data_1FBA
# 
_entry.id   1FBA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FBA         
WWPDB D_1000173215 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FBA 
_pdbx_database_status.recvd_initial_deposition_date   1992-06-08 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Piontek, K.'         1 
'Hester, G.'          2 
'Brenner-Holzach, O.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The crystal structure of fructose-1,6-bisphosphate aldolase from Drosophila melanogaster at 2.5 A resolution.' 
'FEBS Lett.'          292 237 242 1991 FEBLAL NE 0014-5793 0165 ? 1959612 '10.1016/0014-5793(91)80875-4' 
1       
;Fructose-1,6-Bisphosphate Aldolase from Drosophila Melanogaster: Primary Structure Analysis, Secondary Structure Prediction, and Comparison with Vertebrate Aldolases
;
Arch.Biochem.Biophys. 266 10  ?   1988 ABBIA4 US 0003-9861 0158 ? ?       ?                              
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hester, G.'          1  
primary 'Brenner-Holzach, O.' 2  
primary 'Rossi, F.A.'         3  
primary 'Struck-Donatz, M.'   4  
primary 'Winterhalter, K.H.'  5  
primary 'Smit, J.D.'          6  
primary 'Piontek, K.'         7  
1       'Malek, A.A.'         8  
1       'Hy, M.'              9  
1       'Honegger, A.'        10 
1       'Rose, K.'            11 
1       'Brenner-Holzach, O.' 12 
# 
_cell.entry_id           1FBA 
_cell.length_a           86.600 
_cell.length_b           116.800 
_cell.length_c           151.580 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FBA 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'FRUCTOSE 1,6-BISPHOSPHATE ALDOLASE' 38989.180 4    4.1.2.13 ? ? ? 
2 water   nat water                                18.015    1816 ?        ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;(ACE)TTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISG
VILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGK
NTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTA
GQSAKKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGK
KENIAAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;XTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILF
HETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPS
YQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSA
KKNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENI
AAGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY
;
_entity_poly.pdbx_strand_id                 A,B,C,D 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ACE n 
1 2   THR n 
1 3   THR n 
1 4   TYR n 
1 5   PHE n 
1 6   ASN n 
1 7   TYR n 
1 8   PRO n 
1 9   SER n 
1 10  LYS n 
1 11  GLU n 
1 12  LEU n 
1 13  GLN n 
1 14  ASP n 
1 15  GLU n 
1 16  LEU n 
1 17  ARG n 
1 18  GLU n 
1 19  ILE n 
1 20  ALA n 
1 21  GLN n 
1 22  LYS n 
1 23  ILE n 
1 24  VAL n 
1 25  ALA n 
1 26  PRO n 
1 27  GLY n 
1 28  LYS n 
1 29  GLY n 
1 30  ILE n 
1 31  LEU n 
1 32  ALA n 
1 33  ALA n 
1 34  ASP n 
1 35  GLU n 
1 36  SER n 
1 37  GLY n 
1 38  PRO n 
1 39  THR n 
1 40  MET n 
1 41  GLY n 
1 42  LYS n 
1 43  ARG n 
1 44  LEU n 
1 45  GLN n 
1 46  ASP n 
1 47  ILE n 
1 48  GLY n 
1 49  VAL n 
1 50  GLU n 
1 51  ASN n 
1 52  THR n 
1 53  GLU n 
1 54  ASP n 
1 55  ASN n 
1 56  ARG n 
1 57  ARG n 
1 58  ALA n 
1 59  TYR n 
1 60  ARG n 
1 61  GLN n 
1 62  LEU n 
1 63  LEU n 
1 64  PHE n 
1 65  SER n 
1 66  THR n 
1 67  ASP n 
1 68  PRO n 
1 69  LYS n 
1 70  LEU n 
1 71  ALA n 
1 72  GLU n 
1 73  ASN n 
1 74  ILE n 
1 75  SER n 
1 76  GLY n 
1 77  VAL n 
1 78  ILE n 
1 79  LEU n 
1 80  PHE n 
1 81  HIS n 
1 82  GLU n 
1 83  THR n 
1 84  LEU n 
1 85  TYR n 
1 86  GLN n 
1 87  LYS n 
1 88  ALA n 
1 89  ASP n 
1 90  ASP n 
1 91  GLY n 
1 92  THR n 
1 93  PRO n 
1 94  PHE n 
1 95  ALA n 
1 96  GLU n 
1 97  ILE n 
1 98  LEU n 
1 99  LYS n 
1 100 LYS n 
1 101 LYS n 
1 102 GLY n 
1 103 ILE n 
1 104 ILE n 
1 105 LEU n 
1 106 GLY n 
1 107 ILE n 
1 108 LYS n 
1 109 VAL n 
1 110 ASP n 
1 111 LYS n 
1 112 GLY n 
1 113 VAL n 
1 114 VAL n 
1 115 PRO n 
1 116 LEU n 
1 117 PHE n 
1 118 GLY n 
1 119 SER n 
1 120 GLU n 
1 121 ASP n 
1 122 GLU n 
1 123 VAL n 
1 124 THR n 
1 125 THR n 
1 126 GLN n 
1 127 GLY n 
1 128 LEU n 
1 129 ASP n 
1 130 ASP n 
1 131 LEU n 
1 132 ALA n 
1 133 ALA n 
1 134 ARG n 
1 135 CYS n 
1 136 ALA n 
1 137 GLN n 
1 138 TYR n 
1 139 LYS n 
1 140 LYS n 
1 141 ASP n 
1 142 GLY n 
1 143 CYS n 
1 144 ASP n 
1 145 PHE n 
1 146 ALA n 
1 147 LYS n 
1 148 TRP n 
1 149 ARG n 
1 150 CYS n 
1 151 VAL n 
1 152 LEU n 
1 153 LYS n 
1 154 ILE n 
1 155 GLY n 
1 156 LYS n 
1 157 ASN n 
1 158 THR n 
1 159 PRO n 
1 160 SER n 
1 161 TYR n 
1 162 GLN n 
1 163 SER n 
1 164 ILE n 
1 165 LEU n 
1 166 GLU n 
1 167 ASN n 
1 168 ALA n 
1 169 ASN n 
1 170 VAL n 
1 171 LEU n 
1 172 ALA n 
1 173 ARG n 
1 174 TYR n 
1 175 ALA n 
1 176 SER n 
1 177 ILE n 
1 178 CYS n 
1 179 GLN n 
1 180 SER n 
1 181 GLN n 
1 182 ARG n 
1 183 ILE n 
1 184 VAL n 
1 185 PRO n 
1 186 ILE n 
1 187 VAL n 
1 188 GLU n 
1 189 PRO n 
1 190 GLU n 
1 191 VAL n 
1 192 LEU n 
1 193 PRO n 
1 194 ASP n 
1 195 GLY n 
1 196 ASP n 
1 197 HIS n 
1 198 ASP n 
1 199 LEU n 
1 200 ASP n 
1 201 ARG n 
1 202 ALA n 
1 203 GLN n 
1 204 LYS n 
1 205 VAL n 
1 206 THR n 
1 207 GLU n 
1 208 THR n 
1 209 VAL n 
1 210 LEU n 
1 211 ALA n 
1 212 ALA n 
1 213 VAL n 
1 214 TYR n 
1 215 LYS n 
1 216 ALA n 
1 217 LEU n 
1 218 SER n 
1 219 ASP n 
1 220 HIS n 
1 221 HIS n 
1 222 VAL n 
1 223 TYR n 
1 224 LEU n 
1 225 GLU n 
1 226 GLY n 
1 227 THR n 
1 228 LEU n 
1 229 LEU n 
1 230 LYS n 
1 231 PRO n 
1 232 ASN n 
1 233 MET n 
1 234 VAL n 
1 235 THR n 
1 236 ALA n 
1 237 GLY n 
1 238 GLN n 
1 239 SER n 
1 240 ALA n 
1 241 LYS n 
1 242 LYS n 
1 243 ASN n 
1 244 THR n 
1 245 PRO n 
1 246 GLU n 
1 247 GLU n 
1 248 ILE n 
1 249 ALA n 
1 250 LEU n 
1 251 ALA n 
1 252 THR n 
1 253 VAL n 
1 254 GLN n 
1 255 ALA n 
1 256 LEU n 
1 257 ARG n 
1 258 ARG n 
1 259 THR n 
1 260 VAL n 
1 261 PRO n 
1 262 ALA n 
1 263 ALA n 
1 264 VAL n 
1 265 THR n 
1 266 GLY n 
1 267 VAL n 
1 268 THR n 
1 269 PHE n 
1 270 LEU n 
1 271 SER n 
1 272 GLY n 
1 273 GLY n 
1 274 GLN n 
1 275 SER n 
1 276 GLU n 
1 277 GLU n 
1 278 GLU n 
1 279 ALA n 
1 280 THR n 
1 281 VAL n 
1 282 ASN n 
1 283 LEU n 
1 284 SER n 
1 285 ALA n 
1 286 ILE n 
1 287 ASN n 
1 288 ASN n 
1 289 VAL n 
1 290 PRO n 
1 291 LEU n 
1 292 ILE n 
1 293 ARG n 
1 294 PRO n 
1 295 TRP n 
1 296 ALA n 
1 297 LEU n 
1 298 THR n 
1 299 PHE n 
1 300 SER n 
1 301 TYR n 
1 302 GLY n 
1 303 ARG n 
1 304 ALA n 
1 305 LEU n 
1 306 GLN n 
1 307 ALA n 
1 308 SER n 
1 309 VAL n 
1 310 LEU n 
1 311 ARG n 
1 312 ALA n 
1 313 TRP n 
1 314 ALA n 
1 315 GLY n 
1 316 LYS n 
1 317 LYS n 
1 318 GLU n 
1 319 ASN n 
1 320 ILE n 
1 321 ALA n 
1 322 ALA n 
1 323 GLY n 
1 324 GLN n 
1 325 ASN n 
1 326 GLU n 
1 327 LEU n 
1 328 LEU n 
1 329 LYS n 
1 330 ARG n 
1 331 ALA n 
1 332 LYS n 
1 333 ALA n 
1 334 ASN n 
1 335 GLY n 
1 336 ASP n 
1 337 ALA n 
1 338 ALA n 
1 339 GLN n 
1 340 GLY n 
1 341 LYS n 
1 342 TYR n 
1 343 VAL n 
1 344 ALA n 
1 345 GLY n 
1 346 SER n 
1 347 ALA n 
1 348 GLY n 
1 349 ALA n 
1 350 GLY n 
1 351 SER n 
1 352 GLY n 
1 353 SER n 
1 354 LEU n 
1 355 PHE n 
1 356 VAL n 
1 357 ALA n 
1 358 ASN n 
1 359 HIS n 
1 360 ALA n 
1 361 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'fruit fly' 
_entity_src_gen.gene_src_genus                     Drosophila 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ALF_DROME 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P07764 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;TTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFH
ETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSY
QSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLDRAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAK
KNTPEEIALATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFSYGRALQASVLRAWAGKKENIA
AGQNELLKRAKANGDAAQGKYVAGSAGAGSGSLFVANHAY
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FBA A 2 ? 361 ? P07764 1 ? 360 ? 1 363 
2 1 1FBA B 2 ? 361 ? P07764 1 ? 360 ? 1 363 
3 1 1FBA C 2 ? 361 ? P07764 1 ? 360 ? 1 363 
4 1 1FBA D 2 ? 361 ? P07764 1 ? 360 ? 1 363 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACE non-polymer         . 'ACETYL GROUP'  ? 'C2 H4 O'        44.053  
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FBA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.46 
_exptl_crystal.density_percent_sol   49.94 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1FBA 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.1790000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10980 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             1816 
_refine_hist.number_atoms_total               12796 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        8.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    ?     ? ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_struct_ncs_oper.id 
_struct_ncs_oper.code 
_struct_ncs_oper.details 
_struct_ncs_oper.matrix[1][1] 
_struct_ncs_oper.matrix[1][2] 
_struct_ncs_oper.matrix[1][3] 
_struct_ncs_oper.matrix[2][1] 
_struct_ncs_oper.matrix[2][2] 
_struct_ncs_oper.matrix[2][3] 
_struct_ncs_oper.matrix[3][1] 
_struct_ncs_oper.matrix[3][2] 
_struct_ncs_oper.matrix[3][3] 
_struct_ncs_oper.vector[1] 
_struct_ncs_oper.vector[2] 
_struct_ncs_oper.vector[3] 
1 given ? 0.916260  -0.048320 -0.397670 -0.047230 -0.998810 0.012540  -0.397800 0.007300  -0.917440 14.08994  26.70957 64.53925 
2 given ? -1.000000 -0.000990 -0.002730 -0.000360 0.975110  -0.221730 0.002890  -0.221730 -0.975100 3.28260   7.69806  68.96657 
3 given ? -0.914350 0.040800  0.402860  0.046220  -0.977890 0.203940  0.402270  0.205090  0.892250  -10.83144 19.70642 0.22911  
# 
_struct.entry_id                  1FBA 
_struct.title                     
'THE CRYSTAL STRUCTURE OF FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE FROM DROSOPHILA MELANOGASTER AT 2.5 ANGSTROMS RESOLUTION' 
_struct.pdbx_descriptor           'FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE (E.C.4.1.2.13)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FBA 
_struct_keywords.pdbx_keywords   'LYASE(ALDEHYDE)' 
_struct_keywords.text            'LYASE(ALDEHYDE)' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1I  LYS A 10  ? ILE A 23  ? LYS A 9   ILE A 22  1 'SUBUNIT 1' 14 
HELX_P HELX_P2  1A1 GLY A 37  ? ASP A 46  ? GLY A 36  ASP A 45  1 ?           10 
HELX_P HELX_P3  1A2 GLU A 53  ? PHE A 64  ? GLU A 52  PHE A 63  1 ?           12 
HELX_P HELX_P4  1A3 PRO A 68  ? GLU A 72  ? PRO A 67  GLU A 71  5 ?           5  
HELX_P HELX_P5  1B1 HIS A 81  ? LEU A 84  ? HIS A 80  LEU A 83  1 ?           4  
HELX_P HELX_P6  1B2 PHE A 94  ? LYS A 100 ? PHE A 93  LYS A 99  1 ?           7  
HELX_P HELX_P7  1C  LEU A 131 ? LYS A 140 ? LEU A 130 LYS A 139 1 ?           10 
HELX_P HELX_P8  1D  TYR A 161 ? SER A 180 ? TYR A 160 SER A 179 1 ?           20 
HELX_P HELX_P9  1E1 LEU A 199 ? ASP A 219 ? LEU A 198 ASP A 218 1 ?           21 
HELX_P HELX_P10 1E2 LEU A 224 ? GLY A 226 ? LEU A 223 GLY A 225 5 ?           3  
HELX_P HELX_P11 1F  PRO A 245 ? THR A 259 ? PRO A 245 THR A 259 1 ?           15 
HELX_P HELX_P12 1G  GLU A 276 ? ILE A 286 ? GLU A 276 ILE A 286 1 ?           11 
HELX_P HELX_P13 1H1 ARG A 303 ? LEU A 305 ? ARG A 303 LEU A 305 5 ?           3  
HELX_P HELX_P14 1H2 ALA A 307 ? TRP A 313 ? ALA A 307 TRP A 313 1 ?           7  
HELX_P HELX_P15 1H3 ILE A 320 ? ALA A 337 ? ILE A 320 ALA A 337 1 ?           18 
HELX_P HELX_P16 2I  LYS B 10  ? ILE B 23  ? LYS B 9   ILE B 22  1 'SUBUNIT 2' 14 
HELX_P HELX_P17 2A1 GLY B 37  ? GLN B 45  ? GLY B 36  GLN B 44  1 ?           9  
HELX_P HELX_P18 2A2 GLU B 53  ? PHE B 64  ? GLU B 52  PHE B 63  1 ?           12 
HELX_P HELX_P19 2A3 PRO B 68  ? GLU B 72  ? PRO B 67  GLU B 71  5 ?           5  
HELX_P HELX_P20 2B1 HIS B 81  ? LEU B 84  ? HIS B 80  LEU B 83  1 ?           4  
HELX_P HELX_P21 2B2 PHE B 94  ? LYS B 100 ? PHE B 93  LYS B 99  1 ?           7  
HELX_P HELX_P22 2C  LEU B 131 ? LYS B 140 ? LEU B 130 LYS B 139 1 ?           10 
HELX_P HELX_P23 2D  TYR B 161 ? SER B 180 ? TYR B 160 SER B 179 1 ?           20 
HELX_P HELX_P24 2E1 LEU B 199 ? ASP B 219 ? LEU B 198 ASP B 218 1 ?           21 
HELX_P HELX_P25 2E2 LEU B 224 ? GLY B 226 ? LEU B 223 GLY B 225 5 ?           3  
HELX_P HELX_P26 2F  PRO B 245 ? THR B 259 ? PRO B 245 THR B 259 1 ?           15 
HELX_P HELX_P27 2G  GLU B 276 ? ILE B 286 ? GLU B 276 ILE B 286 1 ?           11 
HELX_P HELX_P28 2H1 ARG B 303 ? TRP B 313 ? ARG B 303 TRP B 313 1 ?           11 
HELX_P HELX_P29 2H2 LYS B 317 ? ASN B 319 ? LYS B 317 ASN B 319 5 ?           3  
HELX_P HELX_P30 2H3 ILE B 320 ? ALA B 337 ? ILE B 320 ALA B 337 1 ?           18 
HELX_P HELX_P31 3I  LYS C 10  ? ILE C 23  ? LYS C 9   ILE C 22  1 'SUBUNIT 3' 14 
HELX_P HELX_P32 3A1 GLY C 37  ? ASP C 46  ? GLY C 36  ASP C 45  1 ?           10 
HELX_P HELX_P33 3A2 GLU C 53  ? SER C 65  ? GLU C 52  SER C 64  1 ?           13 
HELX_P HELX_P34 3A3 PRO C 68  ? GLU C 72  ? PRO C 67  GLU C 71  5 ?           5  
HELX_P HELX_P35 3B1 THR C 83  ? TYR C 85  ? THR C 82  TYR C 84  5 ?           3  
HELX_P HELX_P36 3B2 PHE C 94  ? LYS C 100 ? PHE C 93  LYS C 99  1 ?           7  
HELX_P HELX_P37 3C  LEU C 131 ? LYS C 140 ? LEU C 130 LYS C 139 1 ?           10 
HELX_P HELX_P38 3D  TYR C 161 ? SER C 180 ? TYR C 160 SER C 179 1 ?           20 
HELX_P HELX_P39 3E1 LEU C 199 ? ASP C 219 ? LEU C 198 ASP C 218 1 ?           21 
HELX_P HELX_P40 3E2 LEU C 224 ? GLY C 226 ? LEU C 223 GLY C 225 5 ?           3  
HELX_P HELX_P41 3F  PRO C 245 ? THR C 259 ? PRO C 245 THR C 259 1 ?           15 
HELX_P HELX_P42 3G  GLU C 276 ? ILE C 286 ? GLU C 276 ILE C 286 1 ?           11 
HELX_P HELX_P43 3H1 ARG C 303 ? TRP C 313 ? ARG C 303 TRP C 313 1 ?           11 
HELX_P HELX_P44 3H2 LYS C 317 ? ASN C 319 ? LYS C 317 ASN C 319 5 ?           3  
HELX_P HELX_P45 3H3 ILE C 320 ? ALA C 337 ? ILE C 320 ALA C 337 1 ?           18 
HELX_P HELX_P46 4I  LYS D 10  ? ILE D 23  ? LYS D 9   ILE D 22  1 'SUBUNIT 4' 14 
HELX_P HELX_P47 4A1 GLY D 37  ? ASP D 46  ? GLY D 36  ASP D 45  1 ?           10 
HELX_P HELX_P48 4A2 GLU D 53  ? PHE D 64  ? GLU D 52  PHE D 63  1 ?           12 
HELX_P HELX_P49 4A3 PRO D 68  ? GLU D 72  ? PRO D 67  GLU D 71  5 ?           5  
HELX_P HELX_P50 4B1 HIS D 81  ? LEU D 84  ? HIS D 80  LEU D 83  1 ?           4  
HELX_P HELX_P51 4B2 PHE D 94  ? LYS D 100 ? PHE D 93  LYS D 99  1 ?           7  
HELX_P HELX_P52 4C  LEU D 131 ? LYS D 140 ? LEU D 130 LYS D 139 1 ?           10 
HELX_P HELX_P53 4D  TYR D 161 ? SER D 180 ? TYR D 160 SER D 179 1 ?           20 
HELX_P HELX_P54 4E1 LEU D 199 ? ASP D 219 ? LEU D 198 ASP D 218 1 ?           21 
HELX_P HELX_P55 4E2 LEU D 224 ? GLY D 226 ? LEU D 223 GLY D 225 5 ?           3  
HELX_P HELX_P56 4F  PRO D 245 ? THR D 259 ? PRO D 245 THR D 259 1 ?           15 
HELX_P HELX_P57 4G  GLU D 276 ? ILE D 286 ? GLU D 276 ILE D 286 1 ?           11 
HELX_P HELX_P58 4H1 ARG D 303 ? TRP D 313 ? ARG D 303 TRP D 313 1 ?           11 
HELX_P HELX_P59 4H2 LYS D 317 ? ASN D 319 ? LYS D 317 ASN D 319 5 ?           3  
HELX_P HELX_P60 4H3 ILE D 320 ? ALA D 337 ? ILE D 320 ALA D 337 1 ?           18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A THR 2 N ? ? A ACE 0 A THR 1 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? B ACE 1 C ? ? ? 1_555 B THR 2 N ? ? B ACE 0 B THR 1 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale3 covale ? ? C ACE 1 C ? ? ? 1_555 C THR 2 N ? ? C ACE 0 C THR 1 1_555 ? ? ? ? ? ? ? 1.342 ? 
covale4 covale ? ? D ACE 1 C ? ? ? 1_555 D THR 2 N ? ? D ACE 0 D THR 1 1_555 ? ? ? ? ? ? ? 1.340 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 158 A . ? THR 157 A PRO 159 A ? PRO 158 A 1 1.80 
2 THR 158 B . ? THR 157 B PRO 159 B ? PRO 158 B 1 2.85 
3 THR 158 C . ? THR 157 C PRO 159 C ? PRO 158 C 1 4.55 
4 THR 158 D . ? THR 157 D PRO 159 D ? PRO 158 D 1 0.75 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
PS1 ? 8 ? 
AS1 ? 2 ? 
PS2 ? 8 ? 
AS2 ? 2 ? 
PS3 ? 8 ? 
AS3 ? 2 ? 
PS4 ? 8 ? 
AS4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
PS1 1 2 ? parallel      
PS1 2 3 ? parallel      
PS1 3 4 ? parallel      
PS1 4 5 ? parallel      
PS1 5 6 ? parallel      
PS1 6 7 ? parallel      
PS1 7 8 ? parallel      
AS1 1 2 ? anti-parallel 
PS2 1 2 ? parallel      
PS2 2 3 ? parallel      
PS2 3 4 ? parallel      
PS2 4 5 ? parallel      
PS2 5 6 ? parallel      
PS2 6 7 ? parallel      
PS2 7 8 ? parallel      
AS2 1 2 ? anti-parallel 
PS3 1 2 ? parallel      
PS3 2 3 ? parallel      
PS3 3 4 ? parallel      
PS3 4 5 ? parallel      
PS3 5 6 ? parallel      
PS3 6 7 ? parallel      
PS3 7 8 ? parallel      
AS3 1 2 ? anti-parallel 
PS4 1 2 ? parallel      
PS4 2 3 ? parallel      
PS4 3 4 ? parallel      
PS4 4 5 ? parallel      
PS4 5 6 ? parallel      
PS4 6 7 ? parallel      
PS4 7 8 ? parallel      
AS4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
PS1 1 ILE A 104 ? LYS A 108 ? ILE A 103 LYS A 107 
PS1 2 ILE A 74  ? LEU A 79  ? ILE A 73  LEU A 78  
PS1 3 GLY A 29  ? ALA A 33  ? GLY A 28  ALA A 32  
PS1 4 ALA A 296 ? TYR A 301 ? ALA A 296 TYR A 301 
PS1 5 GLY A 266 ? PHE A 269 ? GLY A 266 PHE A 269 
PS1 6 LEU A 228 ? LEU A 229 ? LEU A 227 LEU A 228 
PS1 7 VAL A 184 ? VAL A 191 ? VAL A 183 VAL A 190 
PS1 8 CYS A 143 ? LEU A 152 ? CYS A 142 LEU A 151 
AS1 1 VAL A 113 ? PRO A 115 ? VAL A 112 PRO A 114 
AS1 2 VAL A 123 ? THR A 125 ? VAL A 122 THR A 124 
PS2 1 ILE B 104 ? LYS B 108 ? ILE B 103 LYS B 107 
PS2 2 ILE B 74  ? LEU B 79  ? ILE B 73  LEU B 78  
PS2 3 GLY B 29  ? ALA B 33  ? GLY B 28  ALA B 32  
PS2 4 ALA B 296 ? TYR B 301 ? ALA B 296 TYR B 301 
PS2 5 GLY B 266 ? PHE B 269 ? GLY B 266 PHE B 269 
PS2 6 LEU B 228 ? LEU B 229 ? LEU B 227 LEU B 228 
PS2 7 VAL B 184 ? VAL B 191 ? VAL B 183 VAL B 190 
PS2 8 CYS B 143 ? LEU B 152 ? CYS B 142 LEU B 151 
AS2 1 VAL B 113 ? PRO B 115 ? VAL B 112 PRO B 114 
AS2 2 VAL B 123 ? THR B 125 ? VAL B 122 THR B 124 
PS3 1 ILE C 104 ? LYS C 108 ? ILE C 103 LYS C 107 
PS3 2 ILE C 74  ? LEU C 79  ? ILE C 73  LEU C 78  
PS3 3 GLY C 29  ? ALA C 33  ? GLY C 28  ALA C 32  
PS3 4 ALA C 296 ? TYR C 301 ? ALA C 296 TYR C 301 
PS3 5 GLY C 266 ? PHE C 269 ? GLY C 266 PHE C 269 
PS3 6 LEU C 228 ? LEU C 229 ? LEU C 227 LEU C 228 
PS3 7 VAL C 184 ? VAL C 191 ? VAL C 183 VAL C 190 
PS3 8 CYS C 143 ? LEU C 152 ? CYS C 142 LEU C 151 
AS3 1 VAL C 113 ? PRO C 115 ? VAL C 112 PRO C 114 
AS3 2 VAL C 123 ? THR C 125 ? VAL C 122 THR C 124 
PS4 1 ILE D 104 ? LYS D 108 ? ILE D 103 LYS D 107 
PS4 2 ILE D 74  ? LEU D 79  ? ILE D 73  LEU D 78  
PS4 3 GLY D 29  ? ALA D 33  ? GLY D 28  ALA D 32  
PS4 4 ALA D 296 ? TYR D 301 ? ALA D 296 TYR D 301 
PS4 5 GLY D 266 ? PHE D 269 ? GLY D 266 PHE D 269 
PS4 6 LEU D 228 ? LEU D 229 ? LEU D 227 LEU D 228 
PS4 7 VAL D 184 ? VAL D 191 ? VAL D 183 VAL D 190 
PS4 8 CYS D 143 ? LEU D 152 ? CYS D 142 LEU D 151 
AS4 1 VAL D 113 ? PRO D 115 ? VAL D 112 PRO D 114 
AS4 2 VAL D 123 ? THR D 125 ? VAL D 122 THR D 124 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
PS1 1 2 N ILE A 104 ? N ILE A 103 O SER A 75  ? O SER A 74  
PS1 2 3 N SER A 75  ? N SER A 74  O GLY A 29  ? O GLY A 28  
PS1 3 4 N ILE A 30  ? N ILE A 29  O PHE A 299 ? O PHE A 299 
PS1 4 5 O ALA A 296 ? O ALA A 296 N VAL A 267 ? N VAL A 267 
PS1 5 6 O GLY A 266 ? O GLY A 266 N LEU A 229 ? N LEU A 228 
PS1 6 7 N LEU A 228 ? N LEU A 227 O PRO A 185 ? O PRO A 184 
PS1 7 8 N VAL A 184 ? N VAL A 183 O ASP A 144 ? O ASP A 143 
AS1 1 2 O VAL A 114 ? O VAL A 113 N THR A 124 ? N THR A 123 
PS2 1 2 N ILE B 104 ? N ILE B 103 O SER B 75  ? O SER B 74  
PS2 2 3 N SER B 75  ? N SER B 74  O GLY B 29  ? O GLY B 28  
PS2 3 4 N ILE B 30  ? N ILE B 29  O PHE B 299 ? O PHE B 299 
PS2 4 5 O ALA B 296 ? O ALA B 296 N VAL B 267 ? N VAL B 267 
PS2 5 6 O GLY B 266 ? O GLY B 266 N LEU B 229 ? N LEU B 228 
PS2 6 7 N LEU B 228 ? N LEU B 227 O PRO B 185 ? O PRO B 184 
PS2 7 8 N VAL B 184 ? N VAL B 183 O ASP B 144 ? O ASP B 143 
AS2 1 2 O VAL B 114 ? O VAL B 113 N THR B 124 ? N THR B 123 
PS3 1 2 N ILE C 104 ? N ILE C 103 O SER C 75  ? O SER C 74  
PS3 2 3 N SER C 75  ? N SER C 74  O GLY C 29  ? O GLY C 28  
PS3 3 4 N ILE C 30  ? N ILE C 29  O PHE C 299 ? O PHE C 299 
PS3 4 5 O ALA C 296 ? O ALA C 296 N VAL C 267 ? N VAL C 267 
PS3 5 6 O GLY C 266 ? O GLY C 266 N LEU C 229 ? N LEU C 228 
PS3 6 7 N LEU C 228 ? N LEU C 227 O PRO C 185 ? O PRO C 184 
PS3 7 8 N VAL C 184 ? N VAL C 183 O ASP C 144 ? O ASP C 143 
AS3 1 2 O VAL C 114 ? O VAL C 113 N THR C 124 ? N THR C 123 
PS4 1 2 N ILE D 104 ? N ILE D 103 O SER D 75  ? O SER D 74  
PS4 2 3 N SER D 75  ? N SER D 74  O GLY D 29  ? O GLY D 28  
PS4 3 4 N ILE D 30  ? N ILE D 29  O PHE D 299 ? O PHE D 299 
PS4 4 5 O ALA D 296 ? O ALA D 296 N VAL D 267 ? N VAL D 267 
PS4 5 6 O GLY D 266 ? O GLY D 266 N LEU D 229 ? N LEU D 228 
PS4 6 7 N LEU D 228 ? N LEU D 227 O PRO D 185 ? O PRO D 184 
PS4 7 8 N VAL D 184 ? N VAL D 183 O ASP D 144 ? O ASP D 143 
AS4 1 2 O VAL D 114 ? O VAL D 113 N THR D 124 ? N THR D 123 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
FBA Unknown ? ? ? ? 1 ? 
FBB Unknown ? ? ? ? 1 ? 
FBC Unknown ? ? ? ? 1 ? 
FBD Unknown ? ? ? ? 1 ? 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 FBA 1 LYS A 230 ? LYS A 229 . ? 1_555 ? 
2 FBB 1 LYS B 230 ? LYS B 229 . ? 1_555 ? 
3 FBC 1 LYS C 230 ? LYS C 229 . ? 1_555 ? 
4 FBD 1 LYS D 230 ? LYS D 229 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1FBA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FBA 
_atom_sites.fract_transf_matrix[1][1]   0.011547 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008562 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006597 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
_atom_sites_footnote.id     1 
_atom_sites_footnote.text   'RESIDUE 158 IS A CIS PROLINE IN ALL FOUR CHAINS.' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     C C   . ACE A 1 1   ? 0.381   2.713   31.020  1.00 8.88  ? 0    ACE A C   1 
HETATM 2     O O   . ACE A 1 1   ? 1.026   2.046   31.840  1.00 10.45 ? 0    ACE A O   1 
HETATM 3     C CH3 . ACE A 1 1   ? 0.888   3.996   30.444  1.00 9.25  ? 0    ACE A CH3 1 
ATOM   4     N N   . THR A 1 2   ? -0.810  2.282   30.618  1.00 8.29  ? 1    THR A N   1 
ATOM   5     C CA  . THR A 1 2   ? -1.348  0.990   30.975  1.00 8.35  ? 1    THR A CA  1 
ATOM   6     C C   . THR A 1 2   ? -1.393  0.075   29.752  1.00 9.20  ? 1    THR A C   1 
ATOM   7     O O   . THR A 1 2   ? -2.213  0.370   28.836  1.00 9.67  ? 1    THR A O   1 
ATOM   8     C CB  . THR A 1 2   ? -2.858  1.121   31.489  1.00 5.86  ? 1    THR A CB  1 
ATOM   9     O OG1 . THR A 1 2   ? -2.904  2.138   32.511  1.00 5.39  ? 1    THR A OG1 1 
ATOM   10    C CG2 . THR A 1 2   ? -3.430  -0.217  31.947  1.00 4.90  ? 1    THR A CG2 1 
ATOM   11    N N   . THR A 1 3   ? -0.675  -1.011  29.756  1.00 9.75  ? 2    THR A N   1 
ATOM   12    C CA  . THR A 1 3   ? -0.634  -1.881  28.555  1.00 9.85  ? 2    THR A CA  1 
ATOM   13    C C   . THR A 1 3   ? -1.580  -3.051  28.593  1.00 9.85  ? 2    THR A C   1 
ATOM   14    O O   . THR A 1 3   ? -1.889  -3.618  27.527  1.00 9.17  ? 2    THR A O   1 
ATOM   15    C CB  . THR A 1 3   ? 0.861   -2.338  28.309  1.00 9.47  ? 2    THR A CB  1 
ATOM   16    O OG1 . THR A 1 3   ? 1.195   -3.176  29.447  1.00 9.67  ? 2    THR A OG1 1 
ATOM   17    C CG2 . THR A 1 3   ? 1.817   -1.159  28.131  1.00 8.58  ? 2    THR A CG2 1 
ATOM   18    N N   . TYR A 1 4   ? -2.013  -3.440  29.788  1.00 9.63  ? 3    TYR A N   1 
ATOM   19    C CA  . TYR A 1 4   ? -2.980  -4.556  29.923  1.00 10.65 ? 3    TYR A CA  1 
ATOM   20    C C   . TYR A 1 4   ? -4.375  -3.917  30.013  1.00 11.28 ? 3    TYR A C   1 
ATOM   21    O O   . TYR A 1 4   ? -4.683  -3.250  31.017  1.00 12.40 ? 3    TYR A O   1 
ATOM   22    C CB  . TYR A 1 4   ? -2.680  -5.421  31.149  1.00 10.29 ? 3    TYR A CB  1 
ATOM   23    C CG  . TYR A 1 4   ? -1.445  -6.294  31.128  1.00 10.22 ? 3    TYR A CG  1 
ATOM   24    C CD1 . TYR A 1 4   ? -1.468  -7.506  30.434  1.00 9.32  ? 3    TYR A CD1 1 
ATOM   25    C CD2 . TYR A 1 4   ? -0.277  -5.945  31.805  1.00 8.08  ? 3    TYR A CD2 1 
ATOM   26    C CE1 . TYR A 1 4   ? -0.361  -8.362  30.399  1.00 9.08  ? 3    TYR A CE1 1 
ATOM   27    C CE2 . TYR A 1 4   ? 0.837   -6.776  31.788  1.00 8.84  ? 3    TYR A CE2 1 
ATOM   28    C CZ  . TYR A 1 4   ? 0.787   -7.984  31.086  1.00 9.43  ? 3    TYR A CZ  1 
ATOM   29    O OH  . TYR A 1 4   ? 1.850   -8.840  31.038  1.00 8.84  ? 3    TYR A OH  1 
ATOM   30    N N   . PHE A 1 5   ? -5.157  -4.098  28.961  1.00 11.26 ? 4    PHE A N   1 
ATOM   31    C CA  . PHE A 1 5   ? -6.526  -3.535  28.930  1.00 10.71 ? 4    PHE A CA  1 
ATOM   32    C C   . PHE A 1 5   ? -7.342  -4.313  27.902  1.00 10.62 ? 4    PHE A C   1 
ATOM   33    O O   . PHE A 1 5   ? -6.793  -5.149  27.177  1.00 11.42 ? 4    PHE A O   1 
ATOM   34    C CB  . PHE A 1 5   ? -6.557  -2.032  28.714  1.00 9.18  ? 4    PHE A CB  1 
ATOM   35    C CG  . PHE A 1 5   ? -6.059  -1.559  27.385  1.00 9.43  ? 4    PHE A CG  1 
ATOM   36    C CD1 . PHE A 1 5   ? -4.697  -1.325  27.183  1.00 9.55  ? 4    PHE A CD1 1 
ATOM   37    C CD2 . PHE A 1 5   ? -6.953  -1.388  26.332  1.00 9.51  ? 4    PHE A CD2 1 
ATOM   38    C CE1 . PHE A 1 5   ? -4.227  -0.893  25.936  1.00 9.64  ? 4    PHE A CE1 1 
ATOM   39    C CE2 . PHE A 1 5   ? -6.518  -0.939  25.083  1.00 8.14  ? 4    PHE A CE2 1 
ATOM   40    C CZ  . PHE A 1 5   ? -5.155  -0.694  24.895  1.00 9.48  ? 4    PHE A CZ  1 
ATOM   41    N N   . ASN A 1 6   ? -8.619  -4.000  27.888  1.00 11.16 ? 5    ASN A N   1 
ATOM   42    C CA  . ASN A 1 6   ? -9.564  -4.690  26.982  1.00 12.34 ? 5    ASN A CA  1 
ATOM   43    C C   . ASN A 1 6   ? -10.104 -3.736  25.923  1.00 11.86 ? 5    ASN A C   1 
ATOM   44    O O   . ASN A 1 6   ? -10.718 -2.703  26.215  1.00 12.65 ? 5    ASN A O   1 
ATOM   45    C CB  . ASN A 1 6   ? -10.680 -5.360  27.781  1.00 14.09 ? 5    ASN A CB  1 
ATOM   46    C CG  . ASN A 1 6   ? -10.196 -6.407  28.760  1.00 15.96 ? 5    ASN A CG  1 
ATOM   47    O OD1 . ASN A 1 6   ? -9.675  -7.467  28.385  1.00 18.05 ? 5    ASN A OD1 1 
ATOM   48    N ND2 . ASN A 1 6   ? -10.413 -6.144  30.048  1.00 18.70 ? 5    ASN A ND2 1 
ATOM   49    N N   . TYR A 1 7   ? -9.847  -4.138  24.680  1.00 11.81 ? 6    TYR A N   1 
ATOM   50    C CA  . TYR A 1 7   ? -10.517 -3.470  23.540  1.00 11.66 ? 6    TYR A CA  1 
ATOM   51    C C   . TYR A 1 7   ? -12.015 -3.835  23.669  1.00 11.52 ? 6    TYR A C   1 
ATOM   52    O O   . TYR A 1 7   ? -12.329 -4.914  24.180  1.00 11.34 ? 6    TYR A O   1 
ATOM   53    C CB  . TYR A 1 7   ? -9.996  -4.066  22.222  1.00 11.73 ? 6    TYR A CB  1 
ATOM   54    C CG  . TYR A 1 7   ? -8.614  -3.660  21.794  1.00 10.96 ? 6    TYR A CG  1 
ATOM   55    C CD1 . TYR A 1 7   ? -8.199  -2.325  21.857  1.00 10.48 ? 6    TYR A CD1 1 
ATOM   56    C CD2 . TYR A 1 7   ? -7.717  -4.611  21.302  1.00 10.54 ? 6    TYR A CD2 1 
ATOM   57    C CE1 . TYR A 1 7   ? -6.918  -1.947  21.447  1.00 10.87 ? 6    TYR A CE1 1 
ATOM   58    C CE2 . TYR A 1 7   ? -6.434  -4.242  20.888  1.00 11.10 ? 6    TYR A CE2 1 
ATOM   59    C CZ  . TYR A 1 7   ? -6.045  -2.917  20.965  1.00 10.99 ? 6    TYR A CZ  1 
ATOM   60    O OH  . TYR A 1 7   ? -4.782  -2.585  20.534  1.00 12.09 ? 6    TYR A OH  1 
ATOM   61    N N   . PRO A 1 8   ? -12.847 -2.963  23.142  1.00 11.96 ? 7    PRO A N   1 
ATOM   62    C CA  . PRO A 1 8   ? -14.286 -3.253  23.054  1.00 12.05 ? 7    PRO A CA  1 
ATOM   63    C C   . PRO A 1 8   ? -14.482 -4.487  22.177  1.00 11.91 ? 7    PRO A C   1 
ATOM   64    O O   . PRO A 1 8   ? -13.578 -4.848  21.395  1.00 11.72 ? 7    PRO A O   1 
ATOM   65    C CB  . PRO A 1 8   ? -14.904 -1.998  22.496  1.00 11.69 ? 7    PRO A CB  1 
ATOM   66    C CG  . PRO A 1 8   ? -13.803 -1.074  22.120  1.00 12.30 ? 7    PRO A CG  1 
ATOM   67    C CD  . PRO A 1 8   ? -12.489 -1.684  22.510  1.00 11.37 ? 7    PRO A CD  1 
ATOM   68    N N   . SER A 1 9   ? -15.626 -5.131  22.347  1.00 11.68 ? 8    SER A N   1 
ATOM   69    C CA  . SER A 1 9   ? -15.958 -6.348  21.572  1.00 11.91 ? 8    SER A CA  1 
ATOM   70    C C   . SER A 1 9   ? -16.024 -5.933  20.090  1.00 11.61 ? 8    SER A C   1 
ATOM   71    O O   . SER A 1 9   ? -16.274 -4.768  19.815  1.00 10.50 ? 8    SER A O   1 
ATOM   72    C CB  . SER A 1 9   ? -17.304 -6.941  21.968  1.00 11.10 ? 8    SER A CB  1 
ATOM   73    O OG  . SER A 1 9   ? -18.350 -6.084  21.537  1.00 11.77 ? 8    SER A OG  1 
ATOM   74    N N   . LYS A 1 10  ? -15.800 -6.925  19.239  1.00 12.48 ? 9    LYS A N   1 
ATOM   75    C CA  . LYS A 1 10  ? -15.876 -6.683  17.787  1.00 13.70 ? 9    LYS A CA  1 
ATOM   76    C C   . LYS A 1 10  ? -17.224 -6.078  17.437  1.00 13.38 ? 9    LYS A C   1 
ATOM   77    O O   . LYS A 1 10  ? -17.294 -5.085  16.690  1.00 13.85 ? 9    LYS A O   1 
ATOM   78    C CB  . LYS A 1 10  ? -15.637 -7.954  16.981  1.00 16.70 ? 9    LYS A CB  1 
ATOM   79    C CG  . LYS A 1 10  ? -15.732 -7.747  15.458  1.00 20.51 ? 9    LYS A CG  1 
ATOM   80    C CD  . LYS A 1 10  ? -15.824 -9.095  14.748  1.00 24.15 ? 9    LYS A CD  1 
ATOM   81    C CE  . LYS A 1 10  ? -16.419 -8.956  13.357  1.00 26.39 ? 9    LYS A CE  1 
ATOM   82    N NZ  . LYS A 1 10  ? -15.720 -7.868  12.619  1.00 27.78 ? 9    LYS A NZ  1 
ATOM   83    N N   . GLU A 1 11  ? -18.295 -6.635  17.986  1.00 13.33 ? 10   GLU A N   1 
ATOM   84    C CA  . GLU A 1 11  ? -19.641 -6.144  17.652  1.00 13.24 ? 10   GLU A CA  1 
ATOM   85    C C   . GLU A 1 11  ? -19.850 -4.717  18.114  1.00 12.06 ? 10   GLU A C   1 
ATOM   86    O O   . GLU A 1 11  ? -20.624 -3.989  17.451  1.00 11.19 ? 10   GLU A O   1 
ATOM   87    C CB  . GLU A 1 11  ? -20.783 -6.986  18.187  1.00 17.00 ? 10   GLU A CB  1 
ATOM   88    C CG  . GLU A 1 11  ? -20.704 -8.505  18.027  1.00 22.34 ? 10   GLU A CG  1 
ATOM   89    C CD  . GLU A 1 11  ? -19.583 -9.128  18.832  1.00 26.00 ? 10   GLU A CD  1 
ATOM   90    O OE1 . GLU A 1 11  ? -19.243 -8.701  19.923  1.00 27.39 ? 10   GLU A OE1 1 
ATOM   91    O OE2 . GLU A 1 11  ? -19.062 -10.102 18.245  1.00 28.21 ? 10   GLU A OE2 1 
ATOM   92    N N   . LEU A 1 12  ? -19.239 -4.315  19.228  1.00 10.47 ? 11   LEU A N   1 
ATOM   93    C CA  . LEU A 1 12  ? -19.346 -2.927  19.677  1.00 9.57  ? 11   LEU A CA  1 
ATOM   94    C C   . LEU A 1 12  ? -18.496 -2.013  18.788  1.00 9.41  ? 11   LEU A C   1 
ATOM   95    O O   . LEU A 1 12  ? -18.899 -0.879  18.488  1.00 9.83  ? 11   LEU A O   1 
ATOM   96    C CB  . LEU A 1 12  ? -18.993 -2.799  21.166  1.00 10.12 ? 11   LEU A CB  1 
ATOM   97    C CG  . LEU A 1 12  ? -19.104 -1.378  21.715  1.00 11.19 ? 11   LEU A CG  1 
ATOM   98    C CD1 . LEU A 1 12  ? -20.533 -0.855  21.562  1.00 12.09 ? 11   LEU A CD1 1 
ATOM   99    C CD2 . LEU A 1 12  ? -18.725 -1.391  23.194  1.00 12.72 ? 11   LEU A CD2 1 
ATOM   100   N N   . GLN A 1 13  ? -17.315 -2.490  18.430  1.00 8.87  ? 12   GLN A N   1 
ATOM   101   C CA  . GLN A 1 13  ? -16.437 -1.712  17.520  1.00 9.25  ? 12   GLN A CA  1 
ATOM   102   C C   . GLN A 1 13  ? -17.169 -1.393  16.201  1.00 8.50  ? 12   GLN A C   1 
ATOM   103   O O   . GLN A 1 13  ? -17.214 -0.239  15.772  1.00 7.45  ? 12   GLN A O   1 
ATOM   104   C CB  . GLN A 1 13  ? -15.145 -2.467  17.236  1.00 8.60  ? 12   GLN A CB  1 
ATOM   105   C CG  . GLN A 1 13  ? -14.137 -2.434  18.375  1.00 10.98 ? 12   GLN A CG  1 
ATOM   106   C CD  . GLN A 1 13  ? -12.935 -3.289  18.072  1.00 11.88 ? 12   GLN A CD  1 
ATOM   107   O OE1 . GLN A 1 13  ? -12.406 -3.266  16.965  1.00 12.32 ? 12   GLN A OE1 1 
ATOM   108   N NE2 . GLN A 1 13  ? -12.527 -4.092  19.048  1.00 13.70 ? 12   GLN A NE2 1 
ATOM   109   N N   . ASP A 1 14  ? -17.753 -2.427  15.633  1.00 9.29  ? 13   ASP A N   1 
ATOM   110   C CA  . ASP A 1 14  ? -18.413 -2.328  14.295  1.00 9.41  ? 13   ASP A CA  1 
ATOM   111   C C   . ASP A 1 14  ? -19.561 -1.342  14.347  1.00 9.14  ? 13   ASP A C   1 
ATOM   112   O O   . ASP A 1 14  ? -19.763 -0.476  13.472  1.00 9.47  ? 13   ASP A O   1 
ATOM   113   C CB  . ASP A 1 14  ? -18.843 -3.730  13.862  1.00 11.56 ? 13   ASP A CB  1 
ATOM   114   C CG  . ASP A 1 14  ? -17.677 -4.605  13.439  1.00 13.45 ? 13   ASP A CG  1 
ATOM   115   O OD1 . ASP A 1 14  ? -16.583 -4.026  13.286  1.00 13.86 ? 13   ASP A OD1 1 
ATOM   116   O OD2 . ASP A 1 14  ? -17.843 -5.826  13.277  1.00 14.86 ? 13   ASP A OD2 1 
ATOM   117   N N   . GLU A 1 15  ? -20.357 -1.468  15.420  1.00 8.61  ? 14   GLU A N   1 
ATOM   118   C CA  . GLU A 1 15  ? -21.510 -0.574  15.578  1.00 8.47  ? 14   GLU A CA  1 
ATOM   119   C C   . GLU A 1 15  ? -21.104 0.870   15.684  1.00 7.86  ? 14   GLU A C   1 
ATOM   120   O O   . GLU A 1 15  ? -21.670 1.761   15.015  1.00 6.61  ? 14   GLU A O   1 
ATOM   121   C CB  . GLU A 1 15  ? -22.426 -0.953  16.750  1.00 9.86  ? 14   GLU A CB  1 
ATOM   122   C CG  . GLU A 1 15  ? -23.631 -0.017  16.950  1.00 11.46 ? 14   GLU A CG  1 
ATOM   123   C CD  . GLU A 1 15  ? -24.586 -0.416  18.040  1.00 10.75 ? 14   GLU A CD  1 
ATOM   124   O OE1 . GLU A 1 15  ? -24.377 -1.327  18.804  1.00 12.54 ? 14   GLU A OE1 1 
ATOM   125   O OE2 . GLU A 1 15  ? -25.614 0.293   18.055  1.00 14.04 ? 14   GLU A OE2 1 
ATOM   126   N N   . LEU A 1 16  ? -20.079 1.149   16.520  1.00 7.66  ? 15   LEU A N   1 
ATOM   127   C CA  . LEU A 1 16  ? -19.680 2.539   16.763  1.00 7.57  ? 15   LEU A CA  1 
ATOM   128   C C   . LEU A 1 16  ? -19.075 3.141   15.482  1.00 7.75  ? 15   LEU A C   1 
ATOM   129   O O   . LEU A 1 16  ? -19.381 4.282   15.133  1.00 7.79  ? 15   LEU A O   1 
ATOM   130   C CB  . LEU A 1 16  ? -18.746 2.605   17.974  1.00 7.73  ? 15   LEU A CB  1 
ATOM   131   C CG  . LEU A 1 16  ? -19.357 2.239   19.340  1.00 7.07  ? 15   LEU A CG  1 
ATOM   132   C CD1 . LEU A 1 16  ? -18.243 2.197   20.398  1.00 5.94  ? 15   LEU A CD1 1 
ATOM   133   C CD2 . LEU A 1 16  ? -20.384 3.305   19.704  1.00 4.42  ? 15   LEU A CD2 1 
ATOM   134   N N   . ARG A 1 17  ? -18.231 2.345   14.843  1.00 8.18  ? 16   ARG A N   1 
ATOM   135   C CA  . ARG A 1 17  ? -17.541 2.834   13.628  1.00 9.61  ? 16   ARG A CA  1 
ATOM   136   C C   . ARG A 1 17  ? -18.559 3.131   12.536  1.00 9.29  ? 16   ARG A C   1 
ATOM   137   O O   . ARG A 1 17  ? -18.506 4.188   11.876  1.00 9.24  ? 16   ARG A O   1 
ATOM   138   C CB  . ARG A 1 17  ? -16.457 1.878   13.140  1.00 11.35 ? 16   ARG A CB  1 
ATOM   139   C CG  . ARG A 1 17  ? -15.559 2.552   12.071  1.00 15.29 ? 16   ARG A CG  1 
ATOM   140   C CD  . ARG A 1 17  ? -14.812 1.501   11.305  1.00 19.02 ? 16   ARG A CD  1 
ATOM   141   N NE  . ARG A 1 17  ? -14.510 0.386   12.154  1.00 20.91 ? 16   ARG A NE  1 
ATOM   142   C CZ  . ARG A 1 17  ? -14.982 -0.842  12.144  1.00 21.80 ? 16   ARG A CZ  1 
ATOM   143   N NH1 . ARG A 1 17  ? -15.769 -1.253  11.147  1.00 21.57 ? 16   ARG A NH1 1 
ATOM   144   N NH2 . ARG A 1 17  ? -14.618 -1.707  13.097  1.00 20.58 ? 16   ARG A NH2 1 
ATOM   145   N N   . GLU A 1 18  ? -19.482 2.196   12.380  1.00 9.96  ? 17   GLU A N   1 
ATOM   146   C CA  . GLU A 1 18  ? -20.555 2.381   11.362  1.00 10.70 ? 17   GLU A CA  1 
ATOM   147   C C   . GLU A 1 18  ? -21.349 3.634   11.586  1.00 9.81  ? 17   GLU A C   1 
ATOM   148   O O   . GLU A 1 18  ? -21.618 4.388   10.628  1.00 9.58  ? 17   GLU A O   1 
ATOM   149   C CB  . GLU A 1 18  ? -21.486 1.182   11.295  1.00 14.60 ? 17   GLU A CB  1 
ATOM   150   C CG  . GLU A 1 18  ? -22.694 1.266   10.350  1.00 21.68 ? 17   GLU A CG  1 
ATOM   151   C CD  . GLU A 1 18  ? -23.562 0.035   10.420  1.00 24.94 ? 17   GLU A CD  1 
ATOM   152   O OE1 . GLU A 1 18  ? -23.295 -1.006  9.845   1.00 28.90 ? 17   GLU A OE1 1 
ATOM   153   O OE2 . GLU A 1 18  ? -24.541 0.201   11.180  1.00 27.81 ? 17   GLU A OE2 1 
ATOM   154   N N   . ILE A 1 19  ? -21.784 3.894   12.819  1.00 9.13  ? 18   ILE A N   1 
ATOM   155   C CA  . ILE A 1 19  ? -22.496 5.125   13.137  1.00 8.49  ? 18   ILE A CA  1 
ATOM   156   C C   . ILE A 1 19  ? -21.672 6.355   12.788  1.00 7.54  ? 18   ILE A C   1 
ATOM   157   O O   . ILE A 1 19  ? -22.172 7.295   12.142  1.00 6.82  ? 18   ILE A O   1 
ATOM   158   C CB  . ILE A 1 19  ? -22.989 5.184   14.633  1.00 9.54  ? 18   ILE A CB  1 
ATOM   159   C CG1 . ILE A 1 19  ? -24.031 4.072   14.913  1.00 10.72 ? 18   ILE A CG1 1 
ATOM   160   C CG2 . ILE A 1 19  ? -23.500 6.585   15.024  1.00 9.76  ? 18   ILE A CG2 1 
ATOM   161   C CD1 . ILE A 1 19  ? -24.142 3.716   16.427  1.00 11.28 ? 18   ILE A CD1 1 
ATOM   162   N N   . ALA A 1 20  ? -20.416 6.379   13.236  1.00 7.37  ? 19   ALA A N   1 
ATOM   163   C CA  . ALA A 1 20  ? -19.575 7.578   13.001  1.00 7.12  ? 19   ALA A CA  1 
ATOM   164   C C   . ALA A 1 20  ? -19.381 7.833   11.503  1.00 6.49  ? 19   ALA A C   1 
ATOM   165   O O   . ALA A 1 20  ? -19.391 9.005   11.057  1.00 6.33  ? 19   ALA A O   1 
ATOM   166   C CB  . ALA A 1 20  ? -18.260 7.407   13.767  1.00 5.13  ? 19   ALA A CB  1 
ATOM   167   N N   . GLN A 1 21  ? -19.218 6.776   10.753  1.00 7.73  ? 20   GLN A N   1 
ATOM   168   C CA  . GLN A 1 21  ? -19.016 6.814   9.288   1.00 8.79  ? 20   GLN A CA  1 
ATOM   169   C C   . GLN A 1 21  ? -20.232 7.413   8.597   1.00 9.01  ? 20   GLN A C   1 
ATOM   170   O O   . GLN A 1 21  ? -20.118 8.236   7.657   1.00 8.57  ? 20   GLN A O   1 
ATOM   171   C CB  . GLN A 1 21  ? -18.641 5.421   8.750   1.00 11.60 ? 20   GLN A CB  1 
ATOM   172   C CG  . GLN A 1 21  ? -17.187 5.057   8.979   1.00 15.17 ? 20   GLN A CG  1 
ATOM   173   C CD  . GLN A 1 21  ? -16.812 3.651   8.593   1.00 17.64 ? 20   GLN A CD  1 
ATOM   174   O OE1 . GLN A 1 21  ? -17.614 2.809   8.204   1.00 19.64 ? 20   GLN A OE1 1 
ATOM   175   N NE2 . GLN A 1 21  ? -15.519 3.342   8.722   1.00 18.70 ? 20   GLN A NE2 1 
ATOM   176   N N   . LYS A 1 22  ? -21.413 7.045   9.081   1.00 8.72  ? 21   LYS A N   1 
ATOM   177   C CA  . LYS A 1 22  ? -22.680 7.532   8.543   1.00 9.11  ? 21   LYS A CA  1 
ATOM   178   C C   . LYS A 1 22  ? -22.833 9.029   8.750   1.00 8.28  ? 21   LYS A C   1 
ATOM   179   O O   . LYS A 1 22  ? -23.304 9.717   7.828   1.00 7.70  ? 21   LYS A O   1 
ATOM   180   C CB  . LYS A 1 22  ? -23.916 6.868   9.154   1.00 11.66 ? 21   LYS A CB  1 
ATOM   181   C CG  . LYS A 1 22  ? -24.107 5.427   8.710   1.00 16.03 ? 21   LYS A CG  1 
ATOM   182   C CD  . LYS A 1 22  ? -25.554 4.979   8.930   1.00 18.85 ? 21   LYS A CD  1 
ATOM   183   C CE  . LYS A 1 22  ? -25.628 3.463   8.960   1.00 22.02 ? 21   LYS A CE  1 
ATOM   184   N NZ  . LYS A 1 22  ? -26.940 3.019   9.508   1.00 23.57 ? 21   LYS A NZ  1 
ATOM   185   N N   . ILE A 1 23  ? -22.461 9.493   9.946   1.00 7.50  ? 22   ILE A N   1 
ATOM   186   C CA  . ILE A 1 23  ? -22.548 10.909  10.277  1.00 7.56  ? 22   ILE A CA  1 
ATOM   187   C C   . ILE A 1 23  ? -21.701 11.788  9.369   1.00 7.26  ? 22   ILE A C   1 
ATOM   188   O O   . ILE A 1 23  ? -22.141 12.925  9.055   1.00 7.99  ? 22   ILE A O   1 
ATOM   189   C CB  . ILE A 1 23  ? -22.232 11.196  11.798  1.00 7.04  ? 22   ILE A CB  1 
ATOM   190   C CG1 . ILE A 1 23  ? -23.305 10.538  12.703  1.00 8.28  ? 22   ILE A CG1 1 
ATOM   191   C CG2 . ILE A 1 23  ? -22.083 12.713  12.079  1.00 7.03  ? 22   ILE A CG2 1 
ATOM   192   C CD1 . ILE A 1 23  ? -22.839 10.420  14.204  1.00 9.14  ? 22   ILE A CD1 1 
ATOM   193   N N   . VAL A 1 24  ? -20.513 11.331  8.977   1.00 7.40  ? 23   VAL A N   1 
ATOM   194   C CA  . VAL A 1 24  ? -19.635 12.159  8.137   1.00 7.65  ? 23   VAL A CA  1 
ATOM   195   C C   . VAL A 1 24  ? -19.583 11.696  6.684   1.00 9.04  ? 23   VAL A C   1 
ATOM   196   O O   . VAL A 1 24  ? -18.541 11.902  6.019   1.00 9.84  ? 23   VAL A O   1 
ATOM   197   C CB  . VAL A 1 24  ? -18.214 12.279  8.732   1.00 6.33  ? 23   VAL A CB  1 
ATOM   198   C CG1 . VAL A 1 24  ? -18.215 13.005  10.071  1.00 4.32  ? 23   VAL A CG1 1 
ATOM   199   C CG2 . VAL A 1 24  ? -17.552 10.920  8.793   1.00 5.18  ? 23   VAL A CG2 1 
ATOM   200   N N   . ALA A 1 25  ? -20.652 11.095  6.223   1.00 9.62  ? 24   ALA A N   1 
ATOM   201   C CA  . ALA A 1 25  ? -20.756 10.675  4.802   1.00 9.95  ? 24   ALA A CA  1 
ATOM   202   C C   . ALA A 1 25  ? -20.527 11.887  3.907   1.00 9.62  ? 24   ALA A C   1 
ATOM   203   O O   . ALA A 1 25  ? -20.864 13.034  4.236   1.00 8.96  ? 24   ALA A O   1 
ATOM   204   C CB  . ALA A 1 25  ? -22.118 10.034  4.598   1.00 11.90 ? 24   ALA A CB  1 
ATOM   205   N N   . PRO A 1 26  ? -19.927 11.623  2.743   1.00 9.95  ? 25   PRO A N   1 
ATOM   206   C CA  . PRO A 1 26  ? -19.579 12.692  1.799   1.00 10.05 ? 25   PRO A CA  1 
ATOM   207   C C   . PRO A 1 26  ? -20.746 13.628  1.559   1.00 9.31  ? 25   PRO A C   1 
ATOM   208   O O   . PRO A 1 26  ? -21.871 13.192  1.264   1.00 10.40 ? 25   PRO A O   1 
ATOM   209   C CB  . PRO A 1 26  ? -19.128 11.944  0.540   1.00 10.47 ? 25   PRO A CB  1 
ATOM   210   C CG  . PRO A 1 26  ? -18.665 10.602  1.059   1.00 10.56 ? 25   PRO A CG  1 
ATOM   211   C CD  . PRO A 1 26  ? -19.635 10.286  2.200   1.00 10.04 ? 25   PRO A CD  1 
ATOM   212   N N   . GLY A 1 27  ? -20.527 14.911  1.707   1.00 8.90  ? 26   GLY A N   1 
ATOM   213   C CA  . GLY A 1 27  ? -21.478 15.975  1.526   1.00 8.74  ? 26   GLY A CA  1 
ATOM   214   C C   . GLY A 1 27  ? -22.493 16.170  2.621   1.00 8.98  ? 26   GLY A C   1 
ATOM   215   O O   . GLY A 1 27  ? -23.447 16.944  2.430   1.00 8.42  ? 26   GLY A O   1 
ATOM   216   N N   . LYS A 1 28  ? -22.312 15.520  3.766   1.00 9.50  ? 27   LYS A N   1 
ATOM   217   C CA  . LYS A 1 28  ? -23.260 15.663  4.901   1.00 9.78  ? 27   LYS A CA  1 
ATOM   218   C C   . LYS A 1 28  ? -22.552 16.197  6.155   1.00 9.97  ? 27   LYS A C   1 
ATOM   219   O O   . LYS A 1 28  ? -21.333 16.027  6.333   1.00 9.61  ? 27   LYS A O   1 
ATOM   220   C CB  . LYS A 1 28  ? -23.892 14.319  5.248   1.00 10.55 ? 27   LYS A CB  1 
ATOM   221   C CG  . LYS A 1 28  ? -24.590 13.668  4.046   1.00 14.63 ? 27   LYS A CG  1 
ATOM   222   C CD  . LYS A 1 28  ? -25.208 12.329  4.407   1.00 16.28 ? 27   LYS A CD  1 
ATOM   223   C CE  . LYS A 1 28  ? -26.368 11.991  3.500   1.00 18.19 ? 27   LYS A CE  1 
ATOM   224   N NZ  . LYS A 1 28  ? -26.934 10.661  3.818   1.00 19.32 ? 27   LYS A NZ  1 
ATOM   225   N N   . GLY A 1 29  ? -23.357 16.795  7.024   1.00 10.34 ? 28   GLY A N   1 
ATOM   226   C CA  . GLY A 1 29  ? -22.923 17.371  8.302   1.00 9.91  ? 28   GLY A CA  1 
ATOM   227   C C   . GLY A 1 29  ? -24.104 17.375  9.279   1.00 10.30 ? 28   GLY A C   1 
ATOM   228   O O   . GLY A 1 29  ? -25.215 16.899  8.954   1.00 10.84 ? 28   GLY A O   1 
ATOM   229   N N   . ILE A 1 30  ? -23.857 17.950  10.439  1.00 9.32  ? 29   ILE A N   1 
ATOM   230   C CA  . ILE A 1 30  ? -24.847 17.929  11.538  1.00 8.60  ? 29   ILE A CA  1 
ATOM   231   C C   . ILE A 1 30  ? -25.516 19.274  11.739  1.00 7.72  ? 29   ILE A C   1 
ATOM   232   O O   . ILE A 1 30  ? -24.892 20.336  11.678  1.00 7.61  ? 29   ILE A O   1 
ATOM   233   C CB  . ILE A 1 30  ? -24.118 17.461  12.878  1.00 7.34  ? 29   ILE A CB  1 
ATOM   234   C CG1 . ILE A 1 30  ? -23.489 16.079  12.661  1.00 8.59  ? 29   ILE A CG1 1 
ATOM   235   C CG2 . ILE A 1 30  ? -25.114 17.479  14.071  1.00 7.81  ? 29   ILE A CG2 1 
ATOM   236   C CD1 . ILE A 1 30  ? -22.548 15.597  13.819  1.00 9.86  ? 29   ILE A CD1 1 
ATOM   237   N N   . LEU A 1 31  ? -26.819 19.197  12.005  1.00 7.98  ? 30   LEU A N   1 
ATOM   238   C CA  . LEU A 1 31  ? -27.596 20.356  12.454  1.00 8.74  ? 30   LEU A CA  1 
ATOM   239   C C   . LEU A 1 31  ? -27.628 20.256  14.005  1.00 9.10  ? 30   LEU A C   1 
ATOM   240   O O   . LEU A 1 31  ? -28.093 19.211  14.487  1.00 8.95  ? 30   LEU A O   1 
ATOM   241   C CB  . LEU A 1 31  ? -29.009 20.246  11.850  1.00 9.99  ? 30   LEU A CB  1 
ATOM   242   C CG  . LEU A 1 31  ? -30.033 21.239  12.409  1.00 11.28 ? 30   LEU A CG  1 
ATOM   243   C CD1 . LEU A 1 31  ? -29.509 22.663  12.385  1.00 11.53 ? 30   LEU A CD1 1 
ATOM   244   C CD2 . LEU A 1 31  ? -31.302 21.159  11.548  1.00 11.46 ? 30   LEU A CD2 1 
ATOM   245   N N   . ALA A 1 32  ? -27.090 21.252  14.661  1.00 9.62  ? 31   ALA A N   1 
ATOM   246   C CA  . ALA A 1 32  ? -27.089 21.291  16.142  1.00 11.57 ? 31   ALA A CA  1 
ATOM   247   C C   . ALA A 1 32  ? -28.288 22.135  16.583  1.00 11.80 ? 31   ALA A C   1 
ATOM   248   O O   . ALA A 1 32  ? -28.263 23.354  16.454  1.00 13.15 ? 31   ALA A O   1 
ATOM   249   C CB  . ALA A 1 32  ? -25.777 21.850  16.669  1.00 9.22  ? 31   ALA A CB  1 
ATOM   250   N N   . ALA A 1 33  ? -29.305 21.450  17.072  1.00 13.23 ? 32   ALA A N   1 
ATOM   251   C CA  . ALA A 1 33  ? -30.569 22.086  17.517  1.00 13.71 ? 32   ALA A CA  1 
ATOM   252   C C   . ALA A 1 33  ? -30.798 21.812  19.006  1.00 15.05 ? 32   ALA A C   1 
ATOM   253   O O   . ALA A 1 33  ? -31.947 21.635  19.454  1.00 15.00 ? 32   ALA A O   1 
ATOM   254   C CB  . ALA A 1 33  ? -31.694 21.475  16.679  1.00 13.20 ? 32   ALA A CB  1 
ATOM   255   N N   . ASP A 1 34  ? -29.701 21.770  19.736  1.00 15.90 ? 33   ASP A N   1 
ATOM   256   C CA  . ASP A 1 34  ? -29.694 21.333  21.142  1.00 17.13 ? 33   ASP A CA  1 
ATOM   257   C C   . ASP A 1 34  ? -29.739 22.499  22.121  1.00 18.00 ? 33   ASP A C   1 
ATOM   258   O O   . ASP A 1 34  ? -29.281 22.343  23.281  1.00 18.86 ? 33   ASP A O   1 
ATOM   259   C CB  . ASP A 1 34  ? -28.489 20.399  21.371  1.00 18.04 ? 33   ASP A CB  1 
ATOM   260   C CG  . ASP A 1 34  ? -27.166 21.128  21.239  1.00 19.58 ? 33   ASP A CG  1 
ATOM   261   O OD1 . ASP A 1 34  ? -26.951 21.926  20.319  1.00 20.26 ? 33   ASP A OD1 1 
ATOM   262   O OD2 . ASP A 1 34  ? -26.298 20.881  22.106  1.00 21.97 ? 33   ASP A OD2 1 
ATOM   263   N N   . GLU A 1 35  ? -30.260 23.628  21.687  1.00 17.72 ? 34   GLU A N   1 
ATOM   264   C CA  . GLU A 1 35  ? -30.413 24.795  22.572  1.00 18.96 ? 34   GLU A CA  1 
ATOM   265   C C   . GLU A 1 35  ? -31.408 24.475  23.697  1.00 19.58 ? 34   GLU A C   1 
ATOM   266   O O   . GLU A 1 35  ? -32.506 23.951  23.475  1.00 18.79 ? 34   GLU A O   1 
ATOM   267   C CB  . GLU A 1 35  ? -30.909 26.024  21.849  1.00 18.10 ? 34   GLU A CB  1 
ATOM   268   C CG  . GLU A 1 35  ? -30.173 26.541  20.628  1.00 19.06 ? 34   GLU A CG  1 
ATOM   269   C CD  . GLU A 1 35  ? -30.409 25.881  19.318  1.00 18.55 ? 34   GLU A CD  1 
ATOM   270   O OE1 . GLU A 1 35  ? -31.172 24.895  19.340  1.00 19.39 ? 34   GLU A OE1 1 
ATOM   271   O OE2 . GLU A 1 35  ? -29.919 26.280  18.270  1.00 19.25 ? 34   GLU A OE2 1 
ATOM   272   N N   . SER A 1 36  ? -30.985 24.794  24.909  1.00 21.26 ? 35   SER A N   1 
ATOM   273   C CA  . SER A 1 36  ? -31.836 24.635  26.111  1.00 22.53 ? 35   SER A CA  1 
ATOM   274   C C   . SER A 1 36  ? -32.872 25.763  26.125  1.00 23.30 ? 35   SER A C   1 
ATOM   275   O O   . SER A 1 36  ? -32.750 26.724  25.343  1.00 23.51 ? 35   SER A O   1 
ATOM   276   C CB  . SER A 1 36  ? -30.971 24.729  27.368  1.00 22.59 ? 35   SER A CB  1 
ATOM   277   O OG  . SER A 1 36  ? -30.309 25.995  27.367  1.00 23.59 ? 35   SER A OG  1 
ATOM   278   N N   . GLY A 1 37  ? -33.825 25.642  27.031  1.00 24.18 ? 36   GLY A N   1 
ATOM   279   C CA  . GLY A 1 37  ? -34.916 26.590  27.215  1.00 25.18 ? 36   GLY A CA  1 
ATOM   280   C C   . GLY A 1 37  ? -34.479 28.045  27.187  1.00 26.06 ? 36   GLY A C   1 
ATOM   281   O O   . GLY A 1 37  ? -35.025 28.874  26.434  1.00 26.28 ? 36   GLY A O   1 
ATOM   282   N N   . PRO A 1 38  ? -33.500 28.350  28.038  1.00 27.03 ? 37   PRO A N   1 
ATOM   283   C CA  . PRO A 1 38  ? -32.972 29.708  28.177  1.00 27.62 ? 37   PRO A CA  1 
ATOM   284   C C   . PRO A 1 38  ? -32.353 30.263  26.915  1.00 28.42 ? 37   PRO A C   1 
ATOM   285   O O   . PRO A 1 38  ? -32.629 31.420  26.541  1.00 28.85 ? 37   PRO A O   1 
ATOM   286   C CB  . PRO A 1 38  ? -31.958 29.589  29.315  1.00 27.39 ? 37   PRO A CB  1 
ATOM   287   C CG  . PRO A 1 38  ? -32.555 28.513  30.190  1.00 27.37 ? 37   PRO A CG  1 
ATOM   288   C CD  . PRO A 1 38  ? -33.138 27.510  29.208  1.00 26.94 ? 37   PRO A CD  1 
ATOM   289   N N   . THR A 1 39  ? -31.506 29.465  26.287  1.00 29.44 ? 38   THR A N   1 
ATOM   290   C CA  . THR A 1 39  ? -30.804 29.864  25.059  1.00 30.17 ? 38   THR A CA  1 
ATOM   291   C C   . THR A 1 39  ? -31.802 30.086  23.927  1.00 30.58 ? 38   THR A C   1 
ATOM   292   O O   . THR A 1 39  ? -31.794 31.131  23.263  1.00 30.37 ? 38   THR A O   1 
ATOM   293   C CB  . THR A 1 39  ? -29.711 28.812  24.620  1.00 31.12 ? 38   THR A CB  1 
ATOM   294   O OG1 . THR A 1 39  ? -28.843 28.631  25.773  1.00 32.25 ? 38   THR A OG1 1 
ATOM   295   C CG2 . THR A 1 39  ? -28.929 29.236  23.368  1.00 31.19 ? 38   THR A CG2 1 
ATOM   296   N N   . MET A 1 40  ? -32.618 29.058  23.743  1.00 31.26 ? 39   MET A N   1 
ATOM   297   C CA  . MET A 1 40  ? -33.680 29.107  22.718  1.00 32.45 ? 39   MET A CA  1 
ATOM   298   C C   . MET A 1 40  ? -34.513 30.371  22.965  1.00 33.49 ? 39   MET A C   1 
ATOM   299   O O   . MET A 1 40  ? -34.957 31.033  22.017  1.00 33.24 ? 39   MET A O   1 
ATOM   300   C CB  . MET A 1 40  ? -34.500 27.839  22.725  1.00 31.78 ? 39   MET A CB  1 
ATOM   301   C CG  . MET A 1 40  ? -35.430 27.732  21.548  1.00 33.40 ? 39   MET A CG  1 
ATOM   302   S SD  . MET A 1 40  ? -34.417 27.475  20.044  1.00 32.95 ? 39   MET A SD  1 
ATOM   303   C CE  . MET A 1 40  ? -34.222 29.180  19.496  1.00 32.92 ? 39   MET A CE  1 
ATOM   304   N N   . GLY A 1 41  ? -34.660 30.687  24.243  1.00 34.47 ? 40   GLY A N   1 
ATOM   305   C CA  . GLY A 1 41  ? -35.458 31.819  24.704  1.00 35.89 ? 40   GLY A CA  1 
ATOM   306   C C   . GLY A 1 41  ? -34.937 33.153  24.201  1.00 37.15 ? 40   GLY A C   1 
ATOM   307   O O   . GLY A 1 41  ? -35.727 34.062  23.864  1.00 37.05 ? 40   GLY A O   1 
ATOM   308   N N   . LYS A 1 42  ? -33.623 33.278  24.166  1.00 38.23 ? 41   LYS A N   1 
ATOM   309   C CA  . LYS A 1 42  ? -32.965 34.513  23.711  1.00 39.38 ? 41   LYS A CA  1 
ATOM   310   C C   . LYS A 1 42  ? -33.143 34.673  22.204  1.00 39.99 ? 41   LYS A C   1 
ATOM   311   O O   . LYS A 1 42  ? -33.326 35.805  21.718  1.00 40.24 ? 41   LYS A O   1 
ATOM   312   C CB  . LYS A 1 42  ? -31.482 34.548  24.059  1.00 40.02 ? 41   LYS A CB  1 
ATOM   313   C CG  . LYS A 1 42  ? -31.184 34.089  25.486  1.00 41.87 ? 41   LYS A CG  1 
ATOM   314   C CD  . LYS A 1 42  ? -29.735 34.296  25.875  1.00 42.90 ? 41   LYS A CD  1 
ATOM   315   C CE  . LYS A 1 42  ? -29.416 35.747  26.183  1.00 43.80 ? 41   LYS A CE  1 
ATOM   316   N NZ  . LYS A 1 42  ? -28.045 35.866  26.739  1.00 44.46 ? 41   LYS A NZ  1 
ATOM   317   N N   . ARG A 1 43  ? -33.087 33.553  21.503  1.00 40.58 ? 42   ARG A N   1 
ATOM   318   C CA  . ARG A 1 43  ? -33.180 33.548  20.037  1.00 41.11 ? 42   ARG A CA  1 
ATOM   319   C C   . ARG A 1 43  ? -34.595 33.875  19.569  1.00 41.35 ? 42   ARG A C   1 
ATOM   320   O O   . ARG A 1 43  ? -34.763 34.555  18.538  1.00 41.21 ? 42   ARG A O   1 
ATOM   321   C CB  . ARG A 1 43  ? -32.701 32.236  19.427  1.00 42.22 ? 42   ARG A CB  1 
ATOM   322   C CG  . ARG A 1 43  ? -31.298 31.822  19.784  1.00 43.53 ? 42   ARG A CG  1 
ATOM   323   C CD  . ARG A 1 43  ? -30.225 32.455  18.937  1.00 44.83 ? 42   ARG A CD  1 
ATOM   324   N NE  . ARG A 1 43  ? -29.020 31.617  19.138  1.00 46.77 ? 42   ARG A NE  1 
ATOM   325   C CZ  . ARG A 1 43  ? -28.277 31.773  20.239  1.00 47.76 ? 42   ARG A CZ  1 
ATOM   326   N NH1 . ARG A 1 43  ? -28.426 32.805  21.058  1.00 47.51 ? 42   ARG A NH1 1 
ATOM   327   N NH2 . ARG A 1 43  ? -27.524 30.736  20.631  1.00 48.01 ? 42   ARG A NH2 1 
ATOM   328   N N   . LEU A 1 44  ? -35.567 33.387  20.312  1.00 41.53 ? 43   LEU A N   1 
ATOM   329   C CA  . LEU A 1 44  ? -36.986 33.644  20.020  1.00 42.22 ? 43   LEU A CA  1 
ATOM   330   C C   . LEU A 1 44  ? -37.289 35.125  20.260  1.00 42.88 ? 43   LEU A C   1 
ATOM   331   O O   . LEU A 1 44  ? -37.873 35.784  19.392  1.00 42.85 ? 43   LEU A O   1 
ATOM   332   C CB  . LEU A 1 44  ? -37.840 32.681  20.840  1.00 41.33 ? 43   LEU A CB  1 
ATOM   333   C CG  . LEU A 1 44  ? -37.872 31.231  20.398  1.00 40.99 ? 43   LEU A CG  1 
ATOM   334   C CD1 . LEU A 1 44  ? -38.803 30.402  21.270  1.00 40.22 ? 43   LEU A CD1 1 
ATOM   335   C CD2 . LEU A 1 44  ? -38.319 31.179  18.940  1.00 40.26 ? 43   LEU A CD2 1 
ATOM   336   N N   . GLN A 1 45  ? -36.865 35.590  21.419  1.00 43.70 ? 44   GLN A N   1 
ATOM   337   C CA  . GLN A 1 45  ? -37.068 36.972  21.861  1.00 44.75 ? 44   GLN A CA  1 
ATOM   338   C C   . GLN A 1 45  ? -36.601 37.955  20.787  1.00 45.12 ? 44   GLN A C   1 
ATOM   339   O O   . GLN A 1 45  ? -37.236 38.998  20.565  1.00 45.01 ? 44   GLN A O   1 
ATOM   340   C CB  . GLN A 1 45  ? -36.409 37.254  23.208  1.00 46.25 ? 44   GLN A CB  1 
ATOM   341   C CG  . GLN A 1 45  ? -36.402 38.708  23.625  1.00 48.22 ? 44   GLN A CG  1 
ATOM   342   C CD  . GLN A 1 45  ? -35.111 39.416  23.274  1.00 49.52 ? 44   GLN A CD  1 
ATOM   343   O OE1 . GLN A 1 45  ? -35.089 40.409  22.551  1.00 50.07 ? 44   GLN A OE1 1 
ATOM   344   N NE2 . GLN A 1 45  ? -34.011 38.886  23.812  1.00 49.66 ? 44   GLN A NE2 1 
ATOM   345   N N   . ASP A 1 46  ? -35.513 37.590  20.138  1.00 45.51 ? 45   ASP A N   1 
ATOM   346   C CA  . ASP A 1 46  ? -34.881 38.381  19.079  1.00 45.85 ? 45   ASP A CA  1 
ATOM   347   C C   . ASP A 1 46  ? -35.838 38.631  17.913  1.00 45.85 ? 45   ASP A C   1 
ATOM   348   O O   . ASP A 1 46  ? -35.777 39.708  17.291  1.00 45.94 ? 45   ASP A O   1 
ATOM   349   C CB  . ASP A 1 46  ? -33.555 37.756  18.652  1.00 47.15 ? 45   ASP A CB  1 
ATOM   350   C CG  . ASP A 1 46  ? -32.388 38.173  19.527  1.00 47.77 ? 45   ASP A CG  1 
ATOM   351   O OD1 . ASP A 1 46  ? -32.541 38.958  20.475  1.00 48.22 ? 45   ASP A OD1 1 
ATOM   352   O OD2 . ASP A 1 46  ? -31.277 37.680  19.229  1.00 48.53 ? 45   ASP A OD2 1 
ATOM   353   N N   . ILE A 1 47  ? -36.673 37.652  17.628  1.00 45.70 ? 46   ILE A N   1 
ATOM   354   C CA  . ILE A 1 47  ? -37.658 37.763  16.538  1.00 45.61 ? 46   ILE A CA  1 
ATOM   355   C C   . ILE A 1 47  ? -39.047 38.041  17.100  1.00 45.97 ? 46   ILE A C   1 
ATOM   356   O O   . ILE A 1 47  ? -40.083 37.742  16.488  1.00 46.14 ? 46   ILE A O   1 
ATOM   357   C CB  . ILE A 1 47  ? -37.596 36.506  15.604  1.00 44.49 ? 46   ILE A CB  1 
ATOM   358   C CG1 . ILE A 1 47  ? -38.076 35.250  16.361  1.00 43.82 ? 46   ILE A CG1 1 
ATOM   359   C CG2 . ILE A 1 47  ? -36.187 36.298  14.982  1.00 44.36 ? 46   ILE A CG2 1 
ATOM   360   C CD1 . ILE A 1 47  ? -38.312 34.011  15.458  1.00 42.96 ? 46   ILE A CD1 1 
ATOM   361   N N   . GLY A 1 48  ? -39.049 38.625  18.284  1.00 46.24 ? 47   GLY A N   1 
ATOM   362   C CA  . GLY A 1 48  ? -40.270 38.983  19.003  1.00 46.69 ? 47   GLY A CA  1 
ATOM   363   C C   . GLY A 1 48  ? -41.187 37.791  19.243  1.00 46.84 ? 47   GLY A C   1 
ATOM   364   O O   . GLY A 1 48  ? -42.417 37.895  19.065  1.00 47.05 ? 47   GLY A O   1 
ATOM   365   N N   . VAL A 1 49  ? -40.590 36.680  19.641  1.00 46.68 ? 48   VAL A N   1 
ATOM   366   C CA  . VAL A 1 49  ? -41.346 35.472  20.013  1.00 46.41 ? 48   VAL A CA  1 
ATOM   367   C C   . VAL A 1 49  ? -41.089 35.180  21.499  1.00 46.30 ? 48   VAL A C   1 
ATOM   368   O O   . VAL A 1 49  ? -39.965 35.319  22.002  1.00 46.20 ? 48   VAL A O   1 
ATOM   369   C CB  . VAL A 1 49  ? -41.055 34.296  19.083  1.00 46.55 ? 48   VAL A CB  1 
ATOM   370   C CG1 . VAL A 1 49  ? -41.750 33.012  19.537  1.00 46.26 ? 48   VAL A CG1 1 
ATOM   371   C CG2 . VAL A 1 49  ? -41.417 34.602  17.635  1.00 46.29 ? 48   VAL A CG2 1 
ATOM   372   N N   . GLU A 1 50  ? -42.160 34.784  22.145  1.00 46.16 ? 49   GLU A N   1 
ATOM   373   C CA  . GLU A 1 50  ? -42.201 34.486  23.583  1.00 45.70 ? 49   GLU A CA  1 
ATOM   374   C C   . GLU A 1 50  ? -41.660 33.090  23.854  1.00 44.83 ? 49   GLU A C   1 
ATOM   375   O O   . GLU A 1 50  ? -42.012 32.125  23.155  1.00 44.83 ? 49   GLU A O   1 
ATOM   376   C CB  . GLU A 1 50  ? -43.630 34.583  24.093  1.00 47.75 ? 49   GLU A CB  1 
ATOM   377   C CG  . GLU A 1 50  ? -43.951 34.360  25.558  1.00 50.36 ? 49   GLU A CG  1 
ATOM   378   C CD  . GLU A 1 50  ? -45.381 34.590  25.964  1.00 51.59 ? 49   GLU A CD  1 
ATOM   379   O OE1 . GLU A 1 50  ? -46.247 35.040  25.222  1.00 52.21 ? 49   GLU A OE1 1 
ATOM   380   O OE2 . GLU A 1 50  ? -45.590 34.270  27.156  1.00 52.38 ? 49   GLU A OE2 1 
ATOM   381   N N   . ASN A 1 51  ? -40.823 33.000  24.871  1.00 43.98 ? 50   ASN A N   1 
ATOM   382   C CA  . ASN A 1 51  ? -40.172 31.743  25.246  1.00 42.99 ? 50   ASN A CA  1 
ATOM   383   C C   . ASN A 1 51  ? -41.131 30.843  26.027  1.00 42.58 ? 50   ASN A C   1 
ATOM   384   O O   . ASN A 1 51  ? -41.068 30.753  27.263  1.00 42.73 ? 50   ASN A O   1 
ATOM   385   C CB  . ASN A 1 51  ? -38.838 31.968  25.958  1.00 41.67 ? 50   ASN A CB  1 
ATOM   386   C CG  . ASN A 1 51  ? -38.075 30.673  26.194  1.00 40.96 ? 50   ASN A CG  1 
ATOM   387   O OD1 . ASN A 1 51  ? -38.282 29.677  25.489  1.00 39.94 ? 50   ASN A OD1 1 
ATOM   388   N ND2 . ASN A 1 51  ? -37.179 30.670  27.177  1.00 40.43 ? 50   ASN A ND2 1 
ATOM   389   N N   . THR A 1 52  ? -41.997 30.194  25.274  1.00 41.91 ? 51   THR A N   1 
ATOM   390   C CA  . THR A 1 52  ? -42.909 29.177  25.840  1.00 41.17 ? 51   THR A CA  1 
ATOM   391   C C   . THR A 1 52  ? -42.486 27.826  25.270  1.00 40.86 ? 51   THR A C   1 
ATOM   392   O O   . THR A 1 52  ? -41.888 27.787  24.177  1.00 40.59 ? 51   THR A O   1 
ATOM   393   C CB  . THR A 1 52  ? -44.409 29.527  25.551  1.00 41.10 ? 51   THR A CB  1 
ATOM   394   O OG1 . THR A 1 52  ? -44.597 29.363  24.107  1.00 40.49 ? 51   THR A OG1 1 
ATOM   395   C CG2 . THR A 1 52  ? -44.811 30.937  26.010  1.00 41.15 ? 51   THR A CG2 1 
ATOM   396   N N   . GLU A 1 53  ? -42.777 26.763  26.002  1.00 40.48 ? 52   GLU A N   1 
ATOM   397   C CA  . GLU A 1 53  ? -42.395 25.419  25.565  1.00 40.15 ? 52   GLU A CA  1 
ATOM   398   C C   . GLU A 1 53  ? -43.027 25.121  24.201  1.00 39.44 ? 52   GLU A C   1 
ATOM   399   O O   . GLU A 1 53  ? -42.430 24.440  23.357  1.00 39.46 ? 52   GLU A O   1 
ATOM   400   C CB  . GLU A 1 53  ? -42.819 24.288  26.496  1.00 42.24 ? 52   GLU A CB  1 
ATOM   401   C CG  . GLU A 1 53  ? -42.345 22.891  26.086  1.00 44.53 ? 52   GLU A CG  1 
ATOM   402   C CD  . GLU A 1 53  ? -43.076 21.725  26.665  1.00 46.03 ? 52   GLU A CD  1 
ATOM   403   O OE1 . GLU A 1 53  ? -43.680 22.031  27.718  1.00 47.78 ? 52   GLU A OE1 1 
ATOM   404   O OE2 . GLU A 1 53  ? -43.090 20.604  26.179  1.00 47.01 ? 52   GLU A OE2 1 
ATOM   405   N N   . ASP A 1 54  ? -44.234 25.649  24.044  1.00 38.36 ? 53   ASP A N   1 
ATOM   406   C CA  . ASP A 1 54  ? -45.000 25.430  22.815  1.00 36.87 ? 53   ASP A CA  1 
ATOM   407   C C   . ASP A 1 54  ? -44.379 26.186  21.638  1.00 35.26 ? 53   ASP A C   1 
ATOM   408   O O   . ASP A 1 54  ? -44.441 25.673  20.503  1.00 35.00 ? 53   ASP A O   1 
ATOM   409   C CB  . ASP A 1 54  ? -46.493 25.707  23.000  1.00 39.00 ? 53   ASP A CB  1 
ATOM   410   C CG  . ASP A 1 54  ? -47.283 24.978  21.913  1.00 40.46 ? 53   ASP A CG  1 
ATOM   411   O OD1 . ASP A 1 54  ? -47.479 23.760  22.121  1.00 41.47 ? 53   ASP A OD1 1 
ATOM   412   O OD2 . ASP A 1 54  ? -47.638 25.589  20.899  1.00 41.66 ? 53   ASP A OD2 1 
ATOM   413   N N   . ASN A 1 55  ? -43.830 27.350  21.915  1.00 33.51 ? 54   ASN A N   1 
ATOM   414   C CA  . ASN A 1 55  ? -43.165 28.145  20.857  1.00 32.00 ? 54   ASN A CA  1 
ATOM   415   C C   . ASN A 1 55  ? -41.859 27.447  20.451  1.00 30.54 ? 54   ASN A C   1 
ATOM   416   O O   . ASN A 1 55  ? -41.477 27.482  19.270  1.00 30.07 ? 54   ASN A O   1 
ATOM   417   C CB  . ASN A 1 55  ? -43.006 29.604  21.236  1.00 33.30 ? 54   ASN A CB  1 
ATOM   418   C CG  . ASN A 1 55  ? -44.229 30.444  20.909  1.00 34.77 ? 54   ASN A CG  1 
ATOM   419   O OD1 . ASN A 1 55  ? -45.180 29.954  20.277  1.00 36.16 ? 54   ASN A OD1 1 
ATOM   420   N ND2 . ASN A 1 55  ? -44.214 31.701  21.340  1.00 35.09 ? 54   ASN A ND2 1 
ATOM   421   N N   . ARG A 1 56  ? -41.215 26.833  21.433  1.00 29.11 ? 55   ARG A N   1 
ATOM   422   C CA  . ARG A 1 56  ? -39.979 26.065  21.159  1.00 27.69 ? 55   ARG A CA  1 
ATOM   423   C C   . ARG A 1 56  ? -40.318 24.843  20.322  1.00 27.01 ? 55   ARG A C   1 
ATOM   424   O O   . ARG A 1 56  ? -39.594 24.478  19.371  1.00 26.92 ? 55   ARG A O   1 
ATOM   425   C CB  . ARG A 1 56  ? -39.254 25.694  22.447  1.00 26.89 ? 55   ARG A CB  1 
ATOM   426   C CG  . ARG A 1 56  ? -38.784 26.885  23.270  1.00 26.24 ? 55   ARG A CG  1 
ATOM   427   C CD  . ARG A 1 56  ? -37.777 26.481  24.291  1.00 26.35 ? 55   ARG A CD  1 
ATOM   428   N NE  . ARG A 1 56  ? -38.305 25.510  25.250  1.00 25.62 ? 55   ARG A NE  1 
ATOM   429   C CZ  . ARG A 1 56  ? -38.964 25.895  26.353  1.00 25.80 ? 55   ARG A CZ  1 
ATOM   430   N NH1 . ARG A 1 56  ? -39.180 27.187  26.565  1.00 24.85 ? 55   ARG A NH1 1 
ATOM   431   N NH2 . ARG A 1 56  ? -39.409 25.010  27.238  1.00 25.56 ? 55   ARG A NH2 1 
ATOM   432   N N   . ARG A 1 57  ? -41.430 24.211  20.680  1.00 26.03 ? 56   ARG A N   1 
ATOM   433   C CA  . ARG A 1 57  ? -41.902 23.003  19.972  1.00 24.63 ? 56   ARG A CA  1 
ATOM   434   C C   . ARG A 1 57  ? -42.241 23.367  18.524  1.00 23.83 ? 56   ARG A C   1 
ATOM   435   O O   . ARG A 1 57  ? -41.867 22.634  17.583  1.00 23.25 ? 56   ARG A O   1 
ATOM   436   C CB  . ARG A 1 57  ? -43.076 22.350  20.673  1.00 24.44 ? 56   ARG A CB  1 
ATOM   437   C CG  . ARG A 1 57  ? -43.555 21.010  20.134  1.00 24.73 ? 56   ARG A CG  1 
ATOM   438   C CD  . ARG A 1 57  ? -44.951 20.708  20.611  1.00 26.37 ? 56   ARG A CD  1 
ATOM   439   N NE  . ARG A 1 57  ? -45.889 21.729  20.142  1.00 26.91 ? 56   ARG A NE  1 
ATOM   440   C CZ  . ARG A 1 57  ? -46.368 21.704  18.885  1.00 28.39 ? 56   ARG A CZ  1 
ATOM   441   N NH1 . ARG A 1 57  ? -46.081 20.670  18.093  1.00 27.83 ? 56   ARG A NH1 1 
ATOM   442   N NH2 . ARG A 1 57  ? -47.159 22.666  18.430  1.00 28.93 ? 56   ARG A NH2 1 
ATOM   443   N N   . ALA A 1 58  ? -42.909 24.500  18.381  1.00 22.66 ? 57   ALA A N   1 
ATOM   444   C CA  . ALA A 1 58  ? -43.331 25.013  17.072  1.00 22.06 ? 57   ALA A CA  1 
ATOM   445   C C   . ALA A 1 58  ? -42.118 25.242  16.170  1.00 21.27 ? 57   ALA A C   1 
ATOM   446   O O   . ALA A 1 58  ? -42.122 24.809  15.008  1.00 21.11 ? 57   ALA A O   1 
ATOM   447   C CB  . ALA A 1 58  ? -44.150 26.290  17.218  1.00 22.95 ? 57   ALA A CB  1 
ATOM   448   N N   . TYR A 1 59  ? -41.123 25.927  16.711  1.00 20.52 ? 58   TYR A N   1 
ATOM   449   C CA  . TYR A 1 59  ? -39.886 26.187  15.951  1.00 19.77 ? 58   TYR A CA  1 
ATOM   450   C C   . TYR A 1 59  ? -39.185 24.885  15.583  1.00 19.34 ? 58   TYR A C   1 
ATOM   451   O O   . TYR A 1 59  ? -38.715 24.732  14.435  1.00 19.40 ? 58   TYR A O   1 
ATOM   452   C CB  . TYR A 1 59  ? -38.963 27.180  16.680  1.00 18.29 ? 58   TYR A CB  1 
ATOM   453   C CG  . TYR A 1 59  ? -37.618 27.297  15.982  1.00 18.23 ? 58   TYR A CG  1 
ATOM   454   C CD1 . TYR A 1 59  ? -37.556 27.839  14.692  1.00 17.79 ? 58   TYR A CD1 1 
ATOM   455   C CD2 . TYR A 1 59  ? -36.444 26.833  16.569  1.00 17.44 ? 58   TYR A CD2 1 
ATOM   456   C CE1 . TYR A 1 59  ? -36.346 27.930  14.012  1.00 17.48 ? 58   TYR A CE1 1 
ATOM   457   C CE2 . TYR A 1 59  ? -35.226 26.920  15.892  1.00 17.43 ? 58   TYR A CE2 1 
ATOM   458   C CZ  . TYR A 1 59  ? -35.187 27.472  14.618  1.00 17.17 ? 58   TYR A CZ  1 
ATOM   459   O OH  . TYR A 1 59  ? -34.006 27.590  13.920  1.00 17.46 ? 58   TYR A OH  1 
ATOM   460   N N   . ARG A 1 60  ? -39.118 23.943  16.513  1.00 18.94 ? 59   ARG A N   1 
ATOM   461   C CA  . ARG A 1 60  ? -38.465 22.645  16.267  1.00 18.66 ? 59   ARG A CA  1 
ATOM   462   C C   . ARG A 1 60  ? -39.284 21.826  15.279  1.00 18.93 ? 59   ARG A C   1 
ATOM   463   O O   . ARG A 1 60  ? -38.740 21.002  14.524  1.00 18.78 ? 59   ARG A O   1 
ATOM   464   C CB  . ARG A 1 60  ? -38.159 21.870  17.537  1.00 19.80 ? 59   ARG A CB  1 
ATOM   465   C CG  . ARG A 1 60  ? -36.764 22.061  18.131  1.00 20.18 ? 59   ARG A CG  1 
ATOM   466   C CD  . ARG A 1 60  ? -36.417 23.478  18.412  1.00 19.23 ? 59   ARG A CD  1 
ATOM   467   N NE  . ARG A 1 60  ? -35.103 23.599  19.041  1.00 20.24 ? 59   ARG A NE  1 
ATOM   468   C CZ  . ARG A 1 60  ? -34.888 23.658  20.354  1.00 19.15 ? 59   ARG A CZ  1 
ATOM   469   N NH1 . ARG A 1 60  ? -35.888 23.583  21.225  1.00 18.66 ? 59   ARG A NH1 1 
ATOM   470   N NH2 . ARG A 1 60  ? -33.645 23.833  20.819  1.00 18.41 ? 59   ARG A NH2 1 
ATOM   471   N N   . GLN A 1 61  ? -40.589 22.090  15.262  1.00 18.57 ? 60   GLN A N   1 
ATOM   472   C CA  . GLN A 1 61  ? -41.471 21.368  14.310  1.00 18.39 ? 60   GLN A CA  1 
ATOM   473   C C   . GLN A 1 61  ? -41.116 21.826  12.887  1.00 17.14 ? 60   GLN A C   1 
ATOM   474   O O   . GLN A 1 61  ? -41.027 20.993  11.979  1.00 17.44 ? 60   GLN A O   1 
ATOM   475   C CB  . GLN A 1 61  ? -42.951 21.562  14.600  1.00 18.67 ? 60   GLN A CB  1 
ATOM   476   C CG  . GLN A 1 61  ? -43.840 20.784  13.626  1.00 20.86 ? 60   GLN A CG  1 
ATOM   477   C CD  . GLN A 1 61  ? -45.297 20.895  14.038  1.00 21.20 ? 60   GLN A CD  1 
ATOM   478   O OE1 . GLN A 1 61  ? -45.860 19.975  14.609  1.00 23.19 ? 60   GLN A OE1 1 
ATOM   479   N NE2 . GLN A 1 61  ? -45.875 22.048  13.737  1.00 22.80 ? 60   GLN A NE2 1 
ATOM   480   N N   . LEU A 1 62  ? -40.896 23.117  12.767  1.00 16.66 ? 61   LEU A N   1 
ATOM   481   C CA  . LEU A 1 62  ? -40.513 23.752  11.494  1.00 16.74 ? 61   LEU A CA  1 
ATOM   482   C C   . LEU A 1 62  ? -39.277 23.090  10.904  1.00 16.76 ? 61   LEU A C   1 
ATOM   483   O O   . LEU A 1 62  ? -39.312 22.625  9.743   1.00 16.31 ? 61   LEU A O   1 
ATOM   484   C CB  . LEU A 1 62  ? -40.409 25.252  11.739  1.00 16.65 ? 61   LEU A CB  1 
ATOM   485   C CG  . LEU A 1 62  ? -40.104 26.152  10.557  1.00 17.44 ? 61   LEU A CG  1 
ATOM   486   C CD1 . LEU A 1 62  ? -40.490 27.597  10.868  1.00 16.88 ? 61   LEU A CD1 1 
ATOM   487   C CD2 . LEU A 1 62  ? -38.597 26.093  10.260  1.00 18.46 ? 61   LEU A CD2 1 
ATOM   488   N N   . LEU A 1 63  ? -38.222 23.003  11.703  1.00 16.98 ? 62   LEU A N   1 
ATOM   489   C CA  . LEU A 1 63  ? -36.951 22.416  11.276  1.00 17.11 ? 62   LEU A CA  1 
ATOM   490   C C   . LEU A 1 63  ? -37.087 20.958  10.852  1.00 17.17 ? 62   LEU A C   1 
ATOM   491   O O   . LEU A 1 63  ? -36.465 20.558  9.850   1.00 17.44 ? 62   LEU A O   1 
ATOM   492   C CB  . LEU A 1 63  ? -35.881 22.576  12.366  1.00 15.99 ? 62   LEU A CB  1 
ATOM   493   C CG  . LEU A 1 63  ? -35.549 23.950  12.902  1.00 16.69 ? 62   LEU A CG  1 
ATOM   494   C CD1 . LEU A 1 63  ? -34.687 23.815  14.173  1.00 16.62 ? 62   LEU A CD1 1 
ATOM   495   C CD2 . LEU A 1 63  ? -34.769 24.739  11.857  1.00 15.36 ? 62   LEU A CD2 1 
ATOM   496   N N   . PHE A 1 64  ? -37.854 20.197  11.600  1.00 17.09 ? 63   PHE A N   1 
ATOM   497   C CA  . PHE A 1 64  ? -37.930 18.743  11.437  1.00 17.58 ? 63   PHE A CA  1 
ATOM   498   C C   . PHE A 1 64  ? -38.916 18.288  10.368  1.00 18.26 ? 63   PHE A C   1 
ATOM   499   O O   . PHE A 1 64  ? -38.854 17.107  9.946   1.00 18.65 ? 63   PHE A O   1 
ATOM   500   C CB  . PHE A 1 64  ? -38.160 18.052  12.779  1.00 18.52 ? 63   PHE A CB  1 
ATOM   501   C CG  . PHE A 1 64  ? -37.180 18.377  13.866  1.00 18.13 ? 63   PHE A CG  1 
ATOM   502   C CD1 . PHE A 1 64  ? -35.903 18.843  13.555  1.00 17.95 ? 63   PHE A CD1 1 
ATOM   503   C CD2 . PHE A 1 64  ? -37.527 18.177  15.206  1.00 19.15 ? 63   PHE A CD2 1 
ATOM   504   C CE1 . PHE A 1 64  ? -34.979 19.125  14.548  1.00 18.76 ? 63   PHE A CE1 1 
ATOM   505   C CE2 . PHE A 1 64  ? -36.617 18.457  16.229  1.00 17.86 ? 63   PHE A CE2 1 
ATOM   506   C CZ  . PHE A 1 64  ? -35.337 18.937  15.887  1.00 19.14 ? 63   PHE A CZ  1 
ATOM   507   N N   . SER A 1 65  ? -39.785 19.170  9.925   1.00 19.04 ? 64   SER A N   1 
ATOM   508   C CA  . SER A 1 65  ? -40.812 18.794  8.927   1.00 20.22 ? 64   SER A CA  1 
ATOM   509   C C   . SER A 1 65  ? -40.375 19.187  7.519   1.00 21.16 ? 64   SER A C   1 
ATOM   510   O O   . SER A 1 65  ? -41.125 18.968  6.537   1.00 22.06 ? 64   SER A O   1 
ATOM   511   C CB  . SER A 1 65  ? -42.166 19.385  9.288   1.00 18.85 ? 64   SER A CB  1 
ATOM   512   O OG  . SER A 1 65  ? -42.118 20.802  9.225   1.00 18.51 ? 64   SER A OG  1 
ATOM   513   N N   . THR A 1 66  ? -39.180 19.746  7.434   1.00 21.27 ? 65   THR A N   1 
ATOM   514   C CA  . THR A 1 66  ? -38.555 20.169  6.177   1.00 21.29 ? 65   THR A CA  1 
ATOM   515   C C   . THR A 1 66  ? -38.561 19.020  5.164   1.00 21.17 ? 65   THR A C   1 
ATOM   516   O O   . THR A 1 66  ? -38.520 17.839  5.538   1.00 20.82 ? 65   THR A O   1 
ATOM   517   C CB  . THR A 1 66  ? -37.090 20.722  6.394   1.00 21.40 ? 65   THR A CB  1 
ATOM   518   O OG1 . THR A 1 66  ? -37.199 21.909  7.248   1.00 20.97 ? 65   THR A OG1 1 
ATOM   519   C CG2 . THR A 1 66  ? -36.332 21.068  5.105   1.00 21.39 ? 65   THR A CG2 1 
ATOM   520   N N   . ASP A 1 67  ? -38.617 19.415  3.903   1.00 21.59 ? 66   ASP A N   1 
ATOM   521   C CA  . ASP A 1 67  ? -38.573 18.451  2.766   1.00 22.15 ? 66   ASP A CA  1 
ATOM   522   C C   . ASP A 1 67  ? -37.423 17.475  3.009   1.00 22.10 ? 66   ASP A C   1 
ATOM   523   O O   . ASP A 1 67  ? -36.284 17.881  3.302   1.00 22.32 ? 66   ASP A O   1 
ATOM   524   C CB  . ASP A 1 67  ? -38.493 19.260  1.483   1.00 22.83 ? 66   ASP A CB  1 
ATOM   525   C CG  . ASP A 1 67  ? -38.212 18.579  0.180   1.00 24.33 ? 66   ASP A CG  1 
ATOM   526   O OD1 . ASP A 1 67  ? -37.958 17.381  0.041   1.00 23.52 ? 66   ASP A OD1 1 
ATOM   527   O OD2 . ASP A 1 67  ? -38.247 19.336  -0.837  1.00 26.57 ? 66   ASP A OD2 1 
ATOM   528   N N   . PRO A 1 68  ? -37.722 16.197  2.891   1.00 22.52 ? 67   PRO A N   1 
ATOM   529   C CA  . PRO A 1 68  ? -36.762 15.114  3.085   1.00 22.44 ? 67   PRO A CA  1 
ATOM   530   C C   . PRO A 1 68  ? -35.479 15.291  2.289   1.00 22.55 ? 67   PRO A C   1 
ATOM   531   O O   . PRO A 1 68  ? -34.499 14.550  2.509   1.00 22.57 ? 67   PRO A O   1 
ATOM   532   C CB  . PRO A 1 68  ? -37.513 13.840  2.697   1.00 22.70 ? 67   PRO A CB  1 
ATOM   533   C CG  . PRO A 1 68  ? -38.750 14.317  1.993   1.00 22.86 ? 67   PRO A CG  1 
ATOM   534   C CD  . PRO A 1 68  ? -39.082 15.649  2.660   1.00 22.78 ? 67   PRO A CD  1 
ATOM   535   N N   . LYS A 1 69  ? -35.499 16.246  1.373   1.00 21.95 ? 68   LYS A N   1 
ATOM   536   C CA  . LYS A 1 69  ? -34.299 16.600  0.592   1.00 21.55 ? 68   LYS A CA  1 
ATOM   537   C C   . LYS A 1 69  ? -33.180 17.006  1.565   1.00 20.02 ? 68   LYS A C   1 
ATOM   538   O O   . LYS A 1 69  ? -31.993 16.826  1.264   1.00 19.61 ? 68   LYS A O   1 
ATOM   539   C CB  . LYS A 1 69  ? -34.587 17.743  -0.361  1.00 24.46 ? 68   LYS A CB  1 
ATOM   540   C CG  . LYS A 1 69  ? -33.381 18.326  -1.090  1.00 28.12 ? 68   LYS A CG  1 
ATOM   541   C CD  . LYS A 1 69  ? -33.681 19.743  -1.577  1.00 31.02 ? 68   LYS A CD  1 
ATOM   542   C CE  . LYS A 1 69  ? -32.422 20.527  -1.883  1.00 32.62 ? 68   LYS A CE  1 
ATOM   543   N NZ  . LYS A 1 69  ? -31.649 20.798  -0.637  1.00 34.18 ? 68   LYS A NZ  1 
ATOM   544   N N   . LEU A 1 70  ? -33.581 17.538  2.703   1.00 18.51 ? 69   LEU A N   1 
ATOM   545   C CA  . LEU A 1 70  ? -32.623 17.944  3.756   1.00 17.22 ? 69   LEU A CA  1 
ATOM   546   C C   . LEU A 1 70  ? -31.628 16.829  4.051   1.00 16.14 ? 69   LEU A C   1 
ATOM   547   O O   . LEU A 1 70  ? -30.420 17.104  4.230   1.00 16.60 ? 69   LEU A O   1 
ATOM   548   C CB  . LEU A 1 70  ? -33.424 18.384  4.986   1.00 17.00 ? 69   LEU A CB  1 
ATOM   549   C CG  . LEU A 1 70  ? -32.666 18.899  6.195   1.00 16.61 ? 69   LEU A CG  1 
ATOM   550   C CD1 . LEU A 1 70  ? -32.020 20.253  5.921   1.00 16.98 ? 69   LEU A CD1 1 
ATOM   551   C CD2 . LEU A 1 70  ? -33.652 19.045  7.368   1.00 17.01 ? 69   LEU A CD2 1 
ATOM   552   N N   . ALA A 1 71  ? -32.111 15.609  4.098   1.00 15.52 ? 70   ALA A N   1 
ATOM   553   C CA  . ALA A 1 71  ? -31.336 14.430  4.427   1.00 15.59 ? 70   ALA A CA  1 
ATOM   554   C C   . ALA A 1 71  ? -30.128 14.213  3.526   1.00 16.11 ? 70   ALA A C   1 
ATOM   555   O O   . ALA A 1 71  ? -29.238 13.406  3.887   1.00 16.52 ? 70   ALA A O   1 
ATOM   556   C CB  . ALA A 1 71  ? -32.208 13.175  4.432   1.00 16.41 ? 70   ALA A CB  1 
ATOM   557   N N   . GLU A 1 72  ? -30.138 14.833  2.361   1.00 15.86 ? 71   GLU A N   1 
ATOM   558   C CA  . GLU A 1 72  ? -29.020 14.729  1.419   1.00 15.55 ? 71   GLU A CA  1 
ATOM   559   C C   . GLU A 1 72  ? -27.784 15.425  1.980   1.00 14.13 ? 71   GLU A C   1 
ATOM   560   O O   . GLU A 1 72  ? -26.656 15.003  1.684   1.00 13.47 ? 71   GLU A O   1 
ATOM   561   C CB  . GLU A 1 72  ? -29.322 15.376  0.064   1.00 19.95 ? 71   GLU A CB  1 
ATOM   562   C CG  . GLU A 1 72  ? -30.142 14.571  -0.935  1.00 24.02 ? 71   GLU A CG  1 
ATOM   563   C CD  . GLU A 1 72  ? -30.628 15.331  -2.141  1.00 27.83 ? 71   GLU A CD  1 
ATOM   564   O OE1 . GLU A 1 72  ? -30.270 16.534  -2.151  1.00 29.10 ? 71   GLU A OE1 1 
ATOM   565   O OE2 . GLU A 1 72  ? -31.326 14.833  -3.013  1.00 29.55 ? 71   GLU A OE2 1 
ATOM   566   N N   . ASN A 1 73  ? -28.013 16.458  2.776   1.00 13.64 ? 72   ASN A N   1 
ATOM   567   C CA  . ASN A 1 73  ? -26.902 17.236  3.364   1.00 12.85 ? 72   ASN A CA  1 
ATOM   568   C C   . ASN A 1 73  ? -26.812 17.142  4.881   1.00 12.19 ? 72   ASN A C   1 
ATOM   569   O O   . ASN A 1 73  ? -25.767 17.537  5.452   1.00 11.31 ? 72   ASN A O   1 
ATOM   570   C CB  . ASN A 1 73  ? -26.974 18.680  2.861   1.00 13.01 ? 72   ASN A CB  1 
ATOM   571   C CG  . ASN A 1 73  ? -26.736 18.735  1.343   1.00 16.77 ? 72   ASN A CG  1 
ATOM   572   O OD1 . ASN A 1 73  ? -25.656 18.354  0.864   1.00 17.09 ? 72   ASN A OD1 1 
ATOM   573   N ND2 . ASN A 1 73  ? -27.760 19.194  0.652   1.00 15.32 ? 72   ASN A ND2 1 
ATOM   574   N N   . ILE A 1 74  ? -27.864 16.701  5.532   1.00 11.84 ? 73   ILE A N   1 
ATOM   575   C CA  . ILE A 1 74  ? -27.909 16.569  6.998   1.00 11.81 ? 73   ILE A CA  1 
ATOM   576   C C   . ILE A 1 74  ? -27.975 15.088  7.361   1.00 11.53 ? 73   ILE A C   1 
ATOM   577   O O   . ILE A 1 74  ? -28.975 14.394  7.090   1.00 12.18 ? 73   ILE A O   1 
ATOM   578   C CB  . ILE A 1 74  ? -29.097 17.395  7.596   1.00 11.52 ? 73   ILE A CB  1 
ATOM   579   C CG1 . ILE A 1 74  ? -29.024 18.877  7.190   1.00 11.19 ? 73   ILE A CG1 1 
ATOM   580   C CG2 . ILE A 1 74  ? -29.243 17.197  9.130   1.00 11.39 ? 73   ILE A CG2 1 
ATOM   581   C CD1 . ILE A 1 74  ? -27.746 19.649  7.605   1.00 11.85 ? 73   ILE A CD1 1 
ATOM   582   N N   . SER A 1 75  ? -26.909 14.609  8.003   1.00 10.40 ? 74   SER A N   1 
ATOM   583   C CA  . SER A 1 75  ? -26.822 13.215  8.423   1.00 9.45  ? 74   SER A CA  1 
ATOM   584   C C   . SER A 1 75  ? -27.408 13.001  9.826   1.00 8.71  ? 74   SER A C   1 
ATOM   585   O O   . SER A 1 75  ? -27.885 11.887  10.123  1.00 8.63  ? 74   SER A O   1 
ATOM   586   C CB  . SER A 1 75  ? -25.370 12.734  8.416   1.00 10.61 ? 74   SER A CB  1 
ATOM   587   O OG  . SER A 1 75  ? -24.620 13.526  9.335   1.00 13.12 ? 74   SER A OG  1 
ATOM   588   N N   . GLY A 1 76  ? -27.356 14.031  10.633  1.00 9.10  ? 75   GLY A N   1 
ATOM   589   C CA  . GLY A 1 76  ? -27.770 13.871  12.057  1.00 8.85  ? 75   GLY A CA  1 
ATOM   590   C C   . GLY A 1 76  ? -28.166 15.189  12.661  1.00 8.38  ? 75   GLY A C   1 
ATOM   591   O O   . GLY A 1 76  ? -27.801 16.277  12.204  1.00 9.09  ? 75   GLY A O   1 
ATOM   592   N N   . VAL A 1 77  ? -28.979 15.079  13.722  1.00 7.81  ? 76   VAL A N   1 
ATOM   593   C CA  . VAL A 1 77  ? -29.461 16.270  14.434  1.00 8.31  ? 76   VAL A CA  1 
ATOM   594   C C   . VAL A 1 77  ? -29.142 16.052  15.928  1.00 8.73  ? 76   VAL A C   1 
ATOM   595   O O   . VAL A 1 77  ? -29.416 14.951  16.430  1.00 9.15  ? 76   VAL A O   1 
ATOM   596   C CB  . VAL A 1 77  ? -30.964 16.513  14.189  1.00 7.90  ? 76   VAL A CB  1 
ATOM   597   C CG1 . VAL A 1 77  ? -31.520 17.631  15.057  1.00 8.78  ? 76   VAL A CG1 1 
ATOM   598   C CG2 . VAL A 1 77  ? -31.260 16.829  12.722  1.00 8.61  ? 76   VAL A CG2 1 
ATOM   599   N N   . ILE A 1 78  ? -28.548 17.075  16.506  1.00 9.89  ? 77   ILE A N   1 
ATOM   600   C CA  . ILE A 1 78  ? -28.322 17.058  17.961  1.00 10.00 ? 77   ILE A CA  1 
ATOM   601   C C   . ILE A 1 78  ? -29.552 17.694  18.642  1.00 9.66  ? 77   ILE A C   1 
ATOM   602   O O   . ILE A 1 78  ? -29.871 18.850  18.381  1.00 9.85  ? 77   ILE A O   1 
ATOM   603   C CB  . ILE A 1 78  ? -27.034 17.826  18.416  1.00 10.63 ? 77   ILE A CB  1 
ATOM   604   C CG1 . ILE A 1 78  ? -25.802 17.454  17.586  1.00 10.56 ? 77   ILE A CG1 1 
ATOM   605   C CG2 . ILE A 1 78  ? -26.811 17.562  19.954  1.00 10.90 ? 77   ILE A CG2 1 
ATOM   606   C CD1 . ILE A 1 78  ? -24.500 18.243  17.920  1.00 10.39 ? 77   ILE A CD1 1 
ATOM   607   N N   . LEU A 1 79  ? -30.145 16.920  19.517  1.00 10.14 ? 78   LEU A N   1 
ATOM   608   C CA  . LEU A 1 79  ? -31.336 17.319  20.274  1.00 10.66 ? 78   LEU A CA  1 
ATOM   609   C C   . LEU A 1 79  ? -31.006 17.670  21.735  1.00 11.49 ? 78   LEU A C   1 
ATOM   610   O O   . LEU A 1 79  ? -30.061 17.086  22.267  1.00 10.44 ? 78   LEU A O   1 
ATOM   611   C CB  . LEU A 1 79  ? -32.291 16.111  20.242  1.00 8.97  ? 78   LEU A CB  1 
ATOM   612   C CG  . LEU A 1 79  ? -32.838 15.727  18.874  1.00 10.32 ? 78   LEU A CG  1 
ATOM   613   C CD1 . LEU A 1 79  ? -33.673 14.470  18.954  1.00 12.31 ? 78   LEU A CD1 1 
ATOM   614   C CD2 . LEU A 1 79  ? -33.644 16.899  18.333  1.00 12.61 ? 78   LEU A CD2 1 
ATOM   615   N N   . PHE A 1 80  ? -31.826 18.552  22.263  1.00 11.77 ? 79   PHE A N   1 
ATOM   616   C CA  . PHE A 1 80  ? -31.899 18.874  23.704  1.00 12.68 ? 79   PHE A CA  1 
ATOM   617   C C   . PHE A 1 80  ? -32.976 17.951  24.305  1.00 13.30 ? 79   PHE A C   1 
ATOM   618   O O   . PHE A 1 80  ? -34.033 17.708  23.683  1.00 12.23 ? 79   PHE A O   1 
ATOM   619   C CB  . PHE A 1 80  ? -32.166 20.354  23.927  1.00 15.86 ? 79   PHE A CB  1 
ATOM   620   C CG  . PHE A 1 80  ? -32.451 20.798  25.333  1.00 17.35 ? 79   PHE A CG  1 
ATOM   621   C CD1 . PHE A 1 80  ? -31.427 20.902  26.270  1.00 18.61 ? 79   PHE A CD1 1 
ATOM   622   C CD2 . PHE A 1 80  ? -33.763 21.097  25.715  1.00 18.76 ? 79   PHE A CD2 1 
ATOM   623   C CE1 . PHE A 1 80  ? -31.697 21.304  27.586  1.00 18.80 ? 79   PHE A CE1 1 
ATOM   624   C CE2 . PHE A 1 80  ? -34.062 21.503  27.013  1.00 18.87 ? 79   PHE A CE2 1 
ATOM   625   C CZ  . PHE A 1 80  ? -33.020 21.600  27.943  1.00 19.32 ? 79   PHE A CZ  1 
ATOM   626   N N   . HIS A 1 81  ? -32.715 17.423  25.482  1.00 12.59 ? 80   HIS A N   1 
ATOM   627   C CA  . HIS A 1 81  ? -33.576 16.482  26.197  1.00 13.34 ? 80   HIS A CA  1 
ATOM   628   C C   . HIS A 1 81  ? -35.073 16.659  25.958  1.00 13.61 ? 80   HIS A C   1 
ATOM   629   O O   . HIS A 1 81  ? -35.743 15.678  25.555  1.00 12.95 ? 80   HIS A O   1 
ATOM   630   C CB  . HIS A 1 81  ? -33.312 16.481  27.732  1.00 15.01 ? 80   HIS A CB  1 
ATOM   631   C CG  . HIS A 1 81  ? -34.033 15.395  28.465  1.00 14.16 ? 80   HIS A CG  1 
ATOM   632   N ND1 . HIS A 1 81  ? -33.504 14.182  28.795  1.00 14.49 ? 80   HIS A ND1 1 
ATOM   633   C CD2 . HIS A 1 81  ? -35.319 15.376  28.920  1.00 15.27 ? 80   HIS A CD2 1 
ATOM   634   C CE1 . HIS A 1 81  ? -34.409 13.453  29.430  1.00 15.13 ? 80   HIS A CE1 1 
ATOM   635   N NE2 . HIS A 1 81  ? -35.520 14.154  29.517  1.00 15.71 ? 80   HIS A NE2 1 
ATOM   636   N N   . GLU A 1 82  ? -35.604 17.843  26.187  1.00 13.93 ? 81   GLU A N   1 
ATOM   637   C CA  . GLU A 1 82  ? -37.066 18.054  26.093  1.00 15.57 ? 81   GLU A CA  1 
ATOM   638   C C   . GLU A 1 82  ? -37.581 17.690  24.707  1.00 15.87 ? 81   GLU A C   1 
ATOM   639   O O   . GLU A 1 82  ? -38.597 16.982  24.559  1.00 15.32 ? 81   GLU A O   1 
ATOM   640   C CB  . GLU A 1 82  ? -37.486 19.474  26.434  1.00 17.46 ? 81   GLU A CB  1 
ATOM   641   C CG  . GLU A 1 82  ? -37.831 20.464  25.340  1.00 21.15 ? 81   GLU A CG  1 
ATOM   642   C CD  . GLU A 1 82  ? -38.122 21.875  25.750  1.00 23.29 ? 81   GLU A CD  1 
ATOM   643   O OE1 . GLU A 1 82  ? -38.277 22.242  26.909  1.00 24.53 ? 81   GLU A OE1 1 
ATOM   644   O OE2 . GLU A 1 82  ? -38.173 22.666  24.781  1.00 22.55 ? 81   GLU A OE2 1 
ATOM   645   N N   . THR A 1 83  ? -36.844 18.135  23.693  1.00 15.96 ? 82   THR A N   1 
ATOM   646   C CA  . THR A 1 83  ? -37.248 17.961  22.291  1.00 15.86 ? 82   THR A CA  1 
ATOM   647   C C   . THR A 1 83  ? -37.347 16.510  21.871  1.00 16.22 ? 82   THR A C   1 
ATOM   648   O O   . THR A 1 83  ? -38.201 16.159  21.020  1.00 16.42 ? 82   THR A O   1 
ATOM   649   C CB  . THR A 1 83  ? -36.306 18.767  21.309  1.00 16.55 ? 82   THR A CB  1 
ATOM   650   O OG1 . THR A 1 83  ? -36.129 20.096  21.881  1.00 15.35 ? 82   THR A OG1 1 
ATOM   651   C CG2 . THR A 1 83  ? -36.840 18.833  19.871  1.00 16.32 ? 82   THR A CG2 1 
ATOM   652   N N   . LEU A 1 84  ? -36.485 15.666  22.430  1.00 15.60 ? 83   LEU A N   1 
ATOM   653   C CA  . LEU A 1 84  ? -36.451 14.246  22.111  1.00 15.35 ? 83   LEU A CA  1 
ATOM   654   C C   . LEU A 1 84  ? -37.803 13.583  22.415  1.00 15.18 ? 83   LEU A C   1 
ATOM   655   O O   . LEU A 1 84  ? -38.083 12.538  21.812  1.00 15.20 ? 83   LEU A O   1 
ATOM   656   C CB  . LEU A 1 84  ? -35.270 13.548  22.802  1.00 14.20 ? 83   LEU A CB  1 
ATOM   657   C CG  . LEU A 1 84  ? -35.199 12.034  22.670  1.00 14.99 ? 83   LEU A CG  1 
ATOM   658   C CD1 . LEU A 1 84  ? -34.915 11.602  21.231  1.00 14.43 ? 83   LEU A CD1 1 
ATOM   659   C CD2 . LEU A 1 84  ? -34.111 11.472  23.583  1.00 14.56 ? 83   LEU A CD2 1 
ATOM   660   N N   . TYR A 1 85  ? -38.583 14.178  23.281  1.00 15.51 ? 84   TYR A N   1 
ATOM   661   C CA  . TYR A 1 85  ? -39.861 13.557  23.694  1.00 16.75 ? 84   TYR A CA  1 
ATOM   662   C C   . TYR A 1 85  ? -41.054 14.331  23.186  1.00 17.61 ? 84   TYR A C   1 
ATOM   663   O O   . TYR A 1 85  ? -42.208 14.022  23.548  1.00 18.70 ? 84   TYR A O   1 
ATOM   664   C CB  . TYR A 1 85  ? -39.886 13.357  25.236  1.00 16.35 ? 84   TYR A CB  1 
ATOM   665   C CG  . TYR A 1 85  ? -38.733 12.454  25.641  1.00 15.44 ? 84   TYR A CG  1 
ATOM   666   C CD1 . TYR A 1 85  ? -38.812 11.095  25.368  1.00 14.27 ? 84   TYR A CD1 1 
ATOM   667   C CD2 . TYR A 1 85  ? -37.555 12.967  26.204  1.00 15.04 ? 84   TYR A CD2 1 
ATOM   668   C CE1 . TYR A 1 85  ? -37.757 10.234  25.686  1.00 15.51 ? 84   TYR A CE1 1 
ATOM   669   C CE2 . TYR A 1 85  ? -36.497 12.116  26.517  1.00 13.34 ? 84   TYR A CE2 1 
ATOM   670   C CZ  . TYR A 1 85  ? -36.601 10.762  26.253  1.00 13.64 ? 84   TYR A CZ  1 
ATOM   671   O OH  . TYR A 1 85  ? -35.611 9.862   26.545  1.00 15.38 ? 84   TYR A OH  1 
ATOM   672   N N   . GLN A 1 86  ? -40.784 15.319  22.343  1.00 18.17 ? 85   GLN A N   1 
ATOM   673   C CA  . GLN A 1 86  ? -41.875 16.177  21.819  1.00 18.38 ? 85   GLN A CA  1 
ATOM   674   C C   . GLN A 1 86  ? -42.492 15.531  20.572  1.00 18.89 ? 85   GLN A C   1 
ATOM   675   O O   . GLN A 1 86  ? -41.964 14.567  20.003  1.00 18.22 ? 85   GLN A O   1 
ATOM   676   C CB  . GLN A 1 86  ? -41.456 17.614  21.652  1.00 18.26 ? 85   GLN A CB  1 
ATOM   677   C CG  . GLN A 1 86  ? -41.382 18.385  22.975  1.00 18.10 ? 85   GLN A CG  1 
ATOM   678   C CD  . GLN A 1 86  ? -40.917 19.795  22.752  1.00 18.32 ? 85   GLN A CD  1 
ATOM   679   O OE1 . GLN A 1 86  ? -40.262 20.076  21.743  1.00 19.60 ? 85   GLN A OE1 1 
ATOM   680   N NE2 . GLN A 1 86  ? -41.270 20.700  23.649  1.00 18.08 ? 85   GLN A NE2 1 
ATOM   681   N N   . LYS A 1 87  ? -43.631 16.072  20.204  1.00 19.82 ? 86   LYS A N   1 
ATOM   682   C CA  . LYS A 1 87  ? -44.465 15.578  19.107  1.00 20.98 ? 86   LYS A CA  1 
ATOM   683   C C   . LYS A 1 87  ? -44.951 16.721  18.224  1.00 21.00 ? 86   LYS A C   1 
ATOM   684   O O   . LYS A 1 87  ? -45.062 17.878  18.648  1.00 20.98 ? 86   LYS A O   1 
ATOM   685   C CB  . LYS A 1 87  ? -45.694 14.843  19.641  1.00 22.80 ? 86   LYS A CB  1 
ATOM   686   C CG  . LYS A 1 87  ? -45.423 13.668  20.568  1.00 24.78 ? 86   LYS A CG  1 
ATOM   687   C CD  . LYS A 1 87  ? -46.733 13.128  21.131  1.00 27.32 ? 86   LYS A CD  1 
ATOM   688   C CE  . LYS A 1 87  ? -46.512 12.121  22.243  1.00 29.96 ? 86   LYS A CE  1 
ATOM   689   N NZ  . LYS A 1 87  ? -45.410 11.182  21.888  1.00 31.59 ? 86   LYS A NZ  1 
ATOM   690   N N   . ALA A 1 88  ? -45.222 16.350  16.982  1.00 21.87 ? 87   ALA A N   1 
ATOM   691   C CA  . ALA A 1 88  ? -45.747 17.301  15.982  1.00 22.61 ? 87   ALA A CA  1 
ATOM   692   C C   . ALA A 1 88  ? -47.235 17.531  16.270  1.00 23.16 ? 87   ALA A C   1 
ATOM   693   O O   . ALA A 1 88  ? -47.833 16.753  17.031  1.00 23.55 ? 87   ALA A O   1 
ATOM   694   C CB  . ALA A 1 88  ? -45.499 16.750  14.588  1.00 23.01 ? 87   ALA A CB  1 
ATOM   695   N N   . ASP A 1 89  ? -47.777 18.572  15.694  1.00 23.82 ? 88   ASP A N   1 
ATOM   696   C CA  . ASP A 1 89  ? -49.173 18.986  15.805  1.00 24.62 ? 88   ASP A CA  1 
ATOM   697   C C   . ASP A 1 89  ? -50.138 17.805  15.619  1.00 24.74 ? 88   ASP A C   1 
ATOM   698   O O   . ASP A 1 89  ? -51.158 17.694  16.319  1.00 24.56 ? 88   ASP A O   1 
ATOM   699   C CB  . ASP A 1 89  ? -49.486 20.090  14.788  1.00 26.17 ? 88   ASP A CB  1 
ATOM   700   C CG  . ASP A 1 89  ? -48.972 21.457  15.175  1.00 26.99 ? 88   ASP A CG  1 
ATOM   701   O OD1 . ASP A 1 89  ? -48.715 21.680  16.378  1.00 27.47 ? 88   ASP A OD1 1 
ATOM   702   O OD2 . ASP A 1 89  ? -48.839 22.326  14.300  1.00 28.15 ? 88   ASP A OD2 1 
ATOM   703   N N   . ASP A 1 90  ? -49.798 16.972  14.659  1.00 24.70 ? 89   ASP A N   1 
ATOM   704   C CA  . ASP A 1 90  ? -50.623 15.807  14.303  1.00 25.11 ? 89   ASP A CA  1 
ATOM   705   C C   . ASP A 1 90  ? -50.414 14.656  15.279  1.00 24.76 ? 89   ASP A C   1 
ATOM   706   O O   . ASP A 1 90  ? -51.062 13.611  15.130  1.00 25.03 ? 89   ASP A O   1 
ATOM   707   C CB  . ASP A 1 90  ? -50.386 15.402  12.847  1.00 26.28 ? 89   ASP A CB  1 
ATOM   708   C CG  . ASP A 1 90  ? -48.957 15.001  12.550  1.00 27.75 ? 89   ASP A CG  1 
ATOM   709   O OD1 . ASP A 1 90  ? -48.173 14.604  13.428  1.00 26.81 ? 89   ASP A OD1 1 
ATOM   710   O OD2 . ASP A 1 90  ? -48.618 15.071  11.342  1.00 28.23 ? 89   ASP A OD2 1 
ATOM   711   N N   . GLY A 1 91  ? -49.504 14.840  16.222  1.00 24.73 ? 90   GLY A N   1 
ATOM   712   C CA  . GLY A 1 91  ? -49.187 13.831  17.225  1.00 23.95 ? 90   GLY A CA  1 
ATOM   713   C C   . GLY A 1 91  ? -48.013 12.935  16.909  1.00 23.32 ? 90   GLY A C   1 
ATOM   714   O O   . GLY A 1 91  ? -47.701 12.020  17.715  1.00 23.91 ? 90   GLY A O   1 
ATOM   715   N N   . THR A 1 92  ? -47.340 13.151  15.788  1.00 22.49 ? 91   THR A N   1 
ATOM   716   C CA  . THR A 1 92  ? -46.180 12.298  15.439  1.00 21.59 ? 91   THR A CA  1 
ATOM   717   C C   . THR A 1 92  ? -44.958 12.760  16.235  1.00 20.38 ? 91   THR A C   1 
ATOM   718   O O   . THR A 1 92  ? -44.660 13.963  16.256  1.00 20.81 ? 91   THR A O   1 
ATOM   719   C CB  . THR A 1 92  ? -45.887 12.284  13.892  1.00 22.14 ? 91   THR A CB  1 
ATOM   720   O OG1 . THR A 1 92  ? -47.180 12.262  13.206  1.00 21.60 ? 91   THR A OG1 1 
ATOM   721   C CG2 . THR A 1 92  ? -44.992 11.116  13.456  1.00 21.07 ? 91   THR A CG2 1 
ATOM   722   N N   . PRO A 1 93  ? -44.304 11.819  16.875  1.00 19.99 ? 92   PRO A N   1 
ATOM   723   C CA  . PRO A 1 93  ? -43.069 12.086  17.635  1.00 19.54 ? 92   PRO A CA  1 
ATOM   724   C C   . PRO A 1 93  ? -41.972 12.609  16.708  1.00 19.29 ? 92   PRO A C   1 
ATOM   725   O O   . PRO A 1 93  ? -41.715 12.029  15.633  1.00 18.91 ? 92   PRO A O   1 
ATOM   726   C CB  . PRO A 1 93  ? -42.673 10.739  18.225  1.00 19.70 ? 92   PRO A CB  1 
ATOM   727   C CG  . PRO A 1 93  ? -43.909 9.890   18.135  1.00 20.33 ? 92   PRO A CG  1 
ATOM   728   C CD  . PRO A 1 93  ? -44.597 10.369  16.853  1.00 20.24 ? 92   PRO A CD  1 
ATOM   729   N N   . PHE A 1 94  ? -41.345 13.675  17.141  1.00 18.74 ? 93   PHE A N   1 
ATOM   730   C CA  . PHE A 1 94  ? -40.219 14.288  16.416  1.00 19.04 ? 93   PHE A CA  1 
ATOM   731   C C   . PHE A 1 94  ? -39.173 13.241  16.030  1.00 19.10 ? 93   PHE A C   1 
ATOM   732   O O   . PHE A 1 94  ? -38.638 13.319  14.913  1.00 19.49 ? 93   PHE A O   1 
ATOM   733   C CB  . PHE A 1 94  ? -39.583 15.435  17.204  1.00 16.43 ? 93   PHE A CB  1 
ATOM   734   C CG  . PHE A 1 94  ? -40.380 16.701  17.249  1.00 16.64 ? 93   PHE A CG  1 
ATOM   735   C CD1 . PHE A 1 94  ? -41.436 16.912  16.361  1.00 16.83 ? 93   PHE A CD1 1 
ATOM   736   C CD2 . PHE A 1 94  ? -40.061 17.684  18.183  1.00 15.48 ? 93   PHE A CD2 1 
ATOM   737   C CE1 . PHE A 1 94  ? -42.160 18.110  16.409  1.00 15.62 ? 93   PHE A CE1 1 
ATOM   738   C CE2 . PHE A 1 94  ? -40.756 18.875  18.246  1.00 16.44 ? 93   PHE A CE2 1 
ATOM   739   C CZ  . PHE A 1 94  ? -41.818 19.090  17.346  1.00 16.16 ? 93   PHE A CZ  1 
ATOM   740   N N   . ALA A 1 95  ? -38.908 12.317  16.930  1.00 19.52 ? 94   ALA A N   1 
ATOM   741   C CA  . ALA A 1 95  ? -37.868 11.295  16.760  1.00 20.11 ? 94   ALA A CA  1 
ATOM   742   C C   . ALA A 1 95  ? -38.180 10.399  15.564  1.00 20.77 ? 94   ALA A C   1 
ATOM   743   O O   . ALA A 1 95  ? -37.284 9.972   14.819  1.00 20.40 ? 94   ALA A O   1 
ATOM   744   C CB  . ALA A 1 95  ? -37.673 10.493  18.037  1.00 19.83 ? 94   ALA A CB  1 
ATOM   745   N N   . GLU A 1 96  ? -39.465 10.128  15.420  1.00 21.52 ? 95   GLU A N   1 
ATOM   746   C CA  . GLU A 1 96  ? -39.985 9.319   14.317  1.00 21.97 ? 95   GLU A CA  1 
ATOM   747   C C   . GLU A 1 96  ? -39.868 10.071  12.998  1.00 21.17 ? 95   GLU A C   1 
ATOM   748   O O   . GLU A 1 96  ? -39.409 9.487   12.005  1.00 21.32 ? 95   GLU A O   1 
ATOM   749   C CB  . GLU A 1 96  ? -41.444 8.930   14.553  1.00 25.32 ? 95   GLU A CB  1 
ATOM   750   C CG  . GLU A 1 96  ? -42.040 7.912   13.586  1.00 28.84 ? 95   GLU A CG  1 
ATOM   751   C CD  . GLU A 1 96  ? -43.483 7.556   13.814  1.00 30.39 ? 95   GLU A CD  1 
ATOM   752   O OE1 . GLU A 1 96  ? -43.882 6.951   14.793  1.00 29.82 ? 95   GLU A OE1 1 
ATOM   753   O OE2 . GLU A 1 96  ? -44.208 7.965   12.878  1.00 32.00 ? 95   GLU A OE2 1 
ATOM   754   N N   . ILE A 1 97  ? -40.261 11.329  12.994  1.00 20.81 ? 96   ILE A N   1 
ATOM   755   C CA  . ILE A 1 97  ? -40.219 12.175  11.791  1.00 20.67 ? 96   ILE A CA  1 
ATOM   756   C C   . ILE A 1 97  ? -38.811 12.187  11.203  1.00 21.04 ? 96   ILE A C   1 
ATOM   757   O O   . ILE A 1 97  ? -38.610 11.906  10.005  1.00 20.57 ? 96   ILE A O   1 
ATOM   758   C CB  . ILE A 1 97  ? -40.777 13.597  12.074  1.00 19.99 ? 96   ILE A CB  1 
ATOM   759   C CG1 . ILE A 1 97  ? -42.319 13.505  12.302  1.00 19.85 ? 96   ILE A CG1 1 
ATOM   760   C CG2 . ILE A 1 97  ? -40.451 14.619  10.958  1.00 20.80 ? 96   ILE A CG2 1 
ATOM   761   C CD1 . ILE A 1 97  ? -42.923 14.788  12.925  1.00 19.24 ? 96   ILE A CD1 1 
ATOM   762   N N   . LEU A 1 98  ? -37.860 12.487  12.079  1.00 20.57 ? 97   LEU A N   1 
ATOM   763   C CA  . LEU A 1 98  ? -36.441 12.529  11.701  1.00 20.31 ? 97   LEU A CA  1 
ATOM   764   C C   . LEU A 1 98  ? -35.928 11.180  11.248  1.00 20.34 ? 97   LEU A C   1 
ATOM   765   O O   . LEU A 1 98  ? -35.319 11.088  10.156  1.00 20.09 ? 97   LEU A O   1 
ATOM   766   C CB  . LEU A 1 98  ? -35.664 13.194  12.847  1.00 18.85 ? 97   LEU A CB  1 
ATOM   767   C CG  . LEU A 1 98  ? -35.928 14.663  13.093  1.00 18.20 ? 97   LEU A CG  1 
ATOM   768   C CD1 . LEU A 1 98  ? -35.236 15.163  14.357  1.00 18.48 ? 97   LEU A CD1 1 
ATOM   769   C CD2 . LEU A 1 98  ? -35.416 15.465  11.895  1.00 19.54 ? 97   LEU A CD2 1 
ATOM   770   N N   . LYS A 1 99  ? -36.159 10.130  12.012  1.00 21.06 ? 98   LYS A N   1 
ATOM   771   C CA  . LYS A 1 99  ? -35.625 8.803   11.685  1.00 22.28 ? 98   LYS A CA  1 
ATOM   772   C C   . LYS A 1 99  ? -36.235 8.255   10.387  1.00 22.74 ? 98   LYS A C   1 
ATOM   773   O O   . LYS A 1 99  ? -35.562 7.500   9.659   1.00 21.95 ? 98   LYS A O   1 
ATOM   774   C CB  . LYS A 1 99  ? -35.792 7.782   12.793  1.00 24.57 ? 98   LYS A CB  1 
ATOM   775   C CG  . LYS A 1 99  ? -34.708 7.900   13.892  1.00 26.55 ? 98   LYS A CG  1 
ATOM   776   C CD  . LYS A 1 99  ? -34.970 6.828   14.946  1.00 28.37 ? 98   LYS A CD  1 
ATOM   777   C CE  . LYS A 1 99  ? -33.694 6.197   15.461  1.00 28.68 ? 98   LYS A CE  1 
ATOM   778   N NZ  . LYS A 1 99  ? -34.026 4.998   16.274  1.00 31.22 ? 98   LYS A NZ  1 
ATOM   779   N N   . LYS A 1 100 ? -37.472 8.637   10.152  1.00 22.88 ? 99   LYS A N   1 
ATOM   780   C CA  . LYS A 1 100 ? -38.187 8.222   8.920   1.00 23.51 ? 99   LYS A CA  1 
ATOM   781   C C   . LYS A 1 100 ? -37.436 8.781   7.710   1.00 22.73 ? 99   LYS A C   1 
ATOM   782   O O   . LYS A 1 100 ? -37.305 8.107   6.671   1.00 23.10 ? 99   LYS A O   1 
ATOM   783   C CB  . LYS A 1 100 ? -39.625 8.696   8.904   1.00 25.81 ? 99   LYS A CB  1 
ATOM   784   C CG  . LYS A 1 100 ? -40.576 7.914   9.814   1.00 29.25 ? 99   LYS A CG  1 
ATOM   785   C CD  . LYS A 1 100 ? -40.922 6.559   9.217   1.00 31.62 ? 99   LYS A CD  1 
ATOM   786   C CE  . LYS A 1 100 ? -42.263 6.045   9.689   1.00 33.46 ? 99   LYS A CE  1 
ATOM   787   N NZ  . LYS A 1 100 ? -42.597 4.763   9.000   1.00 34.49 ? 99   LYS A NZ  1 
ATOM   788   N N   . LYS A 1 101 ? -36.944 9.993   7.888   1.00 21.72 ? 100  LYS A N   1 
ATOM   789   C CA  . LYS A 1 101 ? -36.193 10.715  6.861   1.00 20.79 ? 100  LYS A CA  1 
ATOM   790   C C   . LYS A 1 101 ? -34.762 10.246  6.708   1.00 19.70 ? 100  LYS A C   1 
ATOM   791   O O   . LYS A 1 101 ? -34.013 10.788  5.860   1.00 19.85 ? 100  LYS A O   1 
ATOM   792   C CB  . LYS A 1 101 ? -36.220 12.225  7.129   1.00 20.84 ? 100  LYS A CB  1 
ATOM   793   C CG  . LYS A 1 101 ? -37.569 12.838  6.774   1.00 21.60 ? 100  LYS A CG  1 
ATOM   794   C CD  . LYS A 1 101 ? -37.691 14.300  7.171   1.00 21.50 ? 100  LYS A CD  1 
ATOM   795   C CE  . LYS A 1 101 ? -39.151 14.732  7.083   1.00 22.63 ? 100  LYS A CE  1 
ATOM   796   N NZ  . LYS A 1 101 ? -39.263 16.190  7.296   1.00 22.36 ? 100  LYS A NZ  1 
ATOM   797   N N   . GLY A 1 102 ? -34.358 9.286   7.512   1.00 18.32 ? 101  GLY A N   1 
ATOM   798   C CA  . GLY A 1 102 ? -33.026 8.694   7.478   1.00 17.53 ? 101  GLY A CA  1 
ATOM   799   C C   . GLY A 1 102 ? -31.968 9.503   8.211   1.00 16.74 ? 101  GLY A C   1 
ATOM   800   O O   . GLY A 1 102 ? -30.750 9.321   7.971   1.00 17.11 ? 101  GLY A O   1 
ATOM   801   N N   . ILE A 1 103 ? -32.409 10.373  9.088   1.00 15.55 ? 102  ILE A N   1 
ATOM   802   C CA  . ILE A 1 103 ? -31.520 11.237  9.883   1.00 14.58 ? 102  ILE A CA  1 
ATOM   803   C C   . ILE A 1 103 ? -31.228 10.581  11.236  1.00 14.11 ? 102  ILE A C   1 
ATOM   804   O O   . ILE A 1 103 ? -32.152 10.050  11.880  1.00 13.63 ? 102  ILE A O   1 
ATOM   805   C CB  . ILE A 1 103 ? -32.125 12.668  10.003  1.00 14.98 ? 102  ILE A CB  1 
ATOM   806   C CG1 . ILE A 1 103 ? -32.208 13.326  8.590   1.00 13.65 ? 102  ILE A CG1 1 
ATOM   807   C CG2 . ILE A 1 103 ? -31.360 13.579  10.994  1.00 13.38 ? 102  ILE A CG2 1 
ATOM   808   C CD1 . ILE A 1 103 ? -32.851 14.734  8.607   1.00 15.91 ? 102  ILE A CD1 1 
ATOM   809   N N   . ILE A 1 104 ? -29.972 10.625  11.623  1.00 13.36 ? 103  ILE A N   1 
ATOM   810   C CA  . ILE A 1 104 ? -29.517 10.012  12.901  1.00 12.32 ? 103  ILE A CA  1 
ATOM   811   C C   . ILE A 1 104 ? -29.738 11.012  14.031  1.00 11.55 ? 103  ILE A C   1 
ATOM   812   O O   . ILE A 1 104 ? -29.510 12.222  13.850  1.00 11.35 ? 103  ILE A O   1 
ATOM   813   C CB  . ILE A 1 104 ? -28.034 9.548   12.762  1.00 13.29 ? 103  ILE A CB  1 
ATOM   814   C CG1 . ILE A 1 104 ? -27.913 8.449   11.668  1.00 13.35 ? 103  ILE A CG1 1 
ATOM   815   C CG2 . ILE A 1 104 ? -27.437 9.015   14.107  1.00 12.91 ? 103  ILE A CG2 1 
