30.225  112.368 45.294  1.00 58.84  ? 338  VAL F CG1 1 
ATOM   5342  C CG2 . VAL H  2 21  ? 32.237  113.880 45.416  1.00 52.93  ? 338  VAL F CG2 1 
ATOM   5343  N N   . SER H  2 22  ? 30.376  116.657 43.948  1.00 65.13  ? 339  SER F N   1 
ATOM   5344  C CA  . SER H  2 22  ? 30.888  118.022 43.933  1.00 66.27  ? 339  SER F CA  1 
ATOM   5345  C C   . SER H  2 22  ? 30.845  118.422 45.418  1.00 69.07  ? 339  SER F C   1 
ATOM   5346  O O   . SER H  2 22  ? 30.055  117.859 46.203  1.00 59.89  ? 339  SER F O   1 
ATOM   5347  C CB  . SER H  2 22  ? 30.011  118.927 43.074  1.00 66.35  ? 339  SER F CB  1 
ATOM   5348  O OG  . SER H  2 22  ? 28.644  118.706 43.368  1.00 70.94  ? 339  SER F OG  1 
ATOM   5349  N N   . TYR H  2 23  ? 31.695  119.373 45.804  1.00 70.99  ? 340  TYR F N   1 
ATOM   5350  C CA  . TYR H  2 23  ? 31.784  119.781 47.198  1.00 74.89  ? 340  TYR F CA  1 
ATOM   5351  C C   . TYR H  2 23  ? 31.174  121.111 47.603  1.00 78.05  ? 340  TYR F C   1 
ATOM   5352  O O   . TYR H  2 23  ? 31.260  122.120 46.889  1.00 75.59  ? 340  TYR F O   1 
ATOM   5353  C CB  . TYR H  2 23  ? 33.246  119.748 47.654  1.00 75.44  ? 340  TYR F CB  1 
ATOM   5354  C CG  . TYR H  2 23  ? 33.839  118.355 47.644  1.00 81.40  ? 340  TYR F CG  1 
ATOM   5355  C CD1 . TYR H  2 23  ? 33.526  117.436 48.657  1.00 82.23  ? 340  TYR F CD1 1 
ATOM   5356  C CD2 . TYR H  2 23  ? 34.672  117.934 46.602  1.00 74.81  ? 340  TYR F CD2 1 
ATOM   5357  C CE1 . TYR H  2 23  ? 34.022  116.136 48.629  1.00 82.93  ? 340  TYR F CE1 1 
ATOM   5358  C CE2 . TYR H  2 23  ? 35.176  116.638 46.565  1.00 77.21  ? 340  TYR F CE2 1 
ATOM   5359  C CZ  . TYR H  2 23  ? 34.845  115.743 47.582  1.00 84.89  ? 340  TYR F CZ  1 
ATOM   5360  O OH  . TYR H  2 23  ? 35.323  114.452 47.558  1.00 89.13  ? 340  TYR F OH  1 
ATOM   5361  N N   . ARG H  2 24  ? 30.578  121.080 48.794  1.00 81.93  ? 341  ARG F N   1 
ATOM   5362  C CA  . ARG H  2 24  ? 29.914  122.222 49.421  1.00 81.24  ? 341  ARG F CA  1 
ATOM   5363  C C   . ARG H  2 24  ? 30.435  122.378 50.867  1.00 81.62  ? 341  ARG F C   1 
ATOM   5364  O O   . ARG H  2 24  ? 30.371  121.444 51.692  1.00 72.70  ? 341  ARG F O   1 
ATOM   5365  C CB  . ARG H  2 24  ? 28.401  121.974 49.423  1.00 79.39  ? 341  ARG F CB  1 
ATOM   5366  C CG  . ARG H  2 24  ? 27.552  123.030 50.091  1.00 74.97  ? 341  ARG F CG  1 
ATOM   5367  C CD  . ARG H  2 24  ? 26.215  122.402 50.453  1.00 68.87  ? 341  ARG F CD  1 
ATOM   5368  N NE  . ARG H  2 24  ? 26.406  121.285 51.376  1.00 73.39  ? 341  ARG F NE  1 
ATOM   5369  C CZ  . ARG H  2 24  ? 25.814  120.095 51.263  1.00 77.20  ? 341  ARG F CZ  1 
ATOM   5370  N NH1 . ARG H  2 24  ? 24.986  119.855 50.257  1.00 75.73  ? 341  ARG F NH1 1 
ATOM   5371  N NH2 . ARG H  2 24  ? 26.043  119.136 52.157  1.00 78.13  ? 341  ARG F NH2 1 
ATOM   5372  N N   . ASN H  2 25  ? 30.970  123.560 51.154  1.00 80.69  ? 342  ASN F N   1 
ATOM   5373  C CA  . ASN H  2 25  ? 31.499  123.877 52.479  1.00 85.04  ? 342  ASN F CA  1 
ATOM   5374  C C   . ASN H  2 25  ? 30.438  124.708 53.214  1.00 83.33  ? 342  ASN F C   1 
ATOM   5375  O O   . ASN H  2 25  ? 30.158  125.857 52.835  1.00 81.98  ? 342  ASN F O   1 
ATOM   5376  C CB  . ASN H  2 25  ? 32.809  124.671 52.342  1.00 87.43  ? 342  ASN F CB  1 
ATOM   5377  C CG  . ASN H  2 25  ? 33.486  124.931 53.683  1.00 90.24  ? 342  ASN F CG  1 
ATOM   5378  O OD1 . ASN H  2 25  ? 33.185  125.908 54.354  1.00 84.31  ? 342  ASN F OD1 1 
ATOM   5379  N ND2 . ASN H  2 25  ? 34.400  124.051 54.073  1.00 89.60  ? 342  ASN F ND2 1 
ATOM   5380  N N   . PRO H  2 26  ? 29.846  124.140 54.282  1.00 77.51  ? 343  PRO F N   1 
ATOM   5381  C CA  . PRO H  2 26  ? 28.812  124.824 55.060  1.00 74.96  ? 343  PRO F CA  1 
ATOM   5382  C C   . PRO H  2 26  ? 29.162  126.264 55.368  1.00 75.36  ? 343  PRO F C   1 
ATOM   5383  O O   . PRO H  2 26  ? 28.291  127.120 55.421  1.00 80.44  ? 343  PRO F O   1 
ATOM   5384  C CB  . PRO H  2 26  ? 28.706  123.970 56.321  1.00 68.87  ? 343  PRO F CB  1 
ATOM   5385  C CG  . PRO H  2 26  ? 28.977  122.628 55.814  1.00 69.96  ? 343  PRO F CG  1 
ATOM   5386  C CD  . PRO H  2 26  ? 30.177  122.846 54.902  1.00 75.17  ? 343  PRO F CD  1 
ATOM   5387  N N   . ALA H  2 27  ? 30.447  126.531 55.534  1.00 76.77  ? 344  ALA F N   1 
ATOM   5388  C CA  . ALA H  2 27  ? 30.894  127.866 55.867  1.00 79.68  ? 344  ALA F CA  1 
ATOM   5389  C C   . ALA H  2 27  ? 31.195  128.801 54.700  1.00 84.87  ? 344  ALA F C   1 
ATOM   5390  O O   . ALA H  2 27  ? 31.330  130.006 54.900  1.00 91.12  ? 344  ALA F O   1 
ATOM   5391  C CB  . ALA H  2 27  ? 32.119  127.785 56.789  1.00 82.51  ? 344  ALA F CB  1 
ATOM   5392  N N   . GLU H  2 28  ? 31.328  128.295 53.480  1.00 83.77  ? 345  GLU F N   1 
ATOM   5393  C CA  . GLU H  2 28  ? 31.625  129.241 52.402  1.00 84.81  ? 345  GLU F CA  1 
ATOM   5394  C C   . GLU H  2 28  ? 31.063  128.946 51.017  1.00 84.15  ? 345  GLU F C   1 
ATOM   5395  O O   . GLU H  2 28  ? 31.379  129.650 50.043  1.00 78.38  ? 345  GLU F O   1 
ATOM   5396  C CB  . GLU H  2 28  ? 33.140  129.497 52.328  1.00 82.06  ? 345  GLU F CB  1 
ATOM   5397  C CG  . GLU H  2 28  ? 34.010  128.258 52.515  1.00 88.21  ? 345  GLU F CG  1 
ATOM   5398  C CD  . GLU H  2 28  ? 35.489  128.602 52.664  1.00 93.38  ? 345  GLU F CD  1 
ATOM   5399  O OE1 . GLU H  2 28  ? 36.029  129.320 51.791  1.00 92.21  ? 345  GLU F OE1 1 
ATOM   5400  O OE2 . GLU H  2 28  ? 36.110  128.150 53.653  1.00 95.21  ? 345  GLU F OE2 1 
ATOM   5401  N N   . GLY H  2 29  ? 30.213  127.928 50.931  1.00 82.35  ? 346  GLY F N   1 
ATOM   5402  C CA  . GLY H  2 29  ? 29.616  127.598 49.650  1.00 85.14  ? 346  GLY F CA  1 
ATOM   5403  C C   . GLY H  2 29  ? 30.282  126.440 48.937  1.00 86.18  ? 346  GLY F C   1 
ATOM   5404  O O   . GLY H  2 29  ? 31.183  125.790 49.483  1.00 89.93  ? 346  GLY F O   1 
ATOM   5405  N N   . THR H  2 30  ? 29.832  126.179 47.711  1.00 81.80  ? 347  THR F N   1 
ATOM   5406  C CA  . THR H  2 30  ? 30.372  125.092 46.900  1.00 69.99  ? 347  THR F CA  1 
ATOM   5407  C C   . THR H  2 30  ? 31.661  125.538 46.216  1.00 69.26  ? 347  THR F C   1 
ATOM   5408  O O   . THR H  2 30  ? 31.828  126.730 45.904  1.00 66.54  ? 347  THR F O   1 
ATOM   5409  C CB  . THR H  2 30  ? 29.353  124.647 45.835  1.00 67.25  ? 347  THR F CB  1 
ATOM   5410  O OG1 . THR H  2 30  ? 29.040  125.754 44.961  1.00 48.58  ? 347  THR F OG1 1 
ATOM   5411  C CG2 . THR H  2 30  ? 28.079  124.101 46.528  1.00 53.66  ? 347  THR F CG2 1 
ATOM   5412  N N   . TRP H  2 31  ? 32.573  124.590 45.995  1.00 62.99  ? 348  TRP F N   1 
ATOM   5413  C CA  . TRP H  2 31  ? 33.842  124.924 45.362  1.00 62.30  ? 348  TRP F CA  1 
ATOM   5414  C C   . TRP H  2 31  ? 33.552  125.557 44.020  1.00 59.76  ? 348  TRP F C   1 
ATOM   5415  O O   . TRP H  2 31  ? 34.160  126.574 43.629  1.00 48.63  ? 348  TRP F O   1 
ATOM   5416  C CB  . TRP H  2 31  ? 34.686  123.672 45.108  1.00 76.27  ? 348  TRP F CB  1 
ATOM   5417  C CG  . TRP H  2 31  ? 35.182  122.924 46.315  1.00 82.13  ? 348  TRP F CG  1 
ATOM   5418  C CD1 . TRP H  2 31  ? 34.927  123.201 47.622  1.00 85.67  ? 348  TRP F CD1 1 
ATOM   5419  C CD2 . TRP H  2 31  ? 35.986  121.737 46.306  1.00 88.74  ? 348  TRP F CD2 1 
ATOM   5420  N NE1 . TRP H  2 31  ? 35.516  122.258 48.435  1.00 85.58  ? 348  TRP F NE1 1 
ATOM   5421  C CE2 . TRP H  2 31  ? 36.172  121.347 47.652  1.00 89.55  ? 348  TRP F CE2 1 
ATOM   5422  C CE3 . TRP H  2 31  ? 36.566  120.960 45.288  1.00 90.95  ? 348  TRP F CE3 1 
ATOM   5423  C CZ2 . TRP H  2 31  ? 36.914  120.211 48.011  1.00 89.88  ? 348  TRP F CZ2 1 
ATOM   5424  C CZ3 . TRP H  2 31  ? 37.306  119.830 45.645  1.00 88.57  ? 348  TRP F CZ3 1 
ATOM   5425  C CH2 . TRP H  2 31  ? 37.471  119.468 46.997  1.00 88.90  ? 348  TRP F CH2 1 
ATOM   5426  N N   . TYR H  2 32  ? 32.619  124.929 43.308  1.00 56.84  ? 349  TYR F N   1 
ATOM   5427  C CA  . TYR H  2 32  ? 32.273  125.406 41.985  1.00 59.78  ? 349  TYR F CA  1 
ATOM   5428  C C   . TYR H  2 32  ? 31.713  126.828 41.926  1.00 55.96  ? 349  TYR F C   1 
ATOM   5429  O O   . TYR H  2 32  ? 32.332  127.740 41.339  1.00 41.29  ? 349  TYR F O   1 
ATOM   5430  C CB  . TYR H  2 32  ? 31.294  124.437 41.301  1.00 62.37  ? 349  TYR F CB  1 
ATOM   5431  C CG  . TYR H  2 32  ? 31.034  124.793 39.835  1.00 59.08  ? 349  TYR F CG  1 
ATOM   5432  C CD1 . TYR H  2 32  ? 32.090  125.045 38.963  1.00 59.23  ? 349  TYR F CD1 1 
ATOM   5433  C CD2 . TYR H  2 32  ? 29.740  124.896 39.335  1.00 53.34  ? 349  TYR F CD2 1 
ATOM   5434  C CE1 . TYR H  2 32  ? 31.859  125.393 37.640  1.00 62.98  ? 349  TYR F CE1 1 
ATOM   5435  C CE2 . TYR H  2 32  ? 29.500  125.240 38.019  1.00 50.57  ? 349  TYR F CE2 1 
ATOM   5436  C CZ  . TYR H  2 32  ? 30.558  125.488 37.173  1.00 59.43  ? 349  TYR F CZ  1 
ATOM   5437  O OH  . TYR H  2 32  ? 30.332  125.813 35.849  1.00 64.72  ? 349  TYR F OH  1 
ATOM   5438  N N   . ILE H  2 33  ? 30.546  127.015 42.537  1.00 56.73  ? 350  ILE F N   1 
ATOM   5439  C CA  . ILE H  2 33  ? 29.904  128.320 42.504  1.00 59.04  ? 350  ILE F CA  1 
ATOM   5440  C C   . ILE H  2 33  ? 30.799  129.447 42.989  1.00 59.60  ? 350  ILE F C   1 
ATOM   5441  O O   . ILE H  2 33  ? 30.958  130.458 42.289  1.00 54.22  ? 350  ILE F O   1 
ATOM   5442  C CB  . ILE H  2 33  ? 28.593  128.314 43.308  1.00 57.50  ? 350  ILE F CB  1 
ATOM   5443  C CG1 . ILE H  2 33  ? 27.629  127.296 42.694  1.00 56.32  ? 350  ILE F CG1 1 
ATOM   5444  C CG2 . ILE H  2 33  ? 27.943  129.691 43.235  1.00 63.01  ? 350  ILE F CG2 1 
ATOM   5445  C CD1 . ILE H  2 33  ? 27.290  127.610 41.229  1.00 49.48  ? 350  ILE F CD1 1 
ATOM   5446  N N   . GLN H  2 34  ? 31.390  129.266 44.173  1.00 55.86  ? 351  GLN F N   1 
ATOM   5447  C CA  . GLN H  2 34  ? 32.266  130.277 44.735  1.00 56.11  ? 351  GLN F CA  1 
ATOM   5448  C C   . GLN H  2 34  ? 33.323  130.675 43.733  1.00 54.36  ? 351  GLN F C   1 
ATOM   5449  O O   . GLN H  2 34  ? 33.500  131.856 43.424  1.00 56.60  ? 351  GLN F O   1 
ATOM   5450  C CB  . GLN H  2 34  ? 32.911  129.764 46.020  1.00 61.58  ? 351  GLN F CB  1 
ATOM   5451  C CG  . GLN H  2 34  ? 31.949  129.766 47.217  1.00 70.95  ? 351  GLN F CG  1 
ATOM   5452  C CD  . GLN H  2 34  ? 31.154  131.073 47.312  1.00 72.52  ? 351  GLN F CD  1 
ATOM   5453  O OE1 . GLN H  2 34  ? 31.725  132.177 47.299  1.00 57.03  ? 351  GLN F OE1 1 
ATOM   5454  N NE2 . GLN H  2 34  ? 29.830  130.951 47.392  1.00 75.30  ? 351  GLN F NE2 1 
ATOM   5455  N N   . SER H  2 35  ? 34.012  129.676 43.206  1.00 56.83  ? 352  SER F N   1 
ATOM   5456  C CA  . SER H  2 35  ? 35.049  129.916 42.231  1.00 54.54  ? 352  SER F CA  1 
ATOM   5457  C C   . SER H  2 35  ? 34.467  130.639 41.003  1.00 54.96  ? 352  SER F C   1 
ATOM   5458  O O   . SER H  2 35  ? 35.073  131.608 40.481  1.00 40.73  ? 352  SER F O   1 
ATOM   5459  C CB  . SER H  2 35  ? 35.673  128.582 41.840  1.00 55.94  ? 352  SER F CB  1 
ATOM   5460  O OG  . SER H  2 35  ? 36.720  128.807 40.920  1.00 68.03  ? 352  SER F OG  1 
ATOM   5461  N N   . LEU H  2 36  ? 33.287  130.180 40.560  1.00 53.18  ? 353  LEU F N   1 
ATOM   5462  C CA  . LEU H  2 36  ? 32.627  130.778 39.396  1.00 58.21  ? 353  LEU F CA  1 
ATOM   5463  C C   . LEU H  2 36  ? 32.472  132.283 39.584  1.00 59.80  ? 353  LEU F C   1 
ATOM   5464  O O   . LEU H  2 36  ? 32.900  133.083 38.748  1.00 55.01  ? 353  LEU F O   1 
ATOM   5465  C CB  . LEU H  2 36  ? 31.252  130.128 39.166  1.00 56.97  ? 353  LEU F CB  1 
ATOM   5466  C CG  . LEU H  2 36  ? 30.329  130.724 38.078  1.00 57.84  ? 353  LEU F CG  1 
ATOM   5467  C CD1 . LEU H  2 36  ? 31.085  130.956 36.768  1.00 48.54  ? 353  LEU F CD1 1 
ATOM   5468  C CD2 . LEU H  2 36  ? 29.140  129.794 37.865  1.00 44.15  ? 353  LEU F CD2 1 
ATOM   5469  N N   . CYS H  2 37  ? 31.865  132.656 40.705  1.00 65.11  ? 354  CYS F N   1 
ATOM   5470  C CA  . CYS H  2 37  ? 31.638  134.057 41.025  1.00 68.45  ? 354  CYS F CA  1 
ATOM   5471  C C   . CYS H  2 37  ? 32.950  134.820 41.158  1.00 71.24  ? 354  CYS F C   1 
ATOM   5472  O O   . CYS H  2 37  ? 33.109  135.897 40.562  1.00 63.86  ? 354  CYS F O   1 
ATOM   5473  C CB  . CYS H  2 37  ? 30.832  134.167 42.320  1.00 68.25  ? 354  CYS F CB  1 
ATOM   5474  S SG  . CYS H  2 37  ? 29.111  133.598 42.169  1.00 85.76  ? 354  CYS F SG  1 
ATOM   5475  N N   . GLN H  2 38  ? 33.886  134.266 41.936  1.00 73.82  ? 355  GLN F N   1 
ATOM   5476  C CA  . GLN H  2 38  ? 35.186  134.912 42.131  1.00 76.87  ? 355  GLN F CA  1 
ATOM   5477  C C   . GLN H  2 38  ? 35.746  135.268 40.766  1.00 73.49  ? 355  GLN F C   1 
ATOM   5478  O O   . GLN H  2 38  ? 36.027  136.440 40.448  1.00 63.49  ? 355  GLN F O   1 
ATOM   5479  C CB  . GLN H  2 38  ? 36.194  133.978 42.811  1.00 78.20  ? 355  GLN F CB  1 
ATOM   5480  C CG  . GLN H  2 38  ? 35.892  133.554 44.238  1.00 91.64  ? 355  GLN F CG  1 
ATOM   5481  C CD  . GLN H  2 38  ? 37.050  132.743 44.847  1.00 100.00 ? 355  GLN F CD  1 
ATOM   5482  O OE1 . GLN H  2 38  ? 38.185  133.228 44.915  1.00 100.00 ? 355  GLN F OE1 1 
ATOM   5483  N NE2 . GLN H  2 38  ? 36.767  131.509 45.283  1.00 97.14  ? 355  GLN F NE2 1 
ATOM   5484  N N   . SER H  2 39  ? 35.898  134.227 39.957  1.00 70.60  ? 356  SER F N   1 
ATOM   5485  C CA  . SER H  2 39  ? 36.456  134.400 38.642  1.00 70.05  ? 356  SER F CA  1 
ATOM   5486  C C   . SER H  2 39  ? 35.657  135.409 37.832  1.00 64.90  ? 356  SER F C   1 
ATOM   5487  O O   . SER H  2 39  ? 36.229  136.291 37.179  1.00 53.17  ? 356  SER F O   1 
ATOM   5488  C CB  . SER H  2 39  ? 36.518  133.053 37.932  1.00 72.25  ? 356  SER F CB  1 
ATOM   5489  O OG  . SER H  2 39  ? 37.200  133.197 36.697  1.00 85.69  ? 356  SER F OG  1 
ATOM   5490  N N   . LEU H  2 40  ? 34.335  135.285 37.889  1.00 66.28  ? 357  LEU F N   1 
ATOM   5491  C CA  . LEU H  2 40  ? 33.465  136.192 37.147  1.00 65.19  ? 357  LEU F CA  1 
ATOM   5492  C C   . LEU H  2 40  ? 33.723  137.651 37.501  1.00 66.78  ? 357  LEU F C   1 
ATOM   5493  O O   . LEU H  2 40  ? 33.936  138.499 36.612  1.00 53.26  ? 357  LEU F O   1 
ATOM   5494  C CB  . LEU H  2 40  ? 32.002  135.836 37.417  1.00 54.85  ? 357  LEU F CB  1 
ATOM   5495  C CG  . LEU H  2 40  ? 31.473  134.782 36.454  1.00 42.57  ? 357  LEU F CG  1 
ATOM   5496  C CD1 . LEU H  2 40  ? 30.140  134.268 36.909  1.00 25.01  ? 357  LEU F CD1 1 
ATOM   5497  C CD2 . LEU H  2 40  ? 31.407  135.412 35.073  1.00 40.37  ? 357  LEU F CD2 1 
ATOM   5498  N N   . ARG H  2 41  ? 33.739  137.923 38.806  1.00 71.79  ? 358  ARG F N   1 
ATOM   5499  C CA  . ARG H  2 41  ? 33.931  139.280 39.278  1.00 78.81  ? 358  ARG F CA  1 
ATOM   5500  C C   . ARG H  2 41  ? 35.223  139.959 38.860  1.00 82.12  ? 358  ARG F C   1 
ATOM   5501  O O   . ARG H  2 41  ? 35.213  141.154 38.543  1.00 82.44  ? 358  ARG F O   1 
ATOM   5502  C CB  . ARG H  2 41  ? 33.722  139.352 40.798  1.00 79.74  ? 358  ARG F CB  1 
ATOM   5503  C CG  . ARG H  2 41  ? 32.245  139.646 41.141  1.00 90.32  ? 358  ARG F CG  1 
ATOM   5504  C CD  . ARG H  2 41  ? 31.967  139.789 42.626  1.00 94.27  ? 358  ARG F CD  1 
ATOM   5505  N NE  . ARG H  2 41  ? 32.106  138.522 43.338  1.00 97.38  ? 358  ARG F NE  1 
ATOM   5506  C CZ  . ARG H  2 41  ? 31.826  138.359 44.628  1.00 100.00 ? 358  ARG F CZ  1 
ATOM   5507  N NH1 . ARG H  2 41  ? 31.387  139.388 45.349  1.00 100.00 ? 358  ARG F NH1 1 
ATOM   5508  N NH2 . ARG H  2 41  ? 31.985  137.170 45.200  1.00 99.08  ? 358  ARG F NH2 1 
ATOM   5509  N N   . GLU H  2 42  ? 36.329  139.221 38.818  1.00 84.51  ? 359  GLU F N   1 
ATOM   5510  C CA  . GLU H  2 42  ? 37.591  139.843 38.423  1.00 86.55  ? 359  GLU F CA  1 
ATOM   5511  C C   . GLU H  2 42  ? 37.889  139.752 36.932  1.00 86.98  ? 359  GLU F C   1 
ATOM   5512  O O   . GLU H  2 42  ? 38.727  140.492 36.417  1.00 85.87  ? 359  GLU F O   1 
ATOM   5513  C CB  . GLU H  2 42  ? 38.749  139.235 39.212  1.00 89.16  ? 359  GLU F CB  1 
ATOM   5514  C CG  . GLU H  2 42  ? 38.760  137.721 39.208  1.00 94.40  ? 359  GLU F CG  1 
ATOM   5515  C CD  . GLU H  2 42  ? 39.944  137.139 39.983  1.00 100.00 ? 359  GLU F CD  1 
ATOM   5516  O OE1 . GLU H  2 42  ? 40.142  137.538 41.157  1.00 98.04  ? 359  GLU F OE1 1 
ATOM   5517  O OE2 . GLU H  2 42  ? 40.672  136.276 39.421  1.00 100.00 ? 359  GLU F OE2 1 
ATOM   5518  N N   . ARG H  2 43  ? 37.190  138.856 36.239  1.00 88.59  ? 360  ARG F N   1 
ATOM   5519  C CA  . ARG H  2 43  ? 37.402  138.657 34.805  1.00 85.89  ? 360  ARG F CA  1 
ATOM   5520  C C   . ARG H  2 43  ? 36.523  139.511 33.893  1.00 86.09  ? 360  ARG F C   1 
ATOM   5521  O O   . ARG H  2 43  ? 37.030  140.251 33.036  1.00 77.15  ? 360  ARG F O   1 
ATOM   5522  C CB  . ARG H  2 43  ? 37.192  137.183 34.459  1.00 88.72  ? 360  ARG F CB  1 
ATOM   5523  C CG  . ARG H  2 43  ? 38.345  136.268 34.834  1.00 93.89  ? 360  ARG F CG  1 
ATOM   5524  C CD  . ARG H  2 43  ? 39.412  136.286 33.755  1.00 93.21  ? 360  ARG F CD  1 
ATOM   5525  N NE  . ARG H  2 43  ? 40.558  135.449 34.101  1.00 93.90  ? 360  ARG F NE  1 
ATOM   5526  C CZ  . ARG H  2 43  ? 41.614  135.273 33.310  1.00 92.18  ? 360  ARG F CZ  1 
ATOM   5527  N NH1 . ARG H  2 43  ? 41.657  135.878 32.125  1.00 86.54  ? 360  ARG F NH1 1 
ATOM   5528  N NH2 . ARG H  2 43  ? 42.628  134.505 33.704  1.00 88.33  ? 360  ARG F NH2 1 
ATOM   5529  N N   . CYS H  2 44  ? 35.207  139.392 34.072  1.00 87.99  ? 361  CYS F N   1 
ATOM   5530  C CA  . CYS H  2 44  ? 34.235  140.129 33.258  1.00 85.90  ? 361  CYS F CA  1 
ATOM   5531  C C   . CYS H  2 44  ? 34.609  141.590 33.116  1.00 85.45  ? 361  CYS F C   1 
ATOM   5532  O O   . CYS H  2 44  ? 34.538  142.150 32.026  1.00 83.83  ? 361  CYS F O   1 
ATOM   5533  C CB  . CYS H  2 44  ? 32.833  140.016 33.860  1.00 84.32  ? 361  CYS F CB  1 
ATOM   5534  S SG  . CYS H  2 44  ? 32.150  138.348 33.849  1.00 89.97  ? 361  CYS F SG  1 
ATOM   5535  N N   . PRO H  2 45  ? 34.991  142.235 34.228  1.00 87.03  ? 362  PRO F N   1 
ATOM   5536  C CA  . PRO H  2 45  ? 35.372  143.642 34.157  1.00 87.48  ? 362  PRO F CA  1 
ATOM   5537  C C   . PRO H  2 45  ? 36.444  143.829 33.088  1.00 91.13  ? 362  PRO F C   1 
ATOM   5538  O O   . PRO H  2 45  ? 36.361  144.733 32.255  1.00 90.79  ? 362  PRO F O   1 
ATOM   5539  C CB  . PRO H  2 45  ? 35.899  143.913 35.560  1.00 82.70  ? 362  PRO F CB  1 
ATOM   5540  C CG  . PRO H  2 45  ? 35.024  143.052 36.402  1.00 83.82  ? 362  PRO F CG  1 
ATOM   5541  C CD  . PRO H  2 45  ? 35.013  141.762 35.625  1.00 85.70  ? 362  PRO F CD  1 
ATOM   5542  N N   . ARG H  2 46  B 37.439  142.945 33.110  1.00 94.30  ? 362  ARG F N   1 
ATOM   5543  C CA  . ARG H  2 46  B 38.550  142.993 32.164  1.00 93.88  ? 362  ARG F CA  1 
ATOM   5544  C C   . ARG H  2 46  B 38.132  142.645 30.744  1.00 93.27  ? 362  ARG F C   1 
ATOM   5545  O O   . ARG H  2 46  B 38.947  142.704 29.820  1.00 93.30  ? 362  ARG F O   1 
ATOM   5546  C CB  . ARG H  2 46  B 39.665  142.059 32.639  1.00 93.87  ? 362  ARG F CB  1 
ATOM   5547  C CG  . ARG H  2 46  B 40.351  142.549 33.913  1.00 97.61  ? 362  ARG F CG  1 
ATOM   5548  C CD  . ARG H  2 46  B 41.016  141.412 34.670  1.00 100.00 ? 362  ARG F CD  1 
ATOM   5549  N NE  . ARG H  2 46  B 41.876  140.614 33.798  1.00 100.00 ? 362  ARG F NE  1 
ATOM   5550  C CZ  . ARG H  2 46  B 42.434  139.455 34.149  1.00 100.00 ? 362  ARG F CZ  1 
ATOM   5551  N NH1 . ARG H  2 46  B 42.222  138.955 35.367  1.00 100.00 ? 362  ARG F NH1 1 
ATOM   5552  N NH2 . ARG H  2 46  B 43.200  138.796 33.278  1.00 97.12  ? 362  ARG F NH2 1 
ATOM   5553  N N   . GLY H  2 47  ? 36.861  142.287 30.574  1.00 93.15  ? 363  GLY F N   1 
ATOM   5554  C CA  . GLY H  2 47  ? 36.353  141.945 29.251  1.00 94.38  ? 363  GLY F CA  1 
ATOM   5555  C C   . GLY H  2 47  ? 36.603  140.512 28.781  1.00 91.41  ? 363  GLY F C   1 
ATOM   5556  O O   . GLY H  2 47  ? 36.500  140.226 27.580  1.00 86.57  ? 363  GLY F O   1 
ATOM   5557  N N   . ASP H  2 48  ? 36.922  139.614 29.716  1.00 87.38  ? 364  ASP F N   1 
ATOM   5558  C CA  . ASP H  2 48  ? 37.188  138.219 29.380  1.00 83.51  ? 364  ASP F CA  1 
ATOM   5559  C C   . ASP H  2 48  ? 35.937  137.455 29.016  1.00 82.13  ? 364  ASP F C   1 
ATOM   5560  O O   . ASP H  2 48  ? 34.867  137.691 29.584  1.00 81.55  ? 364  ASP F O   1 
ATOM   5561  C CB  . ASP H  2 48  ? 37.893  137.502 30.534  1.00 89.07  ? 364  ASP F CB  1 
ATOM   5562  C CG  . ASP H  2 48  ? 39.382  137.791 30.570  1.00 94.14  ? 364  ASP F CG  1 
ATOM   5563  O OD1 . ASP H  2 48  ? 40.027  137.704 29.503  1.00 98.67  ? 364  ASP F OD1 1 
ATOM   5564  O OD2 . ASP H  2 48  ? 39.909  138.100 31.657  1.00 95.23  ? 364  ASP F OD2 1 
ATOM   5565  N N   . ASP H  2 49  ? 36.086  136.528 28.070  1.00 77.61  ? 365  ASP F N   1 
ATOM   5566  C CA  . ASP H  2 49  ? 34.977  135.713 27.601  1.00 67.89  ? 365  ASP F CA  1 
ATOM   5567  C C   . ASP H  2 49  ? 34.606  134.621 28.635  1.00 61.45  ? 365  ASP F C   1 
ATOM   5568  O O   . ASP H  2 49  ? 35.429  134.239 29.466  1.00 60.02  ? 365  ASP F O   1 
ATOM   5569  C CB  . ASP H  2 49  ? 35.336  135.152 26.213  1.00 66.74  ? 365  ASP F CB  1 
ATOM   5570  C CG  . ASP H  2 49  ? 35.243  133.658 26.148  1.00 77.57  ? 365  ASP F CG  1 
ATOM   5571  O OD1 . ASP H  2 49  ? 36.222  132.996 26.552  1.00 76.04  ? 365  ASP F OD1 1 
ATOM   5572  O OD2 . ASP H  2 49  ? 34.184  133.146 25.706  1.00 82.82  ? 365  ASP F OD2 1 
ATOM   5573  N N   . ILE H  2 50  ? 33.363  134.145 28.599  1.00 54.30  ? 366  ILE F N   1 
ATOM   5574  C CA  . ILE H  2 50  ? 32.893  133.154 29.563  1.00 54.72  ? 366  ILE F CA  1 
ATOM   5575  C C   . ILE H  2 50  ? 33.644  131.835 29.542  1.00 54.21  ? 366  ILE F C   1 
ATOM   5576  O O   . ILE H  2 50  ? 33.882  131.245 30.600  1.00 50.67  ? 366  ILE F O   1 
ATOM   5577  C CB  . ILE H  2 50  ? 31.358  132.902 29.397  1.00 58.88  ? 366  ILE F CB  1 
ATOM   5578  C CG1 . ILE H  2 50  ? 30.710  132.691 30.767  1.00 50.69  ? 366  ILE F CG1 1 
ATOM   5579  C CG2 . ILE H  2 50  ? 31.089  131.700 28.508  1.00 56.31  ? 366  ILE F CG2 1 
ATOM   5580  C CD1 . ILE H  2 50  ? 31.087  131.429 31.430  1.00 48.11  ? 366  ILE F CD1 1 
ATOM   5581  N N   . LEU H  2 51  ? 34.016  131.371 28.349  1.00 55.29  ? 367  LEU F N   1 
ATOM   5582  C CA  . LEU H  2 51  ? 34.755  130.111 28.229  1.00 57.64  ? 367  LEU F CA  1 
ATOM   5583  C C   . LEU H  2 51  ? 36.097  130.255 28.954  1.00 61.54  ? 367  LEU F C   1 
ATOM   5584  O O   . LEU H  2 51  ? 36.506  129.363 29.736  1.00 54.75  ? 367  LEU F O   1 
ATOM   5585  C CB  . LEU H  2 51  ? 34.949  129.737 26.747  1.00 52.05  ? 367  LEU F CB  1 
ATOM   5586  C CG  . LEU H  2 51  ? 33.667  129.225 26.056  1.00 53.24  ? 367  LEU F CG  1 
ATOM   5587  C CD1 . LEU H  2 51  ? 33.966  128.819 24.623  1.00 47.31  ? 367  LEU F CD1 1 
ATOM   5588  C CD2 . LEU H  2 51  ? 33.093  128.041 26.821  1.00 31.36  ? 367  LEU F CD2 1 
ATOM   5589  N N   . THR H  2 52  ? 36.773  131.382 28.703  1.00 58.92  ? 368  THR F N   1 
ATOM   5590  C CA  . THR H  2 52  ? 38.038  131.676 29.385  1.00 54.66  ? 368  THR F CA  1 
ATOM   5591  C C   . THR H  2 52  ? 37.783  131.584 30.905  1.00 52.01  ? 368  THR F C   1 
ATOM   5592  O O   . THR H  2 52  ? 38.451  130.864 31.626  1.00 46.90  ? 368  THR F O   1 
ATOM   5593  C CB  . THR H  2 52  ? 38.531  133.095 29.064  1.00 54.49  ? 368  THR F CB  1 
ATOM   5594  O OG1 . THR H  2 52  ? 38.990  133.155 27.708  1.00 58.91  ? 368  THR F OG1 1 
ATOM   5595  C CG2 . THR H  2 52  ? 39.641  133.489 30.009  1.00 46.89  ? 368  THR F CG2 1 
ATOM   5596  N N   . ILE H  2 53  ? 36.787  132.315 31.375  1.00 53.43  ? 369  ILE F N   1 
ATOM   5597  C CA  . ILE H  2 53  ? 36.425  132.307 32.782  1.00 55.49  ? 369  ILE F CA  1 
ATOM   5598  C C   . ILE H  2 53  ? 36.180  130.885 33.289  1.00 54.89  ? 369  ILE F C   1 
ATOM   5599  O O   . ILE H  2 53  ? 36.701  130.489 34.327  1.00 49.25  ? 369  ILE F O   1 
ATOM   5600  C CB  . ILE H  2 53  ? 35.157  133.174 32.997  1.00 58.07  ? 369  ILE F CB  1 
ATOM   5601  C CG1 . ILE H  2 53  ? 35.431  134.583 32.461  1.00 58.34  ? 369  ILE F CG1 1 
ATOM   5602  C CG2 . ILE H  2 53  ? 34.762  133.201 34.479  1.00 42.66  ? 369  ILE F CG2 1 
ATOM   5603  C CD1 . ILE H  2 53  ? 34.215  135.457 32.363  1.00 61.74  ? 369  ILE F CD1 1 
ATOM   5604  N N   . LEU H  2 54  ? 35.384  130.119 32.554  1.00 56.26  ? 370  LEU F N   1 
ATOM   5605  C CA  . LEU H  2 54  ? 35.092  128.762 32.961  1.00 54.24  ? 370  LEU F CA  1 
ATOM   5606  C C   . LEU H  2 54  ? 36.352  127.903 33.035  1.00 58.06  ? 370  LEU F C   1 
ATOM   5607  O O   . LEU H  2 54  ? 36.460  127.019 33.902  1.00 55.66  ? 370  LEU F O   1 
ATOM   5608  C CB  . LEU H  2 54  ? 34.075  128.159 32.011  1.00 50.98  ? 370  LEU F CB  1 
ATOM   5609  C CG  . LEU H  2 54  ? 32.662  128.522 32.440  1.00 43.09  ? 370  LEU F CG  1 
ATOM   5610  C CD1 . LEU H  2 54  ? 31.662  128.093 31.388  1.00 43.84  ? 370  LEU F CD1 1 
ATOM   5611  C CD2 . LEU H  2 54  ? 32.362  127.829 33.752  1.00 22.28  ? 370  LEU F CD2 1 
ATOM   5612  N N   . THR H  2 55  ? 37.301  128.158 32.134  1.00 52.16  ? 371  THR F N   1 
ATOM   5613  C CA  . THR H  2 55  ? 38.564  127.416 32.138  1.00 54.72  ? 371  THR F CA  1 
ATOM   5614  C C   . THR H  2 55  ? 39.323  127.674 33.440  1.00 57.51  ? 371  THR F C   1 
ATOM   5615  O O   . THR H  2 55  ? 39.858  126.741 34.053  1.00 51.04  ? 371  THR F O   1 
ATOM   5616  C CB  . THR H  2 55  ? 39.471  127.847 30.988  1.00 55.33  ? 371  THR F CB  1 
ATOM   5617  O OG1 . THR H  2 55  ? 38.867  127.493 29.745  1.00 64.99  ? 371  THR F OG1 1 
ATOM   5618  C CG2 . THR H  2 55  ? 40.805  127.177 31.103  1.00 52.36  ? 371  THR F CG2 1 
ATOM   5619  N N   . GLU H  2 56  ? 39.379  128.950 33.840  1.00 58.10  ? 372  GLU F N   1 
ATOM   5620  C CA  . GLU H  2 56  ? 40.053  129.353 35.074  1.00 55.30  ? 372  GLU F CA  1 
ATOM   5621  C C   . GLU H  2 56  ? 39.368  128.632 36.234  1.00 49.58  ? 372  GLU F C   1 
ATOM   5622  O O   . GLU H  2 56  ? 40.013  128.206 37.187  1.00 49.40  ? 372  GLU F O   1 
ATOM   5623  C CB  . GLU H  2 56  ? 39.961  130.871 35.263  1.00 62.77  ? 372  GLU F CB  1 
ATOM   5624  C CG  . GLU H  2 56  ? 40.812  131.474 36.410  1.00 70.80  ? 372  GLU F CG  1 
ATOM   5625  C CD  . GLU H  2 56  ? 40.872  133.020 36.365  1.00 74.03  ? 372  GLU F CD  1 
ATOM   5626  O OE1 . GLU H  2 56  ? 39.932  133.703 36.851  1.00 75.08  ? 372  GLU F OE1 1 
ATOM   5627  O OE2 . GLU H  2 56  ? 41.866  133.549 35.824  1.00 64.50  ? 372  GLU F OE2 1 
ATOM   5628  N N   . VAL H  2 57  ? 38.059  128.467 36.140  1.00 38.34  ? 373  VAL F N   1 
ATOM   5629  C CA  . VAL H  2 57  ? 37.355  127.790 37.202  1.00 38.59  ? 373  VAL F CA  1 
ATOM   5630  C C   . VAL H  2 57  ? 37.863  126.365 37.253  1.00 45.39  ? 373  VAL F C   1 
ATOM   5631  O O   . VAL H  2 57  ? 38.123  125.832 38.332  1.00 42.53  ? 373  VAL F O   1 
ATOM   5632  C CB  . VAL H  2 57  ? 35.832  127.789 36.956  1.00 43.56  ? 373  VAL F CB  1 
ATOM   5633  C CG1 . VAL H  2 57  ? 35.100  127.174 38.168  1.00 29.83  ? 373  VAL F CG1 1 
ATOM   5634  C CG2 . VAL H  2 57  ? 35.347  129.205 36.678  1.00 30.49  ? 373  VAL F CG2 1 
ATOM   5635  N N   . ASN H  2 58  ? 37.999  125.748 36.079  1.00 51.84  ? 374  ASN F N   1 
ATOM   5636  C CA  . ASN H  2 58  ? 38.485  124.378 36.008  1.00 51.32  ? 374  ASN F CA  1 
ATOM   5637  C C   . ASN H  2 58  ? 39.844  124.264 36.694  1.00 51.22  ? 374  ASN F C   1 
ATOM   5638  O O   . ASN H  2 58  ? 40.072  123.364 37.513  1.00 41.72  ? 374  ASN F O   1 
ATOM   5639  C CB  . ASN H  2 58  ? 38.593  123.920 34.557  1.00 49.06  ? 374  ASN F CB  1 
ATOM   5640  C CG  . ASN H  2 58  ? 37.281  123.401 34.022  1.00 60.16  ? 374  ASN F CG  1 
ATOM   5641  O OD1 . ASN H  2 58  ? 36.395  122.992 34.796  1.00 58.33  ? 374  ASN F OD1 1 
ATOM   5642  N ND2 . ASN H  2 58  ? 37.147  123.386 32.693  1.00 53.93  ? 374  ASN F ND2 1 
ATOM   5643  N N   . TYR H  2 59  ? 40.740  125.190 36.374  1.00 51.01  ? 375  TYR F N   1 
ATOM   5644  C CA  . TYR H  2 59  ? 42.068  125.177 36.964  1.00 54.73  ? 375  TYR F CA  1 
ATOM   5645  C C   . TYR H  2 59  ? 41.916  125.168 38.479  1.00 60.35  ? 375  TYR F C   1 
ATOM   5646  O O   . TYR H  2 59  ? 42.252  124.198 39.152  1.00 62.95  ? 375  TYR F O   1 
ATOM   5647  C CB  . TYR H  2 59  ? 42.829  126.418 36.510  1.00 55.67  ? 375  TYR F CB  1 
ATOM   5648  C CG  . TYR H  2 59  ? 44.264  126.477 36.970  1.00 72.76  ? 375  TYR F CG  1 
ATOM   5649  C CD1 . TYR H  2 59  ? 44.596  126.348 38.327  1.00 78.44  ? 375  TYR F CD1 1 
ATOM   5650  C CD2 . TYR H  2 59  ? 45.303  126.677 36.047  1.00 73.24  ? 375  TYR F CD2 1 
ATOM   5651  C CE1 . TYR H  2 59  ? 45.925  126.416 38.751  1.00 81.45  ? 375  TYR F CE1 1 
ATOM   5652  C CE2 . TYR H  2 59  ? 46.632  126.746 36.457  1.00 73.53  ? 375  TYR F CE2 1 
ATOM   5653  C CZ  . TYR H  2 59  ? 46.935  126.613 37.805  1.00 80.93  ? 375  TYR F CZ  1 
ATOM   5654  O OH  . TYR H  2 59  ? 48.247  126.660 38.203  1.00 83.18  ? 375  TYR F OH  1 
ATOM   5655  N N   . GLU H  2 60  ? 41.368  126.257 38.999  1.00 65.66  ? 376  GLU F N   1 
ATOM   5656  C CA  . GLU H  2 60  ? 41.159  126.449 40.426  1.00 62.40  ? 376  GLU F CA  1 
ATOM   5657  C C   . GLU H  2 60  ? 40.507  125.292 41.170  1.00 60.61  ? 376  GLU F C   1 
ATOM   5658  O O   . GLU H  2 60  ? 41.021  124.846 42.191  1.00 64.43  ? 376  GLU F O   1 
ATOM   5659  C CB  . GLU H  2 60  ? 40.333  127.718 40.662  1.00 67.25  ? 376  GLU F CB  1 
ATOM   5660  C CG  . GLU H  2 60  ? 41.014  129.026 40.244  1.00 71.34  ? 376  GLU F CG  1 
ATOM   5661  C CD  . GLU H  2 60  ? 42.275  129.302 41.041  1.00 75.61  ? 376  GLU F CD  1 
ATOM   5662  O OE1 . GLU H  2 60  ? 42.253  129.101 42.278  1.00 76.68  ? 376  GLU F OE1 1 
ATOM   5663  O OE2 . GLU H  2 60  ? 43.283  129.728 40.435  1.00 75.43  ? 376  GLU F OE2 1 
ATOM   5664  N N   . VAL H  2 61  ? 39.374  124.807 40.682  1.00 54.34  ? 377  VAL F N   1 
ATOM   5665  C CA  . VAL H  2 61  ? 38.697  123.733 41.387  1.00 52.25  ? 377  VAL F CA  1 
ATOM   5666  C C   . VAL H  2 61  ? 39.526  122.468 41.374  1.00 59.64  ? 377  VAL F C   1 
ATOM   5667  O O   . VAL H  2 61  ? 39.309  121.557 42.188  1.00 57.63  ? 377  VAL F O   1 
ATOM   5668  C CB  . VAL H  2 61  ? 37.321  123.451 40.770  1.00 47.63  ? 377  VAL F CB  1 
ATOM   5669  C CG1 . VAL H  2 61  ? 36.537  122.472 41.657  1.00 37.90  ? 377  VAL F CG1 1 
ATOM   5670  C CG2 . VAL H  2 61  ? 36.564  124.749 40.606  1.00 53.42  ? 377  VAL F CG2 1 
ATOM   5671  N N   . SER H  2 62  ? 40.486  122.408 40.453  1.00 66.04  ? 378  SER F N   1 
ATOM   5672  C CA  . SER H  2 62  ? 41.333  121.220 40.341  1.00 77.45  ? 378  SER F CA  1 
ATOM   5673  C C   . SER H  2 62  ? 42.338  121.144 41.472  1.00 78.10  ? 378  SER F C   1 
ATOM   5674  O O   . SER H  2 62  ? 42.635  120.055 41.986  1.00 75.45  ? 378  SER F O   1 
ATOM   5675  C CB  . SER H  2 62  ? 42.068  121.206 38.999  1.00 79.17  ? 378  SER F CB  1 
ATOM   5676  O OG  . SER H  2 62  ? 41.156  120.993 37.936  1.00 86.99  ? 378  SER F OG  1 
ATOM   5677  N N   . ASN H  2 63  ? 42.849  122.308 41.862  1.00 76.37  ? 379  ASN F N   1 
ATOM   5678  C CA  . ASN H  2 63  ? 43.823  122.383 42.940  1.00 75.29  ? 379  ASN F CA  1 
ATOM   5679  C C   . ASN H  2 63  ? 43.186  122.130 44.300  1.00 73.73  ? 379  ASN F C   1 
ATOM   5680  O O   . ASN H  2 63  ? 43.881  121.832 45.259  1.00 80.36  ? 379  ASN F O   1 
ATOM   5681  C CB  . ASN H  2 63  ? 44.514  123.739 42.917  1.00 72.41  ? 379  ASN F CB  1 
ATOM   5682  C CG  . ASN H  2 63  ? 45.349  123.937 41.669  1.00 80.96  ? 379  ASN F CG  1 
ATOM   5683  O OD1 . ASN H  2 63  ? 44.889  123.699 40.543  1.00 90.48  ? 379  ASN F OD1 1 
ATOM   5684  N ND2 . ASN H  2 63  ? 46.583  124.377 41.857  1.00 85.54  ? 379  ASN F ND2 1 
ATOM   5685  N N   . LYS H  2 64  ? 41.866  122.240 44.385  1.00 75.20  ? 381  LYS F N   1 
ATOM   5686  C CA  . LYS H  2 64  ? 41.170  121.991 45.645  1.00 77.73  ? 381  LYS F CA  1 
ATOM   5687  C C   . LYS H  2 64  ? 41.101  120.493 45.893  1.00 77.95  ? 381  LYS F C   1 
ATOM   5688  O O   . LYS H  2 64  ? 41.192  119.697 44.957  1.00 80.07  ? 381  LYS F O   1 
ATOM   5689  C CB  . LYS H  2 64  ? 39.737  122.540 45.607  1.00 81.90  ? 381  LYS F CB  1 
ATOM   5690  C CG  . LYS H  2 64  ? 39.622  124.052 45.539  1.00 86.95  ? 381  LYS F CG  1 
ATOM   5691  C CD  . LYS H  2 64  ? 38.175  124.495 45.768  1.00 94.19  ? 381  LYS F CD  1 
ATOM   5692  C CE  . LYS H  2 64  ? 38.062  126.019 45.836  1.00 96.65  ? 381  LYS F CE  1 
ATOM   5693  N NZ  . LYS H  2 64  ? 38.903  126.579 46.939  1.00 92.51  ? 381  LYS F NZ  1 
ATOM   5694  N N   . ASP H  2 65  A 40.936  120.110 47.154  1.00 79.97  ? 381  ASP F N   1 
ATOM   5695  C CA  . ASP H  2 65  A 40.826  118.698 47.491  1.00 81.20  ? 381  ASP F CA  1 
ATOM   5696  C C   . ASP H  2 65  A 40.245  118.393 48.856  1.00 79.57  ? 381  ASP F C   1 
ATOM   5697  O O   . ASP H  2 65  A 40.505  119.083 49.851  1.00 77.68  ? 381  ASP F O   1 
ATOM   5698  C CB  . ASP H  2 65  A 42.179  117.986 47.348  1.00 89.41  ? 381  ASP F CB  1 
ATOM   5699  C CG  . ASP H  2 65  A 43.293  118.645 48.157  1.00 93.56  ? 381  ASP F CG  1 
ATOM   5700  O OD1 . ASP H  2 65  A 43.150  118.742 49.401  1.00 94.13  ? 381  ASP F OD1 1 
ATOM   5701  O OD2 . ASP H  2 65  A 44.313  119.055 47.538  1.00 87.62  ? 381  ASP F OD2 1 
ATOM   5702  N N   . ASP H  2 66  B 39.408  117.359 48.847  1.00 83.00  ? 381  ASP F N   1 
ATOM   5703  C CA  . ASP H  2 66  B 38.773  116.851 50.039  1.00 87.91  ? 381  ASP F CA  1 
ATOM   5704  C C   . ASP H  2 66  B 39.973  116.245 50.711  1.00 94.14  ? 381  ASP F C   1 
ATOM   5705  O O   . ASP H  2 66  B 40.439  115.150 50.370  1.00 94.48  ? 381  ASP F O   1 
ATOM   5706  C CB  . ASP H  2 66  B 37.735  115.766 49.715  1.00 86.79  ? 381  ASP F CB  1 
ATOM   5707  C CG  . ASP H  2 66  B 37.095  115.154 50.973  1.00 89.68  ? 381  ASP F CG  1 
ATOM   5708  O OD1 . ASP H  2 66  B 36.643  115.910 51.872  1.00 89.42  ? 381  ASP F OD1 1 
ATOM   5709  O OD2 . ASP H  2 66  B 37.027  113.906 51.053  1.00 85.64  ? 381  ASP F OD2 1 
ATOM   5710  N N   . LYS H  2 67  C 40.498  117.034 51.632  1.00 100.00 ? 381  LYS F N   1 
ATOM   5711  C CA  . LYS H  2 67  C 41.655  116.704 52.441  1.00 100.00 ? 381  LYS F CA  1 
ATOM   5712  C C   . LYS H  2 67  C 41.393  115.379 53.177  1.00 99.78  ? 381  LYS F C   1 
ATOM   5713  O O   . LYS H  2 67  C 42.280  114.526 53.292  1.00 95.74  ? 381  LYS F O   1 
ATOM   5714  C CB  . LYS H  2 67  C 41.870  117.858 53.432  1.00 100.00 ? 381  LYS F CB  1 
ATOM   5715  C CG  . LYS H  2 67  C 41.300  119.231 52.949  1.00 100.00 ? 381  LYS F CG  1 
ATOM   5716  C CD  . LYS H  2 67  C 39.744  119.265 52.906  1.00 100.00 ? 381  LYS F CD  1 
ATOM   5717  C CE  . LYS H  2 67  C 39.172  120.690 52.759  1.00 100.00 ? 381  LYS F CE  1 
ATOM   5718  N NZ  . LYS H  2 67  C 39.313  121.306 51.399  1.00 98.24  ? 381  LYS F NZ  1 
ATOM   5719  N N   . LYS H  2 68  D 40.152  115.234 53.648  1.00 100.00 ? 381  LYS F N   1 
ATOM   5720  C CA  . LYS H  2 68  D 39.673  114.061 54.377  1.00 98.70  ? 381  LYS F CA  1 
ATOM   5721  C C   . LYS H  2 68  D 39.837  112.753 53.616  1.00 100.00 ? 381  LYS F C   1 
ATOM   5722  O O   . LYS H  2 68  D 40.815  112.031 53.805  1.00 100.00 ? 381  LYS F O   1 
ATOM   5723  C CB  . LYS H  2 68  D 38.192  114.228 54.732  1.00 96.59  ? 381  LYS F CB  1 
ATOM   5724  C CG  . LYS H  2 68  D 37.527  112.938 55.185  1.00 97.29  ? 381  LYS F CG  1 
ATOM   5725  C CD  . LYS H  2 68  D 36.031  113.102 55.362  1.00 100.00 ? 381  LYS F CD  1 
ATOM   5726  C CE  . LYS H  2 68  D 35.398  111.788 55.807  1.00 99.08  ? 381  LYS F CE  1 
ATOM   5727  N NZ  . LYS H  2 68  D 33.997  111.966 56.288  1.00 98.29  ? 381  LYS F NZ  1 
ATOM   5728  N N   . ASN H  2 69  E 38.867  112.449 52.756  1.00 100.00 ? 381  ASN F N   1 
ATOM   5729  C CA  . ASN H  2 69  E 38.901  111.204 52.000  1.00 100.00 ? 381  ASN F CA  1 
ATOM   5730  C C   . ASN H  2 69  E 39.583  111.282 50.635  1.00 100.00 ? 381  ASN F C   1 
ATOM   5731  O O   . ASN H  2 69  E 39.082  110.747 49.636  1.00 99.51  ? 381  ASN F O   1 
ATOM   5732  C CB  . ASN H  2 69  E 37.486  110.624 51.854  1.00 100.00 ? 381  ASN F CB  1 
ATOM   5733  C CG  . ASN H  2 69  E 37.495  109.239 51.245  1.00 93.96  ? 381  ASN F CG  1 
ATOM   5734  O OD1 . ASN H  2 69  E 38.471  108.496 51.380  1.00 87.79  ? 381  ASN F OD1 1 
ATOM   5735  N ND2 . ASN H  2 69  E 36.404  108.877 50.582  1.00 92.13  ? 381  ASN F ND2 1 
ATOM   5736  N N   . MET H  2 70  ? 40.724  111.964 50.606  1.00 99.16  ? 382  MET F N   1 
ATOM   5737  C CA  . MET H  2 70  ? 41.528  112.067 49.400  1.00 97.97  ? 382  MET F CA  1 
ATOM   5738  C C   . MET H  2 70  ? 40.725  112.073 48.084  1.00 95.14  ? 382  MET F C   1 
ATOM   5739  O O   . MET H  2 70  ? 40.935  111.211 47.229  1.00 97.47  ? 382  MET F O   1 
ATOM   5740  C CB  . MET H  2 70  ? 42.529  110.898 49.412  1.00 100.00 ? 382  MET F CB  1 
ATOM   5741  C CG  . MET H  2 70  ? 41.850  109.501 49.462  1.00 100.00 ? 382  MET F CG  1 
ATOM   5742  S SD  . MET H  2 70  ? 42.683  108.152 50.368  1.00 100.00 ? 382  MET F SD  1 
ATOM   5743  C CE  . MET H  2 70  ? 41.301  107.423 51.238  1.00 86.87  ? 382  MET F CE  1 
ATOM   5744  N N   . GLY H  2 71  ? 39.795  113.022 47.947  1.00 90.05  ? 383  GLY F N   1 
ATOM   5745  C CA  . GLY H  2 71  ? 38.995  113.178 46.734  1.00 84.72  ? 383  GLY F CA  1 
ATOM   5746  C C   . GLY H  2 71  ? 39.190  114.536 46.066  1.00 80.53  ? 383  GLY F C   1 
ATOM   5747  O O   . GLY H  2 71  ? 39.758  115.462 46.663  1.00 86.92  ? 383  GLY F O   1 
ATOM   5748  N N   . LYS H  2 72  ? 38.728  114.659 44.824  1.00 72.23  ? 384  LYS F N   1 
ATOM   5749  C CA  . LYS H  2 72  ? 38.854  115.911 44.083  1.00 63.32  ? 384  LYS F CA  1 
ATOM   5750  C C   . LYS H  2 72  ? 37.597  116.184 43.275  1.00 61.93  ? 384  LYS F C   1 
ATOM   5751  O O   . LYS H  2 72  ? 36.655  115.376 43.280  1.00 65.17  ? 384  LYS F O   1 
ATOM   5752  C CB  . LYS H  2 72  ? 40.075  115.852 43.182  1.00 58.27  ? 384  LYS F CB  1 
ATOM   5753  C CG  . LYS H  2 72  ? 41.344  115.590 43.962  1.00 49.70  ? 384  LYS F CG  1 
ATOM   5754  C CD  . LYS H  2 72  ? 42.539  115.762 43.081  1.00 56.53  ? 384  LYS F CD  1 
ATOM   5755  C CE  . LYS H  2 72  ? 42.780  117.223 42.779  1.00 47.69  ? 384  LYS F CE  1 
ATOM   5756  N NZ  . LYS H  2 72  ? 43.292  117.921 43.961  1.00 52.25  ? 384  LYS F NZ  1 
ATOM   5757  N N   . GLN H  2 73  ? 37.573  117.319 42.582  1.00 60.36  ? 385  GLN F N   1 
ATOM   5758  C CA  . GLN H  2 73  ? 36.397  117.699 41.795  1.00 62.10  ? 385  GLN F CA  1 
ATOM   5759  C C   . GLN H  2 73  ? 36.798  118.222 40.431  1.00 57.59  ? 385  GLN F C   1 
ATOM   5760  O O   . GLN H  2 73  ? 37.680  119.080 40.331  1.00 57.91  ? 385  GLN F O   1 
ATOM   5761  C CB  . GLN H  2 73  ? 35.604  118.781 42.545  1.00 70.24  ? 385  GLN F CB  1 
ATOM   5762  C CG  . GLN H  2 73  ? 34.320  119.210 41.865  1.00 79.60  ? 385  GLN F CG  1 
ATOM   5763  C CD  . GLN H  2 73  ? 33.482  120.152 42.715  1.00 82.98  ? 385  GLN F CD  1 
ATOM   5764  O OE1 . GLN H  2 73  ? 33.119  119.829 43.846  1.00 83.18  ? 385  GLN F OE1 1 
ATOM   5765  N NE2 . GLN H  2 73  ? 33.166  121.322 42.168  1.00 88.02  ? 385  GLN F NE2 1 
ATOM   5766  N N   . MET H  2 74  ? 36.154  117.706 39.383  1.00 59.00  ? 386  MET F N   1 
ATOM   5767  C CA  . MET H  2 74  ? 36.444  118.143 38.005  1.00 61.09  ? 386  MET F CA  1 
ATOM   5768  C C   . MET H  2 74  ? 35.203  118.721 37.305  1.00 63.65  ? 386  MET F C   1 
ATOM   5769  O O   . MET H  2 74  ? 34.288  117.975 36.920  1.00 55.61  ? 386  MET F O   1 
ATOM   5770  C CB  . MET H  2 74  ? 37.003  116.978 37.178  1.00 50.99  ? 386  MET F CB  1 
ATOM   5771  C CG  . MET H  2 74  ? 37.431  117.371 35.787  1.00 45.77  ? 386  MET F CG  1 
ATOM   5772  S SD  . MET H  2 74  ? 38.855  118.458 35.772  1.00 63.52  ? 386  MET F SD  1 
ATOM   5773  C CE  . MET H  2 74  ? 38.170  120.008 35.300  1.00 59.32  ? 386  MET F CE  1 
ATOM   5774  N N   . PRO H  2 75  ? 35.146  120.066 37.166  1.00 67.26  ? 387  PRO F N   1 
ATOM   5775  C CA  . PRO H  2 75  ? 34.040  120.790 36.524  1.00 64.87  ? 387  PRO F CA  1 
ATOM   5776  C C   . PRO H  2 75  ? 34.057  120.482 35.042  1.00 63.68  ? 387  PRO F C   1 
ATOM   5777  O O   . PRO H  2 75  ? 35.120  120.243 34.490  1.00 65.33  ? 387  PRO F O   1 
ATOM   5778  C CB  . PRO H  2 75  ? 34.380  122.248 36.797  1.00 65.12  ? 387  PRO F CB  1 
ATOM   5779  C CG  . PRO H  2 75  ? 35.144  122.187 38.076  1.00 66.73  ? 387  PRO F CG  1 
ATOM   5780  C CD  . PRO H  2 75  ? 36.051  121.017 37.838  1.00 67.45  ? 387  PRO F CD  1 
ATOM   5781  N N   . GLN H  2 76  ? 32.896  120.521 34.389  1.00 65.53  ? 388  GLN F N   1 
ATOM   5782  C CA  . GLN H  2 76  ? 32.842  120.186 32.974  1.00 54.14  ? 388  GLN F CA  1 
ATOM   5783  C C   . GLN H  2 76  ? 31.836  120.936 32.119  1.00 46.42  ? 388  GLN F C   1 
ATOM   5784  O O   . GLN H  2 76  ? 30.677  120.503 31.961  1.00 43.44  ? 388  GLN F O   1 
ATOM   5785  C CB  . GLN H  2 76  ? 32.570  118.695 32.838  1.00 58.05  ? 388  GLN F CB  1 
ATOM   5786  C CG  . GLN H  2 76  ? 32.747  118.154 31.445  1.00 57.25  ? 388  GLN F CG  1 
ATOM   5787  C CD  . GLN H  2 76  ? 32.050  116.830 31.296  1.00 56.35  ? 388  GLN F CD  1 
ATOM   5788  O OE1 . GLN H  2 76  ? 32.245  115.914 32.095  1.00 51.55  ? 388  GLN F OE1 1 
ATOM   5789  N NE2 . GLN H  2 76  ? 31.215  116.723 30.282  1.00 61.03  ? 388  GLN F NE2 1 
ATOM   5790  N N   . PRO H  2 77  ? 32.262  122.068 31.553  1.00 32.76  ? 389  PRO F N   1 
ATOM   5791  C CA  . PRO H  2 77  ? 31.362  122.843 30.695  1.00 36.68  ? 389  PRO F CA  1 
ATOM   5792  C C   . PRO H  2 77  ? 31.139  122.205 29.310  1.00 41.07  ? 389  PRO F C   1 
ATOM   5793  O O   . PRO H  2 77  ? 31.998  121.503 28.777  1.00 47.08  ? 389  PRO F O   1 
ATOM   5794  C CB  . PRO H  2 77  ? 32.058  124.203 30.589  1.00 36.27  ? 389  PRO F CB  1 
ATOM   5795  C CG  . PRO H  2 77  ? 33.507  123.901 30.811  1.00 30.21  ? 389  PRO F CG  1 
ATOM   5796  C CD  . PRO H  2 77  ? 33.476  122.820 31.886  1.00 24.12  ? 389  PRO F CD  1 
ATOM   5797  N N   . THR H  2 78  ? 29.970  122.451 28.745  1.00 42.38  ? 390  THR F N   1 
ATOM   5798  C CA  . THR H  2 78  ? 29.616  121.966 27.416  1.00 44.34  ? 390  THR F CA  1 
ATOM   5799  C C   . THR H  2 78  ? 28.919  123.120 26.711  1.00 44.16  ? 390  THR F C   1 
ATOM   5800  O O   . THR H  2 78  ? 28.150  123.833 27.331  1.00 43.81  ? 390  THR F O   1 
ATOM   5801  C CB  . THR H  2 78  ? 28.653  120.846 27.500  1.00 39.84  ? 390  THR F CB  1 
ATOM   5802  O OG1 . THR H  2 78  ? 29.160  119.872 28.425  1.00 42.68  ? 390  THR F OG1 1 
ATOM   5803  C CG2 . THR H  2 78  ? 28.458  120.251 26.104  1.00 34.95  ? 390  THR F CG2 1 
ATOM   5804  N N   . PHE H  2 79  ? 29.142  123.307 25.424  1.00 40.89  ? 392  PHE F N   1 
ATOM   5805  C CA  . PHE H  2 79  ? 28.500  124.442 24.824  1.00 36.39  ? 392  PHE F CA  1 
ATOM   5806  C C   . PHE H  2 79  ? 28.209  124.394 23.345  1.00 38.17  ? 392  PHE F C   1 
ATOM   5807  O O   . PHE H  2 79  ? 28.882  123.704 22.582  1.00 39.29  ? 392  PHE F O   1 
ATOM   5808  C CB  . PHE H  2 79  ? 29.348  125.659 25.122  1.00 32.49  ? 392  PHE F CB  1 
ATOM   5809  C CG  . PHE H  2 79  ? 30.678  125.667 24.414  1.00 32.70  ? 392  PHE F CG  1 
ATOM   5810  C CD1 . PHE H  2 79  ? 31.800  125.083 25.003  1.00 43.35  ? 392  PHE F CD1 1 
ATOM   5811  C CD2 . PHE H  2 79  ? 30.837  126.323 23.191  1.00 29.71  ? 392  PHE F CD2 1 
ATOM   5812  C CE1 . PHE H  2 79  ? 33.080  125.160 24.387  1.00 28.00  ? 392  PHE F CE1 1 
ATOM   5813  C CE2 . PHE H  2 79  ? 32.106  126.408 22.562  1.00 27.30  ? 392  PHE F CE2 1 
ATOM   5814  C CZ  . PHE H  2 79  ? 33.225  125.826 23.165  1.00 25.45  ? 392  PHE F CZ  1 
ATOM   5815  N N   . THR H  2 80  ? 27.185  125.138 22.947  1.00 38.06  ? 393  THR F N   1 
ATOM   5816  C CA  . THR H  2 80  ? 26.851  125.233 21.543  1.00 39.81  ? 393  THR F CA  1 
ATOM   5817  C C   . THR H  2 80  ? 26.923  126.703 21.156  1.00 40.07  ? 393  THR F C   1 
ATOM   5818  O O   . THR H  2 80  ? 26.427  127.087 20.106  1.00 43.41  ? 393  THR F O   1 
ATOM   5819  C CB  . THR H  2 80  ? 25.464  124.664 21.234  1.00 36.79  ? 393  THR F CB  1 
ATOM   5820  O OG1 . THR H  2 80  ? 24.490  125.291 22.065  1.00 33.78  ? 393  THR F OG1 1 
ATOM   5821  C CG2 . THR H  2 80  ? 25.452  123.168 21.487  1.00 39.88  ? 393  THR F CG2 1 
ATOM   5822  N N   . LEU H  2 81  ? 27.564  127.516 22.001  1.00 33.60  ? 394  LEU F N   1 
ATOM   5823  C CA  . LEU H  2 81  ? 27.708  128.944 21.740  1.00 29.54  ? 394  LEU F CA  1 
ATOM   5824  C C   . LEU H  2 81  ? 28.330  129.177 20.379  1.00 28.94  ? 394  LEU F C   1 
ATOM   5825  O O   . LEU H  2 81  ? 29.276  128.501 20.024  1.00 34.80  ? 394  LEU F O   1 
ATOM   5826  C CB  . LEU H  2 81  ? 28.577  129.595 22.810  1.00 34.88  ? 394  LEU F CB  1 
ATOM   5827  C CG  . LEU H  2 81  ? 28.148  129.460 24.276  1.00 41.60  ? 394  LEU F CG  1 
ATOM   5828  C CD1 . LEU H  2 81  ? 29.124  130.238 25.121  1.00 46.03  ? 394  LEU F CD1 1 
ATOM   5829  C CD2 . LEU H  2 81  ? 26.743  129.982 24.502  1.00 35.56  ? 394  LEU F CD2 1 
ATOM   5830  N N   . ARG H  2 82  ? 27.807  130.136 19.618  1.00 33.14  ? 395  ARG F N   1 
ATOM   5831  C CA  . ARG H  2 82  ? 28.339  130.400 18.287  1.00 38.06  ? 395  ARG F CA  1 
ATOM   5832  C C   . ARG H  2 82  ? 29.132  131.680 18.245  1.00 40.00  ? 395  ARG F C   1 
ATOM   5833  O O   . ARG H  2 82  ? 29.643  132.075 17.193  1.00 39.46  ? 395  ARG F O   1 
ATOM   5834  C CB  . ARG H  2 82  ? 27.212  130.462 17.245  1.00 39.61  ? 395  ARG F CB  1 
ATOM   5835  C CG  . ARG H  2 82  ? 26.366  129.206 17.166  1.00 42.14  ? 395  ARG F CG  1 
ATOM   5836  C CD  . ARG H  2 82  ? 25.167  129.389 16.272  1.00 46.88  ? 395  ARG F CD  1 
ATOM   5837  N NE  . ARG H  2 82  ? 24.422  130.588 16.638  1.00 58.02  ? 395  ARG F NE  1 
ATOM   5838  C CZ  . ARG H  2 82  ? 24.434  131.714 15.935  1.00 53.11  ? 395  ARG F CZ  1 
ATOM   5839  N NH1 . ARG H  2 82  ? 25.146  131.802 14.814  1.00 58.26  ? 395  ARG F NH1 1 
ATOM   5840  N NH2 . ARG H  2 82  ? 23.755  132.754 16.375  1.00 57.14  ? 395  ARG F NH2 1 
ATOM   5841  N N   . LYS H  2 83  ? 29.229  132.336 19.392  1.00 46.45  ? 396  LYS F N   1 
ATOM   5842  C CA  . LYS H  2 83  ? 29.962  133.595 19.478  1.00 53.01  ? 396  LYS F CA  1 
ATOM   5843  C C   . LYS H  2 83  ? 30.618  133.610 20.818  1.00 53.50  ? 396  LYS F C   1 
ATOM   5844  O O   . LYS H  2 83  ? 30.370  132.718 21.640  1.00 55.14  ? 396  LYS F O   1 
ATOM   5845  C CB  . LYS H  2 83  ? 29.025  134.813 19.420  1.00 59.01  ? 396  LYS F CB  1 
ATOM   5846  C CG  . LYS H  2 83  ? 28.178  134.955 18.156  1.00 70.53  ? 396  LYS F CG  1 
ATOM   5847  C CD  . LYS H  2 83  ? 27.446  136.297 18.109  1.00 71.83  ? 396  LYS F CD  1 
ATOM   5848  C CE  . LYS H  2 83  ? 26.581  136.417 16.858  1.00 71.87  ? 396  LYS F CE  1 
ATOM   5849  N NZ  . LYS H  2 83  ? 26.126  137.810 16.606  1.00 69.66  ? 396  LYS F NZ  1 
ATOM   5850  N N   . LYS H  2 84  ? 31.454  134.618 21.043  1.00 49.84  ? 397  LYS F N   1 
ATOM   5851  C CA  . LYS H  2 84  ? 32.096  134.738 22.328  1.00 52.27  ? 397  LYS F CA  1 
ATOM   5852  C C   . LYS H  2 84  ? 31.058  135.343 23.251  1.00 51.55  ? 397  LYS F C   1 
ATOM   5853  O O   . LYS H  2 84  ? 30.411  136.326 22.903  1.00 64.87  ? 397  LYS F O   1 
ATOM   5854  C CB  . LYS H  2 84  ? 33.311  135.640 22.231  1.00 58.41  ? 397  LYS F CB  1 
ATOM   5855  C CG  . LYS H  2 84  ? 34.538  134.960 21.694  1.00 66.71  ? 397  LYS F CG  1 
ATOM   5856  C CD  . LYS H  2 84  ? 35.785  135.547 22.319  1.00 77.97  ? 397  LYS F CD  1 
ATOM   5857  C CE  . LYS H  2 84  ? 37.009  134.725 21.975  1.00 83.79  ? 397  LYS F CE  1 
ATOM   5858  N NZ  . LYS H  2 84  ? 38.152  135.122 22.835  1.00 97.28  ? 397  LYS F NZ  1 
ATOM   5859  N N   . LEU H  2 85  ? 30.861  134.742 24.405  1.00 44.38  ? 398  LEU F N   1 
ATOM   5860  C CA  . LEU H  2 85  ? 29.891  135.276 25.336  1.00 58.10  ? 398  LEU F CA  1 
ATOM   5861  C C   . LEU H  2 85  ? 30.626  136.111 26.369  1.00 67.85  ? 398  LEU F C   1 
ATOM   5862  O O   . LEU H  2 85  ? 31.365  135.576 27.199  1.00 72.64  ? 398  LEU F O   1 
ATOM   5863  C CB  . LEU H  2 85  ? 29.135  134.151 26.050  1.00 51.87  ? 398  LEU F CB  1 
ATOM   5864  C CG  . LEU H  2 85  ? 28.258  134.595 27.228  1.00 44.85  ? 398  LEU F CG  1 
ATOM   5865  C CD1 . LEU H  2 85  ? 27.230  135.590 26.720  1.00 49.24  ? 398  LEU F CD1 1 
ATOM   5866  C CD2 . LEU H  2 85  ? 27.567  133.408 27.863  1.00 45.27  ? 398  LEU F CD2 1 
ATOM   5867  N N   . VAL H  2 86  ? 30.426  137.421 26.331  1.00 71.42  ? 399  VAL F N   1 
ATOM   5868  C CA  . VAL H  2 86  ? 31.084  138.287 27.299  1.00 71.92  ? 399  VAL F CA  1 
ATOM   5869  C C   . VAL H  2 86  ? 30.057  139.104 28.083  1.00 71.53  ? 399  VAL F C   1 
ATOM   5870  O O   . VAL H  2 86  ? 29.047  139.538 27.534  1.00 72.29  ? 399  VAL F O   1 
ATOM   5871  C CB  . VAL H  2 86  ? 32.075  139.220 26.591  1.00 70.67  ? 399  VAL F CB  1 
ATOM   5872  C CG1 . VAL H  2 86  ? 31.397  139.856 25.402  1.00 73.20  ? 399  VAL F CG1 1 
ATOM   5873  C CG2 . VAL H  2 86  ? 32.586  140.271 27.553  1.00 66.08  ? 399  VAL F CG2 1 
ATOM   5874  N N   . PHE H  2 87  ? 30.330  139.296 29.370  1.00 72.43  ? 400  PHE F N   1 
ATOM   5875  C CA  . PHE H  2 87  ? 29.458  140.050 30.272  1.00 73.26  ? 400  PHE F CA  1 
ATOM   5876  C C   . PHE H  2 87  ? 30.066  141.387 30.711  1.00 77.95  ? 400  PHE F C   1 
ATOM   5877  O O   . PHE H  2 87  ? 30.625  141.507 31.816  1.00 75.91  ? 400  PHE F O   1 
ATOM   5878  C CB  . PHE H  2 87  ? 29.165  139.223 31.516  1.00 63.69  ? 400  PHE F CB  1 
ATOM   5879  C CG  . PHE H  2 87  ? 28.380  138.003 31.243  1.00 60.31  ? 400  PHE F CG  1 
ATOM   5880  C CD1 . PHE H  2 87  ? 27.500  137.958 30.164  1.00 58.37  ? 400  PHE F CD1 1 
ATOM   5881  C CD2 . PHE H  2 87  ? 28.494  136.897 32.074  1.00 61.10  ? 400  PHE F CD2 1 
ATOM   5882  C CE1 . PHE H  2 87  ? 26.738  136.823 29.918  1.00 61.87  ? 400  PHE F CE1 1 
ATOM   5883  C CE2 . PHE H  2 87  ? 27.738  135.750 31.836  1.00 61.87  ? 400  PHE F CE2 1 
ATOM   5884  C CZ  . PHE H  2 87  ? 26.856  135.712 30.755  1.00 61.22  ? 400  PHE F CZ  1 
ATOM   5885  N N   . PRO H  2 88  ? 29.954  142.414 29.855  1.00 80.35  ? 401  PRO F N   1 
ATOM   5886  C CA  . PRO H  2 88  ? 30.496  143.735 30.173  1.00 81.05  ? 401  PRO F CA  1 
ATOM   5887  C C   . PRO H  2 88  ? 29.947  144.257 31.488  1.00 84.55  ? 401  PRO F C   1 
ATOM   5888  O O   . PRO H  2 88  ? 28.828  143.934 31.888  1.00 80.50  ? 401  PRO F O   1 
ATOM   5889  C CB  . PRO H  2 88  ? 30.076  144.581 28.974  1.00 79.76  ? 401  PRO F CB  1 
ATOM   5890  C CG  . PRO H  2 88  ? 28.842  143.896 28.487  1.00 83.79  ? 401  PRO F CG  1 
ATOM   5891  C CD  . PRO H  2 88  ? 29.207  142.442 28.587  1.00 80.35  ? 401  PRO F CD  1 
ATOM   5892  N N   . SER H  2 89  ? 30.759  145.060 32.162  1.00 94.09  ? 402  SER F N   1 
ATOM   5893  C CA  . SER H  2 89  ? 30.394  145.632 33.453  1.00 99.36  ? 402  SER F CA  1 
ATOM   5894  C C   . SER H  2 89  ? 30.338  147.171 33.415  1.00 100.00 ? 402  SER F C   1 
ATOM   5895  O O   . SER H  2 89  ? 29.247  147.742 33.658  1.00 100.00 ? 402  SER F O   1 
ATOM   5896  C CB  . SER H  2 89  ? 31.403  145.154 34.508  1.00 98.49  ? 402  SER F CB  1 
ATOM   5897  O OG  . SER H  2 89  ? 31.079  145.638 35.798  1.00 100.00 ? 402  SER F OG  1 
HETATM 5898  C C1  . PHQ I  3 1   ? 34.521  120.394 55.090  1.00 100.00 ? 4300 PHQ S C1  1 
HETATM 5899  O O1  . PHQ I  3 1   ? 35.422  119.537 55.247  1.00 100.00 ? 4300 PHQ S O1  1 
HETATM 5900  O O2  . PHQ I  3 1   ? 34.174  121.373 56.070  1.00 100.00 ? 4300 PHQ S O2  1 
HETATM 5901  C C2  . PHQ I  3 1   ? 34.854  121.482 57.346  1.00 100.00 ? 4300 PHQ S C2  1 
HETATM 5902  C C3  . PHQ I  3 1   ? 34.169  122.581 58.141  1.00 100.00 ? 4300 PHQ S C3  1 
HETATM 5903  C C4  . PHQ I  3 1   ? 32.992  122.269 58.955  1.00 100.00 ? 4300 PHQ S C4  1 
HETATM 5904  C C5  . PHQ I  3 1   ? 32.322  123.323 59.715  1.00 100.00 ? 4300 PHQ S C5  1 
HETATM 5905  C C6  . PHQ I  3 1   ? 32.816  124.699 59.671  1.00 100.00 ? 4300 PHQ S C6  1 
HETATM 5906  C C7  . PHQ I  3 1   ? 33.989  125.028 58.861  1.00 99.97  ? 4300 PHQ S C7  1 
HETATM 5907  C C8  . PHQ I  3 1   ? 34.659  123.967 58.100  1.00 99.95  ? 4300 PHQ S C8  1 
ATOM   5908  N N   . ASP I  3 2   ? 33.808  120.450 54.017  1.00 93.91  ? 4301 ASP S N   1 
ATOM   5909  C CA  . ASP I  3 2   ? 33.985  119.510 52.938  1.00 85.39  ? 4301 ASP S CA  1 
ATOM   5910  C C   . ASP I  3 2   ? 32.682  118.591 53.034  1.00 91.01  ? 4301 ASP S C   1 
ATOM   5911  O O   . ASP I  3 2   ? 32.511  117.880 54.047  1.00 91.73  ? 4301 ASP S O   1 
ATOM   5912  C CB  . ASP I  3 2   ? 34.219  120.242 51.621  1.00 79.76  ? 4301 ASP S CB  1 
ATOM   5913  C CG  . ASP I  3 2   ? 35.521  121.089 51.586  1.00 84.55  ? 4301 ASP S CG  1 
ATOM   5914  O OD1 . ASP I  3 2   ? 35.488  122.388 51.487  1.00 75.53  ? 4301 ASP S OD1 1 
ATOM   5915  O OD2 . ASP I  3 2   ? 36.661  120.495 51.650  1.00 89.40  ? 4301 ASP S OD2 1 
ATOM   5916  N N   . GLU I  3 3   ? 31.751  118.707 52.033  1.00 89.69  ? 4302 GLU S N   1 
ATOM   5917  C CA  . GLU I  3 3   ? 30.410  117.967 52.004  1.00 87.60  ? 4302 GLU S CA  1 
ATOM   5918  C C   . GLU I  3 3   ? 30.004  117.564 50.569  1.00 85.03  ? 4302 GLU S C   1 
ATOM   5919  O O   . GLU I  3 3   ? 30.335  118.273 49.589  1.00 79.78  ? 4302 GLU S O   1 
ATOM   5920  C CB  . GLU I  3 3   ? 29.280  118.853 52.575  1.00 93.82  ? 4302 GLU S CB  1 
ATOM   5921  C CG  . GLU I  3 3   ? 28.738  118.390 53.939  1.00 98.27  ? 4302 GLU S CG  1 
ATOM   5922  C CD  . GLU I  3 3   ? 28.745  119.510 55.010  1.00 100.00 ? 4302 GLU S CD  1 
ATOM   5923  O OE1 . GLU I  3 3   ? 29.879  119.912 55.516  1.00 100.00 ? 4302 GLU S OE1 1 
ATOM   5924  O OE2 . GLU I  3 3   ? 27.630  120.067 55.411  1.00 98.95  ? 4302 GLU S OE2 1 
ATOM   5925  N N   . VAL I  3 4   ? 29.283  116.408 50.437  1.00 80.65  ? 4303 VAL S N   1 
ATOM   5926  C CA  . VAL I  3 4   ? 28.870  115.942 49.059  1.00 80.72  ? 4303 VAL S CA  1 
ATOM   5927  C C   . VAL I  3 4   ? 27.384  115.901 48.737  1.00 85.93  ? 4303 VAL S C   1 
ATOM   5928  O O   . VAL I  3 4   ? 26.578  115.958 49.654  1.00 79.59  ? 4303 VAL S O   1 
ATOM   5929  C CB  . VAL I  3 4   ? 29.503  114.557 48.737  1.00 67.87  ? 4303 VAL S CB  1 
ATOM   5930  C CG1 . VAL I  3 4   ? 31.013  114.524 48.984  1.00 59.97  ? 4303 VAL S CG1 1 
ATOM   5931  C CG2 . VAL I  3 4   ? 28.950  113.395 49.579  1.00 52.38  ? 4303 VAL S CG2 1 
HETATM 5932  N N   . ASA I  3 5   ? 27.266  116.640 47.783  1.00 88.80  ? 4304 ASA S N   1 
HETATM 5933  C CA  . ASA I  3 5   ? 25.951  116.816 47.125  1.00 87.63  ? 4304 ASA S CA  1 
HETATM 5934  C C   . ASA I  3 5   ? 25.644  115.560 46.279  1.00 89.46  ? 4304 ASA S C   1 
HETATM 5935  O O   . ASA I  3 5   ? 24.422  115.115 46.019  1.00 68.90  ? 4304 ASA S O   1 
HETATM 5936  C CB  . ASA I  3 5   ? 26.018  118.044 46.183  1.00 90.62  ? 4304 ASA S CB  1 
HETATM 5937  C CG  . ASA I  3 5   ? 26.002  119.412 46.874  1.00 96.21  ? 4304 ASA S CG  1 
HETATM 5938  O OD1 . ASA I  3 5   ? 25.106  119.645 47.721  1.00 100.00 ? 4304 ASA S OD1 1 
HETATM 5939  O OD2 . ASA I  3 5   ? 26.877  120.273 46.544  1.00 95.71  ? 4304 ASA S OD2 1 
ATOM   5940  N N   . LEU J  1 1   ? 48.408  136.867 30.940  1.00 96.98  ? 149  LEU G N   1 
ATOM   5941  C CA  . LEU J  1 1   ? 48.698  136.277 32.280  1.00 96.02  ? 149  LEU G CA  1 
ATOM   5942  C C   . LEU J  1 1   ? 47.798  135.061 32.541  1.00 97.44  ? 149  LEU G C   1 
ATOM   5943  O O   . LEU J  1 1   ? 47.572  134.670 33.695  1.00 96.54  ? 149  LEU G O   1 
ATOM   5944  C CB  . LEU J  1 1   ? 48.498  137.339 33.372  1.00 97.08  ? 149  LEU G CB  1 
ATOM   5945  C CG  . LEU J  1 1   ? 48.844  136.979 34.825  1.00 98.62  ? 149  LEU G CG  1 
ATOM   5946  C CD1 . LEU J  1 1   ? 50.292  136.521 34.921  1.00 89.96  ? 149  LEU G CD1 1 
ATOM   5947  C CD2 . LEU J  1 1   ? 48.604  138.187 35.724  1.00 97.06  ? 149  LEU G CD2 1 
ATOM   5948  N N   . ASP J  1 2   ? 47.278  134.470 31.466  1.00 94.77  ? 150  ASP G N   1 
ATOM   5949  C CA  . ASP J  1 2   ? 46.426  133.287 31.588  1.00 92.80  ? 150  ASP G CA  1 
ATOM   5950  C C   . ASP J  1 2   ? 47.323  132.058 31.462  1.00 87.97  ? 150  ASP G C   1 
ATOM   5951  O O   . ASP J  1 2   ? 48.238  132.043 30.637  1.00 84.54  ? 150  ASP G O   1 
ATOM   5952  C CB  . ASP J  1 2   ? 45.373  133.221 30.465  1.00 97.66  ? 150  ASP G CB  1 
ATOM   5953  C CG  . ASP J  1 2   ? 44.587  134.505 30.305  1.00 100.00 ? 150  ASP G CG  1 
ATOM   5954  O OD1 . ASP J  1 2   ? 44.129  135.049 31.333  1.00 100.00 ? 150  ASP G OD1 1 
ATOM   5955  O OD2 . ASP J  1 2   ? 44.419  134.958 29.146  1.00 100.00 ? 150  ASP G OD2 1 
ATOM   5956  N N   . LYS J  1 3   ? 47.065  131.034 32.272  1.00 84.21  ? 151  LYS G N   1 
ATOM   5957  C CA  . LYS J  1 3   ? 47.842  129.802 32.201  1.00 78.76  ? 151  LYS G CA  1 
ATOM   5958  C C   . LYS J  1 3   ? 47.629  129.185 30.807  1.00 80.09  ? 151  LYS G C   1 
ATOM   5959  O O   . LYS J  1 3   ? 46.546  129.295 30.221  1.00 81.04  ? 151  LYS G O   1 
ATOM   5960  C CB  . LYS J  1 3   ? 47.361  128.808 33.258  1.00 75.08  ? 151  LYS G CB  1 
ATOM   5961  C CG  . LYS J  1 3   ? 47.308  129.340 34.664  1.00 78.81  ? 151  LYS G CG  1 
ATOM   5962  C CD  . LYS J  1 3   ? 48.687  129.390 35.292  1.00 93.15  ? 151  LYS G CD  1 
ATOM   5963  C CE  . LYS J  1 3   ? 48.623  129.853 36.752  1.00 96.87  ? 151  LYS G CE  1 
ATOM   5964  N NZ  . LYS J  1 3   ? 49.966  129.892 37.420  1.00 96.42  ? 151  LYS G NZ  1 
ATOM   5965  N N   . VAL J  1 4   ? 48.658  128.537 30.274  1.00 78.67  ? 152  VAL G N   1 
ATOM   5966  C CA  . VAL J  1 4   ? 48.548  127.909 28.965  1.00 72.46  ? 152  VAL G CA  1 
ATOM   5967  C C   . VAL J  1 4   ? 49.241  126.562 28.960  1.00 75.65  ? 152  VAL G C   1 
ATOM   5968  O O   . VAL J  1 4   ? 50.208  126.343 29.695  1.00 80.52  ? 152  VAL G O   1 
ATOM   5969  C CB  . VAL J  1 4   ? 49.171  128.788 27.857  1.00 64.65  ? 152  VAL G CB  1 
ATOM   5970  C CG1 . VAL J  1 4   ? 49.096  128.085 26.528  1.00 58.93  ? 152  VAL G CG1 1 
ATOM   5971  C CG2 . VAL J  1 4   ? 48.446  130.104 27.781  1.00 60.09  ? 152  VAL G CG2 1 
ATOM   5972  N N   . TYR J  1 5   ? 48.727  125.648 28.146  1.00 77.42  ? 153  TYR G N   1 
ATOM   5973  C CA  . TYR J  1 5   ? 49.329  124.331 28.023  1.00 73.20  ? 153  TYR G CA  1 
ATOM   5974  C C   . TYR J  1 5   ? 50.602  124.471 27.209  1.00 74.97  ? 153  TYR G C   1 
ATOM   5975  O O   . TYR J  1 5   ? 50.609  125.087 26.131  1.00 73.86  ? 153  TYR G O   1 
ATOM   5976  C CB  . TYR J  1 5   ? 48.381  123.381 27.318  1.00 65.61  ? 153  TYR G CB  1 
ATOM   5977  C CG  . TYR J  1 5   ? 47.287  122.873 28.205  1.00 59.81  ? 153  TYR G CG  1 
ATOM   5978  C CD1 . TYR J  1 5   ? 47.585  122.281 29.425  1.00 49.00  ? 153  TYR G CD1 1 
ATOM   5979  C CD2 . TYR J  1 5   ? 45.953  122.939 27.805  1.00 54.78  ? 153  TYR G CD2 1 
ATOM   5980  C CE1 . TYR J  1 5   ? 46.575  121.756 30.230  1.00 50.37  ? 153  TYR G CE1 1 
ATOM   5981  C CE2 . TYR J  1 5   ? 44.943  122.418 28.603  1.00 52.27  ? 153  TYR G CE2 1 
ATOM   5982  C CZ  . TYR J  1 5   ? 45.264  121.823 29.814  1.00 45.91  ? 153  TYR G CZ  1 
ATOM   5983  O OH  . TYR J  1 5   ? 44.285  121.256 30.589  1.00 48.02  ? 153  TYR G OH  1 
ATOM   5984  N N   . GLN J  1 6   ? 51.683  123.916 27.742  1.00 72.35  ? 154  GLN G N   1 
ATOM   5985  C CA  . GLN J  1 6   ? 52.959  123.962 27.055  1.00 71.86  ? 154  GLN G CA  1 
ATOM   5986  C C   . GLN J  1 6   ? 52.827  123.189 25.732  1.00 67.81  ? 154  GLN G C   1 
ATOM   5987  O O   . GLN J  1 6   ? 52.196  122.112 25.676  1.00 49.82  ? 154  GLN G O   1 
ATOM   5988  C CB  . GLN J  1 6   ? 54.025  123.328 27.939  1.00 76.62  ? 154  GLN G CB  1 
ATOM   5989  C CG  . GLN J  1 6   ? 55.435  123.448 27.414  1.00 81.47  ? 154  GLN G CG  1 
ATOM   5990  C CD  . GLN J  1 6   ? 56.442  122.798 28.343  1.00 88.80  ? 154  GLN G CD  1 
ATOM   5991  O OE1 . GLN J  1 6   ? 56.466  121.575 28.496  1.00 91.17  ? 154  GLN G OE1 1 
ATOM   5992  N NE2 . GLN J  1 6   ? 57.272  123.618 28.982  1.00 92.91  ? 154  GLN G NE2 1 
ATOM   5993  N N   . MET J  1 7   ? 53.405  123.756 24.676  1.00 64.57  ? 155  MET G N   1 
ATOM   5994  C CA  . MET J  1 7   ? 53.362  123.133 23.367  1.00 71.49  ? 155  MET G CA  1 
ATOM   5995  C C   . MET J  1 7   ? 54.615  123.365 22.531  1.00 75.52  ? 155  MET G C   1 
ATOM   5996  O O   . MET J  1 7   ? 54.550  123.990 21.465  1.00 73.47  ? 155  MET G O   1 
ATOM   5997  C CB  . MET J  1 7   ? 52.142  123.624 22.599  1.00 70.75  ? 155  MET G CB  1 
ATOM   5998  C CG  . MET J  1 7   ? 50.841  123.028 23.097  1.00 75.43  ? 155  MET G CG  1 
ATOM   5999  S SD  . MET J  1 7   ? 50.687  121.256 22.742  1.00 74.43  ? 155  MET G SD  1 
ATOM   6000  C CE  . MET J  1 7   ? 50.462  121.355 21.006  1.00 64.26  ? 155  MET G CE  1 
ATOM   6001  N N   . LYS J  1 8   ? 55.750  122.853 23.008  1.00 76.52  ? 156  LYS G N   1 
ATOM   6002  C CA  . LYS J  1 8   ? 57.016  122.998 22.293  1.00 76.25  ? 156  LYS G CA  1 
ATOM   6003  C C   . LYS J  1 8   ? 57.460  121.638 21.776  1.00 74.74  ? 156  LYS G C   1 
ATOM   6004  O O   . LYS J  1 8   ? 57.869  121.518 20.626  1.00 73.62  ? 156  LYS G O   1 
ATOM   6005  C CB  . LYS J  1 8   ? 58.079  123.594 23.215  1.00 78.93  ? 156  LYS G CB  1 
ATOM   6006  C CG  . LYS J  1 8   ? 58.344  122.774 24.469  1.00 85.71  ? 156  LYS G CG  1 
ATOM   6007  C CD  . LYS J  1 8   ? 58.308  123.622 25.747  1.00 90.96  ? 156  LYS G CD  1 
ATOM   6008  C CE  . LYS J  1 8   ? 59.326  124.773 25.742  1.00 99.14  ? 156  LYS G CE  1 
ATOM   6009  N NZ  . LYS J  1 8   ? 58.966  125.883 24.798  1.00 100.00 ? 156  LYS G NZ  1 
ATOM   6010  N N   . SER J  1 9   ? 57.352  120.622 22.631  1.00 70.67  ? 157  SER G N   1 
ATOM   6011  C CA  . SER J  1 9   ? 57.712  119.244 22.301  1.00 70.19  ? 157  SER G CA  1 
ATOM   6012  C C   . SER J  1 9   ? 57.990  118.910 20.824  1.00 72.47  ? 157  SER G C   1 
ATOM   6013  O O   . SER J  1 9   ? 57.143  119.107 19.956  1.00 67.64  ? 157  SER G O   1 
ATOM   6014  C CB  . SER J  1 9   ? 56.632  118.301 22.834  1.00 67.28  ? 157  SER G CB  1 
ATOM   6015  O OG  . SER J  1 9   ? 56.617  117.090 22.100  1.00 77.47  ? 157  SER G OG  1 
ATOM   6016  N N   . LYS J  1 10  ? 59.189  118.377 20.582  1.00 80.81  ? 160  LYS G N   1 
ATOM   6017  C CA  . LYS J  1 10  ? 59.684  117.973 19.265  1.00 85.54  ? 160  LYS G CA  1 
ATOM   6018  C C   . LYS J  1 10  ? 58.602  117.416 18.348  1.00 87.74  ? 160  LYS G C   1 
ATOM   6019  O O   . LYS J  1 10  ? 58.415  117.921 17.238  1.00 92.20  ? 160  LYS G O   1 
ATOM   6020  C CB  . LYS J  1 10  ? 60.813  116.943 19.435  1.00 94.24  ? 160  LYS G CB  1 
ATOM   6021  C CG  . LYS J  1 10  ? 61.932  117.414 20.360  1.00 95.82  ? 160  LYS G CG  1 
ATOM   6022  C CD  . LYS J  1 10  ? 63.107  116.450 20.380  1.00 96.07  ? 160  LYS G CD  1 
ATOM   6023  C CE  . LYS J  1 10  ? 64.267  117.062 21.152  1.00 99.47  ? 160  LYS G CE  1 
ATOM   6024  N NZ  . LYS J  1 10  ? 65.475  116.194 21.169  1.00 100.00 ? 160  LYS G NZ  1 
ATOM   6025  N N   . PRO J  1 11  ? 57.914  116.337 18.766  1.00 84.61  ? 161  PRO G N   1 
ATOM   6026  C CA  . PRO J  1 11  ? 56.879  115.862 17.846  1.00 79.98  ? 161  PRO G CA  1 
ATOM   6027  C C   . PRO J  1 11  ? 55.497  116.268 18.364  1.00 76.48  ? 161  PRO G C   1 
ATOM   6028  O O   . PRO J  1 11  ? 54.482  115.886 17.787  1.00 83.62  ? 161  PRO G O   1 
ATOM   6029  C CB  . PRO J  1 11  ? 57.066  114.340 17.852  1.00 77.41  ? 161  PRO G CB  1 
ATOM   6030  C CG  . PRO J  1 11  ? 58.400  114.122 18.552  1.00 84.36  ? 161  PRO G CG  1 