ATOM   816   C CD1 . ILE A 1 104 ? -26.430 8.237   11.222  1.00 14.50 ? 103  ILE A CD1 1 
ATOM   817   N N   . LEU A 1 105 ? -30.163 10.501  15.189  1.00 10.99 ? 104  LEU A N   1 
ATOM   818   C CA  . LEU A 1 105 ? -30.444 11.357  16.346  1.00 10.58 ? 104  LEU A CA  1 
ATOM   819   C C   . LEU A 1 105 ? -29.260 11.352  17.336  1.00 9.33  ? 104  LEU A C   1 
ATOM   820   O O   . LEU A 1 105 ? -28.694 10.307  17.656  1.00 8.86  ? 104  LEU A O   1 
ATOM   821   C CB  . LEU A 1 105 ? -31.736 10.864  17.010  1.00 12.02 ? 104  LEU A CB  1 
ATOM   822   C CG  . LEU A 1 105 ? -33.034 10.819  16.236  1.00 13.45 ? 104  LEU A CG  1 
ATOM   823   C CD1 . LEU A 1 105 ? -34.205 10.560  17.204  1.00 13.98 ? 104  LEU A CD1 1 
ATOM   824   C CD2 . LEU A 1 105 ? -33.270 12.145  15.534  1.00 14.28 ? 104  LEU A CD2 1 
ATOM   825   N N   . GLY A 1 106 ? -28.968 12.534  17.805  1.00 10.15 ? 105  GLY A N   1 
ATOM   826   C CA  . GLY A 1 106 ? -27.906 12.798  18.791  1.00 10.50 ? 105  GLY A CA  1 
ATOM   827   C C   . GLY A 1 106 ? -28.544 13.524  19.982  1.00 10.59 ? 105  GLY A C   1 
ATOM   828   O O   . GLY A 1 106 ? -29.625 14.109  19.826  1.00 10.60 ? 105  GLY A O   1 
ATOM   829   N N   . ILE A 1 107 ? -27.849 13.477  21.117  1.00 10.42 ? 106  ILE A N   1 
ATOM   830   C CA  . ILE A 1 107 ? -28.353 14.071  22.363  1.00 8.92  ? 106  ILE A CA  1 
ATOM   831   C C   . ILE A 1 107 ? -27.218 14.744  23.141  1.00 9.34  ? 106  ILE A C   1 
ATOM   832   O O   . ILE A 1 107 ? -26.135 14.133  23.304  1.00 8.93  ? 106  ILE A O   1 
ATOM   833   C CB  . ILE A 1 107 ? -29.052 12.954  23.211  1.00 9.39  ? 106  ILE A CB  1 
ATOM   834   C CG1 . ILE A 1 107 ? -29.631 13.550  24.524  1.00 8.45  ? 106  ILE A CG1 1 
ATOM   835   C CG2 . ILE A 1 107 ? -28.121 11.751  23.520  1.00 6.82  ? 106  ILE A CG2 1 
ATOM   836   C CD1 . ILE A 1 107 ? -30.687 14.663  24.340  1.00 7.57  ? 106  ILE A CD1 1 
ATOM   837   N N   . LYS A 1 108 ? -27.492 15.944  23.583  1.00 8.97  ? 107  LYS A N   1 
ATOM   838   C CA  . LYS A 1 108 ? -26.572 16.704  24.465  1.00 9.46  ? 107  LYS A CA  1 
ATOM   839   C C   . LYS A 1 108 ? -26.680 16.114  25.881  1.00 8.89  ? 107  LYS A C   1 
ATOM   840   O O   . LYS A 1 108 ? -27.777 16.027  26.486  1.00 8.53  ? 107  LYS A O   1 
ATOM   841   C CB  . LYS A 1 108 ? -26.933 18.176  24.465  1.00 10.41 ? 107  LYS A CB  1 
ATOM   842   C CG  . LYS A 1 108 ? -25.951 19.037  25.291  1.00 14.71 ? 107  LYS A CG  1 
ATOM   843   C CD  . LYS A 1 108 ? -26.708 19.791  26.368  1.00 16.32 ? 107  LYS A CD  1 
ATOM   844   C CE  . LYS A 1 108 ? -27.489 20.954  25.804  1.00 19.38 ? 107  LYS A CE  1 
ATOM   845   N NZ  . LYS A 1 108 ? -26.551 21.812  25.013  1.00 21.83 ? 107  LYS A NZ  1 
ATOM   846   N N   . VAL A 1 109 ? -25.545 15.663  26.395  1.00 7.89  ? 108  VAL A N   1 
ATOM   847   C CA  . VAL A 1 109 ? -25.513 14.996  27.697  1.00 8.33  ? 108  VAL A CA  1 
ATOM   848   C C   . VAL A 1 109 ? -24.738 15.737  28.777  1.00 8.12  ? 108  VAL A C   1 
ATOM   849   O O   . VAL A 1 109 ? -24.822 15.225  29.919  1.00 8.13  ? 108  VAL A O   1 
ATOM   850   C CB  . VAL A 1 109 ? -25.040 13.538  27.576  1.00 7.43  ? 108  VAL A CB  1 
ATOM   851   C CG1 . VAL A 1 109 ? -25.982 12.696  26.731  1.00 8.61  ? 108  VAL A CG1 1 
ATOM   852   C CG2 . VAL A 1 109 ? -23.586 13.465  27.093  1.00 7.90  ? 108  VAL A CG2 1 
ATOM   853   N N   . ASP A 1 110 ? -24.048 16.815  28.493  1.00 8.19  ? 109  ASP A N   1 
ATOM   854   C CA  . ASP A 1 110 ? -23.329 17.527  29.582  1.00 8.52  ? 109  ASP A CA  1 
ATOM   855   C C   . ASP A 1 110 ? -24.319 18.346  30.415  1.00 9.13  ? 109  ASP A C   1 
ATOM   856   O O   . ASP A 1 110 ? -25.447 18.665  29.989  1.00 9.31  ? 109  ASP A O   1 
ATOM   857   C CB  . ASP A 1 110 ? -22.145 18.336  29.090  1.00 7.29  ? 109  ASP A CB  1 
ATOM   858   C CG  . ASP A 1 110 ? -22.538 19.555  28.280  1.00 11.36 ? 109  ASP A CG  1 
ATOM   859   O OD1 . ASP A 1 110 ? -22.926 20.555  28.926  1.00 10.52 ? 109  ASP A OD1 1 
ATOM   860   O OD2 . ASP A 1 110 ? -22.489 19.527  27.027  1.00 10.57 ? 109  ASP A OD2 1 
ATOM   861   N N   . LYS A 1 111 ? -23.836 18.722  31.604  1.00 8.74  ? 110  LYS A N   1 
ATOM   862   C CA  . LYS A 1 111 ? -24.673 19.547  32.506  1.00 9.72  ? 110  LYS A CA  1 
ATOM   863   C C   . LYS A 1 111 ? -24.083 20.913  32.748  1.00 9.37  ? 110  LYS A C   1 
ATOM   864   O O   . LYS A 1 111 ? -24.246 21.534  33.817  1.00 9.69  ? 110  LYS A O   1 
ATOM   865   C CB  . LYS A 1 111 ? -24.982 18.812  33.805  1.00 11.33 ? 110  LYS A CB  1 
ATOM   866   C CG  . LYS A 1 111 ? -25.805 17.517  33.705  1.00 12.86 ? 110  LYS A CG  1 
ATOM   867   C CD  . LYS A 1 111 ? -25.864 16.854  35.081  1.00 15.61 ? 110  LYS A CD  1 
ATOM   868   C CE  . LYS A 1 111 ? -26.451 15.475  35.145  1.00 18.35 ? 110  LYS A CE  1 
ATOM   869   N NZ  . LYS A 1 111 ? -25.975 14.746  36.381  1.00 15.67 ? 110  LYS A NZ  1 
ATOM   870   N N   . GLY A 1 112 ? -23.395 21.437  31.736  1.00 9.07  ? 111  GLY A N   1 
ATOM   871   C CA  . GLY A 1 112 ? -22.840 22.791  31.728  1.00 8.65  ? 111  GLY A CA  1 
ATOM   872   C C   . GLY A 1 112 ? -21.489 22.908  32.429  1.00 8.42  ? 111  GLY A C   1 
ATOM   873   O O   . GLY A 1 112 ? -20.940 21.923  32.949  1.00 8.99  ? 111  GLY A O   1 
ATOM   874   N N   . VAL A 1 113 ? -20.975 24.118  32.465  1.00 8.94  ? 112  VAL A N   1 
ATOM   875   C CA  . VAL A 1 113 ? -19.635 24.402  33.006  1.00 9.09  ? 112  VAL A CA  1 
ATOM   876   C C   . VAL A 1 113 ? -19.690 24.809  34.477  1.00 8.97  ? 112  VAL A C   1 
ATOM   877   O O   . VAL A 1 113 ? -20.680 25.360  34.951  1.00 8.13  ? 112  VAL A O   1 
ATOM   878   C CB  . VAL A 1 113 ? -18.871 25.399  32.124  1.00 9.24  ? 112  VAL A CB  1 
ATOM   879   C CG1 . VAL A 1 113 ? -18.739 24.871  30.684  1.00 10.44 ? 112  VAL A CG1 1 
ATOM   880   C CG2 . VAL A 1 113 ? -19.440 26.802  32.132  1.00 10.54 ? 112  VAL A CG2 1 
ATOM   881   N N   . VAL A 1 114 ? -18.575 24.534  35.145  1.00 9.70  ? 113  VAL A N   1 
ATOM   882   C CA  . VAL A 1 114 ? -18.385 24.909  36.561  1.00 8.76  ? 113  VAL A CA  1 
ATOM   883   C C   . VAL A 1 114 ? -16.961 25.454  36.715  1.00 8.94  ? 113  VAL A C   1 
ATOM   884   O O   . VAL A 1 114 ? -16.045 24.934  36.062  1.00 8.75  ? 113  VAL A O   1 
ATOM   885   C CB  . VAL A 1 114 ? -18.694 23.753  37.511  1.00 9.07  ? 113  VAL A CB  1 
ATOM   886   C CG1 . VAL A 1 114 ? -20.169 23.343  37.566  1.00 8.10  ? 113  VAL A CG1 1 
ATOM   887   C CG2 . VAL A 1 114 ? -17.812 22.527  37.305  1.00 7.18  ? 113  VAL A CG2 1 
ATOM   888   N N   . PRO A 1 115 ? -16.802 26.420  37.611  1.00 8.63  ? 114  PRO A N   1 
ATOM   889   C CA  . PRO A 1 115 ? -15.517 27.079  37.831  1.00 8.51  ? 114  PRO A CA  1 
ATOM   890   C C   . PRO A 1 115 ? -14.505 26.194  38.533  1.00 8.17  ? 114  PRO A C   1 
ATOM   891   O O   . PRO A 1 115 ? -14.836 25.392  39.409  1.00 8.12  ? 114  PRO A O   1 
ATOM   892   C CB  . PRO A 1 115 ? -15.857 28.326  38.644  1.00 9.38  ? 114  PRO A CB  1 
ATOM   893   C CG  . PRO A 1 115 ? -17.124 27.972  39.375  1.00 8.88  ? 114  PRO A CG  1 
ATOM   894   C CD  . PRO A 1 115 ? -17.850 26.965  38.504  1.00 8.88  ? 114  PRO A CD  1 
ATOM   895   N N   . LEU A 1 116 ? -13.270 26.343  38.082  1.00 8.00  ? 115  LEU A N   1 
ATOM   896   C CA  . LEU A 1 116 ? -12.104 25.680  38.708  1.00 7.67  ? 115  LEU A CA  1 
ATOM   897   C C   . LEU A 1 116 ? -11.626 26.634  39.811  1.00 7.08  ? 115  LEU A C   1 
ATOM   898   O O   . LEU A 1 116 ? -11.142 27.722  39.527  1.00 6.34  ? 115  LEU A O   1 
ATOM   899   C CB  . LEU A 1 116 ? -11.083 25.409  37.604  1.00 8.21  ? 115  LEU A CB  1 
ATOM   900   C CG  . LEU A 1 116 ? -11.416 24.349  36.576  1.00 9.32  ? 115  LEU A CG  1 
ATOM   901   C CD1 . LEU A 1 116 ? -10.286 24.253  35.541  1.00 11.79 ? 115  LEU A CD1 1 
ATOM   902   C CD2 . LEU A 1 116 ? -11.618 23.003  37.263  1.00 7.22  ? 115  LEU A CD2 1 
ATOM   903   N N   . PHE A 1 117 ? -11.819 26.197  41.041  1.00 8.10  ? 116  PHE A N   1 
ATOM   904   C CA  . PHE A 1 117 ? -11.494 27.047  42.229  1.00 8.74  ? 116  PHE A CA  1 
ATOM   905   C C   . PHE A 1 117 ? -9.987  27.353  42.250  1.00 8.88  ? 116  PHE A C   1 
ATOM   906   O O   . PHE A 1 117 ? -9.194  26.423  42.088  1.00 9.82  ? 116  PHE A O   1 
ATOM   907   C CB  . PHE A 1 117 ? -11.989 26.356  43.500  1.00 10.67 ? 116  PHE A CB  1 
ATOM   908   C CG  . PHE A 1 117 ? -11.895 27.187  44.749  1.00 11.34 ? 116  PHE A CG  1 
ATOM   909   C CD1 . PHE A 1 117 ? -12.508 28.444  44.777  1.00 13.84 ? 116  PHE A CD1 1 
ATOM   910   C CD2 . PHE A 1 117 ? -11.222 26.718  45.867  1.00 12.56 ? 116  PHE A CD2 1 
ATOM   911   C CE1 . PHE A 1 117 ? -12.439 29.243  45.916  1.00 14.28 ? 116  PHE A CE1 1 
ATOM   912   C CE2 . PHE A 1 117 ? -11.142 27.503  47.034  1.00 11.47 ? 116  PHE A CE2 1 
ATOM   913   C CZ  . PHE A 1 117 ? -11.755 28.763  47.041  1.00 11.91 ? 116  PHE A CZ  1 
ATOM   914   N N   . GLY A 1 118 ? -9.637  28.607  42.430  1.00 8.98  ? 117  GLY A N   1 
ATOM   915   C CA  . GLY A 1 118 ? -8.250  29.069  42.451  1.00 10.15 ? 117  GLY A CA  1 
ATOM   916   C C   . GLY A 1 118 ? -7.717  29.413  41.055  1.00 10.21 ? 117  GLY A C   1 
ATOM   917   O O   . GLY A 1 118 ? -6.651  30.062  40.923  1.00 9.95  ? 117  GLY A O   1 
ATOM   918   N N   . SER A 1 119 ? -8.467  29.013  40.027  1.00 10.21 ? 118  SER A N   1 
ATOM   919   C CA  . SER A 1 119 ? -7.999  29.298  38.638  1.00 10.29 ? 118  SER A CA  1 
ATOM   920   C C   . SER A 1 119 ? -8.300  30.745  38.291  1.00 9.81  ? 118  SER A C   1 
ATOM   921   O O   . SER A 1 119 ? -9.119  31.422  38.944  1.00 10.50 ? 118  SER A O   1 
ATOM   922   C CB  . SER A 1 119 ? -8.652  28.350  37.636  1.00 8.63  ? 118  SER A CB  1 
ATOM   923   O OG  . SER A 1 119 ? -9.972  28.836  37.331  1.00 7.96  ? 118  SER A OG  1 
ATOM   924   N N   . GLU A 1 120 ? -7.638  31.238  37.256  1.00 10.69 ? 119  GLU A N   1 
ATOM   925   C CA  . GLU A 1 120 ? -7.907  32.555  36.680  1.00 11.32 ? 119  GLU A CA  1 
ATOM   926   C C   . GLU A 1 120 ? -9.083  32.485  35.715  1.00 12.35 ? 119  GLU A C   1 
ATOM   927   O O   . GLU A 1 120 ? -8.972  32.566  34.472  1.00 12.17 ? 119  GLU A O   1 
ATOM   928   C CB  . GLU A 1 120 ? -6.690  33.138  35.963  1.00 11.06 ? 119  GLU A CB  1 
ATOM   929   C CG  . GLU A 1 120 ? -5.451  33.261  36.840  1.00 13.58 ? 119  GLU A CG  1 
ATOM   930   C CD  . GLU A 1 120 ? -4.283  34.040  36.333  1.00 15.16 ? 119  GLU A CD  1 
ATOM   931   O OE1 . GLU A 1 120 ? -3.898  33.687  35.205  1.00 17.11 ? 119  GLU A OE1 1 
ATOM   932   O OE2 . GLU A 1 120 ? -3.726  34.916  36.979  1.00 17.14 ? 119  GLU A OE2 1 
ATOM   933   N N   . ASP A 1 121 ? -10.241 32.330  36.330  1.00 12.34 ? 120  ASP A N   1 
ATOM   934   C CA  . ASP A 1 121 ? -11.534 32.262  35.659  1.00 13.03 ? 120  ASP A CA  1 
ATOM   935   C C   . ASP A 1 121 ? -11.687 31.156  34.629  1.00 11.52 ? 120  ASP A C   1 
ATOM   936   O O   . ASP A 1 121 ? -12.293 31.409  33.548  1.00 12.11 ? 120  ASP A O   1 
ATOM   937   C CB  . ASP A 1 121 ? -11.826 33.659  35.067  1.00 18.55 ? 120  ASP A CB  1 
ATOM   938   C CG  . ASP A 1 121 ? -13.015 34.263  35.810  1.00 24.45 ? 120  ASP A CG  1 
ATOM   939   O OD1 . ASP A 1 121 ? -12.857 34.750  36.937  1.00 26.98 ? 120  ASP A OD1 1 
ATOM   940   O OD2 . ASP A 1 121 ? -14.104 34.159  35.192  1.00 27.49 ? 120  ASP A OD2 1 
ATOM   941   N N   . GLU A 1 122 ? -11.206 29.979  34.915  1.00 9.48  ? 121  GLU A N   1 
ATOM   942   C CA  . GLU A 1 122 ? -11.347 28.819  34.020  1.00 8.46  ? 121  GLU A CA  1 
ATOM   943   C C   . GLU A 1 122 ? -12.390 27.857  34.548  1.00 7.05  ? 121  GLU A C   1 
ATOM   944   O O   . GLU A 1 122 ? -12.770 27.937  35.729  1.00 7.10  ? 121  GLU A O   1 
ATOM   945   C CB  . GLU A 1 122 ? -10.034 28.093  33.810  1.00 8.24  ? 121  GLU A CB  1 
ATOM   946   C CG  . GLU A 1 122 ? -8.956  29.017  33.180  1.00 9.25  ? 121  GLU A CG  1 
ATOM   947   C CD  . GLU A 1 122 ? -7.631  28.347  33.004  1.00 11.26 ? 121  GLU A CD  1 
ATOM   948   O OE1 . GLU A 1 122 ? -6.846  28.204  33.922  1.00 10.74 ? 121  GLU A OE1 1 
ATOM   949   O OE2 . GLU A 1 122 ? -7.472  27.954  31.822  1.00 9.96  ? 121  GLU A OE2 1 
ATOM   950   N N   . VAL A 1 123 ? -12.836 26.982  33.667  1.00 6.29  ? 122  VAL A N   1 
ATOM   951   C CA  . VAL A 1 123 ? -13.920 26.048  33.924  1.00 5.04  ? 122  VAL A CA  1 
ATOM   952   C C   . VAL A 1 123 ? -13.564 24.645  33.431  1.00 5.00  ? 122  VAL A C   1 
ATOM   953   O O   . VAL A 1 123 ? -12.604 24.423  32.701  1.00 6.10  ? 122  VAL A O   1 
ATOM   954   C CB  . VAL A 1 123 ? -15.253 26.517  33.304  1.00 5.38  ? 122  VAL A CB  1 
ATOM   955   C CG1 . VAL A 1 123 ? -15.708 27.891  33.768  1.00 4.29  ? 122  VAL A CG1 1 
ATOM   956   C CG2 . VAL A 1 123 ? -15.175 26.485  31.763  1.00 6.43  ? 122  VAL A CG2 1 
ATOM   957   N N   . THR A 1 124 ? -14.409 23.760  33.882  1.00 3.64  ? 123  THR A N   1 
ATOM   958   C CA  . THR A 1 124 ? -14.524 22.378  33.430  1.00 3.80  ? 123  THR A CA  1 
ATOM   959   C C   . THR A 1 124 ? -16.044 22.142  33.249  1.00 3.71  ? 123  THR A C   1 
ATOM   960   O O   . THR A 1 124 ? -16.826 23.024  33.611  1.00 4.79  ? 123  THR A O   1 
ATOM   961   C CB  . THR A 1 124 ? -13.869 21.343  34.367  1.00 2.58  ? 123  THR A CB  1 
ATOM   962   O OG1 . THR A 1 124 ? -13.798 20.076  33.638  1.00 4.47  ? 123  THR A OG1 1 
ATOM   963   C CG2 . THR A 1 124 ? -14.621 21.086  35.708  1.00 3.79  ? 123  THR A CG2 1 
ATOM   964   N N   . THR A 1 125 ? -16.361 21.003  32.715  1.00 4.29  ? 124  THR A N   1 
ATOM   965   C CA  . THR A 1 125 ? -17.749 20.607  32.450  1.00 5.00  ? 124  THR A CA  1 
ATOM   966   C C   . THR A 1 125 ? -18.170 19.461  33.345  1.00 4.91  ? 124  THR A C   1 
ATOM   967   O O   . THR A 1 125 ? -17.378 18.545  33.590  1.00 5.55  ? 124  THR A O   1 
ATOM   968   C CB  . THR A 1 125 ? -17.885 20.201  30.913  1.00 3.24  ? 124  THR A CB  1 
ATOM   969   O OG1 . THR A 1 125 ? -17.517 21.434  30.246  1.00 4.19  ? 124  THR A OG1 1 
ATOM   970   C CG2 . THR A 1 125 ? -19.291 19.714  30.565  1.00 4.96  ? 124  THR A CG2 1 
ATOM   971   N N   . GLN A 1 126 ? -19.409 19.555  33.812  1.00 5.61  ? 125  GLN A N   1 
ATOM   972   C CA  . GLN A 1 126 ? -19.988 18.503  34.673  1.00 6.19  ? 125  GLN A CA  1 
ATOM   973   C C   . GLN A 1 126 ? -21.034 17.711  33.895  1.00 7.16  ? 125  GLN A C   1 
ATOM   974   O O   . GLN A 1 126 ? -21.430 18.127  32.784  1.00 7.77  ? 125  GLN A O   1 
ATOM   975   C CB  . GLN A 1 126 ? -20.562 19.120  35.949  1.00 6.96  ? 125  GLN A CB  1 
ATOM   976   C CG  . GLN A 1 126 ? -21.753 20.038  35.715  1.00 6.70  ? 125  GLN A CG  1 
ATOM   977   C CD  . GLN A 1 126 ? -22.493 20.329  37.007  1.00 10.10 ? 125  GLN A CD  1 
ATOM   978   O OE1 . GLN A 1 126 ? -21.981 20.083  38.101  1.00 7.70  ? 125  GLN A OE1 1 
ATOM   979   N NE2 . GLN A 1 126 ? -23.701 20.857  36.846  1.00 9.22  ? 125  GLN A NE2 1 
ATOM   980   N N   . GLY A 1 127 ? -21.440 16.590  34.469  1.00 7.15  ? 126  GLY A N   1 
ATOM   981   C CA  . GLY A 1 127 ? -22.475 15.722  33.930  1.00 6.60  ? 126  GLY A CA  1 
ATOM   982   C C   . GLY A 1 127 ? -22.125 14.277  33.806  1.00 6.00  ? 126  GLY A C   1 
ATOM   983   O O   . GLY A 1 127 ? -22.864 13.517  33.115  1.00 6.70  ? 126  GLY A O   1 
ATOM   984   N N   . LEU A 1 128 ? -21.051 13.793  34.430  1.00 4.53  ? 127  LEU A N   1 
ATOM   985   C CA  . LEU A 1 128 ? -20.746 12.362  34.396  1.00 5.16  ? 127  LEU A CA  1 
ATOM   986   C C   . LEU A 1 128 ? -21.673 11.527  35.278  1.00 4.60  ? 127  LEU A C   1 
ATOM   987   O O   . LEU A 1 128 ? -21.781 10.310  35.020  1.00 4.31  ? 127  LEU A O   1 
ATOM   988   C CB  . LEU A 1 128 ? -19.270 12.114  34.791  1.00 5.79  ? 127  LEU A CB  1 
ATOM   989   C CG  . LEU A 1 128 ? -18.180 12.840  34.039  1.00 6.46  ? 127  LEU A CG  1 
ATOM   990   C CD1 . LEU A 1 128 ? -16.833 12.687  34.756  1.00 6.51  ? 127  LEU A CD1 1 
ATOM   991   C CD2 . LEU A 1 128 ? -18.065 12.225  32.631  1.00 5.98  ? 127  LEU A CD2 1 
ATOM   992   N N   . ASP A 1 129 ? -22.284 12.100  36.298  1.00 5.92  ? 128  ASP A N   1 
ATOM   993   C CA  . ASP A 1 129 ? -23.041 11.281  37.290  1.00 6.57  ? 128  ASP A CA  1 
ATOM   994   C C   . ASP A 1 129 ? -24.197 10.538  36.625  1.00 6.98  ? 128  ASP A C   1 
ATOM   995   O O   . ASP A 1 129 ? -25.033 11.196  35.986  1.00 7.29  ? 128  ASP A O   1 
ATOM   996   C CB  . ASP A 1 129 ? -23.510 12.151  38.463  1.00 6.83  ? 128  ASP A CB  1 
ATOM   997   C CG  . ASP A 1 129 ? -22.347 12.597  39.333  1.00 5.42  ? 128  ASP A CG  1 
ATOM   998   O OD1 . ASP A 1 129 ? -21.215 12.175  39.118  1.00 6.08  ? 128  ASP A OD1 1 
ATOM   999   O OD2 . ASP A 1 129 ? -22.614 13.442  40.220  1.00 7.09  ? 128  ASP A OD2 1 
ATOM   1000  N N   . ASP A 1 130 ? -24.242 9.243   36.798  1.00 7.70  ? 129  ASP A N   1 
ATOM   1001  C CA  . ASP A 1 130 ? -25.250 8.354   36.220  1.00 9.25  ? 129  ASP A CA  1 
ATOM   1002  C C   . ASP A 1 130 ? -25.322 8.496   34.685  1.00 9.19  ? 129  ASP A C   1 
ATOM   1003  O O   . ASP A 1 130 ? -26.385 8.168   34.111  1.00 7.95  ? 129  ASP A O   1 
ATOM   1004  C CB  . ASP A 1 130 ? -26.627 8.555   36.854  1.00 12.57 ? 129  ASP A CB  1 
ATOM   1005  C CG  . ASP A 1 130 ? -26.711 8.210   38.337  1.00 16.97 ? 129  ASP A CG  1 
ATOM   1006  O OD1 . ASP A 1 130 ? -26.051 7.309   38.874  1.00 17.18 ? 129  ASP A OD1 1 
ATOM   1007  O OD2 . ASP A 1 130 ? -27.534 8.895   38.984  1.00 18.02 ? 129  ASP A OD2 1 
ATOM   1008  N N   . LEU A 1 131 ? -24.250 8.928   34.053  1.00 8.67  ? 130  LEU A N   1 
ATOM   1009  C CA  . LEU A 1 131 ? -24.253 9.085   32.583  1.00 8.52  ? 130  LEU A CA  1 
ATOM   1010  C C   . LEU A 1 131 ? -24.513 7.768   31.878  1.00 8.55  ? 130  LEU A C   1 
ATOM   1011  O O   . LEU A 1 131 ? -25.222 7.769   30.846  1.00 8.86  ? 130  LEU A O   1 
ATOM   1012  C CB  . LEU A 1 131 ? -22.971 9.812   32.145  1.00 8.97  ? 130  LEU A CB  1 
ATOM   1013  C CG  . LEU A 1 131 ? -22.857 10.071  30.638  1.00 8.47  ? 130  LEU A CG  1 
ATOM   1014  C CD1 . LEU A 1 131 ? -23.930 11.069  30.194  1.00 7.70  ? 130  LEU A CD1 1 
ATOM   1015  C CD2 . LEU A 1 131 ? -21.475 10.600  30.326  1.00 8.87  ? 130  LEU A CD2 1 
ATOM   1016  N N   . ALA A 1 132 ? -23.986 6.662   32.359  1.00 8.70  ? 131  ALA A N   1 
ATOM   1017  C CA  . ALA A 1 132 ? -24.149 5.360   31.725  1.00 9.45  ? 131  ALA A CA  1 
ATOM   1018  C C   . ALA A 1 132 ? -25.634 4.986   31.656  1.00 9.98  ? 131  ALA A C   1 
ATOM   1019  O O   . ALA A 1 132 ? -26.100 4.519   30.590  1.00 9.65  ? 131  ALA A O   1 
ATOM   1020  C CB  . ALA A 1 132 ? -23.326 4.260   32.374  1.00 10.69 ? 131  ALA A CB  1 
ATOM   1021  N N   . ALA A 1 133 ? -26.333 5.223   32.756  1.00 9.79  ? 132  ALA A N   1 
ATOM   1022  C CA  . ALA A 1 133 ? -27.783 4.901   32.816  1.00 9.32  ? 132  ALA A CA  1 
ATOM   1023  C C   . ALA A 1 133 ? -28.562 5.795   31.863  1.00 8.68  ? 132  ALA A C   1 
ATOM   1024  O O   . ALA A 1 133 ? -29.502 5.309   31.201  1.00 8.79  ? 132  ALA A O   1 
ATOM   1025  C CB  . ALA A 1 133 ? -28.284 5.012   34.256  1.00 9.39  ? 132  ALA A CB  1 
ATOM   1026  N N   . ARG A 1 134 ? -28.224 7.059   31.822  1.00 9.01  ? 133  ARG A N   1 
ATOM   1027  C CA  . ARG A 1 134 ? -28.833 8.055   30.944  1.00 9.98  ? 133  ARG A CA  1 
ATOM   1028  C C   . ARG A 1 134 ? -28.638 7.651   29.479  1.00 10.21 ? 133  ARG A C   1 
ATOM   1029  O O   . ARG A 1 134 ? -29.607 7.638   28.700  1.00 9.88  ? 133  ARG A O   1 
ATOM   1030  C CB  . ARG A 1 134 ? -28.312 9.467   31.177  1.00 10.41 ? 133  ARG A CB  1 
ATOM   1031  C CG  . ARG A 1 134 ? -28.652 10.100  32.519  1.00 12.98 ? 133  ARG A CG  1 
ATOM   1032  C CD  . ARG A 1 134 ? -28.040 11.465  32.636  1.00 12.77 ? 133  ARG A CD  1 
ATOM   1033  N NE  . ARG A 1 134 ? -28.611 12.338  31.625  1.00 15.77 ? 133  ARG A NE  1 
ATOM   1034  C CZ  . ARG A 1 134 ? -27.979 13.352  31.031  1.00 16.98 ? 133  ARG A CZ  1 
ATOM   1035  N NH1 . ARG A 1 134 ? -26.732 13.656  31.385  1.00 15.71 ? 133  ARG A NH1 1 
ATOM   1036  N NH2 . ARG A 1 134 ? -28.576 14.085  30.079  1.00 15.24 ? 133  ARG A NH2 1 
ATOM   1037  N N   . CYS A 1 135 ? -27.409 7.315   29.128  1.00 10.27 ? 134  CYS A N   1 
ATOM   1038  C CA  . CYS A 1 135 ? -27.076 6.881   27.767  1.00 10.60 ? 134  CYS A CA  1 
ATOM   1039  C C   . CYS A 1 135 ? -27.857 5.644   27.350  1.00 11.38 ? 134  CYS A C   1 
ATOM   1040  O O   . CYS A 1 135 ? -28.326 5.565   26.194  1.00 11.08 ? 134  CYS A O   1 
ATOM   1041  C CB  . CYS A 1 135 ? -25.572 6.656   27.603  1.00 9.92  ? 134  CYS A CB  1 
ATOM   1042  S SG  . CYS A 1 135 ? -24.593 8.142   27.458  1.00 11.23 ? 134  CYS A SG  1 
ATOM   1043  N N   . ALA A 1 136 ? -27.982 4.684   28.256  1.00 11.22 ? 135  ALA A N   1 
ATOM   1044  C CA  . ALA A 1 136 ? -28.694 3.444   27.975  1.00 11.17 ? 135  ALA A CA  1 
ATOM   1045  C C   . ALA A 1 136 ? -30.152 3.729   27.576  1.00 11.32 ? 135  ALA A C   1 
ATOM   1046  O O   . ALA A 1 136 ? -30.687 3.032   26.694  1.00 10.63 ? 135  ALA A O   1 
ATOM   1047  C CB  . ALA A 1 136 ? -28.593 2.463   29.125  1.00 11.69 ? 135  ALA A CB  1 
ATOM   1048  N N   . GLN A 1 137 ? -30.718 4.710   28.232  1.00 11.22 ? 136  GLN A N   1 
ATOM   1049  C CA  . GLN A 1 137 ? -32.109 5.125   28.003  1.00 11.41 ? 136  GLN A CA  1 
ATOM   1050  C C   . GLN A 1 137 ? -32.194 5.894   26.680  1.00 11.28 ? 136  GLN A C   1 
ATOM   1051  O O   . GLN A 1 137 ? -33.108 5.618   25.881  1.00 10.69 ? 136  GLN A O   1 
ATOM   1052  C CB  . GLN A 1 137 ? -32.687 5.901   29.172  1.00 12.68 ? 136  GLN A CB  1 
ATOM   1053  C CG  . GLN A 1 137 ? -34.138 6.335   28.975  1.00 15.20 ? 136  GLN A CG  1 
ATOM   1054  C CD  . GLN A 1 137 ? -35.055 5.138   28.912  1.00 15.94 ? 136  GLN A CD  1 
ATOM   1055  O OE1 . GLN A 1 137 ? -35.000 4.263   29.767  1.00 17.27 ? 136  GLN A OE1 1 
ATOM   1056  N NE2 . GLN A 1 137 ? -35.888 5.076   27.875  1.00 16.34 ? 136  GLN A NE2 1 
ATOM   1057  N N   . TYR A 1 138 ? -31.266 6.801   26.468  1.00 10.61 ? 137  TYR A N   1 
ATOM   1058  C CA  . TYR A 1 138 ? -31.208 7.605   25.232  1.00 10.83 ? 137  TYR A CA  1 
ATOM   1059  C C   . TYR A 1 138 ? -31.090 6.691   24.017  1.00 10.88 ? 137  TYR A C   1 
ATOM   1060  O O   . TYR A 1 138 ? -31.774 6.940   22.999  1.00 11.10 ? 137  TYR A O   1 
ATOM   1061  C CB  . TYR A 1 138 ? -30.131 8.685   25.301  1.00 9.12  ? 137  TYR A CB  1 
ATOM   1062  C CG  . TYR A 1 138 ? -30.422 9.878   26.170  1.00 9.57  ? 137  TYR A CG  1 
ATOM   1063  C CD1 . TYR A 1 138 ? -31.701 10.423  26.301  1.00 9.98  ? 137  TYR A CD1 1 
ATOM   1064  C CD2 . TYR A 1 138 ? -29.388 10.522  26.857  1.00 9.26  ? 137  TYR A CD2 1 
ATOM   1065  C CE1 . TYR A 1 138 ? -31.954 11.545  27.079  1.00 9.96  ? 137  TYR A CE1 1 
ATOM   1066  C CE2 . TYR A 1 138 ? -29.624 11.640  27.649  1.00 10.09 ? 137  TYR A CE2 1 
ATOM   1067  C CZ  . TYR A 1 138 ? -30.906 12.147  27.770  1.00 9.87  ? 137  TYR A CZ  1 
ATOM   1068  O OH  . TYR A 1 138 ? -31.099 13.255  28.552  1.00 9.90  ? 137  TYR A OH  1 
ATOM   1069  N N   . LYS A 1 139 ? -30.309 5.642   24.138  1.00 10.83 ? 138  LYS A N   1 
ATOM   1070  C CA  . LYS A 1 139 ? -30.076 4.664   23.065  1.00 11.90 ? 138  LYS A CA  1 
ATOM   1071  C C   . LYS A 1 139 ? -31.392 3.950   22.736  1.00 13.31 ? 138  LYS A C   1 
ATOM   1072  O O   . LYS A 1 139 ? -31.763 3.779   21.565  1.00 12.97 ? 138  LYS A O   1 
ATOM   1073  C CB  . LYS A 1 139 ? -28.979 3.687   23.402  1.00 10.11 ? 138  LYS A CB  1 
ATOM   1074  C CG  . LYS A 1 139 ? -28.576 2.670   22.357  1.00 11.03 ? 138  LYS A CG  1 
ATOM   1075  C CD  . LYS A 1 139 ? -27.784 3.223   21.193  1.00 11.54 ? 138  LYS A CD  1 
ATOM   1076  C CE  . LYS A 1 139 ? -27.555 2.184   20.104  1.00 12.56 ? 138  LYS A CE  1 
ATOM   1077  N NZ  . LYS A 1 139 ? -26.572 2.694   19.107  1.00 11.79 ? 138  LYS A NZ  1 
ATOM   1078  N N   . LYS A 1 140 ? -32.087 3.562   23.791  1.00 14.20 ? 139  LYS A N   1 
ATOM   1079  C CA  . LYS A 1 140 ? -33.395 2.911   23.732  1.00 14.95 ? 139  LYS A CA  1 
ATOM   1080  C C   . LYS A 1 140 ? -34.409 3.801   23.024  1.00 14.52 ? 139  LYS A C   1 
ATOM   1081  O O   . LYS A 1 140 ? -35.222 3.302   22.225  1.00 14.96 ? 139  LYS A O   1 
ATOM   1082  C CB  . LYS A 1 140 ? -33.902 2.634   25.156  1.00 19.38 ? 139  LYS A CB  1 
ATOM   1083  C CG  . LYS A 1 140 ? -34.979 1.577   25.301  1.00 23.85 ? 139  LYS A CG  1 
ATOM   1084  C CD  . LYS A 1 140 ? -34.923 0.967   26.722  1.00 26.96 ? 139  LYS A CD  1 
ATOM   1085  C CE  . LYS A 1 140 ? -33.477 0.717   27.110  1.00 28.73 ? 139  LYS A CE  1 
ATOM   1086  N NZ  . LYS A 1 140 ? -33.361 -0.187  28.277  1.00 30.99 ? 139  LYS A NZ  1 
ATOM   1087  N N   . ASP A 1 141 ? -34.353 5.072   23.319  1.00 13.40 ? 140  ASP A N   1 
ATOM   1088  C CA  . ASP A 1 141 ? -35.247 6.089   22.784  1.00 14.21 ? 140  ASP A CA  1 
ATOM   1089  C C   . ASP A 1 141 ? -34.840 6.559   21.381  1.00 13.93 ? 140  ASP A C   1 
ATOM   1090  O O   . ASP A 1 141 ? -35.462 7.518   20.902  1.00 14.25 ? 140  ASP A O   1 
ATOM   1091  C CB  . ASP A 1 141 ? -35.417 7.250   23.774  1.00 15.71 ? 140  ASP A CB  1 
ATOM   1092  C CG  . ASP A 1 141 ? -36.102 6.822   25.072  1.00 16.98 ? 140  ASP A CG  1 
ATOM   1093  O OD1 . ASP A 1 141 ? -36.713 5.736   25.044  1.00 18.21 ? 140  ASP A OD1 1 
ATOM   1094  O OD2 . ASP A 1 141 ? -36.013 7.524   26.090  1.00 17.33 ? 140  ASP A OD2 1 
ATOM   1095  N N   . GLY A 1 142 ? -33.826 5.959   20.788  1.00 13.68 ? 141  GLY A N   1 
ATOM   1096  C CA  . GLY A 1 142 ? -33.458 6.210   19.402  1.00 13.44 ? 141  GLY A CA  1 
ATOM   1097  C C   . GLY A 1 142 ? -32.236 7.025   19.093  1.00 13.00 ? 141  GLY A C   1 
ATOM   1098  O O   . GLY A 1 142 ? -32.012 7.347   17.888  1.00 12.35 ? 141  GLY A O   1 
ATOM   1099  N N   . CYS A 1 143 ? -31.429 7.375   20.083  1.00 11.91 ? 142  CYS A N   1 
ATOM   1100  C CA  . CYS A 1 143 ? -30.211 8.187   19.895  1.00 10.95 ? 142  CYS A CA  1 
ATOM   1101  C C   . CYS A 1 143 ? -29.003 7.293   19.663  1.00 9.96  ? 142  CYS A C   1 
ATOM   1102  O O   . CYS A 1 143 ? -28.916 6.197   20.243  1.00 10.59 ? 142  CYS A O   1 
ATOM   1103  C CB  . CYS A 1 143 ? -29.975 9.097   21.104  1.00 13.02 ? 142  CYS A CB  1 
ATOM   1104  S SG  . CYS A 1 143 ? -31.208 10.350  21.406  1.00 14.30 ? 142  CYS A SG  1 
ATOM   1105  N N   . ASP A 1 144 ? -28.072 7.747   18.829  1.00 10.21 ? 143  ASP A N   1 
ATOM   1106  C CA  . ASP A 1 144 ? -26.902 6.927   18.472  1.00 9.65  ? 143  ASP A CA  1 
ATOM   1107  C C   . ASP A 1 144 ? -25.579 7.671   18.679  1.00 8.43  ? 143  ASP A C   1 
ATOM   1108  O O   . ASP A 1 144 ? -24.538 6.998   18.562  1.00 9.06  ? 143  ASP A O   1 
ATOM   1109  C CB  . ASP A 1 144 ? -26.985 6.401   17.030  1.00 10.75 ? 143  ASP A CB  1 
ATOM   1110  C CG  . ASP A 1 144 ? -28.023 5.329   16.812  1.00 12.22 ? 143  ASP A CG  1 
ATOM   1111  O OD1 . ASP A 1 144 ? -28.003 4.327   17.551  1.00 10.03 ? 143  ASP A OD1 1 
ATOM   1112  O OD2 . ASP A 1 144 ? -28.849 5.497   15.885  1.00 14.06 ? 143  ASP A OD2 1 
ATOM   1113  N N   . PHE A 1 145 ? -25.621 8.942   18.895  1.00 9.22  ? 144  PHE A N   1 
ATOM   1114  C CA  . PHE A 1 145 ? -24.416 9.758   19.187  1.00 9.45  ? 144  PHE A CA  1 
ATOM   1115  C C   . PHE A 1 145 ? -24.756 10.743  20.298  1.00 9.04  ? 144  PHE A C   1 
ATOM   1116  O O   . PHE A 1 145 ? -25.933 11.048  20.579  1.00 8.35  ? 144  PHE A O   1 
ATOM   1117  C CB  . PHE A 1 145 ? -23.832 10.397  17.940  1.00 9.53  ? 144  PHE A CB  1 
ATOM   1118  C CG  . PHE A 1 145 ? -24.541 11.541  17.284  1.00 9.13  ? 144  PHE A CG  1 
ATOM   1119  C CD1 . PHE A 1 145 ? -25.579 11.302  16.381  1.00 9.98  ? 144  PHE A CD1 1 
ATOM   1120  C CD2 . PHE A 1 145 ? -24.155 12.852  17.531  1.00 9.40  ? 144  PHE A CD2 1 
ATOM   1121  C CE1 . PHE A 1 145 ? -26.252 12.350  15.751  1.00 7.64  ? 144  PHE A CE1 1 
ATOM   1122  C CE2 . PHE A 1 145 ? -24.784 13.923  16.899  1.00 11.40 ? 144  PHE A CE2 1 
ATOM   1123  C CZ  . PHE A 1 145 ? -25.847 13.673  16.006  1.00 8.83  ? 144  PHE A CZ  1 
ATOM   1124  N N   . ALA A 1 146 ? -23.700 11.288  20.905  1.00 9.10  ? 145  ALA A N   1 
ATOM   1125  C CA  . ALA A 1 146 ? -23.864 12.274  21.974  1.00 9.47  ? 145  ALA A CA  1 
ATOM   1126  C C   . ALA A 1 146 ? -22.944 13.477  21.760  1.00 9.25  ? 145  ALA A C   1 
ATOM   1127  O O   . ALA A 1 146 ? -21.972 13.406  20.988  1.00 9.73  ? 145  ALA A O   1 
ATOM   1128  C CB  . ALA A 1 146 ? -23.593 11.635  23.343  1.00 7.94  ? 145  ALA A CB  1 
ATOM   1129  N N   . LYS A 1 147 ? -23.263 14.529  22.478  1.00 9.49  ? 146  LYS A N   1 
ATOM   1130  C CA  . LYS A 1 147 ? -22.534 15.791  22.502  1.00 9.77  ? 146  LYS A CA  1 
ATOM   1131  C C   . LYS A 1 147 ? -22.236 16.232  23.947  1.00 9.43  ? 146  LYS A C   1 
ATOM   1132  O O   . LYS A 1 147 ? -23.093 16.142  24.840  1.00 9.00  ? 146  LYS A O   1 
ATOM   1133  C CB  . LYS A 1 147 ? -23.340 16.899  21.829  1.00 13.00 ? 146  LYS A CB  1 
ATOM   1134  C CG  . LYS A 1 147 ? -22.596 18.250  21.826  1.00 15.81 ? 146  LYS A CG  1 
ATOM   1135  C CD  . LYS A 1 147 ? -23.527 19.340  22.288  1.00 20.05 ? 146  LYS A CD  1 
ATOM   1136  C CE  . LYS A 1 147 ? -22.871 20.684  22.465  1.00 20.95 ? 146  LYS A CE  1 
ATOM   1137  N NZ  . LYS A 1 147 ? -23.885 21.760  22.349  1.00 23.13 ? 146  LYS A NZ  1 
ATOM   1138  N N   . TRP A 1 148 ? -21.045 16.756  24.131  1.00 8.92  ? 147  TRP A N   1 
ATOM   1139  C CA  . TRP A 1 148 ? -20.551 17.243  25.444  1.00 8.43  ? 147  TRP A CA  1 
ATOM   1140  C C   . TRP A 1 148 ? -19.541 18.371  25.159  1.00 8.25  ? 147  TRP A C   1 
ATOM   1141  O O   . TRP A 1 148 ? -18.523 18.114  24.499  1.00 8.48  ? 147  TRP A O   1 
ATOM   1142  C CB  . TRP A 1 148 ? -19.929 16.134  26.263  1.00 7.10  ? 147  TRP A CB  1 
ATOM   1143  C CG  . TRP A 1 148 ? -19.194 16.472  27.517  1.00 6.58  ? 147  TRP A CG  1 
ATOM   1144  C CD1 . TRP A 1 148 ? -18.107 17.281  27.672  1.00 7.89  ? 147  TRP A CD1 1 
ATOM   1145  C CD2 . TRP A 1 148 ? -19.486 15.956  28.840  1.00 7.31  ? 147  TRP A CD2 1 
ATOM   1146  N NE1 . TRP A 1 148 ? -17.697 17.305  28.993  1.00 8.11  ? 147  TRP A NE1 1 
ATOM   1147  C CE2 . TRP A 1 148 ? -18.531 16.503  29.722  1.00 8.58  ? 147  TRP A CE2 1 
ATOM   1148  C CE3 . TRP A 1 148 ? -20.465 15.104  29.336  1.00 7.87  ? 147  TRP A CE3 1 
ATOM   1149  C CZ2 . TRP A 1 148 ? -18.527 16.225  31.093  1.00 7.29  ? 147  TRP A CZ2 1 
ATOM   1150  C CZ3 . TRP A 1 148 ? -20.472 14.831  30.700  1.00 7.14  ? 147  TRP A CZ3 1 
ATOM   1151  C CH2 . TRP A 1 148 ? -19.520 15.380  31.565  1.00 6.64  ? 147  TRP A CH2 1 
ATOM   1152  N N   . ARG A 1 149 ? -19.826 19.533  25.697  1.00 8.24  ? 148  ARG A N   1 
ATOM   1153  C CA  . ARG A 1 149 ? -18.968 20.684  25.395  1.00 9.48  ? 148  ARG A CA  1 
ATOM   1154  C C   . ARG A 1 149 ? -18.079 21.124  26.541  1.00 9.62  ? 148  ARG A C   1 
ATOM   1155  O O   . ARG A 1 149 ? -18.537 21.433  27.642  1.00 9.36  ? 148  ARG A O   1 
ATOM   1156  C CB  . ARG A 1 149 ? -19.833 21.840  24.888  1.00 10.80 ? 148  ARG A CB  1 
ATOM   1157  C CG  . ARG A 1 149 ? -19.093 23.149  24.659  1.00 11.14 ? 148  ARG A CG  1 
ATOM   1158  C CD  . ARG A 1 149 ? -20.072 24.246  24.377  1.00 13.52 ? 148  ARG A CD  1 
ATOM   1159  N NE  . ARG A 1 149 ? -19.398 25.461  23.934  1.00 13.07 ? 148  ARG A NE  1 
ATOM   1160  C CZ  . ARG A 1 149 ? -19.604 26.642  24.503  1.00 13.53 ? 148  ARG A CZ  1 
ATOM   1161  N NH1 . ARG A 1 149 ? -20.423 26.780  25.548  1.00 14.64 ? 148  ARG A NH1 1 
ATOM   1162  N NH2 . ARG A 1 149 ? -19.010 27.707  23.982  1.00 12.78 ? 148  ARG A NH2 1 
ATOM   1163  N N   . CYS A 1 150 ? -16.780 21.183  26.229  1.00 9.67  ? 149  CYS A N   1 
ATOM   1164  C CA  . CYS A 1 150 ? -15.781 21.795  27.142  1.00 8.85  ? 149  CYS A CA  1 
ATOM   1165  C C   . CYS A 1 150 ? -15.406 23.149  26.562  1.00 9.24  ? 149  CYS A C   1 
ATOM   1166  O O   . CYS A 1 150 ? -15.406 23.340  25.326  1.00 9.08  ? 149  CYS A O   1 
ATOM   1167  C CB  . CYS A 1 150 ? -14.571 20.888  27.332  1.00 7.69  ? 149  CYS A CB  1 
ATOM   1168  S SG  . CYS A 1 150 ? -14.821 19.447  28.363  1.00 8.34  ? 149  CYS A SG  1 
ATOM   1169  N N   . VAL A 1 151 ? -15.083 24.093  27.434  1.00 9.25  ? 150  VAL A N   1 
ATOM   1170  C CA  . VAL A 1 151 ? -14.741 25.458  27.027  1.00 10.20 ? 150  VAL A CA  1 
ATOM   1171  C C   . VAL A 1 151 ? -13.354 25.840  27.548  1.00 11.01 ? 150  VAL A C   1 
ATOM   1172  O O   . VAL A 1 151 ? -13.104 25.745  28.770  1.00 11.04 ? 150  VAL A O   1 
ATOM   1173  C CB  . VAL A 1 151 ? -15.866 26.416  27.475  1.00 11.55 ? 150  VAL A CB  1 
ATOM   1174  C CG1 . VAL A 1 151 ? -15.600 27.860  27.069  1.00 14.04 ? 150  VAL A CG1 1 
ATOM   1175  C CG2 . VAL A 1 151 ? -17.246 26.003  26.975  1.00 12.82 ? 150  VAL A CG2 1 
ATOM   1176  N N   . LEU A 1 152 ? -12.472 26.204  26.627  1.00 10.23 ? 151  LEU A N   1 
ATOM   1177  C CA  . LEU A 1 152 ? -11.133 26.711  26.988  1.00 10.47 ? 151  LEU A CA  1 
ATOM   1178  C C   . LEU A 1 152 ? -11.064 28.177  26.562  1.00 10.87 ? 151  LEU A C   1 
ATOM   1179  O O   . LEU A 1 152 ? -11.579 28.524  25.489  1.00 10.99 ? 151  LEU A O   1 
ATOM   1180  C CB  . LEU A 1 152 ? -10.053 25.839  26.353  1.00 11.81 ? 151  LEU A CB  1 
ATOM   1181  C CG  . LEU A 1 152 ? -10.109 24.364  26.736  1.00 14.81 ? 151  LEU A CG  1 
ATOM   1182  C CD1 . LEU A 1 152 ? -9.380  23.513  25.715  1.00 17.30 ? 151  LEU A CD1 1 
ATOM   1183  C CD2 . LEU A 1 152 ? -9.449  24.215  28.107  1.00 14.97 ? 151  LEU A CD2 1 
ATOM   1184  N N   . LYS A 1 153 ? -10.427 28.986  27.381  1.00 10.13 ? 152  LYS A N   1 
ATOM   1185  C CA  . LYS A 1 153 ? -10.380 30.437  27.184  1.00 10.44 ? 152  LYS A CA  1 
ATOM   1186  C C   . LYS A 1 153 ? -8.975  30.943  26.951  1.00 10.29 ? 152  LYS A C   1 
ATOM   1187  O O   . LYS A 1 153 ? -8.036  30.590  27.697  1.00 9.25  ? 152  LYS A O   1 
ATOM   1188  C CB  . LYS A 1 153 ? -10.972 31.076  28.458  1.00 14.79 ? 152  LYS A CB  1 
ATOM   1189  C CG  . LYS A 1 153 ? -11.965 32.206  28.229  1.00 19.21 ? 152  LYS A CG  1 
ATOM   1190  C CD  . LYS A 1 153 ? -12.894 32.394  29.440  1.00 21.30 ? 152  LYS A CD  1 
ATOM   1191  C CE  . LYS A 1 153 ? -13.451 31.083  29.937  1.00 22.07 ? 152  LYS A CE  1 
ATOM   1192  N NZ  . LYS A 1 153 ? -14.227 31.243  31.194  1.00 26.27 ? 152  LYS A NZ  1 
ATOM   1193  N N   . ILE A 1 154 ? -8.795  31.756  25.902  1.00 9.25  ? 153  ILE A N   1 
ATOM   1194  C CA  . ILE A 1 154 ? -7.465  32.333  25.631  1.00 9.29  ? 153  ILE A CA  1 
ATOM   1195  C C   . ILE A 1 154 ? -7.342  33.681  26.339  1.00 9.40  ? 153  ILE A C   1 
ATOM   1196  O O   . ILE A 1 154 ? -8.112  34.618  26.045  1.00 9.81  ? 153  ILE A O   1 
ATOM   1197  C CB  . ILE A 1 154 ? -7.149  32.469  24.106  1.00 8.83  ? 153  ILE A CB  1 
ATOM   1198  C CG1 . ILE A 1 154 ? -7.138  31.093  23.416  1.00 6.89  ? 153  ILE A CG1 1 
ATOM   1199  C CG2 . ILE A 1 154 ? -5.820  33.254  23.868  1.00 8.15  ? 153  ILE A CG2 1 
ATOM   1200  C CD1 . ILE A 1 154 ? -7.071  31.187  21.850  1.00 7.05  ? 153  ILE A CD1 1 
ATOM   1201  N N   . GLY A 1 155 ? -6.375  33.757  27.236  1.00 9.58  ? 154  GLY A N   1 
ATOM   1202  C CA  . GLY A 1 155 ? -6.131  34.999  28.003  1.00 10.16 ? 154  GLY A CA  1 
ATOM   1203  C C   . GLY A 1 155 ? -4.635  35.117  28.284  1.00 10.51 ? 154  GLY A C   1 
ATOM   1204  O O   . GLY A 1 155 ? -3.821  34.375  27.722  1.00 10.63 ? 154  GLY A O   1 
ATOM   1205  N N   . LYS A 1 156 ? -4.302  36.032  29.194  1.00 10.82 ? 155  LYS A N   1 
ATOM   1206  C CA  . LYS A 1 156 ? -2.904  36.292  29.555  1.00 11.56 ? 155  LYS A CA  1 
ATOM   1207  C C   . LYS A 1 156 ? -2.171  35.006  29.878  1.00 10.97 ? 155  LYS A C   1 
ATOM   1208  O O   . LYS A 1 156 ? -1.123  34.729  29.256  1.00 11.67 ? 155  LYS A O   1 
ATOM   1209  C CB  . LYS A 1 156 ? -2.796  37.256  30.753  1.00 15.30 ? 155  LYS A CB  1 
ATOM   1210  C CG  . LYS A 1 156 ? -1.741  38.333  30.500  1.00 20.68 ? 155  LYS A CG  1 
ATOM   1211  C CD  . LYS A 1 156 ? -0.527  38.263  31.408  1.00 22.95 ? 155  LYS A CD  1 
ATOM   1212  C CE  . LYS A 1 156 ? 0.643   39.035  30.815  1.00 25.79 ? 155  LYS A CE  1 
ATOM   1213  N NZ  . LYS A 1 156 ? 1.468   39.680  31.868  1.00 26.82 ? 155  LYS A NZ  1 
ATOM   1214  N N   . ASN A 1 157 ? -2.720  34.247  30.812  1.00 9.73  ? 156  ASN A N   1 
ATOM   1215  C CA  . ASN A 1 157 ? -2.138  32.972  31.246  1.00 9.16  ? 156  ASN A CA  1 
ATOM   1216  C C   . ASN A 1 157 ? -2.989  31.760  30.947  1.00 8.34  ? 156  ASN A C   1 
ATOM   1217  O O   . ASN A 1 157 ? -2.648  30.635  31.430  1.00 8.74  ? 156  ASN A O   1 
ATOM   1218  C CB  . ASN A 1 157 ? -1.804  33.034  32.770  1.00 10.44 ? 156  ASN A CB  1 
ATOM   1219  C CG  . ASN A 1 157 ? -1.047  34.284  33.136  1.00 11.17 ? 156  ASN A CG  1 
ATOM   1220  O OD1 . ASN A 1 157 ? -0.008  34.581  32.527  1.00 12.76 ? 156  ASN A OD1 1 
ATOM   1221  N ND2 . ASN A 1 157 ? -1.559  35.041  34.104  1.00 10.14 ? 156  ASN A ND2 1 
ATOM   1222  N N   . THR A 1 158 ? -4.052  31.892  30.187  1.00 6.67  ? 157  THR A N   1 
ATOM   1223  C CA  . THR A 1 158 ? -4.959  30.746  29.964  1.00 6.89  ? 157  THR A CA  1 
ATOM   1224  C C   . THR A 1 158 ? -4.986  30.395  28.458  1.00 6.30  ? 157  THR A C   1 
ATOM   1225  O O   . THR A 1 158 ? -4.822  31.311  27.656  1.00 5.11  ? 157  THR A O   1 
ATOM   1226  C CB  . THR A 1 158 ? -6.386  31.058  30.545  1.00 6.63  ? 157  THR A CB  1 
ATOM   1227  O OG1 . THR A 1 158 ? -6.901  32.173  29.756  1.00 8.09  ? 157  THR A OG1 1 
ATOM   1228  C CG2 . THR A 1 158 ? -6.352  31.468  32.041  1.00 6.95  ? 157  THR A CG2 1 
ATOM   1229  N N   . PRO A 1 159 ? -5.230  29.149  28.135  1.00 6.00  ? 158  PRO A N   1 
ATOM   1230  C CA  . PRO A 1 159 ? -5.519  28.044  29.044  1.00 6.44  ? 158  PRO A CA  1 
ATOM   1231  C C   . PRO A 1 159 ? -4.294  27.600  29.836  1.00 6.00  ? 158  PRO A C   1 
ATOM   1232  O O   . PRO A 1 159 ? -3.193  27.489  29.298  1.00 5.59  ? 158  PRO A O   1 
ATOM   1233  C CB  . PRO A 1 159 ? -5.999  26.892  28.170  1.00 6.01  ? 158  PRO A CB  1 
ATOM   1234  C CG  . PRO A 1 159 ? -6.125  27.430  26.777  1.00 6.77  ? 158  PRO A CG  1 
ATOM   1235  C CD  . PRO A 1 159 ? -5.441  28.759  26.725  1.00 6.73  ? 158  PRO A CD  1 
ATOM   1236  N N   . SER A 1 160 ? -4.552  27.319  31.111  1.00 6.52  ? 159  SER A N   1 
ATOM   1237  C CA  . SER A 1 160 ? -3.453  26.850  32.000  1.00 6.10  ? 159  SER A CA  1 
ATOM   1238  C C   . SER A 1 160 ? -3.289  25.354  31.815  1.00 5.51  ? 159  SER A C   1 
ATOM   1239  O O   . SER A 1 160 ? -4.131  24.672  31.211  1.00 5.66  ? 159  SER A O   1 
ATOM   1240  C CB  . SER A 1 160 ? -3.775  27.173  33.463  1.00 6.34  ? 159  SER A CB  1 
ATOM   1241  O OG  . SER A 1 160 ? -4.947  26.429  33.819  1.00 7.24  ? 159  SER A OG  1 
ATOM   1242  N N   . TYR A 1 161 ? -2.193  24.839  32.361  1.00 4.73  ? 160  TYR A N   1 
ATOM   1243  C CA  . TYR A 1 161 ? -1.972  23.384  32.395  1.00 4.07  ? 160  TYR A CA  1 
ATOM   1244  C C   . TYR A 1 161 ? -3.115  22.670  33.117  1.00 3.71  ? 160  TYR A C   1 
ATOM   1245  O O   . TYR A 1 161 ? -3.588  21.593  32.693  1.00 2.36  ? 160  TYR A O   1 
ATOM   1246  C CB  . TYR A 1 161 ? -0.601  23.093  33.048  1.00 5.04  ? 160  TYR A CB  1 
ATOM   1247  C CG  . TYR A 1 161 ? -0.368  21.628  33.285  1.00 6.52  ? 160  TYR A CG  1 
ATOM   1248  C CD1 . TYR A 1 161 ? -0.123  20.795  32.187  1.00 7.55  ? 160  TYR A CD1 1 
ATOM   1249  C CD2 . TYR A 1 161 ? -0.421  21.069  34.556  1.00 6.54  ? 160  TYR A CD2 1 
ATOM   1250  C CE1 . TYR A 1 161 ? 0.064   19.436  32.344  1.00 8.10  ? 160  TYR A CE1 1 
ATOM   1251  C CE2 . TYR A 1 161 ? -0.209  19.697  34.740  1.00 7.92  ? 160  TYR A CE2 1 
ATOM   1252  C CZ  . TYR A 1 161 ? 0.019   18.895  33.631  1.00 8.38  ? 160  TYR A CZ  1 
ATOM   1253  O OH  . TYR A 1 161 ? 0.230   17.554  33.729  1.00 10.57 ? 160  TYR A OH  1 
ATOM   1254  N N   . GLN A 1 162 ? -3.575  23.305  34.187  1.00 3.10  ? 161  GLN A N   1 
ATOM   1255  C CA  . GLN A 1 162 ? -4.671  22.781  35.004  1.00 3.58  ? 161  GLN A CA  1 
ATOM   1256  C C   . GLN A 1 162 ? -5.921  22.520  34.145  1.00 3.32  ? 161  GLN A C   1 
ATOM   1257  O O   . GLN A 1 162 ? -6.492  21.434  34.157  1.00 4.12  ? 161  GLN A O   1 
ATOM   1258  C CB  . GLN A 1 162 ? -5.078  23.680  36.192  1.00 2.98  ? 161  GLN A CB  1 
ATOM   1259  C CG  . GLN A 1 162 ? -6.209  22.975  36.972  1.00 4.75  ? 161  GLN A CG  1 
ATOM   1260  C CD  . GLN A 1 162 ? -6.940  23.805  37.969  1.00 4.43  ? 161  GLN A CD  1 
ATOM   1261  O OE1 . GLN A 1 162 ? -7.776  23.277  38.756  1.00 7.24  ? 161  GLN A OE1 1 
ATOM   1262  N NE2 . GLN A 1 162 ? -6.716  25.089  38.027  1.00 2.89  ? 161  GLN A NE2 1 
ATOM   1263  N N   . SER A 1 163 ? -6.309  23.552  33.444  1.00 5.00  ? 162  SER A N   1 
ATOM   1264  C CA  . SER A 1 163 ? -7.491  23.548  32.569  1.00 6.08  ? 162  SER A CA  1 
ATOM   1265  C C   . SER A 1 163 ? -7.348  22.517  31.461  1.00 5.30  ? 162  SER A C   1 
ATOM   1266  O O   . SER A 1 163 ? -8.288  21.777  31.149  1.00 4.84  ? 162  SER A O   1 
ATOM   1267  C CB  . SER A 1 163 ? -7.736  24.968  32.068  1.00 7.45  ? 162  SER A CB  1 
ATOM   1268  O OG  . SER A 1 163 ? -8.777  24.961  31.120  1.00 15.67 ? 162  SER A OG  1 
ATOM   1269  N N   . ILE A 1 164 ? -6.151  22.436  30.885  1.00 5.53  ? 163  ILE A N   1 
ATOM   1270  C CA  . ILE A 1 164 ? -5.881  21.496  29.791  1.00 5.46  ? 163  ILE A CA  1 
ATOM   1271  C C   . ILE A 1 164 ? -5.985  20.065  30.266  1.00 5.23  ? 163  ILE A C   1 
ATOM   1272  O O   . ILE A 1 164 ? -6.689  19.222  29.673  1.00 5.26  ? 163  ILE A O   1 
ATOM   1273  C CB  . ILE A 1 164 ? -4.526  21.826  29.062  1.00 5.04  ? 163  ILE A CB  1 
ATOM   1274  C CG1 . ILE A 1 164 ? -4.657  23.197  28.353  1.00 6.12  ? 163  ILE A CG1 1 
ATOM   1275  C CG2 . ILE A 1 164 ? -4.138  20.659  28.114  1.00 4.83  ? 163  ILE A CG2 1 
ATOM   1276  C CD1 . ILE A 1 164 ? -3.315  23.909  28.017  1.00 5.58  ? 163  ILE A CD1 1 
ATOM   1277  N N   . LEU A 1 165 ? -5.315  19.767  31.378  1.00 5.22  ? 164  LEU A N   1 
ATOM   1278  C CA  . LEU A 1 165 ? -5.348  18.427  31.968  1.00 4.57  ? 164  LEU A CA  1 
ATOM   1279  C C   . LEU A 1 165 ? -6.780  18.000  32.319  1.00 3.28  ? 164  LEU A C   1 
ATOM   1280  O O   . LEU A 1 165 ? -7.183  16.878  31.996  1.00 2.54  ? 164  LEU A O   1 
ATOM   1281  C CB  . LEU A 1 165 ? -4.414  18.444  33.198  1.00 8.24  ? 164  LEU A CB  1 
ATOM   1282  C CG  . LEU A 1 165 ? -4.736  17.454  34.303  1.00 11.83 ? 164  LEU A CG  1 
ATOM   1283  C CD1 . LEU A 1 165 ? -4.335  16.041  33.886  1.00 12.94 ? 164  LEU A CD1 1 
ATOM   1284  C CD2 . LEU A 1 165 ? -3.980  17.843  35.573  1.00 12.44 ? 164  LEU A CD2 1 
ATOM   1285  N N   . GLU A 1 166 ? -7.484  18.871  33.026  1.00 3.47  ? 165  GLU A N   1 
ATOM   1286  C CA  . GLU A 1 166 ? -8.826  18.541  33.520  1.00 3.24  ? 165  GLU A CA  1 
ATOM   1287  C C   . GLU A 1 166 ? -9.869  18.347  32.414  1.00 2.77  ? 165  GLU A C   1 
ATOM   1288  O O   . GLU A 1 166 ? -10.637 17.371  32.451  1.00 2.04  ? 165  GLU A O   1 
ATOM   1289  C CB  . GLU A 1 166 ? -9.329  19.610  34.486  1.00 3.07  ? 165  GLU A CB  1 
ATOM   1290  C CG  . GLU A 1 166 ? -10.800 19.597  34.888  1.00 4.40  ? 165  GLU A CG  1 
ATOM   1291  C CD  . GLU A 1 166 ? -11.383 18.312  35.326  1.00 4.07  ? 165  GLU A CD  1 
ATOM   1292  O OE1 . GLU A 1 166 ? -10.748 17.384  35.826  1.00 7.04  ? 165  GLU A OE1 1 
ATOM   1293  O OE2 . GLU A 1 166 ? -12.625 18.222  35.111  1.00 5.24  ? 165  GLU A OE2 1 
ATOM   1294  N N   . ASN A 1 167 ? -9.880  19.288  31.489  1.00 3.43  ? 166  ASN A N   1 
ATOM   1295  C CA  . ASN A 1 167 ? -10.829 19.256  30.347  1.00 4.26  ? 166  ASN A CA  1 
ATOM   1296  C C   . ASN A 1 167 ? -10.557 18.045  29.472  1.00 3.58  ? 166  ASN A C   1 
ATOM   1297  O O   . ASN A 1 167 ? -11.534 17.409  29.059  1.00 3.80  ? 166  ASN A O   1 
ATOM   1298  C CB  . ASN A 1 167 ? -10.894 20.593  29.631  1.00 4.45  ? 166  ASN A CB  1 
ATOM   1299  C CG  . ASN A 1 167 ? -11.755 21.624  30.333  1.00 6.70  ? 166  ASN A CG  1 
ATOM   1300  O OD1 . ASN A 1 167 ? -12.987 21.590  30.256  1.00 6.18  ? 166  ASN A OD1 1 
ATOM   1301  N ND2 . ASN A 1 167 ? -11.116 22.562  31.041  1.00 6.26  ? 166  ASN A ND2 1 
ATOM   1302  N N   . ALA A 1 168 ? -9.288  17.739  29.208  1.00 3.74  ? 167  ALA A N   1 
ATOM   1303  C CA  . ALA A 1 168 ? -8.949  16.524  28.451  1.00 2.64  ? 167  ALA A CA  1 
ATOM   1304  C C   . ALA A 1 168 ? -9.373  15.272  29.190  1.00 2.33  ? 167  ALA A C   1 
ATOM   1305  O O   . ALA A 1 168 ? -9.876  14.300  28.596  1.00 2.00  ? 167  ALA A O   1 
ATOM   1306  C CB  . ALA A 1 168 ? -7.454  16.489  28.110  1.00 3.33  ? 167  ALA A CB  1 
ATOM   1307  N N   . ASN A 1 169 ? -9.147  15.255  30.524  1.00 2.56  ? 168  ASN A N   1 
ATOM   1308  C CA  . ASN A 1 169 ? -9.538  14.034  31.290  1.00 3.20  ? 168  ASN A CA  1 
ATOM   1309  C C   . ASN A 1 169 ? -11.055 13.836  31.322  1.00 3.12  ? 168  ASN A C   1 
ATOM   1310  O O   . ASN A 1 169 ? -11.496 12.675  31.246  1.00 3.41  ? 168  ASN A O   1 
ATOM   1311  C CB  . ASN A 1 169 ? -8.920  14.015  32.694  1.00 4.60  ? 168  ASN A CB  1 
ATOM   1312  C CG  . ASN A 1 169 ? -8.994  12.630  33.305  1.00 6.37  ? 168  ASN A CG  1 
ATOM   1313  O OD1 . ASN A 1 169 ? -8.194  11.755  32.955  1.00 6.80  ? 168  ASN A OD1 1 
ATOM   1314  N ND2 . ASN A 1 169 ? -9.970  12.454  34.219  1.00 6.29  ? 168  ASN A ND2 1 
ATOM   1315  N N   . VAL A 1 170 ? -11.795 14.913  31.475  1.00 4.08  ? 169  VAL A N   1 
ATOM   1316  C CA  . VAL A 1 170 ? -13.274 14.798  31.562  1.00 4.76  ? 169  VAL A CA  1 
ATOM   1317  C C   . VAL A 1 170 ? -13.866 14.380  30.218  1.00 4.58  ? 169  VAL A C   1 
ATOM   1318  O O   . VAL A 1 170 ? -14.843 13.609  30.224  1.00 4.22  ? 169  VAL A O   1 
ATOM   1319  C CB  . VAL A 1 170 ? -13.899 16.041  32.201  1.00 5.10  ? 169  VAL A CB  1 
ATOM   1320  C CG1 . VAL A 1 170 ? -14.210 17.187  31.259  1.00 7.25  ? 169  VAL A CG1 1 
ATOM   1321  C CG2 . VAL A 1 170 ? -15.166 15.635  32.979  1.00 7.49  ? 169  VAL A CG2 1 
ATOM   1322  N N   . LEU A 1 171 ? -13.293 14.857  29.128  1.00 4.68  ? 170  LEU A N   1 
ATOM   1323  C CA  . LEU A 1 171 ? -13.701 14.402  27.780  1.00 4.45  ? 170  LEU A CA  1 
ATOM   1324  C C   . LEU A 1 171 ? -13.470 12.923  27.617  1.00 4.00  ? 170  LEU A C   1 
ATOM   1325  O O   . LEU A 1 171 ? -14.298 12.220  27.010  1.00 4.35  ? 170  LEU A O   1 
ATOM   1326  C CB  . LEU A 1 171 ? -13.020 15.270  26.708  1.00 4.07  ? 170  LEU A CB  1 
ATOM   1327  C CG  . LEU A 1 171 ? -13.560 16.666  26.493  1.00 4.02  ? 170  LEU A CG  1 
ATOM   1328  C CD1 . LEU A 1 171 ? -12.642 17.488  25.583  1.00 5.29  ? 170  LEU A CD1 1 
ATOM   1329  C CD2 . LEU A 1 171 ? -14.942 16.555  25.829  1.00 5.22  ? 170  LEU A CD2 1 
ATOM   1330  N N   . ALA A 1 172 ? -12.350 12.418  28.107  1.00 3.65  ? 171  ALA A N   1 
ATOM   1331  C CA  . ALA A 1 172 ? -12.019 10.989  27.996  1.00 4.63  ? 171  ALA A CA  1 
ATOM   1332  C C   . ALA A 1 172 ? -13.005 10.144  28.784  1.00 4.63  ? 171  ALA A C   1 
ATOM   1333  O O   . ALA A 1 172 ? -13.411 9.050   28.350  1.00 4.41  ? 171  ALA A O   1 
ATOM   1334  C CB  . ALA A 1 172 ? -10.567 10.784  28.416  1.00 2.93  ? 171  ALA A CB  1 
ATOM   1335  N N   . ARG A 1 173 ? -13.394 10.661  29.968  1.00 4.10  ? 172  ARG A N   1 
ATOM   1336  C CA  . ARG A 1 173 ? -14.333 9.902   30.822  1.00 3.67  ? 172  ARG A CA  1 
ATOM   1337  C C   . ARG A 1 173 ? -15.708 9.810   30.121  1.00 3.06  ? 172  ARG A C   1 
ATOM   1338  O O   . ARG A 1 173 ? -16.284 8.739   30.055  1.00 2.00  ? 172  ARG A O   1 
ATOM   1339  C CB  . ARG A 1 173 ? -14.536 10.564  32.193  1.00 4.71  ? 172  ARG A CB  1 
ATOM   1340  C CG  . ARG A 1 173 ? -13.328 10.392  33.131  1.00 4.79  ? 172  ARG A CG  1 
ATOM   1341  C CD  . ARG A 1 173 ? -13.272 9.003   33.678  1.00 6.96  ? 172  ARG A CD  1 
ATOM   1342  N NE  . ARG A 1 173 ? -14.487 8.696   34.441  1.00 7.52  ? 172  ARG A NE  1 
ATOM   1343  C CZ  . ARG A 1 173 ? -15.222 7.605   34.235  1.00 6.53  ? 172  ARG A CZ  1 
ATOM   1344  N NH1 . ARG A 1 173 ? -14.935 6.743   33.270  1.00 7.74  ? 172  ARG A NH1 1 
ATOM   1345  N NH2 . ARG A 1 173 ? -16.315 7.368   34.965  1.00 9.40  ? 172  ARG A NH2 1 
ATOM   1346  N N   . TYR A 1 174 ? -16.165 10.935  29.663  1.00 4.33  ? 173  TYR A N   1 
ATOM   1347  C CA  . TYR A 1 174 ? -17.451 11.062  28.937  1.00 5.37  ? 173  TYR A CA  1 
ATOM   1348  C C   . TYR A 1 174 ? -17.481 10.149  27.722  1.00 5.70  ? 173  TYR A C   1 
ATOM   1349  O O   . TYR A 1 174 ? -18.502 9.463   27.482  1.00 6.55  ? 173  TYR A O   1 
ATOM   1350  C CB  . TYR A 1 174 ? -17.676 12.524  28.555  1.00 5.62  ? 173  TYR A CB  1 
ATOM   1351  C CG  . TYR A 1 174 ? -18.319 12.734  27.197  1.00 6.80  ? 173  TYR A CG  1 
ATOM   1352  C CD1 . TYR A 1 174 ? -19.680 12.479  27.006  1.00 5.10  ? 173  TYR A CD1 1 
ATOM   1353  C CD2 . TYR A 1 174 ? -17.545 13.140  26.103  1.00 6.55  ? 173  TYR A CD2 1 
ATOM   1354  C CE1 . TYR A 1 174 ? -20.281 12.694  25.760  1.00 6.46  ? 173  TYR A CE1 1 
ATOM   1355  C CE2 . TYR A 1 174 ? -18.135 13.335  24.846  1.00 6.53  ? 173  TYR A CE2 1 
ATOM   1356  C CZ  . TYR A 1 174 ? -19.492 13.100  24.684  1.00 7.19  ? 173  TYR A CZ  1 
ATOM   1357  O OH  . TYR A 1 174 ? -20.054 13.329  23.444  1.00 5.90  ? 173  TYR A OH  1 
ATOM   1358  N N   . ALA A 1 175 ? -16.375 10.126  26.996  1.00 5.32  ? 174  ALA A N   1 
ATOM   1359  C CA  . ALA A 1 175 ? -16.290 9.329   25.746  1.00 5.18  ? 174  ALA A CA  1 
ATOM   1360  C C   . ALA A 1 175 ? -16.336 7.861   26.041  1.00 4.94  ? 174  ALA A C   1 
ATOM   1361  O O   . ALA A 1 175 ? -17.052 7.092   25.360  1.00 4.35  ? 174  ALA A O   1 
ATOM   1362  C CB  . ALA A 1 175 ? -15.107 9.762   24.906  1.00 4.53  ? 174  ALA A CB  1 
ATOM   1363  N N   . SER A 1 176 ? -15.616 7.453   27.083  1.00 3.33  ? 175  SER A N   1 
ATOM   1364  C CA  . SER A 1 176 ? -15.578 6.056   27.513  1.00 3.69  ? 175  SER A CA  1 
ATOM   1365  C C   . SER A 1 176 ? -16.982 5.578   27.902  1.00 3.99  ? 175  SER A C   1 
ATOM   1366  O O   . SER A 1 176 ? -17.420 4.473   27.520  1.00 4.15  ? 175  SER A O   1 
ATOM   1367  C CB  . SER A 1 176 ? -14.612 5.951   28.718  1.00 2.48  ? 175  SER A CB  1 
ATOM   1368  O OG  . SER A 1 176 ? -14.498 4.625   29.135  1.00 11.01 ? 175  SER A OG  1 
ATOM   1369  N N   . ILE A 1 177 ? -17.663 6.407   28.665  1.00 4.34  ? 176  ILE A N   1 
ATOM   1370  C CA  . ILE A 1 177 ? -19.009 6.026   29.166  1.00 4.74  ? 176  ILE A CA  1 
ATOM   1371  C C   . ILE A 1 177 ? -19.958 5.842   27.968  1.00 4.27  ? 176  ILE A C   1 
ATOM   1372  O O   . ILE A 1 177 ? -20.680 4.847   27.934  1.00 3.66  ? 176  ILE A O   1 
ATOM   1373  C CB  . ILE A 1 177 ? -19.516 7.046   30.215  1.00 5.35  ? 176  ILE A CB  1 
ATOM   1374  C CG1 . ILE A 1 177 ? -18.687 6.906   31.561  1.00 5.49  ? 176  ILE A CG1 1 
ATOM   1375  C CG2 . ILE A 1 177 ? -21.030 6.867   30.538  1.00 5.76  ? 176  ILE A CG2 1 
ATOM   1376  C CD1 . ILE A 1 177 ? -18.875 8.177   32.450  1.00 6.28  ? 176  ILE A CD1 1 
ATOM   1377  N N   . CYS A 1 178 ? -19.895 6.789   27.044  1.00 5.05  ? 177  CYS A N   1 
ATOM   1378  C CA  . CYS A 1 178 ? -20.791 6.730   25.861  1.00 5.88  ? 177  CYS A CA  1 
ATOM   1379  C C   . CYS A 1 178 ? -20.590 5.427   25.114  1.00 6.01  ? 177  CYS A C   1 
ATOM   1380  O O   . CYS A 1 178 ? -21.561 4.716   24.801  1.00 5.56  ? 177  CYS A O   1 
ATOM   1381  C CB  . CYS A 1 178 ? -20.652 7.938   24.972  1.00 5.16  ? 177  CYS A CB  1 
ATOM   1382  S SG  . CYS A 1 178 ? -21.277 9.501   25.524  1.00 9.90  ? 177  CYS A SG  1 
ATOM   1383  N N   . GLN A 1 179 ? -19.322 5.110   24.847  1.00 6.62  ? 178  GLN A N   1 
ATOM   1384  C CA  . GLN A 1 179 ? -18.982 3.898   24.097  1.00 6.61  ? 178  GLN A CA  1 
ATOM   1385  C C   . GLN A 1 179 ? -19.471 2.640   24.777  1.00 7.51  ? 178  GLN A C   1 
ATOM   1386  O O   . GLN A 1 179 ? -19.930 1.715   24.076  1.00 7.10  ? 178  GLN A O   1 
ATOM   1387  C CB  . GLN A 1 179 ? -17.485 3.802   23.753  1.00 6.33  ? 178  GLN A CB  1 
ATOM   1388  C CG  . GLN A 1 179 ? -17.075 4.927   22.802  1.00 4.84  ? 178  GLN A CG  1 
ATOM   1389  C CD  . GLN A 1 179 ? -15.706 4.703   22.208  1.00 6.31  ? 178  GLN A CD  1 
ATOM   1390  O OE1 . GLN A 1 179 ? -14.795 4.171   22.833  1.00 4.45  ? 178  GLN A OE1 1 
ATOM   1391  N NE2 . GLN A 1 179 ? -15.538 5.164   20.958  1.00 5.15  ? 178  GLN A NE2 1 
ATOM   1392  N N   . SER A 1 180 ? -19.378 2.578   26.107  1.00 7.03  ? 179  SER A N   1 
ATOM   1393  C CA  . SER A 1 180 ? -19.843 1.411   26.853  1.00 7.04  ? 179  SER A CA  1 
ATOM   1394  C C   . SER A 1 180 ? -21.350 1.189   26.635  1.00 7.20  ? 179  SER A C   1 
ATOM   1395  O O   . SER A 1 180 ? -21.798 0.041   26.787  1.00 6.67  ? 179  SER A O   1 
ATOM   1396  C CB  . SER A 1 180 ? -19.569 1.559   28.361  1.00 6.62  ? 179  SER A CB  1 
ATOM   1397  O OG  . SER A 1 180 ? -20.444 2.549   28.892  1.00 6.72  ? 179  SER A OG  1 
ATOM   1398  N N   . GLN A 1 181 ? -22.069 2.223   26.298  1.00 7.34  ? 180  GLN A N   1 
ATOM   1399  C CA  . GLN A 1 181 ? -23.524 2.164   26.065  1.00 8.49  ? 180  GLN A CA  1 
ATOM   1400  C C   . GLN A 1 181 ? -23.912 2.263   24.597  1.00 8.90  ? 180  GLN A C   1 
ATOM   1401  O O   . GLN A 1 181 ? -25.048 2.686   24.281  1.00 9.99  ? 180  GLN A O   1 
ATOM   1402  C CB  . GLN A 1 181 ? -24.246 3.250   26.871  1.00 9.47  ? 180  GLN A CB  1 
ATOM   1403  C CG  . GLN A 1 181 ? -23.975 3.187   28.368  1.00 10.21 ? 180  GLN A CG  1 
ATOM   1404  C CD  . GLN A 1 181 ? -24.253 1.871   29.003  1.00 13.03 ? 180  GLN A CD  1 
ATOM   1405  O OE1 . GLN A 1 181 ? -25.302 1.230   28.833  1.00 14.43 ? 180  GLN A OE1 1 
ATOM   1406  N NE2 . GLN A 1 181 ? -23.267 1.396   29.777  1.00 16.33 ? 180  GLN A NE2 1 
ATOM   1407  N N   . ARG A 1 182 ? -23.010 1.937   23.690  1.00 9.06  ? 181  ARG A N   1 
ATOM   1408  C CA  . ARG A 1 182 ? -23.291 1.932   22.250  1.00 9.69  ? 181  ARG A CA  1 
ATOM   1409  C C   . ARG A 1 182 ? -23.655 3.282   21.669  1.00 9.68  ? 181  ARG A C   1 
ATOM   1410  O O   . ARG A 1 182 ? -24.500 3.367   20.732  1.00 10.29 ? 181  ARG A O   1 
ATOM   1411  C CB  . ARG A 1 182 ? -24.422 0.916   21.961  1.00 11.21 ? 181  ARG A CB  1 
ATOM   1412  C CG  . ARG A 1 182 ? -24.125 -0.504  22.434  1.00 12.98 ? 181  ARG A CG  1 
ATOM   1413  C CD  . ARG A 1 182 ? -25.375 -1.350  22.361  1.00 16.51 ? 181  ARG A CD  1 
ATOM   1414  N NE  . ARG A 1 182 ? -25.926 -1.335  21.006  1.00 18.85 ? 181  ARG A NE  1 
ATOM   1415  C CZ  . ARG A 1 182 ? -27.232 -1.406  20.739  1.00 20.19 ? 181  ARG A CZ  1 
ATOM   1416  N NH1 . ARG A 1 182 ? -28.118 -1.506  21.732  1.00 20.17 ? 181  ARG A NH1 1 
ATOM   1417  N NH2 . ARG A 1 182 ? -27.649 -1.365  19.465  1.00 19.15 ? 181  ARG A NH2 1 
ATOM   1418  N N   . ILE A 1 183 ? -23.065 4.342   22.177  1.00 7.80  ? 182  ILE A N   1 
ATOM   1419  C CA  . ILE A 1 183 ? -23.266 5.716   21.746  1.00 8.35  ? 182  ILE A CA  1 
ATOM   1420  C C   . ILE A 1 183 ? -21.937 6.315   21.284  1.00 8.03  ? 182  ILE A C   1 
ATOM   1421  O O   . ILE A 1 183 ? -20.927 6.237   22.024  1.00 8.30  ? 182  ILE A O   1 
ATOM   1422  C CB  . ILE A 1 183 ? -23.878 6.597   22.905  1.00 9.70  ? 182  ILE A CB  1 
ATOM   1423  C CG1 . ILE A 1 183 ? -25.208 5.979   23.381  1.00 10.63 ? 182  ILE A CG1 1 
ATOM   1424  C CG2 . ILE A 1 183 ? -24.010 8.090   22.537  1.00 8.85  ? 182  ILE A CG2 1 
ATOM   1425  C CD1 . ILE A 1 183 ? -26.486 6.421   22.663  1.00 13.23 ? 182  ILE A CD1 1 
ATOM   1426  N N   . VAL A 1 184 ? -21.961 6.907   20.093  1.00 7.80  ? 183  VAL A N   1 
ATOM   1427  C CA  . VAL A 1 184 ? -20.743 7.590   19.597  1.00 6.37  ? 183  VAL A CA  1 
ATOM   1428  C C   . VAL A 1 184 ? -20.628 8.954   20.250  1.00 6.03  ? 183  VAL A C   1 
ATOM   1429  O O   . VAL A 1 184 ? -21.510 9.819   20.086  1.00 6.78  ? 183  VAL A O   1 
ATOM   1430  C CB  . VAL A 1 184 ? -20.787 7.690   18.051  1.00 7.78  ? 183  VAL A CB  1 
ATOM   1431  C CG1 . VAL A 1 184 ? -19.738 8.682   17.548  1.00 7.14  ? 183  VAL A CG1 1 
ATOM   1432  C CG2 . VAL A 1 184 ? -20.635 6.333   17.402  1.00 6.63  ? 183  VAL A CG2 1 
ATOM   1433  N N   . PRO A 1 185 ? -19.530 9.170   20.954  1.00 5.82  ? 184  PRO A N   1 
ATOM   1434  C CA  . PRO A 1 185 ? -19.274 10.482  21.562  1.00 6.04  ? 184  PRO A CA  1 
ATOM   1435  C C   . PRO A 1 185 ? -18.683 11.425  20.516  1.00 5.80  ? 184  PRO A C   1 
ATOM   1436  O O   . PRO A 1 185 ? -17.746 11.003  19.795  1.00 6.90  ? 184  PRO A O   1 
ATOM   1437  C CB  . PRO A 1 185 ? -18.256 10.166  22.666  1.00 5.29  ? 184  PRO A CB  1 
ATOM   1438  C CG  . PRO A 1 185 ? -17.524 8.953   22.173  1.00 5.44  ? 184  PRO A CG  1 
ATOM   1439  C CD  . PRO A 1 185 ? -18.503 8.173   21.315  1.00 5.60  ? 184  PRO A CD  1 
ATOM   1440  N N   . ILE A 1 186 ? -19.224 12.612  20.437  1.00 5.37  ? 185  ILE A N   1 
ATOM   1441  C CA  . ILE A 1 186 ? -18.548 13.725  19.746  1.00 6.49  ? 185  ILE A CA  1 
ATOM   1442  C C   . ILE A 1 186 ? -17.750 14.477  20.857  1.00 6.84  ? 185  ILE A C   1 
ATOM   1443  O O   . ILE A 1 186 ? -18.356 14.982  21.805  1.00 6.90  ? 185  ILE A O   1 
ATOM   1444  C CB  . ILE A 1 186 ? -19.500 14.675  19.003  1.00 5.34  ? 185  ILE A CB  1 
ATOM   1445  C CG1 . ILE A 1 186 ? -20.305 13.923  17.878  1.00 6.69  ? 185  ILE A CG1 1 
ATOM   1446  C CG2 . ILE A 1 186 ? -18.791 15.932  18.413  1.00 7.27  ? 185  ILE A CG2 1 
ATOM   1447  C CD1 . ILE A 1 186 ? -21.305 14.923  17.194  1.00 6.89  ? 185  ILE A CD1 1 
ATOM   1448  N N   . VAL A 1 187 ? -16.451 14.494  20.683  1.00 7.16  ? 186  VAL A N   1 
ATOM   1449  C CA  . VAL A 1 187 ? -15.512 15.152  21.621  1.00 7.18  ? 186  VAL A CA  1 
ATOM   1450  C C   . VAL A 1 187 ? -15.404 16.607  21.207  1.00 7.81  ? 186  VAL A C   1 
ATOM   1451  O O   . VAL A 1 187 ? -14.967 16.847  20.055  1.00 8.08  ? 186  VAL A O   1 
ATOM   1452  C CB  . VAL A 1 187 ? -14.166 14.395  21.572  1.00 7.51  ? 186  VAL A CB  1 
ATOM   1453  C CG1 . VAL A 1 187 ? -13.086 15.019  22.450  1.00 8.92  ? 186  VAL A CG1 1 
ATOM   1454  C CG2 . VAL A 1 187 ? -14.369 12.932  21.888  1.00 7.87  ? 186  VAL A CG2 1 
ATOM   1455  N N   . GLU A 1 188 ? -15.795 17.503  22.079  1.00 6.90  ? 187  GLU A N   1 
ATOM   1456  C CA  . GLU A 1 188 ? -15.831 18.934  21.767  1.00 7.38  ? 187  GLU A CA  1 
ATOM   1457  C C   . GLU A 1 188 ? -15.074 19.804  22.745  1.00 7.47  ? 187  GLU A C   1 
ATOM   1458  O O   . GLU A 1 188 ? -15.602 20.281  23.774  1.00 7.36  ? 187  GLU A O   1 
ATOM   1459  C CB  . GLU A 1 188 ? -17.284 19.427  21.694  1.00 7.30  ? 187  GLU A CB  1 
ATOM   1460  C CG  . GLU A 1 188 ? -17.534 20.840  21.291  1.00 7.84  ? 187  GLU A CG  1 
ATOM   1461  C CD  . GLU A 1 188 ? -18.906 21.420  21.211  1.00 9.31  ? 187  GLU A CD  1 
ATOM   1462  O OE1 . GLU A 1 188 ? -19.822 20.604  21.267  1.00 9.56  ? 187  GLU A OE1 1 
ATOM   1463  O OE2 . GLU A 1 188 ? -19.100 22.617  21.075  1.00 10.01 ? 187  GLU A OE2 1 
ATOM   1464  N N   . PRO A 1 189 ? -13.803 20.037  22.413  1.00 7.89  ? 188  PRO A N   1 
ATOM   1465  C CA  . PRO A 1 189 ? -12.923 20.937  23.197  1.00 6.94  ? 188  PRO A CA  1 
ATOM   1466  C C   . PRO A 1 189 ? -12.899 22.290  22.524  1.00 7.29  ? 188  PRO A C   1 
ATOM   1467  O O   . PRO A 1 189 ? -11.982 22.554  21.707  1.00 7.63  ? 188  PRO A O   1 
ATOM   1468  C CB  . PRO A 1 189 ? -11.569 20.232  23.135  1.00 7.42  ? 188  PRO A CB  1 
ATOM   1469  C CG  . PRO A 1 189 ? -11.586 19.395  21.892  1.00 7.83  ? 188  PRO A CG  1 
ATOM   1470  C CD  . PRO A 1 189 ? -13.017 19.333  21.395  1.00 7.30  ? 188  PRO A CD  1 
ATOM   1471  N N   . GLU A 1 190 ? -13.866 23.149  22.826  1.00 5.70  ? 189  GLU A N   1 
ATOM   1472  C CA  . GLU A 1 190 ? -13.942 24.436  22.169  1.00 6.42  ? 189  GLU A CA  1 
ATOM   1473  C C   . GLU A 1 190 ? -13.017 25.493  22.763  1.00 6.52  ? 189  GLU A C   1 
ATOM   1474  O O   . GLU A 1 190 ? -13.140 25.877  23.937  1.00 7.52  ? 189  GLU A O   1 
ATOM   1475  C CB  . GLU A 1 190 ? -15.352 25.054  22.141  1.00 7.12  ? 189  GLU A CB  1 
ATOM   1476  C CG  . GLU A 1 190 ? -15.401 26.454  21.541  1.00 8.06  ? 189  GLU A CG  1 
ATOM   1477  C CD  . GLU A 1 190 ? -16.722 27.097  21.284  1.00 9.16  ? 189  GLU A CD  1 
ATOM   1478  O OE1 . GLU A 1 190 ? -17.701 26.475  21.739  1.00 10.42 ? 189  GLU A OE1 1 
ATOM   1479  O OE2 . GLU A 1 190 ? -16.843 28.170  20.707  1.00 10.82 ? 189  GLU A OE2 1 
ATOM   1480  N N   . VAL A 1 191 ? -12.090 25.930  21.927  1.00 5.80  ? 190  VAL A N   1 
ATOM   1481  C CA  . VAL A 1 191 ? -11.250 27.100  22.291  1.00 6.86  ? 190  VAL A CA  1 
ATOM   1482  C C   . VAL A 1 191 ? -12.053 28.319  21.836  1.00 8.06  ? 190  VAL A C   1 
ATOM   1483  O O   . VAL A 1 191 ? -12.342 28.413  20.628  1.00 7.41  ? 190  VAL A O   1 
ATOM   1484  C CB  . VAL A 1 191 ? -9.861  26.940  21.656  1.00 6.43  ? 190  VAL A CB  1 
ATOM   1485  C CG1 . VAL A 1 191 ? -9.001  28.180  21.868  1.00 7.76  ? 190  VAL A CG1 1 
ATOM   1486  C CG2 . VAL A 1 191 ? -9.163  25.669  22.083  1.00 6.53  ? 190  VAL A CG2 1 
ATOM   1487  N N   . LEU A 1 192 ? -12.449 29.162  22.780  1.00 8.32  ? 191  LEU A N   1 
ATOM   1488  C CA  . LEU A 1 192 ? -13.291 30.322  22.517  1.00 10.14 ? 191  LEU A CA  1 
ATOM   1489  C C   . LEU A 1 192 ? -12.576 31.374  21.676  1.00 10.57 ? 191  LEU A C   1 
ATOM   1490  O O   . LEU A 1 192 ? -11.369 31.611  21.833  1.00 10.75 ? 191  LEU A O   1 
ATOM   1491  C CB  . LEU A 1 192 ? -13.737 30.927  23.867  1.00 11.45 ? 191  LEU A CB  1 
ATOM   1492  C CG  . LEU A 1 192 ? -14.609 30.065  24.770  1.00 11.83 ? 191  LEU A CG  1 
ATOM   1493  C CD1 . LEU A 1 192 ? -14.800 30.763  26.118  1.00 13.14 ? 191  LEU A CD1 1 
ATOM   1494  C CD2 . LEU A 1 192 ? -15.961 29.878  24.093  1.00 12.39 ? 191  LEU A CD2 1 
ATOM   1495  N N   . PRO A 1 193 ? -13.354 32.027  20.818  1.00 12.11 ? 192  PRO A N   1 
ATOM   1496  C CA  . PRO A 1 193 ? -12.843 33.111  19.972  1.00 12.42 ? 192  PRO A CA  1 
ATOM   1497  C C   . PRO A 1 193 ? -12.609 34.403  20.708  1.00 13.26 ? 192  PRO A C   1 
ATOM   1498  O O   . PRO A 1 193 ? -11.805 35.256  20.246  1.00 13.86 ? 192  PRO A O   1 
ATOM   1499  C CB  . PRO A 1 193 ? -13.913 33.228  18.875  1.00 12.78 ? 192  PRO A CB  1 
ATOM   1500  C CG  . PRO A 1 193 ? -15.184 32.882  19.613  1.00 12.79 ? 192  PRO A CG  1 
ATOM   1501  C CD  . PRO A 1 193 ? -14.784 31.749  20.559  1.00 11.62 ? 192  PRO A CD  1 
ATOM   1502  N N   . ASP A 1 194 ? -13.246 34.590  21.853  1.00 13.51 ? 193  ASP A N   1 
ATOM   1503  C CA  . ASP A 1 194 ? -13.142 35.812  22.665  1.00 14.25 ? 193  ASP A CA  1 
ATOM   1504  C C   . ASP A 1 194 ? -11.694 36.276  22.850  1.00 14.24 ? 193  ASP A C   1 
ATOM   1505  O O   . ASP A 1 194 ? -10.800 35.472  23.162  1.00 14.44 ? 193  ASP A O   1 
ATOM   1506  C CB  . ASP A 1 194 ? -13.836 35.631  24.010  1.00 15.92 ? 193  ASP A CB  1 
ATOM   1507  C CG  . ASP A 1 194 ? -15.213 35.034  23.996  1.00 16.82 ? 193  ASP A CG  1 
ATOM   1508  O OD1 . ASP A 1 194 ? -15.491 34.013  23.354  1.00 17.12 ? 193  ASP A OD1 1 
ATOM   1509  O OD2 . ASP A 1 194 ? -16.075 35.601  24.718  1.00 17.72 ? 193  ASP A OD2 1 
ATOM   1510  N N   . GLY A 1 195 ? -11.489 37.576  22.704  1.00 14.38 ? 194  GLY A N   1 
ATOM   1511  C CA  . GLY A 1 195 ? -10.170 38.191  22.875  1.00 14.58 ? 194  GLY A CA  1 
ATOM   1512  C C   . GLY A 1 195 ? -9.637  38.803  21.589  1.00 15.31 ? 194  GLY A C   1 
ATOM   1513  O O   . GLY A 1 195 ? -10.270 38.764  20.513  1.00 14.75 ? 194  GLY A O   1 
ATOM   1514  N N   . ASP A 1 196 ? -8.442  39.360  21.718  1.00 15.90 ? 195  ASP A N   1 
ATOM   1515  C CA  . ASP A 1 196 ? -7.769  40.066  20.613  1.00 15.78 ? 195  ASP A CA  1 
ATOM   1516  C C   . ASP A 1 196 ? -6.438  39.415  20.263  1.00 14.92 ? 195  ASP A C   1 
ATOM   1517  O O   . ASP A 1 196 ? -5.519  40.102  19.770  1.00 15.61 ? 195  ASP A O   1 
ATOM   1518  C CB  . ASP A 1 196 ? -7.631  41.548  20.961  1.00 19.23 ? 195  ASP A CB  1 
ATOM   1519  C CG  . ASP A 1 196 ? -6.625  41.784  22.072  1.00 21.51 ? 195  ASP A CG  1 
ATOM   1520  O OD1 . ASP A 1 196 ? -6.241  40.844  22.783  1.00 23.81 ? 195  ASP A OD1 1 
ATOM   1521  O OD2 . ASP A 1 196 ? -6.217  42.958  22.208  1.00 25.80 ? 195  ASP A OD2 1 
ATOM   1522  N N   . HIS A 1 197 ? -6.342  38.132  20.520  1.00 14.14 ? 196  HIS A N   1 
ATOM   1523  C CA  . HIS A 1 197 ? -5.151  37.333  20.197  1.00 13.19 ? 196  HIS A CA  1 
ATOM   1524  C C   . HIS A 1 197 ? -5.111  37.125  18.666  1.00 13.07 ? 196  HIS A C   1 
ATOM   1525  O O   . HIS A 1 197 ? -6.151  37.215  17.996  1.00 13.03 ? 196  HIS A O   1 
ATOM   1526  C CB  . HIS A 1 197 ? -5.171  35.944  20.885  1.00 11.28 ? 196  HIS A CB  1 
ATOM   1527  C CG  . HIS A 1 197 ? -6.480  35.243  20.718  1.00 10.67 ? 196  HIS A CG  1 
ATOM   1528  N ND1 . HIS A 1 197 ? -7.585  35.437  21.506  1.00 11.68 ? 196  HIS A ND1 1 
ATOM   1529  C CD2 . HIS A 1 197 ? -6.868  34.353  19.760  1.00 11.32 ? 196  HIS A CD2 1 
ATOM   1530  C CE1 . HIS A 1 197 ? -8.581  34.694  21.069  1.00 10.35 ? 196  HIS A CE1 1 
ATOM   1531  N NE2 . HIS A 1 197 ? -8.178  34.034  20.003  1.00 10.70 ? 196  HIS A NE2 1 
ATOM   1532  N N   . ASP A 1 198 ? -3.927  36.803  18.190  1.00 12.65 ? 197  ASP A N   1 
ATOM   1533  C CA  . ASP A 1 198 ? -3.700  36.597  16.736  1.00 12.54 ? 197  ASP A CA  1 
ATOM   1534  C C   . ASP A 1 198 ? -3.825  35.117  16.406  1.00 11.42 ? 197  ASP A C   1 
ATOM   1535  O O   . ASP A 1 198 ? -4.044  34.284  17.302  1.00 11.02 ? 197  ASP A O   1 
ATOM   1536  C CB  . ASP A 1 198 ? -2.401  37.263  16.312  1.00 14.05 ? 197  ASP A CB  1 
ATOM   1537  C CG  . ASP A 1 198 ? -1.159  36.678  16.940  1.00 14.74 ? 197  ASP A CG  1 
ATOM   1538  O OD1 . ASP A 1 198 ? -1.149  35.566  17.482  1.00 15.46 ? 197  ASP A OD1 1 
ATOM   1539  O OD2 . ASP A 1 198 ? -0.126  37.380  16.877  1.00 17.26 ? 197  ASP A OD2 1 
ATOM   1540  N N   . LEU A 1 199 ? -3.706  34.826  15.121  1.00 10.74 ? 198  LEU A N   1 
ATOM   1541  C CA  . LEU A 1 199 ? -3.775  33.497  14.557  1.00 10.21 ? 198  LEU A CA  1 
ATOM   1542  C C   . LEU A 1 199 ? -2.651  32.597  15.092  1.00 9.61  ? 198  LEU A C   1 
ATOM   1543  O O   . LEU A 1 199 ? -2.897  31.416  15.295  1.00 9.21  ? 198  LEU A O   1 
ATOM   1544  C CB  . LEU A 1 199 ? -3.736  33.583  13.008  1.00 11.32 ? 198  LEU A CB  1 
ATOM   1545  C CG  . LEU A 1 199 ? -3.957  32.277  12.262  1.00 11.03 ? 198  LEU A CG  1 
ATOM   1546  C CD1 . LEU A 1 199 ? -5.420  31.840  12.321  1.00 11.67 ? 198  LEU A CD1 1 
ATOM   1547  C CD2 . LEU A 1 199 ? -3.584  32.472  10.786  1.00 11.22 ? 198  LEU A CD2 1 
ATOM   1548  N N   . ASP A 1 200 ? -1.480  33.180  15.274  1.00 9.57  ? 199  ASP A N   1 
ATOM   1549  C CA  . ASP A 1 200 ? -0.312  32.470  15.788  1.00 9.72  ? 199  ASP A CA  1 
ATOM   1550  C C   . ASP A 1 200 ? -0.643  31.856  17.165  1.00 9.57  ? 199  ASP A C   1 
ATOM   1551  O O   . ASP A 1 200 ? -0.368  30.679  17.437  1.00 9.08  ? 199  ASP A O   1 
ATOM   1552  C CB  . ASP A 1 200 ? 0.896   33.402  15.798  1.00 13.47 ? 199  ASP A CB  1 
ATOM   1553  C CG  . ASP A 1 200 ? 2.144   32.736  16.329  1.00 16.55 ? 199  ASP A CG  1 
ATOM   1554  O OD1 . ASP A 1 200 ? 2.730   31.920  15.581  1.00 19.43 ? 199  ASP A OD1 1 
ATOM   1555  O OD2 . ASP A 1 200 ? 2.542   32.977  17.481  1.00 19.79 ? 199  ASP A OD2 1 
ATOM   1556  N N   . ARG A 1 201 ? -1.200  32.701  18.003  1.00 9.40  ? 200  ARG A N   1 
ATOM   1557  C CA  . ARG A 1 201 ? -1.567  32.291  19.375  1.00 9.23  ? 200  ARG A CA  1 
ATOM   1558  C C   . ARG A 1 201 ? -2.641  31.225  19.339  1.00 8.16  ? 200  ARG A C   1 
ATOM   1559  O O   . ARG A 1 201 ? -2.551  30.190  20.013  1.00 8.19  ? 200  ARG A O   1 
ATOM   1560  C CB  . ARG A 1 201 ? -1.995  33.485  20.229  1.00 9.09  ? 200  ARG A CB  1 
ATOM   1561  C CG  . ARG A 1 201 ? -2.546  33.090  21.600  1.00 11.67 ? 200  ARG A CG  1 
ATOM   1562  C CD  . ARG A 1 201 ? -1.649  33.437  22.728  1.00 13.99 ? 200  ARG A CD  1 
ATOM   1563  N NE  . ARG A 1 201 ? -2.321  33.178  24.023  1.00 12.34 ? 200  ARG A NE  1 
ATOM   1564  C CZ  . ARG A 1 201 ? -1.929  32.138  24.773  1.00 10.52 ? 200  ARG A CZ  1 
ATOM   1565  N NH1 . ARG A 1 201 ? -0.943  31.343  24.388  1.00 8.62  ? 200  ARG A NH1 1 
ATOM   1566  N NH2 . ARG A 1 201 ? -2.532  31.951  25.947  1.00 10.64 ? 200  ARG A NH2 1 
ATOM   1567  N N   . ALA A 1 202 ? -3.687  31.475  18.538  1.00 7.31  ? 201  ALA A N   1 
ATOM   1568  C CA  . ALA A 1 202 ? -4.800  30.510  18.423  1.00 6.83  ? 201  ALA A CA  1 
ATOM   1569  C C   . ALA A 1 202 ? -4.342  29.158  17.937  1.00 5.61  ? 201  ALA A C   1 
ATOM   1570  O O   . ALA A 1 202 ? -4.826  28.079  18.364  1.00 5.18  ? 201  ALA A O   1 
ATOM   1571  C CB  . ALA A 1 202 ? -5.881  31.127  17.513  1.00 7.76  ? 201  ALA A CB  1 
ATOM   1572  N N   . GLN A 1 203 ? -3.344  29.128  17.040  1.00 5.75  ? 202  GLN A N   1 
ATOM   1573  C CA  . GLN A 1 203 ? -2.855  27.843  16.500  1.00 4.28  ? 202  GLN A CA  1 
ATOM   1574  C C   . GLN A 1 203 ? -2.098  27.072  17.590  1.00 3.76  ? 202  GLN A C   1 
ATOM   1575  O O   . GLN A 1 203 ? -2.295  25.860  17.791  1.00 2.81  ? 202  GLN A O   1 
ATOM   1576  C CB  . GLN A 1 203 ? -2.002  27.986  15.234  1.00 4.41  ? 202  GLN A CB  1 
ATOM   1577  C CG  . GLN A 1 203 ? -1.559  26.670  14.637  1.00 5.71  ? 202  GLN A CG  1 
ATOM   1578  C CD  . GLN A 1 203 ? -0.875  26.798  13.279  1.00 3.78  ? 202  GLN A CD  1 
ATOM   1579  O OE1 . GLN A 1 203 ? -0.828  27.867  12.692  1.00 5.64  ? 202  GLN A OE1 1 
ATOM   1580  N NE2 . GLN A 1 203 ? -0.384  25.680  12.781  1.00 6.29  ? 202  GLN A NE2 1 
ATOM   1581  N N   . LYS A 1 204 ? -1.258  27.788  18.298  1.00 3.78  ? 203  LYS A N   1 
ATOM   1582  C CA  . LYS A 1 204 ? -0.428  27.138  19.361  1.00 3.40  ? 203  LYS A CA  1 
ATOM   1583  C C   . LYS A 1 204 ? -1.324  26.600  20.482  1.00 2.94  ? 203  LYS A C   1 
ATOM   1584  O O   . LYS A 1 204 ? -1.123  25.447  20.899  1.00 2.27  ? 203  LYS A O   1 
ATOM   1585  C CB  . LYS A 1 204 ? 0.615   28.114  19.854  1.00 4.32  ? 203  LYS A CB  1 
ATOM   1586  C CG  . LYS A 1 204 ? 1.794   28.243  18.849  1.00 6.26  ? 203  LYS A CG  1 
ATOM   1587  C CD  . LYS A 1 204 ? 2.641   29.436  19.225  1.00 6.05  ? 203  LYS A CD  1 
ATOM   1588  C CE  . LYS A 1 204 ? 3.753   29.708  18.215  1.00 5.18  ? 203  LYS A CE  1 
ATOM   1589  N NZ  . LYS A 1 204 ? 4.315   31.054  18.506  1.00 6.35  ? 203  LYS A NZ  1 
ATOM   1590  N N   . VAL A 1 205 ? -2.285  27.384  20.895  1.00 3.80  ? 204  VAL A N   1 
ATOM   1591  C CA  . VAL A 1 205 ? -3.273  26.968  21.908  1.00 4.90  ? 204  VAL A CA  1 
ATOM   1592  C C   . VAL A 1 205 ? -4.045  25.749  21.413  1.00 5.96  ? 204  VAL A C   1 
ATOM   1593  O O   . VAL A 1 205 ? -4.274  24.804  22.190  1.00 7.22  ? 204  VAL A O   1 
ATOM   1594  C CB  . VAL A 1 205 ? -4.234  28.079  22.347  1.00 3.82  ? 204  VAL A CB  1 
ATOM   1595  C CG1 . VAL A 1 205 ? -5.405  27.509  23.187  1.00 2.16  ? 204  VAL A CG1 1 
ATOM   1596  C CG2 . VAL A 1 205 ? -3.595  29.242  23.062  1.00 3.48  ? 204  VAL A CG2 1 
ATOM   1597  N N   . THR A 1 206 ? -4.487  25.777  20.162  1.00 5.54  ? 205  THR A N   1 
ATOM   1598  C CA  . THR A 1 206 ? -5.254  24.673  19.593  1.00 4.89  ? 205  THR A CA  1 
ATOM   1599  C C   . THR A 1 206 ? -4.460  23.378  19.513  1.00 4.60  ? 205  THR A C   1 
ATOM   1600  O O   . THR A 1 206 ? -4.993  22.291  19.847  1.00 5.18  ? 205  THR A O   1 
ATOM   1601  C CB  . THR A 1 206 ? -5.960  25.010  18.215  1.00 5.74  ? 205  THR A CB  1 
ATOM   1602  O OG1 . THR A 1 206 ? -6.881  26.090  18.482  1.00 7.08  ? 205  THR A OG1 1 
ATOM   1603  C CG2 . THR A 1 206 ? -6.697  23.781  17.652  1.00 8.21  ? 205  THR A CG2 1 
ATOM   1604  N N   . GLU A 1 207 ? -3.206  23.461  19.114  1.00 3.63  ? 206  GLU A N   1 
ATOM   1605  C CA  . GLU A 1 207 ? -2.322  22.305  19.052  1.00 3.89  ? 206  GLU A CA  1 
ATOM   1606  C C   . GLU A 1 207 ? -2.013  21.735  20.440  1.00 4.39  ? 206  GLU A C   1 
ATOM   1607  O O   . GLU A 1 207 ? -1.937  20.489  20.579  1.00 3.52  ? 206  GLU A O   1 
ATOM   1608  C CB  . GLU A 1 207 ? -1.041  22.635  18.298  1.00 6.07  ? 206  GLU A CB  1 
ATOM   1609  C CG  . GLU A 1 207 ? -1.202  22.739  16.746  1.00 4.99  ? 206  GLU A CG  1 
ATOM   1610  C CD  . GLU A 1 207 ? -0.037  23.413  16.072  1.00 9.15  ? 206  GLU A CD  1 
ATOM   1611  O OE1 . GLU A 1 207 ? 0.966   23.791  16.666  1.00 7.60  ? 206  GLU A OE1 1 
ATOM   1612  O OE2 . GLU A 1 207 ? -0.201  23.582  14.828  1.00 6.02  ? 206  GLU A OE2 1 
ATOM   1613  N N   . THR A 1 208 ? -1.871  22.614  21.413  1.00 4.16  ? 207  THR A N   1 
ATOM   1614  C CA  . THR A 1 208 ? -1.570  22.169  22.805  1.00 4.77  ? 207  THR A CA  1 
ATOM   1615  C C   . THR A 1 208 ? -2.762  21.413  23.385  1.00 4.09  ? 207  THR A C   1 
ATOM   1616  O O   . THR A 1 208 ? -2.585  20.326  23.968  1.00 3.32  ? 207  THR A O   1 
ATOM   1617  C CB  . THR A 1 208 ? -1.177  23.353  23.743  1.00 4.50  ? 207  THR A CB  1 
ATOM   1618  O OG1 . THR A 1 208 ? -0.101  24.072  23.113  1.00 6.47  ? 207  THR A OG1 1 
ATOM   1619  C CG2 . THR A 1 208 ? -0.847  22.944  25.201  1.00 3.11  ? 207  THR A CG2 1 
ATOM   1620  N N   . VAL A 1 209 ? -3.921  22.017  23.190  1.00 4.88  ? 208  VAL A N   1 
ATOM   1621  C CA  . VAL A 1 209 ? -5.177  21.444  23.680  1.00 5.52  ? 208  VAL A CA  1 
ATOM   1622  C C   . VAL A 1 209 ? -5.425  20.069  23.104  1.00 5.53  ? 208  VAL A C   1 
ATOM   1623  O O   . VAL A 1 209 ? -5.722  19.117  23.836  1.00 5.34  ? 208  VAL A O   1 
ATOM   1624  C CB  . VAL A 1 209 ? -6.368  22.399  23.468  1.00 5.07  ? 208  VAL A CB  1 
ATOM   1625  C CG1 . VAL A 1 209 ? -7.690  21.666  23.725  1.00 5.89  ? 208  VAL A CG1 1 
ATOM   1626  C CG2 . VAL A 1 209 ? -6.254  23.652  24.322  1.00 5.34  ? 208  VAL A CG2 1 
ATOM   1627  N N   . LEU A 1 210 ? -5.354  19.965  21.770  1.00 5.53  ? 209  LEU A N   1 
ATOM   1628  C CA  . LEU A 1 210 ? -5.655  18.694  21.100  1.00 5.20  ? 209  LEU A CA  1 
ATOM   1629  C C   . LEU A 1 210 ? -4.684  17.586  21.454  1.00 3.23  ? 209  LEU A C   1 
ATOM   1630  O O   . LEU A 1 210 ? -5.109  16.415  21.506  1.00 2.55  ? 209  LEU A O   1 
ATOM   1631  C CB  . LEU A 1 210 ? -5.809  18.909  19.583  1.00 6.37  ? 209  LEU A CB  1 
ATOM   1632  C CG  . LEU A 1 210 ? -6.967  19.756  19.083  1.00 9.12  ? 209  LEU A CG  1 
ATOM   1633  C CD1 . LEU A 1 210 ? -6.985  19.759  17.541  1.00 8.89  ? 209  LEU A CD1 1 
ATOM   1634  C CD2 . LEU A 1 210 ? -8.281  19.186  19.590  1.00 8.79  ? 209  LEU A CD2 1 
ATOM   1635  N N   . ALA A 1 211 ? -3.401  17.885  21.642  1.00 2.58  ? 210  ALA A N   1 
ATOM   1636  C CA  . ALA A 1 211 ? -2.436  16.847  22.031  1.00 2.02  ? 210  ALA A CA  1 
ATOM   1637  C C   . ALA A 1 211 ? -2.858  16.179  23.350  1.00 2.00  ? 210  ALA A C   1 
ATOM   1638  O O   . ALA A 1 211 ? -2.805  14.944  23.489  1.00 2.55  ? 210  ALA A O   1 
ATOM   1639  C CB  . ALA A 1 211 ? -1.041  17.454  22.128  1.00 3.26  ? 210  ALA A CB  1 
ATOM   1640  N N   . ALA A 1 212 ? -3.259  17.016  24.281  1.00 2.13  ? 211  ALA A N   1 
ATOM   1641  C CA  . ALA A 1 212 ? -3.707  16.579  25.621  1.00 2.45  ? 211  ALA A CA  1 
ATOM   1642  C C   . ALA A 1 212 ? -4.980  15.755  25.509  1.00 2.14  ? 211  ALA A C   1 
ATOM   1643  O O   . ALA A 1 212 ? -5.122  14.722  26.170  1.00 3.09  ? 211  ALA A O   1 
ATOM   1644  C CB  . ALA A 1 212 ? -3.910  17.802  26.500  1.00 2.26  ? 211  ALA A CB  1 
ATOM   1645  N N   . VAL A 1 213 ? -5.892  16.214  24.666  1.00 2.26  ? 212  VAL A N   1 
ATOM   1646  C CA  . VAL A 1 213 ? -7.143  15.472  24.436  1.00 2.67  ? 212  VAL A CA  1 
ATOM   1647  C C   . VAL A 1 213 ? -6.875  14.050  23.982  1.00 2.42  ? 212  VAL A C   1 
ATOM   1648  O O   . VAL A 1 213 ? -7.467  13.078  24.493  1.00 2.28  ? 212  VAL A O   1 
ATOM   1649  C CB  . VAL A 1 213 ? -8.074  16.256  23.479  1.00 2.59  ? 212  VAL A CB  1 
ATOM   1650  C CG1 . VAL A 1 213 ? -9.133  15.352  22.878  1.00 4.57  ? 212  VAL A CG1 1 
ATOM   1651  C CG2 . VAL A 1 213 ? -8.699  17.489  24.093  1.00 2.34  ? 212  VAL A CG2 1 
ATOM   1652  N N   . TYR A 1 214 ? -5.986  13.887  22.986  1.00 2.24  ? 213  TYR A N   1 
ATOM   1653  C CA  . TYR A 1 214 ? -5.702  12.548  22.468  1.00 2.41  ? 213  TYR A CA  1 
ATOM   1654  C C   . TYR A 1 214 ? -4.868  11.746  23.447  1.00 2.00  ? 213  TYR A C   1 
ATOM   1655  O O   . TYR A 1 214 ? -4.987  10.512  23.458  1.00 2.74  ? 213  TYR A O   1 
ATOM   1656  C CB  . TYR A 1 214 ? -5.156  12.536  20.989  1.00 2.95  ? 213  TYR A CB  1 
ATOM   1657  C CG  . TYR A 1 214 ? -6.420  12.817  20.142  1.00 3.57  ? 213  TYR A CG  1 
ATOM   1658  C CD1 . TYR A 1 214 ? -7.388  11.835  20.034  1.00 4.26  ? 213  TYR A CD1 1 
ATOM   1659  C CD2 . TYR A 1 214 ? -6.677  14.086  19.666  1.00 5.48  ? 213  TYR A CD2 1 
ATOM   1660  C CE1 . TYR A 1 214 ? -8.588  12.097  19.361  1.00 6.53  ? 213  TYR A CE1 1 
ATOM   1661  C CE2 . TYR A 1 214 ? -7.859  14.369  18.968  1.00 7.04  ? 213  TYR A CE2 1 
ATOM   1662  C CZ  . TYR A 1 214 ? -8.807  13.359  18.833  1.00 6.86  ? 213  TYR A CZ  1 
ATOM   1663  O OH  . TYR A 1 214 ? -9.979  13.652  18.187  1.00 7.30  ? 213  TYR A OH  1 
ATOM   1664  N N   . LYS A 1 215 ? -4.020  12.401  24.231  1.00 2.02  ? 214  LYS A N   1 
ATOM   1665  C CA  . LYS A 1 215 ? -3.279  11.564  25.239  1.00 2.00  ? 214  LYS A CA  1 
ATOM   1666  C C   . LYS A 1 215 ? -4.276  11.003  26.250  1.00 2.08  ? 214  LYS A C   1 
ATOM   1667  O O   . LYS A 1 215 ? -4.184  9.826   26.666  1.00 2.38  ? 214  LYS A O   1 
ATOM   1668  C CB  . LYS A 1 215 ? -2.128  12.310  25.899  1.00 2.00  ? 214  LYS A CB  1 
ATOM   1669  C CG  . LYS A 1 215 ? -1.389  11.439  26.940  1.00 2.05  ? 214  LYS A CG  1 
ATOM   1670  C CD  . LYS A 1 215 ? -0.888  10.126  26.381  1.00 3.35  ? 214  LYS A CD  1 
ATOM   1671  C CE  . LYS A 1 215 ? 0.342   9.630   27.156  1.00 3.80  ? 214  LYS A CE  1 
ATOM   1672  N NZ  . LYS A 1 215 ? -0.045  9.463   28.590  1.00 5.05  ? 214  LYS A NZ  1 
ATOM   1673  N N   . ALA A 1 216 ? -5.221  11.833  26.659  1.00 2.10  ? 215  ALA A N   1 
ATOM   1674  C CA  . ALA A 1 216 ? -6.256  11.383  27.621  1.00 2.75  ? 215  ALA A CA  1 
ATOM   1675  C C   . ALA A 1 216 ? -7.125  10.295  27.048  1.00 2.77  ? 215  ALA A C   1 
ATOM   1676  O O   . ALA A 1 216 ? -7.421  9.284   27.746  1.00 2.36  ? 215  ALA A O   1 
ATOM   1677  C CB  . ALA A 1 216 ? -7.000  12.593  28.177  1.00 2.00  ? 215  ALA A CB  1 
ATOM   1678  N N   . LEU A 1 217 ? -7.551  10.392  25.788  1.00 2.56  ? 216  LEU A N   1 
ATOM   1679  C CA  . LEU A 1 217 ? -8.350  9.335   25.158  1.00 2.57  ? 216  LEU A CA  1 
ATOM   1680  C C   . LEU A 1 217 ? -7.563  8.031   25.135  1.00 2.41  ? 216  LEU A C   1 
ATOM   1681  O O   . LEU A 1 217 ? -8.161  6.953   25.305  1.00 2.44  ? 216  LEU A O   1 
ATOM   1682  C CB  . LEU A 1 217 ? -8.821  9.770   23.756  1.00 3.90  ? 216  LEU A CB  1 
ATOM   1683  C CG  . LEU A 1 217 ? -9.838  10.890  23.658  1.00 6.80  ? 216  LEU A CG  1 
ATOM   1684  C CD1 . LEU A 1 217 ? -10.175 11.159  22.177  1.00 6.83  ? 216  LEU A CD1 1 
ATOM   1685  C CD2 . LEU A 1 217 ? -11.095 10.508  24.402  1.00 6.81  ? 216  LEU A CD2 1 
ATOM   1686  N N   . SER A 1 218 ? -6.256  8.125   24.940  1.00 2.54  ? 217  SER A N   1 
ATOM   1687  C CA  . SER A 1 218 ? -5.368  6.951   24.986  1.00 3.09  ? 217  SER A CA  1 
ATOM   1688  C C   . SER A 1 218 ? -5.315  6.322   26.388  1.00 3.42  ? 217  SER A C   1 
ATOM   1689  O O   . SER A 1 218 ? -5.479  5.092   26.552  1.00 3.69  ? 217  SER A O   1 
ATOM   1690  C CB  . SER A 1 218 ? -3.947  7.335   24.551  1.00 4.07  ? 217  SER A CB  1 
ATOM   1691  O OG  . SER A 1 218 ? -3.094  6.203   24.638  1.00 3.48  ? 217  SER A OG  1 
ATOM   1692  N N   . ASP A 1 219 ? -5.085  7.171   27.364  1.00 3.57  ? 218  ASP A N   1 
ATOM   1693  C CA  . ASP A 1 219 ? -4.985  6.780   28.791  1.00 4.51  ? 218  ASP A CA  1 
ATOM   1694  C C   . ASP A 1 219 ? -6.210  6.006   29.273  1.00 4.87  ? 218  ASP A C   1 
ATOM   1695  O O   . ASP A 1 219 ? -6.105  5.089   30.118  1.00 5.13  ? 218  ASP A O   1 
ATOM   1696  C CB  . ASP A 1 219 ? -4.736  8.029   29.655  1.00 5.24  ? 218  ASP A CB  1 
ATOM   1697  C CG  . ASP A 1 219 ? -3.318  8.553   29.503  1.00 5.08  ? 218  ASP A CG  1 
ATOM   1698  O OD1 . ASP A 1 219 ? -2.505  7.881   28.864  1.00 6.68  ? 218  ASP A OD1 1 
ATOM   1699  O OD2 . ASP A 1 219 ? -3.065  9.666   30.006  1.00 6.29  ? 218  ASP A OD2 1 
ATOM   1700  N N   . HIS A 1 220 ? -7.352  6.407   28.743  1.00 5.53  ? 219  HIS A N   1 
ATOM   1701  C CA  . HIS A 1 220 ? -8.644  5.796   29.083  1.00 5.76  ? 219  HIS A CA  1 
ATOM   1702  C C   . HIS A 1 220 ? -9.154  4.789   28.072  1.00 6.11  ? 219  HIS A C   1 
ATOM   1703  O O   . HIS A 1 220 ? -10.359 4.406   28.159  1.00 5.74  ? 219  HIS A O   1 
ATOM   1704  C CB  . HIS A 1 220 ? -9.717  6.861   29.349  1.00 5.84  ? 219  HIS A CB  1 
ATOM   1705  C CG  . HIS A 1 220 ? -9.446  7.763   30.506  1.00 5.99  ? 219  HIS A CG  1 
ATOM   1706  N ND1 . HIS A 1 220 ? -9.942  7.491   31.763  1.00 7.19  ? 219  HIS A ND1 1 
ATOM   1707  C CD2 . HIS A 1 220 ? -8.807  8.954   30.597  1.00 7.39  ? 219  HIS A CD2 1 
ATOM   1708  C CE1 . HIS A 1 220 ? -9.574  8.465   32.590  1.00 6.08  ? 219  HIS A CE1 1 
ATOM   1709  N NE2 . HIS A 1 220 ? -8.916  9.376   31.916  1.00 7.81  ? 219  HIS A NE2 1 
ATOM   1710  N N   . HIS A 1 221 ? -8.324  4.368   27.138  1.00 4.71  ? 220  HIS A N   1 
ATOM   1711  C CA  . HIS A 1 221 ? -8.647  3.298   26.190  1.00 5.49  ? 220  HIS A CA  1 
ATOM   1712  C C   . HIS A 1 221 ? -9.928  3.512   25.378  1.00 4.87  ? 220  HIS A C   1 
ATOM   1713  O O   . HIS A 1 221 ? -10.696 2.552   25.149  1.00 3.97  ? 220  HIS A O   1 
ATOM   1714  C CB  . HIS A 1 221 ? -8.760  1.916   26.899  1.00 6.93  ? 220  HIS A CB  1 
ATOM   1715  C CG  . HIS A 1 221 ? -7.644  1.710   27.892  1.00 9.13  ? 220  HIS A CG  1 
ATOM   1716  N ND1 . HIS A 1 221 ? -6.320  1.725   27.552  1.00 10.92 ? 220  HIS A ND1 1 
ATOM   1717  C CD2 . HIS A 1 221 ? -7.689  1.463   29.224  1.00 10.18 ? 220  HIS A CD2 1 
ATOM   1718  C CE1 . HIS A 1 221 ? -5.578  1.501   28.635  1.00 9.82  ? 220  HIS A CE1 1 
ATOM   1719  N NE2 . HIS A 1 221 ? -6.387  1.335   29.652  1.00 10.75 ? 220  HIS A NE2 1 
ATOM   1720  N N   . VAL A 1 222 ? -10.137 4.708   24.936  1.00 4.94  ? 221  VAL A N   1 
ATOM   1721  C CA  . VAL A 1 222 ? -11.258 5.078   24.027  1.00 6.03  ? 221  VAL A CA  1 
ATOM   1722  C C   . VAL A 1 222 ? -10.953 4.589   22.614  1.00 6.49  ? 221  VAL A C   1 
ATOM   1723  O O   . VAL A 1 222 ? -9.829  4.723   22.104  1.00 6.10  ? 221  VAL A O   1 
ATOM   1724  C CB  . VAL A 1 222 ? -11.484 6.591   24.138  1.00 6.95  ? 221  VAL A CB  1 
ATOM   1725  C CG1 . VAL A 1 222 ? -12.491 7.138   23.131  1.00 8.10  ? 221  VAL A CG1 1 
ATOM   1726  C CG2 . VAL A 1 222 ? -11.859 7.032   25.545  1.00 8.24  ? 221  VAL A CG2 1 
ATOM   1727  N N   . TYR A 1 223 ? -11.967 4.030   21.975  1.00 6.82  ? 222  TYR A N   1 
ATOM   1728  C CA  . TYR A 1 223 ? -11.871 3.509   20.596  1.00 6.17  ? 222  TYR A CA  1 
ATOM   1729  C C   . TYR A 1 223 ? -12.088 4.636   19.597  1.00 5.83  ? 222  TYR A C   1 
ATOM   1730  O O   . TYR A 1 223 ? -13.201 5.111   19.304  1.00 5.70  ? 222  TYR A O   1 
ATOM   1731  C CB  . TYR A 1 223 ? -12.819 2.312   20.475  1.00 6.77  ? 222  TYR A CB  1 
ATOM   1732  C CG  . TYR A 1 223 ? -12.946 1.712   19.093  1.00 7.53  ? 222  TYR A CG  1 
ATOM   1733  C CD1 . TYR A 1 223 ? -11.859 1.036   18.524  1.00 7.80  ? 222  TYR A CD1 1 
ATOM   1734  C CD2 . TYR A 1 223 ? -14.142 1.794   18.388  1.00 7.64  ? 222  TYR A CD2 1 
ATOM   1735  C CE1 . TYR A 1 223 ? -11.972 0.458   17.246  1.00 9.13  ? 222  TYR A CE1 1 
ATOM   1736  C CE2 . TYR A 1 223 ? -14.272 1.228   17.120  1.00 8.26  ? 222  TYR A CE2 1 
ATOM   1737  C CZ  . TYR A 1 223 ? -13.175 0.569   16.559  1.00 8.75  ? 222  TYR A CZ  1 
ATOM   1738  O OH  . TYR A 1 223 ? -13.255 -0.008  15.317  1.00 10.95 ? 222  TYR A OH  1 
ATOM   1739  N N   . LEU A 1 224 ? -10.961 5.131   19.061  1.00 4.31  ? 223  LEU A N   1 
ATOM   1740  C CA  . LEU A 1 224 ? -10.935 6.335   18.236  1.00 4.40  ? 223  LEU A CA  1 
ATOM   1741  C C   . LEU A 1 224 ? -11.810 6.250   16.988  1.00 4.61  ? 223  LEU A C   1 
ATOM   1742  O O   . LEU A 1 224 ? -12.395 7.256   16.590  1.00 5.03  ? 223  LEU A O   1 
ATOM   1743  C CB  . LEU A 1 224 ? -9.463  6.651   17.885  1.00 4.99  ? 223  LEU A CB  1 
ATOM   1744  C CG  . LEU A 1 224 ? -8.534  6.980   19.065  1.00 6.19  ? 223  LEU A CG  1 
ATOM   1745  C CD1 . LEU A 1 224 ? -7.112  7.236   18.527  1.00 7.78  ? 223  LEU A CD1 1 
ATOM   1746  C CD2 . LEU A 1 224 ? -9.050  8.225   19.742  1.00 6.45  ? 223  LEU A CD2 1 
ATOM   1747  N N   . GLU A 1 225 ? -11.859 5.092   16.378  1.00 5.88  ? 224  GLU A N   1 
ATOM   1748  C CA  . GLU A 1 225 ? -12.642 4.895   15.130  1.00 6.95  ? 224  GLU A CA  1 
ATOM   1749  C C   . GLU A 1 225 ? -14.128 5.072   15.402  1.00 8.28  ? 224  GLU A C   1 
ATOM   1750  O O   . GLU A 1 225 ? -14.925 5.385   14.489  1.00 8.39  ? 224  GLU A O   1 
ATOM   1751  C CB  . GLU A 1 225 ? -12.395 3.503   14.564  1.00 6.05  ? 224  GLU A CB  1 
ATOM   1752  C CG  . GLU A 1 225 ? -11.001 3.121   14.163  1.00 8.29  ? 224  GLU A CG  1 
ATOM   1753  C CD  . GLU A 1 225 ? -9.892  2.815   15.090  1.00 9.43  ? 224  GLU A CD  1 
ATOM   1754  O OE1 . GLU A 1 225 ? -10.045 3.148   16.294  1.00 9.60  ? 224  GLU A OE1 1 
ATOM   1755  O OE2 . GLU A 1 225 ? -8.850  2.279   14.713  1.00 8.38  ? 224  GLU A OE2 1 
ATOM   1756  N N   . GLY A 1 226 ? -14.503 4.880   16.673  1.00 7.94  ? 225  GLY A N   1 
ATOM   1757  C CA  . GLY A 1 226 ? -15.883 5.118   17.090  1.00 7.61  ? 225  GLY A CA  1 
ATOM   1758  C C   . GLY A 1 226 ? -16.104 6.473   17.743  1.00 7.63  ? 225  GLY A C   1 
ATOM   1759  O O   . GLY A 1 226 ? -17.009 6.592   18.600  1.00 7.52  ? 225  GLY A O   1 
ATOM   1760  N N   . THR A 1 227 ? -15.338 7.486   17.381  1.00 7.54  ? 226  THR A N   1 
ATOM   1761  C CA  . THR A 1 227 ? -15.545 8.850   17.902  1.00 6.52  ? 226  THR A CA  1 
ATOM   1762  C C   . THR A 1 227 ? -15.508 9.854   16.746  1.00 6.36  ? 226  THR A C   1 
ATOM   1763  O O   . THR A 1 227 ? -15.069 9.472   15.652  1.00 7.20  ? 226  THR A O   1 
ATOM   1764  C CB  . THR A 1 227 ? -14.449 9.277   18.965  1.00 6.59  ? 226  THR A CB  1 
ATOM   1765  O OG1 . THR A 1 227 ? -13.220 9.592   18.211  1.00 6.81  ? 226  THR A OG1 1 
ATOM   1766  C CG2 . THR A 1 227 ? -14.194 8.232   20.041  1.00 5.63  ? 226  THR A CG2 1 
ATOM   1767  N N   . LEU A 1 228 ? -15.923 11.067  17.027  1.00 6.05  ? 227  LEU A N   1 
ATOM   1768  C CA  . LEU A 1 228 ? -15.798 12.248  16.184  1.00 6.50  ? 227  LEU A CA  1 
ATOM   1769  C C   . LEU A 1 228 ? -15.248 13.397  17.054  1.00 7.30  ? 227  LEU A C   1 
ATOM   1770  O O   . LEU A 1 228 ? -15.411 13.350  18.297  1.00 7.03  ? 227  LEU A O   1 
ATOM   1771  C CB  . LEU A 1 228 ? -17.138 12.644  15.560  1.00 5.83  ? 227  LEU A CB  1 
ATOM   1772  C CG  . LEU A 1 228 ? -17.875 11.607  14.729  1.00 5.89  ? 227  LEU A CG  1 
ATOM   1773  C CD1 . LEU A 1 228 ? -19.291 12.137  14.427  1.00 7.43  ? 227  LEU A CD1 1 
ATOM   1774  C CD2 . LEU A 1 228 ? -17.093 11.404  13.432  1.00 5.49  ? 227  LEU A CD2 1 
ATOM   1775  N N   . LEU A 1 229 ? -14.642 14.354  16.371  1.00 5.94  ? 228  LEU A N   1 
ATOM   1776  C CA  . LEU A 1 229 ? -14.093 15.553  16.995  1.00 6.19  ? 228  LEU A CA  1 
ATOM   1777  C C   . LEU A 1 229 ? -14.854 16.777  16.468  1.00 6.02  ? 228  LEU A C   1 
ATOM   1778  O O   . LEU A 1 229 ? -15.102 16.871  15.251  1.00 6.22  ? 228  LEU A O   1 
ATOM   1779  C CB  . LEU A 1 229 ? -12.586 15.649  16.743  1.00 5.17  ? 228  LEU A CB  1 
ATOM   1780  C CG  . LEU A 1 229 ? -11.876 16.892  17.284  1.00 6.05  ? 228  LEU A CG  1 
ATOM   1781  C CD1 . LEU A 1 229 ? -11.689 16.746  18.805  1.00 4.49  ? 228  LEU A CD1 1 
ATOM   1782  C CD2 . LEU A 1 229 ? -10.498 16.993  16.618  1.00 5.77  ? 228  LEU A CD2 1 
ATOM   1783  N N   . LYS A 1 230 ? -15.184 17.638  17.399  1.00 5.84  ? 229  LYS A N   1 
ATOM   1784  C CA  . LYS A 1 230 ? -15.866 18.913  17.121  1.00 6.51  ? 229  LYS A CA  1 
ATOM   1785  C C   . LYS A 1 230 ? -15.060 20.062  17.704  1.00 7.59  ? 229  LYS A C   1 
ATOM   1786  O O   . LYS A 1 230 ? -15.338 20.558  18.812  1.00 7.69  ? 229  LYS A O   1 
ATOM   1787  C CB  . LYS A 1 230 ? -17.295 18.937  17.648  1.00 3.84  ? 229  LYS A CB  1 
ATOM   1788  C CG  . LYS A 1 230 ? -18.034 20.256  17.385  1.00 5.01  ? 229  LYS A CG  1 
ATOM   1789  C CD  . LYS A 1 230 ? -19.545 20.125  17.579  1.00 6.08  ? 229  LYS A CD  1 
ATOM   1790  C CE  . LYS A 1 230 ? -20.208 21.499  17.427  1.00 6.43  ? 229  LYS A CE  1 
ATOM   1791  N NZ  . LYS A 1 230 ? -21.690 21.368  17.510  1.00 10.55 ? 229  LYS A NZ  1 
ATOM   1792  N N   . PRO A 1 231 ? -14.074 20.510  16.934  1.00 7.94  ? 230  PRO A N   1 
ATOM   1793  C CA  . PRO A 1 231 ? -13.180 21.590  17.340  1.00 7.32  ? 230  PRO A CA  1 
ATOM   1794  C C   . PRO A 1 231 ? -13.569 22.916  16.722  1.00 7.93  ? 230  PRO A C   1 
ATOM   1795  O O   . PRO A 1 231 ? -14.376 22.989  15.779  1.00 7.30  ? 230  PRO A O   1 
ATOM   1796  C CB  . PRO A 1 231 ? -11.835 21.100  16.752  1.00 7.87  ? 230  PRO A CB  1 
ATOM   1797  C CG  . PRO A 1 231 ? -12.267 20.565  15.390  1.00 7.62  ? 230  PRO A CG  1 
ATOM   1798  C CD  . PRO A 1 231 ? -13.607 19.888  15.673  1.00 7.40  ? 230  PRO A CD  1 
ATOM   1799  N N   . ASN A 1 232 ? -12.996 23.958  17.288  1.00 7.90  ? 231  ASN A N   1 
ATOM   1800  C CA  . ASN A 1 232 ? -13.045 25.315  16.694  1.00 8.25  ? 231  ASN A CA  1 
ATOM   1801  C C   . ASN A 1 232 ? -12.137 25.283  15.451  1.00 7.78  ? 231  ASN A C   1 
ATOM   1802  O O   . ASN A 1 232 ? -11.211 24.464  15.425  1.00 6.27  ? 231  ASN A O   1 
ATOM   1803  C CB  . ASN A 1 232 ? -12.515 26.319  17.732  1.00 10.21 ? 231  ASN A CB  1 
ATOM   1804  C CG  . ASN A 1 232 ? -11.208 25.812  18.354  1.00 12.19 ? 231  ASN A CG  1 
ATOM   1805  O OD1 . ASN A 1 232 ? -11.229 24.877  19.186  1.00 12.65 ? 231  ASN A OD1 1 
ATOM   1806  N ND2 . ASN A 1 232 ? -10.088 26.402  17.930  1.00 10.45 ? 231  ASN A ND2 1 
ATOM   1807  N N   . MET A 1 233 ? -12.428 26.159  14.486  1.00 8.00  ? 232  MET A N   1 
ATOM   1808  C CA  . MET A 1 233 ? -11.428 26.364  13.390  1.00 8.13  ? 232  MET A CA  1 
ATOM   1809  C C   . MET A 1 233 ? -10.368 27.274  14.045  1.00 8.23  ? 232  MET A C   1 
ATOM   1810  O O   . MET A 1 233 ? -10.711 27.981  15.020  1.00 8.30  ? 232  MET A O   1 
ATOM   1811  C CB  . MET A 1 233 ? -12.036 27.020  12.163  1.00 9.15  ? 232  MET A CB  1 
ATOM   1812  C CG  . MET A 1 233 ? -13.119 26.211  11.489  1.00 8.75  ? 232  MET A CG  1 
ATOM   1813  S SD  . MET A 1 233 ? -13.826 27.280  10.140  1.00 9.87  ? 232  MET A SD  1 
ATOM   1814  C CE  . MET A 1 233 ? -15.090 26.142  9.550   1.00 11.01 ? 232  MET A CE  1 
ATOM   1815  N N   . VAL A 1 234 ? -9.151  27.267  13.543  1.00 8.58  ? 233  VAL A N   1 
ATOM   1816  C CA  . VAL A 1 234 ? -8.109  28.180  14.076  1.00 8.35  ? 233  VAL A CA  1 
ATOM   1817  C C   . VAL A 1 234 ? -8.255  29.548  13.411  1.00 9.17  ? 233  VAL A C   1 
ATOM   1818  O O   . VAL A 1 234 ? -8.027  29.701  12.189  1.00 9.11  ? 233  VAL A O   1 
ATOM   1819  C CB  . VAL A 1 234 ? -6.717  27.545  13.895  1.00 8.74  ? 233  VAL A CB  1 
ATOM   1820  C CG1 . VAL A 1 234 ? -5.584  28.451  14.380  1.00 7.81  ? 233  VAL A CG1 1 
ATOM   1821  C CG2 . VAL A 1 234 ? -6.611  26.166  14.517  1.00 8.69  ? 233  VAL A CG2 1 
ATOM   1822  N N   . THR A 1 235 ? -8.637  30.531  14.196  1.00 8.64  ? 234  THR A N   1 
ATOM   1823  C CA  . THR A 1 235 ? -8.814  31.920  13.805  1.00 9.78  ? 234  THR A CA  1 
ATOM   1824  C C   . THR A 1 235 ? -8.234  32.826  14.904  1.00 10.95 ? 234  THR A C   1 
ATOM   1825  O O   . THR A 1 235 ? -8.100  32.368  16.041  1.00 10.77 ? 234  THR A O   1 
ATOM   1826  C CB  . THR A 1 235 ? -10.331 32.305  13.571  1.00 9.87  ? 234  THR A CB  1 
ATOM   1827  O OG1 . THR A 1 235 ? -10.927 32.465  14.906  1.00 10.38 ? 234  THR A OG1 1 
ATOM   1828  C CG2 . THR A 1 235 ? -11.111 31.274  12.753  1.00 10.01 ? 234  THR A CG2 1 
ATOM   1829  N N   . ALA A 1 236 ? -7.914  34.033  14.508  1.00 11.89 ? 235  ALA A N   1 
ATOM   1830  C CA  . ALA A 1 236 ? -7.512  35.111  15.420  1.00 12.93 ? 235  ALA A CA  1 
ATOM   1831  C C   . ALA A 1 236 ? -8.748  35.455  16.260  1.00 13.52 ? 235  ALA A C   1 
ATOM   1832  O O   . ALA A 1 236 ? -9.864  35.046  15.887  1.00 13.37 ? 235  ALA A O   1 
ATOM   1833  C CB  . ALA A 1 236 ? -6.998  36.298  14.621  1.00 13.38 ? 235  ALA A CB  1 
ATOM   1834  N N   . GLY A 1 237 ? -8.531  36.166  17.354  1.00 14.16 ? 236  GLY A N   1 
ATOM   1835  C CA  . GLY A 1 237 ? -9.633  36.513  18.260  1.00 14.76 ? 236  GLY A CA  1 
ATOM   1836  C C   . GLY A 1 237 ? -10.642 37.428  17.561  1.00 16.44 ? 236  GLY A C   1 
ATOM   1837  O O   . GLY A 1 237 ? -10.343 38.125  16.576  1.00 16.30 ? 236  GLY A O   1 
ATOM   1838  N N   . GLN A 1 238 ? -11.826 37.395  18.111  1.00 17.40 ? 237  GLN A N   1 
ATOM   1839  C CA  . GLN A 1 238 ? -13.003 38.152  17.701  1.00 19.34 ? 237  GLN A CA  1 
ATOM   1840  C C   . GLN A 1 238 ? -12.750 39.650  17.562  1.00 20.14 ? 237  GLN A C   1 
ATOM   1841  O O   . GLN A 1 238 ? -13.385 40.318  16.714  1.00 19.72 ? 237  GLN A O   1 
ATOM   1842  C CB  . GLN A 1 238 ? -14.142 37.874  18.694  1.00 21.99 ? 237  GLN A CB  1 
ATOM   1843  C CG  . GLN A 1 238 ? -15.505 38.292  18.222  1.00 26.84 ? 237  GLN A CG  1 
ATOM   1844  C CD  . GLN A 1 238 ? -16.037 37.504  17.055  1.00 28.43 ? 237  GLN A CD  1 
ATOM   1845  O OE1 . GLN A 1 238 ? -15.902 36.277  16.943  1.00 31.26 ? 237  GLN A OE1 1 
ATOM   1846  N NE2 . GLN A 1 238 ? -16.677 38.243  16.149  1.00 29.89 ? 237  GLN A NE2 1 
ATOM   1847  N N   . SER A 1 239 ? -11.847 40.180  18.364  1.00 20.82 ? 238  SER A N   1 
ATOM   1848  C CA  . SER A 1 239 ? -11.508 41.597  18.406  1.00 21.88 ? 238  SER A CA  1 
ATOM   1849  C C   . SER A 1 239 ? -10.201 41.896  17.683  1.00 22.36 ? 238  SER A C   1 
ATOM   1850  O O   . SER A 1 239 ? -9.694  43.034  17.812  1.00 22.93 ? 238  SER A O   1 
ATOM   1851  C CB  . SER A 1 239 ? -11.378 42.138  19.833  1.00 21.88 ? 238  SER A CB  1 
ATOM   1852  O OG  . SER A 1 239 ? -12.484 41.769  20.614  1.00 25.37 ? 238  SER A OG  1 
ATOM   1853  N N   . ALA A 1 240 ? -9.675  40.908  16.995  1.00 22.40 ? 240  ALA A N   1 
ATOM   1854  C CA  . ALA A 1 240 ? -8.442  41.117  16.214  1.00 22.61 ? 240  ALA A CA  1 
ATOM   1855  C C   . ALA A 1 240 ? -8.857  41.305  14.748  1.00 22.96 ? 240  ALA A C   1 
ATOM   1856  O O   . ALA A 1 240 ? -10.024 41.076  14.397  1.00 22.81 ? 240  ALA A O   1 
ATOM   1857  C CB  . ALA A 1 240 ? -7.478  39.965  16.378  1.00 22.04 ? 240  ALA A CB  1 
ATOM   1858  N N   . LYS A 1 241 ? -7.888  41.729  13.967  1.00 23.41 ? 241  LYS A N   1 
ATOM   1859  C CA  . LYS A 1 241 ? -8.074  41.825  12.503  1.00 23.63 ? 241  LYS A CA  1 
ATOM   1860  C C   . LYS A 1 241 ? -8.430  40.423  11.993  1.00 23.70 ? 241  LYS A C   1 
ATOM   1861  O O   . LYS A 1 241 ? -7.835  39.431  12.449  1.00 23.43 ? 241  LYS A O   1 
ATOM   1862  C CB  . LYS A 1 241 ? -6.802  42.319  11.836  1.00 26.57 ? 241  LYS A CB  1 
ATOM   1863  C CG  . LYS A 1 241 ? -6.842  42.323  10.303  1.00 29.07 ? 241  LYS A CG  1 
ATOM   1864  C CD  . LYS A 1 241 ? -5.631  43.048  9.729   1.00 31.17 ? 241  LYS A CD  1 
ATOM   1865  C CE  . LYS A 1 241 ? -5.899  43.583  8.331   1.00 32.04 ? 241  LYS A CE  1 
ATOM   1866  N NZ  . LYS A 1 241 ? -5.598  45.048  8.295   1.00 33.63 ? 241  LYS A NZ  1 
ATOM   1867  N N   . LYS A 1 242 ? -9.392  40.381  11.085  1.00 23.30 ? 242  LYS A N   1 
ATOM   1868  C CA  . LYS A 1 242 ? -9.819  39.131  10.449  1.00 23.17 ? 242  LYS A CA  1 
ATOM   1869  C C   . LYS A 1 242 ? -8.694  38.611  9.548   1.00 22.25 ? 242  LYS A C   1 
ATOM   1870  O O   . LYS A 1 242 ? -7.893  39.409  9.038   1.00 22.53 ? 242  LYS A O   1 
ATOM   1871  C CB  . LYS A 1 242 ? -11.076 39.290  9.609   1.00 25.53 ? 242  LYS A CB  1 
ATOM   1872  C CG  . LYS A 1 242 ? -12.380 39.298  10.404  1.00 28.18 ? 242  LYS A CG  1 
ATOM   1873  C CD  . LYS A 1 242 ? -13.567 38.986  9.496   1.00 28.75 ? 242  LYS A CD  1 
ATOM   1874  C CE  . LYS A 1 242 ? -14.878 39.055  10.255  1.00 30.01 ? 242  LYS A CE  1 
ATOM   1875  N NZ  . LYS A 1 242 ? -14.817 38.145  11.435  1.00 31.24 ? 242  LYS A NZ  1 
ATOM   1876  N N   . ASN A 1 243 ? -8.659  37.297  9.420   1.00 20.43 ? 243  ASN A N   1 
ATOM   1877  C CA  . ASN A 1 243 ? -7.723  36.632  8.487   1.00 18.89 ? 243  ASN A CA  1 
ATOM   1878  C C   . ASN A 1 243 ? -8.545  36.207  7.256   1.00 17.27 ? 243  ASN A C   1 
ATOM   1879  O O   . ASN A 1 243 ? -9.779  36.185  7.335   1.00 17.45 ? 243  ASN A O   1 
ATOM   1880  C CB  . ASN A 1 243 ? -6.999  35.463  9.137   1.00 19.50 ? 243  ASN A CB  1 
ATOM   1881  C CG  . ASN A 1 243 ? -5.980  35.888  10.184  1.00 19.90 ? 243  ASN A CG  1 
ATOM   1882  O OD1 . ASN A 1 243 ? -6.289  35.861  11.378  1.00 22.29 ? 243  ASN A OD1 1 
ATOM   1883  N ND2 . ASN A 1 243 ? -4.794  36.298  9.750   1.00 20.40 ? 243  ASN A ND2 1 
ATOM   1884  N N   . THR A 1 244 ? -7.835  35.861  6.208   1.00 16.11 ? 244  THR A N   1 
ATOM   1885  C CA  . THR A 1 244 ? -8.430  35.312  4.978   1.00 14.53 ? 244  THR A CA  1 
ATOM   1886  C C   . THR A 1 244 ? -8.784  33.847  5.190   1.00 13.68 ? 244  THR A C   1 
ATOM   1887  O O   . THR A 1 244 ? -8.222  33.187  6.089   1.00 13.52 ? 244  THR A O   1 
ATOM   1888  C CB  . THR A 1 244 ? -7.434  35.472  3.752   1.00 14.79 ? 244  THR A CB  1 
ATOM   1889  O OG1 . THR A 1 244 ? -6.368  34.493  3.960   1.00 12.72 ? 244  THR A OG1 1 
ATOM   1890  C CG2 . THR A 1 244 ? -6.888  36.888  3.572   1.00 14.22 ? 244  THR A CG2 1 
ATOM   1891  N N   . PRO A 1 245 ? -9.696  33.354  4.368   1.00 12.69 ? 245  PRO A N   1 
ATOM   1892  C CA  . PRO A 1 245 ? -10.104 31.951  4.407   1.00 11.99 ? 245  PRO A CA  1 
ATOM   1893  C C   . PRO A 1 245 ? -8.906  31.037  4.268   1.00 11.37 ? 245  PRO A C   1 
ATOM   1894  O O   . PRO A 1 245 ? -8.836  29.965  4.888   1.00 10.55 ? 245  PRO A O   1 
ATOM   1895  C CB  . PRO A 1 245 ? -11.123 31.809  3.282   1.00 11.96 ? 245  PRO A CB  1 
ATOM   1896  C CG  . PRO A 1 245 ? -11.644 33.201  3.065   1.00 12.22 ? 245  PRO A CG  1 
ATOM   1897  C CD  . PRO A 1 245 ? -10.479 34.124  3.375   1.00 12.84 ? 245  PRO A CD  1 
ATOM   1898  N N   . GLU A 1 246 ? -7.964  31.461  3.423   1.00 11.28 ? 246  GLU A N   1 
ATOM   1899  C CA  . GLU A 1 246 ? -6.775  30.638  3.157   1.00 12.16 ? 246  GLU A CA  1 
ATOM   1900  C C   . GLU A 1 246 ? -5.835  30.561  4.359   1.00 11.22 ? 246  GLU A C   1 
ATOM   1901  O O   . GLU A 1 246 ? -5.249  29.482  4.590   1.00 12.01 ? 246  GLU A O   1 
ATOM   1902  C CB  . GLU A 1 246 ? -5.987  31.131  1.937   1.00 14.88 ? 246  GLU A CB  1 
ATOM   1903  C CG  . GLU A 1 246 ? -6.701  30.885  0.597   1.00 19.28 ? 246  GLU A CG  1 
ATOM   1904  C CD  . GLU A 1 246 ? -7.973  31.642  0.379   1.00 20.44 ? 246  GLU A CD  1 
ATOM   1905  O OE1 . GLU A 1 246 ? -7.914  32.831  0.768   1.00 21.16 ? 246  GLU A OE1 1 
ATOM   1906  O OE2 . GLU A 1 246 ? -8.987  31.159  -0.114  1.00 23.51 ? 246  GLU A OE2 1 
ATOM   1907  N N   . GLU A 1 247 ? -5.710  31.645  5.076   1.00 10.88 ? 247  GLU A N   1 
ATOM   1908  C CA  . GLU A 1 247 ? -4.872  31.683  6.296   1.00 10.91 ? 247  GLU A CA  1 
ATOM   1909  C C   . GLU A 1 247 ? -5.464  30.788  7.372   1.00 10.23 ? 247  GLU A C   1 
ATOM   1910  O O   . GLU A 1 247 ? -4.750  29.989  8.001   1.00 10.03 ? 247  GLU A O   1 
ATOM   1911  C CB  . GLU A 1 247 ? -4.735  33.104  6.815   1.00 14.08 ? 247  GLU A CB  1 
ATOM   1912  C CG  . GLU A 1 247 ? -3.822  34.020  5.993   1.00 17.72 ? 247  GLU A CG  1 
ATOM   1913  C CD  . GLU A 1 247 ? -3.858  35.472  6.342   1.00 19.48 ? 247  GLU A CD  1 
ATOM   1914  O OE1 . GLU A 1 247 ? -4.743  36.020  6.980   1.00 21.50 ? 247  GLU A OE1 1 
ATOM   1915  O OE2 . GLU A 1 247 ? -2.855  36.076  5.899   1.00 21.99 ? 247  GLU A OE2 1 
ATOM   1916  N N   . ILE A 1 248 ? -6.776  30.909  7.552   1.00 9.19  ? 248  ILE A N   1 
ATOM   1917  C CA  . ILE A 1 248 ? -7.545  30.107  8.496   1.00 8.64  ? 248  ILE A CA  1 
ATOM   1918  C C   . ILE A 1 248 ? -7.453  28.625  8.182   1.00 7.96  ? 248  ILE A C   1 
ATOM   1919  O O   . ILE A 1 248 ? -7.144  27.763  9.045   1.00 7.93  ? 248  ILE A O   1 
ATOM   1920  C CB  . ILE A 1 248 ? -9.038  30.604  8.574   1.00 8.17  ? 248  ILE A CB  1 
ATOM   1921  C CG1 . ILE A 1 248 ? -9.102  32.034  9.121   1.00 9.39  ? 248  ILE A CG1 1 
ATOM   1922  C CG2 . ILE A 1 248 ? -9.916  29.597  9.364   1.00 7.54  ? 248  ILE A CG2 1 
ATOM   1923  C CD1 . ILE A 1 248 ? -10.494 32.715  9.107   1.00 8.25  ? 248  ILE A CD1 1 
ATOM   1924  N N   . ALA A 1 249 ? -7.717  28.311  6.906   1.00 6.61  ? 249  ALA A N   1 
ATOM   1925  C CA  . ALA A 1 249 ? -7.703  26.937  6.427   1.00 6.42  ? 249  ALA A CA  1 
ATOM   1926  C C   . ALA A 1 249 ? -6.362  26.277  6.704   1.00 6.22  ? 249  ALA A C   1 
ATOM   1927  O O   . ALA A 1 249 ? -6.306  25.152  7.236   1.00 5.61  ? 249  ALA A O   1 
ATOM   1928  C CB  . ALA A 1 249 ? -8.076  26.857  4.927   1.00 6.00  ? 249  ALA A CB  1 
ATOM   1929  N N   . LEU A 1 250 ? -5.282  26.968  6.348   1.00 6.09  ? 250  LEU A N   1 
ATOM   1930  C CA  . LEU A 1 250 ? -3.947  26.419  6.530   1.00 6.16  ? 250  LEU A CA  1 
ATOM   1931  C C   . LEU A 1 250 ? -3.640  26.145  8.017   1.00 5.24  ? 250  LEU A C   1 
ATOM   1932  O O   . LEU A 1 250 ? -3.176  25.040  8.319   1.00 5.35  ? 250  LEU A O   1 
ATOM   1933  C CB  . LEU A 1 250 ? -2.878  27.322  5.907   1.00 7.93  ? 250  LEU A CB  1 
ATOM   1934  C CG  . LEU A 1 250 ? -1.449  26.791  6.019   1.00 9.24  ? 250  LEU A CG  1 
ATOM   1935  C CD1 . LEU A 1 250 ? -1.294  25.427  5.375   1.00 9.75  ? 250  LEU A CD1 1 
ATOM   1936  C CD2 . LEU A 1 250 ? -0.517  27.795  5.341   1.00 12.17 ? 250  LEU A CD2 1 
ATOM   1937  N N   . ALA A 1 251 ? -3.861  27.152  8.824   1.00 4.88  ? 251  ALA A N   1 
ATOM   1938  C CA  . ALA A 1 251 ? -3.611  27.034  10.281  1.00 4.86  ? 251  ALA A CA  1 
ATOM   1939  C C   . ALA A 1 251 ? -4.395  25.878  10.854  1.00 5.41  ? 251  ALA A C   1 
ATOM   1940  O O   . ALA A 1 251 ? -3.851  25.065  11.626  1.00 5.63  ? 251  ALA A O   1 
ATOM   1941  C CB  . ALA A 1 251 ? -3.910  28.370  10.956  1.00 4.81  ? 251  ALA A CB  1 
ATOM   1942  N N   . THR A 1 252 ? -5.671  25.770  10.458  1.00 5.97  ? 252  THR A N   1 
ATOM   1943  C CA  . THR A 1 252 ? -6.584  24.743  10.954  1.00 5.59  ? 252  THR A CA  1 
ATOM   1944  C C   . THR A 1 252 ? -6.138  23.350  10.567  1.00 5.96  ? 252  THR A C   1 
ATOM   1945  O O   . THR A 1 252 ? -6.091  22.423  11.406  1.00 5.93  ? 252  THR A O   1 
ATOM   1946  C CB  . THR A 1 252 ? -8.092  24.975  10.531  1.00 5.43  ? 252  THR A CB  1 
ATOM   1947  O OG1 . THR A 1 252 ? -8.470  26.284  11.036  1.00 6.71  ? 252  THR A OG1 1 
ATOM   1948  C CG2 . THR A 1 252 ? -9.043  23.881  11.031  1.00 7.18  ? 252  THR A CG2 1 
ATOM   1949  N N   . VAL A 1 253 ? -5.822  23.176  9.281   1.00 5.31  ? 253  VAL A N   1 
ATOM   1950  C CA  . VAL A 1 253 ? -5.433  21.850  8.798   1.00 5.26  ? 253  VAL A CA  1 
ATOM   1951  C C   . VAL A 1 253 ? -4.085  21.440  9.416   1.00 4.71  ? 253  VAL A C   1 
ATOM   1952  O O   . VAL A 1 253 ? -3.923  20.260  9.696   1.00 4.88  ? 253  VAL A O   1 
ATOM   1953  C CB  . VAL A 1 253 ? -5.506  21.739  7.269   1.00 5.74  ? 253  VAL A CB  1 
ATOM   1954  C CG1 . VAL A 1 253 ? -4.875  20.479  6.708   1.00 5.56  ? 253  VAL A CG1 1 
ATOM   1955  C CG2 . VAL A 1 253 ? -6.972  21.784  6.782   1.00 6.12  ? 253  VAL A CG2 1 
ATOM   1956  N N   . GLN A 1 254 ? -3.197  22.405  9.600   1.00 4.80  ? 254  GLN A N   1 
ATOM   1957  C CA  . GLN A 1 254 ? -1.871  22.107  10.178  1.00 4.84  ? 254  GLN A CA  1 
ATOM   1958  C C   . GLN A 1 254 ? -2.085  21.590  11.623  1.00 3.78  ? 254  GLN A C   1 
ATOM   1959  O O   . GLN A 1 254 ? -1.559  20.531  11.970  1.00 3.20  ? 254  GLN A O   1 
ATOM   1960  C CB  . GLN A 1 254 ? -0.907  23.260  10.104  1.00 5.39  ? 254  GLN A CB  1 
ATOM   1961  C CG  . GLN A 1 254 ? -0.201  23.461  8.776   1.00 8.81  ? 254  GLN A CG  1 
ATOM   1962  C CD  . GLN A 1 254 ? 0.662   24.697  8.746   1.00 10.02 ? 254  GLN A CD  1 
ATOM   1963  O OE1 . GLN A 1 254 ? 1.493   24.888  7.839   1.00 12.49 ? 254  GLN A OE1 1 
ATOM   1964  N NE2 . GLN A 1 254 ? 0.472   25.579  9.722   1.00 8.03  ? 254  GLN A NE2 1 
ATOM   1965  N N   . ALA A 1 255 ? -2.881  22.322  12.359  1.00 4.11  ? 255  ALA A N   1 
ATOM   1966  C CA  . ALA A 1 255 ? -3.203  21.975  13.762  1.00 4.68  ? 255  ALA A CA  1 
ATOM   1967  C C   . ALA A 1 255 ? -3.750  20.579  13.904  1.00 4.35  ? 255  ALA A C   1 
ATOM   1968  O O   . ALA A 1 255 ? -3.252  19.774  14.729  1.00 3.24  ? 255  ALA A O   1 
ATOM   1969  C CB  . ALA A 1 255 ? -4.030  23.100  14.380  1.00 4.10  ? 255  ALA A CB  1 
ATOM   1970  N N   . LEU A 1 256 ? -4.736  20.187  13.088  1.00 3.77  ? 256  LEU A N   1 
ATOM   1971  C CA  . LEU A 1 256 ? -5.293  18.849  13.090  1.00 4.33  ? 256  LEU A CA  1 
ATOM   1972  C C   . LEU A 1 256 ? -4.315  17.777  12.635  1.00 3.88  ? 256  LEU A C   1 
ATOM   1973  O O   . LEU A 1 256 ? -4.255  16.673  13.203  1.00 3.09  ? 256  LEU A O   1 
ATOM   1974  C CB  . LEU A 1 256 ? -6.631  18.840  12.317  1.00 5.11  ? 256  LEU A CB  1 
ATOM   1975  C CG  . LEU A 1 256 ? -7.651  19.902  12.685  1.00 8.17  ? 256  LEU A CG  1 
ATOM   1976  C CD1 . LEU A 1 256 ? -8.897  19.822  11.810  1.00 9.41  ? 256  LEU A CD1 1 
ATOM   1977  C CD2 . LEU A 1 256 ? -8.079  19.686  14.147  1.00 9.36  ? 256  LEU A CD2 1 
ATOM   1978  N N   . ARG A 1 257 ? -3.546  18.055  11.581  1.00 3.50  ? 257  ARG A N   1 
ATOM   1979  C CA  . ARG A 1 257 ? -2.548  17.100  11.086  1.00 3.96  ? 257  ARG A CA  1 
ATOM   1980  C C   . ARG A 1 257 ? -1.542  16.739  12.184  1.00 3.13  ? 257  ARG A C   1 
ATOM   1981  O O   . ARG A 1 257 ? -1.067  15.595  12.229  1.00 3.81  ? 257  ARG A O   1 
ATOM   1982  C CB  . ARG A 1 257 ? -1.786  17.704  9.862   1.00 3.72  ? 257  ARG A CB  1 
ATOM   1983  C CG  . ARG A 1 257 ? -2.571  17.461  8.553   1.00 4.87  ? 257  ARG A CG  1 
ATOM   1984  C CD  . ARG A 1 257 ? -1.993  18.250  7.408   1.00 4.51  ? 257  ARG A CD  1 
ATOM   1985  N NE  . ARG A 1 257 ? -0.574  17.993  7.247   1.00 3.63  ? 257  ARG A NE  1 
ATOM   1986  C CZ  . ARG A 1 257 ? -0.004  16.902  6.770   1.00 4.94  ? 257  ARG A CZ  1 
ATOM   1987  N NH1 . ARG A 1 257 ? -0.708  15.880  6.296   1.00 6.55  ? 257  ARG A NH1 1 
ATOM   1988  N NH2 . ARG A 1 257 ? 1.330   16.815  6.703   1.00 7.46  ? 257  ARG A NH2 1 
ATOM   1989  N N   . ARG A 1 258 ? -1.241  17.693  13.024  1.00 3.47  ? 258  ARG A N   1 
ATOM   1990  C CA  . ARG A 1 258 ? -0.246  17.517  14.093  1.00 3.80  ? 258  ARG A CA  1 
ATOM   1991  C C   . ARG A 1 258 ? -0.768  16.829  15.340  1.00 5.01  ? 258  ARG A C   1 
ATOM   1992  O O   . ARG A 1 258 ? 0.078   16.395  16.169  1.00 4.25  ? 258  ARG A O   1 
ATOM   1993  C CB  . ARG A 1 258 ? 0.363   18.878  14.437  1.00 4.39  ? 258  ARG A CB  1 
ATOM   1994  C CG  . ARG A 1 258 ? 1.297   19.420  13.350  1.00 3.62  ? 258  ARG A CG  1 
ATOM   1995  C CD  . ARG A 1 258 ? 1.424   20.899  13.467  1.00 5.37  ? 258  ARG A CD  1 
ATOM   1996  N NE  . ARG A 1 258 ? 2.187   21.430  12.329  1.00 6.30  ? 258  ARG A NE  1 
ATOM   1997  C CZ  . ARG A 1 258 ? 2.516   22.687  12.156  1.00 4.41  ? 258  ARG A CZ  1 
ATOM   1998  N NH1 . ARG A 1 258 ? 2.170   23.656  12.991  1.00 6.92  ? 258  ARG A NH1 1 
ATOM   1999  N NH2 . ARG A 1 258 ? 3.275   23.010  11.079  1.00 6.36  ? 258  ARG A NH2 1 
ATOM   2000  N N   . THR A 1 259 ? -2.088  16.670  15.470  1.00 4.91  ? 259  THR A N   1 
ATOM   2001  C CA  . THR A 1 259 ? -2.628  16.190  16.767  1.00 5.40  ? 259  THR A CA  1 
ATOM   2002  C C   . THR A 1 259 ? -3.697  15.137  16.707  1.00 5.68  ? 259  THR A C   1 
ATOM   2003  O O   . THR A 1 259 ? -3.825  14.347  17.683  1.00 6.08  ? 259  THR A O   1 
ATOM   2004  C CB  . THR A 1 259 ? -3.151  17.444  17.583  1.00 4.91  ? 259  THR A CB  1 
ATOM   2005  O OG1 . THR A 1 259 ? -4.283  17.965  16.801  1.00 4.29  ? 259  THR A OG1 1 
ATOM   2006  C CG2 . THR A 1 259 ? -2.111  18.520  17.867  1.00 3.96  ? 259  THR A CG2 1 
ATOM   2007  N N   . VAL A 1 260 ? -4.511  15.137  15.644  1.00 5.07  ? 260  VAL A N   1 
ATOM   2008  C CA  . VAL A 1 260 ? -5.650  14.203  15.543  1.00 4.76  ? 260  VAL A CA  1 
ATOM   2009  C C   . VAL A 1 260 ? -5.315  12.963  14.739  1.00 5.18  ? 260  VAL A C   1 
ATOM   2010  O O   . VAL A 1 260 ? -5.156  13.029  13.505  1.00 5.05  ? 260  VAL A O   1 
ATOM   2011  C CB  . VAL A 1 260 ? -6.880  14.946  14.961  1.00 4.54  ? 260  VAL A CB  1 
ATOM   2012  C CG1 . VAL A 1 260 ? -8.123  14.041  14.942  1.00 2.38  ? 260  VAL A CG1 1 
ATOM   2013  C CG2 . VAL A 1 260 ? -7.181  16.260  15.628  1.00 4.08  ? 260  VAL A CG2 1 
ATOM   2014  N N   . PRO A 1 261 ? -5.276  11.807  15.402  1.00 5.70  ? 261  PRO A N   1 
ATOM   2015  C CA  . PRO A 1 261 ? -4.953  10.541  14.769  1.00 5.47  ? 261  PRO A CA  1 
ATOM   2016  C C   . PRO A 1 261 ? -5.893  10.270  13.585  1.00 5.92  ? 261  PRO A C   1 
ATOM   2017  O O   . PRO A 1 261 ? -7.065  10.642  13.604  1.00 4.62  ? 261  PRO A O   1 
ATOM   2018  C CB  . PRO A 1 261 ? -5.102  9.491   15.854  1.00 6.03  ? 261  PRO A CB  1 
ATOM   2019  C CG  . PRO A 1 261 ? -4.973  10.260  17.156  1.00 5.73  ? 261  PRO A CG  1 
ATOM   2020  C CD  . PRO A 1 261 ? -5.460  11.668  16.867  1.00 5.54  ? 261  PRO A CD  1 
ATOM   2021  N N   . ALA A 1 262 ? -5.294  9.642   12.578  1.00 5.63  ? 262  ALA A N   1 
ATOM   2022  C CA  . ALA A 1 262 ? -6.012  9.269   11.354  1.00 5.65  ? 262  ALA A CA  1 
ATOM   2023  C C   . ALA A 1 262 ? -7.177  8.347   11.675  1.00 6.07  ? 262  ALA A C   1 
ATOM   2024  O O   . ALA A 1 262 ? -8.145  8.295   10.899  1.00 5.53  ? 262  ALA A O   1 
ATOM   2025  C CB  . ALA A 1 262 ? -5.026  8.604   10.380  1.00 5.51  ? 262  ALA A CB  1 
ATOM   2026  N N   . ALA A 1 263 ? -7.059  7.559   12.753  1.00 5.88  ? 263  ALA A N   1 
ATOM   2027  C CA  . ALA A 1 263 ? -8.112  6.684   13.220  1.00 6.50  ? 263  ALA A CA  1 
ATOM   2028  C C   . ALA A 1 263 ? -9.402  7.414   13.564  1.00 6.13  ? 263  ALA A C   1 
ATOM   2029  O O   . ALA A 1 263 ? -10.458 6.737   13.486  1.00 7.01  ? 263  ALA A O   1 
ATOM   2030  C CB  . ALA A 1 263 ? -7.664  5.782   14.385  1.00 6.41  ? 263  ALA A CB  1 
ATOM   2031  N N   . VAL A 1 264 ? -9.376  8.670   13.928  1.00 6.05  ? 264  VAL A N   1 
ATOM   2032  C CA  . VAL A 1 264 ? -10.607 9.439   14.229  1.00 6.97  ? 264  VAL A CA  1 
ATOM   2033  C C   . VAL A 1 264 ? -11.420 9.512   12.913  1.00 7.89  ? 264  VAL A C   1 
ATOM   2034  O O   . VAL A 1 264 ? -10.869 9.951   11.899  1.00 7.65  ? 264  VAL A O   1 
ATOM   2035  C CB  . VAL A 1 264 ? -10.281 10.814  14.805  1.00 7.41  ? 264  VAL A CB  1 
ATOM   2036  C CG1 . VAL A 1 264 ? -11.505 11.727  14.913  1.00 6.10  ? 264  VAL A CG1 1 
ATOM   2037  C CG2 . VAL A 1 264 ? -9.571  10.711  16.158  1.00 7.88  ? 264  VAL A CG2 1 
ATOM   2038  N N   . THR A 1 265 ? -12.659 9.088   12.994  1.00 8.27  ? 265  THR A N   1 
ATOM   2039  C CA  . THR A 1 265 ? -13.498 8.967   11.788  1.00 8.71  ? 265  THR A CA  1 
ATOM   2040  C C   . THR A 1 265 ? -13.777 10.277  11.092  1.00 8.59  ? 265  THR A C   1 
ATOM   2041  O O   . THR A 1 265 ? -13.812 10.314  9.838   1.00 10.19 ? 265  THR A O   1 
ATOM   2042  C CB  . THR A 1 265 ? -14.810 8.149   12.137  1.00 7.21  ? 265  THR A CB  1 
ATOM   2043  O OG1 . THR A 1 265 ? -14.305 6.807   12.401  1.00 7.68  ? 265  THR A OG1 1 
ATOM   2044  C CG2 . THR A 1 265 ? -15.850 8.173   11.008  1.00 8.59  ? 265  THR A CG2 1 
ATOM   2045  N N   . GLY A 1 266 ? -13.977 11.354  11.810  1.00 7.52  ? 266  GLY A N   1 
ATOM   2046  C CA  . GLY A 1 266 ? -14.225 12.656  11.196  1.00 7.41  ? 266  GLY A CA  1 
ATOM   2047  C C   . GLY A 1 266 ? -14.218 13.812  12.170  1.00 7.57  ? 266  GLY A C   1 
ATOM   2048  O O   . GLY A 1 266 ? -14.281 13.673  13.404  1.00 8.07  ? 266  GLY A O   1 
ATOM   2049  N N   . VAL A 1 267 ? -14.118 14.984  11.569  1.00 6.92  ? 267  VAL A N   1 
ATOM   2050  C CA  . VAL A 1 267 ? -14.069 16.281  12.237  1.00 7.91  ? 267  VAL A CA  1 
ATOM   2051  C C   . VAL A 1 267 ? -15.312 17.076  11.805  1.00 8.23  ? 267  VAL A C   1 
ATOM   2052  O O   . VAL A 1 267 ? -15.470 17.333  10.602  1.00 7.93  ? 267  VAL A O   1 
ATOM   2053  C CB  . VAL A 1 267 ? -12.758 17.016  11.902  1.00 6.16  ? 267  VAL A CB  1 
ATOM   2054  C CG1 . VAL A 1 267 ? -12.708 18.415  12.503  1.00 8.09  ? 267  VAL A CG1 1 
ATOM   2055  C CG2 . VAL A 1 267 ? -11.527 16.194  12.196  1.00 7.56  ? 267  VAL A CG2 1 
ATOM   2056  N N   . THR A 1 268 ? -16.114 17.416  12.803  1.00 8.23  ? 268  THR A N   1 
ATOM   2057  C CA  . THR A 1 268 ? -17.309 18.253  12.567  1.00 8.24  ? 268  THR A CA  1 
ATOM   2058  C C   . THR A 1 268 ? -17.124 19.603  13.237  1.00 8.38  ? 268  THR A C   1 
ATOM   2059  O O   . THR A 1 268 ? -17.388 19.774  14.444  1.00 8.13  ? 268  THR A O   1 
ATOM   2060  C CB  . THR A 1 268 ? -18.614 17.489  12.963  1.00 9.35  ? 268  THR A CB  1 
ATOM   2061  O OG1 . THR A 1 268 ? -18.576 17.298  14.420  1.00 9.13  ? 268  THR A OG1 1 
ATOM   2062  C CG2 . THR A 1 268 ? -18.773 16.134  12.255  1.00 9.65  ? 268  THR A CG2 1 
ATOM   2063  N N   . PHE A 1 269 ? -16.704 20.590  12.439  1.00 7.59  ? 269  PHE A N   1 
ATOM   2064  C CA  . PHE A 1 269 ? -16.384 21.927  12.939  1.00 7.63  ? 269  PHE A CA  1 
ATOM   2065  C C   . PHE A 1 269 ? -17.582 22.645  13.569  1.00 8.65  ? 269  PHE A C   1 
ATOM   2066  O O   . PHE A 1 269 ? -18.715 22.561  13.097  1.00 7.86  ? 269  PHE A O   1 
ATOM   2067  C CB  . PHE A 1 269 ? -15.772 22.839  11.852  1.00 6.81  ? 269  PHE A CB  1 
ATOM   2068  C CG  . PHE A 1 269 ? -14.371 22.444  11.458  1.00 7.95  ? 269  PHE A CG  1 
ATOM   2069  C CD1 . PHE A 1 269 ? -13.303 22.801  12.298  1.00 6.81  ? 269  PHE A CD1 1 
ATOM   2070  C CD2 . PHE A 1 269 ? -14.145 21.704  10.310  1.00 7.07  ? 269  PHE A CD2 1 
ATOM   2071  C CE1 . PHE A 1 269 ? -12.005 22.427  11.968  1.00 5.87  ? 269  PHE A CE1 1 
ATOM   2072  C CE2 . PHE A 1 269 ? -12.838 21.311  9.961   1.00 6.36  ? 269  PHE A CE2 1 
ATOM   2073  C CZ  . PHE A 1 269 ? -11.781 21.690  10.795  1.00 4.52  ? 269  PHE A CZ  1 
ATOM   2074  N N   . LEU A 1 270 ? -17.256 23.368  14.637  1.00 9.52  ? 270  LEU A N   1 
ATOM   2075  C CA  . LEU A 1 270 ? -18.194 24.363  15.218  1.00 10.16 ? 270  LEU A CA  1 
ATOM   2076  C C   . LEU A 1 270 ? -17.902 25.684  14.534  1.00 11.42 ? 270  LEU A C   1 
ATOM   2077  O O   . LEU A 1 270 ? -16.791 25.919  14.017  1.00 11.73 ? 270  LEU A O   1 
ATOM   2078  C CB  . LEU A 1 270 ? -18.048 24.315  16.736  1.00 11.37 ? 270  LEU A CB  1 
ATOM   2079  C CG  . LEU A 1 270 ? -16.673 24.649  17.295  1.00 9.90  ? 270  LEU A CG  1 
ATOM   2080  C CD1 . LEU A 1 270 ? -16.489 26.159  17.368  1.00 11.06 ? 270  LEU A CD1 1 
ATOM   2081  C CD2 . LEU A 1 270 ? -16.562 24.031  18.704  1.00 10.35 ? 270  LEU A CD2 1 
ATOM   2082  N N   . SER A 1 271 ? -18.878 26.576  14.484  1.00 13.08 ? 271  SER A N   1 
ATOM   2083  C CA  . SER A 1 271 ? -18.760 27.854  13.788  1.00 14.49 ? 271  SER A CA  1 
ATOM   2084  C C   . SER A 1 271 ? -18.302 28.992  14.692  1.00 14.62 ? 271  SER A C   1 
ATOM   2085  O O   . SER A 1 271 ? -17.833 30.010  14.187  1.00 14.57 ? 271  SER A O   1 
ATOM   2086  C CB  . SER A 1 271 ? -20.069 28.232  13.090  1.00 15.34 ? 271  SER A CB  1 
ATOM   2087  O OG  . SER A 1 271 ? -21.138 28.340  14.001  1.00 16.70 ? 271  SER A OG  1 
ATOM   2088  N N   . GLY A 1 272 ? -18.479 28.836  15.994  1.00 15.48 ? 272  GLY A N   1 
ATOM   2089  C CA  . GLY A 1 272 ? -18.048 29.905  16.937  1.00 15.20 ? 272  GLY A CA  1 
ATOM   2090  C C   . GLY A 1 272 ? -18.899 31.149  16.693  1.00 15.12 ? 272  GLY A C   1 
ATOM   2091  O O   . GLY A 1 272 ? -20.142 31.041  16.728  1.00 15.90 ? 272  GLY A O   1 
ATOM   2092  N N   . GLY A 1 273 ? -18.256 32.263  16.430  1.00 14.43 ? 273  GLY A N   1 
ATOM   2093  C CA  . GLY A 1 273 ? -18.954 33.534  16.225  1.00 15.33 ? 273  GLY A CA  1 
ATOM   2094  C C   . GLY A 1 273 ? -19.044 33.944  14.751  1.00 15.10 ? 273  GLY A C   1 
ATOM   2095  O O   . GLY A 1 273 ? -19.406 35.104  14.467  1.00 15.59 ? 273  GLY A O   1 
ATOM   2096  N N   . GLN A 1 274 ? -18.715 33.014  13.880  1.00 14.97 ? 274  GLN A N   1 
ATOM   2097  C CA  . GLN A 1 274 ? -18.718 33.229  12.427  1.00 14.16 ? 274  GLN A CA  1 
ATOM   2098  C C   . GLN A 1 274 ? -20.156 33.386  11.906  1.00 13.38 ? 274  GLN A C   1 
ATOM   2099  O O   . GLN A 1 274 ? -21.114 32.743  12.362  1.00 12.48 ? 274  GLN A O   1 
ATOM   2100  C CB  . GLN A 1 274 ? -17.982 32.138  11.663  1.00 15.35 ? 274  GLN A CB  1 
ATOM   2101  C CG  . GLN A 1 274 ? -16.531 31.919  12.024  1.00 16.07 ? 274  GLN A CG  1 
ATOM   2102  C CD  . GLN A 1 274 ? -15.906 30.746  11.295  1.00 17.35 ? 274  GLN A CD  1 
ATOM   2103  O OE1 . GLN A 1 274 ? -16.020 30.617  10.074  1.00 18.46 ? 274  GLN A OE1 1 
ATOM   2104  N NE2 . GLN A 1 274 ? -15.225 29.871  12.017  1.00 15.60 ? 274  GLN A NE2 1 
ATOM   2105  N N   . SER A 1 275 ? -20.263 34.298  10.942  1.00 13.36 ? 275  SER A N   1 
ATOM   2106  C CA  . SER A 1 275 ? -21.548 34.493  10.227  1.00 13.24 ? 275  SER A CA  1 
ATOM   2107  C C   . SER A 1 275 ? -21.809 33.221  9.427   1.00 13.15 ? 275  SER A C   1 
ATOM   2108  O O   . SER A 1 275 ? -20.902 32.381  9.260   1.00 13.01 ? 275  SER A O   1 
ATOM   2109  C CB  . SER A 1 275 ? -21.482 35.708  9.326   1.00 14.21 ? 275  SER A CB  1 
ATOM   2110  O OG  . SER A 1 275 ? -20.760 35.402  8.128   1.00 16.19 ? 275  SER A OG  1 
ATOM   2111  N N   . GLU A 1 276 ? -23.034 33.076  8.939   1.00 13.21 ? 276  GLU A N   1 
ATOM   2112  C CA  . GLU A 1 276 ? -23.413 31.895  8.156   1.00 13.37 ? 276  GLU A CA  1 
ATOM   2113  C C   . GLU A 1 276 ? -22.510 31.722  6.947   1.00 12.56 ? 276  GLU A C   1 
ATOM   2114  O O   . GLU A 1 276 ? -22.065 30.611  6.635   1.00 12.50 ? 276  GLU A O   1 
ATOM   2115  C CB  . GLU A 1 276 ? -24.871 31.986  7.690   1.00 14.81 ? 276  GLU A CB  1 
ATOM   2116  C CG  . GLU A 1 276 ? -25.930 31.968  8.795   1.00 16.74 ? 276  GLU A CG  1 
ATOM   2117  C CD  . GLU A 1 276 ? -27.361 32.081  8.350   1.00 17.76 ? 276  GLU A CD  1 
ATOM   2118  O OE1 . GLU A 1 276 ? -27.576 33.076  7.635   1.00 17.66 ? 276  GLU A OE1 1 
ATOM   2119  O OE2 . GLU A 1 276 ? -28.232 31.287  8.659   1.00 20.21 ? 276  GLU A OE2 1 
ATOM   2120  N N   . GLU A 1 277 ? -22.200 32.823  6.282   1.00 13.11 ? 277  GLU A N   1 
ATOM   2121  C CA  . GLU A 1 277 ? -21.385 32.812  5.059   1.00 12.91 ? 277  GLU A CA  1 
ATOM   2122  C C   . GLU A 1 277 ? -19.923 32.513  5.328   1.00 12.45 ? 277  GLU A C   1 
ATOM   2123  O O   . GLU A 1 277 ? -19.332 31.635  4.664   1.00 11.33 ? 277  GLU A O   1 
ATOM   2124  C CB  . GLU A 1 277 ? -21.527 34.111  4.269   1.00 13.79 ? 277  GLU A CB  1 
ATOM   2125  C CG  . GLU A 1 277 ? -20.840 34.194  2.921   1.00 15.12 ? 277  GLU A CG  1 
ATOM   2126  C CD  . GLU A 1 277 ? -21.194 33.215  1.850   1.00 14.57 ? 277  GLU A CD  1 
ATOM   2127  O OE1 . GLU A 1 277 ? -22.090 32.394  1.855   1.00 15.29 ? 277  GLU A OE1 1 
ATOM   2128  O OE2 . GLU A 1 277 ? -20.427 33.333  0.861   1.00 14.86 ? 277  GLU A OE2 1 
ATOM   2129  N N   . GLU A 1 278 ? -19.312 33.187  6.288   1.00 12.94 ? 278  GLU A N   1 
ATOM   2130  C CA  . GLU A 1 278 ? -17.923 32.908  6.677   1.00 13.20 ? 278  GLU A CA  1 
ATOM   2131  C C   . GLU A 1 278 ? -17.714 31.440  7.031   1.00 12.20 ? 278  GLU A C   1 
ATOM   2132  O O   . GLU A 1 278 ? -16.673 30.836  6.690   1.00 12.46 ? 278  GLU A O   1 
ATOM   2133  C CB  . GLU A 1 278 ? -17.489 33.701  7.914   1.00 16.18 ? 278  GLU A CB  1 
ATOM   2134  C CG  . GLU A 1 278 ? -17.236 35.193  7.769   1.00 20.41 ? 278  GLU A CG  1 
ATOM   2135  C CD  . GLU A 1 278 ? -16.912 35.895  9.064   1.00 22.46 ? 278  GLU A CD  1 
ATOM   2136  O OE1 . GLU A 1 278 ? -16.988 35.381  10.154  1.00 24.40 ? 278  GLU A OE1 1 
ATOM   2137  O OE2 . GLU A 1 278 ? -16.559 37.083  8.883   1.00 26.85 ? 278  GLU A OE2 1 
ATOM   2138  N N   . ALA A 1 279 ? -18.666 30.878  7.756   1.00 11.28 ? 279  ALA A N   1 
ATOM   2139  C CA  . ALA A 1 279 ? -18.621 29.486  8.215   1.00 10.35 ? 279  ALA A CA  1 
ATOM   2140  C C   . ALA A 1 279 ? -18.558 28.516  7.039   1.00 10.36 ? 279  ALA A C   1 
ATOM   2141  O O   . ALA A 1 279 ? -17.892 27.468  7.065   1.00 9.46  ? 279  ALA A O   1 
ATOM   2142  C CB  . ALA A 1 279 ? -19.825 29.162  9.090   1.00 9.56  ? 279  ALA A CB  1 
ATOM   2143  N N   . THR A 1 280 ? -19.305 28.877  5.993   1.00 9.72  ? 280  THR A N   1 
ATOM   2144  C CA  . THR A 1 280 ? -19.329 28.076  4.775   1.00 9.27  ? 280  THR A CA  1 
ATOM   2145  C C   . THR A 1 280 ? -18.033 28.253  3.966   1.00 8.70  ? 280  THR A C   1 
ATOM   2146  O O   . THR A 1 280 ? -17.440 27.249  3.546   1.00 8.95  ? 280  THR A O   1 
ATOM   2147  C CB  . THR A 1 280 ? -20.565 28.437  3.848   1.00 9.72  ? 280  THR A CB  1 
ATOM   2148  O OG1 . THR A 1 280 ? -21.743 28.447  4.703   1.00 10.29 ? 280  THR A OG1 1 
ATOM   2149  C CG2 . THR A 1 280 ? -20.680 27.433  2.693   1.00 9.35  ? 280  THR A CG2 1 
ATOM   2150  N N   . VAL A 1 281 ? -17.659 29.499  3.756   1.00 8.22  ? 281  VAL A N   1 
ATOM   2151  C CA  . VAL A 1 281 ? -16.437 29.812  2.976   1.00 8.15  ? 281  VAL A CA  1 
ATOM   2152  C C   . VAL A 1 281 ? -15.215 29.177  3.651   1.00 7.85  ? 281  VAL A C   1 
ATOM   2153  O O   . VAL A 1 281 ? -14.343 28.586  2.976   1.00 6.76  ? 281  VAL A O   1 
ATOM   2154  C CB  . VAL A 1 281 ? -16.329 31.325  2.762   1.00 9.51  ? 281  VAL A CB  1 
ATOM   2155  C CG1 . VAL A 1 281 ? -14.963 31.752  2.213   1.00 8.32  ? 281  VAL A CG1 1 
ATOM   2156  C CG2 . VAL A 1 281 ? -17.434 31.875  1.855   1.00 7.83  ? 281  VAL A CG2 1 
ATOM   2157  N N   . ASN A 1 282 ? -15.189 29.291  4.972   1.00 7.61  ? 282  ASN A N   1 
ATOM   2158  C CA  . ASN A 1 282 ? -14.031 28.746  5.747   1.00 7.07  ? 282  ASN A CA  1 
ATOM   2159  C C   . ASN A 1 282 ? -13.930 27.256  5.584   1.00 6.46  ? 282  ASN A C   1 
ATOM   2160  O O   . ASN A 1 282 ? -12.817 26.743  5.309   1.00 6.71  ? 282  ASN A O   1 
ATOM   2161  C CB  . ASN A 1 282 ? -14.053 29.259  7.191   1.00 8.30  ? 282  ASN A CB  1 
ATOM   2162  C CG  . ASN A 1 282 ? -13.585 30.697  7.276   1.00 10.71 ? 282  ASN A CG  1 
ATOM   2163  O OD1 . ASN A 1 282 ? -12.942 31.232  6.355   1.00 13.09 ? 282  ASN A OD1 1 
ATOM   2164  N ND2 . ASN A 1 282 ? -13.899 31.364  8.380   1.00 11.64 ? 282  ASN A ND2 1 
ATOM   2165  N N   . LEU A 1 283 ? -15.031 26.541  5.763   1.00 6.47  ? 283  LEU A N   1 
ATOM   2166  C CA  . LEU A 1 283 ? -15.085 25.096  5.609   1.00 6.39  ? 283  LEU A CA  1 
ATOM   2167  C C   . LEU A 1 283 ? -14.640 24.656  4.203   1.00 6.31  ? 283  LEU A C   1 
ATOM   2168  O O   . LEU A 1 283 ? -13.909 23.659  4.045   1.00 6.21  ? 283  LEU A O   1 
ATOM   2169  C CB  . LEU A 1 283 ? -16.479 24.582  6.000   1.00 7.93  ? 283  LEU A CB  1 
ATOM   2170  C CG  . LEU A 1 283 ? -16.718 23.083  5.907   1.00 8.18  ? 283  LEU A CG  1 
ATOM   2171  C CD1 . LEU A 1 283 ? -15.770 22.305  6.815   1.00 9.94  ? 283  LEU A CD1 1 
ATOM   2172  C CD2 . LEU A 1 283 ? -18.152 22.770  6.340   1.00 10.24 ? 283  LEU A CD2 1 
ATOM   2173  N N   . SER A 1 284 ? -15.057 25.416  3.200   1.00 6.38  ? 284  SER A N   1 
ATOM   2174  C CA  . SER A 1 284 ? -14.708 25.069  1.809   1.00 5.78  ? 284  SER A CA  1 
ATOM   2175  C C   . SER A 1 284 ? -13.194 25.173  1.587   1.00 5.10  ? 284  SER A C   1 
ATOM   2176  O O   . SER A 1 284 ? -12.616 24.288  0.944   1.00 5.21  ? 284  SER A O   1 
ATOM   2177  C CB  . SER A 1 284 ? -15.512 25.871  0.810   1.00 5.65  ? 284  SER A CB  1 
ATOM   2178  O OG  . SER A 1 284 ? -15.621 25.110  -0.414  1.00 6.30  ? 284  SER A OG  1 
ATOM   2179  N N   . ALA A 1 285 ? -12.593 26.225  2.072   1.00 5.59  ? 285  ALA A N   1 
ATOM   2180  C CA  . ALA A 1 285 ? -11.144 26.468  1.991   1.00 5.85  ? 285  ALA A CA  1 
ATOM   2181  C C   . ALA A 1 285 ? -10.366 25.388  2.726   1.00 5.40  ? 285  ALA A C   1 
ATOM   2182  O O   . ALA A 1 285 ? -9.295  24.982  2.269   1.00 5.91  ? 285  ALA A O   1 
ATOM   2183  C CB  . ALA A 1 285 ? -10.814 27.846  2.536   1.00 3.58  ? 285  ALA A CB  1 
ATOM   2184  N N   . ILE A 1 286 ? -10.885 24.944  3.858   1.00 6.09  ? 286  ILE A N   1 
ATOM   2185  C CA  . ILE A 1 286 ? -10.239 23.864  4.638   1.00 5.85  ? 286  ILE A CA  1 
ATOM   2186  C C   . ILE A 1 286 ? -10.140 22.600  3.798   1.00 6.83  ? 286  ILE A C   1 
ATOM   2187  O O   . ILE A 1 286 ? -9.133  21.850  3.825   1.00 6.44  ? 286  ILE A O   1 
ATOM   2188  C CB  . ILE A 1 286 ? -11.057 23.635  5.960   1.00 5.84  ? 286  ILE A CB  1 
ATOM   2189  C CG1 . ILE A 1 286 ? -10.673 24.736  6.971   1.00 7.32  ? 286  ILE A CG1 1 
ATOM   2190  C CG2 . ILE A 1 286 ? -10.878 22.184  6.467   1.00 6.25  ? 286  ILE A CG2 1 
ATOM   2191  C CD1 . ILE A 1 286 ? -11.548 24.759  8.267   1.00 7.91  ? 286  ILE A CD1 1 
ATOM   2192  N N   . ASN A 1 287 ? -11.208 22.368  3.039   1.00 5.70  ? 287  ASN A N   1 
ATOM   2193  C CA  . ASN A 1 287 ? -11.284 21.207  2.161   1.00 7.39  ? 287  ASN A CA  1 
ATOM   2194  C C   . ASN A 1 287 ? -10.482 21.381  0.861   1.00 7.62  ? 287  ASN A C   1 
ATOM   2195  O O   . ASN A 1 287 ? -10.579 20.464  0.017   1.00 8.53  ? 287  ASN A O   1 
ATOM   2196  C CB  . ASN A 1 287 ? -12.741 20.784  1.924   1.00 6.35  ? 287  ASN A CB  1 
ATOM   2197  C CG  . ASN A 1 287 ? -13.206 19.871  3.068   1.00 7.75  ? 287  ASN A CG  1 
ATOM   2198  O OD1 . ASN A 1 287 ? -12.748 18.732  3.164   1.00 9.46  ? 287  ASN A OD1 1 
ATOM   2199  N ND2 . ASN A 1 287 ? -14.118 20.364  3.874   1.00 7.08  ? 287  ASN A ND2 1 
ATOM   2200  N N   . ASN A 1 288 ? -9.734  22.430  0.711   1.00 8.52  ? 288  ASN A N   1 
ATOM   2201  C CA  . ASN A 1 288 ? -8.842  22.659  -0.428  1.00 10.12 ? 288  ASN A CA  1 
ATOM   2202  C C   . ASN A 1 288 ? -7.381  22.856  -0.014  1.00 10.66 ? 288  ASN A C   1 
ATOM   2203  O O   . ASN A 1 288 ? -6.566  23.283  -0.884  1.00 10.84 ? 288  ASN A O   1 
ATOM   2204  C CB  . ASN A 1 288 ? -9.336  23.871  -1.248  1.00 12.02 ? 288  ASN A CB  1 
ATOM   2205  C CG  . ASN A 1 288 ? -10.531 23.488  -2.118  1.00 12.80 ? 288  ASN A CG  1 
ATOM   2206  O OD1 . ASN A 1 288 ? -10.376 22.656  -3.019  1.00 15.04 ? 288  ASN A OD1 1 
ATOM   2207  N ND2 . ASN A 1 288 ? -11.675 24.082  -1.827  1.00 11.99 ? 288  ASN A ND2 1 
ATOM   2208  N N   . VAL A 1 289 ? -7.026  22.611  1.222   1.00 10.43 ? 289  VAL A N   1 
ATOM   2209  C CA  . VAL A 1 289 ? -5.605  22.798  1.651   1.00 9.57  ? 289  VAL A CA  1 
ATOM   2210  C C   . VAL A 1 289 ? -4.808  21.652  1.031   1.00 9.08  ? 289  VAL A C   1 
ATOM   2211  O O   . VAL A 1 289 ? -5.210  20.496  1.161   1.00 9.19  ? 289  VAL A O   1 
ATOM   2212  C CB  . VAL A 1 289 ? -5.512  22.829  3.187   1.00 10.75 ? 289  VAL A CB  1 
ATOM   2213  C CG1 . VAL A 1 289 ? -4.052  22.916  3.653   1.00 10.14 ? 289  VAL A CG1 1 
ATOM   2214  C CG2 . VAL A 1 289 ? -6.320  23.954  3.799   1.00 8.49  ? 289  VAL A CG2 1 
ATOM   2215  N N   . PRO A 1 290 ? -3.690  21.993  0.400   1.00 9.81  ? 290  PRO A N   1 
ATOM   2216  C CA  . PRO A 1 290 ? -2.888  20.996  -0.307  1.00 10.73 ? 290  PRO A CA  1 
ATOM   2217  C C   . PRO A 1 290 ? -2.006  20.187  0.625   1.00 10.87 ? 290  PRO A C   1 
ATOM   2218  O O   . PRO A 1 290 ? -0.791  20.062  0.405   1.00 11.95 ? 290  PRO A O   1 
ATOM   2219  C CB  . PRO A 1 290 ? -2.147  21.811  -1.363  1.00 10.59 ? 290  PRO A CB  1 
ATOM   2220  C CG  . PRO A 1 290 ? -1.968  23.159  -0.726  1.00 10.54 ? 290  PRO A CG  1 
ATOM   2221  C CD  . PRO A 1 290 ? -3.217  23.363  0.142   1.00 10.31 ? 290  PRO A CD  1 
ATOM   2222  N N   . LEU A 1 291 ? -2.608  19.618  1.644   1.00 9.79  ? 291  LEU A N   1 
ATOM   2223  C CA  . LEU A 1 291 ? -1.917  18.701  2.578   1.00 8.58  ? 291  LEU A CA  1 
ATOM   2224  C C   . LEU A 1 291 ? -2.828  17.492  2.733   1.00 7.51  ? 291  LEU A C   1 
ATOM   2225  O O   . LEU A 1 291 ? -4.044  17.652  2.552   1.00 7.48  ? 291  LEU A O   1 
ATOM   2226  C CB  . LEU A 1 291 ? -1.677  19.447  3.894   1.00 8.73  ? 291  LEU A CB  1 
ATOM   2227  C CG  . LEU A 1 291 ? -0.748  20.635  3.884   1.00 9.05  ? 291  LEU A CG  1 
ATOM   2228  C CD1 . LEU A 1 291 ? -0.795  21.391  5.208   1.00 8.58  ? 291  LEU A CD1 1 
ATOM   2229  C CD2 . LEU A 1 291 ? 0.662   20.125  3.591   1.00 10.81 ? 291  LEU A CD2 1 
ATOM   2230  N N   . ILE A 1 292 ? -2.273  16.353  3.069   1.00 7.61  ? 292  ILE A N   1 
ATOM   2231  C CA  . ILE A 1 292 ? -3.088  15.142  3.256   1.00 7.34  ? 292  ILE A CA  1 
ATOM   2232  C C   . ILE A 1 292 ? -4.010  15.366  4.466   1.00 7.68  ? 292  ILE A C   1 
ATOM   2233  O O   . ILE A 1 292 ? -3.496  15.784  5.504   1.00 6.60  ? 292  ILE A O   1 
ATOM   2234  C CB  . ILE A 1 292 ? -2.203  13.883  3.413   1.00 7.68  ? 292  ILE A CB  1 
ATOM   2235  C CG1 . ILE A 1 292 ? -1.491  13.604  2.032   1.00 8.97  ? 292  ILE A CG1 1 
ATOM   2236  C CG2 . ILE A 1 292 ? -2.960  12.623  3.884   1.00 6.63  ? 292  ILE A CG2 1 
ATOM   2237  C CD1 . ILE A 1 292 ? -0.291  12.637  2.256   1.00 11.43 ? 292  ILE A CD1 1 
ATOM   2238  N N   . ARG A 1 293 ? -5.270  15.071  4.248   1.00 7.30  ? 293  ARG A N   1 
ATOM   2239  C CA  . ARG A 1 293 ? -6.335  15.237  5.256   1.00 8.47  ? 293  ARG A CA  1 
ATOM   2240  C C   . ARG A 1 293 ? -7.039  13.904  5.421   1.00 7.85  ? 293  ARG A C   1 
ATOM   2241  O O   . ARG A 1 293 ? -7.959  13.567  4.645   1.00 8.24  ? 293  ARG A O   1 
ATOM   2242  C CB  . ARG A 1 293 ? -7.302  16.339  4.782   1.00 11.91 ? 293  ARG A CB  1 
ATOM   2243  C CG  . ARG A 1 293 ? -6.670  17.718  4.749   1.00 14.75 ? 293  ARG A CG  1 
ATOM   2244  C CD  . ARG A 1 293 ? -7.538  18.777  4.157   1.00 16.72 ? 293  ARG A CD  1 
ATOM   2245  N NE  . ARG A 1 293 ? -7.322  18.937  2.742   1.00 17.82 ? 293  ARG A NE  1 
ATOM   2246  C CZ  . ARG A 1 293 ? -8.118  18.520  1.758   1.00 19.62 ? 293  ARG A CZ  1 
ATOM   2247  N NH1 . ARG A 1 293 ? -9.336  18.045  1.996   1.00 20.74 ? 293  ARG A NH1 1 
ATOM   2248  N NH2 . ARG A 1 293 ? -7.730  18.638  0.490   1.00 19.80 ? 293  ARG A NH2 1 
ATOM   2249  N N   . PRO A 1 294 ? -6.597  13.137  6.421   1.00 7.37  ? 294  PRO A N   1 
ATOM   2250  C CA  . PRO A 1 294 ? -6.999  11.746  6.546   1.00 7.24  ? 294  PRO A CA  1 
ATOM   2251  C C   . PRO A 1 294 ? -8.369  11.510  7.125   1.00 6.70  ? 294  PRO A C   1 
ATOM   2252  O O   . PRO A 1 294 ? -8.734  10.321  7.230   1.00 8.99  ? 294  PRO A O   1 
ATOM   2253  C CB  . PRO A 1 294 ? -5.861  11.114  7.381   1.00 7.47  ? 294  PRO A CB  1 
ATOM   2254  C CG  . PRO A 1 294 ? -5.460  12.267  8.279   1.00 7.57  ? 294  PRO A CG  1 
ATOM   2255  C CD  . PRO A 1 294 ? -5.467  13.468  7.322   1.00 7.19  ? 294  PRO A CD  1 
ATOM   2256  N N   . TRP A 1 295 ? -9.100  12.536  7.484   1.00 5.59  ? 295  TRP A N   1 
ATOM   2257  C CA  . TRP A 1 295 ? -10.451 12.387  8.067   1.00 5.61  ? 295  TRP A CA  1 
ATOM   2258  C C   . TRP A 1 295 ? -11.430 13.270  7.275   1.00 5.58  ? 295  TRP A C   1 
ATOM   2259  O O   . TRP A 1 295 ? -11.027 14.281  6.669   1.00 6.26  ? 295  TRP A O   1 
ATOM   2260  C CB  . TRP A 1 295 ? -10.472 12.781  9.553   1.00 3.22  ? 295  TRP A CB  1 
ATOM   2261  C CG  . TRP A 1 295 ? -9.156  13.119  10.194  1.00 4.76  ? 295  TRP A CG  1 
ATOM   2262  C CD1 . TRP A 1 295 ? -8.477  12.413  11.152  1.00 3.73  ? 295  TRP A CD1 1 
ATOM   2263  C CD2 . TRP A 1 295 ? -8.361  14.286  9.928   1.00 3.32  ? 295  TRP A CD2 1 
ATOM   2264  N NE1 . TRP A 1 295 ? -7.302  13.071  11.498  1.00 3.43  ? 295  TRP A NE1 1 
ATOM   2265  C CE2 . TRP A 1 295 ? -7.210  14.211  10.755  1.00 3.20  ? 295  TRP A CE2 1 
ATOM   2266  C CE3 . TRP A 1 295 ? -8.493  15.362  9.060   1.00 3.76  ? 295  TRP A CE3 1 
ATOM   2267  C CZ2 . TRP A 1 295 ? -6.223  15.192  10.739  1.00 2.01  ? 295  TRP A CZ2 1 
ATOM   2268  C CZ3 . TRP A 1 295 ? -7.517  16.329  9.038   1.00 3.95  ? 295  TRP A CZ3 1 
ATOM   2269  C CH2 . TRP A 1 295 ? -6.381  16.252  9.861   1.00 4.27  ? 295  TRP A CH2 1 
ATOM   2270  N N   . ALA A 1 296 ? -12.696 12.918  7.342   1.00 6.06  ? 296  ALA A N   1 
ATOM   2271  C CA  . ALA A 1 296 ? -13.748 13.814  6.776   1.00 6.41  ? 296  ALA A CA  1 
ATOM   2272  C C   . ALA A 1 296 ? -13.675 15.140  7.506   1.00 6.77  ? 296  ALA A C   1 
ATOM   2273  O O   . ALA A 1 296 ? -13.437 15.142  8.727   1.00 6.53  ? 296  ALA A O   1 
ATOM   2274  C CB  . ALA A 1 296 ? -15.109 13.154  6.927   1.00 7.73  ? 296  ALA A CB  1 
ATOM   2275  N N   . LEU A 1 297 ? -13.819 16.243  6.796   1.00 6.48  ? 297  LEU A N   1 
ATOM   2276  C CA  . LEU A 1 297 ? -13.824 17.593  7.348   1.00 7.76  ? 297  LEU A CA  1 
ATOM   2277  C C   . LEU A 1 297 ? -15.161 18.263  7.010   1.00 8.65  ? 297  LEU A C   1 
ATOM   2278  O O   . LEU A 1 297 ? -15.340 18.790  5.893   1.00 8.52  ? 297  LEU A O   1 
ATOM   2279  C CB  . LEU A 1 297 ? -12.607 18.357  6.815   1.00 7.47  ? 297  LEU A CB  1 
ATOM   2280  C CG  . LEU A 1 297 ? -11.243 17.833  7.263   1.00 8.94  ? 297  LEU A CG  1 
ATOM   2281  C CD1 . LEU A 1 297 ? -10.135 18.322  6.340   1.00 5.40  ? 297  LEU A CD1 1 
ATOM   2282  C CD2 . LEU A 1 297 ? -10.991 18.368  8.682   1.00 8.83  ? 297  LEU A CD2 1 
ATOM   2283  N N   . THR A 1 298 ? -16.048 18.253  8.003   1.00 8.44  ? 298  THR A N   1 
ATOM   2284  C CA  . THR A 1 298 ? -17.423 18.753  7.776   1.00 7.26  ? 298  THR A CA  1 
ATOM   2285  C C   . THR A 1 298 ? -17.885 19.700  8.866   1.00 7.60  ? 298  THR A C   1 
ATOM   2286  O O   . THR A 1 298 ? -17.075 20.295  9.600   1.00 6.99  ? 298  THR A O   1 
ATOM   2287  C CB  . THR A 1 298 ? -18.350 17.520  7.460   1.00 7.22  ? 298  THR A CB  1 
ATOM   2288  O OG1 . THR A 1 298 ? -19.638 18.048  7.012   1.00 9.33  ? 298  THR A OG1 1 
ATOM   2289  C CG2 . THR A 1 298 ? -18.513 16.513  8.597   1.00 7.22  ? 298  THR A CG2 1 
ATOM   2290  N N   . PHE A 1 299 ? -19.194 19.874  8.979   1.00 7.02  ? 299  PHE A N   1 
ATOM   2291  C CA  . PHE A 1 299 ? -19.836 20.839  9.847   1.00 7.43  ? 299  PHE A CA  1 
ATOM   2292  C C   . PHE A 1 299 ? -20.756 20.194  10.895  1.00 7.53  ? 299  PHE A C   1 
ATOM   2293  O O   . PHE A 1 299 ? -21.343 19.128  10.694  1.00 7.36  ? 299  PHE A O   1 
ATOM   2294  C CB  . PHE A 1 299 ? -20.652 21.868  9.027   1.00 8.25  ? 299  PHE A CB  1 
ATOM   2295  C CG  . PHE A 1 299 ? -21.791 21.290  8.229   1.00 9.85  ? 299  PHE A CG  1 
ATOM   2296  C CD1 . PHE A 1 299 ? -21.579 20.856  6.914   1.00 10.15 ? 299  PHE A CD1 1 
ATOM   2297  C CD2 . PHE A 1 299 ? -23.069 21.187  8.779   1.00 10.16 ? 299  PHE A CD2 1 
ATOM   2298  C CE1 . PHE A 1 299 ? -22.624 20.329  6.162   1.00 9.02  ? 299  PHE A CE1 1 
ATOM   2299  C CE2 . PHE A 1 299 ? -24.135 20.652  8.045   1.00 9.77  ? 299  PHE A CE2 1 
ATOM   2300  C CZ  . PHE A 1 299 ? -23.899 20.239  6.717   1.00 9.26  ? 299  PHE A CZ  1 
ATOM   2301  N N   . SER A 1 300 ? -20.840 20.930  11.986  1.00 8.72  ? 300  SER A N   1 
ATOM   2302  C CA  . SER A 1 300 ? -21.826 20.670  13.071  1.00 9.48  ? 300  SER A CA  1 
ATOM   2303  C C   . SER A 1 300 ? -22.215 22.072  13.541  1.00 9.99  ? 300  SER A C   1 
ATOM   2304  O O   . SER A 1 300 ? -21.649 22.652  14.482  1.00 10.63 ? 300  SER A O   1 
ATOM   2305  C CB  . SER A 1 300 ? -21.308 19.767  14.152  1.00 8.93  ? 300  SER A CB  1 
ATOM   2306  O OG  . SER A 1 300 ? -22.270 19.493  15.161  1.00 8.94  ? 300  SER A OG  1 
ATOM   2307  N N   . TYR A 1 301 ? -23.173 22.631  12.793  1.00 9.74  ? 301  TYR A N   1 
ATOM   2308  C CA  . TYR A 1 301 ? -23.545 24.038  12.961  1.00 9.57  ? 301  TYR A CA  1 
ATOM   2309  C C   . TYR A 1 301 ? -24.937 24.201  13.583  1.00 9.83  ? 301  TYR A C   1 
ATOM   2310  O O   . TYR A 1 301 ? -25.868 23.447  13.324  1.00 10.22 ? 301  TYR A O   1 
ATOM   2311  C CB  . TYR A 1 301 ? -23.416 24.801  11.642  1.00 10.19 ? 301  TYR A CB  1 
ATOM   2312  C CG  . TYR A 1 301 ? -22.062 24.920  10.991  1.00 9.13  ? 301  TYR A CG  1 
ATOM   2313  C CD1 . TYR A 1 301 ? -20.857 24.687  11.670  1.00 8.13  ? 301  TYR A CD1 1 
ATOM   2314  C CD2 . TYR A 1 301 ? -21.993 25.368  9.663   1.00 9.71  ? 301  TYR A CD2 1 
ATOM   2315  C CE1 . TYR A 1 301 ? -19.628 24.843  11.038  1.00 8.91  ? 301  TYR A CE1 1 
ATOM   2316  C CE2 . TYR A 1 301 ? -20.767 25.541  9.015   1.00 9.46  ? 301  TYR A CE2 1 
ATOM   2317  C CZ  . TYR A 1 301 ? -19.586 25.274  9.711   1.00 9.03  ? 301  TYR A CZ  1 
ATOM   2318  O OH  . TYR A 1 301 ? -18.413 25.482  9.041   1.00 8.60  ? 301  TYR A OH  1 
ATOM   2319  N N   . GLY A 1 302 ? -25.017 25.194  14.432  1.00 10.67 ? 302  GLY A N   1 
ATOM   2320  C CA  . GLY A 1 302 ? -26.256 25.565  15.163  1.00 11.53 ? 302  GLY A CA  1 
ATOM   2321  C C   . GLY A 1 302 ? -26.715 26.913  14.597  1.00 12.26 ? 302  GLY A C   1 
ATOM   2322  O O   . GLY A 1 302 ? -27.475 26.915  13.614  1.00 12.81 ? 302  GLY A O   1 
ATOM   2323  N N   . ARG A 1 303 ? -26.260 27.995  15.189  1.00 13.67 ? 303  ARG A N   1 
ATOM   2324  C CA  . ARG A 1 303 ? -26.600 29.346  14.744  1.00 15.14 ? 303  ARG A CA  1 
ATOM   2325  C C   . ARG A 1 303 ? -26.277 29.593  13.267  1.00 15.60 ? 303  ARG A C   1 
ATOM   2326  O O   . ARG A 1 303 ? -26.961 30.416  12.621  1.00 15.30 ? 303  ARG A O   1 
ATOM   2327  C CB  . ARG A 1 303 ? -25.905 30.440  15.553  1.00 18.87 ? 303  ARG A CB  1 
ATOM   2328  C CG  . ARG A 1 303 ? -26.472 30.694  16.934  1.00 23.34 ? 303  ARG A CG  1 
ATOM   2329  C CD  . ARG A 1 303 ? -26.305 32.118  17.346  1.00 26.81 ? 303  ARG A CD  1 
ATOM   2330  N NE  . ARG A 1 303 ? -27.263 33.006  16.680  1.00 29.11 ? 303  ARG A NE  1 
ATOM   2331  C CZ  . ARG A 1 303 ? -27.309 34.305  17.033  1.00 30.28 ? 303  ARG A CZ  1 
ATOM   2332  N NH1 . ARG A 1 303 ? -26.430 34.720  17.954  1.00 31.63 ? 303  ARG A NH1 1 
ATOM   2333  N NH2 . ARG A 1 303 ? -28.170 35.151  16.493  1.00 31.20 ? 303  ARG A NH2 1 
ATOM   2334  N N   . ALA A 1 304 ? -25.222 28.961  12.784  1.00 15.59 ? 304  ALA A N   1 
ATOM   2335  C CA  . ALA A 1 304 ? -24.760 29.155  11.402  1.00 15.53 ? 304  ALA A CA  1 
ATOM   2336  C C   . ALA A 1 304 ? -25.655 28.454  10.395  1.00 15.12 ? 304  ALA A C   1 
ATOM   2337  O O   . ALA A 1 304 ? -25.527 28.697  9.170   1.00 14.59 ? 304  ALA A O   1 
ATOM   2338  C CB  . ALA A 1 304 ? -23.290 28.759  11.274  1.00 16.34 ? 304  ALA A CB  1 
ATOM   2339  N N   . LEU A 1 305 ? -26.552 27.597  10.861  1.00 14.52 ? 305  LEU A N   1 
ATOM   2340  C CA  . LEU A 1 305 ? -27.524 26.944  9.979   1.00 14.99 ? 305  LEU A CA  1 
ATOM   2341  C C   . LEU A 1 305 ? -28.944 27.436  10.281  1.00 15.80 ? 305  LEU A C   1 
ATOM   2342  O O   . LEU A 1 305 ? -29.881 26.909  9.637   1.00 17.41 ? 305  LEU A O   1 
ATOM   2343  C CB  . LEU A 1 305 ? -27.444 25.426  10.109  1.00 11.99 ? 305  LEU A CB  1 
ATOM   2344  C CG  . LEU A 1 305 ? -26.565 24.572  9.234   1.00 9.88  ? 305  LEU A CG  1 
ATOM   2345  C CD1 . LEU A 1 305 ? -26.652 23.118  9.711   1.00 9.35  ? 305  LEU A CD1 1 
ATOM   2346  C CD2 . LEU A 1 305 ? -27.086 24.649  7.782   1.00 10.84 ? 305  LEU A CD2 1 
ATOM   2347  N N   . GLN A 1 306 ? -29.083 28.371  11.204  1.00 15.76 ? 306  GLN A N   1 
ATOM   2348  C CA  . GLN A 1 306 ? -30.423 28.715  11.696  1.00 16.04 ? 306  GLN A CA  1 
ATOM   2349  C C   . GLN A 1 306 ? -30.729 30.193  11.817  1.00 16.03 ? 306  GLN A C   1 
ATOM   2350  O O   . GLN A 1 306 ? -31.927 30.496  12.081  1.00 16.44 ? 306  GLN A O   1 
ATOM   2351  C CB  . GLN A 1 306 ? -30.666 28.104  13.100  1.00 16.70 ? 306  GLN A CB  1 
ATOM   2352  C CG  . GLN A 1 306 ? -30.638 26.590  13.156  1.00 16.95 ? 306  GLN A CG  1 
ATOM   2353  C CD  . GLN A 1 306 ? -31.003 26.086  14.538  1.00 18.91 ? 306  GLN A CD  1 
ATOM   2354  O OE1 . GLN A 1 306 ? -32.104 26.322  15.036  1.00 19.60 ? 306  GLN A OE1 1 
ATOM   2355  N NE2 . GLN A 1 306 ? -30.065 25.384  15.159  1.00 18.40 ? 306  GLN A NE2 1 
ATOM   2356  N N   . ALA A 1 307 ? -29.760 31.059  11.685  1.00 16.26 ? 307  ALA A N   1 
ATOM   2357  C CA  . ALA A 1 307 ? -29.979 32.497  11.883  1.00 17.01 ? 307  ALA A CA  1 
ATOM   2358  C C   . ALA A 1 307 ? -31.003 33.034  10.887  1.00 17.90 ? 307  ALA A C   1 
ATOM   2359  O O   . ALA A 1 307 ? -31.940 33.762  11.277  1.00 17.76 ? 307  ALA A O   1 
ATOM   2360  C CB  . ALA A 1 307 ? -28.670 33.262  11.850  1.00 18.40 ? 307  ALA A CB  1 
ATOM   2361  N N   . SER A 1 308 ? -30.815 32.667  9.637   1.00 18.57 ? 308  SER A N   1 
ATOM   2362  C CA  . SER A 1 308 ? -31.673 33.096  8.526   1.00 19.37 ? 308  SER A CA  1 
ATOM   2363  C C   . SER A 1 308 ? -33.020 32.393  8.569   1.00 19.84 ? 308  SER A C   1 
ATOM   2364  O O   . SER A 1 308 ? -34.027 32.958  8.083   1.00 20.20 ? 308  SER A O   1 
ATOM   2365  C CB  . SER A 1 308 ? -30.975 32.888  7.181   1.00 18.88 ? 308  SER A CB  1 
ATOM   2366  O OG  . SER A 1 308 ? -29.982 33.880  6.984   1.00 18.62 ? 308  SER A OG  1 
ATOM   2367  N N   . VAL A 1 309 ? -33.042 31.194  9.114   1.00 20.47 ? 309  VAL A N   1 
ATOM   2368  C CA  . VAL A 1 309 ? -34.312 30.461  9.298   1.00 21.69 ? 309  VAL A CA  1 
ATOM   2369  C C   . VAL A 1 309 ? -35.212 31.263  10.243  1.00 22.76 ? 309  VAL A C   1 
ATOM   2370  O O   . VAL A 1 309 ? -36.368 31.569  9.902   1.00 22.37 ? 309  VAL A O   1 
ATOM   2371  C CB  . VAL A 1 309 ? -34.060 29.027  9.784   1.00 22.34 ? 309  VAL A CB  1 
ATOM   2372  C CG1 . VAL A 1 309 ? -35.354 28.235  9.998   1.00 22.30 ? 309  VAL A CG1 1 
ATOM   2373  C CG2 . VAL A 1 309 ? -33.104 28.270  8.885   1.00 21.00 ? 309  VAL A CG2 1 
ATOM   2374  N N   . LEU A 1 310 ? -34.652 31.586  11.399  1.00 23.33 ? 310  LEU A N   1 
ATOM   2375  C CA  . LEU A 1 310 ? -35.359 32.353  12.434  1.00 24.50 ? 310  LEU A CA  1 
ATOM   2376  C C   . LEU A 1 310 ? -35.853 33.691  11.901  1.00 25.64 ? 310  LEU A C   1 
ATOM   2377  O O   . LEU A 1 310 ? -37.000 34.081  12.170  1.00 25.73 ? 310  LEU A O   1 
ATOM   2378  C CB  . LEU A 1 310 ? -34.451 32.472  13.666  1.00 24.00 ? 310  LEU A CB  1 
ATOM   2379  C CG  . LEU A 1 310 ? -34.409 31.256  14.579  1.00 23.85 ? 310  LEU A CG  1 
ATOM   2380  C CD1 . LEU A 1 310 ? -33.208 31.308  15.512  1.00 23.54 ? 310  LEU A CD1 1 
ATOM   2381  C CD2 . LEU A 1 310 ? -35.708 31.204  15.378  1.00 22.84 ? 310  LEU A CD2 1 
ATOM   2382  N N   . ARG A 1 311 ? -34.986 34.375  11.180  1.00 26.81 ? 311  ARG A N   1 
ATOM   2383  C CA  . ARG A 1 311 ? -35.310 35.672  10.571  1.00 28.13 ? 311  ARG A CA  1 
ATOM   2384  C C   . ARG A 1 311 ? -36.504 35.548  9.628   1.00 28.40 ? 311  ARG A C   1 
ATOM   2385  O O   . ARG A 1 311 ? -37.458 36.333  9.729   1.00 28.50 ? 311  ARG A O   1 
ATOM   2386  C CB  . ARG A 1 311 ? -34.110 36.277  9.861   1.00 30.71 ? 311  ARG A CB  1 
ATOM   2387  C CG  . ARG A 1 311 ? -34.331 37.576  9.107   1.00 35.05 ? 311  ARG A CG  1 
ATOM   2388  C CD  . ARG A 1 311 ? -33.131 38.464  9.194   1.00 38.08 ? 311  ARG A CD  1 
ATOM   2389  N NE  . ARG A 1 311 ? -33.011 39.387  8.086   1.00 41.48 ? 311  ARG A NE  1 
ATOM   2390  C CZ  . ARG A 1 311 ? -32.539 40.631  8.175   1.00 42.98 ? 311  ARG A CZ  1 
ATOM   2391  N NH1 . ARG A 1 311 ? -32.118 41.160  9.321   1.00 44.09 ? 311  ARG A NH1 1 
ATOM   2392  N NH2 . ARG A 1 311 ? -32.493 41.395  7.078   1.00 43.96 ? 311  ARG A NH2 1 
ATOM   2393  N N   . ALA A 1 312 ? -36.451 34.574  8.744   1.00 28.92 ? 312  ALA A N   1 
ATOM   2394  C CA  . ALA A 1 312 ? -37.486 34.331  7.736   1.00 29.19 ? 312  ALA A CA  1 
ATOM   2395  C C   . ALA A 1 312 ? -38.825 33.965  8.375   1.00 29.91 ? 312  ALA A C   1 
ATOM   2396  O O   . ALA A 1 312 ? -39.881 34.493  7.980   1.00 29.75 ? 312  ALA A O   1 
ATOM   2397  C CB  . ALA A 1 312 ? -37.020 33.271  6.750   1.00 28.69 ? 312  ALA A CB  1 
ATOM   2398  N N   . TRP A 1 313 ? -38.784 33.069  9.340   1.00 30.26 ? 313  TRP A N   1 
ATOM   2399  C CA  . TRP A 1 313 ? -39.985 32.589  10.045  1.00 31.04 ? 313  TRP A CA  1 
ATOM   2400  C C   . TRP A 1 313 ? -40.687 33.729  10.779  1.00 31.88 ? 313  TRP A C   1 
ATOM   2401  O O   . TRP A 1 313 ? -41.875 34.012  10.534  1.00 32.25 ? 313  TRP A O   1 
ATOM   2402  C CB  . TRP A 1 313 ? -39.629 31.436  10.970  1.00 29.92 ? 313  TRP A CB  1 
ATOM   2403  C CG  . TRP A 1 313 ? -40.712 30.912  11.836  1.00 29.50 ? 313  TRP A CG  1 
ATOM   2404  C CD1 . TRP A 1 313 ? -41.962 30.496  11.449  1.00 29.39 ? 313  TRP A CD1 1 
ATOM   2405  C CD2 . TRP A 1 313 ? -40.646 30.708  13.258  1.00 28.89 ? 313  TRP A CD2 1 
ATOM   2406  N NE1 . TRP A 1 313 ? -42.666 30.044  12.534  1.00 29.05 ? 313  TRP A NE1 1 
ATOM   2407  C CE2 . TRP A 1 313 ? -41.893 30.172  13.654  1.00 28.75 ? 313  TRP A CE2 1 
ATOM   2408  C CE3 . TRP A 1 313 ? -39.659 30.934  14.211  1.00 28.67 ? 313  TRP A CE3 1 
ATOM   2409  C CZ2 . TRP A 1 313 ? -42.173 29.854  14.977  1.00 28.50 ? 313  TRP A CZ2 1 
ATOM   2410  C CZ3 . TRP A 1 313 ? -39.937 30.618  15.527  1.00 27.92 ? 313  TRP A CZ3 1 
ATOM   2411  C CH2 . TRP A 1 313 ? -41.167 30.090  15.906  1.00 28.38 ? 313  TRP A CH2 1 
ATOM   2412  N N   . ALA A 1 314 ? -39.958 34.347  11.682  1.00 32.56 ? 314  ALA A N   1 
ATOM   2413  C CA  . ALA A 1 314 ? -40.395 35.491  12.475  1.00 33.26 ? 314  ALA A CA  1 
ATOM   2414  C C   . ALA A 1 314 ? -41.568 35.157  13.387  1.00 33.63 ? 314  ALA A C   1 
ATOM   2415  O O   . ALA A 1 314 ? -42.285 36.082  13.814  1.00 33.49 ? 314  ALA A O   1 
ATOM   2416  C CB  . ALA A 1 314 ? -40.756 36.659  11.555  1.00 33.60 ? 314  ALA A CB  1 
ATOM   2417  N N   . GLY A 1 315 ? -41.755 33.880  13.647  1.00 34.18 ? 315  GLY A N   1 
ATOM   2418  C CA  . GLY A 1 315 ? -42.796 33.401  14.560  1.00 34.93 ? 315  GLY A CA  1 
ATOM   2419  C C   . GLY A 1 315 ? -44.138 33.227  13.876  1.00 35.74 ? 315  GLY A C   1 
ATOM   2420  O O   . GLY A 1 315 ? -45.090 32.743  14.524  1.00 35.96 ? 315  GLY A O   1 
ATOM   2421  N N   . LYS A 1 316 ? -44.215 33.576  12.607  1.00 36.09 ? 316  LYS A N   1 
ATOM   2422  C CA  . LYS A 1 316 ? -45.479 33.525  11.850  1.00 36.67 ? 316  LYS A CA  1 
ATOM   2423  C C   . LYS A 1 316 ? -45.666 32.187  11.154  1.00 36.94 ? 316  LYS A C   1 
ATOM   2424  O O   . LYS A 1 316 ? -44.798 31.694  10.423  1.00 37.25 ? 316  LYS A O   1 
ATOM   2425  C CB  . LYS A 1 316 ? -45.583 34.680  10.857  1.00 36.89 ? 316  LYS A CB  1 
ATOM   2426  C CG  . LYS A 1 316 ? -45.215 36.021  11.498  1.00 37.37 ? 316  LYS A CG  1 
ATOM   2427  C CD  . LYS A 1 316 ? -45.957 37.198  10.906  1.00 38.68 ? 316  LYS A CD  1 
ATOM   2428  C CE  . LYS A 1 316 ? -45.118 38.027  9.961   1.00 40.20 ? 316  LYS A CE  1 
ATOM   2429  N NZ  . LYS A 1 316 ? -45.236 37.541  8.562   1.00 40.89 ? 316  LYS A NZ  1 
ATOM   2430  N N   . LYS A 1 317 ? -46.833 31.614  11.392  1.00 37.03 ? 317  LYS A N   1 
ATOM   2431  C CA  . LYS A 1 317 ? -47.262 30.319  10.871  1.00 37.29 ? 317  LYS A CA  1 
ATOM   2432  C C   . LYS A 1 317 ? -47.194 30.280  9.345   1.00 37.05 ? 317  LYS A C   1 
ATOM   2433  O O   . LYS A 1 317 ? -46.866 29.236  8.748   1.00 36.72 ? 317  LYS A O   1 
ATOM   2434  C CB  . LYS A 1 317 ? -48.692 30.003  11.298  1.00 39.17 ? 317  LYS A CB  1 
ATOM   2435  C CG  . LYS A 1 317 ? -49.034 28.517  11.345  1.00 41.35 ? 317  LYS A CG  1 
ATOM   2436  C CD  . LYS A 1 317 ? -48.303 27.815  12.489  1.00 42.79 ? 317  LYS A CD  1 
ATOM   2437  C CE  . LYS A 1 317 ? -48.902 26.457  12.793  1.00 43.27 ? 317  LYS A CE  1 
ATOM   2438  N NZ  . LYS A 1 317 ? -47.895 25.568  13.423  1.00 44.71 ? 317  LYS A NZ  1 
ATOM   2439  N N   . GLU A 1 318 ? -47.534 31.412  8.751   1.00 37.00 ? 318  GLU A N   1 
ATOM   2440  C CA  . GLU A 1 318 ? -47.500 31.541  7.288   1.00 37.29 ? 318  GLU A CA  1 
ATOM   2441  C C   . GLU A 1 318 ? -46.076 31.309  6.787   1.00 36.68 ? 318  GLU A C   1 
ATOM   2442  O O   . GLU A 1 318 ? -45.881 30.534  5.835   1.00 37.15 ? 318  GLU A O   1 
ATOM   2443  C CB  . GLU A 1 318 ? -47.979 32.882  6.781   1.00 39.72 ? 318  GLU A CB  1 
ATOM   2444  C CG  . GLU A 1 318 ? -49.221 33.511  7.401   1.00 41.95 ? 318  GLU A CG  1 
ATOM   2445  C CD  . GLU A 1 318 ? -48.958 34.430  8.560   1.00 43.52 ? 318  GLU A CD  1 
ATOM   2446  O OE1 . GLU A 1 318 ? -48.319 35.472  8.475   1.00 44.52 ? 318  GLU A OE1 1 
ATOM   2447  O OE2 . GLU A 1 318 ? -49.479 34.013  9.616   1.00 44.16 ? 318  GLU A OE2 1 
ATOM   2448  N N   . ASN A 1 319 ? -45.125 31.927  7.460   1.00 35.66 ? 319  ASN A N   1 
ATOM   2449  C CA  . ASN A 1 319 ? -43.715 31.943  7.110   1.00 34.40 ? 319  ASN A CA  1 
ATOM   2450  C C   . ASN A 1 319 ? -42.969 30.628  7.283   1.00 33.53 ? 319  ASN A C   1 
ATOM   2451  O O   . ASN A 1 319 ? -41.720 30.642  7.177   1.00 33.55 ? 319  ASN A O   1 
ATOM   2452  C CB  . ASN A 1 319 ? -42.991 33.049  7.907   1.00 34.21 ? 319  ASN A CB  1 
ATOM   2453  C CG  . ASN A 1 319 ? -43.402 34.442  7.497   1.00 34.44 ? 319  ASN A CG  1 
ATOM   2454  O OD1 . ASN A 1 319 ? -42.930 35.436  8.071   1.00 35.44 ? 319  ASN A OD1 1 
ATOM   2455  N ND2 . ASN A 1 319 ? -44.284 34.526  6.506   1.00 34.30 ? 319  ASN A ND2 1 
ATOM   2456  N N   . ILE A 1 320 ? -43.659 29.548  7.539   1.00 32.63 ? 320  ILE A N   1 
ATOM   2457  C CA  . ILE A 1 320 ? -43.020 28.246  7.760   1.00 31.59 ? 320  ILE A CA  1 
ATOM   2458  C C   . ILE A 1 320 ? -42.159 27.825  6.578   1.00 30.68 ? 320  ILE A C   1 
ATOM   2459  O O   . ILE A 1 320 ? -41.000 27.402  6.767   1.00 30.25 ? 320  ILE A O   1 
ATOM   2460  C CB  . ILE A 1 320 ? -44.104 27.187  8.156   1.00 31.90 ? 320  ILE A CB  1 
ATOM   2461  C CG1 . ILE A 1 320 ? -44.574 27.486  9.609   1.00 31.57 ? 320  ILE A CG1 1 
ATOM   2462  C CG2 . ILE A 1 320 ? -43.625 25.732  7.977   1.00 31.45 ? 320  ILE A CG2 1 
ATOM   2463  C CD1 . ILE A 1 320 ? -45.757 26.593  10.071  1.00 32.79 ? 320  ILE A CD1 1 
ATOM   2464  N N   . ALA A 1 321 ? -42.722 27.936  5.388   1.00 29.63 ? 321  ALA A N   1 
ATOM   2465  C CA  . ALA A 1 321 ? -42.069 27.482  4.151   1.00 28.58 ? 321  ALA A CA  1 
ATOM   2466  C C   . ALA A 1 321 ? -40.826 28.312  3.845   1.00 27.44 ? 321  ALA A C   1 
ATOM   2467  O O   . ALA A 1 321 ? -39.840 27.783  3.312   1.00 27.23 ? 321  ALA A O   1 
ATOM   2468  C CB  . ALA A 1 321 ? -43.039 27.540  2.970   1.00 29.20 ? 321  ALA A CB  1 
ATOM   2469  N N   . ALA A 1 322 ? -40.937 29.590  4.156   1.00 26.48 ? 322  ALA A N   1 
ATOM   2470  C CA  . ALA A 1 322 ? -39.868 30.572  3.950   1.00 25.37 ? 322  ALA A CA  1 
ATOM   2471  C C   . ALA A 1 322 ? -38.650 30.222  4.802   1.00 24.83 ? 322  ALA A C   1 
ATOM   2472  O O   . ALA A 1 322 ? -37.505 30.273  4.329   1.00 24.38 ? 322  ALA A O   1 
ATOM   2473  C CB  . ALA A 1 322 ? -40.381 31.972  4.243   1.00 25.08 ? 322  ALA A CB  1 
ATOM   2474  N N   . GLY A 1 323 ? -38.922 29.860  6.046   1.00 24.16 ? 323  GLY A N   1 
ATOM   2475  C CA  . GLY A 1 323 ? -37.880 29.468  7.005   1.00 23.63 ? 323  GLY A CA  1 
ATOM   2476  C C   . GLY A 1 323 ? -37.185 28.194  6.546   1.00 23.19 ? 323  GLY A C   1 
ATOM   2477  O O   . GLY A 1 323 ? -35.942 28.131  6.478   1.00 23.18 ? 323  GLY A O   1 
ATOM   2478  N N   . GLN A 1 324 ? -37.979 27.197  6.236   1.00 22.78 ? 324  GLN A N   1 
ATOM   2479  C CA  . GLN A 1 324 ? -37.513 25.881  5.800   1.00 22.95 ? 324  GLN A CA  1 
ATOM   2480  C C   . GLN A 1 324 ? -36.631 25.985  4.552   1.00 23.36 ? 324  GLN A C   1 
ATOM   2481  O O   . GLN A 1 324 ? -35.699 25.183  4.367   1.00 23.04 ? 324  GLN A O   1 
ATOM   2482  C CB  . GLN A 1 324 ? -38.667 24.913  5.532   1.00 23.75 ? 324  GLN A CB  1 
ATOM   2483  C CG  . GLN A 1 324 ? -39.562 24.687  6.736   1.00 24.19 ? 324  GLN A CG  1 
ATOM   2484  C CD  . GLN A 1 324 ? -40.576 23.590  6.532   1.00 24.93 ? 324  GLN A CD  1 
ATOM   2485  O OE1 . GLN A 1 324 ? -41.145 23.415  5.460   1.00 24.69 ? 324  GLN A OE1 1 
ATOM   2486  N NE2 . GLN A 1 324 ? -40.811 22.833  7.602   1.00 24.53 ? 324  GLN A NE2 1 
ATOM   2487  N N   . ASN A 1 325 ? -36.979 26.951  3.723   1.00 23.16 ? 325  ASN A N   1 
ATOM   2488  C CA  . ASN A 1 325 ? -36.275 27.177  2.447   1.00 23.10 ? 325  ASN A CA  1 
ATOM   2489  C C   . ASN A 1 325 ? -34.868 27.708  2.733   1.00 21.87 ? 325  ASN A C   1 
ATOM   2490  O O   . ASN A 1 325 ? -33.916 27.302  2.042   1.00 21.01 ? 325  ASN A O   1 
ATOM   2491  C CB  . ASN A 1 325 ? -37.131 28.017  1.506   1.00 26.79 ? 325  ASN A CB  1 
ATOM   2492  C CG  . ASN A 1 325 ? -38.111 27.163  0.712   1.00 29.70 ? 325  ASN A CG  1 
ATOM   2493  O OD1 . ASN A 1 325 ? -37.747 26.604  -0.337  1.00 33.50 ? 325  ASN A OD1 1 
ATOM   2494  N ND2 . ASN A 1 325 ? -39.347 27.038  1.187   1.00 31.10 ? 325  ASN A ND2 1 
ATOM   2495  N N   . GLU A 1 326 ? -34.776 28.583  3.710   1.00 21.26 ? 326  GLU A N   1 
ATOM   2496  C CA  . GLU A 1 326 ? -33.493 29.135  4.164   1.00 20.82 ? 326  GLU A CA  1 
ATOM   2497  C C   . GLU A 1 326 ? -32.597 28.023  4.715   1.00 19.88 ? 326  GLU A C   1 
ATOM   2498  O O   . GLU A 1 326 ? -31.368 28.069  4.519   1.00 20.08 ? 326  GLU A O   1 
ATOM   2499  C CB  . GLU A 1 326 ? -33.601 30.204  5.229   1.00 22.90 ? 326  GLU A CB  1 
ATOM   2500  C CG  . GLU A 1 326 ? -34.055 31.607  4.855   1.00 24.81 ? 326  GLU A CG  1 
ATOM   2501  C CD  . GLU A 1 326 ? -33.368 32.181  3.644   1.00 26.60 ? 326  GLU A CD  1 
ATOM   2502  O OE1 . GLU A 1 326 ? -32.166 32.166  3.486   1.00 26.90 ? 326  GLU A OE1 1 
ATOM   2503  O OE2 . GLU A 1 326 ? -34.187 32.658  2.822   1.00 27.62 ? 326  GLU A OE2 1 
ATOM   2504  N N   . LEU A 1 327 ? -33.215 27.058  5.379   1.00 18.92 ? 327  LEU A N   1 
ATOM   2505  C CA  . LEU A 1 327 ? -32.493 25.912  5.940   1.00 17.90 ? 327  LEU A CA  1 
ATOM   2506  C C   . LEU A 1 327 ? -31.923 25.041  4.828   1.00 17.95 ? 327  LEU A C   1 
ATOM   2507  O O   . LEU A 1 327 ? -30.750 24.625  4.881   1.00 17.19 ? 327  LEU A O   1 
ATOM   2508  C CB  . LEU A 1 327 ? -33.395 25.135  6.914   1.00 16.99 ? 327  LEU A CB  1 
ATOM   2509  C CG  . LEU A 1 327 ? -32.768 23.871  7.493   1.00 17.30 ? 327  LEU A CG  1 
ATOM   2510  C CD1 . LEU A 1 327 ? -31.586 24.222  8.395   1.00 16.86 ? 327  LEU A CD1 1 
ATOM   2511  C CD2 . LEU A 1 327 ? -33.806 23.062  8.237   1.00 16.80 ? 327  LEU A CD2 1 
ATOM   2512  N N   . LEU A 1 328 ? -32.775 24.770  3.838   1.00 16.96 ? 328  LEU A N   1 
ATOM   2513  C CA  . LEU A 1 328 ? -32.340 23.947  2.703   1.00 17.13 ? 328  LEU A CA  1 
ATOM   2514  C C   . LEU A 1 328 ? -31.187 24.641  1.975   1.00 16.60 ? 328  LEU A C   1 
ATOM   2515  O O   . LEU A 1 328 ? -30.246 23.965  1.531   1.00 17.04 ? 328  LEU A O   1 
ATOM   2516  C CB  . LEU A 1 328 ? -33.548 23.655  1.809   1.00 17.12 ? 328  LEU A CB  1 
ATOM   2517  C CG  . LEU A 1 328 ? -34.629 22.731  2.332   1.00 17.34 ? 328  LEU A CG  1 
ATOM   2518  C CD1 . LEU A 1 328 ? -35.868 22.826  1.429   1.00 19.46 ? 328  LEU A CD1 1 
ATOM   2519  C CD2 . LEU A 1 328 ? -34.118 21.291  2.338   1.00 16.69 ? 328  LEU A CD2 1 
ATOM   2520  N N   . LYS A 1 329 ? -31.277 25.944  1.860   1.00 16.66 ? 329  LYS A N   1 
ATOM   2521  C CA  . LYS A 1 329 ? -30.287 26.763  1.159   1.00 17.17 ? 329  LYS A CA  1 
ATOM   2522  C C   . LYS A 1 329 ? -28.905 26.599  1.799   1.00 17.11 ? 329  LYS A C   1 
ATOM   2523  O O   . LYS A 1 329 ? -27.923 26.253  1.115   1.00 16.80 ? 329  LYS A O   1 
ATOM   2524  C CB  . LYS A 1 329 ? -30.658 28.239  1.118   1.00 18.52 ? 329  LYS A CB  1 
ATOM   2525  C CG  . LYS A 1 329 ? -31.541 28.631  -0.075  1.00 22.31 ? 329  LYS A CG  1 
ATOM   2526  C CD  . LYS A 1 329 ? -32.125 30.027  0.101   1.00 23.53 ? 329  LYS A CD  1 
ATOM   2527  C CE  . LYS A 1 329 ? -31.051 31.055  0.381   1.00 26.63 ? 329  LYS A CE  1 
ATOM   2528  N NZ  . LYS A 1 329 ? -31.649 32.388  0.662   1.00 27.60 ? 329  LYS A NZ  1 
ATOM   2529  N N   . ARG A 1 330 ? -28.846 26.846  3.094   1.00 16.70 ? 330  ARG A N   1 
ATOM   2530  C CA  . ARG A 1 330 ? -27.599 26.743  3.871   1.00 16.06 ? 330  ARG A CA  1 
ATOM   2531  C C   . ARG A 1 330 ? -27.072 25.333  4.032   1.00 14.93 ? 330  ARG A C   1 
ATOM   2532  O O   . ARG A 1 330 ? -25.833 25.141  4.044   1.00 14.57 ? 330  ARG A O   1 
ATOM   2533  C CB  . ARG A 1 330 ? -27.774 27.413  5.237   1.00 18.51 ? 330  ARG A CB  1 
ATOM   2534  C CG  . ARG A 1 330 ? -27.687 28.933  5.156   1.00 20.92 ? 330  ARG A CG  1 
ATOM   2535  C CD  . ARG A 1 330 ? -26.343 29.429  5.421   1.00 22.94 ? 330  ARG A CD  1 
ATOM   2536  N NE  . ARG A 1 330 ? -25.284 29.357  4.486   1.00 22.28 ? 330  ARG A NE  1 
ATOM   2537  C CZ  . ARG A 1 330 ? -24.794 30.236  3.628   1.00 22.02 ? 330  ARG A CZ  1 
ATOM   2538  N NH1 . ARG A 1 330 ? -25.416 31.350  3.273   1.00 23.08 ? 330  ARG A NH1 1 
ATOM   2539  N NH2 . ARG A 1 330 ? -23.614 29.989  3.022   1.00 19.82 ? 330  ARG A NH2 1 
ATOM   2540  N N   . ALA A 1 331 ? -27.940 24.354  4.177   1.00 13.71 ? 331  ALA A N   1 
ATOM   2541  C CA  . ALA A 1 331 ? -27.548 22.944  4.296   1.00 13.45 ? 331  ALA A CA  1 
ATOM   2542  C C   . ALA A 1 331 ? -26.808 22.489  3.029   1.00 13.02 ? 331  ALA A C   1 
ATOM   2543  O O   . ALA A 1 331 ? -25.774 21.809  3.078   1.00 12.70 ? 331  ALA A O   1 
ATOM   2544  C CB  . ALA A 1 331 ? -28.728 22.038  4.565   1.00 11.87 ? 331  ALA A CB  1 
ATOM   2545  N N   . LYS A 1 332 ? -27.385 22.888  1.906   1.00 13.00 ? 332  LYS A N   1 
ATOM   2546  C CA  . LYS A 1 332 ? -26.788 22.565  0.596   1.00 12.18 ? 332  LYS A CA  1 
ATOM   2547  C C   . LYS A 1 332 ? -25.437 23.253  0.465   1.00 10.59 ? 332  LYS A C   1 
ATOM   2548  O O   . LYS A 1 332 ? -24.482 22.593  0.014   1.00 11.39 ? 332  LYS A O   1 
ATOM   2549  C CB  . LYS A 1 332 ? -27.721 22.965  -0.545  1.00 14.75 ? 332  LYS A CB  1 
ATOM   2550  C CG  . LYS A 1 332 ? -27.110 22.718  -1.924  1.00 18.01 ? 332  LYS A CG  1 
ATOM   2551  C CD  . LYS A 1 332 ? -27.402 21.326  -2.423  1.00 22.73 ? 332  LYS A CD  1 
ATOM   2552  C CE  . LYS A 1 332 ? -26.378 20.829  -3.437  1.00 24.53 ? 332  LYS A CE  1 
ATOM   2553  N NZ  . LYS A 1 332 ? -25.416 19.940  -2.717  1.00 28.04 ? 332  LYS A NZ  1 
ATOM   2554  N N   . ALA A 1 333 ? -25.350 24.506  0.884   1.00 9.85  ? 333  ALA A N   1 
ATOM   2555  C CA  . ALA A 1 333 ? -24.093 25.274  0.745   1.00 9.58  ? 333  ALA A CA  1 
ATOM   2556  C C   . ALA A 1 333 ? -22.975 24.625  1.567   1.00 9.65  ? 333  ALA A C   1 
ATOM   2557  O O   . ALA A 1 333 ? -21.822 24.489  1.121   1.00 8.96  ? 333  ALA A O   1 
ATOM   2558  C CB  . ALA A 1 333 ? -24.302 26.732  1.080   1.00 8.10  ? 333  ALA A CB  1 
ATOM   2559  N N   . ASN A 1 334 ? -23.356 24.208  2.775   1.00 10.05 ? 334  ASN A N   1 
ATOM   2560  C CA  . ASN A 1 334 ? -22.385 23.541  3.683   1.00 9.34  ? 334  ASN A CA  1 
ATOM   2561  C C   . ASN A 1 334 ? -22.034 22.170  3.186   1.00 8.66  ? 334  ASN A C   1 
ATOM   2562  O O   . ASN A 1 334 ? -20.868 21.736  3.319   1.00 9.06  ? 334  ASN A O   1 
ATOM   2563  C CB  . ASN A 1 334 ? -22.878 23.665  5.131   1.00 8.93  ? 334  ASN A CB  1 
ATOM   2564  C CG  . ASN A 1 334 ? -22.701 25.072  5.655   1.00 6.99  ? 334  ASN A CG  1 
ATOM   2565  O OD1 . ASN A 1 334 ? -21.611 25.672  5.611   1.00 9.09  ? 334  ASN A OD1 1 
ATOM   2566  N ND2 . ASN A 1 334 ? -23.763 25.672  6.177   1.00 8.78  ? 334  ASN A ND2 1 
ATOM   2567  N N   . GLY A 1 335 ? -23.006 21.461  2.625   1.00 8.54  ? 335  GLY A N   1 
ATOM   2568  C CA  . GLY A 1 335 ? -22.753 20.156  2.006   1.00 8.12  ? 335  GLY A CA  1 
ATOM   2569  C C   . GLY A 1 335 ? -21.684 20.302  0.912   1.00 8.84  ? 335  GLY A C   1 
ATOM   2570  O O   . GLY A 1 335 ? -20.815 19.416  0.777   1.00 7.96  ? 335  GLY A O   1 
ATOM   2571  N N   . ASP A 1 336 ? -21.784 21.385  0.156   1.00 9.36  ? 336  ASP A N   1 
ATOM   2572  C CA  . ASP A 1 336 ? -20.818 21.649  -0.930  1.00 10.21 ? 336  ASP A CA  1 
ATOM   2573  C C   . ASP A 1 336 ? -19.434 21.989  -0.337  1.00 10.21 ? 336  ASP A C   1 
ATOM   2574  O O   . ASP A 1 336 ? -18.402 21.537  -0.856  1.00 11.30 ? 336  ASP A O   1 
ATOM   2575  C CB  . ASP A 1 336 ? -21.294 22.763  -1.850  1.00 12.25 ? 336  ASP A CB  1 
ATOM   2576  C CG  . ASP A 1 336 ? -22.423 22.371  -2.786  1.00 13.49 ? 336  ASP A CG  1 
ATOM   2577  O OD1 . ASP A 1 336 ? -22.704 21.197  -3.006  1.00 14.79 ? 336  ASP A OD1 1 
ATOM   2578  O OD2 . ASP A 1 336 ? -23.045 23.340  -3.285  1.00 18.35 ? 336  ASP A OD2 1 
ATOM   2579  N N   . ALA A 1 337 ? -19.451 22.791  0.708   1.00 9.91  ? 337  ALA A N   1 
ATOM   2580  C CA  . ALA A 1 337 ? -18.201 23.204  1.383   1.00 9.75  ? 337  ALA A CA  1 
ATOM   2581  C C   . ALA A 1 337 ? -17.475 21.992  1.957   1.00 9.37  ? 337  ALA A C   1 
ATOM   2582  O O   . ALA A 1 337 ? -16.231 21.916  1.891   1.00 8.78  ? 337  ALA A O   1 
ATOM   2583  C CB  . ALA A 1 337 ? -18.488 24.253  2.447   1.00 9.54  ? 337  ALA A CB  1 
ATOM   2584  N N   . ALA A 1 338 ? -18.263 21.054  2.479   1.00 9.48  ? 338  ALA A N   1 
ATOM   2585  C CA  . ALA A 1 338 ? -17.697 19.833  3.072   1.00 10.44 ? 338  ALA A CA  1 
ATOM   2586  C C   . ALA A 1 338 ? -16.961 19.016  2.013   1.00 10.71 ? 338  ALA A C   1 
ATOM   2587  O O   . ALA A 1 338 ? -16.218 18.083  2.335   1.00 9.95  ? 338  ALA A O   1 
ATOM   2588  C CB  . ALA A 1 338 ? -18.784 19.017  3.773   1.00 10.59 ? 338  ALA A CB  1 
ATOM   2589  N N   . GLN A 1 339 ? -17.201 19.361  0.757   1.00 11.18 ? 339  GLN A N   1 
ATOM   2590  C CA  . GLN A 1 339 ? -16.523 18.684  -0.372  1.00 10.86 ? 339  GLN A CA  1 
ATOM   2591  C C   . GLN A 1 339 ? -15.531 19.618  -1.062  1.00 10.39 ? 339  GLN A C   1 
ATOM   2592  O O   . GLN A 1 339 ? -14.951 19.246  -2.108  1.00 9.80  ? 339  GLN A O   1 
ATOM   2593  C CB  . GLN A 1 339 ? -17.541 18.135  -1.368  1.00 14.16 ? 339  GLN A CB  1 
ATOM   2594  C CG  . GLN A 1 339 ? -18.475 17.114  -0.753  1.00 16.03 ? 339  GLN A CG  1 
ATOM   2595  C CD  . GLN A 1 339 ? -19.506 16.610  -1.735  1.00 18.48 ? 339  GLN A CD  1 
ATOM   2596  O OE1 . GLN A 1 339 ? -19.346 15.538  -2.318  1.00 20.18 ? 339  GLN A OE1 1 
ATOM   2597  N NE2 . GLN A 1 339 ? -20.568 17.399  -1.891  1.00 19.33 ? 339  GLN A NE2 1 
ATOM   2598  N N   . GLY A 1 340 ? -15.354 20.802  -0.526  1.00 9.47  ? 340  GLY A N   1 
ATOM   2599  C CA  . GLY A 1 340 ? -14.416 21.798  -1.046  1.00 10.37 ? 340  GLY A CA  1 
ATOM   2600  C C   . GLY A 1 340 ? -14.958 22.447  -2.328  1.00 11.33 ? 340  GLY A C   1 
ATOM   2601  O O   . GLY A 1 340 ? -14.163 23.006  -3.118  1.00 11.44 ? 340  GLY A O   1 
ATOM   2602  N N   . LYS A 1 341 ? -16.267 22.420  -2.483  1.00 11.91 ? 341  LYS A N   1 
ATOM   2603  C CA  . LYS A 1 341 ? -16.892 22.885  -3.740  1.00 12.70 ? 341  LYS A CA  1 
ATOM   2604  C C   . LYS A 1 341 ? -17.746 24.114  -3.621  1.00 13.01 ? 341  LYS A C   1 
ATOM   2605  O O   . LYS A 1 341 ? -18.475 24.415  -4.611  1.00 14.02 ? 341  LYS A O   1 
ATOM   2606  C CB  . LYS A 1 341 ? -17.739 21.756  -4.327  1.00 14.69 ? 341  LYS A CB  1 
ATOM   2607  C CG  . LYS A 1 341 ? -16.996 20.649  -5.046  1.00 19.41 ? 341  LYS A CG  1 
ATOM   2608  C CD  . LYS A 1 341 ? -17.950 19.500  -5.401  1.00 22.34 ? 341  LYS A CD  1 
ATOM   2609  C CE  . LYS A 1 341 ? -19.347 20.013  -5.710  1.00 25.45 ? 341  LYS A CE  1 
ATOM   2610  N NZ  . LYS A 1 341 ? -20.322 18.906  -5.861  1.00 25.72 ? 341  LYS A NZ  1 
ATOM   2611  N N   . TYR A 1 342 ? -17.715 24.864  -2.529  1.00 11.69 ? 342  TYR A N   1 
ATOM   2612  C CA  . TYR A 1 342 ? -18.603 26.024  -2.403  1.00 11.09 ? 342  TYR A CA  1 
ATOM   2613  C C   . TYR A 1 342 ? -18.072 27.239  -3.141  1.00 11.12 ? 342  TYR A C   1 
ATOM   2614  O O   . TYR A 1 342 ? -16.899 27.625  -2.996  1.00 11.38 ? 342  TYR A O   1 
ATOM   2615  C CB  . TYR A 1 342 ? -18.885 26.392  -0.929  1.00 8.14  ? 342  TYR A CB  1 
ATOM   2616  C CG  . TYR A 1 342 ? -19.825 27.572  -0.786  1.00 7.56  ? 342  TYR A CG  1 
ATOM   2617  C CD1 . TYR A 1 342 ? -21.180 27.454  -1.115  1.00 7.39  ? 342  TYR A CD1 1 
ATOM   2618  C CD2 . TYR A 1 342 ? -19.377 28.791  -0.307  1.00 6.60  ? 342  TYR A CD2 1 
ATOM   2619  C CE1 . TYR A 1 342 ? -22.045 28.534  -0.953  1.00 8.16  ? 342  TYR A CE1 1 
ATOM   2620  C CE2 . TYR A 1 342 ? -20.224 29.881  -0.140  1.00 8.34  ? 342  TYR A CE2 1 
ATOM   2621  C CZ  . TYR A 1 342 ? -21.572 29.743  -0.488  1.00 8.30  ? 342  TYR A CZ  1 
ATOM   2622  O OH  . TYR A 1 342 ? -22.368 30.840  -0.331  1.00 9.96  ? 342  TYR A OH  1 
ATOM   2623  N N   . VAL A 1 343 ? -18.979 27.832  -3.934  1.00 11.17 ? 343  VAL A N   1 
ATOM   2624  C CA  . VAL A 1 343 ? -18.631 29.100  -4.623  1.00 11.95 ? 343  VAL A CA  1 
ATOM   2625  C C   . VAL A 1 343 ? -19.083 30.249  -3.730  1.00 11.82 ? 343  VAL A C   1 
ATOM   2626  O O   . VAL A 1 343 ? -20.284 30.402  -3.476  1.00 11.29 ? 343  VAL A O   1 
ATOM   2627  C CB  . VAL A 1 343 ? -19.211 29.156  -6.050  1.00 13.85 ? 343  VAL A CB  1 
ATOM   2628  C CG1 . VAL A 1 343 ? -19.048 30.562  -6.638  1.00 14.14 ? 343  VAL A CG1 1 
ATOM   2629  C CG2 . VAL A 1 343 ? -18.606 28.097  -6.954  1.00 14.64 ? 343  VAL A CG2 1 
ATOM   2630  N N   . ALA A 1 344 ? -18.103 31.027  -3.285  1.00 12.45 ? 345  ALA A N   1 
ATOM   2631  C CA  . ALA A 1 344 ? -18.325 32.117  -2.345  1.00 13.15 ? 345  ALA A CA  1 
ATOM   2632  C C   . ALA A 1 344 ? -19.440 33.048  -2.792  1.00 13.99 ? 345  ALA A C   1 
ATOM   2633  O O   . ALA A 1 344 ? -19.416 33.560  -3.930  1.00 14.01 ? 345  ALA A O   1 
ATOM   2634  C CB  . ALA A 1 344 ? -17.040 32.917  -2.131  1.00 14.00 ? 345  ALA A CB  1 
ATOM   2635  N N   . GLY A 1 345 ? -20.340 33.323  -1.873  1.00 13.54 ? 346  GLY A N   1 
ATOM   2636  C CA  . GLY A 1 345 ? -21.471 34.205  -2.075  1.00 14.42 ? 346  GLY A CA  1 
ATOM   2637  C C   . GLY A 1 345 ? -22.597 33.622  -2.894  1.00 14.84 ? 346  GLY A C   1 
ATOM   2638  O O   . GLY A 1 345 ? -23.652 34.305  -3.016  1.00 14.86 ? 346  GLY A O   1 
ATOM   2639  N N   . SER A 1 346 ? -22.436 32.416  -3.388  1.00 15.31 ? 347  SER A N   1 
ATOM   2640  C CA  . SER A 1 346 ? -23.399 31.773  -4.282  1.00 17.50 ? 347  SER A CA  1 
ATOM   2641  C C   . SER A 1 346 ? -24.718 31.444  -3.588  1.00 18.73 ? 347  SER A C   1 
ATOM   2642  O O   . SER A 1 346 ? -25.760 31.375  -4.269  1.00 18.66 ? 347  SER A O   1 
ATOM   2643  C CB  . SER A 1 346 ? -22.825 30.593  -5.032  1.00 16.90 ? 347  SER A CB  1 
ATOM   2644  O OG  . SER A 1 346 ? -22.635 29.429  -4.269  1.00 18.90 ? 347  SER A OG  1 
ATOM   2645  N N   . ALA A 1 347 ? -24.684 31.283  -2.273  1.00 20.12 ? 348  ALA A N   1 
ATOM   2646  C CA  . ALA A 1 347 ? -25.892 30.954  -1.506  1.00 21.88 ? 348  ALA A CA  1 
ATOM   2647  C C   . ALA A 1 347 ? -26.475 32.186  -0.824  1.00 23.17 ? 348  ALA A C   1 
ATOM   2648  O O   . ALA A 1 347 ? -27.426 32.054  -0.037  1.00 24.01 ? 348  ALA A O   1 
ATOM   2649  C CB  . ALA A 1 347 ? -25.645 29.826  -0.521  1.00 20.67 ? 348  ALA A CB  1 
ATOM   2650  N N   . GLY A 1 348 ? -25.923 33.345  -1.120  1.00 24.57 ? 349  GLY A N   1 
ATOM   2651  C CA  . GLY A 1 348 ? -26.405 34.611  -0.540  1.00 26.23 ? 349  GLY A CA  1 
ATOM   2652  C C   . GLY A 1 348 ? -25.486 35.061  0.592   1.00 27.73 ? 349  GLY A C   1 
ATOM   2653  O O   . GLY A 1 348 ? -24.690 34.263  1.123   1.00 27.84 ? 349  GLY A O   1 
ATOM   2654  N N   . ALA A 1 349 ? -25.628 36.324  0.949   1.00 28.75 ? 351  ALA A N   1 
ATOM   2655  C CA  . ALA A 1 349 ? -24.781 36.965  1.968   1.00 30.16 ? 351  ALA A CA  1 
ATOM   2656  C C   . ALA A 1 349 ? -25.013 36.368  3.351   1.00 31.42 ? 351  ALA A C   1 
ATOM   2657  O O   . ALA A 1 349 ? -24.100 36.319  4.191   1.00 31.13 ? 351  ALA A O   1 
ATOM   2658  C CB  . ALA A 1 349 ? -24.982 38.465  1.924   1.00 30.15 ? 351  ALA A CB  1 
ATOM   2659  N N   . GLY A 1 350 ? -26.229 35.909  3.575   1.00 32.87 ? 352  GLY A N   1 
ATOM   2660  C CA  . GLY A 1 350 ? -26.655 35.282  4.828   1.00 34.23 ? 352  GLY A CA  1 
ATOM   2661  C C   . GLY A 1 350 ? -26.922 36.323  5.914   1.00 35.64 ? 352  GLY A C   1 
ATOM   2662  O O   . GLY A 1 350 ? -27.496 37.395  5.689   1.00 35.85 ? 352  GLY A O   1 
ATOM   2663  N N   . SER A 1 351 ? -26.489 35.972  7.111   1.00 36.78 ? 353  SER A N   1 
ATOM   2664  C CA  . SER A 1 351 ? -26.669 36.771  8.321   1.00 38.03 ? 353  SER A CA  1 
ATOM   2665  C C   . SER A 1 351 ? -25.427 37.604  8.649   1.00 39.00 ? 353  SER A C   1 
ATOM   2666  O O   . SER A 1 351 ? -24.409 37.595  7.947   1.00 39.40 ? 353  SER A O   1 
ATOM   2667  C CB  . SER A 1 351 ? -26.878 35.812  9.517   1.00 38.09 ? 353  SER A CB  1 
ATOM   2668  O OG  . SER A 1 351 ? -25.621 35.215  9.842   1.00 37.00 ? 353  SER A OG  1 
ATOM   2669  N N   . GLY A 1 352 ? -25.562 38.270  9.781   1.00 39.75 ? 354  GLY A N   1 
ATOM   2670  C CA  . GLY A 1 352 ? -24.513 39.090  10.387  1.00 40.56 ? 354  GLY A CA  1 
ATOM   2671  C C   . GLY A 1 352 ? -23.642 38.193  11.279  1.00 41.07 ? 354  GLY A C   1 
ATOM   2672  O O   . GLY A 1 352 ? -23.707 36.958  11.170  1.00 40.87 ? 354  GLY A O   1 
ATOM   2673  N N   . SER A 1 353 ? -22.867 38.853  12.116  1.00 41.53 ? 355  SER A N   1 
ATOM   2674  C CA  . SER A 1 353 ? -21.927 38.152  13.026  1.00 42.04 ? 355  SER A CA  1 
ATOM   2675  C C   . SER A 1 353 ? -22.784 37.479  14.100  1.00 41.99 ? 355  SER A C   1 
ATOM   2676  O O   . SER A 1 353 ? -23.666 38.145  14.666  1.00 41.84 ? 355  SER A O   1 
ATOM   2677  C CB  . SER A 1 353 ? -20.899 39.090  13.602  1.00 42.75 ? 355  SER A CB  1 
ATOM   2678  O OG  . SER A 1 353 ? -20.211 38.520  14.701  1.00 43.04 ? 355  SER A OG  1 
ATOM   2679  N N   . LEU A 1 354 ? -22.517 36.208  14.305  1.00 42.00 ? 356  LEU A N   1 
ATOM   2680  C CA  . LEU A 1 354 ? -23.274 35.381  15.255  1.00 42.58 ? 356  LEU A CA  1 
ATOM   2681  C C   . LEU A 1 354 ? -22.468 35.172  16.540  1.00 43.13 ? 356  LEU A C   1 
ATOM   2682  O O   . LEU A 1 354 ? -22.530 34.090  17.145  1.00 42.90 ? 356  LEU A O   1 
ATOM   2683  C CB  . LEU A 1 354 ? -23.604 34.062  14.550  1.00 41.26 ? 356  LEU A CB  1 
ATOM   2684  C CG  . LEU A 1 354 ? -24.214 34.130  13.161  1.00 40.46 ? 356  LEU A CG  1 
ATOM   2685  C CD1 . LEU A 1 354 ? -24.415 32.729  12.600  1.00 39.49 ? 356  LEU A CD1 1 
ATOM   2686  C CD2 . LEU A 1 354 ? -25.548 34.866  13.248  1.00 40.46 ? 356  LEU A CD2 1 
ATOM   2687  N N   . PHE A 1 355 ? -21.731 36.200  16.902  1.00 44.17 ? 357  PHE A N   1 
ATOM   2688  C CA  . PHE A 1 355 ? -20.861 36.150  18.083  1.00 45.85 ? 357  PHE A CA  1 
ATOM   2689  C C   . PHE A 1 355 ? -21.607 36.651  19.326  1.00 47.33 ? 357  PHE A C   1 
ATOM   2690  O O   . PHE A 1 355 ? -22.229 37.715  19.315  1.00 47.10 ? 357  PHE A O   1 
ATOM   2691  C CB  . PHE A 1 355 ? -19.545 36.902  17.877  1.00 44.40 ? 357  PHE A CB  1 
ATOM   2692  C CG  . PHE A 1 355 ? -18.707 37.061  19.107  1.00 43.89 ? 357  PHE A CG  1 
ATOM   2693  C CD1 . PHE A 1 355 ? -17.964 35.979  19.593  1.00 43.89 ? 357  PHE A CD1 1 
ATOM   2694  C CD2 . PHE A 1 355 ? -18.659 38.278  19.781  1.00 43.64 ? 357  PHE A CD2 1 
ATOM   2695  C CE1 . PHE A 1 355 ? -17.184 36.104  20.736  1.00 43.29 ? 357  PHE A CE1 1 
ATOM   2696  C CE2 . PHE A 1 355 ? -17.871 38.430  20.930  1.00 43.42 ? 357  PHE A CE2 1 
ATOM   2697  C CZ  . PHE A 1 355 ? -17.135 37.332  21.402  1.00 43.33 ? 357  PHE A CZ  1 
ATOM   2698  N N   . VAL A 1 356 ? -21.496 35.833  20.350  1.00 49.28 ? 358  VAL A N   1 
ATOM   2699  C CA  . VAL A 1 356 ? -21.975 36.131  21.715  1.00 51.48 ? 358  VAL A CA  1 
ATOM   2700  C C   . VAL A 1 356 ? -20.836 35.715  22.659  1.00 53.09 ? 358  VAL A C   1 
ATOM   2701  O O   . VAL A 1 356 ? -20.402 34.555  22.642  1.00 52.75 ? 358  VAL A O   1 
ATOM   2702  C CB  . VAL A 1 356 ? -23.326 35.465  21.972  1.00 51.55 ? 358  VAL A CB  1 
ATOM   2703  C CG1 . VAL A 1 356 ? -23.923 35.817  23.333  1.00 51.74 ? 358  VAL A CG1 1 
ATOM   2704  C CG2 . VAL A 1 356 ? -24.329 35.777  20.867  1.00 51.30 ? 358  VAL A CG2 1 
ATOM   2705  N N   . ALA A 1 357 ? -20.371 36.673  23.433  1.00 55.31 ? 359  ALA A N   1 
ATOM   2706  C CA  . ALA A 1 357 ? -19.215 36.513  24.319  1.00 58.12 ? 359  ALA A CA  1 
ATOM   2707  C C   . ALA A 1 357 ? -19.474 35.611  25.520  1.00 60.12 ? 359  ALA A C   1 
ATOM   2708  O O   . ALA A 1 357 ? -20.607 35.243  25.840  1.00 60.16 ? 359  ALA A O   1 
ATOM   2709  C CB  . ALA A 1 357 ? -18.743 37.902  24.753  1.00 57.61 ? 359  ALA A CB  1 
ATOM   2710  N N   . ASN A 1 358 ? -18.381 35.240  26.156  1.00 62.63 ? 360  ASN A N   1 
ATOM   2711  C CA  . ASN A 1 358 ? -18.239 34.576  27.437  1.00 65.29 ? 360  ASN A CA  1 
ATOM   2712  C C   . ASN A 1 358 ? -19.079 33.333  27.673  1.00 67.16 ? 360  ASN A C   1 
ATOM   2713  O O   . ASN A 1 358 ? -20.138 33.437  28.339  1.00 67.41 ? 360  ASN A O   1 
ATOM   2714  C CB  . ASN A 1 358 ? -18.513 35.602  28.562  1.00 66.01 ? 360  ASN A CB  1 
ATOM   2715  C CG  . ASN A 1 358 ? -17.517 36.728  28.649  1.00 67.02 ? 360  ASN A CG  1 
ATOM   2716  O OD1 . ASN A 1 358 ? -16.582 36.680  29.468  1.00 67.96 ? 360  ASN A OD1 1 
ATOM   2717  N ND2 . ASN A 1 358 ? -17.701 37.775  27.843  1.00 67.24 ? 360  ASN A ND2 1 
ATOM   2718  N N   . HIS A 1 359 ? -18.583 32.180  27.263  1.00 68.96 ? 361  HIS A N   1 
ATOM   2719  C CA  . HIS A 1 359 ? -19.347 30.930  27.336  1.00 70.90 ? 361  HIS A CA  1 
ATOM   2720  C C   . HIS A 1 359 ? -19.099 30.135  28.607  1.00 72.08 ? 361  HIS A C   1 
ATOM   2721  O O   . HIS A 1 359 ? -19.951 29.312  29.010  1.00 72.12 ? 361  HIS A O   1 
ATOM   2722  C CB  . HIS A 1 359 ? -19.068 29.996  26.125  1.00 72.39 ? 361  HIS A CB  1 
ATOM   2723  C CG  . HIS A 1 359 ? -19.531 30.599  24.836  1.00 73.63 ? 361  HIS A CG  1 
ATOM   2724  N ND1 . HIS A 1 359 ? -20.138 29.899  23.826  1.00 74.28 ? 361  HIS A ND1 1 
ATOM   2725  C CD2 . HIS A 1 359 ? -19.472 31.888  24.420  1.00 74.20 ? 361  HIS A CD2 1 
ATOM   2726  C CE1 . HIS A 1 359 ? -20.423 30.732  22.833  1.00 74.60 ? 361  HIS A CE1 1 
ATOM   2727  N NE2 . HIS A 1 359 ? -20.034 31.940  23.170  1.00 74.57 ? 361  HIS A NE2 1 
ATOM   2728  N N   . ALA A 1 360 ? -17.947 30.361  29.211  1.00 73.20 ? 362  ALA A N   1 
ATOM   2729  C CA  . ALA A 1 360 ? -17.531 29.611  30.405  1.00 74.36 ? 362  ALA A CA  1 
ATOM   2730  C C   . ALA A 1 360 ? -17.888 30.364  31.680  1.00 75.15 ? 362  ALA A C   1 
ATOM   2731  O O   . ALA A 1 360 ? -17.159 31.277  32.090  1.00 75.24 ? 362  ALA A O   1 
ATOM   2732  C CB  . ALA A 1 360 ? -16.041 29.305  30.329  1.00 74.69 ? 362  ALA A CB  1 
ATOM   2733  N N   . TYR A 1 361 ? -19.000 29.965  32.256  1.00 76.00 ? 363  TYR A N   1 
ATOM   2734  C CA  . TYR A 1 361 ? -19.503 30.451  33.535  1.00 76.89 ? 363  TYR A CA  1 
ATOM   2735  C C   . TYR A 1 361 ? -21.020 30.642  33.520  1.00 77.19 ? 363  TYR A C   1 
ATOM   2736  O O   . TYR A 1 361 ? -21.672 29.809  34.199  1.00 77.24 ? 363  TYR A O   1 
ATOM   2737  C CB  . TYR A 1 361 ? -18.784 31.718  34.021  1.00 78.38 ? 363  TYR A CB  1 
ATOM   2738  C CG  . TYR A 1 361 ? -17.586 31.468  34.910  1.00 79.39 ? 363  TYR A CG  1 
ATOM   2739  C CD1 . TYR A 1 361 ? -17.756 31.165  36.263  1.00 79.92 ? 363  TYR A CD1 1 
ATOM   2740  C CD2 . TYR A 1 361 ? -16.277 31.531  34.421  1.00 79.66 ? 363  TYR A CD2 1 
ATOM   2741  C CE1 . TYR A 1 361 ? -16.666 30.934  37.097  1.00 80.35 ? 363  TYR A CE1 1 
ATOM   2742  C CE2 . TYR A 1 361 ? -15.180 31.297  35.236  1.00 80.05 ? 363  TYR A CE2 1 
ATOM   2743  C CZ  . TYR A 1 361 ? -15.378 30.996  36.583  1.00 80.22 ? 363  TYR A CZ  1 
ATOM   2744  O OH  . TYR A 1 361 ? -14.328 30.756  37.428  1.00 80.29 ? 363  TYR A OH  1 
ATOM   2745  O OXT . TYR A 1 361 ? -21.493 31.586  32.868  1.00 77.72 ? 363  TYR A OXT 1 
HETATM 2746  C C   . ACE B 1 1   ? 1.837   24.322  35.889  1.00 12.02 ? 0    ACE B C   1 
HETATM 2747  O O   . ACE B 1 1   ? 2.098   24.954  34.859  1.00 13.82 ? 0    ACE B O   1 
HETATM 2748  C CH3 . ACE B 1 1   ? 2.486   23.024  36.220  1.00 11.96 ? 0    ACE B CH3 1 
ATOM   2749  N N   . THR B 1 2   ? 0.948   24.809  36.776  1.00 9.29  ? 1    THR B N   1 
ATOM   2750  C CA  . THR B 1 2   ? 0.407   26.127  36.687  1.00 8.83  ? 1    THR B CA  1 
ATOM   2751  C C   . THR B 1 2   ? 0.939   27.003  37.810  1.00 8.98  ? 1    THR B C   1 
ATOM   2752  O O   . THR B 1 2   ? 0.680   26.670  38.998  1.00 9.89  ? 1    THR B O   1 
ATOM   2753  C CB  . THR B 1 2   ? -1.189  26.099  36.784  1.00 7.42  ? 1    THR B CB  1 
ATOM   2754  O OG1 . THR B 1 2   ? -1.616  25.047  35.882  1.00 7.32  ? 1    THR B OG1 1 
ATOM   2755  C CG2 . THR B 1 2   ? -1.815  27.461  36.506  1.00 8.47  ? 1    THR B CG2 1 
ATOM   2756  N N   . THR B 1 3   ? 1.590   28.097  37.478  1.00 8.93  ? 2    THR B N   1 
ATOM   2757  C CA  . THR B 1 3   ? 2.180   28.930  38.560  1.00 10.17 ? 2    THR B CA  1 
ATOM   2758  C C   . THR B 1 3   ? 1.340   30.141  38.901  1.00 10.38 ? 2    THR B C   1 
ATOM   2759  O O   . THR B 1 3   ? 1.500   30.725  39.990  1.00 10.83 ? 2    THR B O   1 
ATOM   2760  C CB  . THR B 1 3   ? 3.673   29.322  38.215  1.00 10.38 ? 2    THR B CB  1 
ATOM   2761  O OG1 . THR B 1 3   ? 3.575   30.301  37.145  1.00 10.39 ? 2    THR B OG1 1 
ATOM   2762  C CG2 . THR B 1 3   ? 4.589   28.145  37.879  1.00 8.68  ? 2    THR B CG2 1 
ATOM   2763  N N   . TYR B 1 4   ? 0.504   30.583  37.977  1.00 11.03 ? 3    TYR B N   1 
ATOM   2764  C CA  . TYR B 1 4   ? -0.381  31.739  38.186  1.00 11.27 ? 3    TYR B CA  1 
ATOM   2765  C C   . TYR B 1 4   ? -1.756  31.201  38.616  1.00 11.90 ? 3    TYR B C   1 
ATOM   2766  O O   . TYR B 1 4   ? -2.506  30.656  37.784  1.00 11.86 ? 3    TYR B O   1 
ATOM   2767  C CB  . TYR B 1 4   ? -0.508  32.603  36.937  1.00 10.82 ? 3    TYR B CB  1 
ATOM   2768  C CG  . TYR B 1 4   ? 0.665   33.429  36.486  1.00 9.49  ? 3    TYR B CG  1 
ATOM   2769  C CD1 . TYR B 1 4   ? 0.990   34.638  37.102  1.00 9.67  ? 3    TYR B CD1 1 
ATOM   2770  C CD2 . TYR B 1 4   ? 1.427   33.034  35.381  1.00 9.94  ? 3    TYR B CD2 1 
ATOM   2771  C CE1 . TYR B 1 4   ? 2.058   35.423  36.673  1.00 9.30  ? 3    TYR B CE1 1 
ATOM   2772  C CE2 . TYR B 1 4   ? 2.493   33.803  34.930  1.00 8.09  ? 3    TYR B CE2 1 
ATOM   2773  C CZ  . TYR B 1 4   ? 2.799   34.997  35.573  1.00 9.01  ? 3    TYR B CZ  1 
ATOM   2774  O OH  . TYR B 1 4   ? 3.848   35.736  35.083  1.00 8.60  ? 3    TYR B OH  1 
ATOM   2775  N N   . PHE B 1 5   ? -2.023  31.363  39.902  1.00 11.54 ? 4    PHE B N   1 
ATOM   2776  C CA  . PHE B 1 5   ? -3.286  30.885  40.506  1.00 11.46 ? 4    PHE B CA  1 
ATOM   2777  C C   . PHE B 1 5   ? -3.562  31.728  41.762  1.00 12.05 ? 4    PHE B C   1 
ATOM   2778  O O   . PHE B 1 5   ? -2.661  32.465  42.207  1.00 12.06 ? 4    PHE B O   1 
ATOM   2779  C CB  . PHE B 1 5   ? -3.279  29.402  40.805  1.00 9.70  ? 4    PHE B CB  1 
ATOM   2780  C CG  . PHE B 1 5   ? -2.259  28.895  41.789  1.00 10.95 ? 4    PHE B CG  1 
ATOM   2781  C CD1 . PHE B 1 5   ? -0.953  28.638  41.395  1.00 10.03 ? 4    PHE B CD1 1 
ATOM   2782  C CD2 . PHE B 1 5   ? -2.624  28.701  43.125  1.00 10.60 ? 4    PHE B CD2 1 
ATOM   2783  C CE1 . PHE B 1 5   ? 0.004   28.159  42.303  1.00 12.52 ? 4    PHE B CE1 1 
ATOM   2784  C CE2 . PHE B 1 5   ? -1.700  28.208  44.053  1.00 10.69 ? 4    PHE B CE2 1 
ATOM   2785  C CZ  . PHE B 1 5   ? -0.388  27.943  43.638  1.00 11.06 ? 4    PHE B CZ  1 
ATOM   2786  N N   . ASN B 1 6   ? -4.763  31.541  42.284  1.00 12.42 ? 5    ASN B N   1 
ATOM   2787  C CA  . ASN B 1 6   ? -5.188  32.297  43.493  1.00 12.94 ? 5    ASN B CA  1 
ATOM   2788  C C   . ASN B 1 6   ? -5.241  31.368  44.708  1.00 12.62 ? 5    ASN B C   1 
ATOM   2789  O O   . ASN B 1 6   ? -5.875  30.298  44.657  1.00 12.36 ? 5    ASN B O   1 
ATOM   2790  C CB  . ASN B 1 6   ? -6.532  32.965  43.229  1.00 15.63 ? 5    ASN B CB  1 
ATOM   2791  C CG  . ASN B 1 6   ? -6.506  33.979  42.109  1.00 18.12 ? 5    ASN B CG  1 
ATOM   2792  O OD1 . ASN B 1 6   ? -5.664  34.881  42.111  1.00 19.60 ? 5    ASN B OD1 1 
ATOM   2793  N ND2 . ASN B 1 6   ? -7.414  33.831  41.145  1.00 20.10 ? 5    ASN B ND2 1 
ATOM   2794  N N   . TYR B 1 7   ? -4.551  31.798  45.763  1.00 12.44 ? 6    TYR B N   1 
ATOM   2795  C CA  . TYR B 1 7   ? -4.684  31.111  47.076  1.00 12.06 ? 6    TYR B CA  1 
ATOM   2796  C C   . TYR B 1 7   ? -6.066  31.506  47.616  1.00 11.50 ? 6    TYR B C   1 
ATOM   2797  O O   . TYR B 1 7   ? -6.544  32.604  47.277  1.00 11.00 ? 6    TYR B O   1 
ATOM   2798  C CB  . TYR B 1 7   ? -3.614  31.599  48.048  1.00 12.91 ? 6    TYR B CB  1 
ATOM   2799  C CG  . TYR B 1 7   ? -2.203  31.121  47.838  1.00 13.22 ? 6    TYR B CG  1 
ATOM   2800  C CD1 . TYR B 1 7   ? -1.929  29.780  47.562  1.00 13.44 ? 6    TYR B CD1 1 
ATOM   2801  C CD2 . TYR B 1 7   ? -1.121  32.013  47.935  1.00 12.72 ? 6    TYR B CD2 1 
ATOM   2802  C CE1 . TYR B 1 7   ? -0.624  29.333  47.374  1.00 15.01 ? 6    TYR B CE1 1 
ATOM   2803  C CE2 . TYR B 1 7   ? 0.180   31.572  47.750  1.00 13.26 ? 6    TYR B CE2 1 
ATOM   2804  C CZ  . TYR B 1 7   ? 0.425   30.243  47.486  1.00 15.03 ? 6    TYR B CZ  1 
ATOM   2805  O OH  . TYR B 1 7   ? 1.695   29.750  47.319  1.00 17.69 ? 6    TYR B OH  1 
ATOM   2806  N N   . PRO B 1 8   ? -6.651  30.627  48.408  1.00 11.65 ? 7    PRO B N   1 
ATOM   2807  C CA  . PRO B 1 8   ? -7.927  30.940  49.062  1.00 11.69 ? 7    PRO B CA  1 
ATOM   2808  C C   . PRO B 1 8   ? -7.750  32.194  49.924  1.00 11.61 ? 7    PRO B C   1 
ATOM   2809  O O   . PRO B 1 8   ? -6.631  32.472  50.395  1.00 11.21 ? 7    PRO B O   1 
ATOM   2810  C CB  . PRO B 1 8   ? -8.265  29.722  49.868  1.00 11.72 ? 7    PRO B CB  1 
ATOM   2811  C CG  . PRO B 1 8   ? -7.242  28.676  49.590  1.00 12.09 ? 7    PRO B CG  1 
ATOM   2812  C CD  . PRO B 1 8   ? -6.136  29.305  48.785  1.00 11.55 ? 7    PRO B CD  1 
ATOM   2813  N N   . SER B 1 9   ? -8.852  32.893  50.138  1.00 11.67 ? 8    SER B N   1 
ATOM   2814  C CA  . SER B 1 9   ? -8.838  34.116  50.976  1.00 11.85 ? 8    SER B CA  1 
ATOM   2815  C C   . SER B 1 9   ? -8.378  33.705  52.388  1.00 11.66 ? 8    SER B C   1 
ATOM   2816  O O   . SER B 1 9   ? -8.553  32.541  52.777  1.00 11.15 ? 8    SER B O   1 
ATOM   2817  C CB  . SER B 1 9   ? -10.222 34.762  51.049  1.00 11.36 ? 8    SER B CB  1 
ATOM   2818  O OG  . SER B 1 9   ? -11.069 33.895  51.823  1.00 12.02 ? 8    SER B OG  1 
ATOM   2819  N N   . LYS B 1 10  ? -7.815  34.673  53.082  1.00 11.88 ? 9    LYS B N   1 
ATOM   2820  C CA  . LYS B 1 10  ? -7.355  34.444  54.465  1.00 12.79 ? 9    LYS B CA  1 
ATOM   2821  C C   . LYS B 1 10  ? -8.512  33.921  55.312  1.00 12.25 ? 9    LYS B C   1 
ATOM   2822  O O   . LYS B 1 10  ? -8.326  32.936  56.062  1.00 12.07 ? 9    LYS B O   1 
ATOM   2823  C CB  . LYS B 1 10  ? -6.727  35.678  55.083  1.00 13.69 ? 9    LYS B CB  1 
ATOM   2824  C CG  . LYS B 1 10  ? -6.302  35.465  56.548  1.00 15.00 ? 9    LYS B CG  1 
ATOM   2825  C CD  . LYS B 1 10  ? -5.945  36.784  57.208  1.00 18.54 ? 9    LYS B CD  1 
ATOM   2826  C CE  . LYS B 1 10  ? -5.894  36.629  58.733  1.00 19.64 ? 9    LYS B CE  1 
ATOM   2827  N NZ  . LYS B 1 10  ? -5.131  35.379  59.061  1.00 22.65 ? 9    LYS B NZ  1 
ATOM   2828  N N   . GLU B 1 11  ? -9.673  34.527  55.166  1.00 12.03 ? 10   GLU B N   1 
ATOM   2829  C CA  . GLU B 1 11  ? -10.857 34.097  55.937  1.00 12.93 ? 10   GLU B CA  1 
ATOM   2830  C C   . GLU B 1 11  ? -11.163 32.629  55.741  1.00 12.22 ? 10   GLU B C   1 
ATOM   2831  O O   . GLU B 1 11  ? -11.449 31.895  56.722  1.00 12.44 ? 10   GLU B O   1 
ATOM   2832  C CB  . GLU B 1 11  ? -12.109 34.902  55.603  1.00 14.91 ? 10   GLU B CB  1 
ATOM   2833  C CG  . GLU B 1 11  ? -12.071 36.393  55.944  1.00 19.72 ? 10   GLU B CG  1 
ATOM   2834  C CD  . GLU B 1 11  ? -11.338 37.277  54.978  1.00 21.28 ? 10   GLU B CD  1 
ATOM   2835  O OE1 . GLU B 1 11  ? -10.774 36.895  53.965  1.00 22.85 ? 10   GLU B OE1 1 
ATOM   2836  O OE2 . GLU B 1 11  ? -11.347 38.472  55.340  1.00 23.20 ? 10   GLU B OE2 1 
ATOM   2837  N N   . LEU B 1 12  ? -11.095 32.174  54.493  1.00 10.92 ? 11   LEU B N   1 
ATOM   2838  C CA  . LEU B 1 12  ? -11.375 30.777  54.164  1.00 9.97  ? 11   LEU B CA  1 
ATOM   2839  C C   . LEU B 1 12  ? -10.300 29.843  54.666  1.00 9.51  ? 11   LEU B C   1 
ATOM   2840  O O   . LEU B 1 12  ? -10.607 28.756  55.180  1.00 8.44  ? 11   LEU B O   1 
ATOM   2841  C CB  . LEU B 1 12  ? -11.663 30.683  52.652  1.00 11.20 ? 11   LEU B CB  1 
ATOM   2842  C CG  . LEU B 1 12  ? -12.022 29.298  52.125  1.00 10.94 ? 11   LEU B CG  1 
ATOM   2843  C CD1 . LEU B 1 12  ? -13.291 28.781  52.791  1.00 12.03 ? 11   LEU B CD1 1 
ATOM   2844  C CD2 . LEU B 1 12  ? -12.246 29.402  50.611  1.00 12.40 ? 11   LEU B CD2 1 
ATOM   2845  N N   . GLN B 1 13  ? -9.031  30.232  54.514  1.00 9.77  ? 12   GLN B N   1 
ATOM   2846  C CA  . GLN B 1 13  ? -7.921  29.378  54.972  1.00 10.03 ? 12   GLN B CA  1 
ATOM   2847  C C   . GLN B 1 13  ? -8.069  29.090  56.485  1.00 9.77  ? 12   GLN B C   1 
ATOM   2848  O O   . GLN B 1 13  ? -7.932  27.947  56.937  1.00 9.67  ? 12   GLN B O   1 
ATOM   2849  C CB  . GLN B 1 13  ? -6.559  30.010  54.715  1.00 10.25 ? 12   GLN B CB  1 
ATOM   2850  C CG  . GLN B 1 13  ? -6.191  30.291  53.277  1.00 11.67 ? 12   GLN B CG  1 
ATOM   2851  C CD  . GLN B 1 13  ? -4.821  30.929  53.157  1.00 13.46 ? 12   GLN B CD  1 
ATOM   2852  O OE1 . GLN B 1 13  ? -3.960  30.700  54.007  1.00 13.73 ? 12   GLN B OE1 1 
ATOM   2853  N NE2 . GLN B 1 13  ? -4.631  31.708  52.096  1.00 14.14 ? 12   GLN B NE2 1 
ATOM   2854  N N   . ASP B 1 14  ? -8.310  30.156  57.208  1.00 9.96  ? 13   ASP B N   1 
ATOM   2855  C CA  . ASP B 1 14  ? -8.432  30.104  58.678  1.00 11.19 ? 13   ASP B CA  1 
ATOM   2856  C C   . ASP B 1 14  ? -9.564  29.162  59.082  1.00 10.39 ? 13   ASP B C   1 
ATOM   2857  O O   . ASP B 1 14  ? -9.364  28.298  59.957  1.00 11.42 ? 13   ASP B O   1 
ATOM   2858  C CB  . ASP B 1 14  ? -8.550  31.493  59.277  1.00 12.08 ? 13   ASP B CB  1 
ATOM   2859  C CG  . ASP B 1 14  ? -7.282  32.319  59.219  1.00 14.03 ? 13   ASP B CG  1 
ATOM   2860  O OD1 . ASP B 1 14  ? -6.208  31.756  58.951  1.00 14.83 ? 13   ASP B OD1 1 
ATOM   2861  O OD2 . ASP B 1 14  ? -7.354  33.542  59.402  1.00 15.18 ? 13   ASP B OD2 1 
ATOM   2862  N N   . GLU B 1 15  ? -10.715 29.347  58.443  1.00 10.47 ? 14   GLU B N   1 
ATOM   2863  C CA  . GLU B 1 15  ? -11.875 28.527  58.756  1.00 9.82  ? 14   GLU B CA  1 
ATOM   2864  C C   . GLU B 1 15  ? -11.586 27.065  58.513  1.00 8.65  ? 14   GLU B C   1 
ATOM   2865  O O   . GLU B 1 15  ? -11.852 26.249  59.430  1.00 8.36  ? 14   GLU B O   1 
ATOM   2866  C CB  . GLU B 1 15  ? -13.192 28.899  58.076  1.00 12.23 ? 14   GLU B CB  1 
ATOM   2867  C CG  . GLU B 1 15  ? -14.362 27.951  58.381  1.00 12.15 ? 14   GLU B CG  1 
ATOM   2868  C CD  . GLU B 1 15  ? -15.692 28.402  57.854  1.00 14.85 ? 14   GLU B CD  1 
ATOM   2869  O OE1 . GLU B 1 15  ? -15.767 29.298  57.028  1.00 16.59 ? 14   GLU B OE1 1 
ATOM   2870  O OE2 . GLU B 1 15  ? -16.670 27.788  58.330  1.00 15.06 ? 14   GLU B OE2 1 
ATOM   2871  N N   . LEU B 1 16  ? -11.057 26.729  57.333  1.00 7.93  ? 15   LEU B N   1 
ATOM   2872  C CA  . LEU B 1 16  ? -10.762 25.339  57.000  1.00 7.43  ? 15   LEU B CA  1 
ATOM   2873  C C   . LEU B 1 16  ? -9.694  24.732  57.923  1.00 7.65  ? 15   LEU B C   1 
ATOM   2874  O O   . LEU B 1 16  ? -9.829  23.558  58.317  1.00 7.41  ? 15   LEU B O   1 
ATOM   2875  C CB  . LEU B 1 16  ? -10.375 25.201  55.518  1.00 7.09  ? 15   LEU B CB  1 
ATOM   2876  C CG  . LEU B 1 16  ? -11.402 25.607  54.455  1.00 7.05  ? 15   LEU B CG  1 
ATOM   2877  C CD1 . LEU B 1 16  ? -10.751 25.538  53.069  1.00 7.10  ? 15   LEU B CD1 1 
ATOM   2878  C CD2 . LEU B 1 16  ? -12.593 24.666  54.512  1.00 5.25  ? 15   LEU B CD2 1 
ATOM   2879  N N   . ARG B 1 17  ? -8.649  25.486  58.193  1.00 8.94  ? 16   ARG B N   1 
ATOM   2880  C CA  . ARG B 1 17  ? -7.551  24.982  59.042  1.00 10.72 ? 16   ARG B CA  1 
ATOM   2881  C C   . ARG B 1 17  ? -8.086  24.701  60.458  1.00 11.36 ? 16   ARG B C   1 
ATOM   2882  O O   . ARG B 1 17  ? -7.736  23.670  61.054  1.00 11.72 ? 16   ARG B O   1 
ATOM   2883  C CB  . ARG B 1 17  ? -6.361  25.934  59.117  1.00 11.70 ? 16   ARG B CB  1 
ATOM   2884  C CG  . ARG B 1 17  ? -5.039  25.322  59.566  1.00 13.28 ? 16   ARG B CG  1 
ATOM   2885  C CD  . ARG B 1 17  ? -3.901  26.305  59.486  1.00 16.16 ? 16   ARG B CD  1 
ATOM   2886  N NE  . ARG B 1 17  ? -4.196  27.510  60.247  1.00 17.67 ? 16   ARG B NE  1 
ATOM   2887  C CZ  . ARG B 1 17  ? -4.609  28.655  59.699  1.00 19.87 ? 16   ARG B CZ  1 
ATOM   2888  N NH1 . ARG B 1 17  ? -4.518  28.861  58.380  1.00 19.32 ? 16   ARG B NH1 1 
ATOM   2889  N NH2 . ARG B 1 17  ? -5.043  29.645  60.479  1.00 20.20 ? 16   ARG B NH2 1 
ATOM   2890  N N   . GLU B 1 18  ? -8.913  25.607  60.929  1.00 11.71 ? 17   GLU B N   1 
ATOM   2891  C CA  . GLU B 1 18  ? -9.493  25.485  62.282  1.00 12.71 ? 17   GLU B CA  1 
ATOM   2892  C C   . GLU B 1 18  ? -10.350 24.250  62.409  1.00 11.54 ? 17   GLU B C   1 
ATOM   2893  O O   . GLU B 1 18  ? -10.208 23.503  63.395  1.00 11.16 ? 17   GLU B O   1 
ATOM   2894  C CB  . GLU B 1 18  ? -10.269 26.725  62.692  1.00 18.34 ? 17   GLU B CB  1 
ATOM   2895  C CG  . GLU B 1 18  ? -9.496  27.829  63.409  1.00 25.89 ? 17   GLU B CG  1 
ATOM   2896  C CD  . GLU B 1 18  ? -9.942  29.239  63.180  1.00 28.86 ? 17   GLU B CD  1 
ATOM   2897  O OE1 . GLU B 1 18  ? -10.913 29.559  62.504  1.00 33.13 ? 17   GLU B OE1 1 
ATOM   2898  O OE2 . GLU B 1 18  ? -9.201  30.083  63.741  1.00 31.15 ? 17   GLU B OE2 1 
ATOM   2899  N N   . ILE B 1 19  ? -11.217 23.986  61.430  1.00 10.89 ? 18   ILE B N   1 
ATOM   2900  C CA  . ILE B 1 19  ? -12.038 22.767  61.444  1.00 10.06 ? 18   ILE B CA  1 
ATOM   2901  C C   . ILE B 1 19  ? -11.180 21.517  61.448  1.00 9.73  ? 18   ILE B C   1 
ATOM   2902  O O   . ILE B 1 19  ? -11.385 20.569  62.250  1.00 10.17 ? 18   ILE B O   1 
ATOM   2903  C CB  . ILE B 1 19  ? -13.125 22.756  60.316  1.00 9.89  ? 18   ILE B CB  1 
ATOM   2904  C CG1 . ILE B 1 19  ? -14.194 23.861  60.504  1.00 11.13 ? 18   ILE B CG1 1 
ATOM   2905  C CG2 . ILE B 1 19  ? -13.810 21.361  60.207  1.00 9.56  ? 18   ILE B CG2 1 
ATOM   2906  C CD1 . ILE B 1 19  ? -14.968 24.135  59.159  1.00 13.16 ? 18   ILE B CD1 1 
ATOM   2907  N N   . ALA B 1 20  ? -10.185 21.436  60.555  1.00 8.85  ? 19   ALA B N   1 
ATOM   2908  C CA  . ALA B 1 20  ? -9.352  20.232  60.465  1.00 8.64  ? 19   ALA B CA  1 
ATOM   2909  C C   . ALA B 1 20  ? -8.609  19.968  61.789  1.00 8.20  ? 19   ALA B C   1 
ATOM   2910  O O   . ALA B 1 20  ? -8.531  18.812  62.229  1.00 7.83  ? 19   ALA B O   1 
ATOM   2911  C CB  . ALA B 1 20  ? -8.371  20.305  59.312  1.00 7.91  ? 19   ALA B CB  1 
ATOM   2912  N N   . GLN B 1 21  ? -8.076  21.017  62.347  1.00 9.48  ? 20   GLN B N   1 
ATOM   2913  C CA  . GLN B 1 21  ? -7.315  20.972  63.611  1.00 10.61 ? 20   GLN B CA  1 
ATOM   2914  C C   . GLN B 1 21  ? -8.189  20.392  64.723  1.00 10.36 ? 20   GLN B C   1 
ATOM   2915  O O   . GLN B 1 21  ? -7.716  19.540  65.490  1.00 9.93  ? 20   GLN B O   1 
ATOM   2916  C CB  . GLN B 1 21  ? -6.736  22.336  63.969  1.00 13.74 ? 20   GLN B CB  1 
ATOM   2917  C CG  . GLN B 1 21  ? -5.458  22.634  63.185  1.00 16.42 ? 20   GLN B CG  1 
ATOM   2918  C CD  . GLN B 1 21  ? -4.972  24.045  63.340  1.00 18.20 ? 20   GLN B CD  1 
ATOM   2919  O OE1 . GLN B 1 21  ? -5.671  24.937  63.798  1.00 21.67 ? 20   GLN B OE1 1 
ATOM   2920  N NE2 . GLN B 1 21  ? -3.730  24.284  62.902  1.00 20.17 ? 20   GLN B NE2 1 
ATOM   2921  N N   . LYS B 1 22  ? -9.432  20.836  64.767  1.00 10.06 ? 21   LYS B N   1 
ATOM   2922  C CA  . LYS B 1 22  ? -10.406 20.385  65.763  1.00 10.47 ? 21   LYS B CA  1 
ATOM   2923  C C   . LYS B 1 22  ? -10.725 18.909  65.666  1.00 9.78  ? 21   LYS B C   1 
ATOM   2924  O O   . LYS B 1 22  ? -10.871 18.243  66.710  1.00 9.17  ? 21   LYS B O   1 
ATOM   2925  C CB  . LYS B 1 22  ? -11.699 21.190  65.721  1.00 13.09 ? 21   LYS B CB  1 
ATOM   2926  C CG  . LYS B 1 22  ? -11.588 22.600  66.309  1.00 16.85 ? 21   LYS B CG  1 
ATOM   2927  C CD  . LYS B 1 22  ? -12.897 23.357  66.094  1.00 19.49 ? 21   LYS B CD  1 
ATOM   2928  C CE  . LYS B 1 22  ? -12.857 24.746  66.718  1.00 21.54 ? 21   LYS B CE  1 