ATOM   6031  C CD  . PRO J  1 11  ? 58.402  115.212 19.574  1.00 81.27  ? 161  PRO G CD  1 
ATOM   6032  N N   . ARG J  1 12  ? 55.459  117.045 19.446  1.00 70.46  ? 162  ARG G N   1 
ATOM   6033  C CA  . ARG J  1 12  ? 54.187  117.498 20.059  1.00 67.29  ? 162  ARG G CA  1 
ATOM   6034  C C   . ARG J  1 12  ? 53.448  116.347 20.728  1.00 63.41  ? 162  ARG G C   1 
ATOM   6035  O O   . ARG J  1 12  ? 53.176  116.376 21.926  1.00 64.57  ? 162  ARG G O   1 
ATOM   6036  C CB  . ARG J  1 12  ? 53.234  118.118 19.026  1.00 62.25  ? 162  ARG G CB  1 
ATOM   6037  C CG  . ARG J  1 12  ? 53.592  119.493 18.539  1.00 60.67  ? 162  ARG G CG  1 
ATOM   6038  C CD  . ARG J  1 12  ? 53.267  120.542 19.559  1.00 68.00  ? 162  ARG G CD  1 
ATOM   6039  N NE  . ARG J  1 12  ? 53.474  121.873 18.998  1.00 80.94  ? 162  ARG G NE  1 
ATOM   6040  C CZ  . ARG J  1 12  ? 54.670  122.423 18.805  1.00 78.38  ? 162  ARG G CZ  1 
ATOM   6041  N NH1 . ARG J  1 12  ? 55.766  121.755 19.142  1.00 75.15  ? 162  ARG G NH1 1 
ATOM   6042  N NH2 . ARG J  1 12  ? 54.771  123.628 18.256  1.00 74.27  ? 162  ARG G NH2 1 
ATOM   6043  N N   . GLY J  1 13  ? 53.109  115.342 19.930  1.00 59.01  ? 163  GLY G N   1 
ATOM   6044  C CA  . GLY J  1 13  ? 52.408  114.178 20.435  1.00 50.74  ? 163  GLY G CA  1 
ATOM   6045  C C   . GLY J  1 13  ? 51.812  113.436 19.264  1.00 49.52  ? 163  GLY G C   1 
ATOM   6046  O O   . GLY J  1 13  ? 51.891  113.897 18.119  1.00 47.94  ? 163  GLY G O   1 
ATOM   6047  N N   . TYR J  1 14  ? 51.221  112.281 19.529  1.00 50.81  ? 164  TYR G N   1 
ATOM   6048  C CA  . TYR J  1 14  ? 50.612  111.535 18.445  1.00 54.22  ? 164  TYR G CA  1 
ATOM   6049  C C   . TYR J  1 14  ? 49.224  112.094 18.157  1.00 56.94  ? 164  TYR G C   1 
ATOM   6050  O O   . TYR J  1 14  ? 48.605  112.755 18.999  1.00 55.23  ? 164  TYR G O   1 
ATOM   6051  C CB  . TYR J  1 14  ? 50.504  110.048 18.801  1.00 50.97  ? 164  TYR G CB  1 
ATOM   6052  C CG  . TYR J  1 14  ? 51.834  109.412 19.110  1.00 58.77  ? 164  TYR G CG  1 
ATOM   6053  C CD1 . TYR J  1 14  ? 52.683  108.993 18.091  1.00 59.96  ? 164  TYR G CD1 1 
ATOM   6054  C CD2 . TYR J  1 14  ? 52.276  109.290 20.417  1.00 63.59  ? 164  TYR G CD2 1 
ATOM   6055  C CE1 . TYR J  1 14  ? 53.936  108.476 18.369  1.00 59.55  ? 164  TYR G CE1 1 
ATOM   6056  C CE2 . TYR J  1 14  ? 53.531  108.770 20.707  1.00 61.99  ? 164  TYR G CE2 1 
ATOM   6057  C CZ  . TYR J  1 14  ? 54.355  108.366 19.681  1.00 62.23  ? 164  TYR G CZ  1 
ATOM   6058  O OH  . TYR J  1 14  ? 55.598  107.846 19.977  1.00 66.27  ? 164  TYR G OH  1 
ATOM   6059  N N   . CYS J  1 15  ? 48.753  111.840 16.946  1.00 55.60  ? 165  CYS G N   1 
ATOM   6060  C CA  . CYS J  1 15  ? 47.429  112.245 16.534  1.00 47.49  ? 165  CYS G CA  1 
ATOM   6061  C C   . CYS J  1 15  ? 46.815  111.055 15.790  1.00 44.88  ? 165  CYS G C   1 
ATOM   6062  O O   . CYS J  1 15  ? 47.006  110.916 14.583  1.00 43.73  ? 165  CYS G O   1 
ATOM   6063  C CB  . CYS J  1 15  ? 47.500  113.467 15.613  1.00 51.48  ? 165  CYS G CB  1 
ATOM   6064  S SG  . CYS J  1 15  ? 45.875  113.956 14.892  1.00 51.60  ? 165  CYS G SG  1 
ATOM   6065  N N   . LEU J  1 16  ? 46.112  110.178 16.506  1.00 36.48  ? 166  LEU G N   1 
ATOM   6066  C CA  . LEU J  1 16  ? 45.482  109.052 15.853  1.00 34.85  ? 166  LEU G CA  1 
ATOM   6067  C C   . LEU J  1 16  ? 44.395  109.559 14.937  1.00 40.58  ? 166  LEU G C   1 
ATOM   6068  O O   . LEU J  1 16  ? 43.960  110.700 15.040  1.00 50.04  ? 166  LEU G O   1 
ATOM   6069  C CB  . LEU J  1 16  ? 44.805  108.135 16.842  1.00 36.04  ? 166  LEU G CB  1 
ATOM   6070  C CG  . LEU J  1 16  ? 45.554  107.634 18.057  1.00 44.68  ? 166  LEU G CG  1 
ATOM   6071  C CD1 . LEU J  1 16  ? 44.783  106.429 18.629  1.00 40.56  ? 166  LEU G CD1 1 
ATOM   6072  C CD2 . LEU J  1 16  ? 46.952  107.249 17.677  1.00 44.58  ? 166  LEU G CD2 1 
ATOM   6073  N N   . ILE J  1 17  ? 43.948  108.688 14.046  1.00 44.35  ? 167  ILE G N   1 
ATOM   6074  C CA  . ILE J  1 17  ? 42.875  108.997 13.129  1.00 34.22  ? 167  ILE G CA  1 
ATOM   6075  C C   . ILE J  1 17  ? 42.223  107.687 12.763  1.00 31.54  ? 167  ILE G C   1 
ATOM   6076  O O   . ILE J  1 17  ? 42.681  107.018 11.869  1.00 37.93  ? 167  ILE G O   1 
ATOM   6077  C CB  . ILE J  1 17  ? 43.376  109.630 11.849  1.00 28.14  ? 167  ILE G CB  1 
ATOM   6078  C CG1 . ILE J  1 17  ? 44.023  110.977 12.134  1.00 35.57  ? 167  ILE G CG1 1 
ATOM   6079  C CG2 . ILE J  1 17  ? 42.216  109.825 10.920  1.00 40.77  ? 167  ILE G CG2 1 
ATOM   6080  C CD1 . ILE J  1 17  ? 44.247  111.838 10.890  1.00 31.62  ? 167  ILE G CD1 1 
ATOM   6081  N N   . ILE J  1 18  ? 41.194  107.285 13.488  1.00 29.71  ? 168  ILE G N   1 
ATOM   6082  C CA  . ILE J  1 18  ? 40.514  106.059 13.141  1.00 30.01  ? 168  ILE G CA  1 
ATOM   6083  C C   . ILE J  1 18  ? 39.605  106.537 12.043  1.00 37.44  ? 168  ILE G C   1 
ATOM   6084  O O   . ILE J  1 18  ? 38.690  107.325 12.287  1.00 34.77  ? 168  ILE G O   1 
ATOM   6085  C CB  . ILE J  1 18  ? 39.655  105.534 14.279  1.00 34.04  ? 168  ILE G CB  1 
ATOM   6086  C CG1 . ILE J  1 18  ? 40.502  105.401 15.540  1.00 42.42  ? 168  ILE G CG1 1 
ATOM   6087  C CG2 . ILE J  1 18  ? 39.034  104.218 13.909  1.00 22.82  ? 168  ILE G CG2 1 
ATOM   6088  C CD1 . ILE J  1 18  ? 41.834  104.767 15.315  1.00 38.80  ? 168  ILE G CD1 1 
ATOM   6089  N N   . ASN J  1 19  ? 39.880  106.080 10.828  1.00 40.00  ? 169  ASN G N   1 
ATOM   6090  C CA  . ASN J  1 19  ? 39.103  106.457 9.659   1.00 39.10  ? 169  ASN G CA  1 
ATOM   6091  C C   . ASN J  1 19  ? 38.262  105.275 9.167   1.00 31.91  ? 169  ASN G C   1 
ATOM   6092  O O   . ASN J  1 19  ? 38.784  104.377 8.531   1.00 25.77  ? 169  ASN G O   1 
ATOM   6093  C CB  . ASN J  1 19  ? 40.063  106.925 8.554   1.00 37.25  ? 169  ASN G CB  1 
ATOM   6094  C CG  . ASN J  1 19  ? 39.348  107.282 7.271   1.00 32.22  ? 169  ASN G CG  1 
ATOM   6095  O OD1 . ASN J  1 19  ? 38.549  106.522 6.772   1.00 51.22  ? 169  ASN G OD1 1 
ATOM   6096  N ND2 . ASN J  1 19  ? 39.638  108.432 6.737   1.00 28.20  ? 169  ASN G ND2 1 
ATOM   6097  N N   . ASN J  1 20  ? 36.968  105.279 9.458   1.00 25.45  ? 170  ASN G N   1 
ATOM   6098  C CA  . ASN J  1 20  ? 36.106  104.197 9.010   1.00 39.95  ? 170  ASN G CA  1 
ATOM   6099  C C   . ASN J  1 20  ? 35.303  104.564 7.768   1.00 48.60  ? 170  ASN G C   1 
ATOM   6100  O O   . ASN J  1 20  ? 34.537  105.533 7.770   1.00 45.53  ? 170  ASN G O   1 
ATOM   6101  C CB  . ASN J  1 20  ? 35.148  103.788 10.117  1.00 43.64  ? 170  ASN G CB  1 
ATOM   6102  C CG  . ASN J  1 20  ? 35.816  102.967 11.176  1.00 37.76  ? 170  ASN G CG  1 
ATOM   6103  O OD1 . ASN J  1 20  ? 37.032  102.843 11.190  1.00 45.02  ? 170  ASN G OD1 1 
ATOM   6104  N ND2 . ASN J  1 20  ? 35.029  102.405 12.080  1.00 38.37  ? 170  ASN G ND2 1 
ATOM   6105  N N   . HIS J  1 21  ? 35.465  103.756 6.720   1.00 55.03  ? 171  HIS G N   1 
ATOM   6106  C CA  . HIS J  1 21  ? 34.793  103.983 5.450   1.00 53.69  ? 171  HIS G CA  1 
ATOM   6107  C C   . HIS J  1 21  ? 33.922  102.829 5.011   1.00 48.72  ? 171  HIS G C   1 
ATOM   6108  O O   . HIS J  1 21  ? 32.721  102.970 4.893   1.00 52.72  ? 171  HIS G O   1 
ATOM   6109  C CB  . HIS J  1 21  ? 35.836  104.265 4.364   1.00 60.03  ? 171  HIS G CB  1 
ATOM   6110  C CG  . HIS J  1 21  ? 35.318  104.097 2.970   1.00 64.17  ? 171  HIS G CG  1 
ATOM   6111  N ND1 . HIS J  1 21  ? 34.548  105.049 2.340   1.00 65.76  ? 171  HIS G ND1 1 
ATOM   6112  C CD2 . HIS J  1 21  ? 35.429  103.066 2.101   1.00 62.18  ? 171  HIS G CD2 1 
ATOM   6113  C CE1 . HIS J  1 21  ? 34.203  104.612 1.144   1.00 59.57  ? 171  HIS G CE1 1 
ATOM   6114  N NE2 . HIS J  1 21  ? 34.725  103.412 0.975   1.00 62.28  ? 171  HIS G NE2 1 
ATOM   6115  N N   . ASN J  1 22  ? 34.541  101.683 4.782   1.00 50.88  ? 172  ASN G N   1 
ATOM   6116  C CA  . ASN J  1 22  ? 33.838  100.494 4.308   1.00 55.14  ? 172  ASN G CA  1 
ATOM   6117  C C   . ASN J  1 22  ? 33.045  99.727  5.360   1.00 46.93  ? 172  ASN G C   1 
ATOM   6118  O O   . ASN J  1 22  ? 33.558  98.811  5.979   1.00 48.44  ? 172  ASN G O   1 
ATOM   6119  C CB  . ASN J  1 22  ? 34.851  99.556  3.610   1.00 58.76  ? 172  ASN G CB  1 
ATOM   6120  C CG  . ASN J  1 22  ? 34.222  98.249  3.119   1.00 52.99  ? 172  ASN G CG  1 
ATOM   6121  O OD1 . ASN J  1 22  ? 33.107  98.219  2.590   1.00 55.71  ? 172  ASN G OD1 1 
ATOM   6122  N ND2 . ASN J  1 22  ? 34.952  97.169  3.278   1.00 55.04  ? 172  ASN G ND2 1 
ATOM   6123  N N   . PHE J  1 23  ? 31.781  100.076 5.539   1.00 41.87  ? 173  PHE G N   1 
ATOM   6124  C CA  . PHE J  1 23  ? 30.966  99.390  6.529   1.00 44.66  ? 173  PHE G CA  1 
ATOM   6125  C C   . PHE J  1 23  ? 30.305  98.137  5.994   1.00 45.18  ? 173  PHE G C   1 
ATOM   6126  O O   . PHE J  1 23  ? 29.160  97.827  6.288   1.00 45.08  ? 173  PHE G O   1 
ATOM   6127  C CB  . PHE J  1 23  ? 29.919  100.344 7.111   1.00 41.92  ? 173  PHE G CB  1 
ATOM   6128  C CG  . PHE J  1 23  ? 30.506  101.351 8.020   1.00 43.06  ? 173  PHE G CG  1 
ATOM   6129  C CD1 . PHE J  1 23  ? 31.231  102.430 7.513   1.00 49.28  ? 173  PHE G CD1 1 
ATOM   6130  C CD2 . PHE J  1 23  ? 30.452  101.167 9.387   1.00 43.14  ? 173  PHE G CD2 1 
ATOM   6131  C CE1 . PHE J  1 23  ? 31.904  103.309 8.366   1.00 48.20  ? 173  PHE G CE1 1 
ATOM   6132  C CE2 . PHE J  1 23  ? 31.120  102.036 10.255  1.00 49.98  ? 173  PHE G CE2 1 
ATOM   6133  C CZ  . PHE J  1 23  ? 31.849  103.109 9.741   1.00 49.83  ? 173  PHE G CZ  1 
ATOM   6134  N N   . ALA J  1 24  ? 31.066  97.374  5.242   1.00 48.89  ? 174  ALA G N   1 
ATOM   6135  C CA  . ALA J  1 24  ? 30.522  96.182  4.641   1.00 47.37  ? 174  ALA G CA  1 
ATOM   6136  C C   . ALA J  1 24  ? 30.130  95.093  5.624   1.00 47.97  ? 174  ALA G C   1 
ATOM   6137  O O   . ALA J  1 24  ? 29.031  94.506  5.515   1.00 41.36  ? 174  ALA G O   1 
ATOM   6138  C CB  . ALA J  1 24  ? 31.500  95.657  3.635   1.00 42.22  ? 174  ALA G CB  1 
ATOM   6139  N N   . LYS J  1 25  ? 31.022  94.812  6.577   1.00 50.97  ? 175  LYS G N   1 
ATOM   6140  C CA  . LYS J  1 25  ? 30.764  93.761  7.563   1.00 47.03  ? 175  LYS G CA  1 
ATOM   6141  C C   . LYS J  1 25  ? 29.483  94.068  8.303   1.00 43.39  ? 175  LYS G C   1 
ATOM   6142  O O   . LYS J  1 25  ? 28.571  93.262  8.347   1.00 38.50  ? 175  LYS G O   1 
ATOM   6143  C CB  . LYS J  1 25  ? 31.923  93.654  8.550   1.00 49.38  ? 175  LYS G CB  1 
ATOM   6144  C CG  . LYS J  1 25  ? 31.672  92.692  9.730   1.00 63.37  ? 175  LYS G CG  1 
ATOM   6145  C CD  . LYS J  1 25  ? 32.242  91.279  9.556   1.00 63.70  ? 175  LYS G CD  1 
ATOM   6146  C CE  . LYS J  1 25  ? 33.728  91.327  9.224   1.00 69.34  ? 175  LYS G CE  1 
ATOM   6147  N NZ  . LYS J  1 25  ? 34.422  92.475  9.899   1.00 60.76  ? 175  LYS G NZ  1 
ATOM   6148  N N   . ALA J  1 26  A 29.412  95.259  8.869   1.00 43.55  ? 175  ALA G N   1 
ATOM   6149  C CA  . ALA J  1 26  A 28.226  95.672  9.604   1.00 47.10  ? 175  ALA G CA  1 
ATOM   6150  C C   . ALA J  1 26  A 26.893  95.420  8.901   1.00 45.82  ? 175  ALA G C   1 
ATOM   6151  O O   . ALA J  1 26  A 25.910  95.113  9.567   1.00 46.28  ? 175  ALA G O   1 
ATOM   6152  C CB  . ALA J  1 26  A 28.337  97.148  9.954   1.00 51.79  ? 175  ALA G CB  1 
ATOM   6153  N N   . ARG J  1 27  B 26.839  95.584  7.575   1.00 50.98  ? 175  ARG G N   1 
ATOM   6154  C CA  . ARG J  1 27  B 25.584  95.369  6.836   1.00 52.15  ? 175  ARG G CA  1 
ATOM   6155  C C   . ARG J  1 27  B 25.295  93.866  6.721   1.00 52.76  ? 175  ARG G C   1 
ATOM   6156  O O   . ARG J  1 27  B 24.210  93.469  6.319   1.00 52.28  ? 175  ARG G O   1 
ATOM   6157  C CB  . ARG J  1 27  B 25.636  95.994  5.424   1.00 44.63  ? 175  ARG G CB  1 
ATOM   6158  C CG  . ARG J  1 27  B 25.783  97.520  5.350   1.00 47.39  ? 175  ARG G CG  1 
ATOM   6159  C CD  . ARG J  1 27  B 25.761  98.083  3.880   1.00 34.10  ? 175  ARG G CD  1 
ATOM   6160  N NE  . ARG J  1 27  B 26.976  97.783  3.127   1.00 20.25  ? 175  ARG G NE  1 
ATOM   6161  C CZ  . ARG J  1 27  B 28.003  98.611  2.944   1.00 26.72  ? 175  ARG G CZ  1 
ATOM   6162  N NH1 . ARG J  1 27  B 27.993  99.834  3.450   1.00 25.21  ? 175  ARG G NH1 1 
ATOM   6163  N NH2 . ARG J  1 27  B 29.069  98.204  2.250   1.00 35.78  ? 175  ARG G NH2 1 
ATOM   6164  N N   . GLU J  1 28  C 26.276  93.044  7.081   1.00 53.98  ? 175  GLU G N   1 
ATOM   6165  C CA  . GLU J  1 28  C 26.142  91.586  7.041   1.00 58.49  ? 175  GLU G CA  1 
ATOM   6166  C C   . GLU J  1 28  C 25.812  91.048  8.422   1.00 58.06  ? 175  GLU G C   1 
ATOM   6167  O O   . GLU J  1 28  C 24.832  90.323  8.618   1.00 58.24  ? 175  GLU G O   1 
ATOM   6168  C CB  . GLU J  1 28  C 27.458  90.941  6.579   1.00 61.27  ? 175  GLU G CB  1 
ATOM   6169  C CG  . GLU J  1 28  C 27.591  89.436  6.854   1.00 73.11  ? 175  GLU G CG  1 
ATOM   6170  C CD  . GLU J  1 28  C 28.973  88.857  6.477   1.00 85.97  ? 175  GLU G CD  1 
ATOM   6171  O OE1 . GLU J  1 28  C 29.203  87.647  6.710   1.00 93.56  ? 175  GLU G OE1 1 
ATOM   6172  O OE2 . GLU J  1 28  C 29.833  89.601  5.949   1.00 90.76  ? 175  GLU G OE2 1 
ATOM   6173  N N   . LYS J  1 29  D 26.649  91.425  9.378   1.00 55.17  ? 175  LYS G N   1 
ATOM   6174  C CA  . LYS J  1 29  D 26.514  90.964  10.732  1.00 50.39  ? 175  LYS G CA  1 
ATOM   6175  C C   . LYS J  1 29  D 25.391  91.578  11.579  1.00 46.46  ? 175  LYS G C   1 
ATOM   6176  O O   . LYS J  1 29  D 24.870  90.886  12.439  1.00 57.41  ? 175  LYS G O   1 
ATOM   6177  C CB  . LYS J  1 29  D 27.880  91.072  11.445  1.00 62.55  ? 175  LYS G CB  1 
ATOM   6178  C CG  . LYS J  1 29  D 29.060  90.225  10.824  1.00 68.88  ? 175  LYS G CG  1 
ATOM   6179  C CD  . LYS J  1 29  D 28.859  88.679  10.921  1.00 79.36  ? 175  LYS G CD  1 
ATOM   6180  C CE  . LYS J  1 29  D 29.867  87.859  10.050  1.00 79.85  ? 175  LYS G CE  1 
ATOM   6181  N NZ  . LYS J  1 29  D 29.651  86.351  10.011  1.00 71.45  ? 175  LYS G NZ  1 
ATOM   6182  N N   . VAL J  1 30  E 24.979  92.827  11.367  1.00 38.68  ? 175  VAL G N   1 
ATOM   6183  C CA  . VAL J  1 30  E 23.887  93.379  12.208  1.00 42.56  ? 175  VAL G CA  1 
ATOM   6184  C C   . VAL J  1 30  E 22.552  93.709  11.498  1.00 49.38  ? 175  VAL G C   1 
ATOM   6185  O O   . VAL J  1 30  E 22.453  94.683  10.759  1.00 48.89  ? 175  VAL G O   1 
ATOM   6186  C CB  . VAL J  1 30  E 24.292  94.676  12.968  1.00 34.97  ? 175  VAL G CB  1 
ATOM   6187  C CG1 . VAL J  1 30  E 23.070  95.211  13.694  1.00 39.66  ? 175  VAL G CG1 1 
ATOM   6188  C CG2 . VAL J  1 30  E 25.381  94.414  13.968  1.00 4.82   ? 175  VAL G CG2 1 
ATOM   6189  N N   . PRO J  1 31  F 21.489  92.934  11.767  1.00 54.05  ? 175  PRO G N   1 
ATOM   6190  C CA  . PRO J  1 31  F 20.227  93.253  11.080  1.00 55.73  ? 175  PRO G CA  1 
ATOM   6191  C C   . PRO J  1 31  F 19.856  94.736  11.048  1.00 53.93  ? 175  PRO G C   1 
ATOM   6192  O O   . PRO J  1 31  F 19.877  95.350  9.991   1.00 49.68  ? 175  PRO G O   1 
ATOM   6193  C CB  . PRO J  1 31  F 19.191  92.385  11.814  1.00 48.38  ? 175  PRO G CB  1 
ATOM   6194  C CG  . PRO J  1 31  F 19.803  92.184  13.157  1.00 52.93  ? 175  PRO G CG  1 
ATOM   6195  C CD  . PRO J  1 31  F 21.268  91.960  12.846  1.00 50.97  ? 175  PRO G CD  1 
ATOM   6196  N N   . LYS J  1 32  G 19.537  95.315  12.200  1.00 55.69  ? 175  LYS G N   1 
ATOM   6197  C CA  . LYS J  1 32  G 19.150  96.722  12.239  1.00 53.93  ? 175  LYS G CA  1 
ATOM   6198  C C   . LYS J  1 32  G 20.082  97.602  11.378  1.00 53.23  ? 175  LYS G C   1 
ATOM   6199  O O   . LYS J  1 32  G 19.672  98.636  10.844  1.00 53.50  ? 175  LYS G O   1 
ATOM   6200  C CB  . LYS J  1 32  G 19.132  97.233  13.696  1.00 50.47  ? 175  LYS G CB  1 
ATOM   6201  C CG  . LYS J  1 32  G 20.495  97.597  14.245  1.00 45.08  ? 175  LYS G CG  1 
ATOM   6202  C CD  . LYS J  1 32  G 20.420  98.327  15.548  1.00 45.84  ? 175  LYS G CD  1 
ATOM   6203  C CE  . LYS J  1 32  G 21.836  98.579  16.064  1.00 50.05  ? 175  LYS G CE  1 
ATOM   6204  N NZ  . LYS J  1 32  G 21.874  99.364  17.348  1.00 58.61  ? 175  LYS G NZ  1 
ATOM   6205  N N   . LEU J  1 33  H 21.322  97.165  11.209  1.00 48.24  ? 175  LEU G N   1 
ATOM   6206  C CA  . LEU J  1 33  H 22.295  97.951  10.459  1.00 47.18  ? 175  LEU G CA  1 
ATOM   6207  C C   . LEU J  1 33  H 22.448  97.587  9.010   1.00 53.85  ? 175  LEU G C   1 
ATOM   6208  O O   . LEU J  1 33  H 23.487  97.888  8.413   1.00 52.86  ? 175  LEU G O   1 
ATOM   6209  C CB  . LEU J  1 33  H 23.667  97.857  11.107  1.00 42.00  ? 175  LEU G CB  1 
ATOM   6210  C CG  . LEU J  1 33  H 24.247  99.045  11.861  1.00 37.97  ? 175  LEU G CG  1 
ATOM   6211  C CD1 . LEU J  1 33  H 23.197  99.714  12.702  1.00 21.55  ? 175  LEU G CD1 1 
ATOM   6212  C CD2 . LEU J  1 33  H 25.424  98.533  12.716  1.00 40.69  ? 175  LEU G CD2 1 
ATOM   6213  N N   . HIS J  1 34  I 21.455  96.905  8.443   1.00 59.70  ? 175  HIS G N   1 
ATOM   6214  C CA  . HIS J  1 34  I 21.523  96.571  7.024   1.00 61.42  ? 175  HIS G CA  1 
ATOM   6215  C C   . HIS J  1 34  I 21.312  97.973  6.468   1.00 62.57  ? 175  HIS G C   1 
ATOM   6216  O O   . HIS J  1 34  I 20.924  98.891  7.220   1.00 64.03  ? 175  HIS G O   1 
ATOM   6217  C CB  . HIS J  1 34  I 20.355  95.671  6.604   1.00 64.82  ? 175  HIS G CB  1 
ATOM   6218  C CG  . HIS J  1 34  I 19.024  96.371  6.606   1.00 80.93  ? 175  HIS G CG  1 
ATOM   6219  N ND1 . HIS J  1 34  I 18.436  96.860  7.757   1.00 84.62  ? 175  HIS G ND1 1 
ATOM   6220  C CD2 . HIS J  1 34  I 18.196  96.714  5.589   1.00 80.75  ? 175  HIS G CD2 1 
ATOM   6221  C CE1 . HIS J  1 34  I 17.307  97.476  7.449   1.00 79.77  ? 175  HIS G CE1 1 
ATOM   6222  N NE2 . HIS J  1 34  I 17.139  97.403  6.140   1.00 82.37  ? 175  HIS G NE2 1 
ATOM   6223  N N   . SER J  1 35  J 21.564  98.166  5.182   1.00 57.88  ? 175  SER G N   1 
ATOM   6224  C CA  . SER J  1 35  J 21.351  99.490  4.594   1.00 55.89  ? 175  SER G CA  1 
ATOM   6225  C C   . SER J  1 35  J 22.276  100.624 5.081   1.00 46.87  ? 175  SER G C   1 
ATOM   6226  O O   . SER J  1 35  J 22.189  101.734 4.576   1.00 48.37  ? 175  SER G O   1 
ATOM   6227  C CB  . SER J  1 35  J 19.906  99.933  4.813   1.00 53.05  ? 175  SER G CB  1 
ATOM   6228  O OG  . SER J  1 35  J 19.868  100.952 5.800   1.00 61.91  ? 175  SER G OG  1 
ATOM   6229  N N   . ILE J  1 36  ? 23.140  100.365 6.055   1.00 41.01  ? 176  ILE G N   1 
ATOM   6230  C CA  . ILE J  1 36  ? 24.064  101.397 6.527   1.00 47.60  ? 176  ILE G CA  1 
ATOM   6231  C C   . ILE J  1 36  ? 25.153  101.552 5.487   1.00 42.13  ? 176  ILE G C   1 
ATOM   6232  O O   . ILE J  1 36  ? 25.968  100.655 5.329   1.00 36.22  ? 176  ILE G O   1 
ATOM   6233  C CB  . ILE J  1 36  ? 24.669  101.006 7.891   1.00 50.43  ? 176  ILE G CB  1 
ATOM   6234  C CG1 . ILE J  1 36  ? 23.511  100.821 8.868   1.00 62.91  ? 176  ILE G CG1 1 
ATOM   6235  C CG2 . ILE J  1 36  ? 25.602  102.099 8.429   1.00 37.94  ? 176  ILE G CG2 1 
ATOM   6236  C CD1 . ILE J  1 36  ? 22.406  101.934 8.767   1.00 59.99  ? 176  ILE G CD1 1 
ATOM   6237  N N   . ARG J  1 37  ? 25.168  102.701 4.810   1.00 37.59  ? 177  ARG G N   1 
ATOM   6238  C CA  . ARG J  1 37  ? 26.107  102.975 3.715   1.00 44.09  ? 177  ARG G CA  1 
ATOM   6239  C C   . ARG J  1 37  ? 27.555  103.337 4.050   1.00 43.73  ? 177  ARG G C   1 
ATOM   6240  O O   . ARG J  1 37  ? 27.885  103.672 5.178   1.00 43.61  ? 177  ARG G O   1 
ATOM   6241  C CB  . ARG J  1 37  ? 25.487  104.033 2.797   1.00 42.42  ? 177  ARG G CB  1 
ATOM   6242  C CG  . ARG J  1 37  ? 24.008  104.243 3.097   1.00 47.23  ? 177  ARG G CG  1 
ATOM   6243  C CD  . ARG J  1 37  ? 23.254  104.931 1.987   1.00 63.05  ? 177  ARG G CD  1 
ATOM   6244  N NE  . ARG J  1 37  ? 24.078  105.895 1.257   1.00 78.49  ? 177  ARG G NE  1 
ATOM   6245  C CZ  . ARG J  1 37  ? 23.590  106.825 0.435   1.00 82.32  ? 177  ARG G CZ  1 
ATOM   6246  N NH1 . ARG J  1 37  ? 22.277  106.930 0.235   1.00 81.79  ? 177  ARG G NH1 1 
ATOM   6247  N NH2 . ARG J  1 37  ? 24.420  107.645 -0.195  1.00 84.91  ? 177  ARG G NH2 1 
ATOM   6248  N N   . ASP J  1 38  ? 28.428  103.257 3.054   1.00 50.26  ? 178  ASP G N   1 
ATOM   6249  C CA  . ASP J  1 38  ? 29.834  103.547 3.283   1.00 53.24  ? 178  ASP G CA  1 
ATOM   6250  C C   . ASP J  1 38  ? 30.027  105.043 3.379   1.00 48.17  ? 178  ASP G C   1 
ATOM   6251  O O   . ASP J  1 38  ? 29.380  105.805 2.681   1.00 49.75  ? 178  ASP G O   1 
ATOM   6252  C CB  . ASP J  1 38  ? 30.705  102.954 2.168   1.00 55.20  ? 178  ASP G CB  1 
ATOM   6253  C CG  . ASP J  1 38  ? 30.625  101.447 2.112   1.00 56.00  ? 178  ASP G CG  1 
ATOM   6254  O OD1 . ASP J  1 38  ? 30.624  100.808 3.183   1.00 58.70  ? 178  ASP G OD1 1 
ATOM   6255  O OD2 . ASP J  1 38  ? 30.566  100.900 0.998   1.00 62.25  ? 178  ASP G OD2 1 
ATOM   6256  N N   . ARG J  1 39  ? 30.929  105.456 4.252   1.00 48.52  ? 179  ARG G N   1 
ATOM   6257  C CA  . ARG J  1 39  ? 31.181  106.868 4.483   1.00 48.21  ? 179  ARG G CA  1 
ATOM   6258  C C   . ARG J  1 39  ? 32.048  107.519 3.418   1.00 46.38  ? 179  ARG G C   1 
ATOM   6259  O O   . ARG J  1 39  ? 33.147  107.978 3.699   1.00 51.87  ? 179  ARG G O   1 
ATOM   6260  C CB  . ARG J  1 39  ? 31.783  107.051 5.893   1.00 37.81  ? 179  ARG G CB  1 
ATOM   6261  C CG  . ARG J  1 39  ? 30.902  106.457 6.979   1.00 32.35  ? 179  ARG G CG  1 
ATOM   6262  C CD  . ARG J  1 39  ? 31.369  106.750 8.367   1.00 36.64  ? 179  ARG G CD  1 
ATOM   6263  N NE  . ARG J  1 39  ? 31.436  108.173 8.604   1.00 32.97  ? 179  ARG G NE  1 
ATOM   6264  C CZ  . ARG J  1 39  ? 32.522  108.903 8.410   1.00 36.46  ? 179  ARG G CZ  1 
ATOM   6265  N NH1 . ARG J  1 39  ? 33.629  108.328 7.981   1.00 30.58  ? 179  ARG G NH1 1 
ATOM   6266  N NH2 . ARG J  1 39  ? 32.496  110.212 8.625   1.00 37.15  ? 179  ARG G NH2 1 
ATOM   6267  N N   . ASN J  1 40  ? 31.534  107.578 2.194   1.00 45.30  ? 180  ASN G N   1 
ATOM   6268  C CA  . ASN J  1 40  ? 32.270  108.177 1.081   1.00 44.74  ? 180  ASN G CA  1 
ATOM   6269  C C   . ASN J  1 40  ? 32.675  109.611 1.366   1.00 41.31  ? 180  ASN G C   1 
ATOM   6270  O O   . ASN J  1 40  ? 31.839  110.487 1.538   1.00 45.26  ? 180  ASN G O   1 
ATOM   6271  C CB  . ASN J  1 40  ? 31.422  108.142 -0.185  1.00 57.48  ? 180  ASN G CB  1 
ATOM   6272  C CG  . ASN J  1 40  ? 31.244  106.736 -0.736  1.00 60.46  ? 180  ASN G CG  1 
ATOM   6273  O OD1 . ASN J  1 40  ? 30.382  106.488 -1.581  1.00 53.55  ? 180  ASN G OD1 1 
ATOM   6274  N ND2 . ASN J  1 40  ? 32.069  105.811 -0.265  1.00 66.96  ? 180  ASN G ND2 1 
ATOM   6275  N N   . GLY J  1 41  ? 33.973  109.842 1.432   1.00 38.20  ? 181  GLY G N   1 
ATOM   6276  C CA  . GLY J  1 41  ? 34.454  111.180 1.690   1.00 40.39  ? 181  GLY G CA  1 
ATOM   6277  C C   . GLY J  1 41  ? 35.407  111.271 2.862   1.00 40.42  ? 181  GLY G C   1 
ATOM   6278  O O   . GLY J  1 41  ? 36.225  112.191 2.925   1.00 40.08  ? 181  GLY G O   1 
ATOM   6279  N N   . THR J  1 42  ? 35.304  110.315 3.784   1.00 43.29  ? 182  THR G N   1 
ATOM   6280  C CA  . THR J  1 42  ? 36.125  110.304 4.993   1.00 47.05  ? 182  THR G CA  1 
ATOM   6281  C C   . THR J  1 42  ? 37.520  110.682 4.623   1.00 46.92  ? 182  THR G C   1 
ATOM   6282  O O   . THR J  1 42  ? 38.161  111.495 5.278   1.00 47.89  ? 182  THR G O   1 
ATOM   6283  C CB  . THR J  1 42  ? 36.230  108.929 5.618   1.00 50.27  ? 182  THR G CB  1 
ATOM   6284  O OG1 . THR J  1 42  ? 35.017  108.220 5.401   1.00 49.22  ? 182  THR G OG1 1 
ATOM   6285  C CG2 . THR J  1 42  ? 36.502  109.049 7.103   1.00 48.77  ? 182  THR G CG2 1 
ATOM   6286  N N   . HIS J  1 43  ? 37.971  110.038 3.562   1.00 48.59  ? 183  HIS G N   1 
ATOM   6287  C CA  . HIS J  1 43  ? 39.286  110.221 2.999   1.00 57.25  ? 183  HIS G CA  1 
ATOM   6288  C C   . HIS J  1 43  ? 39.659  111.694 3.002   1.00 59.39  ? 183  HIS G C   1 
ATOM   6289  O O   . HIS J  1 43  ? 40.753  112.054 3.432   1.00 66.30  ? 183  HIS G O   1 
ATOM   6290  C CB  . HIS J  1 43  ? 39.268  109.671 1.587   1.00 73.59  ? 183  HIS G CB  1 
ATOM   6291  C CG  . HIS J  1 43  ? 38.283  108.555 1.400   1.00 91.65  ? 183  HIS G CG  1 
ATOM   6292  N ND1 . HIS J  1 43  ? 36.955  108.772 1.075   1.00 94.37  ? 183  HIS G ND1 1 
ATOM   6293  C CD2 . HIS J  1 43  ? 38.426  107.213 1.530   1.00 93.12  ? 183  HIS G CD2 1 
ATOM   6294  C CE1 . HIS J  1 43  ? 36.325  107.611 1.012   1.00 96.53  ? 183  HIS G CE1 1 
ATOM   6295  N NE2 . HIS J  1 43  ? 37.195  106.650 1.284   1.00 100.00 ? 183  HIS G NE2 1 
ATOM   6296  N N   . LEU J  1 44  ? 38.751  112.549 2.541   1.00 48.89  ? 184  LEU G N   1 
ATOM   6297  C CA  . LEU J  1 44  ? 39.026  113.964 2.523   1.00 40.93  ? 184  LEU G CA  1 
ATOM   6298  C C   . LEU J  1 44  ? 39.260  114.509 3.933   1.00 38.49  ? 184  LEU G C   1 
ATOM   6299  O O   . LEU J  1 44  ? 40.138  115.346 4.134   1.00 39.11  ? 184  LEU G O   1 
ATOM   6300  C CB  . LEU J  1 44  ? 37.888  114.694 1.801   1.00 47.27  ? 184  LEU G CB  1 
ATOM   6301  C CG  . LEU J  1 44  ? 37.952  114.792 0.261   1.00 35.27  ? 184  LEU G CG  1 
ATOM   6302  C CD1 . LEU J  1 44  ? 39.009  113.857 -0.300  1.00 39.68  ? 184  LEU G CD1 1 
ATOM   6303  C CD2 . LEU J  1 44  ? 36.602  114.489 -0.312  1.00 33.19  ? 184  LEU G CD2 1 
ATOM   6304  N N   . ASP J  1 45  ? 38.495  114.024 4.909   1.00 38.04  ? 185  ASP G N   1 
ATOM   6305  C CA  . ASP J  1 45  ? 38.662  114.460 6.302   1.00 38.06  ? 185  ASP G CA  1 
ATOM   6306  C C   . ASP J  1 45  ? 40.040  114.035 6.776   1.00 39.14  ? 185  ASP G C   1 
ATOM   6307  O O   . ASP J  1 45  ? 40.841  114.841 7.267   1.00 41.12  ? 185  ASP G O   1 
ATOM   6308  C CB  . ASP J  1 45  ? 37.642  113.809 7.234   1.00 37.56  ? 185  ASP G CB  1 
ATOM   6309  C CG  . ASP J  1 45  ? 36.252  114.396 7.106   1.00 39.36  ? 185  ASP G CG  1 
ATOM   6310  O OD1 . ASP J  1 45  ? 36.117  115.516 6.598   1.00 26.63  ? 185  ASP G OD1 1 
ATOM   6311  O OD2 . ASP J  1 45  ? 35.282  113.730 7.540   1.00 49.40  ? 185  ASP G OD2 1 
ATOM   6312  N N   . ALA J  1 46  ? 40.297  112.743 6.645   1.00 37.59  ? 186  ALA G N   1 
ATOM   6313  C CA  . ALA J  1 46  ? 41.572  112.169 7.042   1.00 39.29  ? 186  ALA G CA  1 
ATOM   6314  C C   . ALA J  1 46  ? 42.708  112.987 6.431   1.00 41.46  ? 186  ALA G C   1 
ATOM   6315  O O   . ALA J  1 46  ? 43.652  113.362 7.143   1.00 39.49  ? 186  ALA G O   1 
ATOM   6316  C CB  . ALA J  1 46  ? 41.653  110.723 6.589   1.00 31.79  ? 186  ALA G CB  1 
ATOM   6317  N N   . GLY J  1 47  ? 42.599  113.277 5.129   1.00 35.79  ? 187  GLY G N   1 
ATOM   6318  C CA  . GLY J  1 47  ? 43.627  114.045 4.453   1.00 35.96  ? 187  GLY G CA  1 
ATOM   6319  C C   . GLY J  1 47  ? 43.818  115.380 5.131   1.00 35.10  ? 187  GLY G C   1 
ATOM   6320  O O   . GLY J  1 47  ? 44.911  115.713 5.603   1.00 34.44  ? 187  GLY G O   1 
ATOM   6321  N N   . ALA J  1 48  ? 42.727  116.133 5.187   1.00 33.94  ? 188  ALA G N   1 
ATOM   6322  C CA  . ALA J  1 48  ? 42.705  117.448 5.813   1.00 36.71  ? 188  ALA G CA  1 
ATOM   6323  C C   . ALA J  1 48  ? 43.277  117.414 7.235   1.00 37.55  ? 188  ALA G C   1 
ATOM   6324  O O   . ALA J  1 48  ? 44.123  118.235 7.594   1.00 26.68  ? 188  ALA G O   1 
ATOM   6325  C CB  . ALA J  1 48  ? 41.265  117.989 5.831   1.00 39.22  ? 188  ALA G CB  1 
ATOM   6326  N N   . LEU J  1 49  ? 42.801  116.468 8.040   1.00 36.94  ? 189  LEU G N   1 
ATOM   6327  C CA  . LEU J  1 49  ? 43.289  116.323 9.389   1.00 38.40  ? 189  LEU G CA  1 
ATOM   6328  C C   . LEU J  1 49  ? 44.811  116.141 9.371   1.00 42.42  ? 189  LEU G C   1 
ATOM   6329  O O   . LEU J  1 49  ? 45.545  116.874 10.027  1.00 56.01  ? 189  LEU G O   1 
ATOM   6330  C CB  . LEU J  1 49  ? 42.618  115.124 10.036  1.00 37.28  ? 189  LEU G CB  1 
ATOM   6331  C CG  . LEU J  1 49  ? 41.191  115.411 10.488  1.00 31.56  ? 189  LEU G CG  1 
ATOM   6332  C CD1 . LEU J  1 49  ? 40.484  114.153 10.914  1.00 34.75  ? 189  LEU G CD1 1 
ATOM   6333  C CD2 . LEU J  1 49  ? 41.243  116.369 11.620  1.00 22.52  ? 189  LEU G CD2 1 
ATOM   6334  N N   . THR J  1 50  ? 45.277  115.175 8.595   1.00 36.52  ? 190  THR G N   1 
ATOM   6335  C CA  . THR J  1 50  ? 46.694  114.888 8.490   1.00 39.70  ? 190  THR G CA  1 
ATOM   6336  C C   . THR J  1 50  ? 47.487  116.124 8.183   1.00 43.32  ? 190  THR G C   1 
ATOM   6337  O O   . THR J  1 50  ? 48.444  116.449 8.875   1.00 50.14  ? 190  THR G O   1 
ATOM   6338  C CB  . THR J  1 50  ? 46.993  113.887 7.376   1.00 37.65  ? 190  THR G CB  1 
ATOM   6339  O OG1 . THR J  1 50  ? 46.071  112.808 7.451   1.00 44.54  ? 190  THR G OG1 1 
ATOM   6340  C CG2 . THR J  1 50  ? 48.372  113.329 7.534   1.00 26.75  ? 190  THR G CG2 1 
ATOM   6341  N N   . THR J  1 51  ? 47.099  116.803 7.117   1.00 45.67  ? 191  THR G N   1 
ATOM   6342  C CA  . THR J  1 51  ? 47.788  118.014 6.702   1.00 49.39  ? 191  THR G CA  1 
ATOM   6343  C C   . THR J  1 51  ? 47.806  119.045 7.823   1.00 49.58  ? 191  THR G C   1 
ATOM   6344  O O   . THR J  1 51  ? 48.844  119.560 8.199   1.00 51.95  ? 191  THR G O   1 
ATOM   6345  C CB  . THR J  1 51  ? 47.087  118.667 5.511   1.00 48.89  ? 191  THR G CB  1 
ATOM   6346  O OG1 . THR J  1 51  ? 46.940  117.716 4.457   1.00 47.65  ? 191  THR G OG1 1 
ATOM   6347  C CG2 . THR J  1 51  ? 47.885  119.852 5.021   1.00 48.91  ? 191  THR G CG2 1 
ATOM   6348  N N   . THR J  1 52  ? 46.628  119.338 8.344   1.00 51.89  ? 192  THR G N   1 
ATOM   6349  C CA  . THR J  1 52  ? 46.474  120.324 9.387   1.00 53.53  ? 192  THR G CA  1 
ATOM   6350  C C   . THR J  1 52  ? 47.307  120.054 10.608  1.00 48.21  ? 192  THR G C   1 
ATOM   6351  O O   . THR J  1 52  ? 48.087  120.900 11.018  1.00 51.00  ? 192  THR G O   1 
ATOM   6352  C CB  . THR J  1 52  ? 45.013  120.432 9.825   1.00 54.72  ? 192  THR G CB  1 
ATOM   6353  O OG1 . THR J  1 52  ? 44.181  120.567 8.669   1.00 60.88  ? 192  THR G OG1 1 
ATOM   6354  C CG2 . THR J  1 52  ? 44.825  121.640 10.708  1.00 54.39  ? 192  THR G CG2 1 
ATOM   6355  N N   . PHE J  1 53  ? 47.149  118.883 11.197  1.00 47.95  ? 193  PHE G N   1 
ATOM   6356  C CA  . PHE J  1 53  ? 47.899  118.584 12.394  1.00 51.87  ? 193  PHE G CA  1 
ATOM   6357  C C   . PHE J  1 53  ? 49.363  118.321 12.134  1.00 57.86  ? 193  PHE G C   1 
ATOM   6358  O O   . PHE J  1 53  ? 50.208  118.491 13.017  1.00 61.98  ? 193  PHE G O   1 
ATOM   6359  C CB  . PHE J  1 53  ? 47.239  117.448 13.149  1.00 46.96  ? 193  PHE G CB  1 
ATOM   6360  C CG  . PHE J  1 53  ? 46.006  117.884 13.879  1.00 51.41  ? 193  PHE G CG  1 
ATOM   6361  C CD1 . PHE J  1 53  ? 46.104  118.749 14.970  1.00 49.98  ? 193  PHE G CD1 1 
ATOM   6362  C CD2 . PHE J  1 53  ? 44.749  117.508 13.439  1.00 43.44  ? 193  PHE G CD2 1 
ATOM   6363  C CE1 . PHE J  1 53  ? 44.966  119.234 15.600  1.00 50.79  ? 193  PHE G CE1 1 
ATOM   6364  C CE2 . PHE J  1 53  ? 43.616  117.986 14.064  1.00 46.16  ? 193  PHE G CE2 1 
ATOM   6365  C CZ  . PHE J  1 53  ? 43.718  118.854 15.149  1.00 45.21  ? 193  PHE G CZ  1 
ATOM   6366  N N   . GLU J  1 54  ? 49.672  117.927 10.911  1.00 62.16  ? 194  GLU G N   1 
ATOM   6367  C CA  . GLU J  1 54  ? 51.054  117.701 10.547  1.00 60.42  ? 194  GLU G CA  1 
ATOM   6368  C C   . GLU J  1 54  ? 51.683  119.100 10.628  1.00 55.33  ? 194  GLU G C   1 
ATOM   6369  O O   . GLU J  1 54  ? 52.703  119.295 11.282  1.00 52.98  ? 194  GLU G O   1 
ATOM   6370  C CB  . GLU J  1 54  ? 51.131  117.131 9.123   1.00 64.38  ? 194  GLU G CB  1 
ATOM   6371  C CG  . GLU J  1 54  ? 52.267  116.144 8.904   1.00 73.41  ? 194  GLU G CG  1 
ATOM   6372  C CD  . GLU J  1 54  ? 52.187  115.431 7.566   1.00 78.36  ? 194  GLU G CD  1 
ATOM   6373  O OE1 . GLU J  1 54  ? 52.202  116.115 6.518   1.00 80.95  ? 194  GLU G OE1 1 
ATOM   6374  O OE2 . GLU J  1 54  ? 52.111  114.181 7.565   1.00 84.61  ? 194  GLU G OE2 1 
ATOM   6375  N N   . GLU J  1 55  ? 51.044  120.074 9.990   1.00 56.20  ? 195  GLU G N   1 
ATOM   6376  C CA  . GLU J  1 55  ? 51.529  121.450 9.993   1.00 61.80  ? 195  GLU G CA  1 
ATOM   6377  C C   . GLU J  1 55  ? 51.665  121.989 11.419  1.00 62.87  ? 195  GLU G C   1 
ATOM   6378  O O   . GLU J  1 55  ? 52.424  122.918 11.669  1.00 63.85  ? 195  GLU G O   1 
ATOM   6379  C CB  . GLU J  1 55  ? 50.577  122.368 9.207   1.00 70.30  ? 195  GLU G CB  1 
ATOM   6380  C CG  . GLU J  1 55  ? 50.345  121.999 7.746   1.00 77.62  ? 195  GLU G CG  1 
ATOM   6381  C CD  . GLU J  1 55  ? 49.366  122.943 7.062   1.00 82.99  ? 195  GLU G CD  1 
ATOM   6382  O OE1 . GLU J  1 55  ? 49.120  124.052 7.591   1.00 83.16  ? 195  GLU G OE1 1 
ATOM   6383  O OE2 . GLU J  1 55  ? 48.845  122.576 5.989   1.00 86.16  ? 195  GLU G OE2 1 
ATOM   6384  N N   . LEU J  1 56  ? 50.917  121.416 12.350  1.00 64.06  ? 196  LEU G N   1 
ATOM   6385  C CA  . LEU J  1 56  ? 50.962  121.862 13.733  1.00 61.74  ? 196  LEU G CA  1 
ATOM   6386  C C   . LEU J  1 56  ? 51.990  121.092 14.519  1.00 65.54  ? 196  LEU G C   1 
ATOM   6387  O O   . LEU J  1 56  ? 52.064  121.205 15.755  1.00 62.79  ? 196  LEU G O   1 
ATOM   6388  C CB  . LEU J  1 56  ? 49.593  121.715 14.383  1.00 66.93  ? 196  LEU G CB  1 
ATOM   6389  C CG  . LEU J  1 56  ? 48.556  122.720 13.874  1.00 68.79  ? 196  LEU G CG  1 
ATOM   6390  C CD1 . LEU J  1 56  ? 47.244  122.493 14.598  1.00 67.25  ? 196  LEU G CD1 1 
ATOM   6391  C CD2 . LEU J  1 56  ? 49.051  124.143 14.104  1.00 73.63  ? 196  LEU G CD2 1 
ATOM   6392  N N   . HIS J  1 57  ? 52.776  120.308 13.777  1.00 67.56  ? 197  HIS G N   1 
ATOM   6393  C CA  . HIS J  1 57  ? 53.868  119.494 14.312  1.00 63.18  ? 197  HIS G CA  1 
ATOM   6394  C C   . HIS J  1 57  ? 53.438  118.283 15.122  1.00 60.83  ? 197  HIS G C   1 
ATOM   6395  O O   . HIS J  1 57  ? 54.039  117.986 16.150  1.00 59.73  ? 197  HIS G O   1 
ATOM   6396  C CB  . HIS J  1 57  ? 54.805  120.361 15.161  1.00 70.92  ? 197  HIS G CB  1 
ATOM   6397  C CG  . HIS J  1 57  ? 55.291  121.593 14.457  1.00 76.24  ? 197  HIS G CG  1 
ATOM   6398  N ND1 . HIS J  1 57  ? 55.786  121.566 13.171  1.00 76.56  ? 197  HIS G ND1 1 
ATOM   6399  C CD2 . HIS J  1 57  ? 55.351  122.887 14.853  1.00 79.32  ? 197  HIS G CD2 1 
ATOM   6400  C CE1 . HIS J  1 57  ? 56.127  122.788 12.804  1.00 73.96  ? 197  HIS G CE1 1 
ATOM   6401  N NE2 . HIS J  1 57  ? 55.873  123.608 13.806  1.00 80.68  ? 197  HIS G NE2 1 
ATOM   6402  N N   . PHE J  1 58  ? 52.405  117.585 14.659  1.00 57.21  ? 198  PHE G N   1 
ATOM   6403  C CA  . PHE J  1 58  ? 51.918  116.382 15.333  1.00 53.43  ? 198  PHE G CA  1 
ATOM   6404  C C   . PHE J  1 58  ? 52.283  115.170 14.478  1.00 57.16  ? 198  PHE G C   1 
ATOM   6405  O O   . PHE J  1 58  ? 52.355  115.261 13.250  1.00 59.12  ? 198  PHE G O   1 
ATOM   6406  C CB  . PHE J  1 58  ? 50.393  116.429 15.512  1.00 47.77  ? 198  PHE G CB  1 
ATOM   6407  C CG  . PHE J  1 58  ? 49.948  117.133 16.755  1.00 48.25  ? 198  PHE G CG  1 
ATOM   6408  C CD1 . PHE J  1 58  ? 49.989  118.520 16.844  1.00 51.60  ? 198  PHE G CD1 1 
ATOM   6409  C CD2 . PHE J  1 58  ? 49.537  116.404 17.867  1.00 40.75  ? 198  PHE G CD2 1 
ATOM   6410  C CE1 . PHE J  1 58  ? 49.630  119.161 18.028  1.00 49.59  ? 198  PHE G CE1 1 
ATOM   6411  C CE2 . PHE J  1 58  ? 49.177  117.040 19.057  1.00 36.40  ? 198  PHE G CE2 1 
ATOM   6412  C CZ  . PHE J  1 58  ? 49.223  118.415 19.140  1.00 38.14  ? 198  PHE G CZ  1 
ATOM   6413  N N   . GLU J  1 59  ? 52.514  114.031 15.114  1.00 56.20  ? 199  GLU G N   1 
ATOM   6414  C CA  . GLU J  1 59  ? 52.849  112.845 14.353  1.00 53.13  ? 199  GLU G CA  1 
ATOM   6415  C C   . GLU J  1 59  ? 51.572  112.077 14.083  1.00 47.81  ? 199  GLU G C   1 
ATOM   6416  O O   . GLU J  1 59  ? 51.052  111.391 14.957  1.00 54.07  ? 199  GLU G O   1 
ATOM   6417  C CB  . GLU J  1 59  ? 53.862  111.974 15.114  1.00 61.88  ? 199  GLU G CB  1 
ATOM   6418  C CG  . GLU J  1 59  ? 54.201  110.664 14.399  1.00 72.70  ? 199  GLU G CG  1 
ATOM   6419  C CD  . GLU J  1 59  ? 55.467  110.020 14.899  1.00 73.43  ? 199  GLU G CD  1 
ATOM   6420  O OE1 . GLU J  1 59  ? 56.340  110.744 15.413  1.00 78.51  ? 199  GLU G OE1 1 
ATOM   6421  O OE2 . GLU J  1 59  ? 55.596  108.787 14.759  1.00 80.07  ? 199  GLU G OE2 1 
ATOM   6422  N N   . ILE J  1 60  ? 51.078  112.190 12.860  1.00 39.64  ? 200  ILE G N   1 
ATOM   6423  C CA  . ILE J  1 60  ? 49.843  111.532 12.456  1.00 36.01  ? 200  ILE G CA  1 
ATOM   6424  C C   . ILE J  1 60  ? 49.985  110.033 12.469  1.00 30.54  ? 200  ILE G C   1 
ATOM   6425  O O   . ILE J  1 60  ? 51.038  109.509 12.136  1.00 33.11  ? 200  ILE G O   1 
ATOM   6426  C CB  . ILE J  1 60  ? 49.427  111.988 11.035  1.00 39.14  ? 200  ILE G CB  1 
ATOM   6427  C CG1 . ILE J  1 60  ? 49.657  113.498 10.893  1.00 46.20  ? 200  ILE G CG1 1 
ATOM   6428  C CG2 . ILE J  1 60  ? 47.974  111.665 10.781  1.00 39.07  ? 200  ILE G CG2 1 
ATOM   6429  C CD1 . ILE J  1 60  ? 49.148  114.336 12.076  1.00 44.99  ? 200  ILE G CD1 1 
ATOM   6430  N N   . LYS J  1 61  ? 48.919  109.342 12.841  1.00 28.45  ? 201  LYS G N   1 
ATOM   6431  C CA  . LYS J  1 61  ? 48.932  107.880 12.911  1.00 38.31  ? 201  LYS G CA  1 
ATOM   6432  C C   . LYS J  1 61  ? 47.586  107.336 12.433  1.00 38.98  ? 201  LYS G C   1 
ATOM   6433  O O   . LYS J  1 61  ? 46.706  106.983 13.230  1.00 41.00  ? 201  LYS G O   1 
ATOM   6434  C CB  . LYS J  1 61  ? 49.201  107.413 14.357  1.00 42.56  ? 201  LYS G CB  1 
ATOM   6435  C CG  . LYS J  1 61  ? 50.629  107.601 14.816  1.00 41.76  ? 201  LYS G CG  1 
ATOM   6436  C CD  . LYS J  1 61  ? 51.537  106.568 14.185  1.00 48.59  ? 201  LYS G CD  1 
ATOM   6437  C CE  . LYS J  1 61  ? 53.009  106.854 14.467  1.00 57.07  ? 201  LYS G CE  1 
ATOM   6438  N NZ  . LYS J  1 61  ? 53.889  105.784 13.915  1.00 58.74  ? 201  LYS G NZ  1 
ATOM   6439  N N   . PRO J  1 62  ? 47.410  107.252 11.117  1.00 37.47  ? 202  PRO G N   1 
ATOM   6440  C CA  . PRO J  1 62  ? 46.173  106.758 10.510  1.00 37.53  ? 202  PRO G CA  1 
ATOM   6441  C C   . PRO J  1 62  ? 45.910  105.291 10.746  1.00 36.86  ? 202  PRO G C   1 
ATOM   6442  O O   . PRO J  1 62  ? 46.829  104.535 11.035  1.00 35.17  ? 202  PRO G O   1 
ATOM   6443  C CB  . PRO J  1 62  ? 46.370  107.073 9.036   1.00 30.69  ? 202  PRO G CB  1 
ATOM   6444  C CG  . PRO J  1 62  ? 47.817  106.957 8.886   1.00 29.76  ? 202  PRO G CG  1 
ATOM   6445  C CD  . PRO J  1 62  ? 48.373  107.643 10.087  1.00 31.47  ? 202  PRO G CD  1 
ATOM   6446  N N   . HIS J  1 63  ? 44.641  104.915 10.613  1.00 32.35  ? 203  HIS G N   1 
ATOM   6447  C CA  . HIS J  1 63  ? 44.160  103.557 10.776  1.00 34.20  ? 203  HIS G CA  1 
ATOM   6448  C C   . HIS J  1 63  ? 42.872  103.543 9.987   1.00 41.22  ? 203  HIS G C   1 
ATOM   6449  O O   . HIS J  1 63  ? 42.064  104.451 10.137  1.00 47.80  ? 203  HIS G O   1 
ATOM   6450  C CB  . HIS J  1 63  ? 43.866  103.258 12.245  1.00 43.26  ? 203  HIS G CB  1 
ATOM   6451  C CG  . HIS J  1 63  ? 45.096  103.119 13.087  1.00 51.11  ? 203  HIS G CG  1 
ATOM   6452  N ND1 . HIS J  1 63  ? 45.791  101.936 13.203  1.00 51.00  ? 203  HIS G ND1 1 
ATOM   6453  C CD2 . HIS J  1 63  ? 45.794  104.032 13.803  1.00 58.30  ? 203  HIS G CD2 1 
ATOM   6454  C CE1 . HIS J  1 63  ? 46.866  102.125 13.947  1.00 45.91  ? 203  HIS G CE1 1 
ATOM   6455  N NE2 . HIS J  1 63  ? 46.893  103.388 14.323  1.00 52.97  ? 203  HIS G NE2 1 
ATOM   6456  N N   . HIS J  1 64  ? 42.662  102.524 9.154   1.00 45.95  ? 204  HIS G N   1 
ATOM   6457  C CA  . HIS J  1 64  ? 41.466  102.465 8.331   1.00 37.05  ? 204  HIS G CA  1 
ATOM   6458  C C   . HIS J  1 64  ? 40.537  101.297 8.550   1.00 39.24  ? 204  HIS G C   1 
ATOM   6459  O O   . HIS J  1 64  ? 40.956  100.204 8.879   1.00 53.68  ? 204  HIS G O   1 
ATOM   6460  C CB  . HIS J  1 64  ? 41.884  102.523 6.880   1.00 42.71  ? 204  HIS G CB  1 
ATOM   6461  C CG  . HIS J  1 64  ? 42.676  103.748 6.536   1.00 49.76  ? 204  HIS G CG  1 
ATOM   6462  N ND1 . HIS J  1 64  ? 42.087  104.963 6.251   1.00 57.26  ? 204  HIS G ND1 1 
ATOM   6463  C CD2 . HIS J  1 64  ? 44.013  103.958 6.479   1.00 46.51  ? 204  HIS G CD2 1 
ATOM   6464  C CE1 . HIS J  1 64  ? 43.027  105.866 6.033   1.00 49.34  ? 204  HIS G CE1 1 
ATOM   6465  N NE2 . HIS J  1 64  ? 44.204  105.282 6.167   1.00 45.87  ? 204  HIS G NE2 1 
ATOM   6466  N N   . ASP J  1 65  ? 39.257  101.561 8.367   1.00 42.84  ? 205  ASP G N   1 
ATOM   6467  C CA  . ASP J  1 65  ? 38.220  100.574 8.521   1.00 47.02  ? 205  ASP G CA  1 
ATOM   6468  C C   . ASP J  1 65  ? 38.422  99.662  9.724   1.00 51.73  ? 205  ASP G C   1 
ATOM   6469  O O   . ASP J  1 65  ? 38.340  98.437  9.617   1.00 58.36  ? 205  ASP G O   1 
ATOM   6470  C CB  . ASP J  1 65  ? 38.134  99.779  7.238   1.00 53.33  ? 205  ASP G CB  1 
ATOM   6471  C CG  . ASP J  1 65  ? 37.789  100.646 6.050   1.00 58.81  ? 205  ASP G CG  1 
ATOM   6472  O OD1 . ASP J  1 65  ? 36.638  101.112 5.955   1.00 62.53  ? 205  ASP G OD1 1 
ATOM   6473  O OD2 . ASP J  1 65  ? 38.675  100.868 5.209   1.00 65.21  ? 205  ASP G OD2 1 
ATOM   6474  N N   . CYS J  1 66  ? 38.672  100.270 10.878  1.00 42.70  ? 206  CYS G N   1 
ATOM   6475  C CA  . CYS J  1 66  ? 38.883  99.520  12.099  1.00 36.64  ? 206  CYS G CA  1 
ATOM   6476  C C   . CYS J  1 66  ? 37.555  99.024  12.680  1.00 39.20  ? 206  CYS G C   1 
ATOM   6477  O O   . CYS J  1 66  ? 36.535  99.677  12.539  1.00 35.81  ? 206  CYS G O   1 
ATOM   6478  C CB  . CYS J  1 66  ? 39.592  100.407 13.111  1.00 26.76  ? 206  CYS G CB  1 
ATOM   6479  S SG  . CYS J  1 66  ? 41.090  101.304 12.470  1.00 35.72  ? 206  CYS G SG  1 
ATOM   6480  N N   . THR J  1 67  ? 37.557  97.853  13.309  1.00 41.80  ? 207  THR G N   1 
ATOM   6481  C CA  . THR J  1 67  ? 36.343  97.342  13.925  1.00 43.29  ? 207  THR G CA  1 
ATOM   6482  C C   . THR J  1 67  ? 36.435  97.793  15.367  1.00 48.36  ? 207  THR G C   1 
ATOM   6483  O O   . THR J  1 67  ? 37.473  98.316  15.776  1.00 49.47  ? 207  THR G O   1 
ATOM   6484  C CB  . THR J  1 67  ? 36.284  95.814  13.920  1.00 42.93  ? 207  THR G CB  1 
ATOM   6485  O OG1 . THR J  1 67  ? 37.348  95.290  14.729  1.00 43.53  ? 207  THR G OG1 1 
ATOM   6486  C CG2 . THR J  1 67  ? 36.408  95.295  12.534  1.00 42.18  ? 207  THR G CG2 1 
ATOM   6487  N N   . VAL J  1 68  ? 35.369  97.599  16.142  1.00 51.33  ? 208  VAL G N   1 
ATOM   6488  C CA  . VAL J  1 68  ? 35.383  97.998  17.550  1.00 50.72  ? 208  VAL G CA  1 
ATOM   6489  C C   . VAL J  1 68  ? 36.588  97.365  18.198  1.00 52.10  ? 208  VAL G C   1 
ATOM   6490  O O   . VAL J  1 68  ? 37.379  98.034  18.854  1.00 51.37  ? 208  VAL G O   1 
ATOM   6491  C CB  . VAL J  1 68  ? 34.139  97.516  18.283  1.00 52.08  ? 208  VAL G CB  1 
ATOM   6492  C CG1 . VAL J  1 68  ? 34.338  97.654  19.776  1.00 55.41  ? 208  VAL G CG1 1 
ATOM   6493  C CG2 . VAL J  1 68  ? 32.945  98.333  17.843  1.00 56.16  ? 208  VAL G CG2 1 
ATOM   6494  N N   . GLU J  1 69  ? 36.717  96.062  17.980  1.00 53.44  ? 209  GLU G N   1 
ATOM   6495  C CA  . GLU J  1 69  ? 37.823  95.272  18.497  1.00 54.10  ? 209  GLU G CA  1 
ATOM   6496  C C   . GLU J  1 69  ? 39.138  95.995  18.224  1.00 50.12  ? 209  GLU G C   1 
ATOM   6497  O O   . GLU J  1 69  ? 39.914  96.289  19.129  1.00 33.22  ? 209  GLU G O   1 
ATOM   6498  C CB  . GLU J  1 69  ? 37.836  93.905  17.796  1.00 73.83  ? 209  GLU G CB  1 
ATOM   6499  C CG  . GLU J  1 69  ? 38.799  92.878  18.385  1.00 84.24  ? 209  GLU G CG  1 
ATOM   6500  C CD  . GLU J  1 69  ? 38.400  92.457  19.777  1.00 84.42  ? 209  GLU G CD  1 
ATOM   6501  O OE1 . GLU J  1 69  ? 38.278  93.345  20.642  1.00 89.10  ? 209  GLU G OE1 1 
ATOM   6502  O OE2 . GLU J  1 69  ? 38.206  91.245  20.012  1.00 87.20  ? 209  GLU G OE2 1 
ATOM   6503  N N   . GLN J  1 70  ? 39.362  96.288  16.950  1.00 50.00  ? 210  GLN G N   1 
ATOM   6504  C CA  . GLN J  1 70  ? 40.574  96.943  16.507  1.00 48.11  ? 210  GLN G CA  1 
ATOM   6505  C C   . GLN J  1 70  ? 40.800  98.321  17.110  1.00 44.46  ? 210  GLN G C   1 
ATOM   6506  O O   . GLN J  1 70  ? 41.941  98.715  17.388  1.00 36.11  ? 210  GLN G O   1 
ATOM   6507  C CB  . GLN J  1 70  ? 40.542  97.024  14.986  1.00 53.92  ? 210  GLN G CB  1 
ATOM   6508  C CG  . GLN J  1 70  ? 40.327  95.675  14.320  1.00 54.26  ? 210  GLN G CG  1 
ATOM   6509  C CD  . GLN J  1 70  ? 40.277  95.781  12.831  1.00 55.70  ? 210  GLN G CD  1 
ATOM   6510  O OE1 . GLN J  1 70  ? 41.197  96.294  12.200  1.00 70.54  ? 210  GLN G OE1 1 
ATOM   6511  N NE2 . GLN J  1 70  ? 39.200  95.300  12.251  1.00 63.75  ? 210  GLN G NE2 1 
ATOM   6512  N N   . ILE J  1 71  ? 39.710  99.056  17.307  1.00 43.11  ? 211  ILE G N   1 
ATOM   6513  C CA  . ILE J  1 71  ? 39.800  100.400 17.860  1.00 40.23  ? 211  ILE G CA  1 
ATOM   6514  C C   . ILE J  1 71  ? 40.325  100.318 19.278  1.00 37.50  ? 211  ILE G C   1 
ATOM   6515  O O   . ILE J  1 71  ? 41.346  100.938 19.631  1.00 25.58  ? 211  ILE G O   1 
ATOM   6516  C CB  . ILE J  1 71  ? 38.421  101.102 17.822  1.00 47.23  ? 211  ILE G CB  1 
ATOM   6517  C CG1 . ILE J  1 71  ? 38.076  101.478 16.373  1.00 42.17  ? 211  ILE G CG1 1 
ATOM   6518  C CG2 . ILE J  1 71  ? 38.432  102.360 18.696  1.00 44.76  ? 211  ILE G CG2 1 
ATOM   6519  C CD1 . ILE J  1 71  ? 36.664  101.971 16.193  1.00 27.68  ? 211  ILE G CD1 1 
ATOM   6520  N N   . TYR J  1 72  ? 39.637  99.536  20.093  1.00 38.31  ? 212  TYR G N   1 
ATOM   6521  C CA  . TYR J  1 72  ? 40.072  99.350  21.464  1.00 42.12  ? 212  TYR G CA  1 
ATOM   6522  C C   . TYR J  1 72  ? 41.555  98.975  21.493  1.00 47.56  ? 212  TYR G C   1 
ATOM   6523  O O   . TYR J  1 72  ? 42.331  99.542  22.261  1.00 54.09  ? 212  TYR G O   1 
ATOM   6524  C CB  . TYR J  1 72  ? 39.237  98.268  22.117  1.00 41.54  ? 212  TYR G CB  1 
ATOM   6525  C CG  . TYR J  1 72  ? 37.871  98.742  22.544  1.00 46.00  ? 212  TYR G CG  1 
ATOM   6526  C CD1 . TYR J  1 72  ? 37.724  99.942  23.235  1.00 47.73  ? 212  TYR G CD1 1 
ATOM   6527  C CD2 . TYR J  1 72  ? 36.732  97.968  22.312  1.00 45.41  ? 212  TYR G CD2 1 
ATOM   6528  C CE1 . TYR J  1 72  ? 36.486  100.361 23.692  1.00 52.62  ? 212  TYR G CE1 1 
ATOM   6529  C CE2 . TYR J  1 72  ? 35.488  98.377  22.761  1.00 50.62  ? 212  TYR G CE2 1 
ATOM   6530  C CZ  . TYR J  1 72  ? 35.373  99.575  23.454  1.00 56.36  ? 212  TYR G CZ  1 
ATOM   6531  O OH  . TYR J  1 72  ? 34.146  99.986  23.921  1.00 66.08  ? 212  TYR G OH  1 
ATOM   6532  N N   . GLU J  1 73  ? 41.944  98.031  20.641  1.00 50.98  ? 213  GLU G N   1 
ATOM   6533  C CA  . GLU J  1 73  ? 43.328  97.585  20.548  1.00 47.73  ? 213  GLU G CA  1 
ATOM   6534  C C   . GLU J  1 73  ? 44.254  98.751  20.314  1.00 43.27  ? 213  GLU G C   1 
ATOM   6535  O O   . GLU J  1 73  ? 45.257  98.908  21.020  1.00 43.38  ? 213  GLU G O   1 
ATOM   6536  C CB  . GLU J  1 73  ? 43.502  96.598  19.395  1.00 62.64  ? 213  GLU G CB  1 
ATOM   6537  C CG  . GLU J  1 73  ? 43.190  95.132  19.712  1.00 76.88  ? 213  GLU G CG  1 
ATOM   6538  C CD  . GLU J  1 73  ? 43.292  94.234  18.468  1.00 87.86  ? 213  GLU G CD  1 
ATOM   6539  O OE1 . GLU J  1 73  ? 44.204  94.468  17.631  1.00 89.21  ? 213  GLU G OE1 1 
ATOM   6540  O OE2 . GLU J  1 73  ? 42.469  93.292  18.331  1.00 86.82  ? 213  GLU G OE2 1 
ATOM   6541  N N   . ILE J  1 74  ? 43.922  99.567  19.316  1.00 38.84  ? 214  ILE G N   1 
ATOM   6542  C CA  . ILE J  1 74  ? 44.748  100.725 18.966  1.00 33.55  ? 214  ILE G CA  1 
ATOM   6543  C C   . ILE J  1 74  ? 44.870  101.726 20.104  1.00 34.53  ? 214  ILE G C   1 
ATOM   6544  O O   . ILE J  1 74  ? 45.941  102.313 20.338  1.00 25.85  ? 214  ILE G O   1 
ATOM   6545  C CB  . ILE J  1 74  ? 44.192  101.442 17.754  1.00 30.16  ? 214  ILE G CB  1 
ATOM   6546  C CG1 . ILE J  1 74  ? 44.065  100.456 16.605  1.00 29.65  ? 214  ILE G CG1 1 
ATOM   6547  C CG2 . ILE J  1 74  ? 45.090  102.613 17.394  1.00 24.29  ? 214  ILE G CG2 1 
ATOM   6548  C CD1 . ILE J  1 74  ? 43.529  101.047 15.331  1.00 34.19  ? 214  ILE G CD1 1 
ATOM   6549  N N   . LEU J  1 75  ? 43.765  101.937 20.811  1.00 33.05  ? 215  LEU G N   1 
ATOM   6550  C CA  . LEU J  1 75  ? 43.804  102.859 21.930  1.00 39.08  ? 215  LEU G CA  1 
ATOM   6551  C C   . LEU J  1 75  ? 44.637  102.266 23.068  1.00 43.82  ? 215  LEU G C   1 
ATOM   6552  O O   . LEU J  1 75  ? 45.402  102.978 23.729  1.00 44.08  ? 215  LEU G O   1 
ATOM   6553  C CB  . LEU J  1 75  ? 42.382  103.174 22.381  1.00 38.20  ? 215  LEU G CB  1 
ATOM   6554  C CG  . LEU J  1 75  ? 41.564  103.940 21.326  1.00 27.70  ? 215  LEU G CG  1 
ATOM   6555  C CD1 . LEU J  1 75  ? 40.158  104.138 21.817  1.00 29.69  ? 215  LEU G CD1 1 
ATOM   6556  C CD2 . LEU J  1 75  ? 42.216  105.305 21.020  1.00 32.31  ? 215  LEU G CD2 1 
ATOM   6557  N N   . LYS J  1 76  ? 44.509  100.955 23.268  1.00 42.46  ? 216  LYS G N   1 
ATOM   6558  C CA  . LYS J  1 76  ? 45.271  100.269 24.301  1.00 43.15  ? 216  LYS G CA  1 
ATOM   6559  C C   . LYS J  1 76  ? 46.756  100.549 24.122  1.00 41.22  ? 216  LYS G C   1 
ATOM   6560  O O   . LYS J  1 76  ? 47.478  100.818 25.075  1.00 47.49  ? 216  LYS G O   1 
ATOM   6561  C CB  . LYS J  1 76  ? 45.041  98.764  24.241  1.00 43.44  ? 216  LYS G CB  1 
ATOM   6562  C CG  . LYS J  1 76  ? 45.621  98.004  25.443  1.00 45.01  ? 216  LYS G CG  1 
ATOM   6563  C CD  . LYS J  1 76  ? 44.994  98.509  26.732  1.00 67.28  ? 216  LYS G CD  1 
ATOM   6564  C CE  . LYS J  1 76  ? 45.436  97.723  27.963  1.00 80.95  ? 216  LYS G CE  1 
ATOM   6565  N NZ  . LYS J  1 76  ? 44.859  98.314  29.226  1.00 86.99  ? 216  LYS G NZ  1 
ATOM   6566  N N   . ILE J  1 77  ? 47.214  100.469 22.890  1.00 37.88  ? 217  ILE G N   1 
ATOM   6567  C CA  . ILE J  1 77  ? 48.606  100.724 22.604  1.00 40.12  ? 217  ILE G CA  1 
ATOM   6568  C C   . ILE J  1 77  ? 48.997  102.120 23.049  1.00 43.32  ? 217  ILE G C   1 
ATOM   6569  O O   . ILE J  1 77  ? 49.933  102.299 23.823  1.00 49.12  ? 217  ILE G O   1 
ATOM   6570  C CB  . ILE J  1 77  ? 48.875  100.615 21.102  1.00 45.40  ? 217  ILE G CB  1 
ATOM   6571  C CG1 . ILE J  1 77  ? 48.724  99.164  20.656  1.00 50.56  ? 217  ILE G CG1 1 
ATOM   6572  C CG2 . ILE J  1 77  ? 50.237  101.192 20.764  1.00 32.33  ? 217  ILE G CG2 1 
ATOM   6573  C CD1 . ILE J  1 77  ? 48.791  98.986  19.149  1.00 55.74  ? 217  ILE G CD1 1 
ATOM   6574  N N   . TYR J  1 78  ? 48.288  103.129 22.569  1.00 42.76  ? 218  TYR G N   1 
ATOM   6575  C CA  . TYR J  1 78  ? 48.680  104.483 22.942  1.00 46.33  ? 218  TYR G CA  1 
ATOM   6576  C C   . TYR J  1 78  ? 48.430  104.755 24.412  1.00 43.61  ? 218  TYR G C   1 
ATOM   6577  O O   . TYR J  1 78  ? 49.098  105.594 25.052  1.00 29.16  ? 218  TYR G O   1 
ATOM   6578  C CB  . TYR J  1 78  ? 47.986  105.511 22.035  1.00 42.83  ? 218  TYR G CB  1 
ATOM   6579  C CG  . TYR J  1 78  ? 48.512  105.441 20.619  1.00 40.77  ? 218  TYR G CG  1 
ATOM   6580  C CD1 . TYR J  1 78  ? 48.001  104.515 19.703  1.00 29.31  ? 218  TYR G CD1 1 
ATOM   6581  C CD2 . TYR J  1 78  ? 49.601  106.227 20.229  1.00 35.95  ? 218  TYR G CD2 1 
ATOM   6582  C CE1 . TYR J  1 78  ? 48.566  104.373 18.442  1.00 37.60  ? 218  TYR G CE1 1 
ATOM   6583  C CE2 . TYR J  1 78  ? 50.178  106.083 18.955  1.00 34.15  ? 218  TYR G CE2 1 
ATOM   6584  C CZ  . TYR J  1 78  ? 49.658  105.157 18.066  1.00 35.26  ? 218  TYR G CZ  1 
ATOM   6585  O OH  . TYR J  1 78  ? 50.230  105.021 16.802  1.00 40.57  ? 218  TYR G OH  1 
ATOM   6586  N N   . GLN J  1 79  ? 47.477  104.019 24.966  1.00 43.08  ? 219  GLN G N   1 
ATOM   6587  C CA  . GLN J  1 79  ? 47.189  104.191 26.373  1.00 45.38  ? 219  GLN G CA  1 
ATOM   6588  C C   . GLN J  1 79  ? 48.426  103.788 27.154  1.00 49.61  ? 219  GLN G C   1 
ATOM   6589  O O   . GLN J  1 79  ? 48.766  104.419 28.146  1.00 54.23  ? 219  GLN G O   1 
ATOM   6590  C CB  . GLN J  1 79  ? 46.039  103.305 26.809  1.00 39.85  ? 219  GLN G CB  1 
ATOM   6591  C CG  . GLN J  1 79  ? 45.874  103.326 28.299  1.00 50.75  ? 219  GLN G CG  1 
ATOM   6592  C CD  . GLN J  1 79  ? 45.514  101.973 28.876  1.00 59.61  ? 219  GLN G CD  1 
ATOM   6593  O OE1 . GLN J  1 79  ? 44.667  101.243 28.343  1.00 61.95  ? 219  GLN G OE1 1 
ATOM   6594  N NE2 . GLN J  1 79  ? 46.140  101.638 29.984  1.00 59.15  ? 219  GLN G NE2 1 
ATOM   6595  N N   . LEU J  1 80  ? 49.089  102.727 26.685  1.00 49.53  ? 220  LEU G N   1 
ATOM   6596  C CA  . LEU J  1 80  ? 50.281  102.175 27.320  1.00 43.21  ? 220  LEU G CA  1 
ATOM   6597  C C   . LEU J  1 80  ? 51.609  102.764 26.876  1.00 46.78  ? 220  LEU G C   1 
ATOM   6598  O O   . LEU J  1 80  ? 52.654  102.405 27.407  1.00 49.35  ? 220  LEU G O   1 
ATOM   6599  C CB  . LEU J  1 80  ? 50.332  100.668 27.119  1.00 28.12  ? 220  LEU G CB  1 
ATOM   6600  C CG  . LEU J  1 80  ? 49.152  99.939  27.748  1.00 47.02  ? 220  LEU G CG  1 
ATOM   6601  C CD1 . LEU J  1 80  ? 49.200  98.468  27.403  1.00 37.12  ? 220  LEU G CD1 1 
ATOM   6602  C CD2 . LEU J  1 80  ? 49.191  100.128 29.265  1.00 54.99  ? 220  LEU G CD2 1 
ATOM   6603  N N   . MET J  1 81  ? 51.594  103.649 25.898  1.00 45.01  ? 221  MET G N   1 
ATOM   6604  C CA  . MET J  1 81  ? 52.837  104.240 25.479  1.00 48.34  ? 221  MET G CA  1 
ATOM   6605  C C   . MET J  1 81  ? 53.337  105.227 26.524  1.00 52.07  ? 221  MET G C   1 
ATOM   6606  O O   . MET J  1 81  ? 52.638  105.537 27.480  1.00 54.78  ? 221  MET G O   1 
ATOM   6607  C CB  . MET J  1 81  ? 52.643  104.956 24.168  1.00 53.67  ? 221  MET G CB  1 
ATOM   6608  C CG  . MET J  1 81  ? 52.641  104.038 22.998  1.00 64.31  ? 221  MET G CG  1 
ATOM   6609  S SD  . MET J  1 81  ? 53.205  105.018 21.628  1.00 71.68  ? 221  MET G SD  1 
ATOM   6610  C CE  . MET J  1 81  ? 54.585  105.928 22.401  1.00 70.18  ? 221  MET G CE  1 
ATOM   6611  N N   . ASP J  1 82  ? 54.560  105.708 26.351  1.00 52.87  ? 222  ASP G N   1 
ATOM   6612  C CA  . ASP J  1 82  ? 55.117  106.665 27.279  1.00 53.73  ? 222  ASP G CA  1 
ATOM   6613  C C   . ASP J  1 82  ? 55.160  107.982 26.546  1.00 54.98  ? 222  ASP G C   1 
ATOM   6614  O O   . ASP J  1 82  ? 55.982  108.171 25.639  1.00 44.15  ? 222  ASP G O   1 
ATOM   6615  C CB  . ASP J  1 82  ? 56.528  106.257 27.729  1.00 58.93  ? 222  ASP G CB  1 
ATOM   6616  C CG  . ASP J  1 82  ? 57.182  107.309 28.631  1.00 66.89  ? 222  ASP G CG  1 
ATOM   6617  O OD1 . ASP J  1 82  ? 56.818  108.500 28.535  1.00 75.55  ? 222  ASP G OD1 1 
ATOM   6618  O OD2 . ASP J  1 82  ? 58.067  106.956 29.431  1.00 72.96  ? 222  ASP G OD2 1 
ATOM   6619  N N   . HIS J  1 83  ? 54.280  108.895 26.958  1.00 53.65  ? 224  HIS G N   1 
ATOM   6620  C CA  . HIS J  1 83  ? 54.175  110.208 26.322  1.00 54.19  ? 224  HIS G CA  1 
ATOM   6621  C C   . HIS J  1 83  ? 55.008  111.271 27.026  1.00 57.03  ? 224  HIS G C   1 
ATOM   6622  O O   . HIS J  1 83  ? 54.853  112.465 26.745  1.00 54.82  ? 224  HIS G O   1 
ATOM   6623  C CB  . HIS J  1 83  ? 52.707  110.656 26.302  1.00 52.32  ? 224  HIS G CB  1 
ATOM   6624  C CG  . HIS J  1 83  ? 51.786  109.715 25.584  1.00 47.95  ? 224  HIS G CG  1 
ATOM   6625  N ND1 . HIS J  1 83  ? 51.398  109.910 24.275  1.00 35.91  ? 224  HIS G ND1 1 
ATOM   6626  C CD2 . HIS J  1 83  ? 51.199  108.558 25.986  1.00 44.33  ? 224  HIS G CD2 1 
ATOM   6627  C CE1 . HIS J  1 83  ? 50.616  108.910 23.901  1.00 38.96  ? 224  HIS G CE1 1 
ATOM   6628  N NE2 . HIS J  1 83  ? 50.481  108.075 24.918  1.00 30.25  ? 224  HIS G NE2 1 
ATOM   6629  N N   . SER J  1 84  ? 55.900  110.841 27.917  1.00 55.56  ? 225  SER G N   1 
ATOM   6630  C CA  . SER J  1 84  ? 56.719  111.775 28.689  1.00 54.61  ? 225  SER G CA  1 
ATOM   6631  C C   . SER J  1 84  ? 57.352  112.925 27.913  1.00 57.22  ? 225  SER G C   1 
ATOM   6632  O O   . SER J  1 84  ? 57.471  114.035 28.434  1.00 65.16  ? 225  SER G O   1 
ATOM   6633  C CB  . SER J  1 84  ? 57.806  111.022 29.456  1.00 45.40  ? 225  SER G CB  1 
ATOM   6634  O OG  . SER J  1 84  ? 57.244  110.160 30.438  1.00 38.75  ? 225  SER G OG  1 
ATOM   6635  N N   . ASN J  1 85  ? 57.739  112.686 26.670  1.00 56.54  ? 226  ASN G N   1 
ATOM   6636  C CA  . ASN J  1 85  ? 58.370  113.738 25.885  1.00 59.16  ? 226  ASN G CA  1 
ATOM   6637  C C   . ASN J  1 85  ? 57.399  114.358 24.932  1.00 56.16  ? 226  ASN G C   1 
ATOM   6638  O O   . ASN J  1 85  ? 57.793  114.971 23.937  1.00 54.49  ? 226  ASN G O   1 
ATOM   6639  C CB  . ASN J  1 85  ? 59.562  113.184 25.104  1.00 71.30  ? 226  ASN G CB  1 
ATOM   6640  C CG  . ASN J  1 85  ? 60.737  112.804 26.006  1.00 76.09  ? 226  ASN G CG  1 
ATOM   6641  O OD1 . ASN J  1 85  ? 61.695  112.182 25.555  1.00 77.64  ? 226  ASN G OD1 1 
ATOM   6642  N ND2 . ASN J  1 85  ? 60.668  113.185 27.279  1.00 81.67  ? 226  ASN G ND2 1 
ATOM   6643  N N   . MET J  1 86  ? 56.124  114.184 25.248  1.00 57.01  ? 227  MET G N   1 
ATOM   6644  C CA  . MET J  1 86  ? 55.049  114.715 24.433  1.00 60.25  ? 227  MET G CA  1 
ATOM   6645  C C   . MET J  1 86  ? 54.258  115.762 25.241  1.00 65.82  ? 227  MET G C   1 
ATOM   6646  O O   . MET J  1 86  ? 54.092  115.641 26.463  1.00 62.56  ? 227  MET G O   1 
ATOM   6647  C CB  . MET J  1 86  ? 54.153  113.560 23.984  1.00 50.67  ? 227  MET G CB  1 
ATOM   6648  C CG  . MET J  1 86  ? 54.918  112.441 23.327  1.00 48.20  ? 227  MET G CG  1 
ATOM   6649  S SD  . MET J  1 86  ? 55.664  112.954 21.747  1.00 68.07  ? 227  MET G SD  1 
ATOM   6650  C CE  . MET J  1 86  ? 55.026  111.677 20.664  1.00 48.97  ? 227  MET G CE  1 
ATOM   6651  N N   . ASP J  1 87  ? 53.793  116.806 24.561  1.00 65.53  ? 228  ASP G N   1 
ATOM   6652  C CA  . ASP J  1 87  ? 53.038  117.850 25.226  1.00 66.23  ? 228  ASP G CA  1 
ATOM   6653  C C   . ASP J  1 87  ? 51.524  117.725 25.093  1.00 67.63  ? 228  ASP G C   1 
ATOM   6654  O O   . ASP J  1 87  ? 50.770  118.325 25.865  1.00 71.09  ? 228  ASP G O   1 
ATOM   6655  C CB  . ASP J  1 87  ? 53.483  119.215 24.704  1.00 63.86  ? 228  ASP G CB  1 
ATOM   6656  C CG  . ASP J  1 87  ? 54.780  119.667 25.328  1.00 70.24  ? 228  ASP G CG  1 
ATOM   6657  O OD1 . ASP J  1 87  ? 55.055  119.242 26.475  1.00 67.50  ? 228  ASP G OD1 1 
ATOM   6658  O OD2 . ASP J  1 87  ? 55.514  120.454 24.689  1.00 73.54  ? 228  ASP G OD2 1 
ATOM   6659  N N   . CYS J  1 88  ? 51.081  116.925 24.132  1.00 66.07  ? 229  CYS G N   1 
ATOM   6660  C CA  . CYS J  1 88  ? 49.660  116.763 23.875  1.00 61.43  ? 229  CYS G CA  1 
ATOM   6661  C C   . CYS J  1 88  ? 49.371  115.439 23.177  1.00 56.50  ? 229  CYS G C   1 
ATOM   6662  O O   . CYS J  1 88  ? 50.263  114.829 22.614  1.00 66.07  ? 229  CYS G O   1 
ATOM   6663  C CB  . CYS J  1 88  ? 49.203  117.935 22.993  1.00 63.75  ? 229  CYS G CB  1 
ATOM   6664  S SG  . CYS J  1 88  ? 47.499  117.880 22.399  1.00 63.48  ? 229  CYS G SG  1 
ATOM   6665  N N   . PHE J  1 89  ? 48.123  114.995 23.230  1.00 50.79  ? 230  PHE G N   1 
ATOM   6666  C CA  . PHE J  1 89  ? 47.691  113.772 22.563  1.00 43.49  ? 230  PHE G CA  1 
ATOM   6667  C C   . PHE J  1 89  ? 46.359  114.072 21.887  1.00 48.07  ? 230  PHE G C   1 
ATOM   6668  O O   . PHE J  1 89  ? 45.502  114.725 22.471  1.00 48.33  ? 230  PHE G O   1 
ATOM   6669  C CB  . PHE J  1 89  ? 47.492  112.649 23.555  1.00 32.84  ? 230  PHE G CB  1 
ATOM   6670  C CG  . PHE J  1 89  ? 46.860  111.433 22.961  1.00 34.39  ? 230  PHE G CG  1 
ATOM   6671  C CD1 . PHE J  1 89  ? 47.549  110.647 22.055  1.00 38.21  ? 230  PHE G CD1 1 
ATOM   6672  C CD2 . PHE J  1 89  ? 45.575  111.049 23.328  1.00 38.07  ? 230  PHE G CD2 1 
ATOM   6673  C CE1 . PHE J  1 89  ? 46.962  109.482 21.525  1.00 46.20  ? 230  PHE G CE1 1 
ATOM   6674  C CE2 . PHE J  1 89  ? 44.979  109.884 22.801  1.00 40.87  ? 230  PHE G CE2 1 
ATOM   6675  C CZ  . PHE J  1 89  ? 45.675  109.103 21.903  1.00 38.47  ? 230  PHE G CZ  1 
ATOM   6676  N N   . ILE J  1 90  ? 46.185  113.605 20.655  1.00 50.17  ? 231  ILE G N   1 
ATOM   6677  C CA  . ILE J  1 90  ? 44.940  113.839 19.923  1.00 50.12  ? 231  ILE G CA  1 
ATOM   6678  C C   . ILE J  1 90  ? 44.436  112.570 19.254  1.00 51.24  ? 231  ILE G C   1 
ATOM   6679  O O   . ILE J  1 90  ? 45.201  111.820 18.670  1.00 62.67  ? 231  ILE G O   1 
ATOM   6680  C CB  . ILE J  1 90  ? 45.118  114.891 18.811  1.00 49.05  ? 231  ILE G CB  1 
ATOM   6681  C CG1 . ILE J  1 90  ? 45.604  116.212 19.394  1.00 46.08  ? 231  ILE G CG1 1 
ATOM   6682  C CG2 . ILE J  1 90  ? 43.802  115.120 18.102  1.00 42.78  ? 231  ILE G CG2 1 
ATOM   6683  C CD1 . ILE J  1 90  ? 45.671  117.299 18.360  1.00 39.22  ? 231  ILE G CD1 1 
ATOM   6684  N N   . CYS J  1 91  ? 43.140  112.335 19.330  1.00 47.45  ? 232  CYS G N   1 
ATOM   6685  C CA  . CYS J  1 91  ? 42.557  111.164 18.711  1.00 40.64  ? 232  CYS G CA  1 
ATOM   6686  C C   . CYS J  1 91  ? 41.309  111.575 17.936  1.00 43.10  ? 232  CYS G C   1 
ATOM   6687  O O   . CYS J  1 91  ? 40.344  112.078 18.515  1.00 44.61  ? 232  CYS G O   1 
ATOM   6688  C CB  . CYS J  1 91  ? 42.189  110.156 19.770  1.00 28.26  ? 232  CYS G CB  1 
ATOM   6689  S SG  . CYS J  1 91  ? 41.161  108.832 19.167  1.00 35.31  ? 232  CYS G SG  1 
ATOM   6690  N N   . CYS J  1 92  ? 41.337  111.379 16.623  1.00 37.64  ? 233  CYS G N   1 
ATOM   6691  C CA  . CYS J  1 92  ? 40.193  111.719 15.792  1.00 32.65  ? 233  CYS G CA  1 
ATOM   6692  C C   . CYS J  1 92  ? 39.513  110.436 15.366  1.00 36.73  ? 233  CYS G C   1 
ATOM   6693  O O   . CYS J  1 92  ? 40.170  109.460 15.018  1.00 46.60  ? 233  CYS G O   1 
ATOM   6694  C CB  . CYS J  1 92  ? 40.632  112.466 14.547  1.00 25.22  ? 233  CYS G CB  1 
ATOM   6695  S SG  . CYS J  1 92  ? 41.698  113.868 14.861  1.00 34.06  ? 233  CYS G SG  1 
ATOM   6696  N N   . ILE J  1 93  ? 38.194  110.429 15.399  1.00 33.20  ? 234  ILE G N   1 
ATOM   6697  C CA  . ILE J  1 93  ? 37.451  109.262 14.992  1.00 27.07  ? 234  ILE G CA  1 
ATOM   6698  C C   . ILE J  1 93  ? 36.386  109.665 13.984  1.00 30.60  ? 234  ILE G C   1 
ATOM   6699  O O   . ILE J  1 93  ? 35.498  110.463 14.287  1.00 23.53  ? 234  ILE G O   1 
ATOM   6700  C CB  . ILE J  1 93  ? 36.802  108.609 16.174  1.00 22.33  ? 234  ILE G CB  1 
ATOM   6701  C CG1 . ILE J  1 93  ? 37.885  108.118 17.114  1.00 15.49  ? 234  ILE G CG1 1 
ATOM   6702  C CG2 . ILE J  1 93  ? 35.940  107.453 15.721  1.00 25.95  ? 234  ILE G CG2 1 
ATOM   6703  C CD1 . ILE J  1 93  ? 37.323  107.424 18.315  1.00 22.74  ? 234  ILE G CD1 1 
ATOM   6704  N N   . LEU J  1 94  ? 36.515  109.118 12.779  1.00 26.69  ? 235  LEU G N   1 
ATOM   6705  C CA  . LEU J  1 94  ? 35.607  109.377 11.679  1.00 21.62  ? 235  LEU G CA  1 
ATOM   6706  C C   . LEU J  1 94  ? 34.876  108.068 11.433  1.00 25.61  ? 235  LEU G C   1 
ATOM   6707  O O   . LEU J  1 94  ? 35.483  107.094 11.002  1.00 31.61  ? 235  LEU G O   1 
ATOM   6708  C CB  . LEU J  1 94  ? 36.411  109.756 10.438  1.00 20.41  ? 235  LEU G CB  1 
ATOM   6709  C CG  . LEU J  1 94  ? 37.604  110.658 10.709  1.00 18.47  ? 235  LEU G CG  1 
ATOM   6710  C CD1 . LEU J  1 94  ? 38.313  110.988 9.443   1.00 31.27  ? 235  LEU G CD1 1 
ATOM   6711  C CD2 . LEU J  1 94  ? 37.158  111.892 11.362  1.00 24.46  ? 235  LEU G CD2 1 
ATOM   6712  N N   . SER J  1 95  ? 33.579  108.032 11.686  1.00 19.05  ? 236  SER G N   1 
ATOM   6713  C CA  . SER J  1 95  ? 32.850  106.795 11.503  1.00 21.87  ? 236  SER G CA  1 
ATOM   6714  C C   . SER J  1 95  ? 31.361  107.061 11.671  1.00 22.21  ? 236  SER G C   1 
ATOM   6715  O O   . SER J  1 95  ? 30.948  108.185 11.765  1.00 23.58  ? 236  SER G O   1 
ATOM   6716  C CB  . SER J  1 95  ? 33.336  105.783 12.555  1.00 23.20  ? 236  SER G CB  1 
ATOM   6717  O OG  . SER J  1 95  ? 32.646  104.538 12.510  1.00 28.68  ? 236  SER G OG  1 
ATOM   6718  N N   . HIS J  1 96  ? 30.558  106.012 11.654  1.00 28.67  ? 237  HIS G N   1 
ATOM   6719  C CA  . HIS J  1 96  ? 29.138  106.134 11.897  1.00 33.33  ? 237  HIS G CA  1 
ATOM   6720  C C   . HIS J  1 96  ? 28.993  106.076 13.410  1.00 40.34  ? 237  HIS G C   1 