ATOM   2929  N NZ  . LYS B 1 22  ? -14.241 25.315  66.716  1.00 22.72 ? 21   LYS B NZ  1 
ATOM   2930  N N   . ILE B 1 23  ? -10.842 18.388  64.452  1.00 9.22  ? 22   ILE B N   1 
ATOM   2931  C CA  . ILE B 1 23  ? -11.161 16.985  64.222  1.00 9.71  ? 22   ILE B CA  1 
ATOM   2932  C C   . ILE B 1 23  ? -10.083 16.045  64.722  1.00 9.31  ? 22   ILE B C   1 
ATOM   2933  O O   . ILE B 1 23  ? -10.359 14.894  65.146  1.00 10.07 ? 22   ILE B O   1 
ATOM   2934  C CB  . ILE B 1 23  ? -11.472 16.752  62.685  1.00 10.55 ? 22   ILE B CB  1 
ATOM   2935  C CG1 . ILE B 1 23  ? -12.734 17.555  62.298  1.00 11.94 ? 22   ILE B CG1 1 
ATOM   2936  C CG2 . ILE B 1 23  ? -11.595 15.253  62.347  1.00 10.19 ? 22   ILE B CG2 1 
ATOM   2937  C CD1 . ILE B 1 23  ? -13.121 17.520  60.791  1.00 12.26 ? 22   ILE B CD1 1 
ATOM   2938  N N   . VAL B 1 24  ? -8.833  16.481  64.652  1.00 9.52  ? 23   VAL B N   1 
ATOM   2939  C CA  . VAL B 1 24  ? -7.715  15.623  65.078  1.00 10.16 ? 23   VAL B CA  1 
ATOM   2940  C C   . VAL B 1 24  ? -7.089  16.089  66.386  1.00 11.27 ? 23   VAL B C   1 
ATOM   2941  O O   . VAL B 1 24  ? -5.901  15.788  66.612  1.00 11.98 ? 23   VAL B O   1 
ATOM   2942  C CB  . VAL B 1 24  ? -6.689  15.456  63.930  1.00 10.33 ? 23   VAL B CB  1 
ATOM   2943  C CG1 . VAL B 1 24  ? -7.348  14.892  62.666  1.00 9.42  ? 23   VAL B CG1 1 
ATOM   2944  C CG2 . VAL B 1 24  ? -5.934  16.738  63.644  1.00 9.34  ? 23   VAL B CG2 1 
ATOM   2945  N N   . ALA B 1 25  ? -7.848  16.809  67.197  1.00 11.87 ? 24   ALA B N   1 
ATOM   2946  C CA  . ALA B 1 25  ? -7.335  17.197  68.541  1.00 12.03 ? 24   ALA B CA  1 
ATOM   2947  C C   . ALA B 1 25  ? -6.894  15.932  69.274  1.00 11.88 ? 24   ALA B C   1 
ATOM   2948  O O   . ALA B 1 25  ? -7.486  14.854  69.125  1.00 10.84 ? 24   ALA B O   1 
ATOM   2949  C CB  . ALA B 1 25  ? -8.425  17.920  69.319  1.00 13.78 ? 24   ALA B CB  1 
ATOM   2950  N N   . PRO B 1 26  ? -5.841  16.089  70.079  1.00 12.44 ? 25   PRO B N   1 
ATOM   2951  C CA  . PRO B 1 26  ? -5.256  14.979  70.829  1.00 12.48 ? 25   PRO B CA  1 
ATOM   2952  C C   . PRO B 1 26  ? -6.309  14.130  71.530  1.00 12.15 ? 25   PRO B C   1 
ATOM   2953  O O   . PRO B 1 26  ? -7.197  14.645  72.235  1.00 12.50 ? 25   PRO B O   1 
ATOM   2954  C CB  . PRO B 1 26  ? -4.314  15.647  71.832  1.00 12.55 ? 25   PRO B CB  1 
ATOM   2955  C CG  . PRO B 1 26  ? -3.996  16.975  71.195  1.00 13.31 ? 25   PRO B CG  1 
ATOM   2956  C CD  . PRO B 1 26  ? -5.335  17.392  70.570  1.00 12.76 ? 25   PRO B CD  1 
ATOM   2957  N N   . GLY B 1 27  ? -6.177  12.847  71.335  1.00 11.79 ? 26   GLY B N   1 
ATOM   2958  C CA  . GLY B 1 27  ? -7.000  11.791  71.875  1.00 12.42 ? 26   GLY B CA  1 
ATOM   2959  C C   . GLY B 1 27  ? -8.397  11.741  71.274  1.00 12.42 ? 26   GLY B C   1 
ATOM   2960  O O   . GLY B 1 27  ? -9.324  11.291  71.960  1.00 13.33 ? 26   GLY B O   1 
ATOM   2961  N N   . LYS B 1 28  ? -8.553  12.196  70.036  1.00 12.29 ? 27   LYS B N   1 
ATOM   2962  C CA  . LYS B 1 28  ? -9.883  12.185  69.388  1.00 11.28 ? 27   LYS B CA  1 
ATOM   2963  C C   . LYS B 1 28  ? -9.812  11.656  67.960  1.00 11.22 ? 27   LYS B C   1 
ATOM   2964  O O   . LYS B 1 28  ? -8.765  11.748  67.291  1.00 11.50 ? 27   LYS B O   1 
ATOM   2965  C CB  . LYS B 1 28  ? -10.498 13.578  69.396  1.00 11.66 ? 27   LYS B CB  1 
ATOM   2966  C CG  . LYS B 1 28  ? -10.767 14.119  70.814  1.00 12.40 ? 27   LYS B CG  1 
ATOM   2967  C CD  . LYS B 1 28  ? -11.493 15.454  70.750  1.00 15.27 ? 27   LYS B CD  1 
ATOM   2968  C CE  . LYS B 1 28  ? -11.840 15.994  72.119  1.00 16.26 ? 27   LYS B CE  1 
ATOM   2969  N NZ  . LYS B 1 28  ? -12.661 17.222  71.988  1.00 19.35 ? 27   LYS B NZ  1 
ATOM   2970  N N   . GLY B 1 29  ? -10.942 11.123  67.521  1.00 10.34 ? 28   GLY B N   1 
ATOM   2971  C CA  . GLY B 1 29  ? -11.045 10.590  66.132  1.00 9.81  ? 28   GLY B CA  1 
ATOM   2972  C C   . GLY B 1 29  ? -12.512 10.685  65.708  1.00 9.41  ? 28   GLY B C   1 
ATOM   2973  O O   . GLY B 1 29  ? -13.364 11.225  66.434  1.00 8.85  ? 28   GLY B O   1 
ATOM   2974  N N   . ILE B 1 30  ? -12.774 10.104  64.557  1.00 9.53  ? 29   ILE B N   1 
ATOM   2975  C CA  . ILE B 1 30  ? -14.104 10.178  63.943  1.00 8.92  ? 29   ILE B CA  1 
ATOM   2976  C C   . ILE B 1 30  ? -14.826 8.847   64.041  1.00 8.06  ? 29   ILE B C   1 
ATOM   2977  O O   . ILE B 1 30  ? -14.243 7.774   63.888  1.00 7.86  ? 29   ILE B O   1 
ATOM   2978  C CB  . ILE B 1 30  ? -13.965 10.616  62.429  1.00 9.00  ? 29   ILE B CB  1 
ATOM   2979  C CG1 . ILE B 1 30  ? -13.305 12.005  62.340  1.00 11.03 ? 29   ILE B CG1 1 
ATOM   2980  C CG2 . ILE B 1 30  ? -15.326 10.576  61.680  1.00 9.56  ? 29   ILE B CG2 1 
ATOM   2981  C CD1 . ILE B 1 30  ? -12.715 12.293  60.917  1.00 12.09 ? 29   ILE B CD1 1 
ATOM   2982  N N   . LEU B 1 31  ? -16.120 8.979   64.307  1.00 8.62  ? 30   LEU B N   1 
ATOM   2983  C CA  . LEU B 1 31  ? -17.062 7.861   64.216  1.00 9.06  ? 30   LEU B CA  1 
ATOM   2984  C C   . LEU B 1 31  ? -17.711 7.940   62.819  1.00 8.89  ? 30   LEU B C   1 
ATOM   2985  O O   . LEU B 1 31  ? -18.395 8.944   62.567  1.00 9.18  ? 30   LEU B O   1 
ATOM   2986  C CB  . LEU B 1 31  ? -18.111 8.064   65.333  1.00 10.84 ? 30   LEU B CB  1 
ATOM   2987  C CG  . LEU B 1 31  ? -19.343 7.171   65.230  1.00 11.96 ? 30   LEU B CG  1 
ATOM   2988  C CD1 . LEU B 1 31  ? -18.958 5.710   65.198  1.00 11.49 ? 30   LEU B CD1 1 
ATOM   2989  C CD2 . LEU B 1 31  ? -20.246 7.451   66.439  1.00 12.03 ? 30   LEU B CD2 1 
ATOM   2990  N N   . ALA B 1 32  ? -17.513 6.938   62.013  1.00 9.12  ? 31   ALA B N   1 
ATOM   2991  C CA  . ALA B 1 32  ? -18.103 6.894   60.652  1.00 9.97  ? 31   ALA B CA  1 
ATOM   2992  C C   . ALA B 1 32  ? -19.451 6.176   60.743  1.00 9.47  ? 31   ALA B C   1 
ATOM   2993  O O   . ALA B 1 32  ? -19.468 4.953   60.888  1.00 10.78 ? 31   ALA B O   1 
ATOM   2994  C CB  . ALA B 1 32  ? -17.152 6.175   59.708  1.00 7.59  ? 31   ALA B CB  1 
ATOM   2995  N N   . ALA B 1 33  ? -20.520 6.934   60.638  1.00 10.11 ? 32   ALA B N   1 
ATOM   2996  C CA  . ALA B 1 33  ? -21.885 6.359   60.791  1.00 10.62 ? 32   ALA B CA  1 
ATOM   2997  C C   . ALA B 1 33  ? -22.683 6.605   59.513  1.00 11.85 ? 32   ALA B C   1 
ATOM   2998  O O   . ALA B 1 33  ? -23.902 6.822   59.548  1.00 11.58 ? 32   ALA B O   1 
ATOM   2999  C CB  . ALA B 1 33  ? -22.548 7.046   61.972  1.00 7.69  ? 32   ALA B CB  1 
ATOM   3000  N N   . ASP B 1 34  ? -21.957 6.530   58.395  1.00 13.14 ? 33   ASP B N   1 
ATOM   3001  C CA  . ASP B 1 34  ? -22.517 7.012   57.116  1.00 14.26 ? 33   ASP B CA  1 
ATOM   3002  C C   . ASP B 1 34  ? -23.013 5.881   56.235  1.00 14.84 ? 33   ASP B C   1 
ATOM   3003  O O   . ASP B 1 34  ? -23.051 6.070   55.000  1.00 15.24 ? 33   ASP B O   1 
ATOM   3004  C CB  . ASP B 1 34  ? -21.465 7.926   56.451  1.00 14.94 ? 33   ASP B CB  1 
ATOM   3005  C CG  . ASP B 1 34  ? -20.218 7.138   56.076  1.00 17.84 ? 33   ASP B CG  1 
ATOM   3006  O OD1 . ASP B 1 34  ? -19.694 6.353   56.881  1.00 20.38 ? 33   ASP B OD1 1 
ATOM   3007  O OD2 . ASP B 1 34  ? -19.763 7.302   54.930  1.00 19.35 ? 33   ASP B OD2 1 
ATOM   3008  N N   . GLU B 1 35  ? -23.392 4.761   56.803  1.00 14.81 ? 34   GLU B N   1 
ATOM   3009  C CA  . GLU B 1 35  ? -23.936 3.621   56.055  1.00 15.93 ? 34   GLU B CA  1 
ATOM   3010  C C   . GLU B 1 35  ? -25.270 3.993   55.409  1.00 16.67 ? 34   GLU B C   1 
ATOM   3011  O O   . GLU B 1 35  ? -26.145 4.604   56.041  1.00 16.55 ? 34   GLU B O   1 
ATOM   3012  C CB  . GLU B 1 35  ? -24.177 2.394   56.923  1.00 16.16 ? 34   GLU B CB  1 
ATOM   3013  C CG  . GLU B 1 35  ? -23.041 1.827   57.743  1.00 17.38 ? 34   GLU B CG  1 
ATOM   3014  C CD  . GLU B 1 35  ? -22.666 2.513   59.021  1.00 16.51 ? 34   GLU B CD  1 
ATOM   3015  O OE1 . GLU B 1 35  ? -23.332 3.516   59.299  1.00 14.69 ? 34   GLU B OE1 1 
ATOM   3016  O OE2 . GLU B 1 35  ? -21.774 2.118   59.756  1.00 18.54 ? 34   GLU B OE2 1 
ATOM   3017  N N   . SER B 1 36  ? -25.395 3.641   54.139  1.00 17.65 ? 35   SER B N   1 
ATOM   3018  C CA  . SER B 1 36  ? -26.628 3.903   53.367  1.00 18.46 ? 35   SER B CA  1 
ATOM   3019  C C   . SER B 1 36  ? -27.683 2.875   53.792  1.00 19.34 ? 35   SER B C   1 
ATOM   3020  O O   . SER B 1 36  ? -27.343 1.896   54.463  1.00 18.85 ? 35   SER B O   1 
ATOM   3021  C CB  . SER B 1 36  ? -26.364 3.755   51.868  1.00 18.00 ? 35   SER B CB  1 
ATOM   3022  O OG  . SER B 1 36  ? -26.090 2.390   51.568  1.00 19.08 ? 35   SER B OG  1 
ATOM   3023  N N   . GLY B 1 37  ? -28.913 3.115   53.368  1.00 20.61 ? 36   GLY B N   1 
ATOM   3024  C CA  . GLY B 1 37  ? -30.034 2.220   53.645  1.00 21.47 ? 36   GLY B CA  1 
ATOM   3025  C C   . GLY B 1 37  ? -29.658 0.758   53.485  1.00 22.32 ? 36   GLY B C   1 
ATOM   3026  O O   . GLY B 1 37  ? -29.846 -0.057  54.410  1.00 22.68 ? 36   GLY B O   1 
ATOM   3027  N N   . PRO B 1 38  ? -29.152 0.418   52.291  1.00 22.82 ? 37   PRO B N   1 
ATOM   3028  C CA  . PRO B 1 38  ? -28.795 -0.953  51.965  1.00 23.09 ? 37   PRO B CA  1 
ATOM   3029  C C   . PRO B 1 38  ? -27.729 -1.565  52.865  1.00 23.51 ? 37   PRO B C   1 
ATOM   3030  O O   . PRO B 1 38  ? -27.864 -2.723  53.312  1.00 23.23 ? 37   PRO B O   1 
ATOM   3031  C CB  . PRO B 1 38  ? -28.333 -0.912  50.513  1.00 23.43 ? 37   PRO B CB  1 
ATOM   3032  C CG  . PRO B 1 38  ? -28.729 0.416   49.965  1.00 23.28 ? 37   PRO B CG  1 
ATOM   3033  C CD  . PRO B 1 38  ? -29.430 1.184   51.053  1.00 22.97 ? 37   PRO B CD  1 
ATOM   3034  N N   . THR B 1 39  ? -26.666 -0.814  53.090  1.00 23.53 ? 38   THR B N   1 
ATOM   3035  C CA  . THR B 1 39  ? -25.524 -1.286  53.875  1.00 24.51 ? 38   THR B CA  1 
ATOM   3036  C C   . THR B 1 39  ? -25.906 -1.480  55.340  1.00 24.69 ? 38   THR B C   1 
ATOM   3037  O O   . THR B 1 39  ? -25.562 -2.509  55.941  1.00 24.09 ? 38   THR B O   1 
ATOM   3038  C CB  . THR B 1 39  ? -24.274 -0.344  53.694  1.00 25.89 ? 38   THR B CB  1 
ATOM   3039  O OG1 . THR B 1 39  ? -23.954 -0.386  52.263  1.00 27.78 ? 38   THR B OG1 1 
ATOM   3040  C CG2 . THR B 1 39  ? -23.062 -0.735  54.548  1.00 26.47 ? 38   THR B CG2 1 
ATOM   3041  N N   . MET B 1 40  ? -26.593 -0.485  55.865  1.00 25.19 ? 39   MET B N   1 
ATOM   3042  C CA  . MET B 1 40  ? -27.103 -0.493  57.250  1.00 26.24 ? 39   MET B CA  1 
ATOM   3043  C C   . MET B 1 40  ? -28.013 -1.702  57.409  1.00 27.27 ? 39   MET B C   1 
ATOM   3044  O O   . MET B 1 40  ? -27.989 -2.401  58.435  1.00 27.26 ? 39   MET B O   1 
ATOM   3045  C CB  . MET B 1 40  ? -27.760 0.833   57.573  1.00 25.57 ? 39   MET B CB  1 
ATOM   3046  C CG  . MET B 1 40  ? -28.134 0.972   59.020  1.00 25.72 ? 39   MET B CG  1 
ATOM   3047  S SD  . MET B 1 40  ? -26.586 1.088   59.999  1.00 24.69 ? 39   MET B SD  1 
ATOM   3048  C CE  . MET B 1 40  ? -26.857 -0.291  61.125  1.00 24.27 ? 39   MET B CE  1 
ATOM   3049  N N   . GLY B 1 41  ? -28.770 -1.973  56.360  1.00 28.29 ? 40   GLY B N   1 
ATOM   3050  C CA  . GLY B 1 41  ? -29.711 -3.101  56.299  1.00 29.10 ? 40   GLY B CA  1 
ATOM   3051  C C   . GLY B 1 41  ? -28.989 -4.421  56.521  1.00 30.12 ? 40   GLY B C   1 
ATOM   3052  O O   . GLY B 1 41  ? -29.506 -5.334  57.199  1.00 30.19 ? 40   GLY B O   1 
ATOM   3053  N N   . LYS B 1 42  ? -27.802 -4.519  55.958  1.00 31.10 ? 41   LYS B N   1 
ATOM   3054  C CA  . LYS B 1 42  ? -26.974 -5.730  56.087  1.00 32.50 ? 41   LYS B CA  1 
ATOM   3055  C C   . LYS B 1 42  ? -26.541 -5.921  57.541  1.00 32.88 ? 41   LYS B C   1 
ATOM   3056  O O   . LYS B 1 42  ? -26.415 -7.063  58.027  1.00 32.81 ? 41   LYS B O   1 
ATOM   3057  C CB  . LYS B 1 42  ? -25.746 -5.671  55.194  1.00 35.56 ? 41   LYS B CB  1 
ATOM   3058  C CG  . LYS B 1 42  ? -26.017 -5.603  53.692  1.00 38.40 ? 41   LYS B CG  1 
ATOM   3059  C CD  . LYS B 1 42  ? -24.715 -5.736  52.894  1.00 40.23 ? 41   LYS B CD  1 
ATOM   3060  C CE  . LYS B 1 42  ? -24.017 -7.052  53.185  1.00 41.76 ? 41   LYS B CE  1 
ATOM   3061  N NZ  . LYS B 1 42  ? -22.759 -7.195  52.403  1.00 41.97 ? 41   LYS B NZ  1 
ATOM   3062  N N   . ARG B 1 43  ? -26.319 -4.807  58.214  1.00 32.95 ? 42   ARG B N   1 
ATOM   3063  C CA  . ARG B 1 43  ? -25.854 -4.787  59.608  1.00 33.00 ? 42   ARG B CA  1 
ATOM   3064  C C   . ARG B 1 43  ? -26.972 -5.183  60.567  1.00 32.79 ? 42   ARG B C   1 
ATOM   3065  O O   . ARG B 1 43  ? -26.736 -5.893  61.555  1.00 32.48 ? 42   ARG B O   1 
ATOM   3066  C CB  . ARG B 1 43  ? -25.295 -3.420  59.993  1.00 34.35 ? 42   ARG B CB  1 
ATOM   3067  C CG  . ARG B 1 43  ? -24.099 -2.969  59.173  1.00 36.32 ? 42   ARG B CG  1 
ATOM   3068  C CD  . ARG B 1 43  ? -22.933 -3.894  59.375  1.00 38.34 ? 42   ARG B CD  1 
ATOM   3069  N NE  . ARG B 1 43  ? -22.391 -4.250  58.062  1.00 40.88 ? 42   ARG B NE  1 
ATOM   3070  C CZ  . ARG B 1 43  ? -21.708 -3.381  57.311  1.00 41.83 ? 42   ARG B CZ  1 
ATOM   3071  N NH1 . ARG B 1 43  ? -21.409 -2.157  57.736  1.00 42.33 ? 42   ARG B NH1 1 
ATOM   3072  N NH2 . ARG B 1 43  ? -21.381 -3.746  56.069  1.00 42.35 ? 42   ARG B NH2 1 
ATOM   3073  N N   . LEU B 1 44  ? -28.159 -4.704  60.250  1.00 32.57 ? 43   LEU B N   1 
ATOM   3074  C CA  . LEU B 1 44  ? -29.371 -4.980  61.020  1.00 32.74 ? 43   LEU B CA  1 
ATOM   3075  C C   . LEU B 1 44  ? -29.811 -6.434  60.901  1.00 33.51 ? 43   LEU B C   1 
ATOM   3076  O O   . LEU B 1 44  ? -30.114 -7.098  61.909  1.00 33.25 ? 43   LEU B O   1 
ATOM   3077  C CB  . LEU B 1 44  ? -30.430 -3.960  60.587  1.00 31.08 ? 43   LEU B CB  1 
ATOM   3078  C CG  . LEU B 1 44  ? -30.180 -2.509  60.965  1.00 30.77 ? 43   LEU B CG  1 
ATOM   3079  C CD1 . LEU B 1 44  ? -31.326 -1.618  60.506  1.00 30.21 ? 43   LEU B CD1 1 
ATOM   3080  C CD2 . LEU B 1 44  ? -30.034 -2.424  62.491  1.00 29.96 ? 43   LEU B CD2 1 
ATOM   3081  N N   . GLN B 1 45  ? -29.868 -6.914  59.673  1.00 34.46 ? 44   GLN B N   1 
ATOM   3082  C CA  . GLN B 1 45  ? -30.298 -8.295  59.388  1.00 35.71 ? 44   GLN B CA  1 
ATOM   3083  C C   . GLN B 1 45  ? -29.496 -9.274  60.250  1.00 35.96 ? 44   GLN B C   1 
ATOM   3084  O O   . GLN B 1 45  ? -29.978 -10.281 60.777  1.00 36.17 ? 44   GLN B O   1 
ATOM   3085  C CB  . GLN B 1 45  ? -30.128 -8.625  57.908  1.00 38.14 ? 44   GLN B CB  1 
ATOM   3086  C CG  . GLN B 1 45  ? -30.495 -10.057 57.562  1.00 41.25 ? 44   GLN B CG  1 
ATOM   3087  C CD  . GLN B 1 45  ? -30.468 -10.295 56.067  1.00 43.20 ? 44   GLN B CD  1 
ATOM   3088  O OE1 . GLN B 1 45  ? -30.457 -9.362  55.263  1.00 45.11 ? 44   GLN B OE1 1 
ATOM   3089  N NE2 . GLN B 1 45  ? -30.458 -11.571 55.699  1.00 44.32 ? 44   GLN B NE2 1 
ATOM   3090  N N   . ASP B 1 46  ? -28.243 -8.928  60.359  1.00 36.11 ? 45   ASP B N   1 
ATOM   3091  C CA  . ASP B 1 46  ? -27.179 -9.645  61.067  1.00 36.38 ? 45   ASP B CA  1 
ATOM   3092  C C   . ASP B 1 46  ? -27.527 -9.854  62.539  1.00 36.09 ? 45   ASP B C   1 
ATOM   3093  O O   . ASP B 1 46  ? -27.017 -10.810 63.166  1.00 35.83 ? 45   ASP B O   1 
ATOM   3094  C CB  . ASP B 1 46  ? -25.895 -8.868  60.798  1.00 38.75 ? 45   ASP B CB  1 
ATOM   3095  C CG  . ASP B 1 46  ? -24.611 -9.612  60.632  1.00 40.54 ? 45   ASP B CG  1 
ATOM   3096  O OD1 . ASP B 1 46  ? -24.520 -10.845 60.743  1.00 42.35 ? 45   ASP B OD1 1 
ATOM   3097  O OD2 . ASP B 1 46  ? -23.604 -8.897  60.381  1.00 41.20 ? 45   ASP B OD2 1 
ATOM   3098  N N   . ILE B 1 47  ? -28.360 -8.986  63.088  1.00 35.57 ? 46   ILE B N   1 
ATOM   3099  C CA  . ILE B 1 47  ? -28.812 -9.086  64.476  1.00 35.34 ? 46   ILE B CA  1 
ATOM   3100  C C   . ILE B 1 47  ? -30.326 -9.255  64.564  1.00 35.54 ? 46   ILE B C   1 
ATOM   3101  O O   . ILE B 1 47  ? -30.951 -8.791  65.536  1.00 35.61 ? 46   ILE B O   1 
ATOM   3102  C CB  . ILE B 1 47  ? -28.339 -7.861  65.344  1.00 33.82 ? 46   ILE B CB  1 
ATOM   3103  C CG1 . ILE B 1 47  ? -28.909 -6.559  64.734  1.00 33.37 ? 46   ILE B CG1 1 
ATOM   3104  C CG2 . ILE B 1 47  ? -26.805 -7.807  65.529  1.00 33.86 ? 46   ILE B CG2 1 
ATOM   3105  C CD1 . ILE B 1 47  ? -28.783 -5.300  65.615  1.00 32.06 ? 46   ILE B CD1 1 
ATOM   3106  N N   . GLY B 1 48  ? -30.892 -9.885  63.555  1.00 35.84 ? 47   GLY B N   1 
ATOM   3107  C CA  . GLY B 1 48  ? -32.312 -10.199 63.486  1.00 35.98 ? 47   GLY B CA  1 
ATOM   3108  C C   . GLY B 1 48  ? -33.222 -9.001  63.326  1.00 36.12 ? 47   GLY B C   1 
ATOM   3109  O O   . GLY B 1 48  ? -34.465 -9.144  63.394  1.00 36.62 ? 47   GLY B O   1 
ATOM   3110  N N   . VAL B 1 49  ? -32.652 -7.835  63.096  1.00 35.87 ? 48   VAL B N   1 
ATOM   3111  C CA  . VAL B 1 49  ? -33.442 -6.604  62.951  1.00 35.79 ? 48   VAL B CA  1 
ATOM   3112  C C   . VAL B 1 49  ? -33.740 -6.281  61.493  1.00 35.83 ? 48   VAL B C   1 
ATOM   3113  O O   . VAL B 1 49  ? -32.868 -6.263  60.611  1.00 36.05 ? 48   VAL B O   1 
ATOM   3114  C CB  . VAL B 1 49  ? -32.756 -5.460  63.722  1.00 35.29 ? 48   VAL B CB  1 
ATOM   3115  C CG1 . VAL B 1 49  ? -33.483 -4.131  63.566  1.00 34.66 ? 48   VAL B CG1 1 
ATOM   3116  C CG2 . VAL B 1 49  ? -32.562 -5.822  65.188  1.00 35.08 ? 48   VAL B CG2 1 
ATOM   3117  N N   . GLU B 1 50  ? -35.012 -6.000  61.264  1.00 35.85 ? 49   GLU B N   1 
ATOM   3118  C CA  . GLU B 1 50  ? -35.541 -5.651  59.950  1.00 35.63 ? 49   GLU B CA  1 
ATOM   3119  C C   . GLU B 1 50  ? -35.104 -4.247  59.555  1.00 34.95 ? 49   GLU B C   1 
ATOM   3120  O O   . GLU B 1 50  ? -35.159 -3.312  60.368  1.00 34.84 ? 49   GLU B O   1 
ATOM   3121  C CB  . GLU B 1 50  ? -37.067 -5.657  59.944  1.00 38.42 ? 49   GLU B CB  1 
ATOM   3122  C CG  . GLU B 1 50  ? -37.785 -5.789  58.597  1.00 41.11 ? 49   GLU B CG  1 
ATOM   3123  C CD  . GLU B 1 50  ? -39.290 -5.763  58.736  1.00 42.26 ? 49   GLU B CD  1 
ATOM   3124  O OE1 . GLU B 1 50  ? -39.881 -6.526  59.484  1.00 43.64 ? 49   GLU B OE1 1 
ATOM   3125  O OE2 . GLU B 1 50  ? -39.819 -4.874  58.041  1.00 42.84 ? 49   GLU B OE2 1 
ATOM   3126  N N   . ASN B 1 51  ? -34.722 -4.122  58.298  1.00 34.00 ? 50   ASN B N   1 
ATOM   3127  C CA  . ASN B 1 51  ? -34.243 -2.855  57.743  1.00 33.08 ? 50   ASN B CA  1 
ATOM   3128  C C   . ASN B 1 51  ? -35.375 -1.914  57.351  1.00 32.53 ? 50   ASN B C   1 
ATOM   3129  O O   . ASN B 1 51  ? -35.799 -1.901  56.180  1.00 32.47 ? 50   ASN B O   1 
ATOM   3130  C CB  . ASN B 1 51  ? -33.256 -3.105  56.588  1.00 32.70 ? 50   ASN B CB  1 
ATOM   3131  C CG  . ASN B 1 51  ? -32.756 -1.768  56.041  1.00 32.74 ? 50   ASN B CG  1 
ATOM   3132  O OD1 . ASN B 1 51  ? -32.743 -0.785  56.798  1.00 32.38 ? 50   ASN B OD1 1 
ATOM   3133  N ND2 . ASN B 1 51  ? -32.368 -1.741  54.777  1.00 32.29 ? 50   ASN B ND2 1 
ATOM   3134  N N   . THR B 1 52  ? -35.818 -1.133  58.312  1.00 31.79 ? 51   THR B N   1 
ATOM   3135  C CA  . THR B 1 52  ? -36.812 -0.075  58.125  1.00 31.18 ? 51   THR B CA  1 
ATOM   3136  C C   . THR B 1 52  ? -36.159 1.269   58.456  1.00 30.86 ? 51   THR B C   1 
ATOM   3137  O O   . THR B 1 52  ? -35.131 1.315   59.151  1.00 30.43 ? 51   THR B O   1 
ATOM   3138  C CB  . THR B 1 52  ? -38.131 -0.305  58.944  1.00 32.29 ? 51   THR B CB  1 
ATOM   3139  O OG1 . THR B 1 52  ? -37.803 -0.075  60.351  1.00 32.35 ? 51   THR B OG1 1 
ATOM   3140  C CG2 . THR B 1 52  ? -38.748 -1.695  58.715  1.00 32.49 ? 51   THR B CG2 1 
ATOM   3141  N N   . GLU B 1 53  ? -36.754 2.325   57.923  1.00 30.38 ? 52   GLU B N   1 
ATOM   3142  C CA  . GLU B 1 53  ? -36.250 3.680   58.144  1.00 29.95 ? 52   GLU B CA  1 
ATOM   3143  C C   . GLU B 1 53  ? -36.243 3.969   59.645  1.00 29.25 ? 52   GLU B C   1 
ATOM   3144  O O   . GLU B 1 53  ? -35.330 4.611   60.180  1.00 28.67 ? 52   GLU B O   1 
ATOM   3145  C CB  . GLU B 1 53  ? -37.073 4.769   57.465  1.00 32.43 ? 52   GLU B CB  1 
ATOM   3146  C CG  . GLU B 1 53  ? -36.540 6.195   57.535  1.00 35.43 ? 52   GLU B CG  1 
ATOM   3147  C CD  . GLU B 1 53  ? -37.465 7.309   57.179  1.00 37.33 ? 52   GLU B CD  1 
ATOM   3148  O OE1 . GLU B 1 53  ? -38.138 7.070   56.150  1.00 38.72 ? 52   GLU B OE1 1 
ATOM   3149  O OE2 . GLU B 1 53  ? -37.556 8.359   57.798  1.00 38.33 ? 52   GLU B OE2 1 
ATOM   3150  N N   . ASP B 1 54  ? -37.291 3.463   60.291  1.00 28.16 ? 53   ASP B N   1 
ATOM   3151  C CA  . ASP B 1 54  ? -37.458 3.717   61.729  1.00 27.27 ? 53   ASP B CA  1 
ATOM   3152  C C   . ASP B 1 54  ? -36.444 2.940   62.569  1.00 25.91 ? 53   ASP B C   1 
ATOM   3153  O O   . ASP B 1 54  ? -36.000 3.453   63.618  1.00 25.18 ? 53   ASP B O   1 
ATOM   3154  C CB  . ASP B 1 54  ? -38.909 3.529   62.180  1.00 29.46 ? 53   ASP B CB  1 
ATOM   3155  C CG  . ASP B 1 54  ? -39.048 4.085   63.604  1.00 30.83 ? 53   ASP B CG  1 
ATOM   3156  O OD1 . ASP B 1 54  ? -39.034 5.328   63.694  1.00 31.45 ? 53   ASP B OD1 1 
ATOM   3157  O OD2 . ASP B 1 54  ? -39.111 3.299   64.555  1.00 32.05 ? 53   ASP B OD2 1 
ATOM   3158  N N   . ASN B 1 55  ? -36.110 1.746   62.115  1.00 24.45 ? 54   ASN B N   1 
ATOM   3159  C CA  . ASN B 1 55  ? -35.095 0.935   62.812  1.00 23.55 ? 54   ASN B CA  1 
ATOM   3160  C C   . ASN B 1 55  ? -33.720 1.590   62.638  1.00 22.55 ? 54   ASN B C   1 
ATOM   3161  O O   . ASN B 1 55  ? -32.909 1.570   63.590  1.00 21.78 ? 54   ASN B O   1 
ATOM   3162  C CB  . ASN B 1 55  ? -35.145 -0.531  62.409  1.00 24.97 ? 54   ASN B CB  1 
ATOM   3163  C CG  . ASN B 1 55  ? -36.228 -1.297  63.166  1.00 25.79 ? 54   ASN B CG  1 
ATOM   3164  O OD1 . ASN B 1 55  ? -36.845 -0.740  64.079  1.00 26.49 ? 54   ASN B OD1 1 
ATOM   3165  N ND2 . ASN B 1 55  ? -36.449 -2.552  62.796  1.00 26.41 ? 54   ASN B ND2 1 
ATOM   3166  N N   . ARG B 1 56  ? -33.486 2.134   61.455  1.00 21.29 ? 55   ARG B N   1 
ATOM   3167  C CA  . ARG B 1 56  ? -32.207 2.821   61.173  1.00 20.09 ? 55   ARG B CA  1 
ATOM   3168  C C   . ARG B 1 56  ? -32.104 4.059   62.056  1.00 19.20 ? 55   ARG B C   1 
ATOM   3169  O O   . ARG B 1 56  ? -31.048 4.342   62.666  1.00 18.00 ? 55   ARG B O   1 
ATOM   3170  C CB  . ARG B 1 56  ? -32.027 3.163   59.699  1.00 20.68 ? 55   ARG B CB  1 
ATOM   3171  C CG  . ARG B 1 56  ? -31.857 1.991   58.748  1.00 21.09 ? 55   ARG B CG  1 
ATOM   3172  C CD  . ARG B 1 56  ? -31.291 2.401   57.429  1.00 21.57 ? 55   ARG B CD  1 
ATOM   3173  N NE  . ARG B 1 56  ? -32.159 3.282   56.672  1.00 21.37 ? 55   ARG B NE  1 
ATOM   3174  C CZ  . ARG B 1 56  ? -33.247 2.913   55.986  1.00 21.83 ? 55   ARG B CZ  1 
ATOM   3175  N NH1 . ARG B 1 56  ? -33.631 1.644   55.956  1.00 21.11 ? 55   ARG B NH1 1 
ATOM   3176  N NH2 . ARG B 1 56  ? -33.985 3.805   55.319  1.00 22.81 ? 55   ARG B NH2 1 
ATOM   3177  N N   . ARG B 1 57  ? -33.213 4.782   62.152  1.00 18.25 ? 56   ARG B N   1 
ATOM   3178  C CA  . ARG B 1 57  ? -33.277 6.000   62.972  1.00 18.21 ? 56   ARG B CA  1 
ATOM   3179  C C   . ARG B 1 57  ? -33.041 5.651   64.445  1.00 17.66 ? 56   ARG B C   1 
ATOM   3180  O O   . ARG B 1 57  ? -32.332 6.388   65.153  1.00 17.72 ? 56   ARG B O   1 
ATOM   3181  C CB  . ARG B 1 57  ? -34.569 6.776   62.789  1.00 19.12 ? 56   ARG B CB  1 
ATOM   3182  C CG  . ARG B 1 57  ? -34.622 8.123   63.493  1.00 21.37 ? 56   ARG B CG  1 
ATOM   3183  C CD  . ARG B 1 57  ? -36.013 8.670   63.546  1.00 24.86 ? 56   ARG B CD  1 
ATOM   3184  N NE  . ARG B 1 57  ? -36.893 7.796   64.332  1.00 26.76 ? 56   ARG B NE  1 
ATOM   3185  C CZ  . ARG B 1 57  ? -36.895 7.789   65.666  1.00 29.14 ? 56   ARG B CZ  1 
ATOM   3186  N NH1 . ARG B 1 57  ? -36.109 8.642   66.328  1.00 29.90 ? 56   ARG B NH1 1 
ATOM   3187  N NH2 . ARG B 1 57  ? -37.678 6.960   66.360  1.00 30.13 ? 56   ARG B NH2 1 
ATOM   3188  N N   . ALA B 1 58  ? -33.604 4.539   64.864  1.00 16.93 ? 57   ALA B N   1 
ATOM   3189  C CA  . ALA B 1 58  ? -33.506 4.046   66.245  1.00 16.19 ? 57   ALA B CA  1 
ATOM   3190  C C   . ALA B 1 58  ? -32.046 3.766   66.611  1.00 15.75 ? 57   ALA B C   1 
ATOM   3191  O O   . ALA B 1 58  ? -31.572 4.177   67.678  1.00 15.79 ? 57   ALA B O   1 
ATOM   3192  C CB  . ALA B 1 58  ? -34.344 2.788   66.413  1.00 15.22 ? 57   ALA B CB  1 
ATOM   3193  N N   . TYR B 1 59  ? -31.395 3.013   65.736  1.00 14.85 ? 58   TYR B N   1 
ATOM   3194  C CA  . TYR B 1 59  ? -29.985 2.684   65.901  1.00 14.43 ? 58   TYR B CA  1 
ATOM   3195  C C   . TYR B 1 59  ? -29.124 3.934   65.990  1.00 14.19 ? 58   TYR B C   1 
ATOM   3196  O O   . TYR B 1 59  ? -28.326 4.046   66.953  1.00 13.77 ? 58   TYR B O   1 
ATOM   3197  C CB  . TYR B 1 59  ? -29.486 1.684   64.841  1.00 13.16 ? 58   TYR B CB  1 
ATOM   3198  C CG  . TYR B 1 59  ? -27.996 1.455   64.996  1.00 12.71 ? 58   TYR B CG  1 
ATOM   3199  C CD1 . TYR B 1 59  ? -27.479 0.796   66.106  1.00 11.92 ? 58   TYR B CD1 1 
ATOM   3200  C CD2 . TYR B 1 59  ? -27.110 1.957   64.030  1.00 12.67 ? 58   TYR B CD2 1 
ATOM   3201  C CE1 . TYR B 1 59  ? -26.104 0.623   66.262  1.00 12.33 ? 58   TYR B CE1 1 
ATOM   3202  C CE2 . TYR B 1 59  ? -25.743 1.769   64.160  1.00 13.18 ? 58   TYR B CE2 1 
ATOM   3203  C CZ  . TYR B 1 59  ? -25.242 1.110   65.285  1.00 12.99 ? 58   TYR B CZ  1 
ATOM   3204  O OH  . TYR B 1 59  ? -23.905 0.916   65.430  1.00 12.97 ? 58   TYR B OH  1 
ATOM   3205  N N   . ARG B 1 60  ? -29.281 4.861   65.055  1.00 13.50 ? 59   ARG B N   1 
ATOM   3206  C CA  . ARG B 1 60  ? -28.558 6.138   65.097  1.00 13.36 ? 59   ARG B CA  1 
ATOM   3207  C C   . ARG B 1 60  ? -28.868 6.921   66.365  1.00 13.56 ? 59   ARG B C   1 
ATOM   3208  O O   . ARG B 1 60  ? -27.975 7.591   66.940  1.00 13.02 ? 59   ARG B O   1 
ATOM   3209  C CB  . ARG B 1 60  ? -28.774 6.985   63.840  1.00 14.52 ? 59   ARG B CB  1 
ATOM   3210  C CG  . ARG B 1 60  ? -27.777 6.690   62.719  1.00 14.30 ? 59   ARG B CG  1 
ATOM   3211  C CD  . ARG B 1 60  ? -27.846 5.268   62.291  1.00 15.18 ? 59   ARG B CD  1 
ATOM   3212  N NE  . ARG B 1 60  ? -26.929 4.967   61.208  1.00 15.79 ? 59   ARG B NE  1 
ATOM   3213  C CZ  . ARG B 1 60  ? -27.211 5.012   59.902  1.00 16.38 ? 59   ARG B CZ  1 
ATOM   3214  N NH1 . ARG B 1 60  ? -28.416 5.326   59.449  1.00 15.86 ? 59   ARG B NH1 1 
ATOM   3215  N NH2 . ARG B 1 60  ? -26.250 4.730   59.014  1.00 14.47 ? 59   ARG B NH2 1 
ATOM   3216  N N   . GLN B 1 61  ? -30.111 6.827   66.819  1.00 12.93 ? 60   GLN B N   1 
ATOM   3217  C CA  . GLN B 1 61  ? -30.506 7.517   68.069  1.00 13.18 ? 60   GLN B CA  1 
ATOM   3218  C C   . GLN B 1 61  ? -29.677 7.010   69.253  1.00 11.89 ? 60   GLN B C   1 
ATOM   3219  O O   . GLN B 1 61  ? -29.277 7.842   70.083  1.00 12.17 ? 60   GLN B O   1 
ATOM   3220  C CB  . GLN B 1 61  ? -32.000 7.394   68.348  1.00 13.98 ? 60   GLN B CB  1 
ATOM   3221  C CG  . GLN B 1 61  ? -32.451 8.291   69.513  1.00 17.23 ? 60   GLN B CG  1 
ATOM   3222  C CD  . GLN B 1 61  ? -33.963 8.159   69.674  1.00 18.04 ? 60   GLN B CD  1 
ATOM   3223  O OE1 . GLN B 1 61  ? -34.736 8.904   69.107  1.00 19.27 ? 60   GLN B OE1 1 
ATOM   3224  N NE2 . GLN B 1 61  ? -34.340 7.138   70.433  1.00 20.52 ? 60   GLN B NE2 1 
ATOM   3225  N N   . LEU B 1 62  ? -29.444 5.723   69.318  1.00 12.19 ? 61   LEU B N   1 
ATOM   3226  C CA  . LEU B 1 62  ? -28.628 5.057   70.347  1.00 12.37 ? 61   LEU B CA  1 
ATOM   3227  C C   . LEU B 1 62  ? -27.221 5.656   70.358  1.00 13.25 ? 61   LEU B C   1 
ATOM   3228  O O   . LEU B 1 62  ? -26.687 6.072   71.411  1.00 12.71 ? 61   LEU B O   1 
ATOM   3229  C CB  . LEU B 1 62  ? -28.673 3.555   70.085  1.00 12.01 ? 61   LEU B CB  1 
ATOM   3230  C CG  . LEU B 1 62  ? -27.878 2.594   70.954  1.00 13.35 ? 61   LEU B CG  1 
ATOM   3231  C CD1 . LEU B 1 62  ? -28.384 1.154   70.777  1.00 12.99 ? 61   LEU B CD1 1 
ATOM   3232  C CD2 . LEU B 1 62  ? -26.399 2.611   70.539  1.00 13.35 ? 61   LEU B CD2 1 
ATOM   3233  N N   . LEU B 1 63  ? -26.631 5.683   69.166  1.00 13.08 ? 62   LEU B N   1 
ATOM   3234  C CA  . LEU B 1 63  ? -25.298 6.223   68.939  1.00 13.96 ? 62   LEU B CA  1 
ATOM   3235  C C   . LEU B 1 63  ? -25.190 7.675   69.398  1.00 14.28 ? 62   LEU B C   1 
ATOM   3236  O O   . LEU B 1 63  ? -24.204 8.036   70.055  1.00 15.12 ? 62   LEU B O   1 
ATOM   3237  C CB  . LEU B 1 63  ? -24.888 6.085   67.462  1.00 12.80 ? 62   LEU B CB  1 
ATOM   3238  C CG  . LEU B 1 63  ? -24.739 4.756   66.804  1.00 11.82 ? 62   LEU B CG  1 
ATOM   3239  C CD1 . LEU B 1 63  ? -24.215 4.925   65.358  1.00 13.68 ? 62   LEU B CD1 1 
ATOM   3240  C CD2 . LEU B 1 63  ? -23.756 3.865   67.555  1.00 12.12 ? 62   LEU B CD2 1 
ATOM   3241  N N   . PHE B 1 64  ? -26.194 8.442   69.051  1.00 14.56 ? 63   PHE B N   1 
ATOM   3242  C CA  . PHE B 1 64  ? -26.246 9.890   69.205  1.00 14.69 ? 63   PHE B CA  1 
ATOM   3243  C C   . PHE B 1 64  ? -26.739 10.369  70.564  1.00 15.10 ? 63   PHE B C   1 
ATOM   3244  O O   . PHE B 1 64  ? -26.593 11.576  70.863  1.00 16.67 ? 63   PHE B O   1 
ATOM   3245  C CB  . PHE B 1 64  ? -27.062 10.501  68.055  1.00 15.34 ? 63   PHE B CB  1 
ATOM   3246  C CG  . PHE B 1 64  ? -26.496 10.293  66.675  1.00 16.37 ? 63   PHE B CG  1 
ATOM   3247  C CD1 . PHE B 1 64  ? -25.224 9.770   66.486  1.00 15.50 ? 63   PHE B CD1 1 
ATOM   3248  C CD2 . PHE B 1 64  ? -27.263 10.647  65.558  1.00 16.15 ? 63   PHE B CD2 1 
ATOM   3249  C CE1 . PHE B 1 64  ? -24.694 9.590   65.210  1.00 17.10 ? 63   PHE B CE1 1 
ATOM   3250  C CE2 . PHE B 1 64  ? -26.750 10.484  64.264  1.00 16.82 ? 63   PHE B CE2 1 
ATOM   3251  C CZ  . PHE B 1 64  ? -25.458 9.954   64.109  1.00 15.99 ? 63   PHE B CZ  1 
ATOM   3252  N N   . SER B 1 65  ? -27.295 9.501   71.373  1.00 14.41 ? 64   SER B N   1 
ATOM   3253  C CA  . SER B 1 65  ? -27.777 9.920   72.710  1.00 14.21 ? 64   SER B CA  1 
ATOM   3254  C C   . SER B 1 65  ? -26.836 9.446   73.805  1.00 14.29 ? 64   SER B C   1 
ATOM   3255  O O   . SER B 1 65  ? -27.145 9.588   75.009  1.00 15.04 ? 64   SER B O   1 
ATOM   3256  C CB  . SER B 1 65  ? -29.211 9.454   72.911  1.00 11.44 ? 64   SER B CB  1 
ATOM   3257  O OG  . SER B 1 65  ? -29.274 8.050   72.757  1.00 15.28 ? 64   SER B OG  1 
ATOM   3258  N N   . THR B 1 66  ? -25.697 8.906   73.417  1.00 13.67 ? 65   THR B N   1 
ATOM   3259  C CA  . THR B 1 66  ? -24.665 8.442   74.361  1.00 13.57 ? 65   THR B CA  1 
ATOM   3260  C C   . THR B 1 66  ? -24.246 9.567   75.293  1.00 14.04 ? 65   THR B C   1 
ATOM   3261  O O   . THR B 1 66  ? -24.322 10.762  74.960  1.00 14.16 ? 65   THR B O   1 
ATOM   3262  C CB  . THR B 1 66  ? -23.430 7.840   73.570  1.00 12.58 ? 65   THR B CB  1 
ATOM   3263  O OG1 . THR B 1 66  ? -23.996 6.741   72.777  1.00 9.16  ? 65   THR B OG1 1 
ATOM   3264  C CG2 . THR B 1 66  ? -22.281 7.326   74.453  1.00 12.38 ? 65   THR B CG2 1 
ATOM   3265  N N   . ASP B 1 67  ? -23.825 9.173   76.486  1.00 14.83 ? 66   ASP B N   1 
ATOM   3266  C CA  . ASP B 1 67  ? -23.291 10.116  77.500  1.00 16.23 ? 66   ASP B CA  1 
ATOM   3267  C C   . ASP B 1 67  ? -22.294 11.041  76.802  1.00 16.33 ? 66   ASP B C   1 
ATOM   3268  O O   . ASP B 1 67  ? -21.496 10.557  75.986  1.00 16.68 ? 66   ASP B O   1 
ATOM   3269  C CB  . ASP B 1 67  ? -22.670 9.277   78.613  1.00 19.24 ? 66   ASP B CB  1 
ATOM   3270  C CG  . ASP B 1 67  ? -21.940 10.010  79.706  1.00 21.58 ? 66   ASP B CG  1 
ATOM   3271  O OD1 . ASP B 1 67  ? -21.489 11.154  79.610  1.00 22.12 ? 66   ASP B OD1 1 
ATOM   3272  O OD2 . ASP B 1 67  ? -21.788 9.342   80.763  1.00 24.95 ? 66   ASP B OD2 1 
ATOM   3273  N N   . PRO B 1 68  ? -22.368 12.314  77.136  1.00 16.95 ? 67   PRO B N   1 
ATOM   3274  C CA  . PRO B 1 68  ? -21.513 13.354  76.571  1.00 17.09 ? 67   PRO B CA  1 
ATOM   3275  C C   . PRO B 1 68  ? -20.034 13.071  76.765  1.00 17.39 ? 67   PRO B C   1 
ATOM   3276  O O   . PRO B 1 68  ? -19.176 13.720  76.138  1.00 17.63 ? 67   PRO B O   1 
ATOM   3277  C CB  . PRO B 1 68  ? -21.944 14.647  77.262  1.00 17.09 ? 67   PRO B CB  1 
ATOM   3278  C CG  . PRO B 1 68  ? -22.819 14.229  78.402  1.00 16.85 ? 67   PRO B CG  1 
ATOM   3279  C CD  . PRO B 1 68  ? -23.440 12.913  77.972  1.00 16.54 ? 67   PRO B CD  1 
ATOM   3280  N N   . LYS B 1 69  ? -19.745 12.114  77.625  1.00 17.33 ? 68   LYS B N   1 
ATOM   3281  C CA  . LYS B 1 69  ? -18.364 11.663  77.848  1.00 17.81 ? 68   LYS B CA  1 
ATOM   3282  C C   . LYS B 1 69  ? -17.739 11.250  76.502  1.00 17.02 ? 68   LYS B C   1 
ATOM   3283  O O   . LYS B 1 69  ? -16.517 11.305  76.333  1.00 16.22 ? 68   LYS B O   1 
ATOM   3284  C CB  . LYS B 1 69  ? -18.333 10.456  78.777  1.00 19.90 ? 68   LYS B CB  1 
ATOM   3285  C CG  . LYS B 1 69  ? -16.978 10.090  79.345  1.00 24.55 ? 68   LYS B CG  1 
ATOM   3286  C CD  . LYS B 1 69  ? -16.972 8.696   79.957  1.00 27.02 ? 68   LYS B CD  1 
ATOM   3287  C CE  . LYS B 1 69  ? -18.173 8.446   80.848  1.00 29.16 ? 68   LYS B CE  1 
ATOM   3288  N NZ  . LYS B 1 69  ? -18.270 7.005   81.206  1.00 30.58 ? 68   LYS B NZ  1 
ATOM   3289  N N   . LEU B 1 70  ? -18.613 10.862  75.583  1.00 16.16 ? 69   LEU B N   1 
ATOM   3290  C CA  . LEU B 1 70  ? -18.180 10.380  74.259  1.00 14.59 ? 69   LEU B CA  1 
ATOM   3291  C C   . LEU B 1 70  ? -17.343 11.413  73.523  1.00 13.79 ? 69   LEU B C   1 
ATOM   3292  O O   . LEU B 1 70  ? -16.409 11.048  72.774  1.00 13.79 ? 69   LEU B O   1 
ATOM   3293  C CB  . LEU B 1 70  ? -19.416 9.904   73.469  1.00 14.01 ? 69   LEU B CB  1 
ATOM   3294  C CG  . LEU B 1 70  ? -19.121 9.428   72.030  1.00 13.39 ? 69   LEU B CG  1 
ATOM   3295  C CD1 . LEU B 1 70  ? -18.409 8.090   72.027  1.00 11.78 ? 69   LEU B CD1 1 
ATOM   3296  C CD2 . LEU B 1 70  ? -20.450 9.328   71.279  1.00 14.73 ? 69   LEU B CD2 1 
ATOM   3297  N N   . ALA B 1 71  ? -17.679 12.675  73.721  1.00 13.43 ? 70   ALA B N   1 
ATOM   3298  C CA  . ALA B 1 71  ? -17.059 13.803  73.041  1.00 13.19 ? 70   ALA B CA  1 
ATOM   3299  C C   . ALA B 1 71  ? -15.597 13.979  73.456  1.00 13.13 ? 70   ALA B C   1 
ATOM   3300  O O   . ALA B 1 71  ? -14.904 14.833  72.887  1.00 12.10 ? 70   ALA B O   1 
ATOM   3301  C CB  . ALA B 1 71  ? -17.822 15.100  73.295  1.00 13.05 ? 70   ALA B CB  1 
ATOM   3302  N N   . GLU B 1 72  ? -15.206 13.237  74.475  1.00 13.07 ? 71   GLU B N   1 
ATOM   3303  C CA  . GLU B 1 72  ? -13.807 13.253  74.916  1.00 13.12 ? 71   GLU B CA  1 
ATOM   3304  C C   . GLU B 1 72  ? -12.925 12.557  73.888  1.00 12.22 ? 71   GLU B C   1 
ATOM   3305  O O   . GLU B 1 72  ? -11.755 12.935  73.744  1.00 11.60 ? 71   GLU B O   1 
ATOM   3306  C CB  . GLU B 1 72  ? -13.593 12.522  76.253  1.00 16.18 ? 71   GLU B CB  1 
ATOM   3307  C CG  . GLU B 1 72  ? -13.954 13.361  77.486  1.00 20.03 ? 71   GLU B CG  1 
ATOM   3308  C CD  . GLU B 1 72  ? -14.000 12.670  78.809  1.00 22.19 ? 71   GLU B CD  1 
ATOM   3309  O OE1 . GLU B 1 72  ? -13.423 11.567  78.844  1.00 23.22 ? 71   GLU B OE1 1 
ATOM   3310  O OE2 . GLU B 1 72  ? -14.590 13.152  79.772  1.00 24.48 ? 71   GLU B OE2 1 
ATOM   3311  N N   . ASN B 1 73  ? -13.508 11.564  73.218  1.00 11.56 ? 72   ASN B N   1 
ATOM   3312  C CA  . ASN B 1 73  ? -12.743 10.777  72.239  1.00 11.20 ? 72   ASN B CA  1 
ATOM   3313  C C   . ASN B 1 73  ? -13.267 10.928  70.809  1.00 10.58 ? 72   ASN B C   1 
ATOM   3314  O O   . ASN B 1 73  ? -12.548 10.500  69.875  1.00 10.19 ? 72   ASN B O   1 
ATOM   3315  C CB  . ASN B 1 73  ? -12.670 9.314   72.683  1.00 13.36 ? 72   ASN B CB  1 
ATOM   3316  C CG  . ASN B 1 73  ? -11.913 9.163   74.011  1.00 15.69 ? 72   ASN B CG  1 
ATOM   3317  O OD1 . ASN B 1 73  ? -10.718 9.517   74.063  1.00 16.58 ? 72   ASN B OD1 1 
ATOM   3318  N ND2 . ASN B 1 73  ? -12.619 8.647   75.008  1.00 14.17 ? 72   ASN B ND2 1 
ATOM   3319  N N   . ILE B 1 74  ? -14.460 11.444  70.670  1.00 9.87  ? 73   ILE B N   1 
ATOM   3320  C CA  . ILE B 1 74  ? -15.074 11.611  69.332  1.00 8.97  ? 73   ILE B CA  1 
ATOM   3321  C C   . ILE B 1 74  ? -15.204 13.079  69.008  1.00 8.24  ? 73   ILE B C   1 
ATOM   3322  O O   . ILE B 1 74  ? -16.017 13.788  69.633  1.00 8.59  ? 73   ILE B O   1 
ATOM   3323  C CB  . ILE B 1 74  ? -16.447 10.854  69.250  1.00 8.39  ? 73   ILE B CB  1 
ATOM   3324  C CG1 . ILE B 1 74  ? -16.277 9.369   69.583  1.00 6.28  ? 73   ILE B CG1 1 
ATOM   3325  C CG2 . ILE B 1 74  ? -17.100 11.107  67.845  1.00 8.27  ? 73   ILE B CG2 1 
ATOM   3326  C CD1 . ILE B 1 74  ? -15.314 8.574   68.626  1.00 7.27  ? 73   ILE B CD1 1 
ATOM   3327  N N   . SER B 1 75  ? -14.387 13.538  68.059  1.00 7.50  ? 74   SER B N   1 
ATOM   3328  C CA  . SER B 1 75  ? -14.435 14.927  67.607  1.00 7.86  ? 74   SER B CA  1 
ATOM   3329  C C   . SER B 1 75  ? -15.531 15.145  66.551  1.00 7.73  ? 74   SER B C   1 
ATOM   3330  O O   . SER B 1 75  ? -16.072 16.256  66.461  1.00 7.55  ? 74   SER B O   1 
ATOM   3331  C CB  . SER B 1 75  ? -13.097 15.361  66.994  1.00 8.20  ? 74   SER B CB  1 
ATOM   3332  O OG  . SER B 1 75  ? -12.798 14.444  65.944  1.00 9.41  ? 74   SER B OG  1 
ATOM   3333  N N   . GLY B 1 76  ? -15.821 14.111  65.792  1.00 8.46  ? 75   GLY B N   1 
ATOM   3334  C CA  . GLY B 1 76  ? -16.760 14.274  64.661  1.00 7.95  ? 75   GLY B CA  1 
ATOM   3335  C C   . GLY B 1 76  ? -17.430 12.986  64.277  1.00 7.06  ? 75   GLY B C   1 
ATOM   3336  O O   . GLY B 1 76  ? -17.000 11.876  64.583  1.00 7.18  ? 75   GLY B O   1 
ATOM   3337  N N   . VAL B 1 77  ? -18.562 13.152  63.587  1.00 7.72  ? 76   VAL B N   1 
ATOM   3338  C CA  . VAL B 1 77  ? -19.368 12.029  63.117  1.00 8.06  ? 76   VAL B CA  1 
ATOM   3339  C C   . VAL B 1 77  ? -19.697 12.284  61.616  1.00 7.85  ? 76   VAL B C   1 
ATOM   3340  O O   . VAL B 1 77  ? -20.149 13.378  61.284  1.00 8.03  ? 76   VAL B O   1 
ATOM   3341  C CB  . VAL B 1 77  ? -20.662 11.862  63.928  1.00 9.66  ? 76   VAL B CB  1 
ATOM   3342  C CG1 . VAL B 1 77  ? -21.558 10.772  63.330  1.00 8.93  ? 76   VAL B CG1 1 
ATOM   3343  C CG2 . VAL B 1 77  ? -20.436 11.579  65.405  1.00 11.93 ? 76   VAL B CG2 1 
ATOM   3344  N N   . ILE B 1 78  ? -19.437 11.270  60.825  1.00 8.60  ? 77   ILE B N   1 
ATOM   3345  C CA  . ILE B 1 78  ? -19.801 11.345  59.388  1.00 8.93  ? 77   ILE B CA  1 
ATOM   3346  C C   . ILE B 1 78  ? -21.201 10.734  59.247  1.00 8.74  ? 77   ILE B C   1 
ATOM   3347  O O   . ILE B 1 78  ? -21.388 9.583   59.651  1.00 8.98  ? 77   ILE B O   1 
ATOM   3348  C CB  . ILE B 1 78  ? -18.774 10.595  58.484  1.00 10.30 ? 77   ILE B CB  1 
ATOM   3349  C CG1 . ILE B 1 78  ? -17.319 10.977  58.861  1.00 10.24 ? 77   ILE B CG1 1 
ATOM   3350  C CG2 . ILE B 1 78  ? -19.059 10.892  56.971  1.00 11.17 ? 77   ILE B CG2 1 
ATOM   3351  C CD1 . ILE B 1 78  ? -16.274 10.067  58.131  1.00 10.86 ? 77   ILE B CD1 1 
ATOM   3352  N N   . LEU B 1 79  ? -22.093 11.501  58.673  1.00 9.38  ? 78   LEU B N   1 
ATOM   3353  C CA  . LEU B 1 79  ? -23.496 11.130  58.491  1.00 9.85  ? 78   LEU B CA  1 
ATOM   3354  C C   . LEU B 1 79  ? -23.802 10.725  57.033  1.00 10.74 ? 78   LEU B C   1 
ATOM   3355  O O   . LEU B 1 79  ? -23.152 11.222  56.097  1.00 9.68  ? 78   LEU B O   1 
ATOM   3356  C CB  . LEU B 1 79  ? -24.298 12.387  58.847  1.00 10.85 ? 78   LEU B CB  1 
ATOM   3357  C CG  . LEU B 1 79  ? -24.888 12.618  60.208  1.00 12.97 ? 78   LEU B CG  1 
ATOM   3358  C CD1 . LEU B 1 79  ? -24.208 11.817  61.298  1.00 15.39 ? 78   LEU B CD1 1 
ATOM   3359  C CD2 . LEU B 1 79  ? -24.815 14.118  60.527  1.00 13.37 ? 78   LEU B CD2 1 
ATOM   3360  N N   . PHE B 1 80  ? -24.802 9.878   56.930  1.00 10.96 ? 79   PHE B N   1 
ATOM   3361  C CA  . PHE B 1 80  ? -25.433 9.586   55.597  1.00 11.36 ? 79   PHE B CA  1 
ATOM   3362  C C   . PHE B 1 80  ? -26.562 10.604  55.464  1.00 12.00 ? 79   PHE B C   1 
ATOM   3363  O O   . PHE B 1 80  ? -27.159 11.015  56.486  1.00 11.46 ? 79   PHE B O   1 
ATOM   3364  C CB  . PHE B 1 80  ? -25.836 8.137   55.476  1.00 12.91 ? 79   PHE B CB  1 
ATOM   3365  C CG  . PHE B 1 80  ? -26.618 7.776   54.236  1.00 15.18 ? 79   PHE B CG  1 
ATOM   3366  C CD1 . PHE B 1 80  ? -25.986 7.743   52.993  1.00 16.04 ? 79   PHE B CD1 1 
ATOM   3367  C CD2 . PHE B 1 80  ? -27.981 7.506   54.331  1.00 15.27 ? 79   PHE B CD2 1 
ATOM   3368  C CE1 . PHE B 1 80  ? -26.711 7.434   51.833  1.00 16.65 ? 79   PHE B CE1 1 
ATOM   3369  C CE2 . PHE B 1 80  ? -28.715 7.197   53.192  1.00 16.41 ? 79   PHE B CE2 1 
ATOM   3370  C CZ  . PHE B 1 80  ? -28.089 7.157   51.948  1.00 15.66 ? 79   PHE B CZ  1 
ATOM   3371  N N   . HIS B 1 81  ? -26.853 11.024  54.243  1.00 11.70 ? 80   HIS B N   1 
ATOM   3372  C CA  . HIS B 1 81  ? -27.854 12.052  53.951  1.00 11.90 ? 80   HIS B CA  1 
ATOM   3373  C C   . HIS B 1 81  ? -29.128 11.965  54.763  1.00 12.00 ? 80   HIS B C   1 
ATOM   3374  O O   . HIS B 1 81  ? -29.533 12.986  55.368  1.00 11.31 ? 80   HIS B O   1 
ATOM   3375  C CB  . HIS B 1 81  ? -28.215 12.109  52.437  1.00 11.44 ? 80   HIS B CB  1 
ATOM   3376  C CG  . HIS B 1 81  ? -29.134 13.236  52.090  1.00 10.25 ? 80   HIS B CG  1 
ATOM   3377  N ND1 . HIS B 1 81  ? -28.739 14.482  51.699  1.00 9.18  ? 80   HIS B ND1 1 
ATOM   3378  C CD2 . HIS B 1 81  ? -30.499 13.258  52.097  1.00 10.05 ? 80   HIS B CD2 1 
ATOM   3379  C CE1 . HIS B 1 81  ? -29.809 15.232  51.479  1.00 9.75  ? 80   HIS B CE1 1 
ATOM   3380  N NE2 . HIS B 1 81  ? -30.888 14.508  51.708  1.00 9.90  ? 80   HIS B NE2 1 
ATOM   3381  N N   . GLU B 1 82  ? -29.794 10.821  54.806  1.00 13.34 ? 81   GLU B N   1 
ATOM   3382  C CA  . GLU B 1 82  ? -31.093 10.737  55.519  1.00 14.76 ? 81   GLU B CA  1 
ATOM   3383  C C   . GLU B 1 82  ? -31.009 11.116  56.986  1.00 14.90 ? 81   GLU B C   1 
ATOM   3384  O O   . GLU B 1 82  ? -31.923 11.770  57.562  1.00 14.82 ? 81   GLU B O   1 
ATOM   3385  C CB  . GLU B 1 82  ? -31.735 9.369   55.400  1.00 16.14 ? 81   GLU B CB  1 
ATOM   3386  C CG  . GLU B 1 82  ? -31.652 8.397   56.568  1.00 18.92 ? 81   GLU B CG  1 
ATOM   3387  C CD  . GLU B 1 82  ? -32.234 7.032   56.326  1.00 19.91 ? 81   GLU B CD  1 
ATOM   3388  O OE1 . GLU B 1 82  ? -33.117 6.802   55.506  1.00 21.46 ? 81   GLU B OE1 1 
ATOM   3389  O OE2 . GLU B 1 82  ? -31.732 6.156   57.060  1.00 19.67 ? 81   GLU B OE2 1 
ATOM   3390  N N   . THR B 1 83  ? -29.905 10.741  57.618  1.00 14.79 ? 82   THR B N   1 
ATOM   3391  C CA  . THR B 1 83  ? -29.700 10.949  59.056  1.00 13.93 ? 82   THR B CA  1 
ATOM   3392  C C   . THR B 1 83  ? -29.569 12.402  59.451  1.00 14.03 ? 82   THR B C   1 
ATOM   3393  O O   . THR B 1 83  ? -29.986 12.810  60.562  1.00 13.73 ? 82   THR B O   1 
ATOM   3394  C CB  . THR B 1 83  ? -28.437 10.125  59.553  1.00 12.92 ? 82   THR B CB  1 
ATOM   3395  O OG1 . THR B 1 83  ? -28.576 8.810   58.955  1.00 12.37 ? 82   THR B OG1 1 
ATOM   3396  C CG2 . THR B 1 83  ? -28.350 10.071  61.083  1.00 13.94 ? 82   THR B CG2 1 
ATOM   3397  N N   . LEU B 1 84  ? -28.972 13.184  58.574  1.00 13.15 ? 83   LEU B N   1 
ATOM   3398  C CA  . LEU B 1 84  ? -28.815 14.623  58.819  1.00 13.75 ? 83   LEU B CA  1 
ATOM   3399  C C   . LEU B 1 84  ? -30.145 15.310  59.076  1.00 13.94 ? 83   LEU B C   1 
ATOM   3400  O O   . LEU B 1 84  ? -30.207 16.346  59.785  1.00 13.31 ? 83   LEU B O   1 
ATOM   3401  C CB  . LEU B 1 84  ? -27.996 15.218  57.660  1.00 13.33 ? 83   LEU B CB  1 
ATOM   3402  C CG  . LEU B 1 84  ? -27.815 16.731  57.729  1.00 14.68 ? 83   LEU B CG  1 
ATOM   3403  C CD1 . LEU B 1 84  ? -27.017 17.121  58.965  1.00 14.50 ? 83   LEU B CD1 1 
ATOM   3404  C CD2 . LEU B 1 84  ? -27.079 17.190  56.472  1.00 14.63 ? 83   LEU B CD2 1 
ATOM   3405  N N   . TYR B 1 85  ? -31.218 14.743  58.541  1.00 14.65 ? 84   TYR B N   1 
ATOM   3406  C CA  . TYR B 1 85  ? -32.548 15.368  58.652  1.00 15.90 ? 84   TYR B CA  1 
ATOM   3407  C C   . TYR B 1 85  ? -33.514 14.630  59.555  1.00 17.04 ? 84   TYR B C   1 
ATOM   3408  O O   . TYR B 1 85  ? -34.722 15.001  59.601  1.00 17.84 ? 84   TYR B O   1 
ATOM   3409  C CB  . TYR B 1 85  ? -33.131 15.593  57.222  1.00 15.73 ? 84   TYR B CB  1 
ATOM   3410  C CG  . TYR B 1 85  ? -32.192 16.468  56.409  1.00 15.66 ? 84   TYR B CG  1 
ATOM   3411  C CD1 . TYR B 1 85  ? -32.097 17.826  56.721  1.00 16.02 ? 84   TYR B CD1 1 
ATOM   3412  C CD2 . TYR B 1 85  ? -31.378 15.965  55.395  1.00 16.29 ? 84   TYR B CD2 1 
ATOM   3413  C CE1 . TYR B 1 85  ? -31.236 18.670  56.027  1.00 16.11 ? 84   TYR B CE1 1 
ATOM   3414  C CE2 . TYR B 1 85  ? -30.506 16.795  54.692  1.00 15.02 ? 84   TYR B CE2 1 
ATOM   3415  C CZ  . TYR B 1 85  ? -30.436 18.142  55.013  1.00 15.37 ? 84   TYR B CZ  1 
ATOM   3416  O OH  . TYR B 1 85  ? -29.607 19.017  54.375  1.00 15.85 ? 84   TYR B OH  1 
ATOM   3417  N N   . GLN B 1 86  ? -33.048 13.652  60.298  1.00 17.32 ? 85   GLN B N   1 
ATOM   3418  C CA  . GLN B 1 86  ? -33.874 12.845  61.205  1.00 17.96 ? 85   GLN B CA  1 
ATOM   3419  C C   . GLN B 1 86  ? -33.915 13.472  62.597  1.00 18.77 ? 85   GLN B C   1 
ATOM   3420  O O   . GLN B 1 86  ? -33.118 14.371  62.930  1.00 18.52 ? 85   GLN B O   1 
ATOM   3421  C CB  . GLN B 1 86  ? -33.415 11.387  61.256  1.00 17.58 ? 85   GLN B CB  1 
ATOM   3422  C CG  . GLN B 1 86  ? -33.770 10.597  60.027  1.00 17.91 ? 85   GLN B CG  1 
ATOM   3423  C CD  . GLN B 1 86  ? -33.339 9.163   60.049  1.00 16.94 ? 85   GLN B CD  1 
ATOM   3424  O OE1 . GLN B 1 86  ? -34.000 8.288   59.493  1.00 18.71 ? 85   GLN B OE1 1 
ATOM   3425  N NE2 . GLN B 1 86  ? -32.215 8.885   60.705  1.00 17.20 ? 85   GLN B NE2 1 
ATOM   3426  N N   . LYS B 1 87  ? -34.861 12.970  63.381  1.00 19.28 ? 86   LYS B N   1 
ATOM   3427  C CA  . LYS B 1 87  ? -35.083 13.458  64.750  1.00 20.20 ? 86   LYS B CA  1 
ATOM   3428  C C   . LYS B 1 87  ? -35.166 12.307  65.750  1.00 19.72 ? 86   LYS B C   1 
ATOM   3429  O O   . LYS B 1 87  ? -35.520 11.175  65.402  1.00 19.30 ? 86   LYS B O   1 
ATOM   3430  C CB  . LYS B 1 87  ? -36.375 14.277  64.847  1.00 22.04 ? 86   LYS B CB  1 
ATOM   3431  C CG  . LYS B 1 87  ? -36.555 15.281  63.719  1.00 24.22 ? 86   LYS B CG  1 
ATOM   3432  C CD  . LYS B 1 87  ? -37.720 16.218  63.993  1.00 26.83 ? 86   LYS B CD  1 
ATOM   3433  C CE  . LYS B 1 87  ? -38.143 16.993  62.763  1.00 27.52 ? 86   LYS B CE  1 
ATOM   3434  N NZ  . LYS B 1 87  ? -37.104 17.965  62.352  1.00 29.72 ? 86   LYS B NZ  1 
ATOM   3435  N N   . ALA B 1 88  ? -34.819 12.635  66.986  1.00 20.76 ? 87   ALA B N   1 
ATOM   3436  C CA  . ALA B 1 88  ? -34.888 11.675  68.105  1.00 22.06 ? 87   ALA B CA  1 
ATOM   3437  C C   . ALA B 1 88  ? -36.368 11.458  68.433  1.00 23.12 ? 87   ALA B C   1 
ATOM   3438  O O   . ALA B 1 88  ? -37.228 12.161  67.877  1.00 22.58 ? 87   ALA B O   1 
ATOM   3439  C CB  . ALA B 1 88  ? -34.111 12.208  69.291  1.00 22.45 ? 87   ALA B CB  1 
ATOM   3440  N N   . ASP B 1 89  ? -36.618 10.503  69.300  1.00 24.63 ? 88   ASP B N   1 
ATOM   3441  C CA  . ASP B 1 89  ? -37.965 10.149  69.762  1.00 26.08 ? 88   ASP B CA  1 
ATOM   3442  C C   . ASP B 1 89  ? -38.729 11.373  70.264  1.00 26.82 ? 88   ASP B C   1 
ATOM   3443  O O   . ASP B 1 89  ? -39.957 11.475  70.027  1.00 27.63 ? 88   ASP B O   1 
ATOM   3444  C CB  . ASP B 1 89  ? -37.900 9.045   70.819  1.00 28.00 ? 88   ASP B CB  1 
ATOM   3445  C CG  . ASP B 1 89  ? -37.763 7.651   70.250  1.00 28.69 ? 88   ASP B CG  1 
ATOM   3446  O OD1 . ASP B 1 89  ? -37.748 7.565   69.003  1.00 29.82 ? 88   ASP B OD1 1 
ATOM   3447  O OD2 . ASP B 1 89  ? -37.692 6.663   71.000  1.00 30.75 ? 88   ASP B OD2 1 
ATOM   3448  N N   . ASP B 1 90  ? -38.032 12.262  70.939  1.00 26.71 ? 89   ASP B N   1 
ATOM   3449  C CA  . ASP B 1 90  ? -38.646 13.463  71.527  1.00 26.78 ? 89   ASP B CA  1 
ATOM   3450  C C   . ASP B 1 90  ? -38.721 14.645  70.571  1.00 26.42 ? 89   ASP B C   1 
ATOM   3451  O O   . ASP B 1 90  ? -39.076 15.767  71.016  1.00 26.48 ? 89   ASP B O   1 
ATOM   3452  C CB  . ASP B 1 90  ? -37.941 13.810  72.845  1.00 28.47 ? 89   ASP B CB  1 
ATOM   3453  C CG  . ASP B 1 90  ? -36.486 14.185  72.611  1.00 30.45 ? 89   ASP B CG  1 
ATOM   3454  O OD1 . ASP B 1 90  ? -36.027 14.192  71.457  1.00 30.57 ? 89   ASP B OD1 1 
ATOM   3455  O OD2 . ASP B 1 90  ? -35.826 14.482  73.627  1.00 31.74 ? 89   ASP B OD2 1 
ATOM   3456  N N   . GLY B 1 91  ? -38.381 14.439  69.319  1.00 25.51 ? 90   GLY B N   1 
ATOM   3457  C CA  . GLY B 1 91  ? -38.451 15.470  68.287  1.00 24.61 ? 90   GLY B CA  1 
ATOM   3458  C C   . GLY B 1 91  ? -37.229 16.336  68.115  1.00 23.81 ? 90   GLY B C   1 
ATOM   3459  O O   . GLY B 1 91  ? -37.243 17.267  67.273  1.00 24.05 ? 90   GLY B O   1 
ATOM   3460  N N   . THR B 1 92  ? -36.159 16.093  68.863  1.00 22.59 ? 91   THR B N   1 
ATOM   3461  C CA  . THR B 1 92  ? -34.930 16.899  68.736  1.00 21.10 ? 91   THR B CA  1 
ATOM   3462  C C   . THR B 1 92  ? -34.152 16.357  67.525  1.00 19.97 ? 91   THR B C   1 
ATOM   3463  O O   . THR B 1 92  ? -33.944 15.137  67.443  1.00 19.36 ? 91   THR B O   1 
ATOM   3464  C CB  . THR B 1 92  ? -34.020 16.829  70.013  1.00 23.52 ? 91   THR B CB  1 
ATOM   3465  O OG1 . THR B 1 92  ? -34.803 17.319  71.152  1.00 26.09 ? 91   THR B OG1 1 
ATOM   3466  C CG2 . THR B 1 92  ? -32.694 17.593  69.873  1.00 22.83 ? 91   THR B CG2 1 
ATOM   3467  N N   . PRO B 1 93  ? -33.783 17.263  66.642  1.00 19.12 ? 92   PRO B N   1 
ATOM   3468  C CA  . PRO B 1 93  ? -32.993 16.885  65.454  1.00 18.60 ? 92   PRO B CA  1 
ATOM   3469  C C   . PRO B 1 93  ? -31.670 16.288  65.902  1.00 17.43 ? 92   PRO B C   1 
ATOM   3470  O O   . PRO B 1 93  ? -31.027 16.822  66.815  1.00 16.99 ? 92   PRO B O   1 
ATOM   3471  C CB  . PRO B 1 93  ? -32.839 18.180  64.670  1.00 18.56 ? 92   PRO B CB  1 
ATOM   3472  C CG  . PRO B 1 93  ? -33.902 19.104  65.194  1.00 19.43 ? 92   PRO B CG  1 
ATOM   3473  C CD  . PRO B 1 93  ? -34.111 18.697  66.648  1.00 19.34 ? 92   PRO B CD  1 
ATOM   3474  N N   . PHE B 1 94  ? -31.291 15.192  65.279  1.00 16.94 ? 93   PHE B N   1 
ATOM   3475  C CA  . PHE B 1 94  ? -29.993 14.543  65.540  1.00 16.83 ? 93   PHE B CA  1 
ATOM   3476  C C   . PHE B 1 94  ? -28.861 15.574  65.460  1.00 16.98 ? 93   PHE B C   1 
ATOM   3477  O O   . PHE B 1 94  ? -27.940 15.545  66.300  1.00 16.88 ? 93   PHE B O   1 
ATOM   3478  C CB  . PHE B 1 94  ? -29.753 13.340  64.650  1.00 15.04 ? 93   PHE B CB  1 
ATOM   3479  C CG  . PHE B 1 94  ? -30.524 12.092  64.912  1.00 14.53 ? 93   PHE B CG  1 
ATOM   3480  C CD1 . PHE B 1 94  ? -31.097 11.836  66.162  1.00 14.84 ? 93   PHE B CD1 1 
ATOM   3481  C CD2 . PHE B 1 94  ? -30.673 11.145  63.895  1.00 13.23 ? 93   PHE B CD2 1 
ATOM   3482  C CE1 . PHE B 1 94  ? -31.812 10.656  66.388  1.00 14.83 ? 93   PHE B CE1 1 
ATOM   3483  C CE2 . PHE B 1 94  ? -31.370 9.970   64.097  1.00 14.50 ? 93   PHE B CE2 1 
ATOM   3484  C CZ  . PHE B 1 94  ? -31.944 9.708   65.347  1.00 14.16 ? 93   PHE B CZ  1 
ATOM   3485  N N   . ALA B 1 95  ? -28.936 16.472  64.486  1.00 16.83 ? 94   ALA B N   1 
ATOM   3486  C CA  . ALA B 1 95  ? -27.888 17.482  64.278  1.00 17.02 ? 94   ALA B CA  1 
ATOM   3487  C C   . ALA B 1 95  ? -27.673 18.319  65.545  1.00 17.43 ? 94   ALA B C   1 
ATOM   3488  O O   . ALA B 1 95  ? -26.527 18.631  65.917  1.00 16.82 ? 94   ALA B O   1 
ATOM   3489  C CB  . ALA B 1 95  ? -28.186 18.363  63.082  1.00 14.89 ? 94   ALA B CB  1 
ATOM   3490  N N   . GLU B 1 96  ? -28.781 18.649  66.182  1.00 17.89 ? 95   GLU B N   1 
ATOM   3491  C CA  . GLU B 1 96  ? -28.795 19.482  67.388  1.00 18.71 ? 95   GLU B CA  1 
ATOM   3492  C C   . GLU B 1 96  ? -28.204 18.759  68.586  1.00 17.72 ? 95   GLU B C   1 
ATOM   3493  O O   . GLU B 1 96  ? -27.430 19.364  69.360  1.00 18.15 ? 95   GLU B O   1 
ATOM   3494  C CB  . GLU B 1 96  ? -30.194 19.954  67.732  1.00 22.60 ? 95   GLU B CB  1 
ATOM   3495  C CG  . GLU B 1 96  ? -30.374 21.041  68.787  1.00 27.17 ? 95   GLU B CG  1 
ATOM   3496  C CD  . GLU B 1 96  ? -31.780 21.593  68.843  1.00 29.53 ? 95   GLU B CD  1 
ATOM   3497  O OE1 . GLU B 1 96  ? -32.540 20.868  69.514  1.00 32.62 ? 95   GLU B OE1 1 
ATOM   3498  O OE2 . GLU B 1 96  ? -32.129 22.614  68.277  1.00 31.53 ? 95   GLU B OE2 1 
ATOM   3499  N N   . ILE B 1 97  ? -28.551 17.496  68.736  1.00 17.26 ? 96   ILE B N   1 
ATOM   3500  C CA  . ILE B 1 97  ? -28.010 16.652  69.815  1.00 16.91 ? 96   ILE B CA  1 
ATOM   3501  C C   . ILE B 1 97  ? -26.482 16.628  69.736  1.00 16.88 ? 96   ILE B C   1 
ATOM   3502  O O   . ILE B 1 97  ? -25.781 16.857  70.736  1.00 15.76 ? 96   ILE B O   1 
ATOM   3503  C CB  . ILE B 1 97  ? -28.611 15.208  69.734  1.00 16.67 ? 96   ILE B CB  1 
ATOM   3504  C CG1 . ILE B 1 97  ? -30.149 15.253  69.976  1.00 17.90 ? 96   ILE B CG1 1 
ATOM   3505  C CG2 . ILE B 1 97  ? -27.927 14.211  70.694  1.00 18.24 ? 96   ILE B CG2 1 
ATOM   3506  C CD1 . ILE B 1 97  ? -30.836 13.878  69.764  1.00 16.94 ? 96   ILE B CD1 1 
ATOM   3507  N N   . LEU B 1 98  ? -25.996 16.326  68.526  1.00 16.32 ? 97   LEU B N   1 
ATOM   3508  C CA  . LEU B 1 98  ? -24.547 16.221  68.305  1.00 16.37 ? 97   LEU B CA  1 
ATOM   3509  C C   . LEU B 1 98  ? -23.850 17.544  68.545  1.00 16.48 ? 97   LEU B C   1 
ATOM   3510  O O   . LEU B 1 98  ? -22.804 17.583  69.225  1.00 16.09 ? 97   LEU B O   1 
ATOM   3511  C CB  . LEU B 1 98  ? -24.281 15.534  66.958  1.00 15.50 ? 97   LEU B CB  1 
ATOM   3512  C CG  . LEU B 1 98  ? -24.739 14.104  66.775  1.00 15.53 ? 97   LEU B CG  1 
ATOM   3513  C CD1 . LEU B 1 98  ? -24.561 13.623  65.333  1.00 17.02 ? 97   LEU B CD1 1 
ATOM   3514  C CD2 . LEU B 1 98  ? -23.909 13.182  67.668  1.00 16.07 ? 97   LEU B CD2 1 
ATOM   3515  N N   . LYS B 1 99  ? -24.398 18.628  68.037  1.00 17.84 ? 98   LYS B N   1 
ATOM   3516  C CA  . LYS B 1 99  ? -23.780 19.958  68.182  1.00 19.56 ? 98   LYS B CA  1 
ATOM   3517  C C   . LYS B 1 99  ? -23.690 20.357  69.652  1.00 19.92 ? 98   LYS B C   1 
ATOM   3518  O O   . LYS B 1 99  ? -22.670 20.916  70.083  1.00 20.41 ? 98   LYS B O   1 
ATOM   3519  C CB  . LYS B 1 99  ? -24.506 21.037  67.397  1.00 21.51 ? 98   LYS B CB  1 
ATOM   3520  C CG  . LYS B 1 99  ? -24.840 20.569  65.969  1.00 24.91 ? 98   LYS B CG  1 
ATOM   3521  C CD  . LYS B 1 99  ? -23.714 20.871  64.998  1.00 26.35 ? 98   LYS B CD  1 
ATOM   3522  C CE  . LYS B 1 99  ? -24.159 21.895  63.958  1.00 27.47 ? 98   LYS B CE  1 
ATOM   3523  N NZ  . LYS B 1 99  ? -23.009 22.718  63.519  1.00 27.06 ? 98   LYS B NZ  1 
ATOM   3524  N N   . LYS B 1 100 ? -24.732 20.045  70.388  1.00 20.32 ? 99   LYS B N   1 
ATOM   3525  C CA  . LYS B 1 100 ? -24.791 20.364  71.830  1.00 20.73 ? 99   LYS B CA  1 
ATOM   3526  C C   . LYS B 1 100 ? -23.658 19.697  72.583  1.00 20.06 ? 99   LYS B C   1 
ATOM   3527  O O   . LYS B 1 100 ? -23.083 20.281  73.535  1.00 20.52 ? 99   LYS B O   1 
ATOM   3528  C CB  . LYS B 1 100 ? -26.145 19.992  72.419  1.00 24.21 ? 99   LYS B CB  1 
ATOM   3529  C CG  . LYS B 1 100 ? -26.753 21.145  73.236  1.00 27.98 ? 99   LYS B CG  1 
ATOM   3530  C CD  . LYS B 1 100 ? -28.163 20.809  73.694  1.00 30.70 ? 99   LYS B CD  1 
ATOM   3531  C CE  . LYS B 1 100 ? -28.343 21.048  75.183  1.00 33.29 ? 99   LYS B CE  1 
ATOM   3532  N NZ  . LYS B 1 100 ? -29.332 20.052  75.721  1.00 34.50 ? 99   LYS B NZ  1 
ATOM   3533  N N   . LYS B 1 101 ? -23.291 18.506  72.162  1.00 19.17 ? 100  LYS B N   1 
ATOM   3534  C CA  . LYS B 1 101 ? -22.204 17.739  72.780  1.00 18.39 ? 100  LYS B CA  1 
ATOM   3535  C C   . LYS B 1 101 ? -20.832 18.149  72.273  1.00 17.89 ? 100  LYS B C   1 
ATOM   3536  O O   . LYS B 1 101 ? -19.809 17.562  72.692  1.00 17.55 ? 100  LYS B O   1 
ATOM   3537  C CB  . LYS B 1 101 ? -22.420 16.242  72.600  1.00 19.07 ? 100  LYS B CB  1 
ATOM   3538  C CG  . LYS B 1 101 ? -23.711 15.767  73.260  1.00 20.57 ? 100  LYS B CG  1 
ATOM   3539  C CD  . LYS B 1 101 ? -23.999 14.303  72.975  1.00 21.38 ? 100  LYS B CD  1 
ATOM   3540  C CE  . LYS B 1 101 ? -25.325 13.887  73.607  1.00 22.12 ? 100  LYS B CE  1 
ATOM   3541  N NZ  . LYS B 1 101 ? -25.620 12.472  73.290  1.00 20.64 ? 100  LYS B NZ  1 
ATOM   3542  N N   . GLY B 1 102 ? -20.805 19.131  71.404  1.00 16.95 ? 101  GLY B N   1 
ATOM   3543  C CA  . GLY B 1 102 ? -19.569 19.694  70.846  1.00 17.05 ? 101  GLY B CA  1 
ATOM   3544  C C   . GLY B 1 102 ? -18.968 18.791  69.775  1.00 16.43 ? 101  GLY B C   1 
ATOM   3545  O O   . GLY B 1 102 ? -17.749 18.840  69.535  1.00 17.36 ? 101  GLY B O   1 
ATOM   3546  N N   . ILE B 1 103 ? -19.809 17.993  69.138  1.00 15.06 ? 102  ILE B N   1 
ATOM   3547  C CA  . ILE B 1 103 ? -19.319 17.100  68.058  1.00 14.41 ? 102  ILE B CA  1 
ATOM   3548  C C   . ILE B 1 103 ? -19.534 17.788  66.718  1.00 14.07 ? 102  ILE B C   1 
ATOM   3549  O O   . ILE B 1 103 ? -20.603 18.388  66.511  1.00 14.05 ? 102  ILE B O   1 
ATOM   3550  C CB  . ILE B 1 103 ? -19.989 15.692  68.177  1.00 13.19 ? 102  ILE B CB  1 
ATOM   3551  C CG1 . ILE B 1 103 ? -19.607 15.076  69.544  1.00 13.17 ? 102  ILE B CG1 1 
ATOM   3552  C CG2 . ILE B 1 103 ? -19.635 14.755  67.000  1.00 12.98 ? 102  ILE B CG2 1 
ATOM   3553  C CD1 . ILE B 1 103 ? -20.291 13.741  69.902  1.00 14.81 ? 102  ILE B CD1 1 
ATOM   3554  N N   . ILE B 1 104 ? -18.534 17.690  65.857  1.00 13.38 ? 103  ILE B N   1 
ATOM   3555  C CA  . ILE B 1 104 ? -18.607 18.263  64.495  1.00 12.21 ? 103  ILE B CA  1 
ATOM   3556  C C   . ILE B 1 104 ? -19.315 17.309  63.541  1.00 10.66 ? 103  ILE B C   1 
ATOM   3557  O O   . ILE B 1 104 ? -19.148 16.083  63.618  1.00 10.62 ? 103  ILE B O   1 
ATOM   3558  C CB  . ILE B 1 104 ? -17.158 18.638  64.008  1.00 13.13 ? 103  ILE B CB  1 
ATOM   3559  C CG1 . ILE B 1 104 ? -16.531 19.649  65.001  1.00 13.54 ? 103  ILE B CG1 1 
ATOM   3560  C CG2 . ILE B 1 104 ? -17.118 19.208  62.562  1.00 13.19 ? 103  ILE B CG2 1 
ATOM   3561  C CD1 . ILE B 1 104 ? -14.984 19.795  64.850  1.00 14.00 ? 103  ILE B CD1 1 
ATOM   3562  N N   . LEU B 1 105 ? -20.113 17.875  62.637  1.00 10.15 ? 104  LEU B N   1 
ATOM   3563  C CA  . LEU B 1 105 ? -20.881 17.051  61.685  1.00 9.51  ? 104  LEU B CA  1 
ATOM   3564  C C   . LEU B 1 105 ? -20.170 16.999  60.317  1.00 8.83  ? 104  LEU B C   1 
ATOM   3565  O O   . LEU B 1 105 ? -19.767 18.048  59.805  1.00 8.12  ? 104  LEU B O   1 
ATOM   3566  C CB  . LEU B 1 105 ? -22.294 17.627  61.539  1.00 10.48 ? 104  LEU B CB  1 
ATOM   3567  C CG  . LEU B 1 105 ? -23.179 17.756  62.768  1.00 11.70 ? 104  LEU B CG  1 
ATOM   3568  C CD1 . LEU B 1 105 ? -24.513 18.381  62.381  1.00 13.30 ? 104  LEU B CD1 1 
ATOM   3569  C CD2 . LEU B 1 105 ? -23.413 16.364  63.354  1.00 12.03 ? 104  LEU B CD2 1 
ATOM   3570  N N   . GLY B 1 106 ? -20.152 15.809  59.791  1.00 9.75  ? 105  GLY B N   1 
ATOM   3571  C CA  . GLY B 1 106 ? -19.582 15.454  58.479  1.00 10.04 ? 105  GLY B CA  1 
ATOM   3572  C C   . GLY B 1 106 ? -20.666 14.751  57.658  1.00 9.88  ? 105  GLY B C   1 
ATOM   3573  O O   . GLY B 1 106 ? -21.614 14.184  58.219  1.00 10.05 ? 105  GLY B O   1 
ATOM   3574  N N   . ILE B 1 107 ? -20.510 14.807  56.346  1.00 9.55  ? 106  ILE B N   1 
ATOM   3575  C CA  . ILE B 1 107 ? -21.485 14.258  55.395  1.00 9.05  ? 106  ILE B CA  1 
ATOM   3576  C C   . ILE B 1 107 ? -20.787 13.494  54.270  1.00 8.83  ? 106  ILE B C   1 
ATOM   3577  O O   . ILE B 1 107 ? -19.777 13.967  53.736  1.00 8.69  ? 106  ILE B O   1 
ATOM   3578  C CB  . ILE B 1 107 ? -22.381 15.439  54.854  1.00 8.94  ? 106  ILE B CB  1 
ATOM   3579  C CG1 . ILE B 1 107 ? -23.458 14.904  53.875  1.00 8.25  ? 106  ILE B CG1 1 
ATOM   3580  C CG2 . ILE B 1 107 ? -21.576 16.582  54.186  1.00 9.72  ? 106  ILE B CG2 1 
ATOM   3581  C CD1 . ILE B 1 107 ? -24.464 13.906  54.492  1.00 9.74  ? 106  ILE B CD1 1 
ATOM   3582  N N   . LYS B 1 108 ? -21.322 12.331  53.944  1.00 9.15  ? 107  LYS B N   1 
ATOM   3583  C CA  . LYS B 1 108 ? -20.815 11.531  52.804  1.00 8.95  ? 107  LYS B CA  1 
ATOM   3584  C C   . LYS B 1 108 ? -21.423 12.130  51.527  1.00 8.53  ? 107  LYS B C   1 
ATOM   3585  O O   . LYS B 1 108 ? -22.666 12.270  51.456  1.00 8.14  ? 107  LYS B O   1 
ATOM   3586  C CB  . LYS B 1 108 ? -21.155 10.071  52.948  1.00 11.22 ? 107  LYS B CB  1 
ATOM   3587  C CG  . LYS B 1 108 ? -20.635 9.227   51.762  1.00 12.79 ? 107  LYS B CG  1 
ATOM   3588  C CD  . LYS B 1 108 ? -21.763 8.430   51.146  1.00 15.11 ? 107  LYS B CD  1 
ATOM   3589  C CE  . LYS B 1 108 ? -22.343 7.381   52.056  1.00 16.96 ? 107  LYS B CE  1 
ATOM   3590  N NZ  . LYS B 1 108 ? -21.375 6.269   52.276  1.00 19.53 ? 107  LYS B NZ  1 
ATOM   3591  N N   . VAL B 1 109 ? -20.565 12.519  50.590  1.00 7.89  ? 108  VAL B N   1 
ATOM   3592  C CA  . VAL B 1 109 ? -21.033 13.246  49.401  1.00 7.82  ? 108  VAL B CA  1 
ATOM   3593  C C   . VAL B 1 109 ? -20.836 12.494  48.083  1.00 8.73  ? 108  VAL B C   1 
ATOM   3594  O O   . VAL B 1 109 ? -21.413 12.982  47.081  1.00 9.14  ? 108  VAL B O   1 
ATOM   3595  C CB  . VAL B 1 109 ? -20.468 14.663  49.284  1.00 6.04  ? 108  VAL B CB  1 
ATOM   3596  C CG1 . VAL B 1 109 ? -20.930 15.628  50.374  1.00 6.02  ? 108  VAL B CG1 1 
ATOM   3597  C CG2 . VAL B 1 109 ? -18.950 14.680  49.136  1.00 5.28  ? 108  VAL B CG2 1 
ATOM   3598  N N   . ASP B 1 110 ? -20.093 11.428  48.076  1.00 8.72  ? 109  ASP B N   1 
ATOM   3599  C CA  . ASP B 1 110 ? -19.906 10.645  46.831  1.00 9.33  ? 109  ASP B CA  1 
ATOM   3600  C C   . ASP B 1 110 ? -21.197 9.892   46.500  1.00 9.87  ? 109  ASP B C   1 
ATOM   3601  O O   . ASP B 1 110 ? -22.054 9.647   47.372  1.00 9.13  ? 109  ASP B O   1 
ATOM   3602  C CB  . ASP B 1 110 ? -18.690 9.744   46.901  1.00 8.94  ? 109  ASP B CB  1 
ATOM   3603  C CG  . ASP B 1 110 ? -18.812 8.550   47.806  1.00 10.10 ? 109  ASP B CG  1 
ATOM   3604  O OD1 . ASP B 1 110 ? -19.533 7.597   47.408  1.00 10.31 ? 109  ASP B OD1 1 
ATOM   3605  O OD2 . ASP B 1 110 ? -18.190 8.524   48.888  1.00 10.08 ? 109  ASP B OD2 1 
ATOM   3606  N N   . LYS B 1 111 ? -21.256 9.505   45.227  1.00 9.40  ? 110  LYS B N   1 
ATOM   3607  C CA  . LYS B 1 111 ? -22.388 8.739   44.701  1.00 10.00 ? 110  LYS B CA  1 
ATOM   3608  C C   . LYS B 1 111 ? -21.982 7.335   44.277  1.00 9.95  ? 110  LYS B C   1 
ATOM   3609  O O   . LYS B 1 111 ? -22.590 6.710   43.381  1.00 10.31 ? 110  LYS B O   1 
ATOM   3610  C CB  . LYS B 1 111 ? -23.127 9.479   43.597  1.00 11.53 ? 110  LYS B CB  1 
ATOM   3611  C CG  . LYS B 1 111 ? -23.839 10.781  43.957  1.00 14.35 ? 110  LYS B CG  1 
ATOM   3612  C CD  . LYS B 1 111 ? -24.426 11.420  42.694  1.00 16.77 ? 110  LYS B CD  1 
ATOM   3613  C CE  . LYS B 1 111 ? -24.603 12.902  42.743  1.00 19.42 ? 110  LYS B CE  1 
ATOM   3614  N NZ  . LYS B 1 111 ? -24.885 13.531  41.415  1.00 18.12 ? 110  LYS B NZ  1 
ATOM   3615  N N   . GLY B 1 112 ? -20.968 6.788   44.923  1.00 9.21  ? 111  GLY B N   1 
ATOM   3616  C CA  . GLY B 1 112 ? -20.565 5.388   44.762  1.00 10.04 ? 111  GLY B CA  1 
ATOM   3617  C C   . GLY B 1 112 ? -19.614 5.197   43.574  1.00 9.00  ? 111  GLY B C   1 
ATOM   3618  O O   . GLY B 1 112 ? -19.288 6.184   42.902  1.00 8.76  ? 111  GLY B O   1 
ATOM   3619  N N   . VAL B 1 113 ? -19.215 3.966   43.358  1.00 9.23  ? 112  VAL B N   1 
ATOM   3620  C CA  . VAL B 1 113 ? -18.218 3.660   42.305  1.00 9.19  ? 112  VAL B CA  1 
ATOM   3621  C C   . VAL B 1 113 ? -18.908 3.256   40.993  1.00 8.76  ? 112  VAL B C   1 
ATOM   3622  O O   . VAL B 1 113 ? -20.054 2.789   40.948  1.00 7.85  ? 112  VAL B O   1 
ATOM   3623  C CB  . VAL B 1 113 ? -17.159 2.667   42.763  1.00 8.02  ? 112  VAL B CB  1 
ATOM   3624  C CG1 . VAL B 1 113 ? -16.436 3.045   44.055  1.00 8.38  ? 112  VAL B CG1 1 
ATOM   3625  C CG2 . VAL B 1 113 ? -17.652 1.228   42.812  1.00 10.38 ? 112  VAL B CG2 1 
ATOM   3626  N N   . VAL B 1 114 ? -18.156 3.479   39.923  1.00 8.37  ? 113  VAL B N   1 
ATOM   3627  C CA  . VAL B 1 114 ? -18.575 3.114   38.555  1.00 7.63  ? 113  VAL B CA  1 
ATOM   3628  C C   . VAL B 1 114 ? -17.343 2.506   37.846  1.00 7.82  ? 113  VAL B C   1 
ATOM   3629  O O   . VAL B 1 114 ? -16.215 2.963   38.083  1.00 8.04  ? 113  VAL B O   1 
ATOM   3630  C CB  . VAL B 1 114 ? -19.170 4.294   37.798  1.00 6.68  ? 113  VAL B CB  1 
ATOM   3631  C CG1 . VAL B 1 114 ? -20.510 4.802   38.340  1.00 8.40  ? 113  VAL B CG1 1 
ATOM   3632  C CG2 . VAL B 1 114 ? -18.197 5.447   37.657  1.00 5.37  ? 113  VAL B CG2 1 
ATOM   3633  N N   . PRO B 1 115 ? -17.597 1.557   36.972  1.00 8.07  ? 114  PRO B N   1 
ATOM   3634  C CA  . PRO B 1 115 ? -16.558 0.865   36.227  1.00 8.04  ? 114  PRO B CA  1 
ATOM   3635  C C   . PRO B 1 115 ? -15.850 1.712   35.185  1.00 7.75  ? 114  PRO B C   1 
ATOM   3636  O O   . PRO B 1 115 ? -16.399 2.611   34.527  1.00 8.69  ? 114  PRO B O   1 
ATOM   3637  C CB  . PRO B 1 115 ? -17.267 -0.347  35.630  1.00 8.57  ? 114  PRO B CB  1 
ATOM   3638  C CG  . PRO B 1 115 ? -18.736 -0.100  35.743  1.00 8.97  ? 114  PRO B CG  1 
ATOM   3639  C CD  . PRO B 1 115 ? -18.954 1.197   36.479  1.00 8.19  ? 114  PRO B CD  1 
ATOM   3640  N N   . LEU B 1 116 ? -14.550 1.457   35.081  1.00 8.02  ? 115  LEU B N   1 
ATOM   3641  C CA  . LEU B 1 116 ? -13.682 2.068   34.048  1.00 7.37  ? 115  LEU B CA  1 
ATOM   3642  C C   . LEU B 1 116 ? -13.710 1.090   32.859  1.00 6.91  ? 115  LEU B C   1 
ATOM   3643  O O   . LEU B 1 116 ? -13.161 -0.007  32.881  1.00 6.12  ? 115  LEU B O   1 
ATOM   3644  C CB  . LEU B 1 116 ? -12.298 2.375   34.590  1.00 7.74  ? 115  LEU B CB  1 
ATOM   3645  C CG  . LEU B 1 116 ? -12.145 3.420   35.680  1.00 7.45  ? 115  LEU B CG  1 
ATOM   3646  C CD1 . LEU B 1 116 ? -10.727 3.407   36.264  1.00 9.69  ? 115  LEU B CD1 1 
ATOM   3647  C CD2 . LEU B 1 116 ? -12.460 4.796   35.116  1.00 7.63  ? 115  LEU B CD2 1 
ATOM   3648  N N   . PHE B 1 117 ? -14.428 1.542   31.840  1.00 7.88  ? 116  PHE B N   1 
ATOM   3649  C CA  . PHE B 1 117 ? -14.651 0.712   30.635  1.00 8.73  ? 116  PHE B CA  1 
ATOM   3650  C C   . PHE B 1 117 ? -13.288 0.398   30.010  1.00 9.15  ? 116  PHE B C   1 
ATOM   3651  O O   . PHE B 1 117 ? -12.486 1.324   29.815  1.00 10.48 ? 116  PHE B O   1 
ATOM   3652  C CB  . PHE B 1 117 ? -15.635 1.386   29.690  1.00 9.53  ? 116  PHE B CB  1 
ATOM   3653  C CG  . PHE B 1 117 ? -16.013 0.540   28.503  1.00 9.94  ? 116  PHE B CG  1 
ATOM   3654  C CD1 . PHE B 1 117 ? -16.538 -0.735  28.735  1.00 12.50 ? 116  PHE B CD1 1 
ATOM   3655  C CD2 . PHE B 1 117 ? -15.862 1.023   27.215  1.00 12.62 ? 116  PHE B CD2 1 
ATOM   3656  C CE1 . PHE B 1 117 ? -16.908 -1.554  27.670  1.00 13.52 ? 116  PHE B CE1 1 
ATOM   3657  C CE2 . PHE B 1 117 ? -16.246 0.223   26.121  1.00 12.61 ? 116  PHE B CE2 1 
ATOM   3658  C CZ  . PHE B 1 117 ? -16.760 -1.054  26.371  1.00 13.56 ? 116  PHE B CZ  1 
ATOM   3659  N N   . GLY B 1 118 ? -13.059 -0.874  29.784  1.00 9.18  ? 117  GLY B N   1 
ATOM   3660  C CA  . GLY B 1 118 ? -11.840 -1.406  29.197  1.00 10.45 ? 117  GLY B CA  1 
ATOM   3661  C C   . GLY B 1 118 ? -10.774 -1.769  30.222  1.00 11.28 ? 117  GLY B C   1 
ATOM   3662  O O   . GLY B 1 118 ? -9.795  -2.476  29.871  1.00 11.73 ? 117  GLY B O   1 
ATOM   3663  N N   . SER B 1 119 ? -10.949 -1.307  31.458  1.00 10.95 ? 118  SER B N   1 
ATOM   3664  C CA  . SER B 1 119 ? -9.989  -1.646  32.534  1.00 10.50 ? 118  SER B CA  1 
ATOM   3665  C C   . SER B 1 119 ? -10.196 -3.105  32.917  1.00 10.59 ? 118  SER B C   1 
ATOM   3666  O O   . SER B 1 119 ? -11.213 -3.720  32.576  1.00 10.58 ? 118  SER B O   1 
ATOM   3667  C CB  . SER B 1 119 ? -10.177 -0.762  33.770  1.00 9.10  ? 118  SER B CB  1 
ATOM   3668  O OG  . SER B 1 119 ? -11.371 -1.128  34.458  1.00 8.05  ? 118  SER B OG  1 
ATOM   3669  N N   . GLU B 1 120 ? -9.227  -3.647  33.645  1.00 11.42 ? 119  GLU B N   1 
ATOM   3670  C CA  . GLU B 1 120 ? -9.345  -4.993  34.221  1.00 11.28 ? 119  GLU B CA  1 
ATOM   3671  C C   . GLU B 1 120 ? -10.069 -4.900  35.562  1.00 11.99 ? 119  GLU B C   1 
ATOM   3672  O O   . GLU B 1 120 ? -9.475  -5.019  36.652  1.00 11.88 ? 119  GLU B O   1 
ATOM   3673  C CB  . GLU B 1 120 ? -7.980  -5.644  34.435  1.00 13.16 ? 119  GLU B CB  1 
ATOM   3674  C CG  . GLU B 1 120 ? -7.092  -5.664  33.180  1.00 13.82 ? 119  GLU B CG  1 
ATOM   3675  C CD  . GLU B 1 120 ? -5.874  -6.520  33.243  1.00 16.01 ? 119  GLU B CD  1 
ATOM   3676  O OE1 . GLU B 1 120 ? -5.078  -6.170  34.138  1.00 18.84 ? 119  GLU B OE1 1 
ATOM   3677  O OE2 . GLU B 1 120 ? -5.645  -7.447  32.493  1.00 16.78 ? 119  GLU B OE2 1 
ATOM   3678  N N   . ASP B 1 121 ? -11.347 -4.598  35.458  1.00 11.48 ? 120  ASP B N   1 
ATOM   3679  C CA  . ASP B 1 121 ? -12.248 -4.546  36.604  1.00 12.13 ? 120  ASP B CA  1 
ATOM   3680  C C   . ASP B 1 121 ? -11.944 -3.470  37.625  1.00 10.68 ? 120  ASP B C   1 
ATOM   3681  O O   . ASP B 1 121 ? -12.081 -3.763  38.847  1.00 10.78 ? 120  ASP B O   1 
ATOM   3682  C CB  . ASP B 1 121 ? -12.159 -5.947  37.282  1.00 17.73 ? 120  ASP B CB  1 
ATOM   3683  C CG  . ASP B 1 121 ? -13.564 -6.526  37.389  1.00 23.39 ? 120  ASP B CG  1 
ATOM   3684  O OD1 . ASP B 1 121 ? -14.041 -7.123  36.409  1.00 26.01 ? 120  ASP B OD1 1 
ATOM   3685  O OD2 . ASP B 1 121 ? -14.118 -6.329  38.491  1.00 24.26 ? 120  ASP B OD2 1 
ATOM   3686  N N   . GLU B 1 122 ? -11.555 -2.301  37.201  1.00 9.12  ? 121  GLU B N   1 
ATOM   3687  C CA  . GLU B 1 122 ? -11.262 -1.184  38.110  1.00 8.13  ? 121  GLU B CA  1 
ATOM   3688  C C   . GLU B 1 122 ? -12.352 -0.135  38.027  1.00 7.45  ? 121  GLU B C   1 
ATOM   3689  O O   . GLU B 1 122 ? -13.147 -0.150  37.073  1.00 7.26  ? 121  GLU B O   1 
ATOM   3690  C CB  . GLU B 1 122 ? -9.920  -0.532  37.771  1.00 9.05  ? 121  GLU B CB  1 
ATOM   3691  C CG  . GLU B 1 122 ? -8.727  -1.496  37.811  1.00 7.84  ? 121  GLU B CG  1 
ATOM   3692  C CD  . GLU B 1 122 ? -7.394  -0.855  37.623  1.00 8.81  ? 121  GLU B CD  1 
ATOM   3693  O OE1 . GLU B 1 122 ? -7.155  -0.587  36.423  1.00 8.34  ? 121  GLU B OE1 1 
ATOM   3694  O OE2 . GLU B 1 122 ? -6.635  -0.587  38.535  1.00 9.46  ? 121  GLU B OE2 1 
ATOM   3695  N N   . VAL B 1 123 ? -12.380 0.754   38.992  1.00 5.93  ? 122  VAL B N   1 
ATOM   3696  C CA  . VAL B 1 123 ? -13.430 1.751   39.152  1.00 6.12  ? 122  VAL B CA  1 
ATOM   3697  C C   . VAL B 1 123 ? -12.869 3.128   39.486  1.00 5.31  ? 122  VAL B C   1 
ATOM   3698  O O   . VAL B 1 123 ? -11.701 3.295   39.830  1.00 5.36  ? 122  VAL B O   1 
ATOM   3699  C CB  . VAL B 1 123 ? -14.409 1.307   40.291  1.00 6.89  ? 122  VAL B CB  1 
ATOM   3700  C CG1 . VAL B 1 123 ? -14.996 -0.064  40.034  1.00 6.15  ? 122  VAL B CG1 1 
ATOM   3701  C CG2 . VAL B 1 123 ? -13.692 1.335   41.639  1.00 4.92  ? 122  VAL B CG2 1 
ATOM   3702  N N   . THR B 1 124 ? -13.786 4.072   39.381  1.00 5.04  ? 123  THR B N   1 
ATOM   3703  C CA  . THR B 1 124 ? -13.595 5.458   39.831  1.00 4.92  ? 123  THR B CA  1 
ATOM   3704  C C   . THR B 1 124 ? -14.845 5.822   40.636  1.00 4.53  ? 123  THR B C   1 
ATOM   3705  O O   . THR B 1 124 ? -15.779 4.999   40.722  1.00 5.58  ? 123  THR B O   1 
ATOM   3706  C CB  . THR B 1 124 ? -13.270 6.466   38.687  1.00 4.61  ? 123  THR B CB  1 
ATOM   3707  O OG1 . THR B 1 124 ? -12.838 7.714   39.352  1.00 4.57  ? 123  THR B OG1 1 
ATOM   3708  C CG2 . THR B 1 124 ? -14.454 6.776   37.740  1.00 6.11  ? 123  THR B CG2 1 
ATOM   3709  N N   . THR B 1 125 ? -14.866 6.999   41.206  1.00 4.76  ? 124  THR B N   1 
ATOM   3710  C CA  . THR B 1 125 ? -16.041 7.387   42.013  1.00 5.37  ? 124  THR B CA  1 
ATOM   3711  C C   . THR B 1 125 ? -16.756 8.560   41.361  1.00 5.54  ? 124  THR B C   1 
ATOM   3712  O O   . THR B 1 125 ? -16.072 9.456   40.847  1.00 5.83  ? 124  THR B O   1 
ATOM   3713  C CB  . THR B 1 125 ? -15.602 7.729   43.504  1.00 5.37  ? 124  THR B CB  1 
ATOM   3714  O OG1 . THR B 1 125 ? -15.064 6.478   44.021  1.00 4.58  ? 124  THR B OG1 1 
ATOM   3715  C CG2 . THR B 1 125 ? -16.763 8.276   44.333  1.00 5.40  ? 124  THR B CG2 1 
ATOM   3716  N N   . GLN B 1 126 ? -18.076 8.510   41.416  1.00 4.97  ? 125  GLN B N   1 
ATOM   3717  C CA  . GLN B 1 126 ? -18.920 9.585   40.854  1.00 5.19  ? 125  GLN B CA  1 
ATOM   3718  C C   . GLN B 1 126 ? -19.530 10.423  41.977  1.00 5.87  ? 125  GLN B C   1 
ATOM   3719  O O   . GLN B 1 126 ? -19.429 10.038  43.164  1.00 5.83  ? 125  GLN B O   1 
ATOM   3720  C CB  . GLN B 1 126 ? -19.965 9.005   39.894  1.00 6.50  ? 125  GLN B CB  1 
ATOM   3721  C CG  . GLN B 1 126 ? -21.009 8.107   40.486  1.00 6.94  ? 125  GLN B CG  1 
ATOM   3722  C CD  . GLN B 1 126 ? -22.250 7.934   39.638  1.00 10.47 ? 125  GLN B CD  1 
ATOM   3723  O OE1 . GLN B 1 126 ? -22.243 8.144   38.421  1.00 9.72  ? 125  GLN B OE1 1 
ATOM   3724  N NE2 . GLN B 1 126 ? -23.339 7.538   40.298  1.00 10.71 ? 125  GLN B NE2 1 
ATOM   3725  N N   . GLY B 1 127 ? -20.090 11.562  41.583  1.00 5.52  ? 126  GLY B N   1 
ATOM   3726  C CA  . GLY B 1 127 ? -20.711 12.505  42.500  1.00 5.69  ? 126  GLY B CA  1 
ATOM   3727  C C   . GLY B 1 127 ? -20.318 13.939  42.451  1.00 4.98  ? 126  GLY B C   1 
ATOM   3728  O O   . GLY B 1 127 ? -20.704 14.744  43.340  1.00 5.16  ? 126  GLY B O   1 
ATOM   3729  N N   . LEU B 1 128 ? -19.555 14.399  41.437  1.00 4.46  ? 127  LEU B N   1 
ATOM   3730  C CA  . LEU B 1 128 ? -19.197 15.800  41.318  1.00 4.59  ? 127  LEU B CA  1 
ATOM   3731  C C   . LEU B 1 128 ? -20.339 16.704  40.861  1.00 4.24  ? 127  LEU B C   1 
ATOM   3732  O O   . LEU B 1 128 ? -20.284 17.930  41.039  1.00 3.68  ? 127  LEU B O   1 
ATOM   3733  C CB  . LEU B 1 128 ? -18.000 15.918  40.340  1.00 5.33  ? 127  LEU B CB  1 
ATOM   3734  C CG  . LEU B 1 128 ? -16.721 15.159  40.665  1.00 5.26  ? 127  LEU B CG  1 
ATOM   3735  C CD1 . LEU B 1 128 ? -15.713 15.354  39.518  1.00 4.67  ? 127  LEU B CD1 1 
ATOM   3736  C CD2 . LEU B 1 128 ? -16.142 15.725  41.962  1.00 4.41  ? 127  LEU B CD2 1 
ATOM   3737  N N   . ASP B 1 129 ? -21.333 16.142  40.201  1.00 5.45  ? 128  ASP B N   1 
ATOM   3738  C CA  . ASP B 1 129 ? -22.395 16.979  39.583  1.00 5.92  ? 128  ASP B CA  1 
ATOM   3739  C C   . ASP B 1 129 ? -23.173 17.722  40.678  1.00 6.76  ? 128  ASP B C   1 
ATOM   3740  O O   . ASP B 1 129 ? -23.680 17.051  41.590  1.00 7.53  ? 128  ASP B O   1 
ATOM   3741  C CB  . ASP B 1 129 ? -23.315 16.145  38.694  1.00 5.96  ? 128  ASP B CB  1 
ATOM   3742  C CG  . ASP B 1 129 ? -22.607 15.604  37.465  1.00 6.27  ? 128  ASP B CG  1 
ATOM   3743  O OD1 . ASP B 1 129 ? -21.427 15.904  37.250  1.00 6.93  ? 128  ASP B OD1 1 
ATOM   3744  O OD2 . ASP B 1 129 ? -23.274 14.831  36.750  1.00 6.07  ? 128  ASP B OD2 1 
ATOM   3745  N N   . ASP B 1 130 ? -23.225 19.006  40.528  1.00 6.93  ? 129  ASP B N   1 
ATOM   3746  C CA  . ASP B 1 130 ? -23.875 19.954  41.424  1.00 9.12  ? 129  ASP B CA  1 
ATOM   3747  C C   . ASP B 1 130 ? -23.329 19.853  42.854  1.00 8.54  ? 129  ASP B C   1 
ATOM   3748  O O   . ASP B 1 130 ? -24.038 20.235  43.797  1.00 7.26  ? 129  ASP B O   1 
ATOM   3749  C CB  . ASP B 1 130 ? -25.416 19.833  41.393  1.00 11.35 ? 129  ASP B CB  1 
ATOM   3750  C CG  . ASP B 1 130 ? -25.951 20.006  39.977  1.00 13.70 ? 129  ASP B CG  1 
ATOM   3751  O OD1 . ASP B 1 130 ? -25.708 21.010  39.312  1.00 14.57 ? 129  ASP B OD1 1 
ATOM   3752  O OD2 . ASP B 1 130 ? -26.621 19.052  39.534  1.00 17.17 ? 129  ASP B OD2 1 
ATOM   3753  N N   . LEU B 1 131 ? -22.086 19.395  42.983  1.00 9.26  ? 130  LEU B N   1 
ATOM   3754  C CA  . LEU B 1 131 ? -21.510 19.225  44.323  1.00 8.55  ? 130  LEU B CA  1 
ATOM   3755  C C   . LEU B 1 131 ? -21.420 20.534  45.074  1.00 8.57  ? 130  LEU B C   1 
ATOM   3756  O O   . LEU B 1 131 ? -21.648 20.517  46.318  1.00 8.30  ? 130  LEU B O   1 
ATOM   3757  C CB  . LEU B 1 131 ? -20.204 18.420  44.254  1.00 8.94  ? 130  LEU B CB  1 
ATOM   3758  C CG  . LEU B 1 131 ? -19.544 18.131  45.604  1.00 6.58  ? 130  LEU B CG  1 
ATOM   3759  C CD1 . LEU B 1 131 ? -20.402 17.184  46.437  1.00 7.88  ? 130  LEU B CD1 1 
ATOM   3760  C CD2 . LEU B 1 131 ? -18.176 17.496  45.318  1.00 5.93  ? 130  LEU B CD2 1 
ATOM   3761  N N   . ALA B 1 132 ? -21.141 21.635  44.388  1.00 8.10  ? 131  ALA B N   1 
ATOM   3762  C CA  . ALA B 1 132 ? -20.992 22.926  45.053  1.00 8.20  ? 131  ALA B CA  1 
ATOM   3763  C C   . ALA B 1 132 ? -22.291 23.354  45.743  1.00 9.02  ? 131  ALA B C   1 
ATOM   3764  O O   . ALA B 1 132 ? -22.281 23.846  46.881  1.00 7.57  ? 131  ALA B O   1 
ATOM   3765  C CB  . ALA B 1 132 ? -20.451 23.981  44.111  1.00 10.60 ? 131  ALA B CB  1 
ATOM   3766  N N   . ALA B 1 133 ? -23.388 23.180  45.018  1.00 8.75  ? 132  ALA B N   1 
ATOM   3767  C CA  . ALA B 1 133 ? -24.725 23.486  45.519  1.00 8.67  ? 132  ALA B CA  1 
ATOM   3768  C C   . ALA B 1 133 ? -25.059 22.586  46.708  1.00 8.64  ? 132  ALA B C   1 
ATOM   3769  O O   . ALA B 1 133 ? -25.540 23.135  47.722  1.00 8.96  ? 132  ALA B O   1 
ATOM   3770  C CB  . ALA B 1 133 ? -25.763 23.392  44.407  1.00 10.50 ? 132  ALA B CB  1 
ATOM   3771  N N   . ARG B 1 134 ? -24.795 21.305  46.576  1.00 8.78  ? 133  ARG B N   1 
ATOM   3772  C CA  . ARG B 1 134 ? -25.044 20.329  47.650  1.00 9.56  ? 133  ARG B CA  1 
ATOM   3773  C C   . ARG B 1 134 ? -24.231 20.708  48.900  1.00 9.69  ? 133  ARG B C   1 
ATOM   3774  O O   . ARG B 1 134 ? -24.794 20.677  50.006  1.00 8.93  ? 133  ARG B O   1 
ATOM   3775  C CB  . ARG B 1 134 ? -24.805 18.892  47.229  1.00 11.71 ? 133  ARG B CB  1 
ATOM   3776  C CG  . ARG B 1 134 ? -25.666 18.350  46.097  1.00 12.42 ? 133  ARG B CG  1 
ATOM   3777  C CD  . ARG B 1 134 ? -25.284 16.947  45.735  1.00 14.73 ? 133  ARG B CD  1 
ATOM   3778  N NE  . ARG B 1 134 ? -25.357 16.062  46.881  1.00 17.11 ? 133  ARG B NE  1 
ATOM   3779  C CZ  . ARG B 1 134 ? -24.568 15.024  47.131  1.00 18.15 ? 133  ARG B CZ  1 
ATOM   3780  N NH1 . ARG B 1 134 ? -23.583 14.675  46.296  1.00 15.70 ? 133  ARG B NH1 1 
ATOM   3781  N NH2 . ARG B 1 134 ? -24.750 14.300  48.254  1.00 17.83 ? 133  ARG B NH2 1 
ATOM   3782  N N   . CYS B 1 135 ? -22.989 21.093  48.715  1.00 9.32  ? 134  CYS B N   1 
ATOM   3783  C CA  . CYS B 1 135 ? -22.097 21.513  49.798  1.00 10.19 ? 134  CYS B CA  1 
ATOM   3784  C C   . CYS B 1 135 ? -22.604 22.763  50.500  1.00 10.23 ? 134  CYS B C   1 
ATOM   3785  O O   . CYS B 1 135 ? -22.551 22.829  51.756  1.00 10.13 ? 134  CYS B O   1 
ATOM   3786  C CB  . CYS B 1 135 ? -20.641 21.655  49.326  1.00 9.98  ? 134  CYS B CB  1 
ATOM   3787  S SG  . CYS B 1 135 ? -19.767 20.072  49.200  1.00 12.56 ? 134  CYS B SG  1 
ATOM   3788  N N   . ALA B 1 136 ? -23.076 23.736  49.729  1.00 9.99  ? 135  ALA B N   1 
ATOM   3789  C CA  . ALA B 1 136 ? -23.604 24.975  50.305  1.00 10.14 ? 135  ALA B CA  1 
ATOM   3790  C C   . ALA B 1 136 ? -24.833 24.666  51.166  1.00 9.44  ? 135  ALA B C   1 
ATOM   3791  O O   . ALA B 1 136 ? -25.024 25.354  52.187  1.00 9.49  ? 135  ALA B O   1 
ATOM   3792  C CB  . ALA B 1 136 ? -23.888 26.055  49.278  1.00 8.67  ? 135  ALA B CB  1 
ATOM   3793  N N   . GLN B 1 137 ? -25.624 23.701  50.750  1.00 9.97  ? 136  GLN B N   1 
ATOM   3794  C CA  . GLN B 1 137 ? -26.825 23.315  51.542  1.00 10.64 ? 136  GLN B CA  1 
ATOM   3795  C C   . GLN B 1 137 ? -26.368 22.586  52.816  1.00 10.66 ? 136  GLN B C   1 
ATOM   3796  O O   . GLN B 1 137 ? -26.840 22.930  53.922  1.00 10.73 ? 136  GLN B O   1 
ATOM   3797  C CB  . GLN B 1 137 ? -27.840 22.513  50.763  1.00 10.32 ? 136  GLN B CB  1 
ATOM   3798  C CG  . GLN B 1 137 ? -29.090 22.090  51.506  1.00 13.47 ? 136  GLN B CG  1 
ATOM   3799  C CD  . GLN B 1 137 ? -30.027 23.215  51.854  1.00 15.44 ? 136  GLN B CD  1 
ATOM   3800  O OE1 . GLN B 1 137 ? -30.263 24.138  51.069  1.00 15.64 ? 136  GLN B OE1 1 
ATOM   3801  N NE2 . GLN B 1 137 ? -30.572 23.183  53.074  1.00 14.61 ? 136  GLN B NE2 1 
ATOM   3802  N N   . TYR B 1 138 ? -25.481 21.625  52.652  1.00 10.23 ? 137  TYR B N   1 
ATOM   3803  C CA  . TYR B 1 138 ? -24.958 20.843  53.791  1.00 10.85 ? 137  TYR B CA  1 
ATOM   3804  C C   . TYR B 1 138 ? -24.322 21.750  54.833  1.00 10.92 ? 137  TYR B C   1 
ATOM   3805  O O   . TYR B 1 138 ? -24.500 21.479  56.055  1.00 11.17 ? 137  TYR B O   1 
ATOM   3806  C CB  . TYR B 1 138 ? -24.020 19.708  53.361  1.00 8.19  ? 137  TYR B CB  1 
ATOM   3807  C CG  . TYR B 1 138 ? -24.648 18.541  52.645  1.00 8.53  ? 137  TYR B CG  1 
ATOM   3808  C CD1 . TYR B 1 138 ? -25.854 17.979  53.076  1.00 6.83  ? 137  TYR B CD1 1 
ATOM   3809  C CD2 . TYR B 1 138 ? -24.024 17.965  51.527  1.00 6.71  ? 137  TYR B CD2 1 
ATOM   3810  C CE1 . TYR B 1 138 ? -26.420 16.899  52.437  1.00 8.30  ? 137  TYR B CE1 1 
ATOM   3811  C CE2 . TYR B 1 138 ? -24.589 16.881  50.861  1.00 8.67  ? 137  TYR B CE2 1 
ATOM   3812  C CZ  . TYR B 1 138 ? -25.798 16.363  51.299  1.00 8.50  ? 137  TYR B CZ  1 
ATOM   3813  O OH  . TYR B 1 138 ? -26.340 15.295  50.652  1.00 8.00  ? 137  TYR B OH  1 
ATOM   3814  N N   . LYS B 1 139 ? -23.635 22.784  54.416  1.00 11.00 ? 138  LYS B N   1 
ATOM   3815  C CA  . LYS B 1 139 ? -22.937 23.722  55.298  1.00 11.29 ? 138  LYS B CA  1 
ATOM   3816  C C   . LYS B 1 139 ? -23.947 24.520  56.125  1.00 12.49 ? 138  LYS B C   1 
ATOM   3817  O O   . LYS B 1 139 ? -23.753 24.708  57.333  1.00 12.23 ? 138  LYS B O   1 
ATOM   3818  C CB  . LYS B 1 139 ? -22.013 24.687  54.576  1.00 10.46 ? 138  LYS B CB  1 
ATOM   3819  C CG  . LYS B 1 139 ? -21.250 25.687  55.441  1.00 9.71  ? 138  LYS B CG  1 
ATOM   3820  C CD  . LYS B 1 139 ? -20.089 25.097  56.220  1.00 8.24  ? 138  LYS B CD  1 
ATOM   3821  C CE  . LYS B 1 139 ? -19.239 26.194  56.875  1.00 7.81  ? 138  LYS B CE  1 
ATOM   3822  N NZ  . LYS B 1 139 ? -18.052 25.586  57.548  1.00 8.26  ? 138  LYS B NZ  1 
ATOM   3823  N N   . LYS B 1 140 ? -24.981 24.971  55.444  1.00 12.24 ? 139  LYS B N   1 
ATOM   3824  C CA  . LYS B 1 140 ? -26.107 25.684  56.067  1.00 13.98 ? 139  LYS B CA  1 
ATOM   3825  C C   . LYS B 1 140 ? -26.829 24.797  57.069  1.00 13.60 ? 139  LYS B C   1 
ATOM   3826  O O   . LYS B 1 140 ? -27.364 25.284  58.083  1.00 14.57 ? 139  LYS B O   1 
ATOM   3827  C CB  . LYS B 1 140 ? -27.069 26.083  54.950  1.00 17.52 ? 139  LYS B CB  1 
ATOM   3828  C CG  . LYS B 1 140 ? -27.927 27.308  55.131  1.00 21.68 ? 139  LYS B CG  1 
ATOM   3829  C CD  . LYS B 1 140 ? -28.450 27.809  53.777  1.00 24.32 ? 139  LYS B CD  1 
ATOM   3830  C CE  . LYS B 1 140 ? -27.301 28.322  52.916  1.00 25.84 ? 139  LYS B CE  1 
ATOM   3831  N NZ  . LYS B 1 140 ? -27.805 28.687  51.562  1.00 26.81 ? 139  LYS B NZ  1 
ATOM   3832  N N   . ASP B 1 141 ? -26.892 23.506  56.812  1.00 13.24 ? 140  ASP B N   1 
ATOM   3833  C CA  . ASP B 1 141 ? -27.593 22.541  57.659  1.00 13.33 ? 140  ASP B CA  1 
ATOM   3834  C C   . ASP B 1 141 ? -26.684 22.002  58.763  1.00 13.44 ? 140  ASP B C   1 
ATOM   3835  O O   . ASP B 1 141 ? -27.065 21.006  59.414  1.00 14.40 ? 140  ASP B O   1 
ATOM   3836  C CB  . ASP B 1 141 ? -28.277 21.447  56.840  1.00 12.73 ? 140  ASP B CB  1 
ATOM   3837  C CG  . ASP B 1 141 ? -29.419 22.002  55.986  1.00 12.62 ? 140  ASP B CG  1 
ATOM   3838  O OD1 . ASP B 1 141 ? -29.920 23.072  56.360  1.00 13.34 ? 140  ASP B OD1 1 
ATOM   3839  O OD2 . ASP B 1 141 ? -29.794 21.392  54.972  1.00 14.30 ? 140  ASP B OD2 1 
ATOM   3840  N N   . GLY B 1 142 ? -25.524 22.607  58.924  1.00 13.23 ? 141  GLY B N   1 
ATOM   3841  C CA  . GLY B 1 142 ? -24.642 22.312  60.055  1.00 13.59 ? 141  GLY B CA  1 
ATOM   3842  C C   . GLY B 1 142 ? -23.444 21.437  59.838  1.00 12.97 ? 141  GLY B C   1 
ATOM   3843  O O   . GLY B 1 142 ? -22.763 21.069  60.847  1.00 13.36 ? 141  GLY B O   1 
ATOM   3844  N N   . CYS B 1 143 ? -23.100 21.135  58.604  1.00 11.82 ? 142  CYS B N   1 
ATOM   3845  C CA  . CYS B 1 143 ? -21.964 20.218  58.305  1.00 11.18 ? 142  CYS B CA  1 
ATOM   3846  C C   . CYS B 1 143 ? -20.707 21.041  58.032  1.00 10.30 ? 142  CYS B C   1 
ATOM   3847  O O   . CYS B 1 143 ? -20.791 22.111  57.388  1.00 10.98 ? 142  CYS B O   1 
ATOM   3848  C CB  . CYS B 1 143 ? -22.315 19.326  57.139  1.00 11.18 ? 142  CYS B CB  1 
ATOM   3849  S SG  . CYS B 1 143 ? -23.579 18.089  57.330  1.00 11.94 ? 142  CYS B SG  1 
ATOM   3850  N N   . ASP B 1 144 ? -19.555 20.565  58.491  1.00 9.73  ? 143  ASP B N   1 
ATOM   3851  C CA  . ASP B 1 144 ? -18.302 21.319  58.326  1.00 9.17  ? 143  ASP B CA  1 
ATOM   3852  C C   . ASP B 1 144 ? -17.215 20.517  57.604  1.00 8.12  ? 143  ASP B C   1 
ATOM   3853  O O   . ASP B 1 144 ? -16.183 21.142  57.270  1.00 9.27  ? 143  ASP B O   1 
ATOM   3854  C CB  . ASP B 1 144 ? -17.739 21.857  59.645  1.00 9.26  ? 143  ASP B CB  1 
ATOM   3855  C CG  . ASP B 1 144 ? -18.555 22.940  60.291  1.00 9.75  ? 143  ASP B CG  1 
ATOM   3856  O OD1 . ASP B 1 144 ? -18.861 23.923  59.597  1.00 9.05  ? 143  ASP B OD1 1 
ATOM   3857  O OD2 . ASP B 1 144 ? -18.888 22.819  61.486  1.00 11.06 ? 143  ASP B OD2 1 
ATOM   3858  N N   . PHE B 1 145 ? -17.427 19.253  57.436  1.00 8.35  ? 144  PHE B N   1 
ATOM   3859  C CA  . PHE B 1 145 ? -16.450 18.391  56.728  1.00 8.05  ? 144  PHE B CA  1 
ATOM   3860  C C   . PHE B 1 145 ? -17.214 17.395  55.867  1.00 8.09  ? 144  PHE B C   1 
ATOM   3861  O O   . PHE B 1 145 ? -18.413 17.183  56.046  1.00 8.64  ? 144  PHE B O   1 
ATOM   3862  C CB  . PHE B 1 145 ? -15.418 17.770  57.638  1.00 6.29  ? 144  PHE B CB  1 
ATOM   3863  C CG  . PHE B 1 145 ? -15.840 16.645  58.533  1.00 6.20  ? 144  PHE B CG  1 
ATOM   3864  C CD1 . PHE B 1 145 ? -16.437 16.916  59.770  1.00 6.54  ? 144  PHE B CD1 1 
ATOM   3865  C CD2 . PHE B 1 145 ? -15.593 15.333  58.165  1.00 4.90  ? 144  PHE B CD2 1 
ATOM   3866  C CE1 . PHE B 1 145 ? -16.795 15.857  60.611  1.00 5.62  ? 144  PHE B CE1 1 
ATOM   3867  C CE2 . PHE B 1 145 ? -15.944 14.262  58.972  1.00 5.93  ? 144  PHE B CE2 1 
ATOM   3868  C CZ  . PHE B 1 145 ? -16.547 14.531  60.215  1.00 5.29  ? 144  PHE B CZ  1 
ATOM   3869  N N   . ALA B 1 146 ? -16.486 16.801  54.923  1.00 7.70  ? 145  ALA B N   1 
ATOM   3870  C CA  . ALA B 1 146 ? -17.107 15.887  53.965  1.00 7.75  ? 145  ALA B CA  1 
ATOM   3871  C C   . ALA B 1 146 ? -16.238 14.651  53.791  1.00 7.92  ? 145  ALA B C   1 
ATOM   3872  O O   . ALA B 1 146 ? -15.052 14.637  54.151  1.00 7.74  ? 145  ALA B O   1 
ATOM   3873  C CB  . ALA B 1 146 ? -17.295 16.635  52.645  1.00 7.40  ? 145  ALA B CB  1 
ATOM   3874  N N   . LYS B 1 147 ? -16.847 13.630  53.243  1.00 8.76  ? 146  LYS B N   1 
ATOM   3875  C CA  . LYS B 1 147 ? -16.239 12.336  52.969  1.00 8.78  ? 146  LYS B CA  1 
ATOM   3876  C C   . LYS B 1 147 ? -16.576 11.866  51.546  1.00 8.84  ? 146  LYS B C   1 
ATOM   3877  O O   . LYS B 1 147 ? -17.732 11.970  51.111  1.00 8.90  ? 146  LYS B O   1 
ATOM   3878  C CB  . LYS B 1 147 ? -16.760 11.276  53.941  1.00 11.60 ? 146  LYS B CB  1 
ATOM   3879  C CG  . LYS B 1 147 ? -16.072 9.913   53.783  1.00 12.95 ? 146  LYS B CG  1 
ATOM   3880  C CD  . LYS B 1 147 ? -17.107 8.852   53.470  1.00 16.55 ? 146  LYS B CD  1 
ATOM   3881  C CE  . LYS B 1 147 ? -16.576 7.439   53.507  1.00 16.25 ? 146  LYS B CE  1 
ATOM   3882  N NZ  . LYS B 1 147 ? -17.718 6.486   53.632  1.00 18.54 ? 146  LYS B NZ  1 
ATOM   3883  N N   . TRP B 1 148 ? -15.555 11.350  50.902  1.00 8.55  ? 147  TRP B N   1 
ATOM   3884  C CA  . TRP B 1 148 ? -15.644 10.828  49.520  1.00 8.21  ? 147  TRP B CA  1 
ATOM   3885  C C   . TRP B 1 148 ? -14.654 9.659   49.421  1.00 7.78  ? 147  TRP B C   1 
ATOM   3886  O O   . TRP B 1 148 ? -13.456 9.843   49.680  1.00 8.11  ? 147  TRP B O   1 
ATOM   3887  C CB  . TRP B 1 148 ? -15.392 11.920  48.513  1.00 7.88  ? 147  TRP B CB  1 
ATOM   3888  C CG  . TRP B 1 148 ? -15.204 11.538  47.089  1.00 8.60  ? 147  TRP B CG  1 
ATOM   3889  C CD1 . TRP B 1 148 ? -14.274 10.701  46.541  1.00 9.28  ? 147  TRP B CD1 1 
ATOM   3890  C CD2 . TRP B 1 148 ? -15.998 12.022  45.985  1.00 8.01  ? 147  TRP B CD2 1 
ATOM   3891  N NE1 . TRP B 1 148 ? -14.425 10.642  45.160  1.00 7.80  ? 147  TRP B NE1 1 
ATOM   3892  C CE2 . TRP B 1 148 ? -15.468 11.446  44.805  1.00 8.57  ? 147  TRP B CE2 1 
ATOM   3893  C CE3 . TRP B 1 148 ? -17.079 12.890  45.902  1.00 9.66  ? 147  TRP B CE3 1 
ATOM   3894  C CZ2 . TRP B 1 148 ? -16.024 11.684  43.555  1.00 7.65  ? 147  TRP B CZ2 1 
ATOM   3895  C CZ3 . TRP B 1 148 ? -17.621 13.137  44.651  1.00 8.49  ? 147  TRP B CZ3 1 
ATOM   3896  C CH2 . TRP B 1 148 ? -17.103 12.553  43.493  1.00 8.60  ? 147  TRP B CH2 1 
ATOM   3897  N N   . ARG B 1 149 ? -15.166 8.522   49.048  1.00 7.93  ? 148  ARG B N   1 
ATOM   3898  C CA  . ARG B 1 149 ? -14.392 7.282   48.993  1.00 9.10  ? 148  ARG B CA  1 
ATOM   3899  C C   . ARG B 1 149 ? -14.057 6.835   47.569  1.00 9.37  ? 148  ARG B C   1 
ATOM   3900  O O   . ARG B 1 149 ? -14.968 6.625   46.768  1.00 9.46  ? 148  ARG B O   1 
ATOM   3901  C CB  . ARG B 1 149 ? -15.149 6.144   49.693  1.00 9.13  ? 148  ARG B CB  1 
ATOM   3902  C CG  . ARG B 1 149 ? -14.352 4.842   49.776  1.00 11.15 ? 148  ARG B CG  1 
ATOM   3903  C CD  . ARG B 1 149 ? -15.208 3.703   50.186  1.00 14.79 ? 148  ARG B CD  1 
ATOM   3904  N NE  . ARG B 1 149 ? -14.454 2.486   50.493  1.00 15.16 ? 148  ARG B NE  1 
ATOM   3905  C CZ  . ARG B 1 149 ? -14.987 1.299   50.151  1.00 16.32 ? 148  ARG B CZ  1 
ATOM   3906  N NH1 . ARG B 1 149 ? -16.173 1.258   49.541  1.00 15.67 ? 148  ARG B NH1 1 
ATOM   3907  N NH2 . ARG B 1 149 ? -14.324 0.177   50.388  1.00 16.80 ? 148  ARG B NH2 1 
ATOM   3908  N N   . CYS B 1 150 ? -12.769 6.671   47.326  1.00 9.98  ? 149  CYS B N   1 
ATOM   3909  C CA  . CYS B 1 150 ? -12.232 6.064   46.104  1.00 9.89  ? 149  CYS B CA  1 
ATOM   3910  C C   . CYS B 1 150 ? -11.666 4.689   46.458  1.00 10.59 ? 149  CYS B C   1 
ATOM   3911  O O   . CYS B 1 150 ? -11.083 4.519   47.549  1.00 10.81 ? 149  CYS B O   1 
ATOM   3912  C CB  . CYS B 1 150 ? -11.135 6.901   45.451  1.00 8.15  ? 149  CYS B CB  1 
ATOM   3913  S SG  . CYS B 1 150 ? -11.694 8.347   44.566  1.00 9.21  ? 149  CYS B SG  1 
ATOM   3914  N N   . VAL B 1 151 ? -11.802 3.755   45.528  1.00 10.30 ? 150  VAL B N   1 
ATOM   3915  C CA  . VAL B 1 151 ? -11.380 2.368   45.754  1.00 10.98 ? 150  VAL B CA  1 
ATOM   3916  C C   . VAL B 1 151 ? -10.329 1.924   44.741  1.00 10.96 ? 150  VAL B C   1 
ATOM   3917  O O   . VAL B 1 151 ? -10.592 2.022   43.520  1.00 11.68 ? 150  VAL B O   1 
ATOM   3918  C CB  . VAL B 1 151 ? -12.630 1.457   45.750  1.00 12.35 ? 150  VAL B CB  1 
ATOM   3919  C CG1 . VAL B 1 151 ? -12.270 -0.017  45.782  1.00 13.67 ? 150  VAL B CG1 1 
ATOM   3920  C CG2 . VAL B 1 151 ? -13.574 1.799   46.902  1.00 13.87 ? 150  VAL B CG2 1 
ATOM   3921  N N   . LEU B 1 152 ? -9.211  1.447   45.229  1.00 10.15 ? 151  LEU B N   1 
ATOM   3922  C CA  . LEU B 1 152 ? -8.130  0.865   44.423  1.00 10.41 ? 151  LEU B CA  1 
ATOM   3923  C C   . LEU B 1 152 ? -7.947  -0.597  44.833  1.00 10.76 ? 151  LEU B C   1 
ATOM   3924  O O   . LEU B 1 152 ? -7.927  -0.898  46.040  1.00 9.99  ? 151  LEU B O   1 
ATOM   3925  C CB  . LEU B 1 152 ? -6.859  1.692   44.594  1.00 11.23 ? 151  LEU B CB  1 
ATOM   3926  C CG  . LEU B 1 152 ? -6.908  3.154   44.179  1.00 14.29 ? 151  LEU B CG  1 
ATOM   3927  C CD1 . LEU B 1 152 ? -5.637  3.861   44.618  1.00 16.43 ? 151  LEU B CD1 1 
ATOM   3928  C CD2 . LEU B 1 152 ? -7.026  3.220   42.658  1.00 13.78 ? 151  LEU B CD2 1 
ATOM   3929  N N   . LYS B 1 153 ? -7.802  -1.452  43.826  1.00 10.62 ? 152  LYS B N   1 
ATOM   3930  C CA  . LYS B 1 153 ? -7.702  -2.884  44.047  1.00 11.83 ? 152  LYS B CA  1 
ATOM   3931  C C   . LYS B 1 153 ? -6.342  -3.444  43.652  1.00 11.79 ? 152  LYS B C   1 
ATOM   3932  O O   . LYS B 1 153 ? -5.868  -3.134  42.542  1.00 12.03 ? 152  LYS B O   1 
ATOM   3933  C CB  . LYS B 1 153 ? -8.739  -3.644  43.193  1.00 15.37 ? 152  LYS B CB  1 
ATOM   3934  C CG  . LYS B 1 153 ? -10.034 -2.832  43.026  1.00 18.97 ? 152  LYS B CG  1 
ATOM   3935  C CD  . LYS B 1 153 ? -11.163 -3.772  42.597  1.00 21.46 ? 152  LYS B CD  1 
ATOM   3936  C CE  . LYS B 1 153 ? -12.241 -3.039  41.817  1.00 22.49 ? 152  LYS B CE  1 
ATOM   3937  N NZ  . LYS B 1 153 ? -13.229 -4.037  41.305  1.00 23.54 ? 152  LYS B NZ  1 
ATOM   3938  N N   . ILE B 1 154 ? -5.770  -4.262  44.527  1.00 10.44 ? 153  ILE B N   1 
ATOM   3939  C CA  . ILE B 1 154 ? -4.524  -4.953  44.187  1.00 9.99  ? 153  ILE B CA  1 
ATOM   3940  C C   . ILE B 1 154 ? -4.815  -6.276  43.507  1.00 10.53 ? 153  ILE B C   1 
ATOM   3941  O O   . ILE B 1 154 ? -5.539  -7.142  44.027  1.00 11.26 ? 153  ILE B O   1 
ATOM   3942  C CB  . ILE B 1 154 ? -3.594  -5.098  45.451  1.00 8.64  ? 153  ILE B CB  1 
ATOM   3943  C CG1 . ILE B 1 154 ? -3.292  -3.694  46.000  1.00 5.59  ? 153  ILE B CG1 1 
ATOM   3944  C CG2 . ILE B 1 154 ? -2.325  -5.914  45.083  1.00 7.67  ? 153  ILE B CG2 1 
ATOM   3945  C CD1 . ILE B 1 154 ? -2.430  -3.680  47.304  1.00 6.73  ? 153  ILE B CD1 1 
ATOM   3946  N N   . GLY B 1 155 ? -4.249  -6.433  42.319  1.00 10.65 ? 154  GLY B N   1 
ATOM   3947  C CA  . GLY B 1 155 ? -4.433  -7.645  41.500  1.00 9.77  ? 154  GLY B CA  1 
ATOM   3948  C C   . GLY B 1 155 ? -3.154  -7.860  40.680  1.00 10.51 ? 154  GLY B C   1 
ATOM   3949  O O   . GLY B 1 155 ? -2.121  -7.256  40.979  1.00 10.40 ? 154  GLY B O   1 
ATOM   3950  N N   . LYS B 1 156 ? -3.279  -8.704  39.673  1.00 10.62 ? 155  LYS B N   1 
ATOM   3951  C CA  . LYS B 1 156 ? -2.131  -9.067  38.819  1.00 11.02 ? 155  LYS B CA  1 
ATOM   3952  C C   . LYS B 1 156 ? -1.496  -7.835  38.201  1.00 10.76 ? 155  LYS B C   1 
ATOM   3953  O O   . LYS B 1 156 ? -0.263  -7.631  38.277  1.00 11.44 ? 155  LYS B O   1 
ATOM   3954  C CB  . LYS B 1 156 ? -2.594  -10.048 37.755  1.00 14.19 ? 155  LYS B CB  1 
ATOM   3955  C CG  . LYS B 1 156 ? -1.480  -10.659 36.881  1.00 17.34 ? 155  LYS B CG  1 
ATOM   3956  C CD  . LYS B 1 156 ? -2.157  -11.576 35.854  1.00 20.53 ? 155  LYS B CD  1 
ATOM   3957  C CE  . LYS B 1 156 ? -1.223  -12.578 35.229  1.00 22.65 ? 155  LYS B CE  1 
ATOM   3958  N NZ  . LYS B 1 156 ? -1.901  -13.246 34.068  1.00 25.75 ? 155  LYS B NZ  1 
ATOM   3959  N N   . ASN B 1 157 ? -2.328  -6.980  37.631  1.00 9.85  ? 156  ASN B N   1 
ATOM   3960  C CA  . ASN B 1 157 ? -1.914  -5.769  36.941  1.00 9.97  ? 156  ASN B CA  1 
ATOM   3961  C C   . ASN B 1 157 ? -2.506  -4.512  37.548  1.00 9.58  ? 156  ASN B C   1 
ATOM   3962  O O   . ASN B 1 157 ? -2.345  -3.446  36.930  1.00 9.85  ? 156  ASN B O   1 
ATOM   3963  C CB  . ASN B 1 157 ? -2.299  -5.875  35.437  1.00 10.73 ? 156  ASN B CB  1 
ATOM   3964  C CG  . ASN B 1 157 ? -1.735  -7.112  34.784  1.00 11.54 ? 156  ASN B CG  1 
ATOM   3965  O OD1 . ASN B 1 157 ? -0.527  -7.414  34.902  1.00 12.61 ? 156  ASN B OD1 1 
ATOM   3966  N ND2 . ASN B 1 157 ? -2.588  -7.875  34.104  1.00 10.16 ? 156  ASN B ND2 1 
ATOM   3967  N N   . THR B 1 158 ? -3.137  -4.598  38.715  1.00 8.24  ? 157  THR B N   1 
ATOM   3968  C CA  . THR B 1 158 ? -3.835  -3.417  39.256  1.00 8.42  ? 157  THR B CA  1 
ATOM   3969  C C   . THR B 1 158 ? -3.292  -3.061  40.643  1.00 8.18  ? 157  THR B C   1 
ATOM   3970  O O   . THR B 1 158 ? -2.819  -3.947  41.381  1.00 8.24  ? 157  THR B O   1 
ATOM   3971  C CB  . THR B 1 158 ? -5.394  -3.654  39.236  1.00 6.97  ? 157  THR B CB  1 
ATOM   3972  O OG1 . THR B 1 158 ? -5.644  -4.783  40.131  1.00 8.70  ? 157  THR B OG1 1 
ATOM   3973  C CG2 . THR B 1 158 ? -5.927  -3.986  37.833  1.00 8.75  ? 157  THR B CG2 1 
ATOM   3974  N N   . PRO B 1 159 ? -3.354  -1.807  41.021  1.00 8.32  ? 158  PRO B N   1 
ATOM   3975  C CA  . PRO B 1 159 ? -3.943  -0.693  40.284  1.00 7.91  ? 158  PRO B CA  1 
ATOM   3976  C C   . PRO B 1 159 ? -3.068  -0.319  39.083  1.00 7.71  ? 158  PRO B C   1 
ATOM   3977  O O   . PRO B 1 159 ? -1.832  -0.340  39.145  1.00 7.68  ? 158  PRO B O   1 
ATOM   3978  C CB  . PRO B 1 159 ? -4.052  0.425   41.277  1.00 8.36  ? 158  PRO B CB  1 
ATOM   3979  C CG  . PRO B 1 159 ? -3.124  0.079   42.414  1.00 9.15  ? 158  PRO B CG  1 
ATOM   3980  C CD  . PRO B 1 159 ? -2.792  -1.376  42.319  1.00 8.50  ? 158  PRO B CD  1 
ATOM   3981  N N   . SER B 1 160 ? -3.773  0.037   38.034  1.00 7.36  ? 159  SER B N   1 
ATOM   3982  C CA  . SER B 1 160 ? -3.128  0.469   36.763  1.00 6.83  ? 159  SER B CA  1 
ATOM   3983  C C   . SER B 1 160 ? -2.796  1.932   36.812  1.00 5.55  ? 159  SER B C   1 
ATOM   3984  O O   . SER B 1 160 ? -3.266  2.684   37.691  1.00 6.05  ? 159  SER B O   1 