ATOM   6721  O O   . HIS J  1 96  ? 29.913  105.662 14.120  1.00 49.23  ? 237  HIS G O   1 
ATOM   6722  C CB  . HIS J  1 96  ? 28.372  104.962 11.315  1.00 38.11  ? 237  HIS G CB  1 
ATOM   6723  C CG  . HIS J  1 96  ? 28.039  105.121 9.875   1.00 46.31  ? 237  HIS G CG  1 
ATOM   6724  N ND1 . HIS J  1 96  ? 27.496  106.279 9.370   1.00 52.20  ? 237  HIS G ND1 1 
ATOM   6725  C CD2 . HIS J  1 96  ? 28.162  104.273 8.830   1.00 46.10  ? 237  HIS G CD2 1 
ATOM   6726  C CE1 . HIS J  1 96  ? 27.303  106.141 8.073   1.00 48.11  ? 237  HIS G CE1 1 
ATOM   6727  N NE2 . HIS J  1 96  ? 27.699  104.932 7.721   1.00 50.92  ? 237  HIS G NE2 1 
ATOM   6728  N N   . GLY J  1 97  ? 27.832  106.470 13.904  1.00 37.61  ? 238  GLY G N   1 
ATOM   6729  C CA  . GLY J  1 97  ? 27.614  106.436 15.326  1.00 36.69  ? 238  GLY G CA  1 
ATOM   6730  C C   . GLY J  1 97  ? 26.158  106.627 15.688  1.00 44.13  ? 238  GLY G C   1 
ATOM   6731  O O   . GLY J  1 97  ? 25.309  106.846 14.834  1.00 47.57  ? 238  GLY G O   1 
ATOM   6732  N N   . ASP J  1 98  ? 25.871  106.535 16.978  1.00 45.40  ? 239  ASP G N   1 
ATOM   6733  C CA  . ASP J  1 98  ? 24.529  106.720 17.490  1.00 37.53  ? 239  ASP G CA  1 
ATOM   6734  C C   . ASP J  1 98  ? 24.654  107.387 18.872  1.00 35.55  ? 239  ASP G C   1 
ATOM   6735  O O   . ASP J  1 98  ? 25.750  107.797 19.268  1.00 24.84  ? 239  ASP G O   1 
ATOM   6736  C CB  . ASP J  1 98  ? 23.827  105.371 17.566  1.00 37.21  ? 239  ASP G CB  1 
ATOM   6737  C CG  . ASP J  1 98  ? 22.328  105.495 17.632  1.00 34.67  ? 239  ASP G CG  1 
ATOM   6738  O OD1 . ASP J  1 98  ? 21.808  106.556 18.028  1.00 53.08  ? 239  ASP G OD1 1 
ATOM   6739  O OD2 . ASP J  1 98  ? 21.655  104.521 17.285  1.00 43.57  ? 239  ASP G OD2 1 
ATOM   6740  N N   . LYS J  1 99  ? 23.543  107.505 19.598  1.00 37.14  ? 240  LYS G N   1 
ATOM   6741  C CA  . LYS J  1 99  ? 23.554  108.152 20.909  1.00 41.16  ? 240  LYS G CA  1 
ATOM   6742  C C   . LYS J  1 99  ? 24.691  107.679 21.786  1.00 41.08  ? 240  LYS G C   1 
ATOM   6743  O O   . LYS J  1 99  ? 24.690  106.539 22.253  1.00 41.91  ? 240  LYS G O   1 
ATOM   6744  C CB  . LYS J  1 99  ? 22.246  107.916 21.659  1.00 43.65  ? 240  LYS G CB  1 
ATOM   6745  C CG  . LYS J  1 99  ? 21.019  108.475 20.993  1.00 55.54  ? 240  LYS G CG  1 
ATOM   6746  C CD  . LYS J  1 99  ? 19.777  108.137 21.813  1.00 70.59  ? 240  LYS G CD  1 
ATOM   6747  C CE  . LYS J  1 99  ? 18.514  108.099 20.948  1.00 78.44  ? 240  LYS G CE  1 
ATOM   6748  N NZ  . LYS J  1 99  ? 17.297  107.799 21.760  1.00 73.91  ? 240  LYS G NZ  1 
ATOM   6749  N N   . GLY J  1 100 ? 25.658  108.561 21.998  1.00 32.93  ? 241  GLY G N   1 
ATOM   6750  C CA  . GLY J  1 100 ? 26.780  108.242 22.850  1.00 35.33  ? 241  GLY G CA  1 
ATOM   6751  C C   . GLY J  1 100 ? 27.760  107.192 22.379  1.00 45.88  ? 241  GLY G C   1 
ATOM   6752  O O   . GLY J  1 100 ? 28.770  106.940 23.045  1.00 52.73  ? 241  GLY G O   1 
ATOM   6753  N N   . ILE J  1 101 ? 27.499  106.583 21.231  1.00 46.77  ? 242  ILE G N   1 
ATOM   6754  C CA  . ILE J  1 101 ? 28.416  105.571 20.756  1.00 43.15  ? 242  ILE G CA  1 
ATOM   6755  C C   . ILE J  1 101 ? 29.032  105.839 19.394  1.00 38.92  ? 242  ILE G C   1 
ATOM   6756  O O   . ILE J  1 101 ? 28.681  106.779 18.701  1.00 36.71  ? 242  ILE G O   1 
ATOM   6757  C CB  . ILE J  1 101 ? 27.729  104.196 20.776  1.00 47.19  ? 242  ILE G CB  1 
ATOM   6758  C CG1 . ILE J  1 101 ? 26.557  104.157 19.787  1.00 40.27  ? 242  ILE G CG1 1 
ATOM   6759  C CG2 . ILE J  1 101 ? 27.234  103.909 22.186  1.00 36.51  ? 242  ILE G CG2 1 
ATOM   6760  C CD1 . ILE J  1 101 ? 26.963  103.895 18.368  1.00 30.72  ? 242  ILE G CD1 1 
ATOM   6761  N N   . ILE J  1 102 ? 29.983  104.996 19.039  1.00 38.45  ? 243  ILE G N   1 
ATOM   6762  C CA  . ILE J  1 102 ? 30.684  105.077 17.780  1.00 36.39  ? 243  ILE G CA  1 
ATOM   6763  C C   . ILE J  1 102 ? 30.496  103.698 17.208  1.00 41.31  ? 243  ILE G C   1 
ATOM   6764  O O   . ILE J  1 102 ? 30.537  102.718 17.938  1.00 43.59  ? 243  ILE G O   1 
ATOM   6765  C CB  . ILE J  1 102 ? 32.180  105.352 18.009  1.00 37.51  ? 243  ILE G CB  1 
ATOM   6766  C CG1 . ILE J  1 102 ? 32.547  106.650 17.341  1.00 34.94  ? 243  ILE G CG1 1 
ATOM   6767  C CG2 . ILE J  1 102 ? 33.049  104.212 17.492  1.00 38.16  ? 243  ILE G CG2 1 
ATOM   6768  C CD1 . ILE J  1 102 ? 31.702  107.767 17.795  1.00 41.93  ? 243  ILE G CD1 1 
ATOM   6769  N N   . TYR J  1 103 ? 30.267  103.616 15.909  1.00 42.46  ? 244  TYR G N   1 
ATOM   6770  C CA  . TYR J  1 103 ? 30.074  102.327 15.298  1.00 36.24  ? 244  TYR G CA  1 
ATOM   6771  C C   . TYR J  1 103 ? 31.369  101.834 14.742  1.00 40.32  ? 244  TYR G C   1 
ATOM   6772  O O   . TYR J  1 103 ? 32.125  102.595 14.133  1.00 31.99  ? 244  TYR G O   1 
ATOM   6773  C CB  . TYR J  1 103 ? 29.058  102.404 14.193  1.00 34.55  ? 244  TYR G CB  1 
ATOM   6774  C CG  . TYR J  1 103 ? 27.667  102.165 14.668  1.00 39.75  ? 244  TYR G CG  1 
ATOM   6775  C CD1 . TYR J  1 103 ? 27.315  100.948 15.224  1.00 40.23  ? 244  TYR G CD1 1 
ATOM   6776  C CD2 . TYR J  1 103 ? 26.687  103.161 14.562  1.00 43.79  ? 244  TYR G CD2 1 
ATOM   6777  C CE1 . TYR J  1 103 ? 26.021  100.720 15.667  1.00 52.34  ? 244  TYR G CE1 1 
ATOM   6778  C CE2 . TYR J  1 103 ? 25.389  102.948 15.004  1.00 42.26  ? 244  TYR G CE2 1 
ATOM   6779  C CZ  . TYR J  1 103 ? 25.061  101.728 15.556  1.00 49.51  ? 244  TYR G CZ  1 
ATOM   6780  O OH  . TYR J  1 103 ? 23.780  101.517 16.004  1.00 57.89  ? 244  TYR G OH  1 
ATOM   6781  N N   . GLY J  1 104 ? 31.627  100.556 14.986  1.00 41.80  ? 245  GLY G N   1 
ATOM   6782  C CA  . GLY J  1 104 ? 32.832  99.936  14.477  1.00 48.38  ? 245  GLY G CA  1 
ATOM   6783  C C   . GLY J  1 104 ? 32.520  99.496  13.065  1.00 45.86  ? 245  GLY G C   1 
ATOM   6784  O O   . GLY J  1 104 ? 31.373  99.200  12.736  1.00 48.08  ? 245  GLY G O   1 
ATOM   6785  N N   . THR J  1 105 ? 33.536  99.441  12.230  1.00 43.61  ? 246  THR G N   1 
ATOM   6786  C CA  . THR J  1 105 ? 33.348  99.063  10.844  1.00 45.39  ? 246  THR G CA  1 
ATOM   6787  C C   . THR J  1 105 ? 32.606  97.742  10.696  1.00 43.92  ? 246  THR G C   1 
ATOM   6788  O O   . THR J  1 105 ? 32.079  97.425  9.643   1.00 46.00  ? 246  THR G O   1 
ATOM   6789  C CB  . THR J  1 105 ? 34.710  99.004  10.155  1.00 47.44  ? 246  THR G CB  1 
ATOM   6790  O OG1 . THR J  1 105 ? 34.536  99.216  8.758   1.00 54.31  ? 246  THR G OG1 1 
ATOM   6791  C CG2 . THR J  1 105 ? 35.387  97.676  10.415  1.00 42.91  ? 246  THR G CG2 1 
ATOM   6792  N N   . ASP J  1 106 ? 32.543  96.987  11.781  1.00 53.22  ? 247  ASP G N   1 
ATOM   6793  C CA  . ASP J  1 106 ? 31.877  95.690  11.807  1.00 52.15  ? 247  ASP G CA  1 
ATOM   6794  C C   . ASP J  1 106 ? 30.485  95.742  12.415  1.00 46.99  ? 247  ASP G C   1 
ATOM   6795  O O   . ASP J  1 106 ? 29.844  94.719  12.596  1.00 41.56  ? 247  ASP G O   1 
ATOM   6796  C CB  . ASP J  1 106 ? 32.734  94.692  12.585  1.00 63.86  ? 247  ASP G CB  1 
ATOM   6797  C CG  . ASP J  1 106 ? 32.871  95.052  14.071  1.00 71.68  ? 247  ASP G CG  1 
ATOM   6798  O OD1 . ASP J  1 106 ? 33.288  96.186  14.387  1.00 66.79  ? 247  ASP G OD1 1 
ATOM   6799  O OD2 . ASP J  1 106 ? 32.575  94.186  14.927  1.00 75.27  ? 247  ASP G OD2 1 
ATOM   6800  N N   . GLY J  1 107 ? 30.023  96.939  12.739  1.00 49.19  ? 248  GLY G N   1 
ATOM   6801  C CA  . GLY J  1 107 ? 28.692  97.087  13.305  1.00 51.71  ? 248  GLY G CA  1 
ATOM   6802  C C   . GLY J  1 107 ? 28.629  97.116  14.821  1.00 51.74  ? 248  GLY G C   1 
ATOM   6803  O O   . GLY J  1 107 ? 27.613  97.461  15.420  1.00 48.58  ? 248  GLY G O   1 
ATOM   6804  N N   . GLN J  1 108 ? 29.722  96.754  15.463  1.00 53.98  ? 254  GLN G N   1 
ATOM   6805  C CA  . GLN J  1 108 ? 29.721  96.745  16.907  1.00 56.48  ? 254  GLN G CA  1 
ATOM   6806  C C   . GLN J  1 108 ? 29.792  98.149  17.444  1.00 54.02  ? 254  GLN G C   1 
ATOM   6807  O O   . GLN J  1 108 ? 30.298  99.054  16.786  1.00 47.88  ? 254  GLN G O   1 
ATOM   6808  C CB  . GLN J  1 108 ? 30.884  95.914  17.444  1.00 65.64  ? 254  GLN G CB  1 
ATOM   6809  C CG  . GLN J  1 108 ? 30.786  94.446  17.075  1.00 75.48  ? 254  GLN G CG  1 
ATOM   6810  C CD  . GLN J  1 108 ? 29.442  93.845  17.447  1.00 72.97  ? 254  GLN G CD  1 
ATOM   6811  O OE1 . GLN J  1 108 ? 29.073  93.806  18.619  1.00 66.55  ? 254  GLN G OE1 1 
ATOM   6812  N NE2 . GLN J  1 108 ? 28.702  93.373  16.445  1.00 70.57  ? 254  GLN G NE2 1 
ATOM   6813  N N   . GLU J  1 109 ? 29.294  98.310  18.664  1.00 54.44  ? 255  GLU G N   1 
ATOM   6814  C CA  . GLU J  1 109 ? 29.246  99.597  19.327  1.00 46.81  ? 255  GLU G CA  1 
ATOM   6815  C C   . GLU J  1 109 ? 30.332  99.892  20.327  1.00 43.67  ? 255  GLU G C   1 
ATOM   6816  O O   . GLU J  1 109 ? 30.715  99.058  21.127  1.00 47.25  ? 255  GLU G O   1 
ATOM   6817  C CB  . GLU J  1 109 ? 27.894  99.753  20.003  1.00 52.45  ? 255  GLU G CB  1 
ATOM   6818  C CG  . GLU J  1 109 ? 26.763  100.047 19.044  1.00 62.58  ? 255  GLU G CG  1 
ATOM   6819  C CD  . GLU J  1 109 ? 25.400  99.869  19.677  1.00 67.79  ? 255  GLU G CD  1 
ATOM   6820  O OE1 . GLU J  1 109 ? 25.286  100.142 20.899  1.00 63.91  ? 255  GLU G OE1 1 
ATOM   6821  O OE2 . GLU J  1 109 ? 24.452  99.464  18.947  1.00 67.23  ? 255  GLU G OE2 1 
ATOM   6822  N N   . ALA J  1 110 ? 30.816  101.119 20.281  1.00 51.77  ? 256  ALA G N   1 
ATOM   6823  C CA  . ALA J  1 110 ? 31.854  101.571 21.197  1.00 50.67  ? 256  ALA G CA  1 
ATOM   6824  C C   . ALA J  1 110 ? 31.416  102.875 21.873  1.00 47.79  ? 256  ALA G C   1 
ATOM   6825  O O   . ALA J  1 110 ? 31.293  103.916 21.239  1.00 49.10  ? 256  ALA G O   1 
ATOM   6826  C CB  . ALA J  1 110 ? 33.168  101.783 20.455  1.00 44.84  ? 256  ALA G CB  1 
ATOM   6827  N N   . PRO J  1 111 ? 31.139  102.817 23.175  1.00 44.70  ? 257  PRO G N   1 
ATOM   6828  C CA  . PRO J  1 111 ? 30.720  104.004 23.916  1.00 38.47  ? 257  PRO G CA  1 
ATOM   6829  C C   . PRO J  1 111 ? 31.848  105.019 23.896  1.00 34.57  ? 257  PRO G C   1 
ATOM   6830  O O   . PRO J  1 111 ? 32.999  104.710 24.157  1.00 35.94  ? 257  PRO G O   1 
ATOM   6831  C CB  . PRO J  1 111 ? 30.460  103.456 25.301  1.00 39.25  ? 257  PRO G CB  1 
ATOM   6832  C CG  . PRO J  1 111 ? 29.955  102.080 25.008  1.00 36.65  ? 257  PRO G CG  1 
ATOM   6833  C CD  . PRO J  1 111 ? 30.938  101.599 23.975  1.00 41.67  ? 257  PRO G CD  1 
ATOM   6834  N N   . ILE J  1 112 ? 31.524  106.246 23.569  1.00 37.62  ? 258  ILE G N   1 
ATOM   6835  C CA  . ILE J  1 112 ? 32.554  107.242 23.511  1.00 38.78  ? 258  ILE G CA  1 
ATOM   6836  C C   . ILE J  1 112 ? 33.243  107.376 24.860  1.00 43.61  ? 258  ILE G C   1 
ATOM   6837  O O   . ILE J  1 112 ? 34.430  107.733 24.938  1.00 41.24  ? 258  ILE G O   1 
ATOM   6838  C CB  . ILE J  1 112 ? 31.951  108.558 23.056  1.00 37.39  ? 258  ILE G CB  1 
ATOM   6839  C CG1 . ILE J  1 112 ? 31.380  108.361 21.651  1.00 29.29  ? 258  ILE G CG1 1 
ATOM   6840  C CG2 . ILE J  1 112 ? 32.993  109.668 23.113  1.00 22.66  ? 258  ILE G CG2 1 
ATOM   6841  C CD1 . ILE J  1 112 ? 30.794  109.594 21.028  1.00 39.77  ? 258  ILE G CD1 1 
ATOM   6842  N N   . TYR J  1 113 ? 32.507  107.069 25.925  1.00 46.20  ? 259  TYR G N   1 
ATOM   6843  C CA  . TYR J  1 113 ? 33.071  107.149 27.266  1.00 49.15  ? 259  TYR G CA  1 
ATOM   6844  C C   . TYR J  1 113 ? 34.213  106.135 27.417  1.00 49.10  ? 259  TYR G C   1 
ATOM   6845  O O   . TYR J  1 113 ? 35.263  106.455 27.959  1.00 46.77  ? 259  TYR G O   1 
ATOM   6846  C CB  . TYR J  1 113 ? 31.994  106.876 28.307  1.00 65.03  ? 259  TYR G CB  1 
ATOM   6847  C CG  . TYR J  1 113 ? 32.473  107.134 29.717  1.00 88.24  ? 259  TYR G CG  1 
ATOM   6848  C CD1 . TYR J  1 113 ? 32.916  108.410 30.105  1.00 92.55  ? 259  TYR G CD1 1 
ATOM   6849  C CD2 . TYR J  1 113 ? 32.520  106.100 30.665  1.00 94.45  ? 259  TYR G CD2 1 
ATOM   6850  C CE1 . TYR J  1 113 ? 33.398  108.648 31.399  1.00 94.97  ? 259  TYR G CE1 1 
ATOM   6851  C CE2 . TYR J  1 113 ? 32.998  106.329 31.967  1.00 94.50  ? 259  TYR G CE2 1 
ATOM   6852  C CZ  . TYR J  1 113 ? 33.436  107.602 32.321  1.00 96.92  ? 259  TYR G CZ  1 
ATOM   6853  O OH  . TYR J  1 113 ? 33.918  107.824 33.589  1.00 100.00 ? 259  TYR G OH  1 
ATOM   6854  N N   . GLU J  1 114 ? 33.990  104.914 26.936  1.00 48.61  ? 260  GLU G N   1 
ATOM   6855  C CA  . GLU J  1 114 ? 34.998  103.865 26.967  1.00 42.82  ? 260  GLU G CA  1 
ATOM   6856  C C   . GLU J  1 114 ? 36.251  104.344 26.246  1.00 43.54  ? 260  GLU G C   1 
ATOM   6857  O O   . GLU J  1 114 ? 37.375  104.057 26.645  1.00 48.77  ? 260  GLU G O   1 
ATOM   6858  C CB  . GLU J  1 114 ? 34.488  102.620 26.246  1.00 46.45  ? 260  GLU G CB  1 
ATOM   6859  C CG  . GLU J  1 114 ? 33.225  102.054 26.831  1.00 65.14  ? 260  GLU G CG  1 
ATOM   6860  C CD  . GLU J  1 114 ? 33.481  101.202 28.049  1.00 69.73  ? 260  GLU G CD  1 
ATOM   6861  O OE1 . GLU J  1 114 ? 34.119  101.702 29.002  1.00 75.89  ? 260  GLU G OE1 1 
ATOM   6862  O OE2 . GLU J  1 114 ? 33.043  100.032 28.043  1.00 75.95  ? 260  GLU G OE2 1 
ATOM   6863  N N   . LEU J  1 115 ? 36.068  105.077 25.167  1.00 41.94  ? 261  LEU G N   1 
ATOM   6864  C CA  . LEU J  1 115 ? 37.225  105.522 24.439  1.00 48.86  ? 261  LEU G CA  1 
ATOM   6865  C C   . LEU J  1 115 ? 38.032  106.552 25.192  1.00 48.49  ? 261  LEU G C   1 
ATOM   6866  O O   . LEU J  1 115 ? 39.199  106.332 25.457  1.00 51.85  ? 261  LEU G O   1 
ATOM   6867  C CB  . LEU J  1 115 ? 36.807  106.058 23.076  1.00 52.19  ? 261  LEU G CB  1 
ATOM   6868  C CG  . LEU J  1 115 ? 35.923  105.063 22.325  1.00 51.80  ? 261  LEU G CG  1 
ATOM   6869  C CD1 . LEU J  1 115 ? 35.745  105.548 20.901  1.00 51.04  ? 261  LEU G CD1 1 
ATOM   6870  C CD2 . LEU J  1 115 ? 36.560  103.672 22.342  1.00 38.57  ? 261  LEU G CD2 1 
ATOM   6871  N N   . THR J  1 116 ? 37.416  107.666 25.565  1.00 51.68  ? 262  THR G N   1 
ATOM   6872  C CA  . THR J  1 116 ? 38.163  108.717 26.258  1.00 49.94  ? 262  THR G CA  1 
ATOM   6873  C C   . THR J  1 116 ? 38.651  108.371 27.647  1.00 49.58  ? 262  THR G C   1 
ATOM   6874  O O   . THR J  1 116 ? 39.629  108.953 28.104  1.00 46.63  ? 262  THR G O   1 
ATOM   6875  C CB  . THR J  1 116 ? 37.353  109.984 26.437  1.00 43.87  ? 262  THR G CB  1 
ATOM   6876  O OG1 . THR J  1 116 ? 36.298  109.727 27.366  1.00 47.23  ? 262  THR G OG1 1 
ATOM   6877  C CG2 . THR J  1 116 ? 36.777  110.437 25.140  1.00 43.26  ? 262  THR G CG2 1 
ATOM   6878  N N   . SER J  1 117 ? 37.971  107.452 28.329  1.00 49.40  ? 263  SER G N   1 
ATOM   6879  C CA  . SER J  1 117 ? 38.363  107.098 29.694  1.00 52.15  ? 263  SER G CA  1 
ATOM   6880  C C   . SER J  1 117 ? 39.656  106.302 29.733  1.00 50.35  ? 263  SER G C   1 
ATOM   6881  O O   . SER J  1 117 ? 40.228  106.042 30.794  1.00 56.47  ? 263  SER G O   1 
ATOM   6882  C CB  . SER J  1 117 ? 37.241  106.323 30.382  1.00 53.92  ? 263  SER G CB  1 
ATOM   6883  O OG  . SER J  1 117 ? 37.146  105.004 29.886  1.00 65.98  ? 263  SER G OG  1 
ATOM   6884  N N   . GLN J  1 118 ? 40.107  105.928 28.552  1.00 52.73  ? 264  GLN G N   1 
ATOM   6885  C CA  . GLN J  1 118 ? 41.331  105.173 28.371  1.00 49.55  ? 264  GLN G CA  1 
ATOM   6886  C C   . GLN J  1 118 ? 42.536  106.029 28.707  1.00 50.80  ? 264  GLN G C   1 
ATOM   6887  O O   . GLN J  1 118 ? 43.601  105.511 28.996  1.00 54.17  ? 264  GLN G O   1 
ATOM   6888  C CB  . GLN J  1 118 ? 41.453  104.738 26.913  1.00 52.32  ? 264  GLN G CB  1 
ATOM   6889  C CG  . GLN J  1 118 ? 40.536  103.632 26.525  1.00 62.78  ? 264  GLN G CG  1 
ATOM   6890  C CD  . GLN J  1 118 ? 40.874  102.381 27.284  1.00 81.04  ? 264  GLN G CD  1 
ATOM   6891  O OE1 . GLN J  1 118 ? 40.589  102.269 28.485  1.00 80.59  ? 264  GLN G OE1 1 
ATOM   6892  N NE2 . GLN J  1 118 ? 41.523  101.430 26.599  1.00 91.68  ? 264  GLN G NE2 1 
ATOM   6893  N N   . PHE J  1 119 ? 42.369  107.343 28.689  1.00 44.84  ? 265  PHE G N   1 
ATOM   6894  C CA  . PHE J  1 119 ? 43.501  108.219 28.915  1.00 42.37  ? 265  PHE G CA  1 
ATOM   6895  C C   . PHE J  1 119 ? 43.451  109.119 30.143  1.00 50.92  ? 265  PHE G C   1 
ATOM   6896  O O   . PHE J  1 119 ? 44.042  110.227 30.159  1.00 46.56  ? 265  PHE G O   1 
ATOM   6897  C CB  . PHE J  1 119 ? 43.729  109.044 27.652  1.00 40.64  ? 265  PHE G CB  1 
ATOM   6898  C CG  . PHE J  1 119 ? 43.887  108.202 26.426  1.00 44.47  ? 265  PHE G CG  1 
ATOM   6899  C CD1 . PHE J  1 119 ? 42.782  107.611 25.824  1.00 43.92  ? 265  PHE G CD1 1 
ATOM   6900  C CD2 . PHE J  1 119 ? 45.150  107.927 25.915  1.00 42.58  ? 265  PHE G CD2 1 
ATOM   6901  C CE1 . PHE J  1 119 ? 42.933  106.754 24.737  1.00 41.28  ? 265  PHE G CE1 1 
ATOM   6902  C CE2 . PHE J  1 119 ? 45.303  107.077 24.833  1.00 40.93  ? 265  PHE G CE2 1 
ATOM   6903  C CZ  . PHE J  1 119 ? 44.191  106.488 24.243  1.00 37.11  ? 265  PHE G CZ  1 
ATOM   6904  N N   . THR J  1 120 ? 42.768  108.636 31.181  1.00 52.22  ? 266  THR G N   1 
ATOM   6905  C CA  . THR J  1 120 ? 42.673  109.380 32.426  1.00 49.75  ? 266  THR G CA  1 
ATOM   6906  C C   . THR J  1 120 ? 44.084  109.517 33.001  1.00 53.37  ? 266  THR G C   1 
ATOM   6907  O O   . THR J  1 120 ? 45.075  109.153 32.360  1.00 52.77  ? 266  THR G O   1 
ATOM   6908  C CB  . THR J  1 120 ? 41.789  108.650 33.440  1.00 54.46  ? 266  THR G CB  1 
ATOM   6909  O OG1 . THR J  1 120 ? 42.511  107.557 34.002  1.00 50.46  ? 266  THR G OG1 1 
ATOM   6910  C CG2 . THR J  1 120 ? 40.555  108.089 32.765  1.00 52.29  ? 266  THR G CG2 1 
ATOM   6911  N N   . GLY J  1 121 ? 44.181  110.062 34.205  1.00 58.40  ? 267  GLY G N   1 
ATOM   6912  C CA  . GLY J  1 121 ? 45.486  110.229 34.818  1.00 56.72  ? 267  GLY G CA  1 
ATOM   6913  C C   . GLY J  1 121 ? 46.089  108.890 35.225  1.00 57.95  ? 267  GLY G C   1 
ATOM   6914  O O   . GLY J  1 121 ? 47.269  108.619 34.989  1.00 55.40  ? 267  GLY G O   1 
ATOM   6915  N N   . LEU J  1 122 ? 45.278  108.045 35.844  1.00 49.85  ? 268  LEU G N   1 
ATOM   6916  C CA  . LEU J  1 122 ? 45.745  106.744 36.270  1.00 53.53  ? 268  LEU G CA  1 
ATOM   6917  C C   . LEU J  1 122 ? 46.080  105.924 35.032  1.00 59.86  ? 268  LEU G C   1 
ATOM   6918  O O   . LEU J  1 122 ? 47.219  105.509 34.826  1.00 68.15  ? 268  LEU G O   1 
ATOM   6919  C CB  . LEU J  1 122 ? 44.662  106.032 37.076  1.00 46.58  ? 268  LEU G CB  1 
ATOM   6920  C CG  . LEU J  1 122 ? 44.072  106.867 38.203  1.00 51.31  ? 268  LEU G CG  1 
ATOM   6921  C CD1 . LEU J  1 122 ? 43.221  105.959 39.067  1.00 48.76  ? 268  LEU G CD1 1 
ATOM   6922  C CD2 . LEU J  1 122 ? 45.179  107.530 39.022  1.00 51.22  ? 268  LEU G CD2 1 
ATOM   6923  N N   . LYS J  1 123 ? 45.073  105.704 34.203  1.00 59.82  ? 269  LYS G N   1 
ATOM   6924  C CA  . LYS J  1 123 ? 45.224  104.944 32.975  1.00 52.51  ? 269  LYS G CA  1 
ATOM   6925  C C   . LYS J  1 123 ? 46.486  105.266 32.153  1.00 53.01  ? 269  LYS G C   1 
ATOM   6926  O O   . LYS J  1 123 ? 47.014  104.374 31.487  1.00 52.40  ? 269  LYS G O   1 
ATOM   6927  C CB  . LYS J  1 123 ? 43.977  105.148 32.099  1.00 52.61  ? 269  LYS G CB  1 
ATOM   6928  C CG  . LYS J  1 123 ? 42.732  104.377 32.533  1.00 55.61  ? 269  LYS G CG  1 
ATOM   6929  C CD  . LYS J  1 123 ? 42.808  102.925 32.077  1.00 63.39  ? 269  LYS G CD  1 
ATOM   6930  C CE  . LYS J  1 123 ? 41.468  102.209 32.162  1.00 69.06  ? 269  LYS G CE  1 
ATOM   6931  N NZ  . LYS J  1 123 ? 41.497  100.899 31.438  1.00 70.27  ? 269  LYS G NZ  1 
ATOM   6932  N N   . CYS J  1 124 ? 46.971  106.512 32.195  1.00 45.89  ? 270  CYS G N   1 
ATOM   6933  C CA  . CYS J  1 124 ? 48.139  106.898 31.395  1.00 41.13  ? 270  CYS G CA  1 
ATOM   6934  C C   . CYS J  1 124 ? 48.900  108.105 31.973  1.00 45.70  ? 270  CYS G C   1 
ATOM   6935  O O   . CYS J  1 124 ? 48.871  109.231 31.438  1.00 47.25  ? 270  CYS G O   1 
ATOM   6936  C CB  . CYS J  1 124 ? 47.688  107.177 29.951  1.00 32.94  ? 270  CYS G CB  1 
ATOM   6937  S SG  . CYS J  1 124 ? 48.899  107.986 28.831  1.00 41.99  ? 270  CYS G SG  1 
ATOM   6938  N N   . PRO J  1 125 ? 49.632  107.869 33.063  1.00 44.80  ? 271  PRO G N   1 
ATOM   6939  C CA  . PRO J  1 125 ? 50.412  108.902 33.747  1.00 43.74  ? 271  PRO G CA  1 
ATOM   6940  C C   . PRO J  1 125 ? 51.312  109.762 32.876  1.00 43.90  ? 271  PRO G C   1 
ATOM   6941  O O   . PRO J  1 125 ? 51.586  110.908 33.201  1.00 51.52  ? 271  PRO G O   1 
ATOM   6942  C CB  . PRO J  1 125 ? 51.196  108.110 34.781  1.00 35.73  ? 271  PRO G CB  1 
ATOM   6943  C CG  . PRO J  1 125 ? 50.251  106.955 35.101  1.00 39.82  ? 271  PRO G CG  1 
ATOM   6944  C CD  . PRO J  1 125 ? 49.774  106.562 33.730  1.00 43.84  ? 271  PRO G CD  1 
ATOM   6945  N N   . SER J  1 126 ? 51.773  109.224 31.766  1.00 45.90  ? 272  SER G N   1 
ATOM   6946  C CA  . SER J  1 126 ? 52.661  109.992 30.894  1.00 48.58  ? 272  SER G CA  1 
ATOM   6947  C C   . SER J  1 126 ? 51.951  111.230 30.338  1.00 53.19  ? 272  SER G C   1 
ATOM   6948  O O   . SER J  1 126 ? 52.601  112.204 29.897  1.00 47.56  ? 272  SER G O   1 
ATOM   6949  C CB  . SER J  1 126 ? 53.161  109.101 29.734  1.00 47.38  ? 272  SER G CB  1 
ATOM   6950  O OG  . SER J  1 126 ? 52.805  107.737 29.944  1.00 55.92  ? 272  SER G OG  1 
ATOM   6951  N N   . LEU J  1 127 ? 50.616  111.194 30.354  1.00 55.21  ? 273  LEU G N   1 
ATOM   6952  C CA  . LEU J  1 127 ? 49.836  112.315 29.830  1.00 60.64  ? 273  LEU G CA  1 
ATOM   6953  C C   . LEU J  1 127 ? 49.246  113.233 30.900  1.00 59.80  ? 273  LEU G C   1 
ATOM   6954  O O   . LEU J  1 127 ? 48.752  114.314 30.578  1.00 63.17  ? 273  LEU G O   1 
ATOM   6955  C CB  . LEU J  1 127 ? 48.728  111.798 28.898  1.00 49.05  ? 273  LEU G CB  1 
ATOM   6956  C CG  . LEU J  1 127 ? 49.275  111.367 27.524  1.00 45.16  ? 273  LEU G CG  1 
ATOM   6957  C CD1 . LEU J  1 127 ? 48.196  110.714 26.681  1.00 34.93  ? 273  LEU G CD1 1 
ATOM   6958  C CD2 . LEU J  1 127 ? 49.822  112.580 26.806  1.00 40.71  ? 273  LEU G CD2 1 
ATOM   6959  N N   . ALA J  1 128 ? 49.316  112.807 32.161  1.00 53.02  ? 274  ALA G N   1 
ATOM   6960  C CA  . ALA J  1 128 ? 48.805  113.586 33.286  1.00 48.97  ? 274  ALA G CA  1 
ATOM   6961  C C   . ALA J  1 128 ? 49.159  115.067 33.193  1.00 56.69  ? 274  ALA G C   1 
ATOM   6962  O O   . ALA J  1 128 ? 50.344  115.426 33.133  1.00 61.33  ? 274  ALA G O   1 
ATOM   6963  C CB  . ALA J  1 128 ? 49.346  113.036 34.557  1.00 50.10  ? 274  ALA G CB  1 
ATOM   6964  N N   . GLY J  1 129 ? 48.134  115.924 33.184  1.00 54.37  ? 275  GLY G N   1 
ATOM   6965  C CA  . GLY J  1 129 ? 48.357  117.363 33.097  1.00 47.91  ? 275  GLY G CA  1 
ATOM   6966  C C   . GLY J  1 129 ? 48.665  117.858 31.694  1.00 47.79  ? 275  GLY G C   1 
ATOM   6967  O O   . GLY J  1 129 ? 49.190  118.971 31.496  1.00 42.76  ? 275  GLY G O   1 
ATOM   6968  N N   . LYS J  1 130 ? 48.366  117.018 30.707  1.00 47.64  ? 276  LYS G N   1 
ATOM   6969  C CA  . LYS J  1 130 ? 48.586  117.391 29.315  1.00 45.94  ? 276  LYS G CA  1 
ATOM   6970  C C   . LYS J  1 130 ? 47.277  117.250 28.567  1.00 41.94  ? 276  LYS G C   1 
ATOM   6971  O O   . LYS J  1 130 ? 46.504  116.289 28.772  1.00 38.79  ? 276  LYS G O   1 
ATOM   6972  C CB  . LYS J  1 130 ? 49.660  116.517 28.669  1.00 55.44  ? 276  LYS G CB  1 
ATOM   6973  C CG  . LYS J  1 130 ? 51.049  116.685 29.270  1.00 72.25  ? 276  LYS G CG  1 
ATOM   6974  C CD  . LYS J  1 130 ? 52.016  115.645 28.715  1.00 77.28  ? 276  LYS G CD  1 
ATOM   6975  C CE  . LYS J  1 130 ? 53.418  115.831 29.254  1.00 72.64  ? 276  LYS G CE  1 
ATOM   6976  N NZ  . LYS J  1 130 ? 54.277  114.650 28.952  1.00 71.92  ? 276  LYS G NZ  1 
ATOM   6977  N N   . PRO J  1 131 ? 46.991  118.216 27.697  1.00 33.87  ? 277  PRO G N   1 
ATOM   6978  C CA  . PRO J  1 131 ? 45.757  118.175 26.926  1.00 33.37  ? 277  PRO G CA  1 
ATOM   6979  C C   . PRO J  1 131 ? 45.565  116.873 26.131  1.00 37.58  ? 277  PRO G C   1 
ATOM   6980  O O   . PRO J  1 131 ? 46.414  116.473 25.338  1.00 35.20  ? 277  PRO G O   1 
ATOM   6981  C CB  . PRO J  1 131 ? 45.892  119.396 26.015  1.00 37.03  ? 277  PRO G CB  1 
ATOM   6982  C CG  . PRO J  1 131 ? 47.362  119.531 25.829  1.00 31.82  ? 277  PRO G CG  1 
ATOM   6983  C CD  . PRO J  1 131 ? 47.852  119.310 27.241  1.00 32.46  ? 277  PRO G CD  1 
ATOM   6984  N N   . LYS J  1 132 ? 44.437  116.224 26.367  1.00 38.35  ? 278  LYS G N   1 
ATOM   6985  C CA  . LYS J  1 132 ? 44.051  115.019 25.668  1.00 37.81  ? 278  LYS G CA  1 
ATOM   6986  C C   . LYS J  1 132 ? 42.783  115.412 24.877  1.00 42.49  ? 278  LYS G C   1 
ATOM   6987  O O   . LYS J  1 132 ? 41.700  115.549 25.435  1.00 49.27  ? 278  LYS G O   1 
ATOM   6988  C CB  . LYS J  1 132 ? 43.761  113.931 26.686  1.00 32.89  ? 278  LYS G CB  1 
ATOM   6989  C CG  . LYS J  1 132 ? 44.967  113.597 27.494  1.00 33.02  ? 278  LYS G CG  1 
ATOM   6990  C CD  . LYS J  1 132 ? 44.625  112.717 28.681  1.00 44.74  ? 278  LYS G CD  1 
ATOM   6991  C CE  . LYS J  1 132 ? 44.396  113.553 29.938  1.00 52.05  ? 278  LYS G CE  1 
ATOM   6992  N NZ  . LYS J  1 132 ? 45.590  114.382 30.309  1.00 49.35  ? 278  LYS G NZ  1 
ATOM   6993  N N   . VAL J  1 133 ? 42.943  115.610 23.578  1.00 39.99  ? 279  VAL G N   1 
ATOM   6994  C CA  . VAL J  1 133 ? 41.864  116.012 22.689  1.00 35.62  ? 279  VAL G CA  1 
ATOM   6995  C C   . VAL J  1 133 ? 41.223  114.893 21.844  1.00 34.84  ? 279  VAL G C   1 
ATOM   6996  O O   . VAL J  1 133 ? 41.917  114.152 21.176  1.00 40.70  ? 279  VAL G O   1 
ATOM   6997  C CB  . VAL J  1 133 ? 42.391  117.049 21.689  1.00 31.20  ? 279  VAL G CB  1 
ATOM   6998  C CG1 . VAL J  1 133 ? 41.262  117.600 20.847  1.00 40.67  ? 279  VAL G CG1 1 
ATOM   6999  C CG2 . VAL J  1 133 ? 43.097  118.138 22.420  1.00 34.94  ? 279  VAL G CG2 1 
ATOM   7000  N N   . PHE J  1 134 ? 39.904  114.792 21.851  1.00 28.40  ? 280  PHE G N   1 
ATOM   7001  C CA  . PHE J  1 134 ? 39.222  113.829 21.008  1.00 29.37  ? 280  PHE G CA  1 
ATOM   7002  C C   . PHE J  1 134 ? 38.220  114.520 20.085  1.00 34.85  ? 280  PHE G C   1 
ATOM   7003  O O   . PHE J  1 134 ? 37.324  115.225 20.550  1.00 38.38  ? 280  PHE G O   1 
ATOM   7004  C CB  . PHE J  1 134 ? 38.442  112.815 21.826  1.00 20.12  ? 280  PHE G CB  1 
ATOM   7005  C CG  . PHE J  1 134 ? 39.292  111.883 22.563  1.00 45.41  ? 280  PHE G CG  1 
ATOM   7006  C CD1 . PHE J  1 134 ? 40.042  112.328 23.640  1.00 56.47  ? 280  PHE G CD1 1 
ATOM   7007  C CD2 . PHE J  1 134 ? 39.323  110.529 22.221  1.00 48.97  ? 280  PHE G CD2 1 
ATOM   7008  C CE1 . PHE J  1 134 ? 40.803  111.432 24.376  1.00 64.63  ? 280  PHE G CE1 1 
ATOM   7009  C CE2 . PHE J  1 134 ? 40.078  109.617 22.944  1.00 39.72  ? 280  PHE G CE2 1 
ATOM   7010  C CZ  . PHE J  1 134 ? 40.817  110.060 24.023  1.00 57.83  ? 280  PHE G CZ  1 
ATOM   7011  N N   . PHE J  1 135 ? 38.365  114.324 18.784  1.00 30.97  ? 281  PHE G N   1 
ATOM   7012  C CA  . PHE J  1 135 ? 37.406  114.880 17.843  1.00 31.62  ? 281  PHE G CA  1 
ATOM   7013  C C   . PHE J  1 135 ? 36.625  113.693 17.328  1.00 29.81  ? 281  PHE G C   1 
ATOM   7014  O O   . PHE J  1 135 ? 37.198  112.772 16.777  1.00 41.20  ? 281  PHE G O   1 
ATOM   7015  C CB  . PHE J  1 135 ? 38.103  115.574 16.673  1.00 24.60  ? 281  PHE G CB  1 
ATOM   7016  C CG  . PHE J  1 135 ? 38.798  116.843 17.061  1.00 33.11  ? 281  PHE G CG  1 
ATOM   7017  C CD1 . PHE J  1 135 ? 38.073  117.952 17.474  1.00 33.81  ? 281  PHE G CD1 1 
ATOM   7018  C CD2 . PHE J  1 135 ? 40.177  116.930 17.043  1.00 32.31  ? 281  PHE G CD2 1 
ATOM   7019  C CE1 . PHE J  1 135 ? 38.720  119.129 17.865  1.00 25.17  ? 281  PHE G CE1 1 
ATOM   7020  C CE2 . PHE J  1 135 ? 40.822  118.103 17.430  1.00 30.91  ? 281  PHE G CE2 1 
ATOM   7021  C CZ  . PHE J  1 135 ? 40.084  119.199 17.842  1.00 24.04  ? 281  PHE G CZ  1 
ATOM   7022  N N   . ILE J  1 136 ? 35.320  113.697 17.512  1.00 25.16  ? 282  ILE G N   1 
ATOM   7023  C CA  . ILE J  1 136 ? 34.518  112.596 17.033  1.00 22.35  ? 282  ILE G CA  1 
ATOM   7024  C C   . ILE J  1 136 ? 33.533  113.049 15.994  1.00 22.61  ? 282  ILE G C   1 
ATOM   7025  O O   . ILE J  1 136 ? 32.645  113.822 16.284  1.00 27.84  ? 282  ILE G O   1 
ATOM   7026  C CB  . ILE J  1 136 ? 33.749  111.959 18.168  1.00 27.02  ? 282  ILE G CB  1 
ATOM   7027  C CG1 . ILE J  1 136 ? 34.731  111.262 19.101  1.00 35.75  ? 282  ILE G CG1 1 
ATOM   7028  C CG2 . ILE J  1 136 ? 32.728  110.991 17.621  1.00 20.50  ? 282  ILE G CG2 1 
ATOM   7029  C CD1 . ILE J  1 136 ? 34.054  110.518 20.199  1.00 52.51  ? 282  ILE G CD1 1 
ATOM   7030  N N   . GLN J  1 137 ? 33.695  112.562 14.772  1.00 29.70  ? 283  GLN G N   1 
ATOM   7031  C CA  . GLN J  1 137 ? 32.795  112.907 13.670  1.00 30.30  ? 283  GLN G CA  1 
ATOM   7032  C C   . GLN J  1 137 ? 31.945  111.681 13.339  1.00 28.80  ? 283  GLN G C   1 
ATOM   7033  O O   . GLN J  1 137 ? 32.423  110.723 12.747  1.00 38.00  ? 283  GLN G O   1 
ATOM   7034  C CB  . GLN J  1 137 ? 33.614  113.372 12.446  1.00 24.42  ? 283  GLN G CB  1 
ATOM   7035  C CG  . GLN J  1 137 ? 32.928  113.300 11.108  1.00 14.37  ? 283  GLN G CG  1 
ATOM   7036  C CD  . GLN J  1 137 ? 31.626  114.093 11.028  1.00 26.98  ? 283  GLN G CD  1 
ATOM   7037  O OE1 . GLN J  1 137 ? 31.601  115.299 11.249  1.00 40.53  ? 283  GLN G OE1 1 
ATOM   7038  N NE2 . GLN J  1 137 ? 30.536  113.411 10.682  1.00 20.23  ? 283  GLN G NE2 1 
ATOM   7039  N N   . ALA J  1 138 ? 30.688  111.714 13.750  1.00 23.41  ? 284  ALA G N   1 
ATOM   7040  C CA  . ALA J  1 138 ? 29.764  110.634 13.495  1.00 23.83  ? 284  ALA G CA  1 
ATOM   7041  C C   . ALA J  1 138 ? 28.362  111.108 13.859  1.00 33.66  ? 284  ALA G C   1 
ATOM   7042  O O   . ALA J  1 138 ? 28.176  112.229 14.342  1.00 28.04  ? 284  ALA G O   1 
ATOM   7043  C CB  . ALA J  1 138 ? 30.136  109.470 14.346  1.00 24.41  ? 284  ALA G CB  1 
ATOM   7044  N N   . CYS J  1 139 ? 27.363  110.271 13.619  1.00 35.77  ? 285  CYS G N   1 
ATOM   7045  C CA  . CYS J  1 139 ? 26.016  110.638 14.013  1.00 35.73  ? 285  CYS G CA  1 
ATOM   7046  C C   . CYS J  1 139 ? 25.851  110.251 15.474  1.00 37.23  ? 285  CYS G C   1 
ATOM   7047  O O   . CYS J  1 139 ? 26.610  109.432 16.010  1.00 37.91  ? 285  CYS G O   1 
ATOM   7048  C CB  . CYS J  1 139 ? 24.989  109.895 13.183  1.00 36.81  ? 285  CYS G CB  1 
ATOM   7049  S SG  . CYS J  1 139 ? 25.001  110.424 11.461  1.00 41.15  ? 285  CYS G SG  1 
ATOM   7050  N N   . GLN J  1 140 ? 24.867  110.854 16.119  1.00 32.49  ? 286  GLN G N   1 
ATOM   7051  C CA  . GLN J  1 140 ? 24.582  110.576 17.513  1.00 38.18  ? 286  GLN G CA  1 
ATOM   7052  C C   . GLN J  1 140 ? 23.101  110.271 17.627  1.00 38.02  ? 286  GLN G C   1 
ATOM   7053  O O   . GLN J  1 140 ? 22.509  110.374 18.693  1.00 42.77  ? 286  GLN G O   1 
ATOM   7054  C CB  . GLN J  1 140 ? 24.955  111.775 18.389  1.00 28.53  ? 286  GLN G CB  1 
ATOM   7055  C CG  . GLN J  1 140 ? 26.447  111.871 18.690  1.00 33.96  ? 286  GLN G CG  1 
ATOM   7056  C CD  . GLN J  1 140 ? 26.973  110.646 19.408  1.00 38.59  ? 286  GLN G CD  1 
ATOM   7057  O OE1 . GLN J  1 140 ? 27.552  109.748 18.790  1.00 34.49  ? 286  GLN G OE1 1 
ATOM   7058  N NE2 . GLN J  1 140 ? 26.744  110.591 20.721  1.00 37.31  ? 286  GLN G NE2 1 
ATOM   7059  N N   . GLY J  1 141 ? 22.524  109.870 16.504  1.00 39.96  ? 287  GLY G N   1 
ATOM   7060  C CA  . GLY J  1 141 ? 21.111  109.566 16.440  1.00 46.05  ? 287  GLY G CA  1 
ATOM   7061  C C   . GLY J  1 141 ? 20.617  109.762 15.016  1.00 52.37  ? 287  GLY G C   1 
ATOM   7062  O O   . GLY J  1 141 ? 21.361  110.190 14.143  1.00 58.28  ? 287  GLY G O   1 
ATOM   7063  N N   . ASP J  1 142 ? 19.352  109.464 14.777  1.00 57.43  ? 288  ASP G N   1 
ATOM   7064  C CA  . ASP J  1 142 ? 18.781  109.586 13.449  1.00 60.07  ? 288  ASP G CA  1 
ATOM   7065  C C   . ASP J  1 142 ? 17.868  110.801 13.303  1.00 59.94  ? 288  ASP G C   1 
ATOM   7066  O O   . ASP J  1 142 ? 17.156  110.936 12.310  1.00 64.39  ? 288  ASP G O   1 
ATOM   7067  C CB  . ASP J  1 142 ? 18.005  108.312 13.123  1.00 65.40  ? 288  ASP G CB  1 
ATOM   7068  C CG  . ASP J  1 142 ? 16.975  107.980 14.188  1.00 81.67  ? 288  ASP G CG  1 
ATOM   7069  O OD1 . ASP J  1 142 ? 17.371  107.777 15.361  1.00 91.42  ? 288  ASP G OD1 1 
ATOM   7070  O OD2 . ASP J  1 142 ? 15.766  107.929 13.863  1.00 86.74  ? 288  ASP G OD2 1 
ATOM   7071  N N   . ASN J  1 143 ? 17.883  111.694 14.279  1.00 57.66  ? 289  ASN G N   1 
ATOM   7072  C CA  . ASN J  1 143 ? 17.024  112.861 14.200  1.00 57.83  ? 289  ASN G CA  1 
ATOM   7073  C C   . ASN J  1 143 ? 17.707  113.995 13.475  1.00 57.74  ? 289  ASN G C   1 
ATOM   7074  O O   . ASN J  1 143 ? 18.935  114.072 13.444  1.00 54.47  ? 289  ASN G O   1 
ATOM   7075  C CB  . ASN J  1 143 ? 16.612  113.329 15.595  1.00 58.39  ? 289  ASN G CB  1 
ATOM   7076  C CG  . ASN J  1 143 ? 15.842  112.280 16.355  1.00 63.82  ? 289  ASN G CG  1 
ATOM   7077  O OD1 . ASN J  1 143 ? 15.561  111.201 15.835  1.00 69.91  ? 289  ASN G OD1 1 
ATOM   7078  N ND2 . ASN J  1 143 ? 15.497  112.587 17.600  1.00 77.17  ? 289  ASN G ND2 1 
ATOM   7079  N N   . TYR J  1 144 ? 16.901  114.870 12.882  1.00 55.88  ? 290  TYR G N   1 
ATOM   7080  C CA  . TYR J  1 144 ? 17.422  116.030 12.179  1.00 52.16  ? 290  TYR G CA  1 
ATOM   7081  C C   . TYR J  1 144 ? 17.288  117.269 13.044  1.00 47.54  ? 290  TYR G C   1 
ATOM   7082  O O   . TYR J  1 144 ? 16.212  117.580 13.522  1.00 48.36  ? 290  TYR G O   1 
ATOM   7083  C CB  . TYR J  1 144 ? 16.660  116.261 10.891  1.00 57.50  ? 290  TYR G CB  1 
ATOM   7084  C CG  . TYR J  1 144 ? 16.904  115.232 9.818   1.00 56.56  ? 290  TYR G CG  1 
ATOM   7085  C CD1 . TYR J  1 144 ? 16.116  114.094 9.719   1.00 65.77  ? 290  TYR G CD1 1 
ATOM   7086  C CD2 . TYR J  1 144 ? 17.896  115.422 8.871   1.00 59.60  ? 290  TYR G CD2 1 
ATOM   7087  C CE1 . TYR J  1 144 ? 16.310  113.171 8.689   1.00 70.26  ? 290  TYR G CE1 1 
ATOM   7088  C CE2 . TYR J  1 144 ? 18.103  114.512 7.844   1.00 63.54  ? 290  TYR G CE2 1 
ATOM   7089  C CZ  . TYR J  1 144 ? 17.311  113.392 7.753   1.00 64.89  ? 290  TYR G CZ  1 
ATOM   7090  O OH  . TYR J  1 144 ? 17.520  112.502 6.722   1.00 60.93  ? 290  TYR G OH  1 
ATOM   7091  N N   . GLN J  1 145 ? 18.392  117.963 13.266  1.00 47.29  ? 291  GLN G N   1 
ATOM   7092  C CA  . GLN J  1 145 ? 18.355  119.172 14.059  1.00 45.96  ? 291  GLN G CA  1 
ATOM   7093  C C   . GLN J  1 145 ? 17.569  120.162 13.196  1.00 52.51  ? 291  GLN G C   1 
ATOM   7094  O O   . GLN J  1 145 ? 17.942  120.432 12.050  1.00 54.85  ? 291  GLN G O   1 
ATOM   7095  C CB  . GLN J  1 145 ? 19.780  119.671 14.310  1.00 39.21  ? 291  GLN G CB  1 
ATOM   7096  C CG  . GLN J  1 145 ? 19.891  120.970 15.094  1.00 37.55  ? 291  GLN G CG  1 
ATOM   7097  C CD  . GLN J  1 145 ? 19.511  120.832 16.555  1.00 43.05  ? 291  GLN G CD  1 
ATOM   7098  O OE1 . GLN J  1 145 ? 19.234  119.735 17.036  1.00 53.42  ? 291  GLN G OE1 1 
ATOM   7099  N NE2 . GLN J  1 145 ? 19.504  121.948 17.271  1.00 39.81  ? 291  GLN G NE2 1 
ATOM   7100  N N   . LYS J  1 146 ? 16.467  120.676 13.736  1.00 53.16  ? 292  LYS G N   1 
ATOM   7101  C CA  . LYS J  1 146 ? 15.632  121.618 13.003  1.00 52.63  ? 292  LYS G CA  1 
ATOM   7102  C C   . LYS J  1 146 ? 16.222  123.013 13.088  1.00 49.67  ? 292  LYS G C   1 
ATOM   7103  O O   . LYS J  1 146 ? 16.969  123.320 14.025  1.00 46.20  ? 292  LYS G O   1 
ATOM   7104  C CB  . LYS J  1 146 ? 14.203  121.617 13.559  1.00 53.31  ? 292  LYS G CB  1 
ATOM   7105  C CG  . LYS J  1 146 ? 13.574  120.227 13.645  1.00 53.98  ? 292  LYS G CG  1 
ATOM   7106  C CD  . LYS J  1 146 ? 12.154  120.292 14.194  1.00 64.44  ? 292  LYS G CD  1 
ATOM   7107  C CE  . LYS J  1 146 ? 11.738  118.997 14.892  1.00 71.26  ? 292  LYS G CE  1 
ATOM   7108  N NZ  . LYS J  1 146 ? 12.496  118.728 16.162  1.00 87.94  ? 292  LYS G NZ  1 
ATOM   7109  N N   . GLY J  1 147 ? 15.890  123.847 12.105  1.00 46.47  ? 293  GLY G N   1 
ATOM   7110  C CA  . GLY J  1 147 ? 16.403  125.205 12.081  1.00 45.22  ? 293  GLY G CA  1 
ATOM   7111  C C   . GLY J  1 147 ? 15.388  126.217 12.567  1.00 40.34  ? 293  GLY G C   1 
ATOM   7112  O O   . GLY J  1 147 ? 14.190  125.997 12.479  1.00 36.51  ? 293  GLY G O   1 
ATOM   7113  N N   . ILE J  1 148 ? 15.877  127.324 13.103  1.00 46.12  ? 294  ILE G N   1 
ATOM   7114  C CA  . ILE J  1 148 ? 15.006  128.388 13.582  1.00 52.58  ? 294  ILE G CA  1 
ATOM   7115  C C   . ILE J  1 148 ? 15.542  129.707 13.012  1.00 56.82  ? 294  ILE G C   1 
ATOM   7116  O O   . ILE J  1 148 ? 16.755  129.913 12.924  1.00 56.14  ? 294  ILE G O   1 
ATOM   7117  C CB  . ILE J  1 148 ? 14.990  128.463 15.126  1.00 53.52  ? 294  ILE G CB  1 
ATOM   7118  C CG1 . ILE J  1 148 ? 16.327  129.011 15.629  1.00 54.07  ? 294  ILE G CG1 1 
ATOM   7119  C CG2 . ILE J  1 148 ? 14.705  127.089 15.712  1.00 40.14  ? 294  ILE G CG2 1 
ATOM   7120  C CD1 . ILE J  1 148 ? 16.413  129.176 17.126  1.00 58.45  ? 294  ILE G CD1 1 
ATOM   7121  N N   . PRO J  1 149 ? 14.640  130.616 12.614  1.00 58.97  ? 295  PRO G N   1 
ATOM   7122  C CA  . PRO J  1 149 ? 14.991  131.921 12.042  1.00 53.58  ? 295  PRO G CA  1 
ATOM   7123  C C   . PRO J  1 149 ? 15.438  132.981 13.056  1.00 51.61  ? 295  PRO G C   1 
ATOM   7124  O O   . PRO J  1 149 ? 14.936  133.044 14.178  1.00 46.49  ? 295  PRO G O   1 
ATOM   7125  C CB  . PRO J  1 149 ? 13.708  132.321 11.340  1.00 50.35  ? 295  PRO G CB  1 
ATOM   7126  C CG  . PRO J  1 149 ? 12.673  131.825 12.325  1.00 60.54  ? 295  PRO G CG  1 
ATOM   7127  C CD  . PRO J  1 149 ? 13.176  130.438 12.654  1.00 61.79  ? 295  PRO G CD  1 
ATOM   7128  N N   . VAL J  1 150 ? 16.382  133.816 12.648  1.00 50.45  ? 296  VAL G N   1 
ATOM   7129  C CA  . VAL J  1 150 ? 16.866  134.888 13.502  1.00 58.87  ? 296  VAL G CA  1 
ATOM   7130  C C   . VAL J  1 150 ? 17.387  136.015 12.618  1.00 66.67  ? 296  VAL G C   1 
ATOM   7131  O O   . VAL J  1 150 ? 17.334  135.909 11.398  1.00 63.92  ? 296  VAL G O   1 
ATOM   7132  C CB  . VAL J  1 150 ? 18.004  134.412 14.416  1.00 57.37  ? 296  VAL G CB  1 
ATOM   7133  C CG1 . VAL J  1 150 ? 17.493  133.356 15.378  1.00 54.25  ? 296  VAL G CG1 1 
ATOM   7134  C CG2 . VAL J  1 150 ? 19.147  133.880 13.577  1.00 55.03  ? 296  VAL G CG2 1 
ATOM   7135  N N   . GLU J  1 151 ? 17.878  137.101 13.211  1.00 75.25  ? 297  GLU G N   1 
ATOM   7136  C CA  . GLU J  1 151 ? 18.407  138.205 12.404  1.00 84.55  ? 297  GLU G CA  1 
ATOM   7137  C C   . GLU J  1 151 ? 19.811  137.843 11.913  1.00 90.85  ? 297  GLU G C   1 
ATOM   7138  O O   . GLU J  1 151 ? 20.165  136.662 11.897  1.00 96.07  ? 297  GLU G O   1 
ATOM   7139  C CB  . GLU J  1 151 ? 18.435  139.478 13.232  1.00 84.23  ? 297  GLU G CB  1 
ATOM   7140  C CG  . GLU J  1 151 ? 17.058  139.885 13.706  1.00 93.99  ? 297  GLU G CG  1 
ATOM   7141  C CD  . GLU J  1 151 ? 17.097  141.007 14.726  1.00 99.41  ? 297  GLU G CD  1 
ATOM   7142  O OE1 . GLU J  1 151 ? 17.609  140.784 15.846  1.00 100.00 ? 297  GLU G OE1 1 
ATOM   7143  O OE2 . GLU J  1 151 ? 16.619  142.118 14.410  1.00 100.00 ? 297  GLU G OE2 1 
ATOM   7144  N N   . THR J  1 152 ? 20.611  138.828 11.505  1.00 93.19  ? 298  THR G N   1 
ATOM   7145  C CA  . THR J  1 152 ? 21.966  138.519 11.029  1.00 94.16  ? 298  THR G CA  1 
ATOM   7146  C C   . THR J  1 152 ? 23.062  138.737 12.082  1.00 98.11  ? 298  THR G C   1 
ATOM   7147  O O   . THR J  1 152 ? 23.442  139.876 12.382  1.00 100.00 ? 298  THR G O   1 
ATOM   7148  C CB  . THR J  1 152 ? 22.300  139.312 9.739   1.00 88.85  ? 298  THR G CB  1 
ATOM   7149  O OG1 . THR J  1 152 ? 21.572  138.742 8.645   1.00 82.02  ? 298  THR G OG1 1 
ATOM   7150  C CG2 . THR J  1 152 ? 23.801  139.254 9.423   1.00 88.31  ? 298  THR G CG2 1 
ATOM   7151  N N   . ASP J  1 153 ? 23.561  137.623 12.632  1.00 100.00 ? 299  ASP G N   1 
ATOM   7152  C CA  . ASP J  1 153 ? 24.610  137.630 13.663  1.00 98.34  ? 299  ASP G CA  1 
ATOM   7153  C C   . ASP J  1 153 ? 25.918  138.177 13.121  1.00 99.23  ? 299  ASP G C   1 
ATOM   7154  O O   . ASP J  1 153 ? 26.934  138.035 13.841  1.00 100.00 ? 299  ASP G O   1 
ATOM   7155  C CB  . ASP J  1 153 ? 24.877  136.214 14.187  1.00 89.20  ? 299  ASP G CB  1 
ATOM   7156  C CG  . ASP J  1 153 ? 23.648  135.563 14.785  1.00 81.95  ? 299  ASP G CG  1 
ATOM   7157  O OD1 . ASP J  1 153 ? 23.372  135.767 15.991  1.00 74.48  ? 299  ASP G OD1 1 
ATOM   7158  O OD2 . ASP J  1 153 ? 22.959  134.845 14.033  1.00 74.17  ? 299  ASP G OD2 1 
ATOM   7159  O OXT . ASP J  1 153 ? 25.907  138.732 11.996  1.00 100.00 ? 299  ASP G OXT 1 
ATOM   7160  N N   . THR K  2 1   ? 54.589  120.350 42.256  1.00 90.17  ? 318  THR H N   1 
ATOM   7161  C CA  . THR K  2 1   ? 54.367  118.889 42.486  1.00 88.01  ? 318  THR H CA  1 
ATOM   7162  C C   . THR K  2 1   ? 53.061  118.660 43.253  1.00 93.03  ? 318  THR H C   1 
ATOM   7163  O O   . THR K  2 1   ? 53.055  118.048 44.332  1.00 93.81  ? 318  THR H O   1 
ATOM   7164  C CB  . THR K  2 1   ? 55.518  118.287 43.290  1.00 82.08  ? 318  THR H CB  1 
ATOM   7165  O OG1 . THR K  2 1   ? 56.725  119.003 42.995  1.00 72.49  ? 318  THR H OG1 1 
ATOM   7166  C CG2 . THR K  2 1   ? 55.687  116.806 42.935  1.00 78.22  ? 318  THR H CG2 1 
ATOM   7167  N N   . ARG K  2 2   ? 51.963  119.134 42.658  1.00 92.92  ? 319  ARG H N   1 
ATOM   7168  C CA  . ARG K  2 2   ? 50.615  119.068 43.227  1.00 91.42  ? 319  ARG H CA  1 
ATOM   7169  C C   . ARG K  2 2   ? 49.642  118.123 42.485  1.00 89.02  ? 319  ARG H C   1 
ATOM   7170  O O   . ARG K  2 2   ? 49.973  117.593 41.428  1.00 91.61  ? 319  ARG H O   1 
ATOM   7171  C CB  . ARG K  2 2   ? 50.079  120.495 43.244  1.00 93.48  ? 319  ARG H CB  1 
ATOM   7172  C CG  . ARG K  2 2   ? 50.851  121.377 42.252  1.00 96.77  ? 319  ARG H CG  1 
ATOM   7173  C CD  . ARG K  2 2   ? 50.369  122.810 42.245  1.00 100.00 ? 319  ARG H CD  1 
ATOM   7174  N NE  . ARG K  2 2   ? 51.143  123.647 41.324  1.00 100.00 ? 319  ARG H NE  1 
ATOM   7175  C CZ  . ARG K  2 2   ? 50.964  124.964 41.163  1.00 100.00 ? 319  ARG H CZ  1 
ATOM   7176  N NH1 . ARG K  2 2   ? 50.030  125.618 41.861  1.00 100.00 ? 319  ARG H NH1 1 
ATOM   7177  N NH2 . ARG K  2 2   ? 51.727  125.635 40.303  1.00 100.00 ? 319  ARG H NH2 1 
ATOM   7178  N N   . TYR K  2 3   ? 48.446  117.919 43.042  1.00 86.93  ? 320  TYR H N   1 
ATOM   7179  C CA  . TYR K  2 3   ? 47.441  117.035 42.437  1.00 85.00  ? 320  TYR H CA  1 
ATOM   7180  C C   . TYR K  2 3   ? 46.329  117.714 41.636  1.00 83.81  ? 320  TYR H C   1 
ATOM   7181  O O   . TYR K  2 3   ? 45.878  118.818 41.981  1.00 80.28  ? 320  TYR H O   1 
ATOM   7182  C CB  . TYR K  2 3   ? 46.743  116.184 43.503  1.00 88.06  ? 320  TYR H CB  1 
ATOM   7183  C CG  . TYR K  2 3   ? 47.579  115.097 44.097  1.00 91.69  ? 320  TYR H CG  1 
ATOM   7184  C CD1 . TYR K  2 3   ? 48.955  115.054 43.879  1.00 92.59  ? 320  TYR H CD1 1 
ATOM   7185  C CD2 . TYR K  2 3   ? 46.995  114.108 44.893  1.00 90.30  ? 320  TYR H CD2 1 
ATOM   7186  C CE1 . TYR K  2 3   ? 49.738  114.052 44.439  1.00 97.99  ? 320  TYR H CE1 1 
ATOM   7187  C CE2 . TYR K  2 3   ? 47.765  113.100 45.459  1.00 97.21  ? 320  TYR H CE2 1 
ATOM   7188  C CZ  . TYR K  2 3   ? 49.137  113.076 45.228  1.00 100.00 ? 320  TYR H CZ  1 
ATOM   7189  O OH  . TYR K  2 3   ? 49.906  112.077 45.783  1.00 100.00 ? 320  TYR H OH  1 
ATOM   7190  N N   . ILE K  2 4   ? 45.890  117.029 40.573  1.00 78.41  ? 321  ILE H N   1 
ATOM   7191  C CA  . ILE K  2 4   ? 44.775  117.485 39.745  1.00 67.54  ? 321  ILE H CA  1 
ATOM   7192  C C   . ILE K  2 4   ? 43.881  116.265 39.590  1.00 66.14  ? 321  ILE H C   1 
ATOM   7193  O O   . ILE K  2 4   ? 44.329  115.138 39.776  1.00 66.47  ? 321  ILE H O   1 
ATOM   7194  C CB  . ILE K  2 4   ? 45.206  117.990 38.368  1.00 61.68  ? 321  ILE H CB  1 
ATOM   7195  C CG1 . ILE K  2 4   ? 45.754  116.844 37.542  1.00 58.41  ? 321  ILE H CG1 1 
ATOM   7196  C CG2 . ILE K  2 4   ? 46.220  119.131 38.522  1.00 56.55  ? 321  ILE H CG2 1 
ATOM   7197  C CD1 . ILE K  2 4   ? 46.146  117.293 36.144  1.00 69.11  ? 321  ILE H CD1 1 
ATOM   7198  N N   . PRO K  2 5   ? 42.589  116.472 39.305  1.00 66.80  ? 322  PRO H N   1 
ATOM   7199  C CA  . PRO K  2 5   ? 41.712  115.305 39.158  1.00 61.84  ? 322  PRO H CA  1 
ATOM   7200  C C   . PRO K  2 5   ? 42.030  114.359 37.997  1.00 60.06  ? 322  PRO H C   1 
ATOM   7201  O O   . PRO K  2 5   ? 42.552  114.759 36.937  1.00 49.96  ? 322  PRO H O   1 
ATOM   7202  C CB  . PRO K  2 5   ? 40.311  115.924 39.063  1.00 63.99  ? 322  PRO H CB  1 
ATOM   7203  C CG  . PRO K  2 5   ? 40.569  117.357 38.619  1.00 65.65  ? 322  PRO H CG  1 
ATOM   7204  C CD  . PRO K  2 5   ? 41.810  117.724 39.368  1.00 65.37  ? 322  PRO H CD  1 
ATOM   7205  N N   . ASP K  2 6   ? 41.711  113.091 38.238  1.00 58.17  ? 323  ASP H N   1 
ATOM   7206  C CA  . ASP K  2 6   ? 41.925  112.004 37.287  1.00 57.88  ? 323  ASP H CA  1 
ATOM   7207  C C   . ASP K  2 6   ? 41.466  112.354 35.869  1.00 57.42  ? 323  ASP H C   1 
ATOM   7208  O O   . ASP K  2 6   ? 42.190  112.103 34.895  1.00 48.08  ? 323  ASP H O   1 
ATOM   7209  C CB  . ASP K  2 6   ? 41.192  110.749 37.786  1.00 58.51  ? 323  ASP H CB  1 
ATOM   7210  C CG  . ASP K  2 6   ? 41.531  109.498 36.976  1.00 60.15  ? 323  ASP H CG  1 
ATOM   7211  O OD1 . ASP K  2 6   ? 42.658  109.427 36.449  1.00 58.76  ? 323  ASP H OD1 1 
ATOM   7212  O OD2 . ASP K  2 6   ? 40.682  108.576 36.885  1.00 50.76  ? 323  ASP H OD2 1 
ATOM   7213  N N   . GLU K  2 7   ? 40.277  112.960 35.767  1.00 56.42  ? 324  GLU H N   1 
ATOM   7214  C CA  . GLU K  2 7   ? 39.688  113.335 34.476  1.00 47.35  ? 324  GLU H CA  1 
ATOM   7215  C C   . GLU K  2 7   ? 39.946  114.757 33.974  1.00 42.21  ? 324  GLU H C   1 
ATOM   7216  O O   . GLU K  2 7   ? 39.234  115.243 33.098  1.00 45.49  ? 324  GLU H O   1 
ATOM   7217  C CB  . GLU K  2 7   ? 38.178  113.084 34.478  1.00 37.51  ? 324  GLU H CB  1 
ATOM   7218  C CG  . GLU K  2 7   ? 37.768  111.702 34.976  1.00 44.92  ? 324  GLU H CG  1 
ATOM   7219  C CD  . GLU K  2 7   ? 36.326  111.362 34.612  1.00 57.44  ? 324  GLU H CD  1 
ATOM   7220  O OE1 . GLU K  2 7   ? 35.809  111.920 33.591  1.00 49.61  ? 324  GLU H OE1 1 
ATOM   7221  O OE2 . GLU K  2 7   ? 35.722  110.527 35.340  1.00 52.27  ? 324  GLU H OE2 1 
ATOM   7222  N N   . ALA K  2 8   ? 40.958  115.418 34.513  1.00 32.94  ? 325  ALA H N   1 
ATOM   7223  C CA  . ALA K  2 8   ? 41.285  116.766 34.064  1.00 38.03  ? 325  ALA H CA  1 
ATOM   7224  C C   . ALA K  2 8   ? 41.867  116.797 32.658  1.00 39.60  ? 325  ALA H C   1 
ATOM   7225  O O   . ALA K  2 8   ? 42.130  115.766 32.056  1.00 50.53  ? 325  ALA H O   1 
ATOM   7226  C CB  . ALA K  2 8   ? 42.279  117.421 35.028  1.00 42.85  ? 325  ALA H CB  1 
ATOM   7227  N N   . ASP K  2 9   ? 42.065  118.006 32.155  1.00 44.14  ? 326  ASP H N   1 
ATOM   7228  C CA  . ASP K  2 9   ? 42.632  118.256 30.838  1.00 49.48  ? 326  ASP H CA  1 
ATOM   7229  C C   . ASP K  2 9   ? 42.123  117.460 29.637  1.00 51.27  ? 326  ASP H C   1 
ATOM   7230  O O   . ASP K  2 9   ? 42.902  116.921 28.867  1.00 56.28  ? 326  ASP H O   1 
ATOM   7231  C CB  . ASP K  2 9   ? 44.119  118.084 30.938  1.00 56.83  ? 326  ASP H CB  1 
ATOM   7232  C CG  . ASP K  2 9   ? 44.651  118.579 32.238  1.00 61.47  ? 326  ASP H CG  1 
ATOM   7233  O OD1 . ASP K  2 9   ? 44.766  119.809 32.383  1.00 49.40  ? 326  ASP H OD1 1 
ATOM   7234  O OD2 . ASP K  2 9   ? 44.938  117.728 33.109  1.00 70.19  ? 326  ASP H OD2 1 
ATOM   7235  N N   . PHE K  2 10  ? 40.814  117.375 29.479  1.00 55.14  ? 327  PHE H N   1 
ATOM   7236  C CA  . PHE K  2 10  ? 40.239  116.687 28.339  1.00 50.63  ? 327  PHE H CA  1 
ATOM   7237  C C   . PHE K  2 10  ? 39.496  117.700 27.473  1.00 54.34  ? 327  PHE H C   1 
ATOM   7238  O O   . PHE K  2 10  ? 39.017  118.741 27.944  1.00 58.73  ? 327  PHE H O   1 
ATOM   7239  C CB  . PHE K  2 10  ? 39.235  115.635 28.776  1.00 50.18  ? 327  PHE H CB  1 
ATOM   7240  C CG  . PHE K  2 10  ? 39.824  114.281 28.997  1.00 59.04  ? 327  PHE H CG  1 
ATOM   7241  C CD1 . PHE K  2 10  ? 40.370  113.932 30.228  1.00 50.93  ? 327  PHE H CD1 1 
ATOM   7242  C CD2 . PHE K  2 10  ? 39.787  113.324 27.976  1.00 64.88  ? 327  PHE H CD2 1 
ATOM   7243  C CE1 . PHE K  2 10  ? 40.858  112.658 30.437  1.00 47.39  ? 327  PHE H CE1 1 
ATOM   7244  C CE2 . PHE K  2 10  ? 40.276  112.038 28.176  1.00 55.34  ? 327  PHE H CE2 1 
ATOM   7245  C CZ  . PHE K  2 10  ? 40.809  111.706 29.407  1.00 53.64  ? 327  PHE H CZ  1 
ATOM   7246  N N   . LEU K  2 11  ? 39.407  117.393 26.194  1.00 49.24  ? 328  LEU H N   1 
ATOM   7247  C CA  . LEU K  2 11  ? 38.669  118.228 25.274  1.00 38.91  ? 328  LEU H CA  1 
ATOM   7248  C C   . LEU K  2 11  ? 38.000  117.286 24.293  1.00 35.87  ? 328  LEU H C   1 
ATOM   7249  O O   . LEU K  2 11  ? 38.666  116.649 23.491  1.00 44.66  ? 328  LEU H O   1 
ATOM   7250  C CB  . LEU K  2 11  ? 39.588  119.190 24.540  1.00 28.39  ? 328  LEU H CB  1 
ATOM   7251  C CG  . LEU K  2 11  ? 38.881  119.795 23.317  1.00 32.58  ? 328  LEU H CG  1 
ATOM   7252  C CD1 . LEU K  2 11  ? 37.466  120.217 23.672  1.00 26.89  ? 328  LEU H CD1 1 
ATOM   7253  C CD2 . LEU K  2 11  ? 39.653  120.968 22.790  1.00 28.38  ? 328  LEU H CD2 1 
ATOM   7254  N N   . LEU K  2 12  ? 36.686  117.171 24.386  1.00 29.52  ? 329  LEU H N   1 
ATOM   7255  C CA  . LEU K  2 12  ? 35.943  116.309 23.486  1.00 32.61  ? 329  LEU H CA  1 
ATOM   7256  C C   . LEU K  2 12  ? 35.206  117.186 22.510  1.00 37.71  ? 329  LEU H C   1 
ATOM   7257  O O   . LEU K  2 12  ? 34.444  118.038 22.911  1.00 42.45  ? 329  LEU H O   1 
ATOM   7258  C CB  . LEU K  2 12  ? 34.931  115.470 24.241  1.00 25.73  ? 329  LEU H CB  1 
ATOM   7259  C CG  . LEU K  2 12  ? 33.961  114.729 23.328  1.00 31.54  ? 329  LEU H CG  1 
ATOM   7260  C CD1 . LEU K  2 12  ? 34.686  114.096 22.149  1.00 41.19  ? 329  LEU H CD1 1 
ATOM   7261  C CD2 . LEU K  2 12  ? 33.253  113.659 24.124  1.00 29.66  ? 329  LEU H CD2 1 
ATOM   7262  N N   . GLY K  2 13  ? 35.441  116.976 21.225  1.00 41.12  ? 330  GLY H N   1 
ATOM   7263  C CA  . GLY K  2 13  ? 34.777  117.772 20.228  1.00 39.82  ? 330  GLY H CA  1 
ATOM   7264  C C   . GLY K  2 13  ? 33.820  116.935 19.408  1.00 42.48  ? 330  GLY H C   1 
ATOM   7265  O O   . GLY K  2 13  ? 34.236  116.277 18.460  1.00 39.00  ? 330  GLY H O   1 
ATOM   7266  N N   . MET K  2 14  ? 32.544  116.951 19.785  1.00 41.71  ? 331  MET H N   1 
ATOM   7267  C CA  . MET K  2 14  ? 31.512  116.236 19.050  1.00 39.65  ? 331  MET H CA  1 
ATOM   7268  C C   . MET K  2 14  ? 31.066  117.047 17.826  1.00 36.36  ? 331  MET H C   1 
ATOM   7269  O O   . MET K  2 14  ? 31.028  118.266 17.865  1.00 42.39  ? 331  MET H O   1 
ATOM   7270  C CB  . MET K  2 14  ? 30.313  115.999 19.944  1.00 38.06  ? 331  MET H CB  1 
ATOM   7271  C CG  . MET K  2 14  ? 30.605  115.135 21.110  1.00 35.64  ? 331  MET H CG  1 
ATOM   7272  S SD  . MET K  2 14  ? 31.127  113.593 20.531  1.00 32.77  ? 331  MET H SD  1 
ATOM   7273  C CE  . MET K  2 14  ? 29.615  112.760 20.181  1.00 22.24  ? 331  MET H CE  1 
ATOM   7274  N N   . ALA K  2 15  ? 30.729  116.359 16.747  1.00 32.69  ? 332  ALA H N   1 
ATOM   7275  C CA  . ALA K  2 15  ? 30.289  117.011 15.518  1.00 37.49  ? 332  ALA H CA  1 
ATOM   7276  C C   . ALA K  2 15  ? 28.806  117.353 15.593  1.00 39.08  ? 332  ALA H C   1 
ATOM   7277  O O   . ALA K  2 15  ? 28.314  118.177 14.827  1.00 38.05  ? 332  ALA H O   1 
ATOM   7278  C CB  . ALA K  2 15  ? 30.545  116.103 14.307  1.00 34.90  ? 332  ALA H CB  1 
ATOM   7279  N N   . THR K  2 16  ? 28.097  116.713 16.518  1.00 33.90  ? 333  THR H N   1 
ATOM   7280  C CA  . THR K  2 16  ? 26.680  116.956 16.672  1.00 32.22  ? 333  THR H CA  1 
ATOM   7281  C C   . THR K  2 16  ? 26.195  116.733 18.093  1.00 36.95  ? 333  THR H C   1 
ATOM   7282  O O   . THR K  2 16  ? 26.758  115.931 18.833  1.00 41.63  ? 333  THR H O   1 
ATOM   7283  C CB  . THR K  2 16  ? 25.871  116.043 15.769  1.00 27.06  ? 333  THR H CB  1 
ATOM   7284  O OG1 . THR K  2 16  ? 24.488  116.181 16.081  1.00 28.26  ? 333  THR H OG1 1 
ATOM   7285  C CG2 . THR K  2 16  ? 26.272  114.598 15.985  1.00 33.71  ? 333  THR H CG2 1 
ATOM   7286  N N   . VAL K  2 17  ? 25.154  117.462 18.480  1.00 36.27  ? 334  VAL H N   1 
ATOM   7287  C CA  . VAL K  2 17  ? 24.573  117.280 19.797  1.00 36.85  ? 334  VAL H CA  1 
ATOM   7288  C C   . VAL K  2 17  ? 24.002  115.873 19.807  1.00 36.19  ? 334  VAL H C   1 
ATOM   7289  O O   . VAL K  2 17  ? 23.888  115.234 18.760  1.00 38.64  ? 334  VAL H O   1 
ATOM   7290  C CB  . VAL K  2 17  ? 23.418  118.260 20.053  1.00 41.55  ? 334  VAL H CB  1 
ATOM   7291  C CG1 . VAL K  2 17  ? 23.967  119.648 20.249  1.00 34.28  ? 334  VAL H CG1 1 
ATOM   7292  C CG2 . VAL K  2 17  ? 22.410  118.209 18.883  1.00 45.93  ? 334  VAL H CG2 1 
ATOM   7293  N N   . ASN K  2 18  ? 23.610  115.392 20.972  1.00 34.61  ? 335  ASN H N   1 
ATOM   7294  C CA  . ASN K  2 18  ? 23.055  114.053 21.044  1.00 41.79  ? 335  ASN H CA  1 
ATOM   7295  C C   . ASN K  2 18  ? 21.724  113.885 20.293  1.00 39.01  ? 335  ASN H C   1 
ATOM   7296  O O   . ASN K  2 18  ? 20.946  114.822 20.151  1.00 38.70  ? 335  ASN H O   1 
ATOM   7297  C CB  . ASN K  2 18  ? 22.874  113.634 22.503  1.00 45.45  ? 335  ASN H CB  1 
ATOM   7298  C CG  . ASN K  2 18  ? 22.848  112.140 22.668  1.00 53.97  ? 335  ASN H CG  1 
ATOM   7299  O OD1 . ASN K  2 18  ? 22.397  111.634 23.682  1.00 63.22  ? 335  ASN H OD1 1 
ATOM   7300  N ND2 . ASN K  2 18  ? 23.348  111.420 21.670  1.00 63.23  ? 335  ASN H ND2 1 
ATOM   7301  N N   . ASN K  2 19  ? 21.483  112.668 19.821  1.00 42.47  ? 336  ASN H N   1 
ATOM   7302  C CA  . ASN K  2 19  ? 20.274  112.296 19.092  1.00 46.28  ? 336  ASN H CA  1 
ATOM   7303  C C   . ASN K  2 19  ? 20.170  112.755 17.664  1.00 44.32  ? 336  ASN H C   1 
ATOM   7304  O O   . ASN K  2 19  ? 19.204  112.422 16.998  1.00 45.58  ? 336  ASN H O   1 
ATOM   7305  C CB  . ASN K  2 19  ? 19.024  112.765 19.817  1.00 50.29  ? 336  ASN H CB  1 
ATOM   7306  C CG  . ASN K  2 19  ? 18.859  112.107 21.149  1.00 62.52  ? 336  ASN H CG  1 
ATOM   7307  O OD1 . ASN K  2 19  ? 19.365  112.587 22.168  1.00 76.06  ? 336  ASN H OD1 1 
ATOM   7308  N ND2 . ASN K  2 19  ? 18.161  110.989 21.158  1.00 64.99  ? 336  ASN H ND2 1 
ATOM   7309  N N   . CYS K  2 20  ? 21.152  113.500 17.176  1.00 44.14  ? 337  CYS H N   1 
ATOM   7310  C CA  . CYS K  2 20  ? 21.076  113.991 15.809  1.00 42.39  ? 337  CYS H CA  1 
ATOM   7311  C C   . CYS K  2 20  ? 22.139  113.495 14.829  1.00 39.09  ? 337  CYS H C   1 
ATOM   7312  O O   . CYS K  2 20  ? 23.116  112.858 15.206  1.00 36.59  ? 337  CYS H O   1 
ATOM   7313  C CB  . CYS K  2 20  ? 21.075  115.507 15.834  1.00 40.10  ? 337  CYS H CB  1 
ATOM   7314  S SG  . CYS K  2 20  ? 19.712  116.122 16.765  1.00 33.94  ? 337  CYS H SG  1 
ATOM   7315  N N   . VAL K  2 21  ? 21.927  113.805 13.558  1.00 35.27  ? 338  VAL H N   1 
ATOM   7316  C CA  . VAL K  2 21  ? 22.842  113.411 12.505  1.00 37.09  ? 338  VAL H CA  1 
ATOM   7317  C C   . VAL K  2 21  ? 23.854  114.500 12.202  1.00 33.73  ? 338  VAL H C   1 
ATOM   7318  O O   . VAL K  2 21  ? 23.615  115.656 12.490  1.00 39.40  ? 338  VAL H O   1 
ATOM   7319  C CB  . VAL K  2 21  ? 22.078  113.102 11.200  1.00 33.26  ? 338  VAL H CB  1 
ATOM   7320  C CG1 . VAL K  2 21  ? 20.982  112.108 11.476  1.00 36.60  ? 338  VAL H CG1 1 
ATOM   7321  C CG2 . VAL K  2 21  ? 21.504  114.360 10.626  1.00 21.62  ? 338  VAL H CG2 1 
ATOM   7322  N N   . SER K  2 22  ? 24.991  114.112 11.648  1.00 32.35  ? 339  SER H N   1 
ATOM   7323  C CA  . SER K  2 22  ? 26.013  115.057 11.241  1.00 36.46  ? 339  SER H CA  1 
ATOM   7324  C C   . SER K  2 22  ? 26.144  114.775 9.738   1.00 44.18  ? 339  SER H C   1 
ATOM   7325  O O   . SER K  2 22  ? 25.829  113.673 9.277   1.00 41.91  ? 339  SER H O   1 
ATOM   7326  C CB  . SER K  2 22  ? 27.331  114.827 11.982  1.00 25.13  ? 339  SER H CB  1 
ATOM   7327  O OG  . SER K  2 22  ? 27.679  113.463 11.976  1.00 52.11  ? 339  SER H OG  1 
ATOM   7328  N N   . TYR K  2 23  ? 26.593  115.764 8.974   1.00 48.44  ? 340  TYR H N   1 
ATOM   7329  C CA  . TYR K  2 23  ? 26.685  115.608 7.538   1.00 47.30  ? 340  TYR H CA  1 
ATOM   7330  C C   . TYR K  2 23  ? 28.058  115.411 6.921   1.00 49.70  ? 340  TYR H C   1 
ATOM   7331  O O   . TYR K  2 23  ? 29.057  115.995 7.354   1.00 54.70  ? 340  TYR H O   1 
ATOM   7332  C CB  . TYR K  2 23  ? 25.986  116.786 6.864   1.00 52.52  ? 340  TYR H CB  1 
ATOM   7333  C CG  . TYR K  2 23  ? 24.501  116.833 7.125   1.00 51.02  ? 340  TYR H CG  1 
ATOM   7334  C CD1 . TYR K  2 23  ? 23.632  116.008 6.423   1.00 50.13  ? 340  TYR H CD1 1 
ATOM   7335  C CD2 . TYR K  2 23  ? 23.968  117.664 8.099   1.00 44.33  ? 340  TYR H CD2 1 
ATOM   7336  C CE1 . TYR K  2 23  ? 22.270  116.008 6.693   1.00 49.62  ? 340  TYR H CE1 1 
ATOM   7337  C CE2 . TYR K  2 23  ? 22.613  117.669 8.367   1.00 43.53  ? 340  TYR H CE2 1 
ATOM   7338  C CZ  . TYR K  2 23  ? 21.772  116.836 7.663   1.00 42.62  ? 340  TYR H CZ  1 
ATOM   7339  O OH  . TYR K  2 23  ? 20.435  116.811 7.944   1.00 51.03  ? 340  TYR H OH  1 
ATOM   7340  N N   . ARG K  2 24  ? 28.070  114.584 5.876   1.00 49.27  ? 341  ARG H N   1 
ATOM   7341  C CA  . ARG K  2 24  ? 29.265  114.242 5.118   1.00 48.44  ? 341  ARG H CA  1 
ATOM   7342  C C   . ARG K  2 24  ? 28.954  114.405 3.627   1.00 49.92  ? 341  ARG H C   1 
ATOM   7343  O O   . ARG K  2 24  ? 27.996  113.821 3.115   1.00 48.98  ? 341  ARG H O   1 
ATOM   7344  C CB  . ARG K  2 24  ? 29.661  112.793 5.434   1.00 48.59  ? 341  ARG H CB  1 
ATOM   7345  C CG  . ARG K  2 24  ? 30.878  112.225 4.701   1.00 40.46  ? 341  ARG H CG  1 
ATOM   7346  C CD  . ARG K  2 24  ? 30.798  110.703 4.718   1.00 42.11  ? 341  ARG H CD  1 
ATOM   7347  N NE  . ARG K  2 24  ? 29.572  110.230 4.057   1.00 42.74  ? 341  ARG H NE  1 
ATOM   7348  C CZ  . ARG K  2 24  ? 28.737  109.342 4.579   1.00 44.86  ? 341  ARG H CZ  1 
ATOM   7349  N NH1 . ARG K  2 24  ? 28.989  108.816 5.762   1.00 54.97  ? 341  ARG H NH1 1 
ATOM   7350  N NH2 . ARG K  2 24  ? 27.631  108.996 3.941   1.00 53.25  ? 341  ARG H NH2 1 
ATOM   7351  N N   . ASN K  2 25  ? 29.758  115.221 2.950   1.00 47.55  ? 342  ASN H N   1 
ATOM   7352  C CA  . ASN K  2 25  ? 29.611  115.474 1.525   1.00 48.60  ? 342  ASN H CA  1 
ATOM   7353  C C   . ASN K  2 25  ? 30.663  114.643 0.811   1.00 51.18  ? 342  ASN H C   1 
ATOM   7354  O O   . ASN K  2 25  ? 31.860  114.907 0.931   1.00 53.14  ? 342  ASN H O   1 
ATOM   7355  C CB  . ASN K  2 25  ? 29.837  116.952 1.224   1.00 54.64  ? 342  ASN H CB  1 
ATOM   7356  C CG  . ASN K  2 25  ? 29.559  117.305 -0.220  1.00 60.08  ? 342  ASN H CG  1 
ATOM   7357  O OD1 . ASN K  2 25  ? 30.443  117.246 -1.058  1.00 53.28  ? 342  ASN H OD1 1 
ATOM   7358  N ND2 . ASN K  2 25  ? 28.318  117.672 -0.517  1.00 66.79  ? 342  ASN H ND2 1 
ATOM   7359  N N   . PRO K  2 26  ? 30.229  113.634 0.037   1.00 49.30  ? 343  PRO H N   1 
ATOM   7360  C CA  . PRO K  2 26  ? 31.135  112.757 -0.697  1.00 43.51  ? 343  PRO H CA  1 
ATOM   7361  C C   . PRO K  2 26  ? 32.249  113.482 -1.411  1.00 42.63  ? 343  PRO H C   1 
ATOM   7362  O O   . PRO K  2 26  ? 33.360  112.975 -1.504  1.00 42.04  ? 343  PRO H O   1 
ATOM   7363  C CB  . PRO K  2 26  ? 30.200  112.036 -1.655  1.00 45.42  ? 343  PRO H CB  1 
ATOM   7364  C CG  . PRO K  2 26  ? 28.953  111.923 -0.861  1.00 43.09  ? 343  PRO H CG  1 
ATOM   7365  C CD  . PRO K  2 26  ? 28.827  113.294 -0.266  1.00 49.31  ? 343  PRO H CD  1 
ATOM   7366  N N   . ALA K  2 27  ? 31.958  114.683 -1.887  1.00 45.02  ? 344  ALA H N   1 
ATOM   7367  C CA  . ALA K  2 27  ? 32.934  115.453 -2.625  1.00 43.45  ? 344  ALA H CA  1 
ATOM   7368  C C   . ALA K  2 27  ? 33.844  116.345 -1.801  1.00 41.36  ? 344  ALA H C   1 
ATOM   7369  O O   . ALA K  2 27  ? 34.842  116.801 -2.310  1.00 42.14  ? 344  ALA H O   1 
ATOM   7370  C CB  . ALA K  2 27  ? 32.224  116.273 -3.684  1.00 52.44  ? 344  ALA H CB  1 
ATOM   7371  N N   . GLU K  2 28  ? 33.534  116.615 -0.543  1.00 47.85  ? 345  GLU H N   1 
ATOM   7372  C CA  . GLU K  2 28  ? 34.426  117.494 0.200   1.00 56.85  ? 345  GLU H CA  1 
ATOM   7373  C C   . GLU K  2 28  ? 34.609  117.237 1.686   1.00 56.53  ? 345  GLU H C   1 
ATOM   7374  O O   . GLU K  2 28  ? 35.292  118.006 2.371   1.00 62.18  ? 345  GLU H O   1 
ATOM   7375  C CB  . GLU K  2 28  ? 34.049  118.969 -0.051  1.00 67.63  ? 345  GLU H CB  1 
ATOM   7376  C CG  . GLU K  2 28  ? 32.545  119.284 -0.079  1.00 83.32  ? 345  GLU H CG  1 
ATOM   7377  C CD  . GLU K  2 28  ? 32.240  120.706 -0.578  1.00 86.58  ? 345  GLU H CD  1 
ATOM   7378  O OE1 . GLU K  2 28  ? 32.805  121.677 -0.022  1.00 93.16  ? 345  GLU H OE1 1 
ATOM   7379  O OE2 . GLU K  2 28  ? 31.432  120.855 -1.523  1.00 84.15  ? 345  GLU H OE2 1 
ATOM   7380  N N   . GLY K  2 29  ? 34.022  116.154 2.185   1.00 51.48  ? 346  GLY H N   1 
ATOM   7381  C CA  . GLY K  2 29  ? 34.177  115.835 3.594   1.00 46.13  ? 346  GLY H CA  1 
ATOM   7382  C C   . GLY K  2 29  ? 33.006  116.221 4.458   1.00 42.20  ? 346  GLY H C   1 
ATOM   7383  O O   . GLY K  2 29  ? 31.987  116.679 3.961   1.00 48.40  ? 346  GLY H O   1 
ATOM   7384  N N   . THR K  2 30  ? 33.156  116.039 5.762   1.00 42.58  ? 347  THR H N   1 
ATOM   7385  C CA  . THR K  2 30  ? 32.094  116.343 6.703   1.00 35.70  ? 347  THR H CA  1 
ATOM   7386  C C   . THR K  2 30  ? 32.086  117.830 7.008   1.00 38.04  ? 347  THR H C   1 
ATOM   7387  O O   . THR K  2 30  ? 33.135  118.486 6.956   1.00 39.80  ? 347  THR H O   1 
ATOM   7388  C CB  . THR K  2 30  ? 32.277  115.531 8.012   1.00 32.46  ? 347  THR H CB  1 
ATOM   7389  O OG1 . THR K  2 30  ? 33.540  115.846 8.608   1.00 25.87  ? 347  THR H OG1 1 
ATOM   7390  C CG2 . THR K  2 30  ? 32.203  114.040 7.722   1.00 18.40  ? 347  THR H CG2 1 
ATOM   7391  N N   . TRP K  2 31  ? 30.906  118.365 7.309   1.00 33.28  ? 348  TRP H N   1 
ATOM   7392  C CA  . TRP K  2 31  ? 30.784  119.783 7.631   1.00 38.28  ? 348  TRP H CA  1 
ATOM   7393  C C   . TRP K  2 31  ? 31.694  120.101 8.797   1.00 38.14  ? 348  TRP H C   1 
ATOM   7394  O O   . TRP K  2 31  ? 32.426  121.100 8.788   1.00 42.01  ? 348  TRP H O   1 
ATOM   7395  C CB  . TRP K  2 31  ? 29.358  120.142 8.058   1.00 34.69  ? 348  TRP H CB  1 
ATOM   7396  C CG  . TRP K  2 31  ? 28.295  120.019 7.019   1.00 40.04  ? 348  TRP H CG  1 
ATOM   7397  C CD1 . TRP K  2 31  ? 28.433  119.558 5.744   1.00 44.61  ? 348  TRP H CD1 1 
ATOM   7398  C CD2 . TRP K  2 31  ? 26.902  120.318 7.188   1.00 44.67  ? 348  TRP H CD2 1 
ATOM   7399  N NE1 . TRP K  2 31  ? 27.214  119.544 5.107   1.00 47.30  ? 348  TRP H NE1 1 
ATOM   7400  C CE2 . TRP K  2 31  ? 26.257  120.005 5.970   1.00 47.53  ? 348  TRP H CE2 1 
ATOM   7401  C CE3 . TRP K  2 31  ? 26.140  120.821 8.250   1.00 38.61  ? 348  TRP H CE3 1 
ATOM   7402  C CZ2 . TRP K  2 31  ? 24.883  120.173 5.786   1.00 39.69  ? 348  TRP H CZ2 1 
ATOM   7403  C CZ3 . TRP K  2 31  ? 24.788  120.989 8.069   1.00 39.55  ? 348  TRP H CZ3 1 
ATOM   7404  C CH2 . TRP K  2 31  ? 24.168  120.664 6.840   1.00 42.83  ? 348  TRP H CH2 1 
ATOM   7405  N N   . TYR K  2 32  ? 31.630  119.241 9.809   1.00 36.96  ? 349  TYR H N   1 
ATOM   7406  C CA  . TYR K  2 32  ? 32.429  119.428 11.004  1.00 40.07  ? 349  TYR H CA  1 
ATOM   7407  C C   . TYR K  2 32  ? 33.934  119.423 10.787  1.00 44.34  ? 349  TYR H C   1 
ATOM   7408  O O   . TYR K  2 32  ? 34.597  120.438 11.016  1.00 42.11  ? 349  TYR H O   1 
ATOM   7409  C CB  . TYR K  2 32  ? 32.085  118.379 12.060  1.00 43.60  ? 349  TYR H CB  1 
ATOM   7410  C CG  . TYR K  2 32  ? 32.752  118.642 13.397  1.00 35.94  ? 349  TYR H CG  1 
ATOM   7411  C CD1 . TYR K  2 32  ? 32.660  119.883 14.008  1.00 39.93  ? 349  TYR H CD1 1 
ATOM   7412  C CD2 . TYR K  2 32  ? 33.467  117.654 14.047  1.00 40.73  ? 349  TYR H CD2 1 
ATOM   7413  C CE1 . TYR K  2 32  ? 33.265  120.130 15.229  1.00 39.61  ? 349  TYR H CE1 1 
ATOM   7414  C CE2 . TYR K  2 32  ? 34.074  117.898 15.279  1.00 39.45  ? 349  TYR H CE2 1 
ATOM   7415  C CZ  . TYR K  2 32  ? 33.970  119.130 15.857  1.00 34.28  ? 349  TYR H CZ  1 
ATOM   7416  O OH  . TYR K  2 32  ? 34.570  119.364 17.068  1.00 39.87  ? 349  TYR H OH  1 
ATOM   7417  N N   . ILE K  2 33  ? 34.481  118.292 10.344  1.00 40.95  ? 350  ILE H N   1 
ATOM   7418  C CA  . ILE K  2 33  ? 35.923  118.199 10.149  1.00 39.21  ? 350  ILE H CA  1 
ATOM   7419  C C   . ILE K  2 33  ? 36.500  119.270 9.233   1.00 39.51  ? 350  ILE H C   1 
ATOM   7420  O O   . ILE K  2 33  ? 37.473  119.946 9.582   1.00 37.17  ? 350  ILE H O   1 
ATOM   7421  C CB  . ILE K  2 33  ? 36.332  116.810 9.635   1.00 34.87  ? 350  ILE H CB  1 
ATOM   7422  C CG1 . ILE K  2 33  ? 35.910  115.738 10.642  1.00 31.19  ? 350  ILE H CG1 1 
ATOM   7423  C CG2 . ILE K  2 33  ? 37.838  116.751 9.483   1.00 28.78  ? 350  ILE H CG2 1 
ATOM   7424  C CD1 . ILE K  2 33  ? 36.573  115.899 11.994  1.00 16.27  ? 350  ILE H CD1 1 
ATOM   7425  N N   . GLN K  2 34  ? 35.900  119.431 8.062   1.00 38.94  ? 351  GLN H N   1 
ATOM   7426  C CA  . GLN K  2 34  ? 36.371  120.431 7.128   1.00 39.70  ? 351  GLN H CA  1 
ATOM   7427  C C   . GLN K  2 34  ? 36.462  121.768 7.817   1.00 44.63  ? 351  GLN H C   1 
ATOM   7428  O O   . GLN K  2 34  ? 37.516  122.399 7.820   1.00 49.84  ? 351  GLN H O   1 
ATOM   7429  C CB  . GLN K  2 34  ? 35.440  120.508 5.933   1.00 35.22  ? 351  GLN H CB  1 
ATOM   7430  C CG  . GLN K  2 34  ? 35.613  119.333 4.996   1.00 41.86  ? 351  GLN H CG  1 
ATOM   7431  C CD  . GLN K  2 34  ? 37.071  119.060 4.679   1.00 49.22  ? 351  GLN H CD  1 
ATOM   7432  O OE1 . GLN K  2 34  ? 37.819  119.962 4.284   1.00 51.43  ? 351  GLN H OE1 1 
ATOM   7433  N NE2 . GLN K  2 34  ? 37.487  117.811 4.852   1.00 48.97  ? 351  GLN H NE2 1 
ATOM   7434  N N   . SER K  2 35  ? 35.359  122.184 8.428   1.00 43.93  ? 352  SER H N   1 
ATOM   7435  C CA  . SER K  2 35  ? 35.320  123.442 9.150   1.00 44.44  ? 352  SER H CA  1 
ATOM   7436  C C   . SER K  2 35  ? 36.412  123.481 10.244  1.00 42.45  ? 352  SER H C   1 
ATOM   7437  O O   . SER K  2 35  ? 37.130  124.457 10.377  1.00 45.51  ? 352  SER H O   1 
ATOM   7438  C CB  . SER K  2 35  ? 33.927  123.633 9.757   1.00 42.44  ? 352  SER H CB  1 
ATOM   7439  O OG  . SER K  2 35  ? 33.860  124.865 10.459  1.00 57.73  ? 352  SER H OG  1 
ATOM   7440  N N   . LEU K  2 36  ? 36.543  122.406 11.009  1.00 42.90  ? 353  LEU H N   1 
ATOM   7441  C CA  . LEU K  2 36  ? 37.539  122.339 12.056  1.00 34.85  ? 353  LEU H CA  1 
ATOM   7442  C C   . LEU K  2 36  ? 38.901  122.668 11.486  1.00 40.69  ? 353  LEU H C   1 
ATOM   7443  O O   . LEU K  2 36  ? 39.590  123.553 11.988  1.00 44.43  ? 353  LEU H O   1 
ATOM   7444  C CB  . LEU K  2 36  ? 37.557  120.940 12.684  1.00 36.39  ? 353  LEU H CB  1 
ATOM   7445  C CG  . LEU K  2 36  ? 38.652  120.567 13.708  1.00 39.45  ? 353  LEU H CG  1 
ATOM   7446  C CD1 . LEU K  2 36  ? 38.780  121.626 14.778  1.00 34.64  ? 353  LEU H CD1 1 
ATOM   7447  C CD2 . LEU K  2 36  ? 38.344  119.220 14.349  1.00 34.11  ? 353  LEU H CD2 1 
ATOM   7448  N N   . CYS K  2 37  ? 39.284  121.972 10.422  1.00 45.58  ? 354  CYS H N   1 
ATOM   7449  C CA  . CYS K  2 37  ? 40.593  122.183 9.812   1.00 50.90  ? 354  CYS H CA  1 
ATOM   7450  C C   . CYS K  2 37  ? 40.742  123.584 9.261   1.00 54.31  ? 354  CYS H C   1 
ATOM   7451  O O   . CYS K  2 37  ? 41.745  124.247 9.516   1.00 56.26  ? 354  CYS H O   1 
ATOM   7452  C CB  . CYS K  2 37  ? 40.844  121.157 8.707   1.00 49.49  ? 354  CYS H CB  1 
ATOM   7453  S SG  . CYS K  2 37  ? 41.078  119.449 9.291   1.00 46.97  ? 354  CYS H SG  1 
ATOM   7454  N N   . GLN K  2 38  ? 39.745  124.038 8.506   1.00 59.60  ? 355  GLN H N   1 
ATOM   7455  C CA  . GLN K  2 38  ? 39.783  125.389 7.935   1.00 61.56  ? 355  GLN H CA  1 
ATOM   7456  C C   . GLN K  2 38  ? 40.089  126.365 9.050   1.00 53.80  ? 355  GLN H C   1 
ATOM   7457  O O   . GLN K  2 38  ? 41.060  127.108 9.001   1.00 50.42  ? 355  GLN H O   1 
ATOM   7458  C CB  . GLN K  2 38  ? 38.434  125.800 7.344   1.00 73.70  ? 355  GLN H CB  1 
ATOM   7459  C CG  . GLN K  2 38  ? 37.927  125.001 6.154   1.00 92.99  ? 355  GLN H CG  1 
ATOM   7460  C CD  . GLN K  2 38  ? 36.625  125.587 5.592   1.00 100.00 ? 355  GLN H CD  1 
ATOM   7461  O OE1 . GLN K  2 38  ? 36.588  126.766 5.210   1.00 100.00 ? 355  GLN H OE1 1 
ATOM   7462  N NE2 . GLN K  2 38  ? 35.555  124.771 5.543   1.00 95.03  ? 355  GLN H NE2 1 
ATOM   7463  N N   . SER K  2 39  ? 39.236  126.348 10.060  1.00 51.75  ? 356  SER H N   1 
ATOM   7464  C CA  . SER K  2 39  ? 39.387  127.234 11.190  1.00 55.26  ? 356  SER H CA  1 
ATOM   7465  C C   . SER K  2 39  ? 40.749  127.059 11.838  1.00 54.58  ? 356  SER H C   1 
ATOM   7466  O O   . SER K  2 39  ? 41.432  128.032 12.133  1.00 58.02  ? 356  SER H O   1 
ATOM   7467  C CB  . SER K  2 39  ? 38.274  126.984 12.206  1.00 54.13  ? 356  SER H CB  1 
ATOM   7468  O OG  . SER K  2 39  ? 38.328  127.940 13.244  1.00 67.01  ? 356  SER H OG  1 
ATOM   7469  N N   . LEU K  2 40  ? 41.155  125.817 12.054  1.00 54.55  ? 357  LEU H N   1 
ATOM   7470  C CA  . LEU K  2 40  ? 42.452  125.568 12.662  1.00 54.44  ? 357  LEU H CA  1 
ATOM   7471  C C   . LEU K  2 40  ? 43.599  126.222 11.890  1.00 56.03  ? 357  LEU H C   1 
ATOM   7472  O O   . LEU K  2 40  ? 44.455  126.906 12.465  1.00 50.69  ? 357  LEU H O   1 
ATOM   7473  C CB  . LEU K  2 40  ? 42.695  124.069 12.759  1.00 45.18  ? 357  LEU H CB  1 
ATOM   7474  C CG  . LEU K  2 40  ? 42.111  123.468 14.034  1.00 50.06  ? 357  LEU H CG  1 
ATOM   7475  C CD1 . LEU K  2 40  ? 42.150  121.942 13.957  1.00 46.76  ? 357  LEU H CD1 1 
ATOM   7476  C CD2 . LEU K  2 40  ? 42.888  123.988 15.229  1.00 38.95  ? 357  LEU H CD2 1 
ATOM   7477  N N   . ARG K  2 41  ? 43.601  126.025 10.578  1.00 58.33  ? 358  ARG H N   1 
ATOM   7478  C CA  . ARG K  2 41  ? 44.666  126.553 9.759   1.00 65.05  ? 358  ARG H CA  1 
ATOM   7479  C C   . ARG K  2 41  ? 44.832  128.053 9.758   1.00 70.45  ? 358  ARG H C   1 
ATOM   7480  O O   . ARG K  2 41  ? 45.962  128.542 9.738   1.00 76.97  ? 358  ARG H O   1 
ATOM   7481  C CB  . ARG K  2 41  ? 44.564  126.000 8.333   1.00 60.82  ? 358  ARG H CB  1 
ATOM   7482  C CG  . ARG K  2 41  ? 45.381  124.708 8.188   1.00 76.66  ? 358  ARG H CG  1 
ATOM   7483  C CD  . ARG K  2 41  ? 45.380  124.134 6.787   1.00 88.04  ? 358  ARG H CD  1 
ATOM   7484  N NE  . ARG K  2 41  ? 44.068  123.611 6.410   1.00 99.34  ? 358  ARG H NE  1 
ATOM   7485  C CZ  . ARG K  2 41  ? 43.818  122.960 5.277   1.00 100.00 ? 358  ARG H CZ  1 
ATOM   7486  N NH1 . ARG K  2 41  ? 44.803  122.752 4.410   1.00 100.00 ? 358  ARG H NH1 1 
ATOM   7487  N NH2 . ARG K  2 41  ? 42.586  122.531 5.005   1.00 98.20  ? 358  ARG H NH2 1 
ATOM   7488  N N   . GLU K  2 42  ? 43.737  128.799 9.805   1.00 73.36  ? 359  GLU H N   1 
ATOM   7489  C CA  . GLU K  2 42  ? 43.854  130.254 9.809   1.00 77.31  ? 359  GLU H CA  1 
ATOM   7490  C C   . GLU K  2 42  ? 43.898  130.868 11.213  1.00 77.91  ? 359  GLU H C   1 
ATOM   7491  O O   . GLU K  2 42  ? 44.328  132.005 11.379  1.00 83.97  ? 359  GLU H O   1 
ATOM   7492  C CB  . GLU K  2 42  ? 42.713  130.878 9.005   1.00 75.74  ? 359  GLU H CB  1 
ATOM   7493  C CG  . GLU K  2 42  ? 41.355  130.371 9.403   1.00 86.46  ? 359  GLU H CG  1 
ATOM   7494  C CD  . GLU K  2 42  ? 40.230  131.006 8.605   1.00 94.31  ? 359  GLU H CD  1 
ATOM   7495  O OE1 . GLU K  2 42  ? 40.315  131.020 7.354   1.00 92.66  ? 359  GLU H OE1 1 
ATOM   7496  O OE2 . GLU K  2 42  ? 39.253  131.482 9.233   1.00 100.00 ? 359  GLU H OE2 1 
ATOM   7497  N N   . ARG K  2 43  ? 43.477  130.112 12.219  1.00 75.45  ? 360  ARG H N   1 
ATOM   7498  C CA  . ARG K  2 43  ? 43.454  130.593 13.597  1.00 77.07  ? 360  ARG H CA  1 
ATOM   7499  C C   . ARG K  2 43  ? 44.723  130.337 14.399  1.00 80.93  ? 360  ARG H C   1 
ATOM   7500  O O   . ARG K  2 43  ? 45.304  131.266 14.950  1.00 83.14  ? 360  ARG H O   1 
ATOM   7501  C CB  . ARG K  2 43  ? 42.278  129.969 14.347  1.00 78.43  ? 360  ARG H CB  1 
ATOM   7502  C CG  . ARG K  2 43  ? 40.935  130.578 14.022  1.00 85.59  ? 360  ARG H CG  1 
ATOM   7503  C CD  . ARG K  2 43  ? 40.687  131.810 14.857  1.00 89.24  ? 360  ARG H CD  1 
ATOM   7504  N NE  . ARG K  2 43  ? 39.405  132.441 14.547  1.00 88.21  ? 360  ARG H NE  1 
ATOM   7505  C CZ  . ARG K  2 43  ? 38.941  133.520 15.165  1.00 84.66  ? 360  ARG H CZ  1 
ATOM   7506  N NH1 . ARG K  2 43  ? 39.651  134.089 16.133  1.00 87.46  ? 360  ARG H NH1 1 
ATOM   7507  N NH2 . ARG K  2 43  ? 37.778  134.038 14.807  1.00 79.62  ? 360  ARG H NH2 1 
ATOM   7508  N N   . CYS K  2 44  ? 45.130  129.070 14.485  1.00 84.53  ? 361  CYS H N   1 
ATOM   7509  C CA  . CYS K  2 44  ? 46.322  128.671 15.239  1.00 82.02  ? 361  CYS H CA  1 
ATOM   7510  C C   . CYS K  2 44  ? 47.518  129.551 14.940  1.00 84.78  ? 361  CYS H C   1 
ATOM   7511  O O   . CYS K  2 44  ? 48.256  129.937 15.853  1.00 88.93  ? 361  CYS H O   1 
ATOM   7512  C CB  . CYS K  2 44  ? 46.682  127.221 14.945  1.00 78.03  ? 361  CYS H CB  1 
ATOM   7513  S SG  . CYS K  2 44  ? 45.470  126.063 15.551  1.00 72.59  ? 361  CYS H SG  1 
ATOM   7514  N N   . PRO K  2 45  ? 47.745  129.861 13.655  1.00 81.51  ? 362  PRO H N   1 
ATOM   7515  C CA  . PRO K  2 45  ? 48.875  130.715 13.299  1.00 81.63  ? 362  PRO H CA  1 
ATOM   7516  C C   . PRO K  2 45  ? 48.786  132.018 14.082  1.00 83.37  ? 362  PRO H C   1 
ATOM   7517  O O   . PRO K  2 45  ? 49.769  132.482 14.653  1.00 91.83  ? 362  PRO H O   1 
ATOM   7518  C CB  . PRO K  2 45  ? 48.681  130.923 11.805  1.00 81.53  ? 362  PRO H CB  1 
ATOM   7519  C CG  . PRO K  2 45  ? 48.123  129.612 11.376  1.00 85.30  ? 362  PRO H CG  1 
ATOM   7520  C CD  . PRO K  2 45  ? 47.080  129.350 12.446  1.00 82.46  ? 362  PRO H CD  1 
ATOM   7521  N N   . ARG K  2 46  B 47.586  132.589 14.123  1.00 84.86  ? 362  ARG H N   1 
ATOM   7522  C CA  . ARG K  2 46  B 47.328  133.841 14.830  1.00 79.94  ? 362  ARG H CA  1 
ATOM   7523  C C   . ARG K  2 46  B 47.404  133.702 16.347  1.00 73.06  ? 362  ARG H C   1 
ATOM   7524  O O   . ARG K  2 46  B 47.248  134.676 17.076  1.00 76.30  ? 362  ARG H O   1 
ATOM   7525  C CB  . ARG K  2 46  B 45.960  134.388 14.414  1.00 83.96  ? 362  ARG H CB  1 
ATOM   7526  C CG  . ARG K  2 46  B 45.912  134.845 12.954  1.00 89.50  ? 362  ARG H CG  1 
ATOM   7527  C CD  . ARG K  2 46  B 44.496  134.842 12.413  1.00 92.84  ? 362  ARG H CD  1 
ATOM   7528  N NE  . ARG K  2 46  B 43.576  135.548 13.299  1.00 95.24  ? 362  ARG H NE  1 
ATOM   7529  C CZ  . ARG K  2 46  B 42.254  135.555 13.154  1.00 97.40  ? 362  ARG H CZ  1 
ATOM   7530  N NH1 . ARG K  2 46  B 41.681  134.893 12.152  1.00 95.62  ? 362  ARG H NH1 1 
ATOM   7531  N NH2 . ARG K  2 46  B 41.503  136.226 14.015  1.00 98.92  ? 362  ARG H NH2 1 
ATOM   7532  N N   . GLY K  2 47  ? 47.642  132.486 16.817  1.00 68.32  ? 363  GLY H N   1 
ATOM   7533  C CA  . GLY K  2 47  ? 47.759  132.253 18.242  1.00 69.11  ? 363  GLY H CA  1 
ATOM   7534  C C   . GLY K  2 47  ? 46.454  132.073 18.992  1.00 73.71  ? 363  GLY H C   1 
ATOM   7535  O O   . GLY K  2 47  ? 46.431  132.159 20.226  1.00 70.54  ? 363  GLY H O   1 
ATOM   7536  N N   . ASP K  2 48  ? 45.368  131.808 18.267  1.00 74.08  ? 364  ASP H N   1 
ATOM   7537  C CA  . ASP K  2 48  ? 44.065  131.632 18.905  1.00 73.33  ? 364  ASP H CA  1 
ATOM   7538  C C   . ASP K  2 48  ? 43.946  130.331 19.680  1.00 67.28  ? 364  ASP H C   1 
ATOM   7539  O O   . ASP K  2 48  ? 44.526  129.323 19.297  1.00 71.88  ? 364  ASP H O   1 
ATOM   7540  C CB  . ASP K  2 48  ? 42.947  131.714 17.867  1.00 75.85  ? 364  ASP H CB  1 
ATOM   7541  C CG  . ASP K  2 48  ? 42.598  133.133 17.519  1.00 81.36  ? 364  ASP H CG  1 
ATOM   7542  O OD1 . ASP K  2 48  ? 42.427  133.932 18.466  1.00 85.43  ? 364  ASP H OD1 1 
ATOM   7543  O OD2 . ASP K  2 48  ? 42.492  133.451 16.314  1.00 83.03  ? 364  ASP H OD2 1 
ATOM   7544  N N   . ASP K  2 49  ? 43.183  130.367 20.765  1.00 57.02  ? 365  ASP H N   1 
ATOM   7545  C CA  . ASP K  2 49  ? 42.986  129.205 21.600  1.00 54.62  ? 365  ASP H CA  1 
ATOM   7546  C C   . ASP K  2 49  ? 41.984  128.229 20.969  1.00 53.92  ? 365  ASP H C   1 
ATOM   7547  O O   . ASP K  2 49  ? 41.178  128.619 20.133  1.00 52.41  ? 365  ASP H O   1 
ATOM   7548  C CB  . ASP K  2 49  ? 42.582  129.665 23.008  1.00 61.36  ? 365  ASP H CB  1 
ATOM   7549  C CG  . ASP K  2 49  ? 41.289  129.072 23.479  1.00 71.13  ? 365  ASP H CG  1 
ATOM   7550  O OD1 . ASP K  2 49  ? 40.232  129.633 23.109  1.00 76.33  ? 365  ASP H OD1 1 
ATOM   7551  O OD2 . ASP K  2 49  ? 41.338  128.053 24.216  1.00 65.33  ? 365  ASP H OD2 1 
ATOM   7552  N N   . ILE K  2 50  ? 42.053  126.954 21.356  1.00 51.83  ? 366  ILE H N   1 
ATOM   7553  C CA  . ILE K  2 50  ? 41.199  125.924 20.776  1.00 51.00  ? 366  ILE H CA  1 
ATOM   7554  C C   . ILE K  2 50  ? 39.703  126.145 20.991  1.00 52.86  ? 366  ILE H C   1 
ATOM   7555  O O   . ILE K  2 50  ? 38.896  125.915 20.075  1.00 54.54  ? 366  ILE H O   1 
ATOM   7556  C CB  . ILE K  2 50  ? 41.639  124.488 21.268  1.00 45.56  ? 366  ILE H CB  1 
ATOM   7557  C CG1 . ILE K  2 50  ? 41.492  123.463 20.125  1.00 36.55  ? 366  ILE H CG1 1 
ATOM   7558  C CG2 . ILE K  2 50  ? 40.843  124.064 22.463  1.00 39.10  ? 366  ILE H CG2 1 
ATOM   7559  C CD1 . ILE K  2 50  ? 40.105  123.185 19.706  1.00 25.63  ? 366  ILE H CD1 1 
ATOM   7560  N N   . LEU K  2 51  ? 39.328  126.586 22.189  1.00 50.70  ? 367  LEU H N   1 
ATOM   7561  C CA  . LEU K  2 51  ? 37.922  126.850 22.485  1.00 46.57  ? 367  LEU H CA  1 
ATOM   7562  C C   . LEU K  2 51  ? 37.401  127.943 21.536  1.00 44.90  ? 367  LEU H C   1 
ATOM   7563  O O   . LEU K  2 51  ? 36.308  127.835 20.989  1.00 41.87  ? 367  LEU H O   1 
ATOM   7564  C CB  . LEU K  2 51  ? 37.756  127.259 23.950  1.00 35.15  ? 367  LEU H CB  1 
ATOM   7565  C CG  . LEU K  2 51  ? 37.925  126.113 24.961  1.00 44.12  ? 367  LEU H CG  1 
ATOM   7566  C CD1 . LEU K  2 51  ? 37.658  126.601 26.377  1.00 43.15  ? 367  LEU H CD1 1 
ATOM   7567  C CD2 . LEU K  2 51  ? 36.965  124.987 24.651  1.00 34.82  ? 367  LEU H CD2 1 
ATOM   7568  N N   . THR K  2 52  ? 38.198  128.986 21.334  1.00 41.09  ? 368  THR H N   1 
ATOM   7569  C CA  . THR K  2 52  ? 37.831  130.047 20.417  1.00 44.27  ? 368  THR H CA  1 
ATOM   7570  C C   . THR K  2 52  ? 37.589  129.409 19.057  1.00 49.95  ? 368  THR H C   1 
ATOM   7571  O O   . THR K  2 52  ? 36.537  129.595 18.447  1.00 54.09  ? 368  THR H O   1 
ATOM   7572  C CB  . THR K  2 52  ? 38.964  131.082 20.277  1.00 49.39  ? 368  THR H CB  1 
ATOM   7573  O OG1 . THR K  2 52  ? 39.045  131.870 21.474  1.00 55.18  ? 368  THR H OG1 1 
ATOM   7574  C CG2 . THR K  2 52  ? 38.735  131.980 19.057  1.00 44.79  ? 368  THR H CG2 1 
ATOM   7575  N N   . ILE K  2 53  ? 38.571  128.642 18.592  1.00 55.92  ? 369  ILE H N   1 
ATOM   7576  C CA  . ILE K  2 53  ? 38.483  127.958 17.301  1.00 52.88  ? 369  ILE H CA  1 
ATOM   7577  C C   . ILE K  2 53  ? 37.218  127.103 17.224  1.00 49.42  ? 369  ILE H C   1 
ATOM   7578  O O   . ILE K  2 53  ? 36.462  127.178 16.253  1.00 41.75  ? 369  ILE H O   1 
ATOM   7579  C CB  . ILE K  2 53  ? 39.728  127.089 17.086  1.00 52.06  ? 369  ILE H CB  1 
ATOM   7580  C CG1 . ILE K  2 53  ? 40.964  127.985 17.162  1.00 52.91  ? 369  ILE H CG1 1 
ATOM   7581  C CG2 . ILE K  2 53  ? 39.665  126.376 15.742  1.00 45.83  ? 369  ILE H CG2 1 
ATOM   7582  C CD1 . ILE K  2 53  ? 42.245  127.226 17.268  1.00 66.36  ? 369  ILE H CD1 1 
ATOM   7583  N N   . LEU K  2 54  ? 36.977  126.311 18.260  1.00 43.77  ? 370  LEU H N   1 
ATOM   7584  C CA  . LEU K  2 54  ? 35.801  125.472 18.272  1.00 48.09  ? 370  LEU H CA  1 
ATOM   7585  C C   . LEU K  2 54  ? 34.502  126.270 18.190  1.00 50.49  ? 370  LEU H C   1 
ATOM   7586  O O   . LEU K  2 54  ? 33.524  125.813 17.593  1.00 55.85  ? 370  LEU H O   1 
ATOM   7587  C CB  . LEU K  2 54  ? 35.818  124.583 19.508  1.00 43.08  ? 370  LEU H CB  1 
ATOM   7588  C CG  . LEU K  2 54  ? 36.675  123.350 19.251  1.00 38.86  ? 370  LEU H CG  1 
ATOM   7589  C CD1 . LEU K  2 54  ? 36.826  122.563 20.537  1.00 44.68  ? 370  LEU H CD1 1 
ATOM   7590  C CD2 . LEU K  2 54  ? 36.044  122.501 18.160  1.00 29.58  ? 370  LEU H CD2 1 
ATOM   7591  N N   . THR K  2 55  ? 34.498  127.462 18.782  1.00 49.61  ? 371  THR H N   1 
ATOM   7592  C CA  . THR K  2 55  ? 33.325  128.333 18.758  1.00 44.61  ? 371  THR H CA  1 
ATOM   7593  C C   . THR K  2 55  ? 33.052  128.767 17.329  1.00 42.55  ? 371  THR H C   1 
ATOM   7594  O O   . THR K  2 55  ? 31.916  128.746 16.863  1.00 45.13  ? 371  THR H O   1 
ATOM   7595  C CB  . THR K  2 55  ? 33.539  129.586 19.599  1.00 37.76  ? 371  THR H CB  1 
ATOM   7596  O OG1 . THR K  2 55  ? 33.623  129.227 20.978  1.00 56.28  ? 371  THR H OG1 1 
ATOM   7597  C CG2 . THR K  2 55  ? 32.395  130.514 19.437  1.00 43.41  ? 371  THR H CG2 1 
ATOM   7598  N N   . GLU K  2 56  ? 34.104  129.160 16.632  1.00 43.76  ? 372  GLU H N   1 
ATOM   7599  C CA  . GLU K  2 56  ? 33.979  129.583 15.246  1.00 44.90  ? 372  GLU H CA  1 
ATOM   7600  C C   . GLU K  2 56  ? 33.392  128.419 14.458  1.00 43.58  ? 372  GLU H C   1 
ATOM   7601  O O   . GLU K  2 56  ? 32.574  128.608 13.554  1.00 45.94  ? 372  GLU H O   1 
ATOM   7602  C CB  . GLU K  2 56  ? 35.356  129.983 14.684  1.00 45.33  ? 372  GLU H CB  1 
ATOM   7603  C CG  . GLU K  2 56  ? 35.349  130.662 13.300  1.00 56.44  ? 372  GLU H CG  1 
ATOM   7604  C CD  . GLU K  2 56  ? 36.707  131.288 12.923  1.00 67.31  ? 372  GLU H CD  1 
ATOM   7605  O OE1 . GLU K  2 56  ? 37.599  130.563 12.422  1.00 65.49  ? 372  GLU H OE1 1 
ATOM   7606  O OE2 . GLU K  2 56  ? 36.884  132.511 13.143  1.00 63.57  ? 372  GLU H OE2 1 
ATOM   7607  N N   . VAL K  2 57  ? 33.791  127.204 14.818  1.00 39.32  ? 373  VAL H N   1 
ATOM   7608  C CA  . VAL K  2 57  ? 33.296  126.042 14.102  1.00 40.65  ? 373  VAL H CA  1 
ATOM   7609  C C   . VAL K  2 57  ? 31.802  125.969 14.326  1.00 44.93  ? 373  VAL H C   1 
ATOM   7610  O O   . VAL K  2 57  ? 31.036  125.730 13.394  1.00 48.15  ? 373  VAL H O   1 
ATOM   7611  C CB  . VAL K  2 57  ? 33.948  124.746 14.591  1.00 39.65  ? 373  VAL H CB  1 
ATOM   7612  C CG1 . VAL K  2 57  ? 33.488  123.588 13.716  1.00 39.71  ? 373  VAL H CG1 1 
ATOM   7613  C CG2 . VAL K  2 57  ? 35.461  124.871 14.558  1.00 40.95  ? 373  VAL H CG2 1 
ATOM   7614  N N   . ASN K  2 58  ? 31.388  126.173 15.570  1.00 45.95  ? 374  ASN H N   1 
ATOM   7615  C CA  . ASN K  2 58  ? 29.974  126.162 15.898  1.00 46.70  ? 374  ASN H CA  1 
ATOM   7616  C C   . ASN K  2 58  ? 29.207  127.174 15.062  1.00 49.69  ? 374  ASN H C   1 
ATOM   7617  O O   . ASN K  2 58  ? 28.138  126.876 14.526  1.00 48.24  ? 374  ASN H O   1 
ATOM   7618  C CB  . ASN K  2 58  ? 29.759  126.468 17.370  1.00 45.14  ? 374  ASN H CB  1 
ATOM   7619  C CG  . ASN K  2 58  ? 29.921  125.239 18.237  1.00 53.54  ? 374  ASN H CG  1 
ATOM   7620  O OD1 . ASN K  2 58  ? 29.820  124.110 17.757  1.00 53.75  ? 374  ASN H OD1 1 
ATOM   7621  N ND2 . ASN K  2 58  ? 30.150  125.447 19.519  1.00 52.29  ? 374  ASN H ND2 1 
ATOM   7622  N N   . TYR K  2 59  ? 29.756  128.375 14.945  1.00 50.64  ? 375  TYR H N   1 
ATOM   7623  C CA  . TYR K  2 59  ? 29.107  129.404 14.157  1.00 56.50  ? 375  TYR H CA  1 
ATOM   7624  C C   . TYR K  2 59  ? 28.917  128.879 12.733  1.00 54.44  ? 375  TYR H C   1 
ATOM   7625  O O   . TYR K  2 59  ? 27.789  128.686 12.264  1.00 57.10  ? 375  TYR H O   1 
ATOM   7626  C CB  . TYR K  2 59  ? 29.975  130.668 14.146  1.00 62.84  ? 375  TYR H CB  1 
ATOM   7627  C CG  . TYR K  2 59  ? 29.366  131.868 13.443  1.00 66.77  ? 375  TYR H CG  1 
ATOM   7628  C CD1 . TYR K  2 59  ? 28.940  131.791 12.114  1.00 69.50  ? 375  TYR H CD1 1 
ATOM   7629  C CD2 . TYR K  2 59  ? 29.227  133.079 14.104  1.00 66.68  ? 375  TYR H CD2 1 
ATOM   7630  C CE1 . TYR K  2 59  ? 28.391  132.884 11.469  1.00 68.45  ? 375  TYR H CE1 1 
ATOM   7631  C CE2 . TYR K  2 59  ? 28.683  134.181 13.465  1.00 73.50  ? 375  TYR H CE2 1 
ATOM   7632  C CZ  . TYR K  2 59  ? 28.263  134.076 12.148  1.00 72.81  ? 375  TYR H CZ  1 
ATOM   7633  O OH  . TYR K  2 59  ? 27.702  135.161 11.517  1.00 79.93  ? 375  TYR H OH  1 
ATOM   7634  N N   . GLU K  2 60  ? 30.036  128.641 12.063  1.00 48.39  ? 376  GLU H N   1 
ATOM   7635  C CA  . GLU K  2 60  ? 30.044  128.165 10.693  1.00 48.55  ? 376  GLU H CA  1 
ATOM   7636  C C   . GLU K  2 60  ? 29.136  126.980 10.379  1.00 45.97  ? 376  GLU H C   1 
ATOM   7637  O O   . GLU K  2 60  ? 28.353  127.020 9.437   1.00 45.73  ? 376  GLU H O   1 
ATOM   7638  C CB  . GLU K  2 60  ? 31.472  127.819 10.292  1.00 50.18  ? 376  GLU H CB  1 
ATOM   7639  C CG  . GLU K  2 60  ? 32.416  129.003 10.256  1.00 55.60  ? 376  GLU H CG  1 
ATOM   7640  C CD  . GLU K  2 60  ? 32.033  130.026 9.214   1.00 58.36  ? 376  GLU H CD  1 
ATOM   7641  O OE1 . GLU K  2 60  ? 31.672  129.631 8.084   1.00 65.48  ? 376  GLU H OE1 1 
ATOM   7642  O OE2 . GLU K  2 60  ? 32.104  131.232 9.516   1.00 66.84  ? 376  GLU H OE2 1 
ATOM   7643  N N   . VAL K  2 61  ? 29.241  125.917 11.156  1.00 41.55  ? 377  VAL H N   1 
ATOM   7644  C CA  . VAL K  2 61  ? 28.426  124.754 10.883  1.00 45.98  ? 377  VAL H CA  1 
ATOM   7645  C C   . VAL K  2 61  ? 26.950  125.053 11.072  1.00 45.86  ? 377  VAL H C   1 
ATOM   7646  O O   . VAL K  2 61  ? 26.098  124.325 10.554  1.00 50.19  ? 377  VAL H O   1 
ATOM   7647  C CB  . VAL K  2 61  ? 28.842  123.577 11.784  1.00 47.58  ? 377  VAL H CB  1 
ATOM   7648  C CG1 . VAL K  2 61  ? 28.099  122.312 11.377  1.00 43.87  ? 377  VAL H CG1 1 
ATOM   7649  C CG2 . VAL K  2 61  ? 30.345  123.378 11.697  1.00 44.05  ? 377  VAL H CG2 1 
ATOM   7650  N N   . SER K  2 62  ? 26.645  126.117 11.814  1.00 41.01  ? 378  SER H N   1 
ATOM   7651  C CA  . SER K  2 62  ? 25.251  126.482 12.065  1.00 43.12  ? 378  SER H CA  1 
ATOM   7652  C C   . SER K  2 62  ? 24.602  127.092 10.847  1.00 45.92  ? 378  SER H C   1 
ATOM   7653  O O   . SER K  2 62  ? 23.417  126.894 10.610  1.00 49.78  ? 378  SER H O   1 
ATOM   7654  C CB  . SER K  2 62  ? 25.147  127.449 13.222  1.00 37.98  ? 378  SER H CB  1 
ATOM   7655  O OG  . SER K  2 62  ? 25.515  126.794 14.407  1.00 38.78  ? 378  SER H OG  1 
ATOM   7656  N N   . ASN K  2 63  ? 25.385  127.830 10.071  1.00 46.84  ? 379  ASN H N   1 
ATOM   7657  C CA  . ASN K  2 63  ? 24.877  128.462 8.874   1.00 50.54  ? 379  ASN H CA  1 
ATOM   7658  C C   . ASN K  2 63  ? 24.684  127.453 7.754   1.00 54.63  ? 379  ASN H C   1 
ATOM   7659  O O   . ASN K  2 63  ? 23.976  127.725 6.787   1.00 56.12  ? 379  ASN H O   1 
ATOM   7660  C CB  . ASN K  2 63  ? 25.822  129.567 8.439   1.00 52.18  ? 379  ASN H CB  1 
ATOM   7661  C CG  . ASN K  2 63  ? 25.858  130.697 9.421   1.00 59.76  ? 379  ASN H CG  1 
ATOM   7662  O OD1 . ASN K  2 63  ? 25.991  130.484 10.631  1.00 64.38  ? 379  ASN H OD1 1 
ATOM   7663  N ND2 . ASN K  2 63  ? 25.738  131.917 8.914   1.00 73.78  ? 379  ASN H ND2 1 
ATOM   7664  N N   . LYS K  2 64  ? 25.310  126.286 7.876   1.00 56.11  ? 381  LYS H N   1 
ATOM   7665  C CA  . LYS K  2 64  ? 25.157  125.242 6.858   1.00 52.64  ? 381  LYS H CA  1 
ATOM   7666  C C   . LYS K  2 64  ? 23.787  124.586 6.997   1.00 49.43  ? 381  LYS H C   1 
ATOM   7667  O O   . LYS K  2 64  ? 23.166  124.623 8.069   1.00 47.46  ? 381  LYS H O   1 
ATOM   7668  C CB  . LYS K  2 64  ? 26.237  124.163 7.008   1.00 53.88  ? 381  LYS H CB  1 
ATOM   7669  C CG  . LYS K  2 64  ? 27.652  124.615 6.715   1.00 65.02  ? 381  LYS H CG  1 
ATOM   7670  C CD  . LYS K  2 64  ? 28.602  123.432 6.636   1.00 68.61  ? 381  LYS H CD  1 
ATOM   7671  C CE  . LYS K  2 64  ? 29.996  123.851 6.201   1.00 69.45  ? 381  LYS H CE  1 
ATOM   7672  N NZ  . LYS K  2 64  ? 29.955  124.506 4.862   1.00 73.27  ? 381  LYS H NZ  1 
ATOM   7673  N N   . ASP K  2 65  A 23.311  123.989 5.912   1.00 49.59  ? 381  ASP H N   1 
ATOM   7674  C CA  . ASP K  2 65  A 22.023  123.305 5.943   1.00 62.01  ? 381  ASP H CA  1 
ATOM   7675  C C   . ASP K  2 65  A 21.754  122.348 4.784   1.00 59.35  ? 381  ASP H C   1 
ATOM   7676  O O   . ASP K  2 65  A 22.189  122.540 3.640   1.00 53.85  ? 381  ASP H O   1 
ATOM   7677  C CB  . ASP K  2 65  A 20.861  124.303 6.053   1.00 70.15  ? 381  ASP H CB  1 
ATOM   7678  C CG  . ASP K  2 65  A 20.855  125.321 4.928   1.00 76.22  ? 381  ASP H CG  1 
ATOM   7679  O OD1 . ASP K  2 65  A 20.819  124.918 3.737   1.00 72.06  ? 381  ASP H OD1 1 
ATOM   7680  O OD2 . ASP K  2 65  A 20.884  126.531 5.249   1.00 83.15  ? 381  ASP H OD2 1 
ATOM   7681  N N   . ASP K  2 66  B 20.959  121.344 5.113   1.00 55.48  ? 381  ASP H N   1 
ATOM   7682  C CA  . ASP K  2 66  B 20.576  120.288 4.216   1.00 50.66  ? 381  ASP H CA  1 
ATOM   7683  C C   . ASP K  2 66  B 19.144  120.515 3.767   1.00 49.08  ? 381  ASP H C   1 
ATOM   7684  O O   . ASP K  2 66  B 18.233  119.821 4.205   1.00 53.35  ? 381  ASP H O   1 
ATOM   7685  C CB  . ASP K  2 66  B 20.727  118.984 4.980   1.00 44.37  ? 381  ASP H CB  1 
ATOM   7686  C CG  . ASP K  2 66  B 19.961  117.890 4.385   1.00 54.33  ? 381  ASP H CG  1 
ATOM   7687  O OD1 . ASP K  2 66  B 20.071  117.705 3.149   1.00 67.51  ? 381  ASP H OD1 1 
ATOM   7688  O OD2 . ASP K  2 66  B 19.247  117.218 5.160   1.00 52.84  ? 381  ASP H OD2 1 
ATOM   7689  N N   . LYS K  2 67  C 18.959  121.494 2.882   1.00 52.16  ? 381  LYS H N   1 
ATOM   7690  C CA  . LYS K  2 67  C 17.633  121.870 2.362   1.00 47.95  ? 381  LYS H CA  1 
ATOM   7691  C C   . LYS K  2 67  C 16.676  120.679 2.151   1.00 49.80  ? 381  LYS H C   1 
ATOM   7692  O O   . LYS K  2 67  C 15.492  120.728 2.532   1.00 39.27  ? 381  LYS H O   1 
ATOM   7693  C CB  . LYS K  2 67  C 17.761  122.611 1.022   1.00 43.50  ? 381  LYS H CB  1 
ATOM   7694  C CG  . LYS K  2 67  C 18.950  123.566 0.839   1.00 53.87  ? 381  LYS H CG  1 
ATOM   7695  C CD  . LYS K  2 67  C 18.592  125.030 1.077   1.00 45.40  ? 381  LYS H CD  1 
ATOM   7696  C CE  . LYS K  2 67  C 19.372  125.946 0.138   1.00 49.52  ? 381  LYS H CE  1 
ATOM   7697  N NZ  . LYS K  2 67  C 19.423  127.366 0.631   1.00 54.30  ? 381  LYS H NZ  1 
ATOM   7698  N N   . LYS K  2 68  D 17.187  119.613 1.540   1.00 46.75  ? 381  LYS H N   1 
ATOM   7699  C CA  . LYS K  2 68  D 16.353  118.455 1.268   1.00 45.22  ? 381  LYS H CA  1 
ATOM   7700  C C   . LYS K  2 68  D 15.431  118.106 2.419   1.00 47.09  ? 381  LYS H C   1 
ATOM   7701  O O   . LYS K  2 68  D 14.215  118.001 2.238   1.00 43.40  ? 381  LYS H O   1 
ATOM   7702  C CB  . LYS K  2 68  D 17.209  117.242 0.941   1.00 40.52  ? 381  LYS H CB  1 
ATOM   7703  C CG  . LYS K  2 68  D 16.425  116.140 0.277   1.00 39.07  ? 381  LYS H CG  1 
ATOM   7704  C CD  . LYS K  2 68  D 17.361  115.114 -0.338  1.00 59.49  ? 381  LYS H CD  1 
ATOM   7705  C CE  . LYS K  2 68  D 16.616  114.095 -1.191  1.00 74.09  ? 381  LYS H CE  1 
ATOM   7706  N NZ  . LYS K  2 68  D 17.500  112.938 -1.573  1.00 82.57  ? 381  LYS H NZ  1 
ATOM   7707  N N   . ASN K  2 69  E 16.022  117.932 3.602   1.00 48.82  ? 381  ASN H N   1 
ATOM   7708  C CA  . ASN K  2 69  E 15.275  117.555 4.800   1.00 47.62  ? 381  ASN H CA  1 
ATOM   7709  C C   . ASN K  2 69  E 15.124  118.716 5.748   1.00 48.38  ? 381  ASN H C   1 
ATOM   7710  O O   . ASN K  2 69  E 14.754  118.531 6.909   1.00 41.87  ? 381  ASN H O   1 
ATOM   7711  C CB  . ASN K  2 69  E 15.982  116.428 5.537   1.00 45.67  ? 381  ASN H CB  1 
ATOM   7712  C CG  . ASN K  2 69  E 16.441  115.329 4.614   1.00 45.67  ? 381  ASN H CG  1 
ATOM   7713  O OD1 . ASN K  2 69  E 15.636  114.607 4.029   1.00 48.91  ? 381  ASN H OD1 1 
ATOM   7714  N ND2 . ASN K  2 69  E 17.747  115.196 4.476   1.00 46.85  ? 381  ASN H ND2 1 
ATOM   7715  N N   . MET K  2 70  ? 15.409  119.913 5.254   1.00 48.63  ? 382  MET H N   1 
ATOM   7716  C CA  . MET K  2 70  ? 15.293  121.095 6.081   1.00 53.07  ? 382  MET H CA  1 
ATOM   7717  C C   . MET K  2 70  ? 16.030  120.821 7.362   1.00 52.57  ? 382  MET H C   1 
ATOM   7718  O O   . MET K  2 70  ? 15.552  121.185 8.444   1.00 52.21  ? 382  MET H O   1 
ATOM   7719  C CB  . MET K  2 70  ? 13.826  121.402 6.397   1.00 57.95  ? 382  MET H CB  1 
ATOM   7720  C CG  . MET K  2 70  ? 13.088  122.176 5.310   1.00 73.77  ? 382  MET H CG  1 
ATOM   7721  S SD  . MET K  2 70  ? 11.392  122.571 5.779   1.00 84.56  ? 382  MET H SD  1 
ATOM   7722  C CE  . MET K  2 70  ? 10.553  121.034 5.225   1.00 81.24  ? 382  MET H CE  1 
ATOM   7723  N N   . GLY K  2 71  ? 17.196  120.182 7.235   1.00 55.89  ? 383  GLY H N   1 
ATOM   7724  C CA  . GLY K  2 71  ? 17.978  119.857 8.415   1.00 54.81  ? 383  GLY H CA  1 
ATOM   7725  C C   . GLY K  2 71  ? 19.211  120.700 8.665   1.00 53.51  ? 383  GLY H C   1 
ATOM   7726  O O   . GLY K  2 71  ? 19.720  121.382 7.774   1.00 50.35  ? 383  GLY H O   1 
ATOM   7727  N N   . LYS K  2 72  ? 19.698  120.648 9.898   1.00 48.39  ? 384  LYS H N   1 
ATOM   7728  C CA  . LYS K  2 72  ? 20.879  121.395 10.268  1.00 45.96  ? 384  LYS H CA  1 
ATOM   7729  C C   . LYS K  2 72  ? 21.767  120.576 11.178  1.00 45.33  ? 384  LYS H C   1 
ATOM   7730  O O   . LYS K  2 72  ? 21.411  119.456 11.536  1.00 50.23  ? 384  LYS H O   1 
ATOM   7731  C CB  . LYS K  2 72  ? 20.478  122.693 10.942  1.00 43.08  ? 384  LYS H CB  1 
ATOM   7732  C CG  . LYS K  2 72  ? 19.626  123.563 10.053  1.00 45.96  ? 384  LYS H CG  1 
ATOM   7733  C CD  . LYS K  2 72  ? 19.427  124.936 10.662  1.00 37.92  ? 384  LYS H CD  1 
ATOM   7734  C CE  . LYS K  2 72  ? 20.669  125.776 10.508  1.00 44.18  ? 384  LYS H CE  1 
ATOM   7735  N NZ  . LYS K  2 72  ? 20.928  126.128 9.079   1.00 38.37  ? 384  LYS H NZ  1 
ATOM   7736  N N   . GLN K  2 73  ? 22.922  121.132 11.546  1.00 43.22  ? 385  GLN H N   1 
ATOM   7737  C CA  . GLN K  2 73  ? 23.872  120.429 12.402  1.00 37.90  ? 385  GLN H CA  1 
ATOM   7738  C C   . GLN K  2 73  ? 24.393  121.324 13.509  1.00 38.61  ? 385  GLN H C   1 
ATOM   7739  O O   . GLN K  2 73  ? 24.813  122.440 13.240  1.00 39.34  ? 385  GLN H O   1 
ATOM   7740  C CB  . GLN K  2 73  ? 25.048  119.929 11.560  1.00 31.44  ? 385  GLN H CB  1 
ATOM   7741  C CG  . GLN K  2 73  ? 26.052  119.092 12.319  1.00 37.57  ? 385  GLN H CG  1 
ATOM   7742  C CD  . GLN K  2 73  ? 27.087  118.447 11.424  1.00 41.48  ? 385  GLN H CD  1 
ATOM   7743  O OE1 . GLN K  2 73  ? 26.752  117.761 10.471  1.00 52.58  ? 385  GLN H OE1 1 
ATOM   7744  N NE2 . GLN K  2 73  ? 28.352  118.657 11.736  1.00 46.55  ? 385  GLN H NE2 1 
ATOM   7745  N N   . MET K  2 74  ? 24.367  120.837 14.751  1.00 38.86  ? 386  MET H N   1 
ATOM   7746  C CA  . MET K  2 74  ? 24.874  121.614 15.886  1.00 33.23  ? 386  MET H CA  1 
ATOM   7747  C C   . MET K  2 74  ? 25.997  120.893 16.628  1.00 29.37  ? 386  MET H C   1 
ATOM   7748  O O   . MET K  2 74  ? 25.744  119.940 17.349  1.00 35.66  ? 386  MET H O   1 
ATOM   7749  C CB  . MET K  2 74  ? 23.747  121.916 16.867  1.00 32.47  ? 386  MET H CB  1 
ATOM   7750  C CG  . MET K  2 74  ? 24.149  122.797 18.025  1.00 29.10  ? 386  MET H CG  1 
ATOM   7751  S SD  . MET K  2 74  ? 24.569  124.467 17.513  1.00 41.24  ? 386  MET H SD  1 
ATOM   7752  C CE  . MET K  2 74  ? 26.304  124.524 17.693  1.00 41.75  ? 386  MET H CE  1 
ATOM   7753  N N   . PRO K  2 75  ? 27.252  121.332 16.442  1.00 30.00  ? 387  PRO H N   1 
ATOM   7754  C CA  . PRO K  2 75  ? 28.453  120.774 17.069  1.00 31.61  ? 387  PRO H CA  1 
ATOM   7755  C C   . PRO K  2 75  ? 28.419  121.063 18.567  1.00 39.12  ? 387  PRO H C   1 
ATOM   7756  O O   . PRO K  2 75  ? 27.848  122.073 18.991  1.00 36.08  ? 387  PRO H O   1 
ATOM   7757  C CB  . PRO K  2 75  ? 29.583  121.513 16.369  1.00 29.85  ? 387  PRO H CB  1 
ATOM   7758  C CG  . PRO K  2 75  ? 29.015  121.814 15.046  1.00 38.35  ? 387  PRO H CG  1 
ATOM   7759  C CD  . PRO K  2 75  ? 27.631  122.275 15.385  1.00 36.53  ? 387  PRO H CD  1 
ATOM   7760  N N   . GLN K  2 76  ? 29.047  120.206 19.373  1.00 40.17  ? 388  GLN H N   1 
ATOM   7761  C CA  . GLN K  2 76  ? 28.998  120.397 20.818  1.00 34.82  ? 388  GLN H CA  1 
ATOM   7762  C C   . GLN K  2 76  ? 30.213  119.985 21.632  1.00 36.54  ? 388  GLN H C   1 
ATOM   7763  O O   . GLN K  2 76  ? 30.310  118.847 22.129  1.00 40.11  ? 388  GLN H O   1 
ATOM   7764  C CB  . GLN K  2 76  ? 27.797  119.660 21.369  1.00 30.63  ? 388  GLN H CB  1 
ATOM   7765  C CG  . GLN K  2 76  ? 27.506  119.950 22.797  1.00 32.24  ? 388  GLN H CG  1 
ATOM   7766  C CD  . GLN K  2 76  ? 26.609  118.910 23.387  1.00 33.98  ? 388  GLN H CD  1 
ATOM   7767  O OE1 . GLN K  2 76  ? 25.559  118.579 22.851  1.00 34.78  ? 388  GLN H OE1 1 
ATOM   7768  N NE2 . GLN K  2 76  ? 27.020  118.378 24.502  1.00 52.87  ? 388  GLN H NE2 1 
ATOM   7769  N N   . PRO K  2 77  ? 31.155  120.909 21.797  1.00 31.65  ? 389  PRO H N   1 
ATOM   7770  C CA  . PRO K  2 77  ? 32.353  120.604 22.577  1.00 31.20  ? 389  PRO H CA  1 
ATOM   7771  C C   . PRO K  2 77  ? 32.098  120.540 24.094  1.00 32.93  ? 389  PRO H C   1 
ATOM   7772  O O   . PRO K  2 77  ? 31.170  121.159 24.623  1.00 29.10  ? 389  PRO H O   1 
ATOM   7773  C CB  . PRO K  2 77  ? 33.327  121.708 22.174  1.00 25.39  ? 389  PRO H CB  1 
ATOM   7774  C CG  . PRO K  2 77  ? 32.461  122.819 21.752  1.00 30.02  ? 389  PRO H CG  1 
ATOM   7775  C CD  . PRO K  2 77  ? 31.308  122.164 21.047  1.00 34.01  ? 389  PRO H CD  1 
ATOM   7776  N N   . THR K  2 78  ? 32.903  119.733 24.771  1.00 30.51  ? 390  THR H N   1 
ATOM   7777  C CA  . THR K  2 78  ? 32.816  119.551 26.209  1.00 31.36  ? 390  THR H CA  1 
ATOM   7778  C C   . THR K  2 78  ? 34.246  119.516 26.682  1.00 44.81  ? 390  THR H C   1 
ATOM   7779  O O   . THR K  2 78  ? 35.099  118.956 25.999  1.00 57.37  ? 390  THR H O   1 
ATOM   7780  C CB  . THR K  2 78  ? 32.210  118.256 26.570  1.00 16.13  ? 390  THR H CB  1 
ATOM   7781  O OG1 . THR K  2 78  ? 30.971  118.114 25.886  1.00 30.98  ? 390  THR H OG1 1 
ATOM   7782  C CG2 . THR K  2 78  ? 31.979  118.208 28.051  1.00 21.60  ? 390  THR H CG2 1 
ATOM   7783  N N   . PHE K  2 79  ? 34.543  120.083 27.843  1.00 47.02  ? 392  PHE H N   1 
ATOM   7784  C CA  . PHE K  2 79  ? 35.933  120.077 28.235  1.00 48.30  ? 392  PHE H CA  1 
ATOM   7785  C C   . PHE K  2 79  ? 36.228  120.174 29.711  1.00 48.06  ? 392  PHE H C   1 
ATOM   7786  O O   . PHE K  2 79  ? 35.421  120.680 30.493  1.00 48.17  ? 392  PHE H O   1 
ATOM   7787  C CB  . PHE K  2 79  ? 36.653  121.207 27.499  1.00 47.21  ? 392  PHE H CB  1 
ATOM   7788  C CG  . PHE K  2 79  ? 36.232  122.585 27.932  1.00 53.68  ? 392  PHE H CG  1 
ATOM   7789  C CD1 . PHE K  2 79  ? 35.165  123.231 27.318  1.00 64.16  ? 392  PHE H CD1 1 
ATOM   7790  C CD2 . PHE K  2 79  ? 36.931  123.261 28.924  1.00 59.25  ? 392  PHE H CD2 1 
ATOM   7791  C CE1 . PHE K  2 79  ? 34.802  124.545 27.684  1.00 69.96  ? 392  PHE H CE1 1 
ATOM   7792  C CE2 . PHE K  2 79  ? 36.578  124.568 29.296  1.00 62.78  ? 392  PHE H CE2 1 
ATOM   7793  C CZ  . PHE K  2 79  ? 35.512  125.211 28.673  1.00 63.87  ? 392  PHE H CZ  1 
ATOM   7794  N N   . THR K  2 80  ? 37.393  119.652 30.083  1.00 42.69  ? 393  THR H N   1 
ATOM   7795  C CA  . THR K  2 80  ? 37.851  119.731 31.452  1.00 34.15  ? 393  THR H CA  1 
ATOM   7796  C C   . THR K  2 80  ? 39.217  120.399 31.417  1.00 37.49  ? 393  THR H C   1 
ATOM   7797  O O   . THR K  2 80  ? 39.960  120.332 32.380  1.00 46.72  ? 393  THR H O   1 
ATOM   7798  C CB  . THR K  2 80  ? 37.947  118.347 32.138  1.00 32.87  ? 393  THR H CB  1 
ATOM   7799  O OG1 . THR K  2 80  ? 38.774  117.479 31.366  1.00 43.46  ? 393  THR H OG1 1 
ATOM   7800  C CG2 . THR K  2 80  ? 36.575  117.710 32.288  1.00 12.86  ? 393  THR H CG2 1 
ATOM   7801  N N   . LEU K  2 81  ? 39.538  121.059 30.302  1.00 39.27  ? 394  LEU H N   1 
ATOM   7802  C CA  . LEU K  2 81  ? 40.821  121.761 30.161  1.00 47.11  ? 394  LEU H CA  1 
ATOM   7803  C C   . LEU K  2 81  ? 41.003  122.761 31.306  1.00 52.85  ? 394  LEU H C   1 
ATOM   7804  O O   . LEU K  2 81  ? 40.069  123.481 31.661  1.00 63.06  ? 394  LEU H O   1 
ATOM   7805  C CB  . LEU K  2 81  ? 40.879  122.521 28.830  1.00 40.72  ? 394  LEU H CB  1 
ATOM   7806  C CG  . LEU K  2 81  ? 40.676  121.732 27.529  1.00 54.36  ? 394  LEU H CG  1 
ATOM   7807  C CD1 . LEU K  2 81  ? 40.882  122.663 26.339  1.00 40.40  ? 394  LEU H CD1 1 
ATOM   7808  C CD2 . LEU K  2 81  ? 41.668  120.566 27.440  1.00 58.26  ? 394  LEU H CD2 1 
ATOM   7809  N N   . ARG K  2 82  ? 42.197  122.818 31.883  1.00 51.85  ? 395  ARG H N   1 
ATOM   7810  C CA  . ARG K  2 82  ? 42.449  123.741 32.988  1.00 46.97  ? 395  ARG H CA  1 
ATOM   7811  C C   . ARG K  2 82  ? 43.301  124.918 32.549  1.00 47.84  ? 395  ARG H C   1 
ATOM   7812  O O   . ARG K  2 82  ? 43.636  125.788 33.349  1.00 54.76  ? 395  ARG H O   1 
ATOM   7813  C CB  . ARG K  2 82  ? 43.127  123.024 34.161  1.00 33.97  ? 395  ARG H CB  1 
ATOM   7814  C CG  . ARG K  2 82  ? 42.333  121.843 34.705  1.00 49.57  ? 395  ARG H CG  1 
ATOM   7815  C CD  . ARG K  2 82  ? 43.132  121.025 35.712  1.00 49.96  ? 395  ARG H CD  1 
ATOM   7816  N NE  . ARG K  2 82  ? 44.458  120.696 35.192  1.00 64.85  ? 395  ARG H NE  1 
ATOM   7817  C CZ  . ARG K  2 82  ? 45.584  121.311 35.551  1.00 70.76  ? 395  ARG H CZ  1 
ATOM   7818  N NH1 . ARG K  2 82  ? 45.559  122.293 36.451  1.00 78.06  ? 395  ARG H NH1 1 
ATOM   7819  N NH2 . ARG K  2 82  ? 46.735  120.961 34.993  1.00 72.22  ? 395  ARG H NH2 1 
ATOM   7820  N N   . LYS K  2 83  ? 43.652  124.952 31.276  1.00 44.79  ? 396  LYS H N   1 
ATOM   7821  C CA  . LYS K  2 83  ? 44.458  126.057 30.773  1.00 50.83  ? 396  LYS H CA  1 
ATOM   7822  C C   . LYS K  2 83  ? 43.977  126.304 29.367  1.00 52.26  ? 396  LYS H C   1 
ATOM   7823  O O   . LYS K  2 83  ? 43.137  125.565 28.847  1.00 58.86  ? 396  LYS H O   1 
ATOM   7824  C CB  . LYS K  2 83  ? 45.951  125.693 30.694  1.00 58.72  ? 396  LYS H CB  1 
ATOM   7825  C CG  . LYS K  2 83  ? 46.618  125.270 31.986  1.00 60.56  ? 396  LYS H CG  1 
ATOM   7826  C CD  . LYS K  2 83  ? 48.125  125.111 31.795  1.00 57.96  ? 396  LYS H CD  1 
ATOM   7827  C CE  . LYS K  2 83  ? 48.794  124.669 33.099  1.00 65.15  ? 396  LYS H CE  1 
ATOM   7828  N NZ  . LYS K  2 83  ? 50.281  124.818 33.067  1.00 60.08  ? 396  LYS H NZ  1 
ATOM   7829  N N   . LYS K  2 84  ? 44.514  127.340 28.747  1.00 44.24  ? 397  LYS H N   1 
ATOM   7830  C CA  . LYS K  2 84  ? 44.154  127.622 27.393  1.00 49.49  ? 397  LYS H CA  1 
ATOM   7831  C C   . LYS K  2 84  ? 44.963  126.660 26.547  1.00 56.50  ? 397  LYS H C   1 
ATOM   7832  O O   . LYS K  2 84  ? 46.153  126.510 26.755  1.00 65.80  ? 397  LYS H O   1 
ATOM   7833  C CB  . LYS K  2 84  ? 44.502  129.065 27.043  1.00 51.40  ? 397  LYS H CB  1 
ATOM   7834  C CG  . LYS K  2 84  ? 43.460  130.072 27.507  1.00 60.90  ? 397  LYS H CG  1 
ATOM   7835  C CD  . LYS K  2 84  ? 43.373  131.230 26.540  1.00 67.53  ? 397  LYS H CD  1 
ATOM   7836  C CE  . LYS K  2 84  ? 42.189  132.114 26.854  1.00 69.04  ? 397  LYS H CE  1 
ATOM   7837  N NZ  . LYS K  2 84  ? 41.947  133.066 25.734  1.00 74.03  ? 397  LYS H NZ  1 
ATOM   7838  N N   . LEU K  2 85  ? 44.321  125.975 25.617  1.00 58.84  ? 398  LEU H N   1 
ATOM   7839  C CA  . LEU K  2 85  ? 45.045  125.064 24.756  1.00 55.49  ? 398  LEU H CA  1 
ATOM   7840  C C   . LEU K  2 85  ? 45.316  125.772 23.444  1.00 57.17  ? 398  LEU H C   1 
ATOM   7841  O O   . LEU K  2 85  ? 44.403  126.054 22.689  1.00 62.95  ? 398  LEU H O   1 
ATOM   7842  C CB  . LEU K  2 85  ? 44.221  123.811 24.495  1.00 58.94  ? 398  LEU H CB  1 
ATOM   7843  C CG  . LEU K  2 85  ? 44.774  122.878 23.412  1.00 58.26  ? 398  LEU H CG  1 
ATOM   7844  C CD1 . LEU K  2 85  ? 46.178  122.447 23.788  1.00 62.25  ? 398  LEU H CD1 1 
ATOM   7845  C CD2 . LEU K  2 85  ? 43.868  121.657 23.268  1.00 56.42  ? 398  LEU H CD2 1 
ATOM   7846  N N   . VAL K  2 86  ? 46.572  126.065 23.169  1.00 59.76  ? 399  VAL H N   1 
ATOM   7847  C CA  . VAL K  2 86  ? 46.911  126.724 21.921  1.00 60.14  ? 399  VAL H CA  1 
ATOM   7848  C C   . VAL K  2 86  ? 47.935  125.890 21.147  1.00 60.42  ? 399  VAL H C   1 
ATOM   7849  O O   . VAL K  2 86  ? 48.800  125.260 21.748  1.00 58.64  ? 399  VAL H O   1 
ATOM   7850  C CB  . VAL K  2 86  ? 47.470  128.107 22.189  1.00 63.23  ? 399  VAL H CB  1 
ATOM   7851  C CG1 . VAL K  2 86  ? 48.518  128.015 23.279  1.00 59.90  ? 399  VAL H CG1 1 
ATOM   7852  C CG2 . VAL K  2 86  ? 48.066  128.687 20.904  1.00 62.54  ? 399  VAL H CG2 1 
ATOM   7853  N N   . PHE K  2 87  ? 47.820  125.897 19.816  1.00 61.03  ? 400  PHE H N   1 
ATOM   7854  C CA  . PHE K  2 87  ? 48.695  125.128 18.927  1.00 57.74  ? 400  PHE H CA  1 
ATOM   7855  C C   . PHE K  2 87  ? 49.552  126.025 18.078  1.00 64.12  ? 400  PHE H C   1 
ATOM   7856  O O   . PHE K  2 87  ? 49.231  126.290 16.921  1.00 65.89  ? 400  PHE H O   1 
ATOM   7857  C CB  . PHE K  2 87  ? 47.871  124.243 17.997  1.00 50.13  ? 400  PHE H CB  1 
ATOM   7858  C CG  . PHE K  2 87  ? 47.130  123.160 18.704  1.00 48.53  ? 400  PHE H CG  1 
ATOM   7859  C CD1 . PHE K  2 87  ? 47.624  122.621 19.885  1.00 46.88  ? 400  PHE H CD1 1 
ATOM   7860  C CD2 . PHE K  2 87  ? 45.937  122.679 18.195  1.00 49.78  ? 400  PHE H CD2 1 
ATOM   7861  C CE1 . PHE K  2 87  ? 46.940  121.618 20.550  1.00 54.17  ? 400  PHE H CE1 1 
ATOM   7862  C CE2 . PHE K  2 87  ? 45.245  121.678 18.853  1.00 59.28  ? 400  PHE H CE2 1 
ATOM   7863  C CZ  . PHE K  2 87  ? 45.749  121.143 20.035  1.00 56.72  ? 400  PHE H CZ  1 
ATOM   7864  N N   . PRO K  2 88  ? 50.673  126.493 18.638  1.00 69.80  ? 401  PRO H N   1 
ATOM   7865  C CA  . PRO K  2 88  ? 51.586  127.375 17.911  1.00 71.73  ? 401  PRO H CA  1 
ATOM   7866  C C   . PRO K  2 88  ? 52.062  126.743 16.622  1.00 76.47  ? 401  PRO H C   1 
ATOM   7867  O O   . PRO K  2 88  ? 52.157  125.522 16.517  1.00 76.58  ? 401  PRO H O   1 
ATOM   7868  C CB  . PRO K  2 88  ? 52.704  127.609 18.913  1.00 65.97  ? 401  PRO H CB  1 
ATOM   7869  C CG  . PRO K  2 88  ? 52.659  126.375 19.760  1.00 68.89  ? 401  PRO H CG  1 
ATOM   7870  C CD  . PRO K  2 88  ? 51.214  126.151 19.963  1.00 64.45  ? 401  PRO H CD  1 
ATOM   7871  N N   . SER K  2 89  ? 52.351  127.587 15.641  1.00 85.44  ? 402  SER H N   1 
ATOM   7872  C CA  . SER K  2 89  ? 52.798  127.131 14.331  1.00 93.99  ? 402  SER H CA  1 
ATOM   7873  C C   . SER K  2 89  ? 54.202  127.651 13.974  1.00 98.19  ? 402  SER H C   1 
ATOM   7874  O O   . SER K  2 89  ? 55.113  126.815 13.779  1.00 100.00 ? 402  SER H O   1 
ATOM   7875  C CB  . SER K  2 89  ? 51.781  127.585 13.276  1.00 98.07  ? 402  SER H CB  1 
ATOM   7876  O OG  . SER K  2 89  ? 52.139  127.134 11.983  1.00 100.00 ? 402  SER H OG  1 
ATOM   7877  O OXT . SER K  2 89  ? 54.379  128.889 13.886  1.00 98.79  ? 402  SER H OXT 1 
HETATM 7878  C C1  . PHQ L  3 1   ? 25.107  116.333 -0.411  1.00 64.61  ? 4400 PHQ T C1  1 
HETATM 7879  O O1  . PHQ L  3 1   ? 24.381  117.312 -0.539  1.00 78.33  ? 4400 PHQ T O1  1 
HETATM 7880  O O2  . PHQ L  3 1   ? 25.898  115.810 -1.386  1.00 66.08  ? 4400 PHQ T O2  1 
HETATM 7881  C C2  . PHQ L  3 1   ? 26.050  116.321 -2.705  1.00 45.38  ? 4400 PHQ T C2  1 
HETATM 7882  C C3  . PHQ L  3 1   ? 26.894  115.240 -3.246  1.00 24.09  ? 4400 PHQ T C3  1 
HETATM 7883  C C4  . PHQ L  3 1   ? 26.288  113.920 -3.400  1.00 19.36  ? 4400 PHQ T C4  1 
HETATM 7884  C C5  . PHQ L  3 1   ? 27.055  112.812 -3.897  1.00 26.48  ? 4400 PHQ T C5  1 
HETATM 7885  C C6  . PHQ L  3 1   ? 28.445  113.017 -4.245  1.00 33.33  ? 4400 PHQ T C6  1 
HETATM 7886  C C7  . PHQ L  3 1   ? 29.050  114.339 -4.084  1.00 29.68  ? 4400 PHQ T C7  1 
HETATM 7887  C C8  . PHQ L  3 1   ? 28.258  115.447 -3.580  1.00 12.80  ? 4400 PHQ T C8  1 
ATOM   7888  N N   . ASP L  3 2   ? 25.195  115.662 0.624   1.00 58.82  ? 4401 ASP T N   1 
ATOM   7889  C CA  . ASP L  3 2   ? 24.471  115.889 1.826   1.00 51.42  ? 4401 ASP T CA  1 
ATOM   7890  C C   . ASP L  3 2   ? 24.205  114.379 2.143   1.00 53.15  ? 4401 ASP T C   1 
ATOM   7891  O O   . ASP L  3 2   ? 23.464  113.724 1.384   1.00 60.46  ? 4401 ASP T O   1 
ATOM   7892  C CB  . ASP L  3 2   ? 25.247  116.740 2.835   1.00 42.93  ? 4401 ASP T CB  1 
ATOM   7893  C CG  . ASP L  3 2   ? 25.380  118.241 2.421   1.00 40.46  ? 4401 ASP T CG  1 
ATOM   7894  O OD1 . ASP L  3 2   ? 24.312  118.977 2.383   1.00 42.39  ? 4401 ASP T OD1 1 
ATOM   7895  O OD2 . ASP L  3 2   ? 26.534  118.771 2.099   1.00 31.71  ? 4401 ASP T OD2 1 
ATOM   7896  N N   . GLU L  3 3   ? 24.908  113.822 3.134   1.00 49.88  ? 4402 GLU T N   1 
ATOM   7897  C CA  . GLU L  3 3   ? 24.838  112.348 3.480   1.00 37.37  ? 4402 GLU T CA  1 
ATOM   7898  C C   . GLU L  3 3   ? 24.995  112.202 5.017   1.00 32.21  ? 4402 GLU T C   1 
ATOM   7899  O O   . GLU L  3 3   ? 25.814  112.902 5.638   1.00 34.80  ? 4402 GLU T O   1 
ATOM   7900  C CB  . GLU L  3 3   ? 25.956  111.580 2.710   1.00 22.35  ? 4402 GLU T CB  1 
ATOM   7901  C CG  . GLU L  3 3   ? 25.401  110.619 1.661   1.00 21.83  ? 4402 GLU T CG  1 
ATOM   7902  C CD  . GLU L  3 3   ? 26.440  109.836 0.776   1.00 39.79  ? 4402 GLU T CD  1 
ATOM   7903  O OE1 . GLU L  3 3   ? 27.427  109.164 1.311   1.00 49.60  ? 4402 GLU T OE1 1 
ATOM   7904  O OE2 . GLU L  3 3   ? 26.305  109.815 -0.523  1.00 30.42  ? 4402 GLU T OE2 1 
ATOM   7905  N N   . VAL L  3 4   ? 24.187  111.319 5.624   1.00 28.05  ? 4403 VAL T N   1 
ATOM   7906  C CA  . VAL L  3 4   ? 24.216  111.112 7.128   1.00 35.31  ? 4403 VAL T CA  1 
ATOM   7907  C C   . VAL L  3 4   ? 25.160  110.042 7.675   1.00 38.29  ? 4403 VAL T C   1 
ATOM   7908  O O   . VAL L  3 4   ? 25.729  109.322 6.885   1.00 49.96  ? 4403 VAL T O   1 
ATOM   7909  C CB  . VAL L  3 4   ? 22.805  110.839 7.626   1.00 21.39  ? 4403 VAL T CB  1 
ATOM   7910  C CG1 . VAL L  3 4   ? 21.840  111.909 7.140   1.00 25.90  ? 4403 VAL T CG1 1 
ATOM   7911  C CG2 . VAL L  3 4   ? 22.214  109.536 7.102   1.00 32.13  ? 4403 VAL T CG2 1 
HETATM 7912  N N   . ASA L  3 5   ? 25.806  110.590 8.529   1.00 35.56  ? 4404 ASA T N   1 
HETATM 7913  C CA  . ASA L  3 5   ? 26.796  109.839 9.275   1.00 30.20  ? 4404 ASA T CA  1 
HETATM 7914  C C   . ASA L  3 5   ? 26.168  109.310 10.579  1.00 35.73  ? 4404 ASA T C   1 
HETATM 7915  O O   . ASA L  3 5   ? 26.610  108.263 11.221  1.00 19.03  ? 4404 ASA T O   1 
HETATM 7916  C CB  . ASA L  3 5   ? 27.979  110.770 9.592   1.00 28.60  ? 4404 ASA T CB  1 
HETATM 7917  C CG  . ASA L  3 5   ? 29.182  110.555 8.668   1.00 35.53  ? 4404 ASA T CG  1 
HETATM 7918  O OD1 . ASA L  3 5   ? 29.150  109.596 7.860   1.00 27.86  ? 4404 ASA T OD1 1 
HETATM 7919  O OD2 . ASA L  3 5   ? 30.175  111.350 8.758   1.00 31.85  ? 4404 ASA T OD2 1 
ATOM   7920  N N   . LEU M  1 1   ? 23.219  89.725  54.429  1.00 99.17  ? 149  LEU I N   1 
ATOM   7921  C CA  . LEU M  1 1   ? 22.943  91.192  54.476  1.00 100.00 ? 149  LEU I CA  1 
ATOM   7922  C C   . LEU M  1 1   ? 22.620  91.652  55.915  1.00 100.00 ? 149  LEU I C   1 
ATOM   7923  O O   . LEU M  1 1   ? 22.011  92.710  56.126  1.00 100.00 ? 149  LEU I O   1 
ATOM   7924  C CB  . LEU M  1 1   ? 21.781  91.535  53.519  1.00 96.22  ? 149  LEU I CB  1 
ATOM   7925  C CG  . LEU M  1 1   ? 21.397  93.009  53.326  1.00 92.29  ? 149  LEU I CG  1 
ATOM   7926  C CD1 . LEU M  1 1   ? 22.613  93.809  52.872  1.00 90.50  ? 149  LEU I CD1 1 
ATOM   7927  C CD2 . LEU M  1 1   ? 20.269  93.115  52.315  1.00 86.86  ? 149  LEU I CD2 1 
ATOM   7928  N N   . ASP M  1 2   ? 23.027  90.849  56.900  1.00 100.00 ? 150  ASP I N   1 
ATOM   7929  C CA  . ASP M  1 2   ? 22.788  91.186  58.306  1.00 98.09  ? 150  ASP I CA  1 
ATOM   7930  C C   . ASP M  1 2   ? 24.007  91.944  58.807  1.00 94.72  ? 150  ASP I C   1 
ATOM   7931  O O   . ASP M  1 2   ? 25.137  91.578  58.479  1.00 96.51  ? 150  ASP I O   1 
ATOM   7932  C CB  . ASP M  1 2   ? 22.632  89.927  59.178  1.00 100.00 ? 150  ASP I CB  1 
ATOM   7933  C CG  . ASP M  1 2   ? 21.617  88.941  58.633  1.00 100.00 ? 150  ASP I CG  1 
ATOM   7934  O OD1 . ASP M  1 2   ? 20.501  89.375  58.258  1.00 99.70  ? 150  ASP I OD1 1 
ATOM   7935  O OD2 . ASP M  1 2   ? 21.941  87.728  58.600  1.00 100.00 ? 150  ASP I OD2 1 
ATOM   7936  N N   . LYS M  1 3   ? 23.788  92.991  59.599  1.00 89.26  ? 151  LYS I N   1 
ATOM   7937  C CA  . LYS M  1 3   ? 24.900  93.764  60.158  1.00 80.73  ? 151  LYS I CA  1 
ATOM   7938  C C   . LYS M  1 3   ? 25.731  92.825  61.042  1.00 78.30  ? 151  LYS I C   1 
ATOM   7939  O O   . LYS M  1 3   ? 25.199  91.900  61.665  1.00 80.33  ? 151  LYS I O   1 
ATOM   7940  C CB  . LYS M  1 3   ? 24.373  94.920  61.016  1.00 78.91  ? 151  LYS I CB  1 
ATOM   7941  C CG  . LYS M  1 3   ? 23.361  95.825  60.337  1.00 78.93  ? 151  LYS I CG  1 
ATOM   7942  C CD  . LYS M  1 3   ? 24.033  96.803  59.395  1.00 86.03  ? 151  LYS I CD  1 
ATOM   7943  C CE  . LYS M  1 3   ? 23.019  97.763  58.780  1.00 86.26  ? 151  LYS I CE  1 
ATOM   7944  N NZ  . LYS M  1 3   ? 23.654  98.752  57.857  1.00 85.59  ? 151  LYS I NZ  1 
ATOM   7945  N N   . VAL M  1 4   ? 27.036  93.047  61.088  1.00 76.13  ? 152  VAL I N   1 
ATOM   7946  C CA  . VAL M  1 4   ? 27.907  92.215  61.916  1.00 74.10  ? 152  VAL I CA  1 
ATOM   7947  C C   . VAL M  1 4   ? 28.969  93.056  62.617  1.00 78.74  ? 152  VAL I C   1 
ATOM   7948  O O   . VAL M  1 4   ? 29.398  94.100  62.113  1.00 84.36  ? 152  VAL I O   1 
ATOM   7949  C CB  . VAL M  1 4   ? 28.616  91.114  61.086  1.00 61.72  ? 152  VAL I CB  1 
ATOM   7950  C CG1 . VAL M  1 4   ? 29.551  90.300  61.973  1.00 59.05  ? 152  VAL I CG1 1 
ATOM   7951  C CG2 . VAL M  1 4   ? 27.581  90.205  60.467  1.00 59.87  ? 152  VAL I CG2 1 
ATOM   7952  N N   . TYR M  1 5   ? 29.375  92.612  63.799  1.00 79.73  ? 153  TYR I N   1 
ATOM   7953  C CA  . TYR M  1 5   ? 30.404  93.314  64.536  1.00 71.84  ? 153  TYR I CA  1 
ATOM   7954  C C   . TYR M  1 5   ? 31.729  93.020  63.870  1.00 69.24  ? 153  TYR I C   1 
ATOM   7955  O O   . TYR M  1 5   ? 32.070  91.860  63.607  1.00 62.40  ? 153  TYR I O   1 
ATOM   7956  C CB  . TYR M  1 5   ? 30.450  92.837  65.982  1.00 69.69  ? 153  TYR I CB  1 
ATOM   7957  C CG  . TYR M  1 5   ? 29.356  93.421  66.839  1.00 70.94  ? 153  TYR I CG  1 
ATOM   7958  C CD1 . TYR M  1 5   ? 29.124  94.800  66.861  1.00 63.49  ? 153  TYR I CD1 1 
ATOM   7959  C CD2 . TYR M  1 5   ? 28.563  92.597  67.648  1.00 71.97  ? 153  TYR I CD2 1 
ATOM   7960  C CE1 . TYR M  1 5   ? 28.132  95.349  67.673  1.00 64.03  ? 153  TYR I CE1 1 
ATOM   7961  C CE2 . TYR M  1 5   ? 27.566  93.136  68.460  1.00 68.65  ? 153  TYR I CE2 1 
ATOM   7962  C CZ  . TYR M  1 5   ? 27.359  94.513  68.468  1.00 65.31  ? 153  TYR I CZ  1 
ATOM   7963  O OH  . TYR M  1 5   ? 26.394  95.057  69.275  1.00 59.08  ? 153  TYR I OH  1 
ATOM   7964  N N   . GLN M  1 6   ? 32.465  94.086  63.587  1.00 71.06  ? 154  GLN I N   1 
ATOM   7965  C CA  . GLN M  1 6   ? 33.772  93.965  62.974  1.00 68.61  ? 154  GLN I CA  1 
ATOM   7966  C C   . GLN M  1 6   ? 34.685  93.188  63.925  1.00 64.45  ? 154  GLN I C   1 
ATOM   7967  O O   . GLN M  1 6   ? 34.673  93.412  65.144  1.00 56.35  ? 154  GLN I O   1 
ATOM   7968  C CB  . GLN M  1 6   ? 34.335  95.356  62.719  1.00 71.22  ? 154  GLN I CB  1 
ATOM   7969  C CG  . GLN M  1 6   ? 35.615  95.363  61.921  1.00 84.13  ? 154  GLN I CG  1 
ATOM   7970  C CD  . GLN M  1 6   ? 36.128  96.771  61.678  1.00 88.71  ? 154  GLN I CD  1 
ATOM   7971  O OE1 . GLN M  1 6   ? 36.553  97.457  62.606  1.00 91.99  ? 154  GLN I OE1 1 
ATOM   7972  N NE2 . GLN M  1 6   ? 36.084  97.210  60.425  1.00 91.18  ? 154  GLN I NE2 1 
ATOM   7973  N N   . MET M  1 7   ? 35.463  92.267  63.366  1.00 62.34  ? 155  MET I N   1 
ATOM   7974  C CA  . MET M  1 7   ? 36.374  91.457  64.161  1.00 69.92  ? 155  MET I CA  1 
ATOM   7975  C C   . MET M  1 7   ? 37.661  91.094  63.437  1.00 74.66  ? 155  MET I C   1 
ATOM   7976  O O   . MET M  1 7   ? 37.938  89.918  63.207  1.00 73.51  ? 155  MET I O   1 
ATOM   7977  C CB  . MET M  1 7   ? 35.686  90.173  64.621  1.00 71.57  ? 155  MET I CB  1 
ATOM   7978  C CG  . MET M  1 7   ? 34.674  90.387  65.725  1.00 79.39  ? 155  MET I CG  1 
ATOM   7979  S SD  . MET M  1 7   ? 35.467  90.857  67.266  1.00 75.39  ? 155  MET I SD  1 
ATOM   7980  C CE  . MET M  1 7   ? 36.165  89.291  67.703  1.00 70.73  ? 155  MET I CE  1 
ATOM   7981  N N   . LYS M  1 8   ? 38.451  92.107  63.090  1.00 83.43  ? 156  LYS I N   1 
ATOM   7982  C CA  . LYS M  1 8   ? 39.730  91.896  62.405  1.00 82.87  ? 156  LYS I CA  1 
ATOM   7983  C C   . LYS M  1 8   ? 40.881  92.245  63.350  1.00 80.20  ? 156  LYS I C   1 
ATOM   7984  O O   . LYS M  1 8   ? 41.850  91.502  63.440  1.00 80.81  ? 156  LYS I O   1 
ATOM   7985  C CB  . LYS M  1 8   ? 39.802  92.753  61.138  1.00 85.47  ? 156  LYS I CB  1 
ATOM   7986  C CG  . LYS M  1 8   ? 39.652  94.255  61.391  1.00 90.92  ? 156  LYS I CG  1 
ATOM   7987  C CD  . LYS M  1 8   ? 38.600  94.904  60.481  1.00 93.91  ? 156  LYS I CD  1 
ATOM   7988  C CE  . LYS M  1 8   ? 38.902  94.743  58.989  1.00 95.40  ? 156  LYS I CE  1 
ATOM   7989  N NZ  . LYS M  1 8   ? 38.705  93.340  58.510  1.00 100.00 ? 156  LYS I NZ  1 
ATOM   7990  N N   . SER M  1 9   ? 40.746  93.369  64.057  1.00 75.29  ? 157  SER I N   1 
ATOM   7991  C CA  . SER M  1 9   ? 41.732  93.850  65.022  1.00 72.56  ? 157  SER I CA  1 
ATOM   7992  C C   . SER M  1 9   ? 42.860  92.887  65.431  1.00 76.18  ? 157  SER I C   1 
ATOM   7993  O O   . SER M  1 9   ? 42.620  91.787  65.930  1.00 74.50  ? 157  SER I O   1 
ATOM   7994  C CB  . SER M  1 9   ? 41.012  94.339  66.280  1.00 69.26  ? 157  SER I CB  1 
ATOM   7995  O OG  . SER M  1 9   ? 41.871  94.275  67.409  1.00 75.89  ? 157  SER I OG  1 
ATOM   7996  N N   . LYS M  1 10  ? 44.094  93.351  65.235  1.00 85.98  ? 160  LYS I N   1 
ATOM   7997  C CA  . LYS M  1 10  ? 45.333  92.626  65.544  1.00 90.24  ? 160  LYS I CA  1 
ATOM   7998  C C   . LYS M  1 10  ? 45.229  91.740  66.777  1.00 91.77  ? 160  LYS I C   1 
ATOM   7999  O O   . LYS M  1 10  ? 45.482  90.531  66.699  1.00 90.57  ? 160  LYS I O   1 
ATOM   8000  C CB  . LYS M  1 10  ? 46.490  93.627  65.709  1.00 94.04  ? 160  LYS I CB  1 
ATOM   8001  C CG  . LYS M  1 10  ? 46.642  94.565  64.521  1.00 98.89  ? 160  LYS I CG  1 
ATOM   8002  C CD  . LYS M  1 10  ? 47.882  95.421  64.617  1.00 97.88  ? 160  LYS I CD  1 
ATOM   8003  C CE  . LYS M  1 10  ? 48.093  96.170  63.311  1.00 99.04  ? 160  LYS I CE  1 
ATOM   8004  N NZ  . LYS M  1 10  ? 49.335  96.988  63.316  1.00 100.00 ? 160  LYS I NZ  1 
ATOM   8005  N N   . PRO M  1 11  ? 44.912  92.333  67.947  1.00 91.40  ? 161  PRO I N   1 
ATOM   8006  C CA  . PRO M  1 11  ? 44.808  91.433  69.100  1.00 86.77  ? 161  PRO I CA  1 
ATOM   8007  C C   . PRO M  1 11  ? 43.333  91.196  69.455  1.00 81.19  ? 161  PRO I C   1 
ATOM   8008  O O   . PRO M  1 11  ? 43.036  90.544  70.458  1.00 87.23  ? 161  PRO I O   1 
ATOM   8009  C CB  . PRO M  1 11  ? 45.550  92.187  70.208  1.00 85.64  ? 161  PRO I CB  1 
ATOM   8010  C CG  . PRO M  1 11  ? 46.256  93.338  69.481  1.00 88.55  ? 161  PRO I CG  1 
ATOM   8011  C CD  . PRO M  1 11  ? 45.286  93.681  68.404  1.00 85.90  ? 161  PRO I CD  1 
ATOM   8012  N N   . ARG M  1 12  ? 42.419  91.723  68.636  1.00 70.30  ? 162  ARG I N   1 
ATOM   8013  C CA  . ARG M  1 12  ? 40.967  91.585  68.867  1.00 68.90  ? 162  ARG I CA  1 
ATOM   8014  C C   . ARG M  1 12  ? 40.514  92.408  70.064  1.00 63.55  ? 162  ARG I C   1 
ATOM   8015  O O   . ARG M  1 12  ? 39.669  93.291  69.954  1.00 57.79  ? 162  ARG I O   1 
ATOM   8016  C CB  . ARG M  1 12  ? 40.576  90.125  69.123  1.00 71.23  ? 162  ARG I CB  1 
ATOM   8017  C CG  . ARG M  1 12  ? 40.569  89.232  67.908  1.00 80.68  ? 162  ARG I CG  1 
ATOM   8018  C CD  . ARG M  1 12  ? 39.336  89.460  67.051  1.00 84.56  ? 162  ARG I CD  1 
ATOM   8019  N NE  . ARG M  1 12  ? 39.270  88.466  65.981  1.00 89.93  ? 162  ARG I NE  1 
ATOM   8020  C CZ  . ARG M  1 12  ? 40.062  88.467  64.914  1.00 85.78  ? 162  ARG I CZ  1 
ATOM   8021  N NH1 . ARG M  1 12  ? 40.975  89.416  64.769  1.00 86.73  ? 162  ARG I NH1 1 
ATOM   8022  N NH2 . ARG M  1 12  ? 39.958  87.508  64.004  1.00 82.76  ? 162  ARG I NH2 1 
ATOM   8023  N N   . GLY M  1 13  ? 41.077  92.081  71.218  1.00 62.09  ? 163  GLY I N   1 
ATOM   8024  C CA  . GLY M  1 13  ? 40.753  92.781  72.443  1.00 55.29  ? 163  GLY I CA  1 
ATOM   8025  C C   . GLY M  1 13  ? 41.232  91.941  73.605  1.00 53.65  ? 163  GLY I C   1 
ATOM   8026  O O   . GLY M  1 13  ? 41.724  90.809  73.399  1.00 41.67  ? 163  GLY I O   1 
ATOM   8027  N N   . TYR M  1 14  ? 41.108  92.478  74.820  1.00 52.74  ? 164  TYR I N   1 
ATOM   8028  C CA  . TYR M  1 14  ? 41.517  91.710  75.984  1.00 58.40  ? 164  TYR I CA  1 
ATOM   8029  C C   . TYR M  1 14  ? 40.410  90.735  76.392  1.00 58.91  ? 164  TYR I C   1 
ATOM   8030  O O   . TYR M  1 14  ? 39.237  90.916  76.054  1.00 61.59  ? 164  TYR I O   1 
ATOM   8031  C CB  . TYR M  1 14  ? 41.828  92.633  77.153  1.00 62.14  ? 164  TYR I CB  1 
ATOM   8032  C CG  . TYR M  1 14  ? 42.894  93.635  76.848  1.00 69.59  ? 164  TYR I CG  1 
ATOM   8033  C CD1 . TYR M  1 14  ? 44.246  93.286  76.929  1.00 74.35  ? 164  TYR I CD1 1 
ATOM   8034  C CD2 . TYR M  1 14  ? 42.564  94.917  76.428  1.00 72.54  ? 164  TYR I CD2 1 
ATOM   8035  C CE1 . TYR M  1 14  ? 45.249  94.193  76.591  1.00 74.42  ? 164  TYR I CE1 1 
ATOM   8036  C CE2 . TYR M  1 14  ? 43.560  95.833  76.087  1.00 77.79  ? 164  TYR I CE2 1 
ATOM   8037  C CZ  . TYR M  1 14  ? 44.898  95.466  76.167  1.00 76.43  ? 164  TYR I CZ  1 
ATOM   8038  O OH  . TYR M  1 14  ? 45.874  96.375  75.803  1.00 81.00  ? 164  TYR I OH  1 
ATOM   8039  N N   . CYS M  1 15  ? 40.796  89.694  77.110  1.00 53.06  ? 165  CYS I N   1 
ATOM   8040  C CA  . CYS M  1 15  ? 39.847  88.723  77.595  1.00 51.31  ? 165  CYS I CA  1 
ATOM   8041  C C   . CYS M  1 15  ? 40.252  88.423  79.021  1.00 51.85  ? 165  CYS I C   1 
ATOM   8042  O O   . CYS M  1 15  ? 41.098  87.545  79.249  1.00 49.84  ? 165  CYS I O   1 
ATOM   8043  C CB  . CYS M  1 15  ? 39.917  87.453  76.750  1.00 57.65  ? 165  CYS I CB  1 
ATOM   8044  S SG  . CYS M  1 15  ? 38.953  86.057  77.381  1.00 63.11  ? 165  CYS I SG  1 
ATOM   8045  N N   . LEU M  1 16  ? 39.686  89.163  79.976  1.00 50.15  ? 166  LEU I N   1 
ATOM   8046  C CA  . LEU M  1 16  ? 40.017  88.920  81.384  1.00 56.71  ? 166  LEU I CA  1 
ATOM   8047  C C   . LEU M  1 16  ? 39.512  87.552  81.789  1.00 55.41  ? 166  LEU I C   1 
ATOM   8048  O O   . LEU M  1 16  ? 38.701  86.945  81.097  1.00 58.53  ? 166  LEU I O   1 
ATOM   8049  C CB  . LEU M  1 16  ? 39.342  89.916  82.314  1.00 55.17  ? 166  LEU I CB  1 
ATOM   8050  C CG  . LEU M  1 16  ? 39.435  91.397  82.028  1.00 62.30  ? 166  LEU I CG  1 
ATOM   8051  C CD1 . LEU M  1 16  ? 39.032  92.144  83.291  1.00 65.23  ? 166  LEU I CD1 1 
ATOM   8052  C CD2 . LEU M  1 16  ? 40.852  91.756  81.626  1.00 71.06  ? 166  LEU I CD2 1 
ATOM   8053  N N   . ILE M  1 17  ? 39.989  87.080  82.927  1.00 50.40  ? 167  ILE I N   1 
ATOM   8054  C CA  . ILE M  1 17  ? 39.557  85.813  83.459  1.00 47.54  ? 167  ILE I CA  1 
ATOM   8055  C C   . ILE M  1 17  ? 39.786  85.867  84.942  1.00 48.10  ? 167  ILE I C   1 
ATOM   8056  O O   . ILE M  1 17  ? 40.869  85.559  85.397  1.00 51.14  ? 167  ILE I O   1 
ATOM   8057  C CB  . ILE M  1 17  ? 40.361  84.633  82.915  1.00 45.36  ? 167  ILE I CB  1 
ATOM   8058  C CG1 . ILE M  1 17  ? 40.138  84.489  81.417  1.00 33.91  ? 167  ILE I CG1 1 
ATOM   8059  C CG2 . ILE M  1 17  ? 39.944  83.358  83.633  1.00 45.97  ? 167  ILE I CG2 1 
ATOM   8060  C CD1 . ILE M  1 17  ? 40.666  83.184  80.857  1.00 39.55  ? 167  ILE I CD1 1 
ATOM   8061  N N   . ILE M  1 18  ? 38.790  86.303  85.697  1.00 54.00  ? 168  ILE I N   1 
ATOM   8062  C CA  . ILE M  1 18  ? 38.937  86.323  87.144  1.00 57.77  ? 168  ILE I CA  1 
ATOM   8063  C C   . ILE M  1 18  ? 38.660  84.881  87.506  1.00 60.22  ? 168  ILE I C   1 
ATOM   8064  O O   . ILE M  1 18  ? 37.542  84.408  87.335  1.00 68.02  ? 168  ILE I O   1 
ATOM   8065  C CB  . ILE M  1 18  ? 37.883  87.199  87.829  1.00 57.31  ? 168  ILE I CB  1 
ATOM   8066  C CG1 . ILE M  1 18  ? 37.879  88.597  87.208  1.00 51.92  ? 168  ILE I CG1 1 
ATOM   8067  C CG2 . ILE M  1 18  ? 38.168  87.266  89.310  1.00 48.49  ? 168  ILE I CG2 1 
ATOM   8068  C CD1 . ILE M  1 18  ? 39.244  89.162  87.003  1.00 55.04  ? 168  ILE I CD1 1 
ATOM   8069  N N   . ASN M  1 19  ? 39.683  84.184  87.976  1.00 58.77  ? 169  ASN I N   1 
ATOM   8070  C CA  . ASN M  1 19  ? 39.575  82.775  88.332  1.00 59.95  ? 169  ASN I CA  1 
ATOM   8071  C C   . ASN M  1 19  ? 39.684  82.598  89.834  1.00 56.10  ? 169  ASN I C   1 
ATOM   8072  O O   . ASN M  1 19  ? 40.776  82.623  90.376  1.00 57.78  ? 169  ASN I O   1 
ATOM   8073  C CB  . ASN M  1 19  ? 40.700  81.996  87.639  1.00 60.30  ? 169  ASN I CB  1 
ATOM   8074  C CG  . ASN M  1 19  ? 40.727  80.545  88.029  1.00 57.66  ? 169  ASN I CG  1 
ATOM   8075  O OD1 . ASN M  1 19  ? 40.698  80.207  89.207  1.00 54.28  ? 169  ASN I OD1 1 
ATOM   8076  N ND2 . ASN M  1 19  ? 40.792  79.673  87.036  1.00 58.65  ? 169  ASN I ND2 1 
ATOM   8077  N N   . ASN M  1 20  ? 38.560  82.417  90.507  1.00 55.38  ? 170  ASN I N   1 
ATOM   8078  C CA  . ASN M  1 20  ? 38.587  82.237  91.954  1.00 64.34  ? 170  ASN I CA  1 
ATOM   8079  C C   . ASN M  1 20  ? 38.528  80.765  92.349  1.00 72.26  ? 170  ASN I C   1 
ATOM   8080  O O   . ASN M  1 20  ? 37.606  80.042  91.963  1.00 80.15  ? 170  ASN I O   1 
ATOM   8081  C CB  . ASN M  1 20  ? 37.430  82.994  92.598  1.00 53.62  ? 170  ASN I CB  1 
ATOM   8082  C CG  . ASN M  1 20  ? 37.689  84.470  92.671  1.00 56.19  ? 170  ASN I CG  1 
ATOM   8083  O OD1 . ASN M  1 20  ? 38.652  84.970  92.084  1.00 56.09  ? 170  ASN I OD1 1 
ATOM   8084  N ND2 . ASN M  1 20  ? 36.832  85.187  93.388  1.00 52.51  ? 170  ASN I ND2 1 
ATOM   8085  N N   . HIS M  1 21  ? 39.517  80.330  93.124  1.00 72.25  ? 171  HIS I N   1 
ATOM   8086  C CA  . HIS M  1 21  ? 39.597  78.948  93.569  1.00 72.96  ? 171  HIS I CA  1 
ATOM   8087  C C   . HIS M  1 21  ? 39.638  78.793  95.088  1.00 71.70  ? 171  HIS I C   1 
ATOM   8088  O O   . HIS M  1 21  ? 38.749  78.203  95.684  1.00 71.47  ? 171  HIS I O   1 
ATOM   8089  C CB  . HIS M  1 21  ? 40.839  78.296  92.976  1.00 79.54  ? 171  HIS I CB  1 
ATOM   8090  C CG  . HIS M  1 21  ? 41.262  77.050  93.689  1.00 88.89  ? 171  HIS I CG  1 
ATOM   8091  N ND1 . HIS M  1 21  ? 40.651  75.830  93.486  1.00 91.74  ? 171  HIS I ND1 1 
ATOM   8092  C CD2 . HIS M  1 21  ? 42.207  76.844  94.638  1.00 89.31  ? 171  HIS I CD2 1 
ATOM   8093  C CE1 . HIS M  1 21  ? 41.201  74.928  94.279  1.00 92.97  ? 171  HIS I CE1 1 
ATOM   8094  N NE2 . HIS M  1 21  ? 42.147  75.517  94.989  1.00 92.73  ? 171  HIS I NE2 1 
ATOM   8095  N N   . ASN M  1 22  ? 40.681  79.328  95.705  1.00 69.88  ? 172  ASN I N   1 
ATOM   8096  C CA  . ASN M  1 22  ? 40.869  79.226  97.143  1.00 71.82  ? 172  ASN I CA  1 
ATOM   8097  C C   . ASN M  1 22  ? 40.019  80.176  97.991  1.00 72.50  ? 172  ASN I C   1 
ATOM   8098  O O   . ASN M  1 22  ? 40.436  81.291  98.314  1.00 72.38  ? 172  ASN I O   1 
ATOM   8099  C CB  . ASN M  1 22  ? 42.359  79.417  97.461  1.00 75.71  ? 172  ASN I CB  1 