ATOM   3985  C CB  . SER B 1 160 ? -4.098  0.150   35.617  1.00 6.15  ? 159  SER B CB  1 
ATOM   3986  O OG  . SER B 1 160 ? -5.263  0.962   35.714  1.00 7.27  ? 159  SER B OG  1 
ATOM   3987  N N   . TYR B 1 161 ? -1.975  2.384   35.847  1.00 4.87  ? 160  TYR B N   1 
ATOM   3988  C CA  . TYR B 1 161 ? -1.725  3.832   35.715  1.00 4.14  ? 160  TYR B CA  1 
ATOM   3989  C C   . TYR B 1 161 ? -3.052  4.551   35.506  1.00 3.63  ? 160  TYR B C   1 
ATOM   3990  O O   . TYR B 1 161 ? -3.269  5.651   36.069  1.00 3.25  ? 160  TYR B O   1 
ATOM   3991  C CB  . TYR B 1 161 ? -0.736  4.145   34.576  1.00 4.81  ? 160  TYR B CB  1 
ATOM   3992  C CG  . TYR B 1 161 ? -0.597  5.618   34.277  1.00 6.37  ? 160  TYR B CG  1 
ATOM   3993  C CD1 . TYR B 1 161 ? 0.070   6.439   35.194  1.00 5.81  ? 160  TYR B CD1 1 
ATOM   3994  C CD2 . TYR B 1 161 ? -1.143  6.202   33.131  1.00 5.65  ? 160  TYR B CD2 1 
ATOM   3995  C CE1 . TYR B 1 161 ? 0.209   7.793   34.979  1.00 7.12  ? 160  TYR B CE1 1 
ATOM   3996  C CE2 . TYR B 1 161 ? -0.990  7.566   32.889  1.00 7.03  ? 160  TYR B CE2 1 
ATOM   3997  C CZ  . TYR B 1 161 ? -0.328  8.359   33.819  1.00 8.48  ? 160  TYR B CZ  1 
ATOM   3998  O OH  . TYR B 1 161 ? -0.207  9.710   33.611  1.00 11.37 ? 160  TYR B OH  1 
ATOM   3999  N N   . GLN B 1 162 ? -3.937  3.950   34.714  1.00 3.90  ? 161  GLN B N   1 
ATOM   4000  C CA  . GLN B 1 162 ? -5.243  4.604   34.444  1.00 4.15  ? 161  GLN B CA  1 
ATOM   4001  C C   . GLN B 1 162 ? -5.985  4.921   35.756  1.00 4.40  ? 161  GLN B C   1 
ATOM   4002  O O   . GLN B 1 162 ? -6.485  6.026   35.986  1.00 3.67  ? 161  GLN B O   1 
ATOM   4003  C CB  . GLN B 1 162 ? -6.177  3.802   33.534  1.00 3.01  ? 161  GLN B CB  1 
ATOM   4004  C CG  . GLN B 1 162 ? -7.480  4.533   33.277  1.00 4.70  ? 161  GLN B CG  1 
ATOM   4005  C CD  . GLN B 1 162 ? -8.588  3.756   32.631  1.00 3.81  ? 161  GLN B CD  1 
ATOM   4006  O OE1 . GLN B 1 162 ? -9.597  4.341   32.160  1.00 6.21  ? 161  GLN B OE1 1 
ATOM   4007  N NE2 . GLN B 1 162 ? -8.498  2.450   32.575  1.00 2.00  ? 161  GLN B NE2 1 
ATOM   4008  N N   . SER B 1 163 ? -6.116  3.884   36.562  1.00 5.02  ? 162  SER B N   1 
ATOM   4009  C CA  . SER B 1 163 ? -6.855  3.911   37.816  1.00 6.00  ? 162  SER B CA  1 
ATOM   4010  C C   . SER B 1 163 ? -6.276  4.920   38.804  1.00 4.65  ? 162  SER B C   1 
ATOM   4011  O O   . SER B 1 163 ? -7.000  5.710   39.423  1.00 4.46  ? 162  SER B O   1 
ATOM   4012  C CB  . SER B 1 163 ? -6.875  2.506   38.449  1.00 8.02  ? 162  SER B CB  1 
ATOM   4013  O OG  . SER B 1 163 ? -7.546  2.630   39.694  1.00 15.32 ? 162  SER B OG  1 
ATOM   4014  N N   . ILE B 1 164 ? -4.960  4.905   38.910  1.00 5.01  ? 163  ILE B N   1 
ATOM   4015  C CA  . ILE B 1 164 ? -4.243  5.835   39.803  1.00 5.08  ? 163  ILE B CA  1 
ATOM   4016  C C   . ILE B 1 164 ? -4.447  7.280   39.375  1.00 5.17  ? 163  ILE B C   1 
ATOM   4017  O O   . ILE B 1 164 ? -4.782  8.163   40.180  1.00 4.87  ? 163  ILE B O   1 
ATOM   4018  C CB  . ILE B 1 164 ? -2.733  5.421   39.909  1.00 4.75  ? 163  ILE B CB  1 
ATOM   4019  C CG1 . ILE B 1 164 ? -2.624  4.026   40.562  1.00 5.56  ? 163  ILE B CG1 1 
ATOM   4020  C CG2 . ILE B 1 164 ? -1.922  6.520   40.644  1.00 7.27  ? 163  ILE B CG2 1 
ATOM   4021  C CD1 . ILE B 1 164 ? -1.245  3.332   40.401  1.00 5.28  ? 163  ILE B CD1 1 
ATOM   4022  N N   . LEU B 1 165 ? -4.243  7.539   38.083  1.00 5.32  ? 164  LEU B N   1 
ATOM   4023  C CA  . LEU B 1 165 ? -4.441  8.875   37.518  1.00 5.23  ? 164  LEU B CA  1 
ATOM   4024  C C   . LEU B 1 165 ? -5.867  9.409   37.743  1.00 3.66  ? 164  LEU B C   1 
ATOM   4025  O O   . LEU B 1 165 ? -6.043  10.564  38.167  1.00 3.47  ? 164  LEU B O   1 
ATOM   4026  C CB  . LEU B 1 165 ? -4.085  8.812   36.011  1.00 7.17  ? 164  LEU B CB  1 
ATOM   4027  C CG  . LEU B 1 165 ? -4.664  9.897   35.130  1.00 9.60  ? 164  LEU B CG  1 
ATOM   4028  C CD1 . LEU B 1 165 ? -3.904  11.213  35.264  1.00 11.83 ? 164  LEU B CD1 1 
ATOM   4029  C CD2 . LEU B 1 165 ? -4.604  9.472   33.652  1.00 11.89 ? 164  LEU B CD2 1 
ATOM   4030  N N   . GLU B 1 166 ? -6.828  8.593   37.375  1.00 3.60  ? 165  GLU B N   1 
ATOM   4031  C CA  . GLU B 1 166 ? -8.255  8.991   37.465  1.00 3.70  ? 165  GLU B CA  1 
ATOM   4032  C C   . GLU B 1 166 ? -8.713  9.196   38.909  1.00 3.88  ? 165  GLU B C   1 
ATOM   4033  O O   . GLU B 1 166 ? -9.387  10.203  39.194  1.00 3.27  ? 165  GLU B O   1 
ATOM   4034  C CB  . GLU B 1 166 ? -9.142  7.940   36.805  1.00 5.53  ? 165  GLU B CB  1 
ATOM   4035  C CG  . GLU B 1 166 ? -10.654 8.024   36.993  1.00 5.08  ? 165  GLU B CG  1 
ATOM   4036  C CD  . GLU B 1 166 ? -11.244 9.385   36.819  1.00 6.89  ? 165  GLU B CD  1 
ATOM   4037  O OE1 . GLU B 1 166 ? -10.803 10.262  36.076  1.00 8.70  ? 165  GLU B OE1 1 
ATOM   4038  O OE2 . GLU B 1 166 ? -12.281 9.557   37.506  1.00 7.40  ? 165  GLU B OE2 1 
ATOM   4039  N N   . ASN B 1 167 ? -8.375  8.267   39.783  1.00 3.82  ? 166  ASN B N   1 
ATOM   4040  C CA  . ASN B 1 167 ? -8.833  8.369   41.205  1.00 5.37  ? 166  ASN B CA  1 
ATOM   4041  C C   . ASN B 1 167 ? -8.178  9.560   41.872  1.00 4.84  ? 166  ASN B C   1 
ATOM   4042  O O   . ASN B 1 167 ? -8.814  10.303  42.645  1.00 6.10  ? 166  ASN B O   1 
ATOM   4043  C CB  . ASN B 1 167 ? -8.737  7.046   41.949  1.00 4.41  ? 166  ASN B CB  1 
ATOM   4044  C CG  . ASN B 1 167 ? -9.821  6.065   41.583  1.00 7.13  ? 166  ASN B CG  1 
ATOM   4045  O OD1 . ASN B 1 167 ? -10.956 6.098   42.090  1.00 7.60  ? 166  ASN B OD1 1 
ATOM   4046  N ND2 . ASN B 1 167 ? -9.486  5.131   40.691  1.00 4.90  ? 166  ASN B ND2 1 
ATOM   4047  N N   . ALA B 1 168 ? -6.920  9.812   41.521  1.00 5.59  ? 167  ALA B N   1 
ATOM   4048  C CA  . ALA B 1 168 ? -6.177  10.963  42.041  1.00 4.67  ? 167  ALA B CA  1 
ATOM   4049  C C   . ALA B 1 168 ? -6.822  12.255  41.569  1.00 5.42  ? 167  ALA B C   1 
ATOM   4050  O O   . ALA B 1 168 ? -7.006  13.220  42.346  1.00 4.36  ? 167  ALA B O   1 
ATOM   4051  C CB  . ALA B 1 168 ? -4.704  10.854  41.693  1.00 6.19  ? 167  ALA B CB  1 
ATOM   4052  N N   . ASN B 1 169 ? -7.208  12.291  40.284  1.00 4.27  ? 168  ASN B N   1 
ATOM   4053  C CA  . ASN B 1 169 ? -7.809  13.487  39.715  1.00 4.43  ? 168  ASN B CA  1 
ATOM   4054  C C   . ASN B 1 169 ? -9.194  13.755  40.326  1.00 3.80  ? 168  ASN B C   1 
ATOM   4055  O O   . ASN B 1 169 ? -9.482  14.906  40.687  1.00 3.74  ? 168  ASN B O   1 
ATOM   4056  C CB  . ASN B 1 169 ? -7.861  13.416  38.159  1.00 4.43  ? 168  ASN B CB  1 
ATOM   4057  C CG  . ASN B 1 169 ? -8.067  14.795  37.576  1.00 6.03  ? 168  ASN B CG  1 
ATOM   4058  O OD1 . ASN B 1 169 ? -7.162  15.645  37.569  1.00 8.64  ? 168  ASN B OD1 1 
ATOM   4059  N ND2 . ASN B 1 169 ? -9.291  15.057  37.094  1.00 7.99  ? 168  ASN B ND2 1 
ATOM   4060  N N   . VAL B 1 170 ? -9.977  12.696  40.449  1.00 3.71  ? 169  VAL B N   1 
ATOM   4061  C CA  . VAL B 1 170 ? -11.347 12.883  40.986  1.00 4.75  ? 169  VAL B CA  1 
ATOM   4062  C C   . VAL B 1 170 ? -11.300 13.361  42.437  1.00 4.79  ? 169  VAL B C   1 
ATOM   4063  O O   . VAL B 1 170 ? -12.114 14.222  42.830  1.00 4.16  ? 169  VAL B O   1 
ATOM   4064  C CB  . VAL B 1 170 ? -12.215 11.649  40.708  1.00 3.20  ? 169  VAL B CB  1 
ATOM   4065  C CG1 . VAL B 1 170 ? -12.130 10.538  41.735  1.00 4.02  ? 169  VAL B CG1 1 
ATOM   4066  C CG2 . VAL B 1 170 ? -13.663 12.107  40.491  1.00 5.50  ? 169  VAL B CG2 1 
ATOM   4067  N N   . LEU B 1 171 ? -10.362 12.800  43.201  1.00 4.81  ? 170  LEU B N   1 
ATOM   4068  C CA  . LEU B 1 171 ? -10.189 13.246  44.601  1.00 4.82  ? 170  LEU B CA  1 
ATOM   4069  C C   . LEU B 1 171 ? -9.883  14.727  44.659  1.00 4.56  ? 170  LEU B C   1 
ATOM   4070  O O   . LEU B 1 171 ? -10.439 15.423  45.525  1.00 4.92  ? 170  LEU B O   1 
ATOM   4071  C CB  . LEU B 1 171 ? -9.184  12.352  45.339  1.00 3.76  ? 170  LEU B CB  1 
ATOM   4072  C CG  . LEU B 1 171 ? -9.663  10.989  45.771  1.00 4.46  ? 170  LEU B CG  1 
ATOM   4073  C CD1 . LEU B 1 171 ? -8.524  10.069  46.173  1.00 6.31  ? 170  LEU B CD1 1 
ATOM   4074  C CD2 . LEU B 1 171 ? -10.645 11.121  46.951  1.00 6.04  ? 170  LEU B CD2 1 
ATOM   4075  N N   . ALA B 1 172 ? -9.012  15.225  43.771  1.00 3.68  ? 171  ALA B N   1 
ATOM   4076  C CA  . ALA B 1 172 ? -8.661  16.638  43.754  1.00 3.76  ? 171  ALA B CA  1 
ATOM   4077  C C   . ALA B 1 172 ? -9.833  17.527  43.374  1.00 3.27  ? 171  ALA B C   1 
ATOM   4078  O O   . ALA B 1 172 ? -9.961  18.665  43.882  1.00 2.65  ? 171  ALA B O   1 
ATOM   4079  C CB  . ALA B 1 172 ? -7.465  16.870  42.824  1.00 2.20  ? 171  ALA B CB  1 
ATOM   4080  N N   . ARG B 1 173 ? -10.654 17.038  42.443  1.00 3.39  ? 172  ARG B N   1 
ATOM   4081  C CA  . ARG B 1 173 ? -11.847 17.808  42.013  1.00 3.56  ? 172  ARG B CA  1 
ATOM   4082  C C   . ARG B 1 173 ? -12.814 17.961  43.215  1.00 3.18  ? 172  ARG B C   1 
ATOM   4083  O O   . ARG B 1 173 ? -13.300 19.076  43.465  1.00 2.57  ? 172  ARG B O   1 
ATOM   4084  C CB  . ARG B 1 173 ? -12.574 17.114  40.847  1.00 3.54  ? 172  ARG B CB  1 
ATOM   4085  C CG  . ARG B 1 173 ? -11.873 17.308  39.479  1.00 3.79  ? 172  ARG B CG  1 
ATOM   4086  C CD  . ARG B 1 173 ? -11.939 18.715  39.011  1.00 5.02  ? 172  ARG B CD  1 
ATOM   4087  N NE  . ARG B 1 173 ? -13.321 19.097  38.701  1.00 6.95  ? 172  ARG B NE  1 
ATOM   4088  C CZ  . ARG B 1 173 ? -13.897 20.173  39.234  1.00 6.96  ? 172  ARG B CZ  1 
ATOM   4089  N NH1 . ARG B 1 173 ? -13.215 20.951  40.069  1.00 6.80  ? 172  ARG B NH1 1 
ATOM   4090  N NH2 . ARG B 1 173 ? -15.175 20.474  38.969  1.00 7.78  ? 172  ARG B NH2 1 
ATOM   4091  N N   . TYR B 1 174 ? -13.053 16.854  43.860  1.00 2.89  ? 173  TYR B N   1 
ATOM   4092  C CA  . TYR B 1 174 ? -13.925 16.777  45.060  1.00 4.02  ? 173  TYR B CA  1 
ATOM   4093  C C   . TYR B 1 174 ? -13.423 17.718  46.136  1.00 4.47  ? 173  TYR B C   1 
ATOM   4094  O O   . TYR B 1 174 ? -14.199 18.548  46.672  1.00 4.75  ? 173  TYR B O   1 
ATOM   4095  C CB  . TYR B 1 174 ? -14.071 15.312  45.497  1.00 5.01  ? 173  TYR B CB  1 
ATOM   4096  C CG  . TYR B 1 174 ? -14.126 15.114  47.006  1.00 5.47  ? 173  TYR B CG  1 
ATOM   4097  C CD1 . TYR B 1 174 ? -15.288 15.428  47.715  1.00 4.86  ? 173  TYR B CD1 1 
ATOM   4098  C CD2 . TYR B 1 174 ? -12.986 14.729  47.715  1.00 6.16  ? 173  TYR B CD2 1 
ATOM   4099  C CE1 . TYR B 1 174 ? -15.350 15.279  49.097  1.00 6.39  ? 173  TYR B CE1 1 
ATOM   4100  C CE2 . TYR B 1 174 ? -13.034 14.562  49.102  1.00 5.60  ? 173  TYR B CE2 1 
ATOM   4101  C CZ  . TYR B 1 174 ? -14.213 14.854  49.782  1.00 7.23  ? 173  TYR B CZ  1 
ATOM   4102  O OH  . TYR B 1 174 ? -14.239 14.684  51.138  1.00 6.45  ? 173  TYR B OH  1 
ATOM   4103  N N   . ALA B 1 175 ? -12.123 17.669  46.417  1.00 4.54  ? 174  ALA B N   1 
ATOM   4104  C CA  . ALA B 1 175 ? -11.548 18.482  47.507  1.00 4.96  ? 174  ALA B CA  1 
ATOM   4105  C C   . ALA B 1 175 ? -11.668 19.954  47.222  1.00 5.42  ? 174  ALA B C   1 
ATOM   4106  O O   . ALA B 1 175 ? -12.034 20.770  48.096  1.00 5.64  ? 174  ALA B O   1 
ATOM   4107  C CB  . ALA B 1 175 ? -10.121 18.047  47.847  1.00 5.35  ? 174  ALA B CB  1 
ATOM   4108  N N   . SER B 1 176 ? -11.328 20.333  45.985  1.00 4.57  ? 175  SER B N   1 
ATOM   4109  C CA  . SER B 1 176 ? -11.413 21.724  45.540  1.00 4.97  ? 175  SER B CA  1 
ATOM   4110  C C   . SER B 1 176 ? -12.814 22.284  45.770  1.00 3.96  ? 175  SER B C   1 
ATOM   4111  O O   . SER B 1 176 ? -13.005 23.405  46.296  1.00 4.49  ? 175  SER B O   1 
ATOM   4112  C CB  . SER B 1 176 ? -11.055 21.760  44.027  1.00 3.97  ? 175  SER B CB  1 
ATOM   4113  O OG  . SER B 1 176 ? -11.204 23.083  43.576  1.00 12.82 ? 175  SER B OG  1 
ATOM   4114  N N   . ILE B 1 177 ? -13.798 21.509  45.347  1.00 4.62  ? 176  ILE B N   1 
ATOM   4115  C CA  . ILE B 1 177 ? -15.211 21.958  45.437  1.00 5.13  ? 176  ILE B CA  1 
ATOM   4116  C C   . ILE B 1 177 ? -15.619 22.177  46.895  1.00 5.32  ? 176  ILE B C   1 
ATOM   4117  O O   . ILE B 1 177 ? -16.224 23.225  47.186  1.00 5.06  ? 176  ILE B O   1 
ATOM   4118  C CB  . ILE B 1 177 ? -16.180 21.000  44.686  1.00 5.70  ? 176  ILE B CB  1 
ATOM   4119  C CG1 . ILE B 1 177 ? -15.951 21.169  43.143  1.00 7.30  ? 176  ILE B CG1 1 
ATOM   4120  C CG2 . ILE B 1 177 ? -17.680 21.277  45.048  1.00 6.34  ? 176  ILE B CG2 1 
ATOM   4121  C CD1 . ILE B 1 177 ? -16.656 20.038  42.325  1.00 8.47  ? 176  ILE B CD1 1 
ATOM   4122  N N   . CYS B 1 178 ? -15.284 21.200  47.729  1.00 5.53  ? 177  CYS B N   1 
ATOM   4123  C CA  . CYS B 1 178 ? -15.625 21.318  49.172  1.00 6.76  ? 177  CYS B CA  1 
ATOM   4124  C C   . CYS B 1 178 ? -15.012 22.590  49.736  1.00 6.57  ? 177  CYS B C   1 
ATOM   4125  O O   . CYS B 1 178 ? -15.734 23.378  50.368  1.00 6.81  ? 177  CYS B O   1 
ATOM   4126  C CB  . CYS B 1 178 ? -15.137 20.107  49.962  1.00 6.76  ? 177  CYS B CB  1 
ATOM   4127  S SG  . CYS B 1 178 ? -15.998 18.590  49.687  1.00 9.52  ? 177  CYS B SG  1 
ATOM   4128  N N   . GLN B 1 179 ? -13.720 22.784  49.463  1.00 6.22  ? 178  GLN B N   1 
ATOM   4129  C CA  . GLN B 1 179 ? -13.012 23.958  49.976  1.00 6.74  ? 178  GLN B CA  1 
ATOM   4130  C C   . GLN B 1 179 ? -13.668 25.246  49.506  1.00 6.96  ? 178  GLN B C   1 
ATOM   4131  O O   . GLN B 1 179 ? -13.743 26.218  50.298  1.00 6.96  ? 178  GLN B O   1 
ATOM   4132  C CB  . GLN B 1 179 ? -11.500 23.974  49.763  1.00 7.10  ? 178  GLN B CB  1 
ATOM   4133  C CG  . GLN B 1 179 ? -10.795 22.708  50.324  1.00 8.08  ? 178  GLN B CG  1 
ATOM   4134  C CD  . GLN B 1 179 ? -9.312  23.006  50.421  1.00 7.58  ? 178  GLN B CD  1 
ATOM   4135  O OE1 . GLN B 1 179 ? -8.760  23.659  49.534  1.00 9.34  ? 178  GLN B OE1 1 
ATOM   4136  N NE2 . GLN B 1 179 ? -8.656  22.583  51.493  1.00 6.40  ? 178  GLN B NE2 1 
ATOM   4137  N N   . SER B 1 180 ? -14.170 25.260  48.277  1.00 6.74  ? 179  SER B N   1 
ATOM   4138  C CA  . SER B 1 180 ? -14.798 26.472  47.729  1.00 7.10  ? 179  SER B CA  1 
ATOM   4139  C C   . SER B 1 180 ? -16.024 26.843  48.561  1.00 7.25  ? 179  SER B C   1 
ATOM   4140  O O   . SER B 1 180 ? -16.339 28.055  48.692  1.00 8.46  ? 179  SER B O   1 
ATOM   4141  C CB  . SER B 1 180 ? -15.133 26.364  46.248  1.00 5.70  ? 179  SER B CB  1 
ATOM   4142  O OG  . SER B 1 180 ? -16.291 25.579  46.013  1.00 7.57  ? 179  SER B OG  1 
ATOM   4143  N N   . GLN B 1 181 ? -16.666 25.861  49.131  1.00 7.74  ? 180  GLN B N   1 
ATOM   4144  C CA  . GLN B 1 181 ? -17.923 26.033  49.881  1.00 8.71  ? 180  GLN B CA  1 
ATOM   4145  C C   . GLN B 1 181 ? -17.736 25.958  51.394  1.00 9.94  ? 180  GLN B C   1 
ATOM   4146  O O   . GLN B 1 181 ? -18.708 25.694  52.132  1.00 10.08 ? 180  GLN B O   1 
ATOM   4147  C CB  . GLN B 1 181 ? -18.975 25.017  49.402  1.00 9.49  ? 180  GLN B CB  1 
ATOM   4148  C CG  . GLN B 1 181 ? -19.281 25.097  47.909  1.00 11.93 ? 180  GLN B CG  1 
ATOM   4149  C CD  . GLN B 1 181 ? -19.718 26.454  47.449  1.00 13.72 ? 180  GLN B CD  1 
ATOM   4150  O OE1 . GLN B 1 181 ? -20.686 27.041  47.941  1.00 14.29 ? 180  GLN B OE1 1 
ATOM   4151  N NE2 . GLN B 1 181 ? -18.964 26.993  46.491  1.00 13.54 ? 180  GLN B NE2 1 
ATOM   4152  N N   . ARG B 1 182 ? -16.524 26.194  51.881  1.00 10.07 ? 181  ARG B N   1 
ATOM   4153  C CA  . ARG B 1 182 ? -16.197 26.225  53.306  1.00 10.33 ? 181  ARG B CA  1 
ATOM   4154  C C   . ARG B 1 182 ? -16.347 24.892  54.013  1.00 10.10 ? 181  ARG B C   1 
ATOM   4155  O O   . ARG B 1 182 ? -16.670 24.825  55.228  1.00 11.08 ? 181  ARG B O   1 
ATOM   4156  C CB  . ARG B 1 182 ? -16.996 27.315  54.033  1.00 11.03 ? 181  ARG B CB  1 
ATOM   4157  C CG  . ARG B 1 182 ? -16.926 28.708  53.437  1.00 10.83 ? 181  ARG B CG  1 
ATOM   4158  C CD  . ARG B 1 182 ? -18.023 29.596  53.948  1.00 15.78 ? 181  ARG B CD  1 
ATOM   4159  N NE  . ARG B 1 182 ? -17.979 29.704  55.402  1.00 18.16 ? 181  ARG B NE  1 
ATOM   4160  C CZ  . ARG B 1 182 ? -19.010 30.027  56.173  1.00 19.86 ? 181  ARG B CZ  1 
ATOM   4161  N NH1 . ARG B 1 182 ? -20.187 30.388  55.685  1.00 20.29 ? 181  ARG B NH1 1 
ATOM   4162  N NH2 . ARG B 1 182 ? -18.895 29.888  57.506  1.00 20.87 ? 181  ARG B NH2 1 
ATOM   4163  N N   . ILE B 1 183 ? -16.086 23.791  53.345  1.00 9.47  ? 182  ILE B N   1 
ATOM   4164  C CA  . ILE B 1 183 ? -16.163 22.437  53.888  1.00 8.46  ? 182  ILE B CA  1 
ATOM   4165  C C   . ILE B 1 183 ? -14.803 21.745  53.782  1.00 7.67  ? 182  ILE B C   1 
ATOM   4166  O O   . ILE B 1 183 ? -14.211 21.735  52.679  1.00 7.29  ? 182  ILE B O   1 
ATOM   4167  C CB  . ILE B 1 183 ? -17.302 21.597  53.212  1.00 9.39  ? 182  ILE B CB  1 
ATOM   4168  C CG1 . ILE B 1 183 ? -18.673 22.190  53.597  1.00 10.88 ? 182  ILE B CG1 1 
ATOM   4169  C CG2 . ILE B 1 183 ? -17.249 20.086  53.581  1.00 9.18  ? 182  ILE B CG2 1 
ATOM   4170  C CD1 . ILE B 1 183 ? -19.892 21.340  53.198  1.00 14.13 ? 182  ILE B CD1 1 
ATOM   4171  N N   . VAL B 1 184 ? -14.342 21.177  54.895  1.00 6.23  ? 183  VAL B N   1 
ATOM   4172  C CA  . VAL B 1 184 ? -13.086 20.402  54.881  1.00 5.44  ? 183  VAL B CA  1 
ATOM   4173  C C   . VAL B 1 184 ? -13.253 19.041  54.269  1.00 5.82  ? 183  VAL B C   1 
ATOM   4174  O O   . VAL B 1 184 ? -14.017 18.215  54.805  1.00 5.89  ? 183  VAL B O   1 
ATOM   4175  C CB  . VAL B 1 184 ? -12.567 20.260  56.347  1.00 5.10  ? 183  VAL B CB  1 
ATOM   4176  C CG1 . VAL B 1 184 ? -11.454 19.218  56.423  1.00 6.34  ? 183  VAL B CG1 1 
ATOM   4177  C CG2 . VAL B 1 184 ? -12.166 21.600  56.888  1.00 4.49  ? 183  VAL B CG2 1 
ATOM   4178  N N   . PRO B 1 185 ? -12.498 18.753  53.194  1.00 5.85  ? 184  PRO B N   1 
ATOM   4179  C CA  . PRO B 1 185 ? -12.581 17.451  52.549  1.00 5.99  ? 184  PRO B CA  1 
ATOM   4180  C C   . PRO B 1 185 ? -11.680 16.430  53.227  1.00 6.44  ? 184  PRO B C   1 
ATOM   4181  O O   . PRO B 1 185 ? -10.498 16.732  53.462  1.00 7.22  ? 184  PRO B O   1 
ATOM   4182  C CB  . PRO B 1 185 ? -12.079 17.724  51.111  1.00 5.95  ? 184  PRO B CB  1 
ATOM   4183  C CG  . PRO B 1 185 ? -11.128 18.878  51.270  1.00 5.16  ? 184  PRO B CG  1 
ATOM   4184  C CD  . PRO B 1 185 ? -11.715 19.725  52.402  1.00 5.39  ? 184  PRO B CD  1 
ATOM   4185  N N   . ILE B 1 186 ? -12.253 15.279  53.541  1.00 5.95  ? 185  ILE B N   1 
ATOM   4186  C CA  . ILE B 1 186 ? -11.418 14.121  53.901  1.00 6.23  ? 185  ILE B CA  1 
ATOM   4187  C C   . ILE B 1 186 ? -11.154 13.345  52.590  1.00 7.04  ? 185  ILE B C   1 
ATOM   4188  O O   . ILE B 1 186 ? -12.107 12.866  51.951  1.00 7.79  ? 185  ILE B O   1 
ATOM   4189  C CB  . ILE B 1 186 ? -12.081 13.208  54.972  1.00 6.21  ? 185  ILE B CB  1 
ATOM   4190  C CG1 . ILE B 1 186 ? -12.420 14.036  56.254  1.00 7.27  ? 185  ILE B CG1 1 
ATOM   4191  C CG2 . ILE B 1 186 ? -11.237 11.958  55.305  1.00 5.83  ? 185  ILE B CG2 1 
ATOM   4192  C CD1 . ILE B 1 186 ? -13.038 13.100  57.353  1.00 8.74  ? 185  ILE B CD1 1 
ATOM   4193  N N   . VAL B 1 187 ? -9.902  13.307  52.213  1.00 7.12  ? 186  VAL B N   1 
ATOM   4194  C CA  . VAL B 1 187 ? -9.432  12.571  51.020  1.00 7.60  ? 186  VAL B CA  1 
ATOM   4195  C C   . VAL B 1 187 ? -9.272  11.112  51.373  1.00 7.35  ? 186  VAL B C   1 
ATOM   4196  O O   . VAL B 1 187 ? -8.449  10.805  52.261  1.00 7.84  ? 186  VAL B O   1 
ATOM   4197  C CB  . VAL B 1 187 ? -8.104  13.236  50.548  1.00 7.87  ? 186  VAL B CB  1 
ATOM   4198  C CG1 . VAL B 1 187 ? -7.454  12.470  49.409  1.00 8.54  ? 186  VAL B CG1 1 
ATOM   4199  C CG2 . VAL B 1 187 ? -8.345  14.685  50.201  1.00 9.18  ? 186  VAL B CG2 1 
ATOM   4200  N N   . GLU B 1 188 ? -10.012 10.246  50.699  1.00 7.26  ? 187  GLU B N   1 
ATOM   4201  C CA  . GLU B 1 188 ? -9.994  8.819   51.000  1.00 7.27  ? 187  GLU B CA  1 
ATOM   4202  C C   . GLU B 1 188 ? -9.736  7.921   49.810  1.00 7.98  ? 187  GLU B C   1 
ATOM   4203  O O   . GLU B 1 188 ? -10.649 7.412   49.131  1.00 8.16  ? 187  GLU B O   1 
ATOM   4204  C CB  . GLU B 1 188 ? -11.336 8.404   51.658  1.00 7.61  ? 187  GLU B CB  1 
ATOM   4205  C CG  . GLU B 1 188 ? -11.444 6.980   52.159  1.00 7.96  ? 187  GLU B CG  1 
ATOM   4206  C CD  . GLU B 1 188 ? -12.722 6.546   52.819  1.00 9.86  ? 187  GLU B CD  1 
ATOM   4207  O OE1 . GLU B 1 188 ? -13.491 7.491   53.028  1.00 11.77 ? 187  GLU B OE1 1 
ATOM   4208  O OE2 . GLU B 1 188 ? -12.998 5.392   53.104  1.00 11.58 ? 187  GLU B OE2 1 
ATOM   4209  N N   . PRO B 1 189 ? -8.449  7.671   49.562  1.00 7.41  ? 188  PRO B N   1 
ATOM   4210  C CA  . PRO B 1 189 ? -7.986  6.730   48.554  1.00 7.35  ? 188  PRO B CA  1 
ATOM   4211  C C   . PRO B 1 189 ? -7.802  5.348   49.160  1.00 7.22  ? 188  PRO B C   1 
ATOM   4212  O O   . PRO B 1 189 ? -6.669  5.006   49.556  1.00 8.34  ? 188  PRO B O   1 
ATOM   4213  C CB  . PRO B 1 189 ? -6.657  7.339   48.090  1.00 7.42  ? 188  PRO B CB  1 
ATOM   4214  C CG  . PRO B 1 189 ? -6.227  8.321   49.150  1.00 8.00  ? 188  PRO B CG  1 
ATOM   4215  C CD  . PRO B 1 189 ? -7.293  8.291   50.241  1.00 7.39  ? 188  PRO B CD  1 
ATOM   4216  N N   . GLU B 1 190 ? -8.840  4.531   49.247  1.00 6.74  ? 189  GLU B N   1 
ATOM   4217  C CA  . GLU B 1 190 ? -8.687  3.233   49.895  1.00 7.25  ? 189  GLU B CA  1 
ATOM   4218  C C   . GLU B 1 190 ? -8.093  2.164   48.991  1.00 7.47  ? 189  GLU B C   1 
ATOM   4219  O O   . GLU B 1 190 ? -8.722  1.812   47.976  1.00 7.36  ? 189  GLU B O   1 
ATOM   4220  C CB  . GLU B 1 190 ? -9.991  2.648   50.472  1.00 7.91  ? 189  GLU B CB  1 
ATOM   4221  C CG  . GLU B 1 190 ? -9.777  1.314   51.208  1.00 7.08  ? 189  GLU B CG  1 
ATOM   4222  C CD  . GLU B 1 190 ? -10.942 0.662   51.875  1.00 9.46  ? 189  GLU B CD  1 
ATOM   4223  O OE1 . GLU B 1 190 ? -11.982 1.327   51.784  1.00 11.08 ? 189  GLU B OE1 1 
ATOM   4224  O OE2 . GLU B 1 190 ? -10.904 -0.430  52.431  1.00 10.20 ? 189  GLU B OE2 1 
ATOM   4225  N N   . VAL B 1 191 ? -6.934  1.664   49.396  1.00 7.27  ? 190  VAL B N   1 
ATOM   4226  C CA  . VAL B 1 191 ? -6.342  0.465   48.757  1.00 8.37  ? 190  VAL B CA  1 
ATOM   4227  C C   . VAL B 1 191 ? -6.967  -0.734  49.485  1.00 9.77  ? 190  VAL B C   1 
ATOM   4228  O O   . VAL B 1 191 ? -6.710  -0.898  50.701  1.00 9.40  ? 190  VAL B O   1 
ATOM   4229  C CB  . VAL B 1 191 ? -4.809  0.522   48.851  1.00 8.36  ? 190  VAL B CB  1 
ATOM   4230  C CG1 . VAL B 1 191 ? -4.156  -0.762  48.379  1.00 6.05  ? 190  VAL B CG1 1 
ATOM   4231  C CG2 . VAL B 1 191 ? -4.214  1.738   48.139  1.00 8.97  ? 190  VAL B CG2 1 
ATOM   4232  N N   . LEU B 1 192 ? -7.769  -1.514  48.791  1.00 9.80  ? 191  LEU B N   1 
ATOM   4233  C CA  . LEU B 1 192 ? -8.498  -2.644  49.388  1.00 11.72 ? 191  LEU B CA  1 
ATOM   4234  C C   . LEU B 1 192 ? -7.532  -3.730  49.861  1.00 12.41 ? 191  LEU B C   1 
ATOM   4235  O O   . LEU B 1 192 ? -6.497  -3.982  49.222  1.00 12.89 ? 191  LEU B O   1 
ATOM   4236  C CB  . LEU B 1 192 ? -9.463  -3.197  48.339  1.00 10.36 ? 191  LEU B CB  1 
ATOM   4237  C CG  . LEU B 1 192 ? -10.614 -2.351  47.847  1.00 11.89 ? 191  LEU B CG  1 
ATOM   4238  C CD1 . LEU B 1 192 ? -11.347 -3.105  46.729  1.00 10.64 ? 191  LEU B CD1 1 
ATOM   4239  C CD2 . LEU B 1 192 ? -11.574 -2.088  49.013  1.00 10.55 ? 191  LEU B CD2 1 
ATOM   4240  N N   . PRO B 1 193 ? -7.931  -4.413  50.930  1.00 13.33 ? 192  PRO B N   1 
ATOM   4241  C CA  . PRO B 1 193 ? -7.118  -5.500  51.493  1.00 13.73 ? 192  PRO B CA  1 
ATOM   4242  C C   . PRO B 1 193 ? -7.302  -6.815  50.770  1.00 13.74 ? 192  PRO B C   1 
ATOM   4243  O O   . PRO B 1 193 ? -6.517  -7.769  50.951  1.00 13.89 ? 192  PRO B O   1 
ATOM   4244  C CB  . PRO B 1 193 ? -7.559  -5.546  52.955  1.00 14.01 ? 192  PRO B CB  1 
ATOM   4245  C CG  . PRO B 1 193 ? -8.934  -4.953  52.998  1.00 13.96 ? 192  PRO B CG  1 
ATOM   4246  C CD  . PRO B 1 193 ? -9.149  -4.171  51.719  1.00 13.30 ? 192  PRO B CD  1 
ATOM   4247  N N   . ASP B 1 194 ? -8.324  -6.899  49.928  1.00 14.40 ? 193  ASP B N   1 
ATOM   4248  C CA  . ASP B 1 194 ? -8.692  -8.137  49.222  1.00 14.62 ? 193  ASP B CA  1 
ATOM   4249  C C   . ASP B 1 194 ? -7.485  -8.711  48.472  1.00 14.56 ? 193  ASP B C   1 
ATOM   4250  O O   . ASP B 1 194 ? -6.789  -7.959  47.777  1.00 14.89 ? 193  ASP B O   1 
ATOM   4251  C CB  . ASP B 1 194 ? -9.857  -7.895  48.256  1.00 15.45 ? 193  ASP B CB  1 
ATOM   4252  C CG  . ASP B 1 194 ? -11.079 -7.256  48.860  1.00 17.22 ? 193  ASP B CG  1 
ATOM   4253  O OD1 . ASP B 1 194 ? -10.920 -6.228  49.555  1.00 16.51 ? 193  ASP B OD1 1 
ATOM   4254  O OD2 . ASP B 1 194 ? -12.211 -7.735  48.631  1.00 18.40 ? 193  ASP B OD2 1 
ATOM   4255  N N   . GLY B 1 195 ? -7.296  -10.008 48.597  1.00 14.71 ? 194  GLY B N   1 
ATOM   4256  C CA  . GLY B 1 195 ? -6.221  -10.685 47.826  1.00 15.28 ? 194  GLY B CA  1 
ATOM   4257  C C   . GLY B 1 195 ? -5.210  -11.312 48.784  1.00 16.08 ? 194  GLY B C   1 
ATOM   4258  O O   . GLY B 1 195 ? -5.329  -11.196 50.020  1.00 16.01 ? 194  GLY B O   1 
ATOM   4259  N N   . ASP B 1 196 ? -4.214  -11.939 48.173  1.00 16.32 ? 195  ASP B N   1 
ATOM   4260  C CA  . ASP B 1 196 ? -3.177  -12.663 48.909  1.00 16.56 ? 195  ASP B CA  1 
ATOM   4261  C C   . ASP B 1 196 ? -1.789  -12.064 48.734  1.00 16.07 ? 195  ASP B C   1 
ATOM   4262  O O   . ASP B 1 196 ? -0.799  -12.795 48.951  1.00 16.28 ? 195  ASP B O   1 
ATOM   4263  C CB  . ASP B 1 196 ? -3.236  -14.159 48.535  1.00 18.71 ? 195  ASP B CB  1 
ATOM   4264  C CG  . ASP B 1 196 ? -2.845  -14.413 47.090  1.00 19.02 ? 195  ASP B CG  1 
ATOM   4265  O OD1 . ASP B 1 196 ? -2.842  -13.515 46.247  1.00 20.39 ? 195  ASP B OD1 1 
ATOM   4266  O OD2 . ASP B 1 196 ? -2.552  -15.585 46.785  1.00 22.24 ? 195  ASP B OD2 1 
ATOM   4267  N N   . HIS B 1 197 ? -1.687  -10.800 48.354  1.00 15.13 ? 196  HIS B N   1 
ATOM   4268  C CA  . HIS B 1 197 ? -0.370  -10.152 48.229  1.00 14.04 ? 196  HIS B CA  1 
ATOM   4269  C C   . HIS B 1 197 ? 0.229   -9.967  49.631  1.00 13.85 ? 196  HIS B C   1 
ATOM   4270  O O   . HIS B 1 197 ? -0.499  -10.017 50.638  1.00 13.42 ? 196  HIS B O   1 
ATOM   4271  C CB  . HIS B 1 197 ? -0.472  -8.746  47.576  1.00 12.64 ? 196  HIS B CB  1 
ATOM   4272  C CG  . HIS B 1 197 ? -1.575  -7.977  48.256  1.00 11.44 ? 196  HIS B CG  1 
ATOM   4273  N ND1 . HIS B 1 197 ? -2.904  -8.149  47.986  1.00 12.14 ? 196  HIS B ND1 1 
ATOM   4274  C CD2 . HIS B 1 197 ? -1.493  -7.039  49.229  1.00 11.73 ? 196  HIS B CD2 1 
ATOM   4275  C CE1 . HIS B 1 197 ? -3.608  -7.329  48.764  1.00 11.86 ? 196  HIS B CE1 1 
ATOM   4276  N NE2 . HIS B 1 197 ? -2.769  -6.657  49.520  1.00 11.11 ? 196  HIS B NE2 1 
ATOM   4277  N N   . ASP B 1 198 ? 1.523   -9.748  49.652  1.00 13.35 ? 197  ASP B N   1 
ATOM   4278  C CA  . ASP B 1 198 ? 2.296   -9.529  50.895  1.00 13.00 ? 197  ASP B CA  1 
ATOM   4279  C C   . ASP B 1 198 ? 2.371   -8.052  51.243  1.00 11.99 ? 197  ASP B C   1 
ATOM   4280  O O   . ASP B 1 198 ? 1.906   -7.171  50.500  1.00 11.80 ? 197  ASP B O   1 
ATOM   4281  C CB  . ASP B 1 198 ? 3.647   -10.234 50.769  1.00 14.18 ? 197  ASP B CB  1 
ATOM   4282  C CG  . ASP B 1 198 ? 4.585   -9.626  49.750  1.00 16.12 ? 197  ASP B CG  1 
ATOM   4283  O OD1 . ASP B 1 198 ? 4.394   -8.505  49.250  1.00 16.31 ? 197  ASP B OD1 1 
ATOM   4284  O OD2 . ASP B 1 198 ? 5.570   -10.333 49.437  1.00 17.59 ? 197  ASP B OD2 1 
ATOM   4285  N N   . LEU B 1 199 ? 2.966   -7.756  52.394  1.00 11.08 ? 198  LEU B N   1 
ATOM   4286  C CA  . LEU B 1 199 ? 3.148   -6.408  52.909  1.00 10.52 ? 198  LEU B CA  1 
ATOM   4287  C C   . LEU B 1 199 ? 3.980   -5.520  51.986  1.00 10.33 ? 198  LEU B C   1 
ATOM   4288  O O   . LEU B 1 199 ? 3.726   -4.302  51.894  1.00 10.42 ? 198  LEU B O   1 
ATOM   4289  C CB  . LEU B 1 199 ? 3.720   -6.500  54.333  1.00 11.33 ? 198  LEU B CB  1 
ATOM   4290  C CG  . LEU B 1 199 ? 3.957   -5.171  55.046  1.00 13.06 ? 198  LEU B CG  1 
ATOM   4291  C CD1 . LEU B 1 199 ? 2.627   -4.552  55.463  1.00 13.68 ? 198  LEU B CD1 1 
ATOM   4292  C CD2 . LEU B 1 199 ? 4.807   -5.446  56.284  1.00 14.08 ? 198  LEU B CD2 1 
ATOM   4293  N N   . ASP B 1 200 ? 4.964   -6.118  51.354  1.00 10.19 ? 199  ASP B N   1 
ATOM   4294  C CA  . ASP B 1 200 ? 5.867   -5.375  50.442  1.00 10.33 ? 199  ASP B CA  1 
ATOM   4295  C C   . ASP B 1 200 ? 5.052   -4.769  49.284  1.00 9.98  ? 199  ASP B C   1 
ATOM   4296  O O   . ASP B 1 200 ? 5.203   -3.582  49.005  1.00 9.72  ? 199  ASP B O   1 
ATOM   4297  C CB  . ASP B 1 200 ? 7.012   -6.269  50.027  1.00 13.14 ? 199  ASP B CB  1 
ATOM   4298  C CG  . ASP B 1 200 ? 7.921   -5.670  48.964  1.00 14.45 ? 199  ASP B CG  1 
ATOM   4299  O OD1 . ASP B 1 200 ? 8.527   -4.631  49.271  1.00 15.78 ? 199  ASP B OD1 1 
ATOM   4300  O OD2 . ASP B 1 200 ? 8.005   -6.243  47.872  1.00 15.75 ? 199  ASP B OD2 1 
ATOM   4301  N N   . ARG B 1 201 ? 4.230   -5.597  48.671  1.00 10.27 ? 200  ARG B N   1 
ATOM   4302  C CA  . ARG B 1 201 ? 3.354   -5.151  47.562  1.00 10.59 ? 200  ARG B CA  1 
ATOM   4303  C C   . ARG B 1 201 ? 2.384   -4.077  48.028  1.00 9.51  ? 200  ARG B C   1 
ATOM   4304  O O   . ARG B 1 201 ? 2.157   -3.036  47.388  1.00 9.28  ? 200  ARG B O   1 
ATOM   4305  C CB  . ARG B 1 201 ? 2.614   -6.315  46.923  1.00 9.83  ? 200  ARG B CB  1 
ATOM   4306  C CG  . ARG B 1 201 ? 1.585   -5.886  45.872  1.00 10.69 ? 200  ARG B CG  1 
ATOM   4307  C CD  . ARG B 1 201 ? 1.825   -6.566  44.562  1.00 11.85 ? 200  ARG B CD  1 
ATOM   4308  N NE  . ARG B 1 201 ? 0.859   -6.177  43.547  1.00 9.92  ? 200  ARG B NE  1 
ATOM   4309  C CZ  . ARG B 1 201 ? 0.958   -5.130  42.748  1.00 9.12  ? 200  ARG B CZ  1 
ATOM   4310  N NH1 . ARG B 1 201 ? 1.963   -4.269  42.750  1.00 6.46  ? 200  ARG B NH1 1 
ATOM   4311  N NH2 . ARG B 1 201 ? -0.046  -4.927  41.872  1.00 9.93  ? 200  ARG B NH2 1 
ATOM   4312  N N   . ALA B 1 202 ? 1.776   -4.347  49.185  1.00 8.90  ? 201  ALA B N   1 
ATOM   4313  C CA  . ALA B 1 202 ? 0.884   -3.357  49.803  1.00 8.29  ? 201  ALA B CA  1 
ATOM   4314  C C   . ALA B 1 202 ? 1.580   -2.039  50.034  1.00 7.45  ? 201  ALA B C   1 
ATOM   4315  O O   . ALA B 1 202 ? 0.995   -0.958  49.770  1.00 7.01  ? 201  ALA B O   1 
ATOM   4316  C CB  . ALA B 1 202 ? 0.210   -3.940  51.034  1.00 8.06  ? 201  ALA B CB  1 
ATOM   4317  N N   . GLN B 1 203 ? 2.831   -2.042  50.507  1.00 6.56  ? 202  GLN B N   1 
ATOM   4318  C CA  . GLN B 1 203 ? 3.528   -0.786  50.805  1.00 5.95  ? 202  GLN B CA  1 
ATOM   4319  C C   . GLN B 1 203 ? 3.832   -0.028  49.486  1.00 5.76  ? 202  GLN B C   1 
ATOM   4320  O O   . GLN B 1 203 ? 3.684   1.190   49.437  1.00 5.44  ? 202  GLN B O   1 
ATOM   4321  C CB  . GLN B 1 203 ? 4.855   -0.989  51.555  1.00 6.54  ? 202  GLN B CB  1 
ATOM   4322  C CG  . GLN B 1 203 ? 5.486   0.298   52.014  1.00 8.63  ? 202  GLN B CG  1 
ATOM   4323  C CD  . GLN B 1 203 ? 6.690   0.093   52.916  1.00 8.17  ? 202  GLN B CD  1 
ATOM   4324  O OE1 . GLN B 1 203 ? 7.103   -1.029  53.180  1.00 11.87 ? 202  GLN B OE1 1 
ATOM   4325  N NE2 . GLN B 1 203 ? 7.235   1.195   53.395  1.00 9.94  ? 202  GLN B NE2 1 
ATOM   4326  N N   . LYS B 1 204 ? 4.302   -0.794  48.520  1.00 5.65  ? 203  LYS B N   1 
ATOM   4327  C CA  . LYS B 1 204 ? 4.657   -0.180  47.201  1.00 5.47  ? 203  LYS B CA  1 
ATOM   4328  C C   . LYS B 1 204 ? 3.423   0.418   46.534  1.00 4.34  ? 203  LYS B C   1 
ATOM   4329  O O   . LYS B 1 204 ? 3.480   1.544   46.006  1.00 4.56  ? 203  LYS B O   1 
ATOM   4330  C CB  . LYS B 1 204 ? 5.335   -1.213  46.312  1.00 5.92  ? 203  LYS B CB  1 
ATOM   4331  C CG  . LYS B 1 204 ? 6.802   -1.460  46.722  1.00 5.30  ? 203  LYS B CG  1 
ATOM   4332  C CD  . LYS B 1 204 ? 7.315   -2.769  46.138  1.00 7.17  ? 203  LYS B CD  1 
ATOM   4333  C CE  . LYS B 1 204 ? 8.802   -2.950  46.479  1.00 6.81  ? 203  LYS B CE  1 
ATOM   4334  N NZ  . LYS B 1 204 ? 9.227   -4.296  46.041  1.00 8.34  ? 203  LYS B NZ  1 
ATOM   4335  N N   . VAL B 1 205 ? 2.328   -0.293  46.548  1.00 5.23  ? 204  VAL B N   1 
ATOM   4336  C CA  . VAL B 1 205 ? 1.046   0.215   46.000  1.00 5.95  ? 204  VAL B CA  1 
ATOM   4337  C C   . VAL B 1 205 ? 0.625   1.491   46.708  1.00 6.07  ? 204  VAL B C   1 
ATOM   4338  O O   . VAL B 1 205 ? 0.331   2.519   46.056  1.00 5.97  ? 204  VAL B O   1 
ATOM   4339  C CB  . VAL B 1 205 ? -0.024  -0.884  45.979  1.00 3.69  ? 204  VAL B CB  1 
ATOM   4340  C CG1 . VAL B 1 205 ? -1.416  -0.344  45.601  1.00 3.13  ? 204  VAL B CG1 1 
ATOM   4341  C CG2 . VAL B 1 205 ? 0.377   -2.032  45.055  1.00 6.49  ? 204  VAL B CG2 1 
ATOM   4342  N N   . THR B 1 206 ? 0.619   1.452   48.042  1.00 5.94  ? 205  THR B N   1 
ATOM   4343  C CA  . THR B 1 206 ? 0.180   2.618   48.819  1.00 5.57  ? 205  THR B CA  1 
ATOM   4344  C C   . THR B 1 206 ? 1.024   3.841   48.520  1.00 5.33  ? 205  THR B C   1 
ATOM   4345  O O   . THR B 1 206 ? 0.531   4.967   48.326  1.00 5.07  ? 205  THR B O   1 
ATOM   4346  C CB  . THR B 1 206 ? 0.068   2.345   50.375  1.00 6.22  ? 205  THR B CB  1 
ATOM   4347  O OG1 . THR B 1 206 ? -0.949  1.309   50.562  1.00 8.64  ? 205  THR B OG1 1 
ATOM   4348  C CG2 . THR B 1 206 ? -0.289  3.594   51.181  1.00 6.56  ? 205  THR B CG2 1 
ATOM   4349  N N   . GLU B 1 207 ? 2.344   3.634   48.479  1.00 4.77  ? 206  GLU B N   1 
ATOM   4350  C CA  . GLU B 1 207 ? 3.256   4.735   48.180  1.00 4.79  ? 206  GLU B CA  1 
ATOM   4351  C C   . GLU B 1 207 ? 3.000   5.322   46.789  1.00 4.26  ? 206  GLU B C   1 
ATOM   4352  O O   . GLU B 1 207 ? 3.039   6.552   46.645  1.00 4.82  ? 206  GLU B O   1 
ATOM   4353  C CB  . GLU B 1 207 ? 4.717   4.328   48.305  1.00 7.37  ? 206  GLU B CB  1 
ATOM   4354  C CG  . GLU B 1 207 ? 5.197   4.309   49.805  1.00 7.84  ? 206  GLU B CG  1 
ATOM   4355  C CD  . GLU B 1 207 ? 6.513   3.601   49.970  1.00 10.92 ? 206  GLU B CD  1 
ATOM   4356  O OE1 . GLU B 1 207 ? 7.171   3.186   49.028  1.00 11.64 ? 206  GLU B OE1 1 
ATOM   4357  O OE2 . GLU B 1 207 ? 6.828   3.440   51.171  1.00 9.30  ? 206  GLU B OE2 1 
ATOM   4358  N N   . THR B 1 208 ? 2.729   4.466   45.840  1.00 4.82  ? 207  THR B N   1 
ATOM   4359  C CA  . THR B 1 208 ? 2.473   4.921   44.442  1.00 5.13  ? 207  THR B CA  1 
ATOM   4360  C C   . THR B 1 208 ? 1.184   5.742   44.402  1.00 4.57  ? 207  THR B C   1 
ATOM   4361  O O   . THR B 1 208 ? 1.184   6.835   43.816  1.00 4.40  ? 207  THR B O   1 
ATOM   4362  C CB  . THR B 1 208 ? 2.436   3.709   43.451  1.00 5.88  ? 207  THR B CB  1 
ATOM   4363  O OG1 . THR B 1 208 ? 3.690   2.993   43.611  1.00 7.06  ? 207  THR B OG1 1 
ATOM   4364  C CG2 . THR B 1 208 ? 2.207   4.118   41.986  1.00 7.53  ? 207  THR B CG2 1 
ATOM   4365  N N   . VAL B 1 209 ? 0.143   5.203   45.028  1.00 4.72  ? 208  VAL B N   1 
ATOM   4366  C CA  . VAL B 1 209 ? -1.154  5.894   45.083  1.00 5.15  ? 208  VAL B CA  1 
ATOM   4367  C C   . VAL B 1 209 ? -1.074  7.270   45.705  1.00 5.44  ? 208  VAL B C   1 
ATOM   4368  O O   . VAL B 1 209 ? -1.644  8.225   45.145  1.00 5.08  ? 208  VAL B O   1 
ATOM   4369  C CB  . VAL B 1 209 ? -2.243  5.020   45.736  1.00 5.61  ? 208  VAL B CB  1 
ATOM   4370  C CG1 . VAL B 1 209 ? -3.506  5.822   46.048  1.00 5.94  ? 208  VAL B CG1 1 
ATOM   4371  C CG2 . VAL B 1 209 ? -2.559  3.769   44.956  1.00 6.02  ? 208  VAL B CG2 1 
ATOM   4372  N N   . LEU B 1 210 ? -0.442  7.381   46.874  1.00 5.42  ? 209  LEU B N   1 
ATOM   4373  C CA  . LEU B 1 210 ? -0.372  8.621   47.636  1.00 5.07  ? 209  LEU B CA  1 
ATOM   4374  C C   . LEU B 1 210 ? 0.430   9.685   46.896  1.00 4.08  ? 209  LEU B C   1 
ATOM   4375  O O   . LEU B 1 210 ? 0.082   10.873  46.993  1.00 3.20  ? 209  LEU B O   1 
ATOM   4376  C CB  . LEU B 1 210 ? 0.151   8.338   49.055  1.00 7.09  ? 209  LEU B CB  1 
ATOM   4377  C CG  . LEU B 1 210 ? -0.716  7.427   49.936  1.00 9.67  ? 209  LEU B CG  1 
ATOM   4378  C CD1 . LEU B 1 210 ? -0.128  7.302   51.337  1.00 9.24  ? 209  LEU B CD1 1 
ATOM   4379  C CD2 . LEU B 1 210 ? -2.107  8.062   50.021  1.00 9.22  ? 209  LEU B CD2 1 
ATOM   4380  N N   . ALA B 1 211 ? 1.468   9.260   46.191  1.00 3.75  ? 210  ALA B N   1 
ATOM   4381  C CA  . ALA B 1 211 ? 2.276   10.227  45.423  1.00 3.93  ? 210  ALA B CA  1 
ATOM   4382  C C   . ALA B 1 211 ? 1.394   10.876  44.339  1.00 3.38  ? 210  ALA B C   1 
ATOM   4383  O O   . ALA B 1 211 ? 1.493   12.093  44.111  1.00 3.58  ? 210  ALA B O   1 
ATOM   4384  C CB  . ALA B 1 211 ? 3.526   9.579   44.831  1.00 4.82  ? 210  ALA B CB  1 
ATOM   4385  N N   . ALA B 1 212 ? 0.563   10.052  43.736  1.00 3.44  ? 211  ALA B N   1 
ATOM   4386  C CA  . ALA B 1 212 ? -0.347  10.564  42.671  1.00 3.66  ? 211  ALA B CA  1 
ATOM   4387  C C   . ALA B 1 212 ? -1.381  11.494  43.263  1.00 3.52  ? 211  ALA B C   1 
ATOM   4388  O O   . ALA B 1 212 ? -1.687  12.571  42.733  1.00 3.31  ? 211  ALA B O   1 
ATOM   4389  C CB  . ALA B 1 212 ? -0.976  9.409   41.902  1.00 4.12  ? 211  ALA B CB  1 
ATOM   4390  N N   . VAL B 1 213 ? -1.934  11.067  44.415  1.00 4.09  ? 212  VAL B N   1 
ATOM   4391  C CA  . VAL B 1 213 ? -2.917  11.925  45.101  1.00 3.78  ? 212  VAL B CA  1 
ATOM   4392  C C   . VAL B 1 213 ? -2.417  13.319  45.381  1.00 3.45  ? 212  VAL B C   1 
ATOM   4393  O O   . VAL B 1 213 ? -3.141  14.319  45.152  1.00 3.05  ? 212  VAL B O   1 
ATOM   4394  C CB  . VAL B 1 213 ? -3.456  11.206  46.366  1.00 3.82  ? 212  VAL B CB  1 
ATOM   4395  C CG1 . VAL B 1 213 ? -4.204  12.199  47.249  1.00 6.95  ? 212  VAL B CG1 1 
ATOM   4396  C CG2 . VAL B 1 213 ? -4.348  10.034  45.985  1.00 5.58  ? 212  VAL B CG2 1 
ATOM   4397  N N   . TYR B 1 214 ? -1.217  13.449  45.956  1.00 3.34  ? 213  TYR B N   1 
ATOM   4398  C CA  . TYR B 1 214 ? -0.685  14.760  46.305  1.00 2.79  ? 213  TYR B CA  1 
ATOM   4399  C C   . TYR B 1 214 ? -0.238  15.560  45.104  1.00 2.05  ? 213  TYR B C   1 
ATOM   4400  O O   . TYR B 1 214 ? -0.280  16.798  45.145  1.00 2.00  ? 213  TYR B O   1 
ATOM   4401  C CB  . TYR B 1 214 ? 0.374   14.685  47.472  1.00 4.05  ? 213  TYR B CB  1 
ATOM   4402  C CG  . TYR B 1 214 ? -0.479  14.420  48.729  1.00 4.11  ? 213  TYR B CG  1 
ATOM   4403  C CD1 . TYR B 1 214 ? -1.197  15.479  49.284  1.00 6.32  ? 213  TYR B CD1 1 
ATOM   4404  C CD2 . TYR B 1 214 ? -0.620  13.137  49.215  1.00 6.07  ? 213  TYR B CD2 1 
ATOM   4405  C CE1 . TYR B 1 214 ? -2.046  15.248  50.387  1.00 6.79  ? 213  TYR B CE1 1 
ATOM   4406  C CE2 . TYR B 1 214 ? -1.463  12.899  50.319  1.00 8.45  ? 213  TYR B CE2 1 
ATOM   4407  C CZ  . TYR B 1 214 ? -2.157  13.954  50.875  1.00 7.10  ? 213  TYR B CZ  1 
ATOM   4408  O OH  . TYR B 1 214 ? -2.983  13.673  51.936  1.00 7.64  ? 213  TYR B OH  1 
ATOM   4409  N N   . LYS B 1 215 ? 0.101   14.873  44.034  1.00 3.08  ? 214  LYS B N   1 
ATOM   4410  C CA  . LYS B 1 215 ? 0.472   15.630  42.791  1.00 3.17  ? 214  LYS B CA  1 
ATOM   4411  C C   . LYS B 1 215 ? -0.796  16.232  42.208  1.00 3.68  ? 214  LYS B C   1 
ATOM   4412  O O   . LYS B 1 215 ? -0.805  17.409  41.784  1.00 4.33  ? 214  LYS B O   1 
ATOM   4413  C CB  . LYS B 1 215 ? 1.241   14.777  41.812  1.00 3.00  ? 214  LYS B CB  1 
ATOM   4414  C CG  . LYS B 1 215 ? 1.656   15.503  40.514  1.00 2.47  ? 214  LYS B CG  1 
ATOM   4415  C CD  . LYS B 1 215 ? 2.298   16.853  40.729  1.00 2.19  ? 214  LYS B CD  1 
ATOM   4416  C CE  . LYS B 1 215 ? 3.137   17.277  39.520  1.00 2.17  ? 214  LYS B CE  1 
ATOM   4417  N NZ  . LYS B 1 215 ? 2.236   17.756  38.416  1.00 2.34  ? 214  LYS B NZ  1 
ATOM   4418  N N   . ALA B 1 216 ? -1.881  15.472  42.236  1.00 4.15  ? 215  ALA B N   1 
ATOM   4419  C CA  . ALA B 1 216 ? -3.194  15.965  41.757  1.00 4.27  ? 215  ALA B CA  1 
ATOM   4420  C C   . ALA B 1 216 ? -3.710  17.103  42.618  1.00 4.90  ? 215  ALA B C   1 
ATOM   4421  O O   . ALA B 1 216 ? -4.256  18.083  42.096  1.00 3.59  ? 215  ALA B O   1 
ATOM   4422  C CB  . ALA B 1 216 ? -4.203  14.812  41.736  1.00 3.17  ? 215  ALA B CB  1 
ATOM   4423  N N   . LEU B 1 217 ? -3.523  16.993  43.958  1.00 4.51  ? 216  LEU B N   1 
ATOM   4424  C CA  . LEU B 1 217 ? -4.013  18.072  44.826  1.00 4.43  ? 216  LEU B CA  1 
ATOM   4425  C C   . LEU B 1 217 ? -3.286  19.367  44.500  1.00 4.19  ? 216  LEU B C   1 
ATOM   4426  O O   . LEU B 1 217 ? -3.825  20.472  44.569  1.00 4.70  ? 216  LEU B O   1 
ATOM   4427  C CB  . LEU B 1 217 ? -3.868  17.666  46.312  1.00 5.17  ? 216  LEU B CB  1 
ATOM   4428  C CG  . LEU B 1 217 ? -4.774  16.541  46.784  1.00 8.82  ? 216  LEU B CG  1 
ATOM   4429  C CD1 . LEU B 1 217 ? -4.546  16.229  48.254  1.00 9.40  ? 216  LEU B CD1 1 
ATOM   4430  C CD2 . LEU B 1 217 ? -6.217  16.961  46.527  1.00 8.35  ? 216  LEU B CD2 1 
ATOM   4431  N N   . SER B 1 218 ? -2.009  19.194  44.152  1.00 3.52  ? 217  SER B N   1 
ATOM   4432  C CA  . SER B 1 218 ? -1.179  20.368  43.805  1.00 3.76  ? 217  SER B CA  1 
ATOM   4433  C C   . SER B 1 218 ? -1.633  20.958  42.465  1.00 3.82  ? 217  SER B C   1 
ATOM   4434  O O   . SER B 1 218 ? -1.763  22.194  42.347  1.00 3.98  ? 217  SER B O   1 
ATOM   4435  C CB  . SER B 1 218 ? 0.286   19.968  43.792  1.00 4.29  ? 217  SER B CB  1 
ATOM   4436  O OG  . SER B 1 218 ? 1.077   20.989  43.215  1.00 4.60  ? 217  SER B OG  1 
ATOM   4437  N N   . ASP B 1 219 ? -1.827  20.079  41.497  1.00 4.52  ? 218  ASP B N   1 
ATOM   4438  C CA  . ASP B 1 219 ? -2.289  20.513  40.145  1.00 5.02  ? 218  ASP B CA  1 
ATOM   4439  C C   . ASP B 1 219 ? -3.585  21.305  40.256  1.00 5.26  ? 218  ASP B C   1 
ATOM   4440  O O   . ASP B 1 219 ? -3.799  22.297  39.507  1.00 5.51  ? 218  ASP B O   1 
ATOM   4441  C CB  . ASP B 1 219 ? -2.388  19.322  39.201  1.00 5.48  ? 218  ASP B CB  1 
ATOM   4442  C CG  . ASP B 1 219 ? -1.070  18.697  38.816  1.00 5.26  ? 218  ASP B CG  1 
ATOM   4443  O OD1 . ASP B 1 219 ? 0.008   19.236  39.041  1.00 7.59  ? 218  ASP B OD1 1 
ATOM   4444  O OD2 . ASP B 1 219 ? -1.125  17.576  38.255  1.00 6.30  ? 218  ASP B OD2 1 
ATOM   4445  N N   . HIS B 1 220 ? -4.460  20.885  41.173  1.00 4.69  ? 219  HIS B N   1 
ATOM   4446  C CA  . HIS B 1 220 ? -5.748  21.597  41.326  1.00 5.06  ? 219  HIS B CA  1 
ATOM   4447  C C   . HIS B 1 220 ? -5.756  22.642  42.429  1.00 5.77  ? 219  HIS B C   1 
ATOM   4448  O O   . HIS B 1 220 ? -6.835  23.166  42.817  1.00 6.03  ? 219  HIS B O   1 
ATOM   4449  C CB  . HIS B 1 220 ? -6.932  20.625  41.472  1.00 5.28  ? 219  HIS B CB  1 
ATOM   4450  C CG  . HIS B 1 220 ? -7.162  19.735  40.284  1.00 6.06  ? 219  HIS B CG  1 
ATOM   4451  N ND1 . HIS B 1 220 ? -8.100  19.992  39.319  1.00 6.30  ? 219  HIS B ND1 1 
ATOM   4452  C CD2 . HIS B 1 220 ? -6.578  18.548  39.951  1.00 5.46  ? 219  HIS B CD2 1 
ATOM   4453  C CE1 . HIS B 1 220 ? -8.092  19.013  38.436  1.00 5.60  ? 219  HIS B CE1 1 
ATOM   4454  N NE2 . HIS B 1 220 ? -7.188  18.118  38.791  1.00 7.71  ? 219  HIS B NE2 1 
ATOM   4455  N N   . HIS B 1 221 ? -4.611  22.992  42.964  1.00 5.61  ? 220  HIS B N   1 
ATOM   4456  C CA  . HIS B 1 221 ? -4.419  24.083  43.916  1.00 5.88  ? 220  HIS B CA  1 
ATOM   4457  C C   . HIS B 1 221 ? -5.237  23.937  45.208  1.00 5.13  ? 220  HIS B C   1 
ATOM   4458  O O   . HIS B 1 221 ? -5.793  24.927  45.701  1.00 5.29  ? 220  HIS B O   1 
ATOM   4459  C CB  . HIS B 1 221 ? -4.747  25.468  43.277  1.00 7.53  ? 220  HIS B CB  1 
ATOM   4460  C CG  . HIS B 1 221 ? -3.970  25.697  42.006  1.00 10.29 ? 220  HIS B CG  1 
ATOM   4461  N ND1 . HIS B 1 221 ? -2.608  25.583  41.887  1.00 12.28 ? 220  HIS B ND1 1 
ATOM   4462  C CD2 . HIS B 1 221 ? -4.433  26.040  40.784  1.00 9.34  ? 220  HIS B CD2 1 
ATOM   4463  C CE1 . HIS B 1 221 ? -2.263  25.833  40.625  1.00 12.12 ? 220  HIS B CE1 1 
ATOM   4464  N NE2 . HIS B 1 221 ? -3.355  26.106  39.942  1.00 12.09 ? 220  HIS B NE2 1 
ATOM   4465  N N   . VAL B 1 222 ? -5.287  22.735  45.734  1.00 5.02  ? 221  VAL B N   1 
ATOM   4466  C CA  . VAL B 1 222 ? -6.039  22.468  46.993  1.00 5.93  ? 221  VAL B CA  1 
ATOM   4467  C C   . VAL B 1 222 ? -5.217  22.920  48.194  1.00 5.84  ? 221  VAL B C   1 
ATOM   4468  O O   . VAL B 1 222 ? -3.996  22.697  48.250  1.00 6.18  ? 221  VAL B O   1 
ATOM   4469  C CB  . VAL B 1 222 ? -6.477  21.006  47.000  1.00 5.32  ? 221  VAL B CB  1 
ATOM   4470  C CG1 . VAL B 1 222 ? -7.059  20.568  48.333  1.00 6.95  ? 221  VAL B CG1 1 
ATOM   4471  C CG2 . VAL B 1 222 ? -7.486  20.745  45.865  1.00 6.26  ? 221  VAL B CG2 1 
ATOM   4472  N N   . TYR B 1 223 ? -5.894  23.558  49.139  1.00 6.02  ? 222  TYR B N   1 
ATOM   4473  C CA  . TYR B 1 223 ? -5.222  24.065  50.375  1.00 5.67  ? 222  TYR B CA  1 
ATOM   4474  C C   . TYR B 1 223 ? -5.064  22.934  51.361  1.00 5.48  ? 222  TYR B C   1 
ATOM   4475  O O   . TYR B 1 223 ? -5.999  22.493  52.083  1.00 5.35  ? 222  TYR B O   1 
ATOM   4476  C CB  . TYR B 1 223 ? -5.986  25.287  50.880  1.00 7.82  ? 222  TYR B CB  1 
ATOM   4477  C CG  . TYR B 1 223 ? -5.506  25.884  52.187  1.00 9.64  ? 222  TYR B CG  1 
ATOM   4478  C CD1 . TYR B 1 223 ? -4.283  26.527  52.278  1.00 10.27 ? 222  TYR B CD1 1 
ATOM   4479  C CD2 . TYR B 1 223 ? -6.315  25.798  53.331  1.00 8.57  ? 222  TYR B CD2 1 
ATOM   4480  C CE1 . TYR B 1 223 ? -3.848  27.083  53.493  1.00 11.55 ? 222  TYR B CE1 1 
ATOM   4481  C CE2 . TYR B 1 223 ? -5.894  26.333  54.540  1.00 9.19  ? 222  TYR B CE2 1 
ATOM   4482  C CZ  . TYR B 1 223 ? -4.664  26.981  54.611  1.00 10.31 ? 222  TYR B CZ  1 
ATOM   4483  O OH  . TYR B 1 223 ? -4.209  27.524  55.782  1.00 12.56 ? 222  TYR B OH  1 
ATOM   4484  N N   . LEU B 1 224 ? -3.835  22.427  51.444  1.00 4.68  ? 223  LEU B N   1 
ATOM   4485  C CA  . LEU B 1 224 ? -3.509  21.208  52.166  1.00 4.43  ? 223  LEU B CA  1 
ATOM   4486  C C   . LEU B 1 224 ? -3.822  21.308  53.666  1.00 5.14  ? 223  LEU B C   1 
ATOM   4487  O O   . LEU B 1 224 ? -4.230  20.311  54.257  1.00 4.95  ? 223  LEU B O   1 
ATOM   4488  C CB  . LEU B 1 224 ? -2.036  20.870  51.888  1.00 7.22  ? 223  LEU B CB  1 
ATOM   4489  C CG  . LEU B 1 224 ? -1.639  20.430  50.486  1.00 6.41  ? 223  LEU B CG  1 
ATOM   4490  C CD1 . LEU B 1 224 ? -0.155  20.059  50.437  1.00 8.92  ? 223  LEU B CD1 1 
ATOM   4491  C CD2 . LEU B 1 224 ? -2.483  19.236  50.076  1.00 7.46  ? 223  LEU B CD2 1 
ATOM   4492  N N   . GLU B 1 225 ? -3.594  22.478  54.214  1.00 6.61  ? 224  GLU B N   1 
ATOM   4493  C CA  . GLU B 1 225 ? -3.756  22.697  55.674  1.00 7.87  ? 224  GLU B CA  1 
ATOM   4494  C C   . GLU B 1 225 ? -5.209  22.534  56.069  1.00 8.70  ? 224  GLU B C   1 
ATOM   4495  O O   . GLU B 1 225 ? -5.552  22.208  57.215  1.00 10.02 ? 224  GLU B O   1 
ATOM   4496  C CB  . GLU B 1 225 ? -3.197  24.045  56.076  1.00 6.31  ? 224  GLU B CB  1 
ATOM   4497  C CG  . GLU B 1 225 ? -1.684  24.236  55.971  1.00 7.12  ? 224  GLU B CG  1 
ATOM   4498  C CD  . GLU B 1 225 ? -1.039  24.545  54.659  1.00 8.74  ? 224  GLU B CD  1 
ATOM   4499  O OE1 . GLU B 1 225 ? -1.735  24.361  53.623  1.00 5.72  ? 224  GLU B OE1 1 
ATOM   4500  O OE2 . GLU B 1 225 ? 0.114   24.957  54.603  1.00 7.34  ? 224  GLU B OE2 1 
ATOM   4501  N N   . GLY B 1 226 ? -6.072  22.718  55.089  1.00 9.05  ? 225  GLY B N   1 
ATOM   4502  C CA  . GLY B 1 226 ? -7.510  22.576  55.180  1.00 8.54  ? 225  GLY B CA  1 
ATOM   4503  C C   . GLY B 1 226 ? -8.045  21.242  54.706  1.00 8.04  ? 225  GLY B C   1 
ATOM   4504  O O   . GLY B 1 226 ? -9.222  21.179  54.277  1.00 8.66  ? 225  GLY B O   1 
ATOM   4505  N N   . THR B 1 227 ? -7.256  20.197  54.748  1.00 6.95  ? 226  THR B N   1 
ATOM   4506  C CA  . THR B 1 227 ? -7.676  18.850  54.395  1.00 6.94  ? 226  THR B CA  1 
ATOM   4507  C C   . THR B 1 227 ? -7.223  17.839  55.456  1.00 6.51  ? 226  THR B C   1 
ATOM   4508  O O   . THR B 1 227 ? -6.335  18.156  56.256  1.00 8.01  ? 226  THR B O   1 
ATOM   4509  C CB  . THR B 1 227 ? -7.117  18.413  52.979  1.00 7.07  ? 226  THR B CB  1 
ATOM   4510  O OG1 . THR B 1 227 ? -5.736  18.000  53.198  1.00 6.47  ? 226  THR B OG1 1 
ATOM   4511  C CG2 . THR B 1 227 ? -7.190  19.520  51.916  1.00 7.92  ? 226  THR B CG2 1 
ATOM   4512  N N   . LEU B 1 228 ? -7.793  16.669  55.393  1.00 6.21  ? 227  LEU B N   1 
ATOM   4513  C CA  . LEU B 1 228 ? -7.400  15.465  56.118  1.00 7.04  ? 227  LEU B CA  1 
ATOM   4514  C C   . LEU B 1 228 ? -7.236  14.321  55.116  1.00 7.79  ? 227  LEU B C   1 
ATOM   4515  O O   . LEU B 1 228 ? -7.888  14.340  54.033  1.00 7.74  ? 227  LEU B O   1 
ATOM   4516  C CB  . LEU B 1 228 ? -8.468  15.161  57.187  1.00 5.73  ? 227  LEU B CB  1 
ATOM   4517  C CG  . LEU B 1 228 ? -8.717  16.270  58.194  1.00 5.52  ? 227  LEU B CG  1 
ATOM   4518  C CD1 . LEU B 1 228 ? -9.939  15.963  59.055  1.00 7.53  ? 227  LEU B CD1 1 
ATOM   4519  C CD2 . LEU B 1 228 ? -7.467  16.364  59.101  1.00 7.27  ? 227  LEU B CD2 1 
ATOM   4520  N N   . LEU B 1 229 ? -6.414  13.345  55.465  1.00 7.06  ? 228  LEU B N   1 
ATOM   4521  C CA  . LEU B 1 229 ? -6.276  12.137  54.660  1.00 7.48  ? 228  LEU B CA  1 
ATOM   4522  C C   . LEU B 1 229 ? -6.868  10.949  55.435  1.00 8.51  ? 228  LEU B C   1 
ATOM   4523  O O   . LEU B 1 229 ? -6.617  10.871  56.666  1.00 8.46  ? 228  LEU B O   1 
ATOM   4524  C CB  . LEU B 1 229 ? -4.776  11.923  54.340  1.00 6.89  ? 228  LEU B CB  1 
ATOM   4525  C CG  . LEU B 1 229 ? -4.460  10.597  53.631  1.00 7.20  ? 228  LEU B CG  1 
ATOM   4526  C CD1 . LEU B 1 229 ? -4.959  10.666  52.173  1.00 8.00  ? 228  LEU B CD1 1 
ATOM   4527  C CD2 . LEU B 1 229 ? -2.950  10.383  53.638  1.00 5.36  ? 228  LEU B CD2 1 
ATOM   4528  N N   . LYS B 1 230 ? -7.592  10.104  54.743  1.00 7.02  ? 229  LYS B N   1 
ATOM   4529  C CA  . LYS B 1 230 ? -8.104  8.847   55.332  1.00 7.29  ? 229  LYS B CA  1 
ATOM   4530  C C   . LYS B 1 230 ? -7.631  7.657   54.520  1.00 7.50  ? 229  LYS B C   1 
ATOM   4531  O O   . LYS B 1 230 ? -8.354  7.118   53.639  1.00 7.61  ? 229  LYS B O   1 
ATOM   4532  C CB  . LYS B 1 230 ? -9.628  8.878   55.472  1.00 5.03  ? 229  LYS B CB  1 
ATOM   4533  C CG  . LYS B 1 230 ? -10.314 7.551   55.833  1.00 6.62  ? 229  LYS B CG  1 
ATOM   4534  C CD  . LYS B 1 230 ? -11.788 7.822   56.240  1.00 7.83  ? 229  LYS B CD  1 
ATOM   4535  C CE  . LYS B 1 230 ? -12.489 6.518   56.625  1.00 8.00  ? 229  LYS B CE  1 
ATOM   4536  N NZ  . LYS B 1 230 ? -13.814 6.861   57.236  1.00 11.32 ? 229  LYS B NZ  1 
ATOM   4537  N N   . PRO B 1 231 ? -6.421  7.184   54.826  1.00 8.30  ? 230  PRO B N   1 
ATOM   4538  C CA  . PRO B 1 231 ? -5.829  6.052   54.108  1.00 7.90  ? 230  PRO B CA  1 
ATOM   4539  C C   . PRO B 1 231 ? -5.986  4.748   54.868  1.00 8.96  ? 230  PRO B C   1 
ATOM   4540  O O   . PRO B 1 231 ? -6.348  4.689   56.055  1.00 9.41  ? 230  PRO B O   1 
ATOM   4541  C CB  . PRO B 1 231 ? -4.342  6.459   54.055  1.00 8.55  ? 230  PRO B CB  1 
ATOM   4542  C CG  . PRO B 1 231 ? -4.138  7.019   55.444  1.00 8.07  ? 230  PRO B CG  1 
ATOM   4543  C CD  . PRO B 1 231 ? -5.412  7.827   55.698  1.00 7.36  ? 230  PRO B CD  1 
ATOM   4544  N N   . ASN B 1 232 ? -5.750  3.694   54.122  1.00 9.31  ? 231  ASN B N   1 
ATOM   4545  C CA  . ASN B 1 232 ? -5.611  2.345   54.673  1.00 10.21 ? 231  ASN B CA  1 
ATOM   4546  C C   . ASN B 1 232 ? -4.250  2.338   55.429  1.00 9.65  ? 231  ASN B C   1 
ATOM   4547  O O   . ASN B 1 232 ? -3.335  3.072   55.039  1.00 9.54  ? 231  ASN B O   1 
ATOM   4548  C CB  . ASN B 1 232 ? -5.617  1.268   53.603  1.00 12.45 ? 231  ASN B CB  1 
ATOM   4549  C CG  . ASN B 1 232 ? -4.703  1.491   52.402  1.00 15.29 ? 231  ASN B CG  1 
ATOM   4550  O OD1 . ASN B 1 232 ? -5.039  2.256   51.483  1.00 15.36 ? 231  ASN B OD1 1 
ATOM   4551  N ND2 . ASN B 1 232 ? -3.539  0.841   52.344  1.00 14.93 ? 231  ASN B ND2 1 
ATOM   4552  N N   . MET B 1 233 ? -4.234  1.508   56.444  1.00 9.49  ? 232  MET B N   1 
ATOM   4553  C CA  . MET B 1 233 ? -2.947  1.110   57.069  1.00 9.52  ? 232  MET B CA  1 
ATOM   4554  C C   . MET B 1 233 ? -2.338  0.143   56.027  1.00 8.95  ? 232  MET B C   1 
ATOM   4555  O O   . MET B 1 233 ? -3.131  -0.472  55.296  1.00 8.88  ? 232  MET B O   1 
ATOM   4556  C CB  . MET B 1 233 ? -3.180  0.360   58.380  1.00 9.99  ? 232  MET B CB  1 
ATOM   4557  C CG  . MET B 1 233 ? -3.855  1.233   59.402  1.00 10.70 ? 232  MET B CG  1 
ATOM   4558  S SD  . MET B 1 233 ? -3.914  0.244   60.965  1.00 12.68 ? 232  MET B SD  1 
ATOM   4559  C CE  . MET B 1 233 ? -5.019  1.315   61.902  1.00 13.80 ? 232  MET B CE  1 
ATOM   4560  N N   . VAL B 1 234 ? -1.036  0.041   56.006  1.00 8.66  ? 233  VAL B N   1 
ATOM   4561  C CA  . VAL B 1 234 ? -0.347  -0.898  55.108  1.00 9.95  ? 233  VAL B CA  1 
ATOM   4562  C C   . VAL B 1 234 ? -0.266  -2.276  55.771  1.00 10.42 ? 233  VAL B C   1 
ATOM   4563  O O   . VAL B 1 234 ? 0.430   -2.443  56.789  1.00 11.20 ? 233  VAL B O   1 
ATOM   4564  C CB  . VAL B 1 234 ? 1.026   -0.342  54.701  1.00 8.58  ? 233  VAL B CB  1 
ATOM   4565  C CG1 . VAL B 1 234 ? 1.799   -1.335  53.826  1.00 9.59  ? 233  VAL B CG1 1 
ATOM   4566  C CG2 . VAL B 1 234 ? 0.906   1.003   53.999  1.00 9.65  ? 233  VAL B CG2 1 
ATOM   4567  N N   . THR B 1 235 ? -0.957  -3.226  55.187  1.00 10.88 ? 234  THR B N   1 
ATOM   4568  C CA  . THR B 1 235 ? -0.995  -4.618  55.615  1.00 11.17 ? 234  THR B CA  1 
ATOM   4569  C C   . THR B 1 235 ? -0.947  -5.530  54.381  1.00 11.62 ? 234  THR B C   1 
ATOM   4570  O O   . THR B 1 235 ? -1.268  -5.065  53.270  1.00 11.82 ? 234  THR B O   1 
ATOM   4571  C CB  . THR B 1 235 ? -2.302  -4.927  56.458  1.00 12.24 ? 234  THR B CB  1 
ATOM   4572  O OG1 . THR B 1 235 ? -3.394  -5.096  55.493  1.00 11.23 ? 234  THR B OG1 1 
ATOM   4573  C CG2 . THR B 1 235 ? -2.621  -3.828  57.479  1.00 9.92  ? 234  THR B CG2 1 
ATOM   4574  N N   . ALA B 1 236 ? -0.568  -6.761  54.618  1.00 11.73 ? 235  ALA B N   1 
ATOM   4575  C CA  . ALA B 1 236 ? -0.652  -7.828  53.617  1.00 12.72 ? 235  ALA B CA  1 
ATOM   4576  C C   . ALA B 1 236 ? -2.131  -8.085  53.312  1.00 13.34 ? 235  ALA B C   1 
ATOM   4577  O O   . ALA B 1 236 ? -3.005  -7.644  54.083  1.00 13.13 ? 235  ALA B O   1 
ATOM   4578  C CB  . ALA B 1 236 ? 0.001   -9.107  54.145  1.00 12.97 ? 235  ALA B CB  1 
ATOM   4579  N N   . GLY B 1 237 ? -2.371  -8.805  52.235  1.00 14.07 ? 236  GLY B N   1 
ATOM   4580  C CA  . GLY B 1 237 ? -3.713  -9.170  51.784  1.00 15.46 ? 236  GLY B CA  1 
ATOM   4581  C C   . GLY B 1 237 ? -4.473  -9.946  52.861  1.00 17.08 ? 236  GLY B C   1 
ATOM   4582  O O   . GLY B 1 237 ? -3.881  -10.604 53.726  1.00 16.97 ? 236  GLY B O   1 
ATOM   4583  N N   . GLN B 1 238 ? -5.782  -9.852  52.769  1.00 18.31 ? 237  GLN B N   1 
ATOM   4584  C CA  . GLN B 1 238 ? -6.723  -10.512 53.686  1.00 20.26 ? 237  GLN B CA  1 
ATOM   4585  C C   . GLN B 1 238 ? -6.552  -12.026 53.651  1.00 21.28 ? 237  GLN B C   1 
ATOM   4586  O O   . GLN B 1 238 ? -6.827  -12.718 54.645  1.00 21.30 ? 237  GLN B O   1 
ATOM   4587  C CB  . GLN B 1 238 ? -8.163  -10.097 53.395  1.00 21.99 ? 237  GLN B CB  1 
ATOM   4588  C CG  . GLN B 1 238 ? -9.166  -10.520 54.437  1.00 25.92 ? 237  GLN B CG  1 
ATOM   4589  C CD  . GLN B 1 238 ? -9.079  -9.788  55.750  1.00 27.08 ? 237  GLN B CD  1 
ATOM   4590  O OE1 . GLN B 1 238 ? -9.321  -10.364 56.812  1.00 30.26 ? 237  GLN B OE1 1 
ATOM   4591  N NE2 . GLN B 1 238 ? -8.762  -8.493  55.715  1.00 28.64 ? 237  GLN B NE2 1 
ATOM   4592  N N   . SER B 1 239 ? -6.092  -12.541 52.520  1.00 22.19 ? 238  SER B N   1 
ATOM   4593  C CA  . SER B 1 239 ? -5.867  -13.979 52.347  1.00 23.11 ? 238  SER B CA  1 
ATOM   4594  C C   . SER B 1 239 ? -4.421  -14.392 52.590  1.00 23.12 ? 238  SER B C   1 
ATOM   4595  O O   . SER B 1 239 ? -4.102  -15.579 52.365  1.00 23.91 ? 238  SER B O   1 
ATOM   4596  C CB  . SER B 1 239 ? -6.302  -14.439 50.951  1.00 23.40 ? 238  SER B CB  1 
ATOM   4597  O OG  . SER B 1 239 ? -7.644  -14.071 50.726  1.00 26.17 ? 238  SER B OG  1 
ATOM   4598  N N   . ALA B 1 240 ? -3.575  -13.484 52.993  1.00 23.28 ? 240  ALA B N   1 
ATOM   4599  C CA  . ALA B 1 240 ? -2.161  -13.795 53.262  1.00 23.94 ? 240  ALA B CA  1 
ATOM   4600  C C   . ALA B 1 240 ? -1.952  -13.904 54.777  1.00 24.81 ? 240  ALA B C   1 
ATOM   4601  O O   . ALA B 1 240 ? -2.868  -13.607 55.561  1.00 24.59 ? 240  ALA B O   1 
ATOM   4602  C CB  . ALA B 1 240 ? -1.243  -12.744 52.666  1.00 23.92 ? 240  ALA B CB  1 
ATOM   4603  N N   . LYS B 1 241 ? -0.745  -14.314 55.118  1.00 25.32 ? 241  LYS B N   1 
ATOM   4604  C CA  . LYS B 1 241 ? -0.326  -14.413 56.527  1.00 26.23 ? 241  LYS B CA  1 
ATOM   4605  C C   . LYS B 1 241 ? -0.423  -13.031 57.166  1.00 25.62 ? 241  LYS B C   1 
ATOM   4606  O O   . LYS B 1 241 ? -0.155  -12.019 56.493  1.00 25.17 ? 241  LYS B O   1 
ATOM   4607  C CB  . LYS B 1 241 ? 1.108   -14.923 56.664  1.00 29.21 ? 241  LYS B CB  1 
ATOM   4608  C CG  . LYS B 1 241 ? 1.751   -14.500 57.984  1.00 32.25 ? 241  LYS B CG  1 
ATOM   4609  C CD  . LYS B 1 241 ? 3.095   -15.175 58.236  1.00 34.62 ? 241  LYS B CD  1 
ATOM   4610  C CE  . LYS B 1 241 ? 3.676   -14.696 59.569  1.00 36.45 ? 241  LYS B CE  1 
ATOM   4611  N NZ  . LYS B 1 241 ? 4.879   -15.501 59.923  1.00 37.58 ? 241  LYS B NZ  1 
ATOM   4612  N N   . LYS B 1 242 ? -0.796  -13.020 58.436  1.00 25.01 ? 242  LYS B N   1 
ATOM   4613  C CA  . LYS B 1 242 ? -0.921  -11.760 59.180  1.00 24.50 ? 242  LYS B CA  1 
ATOM   4614  C C   . LYS B 1 242 ? 0.467   -11.241 59.542  1.00 23.61 ? 242  LYS B C   1 
ATOM   4615  O O   . LYS B 1 242 ? 1.406   -12.031 59.708  1.00 24.29 ? 242  LYS B O   1 
ATOM   4616  C CB  . LYS B 1 242 ? -1.771  -11.895 60.430  1.00 27.17 ? 242  LYS B CB  1 
ATOM   4617  C CG  . LYS B 1 242 ? -3.223  -11.456 60.234  1.00 29.42 ? 242  LYS B CG  1 
ATOM   4618  C CD  . LYS B 1 242 ? -4.059  -11.809 61.455  1.00 31.26 ? 242  LYS B CD  1 
ATOM   4619  C CE  . LYS B 1 242 ? -5.480  -11.303 61.333  1.00 32.30 ? 242  LYS B CE  1 
ATOM   4620  N NZ  . LYS B 1 242 ? -6.368  -12.345 60.757  1.00 34.32 ? 242  LYS B NZ  1 
ATOM   4621  N N   . ASN B 1 243 ? 0.564   -9.937  59.601  1.00 22.28 ? 243  ASN B N   1 
ATOM   4622  C CA  . ASN B 1 243 ? 1.791   -9.243  60.027  1.00 21.23 ? 243  ASN B CA  1 
ATOM   4623  C C   . ASN B 1 243 ? 1.590   -8.880  61.520  1.00 19.92 ? 243  ASN B C   1 
ATOM   4624  O O   . ASN B 1 243 ? 0.435   -8.878  61.986  1.00 19.74 ? 243  ASN B O   1 
ATOM   4625  C CB  . ASN B 1 243 ? 2.062   -7.997  59.208  1.00 22.24 ? 243  ASN B CB  1 
ATOM   4626  C CG  . ASN B 1 243 ? 2.059   -8.154  57.701  1.00 23.43 ? 243  ASN B CG  1 
ATOM   4627  O OD1 . ASN B 1 243 ? 1.225   -7.505  57.025  1.00 24.93 ? 243  ASN B OD1 1 
ATOM   4628  N ND2 . ASN B 1 243 ? 2.959   -8.972  57.187  1.00 22.17 ? 243  ASN B ND2 1 
ATOM   4629  N N   . THR B 1 244 ? 2.690   -8.564  62.152  1.00 18.79 ? 244  THR B N   1 
ATOM   4630  C CA  . THR B 1 244 ? 2.671   -8.062  63.548  1.00 17.90 ? 244  THR B CA  1 
ATOM   4631  C C   . THR B 1 244 ? 2.361   -6.565  63.513  1.00 17.18 ? 244  THR B C   1 
ATOM   4632  O O   . THR B 1 244 ? 2.601   -5.914  62.479  1.00 16.71 ? 244  THR B O   1 
ATOM   4633  C CB  . THR B 1 244 ? 4.059   -8.336  64.250  1.00 18.27 ? 244  THR B CB  1 
ATOM   4634  O OG1 . THR B 1 244 ? 5.024   -7.405  63.658  1.00 18.02 ? 244  THR B OG1 1 
ATOM   4635  C CG2 . THR B 1 244 ? 4.520   -9.791  64.111  1.00 18.02 ? 244  THR B CG2 1 
ATOM   4636  N N   . PRO B 1 245 ? 1.860   -6.059  64.634  1.00 16.77 ? 245  PRO B N   1 
ATOM   4637  C CA  . PRO B 1 245 ? 1.564   -4.637  64.778  1.00 16.03 ? 245  PRO B CA  1 
ATOM   4638  C C   . PRO B 1 245 ? 2.798   -3.805  64.452  1.00 15.50 ? 245  PRO B C   1 
ATOM   4639  O O   . PRO B 1 245 ? 2.703   -2.717  63.861  1.00 14.41 ? 245  PRO B O   1 
ATOM   4640  C CB  . PRO B 1 245 ? 1.133   -4.491  66.236  1.00 16.52 ? 245  PRO B CB  1 
ATOM   4641  C CG  . PRO B 1 245 ? 0.574   -5.822  66.611  1.00 16.68 ? 245  PRO B CG  1 
ATOM   4642  C CD  . PRO B 1 245 ? 1.207   -6.859  65.702  1.00 16.92 ? 245  PRO B CD  1 
ATOM   4643  N N   . GLU B 1 246 ? 3.940   -4.342  64.875  1.00 14.93 ? 246  GLU B N   1 
ATOM   4644  C CA  . GLU B 1 246 ? 5.230   -3.697  64.624  1.00 15.48 ? 246  GLU B CA  1 
ATOM   4645  C C   . GLU B 1 246 ? 5.510   -3.546  63.125  1.00 14.68 ? 246  GLU B C   1 
ATOM   4646  O O   . GLU B 1 246 ? 5.938   -2.463  62.687  1.00 14.88 ? 246  GLU B O   1 
ATOM   4647  C CB  . GLU B 1 246 ? 6.392   -4.513  65.208  1.00 18.64 ? 246  GLU B CB  1 
ATOM   4648  C CG  . GLU B 1 246 ? 7.796   -4.076  64.820  1.00 23.42 ? 246  GLU B CG  1 
ATOM   4649  C CD  . GLU B 1 246 ? 8.939   -4.622  65.625  1.00 25.33 ? 246  GLU B CD  1 
ATOM   4650  O OE1 . GLU B 1 246 ? 8.729   -5.756  66.097  1.00 26.07 ? 246  GLU B OE1 1 
ATOM   4651  O OE2 . GLU B 1 246 ? 9.984   -4.006  65.799  1.00 28.20 ? 246  GLU B OE2 1 
ATOM   4652  N N   . GLU B 1 247 ? 5.300   -4.612  62.393  1.00 14.26 ? 247  GLU B N   1 
ATOM   4653  C CA  . GLU B 1 247 ? 5.500   -4.625  60.936  1.00 14.04 ? 247  GLU B CA  1 
ATOM   4654  C C   . GLU B 1 247 ? 4.539   -3.680  60.222  1.00 13.32 ? 247  GLU B C   1 
ATOM   4655  O O   . GLU B 1 247 ? 4.987   -2.857  59.402  1.00 12.74 ? 247  GLU B O   1 
ATOM   4656  C CB  . GLU B 1 247 ? 5.367   -6.019  60.361  1.00 16.15 ? 247  GLU B CB  1 
ATOM   4657  C CG  . GLU B 1 247 ? 6.550   -6.960  60.645  1.00 19.26 ? 247  GLU B CG  1 
ATOM   4658  C CD  . GLU B 1 247 ? 6.230   -8.416  60.535  1.00 22.09 ? 247  GLU B CD  1 
ATOM   4659  O OE1 . GLU B 1 247 ? 5.104   -8.873  60.430  1.00 23.17 ? 247  GLU B OE1 1 
ATOM   4660  O OE2 . GLU B 1 247 ? 7.276   -9.111  60.589  1.00 25.48 ? 247  GLU B OE2 1 
ATOM   4661  N N   . ILE B 1 248 ? 3.273   -3.756  60.573  1.00 11.87 ? 248  ILE B N   1 
ATOM   4662  C CA  . ILE B 1 248 ? 2.236   -2.874  60.012  1.00 11.33 ? 248  ILE B CA  1 
ATOM   4663  C C   . ILE B 1 248 ? 2.539   -1.411  60.243  1.00 10.31 ? 248  ILE B C   1 
ATOM   4664  O O   . ILE B 1 248 ? 2.496   -0.559  59.326  1.00 9.82  ? 248  ILE B O   1 
ATOM   4665  C CB  . ILE B 1 248 ? 0.814   -3.279  60.548  1.00 9.22  ? 248  ILE B CB  1 
ATOM   4666  C CG1 . ILE B 1 248 ? 0.409   -4.643  59.971  1.00 10.48 ? 248  ILE B CG1 1 
ATOM   4667  C CG2 . ILE B 1 248 ? -0.236  -2.177  60.256  1.00 9.37  ? 248  ILE B CG2 1 
ATOM   4668  C CD1 . ILE B 1 248 ? -0.837  -5.302  60.638  1.00 10.70 ? 248  ILE B CD1 1 
ATOM   4669  N N   . ALA B 1 249 ? 2.855   -1.088  61.493  1.00 9.51  ? 249  ALA B N   1 
ATOM   4670  C CA  . ALA B 1 249 ? 3.164   0.268   61.916  1.00 8.64  ? 249  ALA B CA  1 
ATOM   4671  C C   . ALA B 1 249 ? 4.348   0.856   61.150  1.00 8.17  ? 249  ALA B C   1 
ATOM   4672  O O   . ALA B 1 249 ? 4.280   2.032   60.749  1.00 6.93  ? 249  ALA B O   1 
ATOM   4673  C CB  . ALA B 1 249 ? 3.397   0.333   63.423  1.00 8.53  ? 249  ALA B CB  1 
ATOM   4674  N N   . LEU B 1 250 ? 5.405   0.068   60.984  1.00 8.53  ? 250  LEU B N   1 
ATOM   4675  C CA  . LEU B 1 250 ? 6.603   0.586   60.297  1.00 8.68  ? 250  LEU B CA  1 
ATOM   4676  C C   . LEU B 1 250 ? 6.294   0.870   58.810  1.00 7.54  ? 250  LEU B C   1 
ATOM   4677  O O   . LEU B 1 250 ? 6.592   1.980   58.359  1.00 7.75  ? 250  LEU B O   1 
ATOM   4678  C CB  . LEU B 1 250 ? 7.796   -0.354  60.469  1.00 10.47 ? 250  LEU B CB  1 
ATOM   4679  C CG  . LEU B 1 250 ? 9.085   0.187   59.810  1.00 11.39 ? 250  LEU B CG  1 
ATOM   4680  C CD1 . LEU B 1 250 ? 9.517   1.480   60.465  1.00 13.86 ? 250  LEU B CD1 1 
ATOM   4681  C CD2 . LEU B 1 250 ? 10.168  -0.875  59.935  1.00 14.17 ? 250  LEU B CD2 1 
ATOM   4682  N N   . ALA B 1 251 ? 5.723   -0.093  58.138  1.00 7.50  ? 251  ALA B N   1 
ATOM   4683  C CA  . ALA B 1 251 ? 5.368   0.059   56.708  1.00 7.17  ? 251  ALA B CA  1 
ATOM   4684  C C   . ALA B 1 251 ? 4.432   1.238   56.513  1.00 7.18  ? 251  ALA B C   1 
ATOM   4685  O O   . ALA B 1 251 ? 4.585   2.022   55.527  1.00 6.96  ? 251  ALA B O   1 
ATOM   4686  C CB  . ALA B 1 251 ? 4.842   -1.235  56.145  1.00 6.55  ? 251  ALA B CB  1 
ATOM   4687  N N   . THR B 1 252 ? 3.482   1.396   57.428  1.00 5.87  ? 252  THR B N   1 
ATOM   4688  C CA  . THR B 1 252 ? 2.489   2.476   57.299  1.00 5.76  ? 252  THR B CA  1 
ATOM   4689  C C   . THR B 1 252 ? 3.137   3.832   57.458  1.00 6.03  ? 252  THR B C   1 
ATOM   4690  O O   . THR B 1 252 ? 2.957   4.756   56.639  1.00 5.44  ? 252  THR B O   1 
ATOM   4691  C CB  . THR B 1 252 ? 1.245   2.338   58.271  1.00 3.76  ? 252  THR B CB  1 
ATOM   4692  O OG1 . THR B 1 252 ? 0.647   1.049   58.020  1.00 4.75  ? 252  THR B OG1 1 
ATOM   4693  C CG2 . THR B 1 252 ? 0.232   3.483   58.122  1.00 5.34  ? 252  THR B CG2 1 
ATOM   4694  N N   . VAL B 1 253 ? 3.894   3.970   58.574  1.00 5.86  ? 253  VAL B N   1 
ATOM   4695  C CA  . VAL B 1 253 ? 4.526   5.268   58.812  1.00 5.76  ? 253  VAL B CA  1 
ATOM   4696  C C   . VAL B 1 253 ? 5.552   5.584   57.721  1.00 5.37  ? 253  VAL B C   1 
ATOM   4697  O O   . VAL B 1 253 ? 5.717   6.775   57.423  1.00 5.29  ? 253  VAL B O   1 
ATOM   4698  C CB  . VAL B 1 253 ? 5.077   5.406   60.249  1.00 7.43  ? 253  VAL B CB  1 
ATOM   4699  C CG1 . VAL B 1 253 ? 5.905   6.684   60.428  1.00 8.29  ? 253  VAL B CG1 1 
ATOM   4700  C CG2 . VAL B 1 253 ? 3.907   5.414   61.236  1.00 8.57  ? 253  VAL B CG2 1 
ATOM   4701  N N   . GLN B 1 254 ? 6.217   4.570   57.215  1.00 6.10  ? 254  GLN B N   1 
ATOM   4702  C CA  . GLN B 1 254 ? 7.223   4.802   56.144  1.00 6.96  ? 254  GLN B CA  1 
ATOM   4703  C C   . GLN B 1 254 ? 6.500   5.316   54.888  1.00 6.40  ? 254  GLN B C   1 
ATOM   4704  O O   . GLN B 1 254 ? 6.959   6.302   54.283  1.00 7.22  ? 254  GLN B O   1 
ATOM   4705  C CB  . GLN B 1 254 ? 8.069   3.582   55.865  1.00 7.96  ? 254  GLN B CB  1 
ATOM   4706  C CG  . GLN B 1 254 ? 9.298   3.411   56.763  1.00 9.34  ? 254  GLN B CG  1 
ATOM   4707  C CD  . GLN B 1 254 ? 10.022  2.125   56.444  1.00 11.52 ? 254  GLN B CD  1 
ATOM   4708  O OE1 . GLN B 1 254 ? 11.133  1.830   56.915  1.00 14.04 ? 254  GLN B OE1 1 
ATOM   4709  N NE2 . GLN B 1 254 ? 9.406   1.299   55.609  1.00 10.09 ? 254  GLN B NE2 1 
ATOM   4710  N N   . ALA B 1 255 ? 5.401   4.697   54.548  1.00 6.84  ? 255  ALA B N   1 
ATOM   4711  C CA  . ALA B 1 255 ? 4.638   5.098   53.319  1.00 6.84  ? 255  ALA B CA  1 
ATOM   4712  C C   . ALA B 1 255 ? 4.164   6.524   53.409  1.00 7.03  ? 255  ALA B C   1 
ATOM   4713  O O   . ALA B 1 255 ? 4.263   7.315   52.429  1.00 7.57  ? 255  ALA B O   1 
ATOM   4714  C CB  . ALA B 1 255 ? 3.546   4.096   53.053  1.00 6.55  ? 255  ALA B CB  1 
ATOM   4715  N N   . LEU B 1 256 ? 3.631   6.921   54.576  1.00 6.09  ? 256  LEU B N   1 
ATOM   4716  C CA  . LEU B 1 256 ? 3.157   8.277   54.805  1.00 5.88  ? 256  LEU B CA  1 
ATOM   4717  C C   . LEU B 1 256 ? 4.276   9.305   54.818  1.00 6.18  ? 256  LEU B C   1 
ATOM   4718  O O   . LEU B 1 256 ? 4.109   10.406  54.247  1.00 5.38  ? 256  LEU B O   1 
ATOM   4719  C CB  . LEU B 1 256 ? 2.305   8.326   56.083  1.00 7.80  ? 256  LEU B CB  1 
ATOM   4720  C CG  . LEU B 1 256 ? 1.118   7.394   56.193  1.00 9.72  ? 256  LEU B CG  1 
ATOM   4721  C CD1 . LEU B 1 256 ? 0.578   7.427   57.631  1.00 9.39  ? 256  LEU B CD1 1 
ATOM   4722  C CD2 . LEU B 1 256 ? 0.039   7.875   55.222  1.00 10.80 ? 256  LEU B CD2 1 
ATOM   4723  N N   . ARG B 1 257 ? 5.381   8.968   55.476  1.00 5.47  ? 257  ARG B N   1 
ATOM   4724  C CA  . ARG B 1 257 ? 6.526   9.880   55.548  1.00 6.04  ? 257  ARG B CA  1 
ATOM   4725  C C   . ARG B 1 257 ? 7.026   10.232  54.132  1.00 5.65  ? 257  ARG B C   1 
ATOM   4726  O O   . ARG B 1 257 ? 7.431   11.376  53.895  1.00 5.71  ? 257  ARG B O   1 
ATOM   4727  C CB  . ARG B 1 257 ? 7.664   9.319   56.417  1.00 6.94  ? 257  ARG B CB  1 
ATOM   4728  C CG  . ARG B 1 257 ? 7.434   9.571   57.930  1.00 8.35  ? 257  ARG B CG  1 
ATOM   4729  C CD  . ARG B 1 257 ? 8.359   8.694   58.743  1.00 7.93  ? 257  ARG B CD  1 
ATOM   4730  N NE  . ARG B 1 257 ? 9.748   8.892   58.347  1.00 8.54  ? 257  ARG B NE  1 
ATOM   4731  C CZ  . ARG B 1 257 ? 10.503  9.960   58.527  1.00 6.61  ? 257  ARG B CZ  1 
ATOM   4732  N NH1 . ARG B 1 257 ? 10.079  11.024  59.187  1.00 6.85  ? 257  ARG B NH1 1 
ATOM   4733  N NH2 . ARG B 1 257 ? 11.760  9.975   58.028  1.00 8.59  ? 257  ARG B NH2 1 
ATOM   4734  N N   . ARG B 1 258 ? 6.905   9.309   53.229  1.00 6.84  ? 258  ARG B N   1 
ATOM   4735  C CA  . ARG B 1 258 ? 7.434   9.439   51.854  1.00 7.13  ? 258  ARG B CA  1 
ATOM   4736  C C   . ARG B 1 258 ? 6.473   10.130  50.895  1.00 7.89  ? 258  ARG B C   1 
ATOM   4737  O O   . ARG B 1 258 ? 6.931   10.508  49.777  1.00 7.23  ? 258  ARG B O   1 
ATOM   4738  C CB  . ARG B 1 258 ? 7.789   8.050   51.305  1.00 7.16  ? 258  ARG B CB  1 
ATOM   4739  C CG  . ARG B 1 258 ? 9.027   7.421   51.923  1.00 8.05  ? 258  ARG B CG  1 
ATOM   4740  C CD  . ARG B 1 258 ? 9.083   5.954   51.700  1.00 6.86  ? 258  ARG B CD  1 
ATOM   4741  N NE  . ARG B 1 258 ? 10.222  5.375   52.430  1.00 7.46  ? 258  ARG B NE  1 
ATOM   4742  C CZ  . ARG B 1 258 ? 10.451  4.072   52.436  1.00 6.46  ? 258  ARG B CZ  1 
ATOM   4743  N NH1 . ARG B 1 258 ? 9.692   3.209   51.770  1.00 7.60  ? 258  ARG B NH1 1 
ATOM   4744  N NH2 . ARG B 1 258 ? 11.503  3.608   53.115  1.00 9.83  ? 258  ARG B NH2 1 
ATOM   4745  N N   . THR B 1 259 ? 5.247   10.368  51.304  1.00 7.17  ? 259  THR B N   1 
ATOM   4746  C CA  . THR B 1 259 ? 4.230   10.866  50.354  1.00 7.98  ? 259  THR B CA  1 
ATOM   4747  C C   . THR B 1 259 ? 3.348   11.991  50.824  1.00 7.69  ? 259  THR B C   1 
ATOM   4748  O O   . THR B 1 259 ? 2.957   12.845  49.993  1.00 8.11  ? 259  THR B O   1 
ATOM   4749  C CB  . THR B 1 259 ? 3.361   9.661   49.812  1.00 7.11  ? 259  THR B CB  1 
ATOM   4750  O OG1 . THR B 1 259 ? 2.690   9.064   50.965  1.00 7.53  ? 259  THR B OG1 1 
ATOM   4751  C CG2 . THR B 1 259 ? 4.151   8.604   49.028  1.00 4.54  ? 259  THR B CG2 1 
ATOM   4752  N N   . VAL B 1 260 ? 2.996   12.031  52.097  1.00 8.47  ? 260  VAL B N   1 
ATOM   4753  C CA  . VAL B 1 260 ? 2.039   12.987  52.652  1.00 7.14  ? 260  VAL B CA  1 
ATOM   4754  C C   . VAL B 1 260 ? 2.732   14.194  53.282  1.00 7.49  ? 260  VAL B C   1 
ATOM   4755  O O   . VAL B 1 260 ? 3.361   14.074  54.347  1.00 8.20  ? 260  VAL B O   1 
ATOM   4756  C CB  . VAL B 1 260 ? 1.159   12.277  53.729  1.00 6.34  ? 260  VAL B CB  1 
ATOM   4757  C CG1 . VAL B 1 260 ? 0.122   13.244  54.277  1.00 3.52  ? 260  VAL B CG1 1 
ATOM   4758  C CG2 . VAL B 1 260 ? 0.563   10.972  53.312  1.00 3.75  ? 260  VAL B CG2 1 
ATOM   4759  N N   . PRO B 1 261 ? 2.595   15.350  52.664  1.00 8.12  ? 261  PRO B N   1 
ATOM   4760  C CA  . PRO B 1 261 ? 3.236   16.569  53.130  1.00 7.93  ? 261  PRO B CA  1 
ATOM   4761  C C   . PRO B 1 261 ? 2.835   16.892  54.573  1.00 8.64  ? 261  PRO B C   1 
ATOM   4762  O O   . PRO B 1 261 ? 1.702   16.625  54.985  1.00 7.67  ? 261  PRO B O   1 
ATOM   4763  C CB  . PRO B 1 261 ? 2.740   17.659  52.173  1.00 8.11  ? 261  PRO B CB  1 
ATOM   4764  C CG  . PRO B 1 261 ? 2.404   16.902  50.909  1.00 7.90  ? 261  PRO B CG  1 
ATOM   4765  C CD  . PRO B 1 261 ? 1.868   15.553  51.380  1.00 7.88  ? 261  PRO B CD  1 
ATOM   4766  N N   . ALA B 1 262 ? 3.782   17.489  55.277  1.00 9.31  ? 262  ALA B N   1 
ATOM   4767  C CA  . ALA B 1 262 ? 3.595   17.936  56.666  1.00 10.56 ? 262  ALA B CA  1 
ATOM   4768  C C   . ALA B 1 262 ? 2.453   18.936  56.798  1.00 10.50 ? 262  ALA B C   1 
ATOM   4769  O O   . ALA B 1 262 ? 1.827   19.040  57.875  1.00 11.11 ? 262  ALA B O   1 
ATOM   4770  C CB  . ALA B 1 262 ? 4.914   18.527  57.173  1.00 9.47  ? 262  ALA B CB  1 
ATOM   4771  N N   . ALA B 1 263 ? 2.171   19.690  55.743  1.00 10.06 ? 263  ALA B N   1 
ATOM   4772  C CA  . ALA B 1 263 ? 1.082   20.670  55.747  1.00 9.47  ? 263  ALA B CA  1 
ATOM   4773  C C   . ALA B 1 263 ? -0.277  20.002  56.005  1.00 8.56  ? 263  ALA B C   1 
ATOM   4774  O O   . ALA B 1 263 ? -1.169  20.697  56.507  1.00 8.85  ? 263  ALA B O   1 
ATOM   4775  C CB  . ALA B 1 263 ? 1.019   21.468  54.449  1.00 7.43  ? 263  ALA B CB  1 
ATOM   4776  N N   . VAL B 1 264 ? -0.425  18.760  55.624  1.00 8.72  ? 264  VAL B N   1 
ATOM   4777  C CA  . VAL B 1 264 ? -1.684  18.009  55.811  1.00 9.59  ? 264  VAL B CA  1 
ATOM   4778  C C   . VAL B 1 264 ? -1.922  17.937  57.340  1.00 10.38 ? 264  VAL B C   1 
ATOM   4779  O O   . VAL B 1 264 ? -1.047  17.416  58.041  1.00 9.72  ? 264  VAL B O   1 
ATOM   4780  C CB  . VAL B 1 264 ? -1.674  16.645  55.125  1.00 7.59  ? 264  VAL B CB  1 
ATOM   4781  C CG1 . VAL B 1 264 ? -2.880  15.784  55.513  1.00 8.05  ? 264  VAL B CG1 1 
ATOM   4782  C CG2 . VAL B 1 264 ? -1.615  16.753  53.587  1.00 8.61  ? 264  VAL B CG2 1 
ATOM   4783  N N   . THR B 1 265 ? -3.061  18.440  57.750  1.00 10.57 ? 265  THR B N   1 
ATOM   4784  C CA  . THR B 1 265 ? -3.378  18.579  59.194  1.00 10.35 ? 265  THR B CA  1 
ATOM   4785  C C   . THR B 1 265 ? -3.387  17.277  59.944  1.00 9.84  ? 265  THR B C   1 
ATOM   4786  O O   . THR B 1 265 ? -2.838  17.204  61.076  1.00 10.87 ? 265  THR B O   1 
ATOM   4787  C CB  . THR B 1 265 ? -4.690  19.429  59.388  1.00 10.09 ? 265  THR B CB  1 
ATOM   4788  O OG1 . THR B 1 265 ? -4.328  20.767  58.958  1.00 10.88 ? 265  THR B OG1 1 
ATOM   4789  C CG2 . THR B 1 265 ? -5.247  19.440  60.833  1.00 10.57 ? 265  THR B CG2 1 
ATOM   4790  N N   . GLY B 1 266 ? -3.953  16.218  59.402  1.00 8.53  ? 266  GLY B N   1 
ATOM   4791  C CA  . GLY B 1 266 ? -4.033  14.939  60.103  1.00 7.41  ? 266  GLY B CA  1 
ATOM   4792  C C   . GLY B 1 266 ? -4.434  13.788  59.206  1.00 6.94  ? 266  GLY B C   1 
ATOM   4793  O O   . GLY B 1 266 ? -4.960  13.965  58.104  1.00 6.88  ? 266  GLY B O   1 
ATOM   4794  N N   . VAL B 1 267 ? -4.168  12.600  59.707  1.00 6.94  ? 267  VAL B N   1 
ATOM   4795  C CA  . VAL B 1 267 ? -4.487  11.331  59.062  1.00 7.37  ? 267  VAL B CA  1 
ATOM   4796  C C   . VAL B 1 267 ? -5.486  10.574  59.937  1.00 7.56  ? 267  VAL B C   1 
ATOM   4797  O O   . VAL B 1 267 ? -5.191  10.324  61.124  1.00 7.70  ? 267  VAL B O   1 
ATOM   4798  C CB  . VAL B 1 267 ? -3.200  10.519  58.837  1.00 6.84  ? 267  VAL B CB  1 
ATOM   4799  C CG1 . VAL B 1 267 ? -3.476  9.227   58.097  1.00 8.84  ? 267  VAL B CG1 1 
ATOM   4800  C CG2 . VAL B 1 267 ? -2.101  11.357  58.215  1.00 8.08  ? 267  VAL B CG2 1 
ATOM   4801  N N   . THR B 1 268 ? -6.603  10.220  59.333  1.00 6.38  ? 268  THR B N   1 
ATOM   4802  C CA  . THR B 1 268 ? -7.649  9.477   60.097  1.00 6.76  ? 268  THR B CA  1 
ATOM   4803  C C   . THR B 1 268 ? -7.835  8.144   59.409  1.00 7.27  ? 268  THR B C   1 
ATOM   4804  O O   . THR B 1 268 ? -8.552  8.088   58.375  1.00 7.64  ? 268  THR B O   1 
ATOM   4805  C CB  . THR B 1 268 ? -8.949  10.357  60.174  1.00 7.51  ? 268  THR B CB  1 
ATOM   4806  O OG1 . THR B 1 268 ? -9.465  10.451  58.791  1.00 6.04  ? 268  THR B OG1 1 
ATOM   4807  C CG2 . THR B 1 268 ? -8.729  11.758  60.740  1.00 6.55  ? 268  THR B CG2 1 
ATOM   4808  N N   . PHE B 1 269 ? -7.204  7.109   59.949  1.00 6.41  ? 269  PHE B N   1 
ATOM   4809  C CA  . PHE B 1 269 ? -7.169  5.782   59.331  1.00 7.43  ? 269  PHE B CA  1 
ATOM   4810  C C   . PHE B 1 269 ? -8.541  5.104   59.256  1.00 9.13  ? 269  PHE B C   1 
ATOM   4811  O O   . PHE B 1 269 ? -9.364  5.203   60.171  1.00 8.23  ? 269  PHE B O   1 
ATOM   4812  C CB  . PHE B 1 269 ? -6.177  4.848   60.055  1.00 6.75  ? 269  PHE B CB  1 
ATOM   4813  C CG  . PHE B 1 269 ? -4.728  5.201   59.873  1.00 8.02  ? 269  PHE B CG  1 
ATOM   4814  C CD1 . PHE B 1 269 ? -4.092  4.842   58.666  1.00 7.99  ? 269  PHE B CD1 1 
ATOM   4815  C CD2 . PHE B 1 269 ? -4.017  5.867   60.854  1.00 8.44  ? 269  PHE B CD2 1 
ATOM   4816  C CE1 . PHE B 1 269 ? -2.756  5.151   58.462  1.00 9.91  ? 269  PHE B CE1 1 
ATOM   4817  C CE2 . PHE B 1 269 ? -2.664  6.183   60.673  1.00 9.04  ? 269  PHE B CE2 1 
ATOM   4818  C CZ  . PHE B 1 269 ? -2.032  5.815   59.471  1.00 9.62  ? 269  PHE B CZ  1 
ATOM   4819  N N   . LEU B 1 270 ? -8.737  4.427   58.124  1.00 9.44  ? 270  LEU B N   1 
ATOM   4820  C CA  . LEU B 1 270 ? -9.854  3.493   57.944  1.00 10.81 ? 270  LEU B CA  1 
ATOM   4821  C C   . LEU B 1 270 ? -9.378  2.140   58.471  1.00 11.63 ? 270  LEU B C   1 
ATOM   4822  O O   . LEU B 1 270 ? -8.161  1.868   58.458  1.00 11.56 ? 270  LEU B O   1 
ATOM   4823  C CB  . LEU B 1 270 ? -10.286 3.489   56.472  1.00 11.63 ? 270  LEU B CB  1 
ATOM   4824  C CG  . LEU B 1 270 ? -9.246  2.983   55.470  1.00 11.73 ? 270  LEU B CG  1 
ATOM   4825  C CD1 . LEU B 1 270 ? -9.373  1.495   55.236  1.00 12.78 ? 270  LEU B CD1 1 
ATOM   4826  C CD2 . LEU B 1 270 ? -9.449  3.756   54.159  1.00 13.67 ? 270  LEU B CD2 1 
ATOM   4827  N N   . SER B 1 271 ? -10.310 1.320   58.909  1.00 12.22 ? 271  SER B N   1 
ATOM   4828  C CA  . SER B 1 271 ? -9.958  0.034   59.520  1.00 13.77 ? 271  SER B CA  1 
ATOM   4829  C C   . SER B 1 271 ? -10.010 -1.136  58.562  1.00 14.38 ? 271  SER B C   1 
ATOM   4830  O O   . SER B 1 271 ? -9.413  -2.190  58.861  1.00 14.61 ? 271  SER B O   1 
ATOM   4831  C CB  . SER B 1 271 ? -10.824 -0.202  60.762  1.00 14.64 ? 271  SER B CB  1 
ATOM   4832  O OG  . SER B 1 271 ? -12.149 -0.537  60.354  1.00 15.13 ? 271  SER B OG  1 
ATOM   4833  N N   . GLY B 1 272 ? -10.692 -0.980  57.431  1.00 14.61 ? 272  GLY B N   1 
ATOM   4834  C CA  . GLY B 1 272 ? -10.784 -2.072  56.437  1.00 15.10 ? 272  GLY B CA  1 
ATOM   4835  C C   . GLY B 1 272 ? -11.538 -3.252  57.055  1.00 15.21 ? 272  GLY B C   1 
ATOM   4836  O O   . GLY B 1 272 ? -12.625 -3.072  57.631  1.00 16.29 ? 272  GLY B O   1 
ATOM   4837  N N   . GLY B 1 273 ? -10.953 -4.425  56.958  1.00 15.13 ? 273  GLY B N   1 
ATOM   4838  C CA  . GLY B 1 273 ? -11.531 -5.651  57.500  1.00 15.45 ? 273  GLY B CA  1 
ATOM   4839  C C   . GLY B 1 273 ? -10.984 -6.070  58.854  1.00 14.87 ? 273  GLY B C   1 
ATOM   4840  O O   . GLY B 1 273 ? -11.262 -7.210  59.278  1.00 15.94 ? 273  GLY B O   1 
ATOM   4841  N N   . GLN B 1 274 ? -10.251 -5.203  59.506  1.00 14.66 ? 274  GLN B N   1 
ATOM   4842  C CA  . GLN B 1 274 ? -9.616  -5.441  60.810  1.00 13.81 ? 274  GLN B CA  1 
ATOM   4843  C C   . GLN B 1 274 ? -10.699 -5.578  61.893  1.00 13.09 ? 274  GLN B C   1 
ATOM   4844  O O   . GLN B 1 274 ? -11.722 -4.879  61.833  1.00 12.90 ? 274  GLN B O   1 
ATOM   4845  C CB  . GLN B 1 274 ? -8.645  -4.322  61.186  1.00 14.05 ? 274  GLN B CB  1 
ATOM   4846  C CG  . GLN B 1 274 ? -7.394  -4.195  60.325  1.00 14.52 ? 274  GLN B CG  1 
ATOM   4847  C CD  . GLN B 1 274 ? -6.513  -3.062  60.771  1.00 14.93 ? 274  GLN B CD  1 
ATOM   4848  O OE1 . GLN B 1 274 ? -6.039  -3.019  61.908  1.00 16.61 ? 274  GLN B OE1 1 
ATOM   4849  N NE2 . GLN B 1 274 ? -6.315  -2.058  59.922  1.00 15.53 ? 274  GLN B NE2 1 
ATOM   4850  N N   . SER B 1 275 ? -10.449 -6.487  62.816  1.00 12.84 ? 275  SER B N   1 
ATOM   4851  C CA  . SER B 1 275 ? -11.324 -6.664  63.999  1.00 12.48 ? 275  SER B CA  1 
ATOM   4852  C C   . SER B 1 275 ? -11.260 -5.388  64.829  1.00 12.09 ? 275  SER B C   1 
ATOM   4853  O O   . SER B 1 275 ? -10.390 -4.519  64.606  1.00 11.56 ? 275  SER B O   1 
ATOM   4854  C CB  . SER B 1 275 ? -10.901 -7.874  64.829  1.00 12.00 ? 275  SER B CB  1 
ATOM   4855  O OG  . SER B 1 275 ? -9.725  -7.577  65.572  1.00 12.10 ? 275  SER B OG  1 
ATOM   4856  N N   . GLU B 1 276 ? -12.163 -5.268  65.793  1.00 12.31 ? 276  GLU B N   1 
ATOM   4857  C CA  . GLU B 1 276 ? -12.196 -4.071  66.651  1.00 12.19 ? 276  GLU B CA  1 
ATOM   4858  C C   . GLU B 1 276 ? -10.873 -3.930  67.388  1.00 12.08 ? 276  GLU B C   1 
ATOM   4859  O O   . GLU B 1 276 ? -10.321 -2.822  67.472  1.00 11.54 ? 276  GLU B O   1 
ATOM   4860  C CB  . GLU B 1 276 ? -13.352 -4.109  67.656  1.00 11.93 ? 276  GLU B CB  1 
ATOM   4861  C CG  . GLU B 1 276 ? -14.753 -3.936  67.025  1.00 13.75 ? 276  GLU B CG  1 
ATOM   4862  C CD  . GLU B 1 276 ? -15.892 -4.043  67.998  1.00 15.12 ? 276  GLU B CD  1 
ATOM   4863  O OE1 . GLU B 1 276 ? -15.753 -5.019  68.765  1.00 15.36 ? 276  GLU B OE1 1 
ATOM   4864  O OE2 . GLU B 1 276 ? -16.812 -3.246  68.031  1.00 16.54 ? 276  GLU B OE2 1 
ATOM   4865  N N   . GLU B 1 277 ? -10.366 -5.050  67.883  1.00 12.32 ? 277  GLU B N   1 
ATOM   4866  C CA  . GLU B 1 277 ? -9.104  -5.056  68.651  1.00 13.06 ? 277  GLU B CA  1 
ATOM   4867  C C   . GLU B 1 277 ? -7.888  -4.762  67.779  1.00 13.06 ? 277  GLU B C   1 
ATOM   4868  O O   . GLU B 1 277 ? -7.032  -3.940  68.154  1.00 12.79 ? 277  GLU B O   1 
ATOM   4869  C CB  . GLU B 1 277 ? -8.857  -6.375  69.365  1.00 15.63 ? 277  GLU B CB  1 
ATOM   4870  C CG  . GLU B 1 277 ? -7.605  -6.493  70.237  1.00 16.64 ? 277  GLU B CG  1 
ATOM   4871  C CD  . GLU B 1 277 ? -7.657  -5.736  71.535  1.00 18.28 ? 277  GLU B CD  1 
ATOM   4872  O OE1 . GLU B 1 277 ? -8.642  -5.156  71.945  1.00 19.36 ? 277  GLU B OE1 1 
ATOM   4873  O OE2 . GLU B 1 277 ? -6.564  -5.736  72.138  1.00 18.64 ? 277  GLU B OE2 1 
ATOM   4874  N N   . GLU B 1 278 ? -7.802  -5.421  66.634  1.00 13.21 ? 278  GLU B N   1 
ATOM   4875  C CA  . GLU B 1 278 ? -6.625  -5.183  65.746  1.00 13.37 ? 278  GLU B CA  1 
ATOM   4876  C C   . GLU B 1 278 ? -6.498  -3.710  65.401  1.00 12.39 ? 278  GLU B C   1 
ATOM   4877  O O   . GLU B 1 278 ? -5.407  -3.098  65.458  1.00 12.55 ? 278  GLU B O   1 
ATOM   4878  C CB  . GLU B 1 278 ? -6.734  -5.954  64.441  1.00 14.98 ? 278  GLU B CB  1 
ATOM   4879  C CG  . GLU B 1 278 ? -6.381  -7.431  64.419  1.00 19.56 ? 278  GLU B CG  1 
ATOM   4880  C CD  . GLU B 1 278 ? -6.880  -8.199  63.222  1.00 21.06 ? 278  GLU B CD  1 
ATOM   4881  O OE1 . GLU B 1 278 ? -7.806  -7.852  62.512  1.00 21.26 ? 278  GLU B OE1 1 
ATOM   4882  O OE2 . GLU B 1 278 ? -6.236  -9.258  63.069  1.00 24.47 ? 278  GLU B OE2 1 
ATOM   4883  N N   . ALA B 1 279 ? -7.631  -3.131  65.022  1.00 11.68 ? 279  ALA B N   1 
ATOM   4884  C CA  . ALA B 1 279 ? -7.703  -1.730  64.614  1.00 11.04 ? 279  ALA B CA  1 
ATOM   4885  C C   . ALA B 1 279 ? -7.118  -0.819  65.682  1.00 10.71 ? 279  ALA B C   1 
ATOM   4886  O O   . ALA B 1 279 ? -6.467  0.184   65.333  1.00 10.72 ? 279  ALA B O   1 
ATOM   4887  C CB  . ALA B 1 279 ? -9.118  -1.322  64.233  1.00 12.69 ? 279  ALA B CB  1 
ATOM   4888  N N   . THR B 1 280 ? -7.348  -1.156  66.948  1.00 9.11  ? 280  THR B N   1 
ATOM   4889  C CA  . THR B 1 280 ? -6.855  -0.330  68.043  1.00 8.58  ? 280  THR B CA  1 
ATOM   4890  C C   . THR B 1 280 ? -5.342  -0.546  68.265  1.00 7.73  ? 280  THR B C   1 
ATOM   4891  O O   . THR B 1 280 ? -4.610  0.428   68.389  1.00 8.46  ? 280  THR B O   1 
ATOM   4892  C CB  . THR B 1 280 ? -7.612  -0.605  69.424  1.00 8.14  ? 280  THR B CB  1 
ATOM   4893  O OG1 . THR B 1 280 ? -9.034  -0.512  69.100  1.00 8.59  ? 280  THR B OG1 1 
ATOM   4894  C CG2 . THR B 1 280 ? -7.181  0.388   70.500  1.00 6.46  ? 280  THR B CG2 1 
ATOM   4895  N N   . VAL B 1 281 ? -4.998  -1.804  68.318  1.00 7.92  ? 281  VAL B N   1 
ATOM   4896  C CA  . VAL B 1 281 ? -3.608  -2.220  68.601  1.00 9.56  ? 281  VAL B CA  1 
ATOM   4897  C C   . VAL B 1 281 ? -2.703  -1.674  67.500  1.00 10.05 ? 281  VAL B C   1 
ATOM   4898  O O   . VAL B 1 281 ? -1.633  -1.136  67.805  1.00 10.35 ? 281  VAL B O   1 
ATOM   4899  C CB  . VAL B 1 281 ? -3.515  -3.717  68.861  1.00 10.33 ? 281  VAL B CB  1 
ATOM   4900  C CG1 . VAL B 1 281 ? -2.065  -4.223  68.857  1.00 10.72 ? 281  VAL B CG1 1 
ATOM   4901  C CG2 . VAL B 1 281 ? -4.177  -4.118  70.194  1.00 11.37 ? 281  VAL B CG2 1 
ATOM   4902  N N   . ASN B 1 282 ? -3.184  -1.799  66.252  1.00 9.73  ? 282  ASN B N   1 
ATOM   4903  C CA  . ASN B 1 282 ? -2.387  -1.302  65.110  1.00 9.03  ? 282  ASN B CA  1 
ATOM   4904  C C   . ASN B 1 282 ? -2.190  0.194   65.184  1.00 8.31  ? 282  ASN B C   1 
ATOM   4905  O O   . ASN B 1 282 ? -1.049  0.651   64.931  1.00 8.97  ? 282  ASN B O   1 
ATOM   4906  C CB  . ASN B 1 282 ? -2.917  -1.825  63.770  1.00 8.70  ? 282  ASN B CB  1 
ATOM   4907  C CG  . ASN B 1 282 ? -2.683  -3.286  63.541  1.00 10.66 ? 282  ASN B CG  1 
ATOM   4908  O OD1 . ASN B 1 282 ? -1.743  -3.884  64.111  1.00 13.36 ? 282  ASN B OD1 1 
ATOM   4909  N ND2 . ASN B 1 282 ? -3.480  -3.937  62.700  1.00 10.38 ? 282  ASN B ND2 1 
ATOM   4910  N N   . LEU B 1 283 ? -3.226  0.962   65.521  1.00 7.33  ? 283  LEU B N   1 
ATOM   4911  C CA  . LEU B 1 283 ? -3.125  2.407   65.625  1.00 6.84  ? 283  LEU B CA  1 
ATOM   4912  C C   . LEU B 1 283 ? -2.147  2.822   66.722  1.00 7.16  ? 283  LEU B C   1 
ATOM   4913  O O   . LEU B 1 283 ? -1.378  3.786   66.550  1.00 6.86  ? 283  LEU B O   1 
ATOM   4914  C CB  . LEU B 1 283 ? -4.491  3.072   65.763  1.00 7.40  ? 283  LEU B CB  1 
ATOM   4915  C CG  . LEU B 1 283 ? -4.526  4.570   66.008  1.00 7.54  ? 283  LEU B CG  1 
ATOM   4916  C CD1 . LEU B 1 283 ? -3.911  5.368   64.861  1.00 7.51  ? 283  LEU B CD1 1 
ATOM   4917  C CD2 . LEU B 1 283 ? -5.986  4.993   66.195  1.00 8.94  ? 283  LEU B CD2 1 
ATOM   4918  N N   . SER B 1 284 ? -2.200  2.091   67.833  1.00 7.49  ? 284  SER B N   1 
ATOM   4919  C CA  . SER B 1 284 ? -1.289  2.391   68.960  1.00 6.91  ? 284  SER B CA  1 
ATOM   4920  C C   . SER B 1 284 ? 0.165   2.240   68.527  1.00 6.18  ? 284  SER B C   1 
ATOM   4921  O O   . SER B 1 284 ? 1.006   3.125   68.828  1.00 6.93  ? 284  SER B O   1 
ATOM   4922  C CB  . SER B 1 284 ? -1.600  1.488   70.164  1.00 5.72  ? 284  SER B CB  1 
ATOM   4923  O OG  . SER B 1 284 ? -1.411  2.279   71.331  1.00 7.57  ? 284  SER B OG  1 
ATOM   4924  N N   . ALA B 1 285 ? 0.453   1.156   67.861  1.00 7.37  ? 285  ALA B N   1 
ATOM   4925  C CA  . ALA B 1 285 ? 1.820   0.851   67.361  1.00 7.57  ? 285  ALA B CA  1 
ATOM   4926  C C   . ALA B 1 285 ? 2.298   1.917   66.392  1.00 8.33  ? 285  ALA B C   1 
ATOM   4927  O O   . ALA B 1 285 ? 3.490   2.308   66.375  1.00 8.63  ? 285  ALA B O   1 
ATOM   4928  C CB  . ALA B 1 285 ? 1.827   -0.545  66.763  1.00 8.00  ? 285  ALA B CB  1 
ATOM   4929  N N   . ILE B 1 286 ? 1.381   2.417   65.570  1.00 8.42  ? 286  ILE B N   1 
ATOM   4930  C CA  . ILE B 1 286 ? 1.682   3.470   64.597  1.00 7.74  ? 286  ILE B CA  1 
ATOM   4931  C C   . ILE B 1 286 ? 2.203   4.703   65.304  1.00 8.56  ? 286  ILE B C   1 
ATOM   4932  O O   . ILE B 1 286 ? 3.125   5.387   64.820  1.00 8.38  ? 286  ILE B O   1 
ATOM   4933  C CB  . ILE B 1 286 ? 0.414   3.782   63.705  1.00 7.45  ? 286  ILE B CB  1 
ATOM   4934  C CG1 . ILE B 1 286 ? 0.215   2.625   62.701  1.00 8.26  ? 286  ILE B CG1 1 
ATOM   4935  C CG2 . ILE B 1 286 ? 0.540   5.177   63.041  1.00 4.65  ? 286  ILE B CG2 1 
ATOM   4936  C CD1 . ILE B 1 286 ? -0.998  2.802   61.727  1.00 7.98  ? 286  ILE B CD1 1 
ATOM   4937  N N   . ASN B 1 287 ? 1.595   5.006   66.462  1.00 8.16  ? 287  ASN B N   1 
ATOM   4938  C CA  . ASN B 1 287 ? 1.973   6.158   67.260  1.00 9.04  ? 287  ASN B CA  1 
ATOM   4939  C C   . ASN B 1 287 ? 3.210   5.862   68.146  1.00 9.08  ? 287  ASN B C   1 
ATOM   4940  O O   . ASN B 1 287 ? 3.529   6.723   68.983  1.00 9.55  ? 287  ASN B O   1 
ATOM   4941  C CB  . ASN B 1 287 ? 0.805   6.736   68.071  1.00 8.98  ? 287  ASN B CB  1 
ATOM   4942  C CG  . ASN B 1 287 ? -0.129  7.598   67.231  1.00 8.05  ? 287  ASN B CG  1 
ATOM   4943  O OD1 . ASN B 1 287 ? 0.156   8.776   66.972  1.00 10.58 ? 287  ASN B OD1 1 
ATOM   4944  N ND2 . ASN B 1 287 ? -1.268  7.046   66.832  1.00 7.89  ? 287  ASN B ND2 1 
ATOM   4945  N N   . ASN B 1 288 ? 3.845   4.743   67.944  1.00 9.36  ? 288  ASN B N   1 
ATOM   4946  C CA  . ASN B 1 288 ? 5.103   4.427   68.663  1.00 10.43 ? 288  ASN B CA  1 
ATOM   4947  C C   . ASN B 1 288 ? 6.276   4.190   67.709  1.00 10.70 ? 288  ASN B C   1 
ATOM   4948  O O   . ASN B 1 288 ? 7.355   3.746   68.169  1.00 10.87 ? 288  ASN B O   1 
ATOM   4949  C CB  . ASN B 1 288 ? 4.908   3.226   69.583  1.00 10.11 ? 288  ASN B CB  1 
ATOM   4950  C CG  . ASN B 1 288 ? 4.216   3.569   70.890  1.00 12.55 ? 288  ASN B CG  1 
ATOM   4951  O OD1 . ASN B 1 288 ? 4.855   4.013   71.856  1.00 12.26 ? 288  ASN B OD1 1 
ATOM   4952  N ND2 . ASN B 1 288 ? 2.903   3.328   70.912  1.00 11.61 ? 288  ASN B ND2 1 
ATOM   4953  N N   . VAL B 1 289 ? 6.085   4.453   66.429  1.00 10.74 ? 289  VAL B N   1 
ATOM   4954  C CA  . VAL B 1 289 ? 7.190   4.237   65.458  1.00 9.82  ? 289  VAL B CA  1 
ATOM   4955  C C   . VAL B 1 289 ? 8.302   5.256   65.697  1.00 9.62  ? 289  VAL B C   1 
ATOM   4956  O O   . VAL B 1 289 ? 8.083   6.465   65.833  1.00 9.14  ? 289  VAL B O   1 
ATOM   4957  C CB  . VAL B 1 289 ? 6.657   4.256   64.012  1.00 9.53  ? 289  VAL B CB  1 
ATOM   4958  C CG1 . VAL B 1 289 ? 7.842   4.151   63.026  1.00 10.41 ? 289  VAL B CG1 1 
ATOM   4959  C CG2 . VAL B 1 289 ? 5.664   3.147   63.762  1.00 8.95  ? 289  VAL B CG2 1 
ATOM   4960  N N   . PRO B 1 290 ? 9.531   4.730   65.730  1.00 10.14 ? 290  PRO B N   1 
ATOM   4961  C CA  . PRO B 1 290 ? 10.711  5.565   65.945  1.00 11.58 ? 290  PRO B CA  1 
ATOM   4962  C C   . PRO B 1 290 ? 11.125  6.339   64.695  1.00 12.18 ? 290  PRO B C   1 
ATOM   4963  O O   . PRO B 1 290 ? 12.272  6.188   64.222  1.00 13.04 ? 290  PRO B O   1 
ATOM   4964  C CB  . PRO B 1 290 ? 11.786  4.585   66.410  1.00 11.32 ? 290  PRO B CB  1 
ATOM   4965  C CG  . PRO B 1 290 ? 11.371  3.259   65.858  1.00 11.15 ? 290  PRO B CG  1 
ATOM   4966  C CD  . PRO B 1 290 ? 9.859   3.305   65.702  1.00 10.33 ? 290  PRO B CD  1 
ATOM   4967  N N   . LEU B 1 291 ? 10.229  7.151   64.194  1.00 12.39 ? 291  LEU B N   1 
ATOM   4968  C CA  . LEU B 1 291 ? 10.442  8.095   63.095  1.00 12.03 ? 291  LEU B CA  1 
ATOM   4969  C C   . LEU B 1 291 ? 9.604   9.340   63.367  1.00 12.12 ? 291  LEU B C   1 
ATOM   4970  O O   . LEU B 1 291 ? 8.567   9.267   64.051  1.00 12.90 ? 291  LEU B O   1 
ATOM   4971  C CB  . LEU B 1 291 ? 10.092  7.405   61.756  1.00 12.02 ? 291  LEU B CB  1 
ATOM   4972  C CG  . LEU B 1 291 ? 10.854  6.156   61.379  1.00 10.78 ? 291  LEU B CG  1 
ATOM   4973  C CD1 . LEU B 1 291 ? 10.137  5.361   60.284  1.00 11.24 ? 291  LEU B CD1 1 
ATOM   4974  C CD2 . LEU B 1 291 ? 12.255  6.538   60.889  1.00 10.49 ? 291  LEU B CD2 1 
ATOM   4975  N N   . ILE B 1 292 ? 10.034  10.460  62.833  1.00 11.94 ? 292  ILE B N   1 
ATOM   4976  C CA  . ILE B 1 292 ? 9.295   11.722  62.931  1.00 12.26 ? 292  ILE B CA  1 
ATOM   4977  C C   . ILE B 1 292 ? 7.954   11.543  62.194  1.00 12.40 ? 292  ILE B C   1 
ATOM   4978  O O   . ILE B 1 292 ? 7.947   11.085  61.048  1.00 12.05 ? 292  ILE B O   1 
ATOM   4979  C CB  . ILE B 1 292 ? 10.137  12.909  62.381  1.00 13.47 ? 292  ILE B CB  1 
ATOM   4980  C CG1 . ILE B 1 292 ? 11.420  13.057  63.263  1.00 15.15 ? 292  ILE B CG1 1 
ATOM   4981  C CG2 . ILE B 1 292 ? 9.357   14.244  62.344  1.00 14.25 ? 292  ILE B CG2 1 
ATOM   4982  C CD1 . ILE B 1 292 ? 12.475  14.017  62.657  1.00 15.34 ? 292  ILE B CD1 1 
ATOM   4983  N N   . ARG B 1 293 ? 6.912   11.909  62.887  1.00 11.93 ? 293  ARG B N   1 
ATOM   4984  C CA  . ARG B 1 293 ? 5.513   11.826  62.400  1.00 11.59 ? 293  ARG B CA  1 
ATOM   4985  C C   . ARG B 1 293 ? 4.907   13.208  62.553  1.00 11.12 ? 293  ARG B C   1 
ATOM   4986  O O   . ARG B 1 293 ? 4.432   13.574  63.651  1.00 11.20 ? 293  ARG B O   1 
ATOM   4987  C CB  . ARG B 1 293 ? 4.789   10.807  63.277  1.00 12.72 ? 293  ARG B CB  1 
ATOM   4988  C CG  . ARG B 1 293 ? 5.164   9.352   63.061  1.00 13.93 ? 293  ARG B CG  1 
ATOM   4989  C CD  . ARG B 1 293 ? 4.701   8.508   64.207  1.00 16.80 ? 293  ARG B CD  1 
ATOM   4990  N NE  . ARG B 1 293 ? 5.769   8.333   65.194  1.00 19.38 ? 293  ARG B NE  1 
ATOM   4991  C CZ  . ARG B 1 293 ? 5.638   8.656   66.486  1.00 21.06 ? 293  ARG B CZ  1 
ATOM   4992  N NH1 . ARG B 1 293 ? 4.544   9.241   66.968  1.00 20.50 ? 293  ARG B NH1 1 
ATOM   4993  N NH2 . ARG B 1 293 ? 6.605   8.328   67.351  1.00 20.23 ? 293  ARG B NH2 1 
ATOM   4994  N N   . PRO B 1 294 ? 4.932   13.989  61.477  1.00 11.20 ? 294  PRO B N   1 
ATOM   4995  C CA  . PRO B 1 294 ? 4.576   15.406  61.569  1.00 10.37 ? 294  PRO B CA  1 
ATOM   4996  C C   . PRO B 1 294 ? 3.098   15.704  61.610  1.00 9.97  ? 294  PRO B C   1 
ATOM   4997  O O   . PRO B 1 294 ? 2.756   16.892  61.776  1.00 10.91 ? 294  PRO B O   1 
ATOM   4998  C CB  . PRO B 1 294 ? 5.274   16.027  60.347  1.00 10.61 ? 294  PRO B CB  1 
ATOM   4999  C CG  . PRO B 1 294 ? 5.202   14.920  59.332  1.00 10.63 ? 294  PRO B CG  1 
ATOM   5000  C CD  . PRO B 1 294 ? 5.453   13.640  60.138  1.00 10.78 ? 294  PRO B CD  1 
ATOM   5001  N N   . TRP B 1 295 ? 2.236   14.722  61.486  1.00 9.42  ? 295  TRP B N   1 
ATOM   5002  C CA  . TRP B 1 295 ? 0.773   14.960  61.486  1.00 8.74  ? 295  TRP B CA  1 
ATOM   5003  C C   . TRP B 1 295 ? 0.148   14.102  62.596  1.00 8.90  ? 295  TRP B C   1 
ATOM   5004  O O   . TRP B 1 295 ? 0.722   13.079  62.979  1.00 9.35  ? 295  TRP B O   1 
ATOM   5005  C CB  . TRP B 1 295 ? 0.143   14.569  60.138  1.00 8.06  ? 295  TRP B CB  1 
ATOM   5006  C CG  . TRP B 1 295 ? 1.080   14.196  59.042  1.00 6.50  ? 295  TRP B CG  1 
ATOM   5007  C CD1 . TRP B 1 295 ? 1.338   14.913  57.902  1.00 8.04  ? 295  TRP B CD1 1 
ATOM   5008  C CD2 . TRP B 1 295 ? 1.868   13.000  58.948  1.00 7.13  ? 295  TRP B CD2 1 
ATOM   5009  N NE1 . TRP B 1 295 ? 2.256   14.239  57.111  1.00 6.18  ? 295  TRP B NE1 1 
ATOM   5010  C CE2 . TRP B 1 295 ? 2.585   13.067  57.728  1.00 6.51  ? 295  TRP B CE2 1 
ATOM   5011  C CE3 . TRP B 1 295 ? 2.039   11.892  59.764  1.00 6.34  ? 295  TRP B CE3 1 
ATOM   5012  C CZ2 . TRP B 1 295 ? 3.470   12.076  57.326  1.00 7.22  ? 295  TRP B CZ2 1 
ATOM   5013  C CZ3 . TRP B 1 295 ? 2.907   10.901  59.361  1.00 8.58  ? 295  TRP B CZ3 1 
ATOM   5014  C CH2 . TRP B 1 295 ? 3.631   10.975  58.159  1.00 8.89  ? 295  TRP B CH2 1 
ATOM   5015  N N   . ALA B 1 296 ? -1.021  14.527  63.033  1.00 8.82  ? 296  ALA B N   1 
ATOM   5016  C CA  . ALA B 1 296 ? -1.827  13.684  63.935  1.00 8.06  ? 296  ALA B CA  1 
ATOM   5017  C C   . ALA B 1 296 ? -2.177  12.392  63.221  1.00 8.15  ? 296  ALA B C   1 
ATOM   5018  O O   . ALA B 1 296 ? -2.542  12.397  62.026  1.00 7.85  ? 296  ALA B O   1 
ATOM   5019  C CB  . ALA B 1 296 ? -3.052  14.454  64.391  1.00 9.78  ? 296  ALA B CB  1 
ATOM   5020  N N   . LEU B 1 297 ? -2.003  11.281  63.923  1.00 6.99  ? 297  LEU B N   1 
ATOM   5021  C CA  . LEU B 1 297 ? -2.358  9.956   63.451  1.00 7.48  ? 297  LEU B CA  1 
ATOM   5022  C C   . LEU B 1 297 ? -3.486  9.383   64.315  1.00 8.05  ? 297  LEU B C   1 
ATOM   5023  O O   . LEU B 1 297 ? -3.207  8.843   65.396  1.00 8.62  ? 297  LEU B O   1 
ATOM   5024  C CB  . LEU B 1 297 ? -1.110  9.071   63.416  1.00 7.36  ? 297  LEU B CB  1 
ATOM   5025  C CG  . LEU B 1 297 ? 0.008   9.550   62.492  1.00 8.09  ? 297  LEU B CG  1 
ATOM   5026  C CD1 . LEU B 1 297 ? 1.368   9.005   62.916  1.00 7.67  ? 297  LEU B CD1 1 
ATOM   5027  C CD2 . LEU B 1 297 ? -0.337  9.088   61.076  1.00 9.59  ? 297  LEU B CD2 1 
ATOM   5028  N N   . THR B 1 298 ? -4.697  9.465   63.810  1.00 7.84  ? 298  THR B N   1 
ATOM   5029  C CA  . THR B 1 298 ? -5.888  8.982   64.553  1.00 7.58  ? 298  THR B CA  1 
ATOM   5030  C C   . THR B 1 298 ? -6.754  8.057   63.734  1.00 7.84  ? 298  THR B C   1 
ATOM   5031  O O   . THR B 1 298 ? -6.296  7.427   62.756  1.00 6.18  ? 298  THR B O   1 
ATOM   5032  C CB  . THR B 1 298 ? -6.592  10.220  65.221  1.00 7.85  ? 298  THR B CB  1 
ATOM   5033  O OG1 . THR B 1 298 ? -7.651  9.706   66.073  1.00 7.74  ? 298  THR B OG1 1 
ATOM   5034  C CG2 . THR B 1 298 ? -7.072  11.303  64.252  1.00 8.21  ? 298  THR B CG2 1 
ATOM   5035  N N   . PHE B 1 299 ? -8.015  7.927   64.132  1.00 8.01  ? 299  PHE B N   1 
ATOM   5036  C CA  . PHE B 1 299 ? -8.979  7.000   63.575  1.00 7.89  ? 299  PHE B CA  1 
ATOM   5037  C C   . PHE B 1 299 ? -10.206 7.710   62.972  1.00 8.17  ? 299  PHE B C   1 
ATOM   5038  O O   . PHE B 1 299 ? -10.628 8.812   63.347  1.00 8.02  ? 299  PHE B O   1 
ATOM   5039  C CB  . PHE B 1 299 ? -9.449  5.947   64.614  1.00 7.30  ? 299  PHE B CB  1 
ATOM   5040  C CG  . PHE B 1 299 ? -10.125 6.577   65.815  1.00 8.38  ? 299  PHE B CG  1 
ATOM   5041  C CD1 . PHE B 1 299 ? -9.342  7.072   66.861  1.00 8.62  ? 299  PHE B CD1 1 