ATOM   8100  C CG  . ASN M  1 22  ? 42.652  79.413  98.964  1.00 83.59  ? 172  ASN I CG  1 
ATOM   8101  O OD1 . ASN M  1 22  ? 42.123  78.589  99.716  1.00 83.97  ? 172  ASN I OD1 1 
ATOM   8102  N ND2 . ASN M  1 22  ? 43.512  80.331  99.402  1.00 84.87  ? 172  ASN I ND2 1 
ATOM   8103  N N   . PHE M  1 23  ? 38.834  79.727  98.385  1.00 71.24  ? 173  PHE I N   1 
ATOM   8104  C CA  . PHE M  1 23  ? 37.971  80.572  99.196  1.00 73.55  ? 173  PHE I CA  1 
ATOM   8105  C C   . PHE M  1 23  ? 38.252  80.485  100.687 1.00 74.53  ? 173  PHE I C   1 
ATOM   8106  O O   . PHE M  1 23  ? 37.334  80.544  101.509 1.00 70.23  ? 173  PHE I O   1 
ATOM   8107  C CB  . PHE M  1 23  ? 36.506  80.254  98.905  1.00 75.43  ? 173  PHE I CB  1 
ATOM   8108  C CG  . PHE M  1 23  ? 36.053  80.761  97.576  1.00 69.34  ? 173  PHE I CG  1 
ATOM   8109  C CD1 . PHE M  1 23  ? 36.431  80.106  96.408  1.00 66.63  ? 173  PHE I CD1 1 
ATOM   8110  C CD2 . PHE M  1 23  ? 35.336  81.951  97.486  1.00 64.35  ? 173  PHE I CD2 1 
ATOM   8111  C CE1 . PHE M  1 23  ? 36.111  80.631  95.165  1.00 67.77  ? 173  PHE I CE1 1 
ATOM   8112  C CE2 . PHE M  1 23  ? 35.007  82.490  96.251  1.00 66.45  ? 173  PHE I CE2 1 
ATOM   8113  C CZ  . PHE M  1 23  ? 35.399  81.827  95.083  1.00 72.94  ? 173  PHE I CZ  1 
ATOM   8114  N N   . ALA M  1 24  ? 39.537  80.356  101.024 1.00 77.50  ? 174  ALA I N   1 
ATOM   8115  C CA  . ALA M  1 24  ? 39.971  80.268  102.413 1.00 76.31  ? 174  ALA I CA  1 
ATOM   8116  C C   . ALA M  1 24  ? 39.460  81.478  103.203 1.00 76.75  ? 174  ALA I C   1 
ATOM   8117  O O   . ALA M  1 24  ? 38.464  81.382  103.921 1.00 72.42  ? 174  ALA I O   1 
ATOM   8118  C CB  . ALA M  1 24  ? 41.483  80.198  102.469 1.00 73.19  ? 174  ALA I CB  1 
ATOM   8119  N N   . LYS M  1 25  ? 40.143  82.612  103.047 1.00 80.11  ? 175  LYS I N   1 
ATOM   8120  C CA  . LYS M  1 25  ? 39.795  83.863  103.728 1.00 80.79  ? 175  LYS I CA  1 
ATOM   8121  C C   . LYS M  1 25  ? 38.292  84.109  103.761 1.00 81.56  ? 175  LYS I C   1 
ATOM   8122  O O   . LYS M  1 25  ? 37.752  84.602  104.761 1.00 75.32  ? 175  LYS I O   1 
ATOM   8123  C CB  . LYS M  1 25  ? 40.489  85.044  103.034 1.00 88.84  ? 175  LYS I CB  1 
ATOM   8124  C CG  . LYS M  1 25  ? 41.560  85.783  103.864 1.00 94.12  ? 175  LYS I CG  1 
ATOM   8125  C CD  . LYS M  1 25  ? 40.953  86.735  104.911 1.00 99.12  ? 175  LYS I CD  1 
ATOM   8126  C CE  . LYS M  1 25  ? 42.041  87.542  105.646 1.00 100.00 ? 175  LYS I CE  1 
ATOM   8127  N NZ  . LYS M  1 25  ? 41.523  88.446  106.730 1.00 100.00 ? 175  LYS I NZ  1 
ATOM   8128  N N   . ALA M  1 26  A 37.622  83.783  102.660 1.00 86.25  ? 175  ALA I N   1 
ATOM   8129  C CA  . ALA M  1 26  A 36.177  83.957  102.568 1.00 91.25  ? 175  ALA I CA  1 
ATOM   8130  C C   . ALA M  1 26  A 35.547  83.228  103.749 1.00 93.47  ? 175  ALA I C   1 
ATOM   8131  O O   . ALA M  1 26  A 34.790  83.817  104.522 1.00 94.28  ? 175  ALA I O   1 
ATOM   8132  C CB  . ALA M  1 26  A 35.666  83.393  101.262 1.00 92.03  ? 175  ALA I CB  1 
ATOM   8133  N N   . ARG M  1 27  B 35.863  81.941  103.882 1.00 94.82  ? 175  ARG I N   1 
ATOM   8134  C CA  . ARG M  1 27  B 35.358  81.154  105.005 1.00 93.41  ? 175  ARG I CA  1 
ATOM   8135  C C   . ARG M  1 27  B 35.874  81.908  106.218 1.00 92.74  ? 175  ARG I C   1 
ATOM   8136  O O   . ARG M  1 27  B 35.220  82.818  106.733 1.00 92.49  ? 175  ARG I O   1 
ATOM   8137  C CB  . ARG M  1 27  B 35.946  79.731  104.990 1.00 88.68  ? 175  ARG I CB  1 
ATOM   8138  C CG  . ARG M  1 27  B 35.315  78.798  103.959 1.00 82.50  ? 175  ARG I CG  1 
ATOM   8139  C CD  . ARG M  1 27  B 36.020  77.453  103.896 1.00 78.59  ? 175  ARG I CD  1 
ATOM   8140  N NE  . ARG M  1 27  B 37.439  77.593  103.583 1.00 79.27  ? 175  ARG I NE  1 
ATOM   8141  C CZ  . ARG M  1 27  B 38.063  76.923  102.616 1.00 80.67  ? 175  ARG I CZ  1 
ATOM   8142  N NH1 . ARG M  1 27  B 37.387  76.064  101.867 1.00 81.92  ? 175  ARG I NH1 1 
ATOM   8143  N NH2 . ARG M  1 27  B 39.359  77.116  102.391 1.00 81.38  ? 175  ARG I NH2 1 
ATOM   8144  N N   . GLU M  1 28  C 37.069  81.527  106.645 1.00 89.68  ? 175  GLU I N   1 
ATOM   8145  C CA  . GLU M  1 28  C 37.733  82.159  107.764 1.00 89.87  ? 175  GLU I CA  1 
ATOM   8146  C C   . GLU M  1 28  C 37.015  83.410  108.328 1.00 86.29  ? 175  GLU I C   1 
ATOM   8147  O O   . GLU M  1 28  C 36.541  83.374  109.455 1.00 83.31  ? 175  GLU I O   1 
ATOM   8148  C CB  . GLU M  1 28  C 39.193  82.456  107.338 1.00 95.55  ? 175  GLU I CB  1 
ATOM   8149  C CG  . GLU M  1 28  C 39.936  83.587  108.079 1.00 100.00 ? 175  GLU I CG  1 
ATOM   8150  C CD  . GLU M  1 28  C 41.398  83.779  107.605 1.00 100.00 ? 175  GLU I CD  1 
ATOM   8151  O OE1 . GLU M  1 28  C 42.016  84.801  107.996 1.00 100.00 ? 175  GLU I OE1 1 
ATOM   8152  O OE2 . GLU M  1 28  C 41.925  82.913  106.859 1.00 96.55  ? 175  GLU I OE2 1 
ATOM   8153  N N   . LYS M  1 29  D 36.879  84.487  107.554 1.00 85.64  ? 175  LYS I N   1 
ATOM   8154  C CA  . LYS M  1 29  D 36.252  85.701  108.094 1.00 86.46  ? 175  LYS I CA  1 
ATOM   8155  C C   . LYS M  1 29  D 34.768  85.941  107.902 1.00 84.29  ? 175  LYS I C   1 
ATOM   8156  O O   . LYS M  1 29  D 34.317  87.032  108.227 1.00 77.18  ? 175  LYS I O   1 
ATOM   8157  C CB  . LYS M  1 29  D 36.976  86.962  107.594 1.00 89.71  ? 175  LYS I CB  1 
ATOM   8158  C CG  . LYS M  1 29  D 38.457  87.077  107.972 1.00 90.32  ? 175  LYS I CG  1 
ATOM   8159  C CD  . LYS M  1 29  D 38.694  87.544  109.402 1.00 86.92  ? 175  LYS I CD  1 
ATOM   8160  C CE  . LYS M  1 29  D 40.194  87.695  109.658 1.00 81.74  ? 175  LYS I CE  1 
ATOM   8161  N NZ  . LYS M  1 29  D 40.494  88.313  110.971 1.00 74.83  ? 175  LYS I NZ  1 
ATOM   8162  N N   . VAL M  1 30  E 34.010  84.967  107.387 1.00 89.83  ? 175  VAL I N   1 
ATOM   8163  C CA  . VAL M  1 30  E 32.552  85.154  107.176 1.00 95.36  ? 175  VAL I CA  1 
ATOM   8164  C C   . VAL M  1 30  E 31.653  84.022  107.774 1.00 98.53  ? 175  VAL I C   1 
ATOM   8165  O O   . VAL M  1 30  E 32.044  82.847  107.803 1.00 96.99  ? 175  VAL I O   1 
ATOM   8166  C CB  . VAL M  1 30  E 32.213  85.343  105.636 1.00 90.34  ? 175  VAL I CB  1 
ATOM   8167  C CG1 . VAL M  1 30  E 30.827  85.962  105.462 1.00 85.98  ? 175  VAL I CG1 1 
ATOM   8168  C CG2 . VAL M  1 30  E 33.245  86.246  104.966 1.00 87.58  ? 175  VAL I CG2 1 
ATOM   8169  N N   . PRO M  1 31  F 30.435  84.378  108.263 1.00 100.00 ? 175  PRO I N   1 
ATOM   8170  C CA  . PRO M  1 31  F 29.467  83.444  108.864 1.00 98.56  ? 175  PRO I CA  1 
ATOM   8171  C C   . PRO M  1 31  F 28.864  82.459  107.872 1.00 98.17  ? 175  PRO I C   1 
ATOM   8172  O O   . PRO M  1 31  F 29.430  81.404  107.584 1.00 94.39  ? 175  PRO I O   1 
ATOM   8173  C CB  . PRO M  1 31  F 28.375  84.369  109.416 1.00 97.53  ? 175  PRO I CB  1 
ATOM   8174  C CG  . PRO M  1 31  F 29.043  85.682  109.571 1.00 98.52  ? 175  PRO I CG  1 
ATOM   8175  C CD  . PRO M  1 31  F 29.911  85.754  108.346 1.00 100.00 ? 175  PRO I CD  1 
ATOM   8176  N N   . LYS M  1 32  G 27.684  82.836  107.386 1.00 98.76  ? 175  LYS I N   1 
ATOM   8177  C CA  . LYS M  1 32  G 26.902  82.077  106.416 1.00 100.00 ? 175  LYS I CA  1 
ATOM   8178  C C   . LYS M  1 32  G 27.762  81.331  105.385 1.00 100.00 ? 175  LYS I C   1 
ATOM   8179  O O   . LYS M  1 32  G 27.291  80.407  104.703 1.00 99.12  ? 175  LYS I O   1 
ATOM   8180  C CB  . LYS M  1 32  G 25.961  83.046  105.684 1.00 100.00 ? 175  LYS I CB  1 
ATOM   8181  C CG  . LYS M  1 32  G 26.698  84.209  105.009 1.00 97.40  ? 175  LYS I CG  1 
ATOM   8182  C CD  . LYS M  1 32  G 25.839  84.931  103.976 1.00 96.38  ? 175  LYS I CD  1 
ATOM   8183  C CE  . LYS M  1 32  G 26.717  85.678  102.966 1.00 97.05  ? 175  LYS I CE  1 
ATOM   8184  N NZ  . LYS M  1 32  G 25.959  86.349  101.861 1.00 95.29  ? 175  LYS I NZ  1 
ATOM   8185  N N   . LEU M  1 33  H 29.023  81.738  105.281 1.00 99.99  ? 175  LEU I N   1 
ATOM   8186  C CA  . LEU M  1 33  H 29.947  81.158  104.322 1.00 100.00 ? 175  LEU I CA  1 
ATOM   8187  C C   . LEU M  1 33  H 30.907  80.136  104.926 1.00 100.00 ? 175  LEU I C   1 
ATOM   8188  O O   . LEU M  1 33  H 31.509  79.337  104.206 1.00 100.00 ? 175  LEU I O   1 
ATOM   8189  C CB  . LEU M  1 33  H 30.736  82.292  103.669 1.00 99.78  ? 175  LEU I CB  1 
ATOM   8190  C CG  . LEU M  1 33  H 29.896  83.517  103.291 1.00 98.39  ? 175  LEU I CG  1 
ATOM   8191  C CD1 . LEU M  1 33  H 30.752  84.499  102.507 1.00 97.84  ? 175  LEU I CD1 1 
ATOM   8192  C CD2 . LEU M  1 33  H 28.694  83.090  102.468 1.00 99.30  ? 175  LEU I CD2 1 
ATOM   8193  N N   . HIS M  1 34  I 31.030  80.175  106.250 1.00 100.00 ? 175  HIS I N   1 
ATOM   8194  C CA  . HIS M  1 34  I 31.917  79.308  107.036 1.00 100.00 ? 175  HIS I CA  1 
ATOM   8195  C C   . HIS M  1 34  I 32.616  78.109  106.359 1.00 100.00 ? 175  HIS I C   1 
ATOM   8196  O O   . HIS M  1 34  I 33.809  77.892  106.586 1.00 97.72  ? 175  HIS I O   1 
ATOM   8197  C CB  . HIS M  1 34  I 31.180  78.810  108.288 1.00 99.79  ? 175  HIS I CB  1 
ATOM   8198  C CG  . HIS M  1 34  I 30.549  77.466  108.117 1.00 100.00 ? 175  HIS I CG  1 
ATOM   8199  N ND1 . HIS M  1 34  I 29.549  77.226  107.197 1.00 100.00 ? 175  HIS I ND1 1 
ATOM   8200  C CD2 . HIS M  1 34  I 30.808  76.276  108.712 1.00 100.00 ? 175  HIS I CD2 1 
ATOM   8201  C CE1 . HIS M  1 34  I 29.220  75.946  107.233 1.00 100.00 ? 175  HIS I CE1 1 
ATOM   8202  N NE2 . HIS M  1 34  I 29.969  75.347  108.143 1.00 100.00 ? 175  HIS I NE2 1 
ATOM   8203  N N   . SER M  1 35  J 31.898  77.328  105.549 1.00 99.05  ? 175  SER I N   1 
ATOM   8204  C CA  . SER M  1 35  J 32.520  76.172  104.904 1.00 98.02  ? 175  SER I CA  1 
ATOM   8205  C C   . SER M  1 35  J 32.309  76.065  103.394 1.00 97.71  ? 175  SER I C   1 
ATOM   8206  O O   . SER M  1 35  J 32.216  74.965  102.854 1.00 99.06  ? 175  SER I O   1 
ATOM   8207  C CB  . SER M  1 35  J 32.050  74.873  105.578 1.00 100.00 ? 175  SER I CB  1 
ATOM   8208  O OG  . SER M  1 35  J 32.754  73.730  105.098 1.00 100.00 ? 175  SER I OG  1 
ATOM   8209  N N   . ILE M  1 36  ? 32.231  77.205  102.716 1.00 95.19  ? 176  ILE I N   1 
ATOM   8210  C CA  . ILE M  1 36  ? 32.075  77.228  101.261 1.00 90.70  ? 176  ILE I CA  1 
ATOM   8211  C C   . ILE M  1 36  ? 33.361  76.651  100.667 1.00 91.53  ? 176  ILE I C   1 
ATOM   8212  O O   . ILE M  1 36  ? 34.323  77.386  100.474 1.00 93.10  ? 176  ILE I O   1 
ATOM   8213  C CB  . ILE M  1 36  ? 31.962  78.670  100.751 1.00 86.79  ? 176  ILE I CB  1 
ATOM   8214  C CG1 . ILE M  1 36  ? 30.705  79.333  101.310 1.00 81.13  ? 176  ILE I CG1 1 
ATOM   8215  C CG2 . ILE M  1 36  ? 32.013  78.682  99.240  1.00 82.14  ? 176  ILE I CG2 1 
ATOM   8216  C CD1 . ILE M  1 36  ? 30.659  80.818  101.050 1.00 63.17  ? 176  ILE I CD1 1 
ATOM   8217  N N   . ARG M  1 37  ? 33.399  75.361  100.355 1.00 91.86  ? 177  ARG I N   1 
ATOM   8218  C CA  . ARG M  1 37  ? 34.645  74.811  99.828  1.00 93.76  ? 177  ARG I CA  1 
ATOM   8219  C C   . ARG M  1 37  ? 35.222  75.498  98.588  1.00 93.03  ? 177  ARG I C   1 
ATOM   8220  O O   . ARG M  1 37  ? 34.606  76.374  97.974  1.00 97.18  ? 177  ARG I O   1 
ATOM   8221  C CB  . ARG M  1 37  ? 34.548  73.287  99.622  1.00 96.62  ? 177  ARG I CB  1 
ATOM   8222  C CG  . ARG M  1 37  ? 35.136  72.479  100.819 1.00 98.79  ? 177  ARG I CG  1 
ATOM   8223  C CD  . ARG M  1 37  ? 34.885  70.977  100.695 1.00 100.00 ? 177  ARG I CD  1 
ATOM   8224  N NE  . ARG M  1 37  ? 33.450  70.692  100.623 1.00 100.00 ? 177  ARG I NE  1 
ATOM   8225  C CZ  . ARG M  1 37  ? 32.903  69.701  99.916  1.00 100.00 ? 177  ARG I CZ  1 
ATOM   8226  N NH1 . ARG M  1 37  ? 33.671  68.876  99.209  1.00 98.99  ? 177  ARG I NH1 1 
ATOM   8227  N NH2 . ARG M  1 37  ? 31.581  69.553  99.897  1.00 99.78  ? 177  ARG I NH2 1 
ATOM   8228  N N   . ASP M  1 38  ? 36.437  75.084  98.255  1.00 86.33  ? 178  ASP I N   1 
ATOM   8229  C CA  . ASP M  1 38  ? 37.212  75.635  97.162  1.00 78.53  ? 178  ASP I CA  1 
ATOM   8230  C C   . ASP M  1 38  ? 36.724  75.096  95.842  1.00 74.73  ? 178  ASP I C   1 
ATOM   8231  O O   . ASP M  1 38  ? 36.337  73.940  95.735  1.00 73.64  ? 178  ASP I O   1 
ATOM   8232  C CB  . ASP M  1 38  ? 38.697  75.309  97.367  1.00 79.26  ? 178  ASP I CB  1 
ATOM   8233  C CG  . ASP M  1 38  ? 39.248  75.899  98.655  1.00 76.90  ? 178  ASP I CG  1 
ATOM   8234  O OD1 . ASP M  1 38  ? 38.921  77.069  98.962  1.00 83.97  ? 178  ASP I OD1 1 
ATOM   8235  O OD2 . ASP M  1 38  ? 40.008  75.201  99.355  1.00 70.81  ? 178  ASP I OD2 1 
ATOM   8236  N N   . ARG M  1 39  ? 36.758  75.950  94.832  1.00 75.75  ? 179  ARG I N   1 
ATOM   8237  C CA  . ARG M  1 39  ? 36.268  75.592  93.515  1.00 72.35  ? 179  ARG I CA  1 
ATOM   8238  C C   . ARG M  1 39  ? 37.224  74.720  92.717  1.00 71.34  ? 179  ARG I C   1 
ATOM   8239  O O   . ARG M  1 39  ? 37.722  75.111  91.666  1.00 74.94  ? 179  ARG I O   1 
ATOM   8240  C CB  . ARG M  1 39  ? 35.895  76.881  92.760  1.00 68.79  ? 179  ARG I CB  1 
ATOM   8241  C CG  . ARG M  1 39  ? 34.887  77.765  93.545  1.00 60.03  ? 179  ARG I CG  1 
ATOM   8242  C CD  . ARG M  1 39  ? 34.355  78.945  92.744  1.00 61.16  ? 179  ARG I CD  1 
ATOM   8243  N NE  . ARG M  1 39  ? 33.741  78.495  91.495  1.00 72.24  ? 179  ARG I NE  1 
ATOM   8244  C CZ  . ARG M  1 39  ? 34.381  78.353  90.334  1.00 68.98  ? 179  ARG I CZ  1 
ATOM   8245  N NH1 . ARG M  1 39  ? 35.673  78.640  90.245  1.00 63.00  ? 179  ARG I NH1 1 
ATOM   8246  N NH2 . ARG M  1 39  ? 33.730  77.903  89.265  1.00 69.95  ? 179  ARG I NH2 1 
ATOM   8247  N N   . ASN M  1 40  ? 37.466  73.518  93.222  1.00 73.96  ? 180  ASN I N   1 
ATOM   8248  C CA  . ASN M  1 40  ? 38.363  72.587  92.546  1.00 76.81  ? 180  ASN I CA  1 
ATOM   8249  C C   . ASN M  1 40  ? 37.945  72.310  91.108  1.00 73.67  ? 180  ASN I C   1 
ATOM   8250  O O   . ASN M  1 40  ? 36.874  71.754  90.861  1.00 76.86  ? 180  ASN I O   1 
ATOM   8251  C CB  . ASN M  1 40  ? 38.422  71.271  93.312  1.00 79.25  ? 180  ASN I CB  1 
ATOM   8252  C CG  . ASN M  1 40  ? 39.148  71.402  94.638  1.00 85.24  ? 180  ASN I CG  1 
ATOM   8253  O OD1 . ASN M  1 40  ? 39.081  70.511  95.480  1.00 88.95  ? 180  ASN I OD1 1 
ATOM   8254  N ND2 . ASN M  1 40  ? 39.856  72.506  94.826  1.00 89.27  ? 180  ASN I ND2 1 
ATOM   8255  N N   . GLY M  1 41  ? 38.796  72.705  90.168  1.00 69.04  ? 181  GLY I N   1 
ATOM   8256  C CA  . GLY M  1 41  ? 38.507  72.470  88.768  1.00 71.77  ? 181  GLY I CA  1 
ATOM   8257  C C   . GLY M  1 41  ? 38.541  73.727  87.923  1.00 73.63  ? 181  GLY I C   1 
ATOM   8258  O O   . GLY M  1 41  ? 38.749  73.641  86.704  1.00 71.73  ? 181  GLY I O   1 
ATOM   8259  N N   . THR M  1 42  ? 38.347  74.884  88.567  1.00 71.36  ? 182  THR I N   1 
ATOM   8260  C CA  . THR M  1 42  ? 38.329  76.177  87.869  1.00 70.35  ? 182  THR I CA  1 
ATOM   8261  C C   . THR M  1 42  ? 39.424  76.175  86.842  1.00 71.71  ? 182  THR I C   1 
ATOM   8262  O O   . THR M  1 42  ? 39.231  76.550  85.684  1.00 67.31  ? 182  THR I O   1 
ATOM   8263  C CB  . THR M  1 42  ? 38.641  77.353  88.787  1.00 67.09  ? 182  THR I CB  1 
ATOM   8264  O OG1 . THR M  1 42  ? 38.135  77.094  90.094  1.00 76.69  ? 182  THR I OG1 1 
ATOM   8265  C CG2 . THR M  1 42  ? 37.998  78.620  88.245  1.00 73.44  ? 182  THR I CG2 1 
ATOM   8266  N N   . HIS M  1 43  ? 40.587  75.754  87.319  1.00 75.80  ? 183  HIS I N   1 
ATOM   8267  C CA  . HIS M  1 43  ? 41.805  75.658  86.543  1.00 75.24  ? 183  HIS I CA  1 
ATOM   8268  C C   . HIS M  1 43  ? 41.501  75.145  85.145  1.00 71.70  ? 183  HIS I C   1 
ATOM   8269  O O   . HIS M  1 43  ? 41.925  75.730  84.157  1.00 67.62  ? 183  HIS I O   1 
ATOM   8270  C CB  . HIS M  1 43  ? 42.761  74.732  87.279  1.00 82.61  ? 183  HIS I CB  1 
ATOM   8271  C CG  . HIS M  1 43  ? 42.569  74.751  88.767  1.00 96.59  ? 183  HIS I CG  1 
ATOM   8272  N ND1 . HIS M  1 43  ? 41.656  73.941  89.414  1.00 100.00 ? 183  HIS I ND1 1 
ATOM   8273  C CD2 . HIS M  1 43  ? 43.133  75.520  89.730  1.00 98.52  ? 183  HIS I CD2 1 
ATOM   8274  C CE1 . HIS M  1 43  ? 41.667  74.208  90.710  1.00 99.83  ? 183  HIS I CE1 1 
ATOM   8275  N NE2 . HIS M  1 43  ? 42.555  75.163  90.928  1.00 100.00 ? 183  HIS I NE2 1 
ATOM   8276  N N   . LEU M  1 44  ? 40.742  74.061  85.061  1.00 71.25  ? 184  LEU I N   1 
ATOM   8277  C CA  . LEU M  1 44  ? 40.396  73.497  83.763  1.00 67.78  ? 184  LEU I CA  1 
ATOM   8278  C C   . LEU M  1 44  ? 39.600  74.487  82.904  1.00 69.64  ? 184  LEU I C   1 
ATOM   8279  O O   . LEU M  1 44  ? 39.808  74.566  81.681  1.00 60.55  ? 184  LEU I O   1 
ATOM   8280  C CB  . LEU M  1 44  ? 39.628  72.189  83.965  1.00 69.65  ? 184  LEU I CB  1 
ATOM   8281  C CG  . LEU M  1 44  ? 40.474  70.918  84.184  1.00 73.91  ? 184  LEU I CG  1 
ATOM   8282  C CD1 . LEU M  1 44  ? 41.945  71.258  84.453  1.00 70.24  ? 184  LEU I CD1 1 
ATOM   8283  C CD2 . LEU M  1 44  ? 39.875  70.115  85.346  1.00 76.58  ? 184  LEU I CD2 1 
ATOM   8284  N N   . ASP M  1 45  ? 38.697  75.243  83.539  1.00 71.95  ? 185  ASP I N   1 
ATOM   8285  C CA  . ASP M  1 45  ? 37.894  76.253  82.825  1.00 71.14  ? 185  ASP I CA  1 
ATOM   8286  C C   . ASP M  1 45  ? 38.847  77.319  82.281  1.00 71.65  ? 185  ASP I C   1 
ATOM   8287  O O   . ASP M  1 45  ? 38.867  77.620  81.074  1.00 64.11  ? 185  ASP I O   1 
ATOM   8288  C CB  . ASP M  1 45  ? 36.893  76.954  83.765  1.00 71.69  ? 185  ASP I CB  1 
ATOM   8289  C CG  . ASP M  1 45  ? 35.683  76.102  84.102  1.00 65.87  ? 185  ASP I CG  1 
ATOM   8290  O OD1 . ASP M  1 45  ? 35.396  75.142  83.359  1.00 68.18  ? 185  ASP I OD1 1 
ATOM   8291  O OD2 . ASP M  1 45  ? 35.006  76.418  85.102  1.00 59.49  ? 185  ASP I OD2 1 
ATOM   8292  N N   . ALA M  1 46  ? 39.620  77.897  83.205  1.00 71.39  ? 186  ALA I N   1 
ATOM   8293  C CA  . ALA M  1 46  ? 40.609  78.920  82.878  1.00 69.04  ? 186  ALA I CA  1 
ATOM   8294  C C   . ALA M  1 46  ? 41.461  78.445  81.698  1.00 65.10  ? 186  ALA I C   1 
ATOM   8295  O O   . ALA M  1 46  ? 41.629  79.164  80.707  1.00 62.07  ? 186  ALA I O   1 
ATOM   8296  C CB  . ALA M  1 46  ? 41.491  79.192  84.092  1.00 66.74  ? 186  ALA I CB  1 
ATOM   8297  N N   . GLY M  1 47  ? 41.982  77.225  81.805  1.00 61.42  ? 187  GLY I N   1 
ATOM   8298  C CA  . GLY M  1 47  ? 42.788  76.680  80.732  1.00 56.90  ? 187  GLY I CA  1 
ATOM   8299  C C   . GLY M  1 47  ? 42.011  76.690  79.432  1.00 57.31  ? 187  GLY I C   1 
ATOM   8300  O O   . GLY M  1 47  ? 42.429  77.310  78.444  1.00 53.32  ? 187  GLY I O   1 
ATOM   8301  N N   . ALA M  1 48  ? 40.866  76.012  79.451  1.00 54.89  ? 188  ALA I N   1 
ATOM   8302  C CA  . ALA M  1 48  ? 40.012  75.904  78.282  1.00 57.73  ? 188  ALA I CA  1 
ATOM   8303  C C   . ALA M  1 48  ? 39.700  77.275  77.693  1.00 57.10  ? 188  ALA I C   1 
ATOM   8304  O O   . ALA M  1 48  ? 39.798  77.479  76.475  1.00 51.66  ? 188  ALA I O   1 
ATOM   8305  C CB  . ALA M  1 48  ? 38.721  75.164  78.651  1.00 56.74  ? 188  ALA I CB  1 
ATOM   8306  N N   . LEU M  1 49  ? 39.320  78.209  78.562  1.00 58.02  ? 189  LEU I N   1 
ATOM   8307  C CA  . LEU M  1 49  ? 38.992  79.561  78.126  1.00 59.74  ? 189  LEU I CA  1 
ATOM   8308  C C   . LEU M  1 49  ? 40.184  80.166  77.394  1.00 67.77  ? 189  LEU I C   1 
ATOM   8309  O O   . LEU M  1 49  ? 40.068  80.616  76.233  1.00 64.68  ? 189  LEU I O   1 
ATOM   8310  C CB  . LEU M  1 49  ? 38.623  80.409  79.334  1.00 49.36  ? 189  LEU I CB  1 
ATOM   8311  C CG  . LEU M  1 49  ? 37.215  80.145  79.835  1.00 51.14  ? 189  LEU I CG  1 
ATOM   8312  C CD1 . LEU M  1 49  ? 36.979  80.817  81.175  1.00 48.04  ? 189  LEU I CD1 1 
ATOM   8313  C CD2 . LEU M  1 49  ? 36.254  80.675  78.791  1.00 52.10  ? 189  LEU I CD2 1 
ATOM   8314  N N   . THR M  1 50  ? 41.332  80.153  78.078  1.00 68.80  ? 190  THR I N   1 
ATOM   8315  C CA  . THR M  1 50  ? 42.574  80.687  77.532  1.00 68.10  ? 190  THR I CA  1 
ATOM   8316  C C   . THR M  1 50  ? 42.857  80.149  76.143  1.00 64.86  ? 190  THR I C   1 
ATOM   8317  O O   . THR M  1 50  ? 43.084  80.923  75.208  1.00 60.95  ? 190  THR I O   1 
ATOM   8318  C CB  . THR M  1 50  ? 43.770  80.313  78.389  1.00 71.06  ? 190  THR I CB  1 
ATOM   8319  O OG1 . THR M  1 50  ? 43.459  80.528  79.767  1.00 73.29  ? 190  THR I OG1 1 
ATOM   8320  C CG2 . THR M  1 50  ? 44.955  81.179  78.007  1.00 75.75  ? 190  THR I CG2 1 
ATOM   8321  N N   . THR M  1 51  ? 42.852  78.821  76.029  1.00 61.14  ? 191  THR I N   1 
ATOM   8322  C CA  . THR M  1 51  ? 43.112  78.153  74.761  1.00 61.05  ? 191  THR I CA  1 
ATOM   8323  C C   . THR M  1 51  ? 42.129  78.605  73.699  1.00 60.37  ? 191  THR I C   1 
ATOM   8324  O O   . THR M  1 51  ? 42.510  79.042  72.619  1.00 64.83  ? 191  THR I O   1 
ATOM   8325  C CB  . THR M  1 51  ? 42.967  76.632  74.880  1.00 60.22  ? 191  THR I CB  1 
ATOM   8326  O OG1 . THR M  1 51  ? 43.781  76.140  75.954  1.00 61.61  ? 191  THR I OG1 1 
ATOM   8327  C CG2 . THR M  1 51  ? 43.372  75.970  73.570  1.00 58.31  ? 191  THR I CG2 1 
ATOM   8328  N N   . THR M  1 52  ? 40.854  78.498  74.028  1.00 62.19  ? 192  THR I N   1 
ATOM   8329  C CA  . THR M  1 52  ? 39.793  78.842  73.108  1.00 61.45  ? 192  THR I CA  1 
ATOM   8330  C C   . THR M  1 52  ? 39.872  80.269  72.605  1.00 59.63  ? 192  THR I C   1 
ATOM   8331  O O   . THR M  1 52  ? 39.904  80.508  71.398  1.00 54.93  ? 192  THR I O   1 
ATOM   8332  C CB  . THR M  1 52  ? 38.414  78.630  73.765  1.00 65.42  ? 192  THR I CB  1 
ATOM   8333  O OG1 . THR M  1 52  ? 38.358  77.331  74.371  1.00 63.52  ? 192  THR I OG1 1 
ATOM   8334  C CG2 . THR M  1 52  ? 37.316  78.743  72.723  1.00 65.92  ? 192  THR I CG2 1 
ATOM   8335  N N   . PHE M  1 53  ? 39.900  81.226  73.523  1.00 61.92  ? 193  PHE I N   1 
ATOM   8336  C CA  . PHE M  1 53  ? 39.931  82.608  73.092  1.00 65.64  ? 193  PHE I CA  1 
ATOM   8337  C C   . PHE M  1 53  ? 41.265  83.016  72.527  1.00 69.62  ? 193  PHE I C   1 
ATOM   8338  O O   . PHE M  1 53  ? 41.352  83.951  71.729  1.00 71.73  ? 193  PHE I O   1 
ATOM   8339  C CB  . PHE M  1 53  ? 39.487  83.522  74.221  1.00 60.82  ? 193  PHE I CB  1 
ATOM   8340  C CG  . PHE M  1 53  ? 38.012  83.500  74.430  1.00 60.11  ? 193  PHE I CG  1 
ATOM   8341  C CD1 . PHE M  1 53  ? 37.166  84.048  73.473  1.00 56.44  ? 193  PHE I CD1 1 
ATOM   8342  C CD2 . PHE M  1 53  ? 37.457  82.853  75.534  1.00 61.70  ? 193  PHE I CD2 1 
ATOM   8343  C CE1 . PHE M  1 53  ? 35.785  83.949  73.603  1.00 64.30  ? 193  PHE I CE1 1 
ATOM   8344  C CE2 . PHE M  1 53  ? 36.077  82.746  75.677  1.00 61.21  ? 193  PHE I CE2 1 
ATOM   8345  C CZ  . PHE M  1 53  ? 35.236  83.295  74.706  1.00 63.31  ? 193  PHE I CZ  1 
ATOM   8346  N N   . GLU M  1 54  ? 42.307  82.299  72.924  1.00 69.84  ? 194  GLU I N   1 
ATOM   8347  C CA  . GLU M  1 54  ? 43.622  82.582  72.397  1.00 74.24  ? 194  GLU I CA  1 
ATOM   8348  C C   . GLU M  1 54  ? 43.505  82.226  70.905  1.00 75.22  ? 194  GLU I C   1 
ATOM   8349  O O   . GLU M  1 54  ? 43.862  83.024  70.031  1.00 75.21  ? 194  GLU I O   1 
ATOM   8350  C CB  . GLU M  1 54  ? 44.669  81.705  73.095  1.00 78.61  ? 194  GLU I CB  1 
ATOM   8351  C CG  . GLU M  1 54  ? 46.041  82.368  73.280  1.00 85.99  ? 194  GLU I CG  1 
ATOM   8352  C CD  . GLU M  1 54  ? 46.979  81.554  74.171  1.00 88.61  ? 194  GLU I CD  1 
ATOM   8353  O OE1 . GLU M  1 54  ? 47.279  80.394  73.816  1.00 91.34  ? 194  GLU I OE1 1 
ATOM   8354  O OE2 . GLU M  1 54  ? 47.416  82.071  75.228  1.00 86.67  ? 194  GLU I OE2 1 
ATOM   8355  N N   . GLU M  1 55  ? 42.966  81.041  70.619  1.00 73.46  ? 195  GLU I N   1 
ATOM   8356  C CA  . GLU M  1 55  ? 42.797  80.587  69.237  1.00 72.65  ? 195  GLU I CA  1 
ATOM   8357  C C   . GLU M  1 55  ? 41.929  81.554  68.435  1.00 73.39  ? 195  GLU I C   1 
ATOM   8358  O O   . GLU M  1 55  ? 42.007  81.595  67.205  1.00 69.90  ? 195  GLU I O   1 
ATOM   8359  C CB  . GLU M  1 55  ? 42.149  79.198  69.187  1.00 72.77  ? 195  GLU I CB  1 
ATOM   8360  C CG  . GLU M  1 55  ? 42.891  78.097  69.918  1.00 80.73  ? 195  GLU I CG  1 
ATOM   8361  C CD  . GLU M  1 55  ? 42.155  76.762  69.856  1.00 87.95  ? 195  GLU I CD  1 
ATOM   8362  O OE1 . GLU M  1 55  ? 41.260  76.600  68.996  1.00 86.87  ? 195  GLU I OE1 1 
ATOM   8363  O OE2 . GLU M  1 55  ? 42.477  75.867  70.670  1.00 94.44  ? 195  GLU I OE2 1 
ATOM   8364  N N   . LEU M  1 56  ? 41.090  82.317  69.132  1.00 73.37  ? 196  LEU I N   1 
ATOM   8365  C CA  . LEU M  1 56  ? 40.213  83.273  68.469  1.00 73.12  ? 196  LEU I CA  1 
ATOM   8366  C C   . LEU M  1 56  ? 40.872  84.632  68.337  1.00 75.31  ? 196  LEU I C   1 
ATOM   8367  O O   . LEU M  1 56  ? 40.233  85.616  67.944  1.00 73.62  ? 196  LEU I O   1 
ATOM   8368  C CB  . LEU M  1 56  ? 38.911  83.398  69.235  1.00 76.00  ? 196  LEU I CB  1 
ATOM   8369  C CG  . LEU M  1 56  ? 38.018  82.170  69.111  1.00 76.26  ? 196  LEU I CG  1 
ATOM   8370  C CD1 . LEU M  1 56  ? 36.737  82.405  69.895  1.00 78.63  ? 196  LEU I CD1 1 
ATOM   8371  C CD2 . LEU M  1 56  ? 37.709  81.915  67.636  1.00 79.38  ? 196  LEU I CD2 1 
ATOM   8372  N N   . HIS M  1 57  ? 42.161  84.661  68.674  1.00 78.05  ? 197  HIS I N   1 
ATOM   8373  C CA  . HIS M  1 57  ? 42.999  85.859  68.596  1.00 78.92  ? 197  HIS I CA  1 
ATOM   8374  C C   . HIS M  1 57  ? 42.718  86.924  69.659  1.00 75.17  ? 197  HIS I C   1 
ATOM   8375  O O   . HIS M  1 57  ? 42.707  88.115  69.361  1.00 71.75  ? 197  HIS I O   1 
ATOM   8376  C CB  . HIS M  1 57  ? 42.894  86.486  67.198  1.00 81.44  ? 197  HIS I CB  1 
ATOM   8377  C CG  . HIS M  1 57  ? 43.155  85.519  66.084  1.00 86.74  ? 197  HIS I CG  1 
ATOM   8378  N ND1 . HIS M  1 57  ? 44.226  84.649  66.089  1.00 90.44  ? 197  HIS I ND1 1 
ATOM   8379  C CD2 . HIS M  1 57  ? 42.482  85.280  64.932  1.00 85.35  ? 197  HIS I CD2 1 
ATOM   8380  C CE1 . HIS M  1 57  ? 44.201  83.916  64.990  1.00 89.53  ? 197  HIS I CE1 1 
ATOM   8381  N NE2 . HIS M  1 57  ? 43.153  84.279  64.271  1.00 89.84  ? 197  HIS I NE2 1 
ATOM   8382  N N   . PHE M  1 58  ? 42.496  86.492  70.896  1.00 73.42  ? 198  PHE I N   1 
ATOM   8383  C CA  . PHE M  1 58  ? 42.237  87.413  72.002  1.00 72.36  ? 198  PHE I CA  1 
ATOM   8384  C C   . PHE M  1 58  ? 43.433  87.382  72.935  1.00 73.60  ? 198  PHE I C   1 
ATOM   8385  O O   . PHE M  1 58  ? 44.096  86.343  73.069  1.00 72.99  ? 198  PHE I O   1 
ATOM   8386  C CB  . PHE M  1 58  ? 40.977  87.001  72.788  1.00 69.02  ? 198  PHE I CB  1 
ATOM   8387  C CG  . PHE M  1 58  ? 39.699  87.552  72.216  1.00 64.14  ? 198  PHE I CG  1 
ATOM   8388  C CD1 . PHE M  1 58  ? 39.150  87.029  71.053  1.00 60.29  ? 198  PHE I CD1 1 
ATOM   8389  C CD2 . PHE M  1 58  ? 39.078  88.649  72.808  1.00 60.70  ? 198  PHE I CD2 1 
ATOM   8390  C CE1 . PHE M  1 58  ? 37.999  87.602  70.487  1.00 58.92  ? 198  PHE I CE1 1 
ATOM   8391  C CE2 . PHE M  1 58  ? 37.930  89.225  72.247  1.00 55.90  ? 198  PHE I CE2 1 
ATOM   8392  C CZ  . PHE M  1 58  ? 37.392  88.702  71.087  1.00 49.08  ? 198  PHE I CZ  1 
ATOM   8393  N N   . GLU M  1 59  ? 43.719  88.509  73.580  1.00 72.68  ? 199  GLU I N   1 
ATOM   8394  C CA  . GLU M  1 59  ? 44.848  88.547  74.504  1.00 72.06  ? 199  GLU I CA  1 
ATOM   8395  C C   . GLU M  1 59  ? 44.345  88.236  75.902  1.00 65.54  ? 199  GLU I C   1 
ATOM   8396  O O   . GLU M  1 59  ? 43.776  89.093  76.579  1.00 61.26  ? 199  GLU I O   1 
ATOM   8397  C CB  . GLU M  1 59  ? 45.548  89.912  74.472  1.00 78.60  ? 199  GLU I CB  1 
ATOM   8398  C CG  . GLU M  1 59  ? 46.694  90.029  75.472  1.00 85.63  ? 199  GLU I CG  1 
ATOM   8399  C CD  . GLU M  1 59  ? 47.624  91.184  75.168  1.00 93.16  ? 199  GLU I CD  1 
ATOM   8400  O OE1 . GLU M  1 59  ? 47.715  91.577  73.983  1.00 94.71  ? 199  GLU I OE1 1 
ATOM   8401  O OE2 . GLU M  1 59  ? 48.275  91.689  76.110  1.00 95.33  ? 199  GLU I OE2 1 
ATOM   8402  N N   . ILE M  1 60  ? 44.565  86.994  76.321  1.00 60.46  ? 200  ILE I N   1 
ATOM   8403  C CA  . ILE M  1 60  ? 44.111  86.529  77.622  1.00 60.73  ? 200  ILE I CA  1 
ATOM   8404  C C   . ILE M  1 60  ? 44.797  87.281  78.742  1.00 58.45  ? 200  ILE I C   1 
ATOM   8405  O O   . ILE M  1 60  ? 45.964  87.612  78.635  1.00 64.67  ? 200  ILE I O   1 
ATOM   8406  C CB  . ILE M  1 60  ? 44.382  85.015  77.784  1.00 61.91  ? 200  ILE I CB  1 
ATOM   8407  C CG1 . ILE M  1 60  ? 44.027  84.276  76.485  1.00 63.33  ? 200  ILE I CG1 1 
ATOM   8408  C CG2 . ILE M  1 60  ? 43.570  84.460  78.936  1.00 62.25  ? 200  ILE I CG2 1 
ATOM   8409  C CD1 . ILE M  1 60  ? 42.693  84.683  75.862  1.00 65.47  ? 200  ILE I CD1 1 
ATOM   8410  N N   . LYS M  1 61  ? 44.068  87.545  79.815  1.00 55.01  ? 201  LYS I N   1 
ATOM   8411  C CA  . LYS M  1 61  ? 44.615  88.256  80.961  1.00 53.10  ? 201  LYS I CA  1 
ATOM   8412  C C   . LYS M  1 61  ? 44.095  87.647  82.258  1.00 55.69  ? 201  LYS I C   1 
ATOM   8413  O O   . LYS M  1 61  ? 43.166  88.181  82.882  1.00 57.02  ? 201  LYS I O   1 
ATOM   8414  C CB  . LYS M  1 61  ? 44.217  89.728  80.889  1.00 54.11  ? 201  LYS I CB  1 
ATOM   8415  C CG  . LYS M  1 61  ? 44.974  90.524  79.836  1.00 63.96  ? 201  LYS I CG  1 
ATOM   8416  C CD  . LYS M  1 61  ? 46.417  90.807  80.271  1.00 68.88  ? 201  LYS I CD  1 
ATOM   8417  C CE  . LYS M  1 61  ? 47.271  91.396  79.142  1.00 59.94  ? 201  LYS I CE  1 
ATOM   8418  N NZ  . LYS M  1 61  ? 48.648  91.735  79.613  1.00 63.67  ? 201  LYS I NZ  1 
ATOM   8419  N N   . PRO M  1 62  ? 44.688  86.520  82.682  1.00 53.91  ? 202  PRO I N   1 
ATOM   8420  C CA  . PRO M  1 62  ? 44.291  85.820  83.911  1.00 53.96  ? 202  PRO I CA  1 
ATOM   8421  C C   . PRO M  1 62  ? 44.548  86.592  85.184  1.00 58.36  ? 202  PRO I C   1 
ATOM   8422  O O   . PRO M  1 62  ? 45.370  87.511  85.222  1.00 57.31  ? 202  PRO I O   1 
ATOM   8423  C CB  . PRO M  1 62  ? 45.111  84.544  83.865  1.00 54.96  ? 202  PRO I CB  1 
ATOM   8424  C CG  . PRO M  1 62  ? 46.337  84.975  83.144  1.00 59.57  ? 202  PRO I CG  1 
ATOM   8425  C CD  . PRO M  1 62  ? 45.798  85.823  82.016  1.00 50.52  ? 202  PRO I CD  1 
ATOM   8426  N N   . HIS M  1 63  ? 43.833  86.189  86.228  1.00 63.64  ? 203  HIS I N   1 
ATOM   8427  C CA  . HIS M  1 63  ? 43.921  86.776  87.566  1.00 66.79  ? 203  HIS I CA  1 
ATOM   8428  C C   . HIS M  1 63  ? 43.400  85.689  88.466  1.00 65.56  ? 203  HIS I C   1 
ATOM   8429  O O   . HIS M  1 63  ? 42.372  85.097  88.165  1.00 74.29  ? 203  HIS I O   1 
ATOM   8430  C CB  . HIS M  1 63  ? 43.036  88.010  87.673  1.00 64.65  ? 203  HIS I CB  1 
ATOM   8431  C CG  . HIS M  1 63  ? 43.568  89.183  86.918  1.00 72.92  ? 203  HIS I CG  1 
ATOM   8432  N ND1 . HIS M  1 63  ? 44.485  90.060  87.457  1.00 71.46  ? 203  HIS I ND1 1 
ATOM   8433  C CD2 . HIS M  1 63  ? 43.351  89.596  85.646  1.00 73.60  ? 203  HIS I CD2 1 
ATOM   8434  C CE1 . HIS M  1 63  ? 44.808  90.965  86.552  1.00 74.90  ? 203  HIS I CE1 1 
ATOM   8435  N NE2 . HIS M  1 63  ? 44.135  90.707  85.444  1.00 81.11  ? 203  HIS I NE2 1 
ATOM   8436  N N   . HIS M  1 64  ? 44.091  85.414  89.563  1.00 66.40  ? 204  HIS I N   1 
ATOM   8437  C CA  . HIS M  1 64  ? 43.648  84.341  90.444  1.00 67.05  ? 204  HIS I CA  1 
ATOM   8438  C C   . HIS M  1 64  ? 43.279  84.738  91.860  1.00 63.65  ? 204  HIS I C   1 
ATOM   8439  O O   . HIS M  1 64  ? 43.832  85.673  92.424  1.00 65.00  ? 204  HIS I O   1 
ATOM   8440  C CB  . HIS M  1 64  ? 44.715  83.252  90.465  1.00 65.48  ? 204  HIS I CB  1 
ATOM   8441  C CG  . HIS M  1 64  ? 45.005  82.690  89.112  1.00 72.93  ? 204  HIS I CG  1 
ATOM   8442  N ND1 . HIS M  1 64  ? 44.236  81.701  88.535  1.00 77.08  ? 204  HIS I ND1 1 
ATOM   8443  C CD2 . HIS M  1 64  ? 45.946  83.021  88.196  1.00 76.57  ? 204  HIS I CD2 1 
ATOM   8444  C CE1 . HIS M  1 64  ? 44.694  81.445  87.321  1.00 79.99  ? 204  HIS I CE1 1 
ATOM   8445  N NE2 . HIS M  1 64  ? 45.730  82.232  87.090  1.00 81.25  ? 204  HIS I NE2 1 
ATOM   8446  N N   . ASP M  1 65  ? 42.314  84.011  92.410  1.00 64.30  ? 205  ASP I N   1 
ATOM   8447  C CA  . ASP M  1 65  ? 41.838  84.218  93.769  1.00 67.44  ? 205  ASP I CA  1 
ATOM   8448  C C   . ASP M  1 65  ? 41.707  85.691  94.146  1.00 64.18  ? 205  ASP I C   1 
ATOM   8449  O O   . ASP M  1 65  ? 42.157  86.121  95.207  1.00 64.42  ? 205  ASP I O   1 
ATOM   8450  C CB  . ASP M  1 65  ? 42.778  83.488  94.731  1.00 69.24  ? 205  ASP I CB  1 
ATOM   8451  C CG  . ASP M  1 65  ? 42.835  81.995  94.456  1.00 75.60  ? 205  ASP I CG  1 
ATOM   8452  O OD1 . ASP M  1 65  ? 41.838  81.302  94.749  1.00 81.53  ? 205  ASP I OD1 1 
ATOM   8453  O OD2 . ASP M  1 65  ? 43.862  81.514  93.934  1.00 78.41  ? 205  ASP I OD2 1 
ATOM   8454  N N   . CYS M  1 66  ? 41.070  86.457  93.277  1.00 56.65  ? 206  CYS I N   1 
ATOM   8455  C CA  . CYS M  1 66  ? 40.892  87.875  93.524  1.00 60.47  ? 206  CYS I CA  1 
ATOM   8456  C C   . CYS M  1 66  ? 39.772  88.090  94.539  1.00 58.96  ? 206  CYS I C   1 
ATOM   8457  O O   . CYS M  1 66  ? 38.827  87.307  94.599  1.00 55.14  ? 206  CYS I O   1 
ATOM   8458  C CB  . CYS M  1 66  ? 40.533  88.594  92.214  1.00 61.24  ? 206  CYS I CB  1 
ATOM   8459  S SG  . CYS M  1 66  ? 41.587  88.176  90.803  1.00 72.99  ? 206  CYS I SG  1 
ATOM   8460  N N   . THR M  1 67  ? 39.887  89.138  95.348  1.00 58.39  ? 207  THR I N   1 
ATOM   8461  C CA  . THR M  1 67  ? 38.838  89.466  96.310  1.00 59.76  ? 207  THR I CA  1 
ATOM   8462  C C   . THR M  1 67  ? 37.950  90.480  95.610  1.00 60.96  ? 207  THR I C   1 
ATOM   8463  O O   . THR M  1 67  ? 38.279  90.934  94.509  1.00 63.71  ? 207  THR I O   1 
ATOM   8464  C CB  . THR M  1 67  ? 39.386  90.120  97.583  1.00 57.76  ? 207  THR I CB  1 
ATOM   8465  O OG1 . THR M  1 67  ? 39.904  91.423  97.278  1.00 58.28  ? 207  THR I OG1 1 
ATOM   8466  C CG2 . THR M  1 67  ? 40.469  89.252  98.173  1.00 56.57  ? 207  THR I CG2 1 
ATOM   8467  N N   . VAL M  1 68  ? 36.832  90.839  96.231  1.00 58.94  ? 208  VAL I N   1 
ATOM   8468  C CA  . VAL M  1 68  ? 35.935  91.804  95.615  1.00 59.19  ? 208  VAL I CA  1 
ATOM   8469  C C   . VAL M  1 68  ? 36.759  93.031  95.316  1.00 62.66  ? 208  VAL I C   1 
ATOM   8470  O O   . VAL M  1 68  ? 36.753  93.553  94.191  1.00 63.30  ? 208  VAL I O   1 
ATOM   8471  C CB  . VAL M  1 68  ? 34.774  92.190  96.550  1.00 51.92  ? 208  VAL I CB  1 
ATOM   8472  C CG1 . VAL M  1 68  ? 34.063  93.404  96.028  1.00 45.05  ? 208  VAL I CG1 1 
ATOM   8473  C CG2 . VAL M  1 68  ? 33.798  91.050  96.639  1.00 54.93  ? 208  VAL I CG2 1 
ATOM   8474  N N   . GLU M  1 69  ? 37.484  93.467  96.339  1.00 63.53  ? 209  GLU I N   1 
ATOM   8475  C CA  . GLU M  1 69  ? 38.345  94.634  96.242  1.00 68.66  ? 209  GLU I CA  1 
ATOM   8476  C C   . GLU M  1 69  ? 39.175  94.553  94.971  1.00 64.17  ? 209  GLU I C   1 
ATOM   8477  O O   . GLU M  1 69  ? 39.123  95.432  94.104  1.00 60.46  ? 209  GLU I O   1 
ATOM   8478  C CB  . GLU M  1 69  ? 39.272  94.675  97.456  1.00 75.96  ? 209  GLU I CB  1 
ATOM   8479  C CG  . GLU M  1 69  ? 40.061  95.964  97.605  1.00 89.83  ? 209  GLU I CG  1 
ATOM   8480  C CD  . GLU M  1 69  ? 39.165  97.168  97.890  1.00 100.00 ? 209  GLU I CD  1 
ATOM   8481  O OE1 . GLU M  1 69  ? 38.237  97.430  97.079  1.00 100.00 ? 209  GLU I OE1 1 
ATOM   8482  O OE2 . GLU M  1 69  ? 39.393  97.854  98.921  1.00 100.00 ? 209  GLU I OE2 1 
ATOM   8483  N N   . GLN M  1 70  ? 39.931  93.469  94.871  1.00 60.78  ? 210  GLN I N   1 
ATOM   8484  C CA  . GLN M  1 70  ? 40.800  93.225  93.733  1.00 59.46  ? 210  GLN I CA  1 
ATOM   8485  C C   . GLN M  1 70  ? 40.081  93.182  92.377  1.00 62.35  ? 210  GLN I C   1 
ATOM   8486  O O   . GLN M  1 70  ? 40.596  93.685  91.368  1.00 56.38  ? 210  GLN I O   1 
ATOM   8487  C CB  . GLN M  1 70  ? 41.548  91.926  93.971  1.00 54.29  ? 210  GLN I CB  1 
ATOM   8488  C CG  . GLN M  1 70  ? 42.273  91.915  95.293  1.00 62.43  ? 210  GLN I CG  1 
ATOM   8489  C CD  . GLN M  1 70  ? 42.990  90.610  95.533  1.00 72.17  ? 210  GLN I CD  1 
ATOM   8490  O OE1 . GLN M  1 70  ? 43.803  90.173  94.713  1.00 71.60  ? 210  GLN I OE1 1 
ATOM   8491  N NE2 . GLN M  1 70  ? 42.692  89.971  96.661  1.00 76.97  ? 210  GLN I NE2 1 
ATOM   8492  N N   . ILE M  1 71  ? 38.895  92.582  92.355  1.00 61.33  ? 211  ILE I N   1 
ATOM   8493  C CA  . ILE M  1 71  ? 38.132  92.484  91.123  1.00 61.41  ? 211  ILE I CA  1 
ATOM   8494  C C   . ILE M  1 71  ? 37.799  93.883  90.620  1.00 60.23  ? 211  ILE I C   1 
ATOM   8495  O O   . ILE M  1 71  ? 38.109  94.236  89.477  1.00 56.64  ? 211  ILE I O   1 
ATOM   8496  C CB  . ILE M  1 71  ? 36.832  91.660  91.344  1.00 61.65  ? 211  ILE I CB  1 
ATOM   8497  C CG1 . ILE M  1 71  ? 37.201  90.193  91.533  1.00 58.66  ? 211  ILE I CG1 1 
ATOM   8498  C CG2 . ILE M  1 71  ? 35.876  91.805  90.155  1.00 58.91  ? 211  ILE I CG2 1 
ATOM   8499  C CD1 . ILE M  1 71  ? 36.040  89.334  91.936  1.00 51.93  ? 211  ILE I CD1 1 
ATOM   8500  N N   . TYR M  1 72  ? 37.173  94.678  91.477  1.00 57.75  ? 212  TYR I N   1 
ATOM   8501  C CA  . TYR M  1 72  ? 36.819  96.029  91.094  1.00 60.67  ? 212  TYR I CA  1 
ATOM   8502  C C   . TYR M  1 72  ? 38.049  96.748  90.539  1.00 61.96  ? 212  TYR I C   1 
ATOM   8503  O O   . TYR M  1 72  ? 37.980  97.408  89.493  1.00 61.64  ? 212  TYR I O   1 
ATOM   8504  C CB  . TYR M  1 72  ? 36.256  96.766  92.300  1.00 61.02  ? 212  TYR I CB  1 
ATOM   8505  C CG  . TYR M  1 72  ? 34.828  96.418  92.596  1.00 58.98  ? 212  TYR I CG  1 
ATOM   8506  C CD1 . TYR M  1 72  ? 33.882  96.391  91.581  1.00 58.81  ? 212  TYR I CD1 1 
ATOM   8507  C CD2 . TYR M  1 72  ? 34.405  96.190  93.899  1.00 66.39  ? 212  TYR I CD2 1 
ATOM   8508  C CE1 . TYR M  1 72  ? 32.544  96.152  91.853  1.00 69.30  ? 212  TYR I CE1 1 
ATOM   8509  C CE2 . TYR M  1 72  ? 33.063  95.950  94.188  1.00 71.79  ? 212  TYR I CE2 1 
ATOM   8510  C CZ  . TYR M  1 72  ? 32.137  95.935  93.159  1.00 72.62  ? 212  TYR I CZ  1 
ATOM   8511  O OH  . TYR M  1 72  ? 30.804  95.719  93.431  1.00 79.82  ? 212  TYR I OH  1 
ATOM   8512  N N   . GLU M  1 73  ? 39.173  96.595  91.240  1.00 59.22  ? 213  GLU I N   1 
ATOM   8513  C CA  . GLU M  1 73  ? 40.429  97.208  90.840  1.00 56.97  ? 213  GLU I CA  1 
ATOM   8514  C C   . GLU M  1 73  ? 40.783  96.826  89.420  1.00 51.45  ? 213  GLU I C   1 
ATOM   8515  O O   . GLU M  1 73  ? 41.050  97.691  88.581  1.00 43.81  ? 213  GLU I O   1 
ATOM   8516  C CB  . GLU M  1 73  ? 41.556  96.759  91.764  1.00 67.80  ? 213  GLU I CB  1 
ATOM   8517  C CG  . GLU M  1 73  ? 41.743  97.596  93.034  1.00 86.31  ? 213  GLU I CG  1 
ATOM   8518  C CD  . GLU M  1 73  ? 42.837  97.025  93.954  1.00 97.38  ? 213  GLU I CD  1 
ATOM   8519  O OE1 . GLU M  1 73  ? 43.870  96.543  93.417  1.00 100.00 ? 213  GLU I OE1 1 
ATOM   8520  O OE2 . GLU M  1 73  ? 42.671  97.063  95.205  1.00 98.55  ? 213  GLU I OE2 1 
ATOM   8521  N N   . ILE M  1 74  ? 40.792  95.519  89.160  1.00 53.42  ? 214  ILE I N   1 
ATOM   8522  C CA  . ILE M  1 74  ? 41.111  94.989  87.829  1.00 48.11  ? 214  ILE I CA  1 
ATOM   8523  C C   . ILE M  1 74  ? 40.180  95.522  86.732  1.00 48.21  ? 214  ILE I C   1 
ATOM   8524  O O   . ILE M  1 74  ? 40.626  95.861  85.632  1.00 44.93  ? 214  ILE I O   1 
ATOM   8525  C CB  . ILE M  1 74  ? 41.052  93.479  87.821  1.00 40.31  ? 214  ILE I CB  1 
ATOM   8526  C CG1 . ILE M  1 74  ? 41.986  92.942  88.892  1.00 41.45  ? 214  ILE I CG1 1 
ATOM   8527  C CG2 . ILE M  1 74  ? 41.444  92.953  86.457  1.00 39.62  ? 214  ILE I CG2 1 
ATOM   8528  C CD1 . ILE M  1 74  ? 42.028  91.429  88.971  1.00 48.86  ? 214  ILE I CD1 1 
ATOM   8529  N N   . LEU M  1 75  ? 38.890  95.602  87.029  1.00 45.10  ? 215  LEU I N   1 
ATOM   8530  C CA  . LEU M  1 75  ? 37.960  96.131  86.054  1.00 48.83  ? 215  LEU I CA  1 
ATOM   8531  C C   . LEU M  1 75  ? 38.213  97.622  85.839  1.00 52.78  ? 215  LEU I C   1 
ATOM   8532  O O   . LEU M  1 75  ? 38.149  98.121  84.710  1.00 52.24  ? 215  LEU I O   1 
ATOM   8533  C CB  . LEU M  1 75  ? 36.525  95.869  86.504  1.00 48.20  ? 215  LEU I CB  1 
ATOM   8534  C CG  . LEU M  1 75  ? 36.196  94.363  86.589  1.00 50.76  ? 215  LEU I CG  1 
ATOM   8535  C CD1 . LEU M  1 75  ? 34.784  94.185  87.111  1.00 55.03  ? 215  LEU I CD1 1 
ATOM   8536  C CD2 . LEU M  1 75  ? 36.335  93.695  85.227  1.00 46.51  ? 215  LEU I CD2 1 
ATOM   8537  N N   . LYS M  1 76  ? 38.531  98.332  86.920  1.00 58.28  ? 216  LYS I N   1 
ATOM   8538  C CA  . LYS M  1 76  ? 38.807  99.765  86.831  1.00 54.32  ? 216  LYS I CA  1 
ATOM   8539  C C   . LYS M  1 76  ? 39.904  100.006 85.800  1.00 54.00  ? 216  LYS I C   1 
ATOM   8540  O O   . LYS M  1 76  ? 39.816  100.906 84.965  1.00 55.39  ? 216  LYS I O   1 
ATOM   8541  C CB  . LYS M  1 76  ? 39.264  100.304 88.184  1.00 54.76  ? 216  LYS I CB  1 
ATOM   8542  C CG  . LYS M  1 76  ? 39.343  101.835 88.255  1.00 60.17  ? 216  LYS I CG  1 
ATOM   8543  C CD  . LYS M  1 76  ? 37.989  102.448 87.930  1.00 68.57  ? 216  LYS I CD  1 
ATOM   8544  C CE  . LYS M  1 76  ? 37.978  103.966 88.050  1.00 75.44  ? 216  LYS I CE  1 
ATOM   8545  N NZ  . LYS M  1 76  ? 36.645  104.539 87.643  1.00 76.15  ? 216  LYS I NZ  1 
ATOM   8546  N N   . ILE M  1 77  ? 40.950  99.200  85.871  1.00 48.46  ? 217  ILE I N   1 
ATOM   8547  C CA  . ILE M  1 77  ? 42.044  99.319  84.933  1.00 47.10  ? 217  ILE I CA  1 
ATOM   8548  C C   . ILE M  1 77  ? 41.539  99.209  83.497  1.00 49.36  ? 217  ILE I C   1 
ATOM   8549  O O   . ILE M  1 77  ? 41.720  100.124 82.687  1.00 42.94  ? 217  ILE I O   1 
ATOM   8550  C CB  . ILE M  1 77  ? 43.071  98.206  85.165  1.00 48.46  ? 217  ILE I CB  1 
ATOM   8551  C CG1 . ILE M  1 77  ? 43.794  98.442  86.489  1.00 49.69  ? 217  ILE I CG1 1 
ATOM   8552  C CG2 . ILE M  1 77  ? 44.026  98.110  83.978  1.00 40.55  ? 217  ILE I CG2 1 
ATOM   8553  C CD1 . ILE M  1 77  ? 44.743  97.302  86.858  1.00 38.27  ? 217  ILE I CD1 1 
ATOM   8554  N N   . TYR M  1 78  ? 40.900  98.086  83.174  1.00 49.76  ? 218  TYR I N   1 
ATOM   8555  C CA  . TYR M  1 78  ? 40.433  97.905  81.815  1.00 41.55  ? 218  TYR I CA  1 
ATOM   8556  C C   . TYR M  1 78  ? 39.350  98.899  81.462  1.00 42.07  ? 218  TYR I C   1 
ATOM   8557  O O   . TYR M  1 78  ? 39.192  99.285  80.301  1.00 43.78  ? 218  TYR I O   1 
ATOM   8558  C CB  . TYR M  1 78  ? 39.996  96.476  81.609  1.00 29.55  ? 218  TYR I CB  1 
ATOM   8559  C CG  . TYR M  1 78  ? 41.184  95.541  81.643  1.00 40.43  ? 218  TYR I CG  1 
ATOM   8560  C CD1 . TYR M  1 78  ? 41.645  95.021  82.835  1.00 40.64  ? 218  TYR I CD1 1 
ATOM   8561  C CD2 . TYR M  1 78  ? 41.903  95.246  80.480  1.00 47.61  ? 218  TYR I CD2 1 
ATOM   8562  C CE1 . TYR M  1 78  ? 42.800  94.228  82.882  1.00 48.38  ? 218  TYR I CE1 1 
ATOM   8563  C CE2 . TYR M  1 78  ? 43.061  94.455  80.513  1.00 42.91  ? 218  TYR I CE2 1 
ATOM   8564  C CZ  . TYR M  1 78  ? 43.504  93.947  81.716  1.00 46.32  ? 218  TYR I CZ  1 
ATOM   8565  O OH  . TYR M  1 78  ? 44.629  93.141  81.761  1.00 45.85  ? 218  TYR I OH  1 
ATOM   8566  N N   . GLN M  1 79  ? 38.623  99.354  82.464  1.00 35.30  ? 219  GLN I N   1 
ATOM   8567  C CA  . GLN M  1 79  ? 37.602  100.329 82.188  1.00 39.46  ? 219  GLN I CA  1 
ATOM   8568  C C   . GLN M  1 79  ? 38.265  101.594 81.668  1.00 49.24  ? 219  GLN I C   1 
ATOM   8569  O O   . GLN M  1 79  ? 37.721  102.285 80.809  1.00 54.52  ? 219  GLN I O   1 
ATOM   8570  C CB  . GLN M  1 79  ? 36.855  100.700 83.445  1.00 45.45  ? 219  GLN I CB  1 
ATOM   8571  C CG  . GLN M  1 79  ? 35.941  101.884 83.208  1.00 47.12  ? 219  GLN I CG  1 
ATOM   8572  C CD  . GLN M  1 79  ? 35.904  102.833 84.366  1.00 49.37  ? 219  GLN I CD  1 
ATOM   8573  O OE1 . GLN M  1 79  ? 35.832  102.426 85.531  1.00 69.81  ? 219  GLN I OE1 1 
ATOM   8574  N NE2 . GLN M  1 79  ? 35.930  104.110 84.062  1.00 51.98  ? 219  GLN I NE2 1 
ATOM   8575  N N   . LEU M  1 80  ? 39.440  101.897 82.215  1.00 52.37  ? 220  LEU I N   1 
ATOM   8576  C CA  . LEU M  1 80  ? 40.174  103.103 81.855  1.00 52.62  ? 220  LEU I CA  1 
ATOM   8577  C C   . LEU M  1 80  ? 41.170  102.947 80.722  1.00 51.41  ? 220  LEU I C   1 
ATOM   8578  O O   . LEU M  1 80  ? 41.786  103.913 80.297  1.00 54.99  ? 220  LEU I O   1 
ATOM   8579  C CB  . LEU M  1 80  ? 40.895  103.652 83.086  1.00 53.52  ? 220  LEU I CB  1 
ATOM   8580  C CG  . LEU M  1 80  ? 39.966  104.082 84.215  1.00 45.03  ? 220  LEU I CG  1 
ATOM   8581  C CD1 . LEU M  1 80  ? 40.781  104.481 85.427  1.00 46.60  ? 220  LEU I CD1 1 
ATOM   8582  C CD2 . LEU M  1 80  ? 39.113  105.243 83.739  1.00 52.64  ? 220  LEU I CD2 1 
ATOM   8583  N N   . MET M  1 81  ? 41.354  101.735 80.242  1.00 45.16  ? 221  MET I N   1 
ATOM   8584  C CA  . MET M  1 81  ? 42.266  101.562 79.143  1.00 51.23  ? 221  MET I CA  1 
ATOM   8585  C C   . MET M  1 81  ? 41.700  102.157 77.858  1.00 51.12  ? 221  MET I C   1 
ATOM   8586  O O   . MET M  1 81  ? 40.548  102.576 77.806  1.00 54.54  ? 221  MET I O   1 
ATOM   8587  C CB  . MET M  1 81  ? 42.543  100.094 78.940  1.00 51.21  ? 221  MET I CB  1 
ATOM   8588  C CG  . MET M  1 81  ? 43.542  99.560  79.910  1.00 66.14  ? 221  MET I CG  1 
ATOM   8589  S SD  . MET M  1 81  ? 44.331  98.185  79.084  1.00 83.59  ? 221  MET I SD  1 
ATOM   8590  C CE  . MET M  1 81  ? 44.592  98.904  77.411  1.00 79.74  ? 221  MET I CE  1 
ATOM   8591  N N   . ASP M  1 82  ? 42.521  102.218 76.821  1.00 53.83  ? 222  ASP I N   1 
ATOM   8592  C CA  . ASP M  1 82  ? 42.055  102.738 75.549  1.00 56.13  ? 222  ASP I CA  1 
ATOM   8593  C C   . ASP M  1 82  ? 41.966  101.535 74.622  1.00 56.86  ? 222  ASP I C   1 
ATOM   8594  O O   . ASP M  1 82  ? 42.982  100.959 74.225  1.00 49.80  ? 222  ASP I O   1 
ATOM   8595  C CB  . ASP M  1 82  ? 43.021  103.784 74.988  1.00 62.05  ? 222  ASP I CB  1 
ATOM   8596  C CG  . ASP M  1 82  ? 42.602  104.283 73.617  1.00 68.07  ? 222  ASP I CG  1 
ATOM   8597  O OD1 . ASP M  1 82  ? 41.903  103.535 72.911  1.00 78.60  ? 222  ASP I OD1 1 
ATOM   8598  O OD2 . ASP M  1 82  ? 42.967  105.412 73.233  1.00 73.87  ? 222  ASP I OD2 1 
ATOM   8599  N N   . HIS M  1 83  ? 40.733  101.159 74.296  1.00 57.59  ? 224  HIS I N   1 
ATOM   8600  C CA  . HIS M  1 83  ? 40.474  100.008 73.446  1.00 60.88  ? 224  HIS I CA  1 
ATOM   8601  C C   . HIS M  1 83  ? 40.293  100.405 71.985  1.00 65.41  ? 224  HIS I C   1 
ATOM   8602  O O   . HIS M  1 83  ? 39.823  99.603  71.183  1.00 63.74  ? 224  HIS I O   1 
ATOM   8603  C CB  . HIS M  1 83  ? 39.199  99.298  73.918  1.00 58.55  ? 224  HIS I CB  1 
ATOM   8604  C CG  . HIS M  1 83  ? 39.260  98.800  75.329  1.00 50.47  ? 224  HIS I CG  1 
ATOM   8605  N ND1 . HIS M  1 83  ? 39.608  97.503  75.648  1.00 42.55  ? 224  HIS I ND1 1 
ATOM   8606  C CD2 . HIS M  1 83  ? 39.062  99.442  76.507  1.00 44.05  ? 224  HIS I CD2 1 
ATOM   8607  C CE1 . HIS M  1 83  ? 39.630  97.371  76.962  1.00 42.30  ? 224  HIS I CE1 1 
ATOM   8608  N NE2 . HIS M  1 83  ? 39.303  98.533  77.506  1.00 44.14  ? 224  HIS I NE2 1 
ATOM   8609  N N   . SER M  1 84  ? 40.671  101.631 71.638  1.00 65.61  ? 225  SER I N   1 
ATOM   8610  C CA  . SER M  1 84  ? 40.493  102.128 70.275  1.00 59.11  ? 225  SER I CA  1 
ATOM   8611  C C   . SER M  1 84  ? 40.930  101.210 69.153  1.00 61.35  ? 225  SER I C   1 
ATOM   8612  O O   . SER M  1 84  ? 40.310  101.206 68.084  1.00 64.48  ? 225  SER I O   1 
ATOM   8613  C CB  . SER M  1 84  ? 41.170  103.482 70.117  1.00 54.22  ? 225  SER I CB  1 
ATOM   8614  O OG  . SER M  1 84  ? 40.534  104.457 70.946  1.00 50.19  ? 225  SER I OG  1 
ATOM   8615  N N   . ASN M  1 85  ? 41.976  100.420 69.383  1.00 64.14  ? 226  ASN I N   1 
ATOM   8616  C CA  . ASN M  1 85  ? 42.464  99.516  68.340  1.00 67.04  ? 226  ASN I CA  1 
ATOM   8617  C C   . ASN M  1 85  ? 42.012  98.102  68.590  1.00 64.78  ? 226  ASN I C   1 
ATOM   8618  O O   . ASN M  1 85  ? 42.613  97.140  68.104  1.00 62.36  ? 226  ASN I O   1 
ATOM   8619  C CB  . ASN M  1 85  ? 43.991  99.545  68.267  1.00 73.50  ? 226  ASN I CB  1 
ATOM   8620  C CG  . ASN M  1 85  ? 44.529  100.852 67.714  1.00 72.54  ? 226  ASN I CG  1 
ATOM   8621  O OD1 . ASN M  1 85  ? 45.732  101.090 67.771  1.00 77.27  ? 226  ASN I OD1 1 
ATOM   8622  N ND2 . ASN M  1 85  ? 43.646  101.700 67.173  1.00 68.77  ? 226  ASN I ND2 1 
ATOM   8623  N N   . MET M  1 86  ? 40.947  97.991  69.368  1.00 67.20  ? 227  MET I N   1 
ATOM   8624  C CA  . MET M  1 86  ? 40.372  96.705  69.713  1.00 62.84  ? 227  MET I CA  1 
ATOM   8625  C C   . MET M  1 86  ? 38.938  96.630  69.167  1.00 60.63  ? 227  MET I C   1 
ATOM   8626  O O   . MET M  1 86  ? 38.210  97.625  69.113  1.00 52.60  ? 227  MET I O   1 
ATOM   8627  C CB  . MET M  1 86  ? 40.404  96.545  71.232  1.00 59.07  ? 227  MET I CB  1 
ATOM   8628  C CG  . MET M  1 86  ? 41.772  96.795  71.811  1.00 51.10  ? 227  MET I CG  1 
ATOM   8629  S SD  . MET M  1 86  ? 42.919  95.499  71.281  1.00 57.64  ? 227  MET I SD  1 
ATOM   8630  C CE  . MET M  1 86  ? 43.576  94.983  72.906  1.00 49.64  ? 227  MET I CE  1 
ATOM   8631  N N   . ASP M  1 87  ? 38.539  95.442  68.746  1.00 63.59  ? 228  ASP I N   1 
ATOM   8632  C CA  . ASP M  1 87  ? 37.206  95.264  68.201  1.00 68.33  ? 228  ASP I CA  1 
ATOM   8633  C C   . ASP M  1 87  ? 36.203  94.675  69.189  1.00 66.83  ? 228  ASP I C   1 
ATOM   8634  O O   . ASP M  1 87  ? 34.997  94.758  68.982  1.00 69.49  ? 228  ASP I O   1 
ATOM   8635  C CB  . ASP M  1 87  ? 37.276  94.378  66.956  1.00 68.76  ? 228  ASP I CB  1 
ATOM   8636  C CG  . ASP M  1 87  ? 37.729  95.141  65.731  1.00 70.89  ? 228  ASP I CG  1 
ATOM   8637  O OD1 . ASP M  1 87  ? 37.463  96.366  65.684  1.00 68.07  ? 228  ASP I OD1 1 
ATOM   8638  O OD2 . ASP M  1 87  ? 38.327  94.523  64.816  1.00 69.54  ? 228  ASP I OD2 1 
ATOM   8639  N N   . CYS M  1 88  ? 36.703  94.104  70.272  1.00 62.00  ? 229  CYS I N   1 
ATOM   8640  C CA  . CYS M  1 88  ? 35.838  93.470  71.237  1.00 61.98  ? 229  CYS I CA  1 
ATOM   8641  C C   . CYS M  1 88  ? 36.527  93.395  72.600  1.00 65.35  ? 229  CYS I C   1 
ATOM   8642  O O   . CYS M  1 88  ? 37.743  93.530  72.694  1.00 69.60  ? 229  CYS I O   1 
ATOM   8643  C CB  . CYS M  1 88  ? 35.516  92.062  70.722  1.00 57.06  ? 229  CYS I CB  1 
ATOM   8644  S SG  . CYS M  1 88  ? 34.567  91.017  71.796  1.00 59.58  ? 229  CYS I SG  1 
ATOM   8645  N N   . PHE M  1 89  ? 35.736  93.196  73.652  1.00 64.12  ? 230  PHE I N   1 
ATOM   8646  C CA  . PHE M  1 89  ? 36.242  93.048  75.016  1.00 56.99  ? 230  PHE I CA  1 
ATOM   8647  C C   . PHE M  1 89  ? 35.482  91.890  75.667  1.00 54.94  ? 230  PHE I C   1 
ATOM   8648  O O   . PHE M  1 89  ? 34.272  91.771  75.516  1.00 53.23  ? 230  PHE I O   1 
ATOM   8649  C CB  . PHE M  1 89  ? 36.010  94.319  75.830  1.00 58.65  ? 230  PHE I CB  1 
ATOM   8650  C CG  . PHE M  1 89  ? 36.334  94.162  77.290  1.00 53.77  ? 230  PHE I CG  1 
ATOM   8651  C CD1 . PHE M  1 89  ? 37.648  94.017  77.711  1.00 52.88  ? 230  PHE I CD1 1 
ATOM   8652  C CD2 . PHE M  1 89  ? 35.322  94.160  78.244  1.00 50.77  ? 230  PHE I CD2 1 
ATOM   8653  C CE1 . PHE M  1 89  ? 37.953  93.875  79.065  1.00 55.01  ? 230  PHE I CE1 1 
ATOM   8654  C CE2 . PHE M  1 89  ? 35.612  94.021  79.599  1.00 49.46  ? 230  PHE I CE2 1 
ATOM   8655  C CZ  . PHE M  1 89  ? 36.929  93.879  80.011  1.00 52.80  ? 230  PHE I CZ  1 
ATOM   8656  N N   . ILE M  1 90  ? 36.193  91.036  76.387  1.00 54.77  ? 231  ILE I N   1 
ATOM   8657  C CA  . ILE M  1 90  ? 35.568  89.893  77.045  1.00 51.30  ? 231  ILE I CA  1 
ATOM   8658  C C   . ILE M  1 90  ? 36.055  89.745  78.479  1.00 54.59  ? 231  ILE I C   1 
ATOM   8659  O O   . ILE M  1 90  ? 37.250  89.851  78.764  1.00 62.98  ? 231  ILE I O   1 
ATOM   8660  C CB  . ILE M  1 90  ? 35.892  88.572  76.329  1.00 42.21  ? 231  ILE I CB  1 
ATOM   8661  C CG1 . ILE M  1 90  ? 35.427  88.624  74.883  1.00 40.08  ? 231  ILE I CG1 1 
ATOM   8662  C CG2 . ILE M  1 90  ? 35.192  87.436  77.026  1.00 33.87  ? 231  ILE I CG2 1 
ATOM   8663  C CD1 . ILE M  1 90  ? 35.613  87.309  74.162  1.00 33.81  ? 231  ILE I CD1 1 
ATOM   8664  N N   . CYS M  1 91  ? 35.129  89.474  79.382  1.00 51.02  ? 232  CYS I N   1 
ATOM   8665  C CA  . CYS M  1 91  ? 35.476  89.296  80.777  1.00 50.13  ? 232  CYS I CA  1 
ATOM   8666  C C   . CYS M  1 91  ? 34.791  88.029  81.302  1.00 52.74  ? 232  CYS I C   1 
ATOM   8667  O O   . CYS M  1 91  ? 33.563  87.924  81.299  1.00 49.74  ? 232  CYS I O   1 
ATOM   8668  C CB  . CYS M  1 91  ? 35.017  90.520  81.573  1.00 44.08  ? 232  CYS I CB  1 
ATOM   8669  S SG  . CYS M  1 91  ? 35.171  90.359  83.345  1.00 49.22  ? 232  CYS I SG  1 
ATOM   8670  N N   . CYS M  1 92  ? 35.587  87.061  81.730  1.00 49.91  ? 233  CYS I N   1 
ATOM   8671  C CA  . CYS M  1 92  ? 35.047  85.828  82.265  1.00 44.99  ? 233  CYS I CA  1 
ATOM   8672  C C   . CYS M  1 92  ? 35.266  85.824  83.756  1.00 47.51  ? 233  CYS I C   1 
ATOM   8673  O O   . CYS M  1 92  ? 36.318  86.214  84.244  1.00 58.02  ? 233  CYS I O   1 
ATOM   8674  C CB  . CYS M  1 92  ? 35.766  84.628  81.666  1.00 46.12  ? 233  CYS I CB  1 
ATOM   8675  S SG  . CYS M  1 92  ? 35.771  84.628  79.879  1.00 53.22  ? 233  CYS I SG  1 
ATOM   8676  N N   . ILE M  1 93  ? 34.273  85.380  84.491  1.00 46.48  ? 234  ILE I N   1 
ATOM   8677  C CA  . ILE M  1 93  ? 34.409  85.317  85.932  1.00 44.14  ? 234  ILE I CA  1 
ATOM   8678  C C   . ILE M  1 93  ? 33.999  83.931  86.413  1.00 41.88  ? 234  ILE I C   1 
ATOM   8679  O O   . ILE M  1 93  ? 32.873  83.496  86.214  1.00 45.44  ? 234  ILE I O   1 
ATOM   8680  C CB  . ILE M  1 93  ? 33.540  86.383  86.591  1.00 44.20  ? 234  ILE I CB  1 
ATOM   8681  C CG1 . ILE M  1 93  ? 34.030  87.757  86.160  1.00 41.18  ? 234  ILE I CG1 1 
ATOM   8682  C CG2 . ILE M  1 93  ? 33.598  86.264  88.086  1.00 34.32  ? 234  ILE I CG2 1 
ATOM   8683  C CD1 . ILE M  1 93  ? 33.251  88.856  86.770  1.00 39.92  ? 234  ILE I CD1 1 
ATOM   8684  N N   . LEU M  1 94  ? 34.945  83.243  87.026  1.00 40.32  ? 235  LEU I N   1 
ATOM   8685  C CA  . LEU M  1 94  ? 34.753  81.903  87.557  1.00 46.48  ? 235  LEU I CA  1 
ATOM   8686  C C   . LEU M  1 94  ? 34.857  82.046  89.065  1.00 51.91  ? 235  LEU I C   1 
ATOM   8687  O O   . LEU M  1 94  ? 35.931  82.342  89.592  1.00 55.10  ? 235  LEU I O   1 
ATOM   8688  C CB  . LEU M  1 94  ? 35.870  80.975  87.057  1.00 39.12  ? 235  LEU I CB  1 
ATOM   8689  C CG  . LEU M  1 94  ? 36.267  81.220  85.602  1.00 40.73  ? 235  LEU I CG  1 
ATOM   8690  C CD1 . LEU M  1 94  ? 37.388  80.288  85.211  1.00 35.35  ? 235  LEU I CD1 1 
ATOM   8691  C CD2 . LEU M  1 94  ? 35.058  81.035  84.700  1.00 27.60  ? 235  LEU I CD2 1 
ATOM   8692  N N   . SER M  1 95  ? 33.761  81.821  89.772  1.00 56.29  ? 236  SER I N   1 
ATOM   8693  C CA  . SER M  1 95  ? 33.800  81.973  91.222  1.00 57.15  ? 236  SER I CA  1 
ATOM   8694  C C   . SER M  1 95  ? 32.482  81.486  91.805  1.00 54.95  ? 236  SER I C   1 
ATOM   8695  O O   . SER M  1 95  ? 31.650  80.924  91.088  1.00 50.80  ? 236  SER I O   1 
ATOM   8696  C CB  . SER M  1 95  ? 34.011  83.463  91.556  1.00 55.96  ? 236  SER I CB  1 
ATOM   8697  O OG  . SER M  1 95  ? 33.979  83.735  92.946  1.00 52.88  ? 236  SER I OG  1 
ATOM   8698  N N   . HIS M  1 96  ? 32.313  81.678  93.107  1.00 52.22  ? 237  HIS I N   1 
ATOM   8699  C CA  . HIS M  1 96  ? 31.070  81.321  93.769  1.00 55.57  ? 237  HIS I CA  1 
ATOM   8700  C C   . HIS M  1 96  ? 30.182  82.516  93.595  1.00 53.07  ? 237  HIS I C   1 
ATOM   8701  O O   . HIS M  1 96  ? 30.663  83.602  93.280  1.00 54.91  ? 237  HIS I O   1 
ATOM   8702  C CB  . HIS M  1 96  ? 31.266  81.090  95.261  1.00 60.62  ? 237  HIS I CB  1 
ATOM   8703  C CG  . HIS M  1 96  ? 31.739  79.717  95.594  1.00 68.73  ? 237  HIS I CG  1 
ATOM   8704  N ND1 . HIS M  1 96  ? 31.158  78.588  95.063  1.00 73.47  ? 237  HIS I ND1 1 
ATOM   8705  C CD2 . HIS M  1 96  ? 32.727  79.284  96.412  1.00 72.41  ? 237  HIS I CD2 1 
ATOM   8706  C CE1 . HIS M  1 96  ? 31.766  77.517  95.539  1.00 72.24  ? 237  HIS I CE1 1 
ATOM   8707  N NE2 . HIS M  1 96  ? 32.722  77.911  96.361  1.00 71.51  ? 237  HIS I NE2 1 
ATOM   8708  N N   . GLY M  1 97  ? 28.889  82.327  93.809  1.00 56.49  ? 238  GLY I N   1 
ATOM   8709  C CA  . GLY M  1 97  ? 27.966  83.439  93.665  1.00 57.73  ? 238  GLY I CA  1 
ATOM   8710  C C   . GLY M  1 97  ? 26.608  83.152  94.256  1.00 54.67  ? 238  GLY I C   1 
ATOM   8711  O O   . GLY M  1 97  ? 26.341  82.056  94.726  1.00 57.89  ? 238  GLY I O   1 
ATOM   8712  N N   . ASP M  1 98  ? 25.746  84.151  94.229  1.00 55.44  ? 239  ASP I N   1 
ATOM   8713  C CA  . ASP M  1 98  ? 24.400  84.016  94.751  1.00 57.33  ? 239  ASP I CA  1 
ATOM   8714  C C   . ASP M  1 98  ? 23.495  84.895  93.877  1.00 59.18  ? 239  ASP I C   1 
ATOM   8715  O O   . ASP M  1 98  ? 23.937  85.422  92.855  1.00 55.73  ? 239  ASP I O   1 
ATOM   8716  C CB  . ASP M  1 98  ? 24.366  84.462  96.218  1.00 66.20  ? 239  ASP I CB  1 
ATOM   8717  C CG  . ASP M  1 98  ? 23.155  83.929  96.972  1.00 70.97  ? 239  ASP I CG  1 
ATOM   8718  O OD1 . ASP M  1 98  ? 22.142  83.595  96.327  1.00 76.41  ? 239  ASP I OD1 1 
ATOM   8719  O OD2 . ASP M  1 98  ? 23.216  83.852  98.220  1.00 73.44  ? 239  ASP I OD2 1 
ATOM   8720  N N   . LYS M  1 99  ? 22.238  85.063  94.279  1.00 56.78  ? 240  LYS I N   1 
ATOM   8721  C CA  . LYS M  1 99  ? 21.297  85.841  93.492  1.00 57.06  ? 240  LYS I CA  1 
ATOM   8722  C C   . LYS M  1 99  ? 21.870  87.154  93.045  1.00 52.65  ? 240  LYS I C   1 
ATOM   8723  O O   . LYS M  1 99  ? 22.100  88.037  93.850  1.00 60.50  ? 240  LYS I O   1 
ATOM   8724  C CB  . LYS M  1 99  ? 20.007  86.107  94.271  1.00 64.71  ? 240  LYS I CB  1 
ATOM   8725  C CG  . LYS M  1 99  ? 19.221  84.865  94.656  1.00 76.29  ? 240  LYS I CG  1 
ATOM   8726  C CD  . LYS M  1 99  ? 17.978  85.257  95.445  1.00 87.33  ? 240  LYS I CD  1 
ATOM   8727  C CE  . LYS M  1 99  ? 17.505  84.119  96.341  1.00 88.02  ? 240  LYS I CE  1 
ATOM   8728  N NZ  . LYS M  1 99  ? 16.278  84.503  97.101  1.00 92.12  ? 240  LYS I NZ  1 
ATOM   8729  N N   . GLY M  1 100 ? 22.103  87.273  91.749  1.00 51.81  ? 241  GLY I N   1 
ATOM   8730  C CA  . GLY M  1 100 ? 22.619  88.510  91.195  1.00 54.93  ? 241  GLY I CA  1 
ATOM   8731  C C   . GLY M  1 100 ? 24.016  88.947  91.588  1.00 55.82  ? 241  GLY I C   1 
ATOM   8732  O O   . GLY M  1 100 ? 24.496  89.990  91.120  1.00 56.86  ? 241  GLY I O   1 
ATOM   8733  N N   . ILE M  1 101 ? 24.691  88.168  92.426  1.00 54.86  ? 242  ILE I N   1 
ATOM   8734  C CA  . ILE M  1 101 ? 26.025  88.566  92.831  1.00 53.33  ? 242  ILE I CA  1 
ATOM   8735  C C   . ILE M  1 101 ? 27.097  87.541  92.567  1.00 53.77  ? 242  ILE I C   1 
ATOM   8736  O O   . ILE M  1 101 ? 26.831  86.405  92.200  1.00 57.10  ? 242  ILE I O   1 
ATOM   8737  C CB  . ILE M  1 101 ? 26.051  88.976  94.324  1.00 50.08  ? 242  ILE I CB  1 
ATOM   8738  C CG1 . ILE M  1 101 ? 25.716  87.790  95.218  1.00 46.86  ? 242  ILE I CG1 1 
ATOM   8739  C CG2 . ILE M  1 101 ? 25.028  90.069  94.562  1.00 52.69  ? 242  ILE I CG2 1 
ATOM   8740  C CD1 . ILE M  1 101 ? 26.880  86.875  95.466  1.00 48.58  ? 242  ILE I CD1 1 
ATOM   8741  N N   . ILE M  1 102 ? 28.328  87.983  92.749  1.00 57.62  ? 243  ILE I N   1 
ATOM   8742  C CA  . ILE M  1 102 ? 29.500  87.160  92.557  1.00 57.44  ? 243  ILE I CA  1 
ATOM   8743  C C   . ILE M  1 102 ? 30.226  87.252  93.879  1.00 61.76  ? 243  ILE I C   1 
ATOM   8744  O O   . ILE M  1 102 ? 30.293  88.314  94.493  1.00 61.93  ? 243  ILE I O   1 
ATOM   8745  C CB  . ILE M  1 102 ? 30.389  87.732  91.446  1.00 56.25  ? 243  ILE I CB  1 
ATOM   8746  C CG1 . ILE M  1 102 ? 30.513  86.702  90.347  1.00 61.78  ? 243  ILE I CG1 1 
ATOM   8747  C CG2 . ILE M  1 102 ? 31.760  88.101  91.971  1.00 54.11  ? 243  ILE I CG2 1 
ATOM   8748  C CD1 . ILE M  1 102 ? 29.169  86.286  89.818  1.00 67.58  ? 243  ILE I CD1 1 
ATOM   8749  N N   . TYR M  1 103 ? 30.767  86.139  94.331  1.00 61.90  ? 244  TYR I N   1 
ATOM   8750  C CA  . TYR M  1 103 ? 31.467  86.151  95.591  1.00 60.19  ? 244  TYR I CA  1 
ATOM   8751  C C   . TYR M  1 103 ? 32.929  86.380  95.393  1.00 62.19  ? 244  TYR I C   1 
ATOM   8752  O O   . TYR M  1 103 ? 33.560  85.775  94.520  1.00 64.42  ? 244  TYR I O   1 
ATOM   8753  C CB  . TYR M  1 103 ? 31.268  84.836  96.331  1.00 64.47  ? 244  TYR I CB  1 
ATOM   8754  C CG  . TYR M  1 103 ? 30.058  84.844  97.220  1.00 69.27  ? 244  TYR I CG  1 
ATOM   8755  C CD1 . TYR M  1 103 ? 29.964  85.750  98.278  1.00 68.55  ? 244  TYR I CD1 1 
ATOM   8756  C CD2 . TYR M  1 103 ? 28.999  83.955  97.006  1.00 70.25  ? 244  TYR I CD2 1 
ATOM   8757  C CE1 . TYR M  1 103 ? 28.846  85.778  99.106  1.00 73.64  ? 244  TYR I CE1 1 
ATOM   8758  C CE2 . TYR M  1 103 ? 27.872  83.970  97.828  1.00 74.87  ? 244  TYR I CE2 1 
ATOM   8759  C CZ  . TYR M  1 103 ? 27.802  84.884  98.878  1.00 79.73  ? 244  TYR I CZ  1 
ATOM   8760  O OH  . TYR M  1 103 ? 26.689  84.903  99.695  1.00 81.89  ? 244  TYR I OH  1 
ATOM   8761  N N   . GLY M  1 104 ? 33.470  87.268  96.210  1.00 62.08  ? 245  GLY I N   1 
ATOM   8762  C CA  . GLY M  1 104 ? 34.885  87.541  96.133  1.00 65.96  ? 245  GLY I CA  1 
ATOM   8763  C C   . GLY M  1 104 ? 35.579  86.465  96.940  1.00 66.57  ? 245  GLY I C   1 
ATOM   8764  O O   . GLY M  1 104 ? 35.020  85.960  97.909  1.00 70.38  ? 245  GLY I O   1 
ATOM   8765  N N   . THR M  1 105 ? 36.795  86.115  96.552  1.00 65.04  ? 246  THR I N   1 
ATOM   8766  C CA  . THR M  1 105 ? 37.553  85.087  97.244  1.00 64.56  ? 246  THR I CA  1 
ATOM   8767  C C   . THR M  1 105 ? 37.614  85.318  98.762  1.00 68.33  ? 246  THR I C   1 
ATOM   8768  O O   . THR M  1 105 ? 37.946  84.422  99.528  1.00 70.25  ? 246  THR I O   1 
ATOM   8769  C CB  . THR M  1 105 ? 38.969  85.022  96.666  1.00 64.05  ? 246  THR I CB  1 
ATOM   8770  O OG1 . THR M  1 105 ? 39.511  83.722  96.892  1.00 66.55  ? 246  THR I OG1 1 
ATOM   8771  C CG2 . THR M  1 105 ? 39.863  86.083  97.304  1.00 66.35  ? 246  THR I CG2 1 
ATOM   8772  N N   . ASP M  1 106 ? 37.271  86.527  99.184  1.00 72.40  ? 247  ASP I N   1 
ATOM   8773  C CA  . ASP M  1 106 ? 37.286  86.902  100.593 1.00 72.88  ? 247  ASP I CA  1 
ATOM   8774  C C   . ASP M  1 106 ? 35.885  86.893  101.207 1.00 71.90  ? 247  ASP I C   1 
ATOM   8775  O O   . ASP M  1 106 ? 35.688  87.322  102.344 1.00 75.17  ? 247  ASP I O   1 
ATOM   8776  C CB  . ASP M  1 106 ? 37.908  88.302  100.753 1.00 75.97  ? 247  ASP I CB  1 
ATOM   8777  C CG  . ASP M  1 106 ? 37.082  89.405  100.080 1.00 80.85  ? 247  ASP I CG  1 
ATOM   8778  O OD1 . ASP M  1 106 ? 36.796  89.303  98.871  1.00 84.80  ? 247  ASP I OD1 1 
ATOM   8779  O OD2 . ASP M  1 106 ? 36.721  90.387  100.760 1.00 86.64  ? 247  ASP I OD2 1 
ATOM   8780  N N   . GLY M  1 107 ? 34.905  86.424  100.449 1.00 68.99  ? 248  GLY I N   1 
ATOM   8781  C CA  . GLY M  1 107 ? 33.552  86.375  100.971 1.00 67.83  ? 248  GLY I CA  1 
ATOM   8782  C C   . GLY M  1 107 ? 32.701  87.594  100.678 1.00 67.05  ? 248  GLY I C   1 
ATOM   8783  O O   . GLY M  1 107 ? 31.489  87.566  100.856 1.00 69.15  ? 248  GLY I O   1 
ATOM   8784  N N   . GLN M  1 108 ? 33.316  88.673  100.227 1.00 67.52  ? 254  GLN I N   1 
ATOM   8785  C CA  . GLN M  1 108 ? 32.540  89.865  99.938  1.00 68.05  ? 254  GLN I CA  1 
ATOM   8786  C C   . GLN M  1 108 ? 31.735  89.698  98.666  1.00 64.77  ? 254  GLN I C   1 
ATOM   8787  O O   . GLN M  1 108 ? 32.084  88.902  97.786  1.00 63.09  ? 254  GLN I O   1 
ATOM   8788  C CB  . GLN M  1 108 ? 33.457  91.083  99.834  1.00 76.63  ? 254  GLN I CB  1 
ATOM   8789  C CG  . GLN M  1 108 ? 34.160  91.425  101.132 1.00 76.89  ? 254  GLN I CG  1 
ATOM   8790  C CD  . GLN M  1 108 ? 33.192  91.546  102.299 1.00 80.04  ? 254  GLN I CD  1 
ATOM   8791  O OE1 . GLN M  1 108 ? 32.299  92.403  102.306 1.00 71.85  ? 254  GLN I OE1 1 
ATOM   8792  N NE2 . GLN M  1 108 ? 33.365  90.681  103.296 1.00 83.14  ? 254  GLN I NE2 1 
ATOM   8793  N N   . GLU M  1 109 ? 30.664  90.472  98.580  1.00 60.08  ? 255  GLU I N   1 
ATOM   8794  C CA  . GLU M  1 109 ? 29.759  90.414  97.453  1.00 66.68  ? 255  GLU I CA  1 
ATOM   8795  C C   . GLU M  1 109 ? 29.915  91.483  96.381  1.00 66.19  ? 255  GLU I C   1 
ATOM   8796  O O   . GLU M  1 109 ? 30.103  92.664  96.665  1.00 65.45  ? 255  GLU I O   1 
ATOM   8797  C CB  . GLU M  1 109 ? 28.318  90.428  97.967  1.00 72.91  ? 255  GLU I CB  1 
ATOM   8798  C CG  . GLU M  1 109 ? 27.872  89.099  98.553  1.00 81.57  ? 255  GLU I CG  1 
ATOM   8799  C CD  . GLU M  1 109 ? 26.571  89.215  99.311  1.00 86.60  ? 255  GLU I CD  1 
ATOM   8800  O OE1 . GLU M  1 109 ? 25.722  90.064  98.915  1.00 82.52  ? 255  GLU I OE1 1 
ATOM   8801  O OE2 . GLU M  1 109 ? 26.402  88.447  100.293 1.00 85.01  ? 255  GLU I OE2 1 
ATOM   8802  N N   . ALA M  1 110 ? 29.812  91.046  95.132  1.00 65.49  ? 256  ALA I N   1 
ATOM   8803  C CA  . ALA M  1 110 ? 29.921  91.942  93.997  1.00 58.63  ? 256  ALA I CA  1 
ATOM   8804  C C   . ALA M  1 110 ? 28.726  91.753  93.073  1.00 52.20  ? 256  ALA I C   1 
ATOM   8805  O O   . ALA M  1 110 ? 28.580  90.716  92.435  1.00 53.20  ? 256  ALA I O   1 
ATOM   8806  C CB  . ALA M  1 110 ? 31.227  91.671  93.228  1.00 52.13  ? 256  ALA I CB  1 
ATOM   8807  N N   . PRO M  1 111 ? 27.839  92.746  93.020  1.00 45.91  ? 257  PRO I N   1 
ATOM   8808  C CA  . PRO M  1 111 ? 26.661  92.685  92.158  1.00 46.21  ? 257  PRO I CA  1 
ATOM   8809  C C   . PRO M  1 111 ? 27.120  92.608  90.699  1.00 50.99  ? 257  PRO I C   1 
ATOM   8810  O O   . PRO M  1 111 ? 27.960  93.388  90.232  1.00 45.74  ? 257  PRO I O   1 
ATOM   8811  C CB  . PRO M  1 111 ? 25.947  93.995  92.456  1.00 46.82  ? 257  PRO I CB  1 
ATOM   8812  C CG  . PRO M  1 111 ? 26.268  94.209  93.885  1.00 48.94  ? 257  PRO I CG  1 
ATOM   8813  C CD  . PRO M  1 111 ? 27.748  93.884  93.945  1.00 49.56  ? 257  PRO I CD  1 
ATOM   8814  N N   . ILE M  1 112 ? 26.566  91.660  89.968  1.00 51.37  ? 258  ILE I N   1 
ATOM   8815  C CA  . ILE M  1 112 ? 26.958  91.523  88.594  1.00 51.43  ? 258  ILE I CA  1 
ATOM   8816  C C   . ILE M  1 112 ? 26.692  92.811  87.832  1.00 51.90  ? 258  ILE I C   1 
ATOM   8817  O O   . ILE M  1 112 ? 27.381  93.130  86.866  1.00 56.40  ? 258  ILE I O   1 
ATOM   8818  C CB  . ILE M  1 112 ? 26.242  90.346  87.977  1.00 47.51  ? 258  ILE I CB  1 
ATOM   8819  C CG1 . ILE M  1 112 ? 26.694  89.074  88.719  1.00 47.02  ? 258  ILE I CG1 1 
ATOM   8820  C CG2 . ILE M  1 112 ? 26.530  90.282  86.490  1.00 41.06  ? 258  ILE I CG2 1 
ATOM   8821  C CD1 . ILE M  1 112 ? 26.096  87.775  88.215  1.00 52.13  ? 258  ILE I CD1 1 
ATOM   8822  N N   . TYR M  1 113 ? 25.710  93.570  88.281  1.00 50.17  ? 259  TYR I N   1 
ATOM   8823  C CA  . TYR M  1 113 ? 25.405  94.821  87.619  1.00 57.14  ? 259  TYR I CA  1 
ATOM   8824  C C   . TYR M  1 113 ? 26.595  95.793  87.770  1.00 61.29  ? 259  TYR I C   1 
ATOM   8825  O O   . TYR M  1 113 ? 27.000  96.470  86.817  1.00 55.95  ? 259  TYR I O   1 
ATOM   8826  C CB  . TYR M  1 113 ? 24.154  95.435  88.232  1.00 68.36  ? 259  TYR I CB  1 
ATOM   8827  C CG  . TYR M  1 113 ? 23.661  96.644  87.474  1.00 83.00  ? 259  TYR I CG  1 
ATOM   8828  C CD1 . TYR M  1 113 ? 23.272  96.539  86.129  1.00 89.17  ? 259  TYR I CD1 1 
ATOM   8829  C CD2 . TYR M  1 113 ? 23.603  97.902  88.085  1.00 88.03  ? 259  TYR I CD2 1 
ATOM   8830  C CE1 . TYR M  1 113 ? 22.839  97.658  85.406  1.00 92.00  ? 259  TYR I CE1 1 
ATOM   8831  C CE2 . TYR M  1 113 ? 23.170  99.031  87.370  1.00 94.38  ? 259  TYR I CE2 1 
ATOM   8832  C CZ  . TYR M  1 113 ? 22.792  98.901  86.034  1.00 95.23  ? 259  TYR I CZ  1 
ATOM   8833  O OH  . TYR M  1 113 ? 22.382  100.014 85.333  1.00 96.77  ? 259  TYR I OH  1 
ATOM   8834  N N   . GLU M  1 114 ? 27.149  95.862  88.977  1.00 59.63  ? 260  GLU I N   1 
ATOM   8835  C CA  . GLU M  1 114 ? 28.290  96.728  89.241  1.00 59.62  ? 260  GLU I CA  1 
ATOM   8836  C C   . GLU M  1 114 ? 29.431  96.380  88.308  1.00 56.57  ? 260  GLU I C   1 
ATOM   8837  O O   . GLU M  1 114 ? 30.171  97.250  87.858  1.00 57.76  ? 260  GLU I O   1 
ATOM   8838  C CB  . GLU M  1 114 ? 28.781  96.529  90.669  1.00 63.80  ? 260  GLU I CB  1 
ATOM   8839  C CG  . GLU M  1 114 ? 27.749  96.825  91.713  1.00 73.06  ? 260  GLU I CG  1 
ATOM   8840  C CD  . GLU M  1 114 ? 27.640  98.299  91.989  1.00 81.25  ? 260  GLU I CD  1 
ATOM   8841  O OE1 . GLU M  1 114 ? 27.407  99.070  91.029  1.00 85.85  ? 260  GLU I OE1 1 
ATOM   8842  O OE2 . GLU M  1 114 ? 27.792  98.681  93.169  1.00 84.40  ? 260  GLU I OE2 1 
ATOM   8843  N N   . LEU M  1 115 ? 29.590  95.095  88.034  1.00 52.19  ? 261  LEU I N   1 
ATOM   8844  C CA  . LEU M  1 115 ? 30.664  94.683  87.161  1.00 53.41  ? 261  LEU I CA  1 
ATOM   8845  C C   . LEU M  1 115 ? 30.454  95.122  85.717  1.00 53.85  ? 261  LEU I C   1 
ATOM   8846  O O   . LEU M  1 115 ? 31.275  95.839  85.170  1.00 55.66  ? 261  LEU I O   1 
ATOM   8847  C CB  . LEU M  1 115 ? 30.852  93.171  87.238  1.00 49.47  ? 261  LEU I CB  1 
ATOM   8848  C CG  . LEU M  1 115 ? 30.997  92.688  88.680  1.00 58.93  ? 261  LEU I CG  1 
ATOM   8849  C CD1 . LEU M  1 115 ? 31.486  91.262  88.697  1.00 51.44  ? 261  LEU I CD1 1 
ATOM   8850  C CD2 . LEU M  1 115 ? 31.992  93.565  89.423  1.00 62.82  ? 261  LEU I CD2 1 
ATOM   8851  N N   . THR M  1 116 ? 29.348  94.727  85.105  1.00 53.24  ? 262  THR I N   1 
ATOM   8852  C CA  . THR M  1 116 ? 29.123  95.078  83.710  1.00 51.50  ? 262  THR I CA  1 
ATOM   8853  C C   . THR M  1 116 ? 28.885  96.542  83.430  1.00 51.84  ? 262  THR I C   1 
ATOM   8854  O O   . THR M  1 116 ? 29.148  96.998  82.324  1.00 54.46  ? 262  THR I O   1 
ATOM   8855  C CB  . THR M  1 116 ? 27.913  94.345  83.113  1.00 51.70  ? 262  THR I CB  1 
ATOM   8856  O OG1 . THR M  1 116 ? 26.703  94.875  83.680  1.00 42.30  ? 262  THR I OG1 1 
ATOM   8857  C CG2 . THR M  1 116 ? 28.019  92.863  83.367  1.00 32.71  ? 262  THR I CG2 1 
ATOM   8858  N N   . SER M  1 117 ? 28.360  97.276  84.403  1.00 51.97  ? 263  SER I N   1 
ATOM   8859  C CA  . SER M  1 117 ? 28.065  98.694  84.184  1.00 55.19  ? 263  SER I CA  1 
ATOM   8860  C C   . SER M  1 117 ? 29.334  99.532  84.091  1.00 53.56  ? 263  SER I C   1 
ATOM   8861  O O   . SER M  1 117 ? 29.312  100.723 83.778  1.00 56.70  ? 263  SER I O   1 
ATOM   8862  C CB  . SER M  1 117 ? 27.164  99.226  85.298  1.00 54.06  ? 263  SER I CB  1 
ATOM   8863  O OG  . SER M  1 117 ? 27.876  99.343  86.513  1.00 67.30  ? 263  SER I OG  1 
ATOM   8864  N N   . GLN M  1 118 ? 30.446  98.877  84.366  1.00 58.51  ? 264  GLN I N   1 
ATOM   8865  C CA  . GLN M  1 118 ? 31.759  99.493  84.312  1.00 62.68  ? 264  GLN I CA  1 
ATOM   8866  C C   . GLN M  1 118 ? 32.147  99.810  82.885  1.00 60.28  ? 264  GLN I C   1 
ATOM   8867  O O   . GLN M  1 118 ? 32.986  100.667 82.653  1.00 62.17  ? 264  GLN I O   1 
ATOM   8868  C CB  . GLN M  1 118 ? 32.805  98.535  84.883  1.00 65.13  ? 264  GLN I CB  1 
ATOM   8869  C CG  . GLN M  1 118 ? 32.774  98.404  86.381  1.00 71.94  ? 264  GLN I CG  1 
ATOM   8870  C CD  . GLN M  1 118 ? 33.120  99.708  87.025  1.00 81.29  ? 264  GLN I CD  1 
ATOM   8871  O OE1 . GLN M  1 118 ? 32.313  100.644 87.020  1.00 86.26  ? 264  GLN I OE1 1 
ATOM   8872  N NE2 . GLN M  1 118 ? 34.341  99.802  87.558  1.00 86.03  ? 264  GLN I NE2 1 
ATOM   8873  N N   . PHE M  1 119 ? 31.524  99.128  81.932  1.00 54.98  ? 265  PHE I N   1 
ATOM   8874  C CA  . PHE M  1 119 ? 31.878  99.314  80.542  1.00 49.33  ? 265  PHE I CA  1 
ATOM   8875  C C   . PHE M  1 119 ? 30.840  99.914  79.619  1.00 47.16  ? 265  PHE I C   1 
ATOM   8876  O O   . PHE M  1 119 ? 30.852  99.673  78.407  1.00 45.02  ? 265  PHE I O   1 
ATOM   8877  C CB  . PHE M  1 119 ? 32.401  97.988  80.002  1.00 40.85  ? 265  PHE I CB  1 
ATOM   8878  C CG  . PHE M  1 119 ? 33.506  97.423  80.836  1.00 48.70  ? 265  PHE I CG  1 
ATOM   8879  C CD1 . PHE M  1 119 ? 33.235  96.820  82.052  1.00 47.18  ? 265  PHE I CD1 1 
ATOM   8880  C CD2 . PHE M  1 119 ? 34.833  97.545  80.433  1.00 54.29  ? 265  PHE I CD2 1 
ATOM   8881  C CE1 . PHE M  1 119 ? 34.271  96.338  82.866  1.00 53.47  ? 265  PHE I CE1 1 
ATOM   8882  C CE2 . PHE M  1 119 ? 35.876  97.070  81.234  1.00 52.82  ? 265  PHE I CE2 1 
ATOM   8883  C CZ  . PHE M  1 119 ? 35.589  96.463  82.456  1.00 52.46  ? 265  PHE I CZ  1 
ATOM   8884  N N   . THR M  1 120 ? 29.968  100.736 80.184  1.00 46.61  ? 266  THR I N   1 
ATOM   8885  C CA  . THR M  1 120 ? 28.949  101.378 79.376  1.00 53.21  ? 266  THR I CA  1 
ATOM   8886  C C   . THR M  1 120 ? 29.643  102.274 78.352  1.00 53.60  ? 266  THR I C   1 
ATOM   8887  O O   . THR M  1 120 ? 30.869  102.259 78.230  1.00 54.59  ? 266  THR I O   1 
ATOM   8888  C CB  . THR M  1 120 ? 28.031  102.234 80.243  1.00 55.66  ? 266  THR I CB  1 
ATOM   8889  O OG1 . THR M  1 120 ? 28.707  103.440 80.602  1.00 64.02  ? 266  THR I OG1 1 
ATOM   8890  C CG2 . THR M  1 120 ? 27.677  101.497 81.509  1.00 55.23  ? 266  THR I CG2 1 
ATOM   8891  N N   . GLY M  1 121 ? 28.859  103.057 77.620  1.00 55.46  ? 267  GLY I N   1 
ATOM   8892  C CA  . GLY M  1 121 ? 29.432  103.948 76.624  1.00 59.83  ? 267  GLY I CA  1 
ATOM   8893  C C   . GLY M  1 121 ? 30.194  105.095 77.267  1.00 64.67  ? 267  GLY I C   1 
ATOM   8894  O O   . GLY M  1 121 ? 31.315  105.417 76.865  1.00 68.38  ? 267  GLY I O   1 
ATOM   8895  N N   . LEU M  1 122 ? 29.588  105.713 78.274  1.00 58.55  ? 268  LEU I N   1 
ATOM   8896  C CA  . LEU M  1 122 ? 30.223  106.811 78.972  1.00 55.13  ? 268  LEU I CA  1 
ATOM   8897  C C   . LEU M  1 122 ? 31.456  106.279 79.686  1.00 60.27  ? 268  LEU I C   1 
ATOM   8898  O O   . LEU M  1 122 ? 32.585  106.692 79.412  1.00 68.58  ? 268  LEU I O   1 
ATOM   8899  C CB  . LEU M  1 122 ? 29.257  107.409 79.987  1.00 55.49  ? 268  LEU I CB  1 
ATOM   8900  C CG  . LEU M  1 122 ? 27.872  107.748 79.431  1.00 59.76  ? 268  LEU I CG  1 
ATOM   8901  C CD1 . LEU M  1 122 ? 27.110  108.560 80.469  1.00 55.81  ? 268  LEU I CD1 1 
ATOM   8902  C CD2 . LEU M  1 122 ? 28.001  108.532 78.108  1.00 61.15  ? 268  LEU I CD2 1 
ATOM   8903  N N   . LYS M  1 123 ? 31.230  105.344 80.594  1.00 57.28  ? 269  LYS I N   1 
ATOM   8904  C CA  . LYS M  1 123 ? 32.296  104.731 81.365  1.00 56.84  ? 269  LYS I CA  1 
ATOM   8905  C C   . LYS M  1 123 ? 33.544  104.341 80.559  1.00 55.76  ? 269  LYS I C   1 
ATOM   8906  O O   . LYS M  1 123 ? 34.656  104.366 81.094  1.00 58.83  ? 269  LYS I O   1 
ATOM   8907  C CB  . LYS M  1 123 ? 31.743  103.490 82.077  1.00 64.78  ? 269  LYS I CB  1 
ATOM   8908  C CG  . LYS M  1 123 ? 30.890  103.773 83.312  1.00 67.92  ? 269  LYS I CG  1 
ATOM   8909  C CD  . LYS M  1 123 ? 31.772  104.079 84.522  1.00 76.07  ? 269  LYS I CD  1 
ATOM   8910  C CE  . LYS M  1 123 ? 31.003  104.006 85.845  1.00 80.49  ? 269  LYS I CE  1 
ATOM   8911  N NZ  . LYS M  1 123 ? 31.918  104.038 87.036  1.00 81.75  ? 269  LYS I NZ  1 
ATOM   8912  N N   . CYS M  1 124 ? 33.375  103.979 79.286  1.00 48.25  ? 270  CYS I N   1 
ATOM   8913  C CA  . CYS M  1 124 ? 34.521  103.558 78.478  1.00 46.59  ? 270  CYS I CA  1 
ATOM   8914  C C   . CYS M  1 124 ? 34.321  103.757 76.972  1.00 46.08  ? 270  CYS I C   1 
ATOM   8915  O O   . CYS M  1 124 ? 34.192  102.802 76.205  1.00 42.32  ? 270  CYS I O   1 
ATOM   8916  C CB  . CYS M  1 124 ? 34.837  102.097 78.787  1.00 29.93  ? 270  CYS I CB  1 
ATOM   8917  S SG  . CYS M  1 124 ? 36.010  101.280 77.692  1.00 48.39  ? 270  CYS I SG  1 
ATOM   8918  N N   . PRO M  1 125 ? 34.340  105.022 76.526  1.00 50.42  ? 271  PRO I N   1 
ATOM   8919  C CA  . PRO M  1 125 ? 34.156  105.379 75.111  1.00 46.28  ? 271  PRO I CA  1 
ATOM   8920  C C   . PRO M  1 125 ? 34.986  104.591 74.094  1.00 47.58  ? 271  PRO I C   1 
ATOM   8921  O O   . PRO M  1 125 ? 34.568  104.444 72.959  1.00 51.84  ? 271  PRO I O   1 
ATOM   8922  C CB  . PRO M  1 125 ? 34.469  106.867 75.084  1.00 36.22  ? 271  PRO I CB  1 
ATOM   8923  C CG  . PRO M  1 125 ? 34.076  107.322 76.493  1.00 40.96  ? 271  PRO I CG  1 
ATOM   8924  C CD  . PRO M  1 125 ? 34.614  106.217 77.353  1.00 46.95  ? 271  PRO I CD  1 
ATOM   8925  N N   . SER M  1 126 ? 36.148  104.089 74.491  1.00 47.08  ? 272  SER I N   1 
ATOM   8926  C CA  . SER M  1 126 ? 36.990  103.331 73.568  1.00 51.59  ? 272  SER I CA  1 
ATOM   8927  C C   . SER M  1 126 ? 36.278  102.070 73.088  1.00 55.84  ? 272  SER I C   1 
ATOM   8928  O O   . SER M  1 126 ? 36.646  101.498 72.045  1.00 57.61  ? 272  SER I O   1 
ATOM   8929  C CB  . SER M  1 126 ? 38.315  102.933 74.242  1.00 52.17  ? 272  SER I CB  1 
ATOM   8930  O OG  . SER M  1 126 ? 38.475  103.597 75.495  1.00 62.39  ? 272  SER I OG  1 
ATOM   8931  N N   . LEU M  1 127 ? 35.267  101.630 73.845  1.00 52.22  ? 273  LEU I N   1 
ATOM   8932  C CA  . LEU M  1 127 ? 34.531  100.417 73.487  1.00 46.89  ? 273  LEU I CA  1 
ATOM   8933  C C   . LEU M  1 127 ? 33.157  100.678 72.883  1.00 49.02  ? 273  LEU I C   1 
ATOM   8934  O O   . LEU M  1 127 ? 32.524  99.757  72.370  1.00 51.45  ? 273  LEU I O   1 
ATOM   8935  C CB  . LEU M  1 127 ? 34.410  99.490  74.694  1.00 38.45  ? 273  LEU I CB  1 
ATOM   8936  C CG  . LEU M  1 127 ? 35.712  98.749  75.018  1.00 38.08  ? 273  LEU I CG  1 
ATOM   8937  C CD1 . LEU M  1 127 ? 35.608  97.967  76.316  1.00 42.68  ? 273  LEU I CD1 1 
ATOM   8938  C CD2 . LEU M  1 127 ? 36.015  97.806  73.895  1.00 41.67  ? 273  LEU I CD2 1 
ATOM   8939  N N   . ALA M  1 128 ? 32.717  101.936 72.920  1.00 46.33  ? 274  ALA I N   1 
ATOM   8940  C CA  . ALA M  1 128 ? 31.427  102.344 72.357  1.00 49.40  ? 274  ALA I CA  1 
ATOM   8941  C C   . ALA M  1 128 ? 31.153  101.722 70.998  1.00 56.21  ? 274  ALA I C   1 
ATOM   8942  O O   . ALA M  1 128 ? 31.919  101.937 70.055  1.00 59.39  ? 274  ALA I O   1 
ATOM   8943  C CB  . ALA M  1 128 ? 31.376  103.842 72.226  1.00 38.16  ? 274  ALA I CB  1 
ATOM   8944  N N   . GLY M  1 129 ? 30.058  100.965 70.895  1.00 59.93  ? 275  GLY I N   1 
ATOM   8945  C CA  . GLY M  1 129 ? 29.717  100.335 69.630  1.00 56.81  ? 275  GLY I CA  1 
ATOM   8946  C C   . GLY M  1 129 ? 30.500  99.064  69.372  1.00 56.04  ? 275  GLY I C   1 
ATOM   8947  O O   . GLY M  1 129 ? 30.558  98.570  68.249  1.00 64.77  ? 275  GLY I O   1 
ATOM   8948  N N   . LYS M  1 130 ? 31.119  98.530  70.408  1.00 54.29  ? 276  LYS I N   1 
ATOM   8949  C CA  . LYS M  1 130 ? 31.858  97.292  70.256  1.00 53.64  ? 276  LYS I CA  1 
ATOM   8950  C C   . LYS M  1 130 ? 31.333  96.264  71.260  1.00 48.70  ? 276  LYS I C   1 
ATOM   8951  O O   . LYS M  1 130 ? 31.009  96.580  72.412  1.00 38.28  ? 276  LYS I O   1 
ATOM   8952  C CB  . LYS M  1 130 ? 33.351  97.536  70.474  1.00 64.93  ? 276  LYS I CB  1 
ATOM   8953  C CG  . LYS M  1 130 ? 33.998  98.435  69.435  1.00 73.08  ? 276  LYS I CG  1 
ATOM   8954  C CD  . LYS M  1 130 ? 35.443  98.762  69.824  1.00 80.92  ? 276  LYS I CD  1 
ATOM   8955  C CE  . LYS M  1 130 ? 36.137  99.622  68.767  1.00 82.44  ? 276  LYS I CE  1 
ATOM   8956  N NZ  . LYS M  1 130 ? 37.407  100.219 69.271  1.00 80.55  ? 276  LYS I NZ  1 
ATOM   8957  N N   . PRO M  1 131 ? 31.224  95.013  70.822  1.00 49.07  ? 277  PRO I N   1 
ATOM   8958  C CA  . PRO M  1 131 ? 30.737  93.963  71.707  1.00 53.02  ? 277  PRO I CA  1 
ATOM   8959  C C   . PRO M  1 131 ? 31.514  93.839  73.006  1.00 51.49  ? 277  PRO I C   1 
ATOM   8960  O O   . PRO M  1 131 ? 32.734  93.680  72.997  1.00 47.55  ? 277  PRO I O   1 
ATOM   8961  C CB  . PRO M  1 131 ? 30.868  92.697  70.846  1.00 51.83  ? 277  PRO I CB  1 
ATOM   8962  C CG  . PRO M  1 131 ? 32.006  93.008  69.958  1.00 40.40  ? 277  PRO I CG  1 
ATOM   8963  C CD  . PRO M  1 131 ? 31.658  94.433  69.544  1.00 49.02  ? 277  PRO I CD  1 
ATOM   8964  N N   . LYS M  1 132 ? 30.785  93.905  74.114  1.00 49.24  ? 278  LYS I N   1 
ATOM   8965  C CA  . LYS M  1 132 ? 31.357  93.758  75.445  1.00 45.82  ? 278  LYS I CA  1 
ATOM   8966  C C   . LYS M  1 132 ? 30.676  92.503  76.012  1.00 43.47  ? 278  LYS I C   1 
ATOM   8967  O O   . LYS M  1 132 ? 29.512  92.540  76.399  1.00 48.89  ? 278  LYS I O   1 
ATOM   8968  C CB  . LYS M  1 132 ? 31.035  95.000  76.272  1.00 43.71  ? 278  LYS I CB  1 
ATOM   8969  C CG  . LYS M  1 132 ? 31.622  96.258  75.675  1.00 37.23  ? 278  LYS I CG  1 
ATOM   8970  C CD  . LYS M  1 132 ? 31.094  97.502  76.327  1.00 42.86  ? 278  LYS I CD  1 
ATOM   8971  C CE  . LYS M  1 132 ? 29.916  98.068  75.542  1.00 48.14  ? 278  LYS I CE  1 
ATOM   8972  N NZ  . LYS M  1 132 ? 30.288  98.436  74.142  1.00 44.46  ? 278  LYS I NZ  1 
ATOM   8973  N N   . VAL M  1 133 ? 31.415  91.402  76.038  1.00 36.07  ? 279  VAL I N   1 
ATOM   8974  C CA  . VAL M  1 133 ? 30.923  90.109  76.493  1.00 38.93  ? 279  VAL I CA  1 
ATOM   8975  C C   . VAL M  1 133 ? 31.333  89.697  77.895  1.00 44.59  ? 279  VAL I C   1 
ATOM   8976  O O   . VAL M  1 133 ? 32.513  89.732  78.228  1.00 49.14  ? 279  VAL I O   1 
ATOM   8977  C CB  . VAL M  1 133 ? 31.446  88.992  75.566  1.00 44.15  ? 279  VAL I CB  1 
ATOM   8978  C CG1 . VAL M  1 133 ? 30.853  87.664  75.957  1.00 43.39  ? 279  VAL I CG1 1 
ATOM   8979  C CG2 . VAL M  1 133 ? 31.143  89.328  74.117  1.00 40.68  ? 279  VAL I CG2 1 
ATOM   8980  N N   . PHE M  1 134 ? 30.374  89.267  78.708  1.00 44.48  ? 280  PHE I N   1 
ATOM   8981  C CA  . PHE M  1 134 ? 30.703  88.785  80.050  1.00 45.33  ? 280  PHE I CA  1 
ATOM   8982  C C   . PHE M  1 134 ? 30.171  87.380  80.266  1.00 44.68  ? 280  PHE I C   1 
ATOM   8983  O O   . PHE M  1 134 ? 28.978  87.142  80.139  1.00 50.52  ? 280  PHE I O   1 
ATOM   8984  C CB  . PHE M  1 134 ? 30.091  89.656  81.144  1.00 47.46  ? 280  PHE I CB  1 
ATOM   8985  C CG  . PHE M  1 134 ? 30.701  90.999  81.262  1.00 52.73  ? 280  PHE I CG  1 
ATOM   8986  C CD1 . PHE M  1 134 ? 30.491  91.954  80.275  1.00 48.29  ? 280  PHE I CD1 1 
ATOM   8987  C CD2 . PHE M  1 134 ? 31.455  91.331  82.388  1.00 52.69  ? 280  PHE I CD2 1 
ATOM   8988  C CE1 . PHE M  1 134 ? 31.016  93.222  80.411  1.00 53.38  ? 280  PHE I CE1 1 
ATOM   8989  C CE2 . PHE M  1 134 ? 31.989  92.595  82.539  1.00 52.25  ? 280  PHE I CE2 1 
ATOM   8990  C CZ  . PHE M  1 134 ? 31.769  93.549  81.551  1.00 58.85  ? 280  PHE I CZ  1 
ATOM   8991  N N   . PHE M  1 135 ? 31.053  86.451  80.592  1.00 38.48  ? 281  PHE I N   1 
ATOM   8992  C CA  . PHE M  1 135 ? 30.638  85.096  80.887  1.00 38.84  ? 281  PHE I CA  1 
ATOM   8993  C C   . PHE M  1 135 ? 30.795  84.923  82.382  1.00 44.30  ? 281  PHE I C   1 
ATOM   8994  O O   . PHE M  1 135 ? 31.890  85.040  82.918  1.00 47.94  ? 281  PHE I O   1 
ATOM   8995  C CB  . PHE M  1 135 ? 31.524  84.076  80.176  1.00 32.49  ? 281  PHE I CB  1 
ATOM   8996  C CG  . PHE M  1 135 ? 31.333  84.050  78.702  1.00 45.48  ? 281  PHE I CG  1 
ATOM   8997  C CD1 . PHE M  1 135 ? 30.126  83.633  78.149  1.00 46.55  ? 281  PHE I CD1 1 
ATOM   8998  C CD2 . PHE M  1 135 ? 32.340  84.476  77.858  1.00 47.67  ? 281  PHE I CD2 1 
ATOM   8999  C CE1 . PHE M  1 135 ? 29.932  83.648  76.774  1.00 47.88  ? 281  PHE I CE1 1 
ATOM   9000  C CE2 . PHE M  1 135 ? 32.155  84.498  76.479  1.00 50.55  ? 281  PHE I CE2 1 
ATOM   9001  C CZ  . PHE M  1 135 ? 30.945  84.081  75.936  1.00 48.39  ? 281  PHE I CZ  1 
ATOM   9002  N N   . ILE M  1 136 ? 29.705  84.655  83.071  1.00 51.41  ? 282  ILE I N   1 
ATOM   9003  C CA  . ILE M  1 136 ? 29.793  84.465  84.508  1.00 55.65  ? 282  ILE I CA  1 
ATOM   9004  C C   . ILE M  1 136 ? 29.435  83.041  84.905  1.00 53.84  ? 282  ILE I C   1 
ATOM   9005  O O   . ILE M  1 136 ? 28.304  82.609  84.698  1.00 61.67  ? 282  ILE I O   1 
ATOM   9006  C CB  . ILE M  1 136 ? 28.860  85.430  85.244  1.00 52.32  ? 282  ILE I CB  1 
ATOM   9007  C CG1 . ILE M  1 136 ? 29.373  86.848  85.066  1.00 47.01  ? 282  ILE I CG1 1 
ATOM   9008  C CG2 . ILE M  1 136 ? 28.783  85.060  86.710  1.00 44.07  ? 282  ILE I CG2 1 
ATOM   9009  C CD1 . ILE M  1 136 ? 28.572  87.843  85.833  1.00 52.98  ? 282  ILE I CD1 1 
ATOM   9010  N N   . GLN M  1 137 ? 30.398  82.326  85.476  1.00 46.79  ? 283  GLN I N   1 
ATOM   9011  C CA  . GLN M  1 137 ? 30.190  80.954  85.919  1.00 48.33  ? 283  GLN I CA  1 
ATOM   9012  C C   . GLN M  1 137 ? 30.224  80.926  87.440  1.00 53.53  ? 283  GLN I C   1 
ATOM   9013  O O   . GLN M  1 137 ? 31.286  81.013  88.063  1.00 53.78  ? 283  GLN I O   1 
ATOM   9014  C CB  . GLN M  1 137 ? 31.274  80.041  85.331  1.00 45.47  ? 283  GLN I CB  1 
ATOM   9015  C CG  . GLN M  1 137 ? 31.507  78.713  86.048  1.00 55.00  ? 283  GLN I CG  1 
ATOM   9016  C CD  . GLN M  1 137 ? 30.266  77.846  86.158  1.00 60.86  ? 283  GLN I CD  1 
ATOM   9017  O OE1 . GLN M  1 137 ? 29.636  77.479  85.149  1.00 61.80  ? 283  GLN I OE1 1 
ATOM   9018  N NE2 . GLN M  1 137 ? 29.913  77.499  87.391  1.00 56.22  ? 283  GLN I NE2 1 
ATOM   9019  N N   . ALA M  1 138 ? 29.043  80.810  88.035  1.00 58.97  ? 284  ALA I N   1 
ATOM   9020  C CA  . ALA M  1 138 ? 28.904  80.775  89.490  1.00 58.16  ? 284  ALA I CA  1 
ATOM   9021  C C   . ALA M  1 138 ? 27.474  80.387  89.826  1.00 58.50  ? 284  ALA I C   1 
ATOM   9022  O O   . ALA M  1 138 ? 26.641  80.205  88.935  1.00 59.10  ? 284  ALA I O   1 
ATOM   9023  C CB  . ALA M  1 138 ? 29.208  82.141  90.071  1.00 50.24  ? 284  ALA I CB  1 
ATOM   9024  N N   . CYS M  1 139 ? 27.179  80.249  91.110  1.00 58.06  ? 285  CYS I N   1 
ATOM   9025  C CA  . CYS M  1 139 ? 25.818  79.925  91.494  1.00 54.49  ? 285  CYS I CA  1 
ATOM   9026  C C   . CYS M  1 139 ? 25.088  81.240  91.608  1.00 57.52  ? 285  CYS I C   1 
ATOM   9027  O O   . CYS M  1 139 ? 25.711  82.304  91.754  1.00 63.97  ? 285  CYS I O   1 
ATOM   9028  C CB  . CYS M  1 139 ? 25.776  79.220  92.840  1.00 50.75  ? 285  CYS I CB  1 
ATOM   9029  S SG  . CYS M  1 139 ? 26.497  77.565  92.803  1.00 55.13  ? 285  CYS I SG  1 
ATOM   9030  N N   . GLN M  1 140 ? 23.770  81.169  91.530  1.00 51.39  ? 286  GLN I N   1 
ATOM   9031  C CA  . GLN M  1 140 ? 22.928  82.347  91.653  1.00 49.18  ? 286  GLN I CA  1 
ATOM   9032  C C   . GLN M  1 140 ? 21.871  82.047  92.713  1.00 50.74  ? 286  GLN I C   1 
ATOM   9033  O O   . GLN M  1 140 ? 20.815  82.678  92.772  1.00 46.50  ? 286  GLN I O   1 
ATOM   9034  C CB  . GLN M  1 140 ? 22.266  82.657  90.315  1.00 53.91  ? 286  GLN I CB  1 
ATOM   9035  C CG  . GLN M  1 140 ? 23.164  83.361  89.330  1.00 50.77  ? 286  GLN I CG  1 
ATOM   9036  C CD  . GLN M  1 140 ? 23.657  84.677  89.863  1.00 51.29  ? 286  GLN I CD  1 
ATOM   9037  O OE1 . GLN M  1 140 ? 24.770  84.768  90.387  1.00 46.07  ? 286  GLN I OE1 1 
ATOM   9038  N NE2 . GLN M  1 140 ? 22.822  85.711  89.751  1.00 50.32  ? 286  GLN I NE2 1 
ATOM   9039  N N   . GLY M  1 141 ? 22.180  81.068  93.554  1.00 54.77  ? 287  GLY I N   1 
ATOM   9040  C CA  . GLY M  1 141 ? 21.276  80.664  94.610  1.00 59.20  ? 287  GLY I CA  1 
ATOM   9041  C C   . GLY M  1 141 ? 21.604  79.254  95.034  1.00 65.49  ? 287  GLY I C   1 
ATOM   9042  O O   . GLY M  1 141 ? 22.469  78.610  94.451  1.00 65.16  ? 287  GLY I O   1 
ATOM   9043  N N   . ASP M  1 142 ? 20.904  78.761  96.045  1.00 75.81  ? 288  ASP I N   1 
ATOM   9044  C CA  . ASP M  1 142 ? 21.139  77.410  96.545  1.00 81.33  ? 288  ASP I CA  1 
ATOM   9045  C C   . ASP M  1 142 ? 20.051  76.423  96.124  1.00 80.00  ? 288  ASP I C   1 
ATOM   9046  O O   . ASP M  1 142 ? 20.010  75.305  96.625  1.00 82.73  ? 288  ASP I O   1 
ATOM   9047  C CB  . ASP M  1 142 ? 21.230  77.438  98.066  1.00 84.26  ? 288  ASP I CB  1 
ATOM   9048  C CG  . ASP M  1 142 ? 20.023  78.105  98.697  1.00 95.49  ? 288  ASP I CG  1 
ATOM   9049  O OD1 . ASP M  1 142 ? 19.776  79.304  98.399  1.00 100.00 ? 288  ASP I OD1 1 
ATOM   9050  O OD2 . ASP M  1 142 ? 19.318  77.431  99.482  1.00 98.51  ? 288  ASP I OD2 1 
ATOM   9051  N N   . ASN M  1 143 ? 19.173  76.831  95.211  1.00 75.96  ? 289  ASN I N   1 
ATOM   9052  C CA  . ASN M  1 143 ? 18.112  75.943  94.759  1.00 73.25  ? 289  ASN I CA  1 
ATOM   9053  C C   . ASN M  1 143 ? 18.555  75.076  93.600  1.00 74.48  ? 289  ASN I C   1 
ATOM   9054  O O   . ASN M  1 143 ? 19.438  75.458  92.832  1.00 76.76  ? 289  ASN I O   1 
ATOM   9055  C CB  . ASN M  1 143 ? 16.888  76.740  94.332  1.00 68.79  ? 289  ASN I CB  1 
ATOM   9056  C CG  . ASN M  1 143 ? 16.331  77.571  95.448  1.00 64.05  ? 289  ASN I CG  1 
ATOM   9057  O OD1 . ASN M  1 143 ? 16.838  77.542  96.567  1.00 66.05  ? 289  ASN I OD1 1 
ATOM   9058  N ND2 . ASN M  1 143 ? 15.283  78.323  95.154  1.00 63.55  ? 289  ASN I ND2 1 
ATOM   9059  N N   . TYR M  1 144 ? 17.931  73.906  93.482  1.00 75.02  ? 290  TYR I N   1 
ATOM   9060  C CA  . TYR M  1 144 ? 18.238  72.976  92.405  1.00 71.25  ? 290  TYR I CA  1 
ATOM   9061  C C   . TYR M  1 144 ? 17.195  73.085  91.309  1.00 69.74  ? 290  TYR I C   1 
ATOM   9062  O O   . TYR M  1 144 ? 15.999  72.973  91.559  1.00 75.57  ? 290  TYR I O   1 
ATOM   9063  C CB  . TYR M  1 144 ? 18.266  71.540  92.915  1.00 68.14  ? 290  TYR I CB  1 
ATOM   9064  C CG  . TYR M  1 144 ? 19.429  71.209  93.813  1.00 76.16  ? 290  TYR I CG  1 
ATOM   9065  C CD1 . TYR M  1 144 ? 19.349  71.401  95.200  1.00 75.79  ? 290  TYR I CD1 1 
ATOM   9066  C CD2 . TYR M  1 144 ? 20.605  70.666  93.279  1.00 79.57  ? 290  TYR I CD2 1 
ATOM   9067  C CE1 . TYR M  1 144 ? 20.412  71.052  96.037  1.00 82.79  ? 290  TYR I CE1 1 
ATOM   9068  C CE2 . TYR M  1 144 ? 21.677  70.316  94.099  1.00 87.64  ? 290  TYR I CE2 1 
ATOM   9069  C CZ  . TYR M  1 144 ? 21.577  70.507  95.480  1.00 90.49  ? 290  TYR I CZ  1 
ATOM   9070  O OH  . TYR M  1 144 ? 22.636  70.137  96.290  1.00 92.47  ? 290  TYR I OH  1 
ATOM   9071  N N   . GLN M  1 145 ? 17.643  73.324  90.089  1.00 69.85  ? 291  GLN I N   1 
ATOM   9072  C CA  . GLN M  1 145 ? 16.716  73.413  88.979  1.00 63.98  ? 291  GLN I CA  1 
ATOM   9073  C C   . GLN M  1 145 ? 16.204  71.988  88.808  1.00 63.57  ? 291  GLN I C   1 
ATOM   9074  O O   . GLN M  1 145 ? 16.997  71.052  88.617  1.00 55.68  ? 291  GLN I O   1 
ATOM   9075  C CB  . GLN M  1 145 ? 17.455  73.882  87.723  1.00 65.45  ? 291  GLN I CB  1 
ATOM   9076  C CG  . GLN M  1 145 ? 16.593  73.994  86.468  1.00 60.19  ? 291  GLN I CG  1 
ATOM   9077  C CD  . GLN M  1 145 ? 15.587  75.144  86.516  1.00 59.40  ? 291  GLN I CD  1 
ATOM   9078  O OE1 . GLN M  1 145 ? 15.564  75.949  87.448  1.00 56.89  ? 291  GLN I OE1 1 
ATOM   9079  N NE2 . GLN M  1 145 ? 14.755  75.226  85.492  1.00 66.06  ? 291  GLN I NE2 1 
ATOM   9080  N N   . LYS M  1 146 ? 14.887  71.823  88.910  1.00 64.91  ? 292  LYS I N   1 
ATOM   9081  C CA  . LYS M  1 146 ? 14.275  70.507  88.767  1.00 67.19  ? 292  LYS I CA  1 
ATOM   9082  C C   . LYS M  1 146 ? 14.114  70.149  87.288  1.00 67.94  ? 292  LYS I C   1 
ATOM   9083  O O   . LYS M  1 146 ? 14.033  71.033  86.411  1.00 59.15  ? 292  LYS I O   1 
ATOM   9084  C CB  . LYS M  1 146 ? 12.917  70.470  89.470  1.00 66.05  ? 292  LYS I CB  1 
ATOM   9085  C CG  . LYS M  1 146 ? 12.944  70.981  90.907  1.00 71.93  ? 292  LYS I CG  1 
ATOM   9086  C CD  . LYS M  1 146 ? 11.561  70.892  91.552  1.00 79.31  ? 292  LYS I CD  1 
ATOM   9087  C CE  . LYS M  1 146 ? 11.387  71.893  92.687  1.00 81.86  ? 292  LYS I CE  1 
ATOM   9088  N NZ  . LYS M  1 146 ? 11.397  73.306  92.207  1.00 78.60  ? 292  LYS I NZ  1 
ATOM   9089  N N   . GLY M  1 147 ? 14.085  68.843  87.020  1.00 70.90  ? 293  GLY I N   1 
ATOM   9090  C CA  . GLY M  1 147 ? 13.946  68.366  85.655  1.00 71.16  ? 293  GLY I CA  1 
ATOM   9091  C C   . GLY M  1 147 ? 12.527  67.939  85.335  1.00 69.08  ? 293  GLY I C   1 
ATOM   9092  O O   . GLY M  1 147 ? 11.774  67.532  86.223  1.00 69.25  ? 293  GLY I O   1 
ATOM   9093  N N   . ILE M  1 148 ? 12.159  68.059  84.064  1.00 66.25  ? 294  ILE I N   1 
ATOM   9094  C CA  . ILE M  1 148 ? 10.833  67.680  83.598  1.00 65.42  ? 294  ILE I CA  1 
ATOM   9095  C C   . ILE M  1 148 ? 11.016  66.799  82.352  1.00 70.43  ? 294  ILE I C   1 
ATOM   9096  O O   . ILE M  1 148 ? 11.878  67.049  81.510  1.00 67.76  ? 294  ILE I O   1 
ATOM   9097  C CB  . ILE M  1 148 ? 9.968   68.916  83.240  1.00 57.74  ? 294  ILE I CB  1 
ATOM   9098  C CG1 . ILE M  1 148 ? 10.462  69.538  81.941  1.00 60.60  ? 294  ILE I CG1 1 
ATOM   9099  C CG2 . ILE M  1 148 ? 10.016  69.935  84.367  1.00 51.21  ? 294  ILE I CG2 1 
ATOM   9100  C CD1 . ILE M  1 148 ? 9.662   70.727  81.476  1.00 64.14  ? 294  ILE I CD1 1 
ATOM   9101  N N   . PRO M  1 149 ? 10.199  65.747  82.225  1.00 73.05  ? 295  PRO I N   1 
ATOM   9102  C CA  . PRO M  1 149 ? 10.253  64.808  81.100  1.00 68.58  ? 295  PRO I CA  1 
ATOM   9103  C C   . PRO M  1 149 ? 9.636   65.304  79.800  1.00 66.93  ? 295  PRO I C   1 
ATOM   9104  O O   . PRO M  1 149 ? 8.628   66.008  79.817  1.00 68.02  ? 295  PRO I O   1 
ATOM   9105  C CB  . PRO M  1 149 ? 9.504   63.617  81.646  1.00 67.68  ? 295  PRO I CB  1 
ATOM   9106  C CG  . PRO M  1 149 ? 8.401   64.294  82.420  1.00 68.65  ? 295  PRO I CG  1 
ATOM   9107  C CD  . PRO M  1 149 ? 9.154   65.352  83.189  1.00 70.00  ? 295  PRO I CD  1 
ATOM   9108  N N   . VAL M  1 150 ? 10.235  64.919  78.675  1.00 66.23  ? 296  VAL I N   1 
ATOM   9109  C CA  . VAL M  1 150 ? 9.715   65.312  77.368  1.00 72.99  ? 296  VAL I CA  1 
ATOM   9110  C C   . VAL M  1 150 ? 10.129  64.285  76.337  1.00 78.54  ? 296  VAL I C   1 
ATOM   9111  O O   . VAL M  1 150 ? 10.783  63.308  76.670  1.00 77.59  ? 296  VAL I O   1 
ATOM   9112  C CB  . VAL M  1 150 ? 10.262  66.676  76.910  1.00 74.19  ? 296  VAL I CB  1 
ATOM   9113  C CG1 . VAL M  1 150 ? 9.768   67.788  77.839  1.00 78.02  ? 296  VAL I CG1 1 
ATOM   9114  C CG2 . VAL M  1 150 ? 11.787  66.625  76.868  1.00 69.44  ? 296  VAL I CG2 1 
ATOM   9115  N N   . GLU M  1 151 ? 9.741   64.509  75.085  1.00 85.92  ? 297  GLU I N   1 
ATOM   9116  C CA  . GLU M  1 151 ? 10.095  63.607  73.990  1.00 91.57  ? 297  GLU I CA  1 
ATOM   9117  C C   . GLU M  1 151 ? 11.411  64.088  73.398  1.00 94.35  ? 297  GLU I C   1 
ATOM   9118  O O   . GLU M  1 151 ? 11.583  65.290  73.204  1.00 93.80  ? 297  GLU I O   1 
ATOM   9119  C CB  . GLU M  1 151 ? 9.034   63.648  72.892  1.00 96.70  ? 297  GLU I CB  1 
ATOM   9120  C CG  . GLU M  1 151 ? 9.151   62.495  71.911  1.00 100.00 ? 297  GLU I CG  1 
ATOM   9121  C CD  . GLU M  1 151 ? 8.694   61.174  72.524  1.00 100.00 ? 297  GLU I CD  1 
ATOM   9122  O OE1 . GLU M  1 151 ? 8.913   60.978  73.746  1.00 100.00 ? 297  GLU I OE1 1 
ATOM   9123  O OE2 . GLU M  1 151 ? 8.126   60.333  71.786  1.00 99.55  ? 297  GLU I OE2 1 
ATOM   9124  N N   . THR M  1 152 ? 12.321  63.160  73.090  1.00 98.76  ? 298  THR I N   1 
ATOM   9125  C CA  . THR M  1 152 ? 13.640  63.507  72.529  1.00 100.00 ? 298  THR I CA  1 
ATOM   9126  C C   . THR M  1 152 ? 13.578  64.596  71.430  1.00 100.00 ? 298  THR I C   1 
ATOM   9127  O O   . THR M  1 152 ? 12.854  64.466  70.434  1.00 100.00 ? 298  THR I O   1 
ATOM   9128  C CB  . THR M  1 152 ? 14.389  62.233  72.006  1.00 100.00 ? 298  THR I CB  1 
ATOM   9129  O OG1 . THR M  1 152 ? 14.590  61.311  73.093  1.00 98.01  ? 298  THR I OG1 1 
ATOM   9130  C CG2 . THR M  1 152 ? 15.759  62.611  71.410  1.00 99.69  ? 298  THR I CG2 1 
ATOM   9131  N N   . ASP M  1 153 ? 14.371  65.654  71.650  1.00 100.00 ? 299  ASP I N   1 
ATOM   9132  C CA  . ASP M  1 153 ? 14.476  66.875  70.816  1.00 100.00 ? 299  ASP I CA  1 
ATOM   9133  C C   . ASP M  1 153 ? 15.023  66.867  69.375  1.00 100.00 ? 299  ASP I C   1 
ATOM   9134  O O   . ASP M  1 153 ? 15.984  67.634  69.092  1.00 97.44  ? 299  ASP I O   1 
ATOM   9135  C CB  . ASP M  1 153 ? 15.246  67.924  71.622  1.00 96.49  ? 299  ASP I CB  1 
ATOM   9136  C CG  . ASP M  1 153 ? 14.470  68.401  72.831  1.00 93.61  ? 299  ASP I CG  1 
ATOM   9137  O OD1 . ASP M  1 153 ? 13.641  69.324  72.654  1.00 86.48  ? 299  ASP I OD1 1 
ATOM   9138  O OD2 . ASP M  1 153 ? 14.679  67.842  73.938  1.00 83.50  ? 299  ASP I OD2 1 
ATOM   9139  O OXT . ASP M  1 153 ? 14.456  66.132  68.534  1.00 100.00 ? 299  ASP I OXT 1 
ATOM   9140  N N   . THR N  2 1   ? 29.231  110.264 62.329  1.00 96.84  ? 318  THR J N   1 
ATOM   9141  C CA  . THR N  2 1   ? 28.871  110.161 63.788  1.00 100.00 ? 318  THR J CA  1 
ATOM   9142  C C   . THR N  2 1   ? 27.354  109.998 64.019  1.00 100.00 ? 318  THR J C   1 
ATOM   9143  O O   . THR N  2 1   ? 26.549  110.787 63.512  1.00 100.00 ? 318  THR J O   1 
ATOM   9144  C CB  . THR N  2 1   ? 29.393  111.402 64.591  1.00 98.91  ? 318  THR J CB  1 
ATOM   9145  O OG1 . THR N  2 1   ? 28.970  112.616 63.948  1.00 96.09  ? 318  THR J OG1 1 
ATOM   9146  C CG2 . THR N  2 1   ? 30.929  111.371 64.701  1.00 91.61  ? 318  THR J CG2 1 
ATOM   9147  N N   . ARG N  2 2   ? 26.980  108.975 64.791  1.00 100.00 ? 319  ARG J N   1 
ATOM   9148  C CA  . ARG N  2 2   ? 25.573  108.664 65.082  1.00 100.00 ? 319  ARG J CA  1 
ATOM   9149  C C   . ARG N  2 2   ? 25.451  108.144 66.527  1.00 99.92  ? 319  ARG J C   1 
ATOM   9150  O O   . ARG N  2 2   ? 26.438  107.629 67.075  1.00 97.40  ? 319  ARG J O   1 
ATOM   9151  C CB  . ARG N  2 2   ? 25.100  107.608 64.080  1.00 100.00 ? 319  ARG J CB  1 
ATOM   9152  C CG  . ARG N  2 2   ? 23.622  107.287 64.098  1.00 100.00 ? 319  ARG J CG  1 
ATOM   9153  C CD  . ARG N  2 2   ? 23.308  106.243 63.016  1.00 100.00 ? 319  ARG J CD  1 
ATOM   9154  N NE  . ARG N  2 2   ? 24.110  105.024 63.168  1.00 100.00 ? 319  ARG J NE  1 
ATOM   9155  C CZ  . ARG N  2 2   ? 24.081  103.992 62.329  1.00 97.84  ? 319  ARG J CZ  1 
ATOM   9156  N NH1 . ARG N  2 2   ? 23.291  104.016 61.261  1.00 96.11  ? 319  ARG J NH1 1 
ATOM   9157  N NH2 . ARG N  2 2   ? 24.841  102.933 62.563  1.00 96.42  ? 319  ARG J NH2 1 
ATOM   9158  N N   . TYR N  2 3   ? 24.263  108.252 67.144  1.00 94.98  ? 320  TYR J N   1 
ATOM   9159  C CA  . TYR N  2 3   ? 24.128  107.800 68.540  1.00 92.52  ? 320  TYR J CA  1 
ATOM   9160  C C   . TYR N  2 3   ? 23.463  106.451 68.794  1.00 87.98  ? 320  TYR J C   1 
ATOM   9161  O O   . TYR N  2 3   ? 22.516  106.074 68.098  1.00 91.06  ? 320  TYR J O   1 
ATOM   9162  C CB  . TYR N  2 3   ? 23.370  108.832 69.388  1.00 92.20  ? 320  TYR J CB  1 
ATOM   9163  C CG  . TYR N  2 3   ? 24.115  110.101 69.666  1.00 93.85  ? 320  TYR J CG  1 
ATOM   9164  C CD1 . TYR N  2 3   ? 25.280  110.419 68.967  1.00 95.10  ? 320  TYR J CD1 1 
ATOM   9165  C CD2 . TYR N  2 3   ? 23.645  110.997 70.621  1.00 95.20  ? 320  TYR J CD2 1 
ATOM   9166  C CE1 . TYR N  2 3   ? 25.963  111.601 69.209  1.00 99.45  ? 320  TYR J CE1 1 
ATOM   9167  C CE2 . TYR N  2 3   ? 24.317  112.187 70.877  1.00 100.00 ? 320  TYR J CE2 1 
ATOM   9168  C CZ  . TYR N  2 3   ? 25.477  112.486 70.165  1.00 100.00 ? 320  TYR J CZ  1 
ATOM   9169  O OH  . TYR N  2 3   ? 26.144  113.671 70.407  1.00 100.00 ? 320  TYR J OH  1 
ATOM   9170  N N   . ILE N  2 4   ? 23.969  105.738 69.801  1.00 76.64  ? 321  ILE J N   1 
ATOM   9171  C CA  . ILE N  2 4   ? 23.398  104.470 70.214  1.00 68.29  ? 321  ILE J CA  1 
ATOM   9172  C C   . ILE N  2 4   ? 23.300  104.584 71.722  1.00 70.33  ? 321  ILE J C   1 
ATOM   9173  O O   . ILE N  2 4   ? 23.990  105.398 72.327  1.00 69.94  ? 321  ILE J O   1 
ATOM   9174  C CB  . ILE N  2 4   ? 24.273  103.252 69.846  1.00 62.47  ? 321  ILE J CB  1 
ATOM   9175  C CG1 . ILE N  2 4   ? 25.583  103.283 70.612  1.00 59.62  ? 321  ILE J CG1 1 
ATOM   9176  C CG2 . ILE N  2 4   ? 24.512  103.219 68.358  1.00 59.70  ? 321  ILE J CG2 1 
ATOM   9177  C CD1 . ILE N  2 4   ? 26.439  102.069 70.333  1.00 63.51  ? 321  ILE J CD1 1 
ATOM   9178  N N   . PRO N  2 5   ? 22.419  103.796 72.351  1.00 74.46  ? 322  PRO J N   1 
ATOM   9179  C CA  . PRO N  2 5   ? 22.304  103.888 73.810  1.00 71.69  ? 322  PRO J CA  1 
ATOM   9180  C C   . PRO N  2 5   ? 23.531  103.484 74.621  1.00 66.31  ? 322  PRO J C   1 
ATOM   9181  O O   . PRO N  2 5   ? 24.321  102.617 74.220  1.00 61.63  ? 322  PRO J O   1 
ATOM   9182  C CB  . PRO N  2 5   ? 21.064  103.035 74.125  1.00 77.54  ? 322  PRO J CB  1 
ATOM   9183  C CG  . PRO N  2 5   ? 20.925  102.118 72.924  1.00 78.93  ? 322  PRO J CG  1 
ATOM   9184  C CD  . PRO N  2 5   ? 21.300  103.024 71.779  1.00 78.34  ? 322  PRO J CD  1 
ATOM   9185  N N   . ASP N  2 6   ? 23.667  104.152 75.765  1.00 62.47  ? 323  ASP J N   1 
ATOM   9186  C CA  . ASP N  2 6   ? 24.755  103.937 76.705  1.00 58.26  ? 323  ASP J CA  1 
ATOM   9187  C C   . ASP N  2 6   ? 25.011  102.451 76.950  1.00 58.58  ? 323  ASP J C   1 
ATOM   9188  O O   . ASP N  2 6   ? 26.162  102.000 76.887  1.00 58.07  ? 323  ASP J O   1 
ATOM   9189  C CB  . ASP N  2 6   ? 24.429  104.654 78.033  1.00 61.29  ? 323  ASP J CB  1 
ATOM   9190  C CG  . ASP N  2 6   ? 25.609  104.672 79.011  1.00 61.85  ? 323  ASP J CG  1 
ATOM   9191  O OD1 . ASP N  2 6   ? 26.773  104.687 78.562  1.00 51.59  ? 323  ASP J OD1 1 
ATOM   9192  O OD2 . ASP N  2 6   ? 25.372  104.693 80.237  1.00 68.29  ? 323  ASP J OD2 1 
ATOM   9193  N N   . GLU N  2 7   ? 23.937  101.690 77.186  1.00 56.58  ? 324  GLU J N   1 
ATOM   9194  C CA  . GLU N  2 7   ? 24.050  100.263 77.479  1.00 52.18  ? 324  GLU J CA  1 
ATOM   9195  C C   . GLU N  2 7   ? 23.963  99.296  76.295  1.00 51.29  ? 324  GLU J C   1 
ATOM   9196  O O   . GLU N  2 7   ? 23.715  98.097  76.480  1.00 49.56  ? 324  GLU J O   1 
ATOM   9197  C CB  . GLU N  2 7   ? 23.011  99.863  78.530  1.00 55.81  ? 324  GLU J CB  1 
ATOM   9198  C CG  . GLU N  2 7   ? 22.992  100.736 79.771  1.00 59.42  ? 324  GLU J CG  1 
ATOM   9199  C CD  . GLU N  2 7   ? 22.231  100.101 80.913  1.00 64.75  ? 324  GLU J CD  1 
ATOM   9200  O OE1 . GLU N  2 7   ? 22.198  98.850  80.987  1.00 67.89  ? 324  GLU J OE1 1 
ATOM   9201  O OE2 . GLU N  2 7   ? 21.674  100.854 81.743  1.00 69.53  ? 324  GLU J OE2 1 
ATOM   9202  N N   . ALA N  2 8   ? 24.181  99.795  75.085  1.00 47.78  ? 325  ALA J N   1 
ATOM   9203  C CA  . ALA N  2 8   ? 24.136  98.927  73.913  1.00 46.69  ? 325  ALA J CA  1 
ATOM   9204  C C   . ALA N  2 8   ? 25.315  97.957  73.848  1.00 50.97  ? 325  ALA J C   1 
ATOM   9205  O O   . ALA N  2 8   ? 26.253  98.011  74.642  1.00 55.65  ? 325  ALA J O   1 
ATOM   9206  C CB  . ALA N  2 8   ? 24.100  99.755  72.653  1.00 40.71  ? 325  ALA J CB  1 
ATOM   9207  N N   . ASP N  2 9   ? 25.244  97.056  72.884  1.00 53.58  ? 326  ASP J N   1 
ATOM   9208  C CA  . ASP N  2 9   ? 26.282  96.063  72.635  1.00 53.65  ? 326  ASP J CA  1 
ATOM   9209  C C   . ASP N  2 9   ? 26.829  95.263  73.797  1.00 53.67  ? 326  ASP J C   1 
ATOM   9210  O O   . ASP N  2 9   ? 28.036  95.130  73.944  1.00 64.88  ? 326  ASP J O   1 
ATOM   9211  C CB  . ASP N  2 9   ? 27.422  96.743  71.901  1.00 53.87  ? 326  ASP J CB  1 
ATOM   9212  C CG  . ASP N  2 9   ? 26.916  97.775  70.929  1.00 65.38  ? 326  ASP J CG  1 
ATOM   9213  O OD1 . ASP N  2 9   ? 26.377  97.386  69.864  1.00 60.65  ? 326  ASP J OD1 1 
ATOM   9214  O OD2 . ASP N  2 9   ? 27.032  98.980  71.252  1.00 71.62  ? 326  ASP J OD2 1 
ATOM   9215  N N   . PHE N  2 10  ? 25.951  94.711  74.618  1.00 53.61  ? 327  PHE J N   1 
ATOM   9216  C CA  . PHE N  2 10  ? 26.398  93.888  75.726  1.00 48.73  ? 327  PHE J CA  1 
ATOM   9217  C C   . PHE N  2 10  ? 25.921  92.466  75.521  1.00 46.69  ? 327  PHE J C   1 
ATOM   9218  O O   . PHE N  2 10  ? 24.901  92.220  74.874  1.00 53.02  ? 327  PHE J O   1 
ATOM   9219  C CB  . PHE N  2 10  ? 25.823  94.385  77.044  1.00 48.30  ? 327  PHE J CB  1 
ATOM   9220  C CG  . PHE N  2 10  ? 26.695  95.367  77.762  1.00 56.83  ? 327  PHE J CG  1 
ATOM   9221  C CD1 . PHE N  2 10  ? 26.590  96.722  77.492  1.00 62.36  ? 327  PHE J CD1 1 
ATOM   9222  C CD2 . PHE N  2 10  ? 27.589  94.942  78.746  1.00 54.25  ? 327  PHE J CD2 1 
ATOM   9223  C CE1 . PHE N  2 10  ? 27.352  97.649  78.196  1.00 61.27  ? 327  PHE J CE1 1 
ATOM   9224  C CE2 . PHE N  2 10  ? 28.352  95.852  79.451  1.00 54.05  ? 327  PHE J CE2 1 
ATOM   9225  C CZ  . PHE N  2 10  ? 28.233  97.210  79.178  1.00 59.85  ? 327  PHE J CZ  1 
ATOM   9226  N N   . LEU N  2 11  ? 26.666  91.528  76.070  1.00 33.17  ? 328  LEU J N   1 
ATOM   9227  C CA  . LEU N  2 11  ? 26.283  90.147  76.002  1.00 34.97  ? 328  LEU J CA  1 
ATOM   9228  C C   . LEU N  2 11  ? 26.694  89.524  77.325  1.00 45.02  ? 328  LEU J C   1 
ATOM   9229  O O   . LEU N  2 11  ? 27.896  89.385  77.612  1.00 49.71  ? 328  LEU J O   1 
ATOM   9230  C CB  . LEU N  2 11  ? 26.969  89.428  74.850  1.00 30.80  ? 328  LEU J CB  1 
ATOM   9231  C CG  . LEU N  2 11  ? 26.873  87.901  75.003  1.00 45.44  ? 328  LEU J CG  1 
ATOM   9232  C CD1 . LEU N  2 11  ? 25.457  87.505  75.396  1.00 45.60  ? 328  LEU J CD1 1 
ATOM   9233  C CD2 . LEU N  2 11  ? 27.275  87.210  73.712  1.00 50.12  ? 328  LEU J CD2 1 
ATOM   9234  N N   . LEU N  2 12  ? 25.700  89.178  78.143  1.00 42.45  ? 329  LEU J N   1 
ATOM   9235  C CA  . LEU N  2 12  ? 25.966  88.566  79.440  1.00 41.75  ? 329  LEU J CA  1 
ATOM   9236  C C   . LEU N  2 12  ? 25.572  87.112  79.352  1.00 42.12  ? 329  LEU J C   1 
ATOM   9237  O O   . LEU N  2 12  ? 24.447  86.792  79.001  1.00 48.79  ? 329  LEU J O   1 
ATOM   9238  C CB  . LEU N  2 12  ? 25.167  89.251  80.562  1.00 36.21  ? 329  LEU J CB  1 
ATOM   9239  C CG  . LEU N  2 12  ? 25.193  88.475  81.892  1.00 36.99  ? 329  LEU J CG  1 
ATOM   9240  C CD1 . LEU N  2 12  ? 26.582  88.030  82.226  1.00 37.79  ? 329  LEU J CD1 1 
ATOM   9241  C CD2 . LEU N  2 12  ? 24.659  89.324  82.980  1.00 29.91  ? 329  LEU J CD2 1 
ATOM   9242  N N   . GLY N  2 13  ? 26.502  86.235  79.675  1.00 37.98  ? 330  GLY J N   1 
ATOM   9243  C CA  . GLY N  2 13  ? 26.218  84.831  79.598  1.00 38.46  ? 330  GLY J CA  1 
ATOM   9244  C C   . GLY N  2 13  ? 26.295  84.193  80.954  1.00 46.90  ? 330  GLY J C   1 
ATOM   9245  O O   . GLY N  2 13  ? 27.376  83.837  81.432  1.00 41.29  ? 330  GLY J O   1 
ATOM   9246  N N   . MET N  2 14  ? 25.134  84.053  81.583  1.00 50.72  ? 331  MET J N   1 
ATOM   9247  C CA  . MET N  2 14  ? 25.048  83.420  82.897  1.00 48.45  ? 331  MET J CA  1 
ATOM   9248  C C   . MET N  2 14  ? 25.046  81.909  82.752  1.00 51.32  ? 331  MET J C   1 
ATOM   9249  O O   . MET N  2 14  ? 24.501  81.369  81.784  1.00 60.36  ? 331  MET J O   1 
ATOM   9250  C CB  . MET N  2 14  ? 23.773  83.852  83.588  1.00 46.57  ? 331  MET J CB  1 
ATOM   9251  C CG  . MET N  2 14  ? 23.711  85.332  83.874  1.00 52.17  ? 331  MET J CG  1 
ATOM   9252  S SD  . MET N  2 14  ? 25.060  85.765  84.969  1.00 62.83  ? 331  MET J SD  1 
ATOM   9253  C CE  . MET N  2 14  ? 24.411  85.256  86.505  1.00 44.05  ? 331  MET J CE  1 
ATOM   9254  N N   . ALA N  2 15  ? 25.649  81.226  83.718  1.00 53.73  ? 332  ALA J N   1 
ATOM   9255  C CA  . ALA N  2 15  ? 25.719  79.768  83.702  1.00 57.69  ? 332  ALA J CA  1 
ATOM   9256  C C   . ALA N  2 15  ? 24.431  79.161  84.234  1.00 58.02  ? 332  ALA J C   1 
ATOM   9257  O O   . ALA N  2 15  ? 24.133  77.996  83.984  1.00 67.69  ? 332  ALA J O   1 
ATOM   9258  C CB  . ALA N  2 15  ? 26.901  79.282  84.539  1.00 58.20  ? 332  ALA J CB  1 
ATOM   9259  N N   . THR N  2 16  ? 23.665  79.953  84.965  1.00 50.71  ? 333  THR J N   1 
ATOM   9260  C CA  . THR N  2 16  ? 22.428  79.467  85.534  1.00 49.75  ? 333  THR J CA  1 
ATOM   9261  C C   . THR N  2 16  ? 21.392  80.570  85.702  1.00 50.96  ? 333  THR J C   1 
ATOM   9262  O O   . THR N  2 16  ? 21.745  81.740  85.885  1.00 45.02  ? 333  THR J O   1 
ATOM   9263  C CB  . THR N  2 16  ? 22.676  78.845  86.913  1.00 47.21  ? 333  THR J CB  1 
ATOM   9264  O OG1 . THR N  2 16  ? 21.424  78.586  87.555  1.00 49.85  ? 333  THR J OG1 1 
ATOM   9265  C CG2 . THR N  2 16  ? 23.460  79.798  87.778  1.00 54.83  ? 333  THR J CG2 1 
ATOM   9266  N N   . VAL N  2 17  ? 20.114  80.193  85.628  1.00 50.56  ? 334  VAL J N   1 
ATOM   9267  C CA  . VAL N  2 17  ? 19.036  81.147  85.827  1.00 54.89  ? 334  VAL J CA  1 
ATOM   9268  C C   . VAL N  2 17  ? 19.158  81.576  87.279  1.00 60.14  ? 334  VAL J C   1 
ATOM   9269  O O   . VAL N  2 17  ? 19.889  80.951  88.067  1.00 53.73  ? 334  VAL J O   1 
ATOM   9270  C CB  . VAL N  2 17  ? 17.650  80.511  85.643  1.00 62.36  ? 334  VAL J CB  1 
ATOM   9271  C CG1 . VAL N  2 17  ? 17.406  80.233  84.176  1.00 59.44  ? 334  VAL J CG1 1 
ATOM   9272  C CG2 . VAL N  2 17  ? 17.539  79.215  86.495  1.00 55.25  ? 334  VAL J CG2 1 
ATOM   9273  N N   . ASN N  2 18  ? 18.433  82.623  87.649  1.00 63.93  ? 335  ASN J N   1 
ATOM   9274  C CA  . ASN N  2 18  ? 18.517  83.103  89.016  1.00 65.50  ? 335  ASN J CA  1 
ATOM   9275  C C   . ASN N  2 18  ? 17.996  82.089  90.040  1.00 65.65  ? 335  ASN J C   1 
ATOM   9276  O O   . ASN N  2 18  ? 17.143  81.249  89.734  1.00 64.12  ? 335  ASN J O   1 
ATOM   9277  C CB  . ASN N  2 18  ? 17.759  84.425  89.157  1.00 68.37  ? 335  ASN J CB  1 
ATOM   9278  C CG  . ASN N  2 18  ? 18.242  85.239  90.333  1.00 71.50  ? 335  ASN J CG  1 
ATOM   9279  O OD1 . ASN N  2 18  ? 17.560  86.160  90.785  1.00 72.60  ? 335  ASN J OD1 1 
ATOM   9280  N ND2 . ASN N  2 18  ? 19.435  84.910  90.832  1.00 72.32  ? 335  ASN J ND2 1 
ATOM   9281  N N   . ASN N  2 19  ? 18.538  82.180  91.253  1.00 66.90  ? 336  ASN J N   1 
ATOM   9282  C CA  . ASN N  2 19  ? 18.169  81.331  92.384  1.00 66.57  ? 336  ASN J CA  1 
ATOM   9283  C C   . ASN N  2 19  ? 18.675  79.903  92.357  1.00 68.88  ? 336  ASN J C   1 
ATOM   9284  O O   . ASN N  2 19  ? 18.433  79.150  93.300  1.00 75.95  ? 336  ASN J O   1 
ATOM   9285  C CB  . ASN N  2 19  ? 16.651  81.286  92.566  1.00 61.03  ? 336  ASN J CB  1 
ATOM   9286  C CG  . ASN N  2 19  ? 16.072  82.624  92.912  1.00 63.14  ? 336  ASN J CG  1 
ATOM   9287  O OD1 . ASN N  2 19  ? 15.691  83.405  92.035  1.00 61.12  ? 336  ASN J OD1 1 
ATOM   9288  N ND2 . ASN N  2 19  ? 16.012  82.915  94.204  1.00 77.55  ? 336  ASN J ND2 1 
ATOM   9289  N N   . CYS N  2 20  ? 19.389  79.515  91.311  1.00 66.94  ? 337  CYS J N   1 
ATOM   9290  C CA  . CYS N  2 20  ? 19.848  78.135  91.250  1.00 65.57  ? 337  CYS J CA  1 
ATOM   9291  C C   . CYS N  2 20  ? 21.341  77.945  91.241  1.00 63.07  ? 337  CYS J C   1 
ATOM   9292  O O   . CYS N  2 20  ? 22.099  78.899  91.132  1.00 69.66  ? 337  CYS J O   1 
ATOM   9293  C CB  . CYS N  2 20  ? 19.240  77.446  90.032  1.00 69.59  ? 337  CYS J CB  1 
ATOM   9294  S SG  . CYS N  2 20  ? 17.442  77.492  90.043  1.00 70.76  ? 337  CYS J SG  1 
ATOM   9295  N N   . VAL N  2 21  ? 21.750  76.687  91.344  1.00 61.26  ? 338  VAL J N   1 
ATOM   9296  C CA  . VAL N  2 21  ? 23.157  76.330  91.358  1.00 60.59  ? 338  VAL J CA  1 
ATOM   9297  C C   . VAL N  2 21  ? 23.645  75.961  89.967  1.00 58.36  ? 338  VAL J C   1 
ATOM   9298  O O   . VAL N  2 21  ? 22.844  75.642  89.097  1.00 56.84  ? 338  VAL J O   1 
ATOM   9299  C CB  . VAL N  2 21  ? 23.415  75.119  92.308  1.00 63.23  ? 338  VAL J CB  1 
ATOM   9300  C CG1 . VAL N  2 21  ? 22.844  75.418  93.707  1.00 57.92  ? 338  VAL J CG1 1 
ATOM   9301  C CG2 . VAL N  2 21  ? 22.798  73.849  91.721  1.00 54.37  ? 338  VAL J CG2 1 
ATOM   9302  N N   . SER N  2 22  ? 24.957  76.045  89.763  1.00 59.49  ? 339  SER J N   1 
ATOM   9303  C CA  . SER N  2 22  ? 25.574  75.644  88.508  1.00 63.11  ? 339  SER J CA  1 
ATOM   9304  C C   . SER N  2 22  ? 26.582  74.589  88.954  1.00 64.10  ? 339  SER J C   1 
ATOM   9305  O O   . SER N  2 22  ? 27.031  74.606  90.108  1.00 65.67  ? 339  SER J O   1 
ATOM   9306  C CB  . SER N  2 22  ? 26.253  76.825  87.820  1.00 66.51  ? 339  SER J CB  1 
ATOM   9307  O OG  . SER N  2 22  ? 27.047  77.558  88.735  1.00 77.86  ? 339  SER J OG  1 
ATOM   9308  N N   . TYR N  2 23  ? 26.929  73.669  88.059  1.00 66.19  ? 340  TYR J N   1 
ATOM   9309  C CA  . TYR N  2 23  ? 27.832  72.583  88.426  1.00 71.28  ? 340  TYR J CA  1 
ATOM   9310  C C   . TYR N  2 23  ? 29.262  72.635  87.938  1.00 70.77  ? 340  TYR J C   1 
ATOM   9311  O O   . TYR N  2 23  ? 29.548  73.058  86.814  1.00 69.97  ? 340  TYR J O   1 
ATOM   9312  C CB  . TYR N  2 23  ? 27.216  71.239  88.025  1.00 76.52  ? 340  TYR J CB  1 
ATOM   9313  C CG  . TYR N  2 23  ? 25.943  70.913  88.777  1.00 78.35  ? 340  TYR J CG  1 
ATOM   9314  C CD1 . TYR N  2 23  ? 25.996  70.426  90.087  1.00 80.21  ? 340  TYR J CD1 1 
ATOM   9315  C CD2 . TYR N  2 23  ? 24.689  71.136  88.205  1.00 73.32  ? 340  TYR J CD2 1 
ATOM   9316  C CE1 . TYR N  2 23  ? 24.833  70.173  90.812  1.00 78.78  ? 340  TYR J CE1 1 
ATOM   9317  C CE2 . TYR N  2 23  ? 23.523  70.883  88.919  1.00 75.91  ? 340  TYR J CE2 1 
ATOM   9318  C CZ  . TYR N  2 23  ? 23.605  70.404  90.224  1.00 77.70  ? 340  TYR J CZ  1 
ATOM   9319  O OH  . TYR N  2 23  ? 22.469  70.158  90.956  1.00 81.87  ? 340  TYR J OH  1 
ATOM   9320  N N   . ARG N  2 24  ? 30.145  72.166  88.816  1.00 71.10  ? 341  ARG J N   1 
ATOM   9321  C CA  . ARG N  2 24  ? 31.583  72.114  88.580  1.00 75.99  ? 341  ARG J CA  1 
ATOM   9322  C C   . ARG N  2 24  ? 32.096  70.713  88.922  1.00 78.56  ? 341  ARG J C   1 
ATOM   9323  O O   . ARG N  2 24  ? 31.905  70.228  90.050  1.00 78.47  ? 341  ARG J O   1 
ATOM   9324  C CB  . ARG N  2 24  ? 32.275  73.154  89.466  1.00 70.22  ? 341  ARG J CB  1 
ATOM   9325  C CG  . ARG N  2 24  ? 33.789  73.200  89.383  1.00 69.68  ? 341  ARG J CG  1 
ATOM   9326  C CD  . ARG N  2 24  ? 34.325  73.887  90.627  1.00 66.65  ? 341  ARG J CD  1 
ATOM   9327  N NE  . ARG N  2 24  ? 33.942  73.145  91.821  1.00 64.36  ? 341  ARG J NE  1 
ATOM   9328  C CZ  . ARG N  2 24  ? 33.397  73.696  92.901  1.00 70.72  ? 341  ARG J CZ  1 
ATOM   9329  N NH1 . ARG N  2 24  ? 33.173  75.002  92.941  1.00 73.93  ? 341  ARG J NH1 1 
ATOM   9330  N NH2 . ARG N  2 24  ? 33.059  72.944  93.942  1.00 63.93  ? 341  ARG J NH2 1 
ATOM   9331  N N   . ASN N  2 25  ? 32.731  70.070  87.940  1.00 78.68  ? 342  ASN J N   1 
ATOM   9332  C CA  . ASN N  2 25  ? 33.293  68.732  88.106  1.00 81.90  ? 342  ASN J CA  1 
ATOM   9333  C C   . ASN N  2 25  ? 34.795  68.888  88.330  1.00 80.45  ? 342  ASN J C   1 
ATOM   9334  O O   . ASN N  2 25  ? 35.529  69.318  87.429  1.00 78.14  ? 342  ASN J O   1 
ATOM   9335  C CB  . ASN N  2 25  ? 33.017  67.880  86.854  1.00 85.97  ? 342  ASN J CB  1 
ATOM   9336  C CG  . ASN N  2 25  ? 33.456  66.424  87.019  1.00 90.86  ? 342  ASN J CG  1 
ATOM   9337  O OD1 . ASN N  2 25  ? 34.614  66.085  86.780  1.00 89.75  ? 342  ASN J OD1 1 
ATOM   9338  N ND2 . ASN N  2 25  ? 32.529  65.562  87.436  1.00 88.98  ? 342  ASN J ND2 1 
ATOM   9339  N N   . PRO N  2 26  ? 35.272  68.534  89.539  1.00 79.97  ? 343  PRO J N   1 
ATOM   9340  C CA  . PRO N  2 26  ? 36.693  68.640  89.887  1.00 82.50  ? 343  PRO J CA  1 
ATOM   9341  C C   . PRO N  2 26  ? 37.620  68.102  88.809  1.00 82.26  ? 343  PRO J C   1 
ATOM   9342  O O   . PRO N  2 26  ? 38.712  68.626  88.602  1.00 85.71  ? 343  PRO J O   1 
ATOM   9343  C CB  . PRO N  2 26  ? 36.791  67.842  91.186  1.00 77.63  ? 343  PRO J CB  1 
ATOM   9344  C CG  . PRO N  2 26  ? 35.476  68.124  91.825  1.00 79.89  ? 343  PRO J CG  1 
ATOM   9345  C CD  . PRO N  2 26  ? 34.515  67.945  90.657  1.00 80.45  ? 343  PRO J CD  1 
ATOM   9346  N N   . ALA N  2 27  ? 37.168  67.072  88.107  1.00 79.68  ? 344  ALA J N   1 
ATOM   9347  C CA  . ALA N  2 27  ? 37.977  66.458  87.073  1.00 76.74  ? 344  ALA J CA  1 
ATOM   9348  C C   . ALA N  2 27  ? 37.875  67.056  85.678  1.00 75.79  ? 344  ALA J C   1 
ATOM   9349  O O   . ALA N  2 27  ? 38.732  66.785  84.848  1.00 79.71  ? 344  ALA J O   1 
ATOM   9350  C CB  . ALA N  2 27  ? 37.679  64.971  87.013  1.00 75.35  ? 344  ALA J CB  1 
ATOM   9351  N N   . GLU N  2 28  ? 36.864  67.862  85.386  1.00 74.92  ? 345  GLU J N   1 
ATOM   9352  C CA  . GLU N  2 28  ? 36.795  68.395  84.026  1.00 80.52  ? 345  GLU J CA  1 
ATOM   9353  C C   . GLU N  2 28  ? 36.234  69.802  83.822  1.00 81.24  ? 345  GLU J C   1 
ATOM   9354  O O   . GLU N  2 28  ? 36.059  70.256  82.681  1.00 78.53  ? 345  GLU J O   1 
ATOM   9355  C CB  . GLU N  2 28  ? 36.067  67.391  83.113  1.00 82.64  ? 345  GLU J CB  1 
ATOM   9356  C CG  . GLU N  2 28  ? 34.835  66.731  83.723  1.00 91.23  ? 345  GLU J CG  1 
ATOM   9357  C CD  . GLU N  2 28  ? 34.306  65.594  82.869  1.00 96.19  ? 345  GLU J CD  1 
ATOM   9358  O OE1 . GLU N  2 28  ? 34.048  65.822  81.666  1.00 99.18  ? 345  GLU J OE1 1 
ATOM   9359  O OE2 . GLU N  2 28  ? 34.148  64.472  83.405  1.00 100.00 ? 345  GLU J OE2 1 
ATOM   9360  N N   . GLY N  2 29  ? 35.970  70.500  84.922  1.00 79.89  ? 346  GLY J N   1 
ATOM   9361  C CA  . GLY N  2 29  ? 35.463  71.853  84.813  1.00 76.93  ? 346  GLY J CA  1 
ATOM   9362  C C   . GLY N  2 29  ? 33.971  71.976  85.013  1.00 72.70  ? 346  GLY J C   1 
ATOM   9363  O O   . GLY N  2 29  ? 33.303  71.005  85.343  1.00 76.94  ? 346  GLY J O   1 
ATOM   9364  N N   . THR N  2 30  ? 33.456  73.183  84.816  1.00 70.26  ? 347  THR J N   1 
ATOM   9365  C CA  . THR N  2 30  ? 32.037  73.460  84.971  1.00 65.39  ? 347  THR J CA  1 
ATOM   9366  C C   . THR N  2 30  ? 31.271  73.034  83.705  1.00 65.09  ? 347  THR J C   1 
ATOM   9367  O O   . THR N  2 30  ? 31.812  73.083  82.596  1.00 62.74  ? 347  THR J O   1 
ATOM   9368  C CB  . THR N  2 30  ? 31.807  74.978  85.241  1.00 66.05  ? 347  THR J CB  1 
ATOM   9369  O OG1 . THR N  2 30  ? 32.354  75.753  84.160  1.00 54.57  ? 347  THR J OG1 1 
ATOM   9370  C CG2 . THR N  2 30  ? 32.469  75.399  86.547  1.00 53.45  ? 347  THR J CG2 1 
ATOM   9371  N N   . TRP N  2 31  ? 30.020  72.617  83.875  1.00 60.15  ? 348  TRP J N   1 
ATOM   9372  C CA  . TRP N  2 31  ? 29.214  72.186  82.745  1.00 56.08  ? 348  TRP J CA  1 
ATOM   9373  C C   . TRP N  2 31  ? 29.140  73.324  81.772  1.00 53.78  ? 348  TRP J C   1 
ATOM   9374  O O   . TRP N  2 31  ? 29.276  73.138  80.561  1.00 58.47  ? 348  TRP J O   1 
ATOM   9375  C CB  . TRP N  2 31  ? 27.783  71.860  83.164  1.00 64.07  ? 348  TRP J CB  1 
ATOM   9376  C CG  . TRP N  2 31  ? 27.596  70.703  84.101  1.00 74.42  ? 348  TRP J CG  1 
ATOM   9377  C CD1 . TRP N  2 31  ? 28.566  69.916  84.661  1.00 77.32  ? 348  TRP J CD1 1 
ATOM   9378  C CD2 . TRP N  2 31  ? 26.348  70.224  84.616  1.00 82.55  ? 348  TRP J CD2 1 
ATOM   9379  N NE1 . TRP N  2 31  ? 27.999  68.976  85.495  1.00 74.09  ? 348  TRP J NE1 1 
ATOM   9380  C CE2 . TRP N  2 31  ? 26.639  69.145  85.486  1.00 83.14  ? 348  TRP J CE2 1 
ATOM   9381  C CE3 . TRP N  2 31  ? 25.008  70.603  84.429  1.00 84.09  ? 348  TRP J CE3 1 
ATOM   9382  C CZ2 . TRP N  2 31  ? 25.636  68.443  86.170  1.00 83.09  ? 348  TRP J CZ2 1 
ATOM   9383  C CZ3 . TRP N  2 31  ? 24.014  69.903  85.108  1.00 83.64  ? 348  TRP J CZ3 1 
ATOM   9384  C CH2 . TRP N  2 31  ? 24.335  68.836  85.968  1.00 81.25  ? 348  TRP J CH2 1 
ATOM   9385  N N   . TYR N  2 32  ? 28.901  74.512  82.309  1.00 48.49  ? 349  TYR J N   1 
ATOM   9386  C CA  . TYR N  2 32  ? 28.769  75.682  81.460  1.00 55.99  ? 349  TYR J CA  1 
ATOM   9387  C C   . TYR N  2 32  ? 30.007  76.021  80.641  1.00 56.58  ? 349  TYR J C   1 
ATOM   9388  O O   . TYR N  2 32  ? 29.972  75.955  79.411  1.00 52.86  ? 349  TYR J O   1 
ATOM   9389  C CB  . TYR N  2 32  ? 28.353  76.912  82.286  1.00 57.05  ? 349  TYR J CB  1 
ATOM   9390  C CG  . TYR N  2 32  ? 28.038  78.123  81.427  1.00 51.70  ? 349  TYR J CG  1 
ATOM   9391  C CD1 . TYR N  2 32  ? 27.165  78.028  80.350  1.00 53.05  ? 349  TYR J CD1 1 
ATOM   9392  C CD2 . TYR N  2 32  ? 28.612  79.356  81.688  1.00 53.90  ? 349  TYR J CD2 1 
ATOM   9393  C CE1 . TYR N  2 32  ? 26.867  79.137  79.551  1.00 53.55  ? 349  TYR J CE1 1 
ATOM   9394  C CE2 . TYR N  2 32  ? 28.319  80.473  80.891  1.00 58.81  ? 349  TYR J CE2 1 
ATOM   9395  C CZ  . TYR N  2 32  ? 27.446  80.354  79.828  1.00 54.19  ? 349  TYR J CZ  1 
ATOM   9396  O OH  . TYR N  2 32  ? 27.145  81.458  79.071  1.00 49.12  ? 349  TYR J OH  1 
ATOM   9397  N N   . ILE N  2 33  ? 31.097  76.375  81.321  1.00 60.84  ? 350  ILE J N   1 
ATOM   9398  C CA  . ILE N  2 33  ? 32.321  76.767  80.629  1.00 61.91  ? 350  ILE J CA  1 
ATOM   9399  C C   . ILE N  2 33  ? 32.812  75.738  79.640  1.00 62.99  ? 350  ILE J C   1 
ATOM   9400  O O   . ILE N  2 33  ? 33.071  76.076  78.478  1.00 67.10  ? 350  ILE J O   1 
ATOM   9401  C CB  . ILE N  2 33  ? 33.459  77.112  81.620  1.00 62.23  ? 350  ILE J CB  1 
ATOM   9402  C CG1 . ILE N  2 33  ? 33.029  78.292  82.499  1.00 59.01  ? 350  ILE J CG1 1 
ATOM   9403  C CG2 . ILE N  2 33  ? 34.711  77.544  80.854  1.00 58.72  ? 350  ILE J CG2 1 
ATOM   9404  C CD1 . ILE N  2 33  ? 32.736  79.557  81.706  1.00 36.13  ? 350  ILE J CD1 1 
ATOM   9405  N N   . GLN N  2 34  ? 32.939  74.491  80.089  1.00 59.97  ? 351  GLN J N   1 
ATOM   9406  C CA  . GLN N  2 34  ? 33.399  73.431  79.203  1.00 58.81  ? 351  GLN J CA  1 
ATOM   9407  C C   . GLN N  2 34  ? 32.574  73.416  77.930  1.00 62.51  ? 351  GLN J C   1 
ATOM   9408  O O   . GLN N  2 34  ? 33.117  73.468  76.815  1.00 64.17  ? 351  GLN J O   1 
ATOM   9409  C CB  . GLN N  2 34  ? 33.312  72.088  79.907  1.00 59.52  ? 351  GLN J CB  1 
ATOM   9410  C CG  . GLN N  2 34  ? 34.410  71.901  80.941  1.00 64.63  ? 351  GLN J CG  1 
ATOM   9411  C CD  . GLN N  2 34  ? 35.770  72.304  80.394  1.00 69.53  ? 351  GLN J CD  1 
ATOM   9412  O OE1 . GLN N  2 34  ? 36.181  71.856  79.317  1.00 71.53  ? 351  GLN J OE1 1 
ATOM   9413  N NE2 . GLN N  2 34  ? 36.474  73.156  81.132  1.00 69.19  ? 351  GLN J NE2 1 
ATOM   9414  N N   . SER N  2 35  ? 31.257  73.378  78.103  1.00 63.07  ? 352  SER J N   1 
ATOM   9415  C CA  . SER N  2 35  ? 30.341  73.372  76.972  1.00 62.82  ? 352  SER J CA  1 
ATOM   9416  C C   . SER N  2 35  ? 30.566  74.619  76.095  1.00 58.13  ? 352  SER J C   1 
ATOM   9417  O O   . SER N  2 35  ? 30.648  74.522  74.862  1.00 51.81  ? 352  SER J O   1 
ATOM   9418  C CB  . SER N  2 35  ? 28.891  73.304  77.483  1.00 63.91  ? 352  SER J CB  1 
ATOM   9419  O OG  . SER N  2 35  ? 27.973  73.245  76.403  1.00 73.09  ? 352  SER J OG  1 
ATOM   9420  N N   . LEU N  2 36  ? 30.680  75.782  76.736  1.00 57.66  ? 353  LEU J N   1 
ATOM   9421  C CA  . LEU N  2 36  ? 30.892  77.038  76.020  1.00 54.32  ? 353  LEU J CA  1 
ATOM   9422  C C   . LEU N  2 36  ? 32.082  76.911  75.081  1.00 58.94  ? 353  LEU J C   1 
ATOM   9423  O O   . LEU N  2 36  ? 31.974  77.191  73.879  1.00 55.01  ? 353  LEU J O   1 
ATOM   9424  C CB  . LEU N  2 36  ? 31.134  78.183  77.011  1.00 46.60  ? 353  LEU J CB  1 
ATOM   9425  C CG  . LEU N  2 36  ? 31.556  79.561  76.465  1.00 48.40  ? 353  LEU J CG  1 
ATOM   9426  C CD1 . LEU N  2 36  ? 30.660  79.994  75.318  1.00 47.18  ? 353  LEU J CD1 1 
ATOM   9427  C CD2 . LEU N  2 36  ? 31.497  80.595  77.589  1.00 49.35  ? 353  LEU J CD2 1 
ATOM   9428  N N   . CYS N  2 37  ? 33.211  76.470  75.634  1.00 61.41  ? 354  CYS J N   1 
ATOM   9429  C CA  . CYS N  2 37  ? 34.441  76.311  74.865  1.00 66.84  ? 354  CYS J CA  1 
ATOM   9430  C C   . CYS N  2 37  ? 34.285  75.275  73.764  1.00 69.95  ? 354  CYS J C   1 
ATOM   9431  O O   . CYS N  2 37  ? 34.613  75.547  72.603  1.00 71.00  ? 354  CYS J O   1 
ATOM   9432  C CB  . CYS N  2 37  ? 35.604  75.920  75.786  1.00 65.40  ? 354  CYS J CB  1 
ATOM   9433  S SG  . CYS N  2 37  ? 36.140  77.230  76.897  1.00 69.14  ? 354  CYS J SG  1 
ATOM   9434  N N   . GLN N  2 38  ? 33.791  74.091  74.127  1.00 69.62  ? 355  GLN J N   1 
ATOM   9435  C CA  . GLN N  2 38  ? 33.583  73.034  73.149  1.00 66.71  ? 355  GLN J CA  1 
ATOM   9436  C C   . GLN N  2 38  ? 32.828  73.627  71.973  1.00 67.80  ? 355  GLN J C   1 
ATOM   9437  O O   . GLN N  2 38  ? 33.289  73.594  70.833  1.00 68.18  ? 355  GLN J O   1 
ATOM   9438  C CB  . GLN N  2 38  ? 32.717  71.912  73.713  1.00 73.78  ? 355  GLN J CB  1 
ATOM   9439  C CG  . GLN N  2 38  ? 33.284  71.117  74.875  1.00 89.43  ? 355  GLN J CG  1 
ATOM   9440  C CD  . GLN N  2 38  ? 32.383  69.923  75.246  1.00 97.93  ? 355  GLN J CD  1 
ATOM   9441  O OE1 . GLN N  2 38  ? 32.086  69.066  74.402  1.00 100.00 ? 355  GLN J OE1 1 
ATOM   9442  N NE2 . GLN N  2 38  ? 31.947  69.870  76.505  1.00 95.25  ? 355  GLN J NE2 1 
ATOM   9443  N N   . SER N  2 39  ? 31.650  74.169  72.269  1.00 68.16  ? 356  SER J N   1 
ATOM   9444  C CA  . SER N  2 39  ? 30.809  74.744  71.238  1.00 70.09  ? 356  SER J CA  1 
ATOM   9445  C C   . SER N  2 39  ? 31.549  75.821  70.461  1.00 68.18  ? 356  SER J C   1 
ATOM   9446  O O   . SER N  2 39  ? 31.511  75.851  69.229  1.00 63.49  ? 356  SER J O   1 
ATOM   9447  C CB  . SER N  2 39  ? 29.530  75.313  71.854  1.00 70.97  ? 356  SER J CB  1 
ATOM   9448  O OG  . SER N  2 39  ? 28.642  75.750  70.836  1.00 75.63  ? 356  SER J OG  1 
ATOM   9449  N N   . LEU N  2 40  ? 32.228  76.701  71.183  1.00 71.08  ? 357  LEU J N   1 
ATOM   9450  C CA  . LEU N  2 40  ? 32.973  77.773  70.540  1.00 72.48  ? 357  LEU J CA  1 
ATOM   9451  C C   . LEU N  2 40  ? 33.982  77.251  69.516  1.00 74.31  ? 357  LEU J C   1 
ATOM   9452  O O   . LEU N  2 40  ? 34.024  77.707  68.354  1.00 69.81  ? 357  LEU J O   1 
ATOM   9453  C CB  . LEU N  2 40  ? 33.700  78.602  71.597  1.00 60.32  ? 357  LEU J CB  1 
ATOM   9454  C CG  . LEU N  2 40  ? 32.823  79.722  72.135  1.00 59.26  ? 357  LEU J CG  1 
ATOM   9455  C CD1 . LEU N  2 40  ? 33.474  80.357  73.348  1.00 55.36  ? 357  LEU J CD1 1 
ATOM   9456  C CD2 . LEU N  2 40  ? 32.581  80.742  71.022  1.00 49.40  ? 357  LEU J CD2 1 
ATOM   9457  N N   . ARG N  2 41  ? 34.785  76.283  69.946  1.00 72.43  ? 358  ARG J N   1 
ATOM   9458  C CA  . ARG N  2 41  ? 35.807  75.734  69.078  1.00 76.91  ? 358  ARG J CA  1 
ATOM   9459  C C   . ARG N  2 41  ? 35.331  75.104  67.775  1.00 82.10  ? 358  ARG J C   1 
ATOM   9460  O O   . ARG N  2 41  ? 35.988  75.277  66.745  1.00 81.93  ? 358  ARG J O   1 
ATOM   9461  C CB  . ARG N  2 41  ? 36.708  74.774  69.865  1.00 75.88  ? 358  ARG J CB  1 
ATOM   9462  C CG  . ARG N  2 41  ? 37.894  75.521  70.487  1.00 85.12  ? 358  ARG J CG  1 
ATOM   9463  C CD  . ARG N  2 41  ? 38.869  74.625  71.218  1.00 90.22  ? 358  ARG J CD  1 
ATOM   9464  N NE  . ARG N  2 41  ? 38.293  74.090  72.448  1.00 99.51  ? 358  ARG J NE  1 
ATOM   9465  C CZ  . ARG N  2 41  ? 38.971  73.366  73.334  1.00 100.00 ? 358  ARG J CZ  1 
ATOM   9466  N NH1 . ARG N  2 41  ? 40.253  73.096  73.117  1.00 100.00 ? 358  ARG J NH1 1 
ATOM   9467  N NH2 . ARG N  2 41  ? 38.369  72.910  74.430  1.00 100.00 ? 358  ARG J NH2 1 
ATOM   9468  N N   . GLU N  2 42  ? 34.198  74.402  67.790  1.00 84.70  ? 359  GLU J N   1 
ATOM   9469  C CA  . GLU N  2 42  ? 33.706  73.782  66.564  1.00 84.07  ? 359  GLU J CA  1 
ATOM   9470  C C   . GLU N  2 42  ? 32.749  74.671  65.763  1.00 83.51  ? 359  GLU J C   1 
ATOM   9471  O O   . GLU N  2 42  ? 32.544  74.441  64.570  1.00 83.50  ? 359  GLU J O   1 
ATOM   9472  C CB  . GLU N  2 42  ? 33.042  72.445  66.884  1.00 82.09  ? 359  GLU J CB  1 
ATOM   9473  C CG  . GLU N  2 42  ? 32.007  72.534  67.981  1.00 93.80  ? 359  GLU J CG  1 
ATOM   9474  C CD  . GLU N  2 42  ? 31.324  71.203  68.263  1.00 99.61  ? 359  GLU J CD  1 
ATOM   9475  O OE1 . GLU N  2 42  ? 32.050  70.203  68.458  1.00 100.00 ? 359  GLU J OE1 1 
ATOM   9476  O OE2 . GLU N  2 42  ? 30.068  71.159  68.300  1.00 99.69  ? 359  GLU J OE2 1 
ATOM   9477  N N   . ARG N  2 43  ? 32.191  75.696  66.407  1.00 83.48  ? 360  ARG J N   1 
ATOM   9478  C CA  . ARG N  2 43  ? 31.239  76.606  65.757  1.00 85.44  ? 360  ARG J CA  1 
ATOM   9479  C C   . ARG N  2 43  ? 31.853  77.826  65.082  1.00 87.89  ? 360  ARG J C   1 