ATOM   5042  C CD2 . PHE B 1 299 ? -11.503 6.664   65.888  1.00 8.60  ? 299  PHE B CD2 1 
ATOM   5043  C CE1 . PHE B 1 299 ? -9.935  7.663   67.972  1.00 8.50  ? 299  PHE B CE1 1 
ATOM   5044  C CE2 . PHE B 1 299 ? -12.135 7.263   66.990  1.00 8.78  ? 299  PHE B CE2 1 
ATOM   5045  C CZ  . PHE B 1 299 ? -11.338 7.756   68.037  1.00 8.21  ? 299  PHE B CZ  1 
ATOM   5046  N N   . SER B 1 300 ? -10.741 7.000   62.004  1.00 9.25  ? 300  SER B N   1 
ATOM   5047  C CA  . SER B 1 300 ? -12.045 7.307   61.365  1.00 9.98  ? 300  SER B CA  1 
ATOM   5048  C C   . SER B 1 300 ? -12.677 5.940   61.111  1.00 10.29 ? 300  SER B C   1 
ATOM   5049  O O   . SER B 1 300 ? -12.607 5.348   60.033  1.00 10.94 ? 300  SER B O   1 
ATOM   5050  C CB  . SER B 1 300 ? -11.894 8.163   60.131  1.00 10.29 ? 300  SER B CB  1 
ATOM   5051  O OG  . SER B 1 300 ? -13.161 8.475   59.569  1.00 10.96 ? 300  SER B OG  1 
ATOM   5052  N N   . TYR B 1 301 ? -13.272 5.406   62.192  1.00 11.04 ? 301  TYR B N   1 
ATOM   5053  C CA  . TYR B 1 301 ? -13.746 4.026   62.187  1.00 10.90 ? 301  TYR B CA  1 
ATOM   5054  C C   . TYR B 1 301 ? -15.277 3.917   62.123  1.00 11.04 ? 301  TYR B C   1 
ATOM   5055  O O   . TYR B 1 301 ? -16.002 4.688   62.756  1.00 9.60  ? 301  TYR B O   1 
ATOM   5056  C CB  . TYR B 1 301 ? -13.192 3.259   63.395  1.00 13.18 ? 301  TYR B CB  1 
ATOM   5057  C CG  . TYR B 1 301 ? -11.715 2.957   63.443  1.00 14.07 ? 301  TYR B CG  1 
ATOM   5058  C CD1 . TYR B 1 301 ? -10.847 3.246   62.381  1.00 13.59 ? 301  TYR B CD1 1 
ATOM   5059  C CD2 . TYR B 1 301 ? -11.168 2.338   64.583  1.00 14.76 ? 301  TYR B CD2 1 
ATOM   5060  C CE1 . TYR B 1 301 ? -9.489  2.973   62.462  1.00 14.04 ? 301  TYR B CE1 1 
ATOM   5061  C CE2 . TYR B 1 301 ? -9.814  2.032   64.667  1.00 15.33 ? 301  TYR B CE2 1 
ATOM   5062  C CZ  . TYR B 1 301 ? -8.970  2.357   63.602  1.00 15.50 ? 301  TYR B CZ  1 
ATOM   5063  O OH  . TYR B 1 301 ? -7.631  2.078   63.653  1.00 14.43 ? 301  TYR B OH  1 
ATOM   5064  N N   . GLY B 1 302 ? -15.692 2.930   61.352  1.00 11.25 ? 302  GLY B N   1 
ATOM   5065  C CA  . GLY B 1 302 ? -17.100 2.562   61.152  1.00 12.25 ? 302  GLY B CA  1 
ATOM   5066  C C   . GLY B 1 302 ? -17.406 1.251   61.873  1.00 13.16 ? 302  GLY B C   1 
ATOM   5067  O O   . GLY B 1 302 ? -17.767 1.251   63.069  1.00 13.58 ? 302  GLY B O   1 
ATOM   5068  N N   . ARG B 1 303 ? -17.231 0.150   61.173  1.00 13.36 ? 303  ARG B N   1 
ATOM   5069  C CA  . ARG B 1 303 ? -17.465 -1.177  61.728  1.00 14.19 ? 303  ARG B CA  1 
ATOM   5070  C C   . ARG B 1 303 ? -16.631 -1.401  63.000  1.00 14.06 ? 303  ARG B C   1 
ATOM   5071  O O   . ARG B 1 303 ? -17.152 -2.003  63.963  1.00 13.63 ? 303  ARG B O   1 
ATOM   5072  C CB  . ARG B 1 303 ? -17.177 -2.312  60.749  1.00 16.69 ? 303  ARG B CB  1 
ATOM   5073  C CG  . ARG B 1 303 ? -18.172 -2.417  59.604  1.00 20.35 ? 303  ARG B CG  1 
ATOM   5074  C CD  . ARG B 1 303 ? -18.229 -3.812  59.074  1.00 22.77 ? 303  ARG B CD  1 
ATOM   5075  N NE  . ARG B 1 303 ? -19.024 -4.681  59.944  1.00 24.67 ? 303  ARG B NE  1 
ATOM   5076  C CZ  . ARG B 1 303 ? -19.121 -5.993  59.685  1.00 25.63 ? 303  ARG B CZ  1 
ATOM   5077  N NH1 . ARG B 1 303 ? -18.472 -6.538  58.652  1.00 25.75 ? 303  ARG B NH1 1 
ATOM   5078  N NH2 . ARG B 1 303 ? -19.895 -6.750  60.449  1.00 26.09 ? 303  ARG B NH2 1 
ATOM   5079  N N   . ALA B 1 304 ? -15.406 -0.912  62.993  1.00 13.08 ? 304  ALA B N   1 
ATOM   5080  C CA  . ALA B 1 304 ? -14.472 -1.120  64.099  1.00 12.92 ? 304  ALA B CA  1 
ATOM   5081  C C   . ALA B 1 304 ? -14.854 -0.363  65.361  1.00 12.08 ? 304  ALA B C   1 
ATOM   5082  O O   . ALA B 1 304 ? -14.189 -0.560  66.415  1.00 12.05 ? 304  ALA B O   1 
ATOM   5083  C CB  . ALA B 1 304 ? -13.045 -0.763  63.659  1.00 11.24 ? 304  ALA B CB  1 
ATOM   5084  N N   . LEU B 1 305 ? -15.824 0.513   65.286  1.00 11.76 ? 305  LEU B N   1 
ATOM   5085  C CA  . LEU B 1 305 ? -16.370 1.207   66.458  1.00 11.83 ? 305  LEU B CA  1 
ATOM   5086  C C   . LEU B 1 305 ? -17.750 0.657   66.823  1.00 12.02 ? 305  LEU B C   1 
ATOM   5087  O O   . LEU B 1 305 ? -18.208 0.861   67.975  1.00 13.67 ? 305  LEU B O   1 
ATOM   5088  C CB  . LEU B 1 305 ? -16.375 2.713   66.226  1.00 10.00 ? 305  LEU B CB  1 
ATOM   5089  C CG  . LEU B 1 305 ? -15.236 3.578   66.722  1.00 9.73  ? 305  LEU B CG  1 
ATOM   5090  C CD1 . LEU B 1 305 ? -15.413 5.026   66.289  1.00 10.41 ? 305  LEU B CD1 1 
ATOM   5091  C CD2 . LEU B 1 305 ? -15.159 3.493   68.247  1.00 11.17 ? 305  LEU B CD2 1 
ATOM   5092  N N   . GLN B 1 306 ? -18.399 -0.039  65.925  1.00 12.21 ? 306  GLN B N   1 
ATOM   5093  C CA  . GLN B 1 306 ? -19.812 -0.407  66.064  1.00 12.39 ? 306  GLN B CA  1 
ATOM   5094  C C   . GLN B 1 306 ? -20.190 -1.858  66.111  1.00 12.36 ? 306  GLN B C   1 
ATOM   5095  O O   . GLN B 1 306 ? -21.395 -2.095  66.428  1.00 12.72 ? 306  GLN B O   1 
ATOM   5096  C CB  . GLN B 1 306 ? -20.627 0.207   64.875  1.00 12.47 ? 306  GLN B CB  1 
ATOM   5097  C CG  . GLN B 1 306 ? -20.562 1.728   64.847  1.00 13.66 ? 306  GLN B CG  1 
ATOM   5098  C CD  . GLN B 1 306 ? -21.305 2.263   63.637  1.00 15.75 ? 306  GLN B CD  1 
ATOM   5099  O OE1 . GLN B 1 306 ? -22.524 2.184   63.534  1.00 15.75 ? 306  GLN B OE1 1 
ATOM   5100  N NE2 . GLN B 1 306 ? -20.527 2.786   62.687  1.00 16.10 ? 306  GLN B NE2 1 
ATOM   5101  N N   . ALA B 1 307 ? -19.333 -2.809  65.813  1.00 12.38 ? 307  ALA B N   1 
ATOM   5102  C CA  . ALA B 1 307 ? -19.780 -4.210  65.748  1.00 13.03 ? 307  ALA B CA  1 
ATOM   5103  C C   . ALA B 1 307 ? -20.322 -4.681  67.098  1.00 13.35 ? 307  ALA B C   1 
ATOM   5104  O O   . ALA B 1 307 ? -21.416 -5.300  67.148  1.00 12.72 ? 307  ALA B O   1 
ATOM   5105  C CB  . ALA B 1 307 ? -18.704 -5.131  65.208  1.00 12.54 ? 307  ALA B CB  1 
ATOM   5106  N N   . SER B 1 308 ? -19.572 -4.406  68.142  1.00 13.69 ? 308  SER B N   1 
ATOM   5107  C CA  . SER B 1 308 ? -19.954 -4.763  69.524  1.00 14.23 ? 308  SER B CA  1 
ATOM   5108  C C   . SER B 1 308 ? -21.197 -4.018  69.987  1.00 14.02 ? 308  SER B C   1 
ATOM   5109  O O   . SER B 1 308 ? -21.996 -4.565  70.789  1.00 14.21 ? 308  SER B O   1 
ATOM   5110  C CB  . SER B 1 308 ? -18.788 -4.592  70.498  1.00 14.32 ? 308  SER B CB  1 
ATOM   5111  O OG  . SER B 1 308 ? -17.805 -5.611  70.309  1.00 15.44 ? 308  SER B OG  1 
ATOM   5112  N N   . VAL B 1 309 ? -21.367 -2.789  69.541  1.00 14.26 ? 309  VAL B N   1 
ATOM   5113  C CA  . VAL B 1 309 ? -22.534 -1.965  69.821  1.00 14.36 ? 309  VAL B CA  1 
ATOM   5114  C C   . VAL B 1 309 ? -23.809 -2.650  69.308  1.00 15.38 ? 309  VAL B C   1 
ATOM   5115  O O   . VAL B 1 309 ? -24.822 -2.763  70.041  1.00 15.04 ? 309  VAL B O   1 
ATOM   5116  C CB  . VAL B 1 309 ? -22.392 -0.537  69.264  1.00 12.79 ? 309  VAL B CB  1 
ATOM   5117  C CG1 . VAL B 1 309 ? -23.725 0.216   69.332  1.00 12.85 ? 309  VAL B CG1 1 
ATOM   5118  C CG2 . VAL B 1 309 ? -21.291 0.263   69.929  1.00 12.23 ? 309  VAL B CG2 1 
ATOM   5119  N N   . LEU B 1 310 ? -23.746 -3.091  68.068  1.00 15.55 ? 310  LEU B N   1 
ATOM   5120  C CA  . LEU B 1 310 ? -24.899 -3.736  67.413  1.00 16.49 ? 310  LEU B CA  1 
ATOM   5121  C C   . LEU B 1 310 ? -25.242 -5.046  68.123  1.00 17.22 ? 310  LEU B C   1 
ATOM   5122  O O   . LEU B 1 310 ? -26.426 -5.353  68.361  1.00 17.22 ? 310  LEU B O   1 
ATOM   5123  C CB  . LEU B 1 310 ? -24.590 -3.898  65.920  1.00 15.93 ? 310  LEU B CB  1 
ATOM   5124  C CG  . LEU B 1 310 ? -24.620 -2.637  65.069  1.00 16.57 ? 310  LEU B CG  1 
ATOM   5125  C CD1 . LEU B 1 310 ? -23.729 -2.785  63.838  1.00 16.41 ? 310  LEU B CD1 1 
ATOM   5126  C CD2 . LEU B 1 310 ? -26.059 -2.348  64.635  1.00 14.96 ? 310  LEU B CD2 1 
ATOM   5127  N N   . ARG B 1 311 ? -24.197 -5.796  68.410  1.00 17.41 ? 311  ARG B N   1 
ATOM   5128  C CA  . ARG B 1 311 ? -24.340 -7.109  69.063  1.00 19.33 ? 311  ARG B CA  1 
ATOM   5129  C C   . ARG B 1 311 ? -25.038 -6.960  70.416  1.00 18.69 ? 311  ARG B C   1 
ATOM   5130  O O   . ARG B 1 311 ? -25.989 -7.710  70.681  1.00 18.71 ? 311  ARG B O   1 
ATOM   5131  C CB  . ARG B 1 311 ? -23.000 -7.815  69.168  1.00 22.68 ? 311  ARG B CB  1 
ATOM   5132  C CG  . ARG B 1 311 ? -23.083 -9.303  69.476  1.00 28.37 ? 311  ARG B CG  1 
ATOM   5133  C CD  . ARG B 1 311 ? -22.104 -10.083 68.660  1.00 33.39 ? 311  ARG B CD  1 
ATOM   5134  N NE  . ARG B 1 311 ? -21.979 -11.453 69.138  1.00 38.16 ? 311  ARG B NE  1 
ATOM   5135  C CZ  . ARG B 1 311 ? -21.075 -12.324 68.682  1.00 39.61 ? 311  ARG B CZ  1 
ATOM   5136  N NH1 . ARG B 1 311 ? -20.246 -11.965 67.708  1.00 41.04 ? 311  ARG B NH1 1 
ATOM   5137  N NH2 . ARG B 1 311 ? -20.995 -13.557 69.194  1.00 41.31 ? 311  ARG B NH2 1 
ATOM   5138  N N   . ALA B 1 312 ? -24.597 -6.013  71.208  1.00 18.18 ? 312  ALA B N   1 
ATOM   5139  C CA  . ALA B 1 312 ? -25.131 -5.697  72.529  1.00 18.49 ? 312  ALA B CA  1 
ATOM   5140  C C   . ALA B 1 312 ? -26.576 -5.217  72.494  1.00 19.19 ? 312  ALA B C   1 
ATOM   5141  O O   . ALA B 1 312 ? -27.419 -5.681  73.287  1.00 19.02 ? 312  ALA B O   1 
ATOM   5142  C CB  . ALA B 1 312 ? -24.235 -4.657  73.209  1.00 16.99 ? 312  ALA B CB  1 
ATOM   5143  N N   . TRP B 1 313 ? -26.877 -4.302  71.587  1.00 19.23 ? 313  TRP B N   1 
ATOM   5144  C CA  . TRP B 1 313 ? -28.218 -3.720  71.430  1.00 19.32 ? 313  TRP B CA  1 
ATOM   5145  C C   . TRP B 1 313 ? -29.224 -4.809  71.056  1.00 19.56 ? 313  TRP B C   1 
ATOM   5146  O O   . TRP B 1 313 ? -30.259 -5.013  71.709  1.00 19.95 ? 313  TRP B O   1 
ATOM   5147  C CB  . TRP B 1 313 ? -28.194 -2.611  70.376  1.00 18.62 ? 313  TRP B CB  1 
ATOM   5148  C CG  . TRP B 1 313 ? -29.506 -1.985  70.058  1.00 18.63 ? 313  TRP B CG  1 
ATOM   5149  C CD1 . TRP B 1 313 ? -30.419 -1.473  70.944  1.00 18.88 ? 313  TRP B CD1 1 
ATOM   5150  C CD2 . TRP B 1 313 ? -30.062 -1.761  68.751  1.00 19.10 ? 313  TRP B CD2 1 
ATOM   5151  N NE1 . TRP B 1 313 ? -31.506 -0.967  70.277  1.00 19.10 ? 313  TRP B NE1 1 
ATOM   5152  C CE2 . TRP B 1 313 ? -31.319 -1.139  68.930  1.00 18.96 ? 313  TRP B CE2 1 
ATOM   5153  C CE3 . TRP B 1 313 ? -29.624 -2.055  67.468  1.00 18.96 ? 313  TRP B CE3 1 
ATOM   5154  C CZ2 . TRP B 1 313 ? -32.131 -0.776  67.870  1.00 19.59 ? 313  TRP B CZ2 1 
ATOM   5155  C CZ3 . TRP B 1 313 ? -30.437 -1.697  66.402  1.00 19.44 ? 313  TRP B CZ3 1 
ATOM   5156  C CH2 . TRP B 1 313 ? -31.666 -1.075  66.584  1.00 18.92 ? 313  TRP B CH2 1 
ATOM   5157  N N   . ALA B 1 314 ? -28.902 -5.473  69.966  1.00 19.56 ? 314  ALA B N   1 
ATOM   5158  C CA  . ALA B 1 314 ? -29.672 -6.545  69.359  1.00 19.72 ? 314  ALA B CA  1 
ATOM   5159  C C   . ALA B 1 314 ? -31.111 -6.144  69.092  1.00 20.09 ? 314  ALA B C   1 
ATOM   5160  O O   . ALA B 1 314 ? -32.019 -7.006  69.133  1.00 20.77 ? 314  ALA B O   1 
ATOM   5161  C CB  . ALA B 1 314 ? -29.607 -7.816  70.198  1.00 19.69 ? 314  ALA B CB  1 
ATOM   5162  N N   . GLY B 1 315 ? -31.322 -4.875  68.822  1.00 20.08 ? 315  GLY B N   1 
ATOM   5163  C CA  . GLY B 1 315 ? -32.611 -4.309  68.472  1.00 19.93 ? 315  GLY B CA  1 
ATOM   5164  C C   . GLY B 1 315 ? -33.547 -4.039  69.634  1.00 20.64 ? 315  GLY B C   1 
ATOM   5165  O O   . GLY B 1 315 ? -34.708 -3.641  69.375  1.00 20.92 ? 315  GLY B O   1 
ATOM   5166  N N   . LYS B 1 316 ? -33.090 -4.168  70.862  1.00 20.52 ? 316  LYS B N   1 
ATOM   5167  C CA  . LYS B 1 316 ? -33.976 -4.005  72.041  1.00 20.84 ? 316  LYS B CA  1 
ATOM   5168  C C   . LYS B 1 316 ? -33.722 -2.756  72.835  1.00 20.64 ? 316  LYS B C   1 
ATOM   5169  O O   . LYS B 1 316 ? -32.569 -2.368  73.115  1.00 20.48 ? 316  LYS B O   1 
ATOM   5170  C CB  . LYS B 1 316 ? -33.833 -5.256  72.917  1.00 23.29 ? 316  LYS B CB  1 
ATOM   5171  C CG  . LYS B 1 316 ? -34.368 -6.500  72.205  1.00 25.46 ? 316  LYS B CG  1 
ATOM   5172  C CD  . LYS B 1 316 ? -33.382 -7.651  72.240  1.00 28.09 ? 316  LYS B CD  1 
ATOM   5173  C CE  . LYS B 1 316 ? -33.477 -8.479  73.500  1.00 29.55 ? 316  LYS B CE  1 
ATOM   5174  N NZ  . LYS B 1 316 ? -33.047 -9.876  73.217  1.00 31.31 ? 316  LYS B NZ  1 
ATOM   5175  N N   . LYS B 1 317 ? -34.805 -2.092  73.246  1.00 20.31 ? 317  LYS B N   1 
ATOM   5176  C CA  . LYS B 1 317 ? -34.727 -0.828  73.989  1.00 20.09 ? 317  LYS B CA  1 
ATOM   5177  C C   . LYS B 1 317 ? -34.006 -1.016  75.333  1.00 19.28 ? 317  LYS B C   1 
ATOM   5178  O O   . LYS B 1 317 ? -33.326 -0.101  75.817  1.00 18.15 ? 317  LYS B O   1 
ATOM   5179  C CB  . LYS B 1 317 ? -36.083 -0.202  74.250  1.00 22.64 ? 317  LYS B CB  1 
ATOM   5180  C CG  . LYS B 1 317 ? -36.588 0.808   73.236  1.00 26.15 ? 317  LYS B CG  1 
ATOM   5181  C CD  . LYS B 1 317 ? -38.083 1.067   73.386  1.00 28.13 ? 317  LYS B CD  1 
ATOM   5182  C CE  . LYS B 1 317 ? -38.500 2.437   72.888  1.00 29.14 ? 317  LYS B CE  1 
ATOM   5183  N NZ  . LYS B 1 317 ? -38.618 3.391   74.027  1.00 30.18 ? 317  LYS B NZ  1 
ATOM   5184  N N   . GLU B 1 318 ? -34.187 -2.196  75.913  1.00 19.23 ? 318  GLU B N   1 
ATOM   5185  C CA  . GLU B 1 318 ? -33.611 -2.515  77.221  1.00 18.97 ? 318  GLU B CA  1 
ATOM   5186  C C   . GLU B 1 318 ? -32.104 -2.723  77.135  1.00 17.91 ? 318  GLU B C   1 
ATOM   5187  O O   . GLU B 1 318 ? -31.429 -2.792  78.175  1.00 16.75 ? 318  GLU B O   1 
ATOM   5188  C CB  . GLU B 1 318 ? -34.205 -3.753  77.874  1.00 21.06 ? 318  GLU B CB  1 
ATOM   5189  C CG  . GLU B 1 318 ? -34.164 -5.046  77.054  1.00 23.73 ? 318  GLU B CG  1 
ATOM   5190  C CD  . GLU B 1 318 ? -35.465 -5.321  76.345  1.00 24.87 ? 318  GLU B CD  1 
ATOM   5191  O OE1 . GLU B 1 318 ? -36.284 -4.445  76.094  1.00 26.73 ? 318  GLU B OE1 1 
ATOM   5192  O OE2 . GLU B 1 318 ? -35.594 -6.526  76.093  1.00 26.78 ? 318  GLU B OE2 1 
ATOM   5193  N N   . ASN B 1 319 ? -31.604 -2.795  75.910  1.00 17.68 ? 319  ASN B N   1 
ATOM   5194  C CA  . ASN B 1 319 ? -30.166 -2.996  75.666  1.00 16.92 ? 319  ASN B CA  1 
ATOM   5195  C C   . ASN B 1 319 ? -29.496 -1.713  75.166  1.00 16.28 ? 319  ASN B C   1 
ATOM   5196  O O   . ASN B 1 319 ? -28.336 -1.809  74.706  1.00 16.02 ? 319  ASN B O   1 
ATOM   5197  C CB  . ASN B 1 319 ? -29.916 -4.137  74.690  1.00 18.40 ? 319  ASN B CB  1 
ATOM   5198  C CG  . ASN B 1 319 ? -30.274 -5.526  75.132  1.00 20.71 ? 319  ASN B CG  1 
ATOM   5199  O OD1 . ASN B 1 319 ? -30.502 -6.399  74.267  1.00 21.07 ? 319  ASN B OD1 1 
ATOM   5200  N ND2 . ASN B 1 319 ? -30.302 -5.788  76.440  1.00 21.40 ? 319  ASN B ND2 1 
ATOM   5201  N N   . ILE B 1 320 ? -30.173 -0.591  75.250  1.00 15.94 ? 320  ILE B N   1 
ATOM   5202  C CA  . ILE B 1 320 ? -29.607 0.666   74.736  1.00 16.01 ? 320  ILE B CA  1 
ATOM   5203  C C   . ILE B 1 320 ? -28.343 1.039   75.507  1.00 16.00 ? 320  ILE B C   1 
ATOM   5204  O O   . ILE B 1 320 ? -27.319 1.394   74.886  1.00 15.74 ? 320  ILE B O   1 
ATOM   5205  C CB  . ILE B 1 320 ? -30.665 1.812   74.696  1.00 16.21 ? 320  ILE B CB  1 
ATOM   5206  C CG1 . ILE B 1 320 ? -31.704 1.521   73.583  1.00 17.10 ? 320  ILE B CG1 1 
ATOM   5207  C CG2 . ILE B 1 320 ? -30.045 3.223   74.531  1.00 15.65 ? 320  ILE B CG2 1 
ATOM   5208  C CD1 . ILE B 1 320 ? -32.895 2.523   73.611  1.00 16.64 ? 320  ILE B CD1 1 
ATOM   5209  N N   . ALA B 1 321 ? -28.451 0.952   76.820  1.00 14.90 ? 321  ALA B N   1 
ATOM   5210  C CA  . ALA B 1 321 ? -27.340 1.332   77.712  1.00 14.39 ? 321  ALA B CA  1 
ATOM   5211  C C   . ALA B 1 321 ? -26.134 0.428   77.471  1.00 13.97 ? 321  ALA B C   1 
ATOM   5212  O O   . ALA B 1 321 ? -24.986 0.916   77.530  1.00 14.18 ? 321  ALA B O   1 
ATOM   5213  C CB  . ALA B 1 321 ? -27.773 1.320   79.166  1.00 13.75 ? 321  ALA B CB  1 
ATOM   5214  N N   . ALA B 1 322 ? -26.423 -0.823  77.208  1.00 13.76 ? 322  ALA B N   1 
ATOM   5215  C CA  . ALA B 1 322 ? -25.405 -1.848  76.953  1.00 13.80 ? 322  ALA B CA  1 
ATOM   5216  C C   . ALA B 1 322 ? -24.638 -1.519  75.666  1.00 13.93 ? 322  ALA B C   1 
ATOM   5217  O O   . ALA B 1 322 ? -23.392 -1.593  75.664  1.00 13.76 ? 322  ALA B O   1 
ATOM   5218  C CB  . ALA B 1 322 ? -25.979 -3.243  76.954  1.00 13.89 ? 322  ALA B CB  1 
ATOM   5219  N N   . GLY B 1 323 ? -25.374 -1.159  74.637  1.00 13.46 ? 323  GLY B N   1 
ATOM   5220  C CA  . GLY B 1 323 ? -24.798 -0.754  73.345  1.00 13.17 ? 323  GLY B CA  1 
ATOM   5221  C C   . GLY B 1 323 ? -23.937 0.486   73.495  1.00 12.90 ? 323  GLY B C   1 
ATOM   5222  O O   . GLY B 1 323 ? -22.791 0.508   72.990  1.00 12.94 ? 323  GLY B O   1 
ATOM   5223  N N   . GLN B 1 324 ? -24.440 1.475   74.205  1.00 12.86 ? 324  GLN B N   1 
ATOM   5224  C CA  . GLN B 1 324 ? -23.763 2.753   74.430  1.00 13.46 ? 324  GLN B CA  1 
ATOM   5225  C C   . GLN B 1 324 ? -22.461 2.542   75.206  1.00 14.03 ? 324  GLN B C   1 
ATOM   5226  O O   . GLN B 1 324 ? -21.461 3.240   74.994  1.00 13.73 ? 324  GLN B O   1 
ATOM   5227  C CB  . GLN B 1 324 ? -24.656 3.798   75.084  1.00 13.22 ? 324  GLN B CB  1 
ATOM   5228  C CG  . GLN B 1 324 ? -25.836 4.191   74.205  1.00 13.57 ? 324  GLN B CG  1 
ATOM   5229  C CD  . GLN B 1 324 ? -26.791 5.131   74.899  1.00 15.28 ? 324  GLN B CD  1 
ATOM   5230  O OE1 . GLN B 1 324 ? -26.898 5.125   76.123  1.00 14.29 ? 324  GLN B OE1 1 
ATOM   5231  N NE2 . GLN B 1 324 ? -27.510 5.926   74.109  1.00 13.89 ? 324  GLN B NE2 1 
ATOM   5232  N N   . ASN B 1 325 ? -22.503 1.557   76.077  1.00 14.63 ? 325  ASN B N   1 
ATOM   5233  C CA  . ASN B 1 325 ? -21.357 1.161   76.888  1.00 15.32 ? 325  ASN B CA  1 
ATOM   5234  C C   . ASN B 1 325 ? -20.218 0.600   76.026  1.00 15.05 ? 325  ASN B C   1 
ATOM   5235  O O   . ASN B 1 325 ? -19.047 0.916   76.277  1.00 14.86 ? 325  ASN B O   1 
ATOM   5236  C CB  . ASN B 1 325 ? -21.795 0.155   77.967  1.00 18.11 ? 325  ASN B CB  1 
ATOM   5237  C CG  . ASN B 1 325 ? -21.437 0.819   79.301  1.00 23.52 ? 325  ASN B CG  1 
ATOM   5238  O OD1 . ASN B 1 325 ? -20.333 0.564   79.804  1.00 25.82 ? 325  ASN B OD1 1 
ATOM   5239  N ND2 . ASN B 1 325 ? -22.356 1.687   79.722  1.00 22.51 ? 325  ASN B ND2 1 
ATOM   5240  N N   . GLU B 1 326 ? -20.604 -0.224  75.083  1.00 14.72 ? 326  GLU B N   1 
ATOM   5241  C CA  . GLU B 1 326 ? -19.638 -0.809  74.126  1.00 14.91 ? 326  GLU B CA  1 
ATOM   5242  C C   . GLU B 1 326 ? -18.975 0.293   73.321  1.00 14.68 ? 326  GLU B C   1 
ATOM   5243  O O   . GLU B 1 326 ? -17.738 0.280   73.141  1.00 14.78 ? 326  GLU B O   1 
ATOM   5244  C CB  . GLU B 1 326 ? -20.291 -1.832  73.219  1.00 15.60 ? 326  GLU B CB  1 
ATOM   5245  C CG  . GLU B 1 326 ? -20.736 -3.144  73.901  1.00 18.64 ? 326  GLU B CG  1 
ATOM   5246  C CD  . GLU B 1 326 ? -19.614 -3.808  74.665  1.00 19.62 ? 326  GLU B CD  1 
ATOM   5247  O OE1 . GLU B 1 326 ? -18.486 -3.943  74.222  1.00 20.34 ? 326  GLU B OE1 1 
ATOM   5248  O OE2 . GLU B 1 326 ? -19.958 -4.151  75.807  1.00 19.43 ? 326  GLU B OE2 1 
ATOM   5249  N N   . LEU B 1 327 ? -19.777 1.241   72.860  1.00 14.01 ? 327  LEU B N   1 
ATOM   5250  C CA  . LEU B 1 327 ? -19.277 2.407   72.122  1.00 13.61 ? 327  LEU B CA  1 
ATOM   5251  C C   . LEU B 1 327 ? -18.274 3.207   72.944  1.00 13.85 ? 327  LEU B C   1 
ATOM   5252  O O   . LEU B 1 327 ? -17.180 3.529   72.443  1.00 13.41 ? 327  LEU B O   1 
ATOM   5253  C CB  . LEU B 1 327 ? -20.465 3.255   71.625  1.00 12.21 ? 327  LEU B CB  1 
ATOM   5254  C CG  . LEU B 1 327 ? -20.121 4.533   70.886  1.00 11.64 ? 327  LEU B CG  1 
ATOM   5255  C CD1 . LEU B 1 327 ? -19.406 4.250   69.564  1.00 12.45 ? 327  LEU B CD1 1 
ATOM   5256  C CD2 . LEU B 1 327 ? -21.392 5.322   70.605  1.00 10.84 ? 327  LEU B CD2 1 
ATOM   5257  N N   . LEU B 1 328 ? -18.666 3.559   74.169  1.00 13.21 ? 328  LEU B N   1 
ATOM   5258  C CA  . LEU B 1 328 ? -17.805 4.329   75.063  1.00 14.07 ? 328  LEU B CA  1 
ATOM   5259  C C   . LEU B 1 328 ? -16.458 3.630   75.277  1.00 13.53 ? 328  LEU B C   1 
ATOM   5260  O O   . LEU B 1 328 ? -15.420 4.315   75.249  1.00 13.97 ? 328  LEU B O   1 
ATOM   5261  C CB  . LEU B 1 328 ? -18.555 4.664   76.357  1.00 14.23 ? 328  LEU B CB  1 
ATOM   5262  C CG  . LEU B 1 328 ? -19.659 5.703   76.291  1.00 14.43 ? 328  LEU B CG  1 
ATOM   5263  C CD1 . LEU B 1 328 ? -20.548 5.631   77.539  1.00 16.30 ? 328  LEU B CD1 1 
ATOM   5264  C CD2 . LEU B 1 328 ? -19.040 7.085   76.163  1.00 15.06 ? 328  LEU B CD2 1 
ATOM   5265  N N   . LYS B 1 329 ? -16.486 2.342   75.486  1.00 13.89 ? 329  LYS B N   1 
ATOM   5266  C CA  . LYS B 1 329 ? -15.295 1.526   75.735  1.00 14.99 ? 329  LYS B CA  1 
ATOM   5267  C C   . LYS B 1 329 ? -14.331 1.575   74.541  1.00 14.45 ? 329  LYS B C   1 
ATOM   5268  O O   . LYS B 1 329 ? -13.135 1.807   74.734  1.00 13.73 ? 329  LYS B O   1 
ATOM   5269  C CB  . LYS B 1 329 ? -15.600 0.086   76.080  1.00 17.46 ? 329  LYS B CB  1 
ATOM   5270  C CG  . LYS B 1 329 ? -16.117 -0.165  77.508  1.00 20.79 ? 329  LYS B CG  1 
ATOM   5271  C CD  . LYS B 1 329 ? -16.444 -1.667  77.652  1.00 22.70 ? 329  LYS B CD  1 
ATOM   5272  C CE  . LYS B 1 329 ? -15.270 -2.506  77.180  1.00 24.38 ? 329  LYS B CE  1 
ATOM   5273  N NZ  . LYS B 1 329 ? -15.722 -3.555  76.225  1.00 26.82 ? 329  LYS B NZ  1 
ATOM   5274  N N   . ARG B 1 330 ? -14.852 1.366   73.345  1.00 14.66 ? 330  ARG B N   1 
ATOM   5275  C CA  . ARG B 1 330 ? -14.041 1.353   72.121  1.00 13.76 ? 330  ARG B CA  1 
ATOM   5276  C C   . ARG B 1 330 ? -13.571 2.730   71.708  1.00 13.03 ? 330  ARG B C   1 
ATOM   5277  O O   . ARG B 1 330 ? -12.463 2.819   71.109  1.00 13.06 ? 330  ARG B O   1 
ATOM   5278  C CB  . ARG B 1 330 ? -14.710 0.652   70.930  1.00 16.56 ? 330  ARG B CB  1 
ATOM   5279  C CG  . ARG B 1 330 ? -14.935 -0.809  71.023  1.00 19.56 ? 330  ARG B CG  1 
ATOM   5280  C CD  . ARG B 1 330 ? -13.904 -1.784  70.722  1.00 22.62 ? 330  ARG B CD  1 
ATOM   5281  N NE  . ARG B 1 330 ? -12.503 -1.536  70.841  1.00 21.08 ? 330  ARG B NE  1 
ATOM   5282  C CZ  . ARG B 1 330 ? -11.576 -2.430  71.193  1.00 22.80 ? 330  ARG B CZ  1 
ATOM   5283  N NH1 . ARG B 1 330 ? -11.859 -3.667  71.594  1.00 21.84 ? 330  ARG B NH1 1 
ATOM   5284  N NH2 . ARG B 1 330 ? -10.274 -2.105  71.041  1.00 20.79 ? 330  ARG B NH2 1 
ATOM   5285  N N   . ALA B 1 331 ? -14.347 3.773   71.981  1.00 11.63 ? 331  ALA B N   1 
ATOM   5286  C CA  . ALA B 1 331 ? -13.925 5.138   71.694  1.00 10.94 ? 331  ALA B CA  1 
ATOM   5287  C C   . ALA B 1 331 ? -12.718 5.504   72.569  1.00 11.07 ? 331  ALA B C   1 
ATOM   5288  O O   . ALA B 1 331 ? -11.755 6.137   72.099  1.00 10.54 ? 331  ALA B O   1 
ATOM   5289  C CB  . ALA B 1 331 ? -15.024 6.164   71.865  1.00 9.58  ? 331  ALA B CB  1 
ATOM   5290  N N   . LYS B 1 332 ? -12.817 5.085   73.830  1.00 10.62 ? 332  LYS B N   1 
ATOM   5291  C CA  . LYS B 1 332 ? -11.718 5.394   74.777  1.00 10.58 ? 332  LYS B CA  1 
ATOM   5292  C C   . LYS B 1 332 ? -10.446 4.651   74.372  1.00 9.74  ? 332  LYS B C   1 
ATOM   5293  O O   . LYS B 1 332 ? -9.343  5.223   74.410  1.00 9.44  ? 332  LYS B O   1 
ATOM   5294  C CB  . LYS B 1 332 ? -12.079 5.032   76.222  1.00 13.55 ? 332  LYS B CB  1 
ATOM   5295  C CG  . LYS B 1 332 ? -10.906 5.373   77.180  1.00 16.72 ? 332  LYS B CG  1 
ATOM   5296  C CD  . LYS B 1 332 ? -10.750 6.873   77.275  1.00 20.70 ? 332  LYS B CD  1 
ATOM   5297  C CE  . LYS B 1 332 ? -9.335  7.381   77.361  1.00 24.80 ? 332  LYS B CE  1 
ATOM   5298  N NZ  . LYS B 1 332 ? -8.876  7.921   76.039  1.00 24.70 ? 332  LYS B NZ  1 
ATOM   5299  N N   . ALA B 1 333 ? -10.626 3.400   74.009  1.00 9.34  ? 333  ALA B N   1 
ATOM   5300  C CA  . ALA B 1 333 ? -9.524  2.529   73.582  1.00 9.70  ? 333  ALA B CA  1 
ATOM   5301  C C   . ALA B 1 333 ? -8.807  3.161   72.377  1.00 9.84  ? 333  ALA B C   1 
ATOM   5302  O O   . ALA B 1 333 ? -7.578  3.210   72.361  1.00 9.22  ? 333  ALA B O   1 
ATOM   5303  C CB  . ALA B 1 333 ? -9.998  1.128   73.277  1.00 8.97  ? 333  ALA B CB  1 
ATOM   5304  N N   . ASN B 1 334 ? -9.607  3.614   71.420  1.00 9.64  ? 334  ASN B N   1 
ATOM   5305  C CA  . ASN B 1 334 ? -9.071  4.230   70.190  1.00 9.25  ? 334  ASN B CA  1 
ATOM   5306  C C   . ASN B 1 334 ? -8.439  5.565   70.482  1.00 8.62  ? 334  ASN B C   1 
ATOM   5307  O O   . ASN B 1 334 ? -7.440  5.940   69.833  1.00 9.01  ? 334  ASN B O   1 
ATOM   5308  C CB  . ASN B 1 334 ? -10.170 4.223   69.109  1.00 8.17  ? 334  ASN B CB  1 
ATOM   5309  C CG  . ASN B 1 334 ? -10.274 2.857   68.476  1.00 6.82  ? 334  ASN B CG  1 
ATOM   5310  O OD1 . ASN B 1 334 ? -9.243  2.236   68.147  1.00 7.68  ? 334  ASN B OD1 1 
ATOM   5311  N ND2 . ASN B 1 334 ? -11.484 2.319   68.302  1.00 5.86  ? 334  ASN B ND2 1 
ATOM   5312  N N   . GLY B 1 335 ? -8.970  6.287   71.454  1.00 8.35  ? 335  GLY B N   1 
ATOM   5313  C CA  . GLY B 1 335 ? -8.451  7.589   71.883  1.00 8.64  ? 335  GLY B CA  1 
ATOM   5314  C C   . GLY B 1 335 ? -7.046  7.405   72.473  1.00 9.86  ? 335  GLY B C   1 
ATOM   5315  O O   . GLY B 1 335 ? -6.164  8.248   72.259  1.00 10.04 ? 335  GLY B O   1 
ATOM   5316  N N   . ASP B 1 336 ? -6.914  6.329   73.222  1.00 10.31 ? 336  ASP B N   1 
ATOM   5317  C CA  . ASP B 1 336 ? -5.618  5.940   73.829  1.00 11.68 ? 336  ASP B CA  1 
ATOM   5318  C C   . ASP B 1 336 ? -4.664  5.546   72.678  1.00 11.55 ? 336  ASP B C   1 
ATOM   5319  O O   . ASP B 1 336 ? -3.493  5.947   72.666  1.00 11.93 ? 336  ASP B O   1 
ATOM   5320  C CB  . ASP B 1 336 ? -5.815  4.842   74.857  1.00 11.03 ? 336  ASP B CB  1 
ATOM   5321  C CG  . ASP B 1 336 ? -6.434  5.289   76.177  1.00 13.42 ? 336  ASP B CG  1 
ATOM   5322  O OD1 . ASP B 1 336 ? -6.473  6.472   76.522  1.00 13.32 ? 336  ASP B OD1 1 
ATOM   5323  O OD2 . ASP B 1 336 ? -6.901  4.368   76.889  1.00 13.27 ? 336  ASP B OD2 1 
ATOM   5324  N N   . ALA B 1 337 ? -5.184  4.763   71.744  1.00 11.54 ? 337  ALA B N   1 
ATOM   5325  C CA  . ALA B 1 337 ? -4.355  4.328   70.586  1.00 11.52 ? 337  ALA B CA  1 
ATOM   5326  C C   . ALA B 1 337 ? -3.819  5.532   69.822  1.00 11.69 ? 337  ALA B C   1 
ATOM   5327  O O   . ALA B 1 337 ? -2.651  5.511   69.371  1.00 11.34 ? 337  ALA B O   1 
ATOM   5328  C CB  . ALA B 1 337 ? -5.118  3.365   69.708  1.00 10.62 ? 337  ALA B CB  1 
ATOM   5329  N N   . ALA B 1 338 ? -4.629  6.559   69.708  1.00 12.18 ? 338  ALA B N   1 
ATOM   5330  C CA  . ALA B 1 338 ? -4.315  7.802   69.007  1.00 13.39 ? 338  ALA B CA  1 
ATOM   5331  C C   . ALA B 1 338 ? -3.187  8.559   69.723  1.00 14.36 ? 338  ALA B C   1 
ATOM   5332  O O   . ALA B 1 338 ? -2.601  9.505   69.163  1.00 13.87 ? 338  ALA B O   1 
ATOM   5333  C CB  . ALA B 1 338 ? -5.538  8.713   68.916  1.00 13.09 ? 338  ALA B CB  1 
ATOM   5334  N N   . GLN B 1 339 ? -2.967  8.140   70.959  1.00 14.40 ? 339  GLN B N   1 
ATOM   5335  C CA  . GLN B 1 339 ? -1.889  8.770   71.763  1.00 15.21 ? 339  GLN B CA  1 
ATOM   5336  C C   . GLN B 1 339 ? -0.785  7.741   71.990  1.00 14.70 ? 339  GLN B C   1 
ATOM   5337  O O   . GLN B 1 339 ? 0.149   8.026   72.759  1.00 15.97 ? 339  GLN B O   1 
ATOM   5338  C CB  . GLN B 1 339 ? -2.397  9.366   73.069  1.00 17.22 ? 339  GLN B CB  1 
ATOM   5339  C CG  . GLN B 1 339 ? -3.513  10.369  72.888  1.00 19.03 ? 339  GLN B CG  1 
ATOM   5340  C CD  . GLN B 1 339 ? -4.203  10.772  74.169  1.00 20.22 ? 339  GLN B CD  1 
ATOM   5341  O OE1 . GLN B 1 339 ? -3.822  11.744  74.818  1.00 22.65 ? 339  GLN B OE1 1 
ATOM   5342  N NE2 . GLN B 1 339 ? -5.254  10.036  74.527  1.00 20.30 ? 339  GLN B NE2 1 
ATOM   5343  N N   . GLY B 1 340 ? -0.925  6.603   71.374  1.00 14.45 ? 340  GLY B N   1 
ATOM   5344  C CA  . GLY B 1 340 ? 0.013   5.485   71.420  1.00 14.77 ? 340  GLY B CA  1 
ATOM   5345  C C   . GLY B 1 340 ? 0.149   4.867   72.816  1.00 15.45 ? 340  GLY B C   1 
ATOM   5346  O O   . GLY B 1 340 ? 1.253   4.394   73.156  1.00 14.94 ? 340  GLY B O   1 
ATOM   5347  N N   . LYS B 1 341 ? -0.933  4.828   73.565  1.00 15.55 ? 341  LYS B N   1 
ATOM   5348  C CA  . LYS B 1 341 ? -0.929  4.355   74.948  1.00 15.97 ? 341  LYS B CA  1 
ATOM   5349  C C   . LYS B 1 341 ? -1.883  3.190   75.167  1.00 15.13 ? 341  LYS B C   1 
ATOM   5350  O O   . LYS B 1 341 ? -2.171  2.871   76.356  1.00 14.88 ? 341  LYS B O   1 
ATOM   5351  C CB  . LYS B 1 341 ? -1.365  5.421   75.954  1.00 18.20 ? 341  LYS B CB  1 
ATOM   5352  C CG  . LYS B 1 341 ? -0.757  6.787   75.875  1.00 21.87 ? 341  LYS B CG  1 
ATOM   5353  C CD  . LYS B 1 341 ? -1.059  7.642   77.095  1.00 23.47 ? 341  LYS B CD  1 
ATOM   5354  C CE  . LYS B 1 341 ? -2.486  8.145   77.113  1.00 25.92 ? 341  LYS B CE  1 
ATOM   5355  N NZ  . LYS B 1 341 ? -2.611  9.232   78.135  1.00 27.59 ? 341  LYS B NZ  1 
ATOM   5356  N N   . TYR B 1 342 ? -2.358  2.555   74.111  1.00 14.35 ? 342  TYR B N   1 
ATOM   5357  C CA  . TYR B 1 342 ? -3.318  1.460   74.313  1.00 14.38 ? 342  TYR B CA  1 
ATOM   5358  C C   . TYR B 1 342 ? -2.618  0.165   74.711  1.00 14.60 ? 342  TYR B C   1 
ATOM   5359  O O   . TYR B 1 342 ? -1.687  -0.293  74.042  1.00 14.22 ? 342  TYR B O   1 
ATOM   5360  C CB  . TYR B 1 342 ? -4.241  1.235   73.098  1.00 11.71 ? 342  TYR B CB  1 
ATOM   5361  C CG  . TYR B 1 342 ? -5.236  0.114   73.333  1.00 10.95 ? 342  TYR B CG  1 
ATOM   5362  C CD1 . TYR B 1 342 ? -6.362  0.330   74.141  1.00 11.67 ? 342  TYR B CD1 1 
ATOM   5363  C CD2 . TYR B 1 342 ? -5.078  -1.123  72.735  1.00 10.01 ? 342  TYR B CD2 1 
ATOM   5364  C CE1 . TYR B 1 342 ? -7.295  -0.680  74.350  1.00 10.57 ? 342  TYR B CE1 1 
ATOM   5365  C CE2 . TYR B 1 342 ? -6.006  -2.147  72.918  1.00 11.18 ? 342  TYR B CE2 1 
ATOM   5366  C CZ  . TYR B 1 342 ? -7.105  -1.914  73.745  1.00 10.56 ? 342  TYR B CZ  1 
ATOM   5367  O OH  . TYR B 1 342 ? -7.979  -2.944  73.926  1.00 10.49 ? 342  TYR B OH  1 
ATOM   5368  N N   . VAL B 1 343 ? -3.121  -0.409  75.808  1.00 14.69 ? 343  VAL B N   1 
ATOM   5369  C CA  . VAL B 1 343 ? -2.634  -1.705  76.306  1.00 15.11 ? 343  VAL B CA  1 
ATOM   5370  C C   . VAL B 1 343 ? -3.470  -2.805  75.666  1.00 15.81 ? 343  VAL B C   1 
ATOM   5371  O O   . VAL B 1 343 ? -4.703  -2.802  75.884  1.00 17.05 ? 343  VAL B O   1 
ATOM   5372  C CB  . VAL B 1 343 ? -2.694  -1.718  77.855  1.00 15.35 ? 343  VAL B CB  1 
ATOM   5373  C CG1 . VAL B 1 343 ? -2.375  -3.108  78.402  1.00 14.78 ? 343  VAL B CG1 1 
ATOM   5374  C CG2 . VAL B 1 343 ? -1.814  -0.648  78.467  1.00 15.90 ? 343  VAL B CG2 1 
ATOM   5375  N N   . ALA B 1 344 ? -2.855  -3.703  74.920  1.00 16.11 ? 345  ALA B N   1 
ATOM   5376  C CA  . ALA B 1 344 ? -3.562  -4.756  74.205  1.00 17.02 ? 345  ALA B CA  1 
ATOM   5377  C C   . ALA B 1 344 ? -4.497  -5.526  75.146  1.00 18.38 ? 345  ALA B C   1 
ATOM   5378  O O   . ALA B 1 344 ? -4.092  -5.888  76.253  1.00 18.03 ? 345  ALA B O   1 
ATOM   5379  C CB  . ALA B 1 344 ? -2.615  -5.736  73.527  1.00 14.99 ? 345  ALA B CB  1 
ATOM   5380  N N   . GLY B 1 345 ? -5.703  -5.768  74.664  1.00 19.15 ? 346  GLY B N   1 
ATOM   5381  C CA  . GLY B 1 345 ? -6.703  -6.565  75.356  1.00 20.18 ? 346  GLY B CA  1 
ATOM   5382  C C   . GLY B 1 345 ? -7.388  -5.872  76.511  1.00 21.32 ? 346  GLY B C   1 
ATOM   5383  O O   . GLY B 1 345 ? -8.272  -6.491  77.161  1.00 21.62 ? 346  GLY B O   1 
ATOM   5384  N N   . SER B 1 346 ? -7.065  -4.625  76.776  1.00 22.07 ? 347  SER B N   1 
ATOM   5385  C CA  . SER B 1 346 ? -7.609  -3.888  77.916  1.00 24.14 ? 347  SER B CA  1 
ATOM   5386  C C   . SER B 1 346 ? -9.057  -3.463  77.730  1.00 25.27 ? 347  SER B C   1 
ATOM   5387  O O   . SER B 1 346 ? -9.765  -3.226  78.733  1.00 25.25 ? 347  SER B O   1 
ATOM   5388  C CB  . SER B 1 346 ? -6.727  -2.700  78.277  1.00 24.16 ? 347  SER B CB  1 
ATOM   5389  O OG  . SER B 1 346 ? -6.997  -1.587  77.445  1.00 25.89 ? 347  SER B OG  1 
ATOM   5390  N N   . ALA B 1 347 ? -9.512  -3.357  76.495  1.00 26.16 ? 348  ALA B N   1 
ATOM   5391  C CA  . ALA B 1 347 ? -10.897 -2.950  76.208  1.00 27.84 ? 348  ALA B CA  1 
ATOM   5392  C C   . ALA B 1 347 ? -11.777 -4.164  75.954  1.00 29.03 ? 348  ALA B C   1 
ATOM   5393  O O   . ALA B 1 347 ? -12.968 -4.013  75.612  1.00 29.78 ? 348  ALA B O   1 
ATOM   5394  C CB  . ALA B 1 347 ? -10.942 -1.960  75.063  1.00 27.70 ? 348  ALA B CB  1 
ATOM   5395  N N   . GLY B 1 348 ? -11.196 -5.339  76.111  1.00 29.91 ? 349  GLY B N   1 
ATOM   5396  C CA  . GLY B 1 348 ? -11.899 -6.611  75.878  1.00 31.27 ? 349  GLY B CA  1 
ATOM   5397  C C   . GLY B 1 348 ? -11.512 -7.197  74.516  1.00 32.09 ? 349  GLY B C   1 
ATOM   5398  O O   . GLY B 1 348 ? -10.810 -6.572  73.710  1.00 32.24 ? 349  GLY B O   1 
ATOM   5399  N N   . ALA B 1 349 ? -11.998 -8.401  74.302  1.00 33.01 ? 351  ALA B N   1 
ATOM   5400  C CA  . ALA B 1 349 ? -11.755 -9.232  73.127  1.00 34.19 ? 351  ALA B CA  1 
ATOM   5401  C C   . ALA B 1 349 ? -12.253 -8.583  71.837  1.00 35.04 ? 351  ALA B C   1 
ATOM   5402  O O   . ALA B 1 349 ? -11.645 -8.767  70.765  1.00 35.11 ? 351  ALA B O   1 
ATOM   5403  C CB  . ALA B 1 349 ? -12.420 -10.597 73.319  1.00 33.96 ? 351  ALA B CB  1 
ATOM   5404  N N   . GLY B 1 350 ? -13.350 -7.860  71.959  1.00 35.62 ? 352  GLY B N   1 
ATOM   5405  C CA  . GLY B 1 350 ? -13.982 -7.190  70.814  1.00 36.55 ? 352  GLY B CA  1 
ATOM   5406  C C   . GLY B 1 350 ? -14.586 -8.239  69.875  1.00 37.18 ? 352  GLY B C   1 
ATOM   5407  O O   . GLY B 1 350 ? -14.913 -9.366  70.271  1.00 37.46 ? 352  GLY B O   1 
ATOM   5408  N N   . SER B 1 351 ? -14.729 -7.828  68.627  1.00 37.58 ? 353  SER B N   1 
ATOM   5409  C CA  . SER B 1 351 ? -15.298 -8.626  67.549  1.00 37.65 ? 353  SER B CA  1 
ATOM   5410  C C   . SER B 1 351 ? -14.255 -9.548  66.916  1.00 37.95 ? 353  SER B C   1 
ATOM   5411  O O   . SER B 1 351 ? -13.086 -9.611  67.307  1.00 37.96 ? 353  SER B O   1 
ATOM   5412  C CB  . SER B 1 351 ? -15.821 -7.682  66.445  1.00 37.65 ? 353  SER B CB  1 
ATOM   5413  O OG  . SER B 1 351 ? -14.706 -7.019  65.841  1.00 35.54 ? 353  SER B OG  1 
ATOM   5414  N N   . GLY B 1 352 ? -14.753 -10.255 65.916  1.00 38.36 ? 354  GLY B N   1 
ATOM   5415  C CA  . GLY B 1 352 ? -13.887 -11.095 65.043  1.00 38.88 ? 354  GLY B CA  1 
ATOM   5416  C C   . GLY B 1 352 ? -13.614 -10.204 63.812  1.00 39.29 ? 354  GLY B C   1 
ATOM   5417  O O   . GLY B 1 352 ? -13.911 -9.001  63.875  1.00 38.80 ? 354  GLY B O   1 
ATOM   5418  N N   . SER B 1 353 ? -13.079 -10.812 62.783  1.00 40.19 ? 355  SER B N   1 
ATOM   5419  C CA  . SER B 1 353 ? -12.821 -10.112 61.506  1.00 41.18 ? 355  SER B CA  1 
ATOM   5420  C C   . SER B 1 353 ? -14.102 -9.420  61.032  1.00 41.71 ? 355  SER B C   1 
ATOM   5421  O O   . SER B 1 353 ? -15.201 -10.000 61.083  1.00 41.49 ? 355  SER B O   1 
ATOM   5422  C CB  . SER B 1 353 ? -12.291 -11.085 60.465  1.00 41.44 ? 355  SER B CB  1 
ATOM   5423  O OG  . SER B 1 353 ? -12.583 -10.687 59.131  1.00 41.44 ? 355  SER B OG  1 
ATOM   5424  N N   . LEU B 1 354 ? -13.930 -8.196  60.576  1.00 42.59 ? 356  LEU B N   1 
ATOM   5425  C CA  . LEU B 1 354 ? -15.022 -7.379  60.026  1.00 43.74 ? 356  LEU B CA  1 
ATOM   5426  C C   . LEU B 1 354 ? -14.885 -7.263  58.511  1.00 45.02 ? 356  LEU B C   1 
ATOM   5427  O O   . LEU B 1 354 ? -15.378 -6.309  57.888  1.00 44.54 ? 356  LEU B O   1 
ATOM   5428  C CB  . LEU B 1 354 ? -14.996 -6.032  60.764  1.00 42.10 ? 356  LEU B CB  1 
ATOM   5429  C CG  . LEU B 1 354 ? -15.159 -6.125  62.277  1.00 41.67 ? 356  LEU B CG  1 
ATOM   5430  C CD1 . LEU B 1 354 ? -14.987 -4.768  62.937  1.00 40.76 ? 356  LEU B CD1 1 
ATOM   5431  C CD2 . LEU B 1 354 ? -16.545 -6.703  62.569  1.00 40.93 ? 356  LEU B CD2 1 
ATOM   5432  N N   . PHE B 1 355 ? -14.215 -8.255  57.944  1.00 46.86 ? 357  PHE B N   1 
ATOM   5433  C CA  . PHE B 1 355 ? -13.906 -8.281  56.513  1.00 49.32 ? 357  PHE B CA  1 
ATOM   5434  C C   . PHE B 1 355 ? -15.130 -8.649  55.667  1.00 51.58 ? 357  PHE B C   1 
ATOM   5435  O O   . PHE B 1 355 ? -15.734 -9.713  55.840  1.00 51.62 ? 357  PHE B O   1 
ATOM   5436  C CB  . PHE B 1 355 ? -12.717 -9.189  56.180  1.00 47.59 ? 357  PHE B CB  1 
ATOM   5437  C CG  . PHE B 1 355 ? -12.446 -9.300  54.706  1.00 47.04 ? 357  PHE B CG  1 
ATOM   5438  C CD1 . PHE B 1 355 ? -11.770 -8.272  54.042  1.00 46.35 ? 357  PHE B CD1 1 
ATOM   5439  C CD2 . PHE B 1 355 ? -12.883 -10.411 53.986  1.00 46.25 ? 357  PHE B CD2 1 
ATOM   5440  C CE1 . PHE B 1 355 ? -11.515 -8.347  52.680  1.00 46.06 ? 357  PHE B CE1 1 
ATOM   5441  C CE2 . PHE B 1 355 ? -12.635 -10.505 52.611  1.00 46.40 ? 357  PHE B CE2 1 
ATOM   5442  C CZ  . PHE B 1 355 ? -11.942 -9.463  51.965  1.00 45.63 ? 357  PHE B CZ  1 
ATOM   5443  N N   . VAL B 1 356 ? -15.435 -7.736  54.769  1.00 54.14 ? 358  VAL B N   1 
ATOM   5444  C CA  . VAL B 1 356 ? -16.461 -7.926  53.729  1.00 57.28 ? 358  VAL B CA  1 
ATOM   5445  C C   . VAL B 1 356 ? -15.795 -7.630  52.375  1.00 59.65 ? 358  VAL B C   1 
ATOM   5446  O O   . VAL B 1 356 ? -15.442 -6.467  52.104  1.00 59.81 ? 358  VAL B O   1 
ATOM   5447  C CB  . VAL B 1 356 ? -17.694 -7.052  54.000  1.00 57.34 ? 358  VAL B CB  1 
ATOM   5448  C CG1 . VAL B 1 356 ? -18.809 -7.289  52.979  1.00 57.63 ? 358  VAL B CG1 1 
ATOM   5449  C CG2 . VAL B 1 356 ? -18.221 -7.203  55.416  1.00 57.41 ? 358  VAL B CG2 1 
ATOM   5450  N N   . ALA B 1 357 ? -15.618 -8.670  51.589  1.00 62.15 ? 359  ALA B N   1 
ATOM   5451  C CA  . ALA B 1 357 ? -14.977 -8.553  50.270  1.00 65.18 ? 359  ALA B CA  1 
ATOM   5452  C C   . ALA B 1 357 ? -15.963 -8.057  49.221  1.00 67.42 ? 359  ALA B C   1 
ATOM   5453  O O   . ALA B 1 357 ? -17.170 -7.931  49.477  1.00 67.50 ? 359  ALA B O   1 
ATOM   5454  C CB  . ALA B 1 357 ? -14.409 -9.913  49.867  1.00 65.25 ? 359  ALA B CB  1 
ATOM   5455  N N   . ASN B 1 358 ? -15.416 -7.780  48.048  1.00 70.03 ? 360  ASN B N   1 
ATOM   5456  C CA  . ASN B 1 358 ? -16.201 -7.433  46.854  1.00 72.86 ? 360  ASN B CA  1 
ATOM   5457  C C   . ASN B 1 358 ? -16.606 -5.960  46.832  1.00 74.70 ? 360  ASN B C   1 
ATOM   5458  O O   . ASN B 1 358 ? -17.795 -5.670  46.583  1.00 74.76 ? 360  ASN B O   1 
ATOM   5459  C CB  . ASN B 1 358 ? -17.408 -8.359  46.708  1.00 74.04 ? 360  ASN B CB  1 
ATOM   5460  C CG  . ASN B 1 358 ? -17.325 -9.392  45.611  1.00 74.76 ? 360  ASN B CG  1 
ATOM   5461  O OD1 . ASN B 1 358 ? -17.826 -9.178  44.491  1.00 74.83 ? 360  ASN B OD1 1 
ATOM   5462  N ND2 . ASN B 1 358 ? -16.715 -10.543 45.909  1.00 74.99 ? 360  ASN B ND2 1 
ATOM   5463  N N   . HIS B 1 359 ? -15.642 -5.092  47.075  1.00 76.70 ? 361  HIS B N   1 
ATOM   5464  C CA  . HIS B 1 359 ? -15.901 -3.641  46.969  1.00 78.77 ? 361  HIS B CA  1 
ATOM   5465  C C   . HIS B 1 359 ? -15.541 -3.200  45.541  1.00 80.01 ? 361  HIS B C   1 
ATOM   5466  O O   . HIS B 1 359 ? -14.937 -3.970  44.784  1.00 79.99 ? 361  HIS B O   1 
ATOM   5467  C CB  . HIS B 1 359 ? -15.166 -2.763  47.979  1.00 80.08 ? 361  HIS B CB  1 
ATOM   5468  C CG  . HIS B 1 359 ? -15.555 -2.976  49.403  1.00 81.15 ? 361  HIS B CG  1 
ATOM   5469  N ND1 . HIS B 1 359 ? -15.939 -1.973  50.257  1.00 81.75 ? 361  HIS B ND1 1 
ATOM   5470  C CD2 . HIS B 1 359 ? -15.604 -4.123  50.129  1.00 81.60 ? 361  HIS B CD2 1 
ATOM   5471  C CE1 . HIS B 1 359 ? -16.204 -2.493  51.450  1.00 82.07 ? 361  HIS B CE1 1 
ATOM   5472  N NE2 . HIS B 1 359 ? -16.013 -3.792  51.395  1.00 81.95 ? 361  HIS B NE2 1 
ATOM   5473  N N   . ALA B 1 360 ? -15.932 -1.985  45.242  1.00 81.33 ? 362  ALA B N   1 
ATOM   5474  C CA  . ALA B 1 360 ? -15.748 -1.320  43.962  1.00 82.79 ? 362  ALA B CA  1 
ATOM   5475  C C   . ALA B 1 360 ? -15.788 -2.275  42.770  1.00 83.88 ? 362  ALA B C   1 
ATOM   5476  O O   . ALA B 1 360 ? -14.798 -2.921  42.410  1.00 83.97 ? 362  ALA B O   1 
ATOM   5477  C CB  . ALA B 1 360 ? -14.453 -0.513  43.957  1.00 83.12 ? 362  ALA B CB  1 
ATOM   5478  N N   . TYR B 1 361 ? -16.937 -2.302  42.144  1.00 84.97 ? 363  TYR B N   1 
ATOM   5479  C CA  . TYR B 1 361 ? -17.302 -3.111  40.993  1.00 86.08 ? 363  TYR B CA  1 
ATOM   5480  C C   . TYR B 1 361 ? -18.037 -4.360  41.500  1.00 86.48 ? 363  TYR B C   1 
ATOM   5481  O O   . TYR B 1 361 ? -17.607 -4.839  42.576  1.00 86.66 ? 363  TYR B O   1 
ATOM   5482  C CB  . TYR B 1 361 ? -16.184 -3.427  39.990  1.00 87.95 ? 363  TYR B CB  1 
ATOM   5483  C CG  . TYR B 1 361 ? -16.767 -4.135  38.770  1.00 89.42 ? 363  TYR B CG  1 
ATOM   5484  C CD1 . TYR B 1 361 ? -17.767 -3.525  38.006  1.00 90.13 ? 363  TYR B CD1 1 
ATOM   5485  C CD2 . TYR B 1 361 ? -16.375 -5.418  38.429  1.00 90.01 ? 363  TYR B CD2 1 
ATOM   5486  C CE1 . TYR B 1 361 ? -18.339 -4.176  36.914  1.00 90.95 ? 363  TYR B CE1 1 
ATOM   5487  C CE2 . TYR B 1 361 ? -16.923 -6.084  37.333  1.00 90.89 ? 363  TYR B CE2 1 
ATOM   5488  C CZ  . TYR B 1 361 ? -17.908 -5.460  36.581  1.00 91.23 ? 363  TYR B CZ  1 
ATOM   5489  O OH  . TYR B 1 361 ? -18.430 -6.143  35.514  1.00 91.69 ? 363  TYR B OH  1 
ATOM   5490  O OXT . TYR B 1 361 ? -19.020 -4.747  40.854  1.00 87.16 ? 363  TYR B OXT 1 
HETATM 5491  C C   . ACE C 1 1   ? 2.825   3.457   37.969  1.00 9.58  ? 0    ACE C C   1 
HETATM 5492  O O   . ACE C 1 1   ? 2.167   2.615   37.344  1.00 12.03 ? 0    ACE C O   1 
HETATM 5493  C CH3 . ACE C 1 1   ? 2.378   4.855   38.201  1.00 11.56 ? 0    ACE C CH3 1 
ATOM   5494  N N   . THR C 1 2   ? 4.005   3.121   38.513  1.00 8.51  ? 1    THR C N   1 
ATOM   5495  C CA  . THR C 1 2   ? 4.546   1.799   38.483  1.00 7.92  ? 1    THR C CA  1 
ATOM   5496  C C   . THR C 1 2   ? 4.577   1.235   39.916  1.00 8.05  ? 1    THR C C   1 
ATOM   5497  O O   . THR C 1 2   ? 5.288   1.830   40.757  1.00 7.92  ? 1    THR C O   1 
ATOM   5498  C CB  . THR C 1 2   ? 6.032   1.794   37.916  1.00 7.47  ? 1    THR C CB  1 
ATOM   5499  O OG1 . THR C 1 2   ? 6.000   2.611   36.706  1.00 8.26  ? 1    THR C OG1 1 
ATOM   5500  C CG2 . THR C 1 2   ? 6.590   0.398   37.659  1.00 7.22  ? 1    THR C CG2 1 
ATOM   5501  N N   . THR C 1 3   ? 3.891   0.142   40.115  1.00 8.21  ? 2    THR C N   1 
ATOM   5502  C CA  . THR C 1 3   ? 3.792   -0.442  41.472  1.00 8.83  ? 2    THR C CA  1 
ATOM   5503  C C   . THR C 1 3   ? 4.763   -1.588  41.674  1.00 9.42  ? 2    THR C C   1 
ATOM   5504  O O   . THR C 1 3   ? 5.085   -1.917  42.833  1.00 8.82  ? 2    THR C O   1 
ATOM   5505  C CB  . THR C 1 3   ? 2.319   -0.882  41.812  1.00 7.00  ? 2    THR C CB  1 
ATOM   5506  O OG1 . THR C 1 3   ? 2.003   -1.967  40.909  1.00 9.41  ? 2    THR C OG1 1 
ATOM   5507  C CG2 . THR C 1 3   ? 1.296   0.246   41.784  1.00 7.33  ? 2    THR C CG2 1 
ATOM   5508  N N   . TYR C 1 4   ? 5.197   -2.200  40.583  1.00 9.05  ? 3    TYR C N   1 
ATOM   5509  C CA  . TYR C 1 4   ? 6.118   -3.338  40.624  1.00 10.78 ? 3    TYR C CA  1 
ATOM   5510  C C   . TYR C 1 4   ? 7.533   -2.805  40.368  1.00 11.90 ? 3    TYR C C   1 
ATOM   5511  O O   . TYR C 1 4   ? 7.848   -2.414  39.242  1.00 12.66 ? 3    TYR C O   1 
ATOM   5512  C CB  . TYR C 1 4   ? 5.754   -4.414  39.603  1.00 8.79  ? 3    TYR C CB  1 
ATOM   5513  C CG  . TYR C 1 4   ? 4.566   -5.301  39.881  1.00 8.76  ? 3    TYR C CG  1 
ATOM   5514  C CD1 . TYR C 1 4   ? 4.651   -6.335  40.798  1.00 8.11  ? 3    TYR C CD1 1 
ATOM   5515  C CD2 . TYR C 1 4   ? 3.351   -5.123  39.194  1.00 7.52  ? 3    TYR C CD2 1 
ATOM   5516  C CE1 . TYR C 1 4   ? 3.581   -7.190  41.069  1.00 9.04  ? 3    TYR C CE1 1 
ATOM   5517  C CE2 . TYR C 1 4   ? 2.273   -5.960  39.444  1.00 7.18  ? 3    TYR C CE2 1 
ATOM   5518  C CZ  . TYR C 1 4   ? 2.381   -6.993  40.366  1.00 7.83  ? 3    TYR C CZ  1 
ATOM   5519  O OH  . TYR C 1 4   ? 1.353   -7.854  40.630  1.00 7.61  ? 3    TYR C OH  1 
ATOM   5520  N N   . PHE C 1 5   ? 8.336   -2.805  41.416  1.00 11.82 ? 4    PHE C N   1 
ATOM   5521  C CA  . PHE C 1 5   ? 9.696   -2.243  41.375  1.00 12.12 ? 4    PHE C CA  1 
ATOM   5522  C C   . PHE C 1 5   ? 10.444  -2.769  42.637  1.00 12.49 ? 4    PHE C C   1 
ATOM   5523  O O   . PHE C 1 5   ? 9.803   -3.253  43.569  1.00 12.22 ? 4    PHE C O   1 
ATOM   5524  C CB  . PHE C 1 5   ? 9.732   -0.731  41.361  1.00 10.91 ? 4    PHE C CB  1 
ATOM   5525  C CG  . PHE C 1 5   ? 9.234   0.018   42.560  1.00 13.60 ? 4    PHE C CG  1 
ATOM   5526  C CD1 . PHE C 1 5   ? 7.875   0.321   42.708  1.00 13.66 ? 4    PHE C CD1 1 
ATOM   5527  C CD2 . PHE C 1 5   ? 10.126  0.472   43.535  1.00 12.38 ? 4    PHE C CD2 1 
ATOM   5528  C CE1 . PHE C 1 5   ? 7.414   1.047   43.812  1.00 14.12 ? 4    PHE C CE1 1 
ATOM   5529  C CE2 . PHE C 1 5   ? 9.692   1.197   44.631  1.00 13.53 ? 4    PHE C CE2 1 
ATOM   5530  C CZ  . PHE C 1 5   ? 8.336   1.483   44.784  1.00 14.40 ? 4    PHE C CZ  1 
ATOM   5531  N N   . ASN C 1 6   ? 11.732  -2.551  42.590  1.00 12.95 ? 5    ASN C N   1 
ATOM   5532  C CA  . ASN C 1 6   ? 12.647  -2.993  43.659  1.00 13.72 ? 5    ASN C CA  1 
ATOM   5533  C C   . ASN C 1 6   ? 13.135  -1.835  44.498  1.00 13.42 ? 5    ASN C C   1 
ATOM   5534  O O   . ASN C 1 6   ? 13.663  -0.836  43.972  1.00 14.06 ? 5    ASN C O   1 
ATOM   5535  C CB  . ASN C 1 6   ? 13.817  -3.759  43.007  1.00 14.99 ? 5    ASN C CB  1 
ATOM   5536  C CG  . ASN C 1 6   ? 13.366  -4.959  42.213  1.00 16.79 ? 5    ASN C CG  1 
ATOM   5537  O OD1 . ASN C 1 6   ? 12.753  -5.899  42.735  1.00 18.89 ? 5    ASN C OD1 1 
ATOM   5538  N ND2 . ASN C 1 6   ? 13.678  -4.953  40.916  1.00 19.32 ? 5    ASN C ND2 1 
ATOM   5539  N N   . TYR C 1 7   ? 12.954  -1.960  45.819  1.00 13.19 ? 6    TYR C N   1 
ATOM   5540  C CA  . TYR C 1 7   ? 13.602  -0.981  46.729  1.00 12.27 ? 6    TYR C CA  1 
ATOM   5541  C C   . TYR C 1 7   ? 15.109  -1.327  46.713  1.00 12.33 ? 6    TYR C C   1 
ATOM   5542  O O   . TYR C 1 7   ? 15.420  -2.486  46.430  1.00 12.48 ? 6    TYR C O   1 
ATOM   5543  C CB  . TYR C 1 7   ? 13.090  -1.202  48.159  1.00 12.48 ? 6    TYR C CB  1 
ATOM   5544  C CG  . TYR C 1 7   ? 11.701  -0.748  48.504  1.00 12.00 ? 6    TYR C CG  1 
ATOM   5545  C CD1 . TYR C 1 7   ? 11.279  0.550   48.222  1.00 11.51 ? 6    TYR C CD1 1 
ATOM   5546  C CD2 . TYR C 1 7   ? 10.800  -1.613  49.132  1.00 10.93 ? 6    TYR C CD2 1 
ATOM   5547  C CE1 . TYR C 1 7   ? 9.994   0.986   48.549  1.00 12.47 ? 6    TYR C CE1 1 
ATOM   5548  C CE2 . TYR C 1 7   ? 9.527   -1.184  49.486  1.00 11.90 ? 6    TYR C CE2 1 
ATOM   5549  C CZ  . TYR C 1 7   ? 9.121   0.107   49.180  1.00 11.66 ? 6    TYR C CZ  1 
ATOM   5550  O OH  . TYR C 1 7   ? 7.875   0.560   49.500  1.00 13.71 ? 6    TYR C OH  1 
ATOM   5551  N N   . PRO C 1 8   ? 15.939  -0.375  47.062  1.00 12.40 ? 7    PRO C N   1 
ATOM   5552  C CA  . PRO C 1 8   ? 17.378  -0.652  47.235  1.00 13.14 ? 7    PRO C CA  1 
ATOM   5553  C C   . PRO C 1 8   ? 17.569  -1.633  48.400  1.00 13.89 ? 7    PRO C C   1 
ATOM   5554  O O   . PRO C 1 8   ? 16.690  -1.781  49.250  1.00 13.47 ? 7    PRO C O   1 
ATOM   5555  C CB  . PRO C 1 8   ? 18.017  0.685   47.458  1.00 12.29 ? 7    PRO C CB  1 
ATOM   5556  C CG  . PRO C 1 8   ? 16.930  1.682   47.650  1.00 12.84 ? 7    PRO C CG  1 
ATOM   5557  C CD  . PRO C 1 8   ? 15.604  1.006   47.388  1.00 12.09 ? 7    PRO C CD  1 
ATOM   5558  N N   . SER C 1 9   ? 18.728  -2.288  48.388  1.00 15.02 ? 8    SER C N   1 
ATOM   5559  C CA  . SER C 1 9   ? 19.072  -3.279  49.423  1.00 15.75 ? 8    SER C CA  1 
ATOM   5560  C C   . SER C 1 9   ? 19.142  -2.552  50.763  1.00 15.70 ? 8    SER C C   1 
ATOM   5561  O O   . SER C 1 9   ? 19.415  -1.355  50.817  1.00 15.06 ? 8    SER C O   1 
ATOM   5562  C CB  . SER C 1 9   ? 20.408  -3.963  49.125  1.00 16.85 ? 8    SER C CB  1 
ATOM   5563  O OG  . SER C 1 9   ? 21.475  -3.019  49.263  1.00 17.01 ? 8    SER C OG  1 
ATOM   5564  N N   . LYS C 1 10  ? 18.902  -3.321  51.818  1.00 16.94 ? 9    LYS C N   1 
ATOM   5565  C CA  . LYS C 1 10  ? 18.982  -2.763  53.185  1.00 17.60 ? 9    LYS C CA  1 
ATOM   5566  C C   . LYS C 1 10  ? 20.318  -2.059  53.375  1.00 17.08 ? 9    LYS C C   1 
ATOM   5567  O O   . LYS C 1 10  ? 20.413  -0.958  53.930  1.00 16.97 ? 9    LYS C O   1 
ATOM   5568  C CB  . LYS C 1 10  ? 18.819  -3.884  54.219  1.00 20.08 ? 9    LYS C CB  1 
ATOM   5569  C CG  . LYS C 1 10  ? 18.812  -3.338  55.652  1.00 24.04 ? 9    LYS C CG  1 
ATOM   5570  C CD  . LYS C 1 10  ? 18.892  -4.458  56.678  1.00 26.05 ? 9    LYS C CD  1 
ATOM   5571  C CE  . LYS C 1 10  ? 19.016  -3.894  58.088  1.00 28.16 ? 9    LYS C CE  1 
ATOM   5572  N NZ  . LYS C 1 10  ? 17.864  -2.980  58.347  1.00 31.08 ? 9    LYS C NZ  1 
ATOM   5573  N N   . GLU C 1 11  ? 21.367  -2.703  52.881  1.00 17.33 ? 10   GLU C N   1 
ATOM   5574  C CA  . GLU C 1 11  ? 22.739  -2.213  53.013  1.00 17.41 ? 10   GLU C CA  1 
ATOM   5575  C C   . GLU C 1 11  ? 22.951  -0.861  52.368  1.00 16.52 ? 10   GLU C C   1 
ATOM   5576  O O   . GLU C 1 11  ? 23.610  0.043   52.914  1.00 15.39 ? 10   GLU C O   1 
ATOM   5577  C CB  . GLU C 1 11  ? 23.760  -3.180  52.414  1.00 21.55 ? 10   GLU C CB  1 
ATOM   5578  C CG  . GLU C 1 11  ? 23.943  -4.519  53.104  1.00 26.56 ? 10   GLU C CG  1 
ATOM   5579  C CD  . GLU C 1 11  ? 22.822  -5.506  52.937  1.00 29.08 ? 10   GLU C CD  1 
ATOM   5580  O OE1 . GLU C 1 11  ? 22.166  -5.624  51.914  1.00 30.97 ? 10   GLU C OE1 1 
ATOM   5581  O OE2 . GLU C 1 11  ? 22.648  -6.210  53.958  1.00 30.38 ? 10   GLU C OE2 1 
ATOM   5582  N N   . LEU C 1 12  ? 22.374  -0.726  51.173  1.00 15.17 ? 11   LEU C N   1 
ATOM   5583  C CA  . LEU C 1 12  ? 22.513  0.526   50.416  1.00 13.51 ? 11   LEU C CA  1 
ATOM   5584  C C   . LEU C 1 12  ? 21.735  1.636   51.104  1.00 12.38 ? 11   LEU C C   1 
ATOM   5585  O O   . LEU C 1 12  ? 22.211  2.773   51.282  1.00 11.79 ? 11   LEU C O   1 
ATOM   5586  C CB  . LEU C 1 12  ? 22.110  0.223   48.970  1.00 12.61 ? 11   LEU C CB  1 
ATOM   5587  C CG  . LEU C 1 12  ? 22.180  1.411   48.019  1.00 13.69 ? 11   LEU C CG  1 
ATOM   5588  C CD1 . LEU C 1 12  ? 23.534  2.095   48.125  1.00 11.72 ? 11   LEU C CD1 1 
ATOM   5589  C CD2 . LEU C 1 12  ? 21.930  0.902   46.597  1.00 13.14 ? 11   LEU C CD2 1 
ATOM   5590  N N   . GLN C 1 13  ? 20.531  1.264   51.527  1.00 12.24 ? 12   GLN C N   1 
ATOM   5591  C CA  . GLN C 1 13  ? 19.638  2.210   52.215  1.00 11.90 ? 12   GLN C CA  1 
ATOM   5592  C C   . GLN C 1 13  ? 20.322  2.825   53.437  1.00 11.68 ? 12   GLN C C   1 
ATOM   5593  O O   . GLN C 1 13  ? 20.309  4.039   53.666  1.00 10.80 ? 12   GLN C O   1 
ATOM   5594  C CB  . GLN C 1 13  ? 18.340  1.529   52.643  1.00 11.87 ? 12   GLN C CB  1 
ATOM   5595  C CG  . GLN C 1 13  ? 17.409  1.118   51.520  1.00 12.30 ? 12   GLN C CG  1 
ATOM   5596  C CD  . GLN C 1 13  ? 16.124  0.522   52.055  1.00 14.35 ? 12   GLN C CD  1 
ATOM   5597  O OE1 . GLN C 1 13  ? 15.619  0.998   53.073  1.00 15.91 ? 12   GLN C OE1 1 
ATOM   5598  N NE2 . GLN C 1 13  ? 15.609  -0.499  51.395  1.00 15.26 ? 12   GLN C NE2 1 
ATOM   5599  N N   . ASP C 1 14  ? 20.881  1.916   54.229  1.00 12.55 ? 13   ASP C N   1 
ATOM   5600  C CA  . ASP C 1 14  ? 21.531  2.312   55.500  1.00 13.26 ? 13   ASP C CA  1 
ATOM   5601  C C   . ASP C 1 14  ? 22.694  3.250   55.215  1.00 13.28 ? 13   ASP C C   1 
ATOM   5602  O O   . ASP C 1 14  ? 22.819  4.269   55.900  1.00 13.75 ? 13   ASP C O   1 
ATOM   5603  C CB  . ASP C 1 14  ? 21.940  1.070   56.296  1.00 14.89 ? 13   ASP C CB  1 
ATOM   5604  C CG  . ASP C 1 14  ? 20.739  0.349   56.879  1.00 15.69 ? 13   ASP C CG  1 
ATOM   5605  O OD1 . ASP C 1 14  ? 19.628  0.906   56.930  1.00 17.99 ? 13   ASP C OD1 1 
ATOM   5606  O OD2 . ASP C 1 14  ? 20.944  -0.819  57.243  1.00 16.42 ? 13   ASP C OD2 1 
ATOM   5607  N N   . GLU C 1 15  ? 23.496  2.868   54.213  1.00 13.27 ? 14   GLU C N   1 
ATOM   5608  C CA  . GLU C 1 15  ? 24.666  3.697   53.873  1.00 12.94 ? 14   GLU C CA  1 
ATOM   5609  C C   . GLU C 1 15  ? 24.267  5.092   53.437  1.00 12.09 ? 14   GLU C C   1 
ATOM   5610  O O   . GLU C 1 15  ? 24.826  6.078   53.958  1.00 11.00 ? 14   GLU C O   1 
ATOM   5611  C CB  . GLU C 1 15  ? 25.583  3.111   52.798  1.00 14.22 ? 14   GLU C CB  1 
ATOM   5612  C CG  . GLU C 1 15  ? 26.811  3.980   52.430  1.00 15.46 ? 14   GLU C CG  1 
ATOM   5613  C CD  . GLU C 1 15  ? 27.756  3.309   51.469  1.00 14.97 ? 14   GLU C CD  1 
ATOM   5614  O OE1 . GLU C 1 15  ? 27.493  2.286   50.861  1.00 17.59 ? 14   GLU C OE1 1 
ATOM   5615  O OE2 . GLU C 1 15  ? 28.833  3.917   51.361  1.00 16.13 ? 14   GLU C OE2 1 
ATOM   5616  N N   . LEU C 1 16  ? 23.347  5.175   52.462  1.00 11.79 ? 15   LEU C N   1 
ATOM   5617  C CA  . LEU C 1 16  ? 22.888  6.493   52.004  1.00 11.32 ? 15   LEU C CA  1 
ATOM   5618  C C   . LEU C 1 16  ? 22.256  7.300   53.143  1.00 11.43 ? 15   LEU C C   1 
ATOM   5619  O O   . LEU C 1 16  ? 22.496  8.508   53.234  1.00 11.49 ? 15   LEU C O   1 
ATOM   5620  C CB  . LEU C 1 16  ? 21.937  6.355   50.812  1.00 10.39 ? 15   LEU C CB  1 
ATOM   5621  C CG  . LEU C 1 16  ? 22.450  5.709   49.527  1.00 10.77 ? 15   LEU C CG  1 
ATOM   5622  C CD1 . LEU C 1 16  ? 21.312  5.584   48.500  1.00 12.79 ? 15   LEU C CD1 1 
ATOM   5623  C CD2 . LEU C 1 16  ? 23.558  6.578   48.937  1.00 10.49 ? 15   LEU C CD2 1 
ATOM   5624  N N   . ARG C 1 17  ? 21.412  6.655   53.937  1.00 12.30 ? 16   ARG C N   1 
ATOM   5625  C CA  . ARG C 1 17  ? 20.711  7.413   55.018  1.00 12.69 ? 16   ARG C CA  1 
ATOM   5626  C C   . ARG C 1 17  ? 21.756  7.985   55.972  1.00 12.23 ? 16   ARG C C   1 
ATOM   5627  O O   . ARG C 1 17  ? 21.701  9.151   56.375  1.00 11.85 ? 16   ARG C O   1 
ATOM   5628  C CB  . ARG C 1 17  ? 19.697  6.526   55.728  1.00 14.24 ? 16   ARG C CB  1 
ATOM   5629  C CG  . ARG C 1 17  ? 18.658  7.269   56.555  1.00 18.12 ? 16   ARG C CG  1 
ATOM   5630  C CD  . ARG C 1 17  ? 17.576  6.360   57.076  1.00 19.89 ? 16   ARG C CD  1 
ATOM   5631  N NE  . ARG C 1 17  ? 18.114  5.263   57.844  1.00 21.92 ? 16   ARG C NE  1 
ATOM   5632  C CZ  . ARG C 1 17  ? 18.367  4.033   57.416  1.00 22.15 ? 16   ARG C CZ  1 
ATOM   5633  N NH1 . ARG C 1 17  ? 18.003  3.542   56.248  1.00 21.09 ? 16   ARG C NH1 1 
ATOM   5634  N NH2 . ARG C 1 17  ? 19.197  3.302   58.187  1.00 23.40 ? 16   ARG C NH2 1 
ATOM   5635  N N   . GLU C 1 18  ? 22.711  7.125   56.317  1.00 13.49 ? 17   GLU C N   1 
ATOM   5636  C CA  . GLU C 1 18  ? 23.777  7.500   57.263  1.00 14.67 ? 17   GLU C CA  1 
ATOM   5637  C C   . GLU C 1 18  ? 24.586  8.687   56.796  1.00 13.92 ? 17   GLU C C   1 
ATOM   5638  O O   . GLU C 1 18  ? 24.878  9.571   57.604  1.00 13.88 ? 17   GLU C O   1 
ATOM   5639  C CB  . GLU C 1 18  ? 24.743  6.355   57.576  1.00 19.12 ? 17   GLU C CB  1 
ATOM   5640  C CG  . GLU C 1 18  ? 25.927  6.697   58.500  1.00 25.60 ? 17   GLU C CG  1 
ATOM   5641  C CD  . GLU C 1 18  ? 26.586  5.500   59.137  1.00 29.18 ? 17   GLU C CD  1 
ATOM   5642  O OE1 . GLU C 1 18  ? 26.093  4.380   59.152  1.00 32.04 ? 17   GLU C OE1 1 
ATOM   5643  O OE2 . GLU C 1 18  ? 27.701  5.768   59.638  1.00 32.02 ? 17   GLU C OE2 1 
ATOM   5644  N N   . ILE C 1 19  ? 24.934  8.701   55.505  1.00 13.75 ? 18   ILE C N   1 
ATOM   5645  C CA  . ILE C 1 19  ? 25.697  9.836   54.944  1.00 12.49 ? 18   ILE C CA  1 
ATOM   5646  C C   . ILE C 1 19  ? 24.922  11.133  55.006  1.00 11.51 ? 18   ILE C C   1 
ATOM   5647  O O   . ILE C 1 19  ? 25.444  12.185  55.416  1.00 10.74 ? 18   ILE C O   1 
ATOM   5648  C CB  . ILE C 1 19  ? 26.193  9.505   53.484  1.00 12.11 ? 18   ILE C CB  1 
ATOM   5649  C CG1 . ILE C 1 19  ? 27.125  8.276   53.504  1.00 13.51 ? 18   ILE C CG1 1 
ATOM   5650  C CG2 . ILE C 1 19  ? 26.819  10.729  52.777  1.00 12.11 ? 18   ILE C CG2 1 
ATOM   5651  C CD1 . ILE C 1 19  ? 27.249  7.578   52.110  1.00 12.24 ? 18   ILE C CD1 1 
ATOM   5652  N N   . ALA C 1 20  ? 23.663  11.076  54.568  1.00 11.65 ? 19   ALA C N   1 
ATOM   5653  C CA  . ALA C 1 20  ? 22.791  12.260  54.548  1.00 11.70 ? 19   ALA C CA  1 
ATOM   5654  C C   . ALA C 1 20  ? 22.589  12.829  55.951  1.00 11.29 ? 19   ALA C C   1 
ATOM   5655  O O   . ALA C 1 20  ? 22.628  14.062  56.144  1.00 10.71 ? 19   ALA C O   1 
ATOM   5656  C CB  . ALA C 1 20  ? 21.458  11.923  53.880  1.00 10.98 ? 19   ALA C CB  1 
ATOM   5657  N N   . GLN C 1 21  ? 22.361  11.932  56.880  1.00 12.76 ? 20   GLN C N   1 
ATOM   5658  C CA  . GLN C 1 21  ? 22.190  12.270  58.310  1.00 14.20 ? 20   GLN C CA  1 
ATOM   5659  C C   . GLN C 1 21  ? 23.440  12.987  58.816  1.00 14.10 ? 20   GLN C C   1 
ATOM   5660  O O   . GLN C 1 21  ? 23.319  14.022  59.490  1.00 14.42 ? 20   GLN C O   1 
ATOM   5661  C CB  . GLN C 1 21  ? 21.875  11.027  59.138  1.00 17.11 ? 20   GLN C CB  1 
ATOM   5662  C CG  . GLN C 1 21  ? 20.509  10.446  58.770  1.00 20.92 ? 20   GLN C CG  1 
ATOM   5663  C CD  . GLN C 1 21  ? 20.169  9.218   59.569  1.00 22.16 ? 20   GLN C CD  1 
ATOM   5664  O OE1 . GLN C 1 21  ? 21.020  8.564   60.178  1.00 24.44 ? 20   GLN C OE1 1 
ATOM   5665  N NE2 . GLN C 1 21  ? 18.875  8.895   59.588  1.00 23.59 ? 20   GLN C NE2 1 
ATOM   5666  N N   . LYS C 1 22  ? 24.604  12.467  58.465  1.00 14.50 ? 21   LYS C N   1 
ATOM   5667  C CA  . LYS C 1 22  ? 25.891  13.053  58.882  1.00 14.80 ? 21   LYS C CA  1 
ATOM   5668  C C   . LYS C 1 22  ? 26.058  14.475  58.393  1.00 14.67 ? 21   LYS C C   1 
ATOM   5669  O O   . LYS C 1 22  ? 26.538  15.369  59.118  1.00 14.80 ? 21   LYS C O   1 
ATOM   5670  C CB  . LYS C 1 22  ? 27.083  12.229  58.423  1.00 17.26 ? 21   LYS C CB  1 
ATOM   5671  C CG  . LYS C 1 22  ? 27.583  11.211  59.444  1.00 20.60 ? 21   LYS C CG  1 
ATOM   5672  C CD  . LYS C 1 22  ? 28.658  10.324  58.819  1.00 22.99 ? 21   LYS C CD  1 
ATOM   5673  C CE  . LYS C 1 22  ? 29.059  9.201   59.770  1.00 25.80 ? 21   LYS C CE  1 
ATOM   5674  N NZ  . LYS C 1 22  ? 29.809  8.149   59.027  1.00 29.07 ? 21   LYS C NZ  1 
ATOM   5675  N N   . ILE C 1 23  ? 25.673  14.706  57.136  1.00 13.84 ? 22   ILE C N   1 
ATOM   5676  C CA  . ILE C 1 23  ? 25.825  16.020  56.511  1.00 13.19 ? 22   ILE C CA  1 
ATOM   5677  C C   . ILE C 1 23  ? 24.992  17.083  57.200  1.00 13.18 ? 22   ILE C C   1 
ATOM   5678  O O   . ILE C 1 23  ? 25.440  18.250  57.291  1.00 13.71 ? 22   ILE C O   1 
ATOM   5679  C CB  . ILE C 1 23  ? 25.503  15.928  54.957  1.00 12.97 ? 22   ILE C CB  1 
ATOM   5680  C CG1 . ILE C 1 23  ? 26.465  14.965  54.263  1.00 12.87 ? 22   ILE C CG1 1 
ATOM   5681  C CG2 . ILE C 1 23  ? 25.458  17.326  54.298  1.00 13.97 ? 22   ILE C CG2 1 
ATOM   5682  C CD1 . ILE C 1 23  ? 26.103  14.531  52.819  1.00 13.74 ? 22   ILE C CD1 1 
ATOM   5683  N N   . VAL C 1 24  ? 23.802  16.714  57.673  1.00 13.05 ? 23   VAL C N   1 
ATOM   5684  C CA  . VAL C 1 24  ? 22.899  17.677  58.305  1.00 13.41 ? 23   VAL C CA  1 
ATOM   5685  C C   . VAL C 1 24  ? 22.868  17.579  59.831  1.00 14.49 ? 23   VAL C C   1 
ATOM   5686  O O   . VAL C 1 24  ? 21.871  17.982  60.465  1.00 14.63 ? 23   VAL C O   1 
ATOM   5687  C CB  . VAL C 1 24  ? 21.493  17.649  57.671  1.00 11.89 ? 23   VAL C CB  1 
ATOM   5688  C CG1 . VAL C 1 24  ? 21.534  18.030  56.192  1.00 10.42 ? 23   VAL C CG1 1 
ATOM   5689  C CG2 . VAL C 1 24  ? 20.777  16.333  57.881  1.00 9.82  ? 23   VAL C CG2 1 
ATOM   5690  N N   . ALA C 1 25  ? 23.937  17.062  60.396  1.00 15.12 ? 24   ALA C N   1 
ATOM   5691  C CA  . ALA C 1 25  ? 24.107  17.041  61.868  1.00 15.82 ? 24   ALA C CA  1 
ATOM   5692  C C   . ALA C 1 25  ? 23.885  18.440  62.430  1.00 16.00 ? 24   ALA C C   1 
ATOM   5693  O O   . ALA C 1 25  ? 24.263  19.485  61.867  1.00 16.17 ? 24   ALA C O   1 
ATOM   5694  C CB  . ALA C 1 25  ? 25.510  16.510  62.166  1.00 15.93 ? 24   ALA C CB  1 
ATOM   5695  N N   . PRO C 1 26  ? 23.242  18.475  63.590  1.00 16.76 ? 25   PRO C N   1 
ATOM   5696  C CA  . PRO C 1 26  ? 22.937  19.739  64.276  1.00 16.41 ? 25   PRO C CA  1 
ATOM   5697  C C   . PRO C 1 26  ? 24.128  20.677  64.309  1.00 15.91 ? 25   PRO C C   1 
ATOM   5698  O O   . PRO C 1 26  ? 25.253  20.284  64.666  1.00 16.55 ? 25   PRO C O   1 
ATOM   5699  C CB  . PRO C 1 26  ? 22.461  19.312  65.655  1.00 16.63 ? 25   PRO C CB  1 
ATOM   5700  C CG  . PRO C 1 26  ? 22.013  17.885  65.482  1.00 16.59 ? 25   PRO C CG  1 
ATOM   5701  C CD  . PRO C 1 26  ? 22.979  17.302  64.460  1.00 16.47 ? 25   PRO C CD  1 
ATOM   5702  N N   . GLY C 1 27  ? 23.885  21.906  63.944  1.00 15.75 ? 26   GLY C N   1 
ATOM   5703  C CA  . GLY C 1 27  ? 24.812  23.013  63.888  1.00 16.39 ? 26   GLY C CA  1 
ATOM   5704  C C   . GLY C 1 27  ? 25.777  22.986  62.714  1.00 16.58 ? 26   GLY C C   1 
ATOM   5705  O O   . GLY C 1 27  ? 26.684  23.850  62.652  1.00 16.80 ? 26   GLY C O   1 
ATOM   5706  N N   . LYS C 1 28  ? 25.589  22.048  61.798  1.00 16.36 ? 27   LYS C N   1 
ATOM   5707  C CA  . LYS C 1 28  ? 26.513  21.874  60.660  1.00 16.39 ? 27   LYS C CA  1 
ATOM   5708  C C   . LYS C 1 28  ? 25.826  22.138  59.326  1.00 16.91 ? 27   LYS C C   1 
ATOM   5709  O O   . LYS C 1 28  ? 24.603  21.978  59.201  1.00 16.12 ? 27   LYS C O   1 
ATOM   5710  C CB  . LYS C 1 28  ? 27.096  20.464  60.678  1.00 16.77 ? 27   LYS C CB  1 
ATOM   5711  C CG  . LYS C 1 28  ? 27.965  20.208  61.928  1.00 17.54 ? 27   LYS C CG  1 
ATOM   5712  C CD  . LYS C 1 28  ? 28.815  18.968  61.743  1.00 18.73 ? 27   LYS C CD  1 
ATOM   5713  C CE  . LYS C 1 28  ? 29.440  18.489  63.034  1.00 19.40 ? 27   LYS C CE  1 
ATOM   5714  N NZ  . LYS C 1 28  ? 30.465  17.451  62.750  1.00 22.76 ? 27   LYS C NZ  1 
ATOM   5715  N N   . GLY C 1 29  ? 26.638  22.555  58.361  1.00 16.68 ? 28   GLY C N   1 
ATOM   5716  C CA  . GLY C 1 29  ? 26.187  22.877  57.000  1.00 16.75 ? 28   GLY C CA  1 
ATOM   5717  C C   . GLY C 1 29  ? 27.315  22.559  56.011  1.00 16.80 ? 28   GLY C C   1 
ATOM   5718  O O   . GLY C 1 29  ? 28.354  21.986  56.387  1.00 17.54 ? 28   GLY C O   1 
ATOM   5719  N N   . ILE C 1 30  ? 27.100  22.965  54.775  1.00 16.73 ? 29   ILE C N   1 
ATOM   5720  C CA  . ILE C 1 30  ? 28.027  22.652  53.678  1.00 15.90 ? 29   ILE C CA  1 
ATOM   5721  C C   . ILE C 1 30  ? 28.708  23.916  53.166  1.00 15.67 ? 29   ILE C C   1 
ATOM   5722  O O   . ILE C 1 30  ? 28.089  24.978  53.076  1.00 14.84 ? 29   ILE C O   1 
ATOM   5723  C CB  . ILE C 1 30  ? 27.263  21.943  52.493  1.00 16.96 ? 29   ILE C CB  1 
ATOM   5724  C CG1 . ILE C 1 30  ? 26.641  20.614  52.963  1.00 16.44 ? 29   ILE C CG1 1 
ATOM   5725  C CG2 . ILE C 1 30  ? 28.159  21.739  51.235  1.00 16.21 ? 29   ILE C CG2 1 
ATOM   5726  C CD1 . ILE C 1 30  ? 25.687  19.982  51.902  1.00 17.73 ? 29   ILE C CD1 1 
ATOM   5727  N N   . LEU C 1 31  ? 29.986  23.715  52.847  1.00 16.48 ? 30   LEU C N   1 
ATOM   5728  C CA  . LEU C 1 31  ? 30.802  24.718  52.164  1.00 17.33 ? 30   LEU C CA  1 
ATOM   5729  C C   . LEU C 1 31  ? 30.854  24.322  50.679  1.00 17.42 ? 30   LEU C C   1 
ATOM   5730  O O   . LEU C 1 31  ? 31.413  23.256  50.381  1.00 17.82 ? 30   LEU C O   1 
ATOM   5731  C CB  . LEU C 1 31  ? 32.208  24.770  52.798  1.00 17.90 ? 30   LEU C CB  1 
ATOM   5732  C CG  . LEU C 1 31  ? 33.215  25.652  52.062  1.00 18.21 ? 30   LEU C CG  1 
ATOM   5733  C CD1 . LEU C 1 31  ? 32.769  27.107  52.048  1.00 17.98 ? 30   LEU C CD1 1 
ATOM   5734  C CD2 . LEU C 1 31  ? 34.574  25.545  52.756  1.00 19.99 ? 30   LEU C CD2 1 
ATOM   5735  N N   . ALA C 1 32  ? 30.250  25.149  49.847  1.00 18.23 ? 31   ALA C N   1 
ATOM   5736  C CA  . ALA C 1 32  ? 30.252  24.898  48.389  1.00 19.19 ? 31   ALA C CA  1 
ATOM   5737  C C   . ALA C 1 32  ? 31.479  25.597  47.805  1.00 19.46 ? 31   ALA C C   1 
ATOM   5738  O O   . ALA C 1 32  ? 31.517  26.826  47.729  1.00 20.46 ? 31   ALA C O   1 
ATOM   5739  C CB  . ALA C 1 32  ? 28.951  25.371  47.763  1.00 18.26 ? 31   ALA C CB  1 
ATOM   5740  N N   . ALA C 1 33  ? 32.451  24.791  47.430  1.00 20.75 ? 32   ALA C N   1 
ATOM   5741  C CA  . ALA C 1 33  ? 33.729  25.325  46.895  1.00 21.65 ? 32   ALA C CA  1 
ATOM   5742  C C   . ALA C 1 33  ? 33.979  24.729  45.512  1.00 22.43 ? 32   ALA C C   1 
ATOM   5743  O O   . ALA C 1 33  ? 35.131  24.481  45.138  1.00 22.44 ? 32   ALA C O   1 
ATOM   5744  C CB  . ALA C 1 33  ? 34.844  24.965  47.868  1.00 21.78 ? 32   ALA C CB  1 
ATOM   5745  N N   . ASP C 1 34  ? 32.881  24.533  44.797  1.00 23.01 ? 33   ASP C N   1 
ATOM   5746  C CA  . ASP C 1 34  ? 32.894  23.815  43.513  1.00 23.88 ? 33   ASP C CA  1 
ATOM   5747  C C   . ASP C 1 34  ? 32.978  24.752  42.318  1.00 24.51 ? 33   ASP C C   1 
ATOM   5748  O O   . ASP C 1 34  ? 32.624  24.326  41.194  1.00 24.73 ? 33   ASP C O   1 
ATOM   5749  C CB  . ASP C 1 34  ? 31.711  22.836  43.465  1.00 24.06 ? 33   ASP C CB  1 
ATOM   5750  C CG  . ASP C 1 34  ? 30.350  23.506  43.493  1.00 24.91 ? 33   ASP C CG  1 
ATOM   5751  O OD1 . ASP C 1 34  ? 30.125  24.486  44.208  1.00 23.76 ? 33   ASP C OD1 1 
ATOM   5752  O OD2 . ASP C 1 34  ? 29.465  23.013  42.743  1.00 25.82 ? 33   ASP C OD2 1 
ATOM   5753  N N   . GLU C 1 35  ? 33.441  25.965  42.527  1.00 24.89 ? 34   GLU C N   1 
ATOM   5754  C CA  . GLU C 1 35  ? 33.555  26.934  41.416  1.00 26.23 ? 34   GLU C CA  1 
ATOM   5755  C C   . GLU C 1 35  ? 34.490  26.374  40.347  1.00 26.86 ? 34   GLU C C   1 
ATOM   5756  O O   . GLU C 1 35  ? 35.548  25.805  40.643  1.00 26.23 ? 34   GLU C O   1 
ATOM   5757  C CB  . GLU C 1 35  ? 34.069  28.291  41.847  1.00 26.56 ? 34   GLU C CB  1 
ATOM   5758  C CG  . GLU C 1 35  ? 33.243  29.086  42.854  1.00 27.33 ? 34   GLU C CG  1 
ATOM   5759  C CD  . GLU C 1 35  ? 33.548  28.884  44.305  1.00 27.08 ? 34   GLU C CD  1 
ATOM   5760  O OE1 . GLU C 1 35  ? 34.277  27.899  44.539  1.00 26.11 ? 34   GLU C OE1 1 
ATOM   5761  O OE2 . GLU C 1 35  ? 33.125  29.635  45.173  1.00 27.77 ? 34   GLU C OE2 1 
ATOM   5762  N N   . SER C 1 36  ? 34.048  26.520  39.102  1.00 27.98 ? 35   SER C N   1 
ATOM   5763  C CA  . SER C 1 36  ? 34.865  26.059  37.958  1.00 29.01 ? 35   SER C CA  1 
ATOM   5764  C C   . SER C 1 36  ? 35.951  27.107  37.707  1.00 29.67 ? 35   SER C C   1 
ATOM   5765  O O   . SER C 1 36  ? 35.881  28.239  38.212  1.00 29.34 ? 35   SER C O   1 
ATOM   5766  C CB  . SER C 1 36  ? 34.020  25.840  36.713  1.00 29.54 ? 35   SER C CB  1 
ATOM   5767  O OG  . SER C 1 36  ? 33.594  27.093  36.187  1.00 30.27 ? 35   SER C OG  1 
ATOM   5768  N N   . GLY C 1 37  ? 36.923  26.677  36.928  1.00 30.63 ? 36   GLY C N   1 
ATOM   5769  C CA  . GLY C 1 37  ? 38.076  27.495  36.534  1.00 31.53 ? 36   GLY C CA  1 
ATOM   5770  C C   . GLY C 1 37  ? 37.673  28.920  36.194  1.00 32.12 ? 36   GLY C C   1 
ATOM   5771  O O   . GLY C 1 37  ? 38.220  29.878  36.769  1.00 32.17 ? 36   GLY C O   1 
ATOM   5772  N N   . PRO C 1 38  ? 36.733  29.037  35.270  1.00 32.97 ? 37   PRO C N   1 
ATOM   5773  C CA  . PRO C 1 38  ? 36.262  30.343  34.798  1.00 33.85 ? 37   PRO C CA  1 
ATOM   5774  C C   . PRO C 1 38  ? 35.608  31.155  35.893  1.00 34.74 ? 37   PRO C C   1 
ATOM   5775  O O   . PRO C 1 38  ? 35.915  32.354  36.055  1.00 34.97 ? 37   PRO C O   1 
ATOM   5776  C CB  . PRO C 1 38  ? 35.326  30.016  33.629  1.00 33.64 ? 37   PRO C CB  1 
ATOM   5777  C CG  . PRO C 1 38  ? 35.866  28.697  33.118  1.00 33.23 ? 37   PRO C CG  1 
ATOM   5778  C CD  . PRO C 1 38  ? 36.229  27.950  34.402  1.00 32.89 ? 37   PRO C CD  1 
ATOM   5779  N N   . THR C 1 39  ? 34.720  30.503  36.631  1.00 35.92 ? 38   THR C N   1 
ATOM   5780  C CA  . THR C 1 39  ? 33.986  31.162  37.722  1.00 37.20 ? 38   THR C CA  1 
ATOM   5781  C C   . THR C 1 39  ? 34.955  31.665  38.791  1.00 37.95 ? 38   THR C C   1 
ATOM   5782  O O   . THR C 1 39  ? 34.868  32.830  39.207  1.00 37.97 ? 38   THR C O   1 
ATOM   5783  C CB  . THR C 1 39  ? 32.868  30.252  38.354  1.00 37.50 ? 38   THR C CB  1 
ATOM   5784  O OG1 . THR C 1 39  ? 31.878  30.024  37.298  1.00 39.19 ? 38   THR C OG1 1 
ATOM   5785  C CG2 . THR C 1 39  ? 32.221  30.875  39.597  1.00 37.95 ? 38   THR C CG2 1 
ATOM   5786  N N   . MET C 1 40  ? 35.837  30.767  39.199  1.00 38.86 ? 39   MET C N   1 
ATOM   5787  C CA  . MET C 1 40  ? 36.845  31.086  40.222  1.00 40.20 ? 39   MET C CA  1 
ATOM   5788  C C   . MET C 1 40  ? 37.660  32.298  39.777  1.00 41.15 ? 39   MET C C   1 
ATOM   5789  O O   . MET C 1 40  ? 38.080  33.131  40.597  1.00 41.06 ? 39   MET C O   1 
ATOM   5790  C CB  . MET C 1 40  ? 37.708  29.877  40.540  1.00 40.25 ? 39   MET C CB  1 
ATOM   5791  C CG  . MET C 1 40  ? 38.603  30.159  41.728  1.00 41.40 ? 39   MET C CG  1 
ATOM   5792  S SD  . MET C 1 40  ? 37.541  30.135  43.221  1.00 42.40 ? 39   MET C SD  1 
ATOM   5793  C CE  . MET C 1 40  ? 38.191  31.575  44.088  1.00 42.08 ? 39   MET C CE  1 
ATOM   5794  N N   . GLY C 1 41  ? 37.859  32.375  38.472  1.00 42.29 ? 40   GLY C N   1 
ATOM   5795  C CA  . GLY C 1 41  ? 38.629  33.423  37.806  1.00 43.43 ? 40   GLY C CA  1 
ATOM   5796  C C   . GLY C 1 41  ? 38.041  34.805  38.062  1.00 44.40 ? 40   GLY C C   1 
ATOM   5797  O O   . GLY C 1 41  ? 38.782  35.784  38.270  1.00 44.34 ? 40   GLY C O   1 
ATOM   5798  N N   . LYS C 1 42  ? 36.721  34.866  38.034  1.00 45.41 ? 41   LYS C N   1 
ATOM   5799  C CA  . LYS C 1 42  ? 35.997  36.118  38.271  1.00 46.73 ? 41   LYS C CA  1 
ATOM   5800  C C   . LYS C 1 42  ? 36.205  36.597  39.706  1.00 47.29 ? 41   LYS C C   1 
ATOM   5801  O O   . LYS C 1 42  ? 36.424  37.798  39.944  1.00 47.34 ? 41   LYS C O   1 
ATOM   5802  C CB  . LYS C 1 42  ? 34.506  36.004  37.965  1.00 48.03 ? 41   LYS C CB  1 
ATOM   5803  C CG  . LYS C 1 42  ? 34.201  35.951  36.469  1.00 49.51 ? 41   LYS C CG  1 
ATOM   5804  C CD  . LYS C 1 42  ? 32.782  36.395  36.159  1.00 50.92 ? 41   LYS C CD  1 
ATOM   5805  C CE  . LYS C 1 42  ? 32.555  36.580  34.667  1.00 51.37 ? 41   LYS C CE  1 
ATOM   5806  N NZ  . LYS C 1 42  ? 31.239  37.215  34.415  1.00 52.35 ? 41   LYS C NZ  1 
ATOM   5807  N N   . ARG C 1 43  ? 36.138  35.652  40.629  1.00 47.91 ? 42   ARG C N   1 
ATOM   5808  C CA  . ARG C 1 43  ? 36.305  35.937  42.055  1.00 48.81 ? 42   ARG C CA  1 
ATOM   5809  C C   . ARG C 1 43  ? 37.708  36.478  42.340  1.00 49.32 ? 42   ARG C C   1 
ATOM   5810  O O   . ARG C 1 43  ? 37.875  37.423  43.125  1.00 49.09 ? 42   ARG C O   1 
ATOM   5811  C CB  . ARG C 1 43  ? 36.020  34.722  42.943  1.00 49.14 ? 42   ARG C CB  1 
ATOM   5812  C CG  . ARG C 1 43  ? 34.629  34.125  42.819  1.00 49.57 ? 42   ARG C CG  1 
ATOM   5813  C CD  . ARG C 1 43  ? 33.574  35.187  42.875  1.00 50.18 ? 42   ARG C CD  1 
ATOM   5814  N NE  . ARG C 1 43  ? 32.706  35.097  41.714  1.00 51.35 ? 42   ARG C NE  1 
ATOM   5815  C CZ  . ARG C 1 43  ? 31.648  34.298  41.615  1.00 51.86 ? 42   ARG C CZ  1 
ATOM   5816  N NH1 . ARG C 1 43  ? 31.243  33.527  42.618  1.00 52.11 ? 42   ARG C NH1 1 
ATOM   5817  N NH2 . ARG C 1 43  ? 31.000  34.241  40.448  1.00 52.28 ? 42   ARG C NH2 1 
ATOM   5818  N N   . LEU C 1 44  ? 38.680  35.861  41.693  1.00 50.08 ? 43   LEU C N   1 
ATOM   5819  C CA  . LEU C 1 44  ? 40.095  36.215  41.882  1.00 51.21 ? 43   LEU C CA  1 
ATOM   5820  C C   . LEU C 1 44  ? 40.395  37.576  41.263  1.00 52.15 ? 43   LEU C C   1 
ATOM   5821  O O   . LEU C 1 44  ? 41.104  38.402  41.854  1.00 52.17 ? 43   LEU C O   1 
ATOM   5822  C CB  . LEU C 1 44  ? 40.944  35.055  41.361  1.00 50.72 ? 43   LEU C CB  1 
ATOM   5823  C CG  . LEU C 1 44  ? 40.749  33.712  42.046  1.00 50.26 ? 43   LEU C CG  1 
ATOM   5824  C CD1 . LEU C 1 44  ? 41.722  32.673  41.506  1.00 50.06 ? 43   LEU C CD1 1 
ATOM   5825  C CD2 . LEU C 1 44  ? 40.950  33.902  43.548  1.00 50.18 ? 43   LEU C CD2 1 
ATOM   5826  N N   . GLN C 1 45  ? 39.840  37.771  40.083  1.00 53.21 ? 44   GLN C N   1 
ATOM   5827  C CA  . GLN C 1 45  ? 40.032  39.006  39.304  1.00 54.44 ? 44   GLN C CA  1 
ATOM   5828  C C   . GLN C 1 45  ? 39.638  40.221  40.145  1.00 54.79 ? 44   GLN C C   1 
ATOM   5829  O O   . GLN C 1 45  ? 40.354  41.236  40.166  1.00 54.84 ? 44   GLN C O   1 
ATOM   5830  C CB  . GLN C 1 45  ? 39.261  38.965  37.986  1.00 55.76 ? 44   GLN C CB  1 
ATOM   5831  C CG  . GLN C 1 45  ? 39.694  39.962  36.937  1.00 57.66 ? 44   GLN C CG  1 
ATOM   5832  C CD  . GLN C 1 45  ? 38.931  39.832  35.636  1.00 58.64 ? 44   GLN C CD  1 
ATOM   5833  O OE1 . GLN C 1 45  ? 38.138  38.916  35.424  1.00 59.07 ? 44   GLN C OE1 1 
ATOM   5834  N NE2 . GLN C 1 45  ? 39.180  40.777  34.729  1.00 59.08 ? 44   GLN C NE2 1 
ATOM   5835  N N   . ASP C 1 46  ? 38.521  40.069  40.840  1.00 55.33 ? 45   ASP C N   1 
ATOM   5836  C CA  . ASP C 1 46  ? 37.951  41.181  41.623  1.00 55.68 ? 45   ASP C CA  1 
ATOM   5837  C C   . ASP C 1 46  ? 38.797  41.464  42.854  1.00 55.83 ? 45   ASP C C   1 
ATOM   5838  O O   . ASP C 1 46  ? 38.687  42.569  43.430  1.00 55.93 ? 45   ASP C O   1 
ATOM   5839  C CB  . ASP C 1 46  ? 36.458  41.027  41.826  1.00 56.93 ? 45   ASP C CB  1 
ATOM   5840  C CG  . ASP C 1 46  ? 36.000  40.088  42.909  1.00 57.98 ? 45   ASP C CG  1 
ATOM   5841  O OD1 . ASP C 1 46  ? 36.479  40.270  44.054  1.00 58.76 ? 45   ASP C OD1 1 
ATOM   5842  O OD2 . ASP C 1 46  ? 35.166  39.193  42.673  1.00 58.49 ? 45   ASP C OD2 1 
ATOM   5843  N N   . ILE C 1 47  ? 39.615  40.499  43.248  1.00 55.76 ? 46   ILE C N   1 
ATOM   5844  C CA  . ILE C 1 47  ? 40.534  40.715  44.381  1.00 55.96 ? 46   ILE C CA  1 
ATOM   5845  C C   . ILE C 1 47  ? 41.916  41.066  43.817  1.00 56.08 ? 46   ILE C C   1 
ATOM   5846  O O   . ILE C 1 47  ? 42.888  41.271  44.555  1.00 56.26 ? 46   ILE C O   1 
ATOM   5847  C CB  . ILE C 1 47  ? 40.555  39.554  45.409  1.00 55.68 ? 46   ILE C CB  1 
ATOM   5848  C CG1 . ILE C 1 47  ? 41.415  38.368  44.902  1.00 55.21 ? 46   ILE C CG1 1 
ATOM   5849  C CG2 . ILE C 1 47  ? 39.138  39.073  45.833  1.00 55.94 ? 46   ILE C CG2 1 
ATOM   5850  C CD1 . ILE C 1 47  ? 41.727  37.312  46.006  1.00 54.63 ? 46   ILE C CD1 1 
ATOM   5851  N N   . GLY C 1 48  ? 41.941  41.118  42.493  1.00 55.91 ? 47   GLY C N   1 
ATOM   5852  C CA  . GLY C 1 48  ? 43.125  41.478  41.722  1.00 55.63 ? 47   GLY C CA  1 
ATOM   5853  C C   . GLY C 1 48  ? 44.137  40.347  41.637  1.00 55.54 ? 47   GLY C C   1 
ATOM   5854  O O   . GLY C 1 48  ? 45.347  40.618  41.514  1.00 55.71 ? 47   GLY C O   1 
ATOM   5855  N N   . VAL C 1 49  ? 43.651  39.123  41.694  1.00 55.23 ? 48   VAL C N   1 
ATOM   5856  C CA  . VAL C 1 49  ? 44.520  37.936  41.562  1.00 54.92 ? 48   VAL C CA  1 
ATOM   5857  C C   . VAL C 1 49  ? 44.270  37.277  40.206  1.00 54.77 ? 48   VAL C C   1 
ATOM   5858  O O   . VAL C 1 49  ? 43.131  37.262  39.707  1.00 54.79 ? 48   VAL C O   1 
ATOM   5859  C CB  . VAL C 1 49  ? 44.354  37.012  42.775  1.00 54.80 ? 48   VAL C CB  1 
ATOM   5860  C CG1 . VAL C 1 49  ? 45.276  35.798  42.729  1.00 54.25 ? 48   VAL C CG1 1 
ATOM   5861  C CG2 . VAL C 1 49  ? 44.535  37.770  44.083  1.00 54.53 ? 48   VAL C CG2 1 
ATOM   5862  N N   . GLU C 1 50  ? 45.345  36.750  39.638  1.00 54.49 ? 49   GLU C N   1 
ATOM   5863  C CA  . GLU C 1 50  ? 45.326  36.132  38.311  1.00 54.15 ? 49   GLU C CA  1 
ATOM   5864  C C   . GLU C 1 50  ? 44.868  34.680  38.386  1.00 53.60 ? 49   GLU C C   1 
ATOM   5865  O O   . GLU C 1 50  ? 45.316  33.921  39.255  1.00 53.63 ? 49   GLU C O   1 
ATOM   5866  C CB  . GLU C 1 50  ? 46.687  36.166  37.625  1.00 55.21 ? 49   GLU C CB  1 
ATOM   5867  C CG  . GLU C 1 50  ? 46.763  35.666  36.181  1.00 56.40 ? 49   GLU C CG  1 
ATOM   5868  C CD  . GLU C 1 50  ? 48.125  35.680  35.553  1.00 56.98 ? 49   GLU C CD  1 
ATOM   5869  O OE1 . GLU C 1 50  ? 49.129  36.083  36.118  1.00 57.30 ? 49   GLU C OE1 1 
ATOM   5870  O OE2 . GLU C 1 50  ? 48.111  35.229  34.386  1.00 57.20 ? 49   GLU C OE2 1 
ATOM   5871  N N   . ASN C 1 51  ? 44.006  34.337  37.444  1.00 52.98 ? 50   ASN C N   1 
ATOM   5872  C CA  . ASN C 1 51  ? 43.365  33.020  37.395  1.00 52.28 ? 50   ASN C CA  1 
ATOM   5873  C C   . ASN C 1 51  ? 44.291  31.968  36.791  1.00 51.69 ? 50   ASN C C   1 
ATOM   5874  O O   . ASN C 1 51  ? 44.174  31.631  35.604  1.00 51.84 ? 50   ASN C O   1 
ATOM   5875  C CB  . ASN C 1 51  ? 42.000  33.069  36.699  1.00 52.07 ? 50   ASN C CB  1 
ATOM   5876  C CG  . ASN C 1 51  ? 41.305  31.718  36.736  1.00 52.17 ? 50   ASN C CG  1 
ATOM   5877  O OD1 . ASN C 1 51  ? 41.583  30.892  37.618  1.00 51.94 ? 50   ASN C OD1 1 
ATOM   5878  N ND2 . ASN C 1 51  ? 40.403  31.482  35.790  1.00 52.45 ? 50   ASN C ND2 1 
ATOM   5879  N N   . THR C 1 52  ? 45.167  31.475  37.638  1.00 51.03 ? 51   THR C N   1 
ATOM   5880  C CA  . THR C 1 52  ? 46.082  30.381  37.255  1.00 50.22 ? 51   THR C CA  1 
ATOM   5881  C C   . THR C 1 52  ? 45.761  29.162  38.111  1.00 49.29 ? 51   THR C C   1 
ATOM   5882  O O   . THR C 1 52  ? 45.291  29.319  39.254  1.00 49.22 ? 51   THR C O   1 
ATOM   5883  C CB  . THR C 1 52  ? 47.583  30.826  37.353  1.00 50.64 ? 51   THR C CB  1 
ATOM   5884  O OG1 . THR C 1 52  ? 48.368  29.770  36.707  1.00 51.41 ? 51   THR C OG1 1 
ATOM   5885  C CG2 . THR C 1 52  ? 48.055  31.104  38.784  1.00 51.19 ? 51   THR C CG2 1 
ATOM   5886  N N   . GLU C 1 53  ? 46.004  27.989  37.548  1.00 48.34 ? 52   GLU C N   1 
ATOM   5887  C CA  . GLU C 1 53  ? 45.714  26.729  38.227  1.00 47.46 ? 52   GLU C CA  1 
ATOM   5888  C C   . GLU C 1 53  ? 46.303  26.715  39.632  1.00 46.71 ? 52   GLU C C   1 
ATOM   5889  O O   . GLU C 1 53  ? 45.658  26.201  40.562  1.00 46.50 ? 52   GLU C O   1 
ATOM   5890  C CB  . GLU C 1 53  ? 46.208  25.482  37.507  1.00 48.20 ? 52   GLU C CB  1 
ATOM   5891  C CG  . GLU C 1 53  ? 45.895  24.149  38.194  1.00 49.63 ? 52   GLU C CG  1 
ATOM   5892  C CD  . GLU C 1 53  ? 46.145  22.906  37.408  1.00 50.04 ? 52   GLU C CD  1 
ATOM   5893  O OE1 . GLU C 1 53  ? 46.979  22.798  36.527  1.00 50.57 ? 52   GLU C OE1 1 
ATOM   5894  O OE2 . GLU C 1 53  ? 45.395  21.965  37.756  1.00 50.93 ? 52   GLU C OE2 1 
ATOM   5895  N N   . ASP C 1 54  ? 47.493  27.284  39.750  1.00 45.87 ? 53   ASP C N   1 
ATOM   5896  C CA  . ASP C 1 54  ? 48.187  27.333  41.048  1.00 44.75 ? 53   ASP C CA  1 
ATOM   5897  C C   . ASP C 1 54  ? 47.534  28.375  41.957  1.00 43.59 ? 53   ASP C C   1 
ATOM   5898  O O   . ASP C 1 54  ? 47.491  28.166  43.180  1.00 43.53 ? 53   ASP C O   1 
ATOM   5899  C CB  . ASP C 1 54  ? 49.701  27.489  40.930  1.00 45.86 ? 53   ASP C CB  1 
ATOM   5900  C CG  . ASP C 1 54  ? 50.381  27.111  42.250  1.00 46.65 ? 53   ASP C CG  1 
ATOM   5901  O OD1 . ASP C 1 54  ? 50.659  25.899  42.402  1.00 46.85 ? 53   ASP C OD1 1 
ATOM   5902  O OD2 . ASP C 1 54  ? 50.597  27.968  43.116  1.00 46.47 ? 53   ASP C OD2 1 
ATOM   5903  N N   . ASN C 1 55  ? 47.068  29.454  41.353  1.00 42.38 ? 54   ASN C N   1 
ATOM   5904  C CA  . ASN C 1 55  ? 46.367  30.482  42.151  1.00 41.22 ? 54   ASN C CA  1 
ATOM   5905  C C   . ASN C 1 55  ? 45.125  29.843  42.784  1.00 40.16 ? 54   ASN C C   1 
ATOM   5906  O O   . ASN C 1 55  ? 44.868  30.027  43.986  1.00 40.01 ? 54   ASN C O   1 
ATOM   5907  C CB  . ASN C 1 55  ? 46.104  31.749  41.354  1.00 41.75 ? 54   ASN C CB  1 
ATOM   5908  C CG  . ASN C 1 55  ? 47.277  32.719  41.410  1.00 42.73 ? 54   ASN C CG  1 
ATOM   5909  O OD1 . ASN C 1 55  ? 48.396  32.306  41.756  1.00 43.22 ? 54   ASN C OD1 1 
ATOM   5910  N ND2 . ASN C 1 55  ? 47.034  33.979  41.083  1.00 42.67 ? 54   ASN C ND2 1 
ATOM   5911  N N   . ARG C 1 56  ? 44.402  29.100  41.970  1.00 38.92 ? 55   ARG C N   1 
ATOM   5912  C CA  . ARG C 1 56  ? 43.180  28.415  42.448  1.00 37.72 ? 55   ARG C CA  1 
ATOM   5913  C C   . ARG C 1 56  ? 43.548  27.437  43.555  1.00 36.81 ? 55   ARG C C   1 
ATOM   5914  O O   . ARG C 1 56  ? 42.923  27.398  44.632  1.00 36.46 ? 55   ARG C O   1 
ATOM   5915  C CB  . ARG C 1 56  ? 42.443  27.743  41.291  1.00 36.87 ? 55   ARG C CB  1 
ATOM   5916  C CG  . ARG C 1 56  ? 42.104  28.711  40.157  1.00 36.84 ? 55   ARG C CG  1 
ATOM   5917  C CD  . ARG C 1 56  ? 41.020  28.194  39.283  1.00 36.85 ? 55   ARG C CD  1 
ATOM   5918  N NE  . ARG C 1 56  ? 41.431  27.003  38.546  1.00 36.84 ? 55   ARG C NE  1 
ATOM   5919  C CZ  . ARG C 1 56  ? 42.014  27.072  37.346  1.00 37.18 ? 55   ARG C CZ  1 
ATOM   5920  N NH1 . ARG C 1 56  ? 42.205  28.270  36.784  1.00 36.72 ? 55   ARG C NH1 1 
ATOM   5921  N NH2 . ARG C 1 56  ? 42.395  25.972  36.706  1.00 36.99 ? 55   ARG C NH2 1 
ATOM   5922  N N   . ARG C 1 57  ? 44.582  26.662  43.263  1.00 35.85 ? 56   ARG C N   1 
ATOM   5923  C CA  . ARG C 1 57  ? 45.125  25.669  44.200  1.00 34.81 ? 56   ARG C CA  1 
ATOM   5924  C C   . ARG C 1 57  ? 45.451  26.333  45.535  1.00 33.90 ? 56   ARG C C   1 
ATOM   5925  O O   . ARG C 1 57  ? 45.118  25.809  46.611  1.00 33.74 ? 56   ARG C O   1 
ATOM   5926  C CB  . ARG C 1 57  ? 46.361  24.975  43.638  1.00 35.03 ? 56   ARG C CB  1 
ATOM   5927  C CG  . ARG C 1 57  ? 46.819  23.756  44.436  1.00 35.58 ? 56   ARG C CG  1 
ATOM   5928  C CD  . ARG C 1 57  ? 48.208  23.367  44.013  1.00 36.18 ? 56   ARG C CD  1 
ATOM   5929  N NE  . ARG C 1 57  ? 49.152  24.447  44.298  1.00 36.35 ? 56   ARG C NE  1 
ATOM   5930  C CZ  . ARG C 1 57  ? 49.616  24.704  45.526  1.00 36.54 ? 56   ARG C CZ  1 
ATOM   5931  N NH1 . ARG C 1 57  ? 49.243  23.926  46.541  1.00 36.74 ? 56   ARG C NH1 1 
ATOM   5932  N NH2 . ARG C 1 57  ? 50.458  25.708  45.754  1.00 36.96 ? 56   ARG C NH2 1 
ATOM   5933  N N   . ALA C 1 58  ? 46.088  27.482  45.429  1.00 32.91 ? 57   ALA C N   1 
ATOM   5934  C CA  . ALA C 1 58  ? 46.511  28.298  46.562  1.00 32.17 ? 57   ALA C CA  1 
ATOM   5935  C C   . ALA C 1 58  ? 45.319  28.694  47.431  1.00 31.52 ? 57   ALA C C   1 
ATOM   5936  O O   . ALA C 1 58  ? 45.340  28.444  48.645  1.00 31.47 ? 57   ALA C O   1 
ATOM   5937  C CB  . ALA C 1 58  ? 47.268  29.534  46.088  1.00 32.03 ? 57   ALA C CB  1 
ATOM   5938  N N   . TYR C 1 59  ? 44.346  29.322  46.798  1.00 30.96 ? 58   TYR C N   1 
ATOM   5939  C CA  . TYR C 1 59  ? 43.137  29.791  47.470  1.00 30.50 ? 58   TYR C CA  1 
ATOM   5940  C C   . TYR C 1 59  ? 42.394  28.638  48.144  1.00 29.96 ? 58   TYR C C   1 
ATOM   5941  O O   . TYR C 1 59  ? 41.770  28.840  49.200  1.00 30.28 ? 58   TYR C O   1 
ATOM   5942  C CB  . TYR C 1 59  ? 42.180  30.555  46.518  1.00 29.79 ? 58   TYR C CB  1 
ATOM   5943  C CG  . TYR C 1 59  ? 40.865  30.878  47.213  1.00 29.84 ? 58   TYR C CG  1 
ATOM   5944  C CD1 . TYR C 1 59  ? 40.853  31.722  48.326  1.00 29.47 ? 58   TYR C CD1 1 
ATOM   5945  C CD2 . TYR C 1 59  ? 39.652  30.319  46.796  1.00 29.06 ? 58   TYR C CD2 1 
ATOM   5946  C CE1 . TYR C 1 59  ? 39.666  32.027  48.998  1.00 28.92 ? 58   TYR C CE1 1 
ATOM   5947  C CE2 . TYR C 1 59  ? 38.463  30.614  47.451  1.00 29.06 ? 58   TYR C CE2 1 
ATOM   5948  C CZ  . TYR C 1 59  ? 38.472  31.464  48.560  1.00 29.29 ? 58   TYR C CZ  1 
ATOM   5949  O OH  . TYR C 1 59  ? 37.326  31.781  49.234  1.00 28.35 ? 58   TYR C OH  1 
ATOM   5950  N N   . ARG C 1 60  ? 42.458  27.475  47.527  1.00 29.48 ? 59   ARG C N   1 
ATOM   5951  C CA  . ARG C 1 60  ? 41.748  26.281  48.027  1.00 28.72 ? 59   ARG C CA  1 
ATOM   5952  C C   . ARG C 1 60  ? 42.506  25.704  49.221  1.00 28.23 ? 59   ARG C C   1 
ATOM   5953  O O   . ARG C 1 60  ? 41.895  25.166  50.166  1.00 27.60 ? 59   ARG C O   1 
ATOM   5954  C CB  . ARG C 1 60  ? 41.472  25.256  46.943  1.00 28.99 ? 59   ARG C CB  1 
ATOM   5955  C CG  . ARG C 1 60  ? 40.136  25.340  46.222  1.00 28.89 ? 59   ARG C CG  1 
ATOM   5956  C CD  . ARG C 1 60  ? 39.840  26.680  45.666  1.00 30.47 ? 59   ARG C CD  1 
ATOM   5957  N NE  . ARG C 1 60  ? 38.534  26.777  45.018  1.00 30.79 ? 59   ARG C NE  1 
ATOM   5958  C CZ  . ARG C 1 60  ? 38.298  26.433  43.748  1.00 31.27 ? 59   ARG C CZ  1 
ATOM   5959  N NH1 . ARG C 1 60  ? 39.312  26.002  42.997  1.00 30.45 ? 59   ARG C NH1 1 
ATOM   5960  N NH2 . ARG C 1 60  ? 37.087  26.520  43.194  1.00 30.13 ? 59   ARG C NH2 1 
ATOM   5961  N N   . GLN C 1 61  ? 43.819  25.854  49.167  1.00 27.54 ? 60   GLN C N   1 
ATOM   5962  C CA  . GLN C 1 61  ? 44.706  25.416  50.256  1.00 27.38 ? 60   GLN C CA  1 
ATOM   5963  C C   . GLN C 1 61  ? 44.347  26.197  51.534  1.00 27.12 ? 60   GLN C C   1 
ATOM   5964  O O   . GLN C 1 61  ? 44.256  25.600  52.616  1.00 27.54 ? 60   GLN C O   1 
ATOM   5965  C CB  . GLN C 1 61  ? 46.180  25.589  49.944  1.00 27.85 ? 60   GLN C CB  1 
ATOM   5966  C CG  . GLN C 1 61  ? 47.097  25.201  51.104  1.00 27.84 ? 60   GLN C CG  1 
ATOM   5967  C CD  . GLN C 1 61  ? 48.534  25.131  50.609  1.00 28.48 ? 60   GLN C CD  1 
ATOM   5968  O OE1 . GLN C 1 61  ? 48.944  24.148  50.014  1.00 29.23 ? 60   GLN C OE1 1 
ATOM   5969  N NE2 . GLN C 1 61  ? 49.242  26.225  50.840  1.00 29.38 ? 60   GLN C NE2 1 
ATOM   5970  N N   . LEU C 1 62  ? 44.159  27.489  51.347  1.00 26.60 ? 61   LEU C N   1 
ATOM   5971  C CA  . LEU C 1 62  ? 43.743  28.381  52.441  1.00 26.51 ? 61   LEU C CA  1 
ATOM   5972  C C   . LEU C 1 62  ? 42.506  27.808  53.122  1.00 26.79 ? 61   LEU C C   1 
ATOM   5973  O O   . LEU C 1 62  ? 42.569  27.420  54.306  1.00 26.70 ? 61   LEU C O   1 
ATOM   5974  C CB  . LEU C 1 62  ? 43.631  29.788  51.880  1.00 27.02 ? 61   LEU C CB  1 
ATOM   5975  C CG  . LEU C 1 62  ? 43.219  30.936  52.784  1.00 26.86 ? 61   LEU C CG  1 
ATOM   5976  C CD1 . LEU C 1 62  ? 43.659  32.270  52.173  1.00 27.87 ? 61   LEU C CD1 1 
ATOM   5977  C CD2 . LEU C 1 62  ? 41.694  30.930  52.922  1.00 27.08 ? 61   LEU C CD2 1 
ATOM   5978  N N   . LEU C 1 63  ? 41.407  27.715  52.381  1.00 26.24 ? 62   LEU C N   1 
ATOM   5979  C CA  . LEU C 1 63  ? 40.145  27.201  52.923  1.00 25.66 ? 62   LEU C CA  1 
ATOM   5980  C C   . LEU C 1 63  ? 40.323  25.892  53.694  1.00 25.33 ? 62   LEU C C   1 
ATOM   5981  O O   . LEU C 1 63  ? 39.840  25.753  54.833  1.00 25.53 ? 62   LEU C O   1 
ATOM   5982  C CB  . LEU C 1 63  ? 39.150  27.017  51.764  1.00 24.00 ? 62   LEU C CB  1 
ATOM   5983  C CG  . LEU C 1 63  ? 38.680  28.231  51.006  1.00 23.14 ? 62   LEU C CG  1 
ATOM   5984  C CD1 . LEU C 1 63  ? 37.643  27.832  49.951  1.00 23.34 ? 62   LEU C CD1 1 
ATOM   5985  C CD2 . LEU C 1 63  ? 38.076  29.236  51.979  1.00 22.12 ? 62   LEU C CD2 1 
ATOM   5986  N N   . PHE C 1 64  ? 40.986  24.950  53.048  1.00 25.10 ? 63   PHE C N   1 
ATOM   5987  C CA  . PHE C 1 64  ? 41.097  23.579  53.535  1.00 25.18 ? 63   PHE C CA  1 
ATOM   5988  C C   . PHE C 1 64  ? 42.097  23.416  54.685  1.00 25.20 ? 63   PHE C C   1 
ATOM   5989  O O   . PHE C 1 64  ? 42.027  22.399  55.402  1.00 24.44 ? 63   PHE C O   1 
ATOM   5990  C CB  . PHE C 1 64  ? 41.402  22.572  52.422  1.00 25.16 ? 63   PHE C CB  1 
ATOM   5991  C CG  . PHE C 1 64  ? 40.471  22.572  51.250  1.00 25.54 ? 63   PHE C CG  1 
ATOM   5992  C CD1 . PHE C 1 64  ? 39.165  23.052  51.381  1.00 25.08 ? 63   PHE C CD1 1 
ATOM   5993  C CD2 . PHE C 1 64  ? 40.900  22.072  50.019  1.00 25.14 ? 63   PHE C CD2 1 
ATOM   5994  C CE1 . PHE C 1 64  ? 38.298  23.052  50.292  1.00 26.22 ? 63   PHE C CE1 1 
ATOM   5995  C CE2 . PHE C 1 64  ? 40.035  22.048  48.916  1.00 25.64 ? 63   PHE C CE2 1 
ATOM   5996  C CZ  . PHE C 1 64  ? 38.733  22.547  49.067  1.00 25.70 ? 63   PHE C CZ  1 
ATOM   5997  N N   . SER C 1 65  ? 42.993  24.374  54.824  1.00 25.55 ? 64   SER C N   1 
ATOM   5998  C CA  . SER C 1 65  ? 44.041  24.218  55.865  1.00 26.49 ? 64   SER C CA  1 
ATOM   5999  C C   . SER C 1 65  ? 43.617  24.895  57.159  1.00 27.00 ? 64   SER C C   1 
ATOM   6000  O O   . SER C 1 65  ? 44.365  24.840  58.159  1.00 27.76 ? 64   SER C O   1 
ATOM   6001  C CB  . SER C 1 65  ? 45.393  24.649  55.340  1.00 25.45 ? 64   SER C CB  1 
ATOM   6002  O OG  . SER C 1 65  ? 45.393  25.986  54.888  1.00 26.60 ? 64   SER C OG  1 
ATOM   6003  N N   . THR C 1 66  ? 42.444  25.489  57.146  1.00 26.90 ? 65   THR C N   1 
ATOM   6004  C CA  . THR C 1 66  ? 41.852  26.187  58.291  1.00 27.19 ? 65   THR C CA  1 
ATOM   6005  C C   . THR C 1 66  ? 41.840  25.301  59.534  1.00 27.20 ? 65   THR C C   1 
ATOM   6006  O O   . THR C 1 66  ? 41.783  24.062  59.451  1.00 27.38 ? 65   THR C O   1 
ATOM   6007  C CB  . THR C 1 66  ? 40.402  26.735  57.970  1.00 27.15 ? 65   THR C CB  1 
ATOM   6008  O OG1 . THR C 1 66  ? 40.513  27.575  56.770  1.00 26.85 ? 65   THR C OG1 1 
ATOM   6009  C CG2 . THR C 1 66  ? 39.770  27.534  59.118  1.00 26.55 ? 65   THR C CG2 1 
ATOM   6010  N N   . ASP C 1 67  ? 41.887  25.961  60.687  1.00 27.24 ? 66   ASP C N   1 
ATOM   6011  C CA  . ASP C 1 67  ? 41.847  25.267  61.993  1.00 27.76 ? 66   ASP C CA  1 
ATOM   6012  C C   . ASP C 1 67  ? 40.743  24.201  61.964  1.00 27.79 ? 66   ASP C C   1 
ATOM   6013  O O   . ASP C 1 67  ? 39.616  24.475  61.539  1.00 27.88 ? 66   ASP C O   1 
ATOM   6014  C CB  . ASP C 1 67  ? 41.691  26.302  63.097  1.00 29.17 ? 66   ASP C CB  1 
ATOM   6015  C CG  . ASP C 1 67  ? 41.541  25.745  64.497  1.00 30.23 ? 66   ASP C CG  1 
ATOM   6016  O OD1 . ASP C 1 67  ? 41.340  24.544  64.724  1.00 30.43 ? 66   ASP C OD1 1 
ATOM   6017  O OD2 . ASP C 1 67  ? 41.638  26.590  65.416  1.00 32.42 ? 66   ASP C OD2 1 
ATOM   6018  N N   . PRO C 1 68  ? 41.097  23.016  62.436  1.00 28.13 ? 67   PRO C N   1 
ATOM   6019  C CA  . PRO C 1 68  ? 40.205  21.863  62.444  1.00 28.37 ? 67   PRO C CA  1 
ATOM   6020  C C   . PRO C 1 68  ? 38.895  22.128  63.166  1.00 28.43 ? 67   PRO C C   1 
ATOM   6021  O O   . PRO C 1 68  ? 37.958  21.304  63.081  1.00 28.77 ? 67   PRO C O   1 
ATOM   6022  C CB  . PRO C 1 68  ? 40.999  20.718  63.040  1.00 28.52 ? 67   PRO C CB  1 
ATOM   6023  C CG  . PRO C 1 68  ? 42.381  21.215  63.292  1.00 28.59 ? 67   PRO C CG  1 
ATOM   6024  C CD  . PRO C 1 68  ? 42.486  22.624  62.770  1.00 28.20 ? 67   PRO C CD  1 
ATOM   6025  N N   . LYS C 1 69  ? 38.831  23.256  63.846  1.00 28.11 ? 68   LYS C N   1 
ATOM   6026  C CA  . LYS C 1 69  ? 37.611  23.683  64.541  1.00 27.99 ? 68   LYS C CA  1 
ATOM   6027  C C   . LYS C 1 69  ? 36.493  23.902  63.513  1.00 27.26 ? 68   LYS C C   1 
ATOM   6028  O O   . LYS C 1 69  ? 35.305  23.874  63.861  1.00 26.95 ? 68   LYS C O   1 
ATOM   6029  C CB  . LYS C 1 69  ? 37.812  24.958  65.344  1.00 30.15 ? 68   LYS C CB  1 
ATOM   6030  C CG  . LYS C 1 69  ? 36.562  25.413  66.100  1.00 32.45 ? 68   LYS C CG  1 
ATOM   6031  C CD  . LYS C 1 69  ? 36.902  26.427  67.182  1.00 34.57 ? 68   LYS C CD  1 
ATOM   6032  C CE  . LYS C 1 69  ? 35.833  26.478  68.264  1.00 35.52 ? 68   LYS C CE  1 
ATOM   6033  N NZ  . LYS C 1 69  ? 35.721  25.141  68.916  1.00 36.26 ? 68   LYS C NZ  1 
ATOM   6034  N N   . LEU C 1 70  ? 36.916  24.111  62.269  1.00 26.15 ? 69   LEU C N   1 
ATOM   6035  C CA  . LEU C 1 70  ? 35.950  24.333  61.173  1.00 25.14 ? 69   LEU C CA  1 
ATOM   6036  C C   . LEU C 1 70  ? 34.950  23.179  61.116  1.00 24.32 ? 69   LEU C C   1 
ATOM   6037  O O   . LEU C 1 70  ? 33.750  23.406  60.847  1.00 24.85 ? 69   LEU C O   1 
ATOM   6038  C CB  . LEU C 1 70  ? 36.719  24.572  59.874  1.00 25.00 ? 69   LEU C CB  1 
ATOM   6039  C CG  . LEU C 1 70  ? 35.889  24.856  58.625  1.00 23.95 ? 69   LEU C CG  1 
ATOM   6040  C CD1 . LEU C 1 70  ? 35.430  26.305  58.583  1.00 23.93 ? 69   LEU C CD1 1 
ATOM   6041  C CD2 . LEU C 1 70  ? 36.749  24.541  57.395  1.00 24.16 ? 69   LEU C CD2 1 
ATOM   6042  N N   . ALA C 1 71  ? 35.442  21.982  61.368  1.00 23.28 ? 70   ALA C N   1 
ATOM   6043  C CA  . ALA C 1 71  ? 34.658  20.753  61.277  1.00 22.88 ? 70   ALA C CA  1 
ATOM   6044  C C   . ALA C 1 71  ? 33.470  20.746  62.229  1.00 23.08 ? 70   ALA C C   1 
ATOM   6045  O O   . ALA C 1 71  ? 32.588  19.874  62.130  1.00 22.48 ? 70   ALA C O   1 
ATOM   6046  C CB  . ALA C 1 71  ? 35.541  19.534  61.441  1.00 21.84 ? 70   ALA C CB  1 
ATOM   6047  N N   . GLU C 1 72  ? 33.444  21.701  63.144  1.00 23.60 ? 71   GLU C N   1 
ATOM   6048  C CA  . GLU C 1 72  ? 32.361  21.843  64.113  1.00 23.95 ? 71   GLU C CA  1 
ATOM   6049  C C   . GLU C 1 72  ? 31.079  22.360  63.479  1.00 23.50 ? 71   GLU C C   1 
ATOM   6050  O O   . GLU C 1 72  ? 29.974  22.079  63.993  1.00 23.24 ? 71   GLU C O   1 
ATOM   6051  C CB  . GLU C 1 72  ? 32.722  22.788  65.266  1.00 26.69 ? 71   GLU C CB  1 
ATOM   6052  C CG  . GLU C 1 72  ? 33.449  22.156  66.444  1.00 29.43 ? 71   GLU C CG  1 
ATOM   6053  C CD  . GLU C 1 72  ? 34.073  23.038  67.474  1.00 31.06 ? 71   GLU C CD  1 
ATOM   6054  O OE1 . GLU C 1 72  ? 33.722  24.239  67.430  1.00 32.10 ? 71   GLU C OE1 1 
ATOM   6055  O OE2 . GLU C 1 72  ? 34.874  22.607  68.300  1.00 31.87 ? 71   GLU C OE2 1 
ATOM   6056  N N   . ASN C 1 73  ? 31.238  23.079  62.375  1.00 22.80 ? 72   ASN C N   1 
ATOM   6057  C CA  . ASN C 1 73  ? 30.076  23.704  61.701  1.00 21.75 ? 72   ASN C CA  1 
ATOM   6058  C C   . ASN C 1 73  ? 30.009  23.319  60.226  1.00 20.96 ? 72   ASN C C   1 
ATOM   6059  O O   . ASN C 1 73  ? 29.000  23.607  59.548  1.00 21.22 ? 72   ASN C O   1 
ATOM   6060  C CB  . ASN C 1 73  ? 30.093  25.215  61.916  1.00 21.35 ? 72   ASN C CB  1 
ATOM   6061  C CG  . ASN C 1 73  ? 30.037  25.618  63.381  1.00 23.15 ? 72   ASN C CG  1 
ATOM   6062  O OD1 . ASN C 1 73  ? 29.082  25.260  64.095  1.00 24.35 ? 72   ASN C OD1 1 
ATOM   6063  N ND2 . ASN C 1 73  ? 31.034  26.364  63.838  1.00 20.66 ? 72   ASN C ND2 1 
ATOM   6064  N N   . ILE C 1 74  ? 31.075  22.721  59.741  1.00 19.70 ? 73   ILE C N   1 
ATOM   6065  C CA  . ILE C 1 74  ? 31.163  22.291  58.333  1.00 17.78 ? 73   ILE C CA  1 
ATOM   6066  C C   . ILE C 1 74  ? 31.231  20.777  58.291  1.00 16.86 ? 73   ILE C C   1 
ATOM   6067  O O   . ILE C 1 74  ? 32.235  20.152  58.664  1.00 17.24 ? 73   ILE C O   1 
ATOM   6068  C CB  . ILE C 1 74  ? 32.333  23.020  57.604  1.00 17.62 ? 73   ILE C CB  1 
ATOM   6069  C CG1 . ILE C 1 74  ? 32.205  24.559  57.736  1.00 17.07 ? 73   ILE C CG1 1 
ATOM   6070  C CG2 . ILE C 1 74  ? 32.506  22.586  56.124  1.00 17.59 ? 73   ILE C CG2 1 
ATOM   6071  C CD1 . ILE C 1 74  ? 31.010  25.218  57.012  1.00 17.75 ? 73   ILE C CD1 1 
ATOM   6072  N N   . SER C 1 75  ? 30.127  20.177  57.866  1.00 16.15 ? 74   SER C N   1 
ATOM   6073  C CA  . SER C 1 75  ? 29.982  18.732  57.719  1.00 15.08 ? 74   SER C CA  1 
ATOM   6074  C C   . SER C 1 75  ? 30.597  18.232  56.409  1.00 14.42 ? 74   SER C C   1 
ATOM   6075  O O   . SER C 1 75  ? 31.076  17.096  56.332  1.00 13.89 ? 74   SER C O   1 
ATOM   6076  C CB  . SER C 1 75  ? 28.493  18.329  57.715  1.00 15.02 ? 74   SER C CB  1 
ATOM   6077  O OG  . SER C 1 75  ? 27.822  19.158  56.754  1.00 16.28 ? 74   SER C OG  1 
ATOM   6078  N N   . GLY C 1 76  ? 30.527  19.089  55.402  1.00 14.48 ? 75   GLY C N   1 
ATOM   6079  C CA  . GLY C 1 76  ? 31.002  18.677  54.055  1.00 14.70 ? 75   GLY C CA  1 
ATOM   6080  C C   . GLY C 1 76  ? 31.339  19.878  53.194  1.00 14.16 ? 75   GLY C C   1 
ATOM   6081  O O   . GLY C 1 76  ? 30.916  21.017  53.417  1.00 14.82 ? 75   GLY C O   1 
ATOM   6082  N N   . VAL C 1 77  ? 32.143  19.568  52.192  1.00 14.51 ? 76   VAL C N   1 
ATOM   6083  C CA  . VAL C 1 77  ? 32.650  20.538  51.220  1.00 14.22 ? 76   VAL C CA  1 
ATOM   6084  C C   . VAL C 1 77  ? 32.382  19.975  49.816  1.00 13.67 ? 76   VAL C C   1 
ATOM   6085  O O   . VAL C 1 77  ? 32.722  18.815  49.562  1.00 12.98 ? 76   VAL C O   1 
ATOM   6086  C CB  . VAL C 1 77  ? 34.152  20.798  51.469  1.00 16.28 ? 76   VAL C CB  1 
ATOM   6087  C CG1 . VAL C 1 77  ? 34.798  21.583  50.333  1.00 16.03 ? 76   VAL C CG1 1 
ATOM   6088  C CG2 . VAL C 1 77  ? 34.395  21.486  52.798  1.00 15.37 ? 76   VAL C CG2 1 
ATOM   6089  N N   . ILE C 1 78  ? 31.774  20.822  48.992  1.00 14.24 ? 77   ILE C N   1 
ATOM   6090  C CA  . ILE C 1 78  ? 31.565  20.420  47.589  1.00 14.39 ? 77   ILE C CA  1 
ATOM   6091  C C   . ILE C 1 78  ? 32.784  20.871  46.777  1.00 13.77 ? 77   ILE C C   1 
ATOM   6092  O O   . ILE C 1 78  ? 33.138  22.045  46.826  1.00 14.03 ? 77   ILE C O   1 
ATOM   6093  C CB  . ILE C 1 78  ? 30.252  20.975  46.957  1.00 14.89 ? 77   ILE C CB  1 
ATOM   6094  C CG1 . ILE C 1 78  ? 29.010  20.606  47.803  1.00 15.46 ? 77   ILE C CG1 1 
ATOM   6095  C CG2 . ILE C 1 78  ? 30.100  20.444  45.491  1.00 15.70 ? 77   ILE C CG2 1 
ATOM   6096  C CD1 . ILE C 1 78  ? 27.736  21.422  47.409  1.00 15.20 ? 77   ILE C CD1 1 
ATOM   6097  N N   . LEU C 1 79  ? 33.352  19.940  46.060  1.00 15.07 ? 78   LEU C N   1 