ATOM   9480  O O   . ARG N  2 43  ? 31.627  78.056  63.895  1.00 84.36  ? 360  ARG J O   1 
ATOM   9481  C CB  . ARG N  2 43  ? 30.200  77.090  66.768  1.00 85.39  ? 360  ARG J CB  1 
ATOM   9482  C CG  . ARG N  2 43  ? 29.129  76.075  67.105  1.00 89.53  ? 360  ARG J CG  1 
ATOM   9483  C CD  . ARG N  2 43  ? 28.016  76.121  66.086  1.00 87.38  ? 360  ARG J CD  1 
ATOM   9484  N NE  . ARG N  2 43  ? 26.974  75.135  66.363  1.00 90.56  ? 360  ARG J NE  1 
ATOM   9485  C CZ  . ARG N  2 43  ? 25.871  74.993  65.633  1.00 90.33  ? 360  ARG J CZ  1 
ATOM   9486  N NH1 . ARG N  2 43  ? 25.662  75.783  64.581  1.00 88.14  ? 360  ARG J NH1 1 
ATOM   9487  N NH2 . ARG N  2 43  ? 24.985  74.051  65.940  1.00 84.96  ? 360  ARG J NH2 1 
ATOM   9488  N N   . CYS N  2 44  ? 32.607  78.615  65.852  1.00 92.73  ? 361  CYS J N   1 
ATOM   9489  C CA  . CYS N  2 44  ? 33.250  79.833  65.346  1.00 91.11  ? 361  CYS J CA  1 
ATOM   9490  C C   . CYS N  2 44  ? 33.957  79.594  64.021  1.00 90.83  ? 361  CYS J C   1 
ATOM   9491  O O   . CYS N  2 44  ? 33.851  80.410  63.098  1.00 90.26  ? 361  CYS J O   1 
ATOM   9492  C CB  . CYS N  2 44  ? 34.247  80.375  66.371  1.00 92.10  ? 361  CYS J CB  1 
ATOM   9493  S SG  . CYS N  2 44  ? 33.471  80.975  67.879  1.00 95.13  ? 361  CYS J SG  1 
ATOM   9494  N N   . PRO N  2 45  ? 34.708  78.482  63.916  1.00 87.22  ? 362  PRO J N   1 
ATOM   9495  C CA  . PRO N  2 45  ? 35.402  78.192  62.664  1.00 89.71  ? 362  PRO J CA  1 
ATOM   9496  C C   . PRO N  2 45  ? 34.400  78.215  61.507  1.00 93.27  ? 362  PRO J C   1 
ATOM   9497  O O   . PRO N  2 45  ? 34.643  78.824  60.459  1.00 98.10  ? 362  PRO J O   1 
ATOM   9498  C CB  . PRO N  2 45  ? 35.965  76.802  62.913  1.00 85.93  ? 362  PRO J CB  1 
ATOM   9499  C CG  . PRO N  2 45  ? 36.292  76.855  64.366  1.00 83.08  ? 362  PRO J CG  1 
ATOM   9500  C CD  . PRO N  2 45  ? 35.062  77.489  64.947  1.00 81.36  ? 362  PRO J CD  1 
ATOM   9501  N N   . ARG N  2 46  B 33.263  77.558  61.717  1.00 92.84  ? 362  ARG J N   1 
ATOM   9502  C CA  . ARG N  2 46  B 32.205  77.487  60.713  1.00 91.85  ? 362  ARG J CA  1 
ATOM   9503  C C   . ARG N  2 46  B 31.506  78.829  60.473  1.00 88.00  ? 362  ARG J C   1 
ATOM   9504  O O   . ARG N  2 46  B 30.617  78.927  59.626  1.00 86.87  ? 362  ARG J O   1 
ATOM   9505  C CB  . ARG N  2 46  B 31.187  76.424  61.125  1.00 94.40  ? 362  ARG J CB  1 
ATOM   9506  C CG  . ARG N  2 46  B 31.763  75.009  61.096  1.00 98.04  ? 362  ARG J CG  1 
ATOM   9507  C CD  . ARG N  2 46  B 30.984  74.063  61.997  1.00 100.00 ? 362  ARG J CD  1 
ATOM   9508  N NE  . ARG N  2 46  B 29.542  74.151  61.769  1.00 100.00 ? 362  ARG J NE  1 
ATOM   9509  C CZ  . ARG N  2 46  B 28.623  73.574  62.540  1.00 100.00 ? 362  ARG J CZ  1 
ATOM   9510  N NH1 . ARG N  2 46  B 28.995  72.856  63.602  1.00 100.00 ? 362  ARG J NH1 1 
ATOM   9511  N NH2 . ARG N  2 46  B 27.331  73.720  62.250  1.00 100.00 ? 362  ARG J NH2 1 
ATOM   9512  N N   . GLY N  2 47  ? 31.908  79.854  61.221  1.00 83.38  ? 363  GLY J N   1 
ATOM   9513  C CA  . GLY N  2 47  ? 31.323  81.172  61.053  1.00 79.84  ? 363  GLY J CA  1 
ATOM   9514  C C   . GLY N  2 47  ? 30.017  81.415  61.782  1.00 80.34  ? 363  GLY J C   1 
ATOM   9515  O O   . GLY N  2 47  ? 29.314  82.378  61.470  1.00 77.54  ? 363  GLY J O   1 
ATOM   9516  N N   . ASP N  2 48  ? 29.687  80.562  62.752  1.00 79.15  ? 364  ASP J N   1 
ATOM   9517  C CA  . ASP N  2 48  ? 28.446  80.709  63.502  1.00 75.61  ? 364  ASP J CA  1 
ATOM   9518  C C   . ASP N  2 48  ? 28.463  81.885  64.459  1.00 74.99  ? 364  ASP J C   1 
ATOM   9519  O O   . ASP N  2 48  ? 29.499  82.214  65.034  1.00 81.13  ? 364  ASP J O   1 
ATOM   9520  C CB  . ASP N  2 48  ? 28.138  79.431  64.274  1.00 81.73  ? 364  ASP J CB  1 
ATOM   9521  C CG  . ASP N  2 48  ? 27.503  78.373  63.400  1.00 87.59  ? 364  ASP J CG  1 
ATOM   9522  O OD1 . ASP N  2 48  ? 26.560  78.715  62.660  1.00 89.21  ? 364  ASP J OD1 1 
ATOM   9523  O OD2 . ASP N  2 48  ? 27.937  77.204  63.456  1.00 93.39  ? 364  ASP J OD2 1 
ATOM   9524  N N   . ASP N  2 49  ? 27.303  82.516  64.624  1.00 70.91  ? 365  ASP J N   1 
ATOM   9525  C CA  . ASP N  2 49  ? 27.164  83.662  65.513  1.00 66.78  ? 365  ASP J CA  1 
ATOM   9526  C C   . ASP N  2 49  ? 27.128  83.226  67.001  1.00 66.81  ? 365  ASP J C   1 
ATOM   9527  O O   . ASP N  2 49  ? 26.800  82.079  67.324  1.00 64.15  ? 365  ASP J O   1 
ATOM   9528  C CB  . ASP N  2 49  ? 25.926  84.467  65.094  1.00 68.42  ? 365  ASP J CB  1 
ATOM   9529  C CG  . ASP N  2 49  ? 24.940  84.648  66.210  1.00 79.66  ? 365  ASP J CG  1 
ATOM   9530  O OD1 . ASP N  2 49  ? 24.133  83.723  66.458  1.00 81.53  ? 365  ASP J OD1 1 
ATOM   9531  O OD2 . ASP N  2 49  ? 24.983  85.720  66.848  1.00 85.25  ? 365  ASP J OD2 1 
ATOM   9532  N N   . ILE N  2 50  ? 27.487  84.140  67.902  1.00 62.36  ? 366  ILE J N   1 
ATOM   9533  C CA  . ILE N  2 50  ? 27.561  83.825  69.327  1.00 57.86  ? 366  ILE J CA  1 
ATOM   9534  C C   . ILE N  2 50  ? 26.238  83.390  69.948  1.00 59.15  ? 366  ILE J C   1 
ATOM   9535  O O   . ILE N  2 50  ? 26.209  82.469  70.773  1.00 60.99  ? 366  ILE J O   1 
ATOM   9536  C CB  . ILE N  2 50  ? 28.183  85.022  70.123  1.00 57.87  ? 366  ILE J CB  1 
ATOM   9537  C CG1 . ILE N  2 50  ? 29.089  84.497  71.244  1.00 55.11  ? 366  ILE J CG1 1 
ATOM   9538  C CG2 . ILE N  2 50  ? 27.102  85.918  70.694  1.00 58.73  ? 366  ILE J CG2 1 
ATOM   9539  C CD1 . ILE N  2 50  ? 28.374  83.832  72.360  1.00 58.58  ? 366  ILE J CD1 1 
ATOM   9540  N N   . LEU N  2 51  ? 25.145  84.042  69.561  1.00 56.24  ? 367  LEU J N   1 
ATOM   9541  C CA  . LEU N  2 51  ? 23.836  83.677  70.091  1.00 54.71  ? 367  LEU J CA  1 
ATOM   9542  C C   . LEU N  2 51  ? 23.545  82.213  69.708  1.00 61.34  ? 367  LEU J C   1 
ATOM   9543  O O   . LEU N  2 51  ? 23.098  81.406  70.544  1.00 60.86  ? 367  LEU J O   1 
ATOM   9544  C CB  . LEU N  2 51  ? 22.755  84.622  69.549  1.00 35.33  ? 367  LEU J CB  1 
ATOM   9545  C CG  . LEU N  2 51  ? 22.807  86.029  70.151  1.00 46.08  ? 367  LEU J CG  1 
ATOM   9546  C CD1 . LEU N  2 51  ? 21.675  86.897  69.626  1.00 44.68  ? 367  LEU J CD1 1 
ATOM   9547  C CD2 . LEU N  2 51  ? 22.692  85.935  71.654  1.00 55.78  ? 367  LEU J CD2 1 
ATOM   9548  N N   . THR N  2 52  ? 23.812  81.866  68.450  1.00 57.56  ? 368  THR J N   1 
ATOM   9549  C CA  . THR N  2 52  ? 23.607  80.492  68.002  1.00 55.87  ? 368  THR J CA  1 
ATOM   9550  C C   . THR N  2 52  ? 24.414  79.586  68.935  1.00 56.72  ? 368  THR J C   1 
ATOM   9551  O O   . THR N  2 52  ? 23.896  78.643  69.522  1.00 58.78  ? 368  THR J O   1 
ATOM   9552  C CB  . THR N  2 52  ? 24.111  80.292  66.549  1.00 54.17  ? 368  THR J CB  1 
ATOM   9553  O OG1 . THR N  2 52  ? 23.215  80.945  65.640  1.00 56.27  ? 368  THR J OG1 1 
ATOM   9554  C CG2 . THR N  2 52  ? 24.218  78.803  66.200  1.00 40.51  ? 368  THR J CG2 1 
ATOM   9555  N N   . ILE N  2 53  ? 25.692  79.894  69.077  1.00 56.08  ? 369  ILE J N   1 
ATOM   9556  C CA  . ILE N  2 53  ? 26.570  79.111  69.924  1.00 57.96  ? 369  ILE J CA  1 
ATOM   9557  C C   . ILE N  2 53  ? 26.000  78.990  71.333  1.00 56.85  ? 369  ILE J C   1 
ATOM   9558  O O   . ILE N  2 53  ? 25.928  77.896  71.905  1.00 49.45  ? 369  ILE J O   1 
ATOM   9559  C CB  . ILE N  2 53  ? 27.970  79.763  69.961  1.00 62.72  ? 369  ILE J CB  1 
ATOM   9560  C CG1 . ILE N  2 53  ? 28.479  79.894  68.522  1.00 62.99  ? 369  ILE J CG1 1 
ATOM   9561  C CG2 . ILE N  2 53  ? 28.945  78.929  70.830  1.00 48.68  ? 369  ILE J CG2 1 
ATOM   9562  C CD1 . ILE N  2 53  ? 29.699  80.756  68.382  1.00 75.49  ? 369  ILE J CD1 1 
ATOM   9563  N N   . LEU N  2 54  ? 25.586  80.119  71.894  1.00 56.73  ? 370  LEU J N   1 
ATOM   9564  C CA  . LEU N  2 54  ? 25.030  80.102  73.237  1.00 60.78  ? 370  LEU J CA  1 
ATOM   9565  C C   . LEU N  2 54  ? 23.779  79.207  73.342  1.00 62.48  ? 370  LEU J C   1 
ATOM   9566  O O   . LEU N  2 54  ? 23.556  78.537  74.364  1.00 63.57  ? 370  LEU J O   1 
ATOM   9567  C CB  . LEU N  2 54  ? 24.731  81.534  73.688  1.00 50.49  ? 370  LEU J CB  1 
ATOM   9568  C CG  . LEU N  2 54  ? 25.995  82.175  74.255  1.00 47.33  ? 370  LEU J CG  1 
ATOM   9569  C CD1 . LEU N  2 54  ? 25.755  83.641  74.543  1.00 39.84  ? 370  LEU J CD1 1 
ATOM   9570  C CD2 . LEU N  2 54  ? 26.426  81.424  75.509  1.00 28.18  ? 370  LEU J CD2 1 
ATOM   9571  N N   . THR N  2 55  ? 22.973  79.190  72.284  1.00 54.69  ? 371  THR J N   1 
ATOM   9572  C CA  . THR N  2 55  ? 21.782  78.356  72.259  1.00 48.62  ? 371  THR J CA  1 
ATOM   9573  C C   . THR N  2 55  ? 22.171  76.880  72.350  1.00 51.43  ? 371  THR J C   1 
ATOM   9574  O O   . THR N  2 55  ? 21.558  76.107  73.098  1.00 51.67  ? 371  THR J O   1 
ATOM   9575  C CB  . THR N  2 55  ? 20.990  78.555  70.974  1.00 46.03  ? 371  THR J CB  1 
ATOM   9576  O OG1 . THR N  2 55  ? 20.471  79.891  70.918  1.00 54.60  ? 371  THR J OG1 1 
ATOM   9577  C CG2 . THR N  2 55  ? 19.850  77.592  70.926  1.00 37.14  ? 371  THR J CG2 1 
ATOM   9578  N N   . GLU N  2 56  ? 23.184  76.492  71.577  1.00 49.30  ? 372  GLU J N   1 
ATOM   9579  C CA  . GLU N  2 56  ? 23.668  75.116  71.580  1.00 50.18  ? 372  GLU J CA  1 
ATOM   9580  C C   . GLU N  2 56  ? 24.130  74.771  72.996  1.00 53.02  ? 372  GLU J C   1 
ATOM   9581  O O   . GLU N  2 56  ? 23.953  73.636  73.472  1.00 43.04  ? 372  GLU J O   1 
ATOM   9582  C CB  . GLU N  2 56  ? 24.823  74.961  70.578  1.00 55.26  ? 372  GLU J CB  1 
ATOM   9583  C CG  . GLU N  2 56  ? 25.294  73.514  70.312  1.00 65.57  ? 372  GLU J CG  1 
ATOM   9584  C CD  . GLU N  2 56  ? 26.271  73.410  69.122  1.00 71.99  ? 372  GLU J CD  1 
ATOM   9585  O OE1 . GLU N  2 56  ? 27.497  73.659  69.286  1.00 69.95  ? 372  GLU J OE1 1 
ATOM   9586  O OE2 . GLU N  2 56  ? 25.800  73.089  68.007  1.00 64.74  ? 372  GLU J OE2 1 
ATOM   9587  N N   . VAL N  2 57  ? 24.713  75.761  73.674  1.00 55.42  ? 373  VAL J N   1 
ATOM   9588  C CA  . VAL N  2 57  ? 25.178  75.536  75.032  1.00 57.39  ? 373  VAL J CA  1 
ATOM   9589  C C   . VAL N  2 57  ? 23.963  75.240  75.890  1.00 55.40  ? 373  VAL J C   1 
ATOM   9590  O O   . VAL N  2 57  ? 23.979  74.319  76.714  1.00 57.17  ? 373  VAL J O   1 
ATOM   9591  C CB  . VAL N  2 57  ? 25.905  76.751  75.602  1.00 58.11  ? 373  VAL J CB  1 
ATOM   9592  C CG1 . VAL N  2 57  ? 26.493  76.396  76.965  1.00 53.66  ? 373  VAL J CG1 1 
ATOM   9593  C CG2 . VAL N  2 57  ? 27.003  77.185  74.650  1.00 62.83  ? 373  VAL J CG2 1 
ATOM   9594  N N   . ASN N  2 58  ? 22.904  76.015  75.687  1.00 48.09  ? 374  ASN J N   1 
ATOM   9595  C CA  . ASN N  2 58  ? 21.686  75.802  76.447  1.00 52.85  ? 374  ASN J CA  1 
ATOM   9596  C C   . ASN N  2 58  ? 21.172  74.387  76.249  1.00 57.23  ? 374  ASN J C   1 
ATOM   9597  O O   . ASN N  2 58  ? 20.804  73.704  77.213  1.00 63.05  ? 374  ASN J O   1 
ATOM   9598  C CB  . ASN N  2 58  ? 20.607  76.800  76.035  1.00 50.34  ? 374  ASN J CB  1 
ATOM   9599  C CG  . ASN N  2 58  ? 20.747  78.126  76.751  1.00 55.17  ? 374  ASN J CG  1 
ATOM   9600  O OD1 . ASN N  2 58  ? 21.359  78.203  77.825  1.00 55.87  ? 374  ASN J OD1 1 
ATOM   9601  N ND2 . ASN N  2 58  ? 20.165  79.177  76.177  1.00 45.39  ? 374  ASN J ND2 1 
ATOM   9602  N N   . TYR N  2 59  ? 21.157  73.939  75.001  1.00 56.66  ? 375  TYR J N   1 
ATOM   9603  C CA  . TYR N  2 59  ? 20.679  72.600  74.702  1.00 59.27  ? 375  TYR J CA  1 
ATOM   9604  C C   . TYR N  2 59  ? 21.505  71.609  75.516  1.00 58.24  ? 375  TYR J C   1 
ATOM   9605  O O   . TYR N  2 59  ? 20.998  70.925  76.406  1.00 61.48  ? 375  TYR J O   1 
ATOM   9606  C CB  . TYR N  2 59  ? 20.829  72.328  73.201  1.00 64.37  ? 375  TYR J CB  1 
ATOM   9607  C CG  . TYR N  2 59  ? 20.284  71.001  72.730  1.00 69.81  ? 375  TYR J CG  1 
ATOM   9608  C CD1 . TYR N  2 59  ? 20.692  69.799  73.315  1.00 79.39  ? 375  TYR J CD1 1 
ATOM   9609  C CD2 . TYR N  2 59  ? 19.369  70.942  71.686  1.00 73.98  ? 375  TYR J CD2 1 
ATOM   9610  C CE1 . TYR N  2 59  ? 20.198  68.568  72.873  1.00 79.66  ? 375  TYR J CE1 1 
ATOM   9611  C CE2 . TYR N  2 59  ? 18.868  69.720  71.233  1.00 77.78  ? 375  TYR J CE2 1 
ATOM   9612  C CZ  . TYR N  2 59  ? 19.287  68.539  71.835  1.00 82.35  ? 375  TYR J CZ  1 
ATOM   9613  O OH  . TYR N  2 59  ? 18.774  67.330  71.422  1.00 88.94  ? 375  TYR J OH  1 
ATOM   9614  N N   . GLU N  2 60  ? 22.790  71.563  75.210  1.00 58.15  ? 376  GLU J N   1 
ATOM   9615  C CA  . GLU N  2 60  ? 23.725  70.661  75.862  1.00 62.56  ? 376  GLU J CA  1 
ATOM   9616  C C   . GLU N  2 60  ? 23.690  70.617  77.376  1.00 59.80  ? 376  GLU J C   1 
ATOM   9617  O O   . GLU N  2 60  ? 23.635  69.542  77.959  1.00 59.41  ? 376  GLU J O   1 
ATOM   9618  C CB  . GLU N  2 60  ? 25.149  70.993  75.416  1.00 72.21  ? 376  GLU J CB  1 
ATOM   9619  C CG  . GLU N  2 60  ? 25.417  70.748  73.935  1.00 79.35  ? 376  GLU J CG  1 
ATOM   9620  C CD  . GLU N  2 60  ? 25.263  69.278  73.553  1.00 84.54  ? 376  GLU J CD  1 
ATOM   9621  O OE1 . GLU N  2 60  ? 25.755  68.406  74.315  1.00 82.72  ? 376  GLU J OE1 1 
ATOM   9622  O OE2 . GLU N  2 60  ? 24.661  69.002  72.489  1.00 85.74  ? 376  GLU J OE2 1 
ATOM   9623  N N   . VAL N  2 61  ? 23.747  71.777  78.020  1.00 58.71  ? 377  VAL J N   1 
ATOM   9624  C CA  . VAL N  2 61  ? 23.743  71.803  79.476  1.00 60.46  ? 377  VAL J CA  1 
ATOM   9625  C C   . VAL N  2 61  ? 22.411  71.298  80.042  1.00 61.97  ? 377  VAL J C   1 
ATOM   9626  O O   . VAL N  2 61  ? 22.331  70.851  81.206  1.00 58.96  ? 377  VAL J O   1 
ATOM   9627  C CB  . VAL N  2 61  ? 24.041  73.226  79.994  1.00 58.62  ? 377  VAL J CB  1 
ATOM   9628  C CG1 . VAL N  2 61  ? 24.250  73.216  81.522  1.00 54.45  ? 377  VAL J CG1 1 
ATOM   9629  C CG2 . VAL N  2 61  ? 25.277  73.757  79.303  1.00 60.03  ? 377  VAL J CG2 1 
ATOM   9630  N N   . SER N  2 62  ? 21.369  71.349  79.217  1.00 56.96  ? 378  SER J N   1 
ATOM   9631  C CA  . SER N  2 62  ? 20.055  70.882  79.650  1.00 65.52  ? 378  SER J CA  1 
ATOM   9632  C C   . SER N  2 62  ? 20.000  69.366  79.801  1.00 67.29  ? 378  SER J C   1 
ATOM   9633  O O   . SER N  2 62  ? 19.375  68.837  80.718  1.00 62.40  ? 378  SER J O   1 
ATOM   9634  C CB  . SER N  2 62  ? 18.986  71.336  78.662  1.00 66.42  ? 378  SER J CB  1 
ATOM   9635  O OG  . SER N  2 62  ? 18.864  72.746  78.688  1.00 75.83  ? 378  SER J OG  1 
ATOM   9636  N N   . ASN N  2 63  ? 20.671  68.669  78.897  1.00 70.40  ? 379  ASN J N   1 
ATOM   9637  C CA  . ASN N  2 63  ? 20.689  67.221  78.932  1.00 71.82  ? 379  ASN J CA  1 
ATOM   9638  C C   . ASN N  2 63  ? 21.544  66.707  80.069  1.00 67.24  ? 379  ASN J C   1 
ATOM   9639  O O   . ASN N  2 63  ? 21.439  65.547  80.435  1.00 75.57  ? 379  ASN J O   1 
ATOM   9640  C CB  . ASN N  2 63  ? 21.191  66.680  77.596  1.00 76.27  ? 379  ASN J CB  1 
ATOM   9641  C CG  . ASN N  2 63  ? 20.248  67.007  76.454  1.00 84.41  ? 379  ASN J CG  1 
ATOM   9642  O OD1 . ASN N  2 63  ? 19.797  68.151  76.302  1.00 81.61  ? 379  ASN J OD1 1 
ATOM   9643  N ND2 . ASN N  2 63  ? 19.940  66.002  75.644  1.00 93.82  ? 379  ASN J ND2 1 
ATOM   9644  N N   . LYS N  2 64  ? 22.389  67.559  80.630  1.00 63.06  ? 381  LYS J N   1 
ATOM   9645  C CA  . LYS N  2 64  ? 23.240  67.129  81.729  1.00 72.41  ? 381  LYS J CA  1 
ATOM   9646  C C   . LYS N  2 64  ? 22.395  67.062  82.996  1.00 75.27  ? 381  LYS J C   1 
ATOM   9647  O O   . LYS N  2 64  ? 21.342  67.710  83.075  1.00 73.13  ? 381  LYS J O   1 
ATOM   9648  C CB  . LYS N  2 64  ? 24.401  68.119  81.957  1.00 75.09  ? 381  LYS J CB  1 
ATOM   9649  C CG  . LYS N  2 64  ? 25.465  68.138  80.878  1.00 80.98  ? 381  LYS J CG  1 
ATOM   9650  C CD  . LYS N  2 64  ? 26.680  68.942  81.323  1.00 83.96  ? 381  LYS J CD  1 
ATOM   9651  C CE  . LYS N  2 64  ? 27.790  68.893  80.280  1.00 91.04  ? 381  LYS J CE  1 
ATOM   9652  N NZ  . LYS N  2 64  ? 28.218  67.484  80.021  1.00 95.10  ? 381  LYS J NZ  1 
ATOM   9653  N N   . ASP N  2 65  A 22.850  66.278  83.976  1.00 75.70  ? 381  ASP J N   1 
ATOM   9654  C CA  . ASP N  2 65  A 22.149  66.178  85.250  1.00 79.62  ? 381  ASP J CA  1 
ATOM   9655  C C   . ASP N  2 65  A 22.980  65.579  86.389  1.00 81.86  ? 381  ASP J C   1 
ATOM   9656  O O   . ASP N  2 65  A 23.800  64.684  86.187  1.00 80.03  ? 381  ASP J O   1 
ATOM   9657  C CB  . ASP N  2 65  A 20.839  65.399  85.084  1.00 86.50  ? 381  ASP J CB  1 
ATOM   9658  C CG  . ASP N  2 65  A 21.042  64.024  84.477  1.00 91.55  ? 381  ASP J CG  1 
ATOM   9659  O OD1 . ASP N  2 65  A 21.808  63.220  85.060  1.00 97.46  ? 381  ASP J OD1 1 
ATOM   9660  O OD2 . ASP N  2 65  A 20.424  63.750  83.419  1.00 88.57  ? 381  ASP J OD2 1 
ATOM   9661  N N   . ASP N  2 66  B 22.780  66.099  87.592  1.00 88.42  ? 381  ASP J N   1 
ATOM   9662  C CA  . ASP N  2 66  B 23.496  65.611  88.762  1.00 92.40  ? 381  ASP J CA  1 
ATOM   9663  C C   . ASP N  2 66  B 22.754  64.367  89.159  1.00 95.47  ? 381  ASP J C   1 
ATOM   9664  O O   . ASP N  2 66  B 21.568  64.417  89.506  1.00 97.66  ? 381  ASP J O   1 
ATOM   9665  C CB  . ASP N  2 66  B 23.461  66.644  89.899  1.00 94.91  ? 381  ASP J CB  1 
ATOM   9666  C CG  . ASP N  2 66  B 23.913  66.073  91.230  1.00 95.84  ? 381  ASP J CG  1 
ATOM   9667  O OD1 . ASP N  2 66  B 24.969  65.399  91.285  1.00 95.17  ? 381  ASP J OD1 1 
ATOM   9668  O OD2 . ASP N  2 66  B 23.203  66.317  92.229  1.00 95.61  ? 381  ASP J OD2 1 
ATOM   9669  N N   . LYS N  2 67  C 23.458  63.247  89.079  1.00 100.00 ? 381  LYS J N   1 
ATOM   9670  C CA  . LYS N  2 67  C 22.879  61.956  89.407  1.00 100.00 ? 381  LYS J CA  1 
ATOM   9671  C C   . LYS N  2 67  C 22.281  61.964  90.811  1.00 99.89  ? 381  LYS J C   1 
ATOM   9672  O O   . LYS N  2 67  C 21.184  61.443  91.011  1.00 100.00 ? 381  LYS J O   1 
ATOM   9673  C CB  . LYS N  2 67  C 23.934  60.840  89.237  1.00 100.00 ? 381  LYS J CB  1 
ATOM   9674  C CG  . LYS N  2 67  C 24.309  60.532  87.755  1.00 100.00 ? 381  LYS J CG  1 
ATOM   9675  C CD  . LYS N  2 67  C 24.857  61.775  87.032  1.00 100.00 ? 381  LYS J CD  1 
ATOM   9676  C CE  . LYS N  2 67  C 25.266  61.513  85.591  1.00 95.99  ? 381  LYS J CE  1 
ATOM   9677  N NZ  . LYS N  2 67  C 25.852  62.755  84.993  1.00 99.27  ? 381  LYS J NZ  1 
ATOM   9678  N N   . LYS N  2 68  D 22.972  62.580  91.770  1.00 97.37  ? 381  LYS J N   1 
ATOM   9679  C CA  . LYS N  2 68  D 22.456  62.633  93.137  1.00 99.74  ? 381  LYS J CA  1 
ATOM   9680  C C   . LYS N  2 68  D 21.125  63.399  93.297  1.00 100.00 ? 381  LYS J C   1 
ATOM   9681  O O   . LYS N  2 68  D 20.066  62.893  92.933  1.00 98.96  ? 381  LYS J O   1 
ATOM   9682  C CB  . LYS N  2 68  D 23.510  63.217  94.090  1.00 100.00 ? 381  LYS J CB  1 
ATOM   9683  C CG  . LYS N  2 68  D 24.190  62.172  94.990  1.00 100.00 ? 381  LYS J CG  1 
ATOM   9684  C CD  . LYS N  2 68  D 24.395  62.677  96.438  1.00 97.84  ? 381  LYS J CD  1 
ATOM   9685  C CE  . LYS N  2 68  D 23.063  62.858  97.194  1.00 94.55  ? 381  LYS J CE  1 
ATOM   9686  N NZ  . LYS N  2 68  D 23.252  63.290  98.612  1.00 79.33  ? 381  LYS J NZ  1 
ATOM   9687  N N   . ASN N  2 69  E 21.181  64.614  93.838  1.00 100.00 ? 381  ASN J N   1 
ATOM   9688  C CA  . ASN N  2 69  E 19.980  65.422  94.066  1.00 100.00 ? 381  ASN J CA  1 
ATOM   9689  C C   . ASN N  2 69  E 18.981  65.528  92.931  1.00 100.00 ? 381  ASN J C   1 
ATOM   9690  O O   . ASN N  2 69  E 18.025  66.307  93.020  1.00 100.00 ? 381  ASN J O   1 
ATOM   9691  C CB  . ASN N  2 69  E 20.365  66.825  94.519  1.00 100.00 ? 381  ASN J CB  1 
ATOM   9692  C CG  . ASN N  2 69  E 20.594  66.898  96.005  1.00 100.00 ? 381  ASN J CG  1 
ATOM   9693  O OD1 . ASN N  2 69  E 19.646  66.821  96.788  1.00 100.00 ? 381  ASN J OD1 1 
ATOM   9694  N ND2 . ASN N  2 69  E 21.856  67.026  96.410  1.00 100.00 ? 381  ASN J ND2 1 
ATOM   9695  N N   . MET N  2 70  ? 19.203  64.770  91.862  1.00 99.72  ? 382  MET J N   1 
ATOM   9696  C CA  . MET N  2 70  ? 18.266  64.769  90.750  1.00 98.37  ? 382  MET J CA  1 
ATOM   9697  C C   . MET N  2 70  ? 18.062  66.211  90.296  1.00 94.39  ? 382  MET J C   1 
ATOM   9698  O O   . MET N  2 70  ? 16.934  66.654  90.055  1.00 92.65  ? 382  MET J O   1 
ATOM   9699  C CB  . MET N  2 70  ? 16.949  64.165  91.249  1.00 100.00 ? 382  MET J CB  1 
ATOM   9700  C CG  . MET N  2 70  ? 16.013  63.621  90.198  1.00 100.00 ? 382  MET J CG  1 
ATOM   9701  S SD  . MET N  2 70  ? 14.606  62.801  90.998  1.00 100.00 ? 382  MET J SD  1 
ATOM   9702  C CE  . MET N  2 70  ? 13.232  64.024  90.690  1.00 96.16  ? 382  MET J CE  1 
ATOM   9703  N N   . GLY N  2 71  ? 19.171  66.936  90.199  1.00 86.74  ? 383  GLY J N   1 
ATOM   9704  C CA  . GLY N  2 71  ? 19.129  68.325  89.790  1.00 84.48  ? 383  GLY J CA  1 
ATOM   9705  C C   . GLY N  2 71  ? 19.610  68.579  88.375  1.00 81.11  ? 383  GLY J C   1 
ATOM   9706  O O   . GLY N  2 71  ? 20.191  67.700  87.737  1.00 82.31  ? 383  GLY J O   1 
ATOM   9707  N N   . LYS N  2 72  ? 19.357  69.790  87.884  1.00 76.64  ? 384  LYS J N   1 
ATOM   9708  C CA  . LYS N  2 72  ? 19.760  70.179  86.539  1.00 68.98  ? 384  LYS J CA  1 
ATOM   9709  C C   . LYS N  2 72  ? 20.244  71.621  86.513  1.00 67.25  ? 384  LYS J C   1 
ATOM   9710  O O   . LYS N  2 72  ? 20.196  72.319  87.531  1.00 65.32  ? 384  LYS J O   1 
ATOM   9711  C CB  . LYS N  2 72  ? 18.597  69.994  85.576  1.00 65.54  ? 384  LYS J CB  1 
ATOM   9712  C CG  . LYS N  2 72  ? 18.072  68.573  85.572  1.00 60.93  ? 384  LYS J CG  1 
ATOM   9713  C CD  . LYS N  2 72  ? 17.067  68.382  84.463  1.00 64.22  ? 384  LYS J CD  1 
ATOM   9714  C CE  . LYS N  2 72  ? 17.755  68.333  83.107  1.00 66.42  ? 384  LYS J CE  1 
ATOM   9715  N NZ  . LYS N  2 72  ? 18.561  67.082  82.947  1.00 61.81  ? 384  LYS J NZ  1 
ATOM   9716  N N   . GLN N  2 73  ? 20.706  72.068  85.347  1.00 65.55  ? 385  GLN J N   1 
ATOM   9717  C CA  . GLN N  2 73  ? 21.229  73.424  85.213  1.00 63.02  ? 385  GLN J CA  1 
ATOM   9718  C C   . GLN N  2 73  ? 20.686  74.110  83.976  1.00 58.43  ? 385  GLN J C   1 
ATOM   9719  O O   . GLN N  2 73  ? 20.688  73.518  82.904  1.00 63.68  ? 385  GLN J O   1 
ATOM   9720  C CB  . GLN N  2 73  ? 22.754  73.370  85.144  1.00 66.85  ? 385  GLN J CB  1 
ATOM   9721  C CG  . GLN N  2 73  ? 23.434  74.732  85.082  1.00 74.04  ? 385  GLN J CG  1 
ATOM   9722  C CD  . GLN N  2 73  ? 24.957  74.642  85.181  1.00 73.76  ? 385  GLN J CD  1 
ATOM   9723  O OE1 . GLN N  2 73  ? 25.499  74.079  86.135  1.00 67.99  ? 385  GLN J OE1 1 
ATOM   9724  N NE2 . GLN N  2 73  ? 25.650  75.205  84.193  1.00 71.07  ? 385  GLN J NE2 1 
ATOM   9725  N N   . MET N  2 74  ? 20.216  75.347  84.123  1.00 50.53  ? 386  MET J N   1 
ATOM   9726  C CA  . MET N  2 74  ? 19.670  76.082  82.981  1.00 53.05  ? 386  MET J CA  1 
ATOM   9727  C C   . MET N  2 74  ? 20.385  77.410  82.768  1.00 55.71  ? 386  MET J C   1 
ATOM   9728  O O   . MET N  2 74  ? 20.169  78.362  83.512  1.00 62.18  ? 386  MET J O   1 
ATOM   9729  C CB  . MET N  2 74  ? 18.183  76.359  83.176  1.00 54.57  ? 386  MET J CB  1 
ATOM   9730  C CG  . MET N  2 74  ? 17.519  77.081  81.997  1.00 57.59  ? 386  MET J CG  1 
ATOM   9731  S SD  . MET N  2 74  ? 17.422  76.059  80.517  1.00 63.14  ? 386  MET J SD  1 
ATOM   9732  C CE  . MET N  2 74  ? 18.603  76.762  79.493  1.00 67.87  ? 386  MET J CE  1 
ATOM   9733  N N   . PRO N  2 75  ? 21.252  77.490  81.746  1.00 55.94  ? 387  PRO J N   1 
ATOM   9734  C CA  . PRO N  2 75  ? 22.029  78.685  81.392  1.00 52.64  ? 387  PRO J CA  1 
ATOM   9735  C C   . PRO N  2 75  ? 21.100  79.779  80.895  1.00 52.35  ? 387  PRO J C   1 
ATOM   9736  O O   . PRO N  2 75  ? 20.049  79.481  80.349  1.00 51.69  ? 387  PRO J O   1 
ATOM   9737  C CB  . PRO N  2 75  ? 22.950  78.174  80.295  1.00 59.81  ? 387  PRO J CB  1 
ATOM   9738  C CG  . PRO N  2 75  ? 23.116  76.715  80.648  1.00 61.26  ? 387  PRO J CG  1 
ATOM   9739  C CD  . PRO N  2 75  ? 21.710  76.329  80.968  1.00 58.62  ? 387  PRO J CD  1 
ATOM   9740  N N   . GLN N  2 76  ? 21.486  81.040  81.048  1.00 47.37  ? 388  GLN J N   1 
ATOM   9741  C CA  . GLN N  2 76  ? 20.593  82.108  80.638  1.00 44.54  ? 388  GLN J CA  1 
ATOM   9742  C C   . GLN N  2 76  ? 21.230  83.391  80.111  1.00 49.56  ? 388  GLN J C   1 
ATOM   9743  O O   . GLN N  2 76  ? 21.477  84.348  80.854  1.00 55.93  ? 388  GLN J O   1 
ATOM   9744  C CB  . GLN N  2 76  ? 19.680  82.463  81.802  1.00 36.21  ? 388  GLN J CB  1 
ATOM   9745  C CG  . GLN N  2 76  ? 18.571  83.402  81.447  1.00 46.57  ? 388  GLN J CG  1 
ATOM   9746  C CD  . GLN N  2 76  ? 17.982  84.050  82.666  1.00 52.84  ? 388  GLN J CD  1 
ATOM   9747  O OE1 . GLN N  2 76  ? 17.628  83.381  83.640  1.00 56.89  ? 388  GLN J OE1 1 
ATOM   9748  N NE2 . GLN N  2 76  ? 17.879  85.364  82.632  1.00 65.17  ? 388  GLN J NE2 1 
ATOM   9749  N N   . PRO N  2 77  ? 21.481  83.441  78.809  1.00 49.76  ? 389  PRO J N   1 
ATOM   9750  C CA  . PRO N  2 77  ? 22.081  84.642  78.230  1.00 42.85  ? 389  PRO J CA  1 
ATOM   9751  C C   . PRO N  2 77  ? 21.113  85.804  78.133  1.00 43.54  ? 389  PRO J C   1 
ATOM   9752  O O   . PRO N  2 77  ? 19.897  85.618  78.050  1.00 49.96  ? 389  PRO J O   1 
ATOM   9753  C CB  . PRO N  2 77  ? 22.567  84.167  76.856  1.00 45.10  ? 389  PRO J CB  1 
ATOM   9754  C CG  . PRO N  2 77  ? 21.674  83.016  76.529  1.00 54.06  ? 389  PRO J CG  1 
ATOM   9755  C CD  . PRO N  2 77  ? 21.492  82.313  77.861  1.00 54.82  ? 389  PRO J CD  1 
ATOM   9756  N N   . THR N  2 78  ? 21.664  87.009  78.167  1.00 40.80  ? 390  THR J N   1 
ATOM   9757  C CA  . THR N  2 78  ? 20.876  88.233  78.040  1.00 35.82  ? 390  THR J CA  1 
ATOM   9758  C C   . THR N  2 78  ? 21.708  89.137  77.156  1.00 39.46  ? 390  THR J C   1 
ATOM   9759  O O   . THR N  2 78  ? 22.936  89.125  77.249  1.00 48.56  ? 390  THR J O   1 
ATOM   9760  C CB  . THR N  2 78  ? 20.727  88.913  79.359  1.00 30.64  ? 390  THR J CB  1 
ATOM   9761  O OG1 . THR N  2 78  ? 20.238  87.968  80.310  1.00 40.01  ? 390  THR J OG1 1 
ATOM   9762  C CG2 . THR N  2 78  ? 19.798  90.083  79.230  1.00 21.92  ? 390  THR J CG2 1 
ATOM   9763  N N   . PHE N  2 79  ? 21.088  89.944  76.317  1.00 35.04  ? 392  PHE J N   1 
ATOM   9764  C CA  . PHE N  2 79  ? 21.918  90.759  75.466  1.00 41.45  ? 392  PHE J CA  1 
ATOM   9765  C C   . PHE N  2 79  ? 21.318  92.031  74.920  1.00 46.39  ? 392  PHE J C   1 
ATOM   9766  O O   . PHE N  2 79  ? 20.094  92.168  74.803  1.00 47.44  ? 392  PHE J O   1 
ATOM   9767  C CB  . PHE N  2 79  ? 22.415  89.910  74.304  1.00 48.45  ? 392  PHE J CB  1 
ATOM   9768  C CG  . PHE N  2 79  ? 21.328  89.484  73.341  1.00 56.23  ? 392  PHE J CG  1 
ATOM   9769  C CD1 . PHE N  2 79  ? 20.596  88.317  73.557  1.00 63.42  ? 392  PHE J CD1 1 
ATOM   9770  C CD2 . PHE N  2 79  ? 21.062  90.227  72.198  1.00 54.41  ? 392  PHE J CD2 1 
ATOM   9771  C CE1 . PHE N  2 79  ? 19.616  87.896  72.643  1.00 60.13  ? 392  PHE J CE1 1 
ATOM   9772  C CE2 . PHE N  2 79  ? 20.091  89.812  71.284  1.00 55.92  ? 392  PHE J CE2 1 
ATOM   9773  C CZ  . PHE N  2 79  ? 19.369  88.645  71.510  1.00 56.22  ? 392  PHE J CZ  1 
ATOM   9774  N N   . THR N  2 80  ? 22.202  92.978  74.610  1.00 45.63  ? 393  THR J N   1 
ATOM   9775  C CA  . THR N  2 80  ? 21.781  94.230  74.009  1.00 45.13  ? 393  THR J CA  1 
ATOM   9776  C C   . THR N  2 80  ? 22.547  94.387  72.709  1.00 41.65  ? 393  THR J C   1 
ATOM   9777  O O   . THR N  2 80  ? 22.581  95.473  72.155  1.00 36.85  ? 393  THR J O   1 
ATOM   9778  C CB  . THR N  2 80  ? 22.039  95.443  74.904  1.00 48.66  ? 393  THR J CB  1 
ATOM   9779  O OG1 . THR N  2 80  ? 23.421  95.467  75.298  1.00 62.49  ? 393  THR J OG1 1 
ATOM   9780  C CG2 . THR N  2 80  ? 21.157  95.375  76.138  1.00 51.89  ? 393  THR J CG2 1 
ATOM   9781  N N   . LEU N  2 81  ? 23.143  93.287  72.230  1.00 42.66  ? 394  LEU J N   1 
ATOM   9782  C CA  . LEU N  2 81  ? 23.884  93.276  70.965  1.00 46.75  ? 394  LEU J CA  1 
ATOM   9783  C C   . LEU N  2 81  ? 23.014  93.817  69.824  1.00 49.97  ? 394  LEU J C   1 
ATOM   9784  O O   . LEU N  2 81  ? 21.847  93.435  69.692  1.00 52.00  ? 394  LEU J O   1 
ATOM   9785  C CB  . LEU N  2 81  ? 24.325  91.853  70.608  1.00 40.62  ? 394  LEU J CB  1 
ATOM   9786  C CG  . LEU N  2 81  ? 25.198  91.101  71.609  1.00 44.22  ? 394  LEU J CG  1 
ATOM   9787  C CD1 . LEU N  2 81  ? 25.616  89.784  70.987  1.00 44.37  ? 394  LEU J CD1 1 
ATOM   9788  C CD2 . LEU N  2 81  ? 26.440  91.905  71.975  1.00 45.57  ? 394  LEU J CD2 1 
ATOM   9789  N N   . ARG N  2 82  ? 23.578  94.696  68.994  1.00 52.98  ? 395  ARG J N   1 
ATOM   9790  C CA  . ARG N  2 82  ? 22.815  95.279  67.883  1.00 52.47  ? 395  ARG J CA  1 
ATOM   9791  C C   . ARG N  2 82  ? 23.241  94.701  66.552  1.00 49.10  ? 395  ARG J C   1 
ATOM   9792  O O   . ARG N  2 82  ? 22.752  95.112  65.515  1.00 53.25  ? 395  ARG J O   1 
ATOM   9793  C CB  . ARG N  2 82  ? 22.966  96.802  67.838  1.00 50.33  ? 395  ARG J CB  1 
ATOM   9794  C CG  . ARG N  2 82  ? 22.541  97.503  69.120  1.00 54.94  ? 395  ARG J CG  1 
ATOM   9795  C CD  . ARG N  2 82  ? 22.930  98.970  69.109  1.00 64.05  ? 395  ARG J CD  1 
ATOM   9796  N NE  . ARG N  2 82  ? 24.337  99.146  68.743  1.00 77.74  ? 395  ARG J NE  1 
ATOM   9797  C CZ  . ARG N  2 82  ? 24.753  99.568  67.552  1.00 78.05  ? 395  ARG J CZ  1 
ATOM   9798  N NH1 . ARG N  2 82  ? 23.866  99.874  66.604  1.00 83.83  ? 395  ARG J NH1 1 
ATOM   9799  N NH2 . ARG N  2 82  ? 26.053  99.659  67.305  1.00 69.40  ? 395  ARG J NH2 1 
ATOM   9800  N N   . LYS N  2 83  ? 24.158  93.748  66.586  1.00 46.01  ? 396  LYS J N   1 
ATOM   9801  C CA  . LYS N  2 83  ? 24.613  93.107  65.368  1.00 50.53  ? 396  LYS J CA  1 
ATOM   9802  C C   . LYS N  2 83  ? 24.911  91.683  65.726  1.00 54.22  ? 396  LYS J C   1 
ATOM   9803  O O   . LYS N  2 83  ? 24.843  91.296  66.891  1.00 60.43  ? 396  LYS J O   1 
ATOM   9804  C CB  . LYS N  2 83  ? 25.910  93.724  64.842  1.00 64.26  ? 396  LYS J CB  1 
ATOM   9805  C CG  . LYS N  2 83  ? 25.870  95.218  64.523  1.00 70.87  ? 396  LYS J CG  1 
ATOM   9806  C CD  . LYS N  2 83  ? 27.166  95.659  63.847  1.00 64.57  ? 396  LYS J CD  1 
ATOM   9807  C CE  . LYS N  2 83  ? 27.131  97.147  63.547  1.00 71.69  ? 396  LYS J CE  1 
ATOM   9808  N NZ  . LYS N  2 83  ? 28.200  97.552  62.588  1.00 72.86  ? 396  LYS J NZ  1 
ATOM   9809  N N   . LYS N  2 84  ? 25.237  90.894  64.719  1.00 53.61  ? 397  LYS J N   1 
ATOM   9810  C CA  . LYS N  2 84  ? 25.567  89.520  64.967  1.00 57.32  ? 397  LYS J CA  1 
ATOM   9811  C C   . LYS N  2 84  ? 27.002  89.556  65.443  1.00 58.02  ? 397  LYS J C   1 
ATOM   9812  O O   . LYS N  2 84  ? 27.842  90.229  64.862  1.00 59.87  ? 397  LYS J O   1 
ATOM   9813  C CB  . LYS N  2 84  ? 25.443  88.694  63.682  1.00 61.93  ? 397  LYS J CB  1 
ATOM   9814  C CG  . LYS N  2 84  ? 24.024  88.273  63.356  1.00 70.24  ? 397  LYS J CG  1 
ATOM   9815  C CD  . LYS N  2 84  ? 24.022  86.931  62.649  1.00 79.37  ? 397  LYS J CD  1 
ATOM   9816  C CE  . LYS N  2 84  ? 22.618  86.360  62.554  1.00 87.34  ? 397  LYS J CE  1 
ATOM   9817  N NZ  . LYS N  2 84  ? 22.657  84.914  62.172  1.00 93.63  ? 397  LYS J NZ  1 
ATOM   9818  N N   . LEU N  2 85  ? 27.283  88.864  66.526  1.00 59.06  ? 398  LEU J N   1 
ATOM   9819  C CA  . LEU N  2 85  ? 28.643  88.828  67.027  1.00 60.13  ? 398  LEU J CA  1 
ATOM   9820  C C   . LEU N  2 85  ? 29.277  87.517  66.581  1.00 59.47  ? 398  LEU J C   1 
ATOM   9821  O O   . LEU N  2 85  ? 28.888  86.436  67.031  1.00 57.37  ? 398  LEU J O   1 
ATOM   9822  C CB  . LEU N  2 85  ? 28.663  88.918  68.557  1.00 63.70  ? 398  LEU J CB  1 
ATOM   9823  C CG  . LEU N  2 85  ? 30.016  88.632  69.212  1.00 62.92  ? 398  LEU J CG  1 
ATOM   9824  C CD1 . LEU N  2 85  ? 31.023  89.632  68.694  1.00 64.87  ? 398  LEU J CD1 1 
ATOM   9825  C CD2 . LEU N  2 85  ? 29.907  88.715  70.717  1.00 67.06  ? 398  LEU J CD2 1 
ATOM   9826  N N   . VAL N  2 86  ? 30.254  87.610  65.691  1.00 58.74  ? 399  VAL J N   1 
ATOM   9827  C CA  . VAL N  2 86  ? 30.920  86.409  65.225  1.00 59.61  ? 399  VAL J CA  1 
ATOM   9828  C C   . VAL N  2 86  ? 32.417  86.498  65.472  1.00 59.06  ? 399  VAL J C   1 
ATOM   9829  O O   . VAL N  2 86  ? 32.996  87.571  65.365  1.00 58.88  ? 399  VAL J O   1 
ATOM   9830  C CB  . VAL N  2 86  ? 30.648  86.187  63.739  1.00 61.16  ? 399  VAL J CB  1 
ATOM   9831  C CG1 . VAL N  2 86  ? 30.860  87.496  62.986  1.00 58.88  ? 399  VAL J CG1 1 
ATOM   9832  C CG2 . VAL N  2 86  ? 31.535  85.056  63.214  1.00 47.36  ? 399  VAL J CG2 1 
ATOM   9833  N N   . PHE N  2 87  ? 33.024  85.362  65.810  1.00 59.90  ? 400  PHE J N   1 
ATOM   9834  C CA  . PHE N  2 87  ? 34.448  85.276  66.102  1.00 62.66  ? 400  PHE J CA  1 
ATOM   9835  C C   . PHE N  2 87  ? 35.196  84.469  65.066  1.00 71.84  ? 400  PHE J C   1 
ATOM   9836  O O   . PHE N  2 87  ? 35.474  83.280  65.277  1.00 69.43  ? 400  PHE J O   1 
ATOM   9837  C CB  . PHE N  2 87  ? 34.671  84.624  67.459  1.00 60.08  ? 400  PHE J CB  1 
ATOM   9838  C CG  . PHE N  2 87  ? 34.179  85.441  68.603  1.00 59.43  ? 400  PHE J CG  1 
ATOM   9839  C CD1 . PHE N  2 87  ? 34.122  86.829  68.508  1.00 54.74  ? 400  PHE J CD1 1 
ATOM   9840  C CD2 . PHE N  2 87  ? 33.765  84.826  69.775  1.00 56.36  ? 400  PHE J CD2 1 
ATOM   9841  C CE1 . PHE N  2 87  ? 33.656  87.590  69.565  1.00 57.10  ? 400  PHE J CE1 1 
ATOM   9842  C CE2 . PHE N  2 87  ? 33.297  85.580  70.837  1.00 58.78  ? 400  PHE J CE2 1 
ATOM   9843  C CZ  . PHE N  2 87  ? 33.240  86.964  70.734  1.00 61.06  ? 400  PHE J CZ  1 
ATOM   9844  N N   . PRO N  2 88  ? 35.548  85.106  63.935  1.00 78.85  ? 401  PRO J N   1 
ATOM   9845  C CA  . PRO N  2 88  ? 36.277  84.432  62.857  1.00 81.06  ? 401  PRO J CA  1 
ATOM   9846  C C   . PRO N  2 88  ? 37.577  83.830  63.360  1.00 83.71  ? 401  PRO J C   1 
ATOM   9847  O O   . PRO N  2 88  ? 38.187  84.333  64.310  1.00 83.19  ? 401  PRO J O   1 
ATOM   9848  C CB  . PRO N  2 88  ? 36.488  85.544  61.829  1.00 80.53  ? 401  PRO J CB  1 
ATOM   9849  C CG  . PRO N  2 88  ? 36.496  86.783  62.664  1.00 83.87  ? 401  PRO J CG  1 
ATOM   9850  C CD  . PRO N  2 88  ? 35.380  86.539  63.636  1.00 79.09  ? 401  PRO J CD  1 
ATOM   9851  N N   . SER N  2 89  ? 37.983  82.742  62.721  1.00 88.52  ? 402  SER J N   1 
ATOM   9852  C CA  . SER N  2 89  ? 39.196  82.032  63.096  1.00 96.50  ? 402  SER J CA  1 
ATOM   9853  C C   . SER N  2 89  ? 40.239  82.001  61.958  1.00 100.00 ? 402  SER J C   1 
ATOM   9854  O O   . SER N  2 89  ? 41.361  82.535  62.158  1.00 100.00 ? 402  SER J O   1 
ATOM   9855  C CB  . SER N  2 89  ? 38.822  80.608  63.522  1.00 96.79  ? 402  SER J CB  1 
ATOM   9856  O OG  . SER N  2 89  ? 39.961  79.877  63.937  1.00 100.00 ? 402  SER J OG  1 
ATOM   9857  O OXT . SER N  2 89  ? 39.930  81.443  60.878  1.00 100.00 ? 402  SER J OXT 1 
HETATM 9858  C C1  . PHQ O  3 1   ? 30.697  64.875  90.723  1.00 100.00 ? 4500 PHQ U C1  1 
HETATM 9859  O O1  . PHQ O  3 1   ? 29.733  64.125  90.433  1.00 100.00 ? 4500 PHQ U O1  1 
HETATM 9860  O O2  . PHQ O  3 1   ? 32.016  64.394  90.946  1.00 100.00 ? 4500 PHQ U O2  1 
HETATM 9861  C C2  . PHQ O  3 1   ? 32.345  62.992  90.816  1.00 100.00 ? 4500 PHQ U C2  1 
HETATM 9862  C C3  . PHQ O  3 1   ? 33.780  62.796  91.267  1.00 100.00 ? 4500 PHQ U C3  1 
HETATM 9863  C C4  . PHQ O  3 1   ? 34.871  63.698  90.901  1.00 100.00 ? 4500 PHQ U C4  1 
HETATM 9864  C C5  . PHQ O  3 1   ? 36.225  63.439  91.417  1.00 100.00 ? 4500 PHQ U C5  1 
HETATM 9865  C C6  . PHQ O  3 1   ? 36.490  62.293  92.290  1.00 100.00 ? 4500 PHQ U C6  1 
HETATM 9866  C C7  . PHQ O  3 1   ? 35.406  61.396  92.656  1.00 100.00 ? 4500 PHQ U C7  1 
HETATM 9867  C C8  . PHQ O  3 1   ? 34.068  61.653  92.145  1.00 100.00 ? 4500 PHQ U C8  1 
ATOM   9868  N N   . ASP O  3 2   ? 30.563  66.161  90.880  1.00 100.00 ? 4501 ASP U N   1 
ATOM   9869  C CA  . ASP O  3 2   ? 29.277  66.846  90.767  1.00 100.00 ? 4501 ASP U CA  1 
ATOM   9870  C C   . ASP O  3 2   ? 29.328  67.783  92.044  1.00 100.00 ? 4501 ASP U C   1 
ATOM   9871  O O   . ASP O  3 2   ? 29.405  67.261  93.172  1.00 100.00 ? 4501 ASP U O   1 
ATOM   9872  C CB  . ASP O  3 2   ? 29.073  67.617  89.431  1.00 99.02  ? 4501 ASP U CB  1 
ATOM   9873  C CG  . ASP O  3 2   ? 28.942  66.770  88.137  1.00 99.16  ? 4501 ASP U CG  1 
ATOM   9874  O OD1 . ASP O  3 2   ? 28.030  65.851  88.050  1.00 96.52  ? 4501 ASP U OD1 1 
ATOM   9875  O OD2 . ASP O  3 2   ? 29.714  66.996  87.122  1.00 98.71  ? 4501 ASP U OD2 1 
ATOM   9876  N N   . GLU O  3 3   ? 29.328  69.136  91.830  1.00 99.11  ? 4502 GLU U N   1 
ATOM   9877  C CA  . GLU O  3 3   ? 29.403  70.182  92.934  1.00 96.92  ? 4502 GLU U CA  1 
ATOM   9878  C C   . GLU O  3 3   ? 28.756  71.516  92.482  1.00 91.97  ? 4502 GLU U C   1 
ATOM   9879  O O   . GLU O  3 3   ? 28.862  71.912  91.307  1.00 87.42  ? 4502 GLU U O   1 
ATOM   9880  C CB  . GLU O  3 3   ? 30.880  70.466  93.341  1.00 100.00 ? 4502 GLU U CB  1 
ATOM   9881  C CG  . GLU O  3 3   ? 31.246  70.015  94.780  1.00 99.90  ? 4502 GLU U CG  1 
ATOM   9882  C CD  . GLU O  3 3   ? 32.781  69.924  95.075  1.00 100.00 ? 4502 GLU U CD  1 
ATOM   9883  O OE1 . GLU O  3 3   ? 33.603  69.394  94.204  1.00 100.00 ? 4502 GLU U OE1 1 
ATOM   9884  O OE2 . GLU O  3 3   ? 33.256  70.375  96.201  1.00 98.30  ? 4502 GLU U OE2 1 
ATOM   9885  N N   . VAL O  3 4   ? 28.084  72.202  93.441  1.00 90.74  ? 4503 VAL U N   1 
ATOM   9886  C CA  . VAL O  3 4   ? 27.391  73.530  93.183  1.00 94.22  ? 4503 VAL U CA  1 
ATOM   9887  C C   . VAL O  3 4   ? 28.292  74.742  93.475  1.00 97.22  ? 4503 VAL U C   1 
ATOM   9888  O O   . VAL O  3 4   ? 29.371  74.538  94.003  1.00 100.00 ? 4503 VAL U O   1 
ATOM   9889  C CB  . VAL O  3 4   ? 26.104  73.631  94.048  1.00 91.74  ? 4503 VAL U CB  1 
ATOM   9890  C CG1 . VAL O  3 4   ? 25.133  72.478  93.789  1.00 87.38  ? 4503 VAL U CG1 1 
ATOM   9891  C CG2 . VAL O  3 4   ? 26.361  73.578  95.570  1.00 82.15  ? 4503 VAL U CG2 1 
HETATM 9892  N N   . ASA O  3 5   ? 28.269  75.463  92.511  1.00 89.02  ? 4504 ASA U N   1 
HETATM 9893  C CA  . ASA O  3 5   ? 29.074  76.701  92.568  1.00 75.95  ? 4504 ASA U CA  1 
HETATM 9894  C C   . ASA O  3 5   ? 28.237  77.904  93.014  1.00 70.24  ? 4504 ASA U C   1 
HETATM 9895  O O   . ASA O  3 5   ? 28.609  78.749  93.951  1.00 65.90  ? 4504 ASA U O   1 
HETATM 9896  C CB  . ASA O  3 5   ? 29.670  76.970  91.193  1.00 76.85  ? 4504 ASA U CB  1 
HETATM 9897  C CG  . ASA O  3 5   ? 31.146  76.638  91.176  1.00 80.35  ? 4504 ASA U CG  1 
HETATM 9898  O OD1 . ASA O  3 5   ? 31.828  76.933  92.196  1.00 80.46  ? 4504 ASA U OD1 1 
HETATM 9899  O OD2 . ASA O  3 5   ? 31.631  76.077  90.153  1.00 82.13  ? 4504 ASA U OD2 1 
ATOM   9900  N N   . LEU P  1 1   ? 22.048  71.890  60.143  1.00 100.00 ? 149  LEU K N   1 
ATOM   9901  C CA  . LEU P  1 1   ? 22.127  70.753  61.110  1.00 99.69  ? 149  LEU K CA  1 
ATOM   9902  C C   . LEU P  1 1   ? 21.934  71.253  62.552  1.00 98.90  ? 149  LEU K C   1 
ATOM   9903  O O   . LEU P  1 1   ? 22.332  70.590  63.518  1.00 97.03  ? 149  LEU K O   1 
ATOM   9904  C CB  . LEU P  1 1   ? 23.481  70.035  60.965  1.00 100.00 ? 149  LEU K CB  1 
ATOM   9905  C CG  . LEU P  1 1   ? 23.735  68.766  61.796  1.00 99.26  ? 149  LEU K CG  1 
ATOM   9906  C CD1 . LEU P  1 1   ? 22.641  67.742  61.509  1.00 95.72  ? 149  LEU K CD1 1 
ATOM   9907  C CD2 . LEU P  1 1   ? 25.115  68.194  61.480  1.00 89.71  ? 149  LEU K CD2 1 
ATOM   9908  N N   . ASP P  1 2   ? 21.332  72.433  62.692  1.00 97.57  ? 150  ASP K N   1 
ATOM   9909  C CA  . ASP P  1 2   ? 21.060  73.001  64.014  1.00 95.52  ? 150  ASP K CA  1 
ATOM   9910  C C   . ASP P  1 2   ? 19.660  72.556  64.445  1.00 94.55  ? 150  ASP K C   1 
ATOM   9911  O O   . ASP P  1 2   ? 18.738  72.553  63.623  1.00 96.84  ? 150  ASP K O   1 
ATOM   9912  C CB  . ASP P  1 2   ? 21.072  74.534  63.978  1.00 94.46  ? 150  ASP K CB  1 
ATOM   9913  C CG  . ASP P  1 2   ? 22.311  75.102  63.322  1.00 94.38  ? 150  ASP K CG  1 
ATOM   9914  O OD1 . ASP P  1 2   ? 23.426  74.632  63.635  1.00 86.35  ? 150  ASP K OD1 1 
ATOM   9915  O OD2 . ASP P  1 2   ? 22.162  76.034  62.500  1.00 94.08  ? 150  ASP K OD2 1 
ATOM   9916  N N   . LYS P  1 3   ? 19.494  72.181  65.717  1.00 87.79  ? 151  LYS K N   1 
ATOM   9917  C CA  . LYS P  1 3   ? 18.185  71.773  66.226  1.00 75.53  ? 151  LYS K CA  1 
ATOM   9918  C C   . LYS P  1 3   ? 17.227  72.964  66.091  1.00 75.12  ? 151  LYS K C   1 
ATOM   9919  O O   . LYS P  1 3   ? 17.627  74.125  66.233  1.00 76.31  ? 151  LYS K O   1 
ATOM   9920  C CB  . LYS P  1 3   ? 18.287  71.395  67.694  1.00 73.72  ? 151  LYS K CB  1 
ATOM   9921  C CG  . LYS P  1 3   ? 19.350  70.385  68.015  1.00 78.44  ? 151  LYS K CG  1 
ATOM   9922  C CD  . LYS P  1 3   ? 18.899  68.985  67.675  1.00 92.65  ? 151  LYS K CD  1 
ATOM   9923  C CE  . LYS P  1 3   ? 19.948  67.944  68.099  1.00 99.75  ? 151  LYS K CE  1 
ATOM   9924  N NZ  . LYS P  1 3   ? 19.536  66.529  67.780  1.00 100.00 ? 151  LYS K NZ  1 
ATOM   9925  N N   . VAL P  1 4   ? 15.961  72.684  65.810  1.00 73.85  ? 152  VAL K N   1 
ATOM   9926  C CA  . VAL P  1 4   ? 14.973  73.756  65.676  1.00 73.05  ? 152  VAL K CA  1 
ATOM   9927  C C   . VAL P  1 4   ? 13.659  73.378  66.345  1.00 77.16  ? 152  VAL K C   1 
ATOM   9928  O O   . VAL P  1 4   ? 13.299  72.199  66.432  1.00 81.06  ? 152  VAL K O   1 
ATOM   9929  C CB  . VAL P  1 4   ? 14.680  74.093  64.196  1.00 61.79  ? 152  VAL K CB  1 
ATOM   9930  C CG1 . VAL P  1 4   ? 13.619  75.178  64.101  1.00 50.62  ? 152  VAL K CG1 1 
ATOM   9931  C CG2 . VAL P  1 4   ? 15.944  74.547  63.520  1.00 66.08  ? 152  VAL K CG2 1 
ATOM   9932  N N   . TYR P  1 5   ? 12.952  74.386  66.836  1.00 76.88  ? 153  TYR K N   1 
ATOM   9933  C CA  . TYR P  1 5   ? 11.673  74.148  67.467  1.00 76.28  ? 153  TYR K CA  1 
ATOM   9934  C C   . TYR P  1 5   ? 10.669  73.861  66.375  1.00 77.44  ? 153  TYR K C   1 
ATOM   9935  O O   . TYR P  1 5   ? 10.566  74.615  65.400  1.00 75.60  ? 153  TYR K O   1 
ATOM   9936  C CB  . TYR P  1 5   ? 11.218  75.374  68.260  1.00 70.56  ? 153  TYR K CB  1 
ATOM   9937  C CG  . TYR P  1 5   ? 11.907  75.510  69.591  1.00 73.73  ? 153  TYR K CG  1 
ATOM   9938  C CD1 . TYR P  1 5   ? 11.973  74.429  70.480  1.00 69.15  ? 153  TYR K CD1 1 
ATOM   9939  C CD2 . TYR P  1 5   ? 12.485  76.721  69.974  1.00 69.18  ? 153  TYR K CD2 1 
ATOM   9940  C CE1 . TYR P  1 5   ? 12.594  74.555  71.720  1.00 66.65  ? 153  TYR K CE1 1 
ATOM   9941  C CE2 . TYR P  1 5   ? 13.107  76.855  71.209  1.00 68.46  ? 153  TYR K CE2 1 
ATOM   9942  C CZ  . TYR P  1 5   ? 13.155  75.772  72.077  1.00 64.88  ? 153  TYR K CZ  1 
ATOM   9943  O OH  . TYR P  1 5   ? 13.729  75.925  73.316  1.00 69.00  ? 153  TYR K OH  1 
ATOM   9944  N N   . GLN P  1 6   ? 9.941   72.759  66.545  1.00 79.50  ? 154  GLN K N   1 
ATOM   9945  C CA  . GLN P  1 6   ? 8.912   72.367  65.601  1.00 76.78  ? 154  GLN K CA  1 
ATOM   9946  C C   . GLN P  1 6   ? 7.845   73.463  65.565  1.00 71.59  ? 154  GLN K C   1 
ATOM   9947  O O   . GLN P  1 6   ? 7.460   74.008  66.601  1.00 70.06  ? 154  GLN K O   1 
ATOM   9948  C CB  . GLN P  1 6   ? 8.300   71.041  66.036  1.00 77.55  ? 154  GLN K CB  1 
ATOM   9949  C CG  . GLN P  1 6   ? 7.350   70.449  65.027  1.00 87.47  ? 154  GLN K CG  1 
ATOM   9950  C CD  . GLN P  1 6   ? 6.786   69.125  65.486  1.00 95.89  ? 154  GLN K CD  1 
ATOM   9951  O OE1 . GLN P  1 6   ? 6.015   69.068  66.449  1.00 100.00 ? 154  GLN K OE1 1 
ATOM   9952  N NE2 . GLN P  1 6   ? 7.173   68.045  64.806  1.00 100.00 ? 154  GLN K NE2 1 
ATOM   9953  N N   . MET P  1 7   ? 7.385   73.797  64.368  1.00 70.18  ? 155  MET K N   1 
ATOM   9954  C CA  . MET P  1 7   ? 6.369   74.826  64.206  1.00 78.02  ? 155  MET K CA  1 
ATOM   9955  C C   . MET P  1 7   ? 5.423   74.566  63.034  1.00 84.79  ? 155  MET K C   1 
ATOM   9956  O O   . MET P  1 7   ? 5.368   75.352  62.078  1.00 84.38  ? 155  MET K O   1 
ATOM   9957  C CB  . MET P  1 7   ? 7.026   76.191  64.028  1.00 72.07  ? 155  MET K CB  1 
ATOM   9958  C CG  . MET P  1 7   ? 7.616   76.745  65.299  1.00 70.58  ? 155  MET K CG  1 
ATOM   9959  S SD  . MET P  1 7   ? 6.353   77.191  66.481  1.00 65.57  ? 155  MET K SD  1 
ATOM   9960  C CE  . MET P  1 7   ? 5.685   78.636  65.666  1.00 51.91  ? 155  MET K CE  1 
ATOM   9961  N N   . LYS P  1 8   ? 4.679   73.463  63.113  1.00 87.80  ? 156  LYS K N   1 
ATOM   9962  C CA  . LYS P  1 8   ? 3.720   73.101  62.068  1.00 85.15  ? 156  LYS K CA  1 
ATOM   9963  C C   . LYS P  1 8   ? 2.298   73.253  62.606  1.00 82.03  ? 156  LYS K C   1 
ATOM   9964  O O   . LYS P  1 8   ? 1.438   73.812  61.934  1.00 83.46  ? 156  LYS K O   1 
ATOM   9965  C CB  . LYS P  1 8   ? 3.966   71.665  61.597  1.00 85.77  ? 156  LYS K CB  1 
ATOM   9966  C CG  . LYS P  1 8   ? 3.858   70.615  62.693  1.00 90.69  ? 156  LYS K CG  1 
ATOM   9967  C CD  . LYS P  1 8   ? 5.065   69.666  62.727  1.00 95.68  ? 156  LYS K CD  1 
ATOM   9968  C CE  . LYS P  1 8   ? 5.275   68.904  61.419  1.00 99.04  ? 156  LYS K CE  1 
ATOM   9969  N NZ  . LYS P  1 8   ? 5.782   69.771  60.310  1.00 100.00 ? 156  LYS K NZ  1 
ATOM   9970  N N   . SER P  1 9   ? 2.077   72.770  63.827  1.00 82.80  ? 157  SER K N   1 
ATOM   9971  C CA  . SER P  1 9   ? 0.788   72.839  64.514  1.00 82.54  ? 157  SER K CA  1 
ATOM   9972  C C   . SER P  1 9   ? -0.289  73.748  63.904  1.00 87.82  ? 157  SER K C   1 
ATOM   9973  O O   . SER P  1 9   ? -0.083  74.966  63.736  1.00 79.13  ? 157  SER K O   1 
ATOM   9974  C CB  . SER P  1 9   ? 1.008   73.249  65.969  1.00 80.23  ? 157  SER K CB  1 
ATOM   9975  O OG  . SER P  1 9   ? -0.151  73.882  66.491  1.00 85.89  ? 157  SER K OG  1 
ATOM   9976  N N   . LYS P  1 10  ? -1.444  73.127  63.617  1.00 93.31  ? 160  LYS K N   1 
ATOM   9977  C CA  . LYS P  1 10  ? -2.632  73.767  63.031  1.00 95.47  ? 160  LYS K CA  1 
ATOM   9978  C C   . LYS P  1 10  ? -2.832  75.219  63.472  1.00 97.17  ? 160  LYS K C   1 
ATOM   9979  O O   . LYS P  1 10  ? -2.913  76.120  62.625  1.00 98.24  ? 160  LYS K O   1 
ATOM   9980  C CB  . LYS P  1 10  ? -3.879  72.936  63.358  1.00 95.82  ? 160  LYS K CB  1 
ATOM   9981  C CG  . LYS P  1 10  ? -3.742  71.476  62.962  1.00 100.00 ? 160  LYS K CG  1 
ATOM   9982  C CD  . LYS P  1 10  ? -5.045  70.715  63.130  1.00 100.00 ? 160  LYS K CD  1 
ATOM   9983  C CE  . LYS P  1 10  ? -4.913  69.323  62.541  1.00 99.62  ? 160  LYS K CE  1 
ATOM   9984  N NZ  . LYS P  1 10  ? -6.179  68.552  62.623  1.00 100.00 ? 160  LYS K NZ  1 
ATOM   9985  N N   . PRO P  1 11  ? -2.975  75.461  64.794  1.00 95.74  ? 161  PRO K N   1 
ATOM   9986  C CA  . PRO P  1 11  ? -3.143  76.869  65.165  1.00 90.37  ? 161  PRO K CA  1 
ATOM   9987  C C   . PRO P  1 11  ? -1.833  77.415  65.764  1.00 86.11  ? 161  PRO K C   1 
ATOM   9988  O O   . PRO P  1 11  ? -1.800  78.558  66.237  1.00 89.46  ? 161  PRO K O   1 
ATOM   9989  C CB  . PRO P  1 11  ? -4.278  76.832  66.201  1.00 89.85  ? 161  PRO K CB  1 
ATOM   9990  C CG  . PRO P  1 11  ? -4.845  75.413  66.104  1.00 92.69  ? 161  PRO K CG  1 
ATOM   9991  C CD  . PRO P  1 11  ? -3.622  74.606  65.804  1.00 91.95  ? 161  PRO K CD  1 
ATOM   9992  N N   . ARG P  1 12  ? -0.767  76.605  65.734  1.00 74.33  ? 162  ARG K N   1 
ATOM   9993  C CA  . ARG P  1 12  ? 0.541   76.994  66.301  1.00 75.46  ? 162  ARG K CA  1 
ATOM   9994  C C   . ARG P  1 12  ? 0.498   77.074  67.835  1.00 72.98  ? 162  ARG K C   1 
ATOM   9995  O O   . ARG P  1 12  ? 1.241   76.372  68.539  1.00 67.39  ? 162  ARG K O   1 
ATOM   9996  C CB  . ARG P  1 12  ? 0.993   78.365  65.781  1.00 73.85  ? 162  ARG K CB  1 
ATOM   9997  C CG  . ARG P  1 12  ? 1.488   78.388  64.359  1.00 78.23  ? 162  ARG K CG  1 
ATOM   9998  C CD  . ARG P  1 12  ? 2.891   77.830  64.239  1.00 81.10  ? 162  ARG K CD  1 
ATOM   9999  N NE  . ARG P  1 12  ? 3.397   78.017  62.880  1.00 86.17  ? 162  ARG K NE  1 
ATOM   10000 C CZ  . ARG P  1 12  ? 2.986   77.319  61.824  1.00 87.35  ? 162  ARG K CZ  1 
ATOM   10001 N NH1 . ARG P  1 12  ? 2.063   76.375  61.959  1.00 95.92  ? 162  ARG K NH1 1 
ATOM   10002 N NH2 . ARG P  1 12  ? 3.486   77.571  60.629  1.00 84.26  ? 162  ARG K NH2 1 
ATOM   10003 N N   . GLY P  1 13  ? -0.366  77.960  68.332  1.00 67.58  ? 163  GLY K N   1 
ATOM   10004 C CA  . GLY P  1 13  ? -0.538  78.153  69.757  1.00 57.83  ? 163  GLY K CA  1 
ATOM   10005 C C   . GLY P  1 13  ? -1.263  79.460  69.991  1.00 56.34  ? 163  GLY K C   1 
ATOM   10006 O O   . GLY P  1 13  ? -1.546  80.213  69.054  1.00 49.15  ? 163  GLY K O   1 
ATOM   10007 N N   . TYR P  1 14  ? -1.583  79.741  71.240  1.00 57.03  ? 164  TYR K N   1 
ATOM   10008 C CA  . TYR P  1 14  ? -2.255  80.987  71.528  1.00 63.25  ? 164  TYR K CA  1 
ATOM   10009 C C   . TYR P  1 14  ? -1.236  82.116  71.626  1.00 69.89  ? 164  TYR K C   1 
ATOM   10010 O O   . TYR P  1 14  ? -0.040  81.894  71.839  1.00 73.71  ? 164  TYR K O   1 
ATOM   10011 C CB  . TYR P  1 14  ? -3.025  80.888  72.847  1.00 69.87  ? 164  TYR K CB  1 
ATOM   10012 C CG  . TYR P  1 14  ? -4.050  79.787  72.866  1.00 71.86  ? 164  TYR K CG  1 
ATOM   10013 C CD1 . TYR P  1 14  ? -5.315  79.985  72.310  1.00 75.33  ? 164  TYR K CD1 1 
ATOM   10014 C CD2 . TYR P  1 14  ? -3.742  78.533  73.380  1.00 68.29  ? 164  TYR K CD2 1 
ATOM   10015 C CE1 . TYR P  1 14  ? -6.245  78.954  72.258  1.00 75.77  ? 164  TYR K CE1 1 
ATOM   10016 C CE2 . TYR P  1 14  ? -4.664  77.501  73.337  1.00 70.63  ? 164  TYR K CE2 1 
ATOM   10017 C CZ  . TYR P  1 14  ? -5.910  77.711  72.774  1.00 72.64  ? 164  TYR K CZ  1 
ATOM   10018 O OH  . TYR P  1 14  ? -6.811  76.673  72.715  1.00 69.35  ? 164  TYR K OH  1 
ATOM   10019 N N   . CYS P  1 15  ? -1.719  83.336  71.459  1.00 70.37  ? 165  CYS K N   1 
ATOM   10020 C CA  . CYS P  1 15  ? -0.872  84.504  71.563  1.00 67.19  ? 165  CYS K CA  1 
ATOM   10021 C C   . CYS P  1 15  ? -1.663  85.551  72.329  1.00 66.80  ? 165  CYS K C   1 
ATOM   10022 O O   . CYS P  1 15  ? -2.392  86.348  71.731  1.00 64.06  ? 165  CYS K O   1 
ATOM   10023 C CB  . CYS P  1 15  ? -0.516  85.038  70.176  1.00 72.23  ? 165  CYS K CB  1 
ATOM   10024 S SG  . CYS P  1 15  ? 0.387   86.642  70.208  1.00 82.06  ? 165  CYS K SG  1 
ATOM   10025 N N   . LEU P  1 16  ? -1.543  85.544  73.653  1.00 65.52  ? 166  LEU K N   1 
ATOM   10026 C CA  . LEU P  1 16  ? -2.269  86.528  74.451  1.00 62.31  ? 166  LEU K CA  1 
ATOM   10027 C C   . LEU P  1 16  ? -1.771  87.905  74.109  1.00 64.21  ? 166  LEU K C   1 
ATOM   10028 O O   . LEU P  1 16  ? -0.722  88.069  73.484  1.00 72.24  ? 166  LEU K O   1 
ATOM   10029 C CB  . LEU P  1 16  ? -2.028  86.346  75.942  1.00 57.78  ? 166  LEU K CB  1 
ATOM   10030 C CG  . LEU P  1 16  ? -2.189  84.974  76.558  1.00 71.36  ? 166  LEU K CG  1 
ATOM   10031 C CD1 . LEU P  1 16  ? -2.287  85.145  78.071  1.00 72.19  ? 166  LEU K CD1 1 
ATOM   10032 C CD2 . LEU P  1 16  ? -3.441  84.301  76.010  1.00 74.84  ? 166  LEU K CD2 1 
ATOM   10033 N N   . ILE P  1 17  ? -2.523  88.898  74.549  1.00 56.91  ? 167  ILE K N   1 
ATOM   10034 C CA  . ILE P  1 17  ? -2.139  90.272  74.348  1.00 56.41  ? 167  ILE K CA  1 
ATOM   10035 C C   . ILE P  1 17  ? -2.822  91.082  75.421  1.00 59.52  ? 167  ILE K C   1 
ATOM   10036 O O   . ILE P  1 17  ? -3.957  91.506  75.242  1.00 65.53  ? 167  ILE K O   1 
ATOM   10037 C CB  . ILE P  1 17  ? -2.591  90.831  72.985  1.00 53.65  ? 167  ILE K CB  1 
ATOM   10038 C CG1 . ILE P  1 17  ? -1.892  90.091  71.844  1.00 54.52  ? 167  ILE K CG1 1 
ATOM   10039 C CG2 . ILE P  1 17  ? -2.265  92.311  72.911  1.00 54.37  ? 167  ILE K CG2 1 
ATOM   10040 C CD1 . ILE P  1 17  ? -2.027  90.785  70.497  1.00 52.23  ? 167  ILE K CD1 1 
ATOM   10041 N N   . ILE P  1 18  ? -2.161  91.270  76.554  1.00 59.43  ? 168  ILE K N   1 
ATOM   10042 C CA  . ILE P  1 18  ? -2.753  92.084  77.600  1.00 60.13  ? 168  ILE K CA  1 
ATOM   10043 C C   . ILE P  1 18  ? -2.450  93.481  77.116  1.00 64.64  ? 168  ILE K C   1 
ATOM   10044 O O   . ILE P  1 18  ? -1.293  93.885  77.070  1.00 70.37  ? 168  ILE K O   1 
ATOM   10045 C CB  . ILE P  1 18  ? -2.075  91.873  78.968  1.00 58.37  ? 168  ILE K CB  1 
ATOM   10046 C CG1 . ILE P  1 18  ? -2.031  90.381  79.308  1.00 60.06  ? 168  ILE K CG1 1 
ATOM   10047 C CG2 . ILE P  1 18  ? -2.826  92.641  80.042  1.00 51.43  ? 168  ILE K CG2 1 
ATOM   10048 C CD1 . ILE P  1 18  ? -3.323  89.638  79.025  1.00 61.19  ? 168  ILE K CD1 1 
ATOM   10049 N N   . ASN P  1 19  ? -3.490  94.206  76.727  1.00 69.94  ? 169  ASN K N   1 
ATOM   10050 C CA  . ASN P  1 19  ? -3.355  95.567  76.215  1.00 68.96  ? 169  ASN K CA  1 
ATOM   10051 C C   . ASN P  1 19  ? -3.924  96.584  77.207  1.00 65.09  ? 169  ASN K C   1 
ATOM   10052 O O   . ASN P  1 19  ? -5.131  96.775  77.276  1.00 64.48  ? 169  ASN K O   1 
ATOM   10053 C CB  . ASN P  1 19  ? -4.101  95.673  74.886  1.00 67.16  ? 169  ASN K CB  1 
ATOM   10054 C CG  . ASN P  1 19  ? -4.097  97.072  74.331  1.00 72.01  ? 169  ASN K CG  1 
ATOM   10055 O OD1 . ASN P  1 19  ? -4.406  98.038  75.044  1.00 71.58  ? 169  ASN K OD1 1 
ATOM   10056 N ND2 . ASN P  1 19  ? -3.755  97.199  73.046  1.00 71.52  ? 169  ASN K ND2 1 
ATOM   10057 N N   . ASN P  1 20  ? -3.058  97.234  77.971  1.00 66.84  ? 170  ASN K N   1 
ATOM   10058 C CA  . ASN P  1 20  ? -3.517  98.219  78.943  1.00 72.30  ? 170  ASN K CA  1 
ATOM   10059 C C   . ASN P  1 20  ? -3.410  99.631  78.399  1.00 78.45  ? 170  ASN K C   1 
ATOM   10060 O O   . ASN P  1 20  ? -2.337  100.070 77.982  1.00 82.28  ? 170  ASN K O   1 
ATOM   10061 C CB  . ASN P  1 20  ? -2.723  98.101  80.241  1.00 68.45  ? 170  ASN K CB  1 
ATOM   10062 C CG  . ASN P  1 20  ? -3.143  96.911  81.061  1.00 68.41  ? 170  ASN K CG  1 
ATOM   10063 O OD1 . ASN P  1 20  ? -3.895  96.053  80.589  1.00 66.84  ? 170  ASN K OD1 1 
ATOM   10064 N ND2 . ASN P  1 20  ? -2.658  96.841  82.295  1.00 66.13  ? 170  ASN K ND2 1 
ATOM   10065 N N   . HIS P  1 21  ? -4.533  100.340 78.413  1.00 80.96  ? 171  HIS K N   1 
ATOM   10066 C CA  . HIS P  1 21  ? -4.593  101.704 77.910  1.00 80.75  ? 171  HIS K CA  1 
ATOM   10067 C C   . HIS P  1 21  ? -5.099  102.713 78.948  1.00 81.85  ? 171  HIS K C   1 
ATOM   10068 O O   . HIS P  1 21  ? -4.381  103.634 79.327  1.00 80.62  ? 171  HIS K O   1 
ATOM   10069 C CB  . HIS P  1 21  ? -5.502  101.755 76.683  1.00 84.48  ? 171  HIS K CB  1 
ATOM   10070 C CG  . HIS P  1 21  ? -5.991  103.132 76.362  1.00 92.14  ? 171  HIS K CG  1 
ATOM   10071 N ND1 . HIS P  1 21  ? -5.210  104.065 75.715  1.00 92.41  ? 171  HIS K ND1 1 
ATOM   10072 C CD2 . HIS P  1 21  ? -7.159  103.754 76.654  1.00 93.85  ? 171  HIS K CD2 1 
ATOM   10073 C CE1 . HIS P  1 21  ? -5.875  105.203 75.623  1.00 92.90  ? 171  HIS K CE1 1 
ATOM   10074 N NE2 . HIS P  1 21  ? -7.060  105.042 76.185  1.00 95.38  ? 171  HIS K NE2 1 
ATOM   10075 N N   . ASN P  1 22  ? -6.339  102.530 79.398  1.00 80.52  ? 172  ASN K N   1 
ATOM   10076 C CA  . ASN P  1 22  ? -6.973  103.431 80.355  1.00 80.40  ? 172  ASN K CA  1 
ATOM   10077 C C   . ASN P  1 22  ? -6.547  103.234 81.813  1.00 80.12  ? 172  ASN K C   1 
ATOM   10078 O O   . ASN P  1 22  ? -7.163  102.465 82.550  1.00 81.10  ? 172  ASN K O   1 
ATOM   10079 C CB  . ASN P  1 22  ? -8.499  103.298 80.225  1.00 82.70  ? 172  ASN K CB  1 
ATOM   10080 C CG  . ASN P  1 22  ? -9.255  104.145 81.240  1.00 88.73  ? 172  ASN K CG  1 
ATOM   10081 O OD1 . ASN P  1 22  ? -8.896  105.298 81.504  1.00 92.68  ? 172  ASN K OD1 1 
ATOM   10082 N ND2 . ASN P  1 22  ? -10.318 103.580 81.803  1.00 86.80  ? 172  ASN K ND2 1 
ATOM   10083 N N   . PHE P  1 23  ? -5.509  103.950 82.238  1.00 78.37  ? 173  PHE K N   1 
ATOM   10084 C CA  . PHE P  1 23  ? -5.034  103.819 83.613  1.00 77.58  ? 173  PHE K CA  1 
ATOM   10085 C C   . PHE P  1 23  ? -5.755  104.721 84.596  1.00 81.83  ? 173  PHE K C   1 
ATOM   10086 O O   . PHE P  1 23  ? -5.156  105.277 85.515  1.00 82.38  ? 173  PHE K O   1 
ATOM   10087 C CB  . PHE P  1 23  ? -3.527  104.065 83.673  1.00 73.24  ? 173  PHE K CB  1 
ATOM   10088 C CG  . PHE P  1 23  ? -2.735  102.940 83.122  1.00 71.56  ? 173  PHE K CG  1 
ATOM   10089 C CD1 . PHE P  1 23  ? -2.641  102.753 81.743  1.00 74.21  ? 173  PHE K CD1 1 
ATOM   10090 C CD2 . PHE P  1 23  ? -2.182  101.989 83.974  1.00 70.64  ? 173  PHE K CD2 1 
ATOM   10091 C CE1 . PHE P  1 23  ? -2.013  101.620 81.211  1.00 74.20  ? 173  PHE K CE1 1 
ATOM   10092 C CE2 . PHE P  1 23  ? -1.550  100.849 83.460  1.00 76.93  ? 173  PHE K CE2 1 
ATOM   10093 C CZ  . PHE P  1 23  ? -1.467  100.663 82.070  1.00 77.58  ? 173  PHE K CZ  1 
ATOM   10094 N N   . ALA P  1 24  ? -7.060  104.835 84.421  1.00 87.79  ? 174  ALA K N   1 
ATOM   10095 C CA  . ALA P  1 24  ? -7.862  105.678 85.287  1.00 94.22  ? 174  ALA K CA  1 
ATOM   10096 C C   . ALA P  1 24  ? -7.721  105.443 86.813  1.00 97.38  ? 174  ALA K C   1 
ATOM   10097 O O   . ALA P  1 24  ? -7.347  106.363 87.556  1.00 97.78  ? 174  ALA K O   1 
ATOM   10098 C CB  . ALA P  1 24  ? -9.322  105.567 84.866  1.00 95.87  ? 174  ALA K CB  1 
ATOM   10099 N N   . LYS P  1 25  ? -8.005  104.227 87.282  1.00 97.94  ? 175  LYS K N   1 
ATOM   10100 C CA  . LYS P  1 25  ? -7.949  103.944 88.719  1.00 97.99  ? 175  LYS K CA  1 
ATOM   10101 C C   . LYS P  1 25  ? -6.614  104.172 89.406  1.00 100.00 ? 175  LYS K C   1 
ATOM   10102 O O   . LYS P  1 25  ? -6.578  104.711 90.518  1.00 99.67  ? 175  LYS K O   1 
ATOM   10103 C CB  . LYS P  1 25  ? -8.397  102.517 89.021  1.00 93.53  ? 175  LYS K CB  1 
ATOM   10104 C CG  . LYS P  1 25  ? -8.362  102.211 90.502  1.00 86.80  ? 175  LYS K CG  1 
ATOM   10105 C CD  . LYS P  1 25  ? -8.595  100.747 90.750  1.00 93.13  ? 175  LYS K CD  1 
ATOM   10106 C CE  . LYS P  1 25  ? -8.396  100.404 92.209  1.00 95.51  ? 175  LYS K CE  1 
ATOM   10107 N NZ  . LYS P  1 25  ? -8.634  98.960  92.459  1.00 92.27  ? 175  LYS K NZ  1 
ATOM   10108 N N   . ALA P  1 26  A -5.529  103.736 88.764  1.00 100.00 ? 175  ALA K N   1 
ATOM   10109 C CA  . ALA P  1 26  A -4.178  103.894 89.319  1.00 100.00 ? 175  ALA K CA  1 
ATOM   10110 C C   . ALA P  1 26  A -4.110  105.239 90.059  1.00 100.00 ? 175  ALA K C   1 
ATOM   10111 O O   . ALA P  1 26  A -3.558  105.362 91.169  1.00 95.61  ? 175  ALA K O   1 
ATOM   10112 C CB  . ALA P  1 26  A -3.139  103.848 88.179  1.00 100.00 ? 175  ALA K CB  1 
ATOM   10113 N N   . ARG P  1 27  B -4.702  106.237 89.409  1.00 100.00 ? 175  ARG K N   1 
ATOM   10114 C CA  . ARG P  1 27  B -4.783  107.585 89.926  1.00 99.41  ? 175  ARG K CA  1 
ATOM   10115 C C   . ARG P  1 27  B -5.978  107.581 90.872  1.00 98.46  ? 175  ARG K C   1 
ATOM   10116 O O   . ARG P  1 27  B -7.008  108.188 90.583  1.00 100.00 ? 175  ARG K O   1 
ATOM   10117 C CB  . ARG P  1 27  B -5.005  108.559 88.761  1.00 96.65  ? 175  ARG K CB  1 
ATOM   10118 C CG  . ARG P  1 27  B -3.940  108.449 87.672  1.00 95.20  ? 175  ARG K CG  1 
ATOM   10119 C CD  . ARG P  1 27  B -4.340  109.141 86.358  1.00 98.83  ? 175  ARG K CD  1 
ATOM   10120 N NE  . ARG P  1 27  B -5.358  108.414 85.590  1.00 100.00 ? 175  ARG K NE  1 
ATOM   10121 C CZ  . ARG P  1 27  B -5.530  108.522 84.269  1.00 100.00 ? 175  ARG K CZ  1 
ATOM   10122 N NH1 . ARG P  1 27  B -4.753  109.328 83.550  1.00 100.00 ? 175  ARG K NH1 1 
ATOM   10123 N NH2 . ARG P  1 27  B -6.477  107.817 83.656  1.00 100.00 ? 175  ARG K NH2 1 
ATOM   10124 N N   . GLU P  1 28  C -5.849  106.850 91.979  1.00 98.93  ? 175  GLU K N   1 
ATOM   10125 C CA  . GLU P  1 28  C -6.912  106.780 92.984  1.00 100.00 ? 175  GLU K CA  1 
ATOM   10126 C C   . GLU P  1 28  C -6.557  105.962 94.236  1.00 100.00 ? 175  GLU K C   1 
ATOM   10127 O O   . GLU P  1 28  C -6.786  106.429 95.360  1.00 100.00 ? 175  GLU K O   1 
ATOM   10128 C CB  . GLU P  1 28  C -8.224  106.232 92.383  1.00 100.00 ? 175  GLU K CB  1 
ATOM   10129 C CG  . GLU P  1 28  C -9.438  106.390 93.334  1.00 100.00 ? 175  GLU K CG  1 
ATOM   10130 C CD  . GLU P  1 28  C -10.686 105.616 92.903  1.00 100.00 ? 175  GLU K CD  1 
ATOM   10131 O OE1 . GLU P  1 28  C -11.713 105.704 93.620  1.00 99.34  ? 175  GLU K OE1 1 
ATOM   10132 O OE2 . GLU P  1 28  C -10.641 104.924 91.858  1.00 100.00 ? 175  GLU K OE2 1 
ATOM   10133 N N   . LYS P  1 29  D -6.028  104.749 94.060  1.00 99.43  ? 175  LYS K N   1 
ATOM   10134 C CA  . LYS P  1 29  D -5.663  103.915 95.213  1.00 99.28  ? 175  LYS K CA  1 
ATOM   10135 C C   . LYS P  1 29  D -4.151  103.973 95.424  1.00 100.00 ? 175  LYS K C   1 
ATOM   10136 O O   . LYS P  1 29  D -3.640  103.666 96.510  1.00 97.74  ? 175  LYS K O   1 
ATOM   10137 C CB  . LYS P  1 29  D -6.123  102.455 95.021  1.00 96.59  ? 175  LYS K CB  1 
ATOM   10138 C CG  . LYS P  1 29  D -7.624  102.291 94.795  1.00 96.16  ? 175  LYS K CG  1 
ATOM   10139 C CD  . LYS P  1 29  D -8.443  103.015 95.869  1.00 100.00 ? 175  LYS K CD  1 
ATOM   10140 C CE  . LYS P  1 29  D -9.903  103.229 95.448  1.00 98.87  ? 175  LYS K CE  1 
ATOM   10141 N NZ  . LYS P  1 29  D -10.690 101.961 95.350  1.00 100.00 ? 175  LYS K NZ  1 
ATOM   10142 N N   . VAL P  1 30  E -3.440  104.368 94.370  1.00 100.00 ? 175  VAL K N   1 
ATOM   10143 C CA  . VAL P  1 30  E -1.989  104.501 94.440  1.00 100.00 ? 175  VAL K CA  1 
ATOM   10144 C C   . VAL P  1 30  E -1.708  105.999 94.486  1.00 100.00 ? 175  VAL K C   1 
ATOM   10145 O O   . VAL P  1 30  E -1.536  106.648 93.434  1.00 100.00 ? 175  VAL K O   1 
ATOM   10146 C CB  . VAL P  1 30  E -1.277  103.916 93.200  1.00 100.00 ? 175  VAL K CB  1 
ATOM   10147 C CG1 . VAL P  1 30  E 0.198   103.699 93.512  1.00 99.58  ? 175  VAL K CG1 1 
ATOM   10148 C CG2 . VAL P  1 30  E -1.937  102.620 92.775  1.00 100.00 ? 175  VAL K CG2 1 
ATOM   10149 N N   . PRO P  1 31  F -1.680  106.574 95.707  1.00 100.00 ? 175  PRO K N   1 
ATOM   10150 C CA  . PRO P  1 31  F -1.413  108.012 95.806  1.00 100.00 ? 175  PRO K CA  1 
ATOM   10151 C C   . PRO P  1 31  F -0.151  108.253 94.992  1.00 100.00 ? 175  PRO K C   1 
ATOM   10152 O O   . PRO P  1 31  F -0.151  109.012 94.009  1.00 100.00 ? 175  PRO K O   1 
ATOM   10153 C CB  . PRO P  1 31  F -1.204  108.219 97.309  1.00 100.00 ? 175  PRO K CB  1 
ATOM   10154 C CG  . PRO P  1 31  F -0.632  106.889 97.768  1.00 99.08  ? 175  PRO K CG  1 
ATOM   10155 C CD  . PRO P  1 31  F -1.512  105.911 97.018  1.00 100.00 ? 175  PRO K CD  1 
ATOM   10156 N N   . LYS P  1 32  G 0.899   107.538 95.401  1.00 100.00 ? 175  LYS K N   1 
ATOM   10157 C CA  . LYS P  1 32  G 2.217   107.580 94.782  1.00 100.00 ? 175  LYS K CA  1 
ATOM   10158 C C   . LYS P  1 32  G 2.180   107.092 93.331  1.00 100.00 ? 175  LYS K C   1 
ATOM   10159 O O   . LYS P  1 32  G 2.891   106.158 92.947  1.00 100.00 ? 175  LYS K O   1 
ATOM   10160 C CB  . LYS P  1 32  G 3.180   106.731 95.615  1.00 98.81  ? 175  LYS K CB  1 
ATOM   10161 C CG  . LYS P  1 32  G 2.553   105.460 96.172  1.00 97.84  ? 175  LYS K CG  1 
ATOM   10162 C CD  . LYS P  1 32  G 3.521   104.740 97.092  1.00 98.05  ? 175  LYS K CD  1 
ATOM   10163 C CE  . LYS P  1 32  G 3.846   105.584 98.319  1.00 100.00 ? 175  LYS K CE  1 
ATOM   10164 N NZ  . LYS P  1 32  G 4.889   104.962 99.192  1.00 100.00 ? 175  LYS K NZ  1 
ATOM   10165 N N   . LEU P  1 33  H 1.351   107.752 92.533  1.00 98.28  ? 175  LEU K N   1 
ATOM   10166 C CA  . LEU P  1 33  H 1.188   107.416 91.138  1.00 98.26  ? 175  LEU K CA  1 
ATOM   10167 C C   . LEU P  1 33  H 0.155   108.394 90.614  1.00 99.33  ? 175  LEU K C   1 
ATOM   10168 O O   . LEU P  1 33  H -0.821  108.011 89.967  1.00 98.76  ? 175  LEU K O   1 
ATOM   10169 C CB  . LEU P  1 33  H 0.683   105.980 91.014  1.00 99.63  ? 175  LEU K CB  1 
ATOM   10170 C CG  . LEU P  1 33  H 0.758   105.299 89.646  1.00 100.00 ? 175  LEU K CG  1 
ATOM   10171 C CD1 . LEU P  1 33  H 2.184   105.325 89.122  1.00 97.36  ? 175  LEU K CD1 1 
ATOM   10172 C CD2 . LEU P  1 33  H 0.266   103.864 89.780  1.00 100.00 ? 175  LEU K CD2 1 
ATOM   10173 N N   . HIS P  1 34  I 0.378   109.668 90.911  1.00 99.84  ? 175  HIS K N   1 
ATOM   10174 C CA  . HIS P  1 34  I -0.535  110.714 90.480  1.00 100.00 ? 175  HIS K CA  1 
ATOM   10175 C C   . HIS P  1 34  I -0.421  111.009 88.990  1.00 99.52  ? 175  HIS K C   1 
ATOM   10176 O O   . HIS P  1 34  I 0.631   110.804 88.378  1.00 97.36  ? 175  HIS K O   1 
ATOM   10177 C CB  . HIS P  1 34  I -0.324  111.994 91.310  1.00 100.00 ? 175  HIS K CB  1 
ATOM   10178 C CG  . HIS P  1 34  I 1.024   112.643 91.146  1.00 100.00 ? 175  HIS K CG  1 
ATOM   10179 N ND1 . HIS P  1 34  I 2.213   111.954 91.273  1.00 100.00 ? 175  HIS K ND1 1 
ATOM   10180 C CD2 . HIS P  1 34  I 1.367   113.945 90.966  1.00 100.00 ? 175  HIS K CD2 1 
ATOM   10181 C CE1 . HIS P  1 34  I 3.227   112.800 91.183  1.00 100.00 ? 175  HIS K CE1 1 
ATOM   10182 N NE2 . HIS P  1 34  I 2.741   114.015 90.998  1.00 100.00 ? 175  HIS K NE2 1 
ATOM   10183 N N   . SER P  1 35  J -1.531  111.476 88.422  1.00 97.57  ? 175  SER K N   1 
ATOM   10184 C CA  . SER P  1 35  J -1.650  111.807 87.000  1.00 99.01  ? 175  SER K CA  1 
ATOM   10185 C C   . SER P  1 35  J -0.844  110.896 86.037  1.00 100.00 ? 175  SER K C   1 
ATOM   10186 O O   . SER P  1 35  J -0.038  111.376 85.227  1.00 100.00 ? 175  SER K O   1 
ATOM   10187 C CB  . SER P  1 35  J -1.284  113.286 86.774  1.00 97.89  ? 175  SER K CB  1 
ATOM   10188 O OG  . SER P  1 35  J -2.242  113.958 85.959  1.00 88.37  ? 175  SER K OG  1 
ATOM   10189 N N   . ILE P  1 36  ? -1.084  109.583 86.116  1.00 100.00 ? 176  ILE K N   1 
ATOM   10190 C CA  . ILE P  1 36  ? -0.409  108.608 85.248  1.00 96.34  ? 176  ILE K CA  1 
ATOM   10191 C C   . ILE P  1 36  ? -1.044  108.623 83.844  1.00 96.17  ? 176  ILE K C   1 
ATOM   10192 O O   . ILE P  1 36  ? -2.263  108.517 83.690  1.00 96.20  ? 176  ILE K O   1 
ATOM   10193 C CB  . ILE P  1 36  ? -0.504  107.165 85.841  1.00 92.20  ? 176  ILE K CB  1 
ATOM   10194 C CG1 . ILE P  1 36  ? -0.302  107.201 87.359  1.00 83.95  ? 176  ILE K CG1 1 
ATOM   10195 C CG2 . ILE P  1 36  ? 0.555   106.263 85.210  1.00 86.14  ? 176  ILE K CG2 1 
ATOM   10196 C CD1 . ILE P  1 36  ? 0.934   107.927 87.782  1.00 76.01  ? 176  ILE K CD1 1 
ATOM   10197 N N   . ARG P  1 37  ? -0.206  108.751 82.825  1.00 94.55  ? 177  ARG K N   1 
ATOM   10198 C CA  . ARG P  1 37  ? -0.651  108.800 81.427  1.00 96.88  ? 177  ARG K CA  1 
ATOM   10199 C C   . ARG P  1 37  ? -1.446  107.601 80.872  1.00 95.46  ? 177  ARG K C   1 
ATOM   10200 O O   . ARG P  1 37  ? -1.089  106.447 81.127  1.00 98.22  ? 177  ARG K O   1 
ATOM   10201 C CB  . ARG P  1 37  ? 0.575   108.957 80.518  1.00 96.22  ? 177  ARG K CB  1 
ATOM   10202 C CG  . ARG P  1 37  ? 1.472   110.131 80.824  1.00 100.00 ? 177  ARG K CG  1 
ATOM   10203 C CD  . ARG P  1 37  ? 0.805   111.443 80.440  1.00 100.00 ? 177  ARG K CD  1 
ATOM   10204 N NE  . ARG P  1 37  ? 0.170   111.399 79.119  1.00 100.00 ? 177  ARG K NE  1 
ATOM   10205 C CZ  . ARG P  1 37  ? 0.705   110.863 78.021  1.00 100.00 ? 177  ARG K CZ  1 
ATOM   10206 N NH1 . ARG P  1 37  ? 1.912   110.297 78.058  1.00 100.00 ? 177  ARG K NH1 1 
ATOM   10207 N NH2 . ARG P  1 37  ? 0.030   110.904 76.875  1.00 98.90  ? 177  ARG K NH2 1 
ATOM   10208 N N   . ASP P  1 38  ? -2.536  107.843 80.139  1.00 88.38  ? 178  ASP K N   1 
ATOM   10209 C CA  . ASP P  1 38  ? -3.152  106.695 79.491  1.00 83.72  ? 178  ASP K CA  1 
ATOM   10210 C C   . ASP P  1 38  ? -2.200  106.408 78.327  1.00 77.60  ? 178  ASP K C   1 
ATOM   10211 O O   . ASP P  1 38  ? -1.660  107.321 77.706  1.00 70.35  ? 178  ASP K O   1 
ATOM   10212 C CB  . ASP P  1 38  ? -4.558  106.991 78.963  1.00 89.54  ? 178  ASP K CB  1 
ATOM   10213 C CG  . ASP P  1 38  ? -5.564  107.161 80.080  1.00 93.66  ? 178  ASP K CG  1 
ATOM   10214 O OD1 . ASP P  1 38  ? -5.485  106.407 81.082  1.00 93.23  ? 178  ASP K OD1 1 
ATOM   10215 O OD2 . ASP P  1 38  ? -6.434  108.046 79.951  1.00 95.56  ? 178  ASP K OD2 1 
ATOM   10216 N N   . ARG P  1 39  ? -1.998  105.130 78.046  1.00 77.43  ? 179  ARG K N   1 
ATOM   10217 C CA  . ARG P  1 39  ? -1.082  104.714 77.002  1.00 75.67  ? 179  ARG K CA  1 
ATOM   10218 C C   . ARG P  1 39  ? -1.638  104.847 75.590  1.00 73.74  ? 179  ARG K C   1 
ATOM   10219 O O   . ARG P  1 39  ? -1.828  103.858 74.875  1.00 74.34  ? 179  ARG K O   1 
ATOM   10220 C CB  . ARG P  1 39  ? -0.622  103.276 77.295  1.00 77.18  ? 179  ARG K CB  1 
ATOM   10221 C CG  . ARG P  1 39  ? -0.023  103.127 78.716  1.00 72.61  ? 179  ARG K CG  1 
ATOM   10222 C CD  . ARG P  1 39  ? 0.612   101.759 78.965  1.00 71.96  ? 179  ARG K CD  1 
ATOM   10223 N NE  . ARG P  1 39  ? 1.642   101.466 77.972  1.00 68.67  ? 179  ARG K NE  1 
ATOM   10224 C CZ  . ARG P  1 39  ? 1.416   100.846 76.817  1.00 70.71  ? 179  ARG K CZ  1 
ATOM   10225 N NH1 . ARG P  1 39  ? 0.190   100.442 76.508  1.00 71.87  ? 179  ARG K NH1 1 
ATOM   10226 N NH2 . ARG P  1 39  ? 2.414   100.635 75.966  1.00 68.82  ? 179  ARG K NH2 1 
ATOM   10227 N N   . ASN P  1 40  ? -1.879  106.087 75.185  1.00 73.15  ? 180  ASN K N   1 
ATOM   10228 C CA  . ASN P  1 40  ? -2.405  106.362 73.851  1.00 78.59  ? 180  ASN K CA  1 
ATOM   10229 C C   . ASN P  1 40  ? -1.526  105.799 72.742  1.00 78.08  ? 180  ASN K C   1 
ATOM   10230 O O   . ASN P  1 40  ? -0.377  106.215 72.575  1.00 77.99  ? 180  ASN K O   1 
ATOM   10231 C CB  . ASN P  1 40  ? -2.556  107.866 73.642  1.00 82.96  ? 180  ASN K CB  1 
ATOM   10232 C CG  . ASN P  1 40  ? -3.680  108.462 74.475  1.00 92.83  ? 180  ASN K CG  1 
ATOM   10233 O OD1 . ASN P  1 40  ? -3.778  109.683 74.605  1.00 99.83  ? 180  ASN K OD1 1 
ATOM   10234 N ND2 . ASN P  1 40  ? -4.540  107.606 75.036  1.00 91.21  ? 180  ASN K ND2 1 
ATOM   10235 N N   . GLY P  1 41  ? -2.073  104.854 71.983  1.00 74.44  ? 181  GLY K N   1 
ATOM   10236 C CA  . GLY P  1 41  ? -1.321  104.259 70.895  1.00 71.80  ? 181  GLY K CA  1 
ATOM   10237 C C   . GLY P  1 41  ? -1.229  102.746 70.993  1.00 77.52  ? 181  GLY K C   1 
ATOM   10238 O O   . GLY P  1 41  ? -1.048  102.080 69.959  1.00 75.58  ? 181  GLY K O   1 
ATOM   10239 N N   . THR P  1 42  ? -1.362  102.208 72.215  1.00 75.18  ? 182  THR K N   1 
ATOM   10240 C CA  . THR P  1 42  ? -1.276  100.758 72.448  1.00 77.92  ? 182  THR K CA  1 
ATOM   10241 C C   . THR P  1 42  ? -1.990  100.039 71.330  1.00 76.19  ? 182  THR K C   1 
ATOM   10242 O O   . THR P  1 42  ? -1.488  99.070  70.761  1.00 70.80  ? 182  THR K O   1 
ATOM   10243 C CB  . THR P  1 42  ? -1.985  100.320 73.737  1.00 82.14  ? 182  THR K CB  1 
ATOM   10244 O OG1 . THR P  1 42  ? -1.888  101.353 74.724  1.00 86.70  ? 182  THR K OG1 1 
ATOM   10245 C CG2 . THR P  1 42  ? -1.346  99.037  74.269  1.00 80.00  ? 182  THR K CG2 1 
ATOM   10246 N N   . HIS P  1 43  ? -3.187  100.545 71.060  1.00 77.38  ? 183  HIS K N   1 
ATOM   10247 C CA  . HIS P  1 43  ? -4.085  100.053 70.037  1.00 80.66  ? 183  HIS K CA  1 
ATOM   10248 C C   . HIS P  1 43  ? -3.300  99.685  68.791  1.00 80.57  ? 183  HIS K C   1 
ATOM   10249 O O   . HIS P  1 43  ? -3.455  98.583  68.242  1.00 78.81  ? 183  HIS K O   1 
ATOM   10250 C CB  . HIS P  1 43  ? -5.112  101.142 69.739  1.00 85.58  ? 183  HIS K CB  1 
ATOM   10251 C CG  . HIS P  1 43  ? -5.419  102.011 70.926  1.00 98.11  ? 183  HIS K CG  1 
ATOM   10252 N ND1 . HIS P  1 43  ? -4.682  103.136 71.233  1.00 100.00 ? 183  HIS K ND1 1 
ATOM   10253 C CD2 . HIS P  1 43  ? -6.341  101.887 71.916  1.00 100.00 ? 183  HIS K CD2 1 
ATOM   10254 C CE1 . HIS P  1 43  ? -5.134  103.666 72.358  1.00 100.00 ? 183  HIS K CE1 1 
ATOM   10255 N NE2 . HIS P  1 43  ? -6.141  102.928 72.793  1.00 100.00 ? 183  HIS K NE2 1 
ATOM   10256 N N   . LEU P  1 44  ? -2.438  100.596 68.353  1.00 76.77  ? 184  LEU K N   1 
ATOM   10257 C CA  . LEU P  1 44  ? -1.632  100.328 67.170  1.00 74.59  ? 184  LEU K CA  1 
ATOM   10258 C C   . LEU P  1 44  ? -0.726  99.101  67.358  1.00 72.22  ? 184  LEU K C   1 
ATOM   10259 O O   . LEU P  1 44  ? -0.549  98.293  66.431  1.00 61.22  ? 184  LEU K O   1 
ATOM   10260 C CB  . LEU P  1 44  ? -0.824  101.574 66.807  1.00 73.01  ? 184  LEU K CB  1 
ATOM   10261 C CG  . LEU P  1 44  ? -1.555  102.636 65.966  1.00 74.72  ? 184  LEU K CG  1 
ATOM   10262 C CD1 . LEU P  1 44  ? -3.063  102.363 65.912  1.00 72.28  ? 184  LEU K CD1 1 
ATOM   10263 C CD2 . LEU P  1 44  ? -1.277  104.016 66.559  1.00 71.92  ? 184  LEU K CD2 1 
ATOM   10264 N N   . ASP P  1 45  ? -0.166  98.955  68.560  1.00 73.91  ? 185  ASP K N   1 
ATOM   10265 C CA  . ASP P  1 45  ? 0.693   97.800  68.865  1.00 76.64  ? 185  ASP K CA  1 
ATOM   10266 C C   . ASP P  1 45  ? -0.152  96.528  68.759  1.00 74.16  ? 185  ASP K C   1 
ATOM   10267 O O   . ASP P  1 45  ? 0.172   95.585  68.012  1.00 65.53  ? 185  ASP K O   1 
ATOM   10268 C CB  . ASP P  1 45  ? 1.258   97.877  70.298  1.00 81.02  ? 185  ASP K CB  1 
ATOM   10269 C CG  . ASP P  1 45  ? 2.377   98.896  70.451  1.00 83.72  ? 185  ASP K CG  1 
ATOM   10270 O OD1 . ASP P  1 45  ? 2.997   99.286  69.429  1.00 82.63  ? 185  ASP K OD1 1 
ATOM   10271 O OD2 . ASP P  1 45  ? 2.641   99.286  71.614  1.00 85.52  ? 185  ASP K OD2 1 
ATOM   10272 N N   . ALA P  1 46  ? -1.231  96.521  69.543  1.00 72.48  ? 186  ALA K N   1 
ATOM   10273 C CA  . ALA P  1 46  ? -2.167  95.410  69.580  1.00 68.86  ? 186  ALA K CA  1 
ATOM   10274 C C   . ALA P  1 46  ? -2.535  95.032  68.140  1.00 66.38  ? 186  ALA K C   1 
ATOM   10275 O O   . ALA P  1 46  ? -2.462  93.857  67.755  1.00 64.20  ? 186  ALA K O   1 
ATOM   10276 C CB  . ALA P  1 46  ? -3.411  95.815  70.370  1.00 54.36  ? 186  ALA K CB  1 
ATOM   10277 N N   . GLY P  1 47  ? -2.907  96.037  67.346  1.00 59.20  ? 187  GLY K N   1 
ATOM   10278 C CA  . GLY P  1 47  ? -3.268  95.769  65.970  1.00 60.18  ? 187  GLY K CA  1 
ATOM   10279 C C   . GLY P  1 47  ? -2.140  95.060  65.248  1.00 58.51  ? 187  GLY K C   1 
ATOM   10280 O O   . GLY P  1 47  ? -2.293  93.939  64.747  1.00 50.58  ? 187  GLY K O   1 
ATOM   10281 N N   . ALA P  1 48  ? -0.993  95.728  65.221  1.00 61.10  ? 188  ALA K N   1 
ATOM   10282 C CA  . ALA P  1 48  ? 0.203   95.219  64.566  1.00 61.99  ? 188  ALA K CA  1 
ATOM   10283 C C   . ALA P  1 48  ? 0.532   93.801  65.017  1.00 64.53  ? 188  ALA K C   1 
ATOM   10284 O O   . ALA P  1 48  ? 0.797   92.916  64.188  1.00 56.33  ? 188  ALA K O   1 
ATOM   10285 C CB  . ALA P  1 48  ? 1.374   96.153  64.857  1.00 65.13  ? 188  ALA K CB  1 
ATOM   10286 N N   . LEU P  1 49  ? 0.527   93.594  66.335  1.00 67.63  ? 189  LEU K N   1 
ATOM   10287 C CA  . LEU P  1 49  ? 0.809   92.278  66.900  1.00 66.88  ? 189  LEU K CA  1 
ATOM   10288 C C   . LEU P  1 49  ? -0.162  91.245  66.315  1.00 71.98  ? 189  LEU K C   1 
ATOM   10289 O O   . LEU P  1 49  ? 0.262   90.221  65.738  1.00 66.99  ? 189  LEU K O   1 
ATOM   10290 C CB  . LEU P  1 49  ? 0.674   92.337  68.421  1.00 63.11  ? 189  LEU K CB  1 
ATOM   10291 C CG  . LEU P  1 49  ? 1.890   92.975  69.095  1.00 65.36  ? 189  LEU K CG  1 
ATOM   10292 C CD1 . LEU P  1 49  ? 1.636   93.254  70.575  1.00 62.04  ? 189  LEU K CD1 1 
ATOM   10293 C CD2 . LEU P  1 49  ? 3.058   92.027  68.923  1.00 60.49  ? 189  LEU K CD2 1 
ATOM   10294 N N   . THR P  1 50  ? -1.462  91.536  66.452  1.00 73.74  ? 190  THR K N   1 
ATOM   10295 C CA  . THR P  1 50  ? -2.529  90.664  65.951  1.00 69.48  ? 190  THR K CA  1 
ATOM   10296 C C   . THR P  1 50  ? -2.294  90.270  64.499  1.00 70.99  ? 190  THR K C   1 
ATOM   10297 O O   . THR P  1 50  ? -2.300  89.088  64.148  1.00 69.84  ? 190  THR K O   1 
ATOM   10298 C CB  . THR P  1 50  ? -3.896  91.345  65.995  1.00 65.83  ? 190  THR K CB  1 
ATOM   10299 O OG1 . THR P  1 50  ? -4.068  92.014  67.246  1.00 67.64  ? 190  THR K OG1 1 
ATOM   10300 C CG2 . THR P  1 50  ? -4.981  90.307  65.850  1.00 62.16  ? 190  THR K CG2 1 
ATOM   10301 N N   . THR P  1 51  ? -2.104  91.276  63.655  1.00 67.65  ? 191  THR K N   1 
ATOM   10302 C CA  . THR P  1 51  ? -1.863  91.046  62.245  1.00 68.06  ? 191  THR K CA  1 
ATOM   10303 C C   . THR P  1 51  ? -0.652  90.158  62.033  1.00 69.74  ? 191  THR K C   1 
ATOM   10304 O O   . THR P  1 51  ? -0.718  89.136  61.355  1.00 71.05  ? 191  THR K O   1 
ATOM   10305 C CB  . THR P  1 51  ? -1.577  92.356  61.506  1.00 70.38  ? 191  THR K CB  1 
ATOM   10306 O OG1 . THR P  1 51  ? -2.624  93.299  61.763  1.00 72.20  ? 191  THR K OG1 1 
ATOM   10307 C CG2 . THR P  1 51  ? -1.464  92.090  60.005  1.00 70.61  ? 191  THR K CG2 1 
ATOM   10308 N N   . THR P  1 52  ? 0.462   90.576  62.618  1.00 74.02  ? 192  THR K N   1 
ATOM   10309 C CA  . THR P  1 52  ? 1.722   89.866  62.480  1.00 73.72  ? 192  THR K CA  1 
ATOM   10310 C C   . THR P  1 52  ? 1.666   88.411  62.904  1.00 72.38  ? 192  THR K C   1 
ATOM   10311 O O   . THR P  1 52  ? 2.025   87.512  62.128  1.00 69.75  ? 192  THR K O   1 
ATOM   10312 C CB  . THR P  1 52  ? 2.829   90.552  63.290  1.00 75.80  ? 192  THR K CB  1 
ATOM   10313 O OG1 . THR P  1 52  ? 2.838   91.957  63.003  1.00 68.79  ? 192  THR K OG1 1 
ATOM   10314 C CG2 . THR P  1 52  ? 4.182   89.947  62.928  1.00 73.33  ? 192  THR K CG2 1 
ATOM   10315 N N   . PHE P  1 53  ? 1.227   88.170  64.135  1.00 68.38  ? 193  PHE K N   1 
ATOM   10316 C CA  . PHE P  1 53  ? 1.180   86.798  64.603  1.00 76.31  ? 193  PHE K CA  1 
ATOM   10317 C C   . PHE P  1 53  ? 0.050   85.993  63.992  1.00 80.33  ? 193  PHE K C   1 
ATOM   10318 O O   . PHE P  1 53  ? 0.122   84.759  63.920  1.00 77.55  ? 193  PHE K O   1 
ATOM   10319 C CB  . PHE P  1 53  ? 1.144   86.765  66.123  1.00 75.90  ? 193  PHE K CB  1 
ATOM   10320 C CG  . PHE P  1 53  ? 2.475   87.058  66.737  1.00 73.77  ? 193  PHE K CG  1 
ATOM   10321 C CD1 . PHE P  1 53  ? 3.520   86.139  66.610  1.00 69.07  ? 193  PHE K CD1 1 
ATOM   10322 C CD2 . PHE P  1 53  ? 2.714   88.273  67.373  1.00 70.51  ? 193  PHE K CD2 1 
ATOM   10323 C CE1 . PHE P  1 53  ? 4.781   86.425  67.101  1.00 69.81  ? 193  PHE K CE1 1 
ATOM   10324 C CE2 . PHE P  1 53  ? 3.969   88.572  67.868  1.00 70.26  ? 193  PHE K CE2 1 
ATOM   10325 C CZ  . PHE P  1 53  ? 5.012   87.642  67.731  1.00 74.57  ? 193  PHE K CZ  1 
ATOM   10326 N N   . GLU P  1 54  ? -0.984  86.697  63.537  1.00 82.41  ? 194  GLU K N   1 
ATOM   10327 C CA  . GLU P  1 54  ? -2.095  86.038  62.881  1.00 81.23  ? 194  GLU K CA  1 
ATOM   10328 C C   . GLU P  1 54  ? -1.471  85.474  61.594  1.00 81.59  ? 194  GLU K C   1 
ATOM   10329 O O   . GLU P  1 54  ? -1.619  84.284  61.287  1.00 83.33  ? 194  GLU K O   1 
ATOM   10330 C CB  . GLU P  1 54  ? -3.197  87.049  62.562  1.00 81.00  ? 194  GLU K CB  1 
ATOM   10331 C CG  . GLU P  1 54  ? -4.608  86.478  62.651  1.00 88.19  ? 194  GLU K CG  1 
ATOM   10332 C CD  . GLU P  1 54  ? -5.690  87.554  62.551  1.00 96.42  ? 194  GLU K CD  1 
ATOM   10333 O OE1 . GLU P  1 54  ? -5.730  88.255  61.510  1.00 100.00 ? 194  GLU K OE1 1 
ATOM   10334 O OE2 . GLU P  1 54  ? -6.499  87.699  63.508  1.00 90.70  ? 194  GLU K OE2 1 
ATOM   10335 N N   . GLU P  1 55  ? -0.740  86.321  60.866  1.00 78.28  ? 195  GLU K N   1 
ATOM   10336 C CA  . GLU P  1 55  ? -0.077  85.899  59.630  1.00 80.34  ? 195  GLU K CA  1 
ATOM   10337 C C   . GLU P  1 55  ? 0.896   84.736  59.879  1.00 79.44  ? 195  GLU K C   1 
ATOM   10338 O O   . GLU P  1 55  ? 1.217   83.973  58.970  1.00 80.61  ? 195  GLU K O   1 
ATOM   10339 C CB  . GLU P  1 55  ? 0.701   87.063  59.005  1.00 82.00  ? 195  GLU K CB  1 
ATOM   10340 C CG  . GLU P  1 55  ? -0.119  88.304  58.679  1.00 86.75  ? 195  GLU K CG  1 
ATOM   10341 C CD  . GLU P  1 55  ? 0.734   89.422  58.091  1.00 94.62  ? 195  GLU K CD  1 
ATOM   10342 O OE1 . GLU P  1 55  ? 1.872   89.133  57.642  1.00 100.00 ? 195  GLU K OE1 1 
ATOM   10343 O OE2 . GLU P  1 55  ? 0.267   90.587  58.073  1.00 88.50  ? 195  GLU K OE2 1 
ATOM   10344 N N   . LEU P  1 56  ? 1.376   84.611  61.110  1.00 77.41  ? 196  LEU K N   1 
ATOM   10345 C CA  . LEU P  1 56  ? 2.304   83.542  61.445  1.00 77.35  ? 196  LEU K CA  1 
ATOM   10346 C C   . LEU P  1 56  ? 1.576   82.299  61.916  1.00 76.98  ? 196  LEU K C   1 
ATOM   10347 O O   . LEU P  1 56  ? 2.201   81.329  62.376  1.00 72.36  ? 196  LEU K O   1 
ATOM   10348 C CB  . LEU P  1 56  ? 3.277   84.015  62.516  1.00 81.30  ? 196  LEU K CB  1 
ATOM   10349 C CG  . LEU P  1 56  ? 4.295   85.024  62.000  1.00 73.78  ? 196  LEU K CG  1 
ATOM   10350 C CD1 . LEU P  1 56  ? 5.221   85.391  63.135  1.00 73.51  ? 196  LEU K CD1 1 
ATOM   10351 C CD2 . LEU P  1 56  ? 5.081   84.414  60.843  1.00 72.80  ? 196  LEU K CD2 1 
ATOM   10352 N N   . HIS P  1 57  ? 0.248   82.353  61.787  1.00 76.31  ? 197  HIS K N   1 
ATOM   10353 C CA  . HIS P  1 57  ? -0.650  81.259  62.148  1.00 77.82  ? 197  HIS K CA  1 
ATOM   10354 C C   . HIS P  1 57  ? -0.846  81.043  63.642  1.00 74.49  ? 197  HIS K C   1 
ATOM   10355 O O   . HIS P  1 57  ? -0.887  79.909  64.110  1.00 73.10  ? 197  HIS K O   1 
ATOM   10356 C CB  . HIS P  1 57  ? -0.179  79.947  61.497  1.00 87.34  ? 197  HIS K CB  1 
ATOM   10357 C CG  . HIS P  1 57  ? 0.026   80.047  60.013  1.00 96.71  ? 197  HIS K CG  1 
ATOM   10358 N ND1 . HIS P  1 57  ? -0.884  80.655  59.172  1.00 95.62  ? 197  HIS K ND1 1 
ATOM   10359 C CD2 . HIS P  1 57  ? 1.046   79.629  59.225  1.00 99.50  ? 197  HIS K CD2 1 
ATOM   10360 C CE1 . HIS P  1 57  ? -0.431  80.608  57.931  1.00 96.75  ? 197  HIS K CE1 1 
ATOM   10361 N NE2 . HIS P  1 57  ? 0.737   79.992  57.936  1.00 99.04  ? 197  HIS K NE2 1 
ATOM   10362 N N   . PHE P  1 58  ? -0.969  82.132  64.390  1.00 74.77  ? 198  PHE K N   1 
ATOM   10363 C CA  . PHE P  1 58  ? -1.185  82.060  65.836  1.00 74.19  ? 198  PHE K CA  1 
ATOM   10364 C C   . PHE P  1 58  ? -2.607  82.514  66.147  1.00 75.43  ? 198  PHE K C   1 
ATOM   10365 O O   . PHE P  1 58  ? -3.156  83.384  65.462  1.00 76.84  ? 198  PHE K O   1 
ATOM   10366 C CB  . PHE P  1 58  ? -0.203  82.976  66.585  1.00 74.71  ? 198  PHE K CB  1 
ATOM   10367 C CG  . PHE P  1 58  ? 1.114   82.330  66.893  1.00 73.10  ? 198  PHE K CG  1 
ATOM   10368 C CD1 . PHE P  1 58  ? 2.063   82.139  65.895  1.00 68.57  ? 198  PHE K CD1 1 
ATOM   10369 C CD2 . PHE P  1 58  ? 1.381   81.853  68.177  1.00 74.00  ? 198  PHE K CD2 1 
ATOM   10370 C CE1 . PHE P  1 58  ? 3.263   81.472  66.169  1.00 71.90  ? 198  PHE K CE1 1 
ATOM   10371 C CE2 . PHE P  1 58  ? 2.578   81.182  68.464  1.00 73.90  ? 198  PHE K CE2 1 
ATOM   10372 C CZ  . PHE P  1 58  ? 3.520   80.990  67.457  1.00 71.31  ? 198  PHE K CZ  1 
ATOM   10373 N N   . GLU P  1 59  ? -3.208  81.942  67.183  1.00 72.38  ? 199  GLU K N   1 
ATOM   10374 C CA  . GLU P  1 59  ? -4.559  82.345  67.526  1.00 68.06  ? 199  GLU K CA  1 
ATOM   10375 C C   . GLU P  1 59  ? -4.490  83.451  68.546  1.00 62.09  ? 199  GLU K C   1 
ATOM   10376 O O   . GLU P  1 59  ? -4.260  83.211  69.735  1.00 61.36  ? 199  GLU K O   1 
ATOM   10377 C CB  . GLU P  1 59  ? -5.369  81.158  68.068  1.00 80.47  ? 199  GLU K CB  1 
ATOM   10378 C CG  . GLU P  1 59  ? -6.791  81.527  68.507  1.00 85.11  ? 199  GLU K CG  1 
ATOM   10379 C CD  . GLU P  1 59  ? -7.699  80.325  68.647  1.00 90.10  ? 199  GLU K CD  1 
ATOM   10380 O OE1 . GLU P  1 59  ? -7.461  79.313  67.949  1.00 90.10  ? 199  GLU K OE1 1 
ATOM   10381 O OE2 . GLU P  1 59  ? -8.661  80.401  69.447  1.00 97.58  ? 199  GLU K OE2 1 
ATOM   10382 N N   . ILE P  1 60  ? -4.699  84.668  68.066  1.00 58.12  ? 200  ILE K N   1 
ATOM   10383 C CA  . ILE P  1 60  ? -4.648  85.846  68.925  1.00 63.12  ? 200  ILE K CA  1 
ATOM   10384 C C   . ILE P  1 60  ? -5.740  85.833  69.982  1.00 59.29  ? 200  ILE K C   1 
ATOM   10385 O O   . ILE P  1 60  ? -6.837  85.373  69.730  1.00 67.22  ? 200  ILE K O   1 
ATOM   10386 C CB  . ILE P  1 60  ? -4.772  87.137  68.093  1.00 65.89  ? 200  ILE K CB  1 
ATOM   10387 C CG1 . ILE P  1 60  ? -3.952  86.998  66.800  1.00 69.43  ? 200  ILE K CG1 1 
ATOM   10388 C CG2 . ILE P  1 60  ? -4.291  88.333  68.903  1.00 64.52  ? 200  ILE K CG2 1 
ATOM   10389 C CD1 . ILE P  1 60  ? -2.554  86.424  66.985  1.00 67.29  ? 200  ILE K CD1 1 
ATOM   10390 N N   . LYS P  1 61  ? -5.432  86.340  71.167  1.00 60.61  ? 201  LYS K N   1 
ATOM   10391 C CA  . LYS P  1 61  ? -6.393  86.368  72.270  1.00 63.43  ? 201  LYS K CA  1 
ATOM   10392 C C   . LYS P  1 61  ? -6.234  87.666  73.062  1.00 64.32  ? 201  LYS K C   1 
ATOM   10393 O O   . LYS P  1 61  ? -5.623  87.700  74.139  1.00 61.22  ? 201  LYS K O   1 
ATOM   10394 C CB  . LYS P  1 61  ? -6.177  85.165  73.195  1.00 65.80  ? 201  LYS K CB  1 
ATOM   10395 C CG  . LYS P  1 61  ? -6.631  83.835  72.614  1.00 71.11  ? 201  LYS K CG  1 
ATOM   10396 C CD  . LYS P  1 61  ? -8.153  83.726  72.654  1.00 73.03  ? 201  LYS K CD  1 
ATOM   10397 C CE  . LYS P  1 61  ? -8.650  82.490  71.911  1.00 78.46  ? 201  LYS K CE  1 
ATOM   10398 N NZ  . LYS P  1 61  ? -10.131 82.356  72.013  1.00 76.81  ? 201  LYS K NZ  1 
ATOM   10399 N N   . PRO P  1 62  ? -6.792  88.759  72.529  1.00 63.54  ? 202  PRO K N   1 
ATOM   10400 C CA  . PRO P  1 62  ? -6.725  90.077  73.161  1.00 62.64  ? 202  PRO K CA  1 
ATOM   10401 C C   . PRO P  1 62  ? -7.454  90.153  74.482  1.00 61.76  ? 202  PRO K C   1 
ATOM   10402 O O   . PRO P  1 62  ? -8.317  89.334  74.766  1.00 58.43  ? 202  PRO K O   1 
ATOM   10403 C CB  . PRO P  1 62  ? -7.347  91.002  72.113  1.00 57.84  ? 202  PRO K CB  1 
ATOM   10404 C CG  . PRO P  1 62  ? -8.321  90.126  71.445  1.00 60.75  ? 202  PRO K CG  1 
ATOM   10405 C CD  . PRO P  1 62  ? -7.557  88.823  71.274  1.00 60.53  ? 202  PRO K CD  1 
ATOM   10406 N N   . HIS P  1 63  ? -7.077  91.155  75.271  1.00 66.01  ? 203  HIS K N   1 
ATOM   10407 C CA  . HIS P  1 63  ? -7.649  91.450  76.588  1.00 72.67  ? 203  HIS K CA  1 
ATOM   10408 C C   . HIS P  1 63  ? -7.311  92.912  76.798  1.00 76.62  ? 203  HIS K C   1 
ATOM   10409 O O   . HIS P  1 63  ? -6.176  93.318  76.561  1.00 83.04  ? 203  HIS K O   1 
ATOM   10410 C CB  . HIS P  1 63  ? -6.990  90.606  77.675  1.00 71.73  ? 203  HIS K CB  1 
ATOM   10411 C CG  . HIS P  1 63  ? -7.373  89.159  77.620  1.00 79.11  ? 203  HIS K CG  1 
ATOM   10412 N ND1 . HIS P  1 63  ? -8.494  88.664  78.251  1.00 73.55  ? 203  HIS K ND1 1 
ATOM   10413 C CD2 . HIS P  1 63  ? -6.818  88.111  76.959  1.00 79.10  ? 203  HIS K CD2 1 
ATOM   10414 C CE1 . HIS P  1 63  ? -8.615  87.375  77.981  1.00 77.33  ? 203  HIS K CE1 1 
ATOM   10415 N NE2 . HIS P  1 63  ? -7.612  87.014  77.199  1.00 80.90  ? 203  HIS K NE2 1 
ATOM   10416 N N   . HIS P  1 64  ? -8.278  93.709  77.234  1.00 76.45  ? 204  HIS K N   1 
ATOM   10417 C CA  . HIS P  1 64  ? -8.022  95.129  77.404  1.00 74.08  ? 204  HIS K CA  1 
ATOM   10418 C C   . HIS P  1 64  ? -8.176  95.664  78.811  1.00 75.88  ? 204  HIS K C   1 
ATOM   10419 O O   . HIS P  1 64  ? -8.993  95.181  79.600  1.00 76.66  ? 204  HIS K O   1 
ATOM   10420 C CB  . HIS P  1 64  ? -8.916  95.909  76.446  1.00 72.31  ? 204  HIS K CB  1 
ATOM   10421 C CG  . HIS P  1 64  ? -8.704  95.542  75.012  1.00 78.61  ? 204  HIS K CG  1 
ATOM   10422 N ND1 . HIS P  1 64  ? -7.694  96.086  74.246  1.00 85.59  ? 204  HIS K ND1 1 
ATOM   10423 C CD2 . HIS P  1 64  ? -9.333  94.642  74.220  1.00 77.29  ? 204  HIS K CD2 1 
ATOM   10424 C CE1 . HIS P  1 64  ? -7.711  95.538  73.043  1.00 83.10  ? 204  HIS K CE1 1 
ATOM   10425 N NE2 . HIS P  1 64  ? -8.695  94.658  73.002  1.00 83.70  ? 204  HIS K NE2 1 
ATOM   10426 N N   . ASP P  1 65  ? -7.362  96.670  79.109  1.00 77.90  ? 205  ASP K N   1 
ATOM   10427 C CA  . ASP P  1 65  ? -7.374  97.338  80.401  1.00 83.12  ? 205  ASP K CA  1 
ATOM   10428 C C   . ASP P  1 65  ? -7.541  96.374  81.581  1.00 84.08  ? 205  ASP K C   1 
ATOM   10429 O O   . ASP P  1 65  ? -8.373  96.582  82.474  1.00 87.38  ? 205  ASP K O   1 
ATOM   10430 C CB  . ASP P  1 65  ? -8.483  98.390  80.396  1.00 83.73  ? 205  ASP K CB  1 
ATOM   10431 C CG  . ASP P  1 65  ? -8.277  99.437  79.313  1.00 92.35  ? 205  ASP K CG  1 
ATOM   10432 O OD1 . ASP P  1 65  ? -7.348  100.265 79.458  1.00 93.03  ? 205  ASP K OD1 1 
ATOM   10433 O OD2 . ASP P  1 65  ? -9.034  99.428  78.312  1.00 99.83  ? 205  ASP K OD2 1 
ATOM   10434 N N   . CYS P  1 66  ? -6.733  95.322  81.585  1.00 77.32  ? 206  CYS K N   1 
ATOM   10435 C CA  . CYS P  1 66  ? -6.796  94.337  82.648  1.00 74.58  ? 206  CYS K CA  1 
ATOM   10436 C C   . CYS P  1 66  ? -6.090  94.866  83.892  1.00 71.96  ? 206  CYS K C   1 
ATOM   10437 O O   . CYS P  1 66  ? -5.125  95.623  83.790  1.00 70.40  ? 206  CYS K O   1 
ATOM   10438 C CB  . CYS P  1 66  ? -6.120  93.042  82.187  1.00 75.07  ? 206  CYS K CB  1 
ATOM   10439 S SG  . CYS P  1 66  ? -6.599  92.477  80.503  1.00 90.64  ? 206  CYS K SG  1 
ATOM   10440 N N   . THR P  1 67  ? -6.581  94.486  85.065  1.00 69.83  ? 207  THR K N   1 
ATOM   10441 C CA  . THR P  1 67  ? -5.933  94.887  86.307  1.00 70.87  ? 207  THR K CA  1 
ATOM   10442 C C   . THR P  1 67  ? -4.986  93.746  86.649  1.00 71.90  ? 207  THR K C   1 
ATOM   10443 O O   . THR P  1 67  ? -5.002  92.705  85.987  1.00 65.14  ? 207  THR K O   1 
ATOM   10444 C CB  . THR P  1 67  ? -6.925  95.032  87.469  1.00 74.87  ? 207  THR K CB  1 
ATOM   10445 O OG1 . THR P  1 67  ? -7.456  93.741  87.832  1.00 72.03  ? 207  THR K OG1 1 
ATOM   10446 C CG2 . THR P  1 67  ? -8.037  95.986  87.071  1.00 76.87  ? 207  THR K CG2 1 
ATOM   10447 N N   . VAL P  1 68  ? -4.159  93.932  87.675  1.00 74.81  ? 208  VAL K N   1 
ATOM   10448 C CA  . VAL P  1 68  ? -3.227  92.878  88.070  1.00 72.17  ? 208  VAL K CA  1 
ATOM   10449 C C   . VAL P  1 68  ? -4.044  91.621  88.300  1.00 74.05  ? 208  VAL K C   1 
ATOM   10450 O O   . VAL P  1 68  ? -3.732  90.547  87.775  1.00 72.56  ? 208  VAL K O   1 
ATOM   10451 C CB  . VAL P  1 68  ? -2.474  93.232  89.369  1.00 64.48  ? 208  VAL K CB  1 
ATOM   10452 C CG1 . VAL P  1 68  ? -1.782  92.007  89.918  1.00 61.55  ? 208  VAL K CG1 1 
ATOM   10453 C CG2 . VAL P  1 68  ? -1.458  94.311  89.090  1.00 63.02  ? 208  VAL K CG2 1 
ATOM   10454 N N   . GLU P  1 69  ? -5.105  91.788  89.080  1.00 75.73  ? 209  GLU K N   1 
ATOM   10455 C CA  . GLU P  1 69  ? -6.015  90.705  89.413  1.00 79.59  ? 209  GLU K CA  1 
ATOM   10456 C C   . GLU P  1 69  ? -6.392  89.954  88.144  1.00 73.08  ? 209  GLU K C   1 
ATOM   10457 O O   . GLU P  1 69  ? -6.187  88.749  88.008  1.00 68.84  ? 209  GLU K O   1 
ATOM   10458 C CB  . GLU P  1 69  ? -7.281  91.289  90.052  1.00 88.72  ? 209  GLU K CB  1 
ATOM   10459 C CG  . GLU P  1 69  ? -8.215  90.251  90.667  1.00 95.17  ? 209  GLU K CG  1 
ATOM   10460 C CD  . GLU P  1 69  ? -7.587  89.532  91.860  1.00 100.00 ? 209  GLU K CD  1 
ATOM   10461 O OE1 . GLU P  1 69  ? -6.484  88.946  91.702  1.00 97.96  ? 209  GLU K OE1 1 
ATOM   10462 O OE2 . GLU P  1 69  ? -8.200  89.553  92.956  1.00 100.00 ? 209  GLU K OE2 1 
ATOM   10463 N N   . GLN P  1 70  ? -6.944  90.702  87.209  1.00 68.47  ? 210  GLN K N   1 
ATOM   10464 C CA  . GLN P  1 70  ? -7.378  90.147  85.949  1.00 71.90  ? 210  GLN K CA  1 
ATOM   10465 C C   . GLN P  1 70  ? -6.268  89.455  85.143  1.00 69.95  ? 210  GLN K C   1 
ATOM   10466 O O   . GLN P  1 70  ? -6.493  88.410  84.507  1.00 62.75  ? 210  GLN K O   1 
ATOM   10467 C CB  . GLN P  1 70  ? -8.018  91.271  85.131  1.00 74.86  ? 210  GLN K CB  1 
ATOM   10468 C CG  . GLN P  1 70  ? -9.130  91.978  85.886  1.00 77.36  ? 210  GLN K CG  1 
ATOM   10469 C CD  . GLN P  1 70  ? -9.749  93.095  85.080  1.00 86.82  ? 210  GLN K CD  1 
ATOM   10470 O OE1 . GLN P  1 70  ? -10.209 92.886  83.949  1.00 92.03  ? 210  GLN K OE1 1 
ATOM   10471 N NE2 . GLN P  1 70  ? -9.767  94.293  85.651  1.00 86.07  ? 210  GLN K NE2 1 
ATOM   10472 N N   . ILE P  1 71  ? -5.077  90.047  85.162  1.00 70.71  ? 211  ILE K N   1 
ATOM   10473 C CA  . ILE P  1 71  ? -3.950  89.492  84.424  1.00 68.70  ? 211  ILE K CA  1 
ATOM   10474 C C   . ILE P  1 71  ? -3.636  88.114  84.971  1.00 66.54  ? 211  ILE K C   1 
ATOM   10475 O O   . ILE P  1 71  ? -3.623  87.132  84.226  1.00 65.86  ? 211  ILE K O   1 
ATOM   10476 C CB  . ILE P  1 71  ? -2.709  90.414  84.521  1.00 67.50  ? 211  ILE K CB  1 
ATOM   10477 C CG1 . ILE P  1 71  ? -2.952  91.667  83.676  1.00 74.07  ? 211  ILE K CG1 1 
ATOM   10478 C CG2 . ILE P  1 71  ? -1.464  89.699  84.018  1.00 62.65  ? 211  ILE K CG2 1 
ATOM   10479 C CD1 . ILE P  1 71  ? -1.903  92.731  83.838  1.00 75.67  ? 211  ILE K CD1 1 
ATOM   10480 N N   . TYR P  1 72  ? -3.396  88.036  86.271  1.00 61.15  ? 212  TYR K N   1 
ATOM   10481 C CA  . TYR P  1 72  ? -3.107  86.756  86.878  1.00 65.78  ? 212  TYR K CA  1 
ATOM   10482 C C   . TYR P  1 72  ? -4.166  85.734  86.479  1.00 69.72  ? 212  TYR K C   1 
ATOM   10483 O O   . TYR P  1 72  ? -3.842  84.605  86.091  1.00 72.85  ? 212  TYR K O   1 
ATOM   10484 C CB  . TYR P  1 72  ? -3.055  86.912  88.388  1.00 66.90  ? 212  TYR K CB  1 
ATOM   10485 C CG  . TYR P  1 72  ? -1.760  87.503  88.870  1.00 76.02  ? 212  TYR K CG  1 
ATOM   10486 C CD1 . TYR P  1 72  ? -0.539  87.029  88.394  1.00 77.78  ? 212  TYR K CD1 1 
ATOM   10487 C CD2 . TYR P  1 72  ? -1.746  88.496  89.845  1.00 81.14  ? 212  TYR K CD2 1 
ATOM   10488 C CE1 . TYR P  1 72  ? 0.661   87.523  88.880  1.00 81.71  ? 212  TYR K CE1 1 
ATOM   10489 C CE2 . TYR P  1 72  ? -0.550  88.999  90.338  1.00 81.31  ? 212  TYR K CE2 1 
ATOM   10490 C CZ  . TYR P  1 72  ? 0.648   88.505  89.853  1.00 84.90  ? 212  TYR K CZ  1 
ATOM   10491 O OH  . TYR P  1 72  ? 1.838   88.978  90.356  1.00 95.94  ? 212  TYR K OH  1 
ATOM   10492 N N   . GLU P  1 73  ? -5.431  86.142  86.566  1.00 74.30  ? 213  GLU K N   1 
ATOM   10493 C CA  . GLU P  1 73  ? -6.562  85.284  86.204  1.00 70.42  ? 213  GLU K CA  1 
ATOM   10494 C C   . GLU P  1 73  ? -6.399  84.737  84.796  1.00 62.31  ? 213  GLU K C   1 
ATOM   10495 O O   . GLU P  1 73  ? -6.471  83.529  84.575  1.00 55.89  ? 213  GLU K O   1 
ATOM   10496 C CB  . GLU P  1 73  ? -7.872  86.071  86.271  1.00 80.40  ? 213  GLU K CB  1 
ATOM   10497 C CG  . GLU P  1 73  ? -8.535  86.131  87.650  1.00 92.18  ? 213  GLU K CG  1 
ATOM   10498 C CD  . GLU P  1 73  ? -9.790  87.010  87.645  1.00 100.00 ? 213  GLU K CD  1 
ATOM   10499 O OE1 . GLU P  1 73  ? -10.544 86.976  86.637  1.00 100.00 ? 213  GLU K OE1 1 
ATOM   10500 O OE2 . GLU P  1 73  ? -10.021 87.727  88.649  1.00 100.00 ? 213  GLU K OE2 1 
ATOM   10501 N N   . ILE P  1 74  ? -6.181  85.643  83.848  1.00 57.40  ? 214  ILE K N   1 
ATOM   10502 C CA  . ILE P  1 74  ? -6.006  85.260  82.453  1.00 56.61  ? 214  ILE K CA  1 
ATOM   10503 C C   . ILE P  1 74  ? -4.863  84.277  82.243  1.00 58.01  ? 214  ILE K C   1 
ATOM   10504 O O   . ILE P  1 74  ? -4.989  83.314  81.486  1.00 59.55  ? 214  ILE K O   1 
ATOM   10505 C CB  . ILE P  1 74  ? -5.771  86.484  81.576  1.00 51.75  ? 214  ILE K CB  1 
ATOM   10506 C CG1 . ILE P  1 74  ? -6.927  87.466  81.788  1.00 46.35  ? 214  ILE K CG1 1 
ATOM   10507 C CG2 . ILE P  1 74  ? -5.637  86.061  80.123  1.00 37.89  ? 214  ILE K CG2 1 
ATOM   10508 C CD1 . ILE P  1 74  ? -6.840  88.706  80.953  1.00 49.82  ? 214  ILE K CD1 1 
ATOM   10509 N N   . LEU P  1 75  ? -3.747  84.511  82.915  1.00 59.77  ? 215  LEU K N   1 
ATOM   10510 C CA  . LEU P  1 75  ? -2.611  83.616  82.780  1.00 57.85  ? 215  LEU K CA  1 
ATOM   10511 C C   . LEU P  1 75  ? -2.938  82.277  83.415  1.00 55.49  ? 215  LEU K C   1 
ATOM   10512 O O   . LEU P  1 75  ? -2.556  81.231  82.892  1.00 58.12  ? 215  LEU K O   1 
ATOM   10513 C CB  . LEU P  1 75  ? -1.364  84.240  83.417  1.00 62.90  ? 215  LEU K CB  1 
ATOM   10514 C CG  . LEU P  1 75  ? -0.897  85.535  82.720  1.00 61.75  ? 215  LEU K CG  1 
ATOM   10515 C CD1 . LEU P  1 75  ? 0.285   86.120  83.482  1.00 62.16  ? 215  LEU K CD1 1 
ATOM   10516 C CD2 . LEU P  1 75  ? -0.525  85.252  81.258  1.00 53.98  ? 215  LEU K CD2 1 
ATOM   10517 N N   . LYS P  1 76  ? -3.667  82.305  84.524  1.00 53.10  ? 216  LYS K N   1 
ATOM   10518 C CA  . LYS P  1 76  ? -4.044  81.070  85.202  1.00 56.13  ? 216  LYS K CA  1 
ATOM   10519 C C   . LYS P  1 76  ? -4.781  80.161  84.225  1.00 56.98  ? 216  LYS K C   1 
ATOM   10520 O O   . LYS P  1 76  ? -4.543  78.953  84.162  1.00 58.97  ? 216  LYS K O   1 
ATOM   10521 C CB  . LYS P  1 76  ? -4.952  81.363  86.394  1.00 58.94  ? 216  LYS K CB  1 
ATOM   10522 C CG  . LYS P  1 76  ? -5.229  80.150  87.293  1.00 51.75  ? 216  LYS K CG  1 
ATOM   10523 C CD  . LYS P  1 76  ? -3.925  79.602  87.834  1.00 62.22  ? 216  LYS K CD  1 
ATOM   10524 C CE  . LYS P  1 76  ? -4.125  78.440  88.808  1.00 68.82  ? 216  LYS K CE  1 
ATOM   10525 N NZ  . LYS P  1 76  ? -2.795  77.880  89.258  1.00 69.28  ? 216  LYS K NZ  1 
ATOM   10526 N N   . ILE P  1 77  ? -5.688  80.751  83.464  1.00 54.61  ? 217  ILE K N   1 
ATOM   10527 C CA  . ILE P  1 77  ? -6.443  79.985  82.484  1.00 56.78  ? 217  ILE K CA  1 
ATOM   10528 C C   . ILE P  1 77  ? -5.501  79.284  81.494  1.00 56.43  ? 217  ILE K C   1 
ATOM   10529 O O   . ILE P  1 77  ? -5.521  78.060  81.347  1.00 49.73  ? 217  ILE K O   1 
ATOM   10530 C CB  . ILE P  1 77  ? -7.383  80.914  81.686  1.00 59.82  ? 217  ILE K CB  1 
ATOM   10531 C CG1 . ILE P  1 77  ? -8.493  81.423  82.600  1.00 56.41  ? 217  ILE K CG1 1 
ATOM   10532 C CG2 . ILE P  1 77  ? -7.934  80.193  80.450  1.00 47.10  ? 217  ILE K CG2 1 
ATOM   10533 C CD1 . ILE P  1 77  ? -9.355  82.464  81.931  1.00 63.62  ? 217  ILE K CD1 1 
ATOM   10534 N N   . TYR P  1 78  ? -4.667  80.065  80.817  1.00 51.98  ? 218  TYR K N   1 
ATOM   10535 C CA  . TYR P  1 78  ? -3.788  79.464  79.847  1.00 48.40  ? 218  TYR K CA  1 
ATOM   10536 C C   . TYR P  1 78  ? -2.774  78.574  80.505  1.00 47.45  ? 218  TYR K C   1 
ATOM   10537 O O   . TYR P  1 78  ? -2.272  77.619  79.902  1.00 52.36  ? 218  TYR K O   1 
ATOM   10538 C CB  . TYR P  1 78  ? -3.146  80.540  78.989  1.00 47.15  ? 218  TYR K CB  1 
ATOM   10539 C CG  . TYR P  1 78  ? -4.169  81.202  78.093  1.00 50.05  ? 218  TYR K CG  1 
ATOM   10540 C CD1 . TYR P  1 78  ? -4.932  82.285  78.547  1.00 48.92  ? 218  TYR K CD1 1 
ATOM   10541 C CD2 . TYR P  1 78  ? -4.439  80.690  76.821  1.00 50.73  ? 218  TYR K CD2 1 
ATOM   10542 C CE1 . TYR P  1 78  ? -5.945  82.843  77.761  1.00 50.76  ? 218  TYR K CE1 1 
ATOM   10543 C CE2 . TYR P  1 78  ? -5.452  81.239  76.021  1.00 53.75  ? 218  TYR K CE2 1 
ATOM   10544 C CZ  . TYR P  1 78  ? -6.199  82.316  76.502  1.00 55.99  ? 218  TYR K CZ  1 
ATOM   10545 O OH  . TYR P  1 78  ? -7.196  82.868  75.729  1.00 62.54  ? 218  TYR K OH  1 
ATOM   10546 N N   . GLN P  1 79  ? -2.482  78.854  81.760  1.00 45.48  ? 219  GLN K N   1 
ATOM   10547 C CA  . GLN P  1 79  ? -1.527  78.015  82.455  1.00 53.38  ? 219  GLN K CA  1 
ATOM   10548 C C   . GLN P  1 79  ? -2.113  76.627  82.570  1.00 53.65  ? 219  GLN K C   1 
ATOM   10549 O O   . GLN P  1 79  ? -1.401  75.628  82.473  1.00 56.25  ? 219  GLN K O   1 
ATOM   10550 C CB  . GLN P  1 79  ? -1.263  78.527  83.861  1.00 55.19  ? 219  GLN K CB  1 
ATOM   10551 C CG  . GLN P  1 79  ? -0.421  77.556  84.660  1.00 59.65  ? 219  GLN K CG  1 
ATOM   10552 C CD  . GLN P  1 79  ? -0.854  77.466  86.099  1.00 69.19  ? 219  GLN K CD  1 
ATOM   10553 O OE1 . GLN P  1 79  ? -1.112  78.482  86.757  1.00 73.38  ? 219  GLN K OE1 1 
ATOM   10554 N NE2 . GLN P  1 79  ? -0.927  76.245  86.609  1.00 66.67  ? 219  GLN K NE2 1 
ATOM   10555 N N   . LEU P  1 80  ? -3.426  76.586  82.783  1.00 54.81  ? 220  LEU K N   1 
ATOM   10556 C CA  . LEU P  1 80  ? -4.145  75.336  82.971  1.00 57.97  ? 220  LEU K CA  1 
ATOM   10557 C C   . LEU P  1 80  ? -4.703  74.704  81.716  1.00 61.23  ? 220  LEU K C   1 
ATOM   10558 O O   . LEU P  1 80  ? -5.255  73.608  81.768  1.00 68.10  ? 220  LEU K O   1 
ATOM   10559 C CB  . LEU P  1 80  ? -5.281  75.534  83.969  1.00 58.21  ? 220  LEU K CB  1 
ATOM   10560 C CG  . LEU P  1 80  ? -4.810  75.910  85.371  1.00 58.13  ? 220  LEU K CG  1 
ATOM   10561 C CD1 . LEU P  1 80  ? -6.020  76.201  86.245  1.00 58.76  ? 220  LEU K CD1 1 
ATOM   10562 C CD2 . LEU P  1 80  ? -3.971  74.786  85.962  1.00 49.90  ? 220  LEU K CD2 1 
ATOM   10563 N N   . MET P  1 81  ? -4.588  75.382  80.588  1.00 56.01  ? 221  MET K N   1 
ATOM   10564 C CA  . MET P  1 81  ? -5.080  74.789  79.373  1.00 53.12  ? 221  MET K CA  1 
ATOM   10565 C C   . MET P  1 81  ? -4.196  73.631  78.941  1.00 57.74  ? 221  MET K C   1 
ATOM   10566 O O   . MET P  1 81  ? -3.132  73.395  79.508  1.00 61.91  ? 221  MET K O   1 
ATOM   10567 C CB  . MET P  1 81  ? -5.117  75.818  78.286  1.00 50.37  ? 221  MET K CB  1 
ATOM   10568 C CG  . MET P  1 81  ? -6.295  76.725  78.387  1.00 65.68  ? 221  MET K CG  1 
ATOM   10569 S SD  . MET P  1 81  ? -6.622  77.309  76.724  1.00 83.81  ? 221  MET K SD  1 
ATOM   10570 C CE  . MET P  1 81  ? -6.403  75.710  75.789  1.00 79.01  ? 221  MET K CE  1 
ATOM   10571 N N   . ASP P  1 82  ? -4.647  72.884  77.946  1.00 62.06  ? 222  ASP K N   1 
ATOM   10572 C CA  . ASP P  1 82  ? -3.856  71.769  77.446  1.00 65.68  ? 222  ASP K CA  1 
ATOM   10573 C C   . ASP P  1 82  ? -3.331  72.204  76.091  1.00 70.05  ? 222  ASP K C   1 
ATOM   10574 O O   . ASP P  1 82  ? -4.100  72.331  75.125  1.00 72.39  ? 222  ASP K O   1 
ATOM   10575 C CB  . ASP P  1 82  ? -4.703  70.493  77.315  1.00 65.21  ? 222  ASP K CB  1 
ATOM   10576 C CG  . ASP P  1 82  ? -3.922  69.332  76.698  1.00 68.90  ? 222  ASP K CG  1 
ATOM   10577 O OD1 . ASP P  1 82  ? -2.962  69.603  75.954  1.00 68.74  ? 222  ASP K OD1 1 
ATOM   10578 O OD2 . ASP P  1 82  ? -4.262  68.152  76.938  1.00 69.63  ? 222  ASP K OD2 1 
ATOM   10579 N N   . HIS P  1 83  ? -2.022  72.442  76.035  1.00 68.20  ? 224  HIS K N   1 
ATOM   10580 C CA  . HIS P  1 83  ? -1.371  72.896  74.811  1.00 70.11  ? 224  HIS K CA  1 
ATOM   10581 C C   . HIS P  1 83  ? -0.793  71.744  73.997  1.00 71.03  ? 224  HIS K C   1 
ATOM   10582 O O   . HIS P  1 83  ? -0.021  71.974  73.070  1.00 73.41  ? 224  HIS K O   1 
ATOM   10583 C CB  . HIS P  1 83  ? -0.244  73.876  75.163  1.00 63.09  ? 224  HIS K CB  1 
ATOM   10584 C CG  . HIS P  1 83  ? -0.707  75.090  75.911  1.00 59.50  ? 224  HIS K CG  1 
ATOM   10585 N ND1 . HIS P  1 83  ? -0.977  76.295  75.289  1.00 56.55  ? 224  HIS K ND1 1 
ATOM   10586 C CD2 . HIS P  1 83  ? -0.977  75.273  77.228  1.00 49.37  ? 224  HIS K CD2 1 
ATOM   10587 C CE1 . HIS P  1 83  ? -1.394  77.165  76.193  1.00 53.80  ? 224  HIS K CE1 1 
ATOM   10588 N NE2 . HIS P  1 83  ? -1.402  76.570  77.376  1.00 48.90  ? 224  HIS K NE2 1 
ATOM   10589 N N   . SER P  1 84  ? -1.182  70.514  74.321  1.00 68.50  ? 225  SER K N   1 
ATOM   10590 C CA  . SER P  1 84  ? -0.643  69.339  73.633  1.00 63.52  ? 225  SER K CA  1 
ATOM   10591 C C   . SER P  1 84  ? -0.595  69.385  72.120  1.00 60.68  ? 225  SER K C   1 
ATOM   10592 O O   . SER P  1 84  ? 0.322   68.825  71.518  1.00 65.41  ? 225  SER K O   1 
ATOM   10593 C CB  . SER P  1 84  ? -1.383  68.080  74.068  1.00 62.02  ? 225  SER K CB  1 
ATOM   10594 O OG  . SER P  1 84  ? -1.157  67.806  75.444  1.00 72.17  ? 225  SER K OG  1 
ATOM   10595 N N   . ASN P  1 85  ? -1.561  70.046  71.498  1.00 60.68  ? 226  ASN K N   1 
ATOM   10596 C CA  . ASN P  1 85  ? -1.584  70.120  70.038  1.00 62.49  ? 226  ASN K CA  1 
ATOM   10597 C C   . ASN P  1 85  ? -1.076  71.453  69.557  1.00 62.38  ? 226  ASN K C   1 
ATOM   10598 O O   . ASN P  1 85  ? -1.367  71.880  68.439  1.00 65.05  ? 226  ASN K O   1 
ATOM   10599 C CB  . ASN P  1 85  ? -2.999  69.906  69.509  1.00 67.98  ? 226  ASN K CB  1 
ATOM   10600 C CG  . ASN P  1 85  ? -3.483  68.485  69.690  1.00 72.63  ? 226  ASN K CG  1 
ATOM   10601 O OD1 . ASN P  1 85  ? -4.659  68.200  69.468  1.00 78.70  ? 226  ASN K OD1 1 
ATOM   10602 N ND2 . ASN P  1 85  ? -2.579  67.578  70.086  1.00 75.64  ? 226  ASN K ND2 1 
ATOM   10603 N N   . MET P  1 86  ? -0.316  72.110  70.420  1.00 64.62  ? 227  MET K N   1 
ATOM   10604 C CA  . MET P  1 86  ? 0.253   73.409  70.114  1.00 63.05  ? 227  MET K CA  1 
ATOM   10605 C C   . MET P  1 86  ? 1.775   73.307  70.129  1.00 64.07  ? 227  MET K C   1 
ATOM   10606 O O   . MET P  1 86  ? 2.359   72.555  70.921  1.00 57.53  ? 227  MET K O   1 
ATOM   10607 C CB  . MET P  1 86  ? -0.241  74.414  71.142  1.00 69.85  ? 227  MET K CB  1 
ATOM   10608 C CG  . MET P  1 86  ? -1.755  74.411  71.288  1.00 68.44  ? 227  MET K CG  1 
ATOM   10609 S SD  . MET P  1 86  ? -2.578  75.029  69.782  1.00 84.30  ? 227  MET K SD  1 
ATOM   10610 C CE  . MET P  1 86  ? -3.584  76.380  70.491  1.00 54.02  ? 227  MET K CE  1 
ATOM   10611 N N   . ASP P  1 87  ? 2.421   74.057  69.240  1.00 68.88  ? 228  ASP K N   1 
ATOM   10612 C CA  . ASP P  1 87  ? 3.880   74.021  69.148  1.00 70.18  ? 228  ASP K CA  1 
ATOM   10613 C C   . ASP P  1 87  ? 4.582   75.163  69.871  1.00 68.17  ? 228  ASP K C   1 
ATOM   10614 O O   . ASP P  1 87  ? 5.778   75.079  70.161  1.00 65.73  ? 228  ASP K O   1 
ATOM   10615 C CB  . ASP P  1 87  ? 4.303   74.005  67.679  1.00 61.63  ? 228  ASP K CB  1 
ATOM   10616 C CG  . ASP P  1 87  ? 4.203   72.628  67.073  1.00 62.75  ? 228  ASP K CG  1 
ATOM   10617 O OD1 . ASP P  1 87  ? 4.359   71.633  67.833  1.00 52.04  ? 228  ASP K OD1 1 
ATOM   10618 O OD2 . ASP P  1 87  ? 3.997   72.546  65.844  1.00 60.13  ? 228  ASP K OD2 1 
ATOM   10619 N N   . CYS P  1 88  ? 3.825   76.211  70.183  1.00 61.10  ? 229  CYS K N   1 
ATOM   10620 C CA  . CYS P  1 88  ? 4.392   77.371  70.827  1.00 60.36  ? 229  CYS K CA  1 
ATOM   10621 C C   . CYS P  1 88  ? 3.335   78.153  71.586  1.00 54.42  ? 229  CYS K C   1 
ATOM   10622 O O   . CYS P  1 88  ? 2.160   77.987  71.342  1.00 60.41  ? 229  CYS K O   1 
ATOM   10623 C CB  . CYS P  1 88  ? 5.023   78.256  69.740  1.00 66.08  ? 229  CYS K CB  1 
ATOM   10624 S SG  . CYS P  1 88  ? 5.780   79.813  70.276  1.00 71.03  ? 229  CYS K SG  1 
ATOM   10625 N N   . PHE P  1 89  ? 3.771   78.995  72.517  1.00 55.74  ? 230  PHE K N   1 
ATOM   10626 C CA  . PHE P  1 89  ? 2.880   79.861  73.290  1.00 54.78  ? 230  PHE K CA  1 
ATOM   10627 C C   . PHE P  1 89  ? 3.513   81.254  73.347  1.00 53.39  ? 230  PHE K C   1 
ATOM   10628 O O   . PHE P  1 89  ? 4.720   81.380  73.541  1.00 51.20  ? 230  PHE K O   1 
ATOM   10629 C CB  . PHE P  1 89  ? 2.694   79.334  74.714  1.00 57.67  ? 230  PHE K CB  1 
ATOM   10630 C CG  . PHE P  1 89  ? 1.933   80.279  75.615  1.00 50.74  ? 230  PHE K CG  1 
ATOM   10631 C CD1 . PHE P  1 89  ? 0.587   80.509  75.425  1.00 52.22  ? 230  PHE K CD1 1 
ATOM   10632 C CD2 . PHE P  1 89  ? 2.574   80.935  76.654  1.00 55.67  ? 230  PHE K CD2 1 
ATOM   10633 C CE1 . PHE P  1 89  ? -0.114  81.382  76.264  1.00 56.28  ? 230  PHE K CE1 1 
ATOM   10634 C CE2 . PHE P  1 89  ? 1.886   81.801  77.493  1.00 55.01  ? 230  PHE K CE2 1 
ATOM   10635 C CZ  . PHE P  1 89  ? 0.537   82.026  77.298  1.00 50.40  ? 230  PHE K CZ  1 
ATOM   10636 N N   . ILE P  1 90  ? 2.704   82.290  73.171  1.00 48.81  ? 231  ILE K N   1 
ATOM   10637 C CA  . ILE P  1 90  ? 3.211   83.649  73.195  1.00 48.12  ? 231  ILE K CA  1 
ATOM   10638 C C   . ILE P  1 90  ? 2.302   84.543  74.012  1.00 57.93  ? 231  ILE K C   1 
ATOM   10639 O O   . ILE P  1 90  ? 1.078   84.477  73.897  1.00 60.58  ? 231  ILE K O   1 
ATOM   10640 C CB  . ILE P  1 90  ? 3.284   84.257  71.807  1.00 39.29  ? 231  ILE K CB  1 
ATOM   10641 C CG1 . ILE P  1 90  ? 4.197   83.424  70.920  1.00 40.56  ? 231  ILE K CG1 1 
ATOM   10642 C CG2 . ILE P  1 90  ? 3.804   85.676  71.892  1.00 39.97  ? 231  ILE K CG2 1 
ATOM   10643 C CD1 . ILE P  1 90  ? 4.408   84.060  69.535  1.00 44.57  ? 231  ILE K CD1 1 
ATOM   10644 N N   . CYS P  1 91  ? 2.911   85.395  74.827  1.00 61.24  ? 232  CYS K N   1 
ATOM   10645 C CA  . CYS P  1 91  ? 2.162   86.318  75.659  1.00 58.25  ? 232  CYS K CA  1 
ATOM   10646 C C   . CYS P  1 91  ? 2.775   87.712  75.536  1.00 58.63  ? 232  CYS K C   1 
ATOM   10647 O O   . CYS P  1 91  ? 3.949   87.916  75.864  1.00 64.56  ? 232  CYS K O   1 
ATOM   10648 C CB  . CYS P  1 91  ? 2.202   85.842  77.110  1.00 52.33  ? 232  CYS K CB  1 
ATOM   10649 S SG  . CYS P  1 91  ? 1.591   87.055  78.249  1.00 57.76  ? 232  CYS K SG  1 
ATOM   10650 N N   . CYS P  1 92  ? 1.989   88.663  75.045  1.00 50.34  ? 233  CYS K N   1 
ATOM   10651 C CA  . CYS P  1 92  ? 2.471   90.026  74.897  1.00 51.96  ? 233  CYS K CA  1 
ATOM   10652 C C   . CYS P  1 92  ? 1.798   90.885  75.927  1.00 54.88  ? 233  CYS K C   1 
ATOM   10653 O O   . CYS P  1 92  ? 0.611   90.741  76.168  1.00 64.13  ? 233  CYS K O   1 
ATOM   10654 C CB  . CYS P  1 92  ? 2.145   90.563  73.516  1.00 47.74  ? 233  CYS K CB  1 
ATOM   10655 S SG  . CYS P  1 92  ? 2.791   89.492  72.203  1.00 54.12  ? 233  CYS K SG  1 
ATOM   10656 N N   . ILE P  1 93  ? 2.552   91.775  76.548  1.00 55.22  ? 234  ILE K N   1 
ATOM   10657 C CA  . ILE P  1 93  ? 1.981   92.643  77.555  1.00 54.13  ? 234  ILE K CA  1 
ATOM   10658 C C   . ILE P  1 93  ? 2.378   94.068  77.248  1.00 61.54  ? 234  ILE K C   1 
ATOM   10659 O O   . ILE P  1 93  ? 3.567   94.394  77.213  1.00 67.75  ? 234  ILE K O   1 
ATOM   10660 C CB  . ILE P  1 93  ? 2.472   92.268  78.945  1.00 50.44  ? 234  ILE K CB  1 
ATOM   10661 C CG1 . ILE P  1 93  ? 1.993   90.864  79.276  1.00 48.87  ? 234  ILE K CG1 1 
ATOM   10662 C CG2 . ILE P  1 93  ? 1.948   93.252  79.969  1.00 45.03  ? 234  ILE K CG2 1 
ATOM   10663 C CD1 . ILE P  1 93  ? 2.416   90.403  80.637  1.00 56.00  ? 234  ILE K CD1 1 
ATOM   10664 N N   . LEU P  1 94  ? 1.365   94.896  77.003  1.00 60.46  ? 235  LEU K N   1 
ATOM   10665 C CA  . LEU P  1 94  ? 1.534   96.306  76.686  1.00 60.42  ? 235  LEU K CA  1 
ATOM   10666 C C   . LEU P  1 94  ? 0.935   97.046  77.867  1.00 65.36  ? 235  LEU K C   1 
ATOM   10667 O O   . LEU P  1 94  ? -0.268  96.981  78.089  1.00 67.73  ? 235  LEU K O   1 
ATOM   10668 C CB  . LEU P  1 94  ? 0.751   96.651  75.422  1.00 54.27  ? 235  LEU K CB  1 
ATOM   10669 C CG  . LEU P  1 94  ? 0.805   95.562  74.357  1.00 60.46  ? 235  LEU K CG  1 
ATOM   10670 C CD1 . LEU P  1 94  ? -0.009  95.961  73.143  1.00 62.70  ? 235  LEU K CD1 1 
ATOM   10671 C CD2 . LEU P  1 94  ? 2.237   95.325  73.970  1.00 61.94  ? 235  LEU K CD2 1 
ATOM   10672 N N   . SER P  1 95  ? 1.760   97.757  78.623  1.00 67.67  ? 236  SER K N   1 
ATOM   10673 C CA  . SER P  1 95  ? 1.252   98.468  79.789  1.00 69.24  ? 236  SER K CA  1 
ATOM   10674 C C   . SER P  1 95  ? 2.361   99.330  80.368  1.00 71.39  ? 236  SER K C   1 
ATOM   10675 O O   . SER P  1 95  ? 3.444   99.448  79.777  1.00 70.48  ? 236  SER K O   1 
ATOM   10676 C CB  . SER P  1 95  ? 0.794   97.444  80.840  1.00 68.60  ? 236  SER K CB  1 
ATOM   10677 O OG  . SER P  1 95  ? 0.353   98.060  82.041  1.00 66.21  ? 236  SER K OG  1 
ATOM   10678 N N   . HIS P  1 96  ? 2.075   99.954  81.507  1.00 69.39  ? 237  HIS K N   1 
ATOM   10679 C CA  . HIS P  1 96  ? 3.078   100.753 82.195  1.00 70.28  ? 237  HIS K CA  1 
ATOM   10680 C C   . HIS P  1 96  ? 3.844   99.771  83.042  1.00 70.31  ? 237  HIS K C   1 
ATOM   10681 O O   . HIS P  1 96  ? 3.376   98.650  83.285  1.00 67.87  ? 237  HIS K O   1 
ATOM   10682 C CB  . HIS P  1 96  ? 2.446   101.791 83.120  1.00 69.81  ? 237  HIS K CB  1 
ATOM   10683 C CG  . HIS P  1 96  ? 2.069   103.061 82.427  1.00 76.22  ? 237  HIS K CG  1 
ATOM   10684 N ND1 . HIS P  1 96  ? 2.914   103.710 81.551  1.00 78.25  ? 237  HIS K ND1 1 
ATOM   10685 C CD2 . HIS P  1 96  ? 0.933   103.794 82.468  1.00 77.19  ? 237  HIS K CD2 1 
ATOM   10686 C CE1 . HIS P  1 96  ? 2.310   104.785 81.077  1.00 74.57  ? 237  HIS K CE1 1 
ATOM   10687 N NE2 . HIS P  1 96  ? 1.107   104.858 81.617  1.00 76.81  ? 237  HIS K NE2 1 
ATOM   10688 N N   . GLY P  1 97  ? 5.019   100.188 83.495  1.00 70.32  ? 238  GLY K N   1 
ATOM   10689 C CA  . GLY P  1 97  ? 5.812   99.311  84.325  1.00 70.27  ? 238  GLY K CA  1 
ATOM   10690 C C   . GLY P  1 97  ? 6.934   100.033 85.026  1.00 67.64  ? 238  GLY K C   1 
ATOM   10691 O O   . GLY P  1 97  ? 7.156   101.217 84.802  1.00 60.53  ? 238  GLY K O   1 
ATOM   10692 N N   . ASP P  1 98  ? 7.634   99.297  85.883  1.00 72.81  ? 239  ASP K N   1 
ATOM   10693 C CA  . ASP P  1 98  ? 8.762   99.824  86.633  1.00 73.96  ? 239  ASP K CA  1 
ATOM   10694 C C   . ASP P  1 98  ? 9.798   98.701  86.765  1.00 71.89  ? 239  ASP K C   1 
ATOM   10695 O O   . ASP P  1 98  ? 9.654   97.644  86.142  1.00 63.36  ? 239  ASP K O   1 
ATOM   10696 C CB  . ASP P  1 98  ? 8.292   100.315 88.007  1.00 79.38  ? 239  ASP K CB  1 
ATOM   10697 C CG  . ASP P  1 98  ? 9.251   101.322 88.631  1.00 83.84  ? 239  ASP K CG  1 
ATOM   10698 O OD1 . ASP P  1 98  ? 10.447  101.346 88.244  1.00 85.39  ? 239  ASP K OD1 1 
ATOM   10699 O OD2 . ASP P  1 98  ? 8.805   102.090 89.515  1.00 84.67  ? 239  ASP K OD2 1 
ATOM   10700 N N   . LYS P  1 99  ? 10.837  98.929  87.566  1.00 73.17  ? 240  LYS K N   1 
ATOM   10701 C CA  . LYS P  1 99  ? 11.897  97.936  87.736  1.00 70.58  ? 240  LYS K CA  1 
ATOM   10702 C C   . LYS P  1 99  ? 11.350  96.549  87.997  1.00 65.78  ? 240  LYS K C   1 
ATOM   10703 O O   . LYS P  1 99  ? 10.788  96.291  89.063  1.00 63.73  ? 240  LYS K O   1 
ATOM   10704 C CB  . LYS P  1 99  ? 12.839  98.307  88.888  1.00 70.64  ? 240  LYS K CB  1 
ATOM   10705 C CG  . LYS P  1 99  ? 13.598  99.593  88.704  1.00 74.83  ? 240  LYS K CG  1 
ATOM   10706 C CD  . LYS P  1 99  ? 14.445  99.868  89.941  1.00 84.74  ? 240  LYS K CD  1 
ATOM   10707 C CE  . LYS P  1 99  ? 14.716  101.356 90.121  1.00 88.40  ? 240  LYS K CE  1 
ATOM   10708 N NZ  . LYS P  1 99  ? 15.590  101.609 91.298  1.00 83.60  ? 240  LYS K NZ  1 
ATOM   10709 N N   . GLY P  1 100 ? 11.527  95.667  87.015  1.00 61.74  ? 241  GLY K N   1 
ATOM   10710 C CA  . GLY P  1 100 ? 11.081  94.291  87.139  1.00 63.69  ? 241  GLY K CA  1 
ATOM   10711 C C   . GLY P  1 100 ? 9.589   94.021  87.242  1.00 64.80  ? 241  GLY K C   1 
ATOM   10712 O O   . GLY P  1 100 ? 9.185   92.864  87.344  1.00 63.32  ? 241  GLY K O   1 
ATOM   10713 N N   . ILE P  1 101 ? 8.763   95.064  87.203  1.00 65.60  ? 242  ILE K N   1 
ATOM   10714 C CA  . ILE P  1 101 ? 7.335   94.849  87.316  1.00 58.08  ? 242  ILE K CA  1 
ATOM   10715 C C   . ILE P  1 101 ? 6.530   95.418  86.171  1.00 59.37  ? 242  ILE K C   1 
ATOM   10716 O O   . ILE P  1 101 ? 7.045   96.127  85.307  1.00 58.70  ? 242  ILE K O   1 
ATOM   10717 C CB  . ILE P  1 101 ? 6.802   95.396  88.660  1.00 55.57  ? 242  ILE K CB  1 
ATOM   10718 C CG1 . ILE P  1 101 ? 6.972   96.924  88.744  1.00 51.38  ? 242  ILE K CG1 1 
ATOM   10719 C CG2 . ILE P  1 101 ? 7.553   94.724  89.790  1.00 46.78  ? 242  ILE K CG2 1 
ATOM   10720 C CD1 . ILE P  1 101 ? 5.893   97.713  88.045  1.00 47.38  ? 242  ILE K CD1 1 
ATOM   10721 N N   . ILE P  1 102 ? 5.255   95.067  86.183  1.00 60.34  ? 243  ILE K N   1 
ATOM   10722 C CA  . ILE P  1 102 ? 4.310   95.500  85.184  1.00 62.21  ? 243  ILE K CA  1 
ATOM   10723 C C   . ILE P  1 102 ? 3.207   96.115  85.995  1.00 63.31  ? 243  ILE K C   1 
ATOM   10724 O O   . ILE P  1 102 ? 2.841   95.602  87.063  1.00 55.76  ? 243  ILE K O   1 
ATOM   10725 C CB  . ILE P  1 102 ? 3.764   94.291  84.387  1.00 67.67  ? 243  ILE K CB  1 
ATOM   10726 C CG1 . ILE P  1 102 ? 4.122   94.452  82.917  1.00 65.28  ? 243  ILE K CG1 1 
ATOM   10727 C CG2 . ILE P  1 102 ? 2.255   94.158  84.566  1.00 70.26  ? 243  ILE K CG2 1 
ATOM   10728 C CD1 . ILE P  1 102 ? 5.600   94.622  82.698  1.00 64.96  ? 243  ILE K CD1 1 
ATOM   10729 N N   . TYR P  1 103 ? 2.683   97.222  85.499  1.00 69.21  ? 244  TYR K N   1 
ATOM   10730 C CA  . TYR P  1 103 ? 1.614   97.889  86.210  1.00 74.30  ? 244  TYR K CA  1 
ATOM   10731 C C   . TYR P  1 103 ? 0.266   97.433  85.722  1.00 76.14  ? 244  TYR K C   1 
ATOM   10732 O O   . TYR P  1 103 ? 0.026   97.342  84.507  1.00 70.58  ? 244  TYR K O   1 
ATOM   10733 C CB  . TYR P  1 103 ? 1.723   99.405  86.056  1.00 74.54  ? 244  TYR K CB  1 
ATOM   10734 C CG  . TYR P  1 103 ? 2.569   100.038 87.126  1.00 73.56  ? 244  TYR K CG  1 
ATOM   10735 C CD1 . TYR P  1 103 ? 2.216   99.920  88.480  1.00 70.68  ? 244  TYR K CD1 1 
ATOM   10736 C CD2 . TYR P  1 103 ? 3.726   100.740 86.795  1.00 68.54  ? 244  TYR K CD2 1 
ATOM   10737 C CE1 . TYR P  1 103 ? 2.995   100.486 89.474  1.00 71.72  ? 244  TYR K CE1 1 
ATOM   10738 C CE2 . TYR P  1 103 ? 4.520   101.308 87.781  1.00 72.20  ? 244  TYR K CE2 1 
ATOM   10739 C CZ  . TYR P  1 103 ? 4.149   101.179 89.119  1.00 74.44  ? 244  TYR K CZ  1 
ATOM   10740 O OH  . TYR P  1 103 ? 4.938   101.737 90.098  1.00 79.76  ? 244  TYR K OH  1 
ATOM   10741 N N   . GLY P  1 104 ? -0.603  97.131  86.684  1.00 78.18  ? 245  GLY K N   1 
ATOM   10742 C CA  . GLY P  1 104 ? -1.950  96.722  86.353  1.00 81.05  ? 245  GLY K CA  1 
ATOM   10743 C C   . GLY P  1 104 ? -2.734  97.998  86.103  1.00 82.87  ? 245  GLY K C   1 
ATOM   10744 O O   . GLY P  1 104 ? -2.450  99.037  86.709  1.00 82.95  ? 245  GLY K O   1 
ATOM   10745 N N   . THR P  1 105 ? -3.717  97.931  85.214  1.00 82.09  ? 246  THR K N   1 
ATOM   10746 C CA  . THR P  1 105 ? -4.533  99.094  84.883  1.00 80.93  ? 246  THR K CA  1 
ATOM   10747 C C   . THR P  1 105 ? -5.095  99.791  86.143  1.00 82.18  ? 246  THR K C   1 
ATOM   10748 O O   . THR P  1 105 ? -5.540  100.944 86.087  1.00 82.00  ? 246  THR K O   1 
ATOM   10749 C CB  . THR P  1 105 ? -5.691  98.671  83.949  1.00 79.35  ? 246  THR K CB  1 
ATOM   10750 O OG1 . THR P  1 105 ? -6.153  99.808  83.216  1.00 74.41  ? 246  THR K OG1 1 
ATOM   10751 C CG2 . THR P  1 105 ? -6.847  98.074  84.755  1.00 77.11  ? 246  THR K CG2 1 
ATOM   10752 N N   . ASP P  1 106 ? -5.053  99.085  87.273  1.00 79.31  ? 247  ASP K N   1 
ATOM   10753 C CA  . ASP P  1 106 ? -5.554  99.600  88.543  1.00 79.12  ? 247  ASP K CA  1 
ATOM   10754 C C   . ASP P  1 106 ? -4.435  100.106 89.451  1.00 78.88  ? 247  ASP K C   1 
ATOM   10755 O O   . ASP P  1 106 ? -4.672  100.443 90.619  1.00 76.82  ? 247  ASP K O   1 
ATOM   10756 C CB  . ASP P  1 106 ? -6.342  98.506  89.274  1.00 83.10  ? 247  ASP K CB  1 
ATOM   10757 C CG  . ASP P  1 106 ? -5.466  97.315  89.678  1.00 89.69  ? 247  ASP K CG  1 
ATOM   10758 O OD1 . ASP P  1 106 ? -4.795  96.738  88.793  1.00 94.31  ? 247  ASP K OD1 1 
ATOM   10759 O OD2 . ASP P  1 106 ? -5.454  96.946  90.878  1.00 88.19  ? 247  ASP K OD2 1 
ATOM   10760 N N   . GLY P  1 107 ? -3.215  100.134 88.925  1.00 75.52  ? 248  GLY K N   1 
ATOM   10761 C CA  . GLY P  1 107 ? -2.091  100.617 89.708  1.00 74.89  ? 248  GLY K CA  1 
ATOM   10762 C C   . GLY P  1 107 ? -1.321  99.561  90.473  1.00 75.29  ? 248  GLY K C   1 
ATOM   10763 O O   . GLY P  1 107 ? -0.221  99.827  90.977  1.00 71.59  ? 248  GLY K O   1 
ATOM   10764 N N   . GLN P  1 108 ? -1.887  98.364  90.572  1.00 75.94  ? 254  GLN K N   1 
ATOM   10765 C CA  . GLN P  1 108 ? -1.205  97.297  91.286  1.00 74.63  ? 254  GLN K CA  1 
ATOM   10766 C C   . GLN P  1 108 ? -0.023  96.773  90.482  1.00 73.98  ? 254  GLN K C   1 
ATOM   10767 O O   . GLN P  1 108 ? 0.019   96.866  89.242  1.00 65.35  ? 254  GLN K O   1 
ATOM   10768 C CB  . GLN P  1 108 ? -2.173  96.165  91.617  1.00 80.13  ? 254  GLN K CB  1 
ATOM   10769 C CG  . GLN P  1 108 ? -3.293  96.583  92.558  1.00 87.33  ? 254  GLN K CG  1 
ATOM   10770 C CD  . GLN P  1 108 ? -2.769  97.270  93.813  1.00 96.16  ? 254  GLN K CD  1 
ATOM   10771 O OE1 . GLN P  1 108 ? -2.037  96.668  94.612  1.00 96.73  ? 254  GLN K OE1 1 
ATOM   10772 N NE2 . GLN P  1 108 ? -3.138  98.541  93.990  1.00 94.18  ? 254  GLN K NE2 1 
ATOM   10773 N N   . GLU P  1 109 ? 0.936   96.216  91.210  1.00 73.43  ? 255  GLU K N   1 
ATOM   10774 C CA  . GLU P  1 109 ? 2.155   95.704  90.617  1.00 71.21  ? 255  GLU K CA  1 
ATOM   10775 C C   . GLU P  1 109 ? 2.223   94.209  90.388  1.00 67.14  ? 255  GLU K C   1 
ATOM   10776 O O   . GLU P  1 109 ? 1.829   93.404  91.229  1.00 65.48  ? 255  GLU K O   1 
ATOM   10777 C CB  . GLU P  1 109 ? 3.339   96.132  91.473  1.00 75.37  ? 255  GLU K CB  1 
ATOM   10778 C CG  . GLU P  1 109 ? 3.711   97.586  91.299  1.00 84.08  ? 255  GLU K CG  1 
ATOM   10779 C CD  . GLU P  1 109 ? 4.666   98.066  92.372  1.00 87.64  ? 255  GLU K CD  1 
ATOM   10780 O OE1 . GLU P  1 109 ? 5.496   97.250  92.845  1.00 84.56  ? 255  GLU K OE1 1 
ATOM   10781 O OE2 . GLU P  1 109 ? 4.587   99.262  92.730  1.00 87.69  ? 255  GLU K OE2 1 
ATOM   10782 N N   . ALA P  1 110 ? 2.750   93.848  89.230  1.00 63.99  ? 256  ALA K N   1 
ATOM   10783 C CA  . ALA P  1 110 ? 2.908   92.454  88.887  1.00 63.61  ? 256  ALA K CA  1 
ATOM   10784 C C   . ALA P  1 110 ? 4.355   92.187  88.477  1.00 62.54  ? 256  ALA K C   1 
ATOM   10785 O O   . ALA P  1 110 ? 4.825   92.684  87.452  1.00 66.82  ? 256  ALA K O   1 
ATOM   10786 C CB  . ALA P  1 110 ? 1.963   92.082  87.746  1.00 59.50  ? 256  ALA K CB  1 
ATOM   10787 N N   . PRO P  1 111 ? 5.092   91.431  89.299  1.00 55.53  ? 257  PRO K N   1 
ATOM   10788 C CA  . PRO P  1 111 ? 6.483   91.100  88.996  1.00 57.11  ? 257  PRO K CA  1 
ATOM   10789 C C   . PRO P  1 111 ? 6.518   90.266  87.707  1.00 60.43  ? 257  PRO K C   1 
ATOM   10790 O O   . PRO P  1 111 ? 5.778   89.283  87.552  1.00 62.67  ? 257  PRO K O   1 
ATOM   10791 C CB  . PRO P  1 111 ? 6.911   90.285  90.209  1.00 58.70  ? 257  PRO K CB  1 
ATOM   10792 C CG  . PRO P  1 111 ? 6.123   90.895  91.298  1.00 56.07  ? 257  PRO K CG  1 
ATOM   10793 C CD  . PRO P  1 111 ? 4.754   91.044  90.674  1.00 55.06  ? 257  PRO K CD  1 
ATOM   10794 N N   . ILE P  1 112 ? 7.369   90.657  86.776  1.00 53.12  ? 258  ILE K N   1 
ATOM   10795 C CA  . ILE P  1 112 ? 7.439   89.937  85.541  1.00 50.10  ? 258  ILE K CA  1 
ATOM   10796 C C   . ILE P  1 112 ? 7.786   88.487  85.806  1.00 50.16  ? 258  ILE K C   1 
ATOM   10797 O O   . ILE P  1 112 ? 7.418   87.608  85.037  1.00 46.84  ? 258  ILE K O   1 
ATOM   10798 C CB  . ILE P  1 112 ? 8.455   90.596  84.632  1.00 55.40  ? 258  ILE K CB  1 
ATOM   10799 C CG1 . ILE P  1 112 ? 7.964   92.013  84.318  1.00 54.51  ? 258  ILE K CG1 1 
ATOM   10800 C CG2 . ILE P  1 112 ? 8.656   89.761  83.367  1.00 56.27  ? 258  ILE K CG2 1 
ATOM   10801 C CD1 . ILE P  1 112 ? 8.838   92.799  83.373  1.00 56.24  ? 258  ILE K CD1 1 
ATOM   10802 N N   . TYR P  1 113 ? 8.475   88.232  86.909  1.00 52.24  ? 259  TYR K N   1 
ATOM   10803 C CA  . TYR P  1 113 ? 8.852   86.863  87.237  1.00 62.31  ? 259  TYR K CA  1 
ATOM   10804 C C   . TYR P  1 113 ? 7.600   86.036  87.532  1.00 61.86  ? 259  TYR K C   1 
ATOM   10805 O O   . TYR P  1 113 ? 7.475   84.896  87.097  1.00 61.62  ? 259  TYR K O   1 
ATOM   10806 C CB  . TYR P  1 113 ? 9.788   86.844  88.445  1.00 74.74  ? 259  TYR K CB  1 
ATOM   10807 C CG  . TYR P  1 113 ? 10.360  85.472  88.734  1.00 89.65  ? 259  TYR K CG  1 
ATOM   10808 C CD1 . TYR P  1 113 ? 11.166  84.817  87.792  1.00 92.02  ? 259  TYR K CD1 1 
ATOM   10809 C CD2 . TYR P  1 113 ? 10.080  84.811  89.939  1.00 92.70  ? 259  TYR K CD2 1 
ATOM   10810 C CE1 . TYR P  1 113 ? 11.675  83.536  88.040  1.00 92.98  ? 259  TYR K CE1 1 
ATOM   10811 C CE2 . TYR P  1 113 ? 10.585  83.529  90.196  1.00 91.91  ? 259  TYR K CE2 1 
ATOM   10812 C CZ  . TYR P  1 113 ? 11.380  82.898  89.243  1.00 91.54  ? 259  TYR K CZ  1 
ATOM   10813 O OH  . TYR P  1 113 ? 11.876  81.633  89.484  1.00 89.34  ? 259  TYR K OH  1 
ATOM   10814 N N   . GLU P  1 114 ? 6.677   86.619  88.283  1.00 64.83  ? 260  GLU K N   1 
ATOM   10815 C CA  . GLU P  1 114 ? 5.422   85.955  88.623  1.00 66.47  ? 260  GLU K CA  1 
ATOM   10816 C C   . GLU P  1 114 ? 4.673   85.589  87.352  1.00 62.48  ? 260  GLU K C   1 
ATOM   10817 O O   . GLU P  1 114 ? 4.010   84.563  87.281  1.00 63.69  ? 260  GLU K O   1 
ATOM   10818 C CB  . GLU P  1 114 ? 4.532   86.896  89.427  1.00 74.62  ? 260  GLU K CB  1 
ATOM   10819 C CG  . GLU P  1 114 ? 5.139   87.376  90.709  1.00 84.45  ? 260  GLU K CG  1 
ATOM   10820 C CD  . GLU P  1 114 ? 4.996   86.357  91.805  1.00 91.67  ? 260  GLU K CD  1 
ATOM   10821 O OE1 . GLU P  1 114 ? 5.429   85.200  91.586  1.00 89.09  ? 260  GLU K OE1 1 
ATOM   10822 O OE2 . GLU P  1 114 ? 4.447   86.720  92.876  1.00 96.90  ? 260  GLU K OE2 1 
ATOM   10823 N N   . LEU P  1 115 ? 4.749   86.449  86.350  1.00 56.18  ? 261  LEU K N   1 
ATOM   10824 C CA  . LEU P  1 115 ? 4.056   86.164  85.117  1.00 52.64  ? 261  LEU K CA  1 
ATOM   10825 C C   . LEU P  1 115 ? 4.678   84.994  84.370  1.00 53.25  ? 261  LEU K C   1 
ATOM   10826 O O   . LEU P  1 115 ? 4.017   84.008  84.151  1.00 59.26  ? 261  LEU K O   1 
ATOM   10827 C CB  . LEU P  1 115 ? 4.035   87.406  84.239  1.00 55.32  ? 261  LEU K CB  1 
ATOM   10828 C CG  . LEU P  1 115 ? 3.530   88.630  85.011  1.00 63.66  ? 261  LEU K CG  1 
ATOM   10829 C CD1 . LEU P  1 115 ? 3.238   89.765  84.036  1.00 58.18  ? 261  LEU K CD1 1 
ATOM   10830 C CD2 . LEU P  1 115 ? 2.263   88.256  85.782  1.00 64.76  ? 261  LEU K CD2 1 
ATOM   10831 N N   . THR P  1 116 ? 5.953   85.076  84.011  1.00 53.75  ? 262  THR K N   1 
ATOM   10832 C CA  . THR P  1 116 ? 6.584   84.004  83.250  1.00 50.90  ? 262  THR K CA  1 
ATOM   10833 C C   . THR P  1 116 ? 6.756   82.698  83.962  1.00 52.32  ? 262  THR K C   1 
ATOM   10834 O O   . THR P  1 116 ? 6.850   81.674  83.296  1.00 54.38  ? 262  THR K O   1 
ATOM   10835 C CB  . THR P  1 116 ? 7.985   84.345  82.789  1.00 52.61  ? 262  THR K CB  1 
ATOM   10836 O OG1 . THR P  1 116 ? 8.854   84.330  83.932  1.00 47.87  ? 262  THR K OG1 1 
ATOM   10837 C CG2 . THR P  1 116 ? 8.010   85.692  82.079  1.00 38.83  ? 262  THR K CG2 1 
ATOM   10838 N N   . SER P  1 117 ? 6.843   82.716  85.290  1.00 54.25  ? 263  SER K N   1 
ATOM   10839 C CA  . SER P  1 117 ? 7.043   81.469  86.051  1.00 58.70  ? 263  SER K CA  1 
ATOM   10840 C C   . SER P  1 117 ? 5.783   80.602  86.063  1.00 60.04  ? 263  SER K C   1 
ATOM   10841 O O   . SER P  1 117 ? 5.781   79.455  86.542  1.00 53.19  ? 263  SER K O   1 
ATOM   10842 C CB  . SER P  1 117 ? 7.486   81.770  87.490  1.00 56.32  ? 263  SER K CB  1 
ATOM   10843 O OG  . SER P  1 117 ? 6.435   82.310  88.268  1.00 67.55  ? 263  SER K OG  1 
ATOM   10844 N N   . GLN P  1 118 ? 4.714   81.180  85.519  1.00 62.13  ? 264  GLN K N   1 
ATOM   10845 C CA  . GLN P  1 118 ? 3.422   80.525  85.417  1.00 60.14  ? 264  GLN K CA  1 
ATOM   10846 C C   . GLN P  1 118 ? 3.471   79.395  84.417  1.00 56.85  ? 264  GLN K C   1 
ATOM   10847 O O   . GLN P  1 118 ? 2.680   78.472  84.486  1.00 66.53  ? 264  GLN K O   1 
ATOM   10848 C CB  . GLN P  1 118 ? 2.370   81.538  84.958  1.00 61.15  ? 264  GLN K CB  1 
ATOM   10849 C CG  . GLN P  1 118 ? 1.932   82.519  86.024  1.00 60.86  ? 264  GLN K CG  1 
ATOM   10850 C CD  . GLN P  1 118 ? 1.260   81.807  87.162  1.00 67.56  ? 264  GLN K CD  1 
ATOM   10851 O OE1 . GLN P  1 118 ? 1.909   81.134  87.973  1.00 62.00  ? 264  GLN K OE1 1 
ATOM   10852 N NE2 . GLN P  1 118 ? -0.061  81.921  87.216  1.00 77.78  ? 264  GLN K NE2 1 
ATOM   10853 N N   . PHE P  1 119 ? 4.418   79.455  83.495  1.00 53.13  ? 265  PHE K N   1 
ATOM   10854 C CA  . PHE P  1 119 ? 4.505   78.449  82.457  1.00 46.58  ? 265  PHE K CA  1 
ATOM   10855 C C   . PHE P  1 119 ? 5.718   77.548  82.445  1.00 39.79  ? 265  PHE K C   1 
ATOM   10856 O O   . PHE P  1 119 ? 6.128   77.087  81.390  1.00 38.33  ? 265  PHE K O   1 
ATOM   10857 C CB  . PHE P  1 119 ? 4.337   79.149  81.124  1.00 46.27  ? 265  PHE K CB  1 
ATOM   10858 C CG  . PHE P  1 119 ? 3.096   79.989  81.065  1.00 55.44  ? 265  PH