ATOM   6098  C CA  . LEU C 1 79  ? 34.534  20.148  45.236  1.00 16.10 ? 78   LEU C CA  1 
ATOM   6099  C C   . LEU C 1 79  ? 34.187  20.166  43.729  1.00 17.29 ? 78   LEU C C   1 
ATOM   6100  O O   . LEU C 1 79  ? 33.247  19.516  43.277  1.00 17.19 ? 78   LEU C O   1 
ATOM   6101  C CB  . LEU C 1 79  ? 35.505  18.979  45.506  1.00 16.92 ? 78   LEU C CB  1 
ATOM   6102  C CG  . LEU C 1 79  ? 36.082  18.819  46.902  1.00 17.43 ? 78   LEU C CG  1 
ATOM   6103  C CD1 . LEU C 1 79  ? 37.130  17.721  46.922  1.00 18.56 ? 78   LEU C CD1 1 
ATOM   6104  C CD2 . LEU C 1 79  ? 36.694  20.142  47.326  1.00 18.05 ? 78   LEU C CD2 1 
ATOM   6105  N N   . PHE C 1 80  ? 35.034  20.892  43.034  1.00 18.02 ? 79   PHE C N   1 
ATOM   6106  C CA  . PHE C 1 80  ? 35.097  20.898  41.555  1.00 18.52 ? 79   PHE C CA  1 
ATOM   6107  C C   . PHE C 1 80  ? 36.124  19.809  41.194  1.00 19.00 ? 79   PHE C C   1 
ATOM   6108  O O   . PHE C 1 80  ? 37.111  19.638  41.944  1.00 18.66 ? 79   PHE C O   1 
ATOM   6109  C CB  . PHE C 1 80  ? 35.437  22.283  41.013  1.00 20.55 ? 79   PHE C CB  1 
ATOM   6110  C CG  . PHE C 1 80  ? 35.611  22.291  39.512  1.00 21.98 ? 79   PHE C CG  1 
ATOM   6111  C CD1 . PHE C 1 80  ? 34.486  22.245  38.685  1.00 22.51 ? 79   PHE C CD1 1 
ATOM   6112  C CD2 . PHE C 1 80  ? 36.886  22.305  38.958  1.00 22.01 ? 79   PHE C CD2 1 
ATOM   6113  C CE1 . PHE C 1 80  ? 34.638  22.228  37.296  1.00 22.86 ? 79   PHE C CE1 1 
ATOM   6114  C CE2 . PHE C 1 80  ? 37.061  22.284  37.574  1.00 22.59 ? 79   PHE C CE2 1 
ATOM   6115  C CZ  . PHE C 1 80  ? 35.930  22.246  36.750  1.00 23.19 ? 79   PHE C CZ  1 
ATOM   6116  N N   . HIS C 1 81  ? 35.880  19.075  40.145  1.00 18.24 ? 80   HIS C N   1 
ATOM   6117  C CA  . HIS C 1 81  ? 36.678  17.940  39.687  1.00 18.69 ? 80   HIS C CA  1 
ATOM   6118  C C   . HIS C 1 81  ? 38.180  18.166  39.861  1.00 18.75 ? 80   HIS C C   1 
ATOM   6119  O O   . HIS C 1 81  ? 38.875  17.302  40.416  1.00 18.02 ? 80   HIS C O   1 
ATOM   6120  C CB  . HIS C 1 81  ? 36.387  17.562  38.201  1.00 18.44 ? 80   HIS C CB  1 
ATOM   6121  C CG  . HIS C 1 81  ? 37.159  16.367  37.749  1.00 17.90 ? 80   HIS C CG  1 
ATOM   6122  N ND1 . HIS C 1 81  ? 36.726  15.074  37.826  1.00 18.35 ? 80   HIS C ND1 1 
ATOM   6123  C CD2 . HIS C 1 81  ? 38.401  16.301  37.194  1.00 18.75 ? 80   HIS C CD2 1 
ATOM   6124  C CE1 . HIS C 1 81  ? 37.638  14.255  37.345  1.00 19.01 ? 80   HIS C CE1 1 
ATOM   6125  N NE2 . HIS C 1 81  ? 38.673  14.977  36.962  1.00 19.08 ? 80   HIS C NE2 1 
ATOM   6126  N N   . GLU C 1 82  ? 38.652  19.298  39.395  1.00 20.22 ? 81   GLU C N   1 
ATOM   6127  C CA  . GLU C 1 82  ? 40.069  19.694  39.430  1.00 21.32 ? 81   GLU C CA  1 
ATOM   6128  C C   . GLU C 1 82  ? 40.646  19.582  40.837  1.00 21.63 ? 81   GLU C C   1 
ATOM   6129  O O   . GLU C 1 82  ? 41.680  18.909  41.055  1.00 21.46 ? 81   GLU C O   1 
ATOM   6130  C CB  . GLU C 1 82  ? 40.235  21.121  38.935  1.00 24.64 ? 81   GLU C CB  1 
ATOM   6131  C CG  . GLU C 1 82  ? 41.421  21.978  39.312  1.00 27.61 ? 81   GLU C CG  1 
ATOM   6132  C CD  . GLU C 1 82  ? 41.518  23.325  38.660  1.00 29.64 ? 81   GLU C CD  1 
ATOM   6133  O OE1 . GLU C 1 82  ? 41.806  23.489  37.484  1.00 31.54 ? 81   GLU C OE1 1 
ATOM   6134  O OE2 . GLU C 1 82  ? 41.256  24.277  39.430  1.00 30.38 ? 81   GLU C OE2 1 
ATOM   6135  N N   . THR C 1 83  ? 39.985  20.225  41.777  1.00 21.54 ? 82   THR C N   1 
ATOM   6136  C CA  . THR C 1 83  ? 40.393  20.291  43.180  1.00 21.37 ? 82   THR C CA  1 
ATOM   6137  C C   . THR C 1 83  ? 40.554  18.943  43.854  1.00 21.18 ? 82   THR C C   1 
ATOM   6138  O O   . THR C 1 83  ? 41.471  18.780  44.701  1.00 21.33 ? 82   THR C O   1 
ATOM   6139  C CB  . THR C 1 83  ? 39.414  21.222  44.006  1.00 21.22 ? 82   THR C CB  1 
ATOM   6140  O OG1 . THR C 1 83  ? 39.097  22.329  43.104  1.00 21.08 ? 82   THR C OG1 1 
ATOM   6141  C CG2 . THR C 1 83  ? 39.993  21.738  45.326  1.00 21.79 ? 82   THR C CG2 1 
ATOM   6142  N N   . LEU C 1 84  ? 39.701  17.996  43.520  1.00 20.61 ? 83   LEU C N   1 
ATOM   6143  C CA  . LEU C 1 84  ? 39.694  16.670  44.138  1.00 20.88 ? 83   LEU C CA  1 
ATOM   6144  C C   . LEU C 1 84  ? 41.034  15.958  43.991  1.00 21.23 ? 83   LEU C C   1 
ATOM   6145  O O   . LEU C 1 84  ? 41.346  15.038  44.783  1.00 21.10 ? 83   LEU C O   1 
ATOM   6146  C CB  . LEU C 1 84  ? 38.498  15.876  43.625  1.00 19.30 ? 83   LEU C CB  1 
ATOM   6147  C CG  . LEU C 1 84  ? 38.381  14.409  44.000  1.00 19.32 ? 83   LEU C CG  1 
ATOM   6148  C CD1 . LEU C 1 84  ? 38.111  14.225  45.493  1.00 18.96 ? 83   LEU C CD1 1 
ATOM   6149  C CD2 . LEU C 1 84  ? 37.250  13.788  43.192  1.00 20.36 ? 83   LEU C CD2 1 
ATOM   6150  N N   . TYR C 1 85  ? 41.791  16.364  42.992  1.00 21.54 ? 84   TYR C N   1 
ATOM   6151  C CA  . TYR C 1 85  ? 43.090  15.722  42.708  1.00 21.66 ? 84   TYR C CA  1 
ATOM   6152  C C   . TYR C 1 85  ? 44.290  16.607  42.972  1.00 22.30 ? 84   TYR C C   1 
ATOM   6153  O O   . TYR C 1 85  ? 45.437  16.208  42.650  1.00 23.18 ? 84   TYR C O   1 
ATOM   6154  C CB  . TYR C 1 85  ? 43.041  15.149  41.270  1.00 21.21 ? 84   TYR C CB  1 
ATOM   6155  C CG  . TYR C 1 85  ? 41.868  14.203  41.108  1.00 19.50 ? 84   TYR C CG  1 
ATOM   6156  C CD1 . TYR C 1 85  ? 41.951  12.906  41.597  1.00 18.90 ? 84   TYR C CD1 1 
ATOM   6157  C CD2 . TYR C 1 85  ? 40.666  14.612  40.514  1.00 19.13 ? 84   TYR C CD2 1 
ATOM   6158  C CE1 . TYR C 1 85  ? 40.895  12.015  41.486  1.00 19.84 ? 84   TYR C CE1 1 
ATOM   6159  C CE2 . TYR C 1 85  ? 39.596  13.732  40.400  1.00 18.72 ? 84   TYR C CE2 1 
ATOM   6160  C CZ  . TYR C 1 85  ? 39.708  12.437  40.880  1.00 19.76 ? 84   TYR C CZ  1 
ATOM   6161  O OH  . TYR C 1 85  ? 38.699  11.522  40.805  1.00 20.34 ? 84   TYR C OH  1 
ATOM   6162  N N   . GLN C 1 86  ? 44.109  17.777  43.560  1.00 22.72 ? 85   GLN C N   1 
ATOM   6163  C CA  . GLN C 1 86  ? 45.222  18.679  43.894  1.00 23.21 ? 85   GLN C CA  1 
ATOM   6164  C C   . GLN C 1 86  ? 45.819  18.311  45.257  1.00 23.99 ? 85   GLN C C   1 
ATOM   6165  O O   . GLN C 1 86  ? 45.264  17.513  46.028  1.00 23.20 ? 85   GLN C O   1 
ATOM   6166  C CB  . GLN C 1 86  ? 44.854  20.155  43.811  1.00 24.03 ? 85   GLN C CB  1 
ATOM   6167  C CG  . GLN C 1 86  ? 44.506  20.593  42.388  1.00 24.99 ? 85   GLN C CG  1 
ATOM   6168  C CD  . GLN C 1 86  ? 44.118  22.024  42.256  1.00 25.60 ? 85   GLN C CD  1 
ATOM   6169  O OE1 . GLN C 1 86  ? 44.395  22.707  41.257  1.00 27.63 ? 85   GLN C OE1 1 
ATOM   6170  N NE2 . GLN C 1 86  ? 43.431  22.554  43.270  1.00 26.38 ? 85   GLN C NE2 1 
ATOM   6171  N N   . LYS C 1 87  ? 46.971  18.920  45.518  1.00 24.42 ? 86   LYS C N   1 
ATOM   6172  C CA  . LYS C 1 87  ? 47.741  18.694  46.750  1.00 25.20 ? 86   LYS C CA  1 
ATOM   6173  C C   . LYS C 1 87  ? 48.213  20.016  47.347  1.00 25.17 ? 86   LYS C C   1 
ATOM   6174  O O   . LYS C 1 87  ? 48.333  21.040  46.665  1.00 25.33 ? 86   LYS C O   1 
ATOM   6175  C CB  . LYS C 1 87  ? 48.956  17.812  46.493  1.00 25.87 ? 86   LYS C CB  1 
ATOM   6176  C CG  . LYS C 1 87  ? 48.673  16.558  45.673  1.00 28.02 ? 86   LYS C CG  1 
ATOM   6177  C CD  . LYS C 1 87  ? 49.964  15.854  45.283  1.00 29.58 ? 86   LYS C CD  1 
ATOM   6178  C CE  . LYS C 1 87  ? 49.708  14.727  44.297  1.00 31.32 ? 86   LYS C CE  1 
ATOM   6179  N NZ  . LYS C 1 87  ? 48.867  13.680  44.937  1.00 33.10 ? 86   LYS C NZ  1 
ATOM   6180  N N   . ALA C 1 88  ? 48.465  19.968  48.645  1.00 26.25 ? 87   ALA C N   1 
ATOM   6181  C CA  . ALA C 1 88  ? 49.013  21.131  49.368  1.00 27.04 ? 87   ALA C CA  1 
ATOM   6182  C C   . ALA C 1 88  ? 50.493  21.283  48.984  1.00 27.45 ? 87   ALA C C   1 
ATOM   6183  O O   . ALA C 1 88  ? 51.062  20.420  48.298  1.00 27.18 ? 87   ALA C O   1 
ATOM   6184  C CB  . ALA C 1 88  ? 48.832  20.961  50.866  1.00 27.24 ? 87   ALA C CB  1 
ATOM   6185  N N   . ASP C 1 89  ? 51.069  22.370  49.449  1.00 28.19 ? 88   ASP C N   1 
ATOM   6186  C CA  . ASP C 1 89  ? 52.472  22.729  49.180  1.00 28.52 ? 88   ASP C CA  1 
ATOM   6187  C C   . ASP C 1 89  ? 53.416  21.611  49.616  1.00 28.61 ? 88   ASP C C   1 
ATOM   6188  O O   . ASP C 1 89  ? 54.409  21.318  48.929  1.00 29.03 ? 88   ASP C O   1 
ATOM   6189  C CB  . ASP C 1 89  ? 52.812  24.055  49.854  1.00 29.35 ? 88   ASP C CB  1 
ATOM   6190  C CG  . ASP C 1 89  ? 52.264  25.280  49.159  1.00 30.80 ? 88   ASP C CG  1 
ATOM   6191  O OD1 . ASP C 1 89  ? 51.914  25.149  47.965  1.00 31.79 ? 88   ASP C OD1 1 
ATOM   6192  O OD2 . ASP C 1 89  ? 52.192  26.368  49.757  1.00 30.86 ? 88   ASP C OD2 1 
ATOM   6193  N N   . ASP C 1 90  ? 53.103  21.033  50.762  1.00 28.75 ? 89   ASP C N   1 
ATOM   6194  C CA  . ASP C 1 90  ? 53.937  19.978  51.361  1.00 28.59 ? 89   ASP C CA  1 
ATOM   6195  C C   . ASP C 1 90  ? 53.645  18.659  50.645  1.00 28.55 ? 89   ASP C C   1 
ATOM   6196  O O   . ASP C 1 90  ? 54.270  17.625  50.910  1.00 28.11 ? 89   ASP C O   1 
ATOM   6197  C CB  . ASP C 1 90  ? 53.743  19.909  52.875  1.00 29.34 ? 89   ASP C CB  1 
ATOM   6198  C CG  . ASP C 1 90  ? 52.297  19.670  53.277  1.00 29.70 ? 89   ASP C CG  1 
ATOM   6199  O OD1 . ASP C 1 90  ? 51.525  19.052  52.527  1.00 29.68 ? 89   ASP C OD1 1 
ATOM   6200  O OD2 . ASP C 1 90  ? 51.958  20.135  54.382  1.00 29.26 ? 89   ASP C OD2 1 
ATOM   6201  N N   . GLY C 1 91  ? 52.666  18.756  49.750  1.00 28.61 ? 90   GLY C N   1 
ATOM   6202  C CA  . GLY C 1 91  ? 52.256  17.635  48.914  1.00 28.62 ? 90   GLY C CA  1 
ATOM   6203  C C   . GLY C 1 91  ? 51.319  16.656  49.590  1.00 28.53 ? 90   GLY C C   1 
ATOM   6204  O O   . GLY C 1 91  ? 51.451  15.434  49.368  1.00 29.23 ? 90   GLY C O   1 
ATOM   6205  N N   . THR C 1 92  ? 50.395  17.163  50.382  1.00 28.31 ? 91   THR C N   1 
ATOM   6206  C CA  . THR C 1 92  ? 49.354  16.354  51.034  1.00 27.66 ? 91   THR C CA  1 
ATOM   6207  C C   . THR C 1 92  ? 48.039  16.583  50.277  1.00 26.95 ? 91   THR C C   1 
ATOM   6208  O O   . THR C 1 92  ? 47.548  17.725  50.326  1.00 27.58 ? 91   THR C O   1 
ATOM   6209  C CB  . THR C 1 92  ? 49.115  16.797  52.535  1.00 28.49 ? 91   THR C CB  1 
ATOM   6210  O OG1 . THR C 1 92  ? 50.407  16.902  53.199  1.00 29.05 ? 91   THR C OG1 1 
ATOM   6211  C CG2 . THR C 1 92  ? 48.150  15.852  53.264  1.00 28.91 ? 91   THR C CG2 1 
ATOM   6212  N N   . PRO C 1 93  ? 47.519  15.553  49.659  1.00 26.53 ? 92   PRO C N   1 
ATOM   6213  C CA  . PRO C 1 93  ? 46.283  15.663  48.858  1.00 26.31 ? 92   PRO C CA  1 
ATOM   6214  C C   . PRO C 1 93  ? 45.173  16.347  49.636  1.00 25.91 ? 92   PRO C C   1 
ATOM   6215  O O   . PRO C 1 93  ? 44.893  15.987  50.791  1.00 26.13 ? 92   PRO C O   1 
ATOM   6216  C CB  . PRO C 1 93  ? 45.937  14.229  48.479  1.00 26.33 ? 92   PRO C CB  1 
ATOM   6217  C CG  . PRO C 1 93  ? 47.242  13.472  48.611  1.00 26.61 ? 92   PRO C CG  1 
ATOM   6218  C CD  . PRO C 1 93  ? 47.965  14.156  49.763  1.00 26.63 ? 92   PRO C CD  1 
ATOM   6219  N N   . PHE C 1 94  ? 44.540  17.315  49.000  1.00 25.94 ? 93   PHE C N   1 
ATOM   6220  C CA  . PHE C 1 94  ? 43.437  18.083  49.596  1.00 25.80 ? 93   PHE C CA  1 
ATOM   6221  C C   . PHE C 1 94  ? 42.381  17.138  50.194  1.00 25.85 ? 93   PHE C C   1 
ATOM   6222  O O   . PHE C 1 94  ? 41.847  17.405  51.291  1.00 25.76 ? 93   PHE C O   1 
ATOM   6223  C CB  . PHE C 1 94  ? 42.812  19.086  48.646  1.00 24.81 ? 93   PHE C CB  1 
ATOM   6224  C CG  . PHE C 1 94  ? 43.569  20.315  48.284  1.00 24.99 ? 93   PHE C CG  1 
ATOM   6225  C CD1 . PHE C 1 94  ? 44.521  20.868  49.132  1.00 24.10 ? 93   PHE C CD1 1 
ATOM   6226  C CD2 . PHE C 1 94  ? 43.316  20.937  47.048  1.00 24.33 ? 93   PHE C CD2 1 
ATOM   6227  C CE1 . PHE C 1 94  ? 45.208  22.033  48.784  1.00 23.02 ? 93   PHE C CE1 1 
ATOM   6228  C CE2 . PHE C 1 94  ? 43.985  22.097  46.681  1.00 24.45 ? 93   PHE C CE2 1 
ATOM   6229  C CZ  . PHE C 1 94  ? 44.937  22.645  47.548  1.00 23.81 ? 93   PHE C CZ  1 
ATOM   6230  N N   . ALA C 1 95  ? 42.104  16.072  49.469  1.00 25.67 ? 94   ALA C N   1 
ATOM   6231  C CA  . ALA C 1 95  ? 41.083  15.095  49.859  1.00 25.83 ? 94   ALA C CA  1 
ATOM   6232  C C   . ALA C 1 95  ? 41.437  14.472  51.208  1.00 26.33 ? 94   ALA C C   1 
ATOM   6233  O O   . ALA C 1 95  ? 40.556  14.180  52.034  1.00 26.45 ? 94   ALA C O   1 
ATOM   6234  C CB  . ALA C 1 95  ? 40.923  14.022  48.798  1.00 25.35 ? 94   ALA C CB  1 
ATOM   6235  N N   . GLU C 1 96  ? 42.734  14.260  51.368  1.00 26.65 ? 95   GLU C N   1 
ATOM   6236  C CA  . GLU C 1 96  ? 43.291  13.652  52.576  1.00 26.75 ? 95   GLU C CA  1 
ATOM   6237  C C   . GLU C 1 96  ? 43.187  14.614  53.750  1.00 25.94 ? 95   GLU C C   1 
ATOM   6238  O O   . GLU C 1 96  ? 42.791  14.222  54.865  1.00 26.51 ? 95   GLU C O   1 
ATOM   6239  C CB  . GLU C 1 96  ? 44.748  13.239  52.395  1.00 29.44 ? 95   GLU C CB  1 
ATOM   6240  C CG  . GLU C 1 96  ? 45.416  12.590  53.608  1.00 33.69 ? 95   GLU C CG  1 
ATOM   6241  C CD  . GLU C 1 96  ? 46.839  12.156  53.381  1.00 35.44 ? 95   GLU C CD  1 
ATOM   6242  O OE1 . GLU C 1 96  ? 47.152  11.328  52.541  1.00 37.49 ? 95   GLU C OE1 1 
ATOM   6243  O OE2 . GLU C 1 96  ? 47.630  12.744  54.150  1.00 37.47 ? 95   GLU C OE2 1 
ATOM   6244  N N   . ILE C 1 97  ? 43.506  15.864  53.486  1.00 25.31 ? 96   ILE C N   1 
ATOM   6245  C CA  . ILE C 1 97  ? 43.430  16.937  54.472  1.00 24.84 ? 96   ILE C CA  1 
ATOM   6246  C C   . ILE C 1 97  ? 42.027  17.000  55.074  1.00 24.92 ? 96   ILE C C   1 
ATOM   6247  O O   . ILE C 1 97  ? 41.873  16.878  56.298  1.00 24.57 ? 96   ILE C O   1 
ATOM   6248  C CB  . ILE C 1 97  ? 43.887  18.309  53.881  1.00 24.30 ? 96   ILE C CB  1 
ATOM   6249  C CG1 . ILE C 1 97  ? 45.389  18.267  53.490  1.00 24.48 ? 96   ILE C CG1 1 
ATOM   6250  C CG2 . ILE C 1 97  ? 43.588  19.493  54.840  1.00 24.47 ? 96   ILE C CG2 1 
ATOM   6251  C CD1 . ILE C 1 97  ? 45.867  19.589  52.812  1.00 22.57 ? 96   ILE C CD1 1 
ATOM   6252  N N   . LEU C 1 98  ? 41.039  17.187  54.206  1.00 24.34 ? 97   LEU C N   1 
ATOM   6253  C CA  . LEU C 1 98  ? 39.638  17.305  54.608  1.00 24.23 ? 97   LEU C CA  1 
ATOM   6254  C C   . LEU C 1 98  ? 39.131  16.100  55.380  1.00 24.47 ? 97   LEU C C   1 
ATOM   6255  O O   . LEU C 1 98  ? 38.486  16.263  56.441  1.00 25.08 ? 97   LEU C O   1 
ATOM   6256  C CB  . LEU C 1 98  ? 38.804  17.656  53.354  1.00 21.78 ? 97   LEU C CB  1 
ATOM   6257  C CG  . LEU C 1 98  ? 39.060  19.027  52.757  1.00 21.24 ? 97   LEU C CG  1 
ATOM   6258  C CD1 . LEU C 1 98  ? 38.235  19.270  51.500  1.00 20.81 ? 97   LEU C CD1 1 
ATOM   6259  C CD2 . LEU C 1 98  ? 38.727  20.093  53.805  1.00 20.63 ? 97   LEU C CD2 1 
ATOM   6260  N N   . LYS C 1 99  ? 39.422  14.913  54.901  1.00 25.16 ? 98   LYS C N   1 
ATOM   6261  C CA  . LYS C 1 99  ? 38.944  13.670  55.505  1.00 25.98 ? 98   LYS C CA  1 
ATOM   6262  C C   . LYS C 1 99  ? 39.492  13.437  56.908  1.00 26.55 ? 98   LYS C C   1 
ATOM   6263  O O   . LYS C 1 99  ? 38.770  12.878  57.768  1.00 26.32 ? 98   LYS C O   1 
ATOM   6264  C CB  . LYS C 1 99  ? 39.226  12.463  54.624  1.00 27.02 ? 98   LYS C CB  1 
ATOM   6265  C CG  . LYS C 1 99  ? 38.437  12.505  53.290  1.00 28.47 ? 98   LYS C CG  1 
ATOM   6266  C CD  . LYS C 1 99  ? 38.261  11.081  52.778  1.00 29.62 ? 98   LYS C CD  1 
ATOM   6267  C CE  . LYS C 1 99  ? 36.886  10.843  52.201  1.00 29.10 ? 98   LYS C CE  1 
ATOM   6268  N NZ  . LYS C 1 99  ? 36.486  9.428   52.415  1.00 30.38 ? 98   LYS C NZ  1 
ATOM   6269  N N   . LYS C 1 100 ? 40.722  13.833  57.129  1.00 26.90 ? 99   LYS C N   1 
ATOM   6270  C CA  . LYS C 1 100 ? 41.375  13.652  58.444  1.00 27.29 ? 99   LYS C CA  1 
ATOM   6271  C C   . LYS C 1 100 ? 40.652  14.489  59.486  1.00 27.41 ? 99   LYS C C   1 
ATOM   6272  O O   . LYS C 1 100 ? 40.555  14.107  60.666  1.00 27.77 ? 99   LYS C O   1 
ATOM   6273  C CB  . LYS C 1 100 ? 42.861  13.982  58.388  1.00 29.39 ? 99   LYS C CB  1 
ATOM   6274  C CG  . LYS C 1 100 ? 43.743  12.779  58.743  1.00 32.34 ? 99   LYS C CG  1 
ATOM   6275  C CD  . LYS C 1 100 ? 44.756  12.463  57.652  1.00 33.89 ? 99   LYS C CD  1 
ATOM   6276  C CE  . LYS C 1 100 ? 44.840  10.958  57.451  1.00 35.28 ? 99   LYS C CE  1 
ATOM   6277  N NZ  . LYS C 1 100 ? 46.083  10.588  56.705  1.00 37.62 ? 99   LYS C NZ  1 
ATOM   6278  N N   . LYS C 1 101 ? 40.138  15.616  59.027  1.00 26.74 ? 100  LYS C N   1 
ATOM   6279  C CA  . LYS C 1 101 ? 39.360  16.548  59.826  1.00 26.16 ? 100  LYS C CA  1 
ATOM   6280  C C   . LYS C 1 101 ? 37.914  16.103  59.990  1.00 25.49 ? 100  LYS C C   1 
ATOM   6281  O O   . LYS C 1 101 ? 37.109  16.795  60.631  1.00 25.64 ? 100  LYS C O   1 
ATOM   6282  C CB  . LYS C 1 101 ? 39.381  17.957  59.222  1.00 26.63 ? 100  LYS C CB  1 
ATOM   6283  C CG  . LYS C 1 101 ? 40.785  18.552  59.201  1.00 26.91 ? 100  LYS C CG  1 
ATOM   6284  C CD  . LYS C 1 101 ? 40.861  19.849  58.416  1.00 26.42 ? 100  LYS C CD  1 
ATOM   6285  C CE  . LYS C 1 101 ? 42.289  20.378  58.381  1.00 25.93 ? 100  LYS C CE  1 
ATOM   6286  N NZ  . LYS C 1 101 ? 42.256  21.871  58.381  1.00 25.79 ? 100  LYS C NZ  1 
ATOM   6287  N N   . GLY C 1 102 ? 37.583  14.968  59.402  1.00 24.90 ? 101  GLY C N   1 
ATOM   6288  C CA  . GLY C 1 102 ? 36.243  14.387  59.486  1.00 24.08 ? 101  GLY C CA  1 
ATOM   6289  C C   . GLY C 1 102 ? 35.235  15.053  58.553  1.00 23.02 ? 101  GLY C C   1 
ATOM   6290  O O   . GLY C 1 102 ? 34.012  14.847  58.735  1.00 22.90 ? 101  GLY C O   1 
ATOM   6291  N N   . ILE C 1 103 ? 35.720  15.805  57.583  1.00 21.91 ? 102  ILE C N   1 
ATOM   6292  C CA  . ILE C 1 103 ? 34.833  16.475  56.611  1.00 21.03 ? 102  ILE C CA  1 
ATOM   6293  C C   . ILE C 1 103 ? 34.534  15.512  55.463  1.00 20.28 ? 102  ILE C C   1 
ATOM   6294  O O   . ILE C 1 103 ? 35.430  14.821  54.962  1.00 20.60 ? 102  ILE C O   1 
ATOM   6295  C CB  . ILE C 1 103 ? 35.388  17.860  56.180  1.00 20.48 ? 102  ILE C CB  1 
ATOM   6296  C CG1 . ILE C 1 103 ? 35.637  18.749  57.428  1.00 20.24 ? 102  ILE C CG1 1 
ATOM   6297  C CG2 . ILE C 1 103 ? 34.455  18.599  55.173  1.00 20.74 ? 102  ILE C CG2 1 
ATOM   6298  C CD1 . ILE C 1 103 ? 36.187  20.163  57.097  1.00 20.05 ? 102  ILE C CD1 1 
ATOM   6299  N N   . ILE C 1 104 ? 33.263  15.467  55.083  1.00 19.46 ? 103  ILE C N   1 
ATOM   6300  C CA  . ILE C 1 104 ? 32.770  14.600  54.000  1.00 17.81 ? 103  ILE C CA  1 
ATOM   6301  C C   . ILE C 1 104 ? 32.930  15.321  52.659  1.00 16.92 ? 103  ILE C C   1 
ATOM   6302  O O   . ILE C 1 104 ? 32.666  16.534  52.575  1.00 17.18 ? 103  ILE C O   1 
ATOM   6303  C CB  . ILE C 1 104 ? 31.288  14.187  54.283  1.00 18.30 ? 103  ILE C CB  1 
ATOM   6304  C CG1 . ILE C 1 104 ? 31.194  13.498  55.679  1.00 18.51 ? 103  ILE C CG1 1 
ATOM   6305  C CG2 . ILE C 1 104 ? 30.683  13.255  53.194  1.00 17.07 ? 103  ILE C CG2 1 
ATOM   6306  C CD1 . ILE C 1 104 ? 29.718  13.248  56.104  1.00 19.10 ? 103  ILE C CD1 1 
ATOM   6307  N N   . LEU C 1 105 ? 33.340  14.579  51.657  1.00 16.52 ? 104  LEU C N   1 
ATOM   6308  C CA  . LEU C 1 105 ? 33.611  15.116  50.319  1.00 16.10 ? 104  LEU C CA  1 
ATOM   6309  C C   . LEU C 1 105 ? 32.416  14.902  49.368  1.00 15.47 ? 104  LEU C C   1 
ATOM   6310  O O   . LEU C 1 105 ? 31.933  13.777  49.236  1.00 14.85 ? 104  LEU C O   1 
ATOM   6311  C CB  . LEU C 1 105 ? 34.854  14.406  49.761  1.00 16.83 ? 104  LEU C CB  1 
ATOM   6312  C CG  . LEU C 1 105 ? 36.174  14.517  50.492  1.00 17.28 ? 104  LEU C CG  1 
ATOM   6313  C CD1 . LEU C 1 105 ? 37.323  14.166  49.541  1.00 17.26 ? 104  LEU C CD1 1 
ATOM   6314  C CD2 . LEU C 1 105 ? 36.345  15.930  51.034  1.00 17.69 ? 104  LEU C CD2 1 
ATOM   6315  N N   . GLY C 1 106 ? 32.055  15.991  48.733  1.00 16.38 ? 105  GLY C N   1 
ATOM   6316  C CA  . GLY C 1 106 ? 31.027  16.055  47.687  1.00 15.82 ? 105  GLY C CA  1 
ATOM   6317  C C   . GLY C 1 106 ? 31.697  16.534  46.381  1.00 15.43 ? 105  GLY C C   1 
ATOM   6318  O O   . GLY C 1 106 ? 32.727  17.225  46.441  1.00 15.59 ? 105  GLY C O   1 
ATOM   6319  N N   . ILE C 1 107 ? 31.086  16.170  45.277  1.00 14.30 ? 106  ILE C N   1 
ATOM   6320  C CA  . ILE C 1 107 ? 31.569  16.443  43.921  1.00 13.84 ? 106  ILE C CA  1 
ATOM   6321  C C   . ILE C 1 107 ? 30.413  16.888  43.013  1.00 13.66 ? 106  ILE C C   1 
ATOM   6322  O O   . ILE C 1 107 ? 29.332  16.270  43.018  1.00 12.66 ? 106  ILE C O   1 
ATOM   6323  C CB  . ILE C 1 107 ? 32.298  15.175  43.361  1.00 13.29 ? 106  ILE C CB  1 
ATOM   6324  C CG1 . ILE C 1 107 ? 32.847  15.430  41.931  1.00 14.16 ? 106  ILE C CG1 1 
ATOM   6325  C CG2 . ILE C 1 107 ? 31.434  13.895  43.421  1.00 13.03 ? 106  ILE C CG2 1 
ATOM   6326  C CD1 . ILE C 1 107 ? 33.965  16.496  41.839  1.00 15.57 ? 106  ILE C CD1 1 
ATOM   6327  N N   . LYS C 1 108 ? 30.683  17.965  42.305  1.00 13.29 ? 107  LYS C N   1 
ATOM   6328  C CA  . LYS C 1 108 ? 29.728  18.513  41.319  1.00 13.78 ? 107  LYS C CA  1 
ATOM   6329  C C   . LYS C 1 108 ? 29.840  17.652  40.055  1.00 13.57 ? 107  LYS C C   1 
ATOM   6330  O O   . LYS C 1 108 ? 30.961  17.509  39.519  1.00 13.38 ? 107  LYS C O   1 
ATOM   6331  C CB  . LYS C 1 108 ? 30.041  19.961  40.993  1.00 16.99 ? 107  LYS C CB  1 
ATOM   6332  C CG  . LYS C 1 108 ? 29.020  20.586  40.018  1.00 19.32 ? 107  LYS C CG  1 
ATOM   6333  C CD  . LYS C 1 108 ? 29.739  21.173  38.816  1.00 20.70 ? 107  LYS C CD  1 
ATOM   6334  C CE  . LYS C 1 108 ? 30.694  22.284  39.201  1.00 21.73 ? 107  LYS C CE  1 
ATOM   6335  N NZ  . LYS C 1 108 ? 29.944  23.461  39.708  1.00 24.03 ? 107  LYS C NZ  1 
ATOM   6336  N N   . VAL C 1 109 ? 28.725  17.079  39.643  1.00 12.98 ? 108  VAL C N   1 
ATOM   6337  C CA  . VAL C 1 109 ? 28.704  16.145  38.520  1.00 12.44 ? 108  VAL C CA  1 
ATOM   6338  C C   . VAL C 1 109 ? 27.929  16.624  37.298  1.00 12.33 ? 108  VAL C C   1 
ATOM   6339  O O   . VAL C 1 109 ? 28.006  15.876  36.291  1.00 13.16 ? 108  VAL C O   1 
ATOM   6340  C CB  . VAL C 1 109 ? 28.260  14.734  38.951  1.00 12.66 ? 108  VAL C CB  1 
ATOM   6341  C CG1 . VAL C 1 109 ? 29.152  14.151  40.055  1.00 11.28 ? 108  VAL C CG1 1 
ATOM   6342  C CG2 . VAL C 1 109 ? 26.787  14.668  39.317  1.00 12.91 ? 108  VAL C CG2 1 
ATOM   6343  N N   . ASP C 1 110 ? 27.215  17.715  37.359  1.00 11.50 ? 109  ASP C N   1 
ATOM   6344  C CA  . ASP C 1 110 ? 26.506  18.200  36.146  1.00 11.38 ? 109  ASP C CA  1 
ATOM   6345  C C   . ASP C 1 110 ? 27.552  18.798  35.187  1.00 11.57 ? 109  ASP C C   1 
ATOM   6346  O O   . ASP C 1 110 ? 28.673  19.163  35.576  1.00 10.36 ? 109  ASP C O   1 
ATOM   6347  C CB  . ASP C 1 110 ? 25.381  19.159  36.449  1.00 10.34 ? 109  ASP C CB  1 
ATOM   6348  C CG  . ASP C 1 110 ? 25.784  20.506  36.993  1.00 11.60 ? 109  ASP C CG  1 
ATOM   6349  O OD1 . ASP C 1 110 ? 26.118  21.391  36.173  1.00 10.66 ? 109  ASP C OD1 1 
ATOM   6350  O OD2 . ASP C 1 110 ? 25.760  20.728  38.219  1.00 11.74 ? 109  ASP C OD2 1 
ATOM   6351  N N   . LYS C 1 111 ? 27.083  18.940  33.958  1.00 11.35 ? 110  LYS C N   1 
ATOM   6352  C CA  . LYS C 1 111 ? 27.923  19.520  32.886  1.00 11.32 ? 110  LYS C CA  1 
ATOM   6353  C C   . LYS C 1 111 ? 27.305  20.788  32.346  1.00 10.88 ? 110  LYS C C   1 
ATOM   6354  O O   . LYS C 1 111 ? 27.440  21.131  31.152  1.00 10.57 ? 110  LYS C O   1 
ATOM   6355  C CB  . LYS C 1 111 ? 28.159  18.486  31.804  1.00 13.23 ? 110  LYS C CB  1 
ATOM   6356  C CG  . LYS C 1 111 ? 28.989  17.263  32.201  1.00 14.85 ? 110  LYS C CG  1 
ATOM   6357  C CD  . LYS C 1 111 ? 29.236  16.375  30.986  1.00 18.11 ? 110  LYS C CD  1 
ATOM   6358  C CE  . LYS C 1 111 ? 29.434  14.920  31.260  1.00 19.70 ? 110  LYS C CE  1 
ATOM   6359  N NZ  . LYS C 1 111 ? 29.107  14.079  30.055  1.00 19.34 ? 110  LYS C NZ  1 
ATOM   6360  N N   . GLY C 1 112 ? 26.593  21.503  33.206  1.00 10.09 ? 111  GLY C N   1 
ATOM   6361  C CA  . GLY C 1 112 ? 26.048  22.832  32.909  1.00 9.98  ? 111  GLY C CA  1 
ATOM   6362  C C   . GLY C 1 112 ? 24.690  22.777  32.198  1.00 9.67  ? 111  GLY C C   1 
ATOM   6363  O O   . GLY C 1 112 ? 24.170  21.701  31.920  1.00 9.02  ? 111  GLY C O   1 
ATOM   6364  N N   . VAL C 1 113 ? 24.169  23.958  31.912  1.00 9.97  ? 112  VAL C N   1 
ATOM   6365  C CA  . VAL C 1 113 ? 22.829  24.131  31.336  1.00 10.71 ? 112  VAL C CA  1 
ATOM   6366  C C   . VAL C 1 113 ? 22.916  24.214  29.802  1.00 10.84 ? 112  VAL C C   1 
ATOM   6367  O O   . VAL C 1 113 ? 23.937  24.631  29.270  1.00 10.59 ? 112  VAL C O   1 
ATOM   6368  C CB  . VAL C 1 113 ? 22.065  25.318  31.934  1.00 9.45  ? 112  VAL C CB  1 
ATOM   6369  C CG1 . VAL C 1 113 ? 21.763  25.138  33.423  1.00 10.90 ? 112  VAL C CG1 1 
ATOM   6370  C CG2 . VAL C 1 113 ? 22.701  26.666  31.680  1.00 11.66 ? 112  VAL C CG2 1 
ATOM   6371  N N   . VAL C 1 114 ? 21.826  23.794  29.190  1.00 11.17 ? 113  VAL C N   1 
ATOM   6372  C CA  . VAL C 1 114 ? 21.642  23.818  27.725  1.00 10.62 ? 113  VAL C CA  1 
ATOM   6373  C C   . VAL C 1 114 ? 20.208  24.319  27.454  1.00 10.65 ? 113  VAL C C   1 
ATOM   6374  O O   . VAL C 1 114 ? 19.295  24.006  28.239  1.00 10.26 ? 113  VAL C O   1 
ATOM   6375  C CB  . VAL C 1 114 ? 21.930  22.454  27.106  1.00 10.78 ? 113  VAL C CB  1 
ATOM   6376  C CG1 . VAL C 1 114 ? 23.409  22.058  27.068  1.00 8.95  ? 113  VAL C CG1 1 
ATOM   6377  C CG2 . VAL C 1 114 ? 21.111  21.326  27.718  1.00 8.68  ? 113  VAL C CG2 1 
ATOM   6378  N N   . PRO C 1 115 ? 20.062  25.086  26.392  1.00 10.49 ? 114  PRO C N   1 
ATOM   6379  C CA  . PRO C 1 115 ? 18.774  25.673  26.013  1.00 9.91  ? 114  PRO C CA  1 
ATOM   6380  C C   . PRO C 1 115 ? 17.760  24.649  25.558  1.00 8.88  ? 114  PRO C C   1 
ATOM   6381  O O   . PRO C 1 115 ? 18.062  23.645  24.899  1.00 9.39  ? 114  PRO C O   1 
ATOM   6382  C CB  . PRO C 1 115 ? 19.138  26.676  24.915  1.00 11.10 ? 114  PRO C CB  1 
ATOM   6383  C CG  . PRO C 1 115 ? 20.357  26.086  24.256  1.00 10.39 ? 114  PRO C CG  1 
ATOM   6384  C CD  . PRO C 1 115 ? 21.099  25.357  25.368  1.00 10.73 ? 114  PRO C CD  1 
ATOM   6385  N N   . LEU C 1 116 ? 16.503  24.899  25.947  1.00 8.99  ? 115  LEU C N   1 
ATOM   6386  C CA  . LEU C 1 116 ? 15.354  24.106  25.447  1.00 7.87  ? 115  LEU C CA  1 
ATOM   6387  C C   . LEU C 1 116 ? 14.885  24.812  24.158  1.00 7.58  ? 115  LEU C C   1 
ATOM   6388  O O   . LEU C 1 116 ? 14.404  25.965  24.204  1.00 7.52  ? 115  LEU C O   1 
ATOM   6389  C CB  . LEU C 1 116 ? 14.314  24.010  26.555  1.00 7.70  ? 115  LEU C CB  1 
ATOM   6390  C CG  . LEU C 1 116 ? 14.663  23.228  27.825  1.00 6.55  ? 115  LEU C CG  1 
ATOM   6391  C CD1 . LEU C 1 116 ? 13.564  23.416  28.871  1.00 8.14  ? 115  LEU C CD1 1 
ATOM   6392  C CD2 . LEU C 1 116 ? 14.770  21.750  27.451  1.00 5.35  ? 115  LEU C CD2 1 
ATOM   6393  N N   . PHE C 1 117 ? 15.085  24.118  23.055  1.00 8.31  ? 116  PHE C N   1 
ATOM   6394  C CA  . PHE C 1 117 ? 14.765  24.676  21.708  1.00 8.87  ? 116  PHE C CA  1 
ATOM   6395  C C   . PHE C 1 117 ? 13.265  24.961  21.635  1.00 8.52  ? 116  PHE C C   1 
ATOM   6396  O O   . PHE C 1 117 ? 12.456  24.072  21.957  1.00 9.26  ? 116  PHE C O   1 
ATOM   6397  C CB  . PHE C 1 117 ? 15.196  23.718  20.593  1.00 12.14 ? 116  PHE C CB  1 
ATOM   6398  C CG  . PHE C 1 117 ? 15.104  24.302  19.190  1.00 11.20 ? 116  PHE C CG  1 
ATOM   6399  C CD1 . PHE C 1 117 ? 15.798  25.451  18.868  1.00 13.72 ? 116  PHE C CD1 1 
ATOM   6400  C CD2 . PHE C 1 117 ? 14.340  23.652  18.225  1.00 14.50 ? 116  PHE C CD2 1 
ATOM   6401  C CE1 . PHE C 1 117 ? 15.746  25.989  17.582  1.00 13.80 ? 116  PHE C CE1 1 
ATOM   6402  C CE2 . PHE C 1 117 ? 14.244  24.177  16.923  1.00 13.11 ? 116  PHE C CE2 1 
ATOM   6403  C CZ  . PHE C 1 117 ? 14.963  25.340  16.617  1.00 14.08 ? 116  PHE C CZ  1 
ATOM   6404  N N   . GLY C 1 118 ? 12.925  26.166  21.266  1.00 9.05  ? 117  GLY C N   1 
ATOM   6405  C CA  . GLY C 1 118 ? 11.512  26.572  21.118  1.00 10.43 ? 117  GLY C CA  1 
ATOM   6406  C C   . GLY C 1 118 ? 10.968  27.221  22.384  1.00 10.22 ? 117  GLY C C   1 
ATOM   6407  O O   . GLY C 1 118 ? 9.928   27.905  22.350  1.00 10.28 ? 117  GLY C O   1 
ATOM   6408  N N   . SER C 1 119 ? 11.687  27.044  23.489  1.00 10.00 ? 118  SER C N   1 
ATOM   6409  C CA  . SER C 1 119 ? 11.246  27.631  24.774  1.00 10.78 ? 118  SER C CA  1 
ATOM   6410  C C   . SER C 1 119 ? 11.538  29.118  24.766  1.00 11.01 ? 118  SER C C   1 
ATOM   6411  O O   . SER C 1 119 ? 12.335  29.624  23.951  1.00 11.84 ? 118  SER C O   1 
ATOM   6412  C CB  . SER C 1 119 ? 11.935  26.937  25.954  1.00 9.64  ? 118  SER C CB  1 
ATOM   6413  O OG  . SER C 1 119 ? 13.187  27.576  26.204  1.00 8.41  ? 118  SER C OG  1 
ATOM   6414  N N   . GLU C 1 120 ? 10.892  29.836  25.666  1.00 11.54 ? 119  GLU C N   1 
ATOM   6415  C CA  . GLU C 1 120 ? 11.145  31.256  25.895  1.00 12.78 ? 119  GLU C CA  1 
ATOM   6416  C C   . GLU C 1 120 ? 12.340  31.447  26.819  1.00 13.38 ? 119  GLU C C   1 
ATOM   6417  O O   . GLU C 1 120 ? 12.236  31.892  27.979  1.00 13.50 ? 119  GLU C O   1 
ATOM   6418  C CB  . GLU C 1 120 ? 9.928   31.979  26.474  1.00 13.92 ? 119  GLU C CB  1 
ATOM   6419  C CG  . GLU C 1 120 ? 8.685   31.957  25.572  1.00 15.84 ? 119  GLU C CG  1 
ATOM   6420  C CD  . GLU C 1 120 ? 7.531   32.789  26.024  1.00 17.81 ? 119  GLU C CD  1 
ATOM   6421  O OE1 . GLU C 1 120 ? 7.190   32.916  27.180  1.00 17.51 ? 119  GLU C OE1 1 
ATOM   6422  O OE2 . GLU C 1 120 ? 6.927   33.346  25.076  1.00 20.10 ? 119  GLU C OE2 1 
ATOM   6423  N N   . ASP C 1 121 ? 13.487  31.079  26.283  1.00 13.31 ? 120  ASP C N   1 
ATOM   6424  C CA  . ASP C 1 121 ? 14.800  31.252  26.895  1.00 13.76 ? 120  ASP C CA  1 
ATOM   6425  C C   . ASP C 1 121 ? 14.972  30.423  28.173  1.00 13.00 ? 120  ASP C C   1 
ATOM   6426  O O   . ASP C 1 121 ? 15.585  30.923  29.131  1.00 13.03 ? 120  ASP C O   1 
ATOM   6427  C CB  . ASP C 1 121 ? 15.062  32.750  27.128  1.00 18.44 ? 120  ASP C CB  1 
ATOM   6428  C CG  . ASP C 1 121 ? 15.244  33.514  25.832  1.00 22.98 ? 120  ASP C CG  1 
ATOM   6429  O OD1 . ASP C 1 121 ? 15.597  32.979  24.770  1.00 25.67 ? 120  ASP C OD1 1 
ATOM   6430  O OD2 . ASP C 1 121 ? 14.993  34.743  25.867  1.00 27.65 ? 120  ASP C OD2 1 
ATOM   6431  N N   . GLU C 1 122 ? 14.461  29.221  28.184  1.00 11.44 ? 121  GLU C N   1 
ATOM   6432  C CA  . GLU C 1 122 ? 14.576  28.309  29.340  1.00 10.88 ? 121  GLU C CA  1 
ATOM   6433  C C   . GLU C 1 122 ? 15.612  27.243  29.075  1.00 10.20 ? 121  GLU C C   1 
ATOM   6434  O O   . GLU C 1 122 ? 16.027  27.075  27.915  1.00 10.35 ? 121  GLU C O   1 
ATOM   6435  C CB  . GLU C 1 122 ? 13.239  27.663  29.673  1.00 8.52  ? 121  GLU C CB  1 
ATOM   6436  C CG  . GLU C 1 122 ? 12.156  28.708  30.045  1.00 8.90  ? 121  GLU C CG  1 
ATOM   6437  C CD  . GLU C 1 122 ? 10.875  28.059  30.513  1.00 9.95  ? 121  GLU C CD  1 
ATOM   6438  O OE1 . GLU C 1 122 ? 10.215  27.531  29.593  1.00 9.47  ? 121  GLU C OE1 1 
ATOM   6439  O OE2 . GLU C 1 122 ? 10.597  28.069  31.693  1.00 8.20  ? 121  GLU C OE2 1 
ATOM   6440  N N   . VAL C 1 123 ? 16.027  26.558  30.134  1.00 9.07  ? 122  VAL C N   1 
ATOM   6441  C CA  . VAL C 1 123 ? 17.097  25.569  30.033  1.00 8.92  ? 122  VAL C CA  1 
ATOM   6442  C C   . VAL C 1 123 ? 16.791  24.291  30.802  1.00 8.91  ? 122  VAL C C   1 
ATOM   6443  O O   . VAL C 1 123 ? 15.883  24.218  31.625  1.00 9.97  ? 122  VAL C O   1 
ATOM   6444  C CB  . VAL C 1 123 ? 18.458  26.138  30.524  1.00 8.01  ? 122  VAL C CB  1 
ATOM   6445  C CG1 . VAL C 1 123 ? 18.934  27.346  29.750  1.00 6.14  ? 122  VAL C CG1 1 
ATOM   6446  C CG2 . VAL C 1 123 ? 18.416  26.458  32.020  1.00 7.52  ? 122  VAL C CG2 1 
ATOM   6447  N N   . THR C 1 124 ? 17.652  23.340  30.482  1.00 7.82  ? 123  THR C N   1 
ATOM   6448  C CA  . THR C 1 124 ? 17.753  22.111  31.281  1.00 7.96  ? 123  THR C CA  1 
ATOM   6449  C C   . THR C 1 124 ? 19.238  21.885  31.575  1.00 7.54  ? 123  THR C C   1 
ATOM   6450  O O   . THR C 1 124 ? 20.083  22.642  31.072  1.00 8.53  ? 123  THR C O   1 
ATOM   6451  C CB  . THR C 1 124 ? 17.062  20.888  30.624  1.00 7.62  ? 123  THR C CB  1 
ATOM   6452  O OG1 . THR C 1 124 ? 16.933  19.899  31.697  1.00 6.78  ? 123  THR C OG1 1 
ATOM   6453  C CG2 . THR C 1 124 ? 17.777  20.274  29.408  1.00 5.60  ? 123  THR C CG2 1 
ATOM   6454  N N   . THR C 1 125 ? 19.516  20.863  32.347  1.00 7.51  ? 124  THR C N   1 
ATOM   6455  C CA  . THR C 1 125 ? 20.906  20.555  32.712  1.00 7.46  ? 124  THR C CA  1 
ATOM   6456  C C   . THR C 1 125 ? 21.329  19.246  32.087  1.00 7.18  ? 124  THR C C   1 
ATOM   6457  O O   . THR C 1 125 ? 20.559  18.270  32.109  1.00 7.56  ? 124  THR C O   1 
ATOM   6458  C CB  . THR C 1 125 ? 21.097  20.555  34.284  1.00 5.99  ? 124  THR C CB  1 
ATOM   6459  O OG1 . THR C 1 125 ? 20.738  21.899  34.701  1.00 6.05  ? 124  THR C OG1 1 
ATOM   6460  C CG2 . THR C 1 125 ? 22.517  20.145  34.694  1.00 5.42  ? 124  THR C CG2 1 
ATOM   6461  N N   . GLN C 1 126 ? 22.554  19.235  31.579  1.00 7.16  ? 125  GLN C N   1 
ATOM   6462  C CA  . GLN C 1 126 ? 23.121  17.986  31.002  1.00 7.59  ? 125  GLN C CA  1 
ATOM   6463  C C   . GLN C 1 126 ? 24.211  17.416  31.895  1.00 8.29  ? 125  GLN C C   1 
ATOM   6464  O O   . GLN C 1 126 ? 24.718  18.103  32.806  1.00 9.49  ? 125  GLN C O   1 
ATOM   6465  C CB  . GLN C 1 126 ? 23.645  18.267  29.583  1.00 9.43  ? 125  GLN C CB  1 
ATOM   6466  C CG  . GLN C 1 126 ? 24.788  19.266  29.586  1.00 9.80  ? 125  GLN C CG  1 
ATOM   6467  C CD  . GLN C 1 126 ? 25.618  19.236  28.315  1.00 12.94 ? 125  GLN C CD  1 
ATOM   6468  O OE1 . GLN C 1 126 ? 25.204  18.721  27.284  1.00 12.55 ? 125  GLN C OE1 1 
ATOM   6469  N NE2 . GLN C 1 126 ? 26.822  19.802  28.416  1.00 13.29 ? 125  GLN C NE2 1 
ATOM   6470  N N   . GLY C 1 127 ? 24.548  16.165  31.666  1.00 8.34  ? 126  GLY C N   1 
ATOM   6471  C CA  . GLY C 1 127 ? 25.593  15.437  32.351  1.00 7.44  ? 126  GLY C CA  1 
ATOM   6472  C C   . GLY C 1 127 ? 25.291  14.043  32.796  1.00 7.26  ? 126  GLY C C   1 
ATOM   6473  O O   . GLY C 1 127 ? 26.076  13.486  33.604  1.00 7.02  ? 126  GLY C O   1 
ATOM   6474  N N   . LEU C 1 128 ? 24.201  13.435  32.312  1.00 7.08  ? 127  LEU C N   1 
ATOM   6475  C CA  . LEU C 1 128 ? 23.885  12.043  32.638  1.00 6.98  ? 127  LEU C CA  1 
ATOM   6476  C C   . LEU C 1 128 ? 24.798  11.017  31.978  1.00 7.01  ? 127  LEU C C   1 
ATOM   6477  O O   . LEU C 1 128 ? 24.892  9.868   32.458  1.00 6.33  ? 127  LEU C O   1 
ATOM   6478  C CB  . LEU C 1 128 ? 22.419  11.729  32.284  1.00 7.49  ? 127  LEU C CB  1 
ATOM   6479  C CG  . LEU C 1 128 ? 21.302  12.576  32.867  1.00 7.91  ? 127  LEU C CG  1 
ATOM   6480  C CD1 . LEU C 1 128 ? 19.954  12.086  32.318  1.00 6.37  ? 127  LEU C CD1 1 
ATOM   6481  C CD2 . LEU C 1 128 ? 21.315  12.430  34.388  1.00 7.62  ? 127  LEU C CD2 1 
ATOM   6482  N N   . ASP C 1 129 ? 25.395  11.357  30.833  1.00 7.74  ? 128  ASP C N   1 
ATOM   6483  C CA  . ASP C 1 129 ? 26.197  10.390  30.079  1.00 7.37  ? 128  ASP C CA  1 
ATOM   6484  C C   . ASP C 1 129 ? 27.381  9.892   30.934  1.00 8.01  ? 128  ASP C C   1 
ATOM   6485  O O   . ASP C 1 129 ? 28.187  10.720  31.364  1.00 8.05  ? 128  ASP C O   1 
ATOM   6486  C CB  . ASP C 1 129 ? 26.666  10.930  28.725  1.00 8.82  ? 128  ASP C CB  1 
ATOM   6487  C CG  . ASP C 1 129 ? 25.500  11.222  27.783  1.00 8.99  ? 128  ASP C CG  1 
ATOM   6488  O OD1 . ASP C 1 129 ? 24.340  10.911  28.090  1.00 9.08  ? 128  ASP C OD1 1 
ATOM   6489  O OD2 . ASP C 1 129 ? 25.798  11.838  26.743  1.00 8.77  ? 128  ASP C OD2 1 
ATOM   6490  N N   . ASP C 1 130 ? 27.427  8.597   31.062  1.00 8.86  ? 129  ASP C N   1 
ATOM   6491  C CA  . ASP C 1 130 ? 28.395  7.800   31.805  1.00 11.16 ? 129  ASP C CA  1 
ATOM   6492  C C   . ASP C 1 130 ? 28.510  8.241   33.271  1.00 11.44 ? 129  ASP C C   1 
ATOM   6493  O O   . ASP C 1 130 ? 29.600  8.085   33.875  1.00 10.70 ? 129  ASP C O   1 
ATOM   6494  C CB  . ASP C 1 130 ? 29.767  7.763   31.121  1.00 13.59 ? 129  ASP C CB  1 
ATOM   6495  C CG  . ASP C 1 130 ? 29.690  7.281   29.677  1.00 14.49 ? 129  ASP C CG  1 
ATOM   6496  O OD1 . ASP C 1 130 ? 29.187  6.197   29.374  1.00 16.49 ? 129  ASP C OD1 1 
ATOM   6497  O OD2 . ASP C 1 130 ? 30.186  8.071   28.857  1.00 18.97 ? 129  ASP C OD2 1 
ATOM   6498  N N   . LEU C 1 131 ? 27.412  8.744   33.798  1.00 11.43 ? 130  LEU C N   1 
ATOM   6499  C CA  . LEU C 1 131 ? 27.399  9.250   35.180  1.00 11.80 ? 130  LEU C CA  1 
ATOM   6500  C C   . LEU C 1 131 ? 27.676  8.125   36.173  1.00 12.64 ? 130  LEU C C   1 
ATOM   6501  O O   . LEU C 1 131 ? 28.377  8.397   37.185  1.00 12.68 ? 130  LEU C O   1 
ATOM   6502  C CB  . LEU C 1 131 ? 26.152  10.095  35.449  1.00 10.08 ? 130  LEU C CB  1 
ATOM   6503  C CG  . LEU C 1 131 ? 26.083  10.753  36.837  1.00 9.62  ? 130  LEU C CG  1 
ATOM   6504  C CD1 . LEU C 1 131 ? 27.194  11.786  37.027  1.00 8.22  ? 130  LEU C CD1 1 
ATOM   6505  C CD2 . LEU C 1 131 ? 24.729  11.444  37.018  1.00 8.64  ? 130  LEU C CD2 1 
ATOM   6506  N N   . ALA C 1 132 ? 27.180  6.940   35.916  1.00 13.49 ? 131  ALA C N   1 
ATOM   6507  C CA  . ALA C 1 132 ? 27.370  5.802   36.832  1.00 14.25 ? 131  ALA C CA  1 
ATOM   6508  C C   . ALA C 1 132 ? 28.867  5.504   36.984  1.00 14.52 ? 131  ALA C C   1 
ATOM   6509  O O   . ALA C 1 132 ? 29.371  5.375   38.104  1.00 13.68 ? 131  ALA C O   1 
ATOM   6510  C CB  . ALA C 1 132 ? 26.599  4.585   36.388  1.00 14.86 ? 131  ALA C CB  1 
ATOM   6511  N N   . ALA C 1 133 ? 29.527  5.394   35.844  1.00 14.73 ? 132  ALA C N   1 
ATOM   6512  C CA  . ALA C 1 133 ? 30.965  5.092   35.805  1.00 14.75 ? 132  ALA C CA  1 
ATOM   6513  C C   . ALA C 1 133 ? 31.746  6.223   36.458  1.00 14.91 ? 132  ALA C C   1 
ATOM   6514  O O   . ALA C 1 133 ? 32.776  5.960   37.117  1.00 16.01 ? 132  ALA C O   1 
ATOM   6515  C CB  . ALA C 1 133 ? 31.450  4.808   34.388  1.00 15.67 ? 132  ALA C CB  1 
ATOM   6516  N N   . ARG C 1 134 ? 31.260  7.434   36.303  1.00 14.47 ? 133  ARG C N   1 
ATOM   6517  C CA  . ARG C 1 134 ? 31.895  8.612   36.902  1.00 14.45 ? 133  ARG C CA  1 
ATOM   6518  C C   . ARG C 1 134 ? 31.759  8.553   38.428  1.00 14.62 ? 133  ARG C C   1 
ATOM   6519  O O   . ARG C 1 134 ? 32.741  8.755   39.171  1.00 13.62 ? 133  ARG C O   1 
ATOM   6520  C CB  . ARG C 1 134 ? 31.356  9.920   36.331  1.00 17.21 ? 133  ARG C CB  1 
ATOM   6521  C CG  . ARG C 1 134 ? 32.159  10.461  35.166  1.00 19.72 ? 133  ARG C CG  1 
ATOM   6522  C CD  . ARG C 1 134 ? 31.493  11.227  34.138  1.00 21.70 ? 133  ARG C CD  1 
ATOM   6523  N NE  . ARG C 1 134 ? 30.982  12.520  34.344  1.00 24.78 ? 133  ARG C NE  1 
ATOM   6524  C CZ  . ARG C 1 134 ? 31.180  13.479  35.222  1.00 24.78 ? 133  ARG C CZ  1 
ATOM   6525  N NH1 . ARG C 1 134 ? 32.241  13.602  36.006  1.00 26.85 ? 133  ARG C NH1 1 
ATOM   6526  N NH2 . ARG C 1 134 ? 30.128  14.284  35.457  1.00 24.51 ? 133  ARG C NH2 1 
ATOM   6527  N N   . CYS C 1 135 ? 30.548  8.248   38.861  1.00 13.79 ? 134  CYS C N   1 
ATOM   6528  C CA  . CYS C 1 135 ? 30.221  8.152   40.291  1.00 14.74 ? 134  CYS C CA  1 
ATOM   6529  C C   . CYS C 1 135 ? 31.017  7.039   40.972  1.00 14.54 ? 134  CYS C C   1 
ATOM   6530  O O   . CYS C 1 135 ? 31.520  7.282   42.081  1.00 14.75 ? 134  CYS C O   1 
ATOM   6531  C CB  . CYS C 1 135 ? 28.715  7.997   40.504  1.00 13.24 ? 134  CYS C CB  1 
ATOM   6532  S SG  . CYS C 1 135 ? 27.784  9.524   40.340  1.00 14.04 ? 134  CYS C SG  1 
ATOM   6533  N N   . ALA C 1 136 ? 31.125  5.901   40.332  1.00 14.73 ? 135  ALA C N   1 
ATOM   6534  C CA  . ALA C 1 136 ? 31.871  4.743   40.819  1.00 15.16 ? 135  ALA C CA  1 
ATOM   6535  C C   . ALA C 1 136 ? 33.298  5.156   41.222  1.00 15.83 ? 135  ALA C C   1 
ATOM   6536  O O   . ALA C 1 136 ? 33.789  4.796   42.311  1.00 15.39 ? 135  ALA C O   1 
ATOM   6537  C CB  . ALA C 1 136 ? 31.912  3.630   39.791  1.00 14.16 ? 135  ALA C CB  1 
ATOM   6538  N N   . GLN C 1 137 ? 33.903  5.901   40.319  1.00 15.68 ? 136  GLN C N   1 
ATOM   6539  C CA  . GLN C 1 137 ? 35.269  6.414   40.431  1.00 15.56 ? 136  GLN C CA  1 
ATOM   6540  C C   . GLN C 1 137 ? 35.372  7.440   41.549  1.00 15.32 ? 136  GLN C C   1 
ATOM   6541  O O   . GLN C 1 137 ? 36.312  7.362   42.361  1.00 15.48 ? 136  GLN C O   1 
ATOM   6542  C CB  . GLN C 1 137 ? 35.798  6.991   39.104  1.00 16.36 ? 136  GLN C CB  1 
ATOM   6543  C CG  . GLN C 1 137 ? 37.256  7.453   39.208  1.00 18.57 ? 136  GLN C CG  1 
ATOM   6544  C CD  . GLN C 1 137 ? 38.201  6.335   39.541  1.00 18.77 ? 136  GLN C CD  1 
ATOM   6545  O OE1 . GLN C 1 137 ? 38.125  5.223   39.026  1.00 19.72 ? 136  GLN C OE1 1 
ATOM   6546  N NE2 . GLN C 1 137 ? 39.118  6.611   40.471  1.00 21.17 ? 136  GLN C NE2 1 
ATOM   6547  N N   . TYR C 1 138 ? 34.451  8.380   41.583  1.00 14.73 ? 137  TYR C N   1 
ATOM   6548  C CA  . TYR C 1 138 ? 34.388  9.435   42.590  1.00 14.52 ? 137  TYR C CA  1 
ATOM   6549  C C   . TYR C 1 138 ? 34.297  8.836   44.000  1.00 14.71 ? 137  TYR C C   1 
ATOM   6550  O O   . TYR C 1 138 ? 34.958  9.343   44.930  1.00 14.30 ? 137  TYR C O   1 
ATOM   6551  C CB  . TYR C 1 138 ? 33.298  10.467  42.298  1.00 13.62 ? 137  TYR C CB  1 
ATOM   6552  C CG  . TYR C 1 138 ? 33.590  11.456  41.194  1.00 14.14 ? 137  TYR C CG  1 
ATOM   6553  C CD1 . TYR C 1 138 ? 34.840  12.057  41.046  1.00 13.73 ? 137  TYR C CD1 1 
ATOM   6554  C CD2 . TYR C 1 138 ? 32.597  11.810  40.270  1.00 13.14 ? 137  TYR C CD2 1 
ATOM   6555  C CE1 . TYR C 1 138 ? 35.110  12.986  40.034  1.00 13.79 ? 137  TYR C CE1 1 
ATOM   6556  C CE2 . TYR C 1 138 ? 32.847  12.744  39.270  1.00 13.01 ? 137  TYR C CE2 1 
ATOM   6557  C CZ  . TYR C 1 138 ? 34.090  13.329  39.143  1.00 13.72 ? 137  TYR C CZ  1 
ATOM   6558  O OH  . TYR C 1 138 ? 34.298  14.244  38.131  1.00 12.04 ? 137  TYR C OH  1 
ATOM   6559  N N   . LYS C 1 139 ? 33.514  7.800   44.138  1.00 15.14 ? 138  LYS C N   1 
ATOM   6560  C CA  . LYS C 1 139 ? 33.305  7.070   45.403  1.00 15.95 ? 138  LYS C CA  1 
ATOM   6561  C C   . LYS C 1 139 ? 34.638  6.465   45.847  1.00 16.73 ? 138  LYS C C   1 
ATOM   6562  O O   . LYS C 1 139 ? 35.083  6.677   46.993  1.00 16.67 ? 138  LYS C O   1 
ATOM   6563  C CB  . LYS C 1 139 ? 32.233  6.026   45.277  1.00 13.90 ? 138  LYS C CB  1 
ATOM   6564  C CG  . LYS C 1 139 ? 31.899  5.183   46.512  1.00 13.80 ? 138  LYS C CG  1 
ATOM   6565  C CD  . LYS C 1 139 ? 31.114  6.012   47.520  1.00 13.73 ? 138  LYS C CD  1 
ATOM   6566  C CE  . LYS C 1 139 ? 30.481  5.143   48.610  1.00 13.56 ? 138  LYS C CE  1 
ATOM   6567  N NZ  . LYS C 1 139 ? 29.836  6.077   49.588  1.00 12.95 ? 138  LYS C NZ  1 
ATOM   6568  N N   . LYS C 1 140 ? 35.269  5.750   44.936  1.00 17.36 ? 139  LYS C N   1 
ATOM   6569  C CA  . LYS C 1 140 ? 36.596  5.168   45.160  1.00 18.39 ? 139  LYS C CA  1 
ATOM   6570  C C   . LYS C 1 140 ? 37.590  6.249   45.583  1.00 18.27 ? 139  LYS C C   1 
ATOM   6571  O O   . LYS C 1 140 ? 38.465  5.952   46.422  1.00 18.72 ? 139  LYS C O   1 
ATOM   6572  C CB  . LYS C 1 140 ? 37.187  4.426   43.979  1.00 20.45 ? 139  LYS C CB  1 
ATOM   6573  C CG  . LYS C 1 140 ? 36.345  3.289   43.416  1.00 24.14 ? 139  LYS C CG  1 
ATOM   6574  C CD  . LYS C 1 140 ? 37.145  2.502   42.381  1.00 25.88 ? 139  LYS C CD  1 
ATOM   6575  C CE  . LYS C 1 140 ? 36.430  1.238   41.951  1.00 27.33 ? 139  LYS C CE  1 
ATOM   6576  N NZ  . LYS C 1 140 ? 35.291  1.582   41.048  1.00 29.65 ? 139  LYS C NZ  1 
ATOM   6577  N N   . ASP C 1 141 ? 37.469  7.431   45.035  1.00 17.91 ? 140  ASP C N   1 
ATOM   6578  C CA  . ASP C 1 141 ? 38.361  8.555   45.297  1.00 18.49 ? 140  ASP C CA  1 
ATOM   6579  C C   . ASP C 1 141 ? 37.979  9.352   46.541  1.00 18.69 ? 140  ASP C C   1 
ATOM   6580  O O   . ASP C 1 141 ? 38.576  10.432  46.770  1.00 19.63 ? 140  ASP C O   1 
ATOM   6581  C CB  . ASP C 1 141 ? 38.507  9.454   44.062  1.00 19.90 ? 140  ASP C CB  1 
ATOM   6582  C CG  . ASP C 1 141 ? 39.276  8.814   42.921  1.00 20.38 ? 140  ASP C CG  1 
ATOM   6583  O OD1 . ASP C 1 141 ? 39.941  7.795   43.180  1.00 20.69 ? 140  ASP C OD1 1 
ATOM   6584  O OD2 . ASP C 1 141 ? 39.208  9.302   41.777  1.00 20.31 ? 140  ASP C OD2 1 
ATOM   6585  N N   . GLY C 1 142 ? 37.000  8.880   47.290  1.00 18.72 ? 141  GLY C N   1 
ATOM   6586  C CA  . GLY C 1 142 ? 36.643  9.435   48.583  1.00 17.81 ? 141  GLY C CA  1 
ATOM   6587  C C   . GLY C 1 142 ? 35.431  10.317  48.673  1.00 17.17 ? 141  GLY C C   1 
ATOM   6588  O O   . GLY C 1 142 ? 35.208  10.939  49.748  1.00 17.02 ? 141  GLY C O   1 
ATOM   6589  N N   . CYS C 1 143 ? 34.632  10.387  47.630  1.00 15.71 ? 142  CYS C N   1 
ATOM   6590  C CA  . CYS C 1 143 ? 33.430  11.260  47.615  1.00 14.98 ? 142  CYS C CA  1 
ATOM   6591  C C   . CYS C 1 143 ? 32.222  10.470  48.081  1.00 13.59 ? 142  CYS C C   1 
ATOM   6592  O O   . CYS C 1 143 ? 32.104  9.281   47.729  1.00 13.54 ? 142  CYS C O   1 
ATOM   6593  C CB  . CYS C 1 143 ? 33.229  11.845  46.221  1.00 15.45 ? 142  CYS C CB  1 
ATOM   6594  S SG  . CYS C 1 143 ? 34.465  13.074  45.743  1.00 18.01 ? 142  CYS C SG  1 
ATOM   6595  N N   . ASP C 1 144 ? 31.354  11.109  48.865  1.00 13.86 ? 143  ASP C N   1 
ATOM   6596  C CA  . ASP C 1 144 ? 30.176  10.383  49.366  1.00 13.58 ? 143  ASP C CA  1 
ATOM   6597  C C   . ASP C 1 144 ? 28.861  11.048  48.958  1.00 13.36 ? 143  ASP C C   1 
ATOM   6598  O O   . ASP C 1 144 ? 27.818  10.378  49.158  1.00 13.97 ? 143  ASP C O   1 
ATOM   6599  C CB  . ASP C 1 144 ? 30.214  10.112  50.875  1.00 14.07 ? 143  ASP C CB  1 
ATOM   6600  C CG  . ASP C 1 144 ? 31.211  9.055   51.285  1.00 14.09 ? 143  ASP C CG  1 
ATOM   6601  O OD1 . ASP C 1 144 ? 31.159  7.927   50.750  1.00 14.79 ? 143  ASP C OD1 1 
ATOM   6602  O OD2 . ASP C 1 144 ? 32.049  9.357   52.150  1.00 15.41 ? 143  ASP C OD2 1 
ATOM   6603  N N   . PHE C 1 145 ? 28.912  12.270  48.511  1.00 14.13 ? 144  PHE C N   1 
ATOM   6604  C CA  . PHE C 1 145 ? 27.708  12.989  48.027  1.00 13.85 ? 144  PHE C CA  1 
ATOM   6605  C C   . PHE C 1 145 ? 28.034  13.715  46.714  1.00 13.99 ? 144  PHE C C   1 
ATOM   6606  O O   . PHE C 1 145 ? 29.194  13.920  46.340  1.00 14.07 ? 144  PHE C O   1 
ATOM   6607  C CB  . PHE C 1 145 ? 27.082  13.887  49.066  1.00 13.16 ? 144  PHE C CB  1 
ATOM   6608  C CG  . PHE C 1 145 ? 27.756  15.161  49.449  1.00 13.66 ? 144  PHE C CG  1 
ATOM   6609  C CD1 . PHE C 1 145 ? 28.798  15.163  50.388  1.00 14.60 ? 144  PHE C CD1 1 
ATOM   6610  C CD2 . PHE C 1 145 ? 27.347  16.371  48.902  1.00 14.40 ? 144  PHE C CD2 1 
ATOM   6611  C CE1 . PHE C 1 145 ? 29.420  16.354  50.756  1.00 13.73 ? 144  PHE C CE1 1 
ATOM   6612  C CE2 . PHE C 1 145 ? 27.940  17.576  49.256  1.00 14.87 ? 144  PHE C CE2 1 
ATOM   6613  C CZ  . PHE C 1 145 ? 28.988  17.569  50.187  1.00 15.15 ? 144  PHE C CZ  1 
ATOM   6614  N N   . ALA C 1 146 ? 26.972  14.100  46.025  1.00 13.78 ? 145  ALA C N   1 
ATOM   6615  C CA  . ALA C 1 146 ? 27.076  14.732  44.701  1.00 12.76 ? 145  ALA C CA  1 
ATOM   6616  C C   . ALA C 1 146 ? 26.173  15.954  44.631  1.00 12.36 ? 145  ALA C C   1 
ATOM   6617  O O   . ALA C 1 146 ? 25.190  16.052  45.388  1.00 11.84 ? 145  ALA C O   1 
ATOM   6618  C CB  . ALA C 1 146 ? 26.739  13.711  43.618  1.00 13.85 ? 145  ALA C CB  1 
ATOM   6619  N N   . LYS C 1 147 ? 26.524  16.843  43.729  1.00 11.95 ? 146  LYS C N   1 
ATOM   6620  C CA  . LYS C 1 147 ? 25.822  18.096  43.444  1.00 11.89 ? 146  LYS C CA  1 
ATOM   6621  C C   . LYS C 1 147 ? 25.451  18.166  41.951  1.00 11.86 ? 146  LYS C C   1 
ATOM   6622  O O   . LYS C 1 147 ? 26.256  17.788  41.073  1.00 12.04 ? 146  LYS C O   1 
ATOM   6623  C CB  . LYS C 1 147 ? 26.690  19.274  43.833  1.00 12.70 ? 146  LYS C CB  1 
ATOM   6624  C CG  . LYS C 1 147 ? 26.152  20.673  43.631  1.00 15.44 ? 146  LYS C CG  1 
ATOM   6625  C CD  . LYS C 1 147 ? 26.568  21.228  42.270  1.00 18.91 ? 146  LYS C CD  1 
ATOM   6626  C CE  . LYS C 1 147 ? 26.076  22.628  42.011  1.00 19.66 ? 146  LYS C CE  1 
ATOM   6627  N NZ  . LYS C 1 147 ? 26.808  23.607  42.847  1.00 23.52 ? 146  LYS C NZ  1 
ATOM   6628  N N   . TRP C 1 148 ? 24.239  18.631  41.708  1.00 11.07 ? 147  TRP C N   1 
ATOM   6629  C CA  . TRP C 1 148 ? 23.686  18.825  40.339  1.00 10.93 ? 147  TRP C CA  1 
ATOM   6630  C C   . TRP C 1 148 ? 22.711  20.003  40.402  1.00 10.45 ? 147  TRP C C   1 
ATOM   6631  O O   . TRP C 1 148 ? 21.701  19.933  41.123  1.00 10.66 ? 147  TRP C O   1 
ATOM   6632  C CB  . TRP C 1 148 ? 23.047  17.562  39.805  1.00 9.99  ? 147  TRP C CB  1 
ATOM   6633  C CG  . TRP C 1 148 ? 22.340  17.600  38.486  1.00 9.43  ? 147  TRP C CG  1 
ATOM   6634  C CD1 . TRP C 1 148 ? 21.236  18.336  38.152  1.00 11.38 ? 147  TRP C CD1 1 
ATOM   6635  C CD2 . TRP C 1 148 ? 22.680  16.843  37.311  1.00 9.90  ? 147  TRP C CD2 1 
ATOM   6636  N NE1 . TRP C 1 148 ? 20.870  18.083  36.847  1.00 11.08 ? 147  TRP C NE1 1 
ATOM   6637  C CE2 . TRP C 1 148 ? 21.732  17.170  36.312  1.00 10.54 ? 147  TRP C CE2 1 
ATOM   6638  C CE3 . TRP C 1 148 ? 23.677  15.920  37.013  1.00 9.21  ? 147  TRP C CE3 1 
ATOM   6639  C CZ2 . TRP C 1 148 ? 21.777  16.625  35.034  1.00 7.73  ? 147  TRP C CZ2 1 
ATOM   6640  C CZ3 . TRP C 1 148 ? 23.732  15.376  35.742  1.00 10.19 ? 147  TRP C CZ3 1 
ATOM   6641  C CH2 . TRP C 1 148 ? 22.795  15.720  34.755  1.00 9.56  ? 147  TRP C CH2 1 
ATOM   6642  N N   . ARG C 1 149 ? 22.993  21.047  39.659  1.00 10.63 ? 148  ARG C N   1 
ATOM   6643  C CA  . ARG C 1 149 ? 22.180  22.256  39.644  1.00 10.88 ? 148  ARG C CA  1 
ATOM   6644  C C   . ARG C 1 149 ? 21.298  22.392  38.400  1.00 11.17 ? 148  ARG C C   1 
ATOM   6645  O O   . ARG C 1 149 ? 21.790  22.434  37.264  1.00 10.58 ? 148  ARG C O   1 
ATOM   6646  C CB  . ARG C 1 149 ? 23.069  23.506  39.729  1.00 12.66 ? 148  ARG C CB  1 
ATOM   6647  C CG  . ARG C 1 149 ? 22.312  24.829  39.845  1.00 13.72 ? 148  ARG C CG  1 
ATOM   6648  C CD  . ARG C 1 149 ? 23.177  25.978  39.486  1.00 15.99 ? 148  ARG C CD  1 
ATOM   6649  N NE  . ARG C 1 149 ? 22.572  27.263  39.726  1.00 17.21 ? 148  ARG C NE  1 
ATOM   6650  C CZ  . ARG C 1 149 ? 22.864  28.357  39.020  1.00 17.04 ? 148  ARG C CZ  1 
ATOM   6651  N NH1 . ARG C 1 149 ? 23.731  28.274  38.013  1.00 17.33 ? 148  ARG C NH1 1 
ATOM   6652  N NH2 . ARG C 1 149 ? 22.287  29.513  39.310  1.00 17.84 ? 148  ARG C NH2 1 
ATOM   6653  N N   . CYS C 1 150 ? 20.006  22.503  38.659  1.00 11.27 ? 149  CYS C N   1 
ATOM   6654  C CA  . CYS C 1 150 ? 19.003  22.888  37.638  1.00 10.99 ? 149  CYS C CA  1 
ATOM   6655  C C   . CYS C 1 150 ? 18.604  24.333  37.937  1.00 10.83 ? 149  CYS C C   1 
ATOM   6656  O O   . CYS C 1 150 ? 18.610  24.753  39.111  1.00 9.87  ? 149  CYS C O   1 
ATOM   6657  C CB  . CYS C 1 150 ? 17.795  21.975  37.652  1.00 9.91  ? 149  CYS C CB  1 
ATOM   6658  S SG  . CYS C 1 150 ? 18.010  20.364  36.950  1.00 9.96  ? 149  CYS C SG  1 
ATOM   6659  N N   . VAL C 1 151 ? 18.274  25.059  36.881  1.00 10.66 ? 150  VAL C N   1 
ATOM   6660  C CA  . VAL C 1 151 ? 17.936  26.479  36.949  1.00 11.33 ? 150  VAL C CA  1 
ATOM   6661  C C   . VAL C 1 151 ? 16.572  26.738  36.319  1.00 12.00 ? 150  VAL C C   1 
ATOM   6662  O O   . VAL C 1 151 ? 16.322  26.350  35.165  1.00 11.93 ? 150  VAL C O   1 
ATOM   6663  C CB  . VAL C 1 151 ? 19.107  27.277  36.311  1.00 13.50 ? 150  VAL C CB  1 
ATOM   6664  C CG1 . VAL C 1 151 ? 18.791  28.722  36.004  1.00 15.52 ? 150  VAL C CG1 1 
ATOM   6665  C CG2 . VAL C 1 151 ? 20.350  27.184  37.194  1.00 14.88 ? 150  VAL C CG2 1 
ATOM   6666  N N   . LEU C 1 152 ? 15.694  27.357  37.090  1.00 12.40 ? 151  LEU C N   1 
ATOM   6667  C CA  . LEU C 1 152 ? 14.347  27.759  36.659  1.00 12.88 ? 151  LEU C CA  1 
ATOM   6668  C C   . LEU C 1 152 ? 14.248  29.273  36.736  1.00 12.83 ? 151  LEU C C   1 
ATOM   6669  O O   . LEU C 1 152 ? 14.732  29.850  37.728  1.00 12.76 ? 151  LEU C O   1 
ATOM   6670  C CB  . LEU C 1 152 ? 13.319  27.017  37.519  1.00 14.49 ? 151  LEU C CB  1 
ATOM   6671  C CG  . LEU C 1 152 ? 13.333  25.500  37.436  1.00 17.36 ? 151  LEU C CG  1 
ATOM   6672  C CD1 . LEU C 1 152 ? 12.520  24.888  38.553  1.00 19.85 ? 151  LEU C CD1 1 
ATOM   6673  C CD2 . LEU C 1 152 ? 12.739  25.093  36.087  1.00 16.59 ? 151  LEU C CD2 1 
ATOM   6674  N N   . LYS C 1 153 ? 13.645  29.885  35.721  1.00 12.60 ? 152  LYS C N   1 
ATOM   6675  C CA  . LYS C 1 153 ? 13.581  31.347  35.652  1.00 12.85 ? 152  LYS C CA  1 
ATOM   6676  C C   . LYS C 1 153 ? 12.151  31.868  35.778  1.00 12.16 ? 152  LYS C C   1 
ATOM   6677  O O   . LYS C 1 153 ? 11.262  31.385  35.054  1.00 11.74 ? 152  LYS C O   1 
ATOM   6678  C CB  . LYS C 1 153 ? 14.109  31.920  34.339  1.00 17.80 ? 152  LYS C CB  1 
ATOM   6679  C CG  . LYS C 1 153 ? 15.366  31.298  33.750  1.00 22.27 ? 152  LYS C CG  1 
ATOM   6680  C CD  . LYS C 1 153 ? 16.065  32.312  32.837  1.00 25.68 ? 152  LYS C CD  1 
ATOM   6681  C CE  . LYS C 1 153 ? 17.163  31.645  32.013  1.00 28.51 ? 152  LYS C CE  1 
ATOM   6682  N NZ  . LYS C 1 153 ? 17.458  32.465  30.805  1.00 30.23 ? 152  LYS C NZ  1 
ATOM   6683  N N   . ILE C 1 154 ? 11.975  32.847  36.652  1.00 11.61 ? 153  ILE C N   1 
ATOM   6684  C CA  . ILE C 1 154 ? 10.663  33.506  36.785  1.00 11.55 ? 153  ILE C CA  1 
ATOM   6685  C C   . ILE C 1 154 ? 10.592  34.645  35.769  1.00 12.32 ? 153  ILE C C   1 
ATOM   6686  O O   . ILE C 1 154 ? 11.454  35.541  35.741  1.00 13.01 ? 153  ILE C O   1 
ATOM   6687  C CB  . ILE C 1 154 ? 10.366  33.998  38.236  1.00 11.59 ? 153  ILE C CB  1 
ATOM   6688  C CG1 . ILE C 1 154 ? 10.430  32.804  39.220  1.00 9.87  ? 153  ILE C CG1 1 
ATOM   6689  C CG2 . ILE C 1 154 ? 8.998   34.735  38.323  1.00 11.40 ? 153  ILE C CG2 1 
ATOM   6690  C CD1 . ILE C 1 154 ? 10.114  33.173  40.699  1.00 8.65  ? 153  ILE C CD1 1 
ATOM   6691  N N   . GLY C 1 155 ? 9.553   34.590  34.951  1.00 11.69 ? 154  GLY C N   1 
ATOM   6692  C CA  . GLY C 1 155 ? 9.359   35.602  33.896  1.00 11.63 ? 154  GLY C CA  1 
ATOM   6693  C C   . GLY C 1 155 ? 7.868   35.672  33.569  1.00 11.46 ? 154  GLY C C   1 
ATOM   6694  O O   . GLY C 1 155 ? 7.046   35.129  34.324  1.00 11.10 ? 154  GLY C O   1 
ATOM   6695  N N   . LYS C 1 156 ? 7.579   36.354  32.471  1.00 11.00 ? 155  LYS C N   1 
ATOM   6696  C CA  . LYS C 1 156 ? 6.195   36.527  32.019  1.00 11.24 ? 155  LYS C CA  1 
ATOM   6697  C C   . LYS C 1 156 ? 5.441   35.215  31.975  1.00 10.79 ? 155  LYS C C   1 
ATOM   6698  O O   . LYS C 1 156 ? 4.368   35.104  32.618  1.00 11.17 ? 155  LYS C O   1 
ATOM   6699  C CB  . LYS C 1 156 ? 6.124   37.256  30.680  1.00 15.13 ? 155  LYS C CB  1 
ATOM   6700  C CG  . LYS C 1 156 ? 4.710   37.576  30.207  1.00 18.59 ? 155  LYS C CG  1 
ATOM   6701  C CD  . LYS C 1 156 ? 4.750   38.291  28.849  1.00 20.82 ? 155  LYS C CD  1 
ATOM   6702  C CE  . LYS C 1 156 ? 3.345   38.477  28.295  1.00 24.05 ? 155  LYS C CE  1 
ATOM   6703  N NZ  . LYS C 1 156 ? 2.973   37.353  27.378  1.00 25.78 ? 155  LYS C NZ  1 
ATOM   6704  N N   . ASN C 1 157 ? 5.980   34.221  31.291  1.00 10.03 ? 156  ASN C N   1 
ATOM   6705  C CA  . ASN C 1 157 ? 5.327   32.907  31.173  1.00 9.59  ? 156  ASN C CA  1 
ATOM   6706  C C   . ASN C 1 157 ? 6.164   31.767  31.711  1.00 9.42  ? 156  ASN C C   1 
ATOM   6707  O O   . ASN C 1 157 ? 5.828   30.597  31.415  1.00 9.38  ? 156  ASN C O   1 
ATOM   6708  C CB  . ASN C 1 157 ? 4.979   32.631  29.673  1.00 10.62 ? 156  ASN C CB  1 
ATOM   6709  C CG  . ASN C 1 157 ? 4.250   33.798  29.051  1.00 10.56 ? 156  ASN C CG  1 
ATOM   6710  O OD1 . ASN C 1 157 ? 3.220   34.229  29.572  1.00 11.49 ? 156  ASN C OD1 1 
ATOM   6711  N ND2 . ASN C 1 157 ? 4.782   34.305  27.934  1.00 10.88 ? 156  ASN C ND2 1 
ATOM   6712  N N   . THR C 1 158 ? 7.229   32.069  32.444  1.00 8.84  ? 157  THR C N   1 
ATOM   6713  C CA  . THR C 1 158 ? 8.147   31.003  32.895  1.00 8.63  ? 157  THR C CA  1 
ATOM   6714  C C   . THR C 1 158 ? 8.267   30.996  34.423  1.00 8.71  ? 157  THR C C   1 
ATOM   6715  O O   . THR C 1 158 ? 8.225   32.076  35.027  1.00 8.86  ? 157  THR C O   1 
ATOM   6716  C CB  . THR C 1 158 ? 9.574   31.232  32.229  1.00 9.80  ? 157  THR C CB  1 
ATOM   6717  O OG1 . THR C 1 158 ? 10.034  32.500  32.797  1.00 9.12  ? 157  THR C OG1 1 
ATOM   6718  C CG2 . THR C 1 158 ? 9.508   31.312  30.694  1.00 8.24  ? 157  THR C CG2 1 
ATOM   6719  N N   . PRO C 1 159 ? 8.503   29.846  35.025  1.00 8.50  ? 158  PRO C N   1 
ATOM   6720  C CA  . PRO C 1 159 ? 8.758   28.565  34.381  1.00 8.39  ? 158  PRO C CA  1 
ATOM   6721  C C   . PRO C 1 159 ? 7.525   27.968  33.708  1.00 8.52  ? 158  PRO C C   1 
ATOM   6722  O O   . PRO C 1 159 ? 6.399   28.009  34.236  1.00 8.38  ? 158  PRO C O   1 
ATOM   6723  C CB  . PRO C 1 159 ? 9.305   27.670  35.479  1.00 8.69  ? 158  PRO C CB  1 
ATOM   6724  C CG  . PRO C 1 159 ? 9.343   28.468  36.743  1.00 9.31  ? 158  PRO C CG  1 
ATOM   6725  C CD  . PRO C 1 159 ? 8.614   29.770  36.498  1.00 9.08  ? 158  PRO C CD  1 
ATOM   6726  N N   . SER C 1 160 ? 7.782   27.378  32.546  1.00 7.53  ? 159  SER C N   1 
ATOM   6727  C CA  . SER C 1 160 ? 6.681   26.732  31.790  1.00 7.15  ? 159  SER C CA  1 
ATOM   6728  C C   . SER C 1 160 ? 6.486   25.326  32.333  1.00 5.73  ? 159  SER C C   1 
ATOM   6729  O O   . SER C 1 160 ? 7.328   24.791  33.073  1.00 4.49  ? 159  SER C O   1 
ATOM   6730  C CB  . SER C 1 160 ? 7.032   26.658  30.298  1.00 6.12  ? 159  SER C CB  1 
ATOM   6731  O OG  . SER C 1 160 ? 8.288   25.992  30.138  1.00 5.63  ? 159  SER C OG  1 
ATOM   6732  N N   . TYR C 1 161 ? 5.375   24.732  31.899  1.00 5.59  ? 160  TYR C N   1 
ATOM   6733  C CA  . TYR C 1 161 ? 5.144   23.309  32.152  1.00 5.00  ? 160  TYR C CA  1 
ATOM   6734  C C   . TYR C 1 161 ? 6.295   22.482  31.572  1.00 5.35  ? 160  TYR C C   1 
ATOM   6735  O O   . TYR C 1 161 ? 6.717   21.475  32.179  1.00 4.23  ? 160  TYR C O   1 
ATOM   6736  C CB  . TYR C 1 161 ? 3.782   22.856  31.590  1.00 6.86  ? 160  TYR C CB  1 
ATOM   6737  C CG  . TYR C 1 161 ? 3.588   21.364  31.708  1.00 8.67  ? 160  TYR C CG  1 
ATOM   6738  C CD1 . TYR C 1 161 ? 3.417   20.780  32.972  1.00 9.42  ? 160  TYR C CD1 1 
ATOM   6739  C CD2 . TYR C 1 161 ? 3.608   20.548  30.583  1.00 9.22  ? 160  TYR C CD2 1 
ATOM   6740  C CE1 . TYR C 1 161 ? 3.265   19.409  33.101  1.00 10.10 ? 160  TYR C CE1 1 
ATOM   6741  C CE2 . TYR C 1 161 ? 3.437   19.173  30.683  1.00 9.58  ? 160  TYR C CE2 1 
ATOM   6742  C CZ  . TYR C 1 161 ? 3.266   18.614  31.954  1.00 10.39 ? 160  TYR C CZ  1 
ATOM   6743  O OH  . TYR C 1 161 ? 3.118   17.263  32.034  1.00 10.28 ? 160  TYR C OH  1 
ATOM   6744  N N   . GLN C 1 162 ? 6.776   22.881  30.381  1.00 3.80  ? 161  GLN C N   1 
ATOM   6745  C CA  . GLN C 1 162 ? 7.872   22.135  29.756  1.00 4.13  ? 161  GLN C CA  1 
ATOM   6746  C C   . GLN C 1 162 ? 9.114   22.099  30.663  1.00 3.93  ? 161  GLN C C   1 
ATOM   6747  O O   . GLN C 1 162 ? 9.682   21.017  30.857  1.00 4.84  ? 161  GLN C O   1 
ATOM   6748  C CB  . GLN C 1 162 ? 8.286   22.638  28.363  1.00 3.06  ? 161  GLN C CB  1 
ATOM   6749  C CG  . GLN C 1 162 ? 9.446   21.832  27.804  1.00 4.61  ? 161  GLN C CG  1 
ATOM   6750  C CD  . GLN C 1 162 ? 10.177  22.413  26.631  1.00 3.58  ? 161  GLN C CD  1 
ATOM   6751  O OE1 . GLN C 1 162 ? 10.968  21.704  25.965  1.00 8.14  ? 161  GLN C OE1 1 
ATOM   6752  N NE2 . GLN C 1 162 ? 10.015  23.670  26.308  1.00 2.00  ? 161  GLN C NE2 1 
ATOM   6753  N N   . SER C 1 163 ? 9.489   23.256  31.131  1.00 5.73  ? 162  SER C N   1 
ATOM   6754  C CA  . SER C 1 163 ? 10.682  23.451  31.975  1.00 7.32  ? 162  SER C CA  1 
ATOM   6755  C C   . SER C 1 163 ? 10.571  22.666  33.277  1.00 7.05  ? 162  SER C C   1 
ATOM   6756  O O   . SER C 1 163 ? 11.531  22.027  33.747  1.00 6.39  ? 162  SER C O   1 
ATOM   6757  C CB  . SER C 1 163 ? 10.826  24.954  32.291  1.00 7.75  ? 162  SER C CB  1 
ATOM   6758  O OG  . SER C 1 163 ? 12.095  25.166  32.881  1.00 16.97 ? 162  SER C OG  1 
ATOM   6759  N N   . ILE C 1 164 ? 9.397   22.798  33.888  1.00 6.66  ? 163  ILE C N   1 
ATOM   6760  C CA  . ILE C 1 164 ? 9.100   22.096  35.145  1.00 6.79  ? 163  ILE C CA  1 
ATOM   6761  C C   . ILE C 1 164 ? 9.196   20.596  35.011  1.00 6.58  ? 163  ILE C C   1 
ATOM   6762  O O   . ILE C 1 164 ? 9.866   19.899  35.818  1.00 5.81  ? 163  ILE C O   1 
ATOM   6763  C CB  . ILE C 1 164 ? 7.723   22.590  35.736  1.00 6.27  ? 163  ILE C CB  1 
ATOM   6764  C CG1 . ILE C 1 164 ? 7.809   24.090  36.069  1.00 7.38  ? 163  ILE C CG1 1 
ATOM   6765  C CG2 . ILE C 1 164 ? 7.328   21.715  36.976  1.00 8.11  ? 163  ILE C CG2 1 
ATOM   6766  C CD1 . ILE C 1 164 ? 6.472   24.802  36.402  1.00 7.94  ? 163  ILE C CD1 1 
ATOM   6767  N N   . LEU C 1 165 ? 8.543   20.055  33.979  1.00 6.12  ? 164  LEU C N   1 
ATOM   6768  C CA  . LEU C 1 165 ? 8.536   18.628  33.673  1.00 6.26  ? 164  LEU C CA  1 
ATOM   6769  C C   . LEU C 1 165 ? 9.944   18.086  33.436  1.00 6.06  ? 164  LEU C C   1 
ATOM   6770  O O   . LEU C 1 165 ? 10.338  17.041  33.951  1.00 4.35  ? 164  LEU C O   1 
ATOM   6771  C CB  . LEU C 1 165 ? 7.625   18.451  32.437  1.00 10.89 ? 164  LEU C CB  1 
ATOM   6772  C CG  . LEU C 1 165 ? 7.651   17.204  31.618  1.00 14.04 ? 164  LEU C CG  1 
ATOM   6773  C CD1 . LEU C 1 165 ? 6.782   17.356  30.336  1.00 15.70 ? 164  LEU C CD1 1 
ATOM   6774  C CD2 . LEU C 1 165 ? 9.064   16.892  31.134  1.00 17.25 ? 164  LEU C CD2 1 
ATOM   6775  N N   . GLU C 1 166 ? 10.680  18.822  32.603  1.00 6.19  ? 165  GLU C N   1 
ATOM   6776  C CA  . GLU C 1 166 ? 12.012  18.392  32.173  1.00 5.53  ? 165  GLU C CA  1 
ATOM   6777  C C   . GLU C 1 166 ? 13.057  18.458  33.291  1.00 5.02  ? 165  GLU C C   1 
ATOM   6778  O O   . GLU C 1 166 ? 13.817  17.493  33.458  1.00 5.39  ? 165  GLU C O   1 
ATOM   6779  C CB  . GLU C 1 166 ? 12.517  19.256  31.010  1.00 5.29  ? 165  GLU C CB  1 
ATOM   6780  C CG  . GLU C 1 166 ? 13.970  19.052  30.611  1.00 6.41  ? 165  GLU C CG  1 
ATOM   6781  C CD  . GLU C 1 166 ? 14.468  17.677  30.434  1.00 5.24  ? 165  GLU C CD  1 
ATOM   6782  O OE1 . GLU C 1 166 ? 13.810  16.684  30.155  1.00 6.91  ? 165  GLU C OE1 1 
ATOM   6783  O OE2 . GLU C 1 166 ? 15.722  17.583  30.607  1.00 5.17  ? 165  GLU C OE2 1 
ATOM   6784  N N   . ASN C 1 167 ? 13.090  19.551  33.986  1.00 5.35  ? 166  ASN C N   1 
ATOM   6785  C CA  . ASN C 1 167 ? 14.062  19.766  35.104  1.00 6.33  ? 166  ASN C CA  1 
ATOM   6786  C C   . ASN C 1 167 ? 13.795  18.753  36.219  1.00 5.86  ? 166  ASN C C   1 
ATOM   6787  O O   . ASN C 1 167 ? 14.751  18.173  36.761  1.00 6.03  ? 166  ASN C O   1 
ATOM   6788  C CB  . ASN C 1 167 ? 14.083  21.224  35.498  1.00 6.66  ? 166  ASN C CB  1 
ATOM   6789  C CG  . ASN C 1 167 ? 14.987  22.034  34.569  1.00 9.65  ? 166  ASN C CG  1 
ATOM   6790  O OD1 . ASN C 1 167 ? 16.215  21.957  34.694  1.00 12.03 ? 166  ASN C OD1 1 
ATOM   6791  N ND2 . ASN C 1 167 ? 14.375  22.763  33.645  1.00 8.60  ? 166  ASN C ND2 1 
ATOM   6792  N N   . ALA C 1 168 ? 12.519  18.506  36.479  1.00 5.72  ? 167  ALA C N   1 
ATOM   6793  C CA  . ALA C 1 168 ? 12.147  17.503  37.504  1.00 6.01  ? 167  ALA C CA  1 
ATOM   6794  C C   . ALA C 1 168 ? 12.578  16.124  37.075  1.00 5.54  ? 167  ALA C C   1 
ATOM   6795  O O   . ALA C 1 168 ? 13.102  15.321  37.872  1.00 4.93  ? 167  ALA C O   1 
ATOM   6796  C CB  . ALA C 1 168 ? 10.673  17.576  37.868  1.00 5.93  ? 167  ALA C CB  1 
ATOM   6797  N N   . ASN C 1 169 ? 12.361  15.810  35.791  1.00 5.29  ? 168  ASN C N   1 
ATOM   6798  C CA  . ASN C 1 169 ? 12.720  14.498  35.263  1.00 4.99  ? 168  ASN C CA  1 
ATOM   6799  C C   . ASN C 1 169 ? 14.222  14.276  35.277  1.00 4.68  ? 168  ASN C C   1 
ATOM   6800  O O   . ASN C 1 169 ? 14.637  13.140  35.569  1.00 4.44  ? 168  ASN C O   1 
ATOM   6801  C CB  . ASN C 1 169 ? 12.081  14.192  33.895  1.00 6.70  ? 168  ASN C CB  1 
ATOM   6802  C CG  . ASN C 1 169 ? 12.161  12.711  33.581  1.00 6.99  ? 168  ASN C CG  1 
ATOM   6803  O OD1 . ASN C 1 169 ? 11.361  11.906  34.066  1.00 8.07  ? 168  ASN C OD1 1 
ATOM   6804  N ND2 . ASN C 1 169 ? 13.163  12.338  32.769  1.00 8.26  ? 168  ASN C ND2 1 
ATOM   6805  N N   . VAL C 1 170 ? 14.989  15.309  34.958  1.00 5.75  ? 169  VAL C N   1 
ATOM   6806  C CA  . VAL C 1 170 ? 16.458  15.100  34.868  1.00 6.18  ? 169  VAL C CA  1 
ATOM   6807  C C   . VAL C 1 170 ? 17.052  14.979  36.285  1.00 5.98  ? 169  VAL C C   1 
ATOM   6808  O O   . VAL C 1 170 ? 18.048  14.265  36.451  1.00 5.42  ? 169  VAL C O   1 
ATOM   6809  C CB  . VAL C 1 170 ? 17.106  16.190  34.000  1.00 6.10  ? 169  VAL C CB  1 
ATOM   6810  C CG1 . VAL C 1 170 ? 17.430  17.482  34.722  1.00 3.60  ? 169  VAL C CG1 1 
ATOM   6811  C CG2 . VAL C 1 170 ? 18.322  15.647  33.263  1.00 8.37  ? 169  VAL C CG2 1 
ATOM   6812  N N   . LEU C 1 171 ? 16.486  15.713  37.222  1.00 6.28  ? 170  LEU C N   1 
ATOM   6813  C CA  . LEU C 1 171 ? 16.909  15.597  38.639  1.00 6.49  ? 170  LEU C CA  1 
ATOM   6814  C C   . LEU C 1 171 ? 16.711  14.178  39.139  1.00 6.57  ? 170  LEU C C   1 
ATOM   6815  O O   . LEU C 1 171 ? 17.565  13.637  39.889  1.00 6.78  ? 170  LEU C O   1 
ATOM   6816  C CB  . LEU C 1 171 ? 16.197  16.697  39.451  1.00 7.05  ? 170  LEU C CB  1 
ATOM   6817  C CG  . LEU C 1 171 ? 16.790  18.086  39.409  1.00 6.62  ? 170  LEU C CG  1 
ATOM   6818  C CD1 . LEU C 1 171 ? 15.890  19.149  40.027  1.00 8.16  ? 170  LEU C CD1 1 
ATOM   6819  C CD2 . LEU C 1 171 ? 18.135  18.089  40.152  1.00 8.27  ? 170  LEU C CD2 1 
ATOM   6820  N N   . ALA C 1 172 ? 15.619  13.531  38.762  1.00 5.68  ? 171  ALA C N   1 
ATOM   6821  C CA  . ALA C 1 172 ? 15.281  12.185  39.187  1.00 6.05  ? 171  ALA C CA  1 
ATOM   6822  C C   . ALA C 1 172 ? 16.218  11.161  38.569  1.00 6.73  ? 171  ALA C C   1 
ATOM   6823  O O   . ALA C 1 172 ? 16.541  10.156  39.222  1.00 6.89  ? 171  ALA C O   1 
ATOM   6824  C CB  . ALA C 1 172 ? 13.814  11.838  38.937  1.00 5.20  ? 171  ALA C CB  1 
ATOM   6825  N N   . ARG C 1 173 ? 16.638  11.402  37.324  1.00 6.40  ? 172  ARG C N   1 
ATOM   6826  C CA  . ARG C 1 173 ? 17.561  10.472  36.651  1.00 6.28  ? 172  ARG C CA  1 
ATOM   6827  C C   . ARG C 1 173 ? 18.923  10.526  37.388  1.00 6.54  ? 172  ARG C C   1 
ATOM   6828  O O   . ARG C 1 173 ? 19.538  9.487   37.645  1.00 6.55  ? 172  ARG C O   1 
ATOM   6829  C CB  . ARG C 1 173 ? 17.773  10.812  35.172  1.00 7.38  ? 172  ARG C CB  1 
ATOM   6830  C CG  . ARG C 1 173 ? 16.569  10.517  34.257  1.00 6.57  ? 172  ARG C CG  1 
ATOM   6831  C CD  . ARG C 1 173 ? 16.402  9.045   34.062  1.00 8.74  ? 172  ARG C CD  1 
ATOM   6832  N NE  . ARG C 1 173 ? 17.568  8.475   33.388  1.00 10.23 ? 172  ARG C NE  1 
ATOM   6833  C CZ  . ARG C 1 173 ? 18.357  7.526   33.881  1.00 11.38 ? 172  ARG C CZ  1 
ATOM   6834  N NH1 . ARG C 1 173 ? 18.090  6.907   35.027  1.00 12.04 ? 172  ARG C NH1 1 
ATOM   6835  N NH2 . ARG C 1 173 ? 19.496  7.234   33.256  1.00 12.12 ? 172  ARG C NH2 1 
ATOM   6836  N N   . TYR C 1 174 ? 19.315  11.741  37.651  1.00 6.63  ? 173  TYR C N   1 
ATOM   6837  C CA  . TYR C 1 174 ? 20.611  12.024  38.311  1.00 8.20  ? 173  TYR C CA  1 
ATOM   6838  C C   . TYR C 1 174 ? 20.638  11.359  39.685  1.00 7.84  ? 173  TYR C C   1 
ATOM   6839  O O   . TYR C 1 174 ? 21.600  10.663  40.041  1.00 8.30  ? 173  TYR C O   1 
ATOM   6840  C CB  . TYR C 1 174 ? 20.854  13.522  38.354  1.00 6.73  ? 173  TYR C CB  1 
ATOM   6841  C CG  . TYR C 1 174 ? 21.486  14.064  39.624  1.00 10.23 ? 173  TYR C CG  1 
ATOM   6842  C CD1 . TYR C 1 174 ? 22.854  13.873  39.861  1.00 8.65  ? 173  TYR C CD1 1 
ATOM   6843  C CD2 . TYR C 1 174 ? 20.732  14.725  40.596  1.00 7.78  ? 173  TYR C CD2 1 
ATOM   6844  C CE1 . TYR C 1 174 ? 23.461  14.364  41.018  1.00 10.76 ? 173  TYR C CE1 1 
ATOM   6845  C CE2 . TYR C 1 174 ? 21.329  15.215  41.756  1.00 10.28 ? 173  TYR C CE2 1 
ATOM   6846  C CZ  . TYR C 1 174 ? 22.687  15.038  41.965  1.00 10.94 ? 173  TYR C CZ  1 
ATOM   6847  O OH  . TYR C 1 174 ? 23.267  15.534  43.111  1.00 9.99  ? 173  TYR C OH  1 
ATOM   6848  N N   . ALA C 1 175 ? 19.562  11.579  40.408  1.00 8.11  ? 174  ALA C N   1 
ATOM   6849  C CA  . ALA C 1 175 ? 19.451  11.092  41.805  1.00 8.36  ? 174  ALA C CA  1 
ATOM   6850  C C   . ALA C 1 175 ? 19.527  9.593   41.845  1.00 8.40  ? 174  ALA C C   1 
ATOM   6851  O O   . ALA C 1 175 ? 20.263  8.970   42.644  1.00 8.42  ? 174  ALA C O   1 
ATOM   6852  C CB  . ALA C 1 175 ? 18.200  11.713  42.423  1.00 8.20  ? 174  ALA C CB  1 
ATOM   6853  N N   . SER C 1 176 ? 18.791  8.942   40.948  1.00 8.49  ? 175  SER C N   1 
ATOM   6854  C CA  . SER C 1 176 ? 18.752  7.486   40.792  1.00 8.69  ? 175  SER C CA  1 
ATOM   6855  C C   . SER C 1 176 ? 20.121  6.888   40.499  1.00 8.46  ? 175  SER C C   1 
ATOM   6856  O O   . SER C 1 176 ? 20.510  5.875   41.111  1.00 8.44  ? 175  SER C O   1 
ATOM   6857  C CB  . SER C 1 176 ? 17.788  7.116   39.645  1.00 9.53  ? 175  SER C CB  1 
ATOM   6858  O OG  . SER C 1 176 ? 17.802  5.710   39.451  1.00 14.22 ? 175  SER C OG  1 
ATOM   6859  N N   . ILE C 1 177 ? 20.832  7.498   39.549  1.00 8.36  ? 176  ILE C N   1 
ATOM   6860  C CA  . ILE C 1 177 ? 22.176  7.019   39.164  1.00 8.10  ? 176  ILE C CA  1 
ATOM   6861  C C   . ILE C 1 177 ? 23.152  7.124   40.354  1.00 8.15  ? 176  ILE C C   1 
ATOM   6862  O O   . ILE C 1 177 ? 23.881  6.164   40.616  1.00 8.15  ? 176  ILE C O   1 
ATOM   6863  C CB  . ILE C 1 177 ? 22.725  7.776   37.915  1.00 8.84  ? 176  ILE C CB  1 
ATOM   6864  C CG1 . ILE C 1 177 ? 21.802  7.500   36.694  1.00 8.23  ? 176  ILE C CG1 1 
ATOM   6865  C CG2 . ILE C 1 177 ? 24.194  7.361   37.576  1.00 9.31  ? 176  ILE C CG2 1 
ATOM   6866  C CD1 . ILE C 1 177 ? 22.180  8.300   35.423  1.00 9.31  ? 176  ILE C CD1 1 
ATOM   6867  N N   . CYS C 1 178 ? 23.142  8.267   40.993  1.00 8.90  ? 177  CYS C N   1 
ATOM   6868  C CA  . CYS C 1 178 ? 23.985  8.555   42.166  1.00 10.63 ? 177  CYS C CA  1 
ATOM   6869  C C   . CYS C 1 178 ? 23.805  7.486   43.247  1.00 10.87 ? 177  CYS C C   1 
ATOM   6870  O O   . CYS C 1 178 ? 24.797  6.980   43.805  1.00 10.74 ? 177  CYS C O   1 
ATOM   6871  C CB  . CYS C 1 178 ? 23.708  9.930   42.748  1.00 9.86  ? 177  CYS C CB  1 
ATOM   6872  S SG  . CYS C 1 178 ? 24.482  11.298  41.887  1.00 13.59 ? 177  CYS C SG  1 
ATOM   6873  N N   . GLN C 1 179 ? 22.538  7.188   43.500  1.00 10.69 ? 178  GLN C N   1 
ATOM   6874  C CA  . GLN C 1 179 ? 22.172  6.216   44.541  1.00 10.81 ? 178  GLN C CA  1 
ATOM   6875  C C   . GLN C 1 179 ? 22.666  4.828   44.171  1.00 11.19 ? 178  GLN C C   1 
ATOM   6876  O O   . GLN C 1 179 ? 23.142  4.078   45.053  1.00 10.90 ? 178  GLN C O   1 
ATOM   6877  C CB  . GLN C 1 179 ? 20.690  6.250   44.910  1.00 10.61 ? 178  GLN C CB  1 
ATOM   6878  C CG  . GLN C 1 179 ? 20.194  7.592   45.430  1.00 9.40  ? 178  GLN C CG  1 
ATOM   6879  C CD  . GLN C 1 179 ? 18.881  7.421   46.179  1.00 8.83  ? 178  GLN C CD  1 
ATOM   6880  O OE1 . GLN C 1 179 ? 18.052  6.598   45.803  1.00 10.10 ? 178  GLN C OE1 1 
ATOM   6881  N NE2 . GLN C 1 179 ? 18.711  8.182   47.256  1.00 9.65  ? 178  GLN C NE2 1 
ATOM   6882  N N   . SER C 1 180 ? 22.583  4.486   42.893  1.00 10.68 ? 179  SER C N   1 
ATOM   6883  C CA  . SER C 1 180 ? 23.013  3.183   42.408  1.00 10.89 ? 179  SER C CA  1 
ATOM   6884  C C   . SER C 1 180 ? 24.517  2.973   42.652  1.00 10.46 ? 179  SER C C   1 
ATOM   6885  O O   . SER C 1 180 ? 24.961  1.809   42.673  1.00 10.68 ? 179  SER C O   1 
ATOM   6886  C CB  . SER C 1 180 ? 22.701  2.933   40.930  1.00 10.52 ? 179  SER C CB  1 
ATOM   6887  O OG  . SER C 1 180 ? 23.520  3.766   40.116  1.00 11.89 ? 179  SER C OG  1 
ATOM   6888  N N   . GLN C 1 181 ? 25.236  4.039   42.816  1.00 11.00 ? 180  GLN C N   1 
ATOM   6889  C CA  . GLN C 1 181 ? 26.690  4.025   43.027  1.00 12.58 ? 180  GLN C CA  1 
ATOM   6890  C C   . GLN C 1 181 ? 27.076  4.467   44.437  1.00 12.70 ? 180  GLN C C   1 
ATOM   6891  O O   . GLN C 1 181 ? 28.197  4.986   44.652  1.00 12.96 ? 180  GLN C O   1 
ATOM   6892  C CB  . GLN C 1 181 ? 27.399  4.881   41.970  1.00 14.01 ? 180  GLN C CB  1 
ATOM   6893  C CG  . GLN C 1 181 ? 27.076  4.480   40.541  1.00 15.87 ? 180  GLN C CG  1 
ATOM   6894  C CD  . GLN C 1 181 ? 27.364  3.046   40.207  1.00 16.76 ? 180  GLN C CD  1 
ATOM   6895  O OE1 . GLN C 1 181 ? 28.447  2.503   40.428  1.00 16.91 ? 180  GLN C OE1 1 
ATOM   6896  N NE2 . GLN C 1 181 ? 26.360  2.391   39.630  1.00 17.19 ? 180  GLN C NE2 1 
ATOM   6897  N N   . ARG C 1 182 ? 26.170  4.322   45.382  1.00 12.76 ? 181  ARG C N   1 
ATOM   6898  C CA  . ARG C 1 182 ? 26.423  4.618   46.803  1.00 12.46 ? 181  ARG C CA  1 
ATOM   6899  C C   . ARG C 1 182 ? 26.759  6.059   47.083  1.00 12.24 ? 181  ARG C C   1 
ATOM   6900  O O   . ARG C 1 182 ? 27.457  6.375   48.087  1.00 12.25 ? 181  ARG C O   1 
ATOM   6901  C CB  . ARG C 1 182 ? 27.538  3.700   47.352  1.00 12.92 ? 181  ARG C CB  1 
ATOM   6902  C CG  . ARG C 1 182 ? 27.298  2.223   47.111  1.00 15.06 ? 181  ARG C CG  1 
ATOM   6903  C CD  . ARG C 1 182 ? 28.559  1.417   47.250  1.00 20.22 ? 181  ARG C CD  1 
ATOM   6904  N NE  . ARG C 1 182 ? 29.332  1.835   48.402  1.00 22.34 ? 181  ARG C NE  1 
ATOM   6905  C CZ  . ARG C 1 182 ? 30.558  1.440   48.750  1.00 23.15 ? 181  ARG C CZ  1 
ATOM   6906  N NH1 . ARG C 1 182 ? 31.302  0.614   48.034  1.00 23.78 ? 181  ARG C NH1 1 
ATOM   6907  N NH2 . ARG C 1 182 ? 31.030  1.843   49.937  1.00 24.09 ? 181  ARG C NH2 1 
ATOM   6908  N N   . ILE C 1 183 ? 26.284  6.967   46.257  1.00 10.84 ? 182  ILE C N   1 
ATOM   6909  C CA  . ILE C 1 183 ? 26.485  8.402   46.388  1.00 10.46 ? 182  ILE C CA  1 
ATOM   6910  C C   . ILE C 1 183 ? 25.163  9.090   46.736  1.00 10.81 ? 182  ILE C C   1 
ATOM   6911  O O   . ILE C 1 183 ? 24.155  8.814   46.049  1.00 10.73 ? 182  ILE C O   1 
ATOM   6912  C CB  . ILE C 1 183 ? 27.090  8.986   45.049  1.00 12.47 ? 182  ILE C CB  1 
ATOM   6913  C CG1 . ILE C 1 183 ? 28.482  8.397   44.784  1.00 13.79 ? 182  ILE C CG1 1 
ATOM   6914  C CG2 . ILE C 1 183 ? 27.086  10.531  45.020  1.00 11.38 ? 182  ILE C CG2 1 
ATOM   6915  C CD1 . ILE C 1 183 ? 29.656  8.934   45.622  1.00 14.99 ? 182  ILE C CD1 1 
ATOM   6916  N N   . VAL C 1 184 ? 25.190  9.944   47.756  1.00 10.18 ? 183  VAL C N   1 
ATOM   6917  C CA  . VAL C 1 184 ? 23.989  10.718  48.122  1.00 9.56  ? 183  VAL C CA  1 
ATOM   6918  C C   . VAL C 1 184 ? 23.850  11.935  47.199  1.00 8.73  ? 183  VAL C C   1 
ATOM   6919  O O   . VAL C 1 184 ? 24.732  12.798  47.152  1.00 8.56  ? 183  VAL C O   1 
ATOM   6920  C CB  . VAL C 1 184 ? 24.041  11.180  49.601  1.00 7.87  ? 183  VAL C CB  1 
ATOM   6921  C CG1 . VAL C 1 184 ? 23.024  12.276  49.859  1.00 8.84  ? 183  VAL C CG1 1 
ATOM   6922  C CG2 . VAL C 1 184 ? 23.902  10.019  50.562  1.00 8.14  ? 183  VAL C CG2 1 
ATOM   6923  N N   . PRO C 1 185 ? 22.715  11.982  46.504  1.00 8.76  ? 184  PRO C N   1 
ATOM   6924  C CA  . PRO C 1 185 ? 22.461  13.125  45.609  1.00 9.11  ? 184  PRO C CA  1 
ATOM   6925  C C   . PRO C 1 185 ? 21.849  14.272  46.381  1.00 9.04  ? 184  PRO C C   1 
ATOM   6926  O O   . PRO C 1 185 ? 20.860  14.043  47.111  1.00 9.27  ? 184  PRO C O   1 
ATOM   6927  C CB  . PRO C 1 185 ? 21.461  12.560  44.590  1.00 8.32  ? 184  PRO C CB  1 
ATOM   6928  C CG  . PRO C 1 185 ? 20.708  11.517  45.361  1.00 8.25  ? 184  PRO C CG  1 
ATOM   6929  C CD  . PRO C 1 185 ? 21.743  10.906  46.319  1.00 8.36  ? 184  PRO C CD  1 
ATOM   6930  N N   . ILE C 1 186 ? 22.395  15.453  46.215  1.00 9.15  ? 185  ILE C N   1 
ATOM   6931  C CA  . ILE C 1 186 ? 21.728  16.683  46.665  1.00 9.60  ? 185  ILE C CA  1 
ATOM   6932  C C   . ILE C 1 186 ? 20.922  17.187  45.423  1.00 10.01 ? 185  ILE C C   1 
ATOM   6933  O O   . ILE C 1 186 ? 21.569  17.475  44.402  1.00 10.09 ? 185  ILE C O   1 
ATOM   6934  C CB  . ILE C 1 186 ? 22.697  17.784  47.138  1.00 8.06  ? 185  ILE C CB  1 
ATOM   6935  C CG1 . ILE C 1 186 ? 23.531  17.270  48.359  1.00 11.06 ? 185  ILE C CG1 1 
ATOM   6936  C CG2 . ILE C 1 186 ? 21.996  19.131  47.442  1.00 8.18  ? 185  ILE C CG2 1 
ATOM   6937  C CD1 . ILE C 1 186 ? 24.472  18.381  48.921  1.00 12.82 ? 185  ILE C CD1 1 
ATOM   6938  N N   . VAL C 1 187 ? 19.638  17.280  45.625  1.00 10.11 ? 186  VAL C N   1 
ATOM   6939  C CA  . VAL C 1 187 ? 18.680  17.725  44.576  1.00 10.50 ? 186  VAL C CA  1 
ATOM   6940  C C   . VAL C 1 187 ? 18.545  19.229  44.597  1.00 10.40 ? 186  VAL C C   1 
ATOM   6941  O O   . VAL C 1 187 ? 18.002  19.812  45.562  1.00 11.15 ? 186  VAL C O   1 
ATOM   6942  C CB  . VAL C 1 187 ? 17.357  16.968  44.812  1.00 10.34 ? 186  VAL C CB  1 
ATOM   6943  C CG1 . VAL C 1 187 ? 16.222  17.443  43.916  1.00 10.67 ? 186  VAL C CG1 1 
ATOM   6944  C CG2 . VAL C 1 187 ? 17.569  15.472  44.708  1.00 11.72 ? 186  VAL C CG2 1 
ATOM   6945  N N   . GLU C 1 188 ? 19.020  19.878  43.534  1.00 9.85  ? 187  GLU C N   1 
ATOM   6946  C CA  . GLU C 1 188 ? 19.055  21.329  43.499  1.00 10.10 ? 187  GLU C CA  1 
ATOM   6947  C C   . GLU C 1 188 ? 18.288  21.972  42.360  1.00 10.59 ? 187  GLU C C   1 
ATOM   6948  O O   . GLU C 1 188 ? 18.864  22.238  41.284  1.00 10.18 ? 187  GLU C O   1 
ATOM   6949  C CB  . GLU C 1 188 ? 20.509  21.843  43.416  1.00 9.77  ? 187  GLU C CB  1 
ATOM   6950  C CG  . GLU C 1 188 ? 20.672  23.347  43.518  1.00 10.52 ? 187  GLU C CG  1 
ATOM   6951  C CD  . GLU C 1 188 ? 22.065  23.902  43.449  1.00 11.79 ? 187  GLU C CD  1 
ATOM   6952  O OE1 . GLU C 1 188 ? 22.950  23.059  43.597  1.00 12.87 ? 187  GLU C OE1 1 
ATOM   6953  O OE2 . GLU C 1 188 ? 22.291  25.083  43.263  1.00 14.08 ? 187  GLU C OE2 1 
ATOM   6954  N N   . PRO C 1 189 ? 17.020  22.225  42.618  1.00 10.41 ? 188  PRO C N   1 
ATOM   6955  C CA  . PRO C 1 189 ? 16.142  22.954  41.686  1.00 10.49 ? 188  PRO C CA  1 
ATOM   6956  C C   . PRO C 1 189 ? 16.165  24.423  42.076  1.00 10.45 ? 188  PRO C C   1 
ATOM   6957  O O   . PRO C 1 189 ? 15.354  24.864  42.916  1.00 11.16 ? 188  PRO C O   1 
ATOM   6958  C CB  . PRO C 1 189 ? 14.779  22.311  41.895  1.00 10.61 ? 188  PRO C CB  1 
ATOM   6959  C CG  . PRO C 1 189 ? 14.814  21.677  43.262  1.00 11.06 ? 188  PRO C CG  1 
ATOM   6960  C CD  . PRO C 1 189 ? 16.239  21.780  43.784  1.00 10.45 ? 188  PRO C CD  1 
ATOM   6961  N N   . GLU C 1 190 ? 17.076  25.187  41.486  1.00 9.86  ? 189  GLU C N   1 
ATOM   6962  C CA  . GLU C 1 190 ? 17.200  26.590  41.832  1.00 10.37 ? 189  GLU C CA  1 
ATOM   6963  C C   . GLU C 1 190 ? 16.263  27.496  41.041  1.00 10.78 ? 189  GLU C C   1 
ATOM   6964  O O   . GLU C 1 190 ? 16.371  27.555  39.812  1.00 11.07 ? 189  GLU C O   1 
ATOM   6965  C CB  . GLU C 1 190 ? 18.621  27.172  41.671  1.00 10.29 ? 189  GLU C CB  1 
ATOM   6966  C CG  . GLU C 1 190 ? 18.677  28.645  42.069  1.00 11.90 ? 189  GLU C CG  1 
ATOM   6967  C CD  . GLU C 1 190 ? 19.978  29.360  42.165  1.00 12.73 ? 189  GLU C CD  1 
ATOM   6968  O OE1 . GLU C 1 190 ? 20.978  28.694  41.868  1.00 13.65 ? 189  GLU C OE1 1 
ATOM   6969  O OE2 . GLU C 1 190 ? 20.027  30.545  42.493  1.00 16.48 ? 189  GLU C OE2 1 
ATOM   6970  N N   . VAL C 1 191 ? 15.378  28.173  41.763  1.00 10.17 ? 190  VAL C N   1 
ATOM   6971  C CA  . VAL C 1 191 ? 14.505  29.201  41.166  1.00 10.77 ? 190  VAL C CA  1 
ATOM   6972  C C   . VAL C 1 191 ? 15.265  30.524  41.312  1.00 11.73 ? 190  VAL C C   1 
ATOM   6973  O O   . VAL C 1 191 ? 15.472  30.961  42.458  1.00 11.23 ? 190  VAL C O   1 
ATOM   6974  C CB  . VAL C 1 191 ? 13.104  29.215  41.796  1.00 9.77  ? 190  VAL C CB  1 
ATOM   6975  C CG1 . VAL C 1 191 ? 12.237  30.329  41.229  1.00 9.49  ? 190  VAL C CG1 1 
ATOM   6976  C CG2 . VAL C 1 191 ? 12.402  27.868  41.687  1.00 8.53  ? 190  VAL C CG2 1 
ATOM   6977  N N   . LEU C 1 192 ? 15.673  31.103  40.187  1.00 12.63 ? 191  LEU C N   1 
ATOM   6978  C CA  . LEU C 1 192 ? 16.502  32.317  40.229  1.00 14.17 ? 191  LEU C CA  1 
ATOM   6979  C C   . LEU C 1 192 ? 15.741  33.500  40.833  1.00 14.87 ? 191  LEU C C   1 
ATOM   6980  O O   . LEU C 1 192 ? 14.522  33.631  40.645  1.00 14.75 ? 191  LEU C O   1 
ATOM   6981  C CB  . LEU C 1 192 ? 16.988  32.653  38.818  1.00 15.55 ? 191  LEU C CB  1 
ATOM   6982  C CG  . LEU C 1 192 ? 17.756  31.593  38.056  1.00 17.11 ? 191  LEU C CG  1 
ATOM   6983  C CD1 . LEU C 1 192 ? 18.211  32.159  36.715  1.00 18.08 ? 191  LEU C CD1 1 
ATOM   6984  C CD2 . LEU C 1 192 ? 18.950  31.166  38.916  1.00 18.56 ? 191  LEU C CD2 1 
ATOM   6985  N N   . PRO C 1 193 ? 16.509  34.354  41.500  1.00 15.40 ? 192  PRO C N   1 
ATOM   6986  C CA  . PRO C 1 193 ? 15.982  35.595  42.069  1.00 16.62 ? 192  PRO C CA  1 
ATOM   6987  C C   . PRO C 1 193 ? 15.750  36.687  41.042  1.00 17.43 ? 192  PRO C C   1 
ATOM   6988  O O   . PRO C 1 193 ? 14.916  37.589  41.291  1.00 18.07 ? 192  PRO C O   1 
ATOM   6989  C CB  . PRO C 1 193 ? 17.034  35.972  43.111  1.00 16.49 ? 192  PRO C CB  1 
ATOM   6990  C CG  . PRO C 1 193 ? 18.326  35.465  42.511  1.00 16.43 ? 192  PRO C CG  1 
ATOM   6991  C CD  . PRO C 1 193 ? 17.954  34.198  41.756  1.00 15.57 ? 192  PRO C CD  1 
ATOM   6992  N N   . ASP C 1 194 ? 16.427  36.645  39.908  1.00 18.04 ? 193  ASP C N   1 
ATOM   6993  C CA  . ASP C 1 194 ? 16.318  37.680  38.861  1.00 19.27 ? 193  ASP C CA  1 
ATOM   6994  C C   . ASP C 1 194 ? 14.847  38.047  38.597  1.00 19.31 ? 193  ASP C C   1 
ATOM   6995  O O   . ASP C 1 194 ? 13.977  37.173  38.451  1.00 19.73 ? 193  ASP C O   1 
ATOM   6996  C CB  . ASP C 1 194 ? 17.013  37.262  37.576  1.00 21.41 ? 193  ASP C CB  1 
ATOM   6997  C CG  . ASP C 1 194 ? 18.405  36.715  37.611  1.00 22.50 ? 193  ASP C CG  1 
ATOM   6998  O OD1 . ASP C 1 194 ? 18.694  35.812  38.417  1.00 23.70 ? 193  ASP C OD1 1 
ATOM   6999  O OD2 . ASP C 1 194 ? 19.263  37.118  36.791  1.00 23.76 ? 193  ASP C OD2 1 
ATOM   7000  N N   . GLY C 1 195 ? 14.588  39.340  38.504  1.00 19.87 ? 194  GLY C N   1 
ATOM   7001  C CA  . GLY C 1 195 ? 13.239  39.826  38.180  1.00 19.91 ? 194  GLY C CA  1 
ATOM   7002  C C   . GLY C 1 195 ? 12.685  40.763  39.236  1.00 20.14 ? 194  GLY C C   1 
ATOM   7003  O O   . GLY C 1 195 ? 13.342  41.074  40.243  1.00 21.07 ? 194  GLY C O   1 
ATOM   7004  N N   . ASP C 1 196 ? 11.453  41.194  39.005  1.00 19.82 ? 195  ASP C N   1 
ATOM   7005  C CA  . ASP C 1 196 ? 10.779  42.164  39.875  1.00 19.74 ? 195  ASP C CA  1 
ATOM   7006  C C   . ASP C 1 196 ? 9.446   41.630  40.389  1.00 18.71 ? 195  ASP C C   1 
ATOM   7007  O O   . ASP C 1 196 ? 8.550   42.423  40.736  1.00 18.93 ? 195  ASP C O   1 
ATOM   7008  C CB  . ASP C 1 196 ? 10.654  43.506  39.159  1.00 23.33 ? 195  ASP C CB  1 
ATOM   7009  C CG  . ASP C 1 196 ? 9.644   43.465  38.027  1.00 25.05 ? 195  ASP C CG  1 
ATOM   7010  O OD1 . ASP C 1 196 ? 9.298   42.400  37.513  1.00 26.38 ? 195  ASP C OD1 1 
ATOM   7011  O OD2 . ASP C 1 196 ? 9.182   44.569  37.673  1.00 27.73 ? 195  ASP C OD2 1 
ATOM   7012  N N   . HIS C 1 197 ? 9.340   40.316  40.429  1.00 17.51 ? 196  HIS C N   1 
ATOM   7013  C CA  . HIS C 1 197 ? 8.130   39.645  40.944  1.00 16.21 ? 196  HIS C CA  1 
ATOM   7014  C C   . HIS C 1 197 ? 8.121   39.799  42.472  1.00 15.58 ? 196  HIS C C   1 
ATOM   7015  O O   . HIS C 1 197 ? 9.196   40.006  43.056  1.00 15.02 ? 196  HIS C O   1 
ATOM   7016  C CB  . HIS C 1 197 ? 8.128   38.131  40.623  1.00 13.88 ? 196  HIS C CB  1 
ATOM   7017  C CG  . HIS C 1 197 ? 9.465   37.513  40.930  1.00 15.30 ? 196  HIS C CG  1 
ATOM   7018  N ND1 . HIS C 1 197 ? 10.578  37.652  40.131  1.00 14.34 ? 196  HIS C ND1 1 
ATOM   7019  C CD2 . HIS C 1 197 ? 9.838   36.750  41.985  1.00 12.64 ? 196  HIS C CD2 1 
ATOM   7020  C CE1 . HIS C 1 197 ? 11.581  36.978  40.691  1.00 15.67 ? 196  HIS C CE1 1 
ATOM   7021  N NE2 . HIS C 1 197 ? 11.163  36.431  41.812  1.00 14.25 ? 196  HIS C NE2 1 
ATOM   7022  N N   . ASP C 1 198 ? 6.947   39.657  43.047  1.00 15.35 ? 197  ASP C N   1 
ATOM   7023  C CA  . ASP C 1 198 ? 6.761   39.763  44.506  1.00 14.80 ? 197  ASP C CA  1 
ATOM   7024  C C   . ASP C 1 198 ? 6.927   38.388  45.145  1.00 14.29 ? 197  ASP C C   1 
ATOM   7025  O O   . ASP C 1 198 ? 7.111   37.379  44.458  1.00 13.82 ? 197  ASP C O   1 
ATOM   7026  C CB  . ASP C 1 198 ? 5.451   40.456  44.840  1.00 15.90 ? 197  ASP C CB  1 
ATOM   7027  C CG  . ASP C 1 198 ? 4.222   39.701  44.361  1.00 17.25 ? 197  ASP C CG  1 
ATOM   7028  O OD1 . ASP C 1 198 ? 4.296   38.513  44.025  1.00 16.90 ? 197  ASP C OD1 1 
ATOM   7029  O OD2 . ASP C 1 198 ? 3.151   40.347  44.361  1.00 18.50 ? 197  ASP C OD2 1 
ATOM   7030  N N   . LEU C 1 199 ? 6.848   38.375  46.472  1.00 13.48 ? 198  LEU C N   1 
ATOM   7031  C CA  . LEU C 1 199 ? 7.005   37.179  47.284  1.00 13.13 ? 198  LEU C CA  1 
ATOM   7032  C C   . LEU C 1 199 ? 5.914   36.145  46.992  1.00 12.48 ? 198  LEU C C   1 
ATOM   7033  O O   . LEU C 1 199 ? 6.210   34.944  46.992  1.00 11.72 ? 198  LEU C O   1 
ATOM   7034  C CB  . LEU C 1 199 ? 7.043   37.611  48.763  1.00 14.79 ? 198  LEU C CB  1 
ATOM   7035  C CG  . LEU C 1 199 ? 7.209   36.518  49.796  1.00 14.51 ? 198  LEU C CG  1 
ATOM   7036  C CD1 . LEU C 1 199 ? 8.614   35.943  49.763  1.00 15.50 ? 198  LEU C CD1 1 
ATOM   7037  C CD2 . LEU C 1 199 ? 6.919   37.124  51.171  1.00 16.57 ? 198  LEU C CD2 1 
ATOM   7038  N N   . ASP C 1 200 ? 4.717   36.639  46.722  1.00 12.32 ? 199  ASP C N   1 
ATOM   7039  C CA  . ASP C 1 200 ? 3.562   35.783  46.417  1.00 12.35 ? 199  ASP C CA  1 
ATOM   7040  C C   . ASP C 1 200 ? 3.861   34.928  45.174  1.00 11.65 ? 199  ASP C C   1 
ATOM   7041  O O   . ASP C 1 200 ? 3.637   33.708  45.185  1.00 11.02 ? 199  ASP C O   1 
ATOM   7042  C CB  . ASP C 1 200 ? 2.289   36.616  46.275  1.00 14.65 ? 199  ASP C CB  1 
ATOM   7043  C CG  . ASP C 1 200 ? 1.095   35.762  45.868  1.00 17.75 ? 199  ASP C CG  1 
ATOM   7044  O OD1 . ASP C 1 200 ? 0.661   34.972  46.729  1.00 19.53 ? 199  ASP C OD1 1 
ATOM   7045  O OD2 . ASP C 1 200 ? 0.586   35.832  44.736  1.00 18.69 ? 199  ASP C OD2 1 
ATOM   7046  N N   . ARG C 1 201 ? 4.348   35.604  44.145  1.00 10.69 ? 200  ARG C N   1 
ATOM   7047  C CA  . ARG C 1 201 ? 4.723   34.887  42.901  1.00 9.71  ? 200  ARG C CA  1 
ATOM   7048  C C   . ARG C 1 201 ? 5.809   33.868  43.185  1.00 8.84  ? 200  ARG C C   1 
ATOM   7049  O O   . ARG C 1 201 ? 5.736   32.685  42.805  1.00 7.73  ? 200  ARG C O   1 
ATOM   7050  C CB  . ARG C 1 201 ? 5.144   35.865  41.798  1.00 10.21 ? 200  ARG C CB  1 
ATOM   7051  C CG  . ARG C 1 201 ? 5.691   35.222  40.527  1.00 10.53 ? 200  ARG C CG  1 
ATOM   7052  C CD  . ARG C 1 201 ? 4.813   35.423  39.337  1.00 13.15 ? 200  ARG C CD  1 
ATOM   7053  N NE  . ARG C 1 201 ? 5.419   34.840  38.131  1.00 11.16 ? 200  ARG C NE  1 
ATOM   7054  C CZ  . ARG C 1 201 ? 5.111   33.659  37.609  1.00 10.94 ? 200  ARG C CZ  1 
ATOM   7055  N NH1 . ARG C 1 201 ? 4.164   32.875  38.125  1.00 8.96  ? 200  ARG C NH1 1 
ATOM   7056  N NH2 . ARG C 1 201 ? 5.743   33.236  36.506  1.00 8.03  ? 200  ARG C NH2 1 
ATOM   7057  N N   . ALA C 1 202 ? 6.855   34.312  43.900  1.00 8.04  ? 201  ALA C N   1 
ATOM   7058  C CA  . ALA C 1 202 ? 7.964   33.387  44.208  1.00 8.36  ? 201  ALA C CA  1 
ATOM   7059  C C   . ALA C 1 202 ? 7.513   32.166  44.972  1.00 7.67  ? 201  ALA C C   1 
ATOM   7060  O O   . ALA C 1 202 ? 7.986   31.024  44.756  1.00 9.08  ? 201  ALA C O   1 
ATOM   7061  C CB  . ALA C 1 202 ? 9.093   34.159  44.889  1.00 9.02  ? 201  ALA C CB  1 
ATOM   7062  N N   . GLN C 1 203 ? 6.576   32.312  45.902  1.00 8.38  ? 202  GLN C N   1 
ATOM   7063  C CA  . GLN C 1 203 ? 6.104   31.163  46.708  1.00 7.38  ? 202  GLN C CA  1 
ATOM   7064  C C   . GLN C 1 203 ? 5.347   30.193  45.797  1.00 6.86  ? 202  GLN C C   1 
ATOM   7065  O O   . GLN C 1 203 ? 5.546   28.972  45.846  1.00 6.68  ? 202  GLN C O   1 
ATOM   7066  C CB  . GLN C 1 203 ? 5.243   31.600  47.895  1.00 8.32  ? 202  GLN C CB  1 
ATOM   7067  C CG  . GLN C 1 203 ? 4.710   30.444  48.733  1.00 8.40  ? 202  GLN C CG  1 
ATOM   7068  C CD  . GLN C 1 203 ? 4.175   30.934  50.074  1.00 11.02 ? 202  GLN C CD  1 
ATOM   7069  O OE1 . GLN C 1 203 ? 4.256   32.110  50.424  1.00 10.52 ? 202  GLN C OE1 1 
ATOM   7070  N NE2 . GLN C 1 203 ? 3.644   30.003  50.847  1.00 10.33 ? 202  GLN C NE2 1 
ATOM   7071  N N   . LYS C 1 204 ? 4.467   30.770  44.998  1.00 6.96  ? 203  LYS C N   1 
ATOM   7072  C CA  . LYS C 1 204 ? 3.627   29.951  44.088  1.00 6.79  ? 203  LYS C CA  1 
ATOM   7073  C C   . LYS C 1 204 ? 4.518   29.187  43.131  1.00 6.00  ? 203  LYS C C   1 
ATOM   7074  O O   . LYS C 1 204 ? 4.296   27.989  42.923  1.00 5.76  ? 203  LYS C O   1 
ATOM   7075  C CB  . LYS C 1 204 ? 2.585   30.805  43.375  1.00 8.04  ? 203  LYS C CB  1 
ATOM   7076  C CG  . LYS C 1 204 ? 1.363   31.118  44.257  1.00 9.27  ? 203  LYS C CG  1 
ATOM   7077  C CD  . LYS C 1 204 ? 0.731   32.428  43.825  1.00 9.93  ? 203  LYS C CD  1 
ATOM   7078  C CE  . LYS C 1 204 ? -0.634  32.650  44.448  1.00 10.07 ? 203  LYS C CE  1 
ATOM   7079  N NZ  . LYS C 1 204 ? -1.133  33.990  44.020  1.00 10.77 ? 203  LYS C NZ  1 
ATOM   7080  N N   . VAL C 1 205 ? 5.520   29.839  42.569  1.00 6.92  ? 204  VAL C N   1 
ATOM   7081  C CA  . VAL C 1 205 ? 6.467   29.149  41.646  1.00 6.71  ? 204  VAL C CA  1 
ATOM   7082  C C   . VAL C 1 205 ? 7.228   28.045  42.368  1.00 6.46  ? 204  VAL C C   1 
ATOM   7083  O O   . VAL C 1 205 ? 7.355   26.905  41.889  1.00 5.96  ? 204  VAL C O   1 
ATOM   7084  C CB  . VAL C 1 205 ? 7.407   30.156  40.951  1.00 6.05  ? 204  VAL C CB  1 
ATOM   7085  C CG1 . VAL C 1 205 ? 8.586   29.447  40.276  1.00 6.96  ? 204  VAL C CG1 1 
ATOM   7086  C CG2 . VAL C 1 205 ? 6.684   31.045  39.956  1.00 8.15  ? 204  VAL C CG2 1 
ATOM   7087  N N   . THR C 1 206 ? 7.762   28.381  43.548  1.00 6.07  ? 205  THR C N   1 
ATOM   7088  C CA  . THR C 1 206 ? 8.512   27.398  44.339  1.00 5.65  ? 205  THR C CA  1 
ATOM   7089  C C   . THR C 1 206 ? 7.657   26.193  44.680  1.00 5.46  ? 205  THR C C   1 
ATOM   7090  O O   . THR C 1 206 ? 8.147   25.055  44.567  1.00 5.43  ? 205  THR C O   1 
ATOM   7091  C CB  . THR C 1 206 ? 9.222   28.010  45.611  1.00 6.75  ? 205  THR C CB  1 
ATOM   7092  O OG1 . THR C 1 206 ? 10.128  29.048  45.129  1.00 10.29 ? 205  THR C OG1 1 
ATOM   7093  C CG2 . THR C 1 206 ? 9.996   26.993  46.451  1.00 8.35  ? 205  THR C CG2 1 
ATOM   7094  N N   . GLU C 1 207 ? 6.408   26.408  45.118  1.00 5.55  ? 206  GLU C N   1 
ATOM   7095  C CA  . GLU C 1 207 ? 5.544   25.259  45.428  1.00 5.53  ? 206  GLU C CA  1 
ATOM   7096  C C   . GLU C 1 207 ? 5.269   24.388  44.201  1.00 5.68  ? 206  GLU C C   1 
ATOM   7097  O O   . GLU C 1 207 ? 5.243   23.145  44.305  1.00 5.41  ? 206  GLU C O   1 
ATOM   7098  C CB  . GLU C 1 207 ? 4.210   25.701  46.034  1.00 7.46  ? 206  GLU C CB  1 
ATOM   7099  C CG  . GLU C 1 207 ? 4.347   26.120  47.535  1.00 8.91  ? 206  GLU C CG  1 
ATOM   7100  C CD  . GLU C 1 207 ? 3.187   26.950  48.012  1.00 11.10 ? 206  GLU C CD  1 
ATOM   7101  O OE1 . GLU C 1 207 ? 2.243   27.263  47.312  1.00 11.21 ? 206  GLU C OE1 1 
ATOM   7102  O OE2 . GLU C 1 207 ? 3.319   27.319  49.193  1.00 10.33 ? 206  GLU C OE2 1 
ATOM   7103  N N   . THR C 1 208 ? 5.058   25.038  43.069  1.00 6.01  ? 207  THR C N   1 
ATOM   7104  C CA  . THR C 1 208 ? 4.814   24.284  41.805  1.00 5.64  ? 207  THR C CA  1 
ATOM   7105  C C   . THR C 1 208 ? 5.998   23.409  41.441  1.00 5.19  ? 207  THR C C   1 
ATOM   7106  O O   . THR C 1 208 ? 5.802   22.218  41.153  1.00 5.22  ? 207  THR C O   1 
ATOM   7107  C CB  . THR C 1 208 ? 4.407   25.260  40.652  1.00 5.81  ? 207  THR C CB  1 
ATOM   7108  O OG1 . THR C 1 208 ? 3.309   26.045  41.159  1.00 5.45  ? 207  THR C OG1 1 
ATOM   7109  C CG2 . THR C 1 208 ? 4.017   24.530  39.344  1.00 6.69  ? 207  THR C CG2 1 
ATOM   7110  N N   . VAL C 1 209 ? 7.177   23.996  41.431  1.00 5.53  ? 208  VAL C N   1 
ATOM   7111  C CA  . VAL C 1 209 ? 8.432   23.312  41.111  1.00 6.03  ? 208  VAL C CA  1 
ATOM   7112  C C   . VAL C 1 209 ? 8.682   22.100  41.993  1.00 5.49  ? 208  VAL C C   1 
ATOM   7113  O O   . VAL C 1 209 ? 8.986   21.013  41.504  1.00 5.06  ? 208  VAL C O   1 
ATOM   7114  C CB  . VAL C 1 209 ? 9.625   24.290  41.116  1.00 6.02  ? 208  VAL C CB  1 
ATOM   7115  C CG1 . VAL C 1 209 ? 10.965  23.586  41.235  1.00 8.19  ? 208  VAL C CG1 1 
ATOM   7116  C CG2 . VAL C 1 209 ? 9.616   25.246  39.935  1.00 7.95  ? 208  VAL C CG2 1 
ATOM   7117  N N   . LEU C 1 210 ? 8.586   22.312  43.310  1.00 6.23  ? 209  LEU C N   1 
ATOM   7118  C CA  . LEU C 1 210 ? 8.859   21.245  44.283  1.00 5.68  ? 209  LEU C CA  1 
ATOM   7119  C C   . LEU C 1 210 ? 7.875   20.093  44.150  1.00 4.48  ? 209  LEU C C   1 
ATOM   7120  O O   . LEU C 1 210 ? 8.284   18.919  44.250  1.00 3.49  ? 209  LEU C O   1 
ATOM   7121  C CB  . LEU C 1 210 ? 8.920   21.899  45.673  1.00 8.53  ? 209  LEU C CB  1 
ATOM   7122  C CG  . LEU C 1 210 ? 10.262  22.083  46.352  1.00 12.10 ? 209  LEU C CG  1 
ATOM   7123  C CD1 . LEU C 1 210 ? 11.432  22.295  45.416  1.00 12.14 ? 209  LEU C CD1 1 
ATOM   7124  C CD2 . LEU C 1 210 ? 10.161  23.260  47.326  1.00 11.07 ? 209  LEU C CD2 1 
ATOM   7125  N N   . ALA C 1 211 ? 6.592   20.363  43.942  1.00 4.19  ? 210  ALA C N   1 
ATOM   7126  C CA  . ALA C 1 211 ? 5.618   19.270  43.750  1.00 3.36  ? 210  ALA C CA  1 
ATOM   7127  C C   . ALA C 1 211 ? 6.017   18.381  42.576  1.00 3.16  ? 210  ALA C C   1 
ATOM   7128  O O   . ALA C 1 211 ? 5.914   17.145  42.658  1.00 3.49  ? 210  ALA C O   1 
ATOM   7129  C CB  . ALA C 1 211 ? 4.210   19.811  43.569  1.00 3.57  ? 210  ALA C CB  1 
ATOM   7130  N N   . ALA C 1 212 ? 6.439   19.010  41.485  1.00 3.09  ? 211  ALA C N   1 
ATOM   7131  C CA  . ALA C 1 212 ? 6.872   18.263  40.291  1.00 3.39  ? 211  ALA C CA  1 
ATOM   7132  C C   . ALA C 1 212 ? 8.126   17.447  40.590  1.00 3.51  ? 211  ALA C C   1 
ATOM   7133  O O   . ALA C 1 212 ? 8.250   16.284  40.173  1.00 3.70  ? 211  ALA C O   1 
ATOM   7134  C CB  . ALA C 1 212 ? 7.096   19.235  39.111  1.00 2.14  ? 211  ALA C CB  1 
ATOM   7135  N N   . VAL C 1 213 ? 9.074   18.069  41.289  1.00 4.28  ? 212  VAL C N   1 
ATOM   7136  C CA  . VAL C 1 213 ? 10.321  17.388  41.652  1.00 4.45  ? 212  VAL C CA  1 
ATOM   7137  C C   . VAL C 1 213 ? 10.036  16.099  42.429  1.00 4.49  ? 212  VAL C C   1 
ATOM   7138  O O   . VAL C 1 213 ? 10.656  15.071  42.151  1.00 4.15  ? 212  VAL C O   1 
ATOM   7139  C CB  . VAL C 1 213 ? 11.284  18.315  42.437  1.00 6.12  ? 212  VAL C CB  1 
ATOM   7140  C CG1 . VAL C 1 213 ? 12.376  17.517  43.152  1.00 6.04  ? 212  VAL C CG1 1 
ATOM   7141  C CG2 . VAL C 1 213 ? 11.892  19.409  41.575  1.00 7.53  ? 212  VAL C CG2 1 
ATOM   7142  N N   . TYR C 1 214 ? 9.151   16.176  43.423  1.00 4.62  ? 213  TYR C N   1 
ATOM   7143  C CA  . TYR C 1 214 ? 8.887   14.961  44.236  1.00 4.83  ? 213  TYR C CA  1 
ATOM   7144  C C   . TYR C 1 214 ? 7.993   13.972  43.534  1.00 5.49  ? 213  TYR C C   1 
ATOM   7145  O O   . TYR C 1 214 ? 7.947   12.791  43.888  1.00 7.03  ? 213  TYR C O   1 
ATOM   7146  C CB  . TYR C 1 214 ? 8.406   15.354  45.673  1.00 5.06  ? 213  TYR C CB  1 
ATOM   7147  C CG  . TYR C 1 214 ? 9.678   15.812  46.402  1.00 3.98  ? 213  TYR C CG  1 
ATOM   7148  C CD1 . TYR C 1 214 ? 10.637  14.852  46.750  1.00 6.00  ? 213  TYR C CD1 1 
ATOM   7149  C CD2 . TYR C 1 214 ? 9.944   17.152  46.589  1.00 6.66  ? 213  TYR C CD2 1 
ATOM   7150  C CE1 . TYR C 1 214 ? 11.836  15.253  47.354  1.00 6.10  ? 213  TYR C CE1 1 
ATOM   7151  C CE2 . TYR C 1 214 ? 11.133  17.572  47.194  1.00 7.13  ? 213  TYR C CE2 1 
ATOM   7152  C CZ  . TYR C 1 214 ? 12.062  16.607  47.567  1.00 6.91  ? 213  TYR C CZ  1 
ATOM   7153  O OH  . TYR C 1 214 ? 13.227  17.037  48.145  1.00 8.82  ? 213  TYR C OH  1 
ATOM   7154  N N   . LYS C 1 215 ? 7.262   14.434  42.520  1.00 4.95  ? 214  LYS C N   1 
ATOM   7155  C CA  . LYS C 1 215 ? 6.467   13.434  41.743  1.00 3.69  ? 214  LYS C CA  1 
ATOM   7156  C C   . LYS C 1 215 ? 7.486   12.678  40.888  1.00 2.95  ? 214  LYS C C   1 
ATOM   7157  O O   . LYS C 1 215 ? 7.407   11.460  40.756  1.00 2.26  ? 214  LYS C O   1 
ATOM   7158  C CB  . LYS C 1 215 ? 5.353   14.031  40.915  1.00 3.23  ? 214  LYS C CB  1 
ATOM   7159  C CG  . LYS C 1 215 ? 4.557   13.029  40.069  1.00 3.12  ? 214  LYS C CG  1 
ATOM   7160  C CD  . LYS C 1 215 ? 3.970   11.883  40.907  1.00 4.71  ? 214  LYS C CD  1 
ATOM   7161  C CE  . LYS C 1 215 ? 2.805   11.211  40.201  1.00 4.46  ? 214  LYS C CE  1 
ATOM   7162  N NZ  . LYS C 1 215 ? 3.223   10.406  39.039  1.00 5.08  ? 214  LYS C NZ  1 
ATOM   7163  N N   . ALA C 1 216 ? 8.449   13.437  40.372  1.00 4.06  ? 215  ALA C N   1 
ATOM   7164  C CA  . ALA C 1 216 ? 9.454   12.786  39.476  1.00 4.49  ? 215  ALA C CA  1 
ATOM   7165  C C   . ALA C 1 216 ? 10.300  11.812  40.277  1.00 4.37  ? 215  ALA C C   1 
ATOM   7166  O O   . ALA C 1 216 ? 10.593  10.729  39.778  1.00 3.88  ? 215  ALA C O   1 
ATOM   7167  C CB  . ALA C 1 216 ? 10.260  13.828  38.726  1.00 2.80  ? 215  ALA C CB  1 
ATOM   7168  N N   . LEU C 1 217 ? 10.651  12.170  41.513  1.00 5.08  ? 216  LEU C N   1 
ATOM   7169  C CA  . LEU C 1 217 ? 11.493  11.262  42.340  1.00 4.94  ? 216  LEU C CA  1 
ATOM   7170  C C   . LEU C 1 217 ? 10.779  9.954   42.602  1.00 4.80  ? 216  LEU C C   1 
ATOM   7171  O O   . LEU C 1 217 ? 11.373  8.880   42.569  1.00 4.53  ? 216  LEU C O   1 
ATOM   7172  C CB  . LEU C 1 217 ? 11.930  12.012  43.604  1.00 7.86  ? 216  LEU C CB  1 
ATOM   7173  C CG  . LEU C 1 217 ? 13.095  12.991  43.465  1.00 8.94  ? 216  LEU C CG  1 
ATOM   7174  C CD1 . LEU C 1 217 ? 13.590  13.449  44.840  1.00 10.49 ? 216  LEU C CD1 1 
ATOM   7175  C CD2 . LEU C 1 217 ? 14.213  12.317  42.687  1.00 9.18  ? 216  LEU C CD2 1 
ATOM   7176  N N   . SER C 1 218 ? 9.484   10.057  42.875  1.00 4.23  ? 217  SER C N   1 
ATOM   7177  C CA  . SER C 1 218 ? 8.630   8.873   43.076  1.00 4.63  ? 217  SER C CA  1 
ATOM   7178  C C   . SER C 1 218 ? 8.536   8.020   41.819  1.00 4.73  ? 217  SER C C   1 
ATOM   7179  O O   . SER C 1 218 ? 8.680   6.781   41.861  1.00 4.77  ? 217  SER C O   1 
ATOM   7180  C CB  . SER C 1 218 ? 7.242   9.354   43.553  1.00 4.81  ? 217  SER C CB  1 
ATOM   7181  O OG  . SER C 1 218 ? 6.315   8.288   43.526  1.00 5.85  ? 217  SER C OG  1 
ATOM   7182  N N   . ASP C 1 219 ? 8.314   8.678   40.681  1.00 5.53  ? 218  ASP C N   1 
ATOM   7183  C CA  . ASP C 1 219 ? 8.173   7.972   39.387  1.00 6.13  ? 218  ASP C CA  1 
ATOM   7184  C C   . ASP C 1 219 ? 9.423   7.138   39.069  1.00 5.92  ? 218  ASP C C   1 
ATOM   7185  O O   . ASP C 1 219 ? 9.326   6.032   38.500  1.00 7.16  ? 218  ASP C O   1 
ATOM   7186  C CB  . ASP C 1 219 ? 7.835   8.949   38.262  1.00 6.07  ? 218  ASP C CB  1 
ATOM   7187  C CG  . ASP C 1 219 ? 6.405   9.451   38.296  1.00 7.38  ? 218  ASP C CG  1 
ATOM   7188  O OD1 . ASP C 1 219 ? 5.557   8.916   39.020  1.00 7.37  ? 218  ASP C OD1 1 
ATOM   7189  O OD2 . ASP C 1 219 ? 6.150   10.430  37.555  1.00 6.55  ? 218  ASP C OD2 1 
ATOM   7190  N N   . HIS C 1 220 ? 10.555  7.668   39.444  1.00 6.38  ? 219  HIS C N   1 
ATOM   7191  C CA  . HIS C 1 220 ? 11.854  6.980   39.229  1.00 6.39  ? 219  HIS C CA  1 
ATOM   7192  C C   . HIS C 1 220 ? 12.326  6.190   40.437  1.00 6.71  ? 219  HIS C C   1 
ATOM   7193  O O   . HIS C 1 220 ? 13.454  5.651   40.469  1.00 6.26  ? 219  HIS C O   1 
ATOM   7194  C CB  . HIS C 1 220 ? 12.923  7.991   38.763  1.00 5.81  ? 219  HIS C CB  1 
ATOM   7195  C CG  . HIS C 1 220 ? 12.614  8.550   37.400  1.00 6.38  ? 219  HIS C CG  1 
ATOM   7196  N ND1 . HIS C 1 220 ? 13.145  8.034   36.249  1.00 7.37  ? 219  HIS C ND1 1 
ATOM   7197  C CD2 . HIS C 1 220 ? 11.859  9.625   37.049  1.00 6.86  ? 219  HIS C CD2 1 
ATOM   7198  C CE1 . HIS C 1 220 ? 12.711  8.769   35.222  1.00 6.18  ? 219  HIS C CE1 1 
ATOM   7199  N NE2 . HIS C 1 220 ? 11.956  9.739   35.671  1.00 7.31  ? 219  HIS C NE2 1 
ATOM   7200  N N   . HIS C 1 221 ? 11.489  6.065   41.457  1.00 7.45  ? 220  HIS C N   1 
ATOM   7201  C CA  . HIS C 1 221 ? 11.755  5.190   42.604  1.00 6.61  ? 220  HIS C CA  1 
ATOM   7202  C C   . HIS C 1 221 ? 13.029  5.572   43.375  1.00 6.27  ? 220  HIS C C   1 
ATOM   7203  O O   . HIS C 1 221 ? 13.784  4.664   43.776  1.00 6.99  ? 220  HIS C O   1 
ATOM   7204  C CB  . HIS C 1 221 ? 11.902  3.703   42.180  1.00 7.96  ? 220  HIS C CB  1 
ATOM   7205  C CG  . HIS C 1 221 ? 10.701  3.200   41.423  1.00 9.14  ? 220  HIS C CG  1 
ATOM   7206  N ND1 . HIS C 1 221 ? 9.395   3.338   41.854  1.00 10.88 ? 220  HIS C ND1 1 
ATOM   7207  C CD2 . HIS C 1 221 ? 10.647  2.535   40.254  1.00 8.89  ? 220  HIS C CD2 1 
ATOM   7208  C CE1 . HIS C 1 221 ? 8.583   2.805   40.951  1.00 9.97  ? 220  HIS C CE1 1 
ATOM   7209  N NE2 . HIS C 1 221 ? 9.326   2.289   39.979  1.00 11.82 ? 220  HIS C NE2 1 
ATOM   7210  N N   . VAL C 1 222 ? 13.250  6.822   43.583  1.00 6.24  ? 221  VAL C N   1 
ATOM   7211  C CA  . VAL C 1 222 ? 14.411  7.335   44.347  1.00 6.88  ? 221  VAL C CA  1 
ATOM   7212  C C   . VAL C 1 222 ? 14.151  7.191   45.854  1.00 7.29  ? 221  VAL C C   1 
ATOM   7213  O O   . VAL C 1 222 ? 13.067  7.511   46.338  1.00 5.55  ? 221  VAL C O   1 
ATOM   7214  C CB  . VAL C 1 222 ? 14.701  8.767   43.895  1.00 7.25  ? 221  VAL C CB  1 
ATOM   7215  C CG1 . VAL C 1 222 ? 15.762  9.458   44.763  1.00 6.66  ? 221  VAL C CG1 1 
ATOM   7216  C CG2 . VAL C 1 222 ? 15.142  8.781   42.423  1.00 6.99  ? 221  VAL C CG2 1 
ATOM   7217  N N   . TYR C 1 223 ? 15.185  6.723   46.548  1.00 7.91  ? 222  TYR C N   1 
ATOM   7218  C CA  . TYR C 1 223 ? 15.071  6.546   48.027  1.00 7.99  ? 222  TYR C CA  1 
ATOM   7219  C C   . TYR C 1 223 ? 15.262  7.866   48.727  1.00 7.35  ? 222  TYR C C   1 
ATOM   7220  O O   . TYR C 1 223 ? 16.392  8.368   48.923  1.00 7.62  ? 222  TYR C O   1 
ATOM   7221  C CB  . TYR C 1 223 ? 16.024  5.408   48.428  1.00 9.44  ? 222  TYR C CB  1 
ATOM   7222  C CG  . TYR C 1 223 ? 16.128  5.151   49.915  1.00 10.71 ? 222  TYR C CG  1 
ATOM   7223  C CD1 . TYR C 1 223 ? 15.081  4.550   50.609  1.00 11.19 ? 222  TYR C CD1 1 
ATOM   7224  C CD2 . TYR C 1 223 ? 17.284  5.505   50.618  1.00 10.62 ? 222  TYR C CD2 1 
ATOM   7225  C CE1 . TYR C 1 223 ? 15.173  4.307   51.983  1.00 11.72 ? 222  TYR C CE1 1 
ATOM   7226  C CE2 . TYR C 1 223 ? 17.385  5.261   51.998  1.00 11.51 ? 222  TYR C CE2 1 
ATOM   7227  C CZ  . TYR C 1 223 ? 16.322  4.668   52.667  1.00 11.53 ? 222  TYR C CZ  1 
ATOM   7228  O OH  . TYR C 1 223 ? 16.385  4.394   54.013  1.00 10.34 ? 222  TYR C OH  1 
ATOM   7229  N N   . LEU C 1 224 ? 14.156  8.498   49.145  1.00 6.48  ? 223  LEU C N   1 
ATOM   7230  C CA  . LEU C 1 224 ? 14.168  9.850   49.671  1.00 5.93  ? 223  LEU C CA  1 
ATOM   7231  C C   . LEU C 1 224 ? 15.019  10.038  50.937  1.00 6.45  ? 223  LEU C C   1 
ATOM   7232  O O   . LEU C 1 224 ? 15.543  11.142  51.138  1.00 5.30  ? 223  LEU C O   1 
ATOM   7233  C CB  . LEU C 1 224 ? 12.727  10.317  49.924  1.00 7.45  ? 223  LEU C CB  1 
ATOM   7234  C CG  . LEU C 1 224 ? 11.746  10.227  48.756  1.00 5.44  ? 223  LEU C CG  1 
ATOM   7235  C CD1 . LEU C 1 224 ? 10.354  10.649  49.256  1.00 8.46  ? 223  LEU C CD1 1 
ATOM   7236  C CD2 . LEU C 1 224 ? 12.211  11.192  47.673  1.00 6.69  ? 223  LEU C CD2 1 
ATOM   7237  N N   . GLU C 1 225 ? 15.043  9.005   51.743  1.00 7.02  ? 224  GLU C N   1 
ATOM   7238  C CA  . GLU C 1 225 ? 15.833  9.086   53.020  1.00 9.20  ? 224  GLU C CA  1 
ATOM   7239  C C   . GLU C 1 225 ? 17.309  9.211   52.708  1.00 9.99  ? 224  GLU C C   1 
ATOM   7240  O O   . GLU C 1 225 ? 18.093  9.795   53.486  1.00 10.98 ? 224  GLU C O   1 
ATOM   7241  C CB  . GLU C 1 225 ? 15.500  7.868   53.868  1.00 8.32  ? 224  GLU C CB  1 
ATOM   7242  C CG  . GLU C 1 225 ? 14.059  7.827   54.395  1.00 9.14  ? 224  GLU C CG  1 
ATOM   7243  C CD  . GLU C 1 225 ? 12.991  7.202   53.549  1.00 11.02 ? 224  GLU C CD  1 
ATOM   7244  O OE1 . GLU C 1 225 ? 13.204  7.196   52.312  1.00 10.33 ? 224  GLU C OE1 1 
ATOM   7245  O OE2 . GLU C 1 225 ? 11.951  6.748   54.028  1.00 9.83  ? 224  GLU C OE2 1 
ATOM   7246  N N   . GLY C 1 226 ? 17.684  8.772   51.520  1.00 10.16 ? 225  GLY C N   1 
ATOM   7247  C CA  . GLY C 1 226 ? 19.045  8.847   51.000  1.00 9.48  ? 225  GLY C CA  1 
ATOM   7248  C C   . GLY C 1 226 ? 19.305  10.050  50.115  1.00 9.86  ? 225  GLY C C   1 
ATOM   7249  O O   . GLY C 1 226 ? 20.207  9.970   49.249  1.00 10.67 ? 225  GLY C O   1 
ATOM   7250  N N   . THR C 1 227 ? 18.583  11.126  50.284  1.00 9.92  ? 226  THR C N   1 
ATOM   7251  C CA  . THR C 1 227 ? 18.729  12.364  49.520  1.00 10.29 ? 226  THR C CA  1 
ATOM   7252  C C   . THR C 1 227 ? 18.663  13.586  50.423  1.00 10.60 ? 226  THR C C   1 
ATOM   7253  O O   . THR C 1 227 ? 18.177  13.517  51.560  1.00 11.31 ? 226  THR C O   1 
ATOM   7254  C CB  . THR C 1 227 ? 17.628  12.515  48.388  1.00 9.82  ? 226  THR C CB  1 
ATOM   7255  O OG1 . THR C 1 227 ? 16.413  13.038  49.026  1.00 9.31  ? 226  THR C OG1 1 
ATOM   7256  C CG2 . THR C 1 227 ? 17.368  11.229  47.611  1.00 9.96  ? 226  THR C CG2 1 
ATOM   7257  N N   . LEU C 1 228 ? 19.131  14.684  49.880  1.00 10.61 ? 227  LEU C N   1 
ATOM   7258  C CA  . LEU C 1 228 ? 19.013  16.016  50.441  1.00 10.81 ? 227  LEU C CA  1 
ATOM   7259  C C   . LEU C 1 228 ? 18.409  16.913  49.340  1.00 11.65 ? 227  LEU C C   1 
ATOM   7260  O O   . LEU C 1 228 ? 18.517  16.565  48.152  1.00 12.23 ? 227  LEU C O   1 
ATOM   7261  C CB  . LEU C 1 228 ? 20.361  16.541  50.923  1.00 11.16 ? 227  LEU C CB  1 
ATOM   7262  C CG  . LEU C 1 228 ? 21.093  15.718  51.993  1.00 10.90 ? 227  LEU C CG  1 
ATOM   7263  C CD1 . LEU C 1 228 ? 22.520  16.250  52.159  1.00 10.86 ? 227  LEU C CD1 1 
ATOM   7264  C CD2 . LEU C 1 228 ? 20.315  15.862  53.296  1.00 9.46  ? 227  LEU C CD2 1 
ATOM   7265  N N   . LEU C 1 229 ? 17.826  18.003  49.776  1.00 11.08 ? 228  LEU C N   1 
ATOM   7266  C CA  . LEU C 1 229 ? 17.263  19.016  48.914  1.00 10.72 ? 228  LEU C CA  1 
ATOM   7267  C C   . LEU C 1 229 ? 18.017  20.329  49.111  1.00 10.85 ? 228  LEU C C   1 
ATOM   7268  O O   . LEU C 1 229 ? 18.259  20.753  50.261  1.00 11.50 ? 228  LEU C O   1 
ATOM   7269  C CB  . LEU C 1 229 ? 15.753  19.204  49.180  1.00 8.91  ? 228  LEU C CB  1 
ATOM   7270  C CG  . LEU C 1 229 ? 15.145  20.361  48.361  1.00 9.38  ? 228  LEU C CG  1 
ATOM   7271  C CD1 . LEU C 1 229 ? 15.024  19.937  46.901  1.00 9.91  ? 228  LEU C CD1 1 
ATOM   7272  C CD2 . LEU C 1 229 ? 13.762  20.666  48.937  1.00 9.21  ? 228  LEU C CD2 1 
ATOM   7273  N N   . LYS C 1 230 ? 18.374  20.926  47.990  1.00 10.19 ? 229  LYS C N   1 
ATOM   7274  C CA  . LYS C 1 230 ? 19.013  22.252  48.006  1.00 10.36 ? 229  LYS C CA  1 
ATOM   7275  C C   . LYS C 1 230 ? 18.218  23.256  47.201  1.00 11.59 ? 229  LYS C C   1 
ATOM   7276  O O   . LYS C 1 230 ? 18.454  23.465  45.986  1.00 11.33 ? 229  LYS C O   1 
ATOM   7277  C CB  . LYS C 1 230 ? 20.457  22.158  47.500  1.00 9.97  ? 229  LYS C CB  1 
ATOM   7278  C CG  . LYS C 1 230 ? 21.163  23.513  47.381  1.00 10.00 ? 229  LYS C CG  1 
ATOM   7279  C CD  . LYS C 1 230 ? 22.677  23.311  47.233  1.00 12.58 ? 229  LYS C CD  1 
ATOM   7280  C CE  . LYS C 1 230 ? 23.378  24.652  47.118  1.00 13.70 ? 229  LYS C CE  1 
ATOM   7281  N NZ  . LYS C 1 230 ? 24.850  24.472  47.042  1.00 16.77 ? 229  LYS C NZ  1 
ATOM   7282  N N   . PRO C 1 231 ? 17.288  23.927  47.879  1.00 12.04 ? 230  PRO C N   1 
ATOM   7283  C CA  . PRO C 1 231 ? 16.420  24.912  47.229  1.00 11.67 ? 230  PRO C CA  1 
ATOM   7284  C C   . PRO C 1 231 ? 16.809  26.329  47.597  1.00 12.16 ? 230  PRO C C   1 
ATOM   7285  O O   . PRO C 1 231 ? 17.618  26.600  48.493  1.00 11.60 ? 230  PRO C O   1 
ATOM   7286  C CB  . PRO C 1 231 ? 15.045  24.545  47.845  1.00 11.65 ? 230  PRO C CB  1 
ATOM   7287  C CG  . PRO C 1 231 ? 15.446  24.361  49.304  1.00 11.51 ? 230  PRO C CG  1 
ATOM   7288  C CD  . PRO C 1 231 ? 16.749  23.562  49.213  1.00 11.47 ? 230  PRO C CD  1 
ATOM   7289  N N   . ASN C 1 232 ? 16.190  27.232  46.858  1.00 12.62 ? 231  ASN C N   1 
ATOM   7290  C CA  . ASN C 1 232 ? 16.232  28.673  47.111  1.00 13.34 ? 231  ASN C CA  1 
ATOM   7291  C C   . ASN C 1 232 ? 15.281  28.944  48.297  1.00 13.50 ? 231  ASN C C   1 
ATOM   7292  O O   . ASN C 1 232 ? 14.314  28.190  48.477  1.00 13.48 ? 231  ASN C O   1 
ATOM   7293  C CB  . ASN C 1 232 ? 15.767  29.412  45.833  1.00 15.86 ? 231  ASN C CB  1 
ATOM   7294  C CG  . ASN C 1 232 ? 14.453  28.791  45.319  1.00 15.86 ? 231  ASN C CG  1 
ATOM   7295  O OD1 . ASN C 1 232 ? 14.477  27.694  44.729  1.00 15.57 ? 231  ASN C OD1 1 
ATOM   7296  N ND2 . ASN C 1 232 ? 13.345  29.465  45.581  1.00 14.16 ? 231  ASN C ND2 1 
ATOM   7297  N N   . MET C 1 233 ? 15.637  29.944  49.089  1.00 13.50 ? 232  MET C N   1 
ATOM   7298  C CA  . MET C 1 233 ? 14.670  30.482  50.076  1.00 13.76 ? 232  MET C CA  1 
ATOM   7299  C C   . MET C 1 233 ? 13.626  31.208  49.199  1.00 13.71 ? 232  MET C C   1 
ATOM   7300  O O   . MET C 1 233 ? 13.989  31.607  48.068  1.00 13.46 ? 232  MET C O   1 
ATOM   7301  C CB  . MET C 1 233 ? 15.317  31.465  51.048  1.00 13.94 ? 232  MET C CB  1 
ATOM   7302  C CG  . MET C 1 233 ? 16.375  30.822  51.895  1.00 14.63 ? 232  MET C CG  1 
ATOM   7303  S SD  . MET C 1 233 ? 17.120  32.118  52.999  1.00 15.21 ? 232  MET C SD  1 
ATOM   7304  C CE  . MET C 1 233 ? 18.472  31.069  53.625  1.00 15.65 ? 232  MET C CE  1 
ATOM   7305  N N   . VAL C 1 234 ? 12.430  31.357  49.714  1.00 13.21 ? 233  VAL C N   1 
ATOM   7306  C CA  . VAL C 1 234 ? 11.371  32.104  49.013  1.00 13.72 ? 233  VAL C CA  1 
ATOM   7307  C C   . VAL C 1 234 ? 11.496  33.583  49.381  1.00 13.99 ? 233  VAL C C   1 
ATOM   7308  O O   . VAL C 1 234 ? 11.281  34.007  50.527  1.00 14.49 ? 233  VAL C O   1 
ATOM   7309  C CB  . VAL C 1 234 ? 9.967   31.531  49.305  1.00 13.02 ? 233  VAL C CB  1 
ATOM   7310  C CG1 . VAL C 1 234 ? 8.878   32.270  48.520  1.00 13.48 ? 233  VAL C CG1 1 
ATOM   7311  C CG2 . VAL C 1 234 ? 9.887   30.034  49.068  1.00 13.15 ? 233  VAL C CG2 1 
ATOM   7312  N N   . THR C 1 235 ? 11.845  34.353  48.374  1.00 14.43 ? 234  THR C N   1 
ATOM   7313  C CA  . THR C 1 235 ? 12.022  35.805  48.444  1.00 14.80 ? 234  THR C CA  1 
ATOM   7314  C C   . THR C 1 235 ? 11.428  36.435  47.180  1.00 15.73 ? 234  THR C C   1 
ATOM   7315  O O   . THR C 1 235 ? 11.300  35.727  46.166  1.00 15.80 ? 234  THR C O   1 
ATOM   7316  C CB  . THR C 1 235 ? 13.545  36.201  48.575  1.00 14.07 ? 234  THR C CB  1 
ATOM   7317  O OG1 . THR C 1 235 ? 14.137  36.013  47.247  1.00 14.06 ? 234  THR C OG1 1 
ATOM   7318  C CG2 . THR C 1 235 ? 14.310  35.442  49.651  1.00 12.99 ? 234  THR C CG2 1 
ATOM   7319  N N   . ALA C 1 236 ? 11.095  37.701  47.291  1.00 16.35 ? 235  ALA C N   1 
ATOM   7320  C CA  . ALA C 1 236 ? 10.661  38.486  46.124  1.00 17.19 ? 235  ALA C CA  1 
ATOM   7321  C C   . ALA C 1 236 ? 11.906  38.652  45.229  1.00 17.60 ? 235  ALA C C   1 
ATOM   7322  O O   . ALA C 1 236 ? 13.017  38.297  45.650  1.00 17.03 ? 235  ALA C O   1 
ATOM   7323  C CB  . ALA C 1 236 ? 10.078  39.819  46.527  1.00 16.91 ? 235  ALA C CB  1 
ATOM   7324  N N   . GLY C 1 237 ? 11.675  39.166  44.041  1.00 18.19 ? 236  GLY C N   1 
ATOM   7325  C CA  . GLY C 1 237 ? 12.751  39.360  43.060  1.00 19.60 ? 236  GLY C CA  1 
ATOM   7326  C C   . GLY C 1 237 ? 13.755  40.409  43.521  1.00 20.62 ? 236  GLY C C   1 
ATOM   7327  O O   . GLY C 1 237 ? 13.465  41.347  44.270  1.00 20.60 ? 236  GLY C O   1 
ATOM   7328  N N   . GLN C 1 238 ? 14.946  40.241  43.020  1.00 22.29 ? 237  GLN C N   1 
ATOM   7329  C CA  . GLN C 1 238 ? 16.141  41.055  43.250  1.00 24.10 ? 237  GLN C CA  1 
ATOM   7330  C C   . GLN C 1 238 ? 15.869  42.534  43.006  1.00 24.85 ? 237  GLN C C   1 
ATOM   7331  O O   . GLN C 1 238 ? 16.486  43.402  43.652  1.00 24.81 ? 237  GLN C O   1 
ATOM   7332  C CB  . GLN C 1 238 ? 17.284  40.511  42.388  1.00 27.67 ? 237  GLN C CB  1 
ATOM   7333  C CG  . GLN C 1 238 ? 18.677  40.736  42.908  1.00 31.68 ? 237  GLN C CG  1 
ATOM   7334  C CD  . GLN C 1 238 ? 19.027  40.034  44.192  1.00 33.47 ? 237  GLN C CD  1 
ATOM   7335  O OE1 . GLN C 1 238 ? 18.722  38.868  44.458  1.00 34.19 ? 237  GLN C OE1 1 
ATOM   7336  N NE2 . GLN C 1 238 ? 19.739  40.783  45.048  1.00 34.52 ? 237  GLN C NE2 1 
ATOM   7337  N N   . SER C 1 239 ? 14.946  42.819  42.102  1.00 25.01 ? 238  SER C N   1 
ATOM   7338  C CA  . SER C 1 239 ? 14.600  44.193  41.701  1.00 25.41 ? 238  SER C CA  1 
ATOM   7339  C C   . SER C 1 239 ? 13.302  44.659  42.344  1.00 25.58 ? 238  SER C C   1 
ATOM   7340  O O   . SER C 1 239 ? 12.807  45.776  42.083  1.00 25.64 ? 238  SER C O   1 
ATOM   7341  C CB  . SER C 1 239 ? 14.576  44.319  40.181  1.00 25.42 ? 238  SER C CB  1 
ATOM   7342  O OG  . SER C 1 239 ? 15.850  43.923  39.660  1.00 26.62 ? 238  SER C OG  1 
ATOM   7343  N N   . ALA C 1 240 ? 12.769  43.810  43.194  1.00 25.95 ? 240  ALA C N   1 
ATOM   7344  C CA  . ALA C 1 240 ? 11.545  44.069  43.965  1.00 26.92 ? 240  ALA C CA  1 
ATOM   7345  C C   . ALA C 1 240 ? 11.932  44.583  45.361  1.00 27.21 ? 240  ALA C C   1 
ATOM   7346  O O   . ALA C 1 240 ? 13.104  44.500  45.743  1.00 27.28 ? 240  ALA C O   1 
ATOM   7347  C CB  . ALA C 1 240 ? 10.722  42.791  44.083  1.00 27.20 ? 240  ALA C CB  1 
ATOM   7348  N N   . LYS C 1 241 ? 10.937  45.090  46.047  1.00 27.79 ? 241  LYS C N   1 
ATOM   7349  C CA  . LYS C 1 241 ? 11.026  45.555  47.444  1.00 28.25 ? 241  LYS C CA  1 
ATOM   7350  C C   . LYS C 1 241 ? 11.503  44.395  48.319  1.00 28.03 ? 241  LYS C C   1 
ATOM   7351  O O   . LYS C 1 241 ? 11.000  43.270  48.152  1.00 27.39 ? 241  LYS C O   1 
ATOM   7352  C CB  . LYS C 1 241 ? 9.635   45.972  47.930  1.00 30.37 ? 241  LYS C CB  1 
ATOM   7353  C CG  . LYS C 1 241 ? 9.623   47.048  49.005  1.00 31.97 ? 241  LYS C CG  1 
ATOM   7354  C CD  . LYS C 1 241 ? 8.286   47.101  49.736  1.00 33.31 ? 241  LYS C CD  1 
ATOM   7355  C CE  . LYS C 1 241 ? 8.465   47.518  51.187  1.00 33.96 ? 241  LYS C CE  1 
ATOM   7356  N NZ  . LYS C 1 241 ? 7.164   47.493  51.908  1.00 34.81 ? 241  LYS C NZ  1 
ATOM   7357  N N   . LYS C 1 242 ? 12.444  44.679  49.208  1.00 28.04 ? 242  LYS C N   1 
ATOM   7358  C CA  . LYS C 1 242 ? 12.968  43.623  50.104  1.00 27.89 ? 242  LYS C CA  1 
ATOM   7359  C C   . LYS C 1 242 ? 11.920  43.256  51.151  1.00 26.82 ? 242  LYS C C   1 
ATOM   7360  O O   . LYS C 1 242 ? 11.140  44.117  51.595  1.00 27.09 ? 242  LYS C O   1 
ATOM   7361  C CB  . LYS C 1 242 ? 14.272  44.000  50.783  1.00 30.51 ? 242  LYS C CB  1 
ATOM   7362  C CG  . LYS C 1 242 ? 15.510  43.826  49.888  1.00 33.22 ? 242  LYS C CG  1 
ATOM   7363  C CD  . LYS C 1 242 ? 16.767  43.625  50.722  1.00 34.55 ? 242  LYS C CD  1 
ATOM   7364  C CE  . LYS C 1 242 ? 18.031  43.645  49.888  1.00 35.86 ? 242  LYS C CE  1 
ATOM   7365  N NZ  . LYS C 1 242 ? 18.215  42.368  49.157  1.00 36.34 ? 242  LYS C NZ  1 
ATOM   7366  N N   . ASN C 1 243 ? 11.911  41.986  51.512  1.00 25.81 ? 243  ASN C N   1 
ATOM   7367  C CA  . ASN C 1 243 ? 10.984  41.492  52.547  1.00 24.75 ? 243  ASN C CA  1 
ATOM   7368  C C   . ASN C 1 243 ? 11.784  41.375  53.854  1.00 23.90 ? 243  ASN C C   1 
ATOM   7369  O O   . ASN C 1 243 ? 13.022  41.388  53.826  1.00 23.83 ? 243  ASN C O   1 
ATOM   7370  C CB  . ASN C 1 243 ? 10.335  40.173  52.159  1.00 26.08 ? 243  ASN C CB  1 
ATOM   7371  C CG  . ASN C 1 243 ? 9.678   40.153  50.791  1.00 26.87 ? 243  ASN C CG  1 
ATOM   7372  O OD1 . ASN C 1 243 ? 10.262  39.596  49.846  1.00 28.87 ? 243  ASN C OD1 1 
ATOM   7373  N ND2 . ASN C 1 243 ? 8.494   40.740  50.680  1.00 26.95 ? 243  ASN C ND2 1 
ATOM   7374  N N   . THR C 1 244 ? 11.026  41.256  54.930  1.00 23.05 ? 244  THR C N   1 
ATOM   7375  C CA  . THR C 1 244 ? 11.637  41.020  56.254  1.00 21.49 ? 244  THR C CA  1 
ATOM   7376  C C   . THR C 1 244 ? 11.998  39.540  56.330  1.00 20.75 ? 244  THR C C   1 
ATOM   7377  O O   . THR C 1 244 ? 11.357  38.712  55.644  1.00 20.89 ? 244  THR C O   1 
ATOM   7378  C CB  . THR C 1 244 ? 10.678  41.457  57.417  1.00 21.49 ? 244  THR C CB  1 
ATOM   7379  O OG1 . THR C 1 244 ? 9.637   40.430  57.486  1.00 21.99 ? 244  THR C OG1 1 
ATOM   7380  C CG2 . THR C 1 244 ? 10.078  42.851  57.220  1.00 22.29 ? 244  THR C CG2 1 
ATOM   7381  N N   . PRO C 1 245 ? 12.996  39.250  57.145  1.00 19.58 ? 245  PRO C N   1 
ATOM   7382  C CA  . PRO C 1 245 ? 13.425  37.879  57.402  1.00 18.99 ? 245  PRO C CA  1 
ATOM   7383  C C   . PRO C 1 245 ? 12.260  36.993  57.816  1.00 18.38 ? 245  PRO C C   1 
ATOM   7384  O O   . PRO C 1 245 ? 12.237  35.798  57.492  1.00 17.46 ? 245  PRO C O   1 
ATOM   7385  C CB  . PRO C 1 245 ? 14.482  37.992  58.493  1.00 19.10 ? 245  PRO C CB  1 
ATOM   7386  C CG  . PRO C 1 245 ? 14.932  39.422  58.479  1.00 19.22 ? 245  PRO C CG  1 
ATOM   7387  C CD  . PRO C 1 245 ? 13.800  40.229  57.895  1.00 19.63 ? 245  PRO C CD  1 
ATOM   7388  N N   . GLU C 1 246 ? 11.319  37.601  58.539  1.00 18.54 ? 246  GLU C N   1 
ATOM   7389  C CA  . GLU C 1 246 ? 10.161  36.854  59.048  1.00 18.57 ? 246  GLU C CA  1 
ATOM   7390  C C   . GLU C 1 246 ? 9.199   36.472  57.923  1.00 17.51 ? 246  GLU C C   1 
ATOM   7391  O O   . GLU C 1 246 ? 8.649   35.361  57.944  1.00 17.44 ? 246  GLU C O   1 
ATOM   7392  C CB  . GLU C 1 246 ? 9.387   37.604  60.117  1.00 20.69 ? 246  GLU C CB  1 
ATOM   7393  C CG  . GLU C 1 246 ? 10.062  37.756  61.486  1.00 22.96 ? 246  GLU C CG  1 
ATOM   7394  C CD  . GLU C 1 246 ? 11.288  38.629  61.506  1.00 24.47 ? 246  GLU C CD  1 
ATOM   7395  O OE1 . GLU C 1 246 ? 11.373  39.741  61.020  1.00 25.08 ? 246  GLU C OE1 1 
ATOM   7396  O OE2 . GLU C 1 246 ? 12.244  38.061  62.096  1.00 27.56 ? 246  GLU C OE2 1 
ATOM   7397  N N   . GLU C 1 247 ? 8.994   37.388  57.013  1.00 17.51 ? 247  GLU C N   1 
ATOM   7398  C CA  . GLU C 1 247 ? 8.144   37.151  55.825  1.00 17.50 ? 247  GLU C CA  1 
ATOM   7399  C C   . GLU C 1 247 ? 8.795   36.049  54.993  1.00 16.96 ? 247  GLU C C   1 
ATOM   7400  O O   . GLU C 1 247 ? 8.166   35.032  54.652  1.00 16.50 ? 247  GLU C O   1 
ATOM   7401  C CB  . GLU C 1 247 ? 7.960   38.407  55.006  1.00 19.42 ? 247  GLU C CB  1 
ATOM   7402  C CG  . GLU C 1 247 ? 7.184   39.555  55.650  1.00 22.89 ? 247  GLU C CG  1 
ATOM   7403  C CD  . GLU C 1 247 ? 7.190   40.853  54.909  1.00 24.34 ? 247  GLU C CD  1 
ATOM   7404  O OE1 . GLU C 1 247 ? 8.102   41.250  54.208  1.00 26.68 ? 247  GLU C OE1 1 
ATOM   7405  O OE2 . GLU C 1 247 ? 6.143   41.513  55.090  1.00 27.46 ? 247  GLU C OE2 1 
ATOM   7406  N N   . ILE C 1 248 ? 10.090  36.243  54.743  1.00 15.67 ? 248  ILE C N   1 
ATOM   7407  C CA  . ILE C 1 248 ? 10.857  35.264  53.965  1.00 15.06 ? 248  ILE C CA  1 
ATOM   7408  C C   . ILE C 1 248 ? 10.744  33.895  54.631  1.00 14.28 ? 248  ILE C C   1 
ATOM   7409  O O   . ILE C 1 248 ? 10.541  32.868  53.958  1.00 13.95 ? 248  ILE C O   1 
ATOM   7410  C CB  . ILE C 1 248 ? 12.354  35.674  53.763  1.00 14.58 ? 248  ILE C CB  1 
ATOM   7411  C CG1 . ILE C 1 248 ? 12.468  36.900  52.838  1.00 15.15 ? 248  ILE C CG1 1 
ATOM   7412  C CG2 . ILE C 1 248 ? 13.218  34.479  53.263  1.00 13.08 ? 248  ILE C CG2 1 
ATOM   7413  C CD1 . ILE C 1 248 ? 13.880  37.548  52.798  1.00 13.98 ? 248  ILE C CD1 1 
ATOM   7414  N N   . ALA C 1 249 ? 10.883  33.922  55.958  1.00 13.25 ? 249  ALA C N   1 
ATOM   7415  C CA  . ALA C 1 249 ? 10.906  32.673  56.729  1.00 12.66 ? 249  ALA C CA  1 
ATOM   7416  C C   . ALA C 1 249 ? 9.576   31.944  56.652  1.00 11.71 ? 249  ALA C C   1 
ATOM   7417  O O   . ALA C 1 249 ? 9.574   30.704  56.451  1.00 12.23 ? 249  ALA C O   1 
ATOM   7418  C CB  . ALA C 1 249 ? 11.357  32.909  58.172  1.00 13.65 ? 249  ALA C CB  1 
ATOM   7419  N N   . LEU C 1 250 ? 8.484   32.660  56.805  1.00 11.94 ? 250  LEU C N   1 
ATOM   7420  C CA  . LEU C 1 250 ? 7.157   32.011  56.756  1.00 12.00 ? 250  LEU C CA  1 
ATOM   7421  C C   . LEU C 1 250 ? 6.927   31.416  55.359  1.00 11.41 ? 250  LEU C C   1 
ATOM   7422  O O   . LEU C 1 250 ? 6.559   30.235  55.240  1.00 11.34 ? 250  LEU C O   1 
ATOM   7423  C CB  . LEU C 1 250 ? 6.078   33.006  57.173  1.00 12.10 ? 250  LEU C CB  1 
ATOM   7424  C CG  . LEU C 1 250 ? 4.663   32.423  57.229  1.00 12.43 ? 250  LEU C CG  1 
ATOM   7425  C CD1 . LEU C 1 250 ? 4.636   31.281  58.236  1.00 13.45 ? 250  LEU C CD1 1 
ATOM   7426  C CD2 . LEU C 1 250 ? 3.697   33.525  57.639  1.00 13.26 ? 250  LEU C CD2 1 
ATOM   7427  N N   . ALA C 1 251 ? 7.151   32.250  54.361  1.00 11.00 ? 251  ALA C N   1 
ATOM   7428  C CA  . ALA C 1 251 ? 6.940   31.802  52.962  1.00 10.62 ? 251  ALA C CA  1 
ATOM   7429  C C   . ALA C 1 251 ? 7.697   30.517  52.699  1.00 10.27 ? 251  ALA C C   1 
ATOM   7430  O O   . ALA C 1 251 ? 7.157   29.554  52.146  1.00 10.48 ? 251  ALA C O   1 
ATOM   7431  C CB  . ALA C 1 251 ? 7.322   32.909  52.000  1.00 12.05 ? 251  ALA C CB  1 
ATOM   7432  N N   . THR C 1 252 ? 8.982   30.513  53.076  1.00 9.42  ? 252  THR C N   1 
ATOM   7433  C CA  . THR C 1 252 ? 9.857   29.375  52.840  1.00 9.41  ? 252  THR C CA  1 
ATOM   7434  C C   . THR C 1 252 ? 9.380   28.118  53.547  1.00 9.47  ? 252  THR C C   1 
ATOM   7435  O O   . THR C 1 252 ? 9.321   27.027  52.931  1.00 8.79  ? 252  THR C O   1 
ATOM   7436  C CB  . THR C 1 252 ? 11.380  29.659  53.173  1.00 8.83  ? 252  THR C CB  1 
ATOM   7437  O OG1 . THR C 1 252 ? 11.744  30.875  52.441  1.00 9.14  ? 252  THR C OG1 1 
ATOM   7438  C CG2 . THR C 1 252 ? 12.295  28.488  52.840  1.00 9.39  ? 252  THR C CG2 1 
ATOM   7439  N N   . VAL C 1 253 ? 9.064   28.263  54.837  1.00 9.38  ? 253  VAL C N   1 
ATOM   7440  C CA  . VAL C 1 253 ? 8.635   27.065  55.604  1.00 8.30  ? 253  VAL C CA  1 
ATOM   7441  C C   . VAL C 1 253 ? 7.296   26.527  55.096  1.00 7.20  ? 253  VAL C C   1 
ATOM   7442  O O   . VAL C 1 253 ? 7.155   25.294  55.039  1.00 7.32  ? 253  VAL C O   1 
ATOM   7443  C CB  . VAL C 1 253 ? 8.682   27.340  57.118  1.00 9.14  ? 253  VAL C CB  1 
ATOM   7444  C CG1 . VAL C 1 253 ? 7.979   26.259  57.916  1.00 7.92  ? 253  VAL C CG1 1 
ATOM   7445  C CG2 . VAL C 1 253 ? 10.145  27.461  57.583  1.00 9.16  ? 253  VAL C CG2 1 
ATOM   7446  N N   . GLN C 1 254 ? 6.394   27.420  54.756  1.00 7.08  ? 254  GLN C N   1 
ATOM   7447  C CA  . GLN C 1 254 ? 5.076   27.006  54.222  1.00 7.94  ? 254  GLN C CA  1 
ATOM   7448  C C   . GLN C 1 254 ? 5.296   26.211  52.923  1.00 6.63  ? 254  GLN C C   1 
ATOM   7449  O O   . GLN C 1 254 ? 4.775   25.106  52.770  1.00 6.71  ? 254  GLN C O   1 
ATOM   7450  C CB  . GLN C 1 254 ? 4.125   28.163  54.000  1.00 9.68  ? 254  GLN C CB  1 
ATOM   7451  C CG  . GLN C 1 254 ? 3.542   28.774  55.256  1.00 12.28 ? 254  GLN C CG  1 
ATOM   7452  C CD  . GLN C 1 254 ? 2.575   29.892  54.979  1.00 13.31 ? 254  GLN C CD  1 
ATOM   7453  O OE1 . GLN C 1 254 ? 1.769   30.270  55.830  1.00 16.81 ? 254  GLN C OE1 1 
ATOM   7454  N NE2 . GLN C 1 254 ? 2.618   30.464  53.784  1.00 13.55 ? 254  GLN C NE2 1 
ATOM   7455  N N   . ALA C 1 255 ? 6.111   26.784  52.054  1.00 6.32  ? 255  ALA C N   1 
ATOM   7456  C CA  . ALA C 1 255 ? 6.394   26.149  50.742  1.00 6.37  ? 255  ALA C CA  1 
ATOM   7457  C C   . ALA C 1 255 ? 6.947   24.753  50.909  1.00 6.63  ? 255  ALA C C   1 
ATOM   7458  O O   . ALA C 1 255 ? 6.526   23.805  50.205  1.00 6.01  ? 255  ALA C O   1 
ATOM   7459  C CB  . ALA C 1 255 ? 7.309   27.062  49.931  1.00 7.73  ? 255  ALA C CB  1 
ATOM   7460  N N   . LEU C 1 256 ? 7.893   24.579  51.846  1.00 5.76  ? 256  LEU C N   1 
ATOM   7461  C CA  . LEU C 1 256 ? 8.508   23.281  52.096  1.00 6.30  ? 256  LEU C CA  1 
ATOM   7462  C C   . LEU C 1 256 ? 7.539   22.284  52.722  1.00 5.98  ? 256  LEU C C   1 
ATOM   7463  O O   . LEU C 1 256 ? 7.506   21.106  52.340  1.00 5.05  ? 256  LEU C O   1 
ATOM   7464  C CB  . LEU C 1 256 ? 9.791   23.474  52.930  1.00 8.30  ? 256  LEU C CB  1 
ATOM   7465  C CG  . LEU C 1 256 ? 10.920  24.297  52.333  1.00 9.43  ? 256  LEU C CG  1 
ATOM   7466  C CD1 . LEU C 1 256 ? 12.163  24.236  53.215  1.00 10.12 ? 256  LEU C CD1 1 
ATOM   7467  C CD2 . LEU C 1 256 ? 11.270  23.725  50.957  1.00 10.80 ? 256  LEU C CD2 1 
ATOM   7468  N N   . ARG C 1 257 ? 6.794   22.739  53.722  1.00 6.20  ? 257  ARG C N   1 
ATOM   7469  C CA  . ARG C 1 257 ? 5.796   21.885  54.409  1.00 5.96  ? 257  ARG C CA  1 
ATOM   7470  C C   . ARG C 1 257 ? 4.789   21.312  53.416  1.00 5.68  ? 257  ARG C C   1 
ATOM   7471  O O   . ARG C 1 257 ? 4.328   20.173  53.535  1.00 5.62  ? 257  ARG C O   1 
ATOM   7472  C CB  . ARG C 1 257 ? 5.085   22.746  55.479  1.00 8.15  ? 257  ARG C CB  1 
ATOM   7473  C CG  . ARG C 1 257 ? 5.848   22.829  56.810  1.00 8.13  ? 257  ARG C CG  1 
ATOM   7474  C CD  . ARG C 1 257 ? 5.263   23.878  57.706  1.00 10.17 ? 257  ARG C CD  1 
ATOM   7475  N NE  . ARG C 1 257 ? 3.851   23.704  57.984  1.00 11.30 ? 257  ARG C NE  1 
ATOM   7476  C CZ  . ARG C 1 257 ? 3.282   22.750  58.701  1.00 12.66 ? 257  ARG C CZ  1 
ATOM   7477  N NH1 . ARG C 1 257 ? 3.960   21.781  59.296  1.00 12.69 ? 257  ARG C NH1 1 
ATOM   7478  N NH2 . ARG C 1 257 ? 1.952   22.770  58.868  1.00 13.20 ? 257  ARG C NH2 1 
ATOM   7479  N N   . ARG C 1 258 ? 4.467   22.106  52.402  1.00 6.19  ? 258  ARG C N   1 
ATOM   7480  C CA  . ARG C 1 258 ? 3.447   21.690  51.409  1.00 6.19  ? 258  ARG C CA  1 
ATOM   7481  C C   . ARG C 1 258 ? 3.956   20.760  50.333  1.00 7.11  ? 258  ARG C C   1 
ATOM   7482  O O   . ARG C 1 258 ? 3.088   20.142  49.652  1.00 6.99  ? 258  ARG C O   1 
ATOM   7483  C CB  . ARG C 1 258 ? 2.789   22.923  50.796  1.00 5.40  ? 258  ARG C CB  1 
ATOM   7484  C CG  . ARG C 1 258 ? 1.942   23.753  51.736  1.00 6.60  ? 258  ARG C CG  1 
ATOM   7485  C CD  . ARG C 1 258 ? 1.771   25.149  51.229  1.00 7.66  ? 258  ARG C CD  1 
ATOM   7486  N NE  . ARG C 1 258 ? 1.049   25.957  52.201  1.00 8.67  ? 258  ARG C NE  1 
ATOM   7487  C CZ  . ARG C 1 258 ? 0.684   27.215  52.027  1.00 9.63  ? 258  ARG C CZ  1 
ATOM   7488  N NH1 . ARG C 1 258 ? 0.953   27.899  50.917  1.00 10.52 ? 258  ARG C NH1 1 
ATOM   7489  N NH2 . ARG C 1 258 ? -0.014  27.818  52.992  1.00 8.95  ? 258  ARG C NH2 1 
ATOM   7490  N N   . THR C 1 259 ? 5.263   20.586  50.198  1.00 6.95  ? 259  THR C N   1 
ATOM   7491  C CA  . THR C 1 259 ? 5.809   19.826  49.062  1.00 7.54  ? 259  THR C CA  1 
ATOM   7492  C C   . THR C 1 259 ? 6.881   18.809  49.326  1.00 7.61  ? 259  THR C C   1 
ATOM   7493  O O   . THR C 1 259 ? 6.984   17.815  48.562  1.00 8.86  ? 259  THR C O   1 
ATOM   7494  C CB  . THR C 1 259 ? 6.329   20.871  47.972  1.00 8.10  ? 259  THR C CB  1 
ATOM   7495  O OG1 . THR C 1 259 ? 7.412   21.641  48.590  1.00 6.48  ? 259  THR C OG1 1 
ATOM   7496  C CG2 . THR C 1 259 ? 5.214   21.766  47.421  1.00 8.09  ? 259  THR C CG2 1 
ATOM   7497  N N   . VAL C 1 260 ? 7.730   19.006  50.323  1.00 7.60  ? 260  VAL C N   1 
ATOM   7498  C CA  . VAL C 1 260 ? 8.871   18.107  50.589  1.00 7.27  ? 260  VAL C CA  1 
ATOM   7499  C C   . VAL C 1 260 ? 8.550   17.072  51.659  1.00 7.37  ? 260  VAL C C   1 
ATOM   7500  O O   . VAL C 1 260 ? 8.444   17.454  52.837  1.00 7.78  ? 260  VAL C O   1 
ATOM   7501  C CB  . VAL C 1 260 ? 10.062  18.996  51.041  1.00 7.52  ? 260  VAL C CB  1 
ATOM   7502  C CG1 . VAL C 1 260 ? 11.281  18.142  51.409  1.00 4.57  ? 260  VAL C CG1 1 
ATOM   7503  C CG2 . VAL C 1 260 ? 10.406  20.062  50.032  1.00 6.98  ? 260  VAL C CG2 1 
ATOM   7504  N N   . PRO C 1 261 ? 8.439   15.812  51.289  1.00 7.67  ? 261  PRO C N   1 
ATOM   7505  C CA  . PRO C 1 261 ? 8.147   14.751  52.241  1.00 8.06  ? 261  PRO C CA  1 
ATOM   7506  C C   . PRO C 1 261 ? 9.135   14.758  53.409  1.00 8.54  ? 261  PRO C C   1 
ATOM   7507  O O   . PRO C 1 261 ? 10.336  15.038  53.270  1.00 8.45  ? 261  PRO C O   1 
ATOM   7508  C CB  . PRO C 1 261 ? 8.227   13.454  51.451  1.00 8.45  ? 261  PRO C CB  1 
ATOM   7509  C CG  . PRO C 1 261 ? 8.182   13.892  49.990  1.00 8.31  ? 261  PRO C CG  1 
ATOM   7510  C CD  . PRO C 1 261 ? 8.807   15.270  49.971  1.00 8.00  ? 261  PRO C CD  1 
ATOM   7511  N N   . ALA C 1 262 ? 8.590   14.399  54.548  1.00 8.58  ? 262  ALA C N   1 
ATOM   7512  C CA  . ALA C 1 262 ? 9.314   14.251  55.826  1.00 8.44  ? 262  ALA C CA  1 
ATOM   7513  C C   . ALA C 1 262 ? 10.420  13.220  55.715  1.00 8.88  ? 262  ALA C C   1 
ATOM   7514  O O   . ALA C 1 262 ? 11.401  13.225  56.491  1.00 9.33  ? 262  ALA C O   1 
ATOM   7515  C CB  . ALA C 1 262 ? 8.255   13.847  56.865  1.00 7.89  ? 262  ALA C CB  1 
ATOM   7516  N N   . ALA C 1 263 ? 10.260  12.302  54.771  1.00 8.83  ? 263  ALA C N   1 
ATOM   7517  C CA  . ALA C 1 263 ? 11.244  11.270  54.479  1.00 9.01  ? 263  ALA C CA  1 
ATOM   7518  C C   . ALA C 1 263 ? 12.571  11.876  54.020  1.00 8.95  ? 263  ALA C C   1 
ATOM   7519  O O   . ALA C 1 263 ? 13.593  11.196  54.229  1.00 9.17  ? 263  ALA C O   1 
ATOM   7520  C CB  . ALA C 1 263 ? 10.753  10.229  53.493  1.00 8.09  ? 263  ALA C CB  1 
ATOM   7521  N N   . VAL C 1 264 ? 12.550  13.055  53.458  1.00 9.30  ? 264  VAL C N   1 
ATOM   7522  C CA  . VAL C 1 264 ? 13.770  13.750  52.999  1.00 10.19 ? 264  VAL C CA  1 
ATOM   7523  C C   . VAL C 1 264 ? 14.600  14.145  54.242  1.00 10.74 ? 264  VAL C C   1 
ATOM   7524  O O   . VAL C 1 264 ? 14.135  14.928  55.069  1.00 10.12 ? 264  VAL C O   1 
ATOM   7525  C CB  . VAL C 1 264 ? 13.430  14.935  52.090  1.00 10.28 ? 264  VAL C CB  1 
ATOM   7526  C CG1 . VAL C 1 264 ? 14.609  15.880  51.861  1.00 11.01 ? 264  VAL C CG1 1 
ATOM   7527  C CG2 . VAL C 1 264 ? 12.885  14.463  50.736  1.00 10.53 ? 264  VAL C CG2 1 
ATOM   7528  N N   . THR C 1 265 ? 15.805  13.628  54.284  1.00 11.33 ? 265  THR C N   1 
ATOM   7529  C CA  . THR C 1 265 ? 16.694  13.791  55.451  1.00 11.68 ? 265  THR C CA  1 
ATOM   7530  C C   . THR C 1 265 ? 17.003  15.213  55.806  1.00 12.48 ? 265  THR C C   1 
ATOM   7531  O O   . THR C 1 265 ? 17.131  15.529  57.020  1.00 13.51 ? 265  THR C O   1 
ATOM   7532  C CB  . THR C 1 265 ? 17.971  12.883  55.291  1.00 10.85 ? 265  THR C CB  1 
ATOM   7533  O OG1 . THR C 1 265 ? 17.461  11.522  55.173  1.00 14.23 ? 265  THR C OG1 1 
ATOM   7534  C CG2 . THR C 1 265 ? 18.982  13.001  56.435  1.00 12.26 ? 265  THR C CG2 1 
ATOM   7535  N N   . GLY C 1 266 ? 17.135  16.118  54.840  1.00 11.67 ? 266  GLY C N   1 
ATOM   7536  C CA  . GLY C 1 266 ? 17.402  17.527  55.164  1.00 11.57 ? 266  GLY C CA  1 
ATOM   7537  C C   . GLY C 1 266 ? 17.395  18.423  53.923  1.00 11.70 ? 266  GLY C C   1 
ATOM   7538  O O   . GLY C 1 266 ? 17.440  17.958  52.789  1.00 11.54 ? 266  GLY C O   1 
ATOM   7539  N N   . VAL C 1 267 ? 17.326  19.697  54.208  1.00 12.07 ? 267  VAL C N   1 
ATOM   7540  C CA  . VAL C 1 267 ? 17.333  20.840  53.319  1.00 12.13 ? 267  VAL C CA  1 
ATOM   7541  C C   . VAL C 1 267 ? 18.561  21.708  53.631  1.00 12.87 ? 267  VAL C C   1 
ATOM   7542  O O   . VAL C 1 267 ? 18.722  22.215  54.756  1.00 13.32 ? 267  VAL C O   1 
ATOM   7543  C CB  . VAL C 1 267 ? 16.024  21.649  53.476  1.00 12.00 ? 267  VAL C CB  1 
ATOM   7544  C CG1 . VAL C 1 267 ? 15.970  22.875  52.583  1.00 10.92 ? 267  VAL C CG1 1 
ATOM   7545  C CG2 . VAL C 1 267 ? 14.788  20.767  53.318  1.00 11.69 ? 267  VAL C CG2 1 
ATOM   7546  N N   . THR C 1 268 ? 19.381  21.864  52.617  1.00 12.86 ? 268  THR C N   1 
ATOM   7547  C CA  . THR C 1 268 ? 20.586  22.711  52.673  1.00 13.05 ? 268  THR C CA  1 
ATOM   7548  C C   . THR C 1 268 ? 20.440  23.840  51.666  1.00 13.59 ? 268  THR C C   1 
ATOM   7549  O O   . THR C 1 268 ? 20.700  23.618  50.464  1.00 13.74 ? 268  THR C O   1 
ATOM   7550  C CB  . THR C 1 268 ? 21.854  21.815  52.431  1.00 13.55 ? 268  THR C CB  1 
ATOM   7551  O OG1 . THR C 1 268 ? 21.798  21.419  51.018  1.00 15.34 ? 268  THR C OG1 1 
ATOM   7552  C CG2 . THR C 1 268 ? 21.863  20.551  53.319  1.00 13.02 ? 268  THR C CG2 1 
ATOM   7553  N N   . PHE C 1 269 ? 20.083  25.009  52.143  1.00 13.31 ? 269  PHE C N   1 
ATOM   7554  C CA  . PHE C 1 269 ? 19.750  26.194  51.375  1.00 14.34 ? 269  PHE C CA  1 
ATOM   7555  C C   . PHE C 1 269 ? 20.930  26.860  50.652  1.00 14.98 ? 269  PHE C C   1 
ATOM   7556  O O   . PHE C 1 269 ? 22.034  27.020  51.180  1.00 14.15 ? 269  PHE C O   1 
ATOM   7557  C CB  . PHE C 1 269 ? 19.045  27.259  52.236  1.00 14.41 ? 269  PHE C CB  1 
ATOM   7558  C CG  . PHE C 1 269 ? 17.680  26.920  52.756  1.00 13.55 ? 269  PHE C CG  1 
ATOM   7559  C CD1 . PHE C 1 269 ? 16.572  27.038  51.902  1.00 13.15 ? 269  PHE C CD1 1 
ATOM   7560  C CD2 . PHE C 1 269 ? 17.495  26.524  54.069  1.00 13.12 ? 269  PHE C CD2 1 
ATOM   7561  C CE1 . PHE C 1 269 ? 15.295  26.750  52.360  1.00 14.26 ? 269  PHE C CE1 1 
ATOM   7562  C CE2 . PHE C 1 269 ? 16.211  26.222  54.555  1.00 12.96 ? 269  PHE C CE2 1 
ATOM   7563  C CZ  . PHE C 1 269 ? 15.116  26.349  53.687  1.00 11.78 ? 269  PHE C CZ  1 
ATOM   7564  N N   . LEU C 1 270 ? 20.600  27.273  49.430  1.00 15.25 ? 270  LEU C N   1 
ATOM   7565  C CA  . LEU C 1 270 ? 21.523  28.093  48.611  1.00 16.37 ? 270  LEU C CA  1 
ATOM   7566  C C   . LEU C 1 270 ? 21.218  29.534  49.006  1.00 17.01 ? 270  LEU C C   1 
ATOM   7567  O O   . LEU C 1 270 ? 20.079  29.829  49.437  1.00 17.66 ? 270  LEU C O   1 
ATOM   7568  C CB  . LEU C 1 270 ? 21.319  27.739  47.132  1.00 15.92 ? 270  LEU C CB  1 
ATOM   7569  C CG  . LEU C 1 270 ? 19.936  27.965  46.548  1.00 14.94 ? 270  LEU C CG  1 
ATOM   7570  C CD1 . LEU C 1 270 ? 19.753  29.395  46.062  1.00 15.74 ? 270  LEU C CD1 1 
ATOM   7571  C CD2 . LEU C 1 270 ? 19.718  26.989  45.393  1.00 14.12 ? 270  LEU C CD2 1 
ATOM   7572  N N   . SER C 1 271 ? 22.197  30.399  48.882  1.00 17.67 ? 271  SER C N   1 
ATOM   7573  C CA  . SER C 1 271 ? 22.031  31.805  49.284  1.00 18.76 ? 271  SER C CA  1 
ATOM   7574  C C   . SER C 1 271 ? 21.576  32.707  48.159  1.00 19.36 ? 271  SER C C   1 
ATOM   7575  O O   . SER C 1 271 ? 21.162  33.846  48.428  1.00 19.79 ? 271  SER C O   1 
ATOM   7576  C CB  . SER C 1 271 ? 23.318  32.312  49.936  1.00 18.90 ? 271  SER C CB  1 
ATOM   7577  O OG  . SER C 1 271 ? 24.423  32.247  49.048  1.00 21.16 ? 271  SER C OG  1 
ATOM   7578  N N   . GLY C 1 272 ? 21.656  32.256  46.917  1.00 20.50 ? 272  GLY C N   1 
ATOM   7579  C CA  . GLY C 1 272 ? 21.263  33.102  45.763  1.00 21.63 ? 272  GLY C CA  1 
ATOM   7580  C C   . GLY C 1 272 ? 22.172  34.331  45.701  1.00 22.55 ? 272  GLY C C   1 
ATOM   7581  O O   . GLY C 1 272 ? 23.413  34.193  45.651  1.00 23.15 ? 272  GLY C O   1 
ATOM   7582  N N   . GLY C 1 273 ? 21.576  35.505  45.706  1.00 22.94 ? 273  GLY C N   1 
ATOM   7583  C CA  . GLY C 1 273 ? 22.325  36.764  45.645  1.00 23.83 ? 273  GLY C CA  1 
ATOM   7584  C C   . GLY C 1 273 ? 22.319  37.528  46.958  1.00 24.07 ? 273  GLY C C   1 
ATOM   7585  O O   . GLY C 1 273 ? 22.687  38.722  47.005  1.00 24.32 ? 273  GLY C O   1 
ATOM   7586  N N   . GLN C 1 274 ? 21.916  36.853  48.013  1.00 24.15 ? 274  GLN C N   1 
ATOM   7587  C CA  . GLN C 1 274 ? 21.857  37.402  49.375  1.00 24.05 ? 274  GLN C CA  1 
ATOM   7588  C C   . GLN C 1 274 ? 23.277  37.714  49.875  1.00 23.99 ? 274  GLN C C   1 
ATOM   7589  O O   . GLN C 1 274 ? 24.239  36.998  49.548  1.00 23.74 ? 274  GLN C O   1 
ATOM   7590  C CB  . GLN C 1 274 ? 21.176  36.444  50.351  1.00 24.50 ? 274  GLN C CB  1 
ATOM   7591  C CG  . GLN C 1 274 ? 19.687  36.212  50.124  1.00 24.97 ? 274  GLN C CG  1 
ATOM   7592  C CD  . GLN C 1 274 ? 19.124  35.222  51.125  1.00 25.26 ? 274  GLN C CD  1 
ATOM   7593  O OE1 . GLN C 1 274 ? 19.131  35.444  52.333  1.00 25.07 ? 274  GLN C OE1 1 
ATOM   7594  N NE2 . GLN C 1 274 ? 18.628  34.104  50.611  1.00 25.08 ? 274  GLN C NE2 1 
ATOM   7595  N N   . SER C 1 275 ? 23.360  38.762  50.673  1.00 23.84 ? 275  SER C N   1 
ATOM   7596  C CA  . SER C 1 275 ? 24.634  39.115  51.347  1.00 23.95 ? 275  SER C CA  1 
ATOM   7597  C C   . SER C 1 275 ? 24.947  38.041  52.389  1.00 23.79 ? 275  SER C C   1 
ATOM   7598  O O   . SER C 1 275 ? 24.097  37.194  52.722  1.00 23.12 ? 275  SER C O   1 
ATOM   7599  C CB  . SER C 1 275 ? 24.538  40.486  51.986  1.00 24.36 ? 275  SER C CB  1 
ATOM   7600  O OG  . SER C 1 275 ? 23.606  40.463  53.062  1.00 25.63 ? 275  SER C OG  1 
ATOM   7601  N N   . GLU C 1 276 ? 26.165  38.090  52.903  1.00 23.85 ? 276  GLU C N   1 
ATOM   7602  C CA  . GLU C 1 276 ? 26.607  37.116  53.914  1.00 24.07 ? 276  GLU C CA  1 
ATOM   7603  C C   . GLU C 1 276 ? 25.750  37.165  55.173  1.00 24.07 ? 276  GLU C C   1 
ATOM   7604  O O   . GLU C 1 276 ? 25.388  36.097  55.715  1.00 24.18 ? 276  GLU C O   1 
ATOM   7605  C CB  . GLU C 1 276 ? 28.069  37.333  54.298  1.00 25.48 ? 276  GLU C CB  1 
ATOM   7606  C CG  . GLU C 1 276 ? 29.107  37.118  53.194  1.00 25.16 ? 276  GLU C CG  1 
ATOM   7607  C CD  . GLU C 1 276 ? 30.538  37.332  53.597  1.00 25.54 ? 276  GLU C CD  1 
ATOM   7608  O OE1 . GLU C 1 276 ? 30.724  38.476  54.066  1.00 26.03 ? 276  GLU C OE1 1 
ATOM   7609  O OE2 . GLU C 1 276 ? 31.416  36.493  53.486  1.00 25.06 ? 276  GLU C OE2 1 
ATOM   7610  N N   . GLU C 1 277 ? 25.427  38.360  55.615  1.00 23.84 ? 277  GLU C N   1 
ATOM   7611  C CA  . GLU C 1 277 ? 24.635  38.604  56.825  1.00 24.21 ? 277  GLU C CA  1 
ATOM   7612  C C   . GLU C 1 277 ? 23.177  38.172  56.596  1.00 23.70 ? 277  GLU C C   1 
ATOM   7613  O O   . GLU C 1 277 ? 22.599  37.491  57.451  1.00 23.92 ? 277  GLU C O   1 
ATOM   7614  C CB  . GLU C 1 277 ? 24.590  40.067  57.219  1.00 24.15 ? 277  GLU C CB  1 
ATOM   7615  C CG  . GLU C 1 277 ? 24.763  40.616  58.588  1.00 25.92 ? 277  GLU C CG  1 
ATOM   7616  C CD  . GLU C 1 277 ? 24.489  39.847  59.826  1.00 26.45 ? 277  GLU C CD  1 
ATOM   7617  O OE1 . GLU C 1 277 ? 25.239  38.847  59.937  1.00 26.83 ? 277  GLU C OE1 1 
ATOM   7618  O OE2 . GLU C 1 277 ? 23.659  40.150  60.680  1.00 26.48 ? 277  GLU C OE2 1 
ATOM   7619  N N   . GLU C 1 278 ? 22.642  38.590  55.465  1.00 23.50 ? 278  GLU C N   1 
ATOM   7620  C CA  . GLU C 1 278 ? 21.259  38.284  55.062  1.00 22.99 ? 278  GLU C CA  1 
ATOM   7621  C C   . GLU C 1 278 ? 20.968  36.791  55.090  1.00 21.91 ? 278  GLU C C   1 
ATOM   7622  O O   . GLU C 1 278 ? 19.954  36.360  55.652  1.00 21.97 ? 278  GLU C O   1 
ATOM   7623  C CB  . GLU C 1 278 ? 20.940  38.743  53.638  1.00 24.63 ? 278  GLU C CB  1 
ATOM   7624  C CG  . GLU C 1 278 ? 20.554  40.201  53.441  1.00 27.69 ? 278  GLU C CG  1 
ATOM   7625  C CD  . GLU C 1 278 ? 20.201  40.617  52.041  1.00 28.78 ? 278  GLU C CD  1 
ATOM   7626  O OE1 . GLU C 1 278 ? 20.829  39.986  51.173  1.00 30.27 ? 278  GLU C OE1 1 
ATOM   7627  O OE2 . GLU C 1 278 ? 19.385  41.479  51.778  1.00 31.64 ? 278  GLU C OE2 1 
ATOM   7628  N N   . ALA C 1 279 ? 21.860  36.049  54.458  1.00 21.05 ? 279  ALA C N   1 
ATOM   7629  C CA  . ALA C 1 279 ? 21.822  34.602  54.340  1.00 19.71 ? 279  ALA C CA  1 
ATOM   7630  C C   . ALA C 1 279 ? 21.774  33.930  55.713  1.00 18.93 ? 279  ALA C C   1 
ATOM   7631  O O   . ALA C 1 279 ? 21.097  32.909  55.902  1.00 17.81 ? 279  ALA C O   1 
ATOM   7632  C CB  . ALA C 1 279 ? 23.003  34.097  53.519  1.00 18.70 ? 279  ALA C CB  1 
ATOM   7633  N N   . THR C 1 280 ? 22.496  34.526  56.651  1.00 18.53 ? 280  THR C N   1 
ATOM   7634  C CA  . THR C 1 280 ? 22.572  34.034  58.028  1.00 17.83 ? 280  THR C CA  1 
ATOM   7635  C C   . THR C 1 280 ? 21.301  34.354  58.805  1.00 16.79 ? 280  THR C C   1 
ATOM   7636  O O   . THR C 1 280 ? 20.735  33.456  59.443  1.00 17.04 ? 280  THR C O   1 
ATOM   7637  C CB  . THR C 1 280 ? 23.857  34.604  58.762  1.00 18.96 ? 280  THR C CB  1 
ATOM   7638  O OG1 . THR C 1 280 ? 24.978  34.270  57.875  1.00 20.51 ? 280  THR C OG1 1 
ATOM   7639  C CG2 . THR C 1 280 ? 24.058  34.055  60.166  1.00 18.15 ? 280  THR C CG2 1 
ATOM   7640  N N   . VAL C 1 281 ? 20.902  35.602  58.750  1.00 16.54 ? 281  VAL C N   1 
ATOM   7641  C CA  . VAL C 1 281 ? 19.694  36.096  59.444  1.00 16.83 ? 281  VAL C CA  1 
ATOM   7642  C C   . VAL C 1 281 ? 18.465  35.344  58.937  1.00 17.12 ? 281  VAL C C   1 
ATOM   7643  O O   . VAL C 1 281 ? 17.600  34.902  59.721  1.00 17.21 ? 281  VAL C O   1 
ATOM   7644  C CB  . VAL C 1 281 ? 19.614  37.618  59.316  1.00 16.60 ? 281  VAL C CB  1 
ATOM   7645  C CG1 . VAL C 1 281 ? 18.291  38.212  59.750  1.00 17.86 ? 281  VAL C CG1 1 
ATOM   7646  C CG2 . VAL C 1 281 ? 20.767  38.305  60.069  1.00 18.68 ? 281  VAL C CG2 1 
ATOM   7647  N N   . ASN C 1 282 ? 18.406  35.194  57.618  1.00 16.47 ? 282  ASN C N   1 
ATOM   7648  C CA  . ASN C 1 282 ? 17.270  34.472  56.993  1.00 15.83 ? 282  ASN C CA  1 
ATOM   7649  C C   . ASN C 1 282 ? 17.204  33.041  57.476  1.00 14.89 ? 282  ASN C C   1 
ATOM   7650  O O   . ASN C 1 282 ? 16.111  32.583  57.868  1.00 15.46 ? 282  ASN C O   1 
ATOM   7651  C CB  . ASN C 1 282 ? 17.267  34.671  55.479  1.00 15.56 ? 282  ASN C CB  1 
ATOM   7652  C CG  . ASN C 1 282 ? 16.863  36.083  55.111  1.00 17.55 ? 282  ASN C CG  1 
ATOM   7653  O OD1 . ASN C 1 282 ? 16.097  36.714  55.854  1.00 17.77 ? 282  ASN C OD1 1 
ATOM   7654  N ND2 . ASN C 1 282 ? 17.385  36.581  53.991  1.00 18.85 ? 282  ASN C ND2 1 
ATOM   7655  N N   . LEU C 1 283 ? 18.319  32.333  57.465  1.00 14.54 ? 283  LEU C N   1 
ATOM   7656  C CA  . LEU C 1 283 ? 18.381  30.954  57.908  1.00 14.50 ? 283  LEU C CA  1 
ATOM   7657  C C   . LEU C 1 283 ? 17.930  30.829  59.380  1.00 14.83 ? 283  LEU C C   1 
ATOM   7658  O O   . LEU C 1 283 ? 17.283  29.846  59.748  1.00 14.42 ? 283  LEU C O   1 
ATOM   7659  C CB  . LEU C 1 283 ? 19.788  30.378  57.698  1.00 14.03 ? 283  LEU C CB  1 
ATOM   7660  C CG  . LEU C 1 283 ? 19.958  28.958  58.215  1.00 14.59 ? 283  LEU C CG  1 
ATOM   7661  C CD1 . LEU C 1 283 ? 18.971  28.017  57.520  1.00 14.79 ? 283  LEU C CD1 1 
ATOM   7662  C CD2 . LEU C 1 283 ? 21.385  28.493  57.923  1.00 15.78 ? 283  LEU C CD2 1 
ATOM   7663  N N   . SER C 1 284 ? 18.305  31.854  60.138  1.00 14.91 ? 284  SER C N   1 
ATOM   7664  C CA  . SER C 1 284 ? 18.010  31.802  61.597  1.00 15.31 ? 284  SER C CA  1 
ATOM   7665  C C   . SER C 1 284 ? 16.503  31.923  61.811  1.00 14.92 ? 284  SER C C   1 
ATOM   7666  O O   . SER C 1 284 ? 15.925  31.152  62.589  1.00 14.63 ? 284  SER C O   1 
ATOM   7667  C CB  . SER C 1 284 ? 18.791  32.854  62.352  1.00 16.34 ? 284  SER C CB  1 
ATOM   7668  O OG  . SER C 1 284 ? 18.878  32.472  63.722  1.00 18.06 ? 284  SER C OG  1 
ATOM   7669  N N   . ALA C 1 285 ? 15.920  32.865  61.097  1.00 15.57 ? 285  ALA C N   1 
ATOM   7670  C CA  . ALA C 1 285 ? 14.472  33.125  61.145  1.00 16.18 ? 285  ALA C CA  1 
ATOM   7671  C C   . ALA C 1 285 ? 13.685  31.899  60.701  1.00 16.62 ? 285  ALA C C   1 
ATOM   7672  O O   . ALA C 1 285 ? 12.621  31.579  61.291  1.00 17.30 ? 285  ALA C O   1 
ATOM   7673  C CB  . ALA C 1 285 ? 14.140  34.361  60.333  1.00 14.88 ? 285  ALA C CB  1 
ATOM   7674  N N   . ILE C 1 286 ? 14.192  31.214  59.681  1.00 16.26 ? 286  ILE C N   1 
ATOM   7675  C CA  . ILE C 1 286 ? 13.567  29.982  59.180  1.00 15.16 ? 286  ILE C CA  1 
ATOM   7676  C C   . ILE C 1 286 ? 13.451  28.940  60.278  1.00 15.66 ? 286  ILE C C   1 
ATOM   7677  O O   . ILE C 1 286 ? 12.435  28.232  60.402  1.00 15.06 ? 286  ILE C O   1 
ATOM   7678  C CB  . ILE C 1 286 ? 14.347  29.427  57.923  1.00 13.58 ? 286  ILE C CB  1 
ATOM   7679  C CG1 . ILE C 1 286 ? 13.970  30.287  56.680  1.00 13.45 ? 286  ILE C CG1 1 
ATOM   7680  C CG2 . ILE C 1 286 ? 14.116  27.922  57.691  1.00 13.42 ? 286  ILE C CG2 1 
ATOM   7681  C CD1 . ILE C 1 286 ? 14.812  29.944  55.409  1.00 14.45 ? 286  ILE C CD1 1 
ATOM   7682  N N   . ASN C 1 287 ? 14.508  28.839  61.083  1.00 15.77 ? 287  ASN C N   1 
ATOM   7683  C CA  . ASN C 1 287 ? 14.562  27.822  62.152  1.00 15.84 ? 287  ASN C CA  1 
ATOM   7684  C C   . ASN C 1 287 ? 13.793  28.291  63.395  1.00 16.40 ? 287  ASN C C   1 
ATOM   7685  O O   . ASN C 1 287 ? 13.956  27.655  64.455  1.00 16.77 ? 287  ASN C O   1 
ATOM   7686  C CB  . ASN C 1 287 ? 15.998  27.416  62.448  1.00 14.75 ? 287  ASN C CB  1 
ATOM   7687  C CG  . ASN C 1 287 ? 16.565  26.363  61.519  1.00 14.59 ? 287  ASN C CG  1 
ATOM   7688  O OD1 . ASN C 1 287 ? 16.249  25.176  61.638  1.00 15.99 ? 287  ASN C OD1 1 
ATOM   7689  N ND2 . ASN C 1 287 ? 17.457  26.760  60.604  1.00 14.73 ? 287  ASN C ND2 1 
ATOM   7690  N N   . ASN C 1 288 ? 13.012  29.326  63.262  1.00 16.74 ? 288  ASN C N   1 
ATOM   7691  C CA  . ASN C 1 288 ? 12.182  29.874  64.337  1.00 17.66 ? 288  ASN C CA  1 
ATOM   7692  C C   . ASN C 1 288 ? 10.706  29.937  63.969  1.00 17.95 ? 288  ASN C C   1 
ATOM   7693  O O   . ASN C 1 288 ? 9.897   30.427  64.801  1.00 18.27 ? 288  ASN C O   1 
ATOM   7694  C CB  . ASN C 1 288 ? 12.699  31.243  64.814  1.00 17.88 ? 288  ASN C CB  1 
ATOM   7695  C CG  . ASN C 1 288 ? 13.831  31.072  65.819  1.00 18.16 ? 288  ASN C CG  1 
ATOM   7696  O OD1 . ASN C 1 288 ? 13.602  30.520  66.906  1.00 20.93 ? 288  ASN C OD1 1 
ATOM   7697  N ND2 . ASN C 1 288 ? 15.019  31.513  65.461  1.00 17.34 ? 288  ASN C ND2 1 
ATOM   7698  N N   . VAL C 1 289 ? 10.352  29.461  62.784  1.00 17.54 ? 289  VAL C N   1 
ATOM   7699  C CA  . VAL C 1 289 ? 8.925   29.506  62.382  1.00 16.38 ? 289  VAL C CA  1 
ATOM   7700  C C   . VAL C 1 289 ? 8.156   28.523  63.263  1.00 15.41 ? 289  VAL C C   1 
ATOM   7701  O O   . VAL C 1 289 ? 8.527   27.339  63.333  1.00 15.52 ? 289  VAL C O   1 
ATOM   7702  C CB  . VAL C 1 289 ? 8.753   29.218  60.880  1.00 15.74 ? 289  VAL C CB  1 
ATOM   7703  C CG1 . VAL C 1 289 ? 7.260   29.180  60.519  1.00 15.83 ? 289  VAL C CG1 1 
ATOM   7704  C CG2 . VAL C 1 289 ? 9.479   30.239  60.018  1.00 14.48 ? 289  VAL C CG2 1 
ATOM   7705  N N   . PRO C 1 290 ? 7.085   29.017  63.858  1.00 15.54 ? 290  PRO C N   1 
ATOM   7706  C CA  . PRO C 1 290 ? 6.230   28.197  64.731  1.00 15.92 ? 290  PRO C CA  1 
ATOM   7707  C C   . PRO C 1 290 ? 5.315   27.263  63.970  1.00 15.87 ? 290  PRO C C   1 
ATOM   7708  O O   . PRO C 1 290 ? 4.065   27.305  64.070  1.00 16.66 ? 290  PRO C O   1 
ATOM   7709  C CB  . PRO C 1 290 ? 5.485   29.238  65.557  1.00 15.96 ? 290  PRO C CB  1 
ATOM   7710  C CG  . PRO C 1 290 ? 5.348   30.427  64.650  1.00 16.09 ? 290  PRO C CG  1 
ATOM   7711  C CD  . PRO C 1 290 ? 6.538   30.374  63.701  1.00 15.75 ? 290  PRO C CD  1 
ATOM   7712  N N   . LEU C 1 291 ? 5.927   26.395  63.198  1.00 15.02 ? 291  LEU C N   1 
ATOM   7713  C CA  . LEU C 1 291 ? 5.228   25.354  62.423  1.00 14.57 ? 291  LEU C CA  1 
ATOM   7714  C C   . LEU C 1 291 ? 6.144   24.138  62.472  1.00 14.50 ? 291  LEU C C   1 
ATOM   7715  O O   . LEU C 1 291 ? 7.368   24.354  62.582  1.00 14.42 ? 291  LEU C O   1 
ATOM   7716  C CB  . LEU C 1 291 ? 4.978   25.864  61.005  1.00 12.54 ? 291  LEU C CB  1 
ATOM   7717  C CG  . LEU C 1 291 ? 4.077   27.047  60.784  1.00 12.70 ? 291  LEU C CG  1 
ATOM   7718  C CD1 . LEU C 1 291 ? 4.183   27.541  59.330  1.00 11.61 ? 291  LEU C CD1 1 
ATOM   7719  C CD2 . LEU C 1 291 ? 2.630   26.658  61.083  1.00 12.93 ? 291  LEU C CD2 1 
ATOM   7720  N N   . ILE C 1 292 ? 5.552   22.965  62.395  1.00 14.62 ? 292  ILE C N   1 
ATOM   7721  C CA  . ILE C 1 292 ? 6.375   21.743  62.464  1.00 14.53 ? 292  ILE C CA  1 
ATOM   7722  C C   . ILE C 1 292 ? 7.276   21.687  61.219  1.00 15.00 ? 292  ILE C C   1 
ATOM   7723  O O   . ILE C 1 292 ? 6.796   21.961  60.104  1.00 14.66 ? 292  ILE C O   1 
ATOM   7724  C CB  . ILE C 1 292 ? 5.513   20.478  62.665  1.00 14.39 ? 292  ILE C CB  1 
ATOM   7725  C CG1 . ILE C 1 292 ? 4.997   20.444  64.152  1.00 15.62 ? 292  ILE C CG1 1 
ATOM   7726  C CG2 . ILE C 1 292 ? 6.217   19.158  62.325  1.00 13.10 ? 292  ILE C CG2 1 
ATOM   7727  C CD1 . ILE C 1 292 ? 3.749   19.520  64.258  1.00 16.26 ? 292  ILE C CD1 1 
ATOM   7728  N N   . ARG C 1 293 ? 8.508   21.336  61.490  1.00 14.27 ? 293  ARG C N   1 
ATOM   7729  C CA  . ARG C 1 293 ? 9.564   21.225  60.465  1.00 14.34 ? 293  ARG C CA  1 
ATOM   7730  C C   . ARG C 1 293 ? 10.303  19.916  60.653  1.00 13.83 ? 293  ARG C C   1 
ATOM   7731  O O   . ARG C 1 293 ? 11.237  19.849  61.485  1.00 14.28 ? 293  ARG C O   1 
ATOM   7732  C CB  . ARG C 1 293 ? 10.526  22.412  60.589  1.00 16.84 ? 293  ARG C CB  1 
ATOM   7733  C CG  . ARG C 1 293 ? 9.866   23.736  60.215  1.00 19.58 ? 293  ARG C CG  1 
ATOM   7734  C CD  . ARG C 1 293 ? 10.588  24.902  60.762  1.00 22.40 ? 293  ARG C CD  1 
ATOM   7735  N NE  . ARG C 1 293 ? 10.324  25.190  62.152  1.00 24.68 ? 293  ARG C NE  1 
ATOM   7736  C CZ  . ARG C 1 293 ? 11.203  25.062  63.146  1.00 25.76 ? 293  ARG C CZ  1 
ATOM   7737  N NH1 . ARG C 1 293 ? 12.420  24.575  62.956  1.00 26.45 ? 293  ARG C NH1 1 
ATOM   7738  N NH2 . ARG C 1 293 ? 10.875  25.534  64.355  1.00 26.28 ? 293  ARG C NH2 1 
ATOM   7739  N N   . PRO C 1 294 ? 9.880   18.923  59.881  1.00 13.12 ? 294  PRO C N   1 
ATOM   7740  C CA  . PRO C 1 294 ? 10.352  17.558  60.032  1.00 12.33 ? 294  PRO C CA  1 
ATOM   7741  C C   . PRO C 1 294 ? 11.727  17.263  59.492  1.00 11.89 ? 294  PRO C C   1 
ATOM   7742  O O   . PRO C 1 294 ? 12.166  16.096  59.603  1.00 13.39 ? 294  PRO C O   1 
ATOM   7743  C CB  . PRO C 1 294 ? 9.255   16.721  59.361  1.00 12.08 ? 294  PRO C CB  1 
ATOM   7744  C CG  . PRO C 1 294 ? 8.743   17.624  58.270  1.00 12.08 ? 294  PRO C CG  1 
ATOM   7745  C CD  . PRO C 1 294 ? 8.781   19.017  58.881  1.00 12.50 ? 294  PRO C CD  1 
ATOM   7746  N N   . TRP C 1 295 ? 12.423  18.243  58.963  1.00 11.52 ? 295  TRP C N   1 
ATOM   7747  C CA  . TRP C 1 295 ? 13.751  18.031  58.366  1.00 10.70 ? 295  TRP C CA  1 
ATOM   7748  C C   . TRP C 1 295 ? 14.699  19.097  58.936  1.00 11.04 ? 295  TRP C C   1 
ATOM   7749  O O   . TRP C 1 295 ? 14.253  20.190  59.290  1.00 10.84 ? 295  TRP C O   1 
ATOM   7750  C CB  . TRP C 1 295 ? 13.729  18.100  56.840  1.00 8.48  ? 295  TRP C CB  1 
ATOM   7751  C CG  . TRP C 1 295 ? 12.402  18.201  56.157  1.00 7.76  ? 295  TRP C CG  1 
ATOM   7752  C CD1 . TRP C 1 295 ? 11.760  17.277  55.381  1.00 6.60  ? 295  TRP C CD1 1 
ATOM   7753  C CD2 . TRP C 1 295 ? 11.581  19.381  56.131  1.00 7.12  ? 295  TRP C CD2 1 
ATOM   7754  N NE1 . TRP C 1 295 ? 10.567  17.794  54.909  1.00 6.75  ? 295  TRP C NE1 1 
ATOM   7755  C CE2 . TRP C 1 295 ? 10.439  19.079  55.353  1.00 7.46  ? 295  TRP C CE2 1 
ATOM   7756  C CE3 . TRP C 1 295 ? 11.696  20.642  56.701  1.00 7.46  ? 295  TRP C CE3 1 
ATOM   7757  C CZ2 . TRP C 1 295 ? 9.432   20.010  55.143  1.00 5.91  ? 295  TRP C CZ2 1 
ATOM   7758  C CZ3 . TRP C 1 295 ? 10.692  21.562  56.506  1.00 7.03  ? 295  TRP C CZ3 1 
ATOM   7759  C CH2 . TRP C 1 295 ? 9.578   21.253  55.722  1.00 8.32  ? 295  TRP C CH2 1 
ATOM   7760  N N   . ALA C 1 296 ? 15.975  18.736  58.955  1.00 11.64 ? 296  ALA C N   1 
ATOM   7761  C CA  . ALA C 1 296 ? 17.000  19.750  59.324  1.00 12.48 ? 296  ALA C CA  1 
ATOM   7762  C C   . ALA C 1 296 ? 16.996  20.822  58.229  1.00 13.03 ? 296  ALA C C   1 
ATOM   7763  O O   . ALA C 1 296 ? 16.899  20.465  57.025  1.00 12.38 ? 296  ALA C O   1 
ATOM   7764  C CB  . ALA C 1 296 ? 18.361  19.083  59.465  1.00 13.02 ? 296  ALA C CB  1 
ATOM   7765  N N   . LEU C 1 297 ? 17.069  22.062  58.651  1.00 12.57 ? 297  LEU C N   1 
ATOM   7766  C CA  . LEU C 1 297 ? 17.124  23.243  57.785  1.00 14.02 ? 297  LEU C CA  1 
ATOM   7767  C C   . LEU C 1 297 ? 18.447  23.986  57.993  1.00 14.94 ? 297  LEU C C   1 
ATOM   7768  O O   . LEU C 1 297 ? 18.569  24.819  58.909  1.00 15.30 ? 297  LEU C O   1 
ATOM   7769  C CB  . LEU C 1 297 ? 15.895  24.128  58.074  1.00 12.65 ? 297  LEU C CB  1 
ATOM   7770  C CG  . LEU C 1 297 ? 14.541  23.468  57.812  1.00 12.30 ? 297  LEU C CG  1 
ATOM   7771  C CD1 . LEU C 1 297 ? 13.420  24.208  58.527  1.00 10.29 ? 297  LEU C CD1 1 
ATOM   7772  C CD2 . LEU C 1 297 ? 14.269  23.506  56.298  1.00 12.50 ? 297  LEU C CD2 1 
ATOM   7773  N N   . THR C 1 298 ? 19.395  23.683  57.122  1.00 15.27 ? 298  THR C N   1 
ATOM   7774  C CA  . THR C 1 298 ? 20.756  24.250  57.243  1.00 15.07 ? 298  THR C CA  1 
ATOM   7775  C C   . THR C 1 298 ? 21.194  24.916  55.955  1.00 15.18 ? 298  THR C C   1 
ATOM   7776  O O   . THR C 1 298 ? 20.336  25.284  55.129  1.00 15.29 ? 298  THR C O   1 
ATOM   7777  C CB  . THR C 1 298 ? 21.715  23.120  57.784  1.00 14.12 ? 298  THR C CB  1 
ATOM   7778  O OG1 . THR C 1 298 ? 22.961  23.760  58.138  1.00 15.58 ? 298  THR C OG1 1 
ATOM   7779  C CG2 . THR C 1 298 ? 21.868  21.951  56.811  1.00 13.86 ? 298  THR C CG2 1 
ATOM   7780  N N   . PHE C 1 299 ? 22.492  25.083  55.777  1.00 14.92 ? 299  PHE C N   1 
ATOM   7781  C CA  . PHE C 1 299 ? 23.072  25.850  54.673  1.00 15.38 ? 299  PHE C CA  1 
ATOM   7782  C C   . PHE C 1 299 ? 23.986  25.006  53.784  1.00 15.68 ? 299  PHE C C   1 
ATOM   7783  O O   . PHE C 1 299 ? 24.545  23.981  54.166  1.00 15.43 ? 299  PHE C O   1 
ATOM   7784  C CB  . PHE C 1 299 ? 23.843  27.072  55.194  1.00 15.06 ? 299  PHE C CB  1 
ATOM   7785  C CG  . PHE C 1 299 ? 24.965  26.708  56.131  1.00 16.37 ? 299  PHE C CG  1 
ATOM   7786  C CD1 . PHE C 1 299 ? 24.680  26.502  57.486  1.00 16.96 ? 299  PHE C CD1 1 
ATOM   7787  C CD2 . PHE C 1 299 ? 26.267  26.559  55.673  1.00 16.42 ? 299  PHE C CD2 1 
ATOM   7788  C CE1 . PHE C 1 299 ? 25.690  26.170  58.379  1.00 17.07 ? 299  PHE C CE1 1 
ATOM   7789  C CE2 . PHE C 1 299 ? 27.298  26.215  56.555  1.00 17.55 ? 299  PHE C CE2 1 
ATOM   7790  C CZ  . PHE C 1 299 ? 27.003  26.023  57.909  1.00 16.88 ? 299  PHE C CZ  1 
ATOM   7791  N N   . SER C 1 300 ? 24.090  25.506  52.561  1.00 16.51 ? 300  SER C N   1 
ATOM   7792  C CA  . SER C 1 300 ? 25.040  25.003  51.548  1.00 16.95 ? 300  SER C CA  1 
ATOM   7793  C C   . SER C 1 300 ? 25.482  26.250  50.756  1.00 17.79 ? 300  SER C C   1 
ATOM   7794  O O   . SER C 1 300 ? 25.059  26.475  49.611  1.00 18.57 ? 300  SER C O   1 
ATOM   7795  C CB  . SER C 1 300 ? 24.478  23.950  50.625  1.00 14.98 ? 300  SER C CB  1 
ATOM   7796  O OG  . SER C 1 300 ? 25.485  23.447  49.747  1.00 13.61 ? 300  SER C OG  1 
ATOM   7797  N N   . TYR C 1 301 ? 26.308  27.017  51.430  1.00 17.90 ? 301  TYR C N   1 
ATOM   7798  C CA  . TYR C 1 301 ? 26.736  28.329  50.985  1.00 18.44 ? 301  TYR C CA  1 
ATOM   7799  C C   . TYR C 1 301 ? 28.079  28.333  50.262  1.00 18.89 ? 301  TYR C C   1 
ATOM   7800  O O   . TYR C 1 301 ? 29.033  27.652  50.637  1.00 18.49 ? 301  TYR C O   1 
ATOM   7801  C CB  . TYR C 1 301 ? 26.736  29.305  52.173  1.00 18.47 ? 301  TYR C CB  1 
ATOM   7802  C CG  . TYR C 1 301 ? 25.378  29.621  52.750  1.00 18.80 ? 301  TYR C CG  1 
ATOM   7803  C CD1 . TYR C 1 301 ? 24.204  29.180  52.131  1.00 18.47 ? 301  TYR C CD1 1 
ATOM   7804  C CD2 . TYR C 1 301 ? 25.256  30.378  53.917  1.00 19.17 ? 301  TYR C CD2 1 
ATOM   7805  C CE1 . TYR C 1 301 ? 22.954  29.485  52.652  1.00 19.49 ? 301  TYR C CE1 1 
ATOM   7806  C CE2 . TYR C 1 301 ? 24.006  30.697  54.458  1.00 19.17 ? 301  TYR C CE2 1 
ATOM   7807  C CZ  . TYR C 1 301 ? 22.856  30.239  53.818  1.00 19.70 ? 301  TYR C CZ  1 
ATOM   7808  O OH  . TYR C 1 301 ? 21.607  30.527  54.298  1.00 20.25 ? 301  TYR C OH  1 
ATOM   7809  N N   . GLY C 1 302 ? 28.106  29.149  49.220  1.00 19.81 ? 302  GLY C N   1 
ATOM   7810  C CA  . GLY C 1 302 ? 29.267  29.356  48.347  1.00 20.96 ? 302  GLY C CA  1 
ATOM   7811  C C   . GLY C 1 302 ? 29.847  30.746  48.602  1.00 21.88 ? 302  GLY C C   1 
ATOM   7812  O O   . GLY C 1 302 ? 30.690  30.916  49.493  1.00 22.02 ? 302  GLY C O   1 
ATOM   7813  N N   . ARG C 1 303 ? 29.384  31.714  47.833  1.00 22.74 ? 303  ARG C N   1 
ATOM   7814  C CA  . ARG C 1 303 ? 29.836  33.097  47.986  1.00 24.19 ? 303  ARG C CA  1 
ATOM   7815  C C   . ARG C 1 303 ? 29.569  33.576  49.417  1.00 24.70 ? 303  ARG C C   1 
ATOM   7816  O O   . ARG C 1 303 ? 30.368  34.319  50.004  1.00 24.61 ? 303  ARG C O   1 
ATOM   7817  C CB  . ARG C 1 303 ? 29.135  34.062  47.026  1.00 26.82 ? 303  ARG C CB  1 
ATOM   7818  C CG  . ARG C 1 303 ? 29.215  33.687  45.555  1.00 30.03 ? 303  ARG C CG  1 
ATOM   7819  C CD  . ARG C 1 303 ? 28.295  34.532  44.743  1.00 32.77 ? 303  ARG C CD  1 
ATOM   7820  N NE  . ARG C 1 303 ? 28.905  35.666  44.118  1.00 35.61 ? 303  ARG C NE  1 
ATOM   7821  C CZ  . ARG C 1 303 ? 29.957  36.388  44.458  1.00 36.91 ? 303  ARG C CZ  1 
ATOM   7822  N NH1 . ARG C 1 303 ? 30.721  36.130  45.519  1.00 37.92 ? 303  ARG C NH1 1 
ATOM   7823  N NH2 . ARG C 1 303 ? 30.250  37.471  43.721  1.00 37.21 ? 303  ARG C NH2 1 
ATOM   7824  N N   . ALA C 1 304 ? 28.419  33.164  49.923  1.00 24.60 ? 304  ALA C N   1 
ATOM   7825  C CA  . ALA C 1 304 ? 27.923  33.562  51.236  1.00 24.92 ? 304  ALA C CA  1 
ATOM   7826  C C   . ALA C 1 304 ? 28.843  33.118  52.368  1.00 25.03 ? 304  ALA C C   1 
ATOM   7827  O O   . ALA C 1 304 ? 28.683  33.638  53.493  1.00 25.20 ? 304  ALA C O   1 
ATOM   7828  C CB  . ALA C 1 304 ? 26.495  33.066  51.444  1.00 23.33 ? 304  ALA C CB  1 
ATOM   7829  N N   . LEU C 1 305 ? 29.745  32.194  52.104  1.00 25.11 ? 305  LEU C N   1 
ATOM   7830  C CA  . LEU C 1 305 ? 30.708  31.745  53.111  1.00 25.57 ? 305  LEU C CA  1 
ATOM   7831  C C   . LEU C 1 305 ? 32.111  32.277  52.826  1.00 25.88 ? 305  LEU C C   1 
ATOM   7832  O O   . LEU C 1 305 ? 32.928  32.340  53.764  1.00 26.12 ? 305  LEU C O   1 
ATOM   7833  C CB  . LEU C 1 305 ? 30.694  30.215  53.215  1.00 24.73 ? 305  LEU C CB  1 
ATOM   7834  C CG  . LEU C 1 305 ? 29.916  29.604  54.374  1.00 24.13 ? 305  LEU C CG  1 
ATOM   7835  C CD1 . LEU C 1 305 ? 29.982  28.090  54.347  1.00 24.06 ? 305  LEU C CD1 1 
ATOM   7836  C CD2 . LEU C 1 305 ? 30.510  30.135  55.685  1.00 24.66 ? 305  LEU C CD2 1 
ATOM   7837  N N   . GLN C 1 306 ? 32.351  32.651  51.588  1.00 26.08 ? 306  GLN C N   1 
ATOM   7838  C CA  . GLN C 1 306 ? 33.673  33.000  51.083  1.00 26.07 ? 306  GLN C CA  1 
ATOM   7839  C C   . GLN C 1 306 ? 33.923  34.458  50.755  1.00 26.17 ? 306  GLN C C   1 
ATOM   7840  O O   . GLN C 1 306 ? 35.116  34.819  50.583  1.00 26.24 ? 306  GLN C O   1 
ATOM   7841  C CB  . GLN C 1 306 ? 33.985  32.194  49.805  1.00 25.58 ? 306  GLN C CB  1 
ATOM   7842  C CG  . GLN C 1 306 ? 34.087  30.707  50.014  1.00 26.00 ? 306  GLN C CG  1 
ATOM   7843  C CD  . GLN C 1 306 ? 34.220  29.975  48.700  1.00 26.50 ? 306  GLN C CD  1 
ATOM   7844  O OE1 . GLN C 1 306 ? 35.229  30.090  48.006  1.00 26.80 ? 306  GLN C OE1 1 
ATOM   7845  N NE2 . GLN C 1 306 ? 33.180  29.221  48.381  1.00 25.82 ? 306  GLN C NE2 1 
ATOM   7846  N N   . ALA C 1 307 ? 32.902  35.261  50.624  1.00 26.41 ? 307  ALA C N   1 
ATOM   7847  C CA  . ALA C 1 307 ? 33.027  36.660  50.215  1.00 27.09 ? 307  ALA C CA  1 
ATOM   7848  C C   . ALA C 1 307 ? 34.104  37.410  50.993  1.00 27.78 ? 307  ALA C C   1 
ATOM   7849  O O   . ALA C 1 307 ? 35.004  38.046  50.395  1.00 27.69 ? 307  ALA C O   1 
ATOM   7850  C CB  . ALA C 1 307 ? 31.680  37.361  50.347  1.00 27.15 ? 307  ALA C CB  1 
ATOM   7851  N N   . SER C 1 308 ? 34.000  37.353  52.305  1.00 28.19 ? 308  SER C N   1 
ATOM   7852  C CA  . SER C 1 308 ? 34.907  38.074  53.207  1.00 28.69 ? 308  SER C CA  1 
ATOM   7853  C C   . SER C 1 308 ? 36.283  37.423  53.250  1.00 29.52 ? 308  SER C C   1 
ATOM   7854  O O   . SER C 1 308 ? 37.277  38.118  53.527  1.00 29.72 ? 308  SER C O   1 
ATOM   7855  C CB  . SER C 1 308 ? 34.305  38.219  54.597  1.00 27.66 ? 308  SER C CB  1 
ATOM   7856  O OG  . SER C 1 308 ? 33.263  39.180  54.562  1.00 26.24 ? 308  SER C OG  1 
ATOM   7857  N N   . VAL C 1 309 ? 36.305  36.130  52.993  1.00 29.99 ? 309  VAL C N   1 
ATOM   7858  C CA  . VAL C 1 309 ? 37.562  35.372  52.983  1.00 31.37 ? 309  VAL C CA  1 
ATOM   7859  C C   . VAL C 1 309 ? 38.493  35.951  51.910  1.00 32.64 ? 309  VAL C C   1 
ATOM   7860  O O   . VAL C 1 309 ? 39.615  36.388  52.215  1.00 32.60 ? 309  VAL C O   1 
ATOM   7861  C CB  . VAL C 1 309 ? 37.284  33.868  52.819  1.00 30.70 ? 309  VAL C CB  1 
ATOM   7862  C CG1 . VAL C 1 309 ? 38.566  33.069  52.604  1.00 30.14 ? 309  VAL C CG1 1 
ATOM   7863  C CG2 . VAL C 1 309 ? 36.471  33.312  53.979  1.00 29.22 ? 309  VAL C CG2 1 
ATOM   7864  N N   . LEU C 1 310 ? 37.993  35.937  50.687  1.00 33.98 ? 310  LEU C N   1 
ATOM   7865  C CA  . LEU C 1 310 ? 38.736  36.430  49.525  1.00 35.73 ? 310  LEU C CA  1 
ATOM   7866  C C   . LEU C 1 310 ? 39.233  37.854  49.775  1.00 37.10 ? 310  LEU C C   1 
ATOM   7867  O O   . LEU C 1 310 ? 40.402  38.180  49.493  1.00 37.15 ? 310  LEU C O   1 
ATOM   7868  C CB  . LEU C 1 310 ? 37.861  36.255  48.284  1.00 35.44 ? 310  LEU C CB  1 
ATOM   7869  C CG  . LEU C 1 310 ? 37.921  34.902  47.583  1.00 35.46 ? 310  LEU C CG  1 
ATOM   7870  C CD1 . LEU C 1 310 ? 36.707  34.694  46.691  1.00 35.59 ? 310  LEU C CD1 1 
ATOM   7871  C CD2 . LEU C 1 310 ? 39.199  34.840  46.749  1.00 34.94 ? 310  LEU C CD2 1 
ATOM   7872  N N   . ARG C 1 311 ? 38.338  38.672  50.292  1.00 38.71 ? 311  ARG C N   1 
ATOM   7873  C CA  . ARG C 1 311 ? 38.630  40.069  50.623  1.00 40.61 ? 311  ARG C CA  1 
ATOM   7874  C C   . ARG C 1 311 ? 39.796  40.173  51.604  1.00 41.24 ? 311  ARG C C   1 
ATOM   7875  O O   . ARG C 1 311 ? 40.729  40.964  51.395  1.00 41.36 ? 311  ARG C O   1 
ATOM   7876  C CB  . ARG C 1 311 ? 37.400  40.791  51.173  1.00 43.86 ? 311  ARG C CB  1 
ATOM   7877  C CG  . ARG C 1 311 ? 37.694  42.208  51.652  1.00 47.56 ? 311  ARG C CG  1 
ATOM   7878  C CD  . ARG C 1 311 ? 36.657  43.180  51.228  1.00 50.35 ? 311  ARG C CD  1 
ATOM   7879  N NE  . ARG C 1 311 ? 35.701  43.478  52.291  1.00 53.25 ? 311  ARG C NE  1 
ATOM   7880  C CZ  . ARG C 1 311 ? 34.963  44.597  52.263  1.00 54.74 ? 311  ARG C CZ  1 
ATOM   7881  N NH1 . ARG C 1 311 ? 35.083  45.472  51.270  1.00 55.37 ? 311  ARG C NH1 1 
ATOM   7882  N NH2 . ARG C 1 311 ? 34.101  44.833  53.250  1.00 55.56 ? 311  ARG C NH2 1 
ATOM   7883  N N   . ALA C 1 312 ? 39.728  39.382  52.659  1.00 41.73 ? 312  ALA C N   1 
ATOM   7884  C CA  . ALA C 1 312 ? 40.755  39.354  53.705  1.00 42.46 ? 312  ALA C CA  1 
ATOM   7885  C C   . ALA C 1 312 ? 42.095  38.893  53.136  1.00 43.15 ? 312  ALA C C   1 
ATOM   7886  O O   . ALA C 1 312 ? 43.152  39.465  53.458  1.00 43.36 ? 312  ALA C O   1 
ATOM   7887  C CB  . ALA C 1 312 ? 40.305  38.471  54.860  1.00 41.91 ? 312  ALA C CB  1 
ATOM   7888  N N   . TRP C 1 313 ? 42.020  37.867  52.310  1.00 43.61 ? 313  TRP C N   1 
ATOM   7889  C CA  . TRP C 1 313 ? 43.194  37.250  51.673  1.00 44.27 ? 313  TRP C CA  1 
ATOM   7890  C C   . TRP C 1 313 ? 43.902  38.250  50.762  1.00 44.81 ? 313  TRP C C   1 
ATOM   7891  O O   . TRP C 1 313 ? 45.054  38.646  51.020  1.00 44.74 ? 313  TRP C O   1 
ATOM   7892  C CB  . TRP C 1 313 ? 42.792  35.970  50.944  1.00 43.93 ? 313  TRP C CB  1 
ATOM   7893  C CG  . TRP C 1 313 ? 43.936  35.249  50.319  1.00 43.61 ? 313  TRP C CG  1 
ATOM   7894  C CD1 . TRP C 1 313 ? 45.166  35.018  50.874  1.00 43.45 ? 313  TRP C CD1 1 
ATOM   7895  C CD2 . TRP C 1 313 ? 43.958  34.638  49.020  1.00 43.72 ? 313  TRP C CD2 1 
ATOM   7896  N NE1 . TRP C 1 313 ? 45.951  34.312  49.998  1.00 43.95 ? 313  TRP C NE1 1 
ATOM   7897  C CE2 . TRP C 1 313 ? 45.242  34.066  48.854  1.00 43.53 ? 313  TRP C CE2 1 
ATOM   7898  C CE3 . TRP C 1 313 ? 43.026  34.528  47.997  1.00 43.60 ? 313  TRP C CE3 1 
ATOM   7899  C CZ2 . TRP C 1 313 ? 45.610  33.388  47.701  1.00 43.38 ? 313  TRP C CZ2 1 
ATOM   7900  C CZ3 . TRP C 1 313 ? 43.393  33.854  46.846  1.00 43.68 ? 313  TRP C CZ3 1 
ATOM   7901  C CH2 . TRP C 1 313 ? 44.658  33.291  46.694  1.00 43.23 ? 313  TRP C CH2 1 
ATOM   7902  N N   . ALA C 1 314 ? 43.201  38.625  49.708  1.00 45.28 ? 314  ALA C N   1 
ATOM   7903  C CA  . ALA C 1 314 ? 43.681  39.602  48.726  1.00 45.97 ? 314  ALA C CA  1 
ATOM   7904  C C   . ALA C 1 314 ? 44.777  39.020  47.840  1.00 46.43 ? 314  ALA C C   1 
ATOM   7905  O O   . ALA C 1 314 ? 45.285  39.713  46.937  1.00 46.76 ? 314  ALA C O   1 
ATOM   7906  C CB  . ALA C 1 314 ? 44.158  40.861  49.437  1.00 46.21 ? 314  ALA C CB  1 
ATOM   7907  N N   . GLY C 1 315 ? 45.138  37.782  48.110  1.00 46.80 ? 315  GLY C N   1 
ATOM   7908  C CA  . GLY C 1 315 ? 46.152  37.054  47.346  1.00 47.02 ? 315  GLY C CA  1 
ATOM   7909  C C   . GLY C 1 315 ? 47.507  37.041  48.034  1.00 47.21 ? 315  GLY C C   1 
ATOM   7910  O O   . GLY C 1 315 ? 48.458  36.408  47.526  1.00 47.28 ? 315  GLY C O   1 
ATOM   7911  N N   . LYS C 1 316 ? 47.595  37.708  49.166  1.00 47.16 ? 316  LYS C N   1 
ATOM   7912  C CA  . LYS C 1 316 ? 48.840  37.840  49.930  1.00 47.23 ? 316  LYS C CA  1 
ATOM   7913  C C   . LYS C 1 316 ? 48.972  36.750  50.985  1.00 47.36 ? 316  LYS C C   1 
ATOM   7914  O O   . LYS C 1 316 ? 48.097  36.546  51.839  1.00 47.26 ? 316  LYS C O   1 
ATOM   7915  C CB  . LYS C 1 316 ? 48.951  39.221  50.576  1.00 47.33 ? 316  LYS C CB  1 
ATOM   7916  C CG  . LYS C 1 316 ? 48.638  40.360  49.609  1.00 47.87 ? 316  LYS C CG  1 
ATOM   7917  C CD  . LYS C 1 316 ? 49.021  41.720  50.143  1.00 48.87 ? 316  LYS C CD  1 
ATOM   7918  C CE  . LYS C 1 316 ? 48.388  42.076  51.464  1.00 49.44 ? 316  LYS C CE  1 
ATOM   7919  N NZ  . LYS C 1 316 ? 49.282  41.743  52.603  1.00 49.63 ? 316  LYS C NZ  1 
ATOM   7920  N N   . LYS C 1 317 ? 50.102  36.076  50.923  1.00 47.58 ? 317  LYS C N   1 
ATOM   7921  C CA  . LYS C 1 317 ? 50.469  34.951  51.769  1.00 48.03 ? 317  LYS C CA  1 
ATOM   7922  C C   . LYS C 1 317 ? 50.451  35.256  53.257  1.00 47.80 ? 317  LYS C C   1 
ATOM   7923  O O   . LYS C 1 317 ? 50.403  34.330  54.096  1.00 47.73 ? 317  LYS C O   1 
ATOM   7924  C CB  . LYS C 1 317 ? 51.875  34.444  51.409  1.00 49.27 ? 317  LYS C CB  1 
ATOM   7925  C CG  . LYS C 1 317 ? 52.041  32.936  51.625  1.00 50.74 ? 317  LYS C CG  1 
ATOM   7926  C CD  . LYS C 1 317 ? 51.109  32.152  50.715  1.00 51.46 ? 317  LYS C CD  1 
ATOM   7927  C CE  . LYS C 1 317 ? 51.331  30.655  50.805  1.00 52.11 ? 317  LYS C CE  1 
ATOM   7928  N NZ  . LYS C 1 317 ? 50.576  29.968  49.720  1.00 52.63 ? 317  LYS C NZ  1 
ATOM   7929  N N   . GLU C 1 318 ? 50.499  36.532  53.583  1.00 47.67 ? 318  GLU C N   1 
ATOM   7930  C CA  . GLU C 1 318 ? 50.541  37.000  54.971  1.00 47.57 ? 318  GLU C CA  1 
ATOM   7931  C C   . GLU C 1 318 ? 49.145  37.146  55.562  1.00 46.88 ? 318  GLU C C   1 
ATOM   7932  O O   . GLU C 1 318 ? 48.997  37.296  56.784  1.00 46.54 ? 318  GLU C O   1 
ATOM   7933  C CB  . GLU C 1 318 ? 51.194  38.381  55.083  1.00 49.30 ? 318  GLU C CB  1 
ATOM   7934  C CG  . GLU C 1 318 ? 52.359  38.701  54.164  1.00 51.42 ? 318  GLU C CG  1 
ATOM   7935  C CD  . GLU C 1 318 ? 52.000  39.213  52.798  1.00 52.85 ? 318  GLU C CD  1 
ATOM   7936  O OE1 . GLU C 1 318 ? 51.227  40.138  52.602  1.00 53.82 ? 318  GLU C OE1 1 
ATOM   7937  O OE2 . GLU C 1 318 ? 52.596  38.587  51.894  1.00 53.34 ? 318  GLU C OE2 1 
ATOM   7938  N N   . ASN C 1 319 ? 48.173  37.125  54.666  1.00 46.18 ? 319  ASN C N   1 
ATOM   7939  C CA  . ASN C 1 319 ? 46.762  37.333  55.020  1.00 45.17 ? 319  ASN C CA  1 
ATOM   7940  C C   . ASN C 1 319 ? 46.034  35.998  55.173  1.00 44.30 ? 319  ASN C C   1 
ATOM   7941  O O   . ASN C 1 319 ? 44.812  35.998  55.394  1.00 44.37 ? 319  ASN C O   1 
ATOM   7942  C CB  . ASN C 1 319 ? 46.081  38.261  54.013  1.00 45.42 ? 319  ASN C CB  1 
ATOM   7943  C CG  . ASN C 1 319 ? 46.555  39.687  53.999  1.00 45.82 ? 319  ASN C CG  1 
ATOM   7944  O OD1 . ASN C 1 319 ? 46.437  40.381  52.965  1.00 46.15 ? 319  ASN C OD1 1 
ATOM   7945  N ND2 . ASN C 1 319 ? 47.083  40.173  55.118  1.00 46.15 ? 319  ASN C ND2 1 
ATOM   7946  N N   . ILE C 1 320 ? 46.777  34.915  55.060  1.00 43.45 ? 320  ILE C N   1 
ATOM   7947  C CA  . ILE C 1 320 ? 46.221  33.556  55.157  1.00 42.21 ? 320  ILE C CA  1 
ATOM   7948  C C   . ILE C 1 320 ? 45.388  33.395  56.423  1.00 41.45 ? 320  ILE C C   1 
ATOM   7949  O O   . ILE C 1 320 ? 44.194  33.034  56.361  1.00 41.39 ? 320  ILE C O   1 
ATOM   7950  C CB  . ILE C 1 320 ? 47.340  32.479  55.006  1.00 42.09 ? 320  ILE C CB  1 
ATOM   7951  C CG1 . ILE C 1 320 ? 47.931  32.535  53.575  1.00 42.57 ? 320  ILE C CG1 1 
ATOM   7952  C CG2 . ILE C 1 320 ? 46.840  31.052  55.353  1.00 42.08 ? 320  ILE C CG2 1 
ATOM   7953  C CD1 . ILE C 1 320 ? 49.076  31.510  53.319  1.00 42.78 ? 320  ILE C CD1 1 
ATOM   7954  N N   . ALA C 1 321 ? 46.013  33.660  57.548  1.00 40.32 ? 321  ALA C N   1 
ATOM   7955  C CA  . ALA C 1 321 ? 45.375  33.555  58.868  1.00 39.15 ? 321  ALA C CA  1 
ATOM   7956  C C   . ALA C 1 321 ? 44.104  34.395  58.917  1.00 38.21 ? 321  ALA C C   1 
ATOM   7957  O O   . ALA C 1 321 ? 43.076  33.944  59.456  1.00 38.24 ? 321  ALA C O   1 
ATOM   7958  C CB  . ALA C 1 321 ? 46.353  33.972  59.958  1.00 39.76 ? 321  ALA C CB  1 
ATOM   7959  N N   . ALA C 1 322 ? 44.201  35.590  58.368  1.00 37.13 ? 322  ALA C N   1 
ATOM   7960  C CA  . ALA C 1 322 ? 43.081  36.534  58.330  1.00 36.31 ? 322  ALA C CA  1 
ATOM   7961  C C   . ALA C 1 322 ? 41.881  35.937  57.594  1.00 35.85 ? 322  ALA C C   1 
ATOM   7962  O O   . ALA C 1 322 ? 40.762  35.915  58.131  1.00 35.78 ? 322  ALA C O   1 
ATOM   7963  C CB  . ALA C 1 322 ? 43.518  37.853  57.708  1.00 35.91 ? 322  ALA C CB  1 
ATOM   7964  N N   . GLY C 1 323 ? 42.130  35.472  56.382  1.00 35.29 ? 323  GLY C N   1 
ATOM   7965  C CA  . GLY C 1 323 ? 41.087  34.866  55.541  1.00 34.70 ? 323  GLY C CA  1 
ATOM   7966  C C   . GLY C 1 323 ? 40.429  33.715  56.305  1.00 34.35 ? 323  GLY C C   1 
ATOM   7967  O O   . GLY C 1 323 ? 39.192  33.657  56.409  1.00 34.51 ? 323  GLY C O   1 
ATOM   7968  N N   . GLN C 1 324 ? 41.264  32.847  56.837  1.00 33.68 ? 324  GLN C N   1 
ATOM   7969  C CA  . GLN C 1 324 ? 40.833  31.659  57.583  1.00 33.31 ? 324  GLN C CA  1 
ATOM   7970  C C   . GLN C 1 324 ? 39.930  32.041  58.754  1.00 33.34 ? 324  GLN C C   1 
ATOM   7971  O O   . GLN C 1 324 ? 38.979  31.309  59.076  1.00 33.03 ? 324  GLN C O   1 
ATOM   7972  C CB  . GLN C 1 324 ? 42.000  30.780  58.025  1.00 32.37 ? 324  GLN C CB  1 
ATOM   7973  C CG  . GLN C 1 324 ? 42.805  30.208  56.861  1.00 32.13 ? 324  GLN C CG  1 
ATOM   7974  C CD  . GLN C 1 324 ? 43.916  29.302  57.326  1.00 31.35 ? 324  GLN C CD  1 
ATOM   7975  O OE1 . GLN C 1 324 ? 44.506  29.510  58.386  1.00 32.36 ? 324  GLN C OE1 1 
ATOM   7976  N NE2 . GLN C 1 324 ? 44.201  28.263  56.555  1.00 30.55 ? 324  GLN C NE2 1 
ATOM   7977  N N   . ASN C 1 325 ? 40.240  33.167  59.368  1.00 33.35 ? 325  ASN C N   1 
ATOM   7978  C CA  . ASN C 1 325 ? 39.463  33.671  60.512  1.00 33.38 ? 325  ASN C CA  1 
ATOM   7979  C C   . ASN C 1 325 ? 38.062  34.104  60.090  1.00 32.75 ? 325  ASN C C   1 
ATOM   7980  O O   . ASN C 1 325 ? 37.104  33.935  60.873  1.00 32.78 ? 325  ASN C O   1 
ATOM   7981  C CB  . ASN C 1 325 ? 40.233  34.750  61.278  1.00 35.91 ? 325  ASN C CB  1 
ATOM   7982  C CG  . ASN C 1 325 ? 41.006  34.115  62.430  1.00 37.78 ? 325  ASN C CG  1 
ATOM   7983  O OD1 . ASN C 1 325 ? 40.486  34.048  63.560  1.00 39.26 ? 325  ASN C OD1 1 
ATOM   7984  N ND2 . ASN C 1 325 ? 42.213  33.637  62.131  1.00 38.81 ? 325  ASN C ND2 1 
ATOM   7985  N N   . GLU C 1 326 ? 37.969  34.659  58.902  1.00 31.97 ? 326  GLU C N   1 
ATOM   7986  C CA  . GLU C 1 326 ? 36.691  35.125  58.352  1.00 31.11 ? 326  GLU C CA  1 
ATOM   7987  C C   . GLU C 1 326 ? 35.775  33.937  58.069  1.00 30.10 ? 326  GLU C C   1 
ATOM   7988  O O   . GLU C 1 326 ? 34.555  34.027  58.297  1.00 30.60 ? 326  GLU C O   1 
ATOM   7989  C CB  . GLU C 1 326 ? 36.867  35.916  57.069  1.00 32.84 ? 326  GLU C CB  1 
ATOM   7990  C CG  . GLU C 1 326 ? 37.511  37.297  57.173  1.00 34.25 ? 326  GLU C CG  1 
ATOM   7991  C CD  . GLU C 1 326 ? 36.845  38.222  58.153  1.00 35.93 ? 326  GLU C CD  1 
ATOM   7992  O OE1 . GLU C 1 326 ? 35.638  38.409  58.208  1.00 35.97 ? 326  GLU C OE1 1 
ATOM   7993  O OE2 . GLU C 1 326 ? 37.680  38.770  58.909  1.00 36.19 ? 326  GLU C OE2 1 
ATOM   7994  N N   . LEU C 1 327 ? 36.368  32.868  57.597  1.00 28.76 ? 327  LEU C N   1 
ATOM   7995  C CA  . LEU C 1 327 ? 35.687  31.607  57.296  1.00 27.57 ? 327  LEU C CA  1 
ATOM   7996  C C   . LEU C 1 327 ? 35.115  30.999  58.576  1.00 27.04 ? 327  LEU C C   1 
ATOM   7997  O O   . LEU C 1 327 ? 33.958  30.562  58.597  1.00 26.51 ? 327  LEU C O   1 
ATOM   7998  C CB  . LEU C 1 327 ? 36.679  30.676  56.583  1.00 27.23 ? 327  LEU C CB  1 
ATOM   7999  C CG  . LEU C 1 327 ? 36.201  29.249  56.331  1.00 26.65 ? 327  LEU C CG  1 
ATOM   8000  C CD1 . LEU C 1 327 ? 34.908  29.256  55.521  1.00 26.73 ? 327  LEU C CD1 1 
ATOM   8001  C CD2 . LEU C 1 327 ? 37.283  28.502  55.561  1.00 27.08 ? 327  LEU C CD2 1 
ATOM   8002  N N   . LEU C 1 328 ? 35.965  30.964  59.596  1.00 25.88 ? 328  LEU C N   1 
ATOM   8003  C CA  . LEU C 1 328 ? 35.583  30.430  60.903  1.00 25.25 ? 328  LEU C CA  1 
ATOM   8004  C C   . LEU C 1 328 ? 34.421  31.222  61.486  1.00 24.74 ? 328  LEU C C   1 
ATOM   8005  O O   . LEU C 1 328 ? 33.465  30.621  62.013  1.00 25.14 ? 328  LEU C O   1 
ATOM   8006  C CB  . LEU C 1 328 ? 36.826  30.381  61.805  1.00 23.92 ? 328  LEU C CB  1 
ATOM   8007  C CG  . LEU C 1 328 ? 37.879  29.336  61.472  1.00 23.54 ? 328  LEU C CG  1 
ATOM   8008  C CD1 . LEU C 1 328 ? 39.173  29.596  62.236  1.00 24.55 ? 328  LEU C CD1 1 
ATOM   8009  C CD2 . LEU C 1 328 ? 37.333  27.951  61.819  1.00 22.56 ? 328  LEU C CD2 1 
ATOM   8010  N N   . LYS C 1 329 ? 34.500  32.532  61.408  1.00 24.76 ? 329  LYS C N   1 
ATOM   8011  C CA  . LYS C 1 329 ? 33.450  33.402  61.944  1.00 24.73 ? 329  LYS C CA  1 
ATOM   8012  C C   . LYS C 1 329 ? 32.111  33.138  61.248  1.00 24.47 ? 329  LYS C C   1 
ATOM   8013  O O   . LYS C 1 329 ? 31.076  33.020  61.923  1.00 23.76 ? 329  LYS C O   1 
ATOM   8014  C CB  . LYS C 1 329 ? 33.782  34.880  61.790  1.00 27.32 ? 329  LYS C CB  1 
ATOM   8015  C CG  . LYS C 1 329 ? 34.492  35.518  62.979  1.00 30.67 ? 329  LYS C CG  1 
ATOM   8016  C CD  . LYS C 1 329 ? 34.979  36.916  62.631  1.00 32.83 ? 329  LYS C CD  1 
ATOM   8017  C CE  . LYS C 1 329 ? 33.859  37.784  62.080  1.00 34.12 ? 329  LYS C CE  1 
ATOM   8018  N NZ  . LYS C 1 329 ? 34.388  39.137  61.729  1.00 35.18 ? 329  LYS C NZ  1 
ATOM   8019  N N   . ARG C 1 330 ? 32.166  33.075  59.923  1.00 24.08 ? 330  ARG C N   1 
ATOM   8020  C CA  . ARG C 1 330 ? 30.965  32.902  59.097  1.00 23.83 ? 330  ARG C CA  1 
ATOM   8021  C C   . ARG C 1 330 ? 30.357  31.520  59.261  1.00 23.25 ? 330  ARG C C   1 
ATOM   8022  O O   . ARG C 1 330 ? 29.114  31.412  59.201  1.00 23.89 ? 330  ARG C O   1 
ATOM   8023  C CB  . ARG C 1 330 ? 31.193  33.199  57.615  1.00 25.63 ? 330  ARG C CB  1 
ATOM   8024  C CG  . ARG C 1 330 ? 30.586  34.513  57.144  1.00 27.43 ? 330  ARG C CG  1 
ATOM   8025  C CD  . ARG C 1 330 ? 29.159  34.664  57.615  1.00 28.33 ? 330  ARG C CD  1 
ATOM   8026  N NE  . ARG C 1 330 ? 28.954  35.972  58.153  1.00 29.15 ? 330  ARG C NE  1 
ATOM   8027  C CZ  . ARG C 1 330 ? 27.951  36.604  58.701  1.00 30.23 ? 330  ARG C CZ  1 
ATOM   8028  N NH1 . ARG C 1 330 ? 26.735  36.118  58.902  1.00 29.75 ? 330  ARG C NH1 1 
ATOM   8029  N NH2 . ARG C 1 330 ? 28.177  37.868  59.125  1.00 31.62 ? 330  ARG C NH2 1 
ATOM   8030  N N   . ALA C 1 331 ? 31.190  30.524  59.444  1.00 22.01 ? 331  ALA C N   1 
ATOM   8031  C CA  . ALA C 1 331 ? 30.746  29.138  59.603  1.00 21.46 ? 331  ALA C CA  1 
ATOM   8032  C C   . ALA C 1 331 ? 30.033  28.965  60.944  1.00 21.65 ? 331  ALA C C   1 
ATOM   8033  O O   . ALA C 1 331 ? 29.003  28.288  61.069  1.00 20.51 ? 331  ALA C O   1 
ATOM   8034  C CB  . ALA C 1 331 ? 31.919  28.194  59.403  1.00 20.77 ? 331  ALA C CB  1 
ATOM   8035  N N   . LYS C 1 332 ? 30.593  29.618  61.951  1.00 22.37 ? 332  LYS C N   1 
ATOM   8036  C CA  . LYS C 1 332 ? 30.041  29.641  63.305  1.00 22.39 ? 332  LYS C CA  1 
ATOM   8037  C C   . LYS C 1 332 ? 28.642  30.250  63.333  1.00 21.45 ? 332  LYS C C   1 
ATOM   8038  O O   . LYS C 1 332 ? 27.732  29.680  63.951  1.00 21.58 ? 332  LYS C O   1 
ATOM   8039  C CB  . LYS C 1 332 ? 30.916  30.457  64.265  1.00 25.07 ? 332  LYS C CB  1 
ATOM   8040  C CG  . LYS C 1 332 ? 30.347  30.506  65.693  1.00 27.05 ? 332  LYS C CG  1 
ATOM   8041  C CD  . LYS C 1 332 ? 30.360  29.107  66.307  1.00 30.04 ? 332  LYS C CD  1 
ATOM   8042  C CE  . LYS C 1 332 ? 29.961  29.135  67.775  1.00 31.59 ? 332  LYS C CE  1 
ATOM   8043  N NZ  . LYS C 1 332 ? 29.551  27.729  68.204  1.00 33.62 ? 332  LYS C NZ  1 
ATOM   8044  N N   . ALA C 1 333 ? 28.530  31.406  62.722  1.00 21.03 ? 333  ALA C N   1 
ATOM   8045  C CA  . ALA C 1 333 ? 27.288  32.174  62.652  1.00 20.15 ? 333  ALA C CA  1 
ATOM   8046  C C   . ALA C 1 333 ? 26.211  31.399  61.895  1.00 19.62 ? 333  ALA C C   1 
ATOM   8047  O O   . ALA C 1 333 ? 25.041  31.437  62.312  1.00 19.10 ? 333  ALA C O   1 
ATOM   8048  C CB  . ALA C 1 333 ? 27.517  33.534  62.007  1.00 20.93 ? 333  ALA C CB  1 
ATOM   8049  N N   . ASN C 1 334 ? 26.634  30.732  60.830  1.00 18.93 ? 334  ASN C N   1 
ATOM   8050  C CA  . ASN C 1 334 ? 25.697  29.913  60.034  1.00 18.60 ? 334  ASN C CA  1 
ATOM   8051  C C   . ASN C 1 334 ? 25.326  28.638  60.778  1.00 19.07 ? 334  ASN C C   1 
ATOM   8052  O O   . ASN C 1 334 ? 24.173  28.176  60.645  1.00 19.71 ? 334  ASN C O   1 
ATOM   8053  C CB  . ASN C 1 334 ? 26.207  29.693  58.611  1.00 17.73 ? 334  ASN C CB  1 
ATOM   8054  C CG  . ASN C 1 334 ? 25.958  30.923  57.763  1.00 15.70 ? 334  ASN C CG  1 
ATOM   8055  O OD1 . ASN C 1 334 ? 24.836  31.450  57.741  1.00 17.02 ? 334  ASN C OD1 1 
ATOM   8056  N ND2 . ASN C 1 334 ? 27.013  31.416  57.125  1.00 15.81 ? 334  ASN C ND2 1 
ATOM   8057  N N   . GLY C 1 335 ? 26.256  28.106  61.547  1.00 18.53 ? 335  GLY C N   1 
ATOM   8058  C CA  . GLY C 1 335 ? 25.993  26.919  62.380  1.00 19.58 ? 335  GLY C CA  1 
ATOM   8059  C C   . GLY C 1 335 ? 24.899  27.270  63.401  1.00 20.32 ? 335  GLY C C   1 
ATOM   8060  O O   . GLY C 1 335 ? 23.968  26.479  63.622  1.00 20.44 ? 335  GLY C O   1 
ATOM   8061  N N   . ASP C 1 336 ? 25.059  28.447  63.985  1.00 20.52 ? 336  ASP C N   1 
ATOM   8062  C CA  . ASP C 1 336 ? 24.100  29.003  64.946  1.00 21.15 ? 336  ASP C CA  1 
ATOM   8063  C C   . ASP C 1 336 ? 22.722  29.180  64.295  1.00 21.00 ? 336  ASP C C   1 
ATOM   8064  O O   . ASP C 1 336 ? 21.694  28.805  64.882  1.00 21.36 ? 336  ASP C O   1 
ATOM   8065  C CB  . ASP C 1 336 ? 24.649  30.291  65.565  1.00 22.45 ? 336  ASP C CB  1 
ATOM   8066  C CG  . ASP C 1 336 ? 25.794  29.989  66.539  1.00 24.09 ? 336  ASP C CG  1 
ATOM   8067  O OD1 . ASP C 1 336 ? 25.899  28.871  67.059  1.00 23.56 ? 336  ASP C OD1 1 
ATOM   8068  O OD2 . ASP C 1 336 ? 26.586  30.937  66.722  1.00 25.95 ? 336  ASP C OD2 1 
ATOM   8069  N N   . ALA C 1 337 ? 22.743  29.773  63.125  1.00 20.62 ? 337  ALA C N   1 
ATOM   8070  C CA  . ALA C 1 337 ? 21.540  30.017  62.305  1.00 20.17 ? 337  ALA C CA  1 
ATOM   8071  C C   . ALA C 1 337 ? 20.815  28.704  62.034  1.00 19.96 ? 337  ALA C C   1 
ATOM   8072  O O   . ALA C 1 337 ? 19.572  28.659  62.104  1.00 20.11 ? 337  ALA C O   1 
ATOM   8073  C CB  . ALA C 1 337 ? 21.927  30.742  61.027  1.00 18.54 ? 337  ALA C CB  1 
ATOM   8074  N N   . ALA C 1 338 ? 21.586  27.673  61.763  1.00 19.88 ? 338  ALA C N   1 
ATOM   8075  C CA  . ALA C 1 338 ? 21.097  26.326  61.486  1.00 20.69 ? 338  ALA C CA  1 
ATOM   8076  C C   . ALA C 1 338 ? 20.336  25.763  62.693  1.00 21.22 ? 338  ALA C C   1 
ATOM   8077  O O   . ALA C 1 338 ? 19.679  24.718  62.589  1.00 20.72 ? 338  ALA C O   1 
ATOM   8078  C CB  . ALA C 1 338 ? 22.239  25.388  61.117  1.00 20.63 ? 338  ALA C CB  1 
ATOM   8079  N N   . GLN C 1 339 ? 20.447  26.486  63.791  1.00 21.89 ? 339  GLN C N   1 
ATOM   8080  C CA  . GLN C 1 339 ? 19.818  26.104  65.059  1.00 22.35 ? 339  GLN C CA  1 
ATOM   8081  C C   . GLN C 1 339 ? 18.819  27.156  65.530  1.00 22.71 ? 339  GLN C C   1 
ATOM   8082  O O   . GLN C 1 339 ? 18.218  26.975  66.611  1.00 23.26 ? 339  GLN C O   1 
ATOM   8083  C CB  . GLN C 1 339 ? 20.878  25.850  66.154  1.00 23.82 ? 339  GLN C CB  1 
ATOM   8084  C CG  . GLN C 1 339 ? 21.673  24.596  65.872  1.00 25.35 ? 339  GLN C CG  1 
ATOM   8085  C CD  . GLN C 1 339 ? 22.791  24.326  66.843  1.00 26.76 ? 339  GLN C CD  1 
ATOM   8086  O OE1 . GLN C 1 339 ? 22.739  23.375  67.615  1.00 27.90 ? 339  GLN C OE1 1 
ATOM   8087  N NE2 . GLN C 1 339 ? 23.822  25.166  66.766  1.00 26.57 ? 339  GLN C NE2 1 
ATOM   8088  N N   . GLY C 1 340 ? 18.680  28.214  64.773  1.00 22.75 ? 340  GLY C N   1 
ATOM   8089  C CA  . GLY C 1 340 ? 17.798  29.333  65.055  1.00 23.29 ? 340  GLY C CA  1 
ATOM   8090  C C   . GLY C 1 340 ? 18.340  30.231  66.162  1.00 24.27 ? 340  GLY C C   1 
ATOM   8091  O O   . GLY C 1 340 ? 17.576  31.037  66.733  1.00 24.01 ? 340  GLY C O   1 
ATOM   8092  N N   . LYS C 1 341 ? 19.635  30.125  66.428  1.00 25.22 ? 341  LYS C N   1 
ATOM   8093  C CA  . LYS C 1 341 ? 20.243  30.878  67.540  1.00 26.66 ? 341  LYS C CA  1 
ATOM   8094  C C   . LYS C 1 341 ? 21.166  32.006  67.152  1.00 27.17 ? 341  LYS C C   1 
ATOM   8095  O O   . LYS C 1 341 ? 22.027  32.368  67.999  1.00 27.10 ? 341  LYS C O   1 
ATOM   8096  C CB  . LYS C 1 341 ? 21.030  29.915  68.444  1.00 27.78 ? 341  LYS C CB  1 
ATOM   8097  C CG  . LYS C 1 341 ? 20.145  28.916  69.194  1.00 30.27 ? 341  LYS C CG  1 
ATOM   8098  C CD  . LYS C 1 341 ? 20.975  28.065  70.148  1.00 32.53 ? 341  LYS C CD  1 
ATOM   8099  C CE  . LYS C 1 341 ? 21.961  27.179  69.412  1.00 33.82 ? 341  LYS C CE  1 
ATOM   8100  N NZ  . LYS C 1 341 ? 23.000  26.677  70.350  1.00 34.72 ? 341  LYS C NZ  1 
ATOM   8101  N N   . TYR C 1 342 ? 21.048  32.583  65.970  1.00 27.79 ? 342  TYR C N   1 
ATOM   8102  C CA  . TYR C 1 342 ? 21.958  33.638  65.536  1.00 28.79 ? 342  TYR C CA  1 
ATOM   8103  C C   . TYR C 1 342 ? 21.479  35.027  65.958  1.00 30.48 ? 342  TYR C C   1 
ATOM   8104  O O   . TYR C 1 342 ? 20.333  35.428  65.708  1.00 30.90 ? 342  TYR C O   1 
ATOM   8105  C CB  . TYR C 1 342 ? 22.239  33.632  64.021  1.00 25.76 ? 342  TYR C CB  1 
ATOM   8106  C CG  . TYR C 1 342 ? 23.166  34.750  63.583  1.00 23.35 ? 342  TYR C CG  1 
ATOM   8107  C CD1 . TYR C 1 342 ? 24.527  34.686  63.902  1.00 23.18 ? 342  TYR C CD1 1 
ATOM   8108  C CD2 . TYR C 1 342 ? 22.721  35.852  62.866  1.00 22.70 ? 342  TYR C CD2 1 
ATOM   8109  C CE1 . TYR C 1 342 ? 25.409  35.686  63.512  1.00 22.93 ? 342  TYR C CE1 1 
ATOM   8110  C CE2 . TYR C 1 342 ? 23.586  36.868  62.465  1.00 23.09 ? 342  TYR C CE2 1 
ATOM   8111  C CZ  . TYR C 1 342 ? 24.940  36.771  62.791  1.00 23.37 ? 342  TYR C CZ  1 
ATOM   8112  O OH  . TYR C 1 342 ? 25.784  37.770  62.388  1.00 23.95 ? 342  TYR C OH  1 
ATOM   8113  N N   . VAL C 1 343 ? 22.412  35.736  66.580  1.00 32.17 ? 343  VAL C N   1 
ATOM   8114  C CA  . VAL C 1 343 ? 22.176  37.124  67.025  1.00 33.97 ? 343  VAL C CA  1 
ATOM   8115  C C   . VAL C 1 343 ? 22.607  38.069  65.902  1.00 35.23 ? 343  VAL C C   1 
ATOM   8116  O O   . VAL C 1 343 ? 23.815  38.226  65.666  1.00 35.57 ? 343  VAL C O   1 
ATOM   8117  C CB  . VAL C 1 343 ? 22.906  37.388  68.351  1.00 34.46 ? 343  VAL C CB  1 
ATOM   8118  C CG1 . VAL C 1 343 ? 22.614  38.775  68.916  1.00 34.74 ? 343  VAL C CG1 1 
ATOM   8119  C CG2 . VAL C 1 343 ? 22.613  36.306  69.382  1.00 34.58 ? 343  VAL C CG2 1 
ATOM   8120  N N   . ALA C 1 344 ? 21.621  38.660  65.266  1.00 36.48 ? 345  ALA C N   1 
ATOM   8121  C CA  . ALA C 1 344 ? 21.809  39.568  64.138  1.00 38.31 ? 345  ALA C CA  1 
ATOM   8122  C C   . ALA C 1 344 ? 22.965  40.534  64.358  1.00 39.83 ? 345  ALA C C   1 
ATOM   8123  O O   . ALA C 1 344 ? 23.020  41.268  65.361  1.00 40.37 ? 345  ALA C O   1 
ATOM   8124  C CB  . ALA C 1 344 ? 20.513  40.333  63.861  1.00 38.17 ? 345  ALA C CB  1 
ATOM   8125  N N   . GLY C 1 345 ? 23.875  40.533  63.400  1.00 40.99 ? 346  GLY C N   1 
ATOM   8126  C CA  . GLY C 1 345 ? 25.010  41.442  63.352  1.00 42.47 ? 346  GLY C CA  1 
ATOM   8127  C C   . GLY C 1 345 ? 26.145  41.075  64.289  1.00 43.53 ? 346  GLY C C   1 
ATOM   8128  O O   . GLY C 1 345 ? 27.079  41.888  64.470  1.00 43.78 ? 346  GLY C O   1 
ATOM   8129  N N   . SER C 1 346 ? 26.093  39.881  64.847  1.00 44.48 ? 347  SER C N   1 
ATOM   8130  C CA  . SER C 1 346 ? 27.111  39.414  65.794  1.00 45.83 ? 347  SER C CA  1 
ATOM   8131  C C   . SER C 1 346 ? 28.364  38.907  65.097  1.00 46.86 ? 347  SER C C   1 
ATOM   8132  O O   . SER C 1 346 ? 29.399  38.694  65.767  1.00 47.05 ? 347  SER C O   1 
ATOM   8133  C CB  . SER C 1 346 ? 26.548  38.367  66.746  1.00 45.54 ? 347  SER C CB  1 
ATOM   8134  O OG  . SER C 1 346 ? 26.572  37.069  66.194  1.00 45.74 ? 347  SER C OG  1 
ATOM   8135  N N   . ALA C 1 347 ? 28.290  38.735  63.789  1.00 47.84 ? 348  ALA C N   1 
ATOM   8136  C CA  . ALA C 1 347 ? 29.399  38.173  63.007  1.00 48.96 ? 348  ALA C CA  1 
ATOM   8137  C C   . ALA C 1 347 ? 30.121  39.206  62.165  1.00 50.09 ? 348  ALA C C   1 
ATOM   8138  O O   . ALA C 1 347 ? 31.054  38.840  61.409  1.00 50.27 ? 348  ALA C O   1 
ATOM   8139  C CB  . ALA C 1 347 ? 28.899  37.006  62.159  1.00 48.67 ? 348  ALA C CB  1 
ATOM   8140  N N   . GLY C 1 348 ? 29.711  40.456  62.270  1.00 51.14 ? 349  GLY C N   1 
ATOM   8141  C CA  . GLY C 1 348 ? 30.392  41.548  61.562  1.00 52.69 ? 349  GLY C CA  1 
ATOM   8142  C C   . GLY C 1 348 ? 29.402  42.436  60.819  1.00 53.87 ? 349  GLY C C   1 
ATOM   8143  O O   . GLY C 1 348 ? 28.579  43.125  61.437  1.00 54.20 ? 349  GLY C O   1 
ATOM   8144  N N   . ALA C 1 349 ? 29.531  42.395  59.506  1.00 54.80 ? 351  ALA C N   1 
ATOM   8145  C CA  . ALA C 1 349 ? 28.694  43.166  58.576  1.00 55.80 ? 351  ALA C CA  1 
ATOM   8146  C C   . ALA C 1 349 ? 28.458  42.326  57.317  1.00 56.42 ? 351  ALA C C   1 
ATOM   8147  O O   . ALA C 1 349 ? 27.326  42.172  56.840  1.00 56.39 ? 351  ALA C O   1 
ATOM   8148  C CB  . ALA C 1 349 ? 29.364  44.491  58.234  1.00 55.73 ? 351  ALA C CB  1 
ATOM   8149  N N   . GLY C 1 350 ? 29.572  41.810  56.826  1.00 57.17 ? 352  GLY C N   1 
ATOM   8150  C CA  . GLY C 1 350 ? 29.596  40.950  55.638  1.00 58.15 ? 352  GLY C CA  1 
ATOM   8151  C C   . GLY C 1 350 ? 29.642  41.833  54.388  1.00 59.05 ? 352  GLY C C   1 
ATOM   8152  O O   . GLY C 1 350 ? 29.572  43.067  54.472  1.00 59.13 ? 352  GLY C O   1 
ATOM   8153  N N   . SER C 1 351 ? 29.777  41.158  53.263  1.00 59.84 ? 353  SER C N   1 
ATOM   8154  C CA  . SER C 1 351 ? 29.756  41.776  51.936  1.00 60.71 ? 353  SER C CA  1 
ATOM   8155  C C   . SER C 1 351 ? 28.447  42.554  51.756  1.00 61.36 ? 353  SER C C   1 
ATOM   8156  O O   . SER C 1 351 ? 27.604  42.615  52.666  1.00 61.45 ? 353  SER C O   1 
ATOM   8157  C CB  . SER C 1 351 ? 29.871  40.694  50.861  1.00 60.94 ? 353  SER C CB  1 
ATOM   8158  O OG  . SER C 1 351 ? 28.856  39.713  51.040  1.00 60.92 ? 353  SER C OG  1 
ATOM   8159  N N   . GLY C 1 352 ? 28.304  43.101  50.568  1.00 62.00 ? 354  GLY C N   1 
ATOM   8160  C CA  . GLY C 1 352 ? 27.156  43.909  50.180  1.00 62.86 ? 354  GLY C CA  1 
ATOM   8161  C C   . GLY C 1 352 ? 26.034  43.117  49.527  1.00 63.33 ? 354  GLY C C   1 
ATOM   8162  O O   . GLY C 1 352 ? 25.024  42.784  50.173  1.00 63.48 ? 354  GLY C O   1 
ATOM   8163  N N   . SER C 1 353 ? 26.187  42.887  48.236  1.00 63.79 ? 355  SER C N   1 
ATOM   8164  C CA  . SER C 1 353 ? 25.263  42.041  47.455  1.00 64.25 ? 355  SER C CA  1 
ATOM   8165  C C   . SER C 1 353 ? 26.125  41.150  46.555  1.00 64.52 ? 355  SER C C   1 
ATOM   8166  O O   . SER C 1 353 ? 26.937  41.660  45.770  1.00 64.58 ? 355  SER C O   1 
ATOM   8167  C CB  . SER C 1 353 ? 24.260  42.852  46.667  1.00 64.72 ? 355  SER C CB  1 
ATOM   8168  O OG  . SER C 1 353 ? 23.530  43.750  47.490  1.00 65.18 ? 355  SER C OG  1 
ATOM   8169  N N   . LEU C 1 354 ? 25.930  39.854  46.715  1.00 64.75 ? 356  LEU C N   1 
ATOM   8170  C CA  . LEU C 1 354 ? 26.701  38.839  45.979  1.00 65.21 ? 356  LEU C CA  1 
ATOM   8171  C C   . LEU C 1 354 ? 25.930  38.375  44.748  1.00 65.64 ? 356  LEU C C   1 
ATOM   8172  O O   . LEU C 1 354 ? 26.186  37.291  44.201  1.00 65.52 ? 356  LEU C O   1 
ATOM   8173  C CB  . LEU C 1 354 ? 26.975  37.705  46.984  1.00 64.49 ? 356  LEU C CB  1 
ATOM   8174  C CG  . LEU C 1 354 ? 27.496  38.118  48.352  1.00 64.40 ? 356  LEU C CG  1 
ATOM   8175  C CD1 . LEU C 1 354 ? 27.267  37.018  49.380  1.00 63.73 ? 356  LEU C CD1 1 
ATOM   8176  C CD2 . LEU C 1 354 ? 28.989  38.422  48.227  1.00 64.09 ? 356  LEU C CD2 1 
ATOM   8177  N N   . PHE C 1 355 ? 24.993  39.215  44.347  1.00 66.28 ? 357  PHE C N   1 
ATOM   8178  C CA  . PHE C 1 355 ? 24.097  38.923  43.229  1.00 67.21 ? 357  PHE C CA  1 
ATOM   8179  C C   . PHE C 1 355 ? 24.774  39.180  41.879  1.00 68.16 ? 357  PHE C C   1 
ATOM   8180  O O   . PHE C 1 355 ? 25.288  40.263  41.588  1.00 68.07 ? 357  PHE C O   1 
ATOM   8181  C CB  . PHE C 1 355 ? 22.759  39.659  43.333  1.00 66.43 ? 357  PHE C CB  1 
ATOM   8182  C CG  . PHE C 1 355 ? 21.860  39.485  42.143  1.00 65.97 ? 357  PHE C CG  1 
ATOM   8183  C CD1 . PHE C 1 355 ? 20.975  38.407  42.088  1.00 65.70 ? 357  PHE C CD1 1 
ATOM   8184  C CD2 . PHE C 1 355 ? 21.908  40.388  41.082  1.00 65.75 ? 357  PHE C CD2 1 
ATOM   8185  C CE1 . PHE C 1 355 ? 20.138  38.226  40.993  1.00 65.44 ? 357  PHE C CE1 1 
ATOM   8186  C CE2 . PHE C 1 355 ? 21.076  40.222  39.965  1.00 65.78 ? 357  PHE C CE2 1 
ATOM   8187  C CZ  . PHE C 1 355 ? 20.190  39.131  39.931  1.00 65.36 ? 357  PHE C CZ  1 
ATOM   8188  N N   . VAL C 1 356 ? 24.732  38.118  41.094  1.00 69.32 ? 358  VAL C N   1 
ATOM   8189  C CA  . VAL C 1 356 ? 25.142  38.122  39.680  1.00 70.65 ? 358  VAL C CA  1 
ATOM   8190  C C   . VAL C 1 356 ? 23.940  37.611  38.867  1.00 71.73 ? 358  VAL C C   1 
ATOM   8191  O O   . VAL C 1 356 ? 23.488  36.476  39.074  1.00 71.61 ? 358  VAL C O   1 
ATOM   8192  C CB  . VAL C 1 356 ? 26.415  37.291  39.472  1.00 70.54 ? 358  VAL C CB  1 
ATOM   8193  C CG1 . VAL C 1 356 ? 26.965  37.410  38.053  1.00 70.46 ? 358  VAL C CG1 1 
ATOM   8194  C CG2 . VAL C 1 356 ? 27.493  37.611  40.493  1.00 70.56 ? 358  VAL C CG2 1 
ATOM   8195  N N   . ALA C 1 357 ? 23.458  38.472  37.993  1.00 73.03 ? 359  ALA C N   1 
ATOM   8196  C CA  . ALA C 1 357 ? 22.305  38.167  37.131  1.00 74.68 ? 359  ALA C CA  1 
ATOM   8197  C C   . ALA C 1 357 ? 22.756  37.317  35.948  1.00 75.99 ? 359  ALA C C   1 
ATOM   8198  O O   . ALA C 1 357 ? 23.833  37.574  35.381  1.00 76.13 ? 359  ALA C O   1 
ATOM   8199  C CB  . ALA C 1 357 ? 21.656  39.463  36.658  1.00 74.29 ? 359  ALA C CB  1 
ATOM   8200  N N   . ASN C 1 358 ? 21.944  36.331  35.616  1.00 77.42 ? 360  ASN C N   1 
ATOM   8201  C CA  . ASN C 1 358 ? 22.170  35.462  34.455  1.00 79.06 ? 360  ASN C CA  1 
ATOM   8202  C C   . ASN C 1 358 ? 22.767  34.115  34.860  1.00 80.16 ? 360  ASN C C   1 
ATOM   8203  O O   . ASN C 1 358 ? 24.003  33.955  34.825  1.00 80.29 ? 360  ASN C O   1 
ATOM   8204  C CB  . ASN C 1 358 ? 23.030  36.164  33.395  1.00 79.85 ? 360  ASN C CB  1 
ATOM   8205  C CG  . ASN C 1 358 ? 22.229  36.951  32.381  1.00 80.36 ? 360  ASN C CG  1 
ATOM   8206  O OD1 . ASN C 1 358 ? 21.722  36.375  31.405  1.00 80.65 ? 360  ASN C OD1 1 
ATOM   8207  N ND2 . ASN C 1 358 ? 22.114  38.263  32.601  1.00 80.58 ? 360  ASN C ND2 1 
ATOM   8208  N N   . HIS C 1 359 ? 21.892  33.180  35.173  1.00 81.24 ? 361  HIS C N   1 
ATOM   8209  C CA  . HIS C 1 359 ? 22.322  31.839  35.611  1.00 82.45 ? 361  HIS C CA  1 
ATOM   8210  C C   . HIS C 1 359 ? 22.207  30.822  34.484  1.00 83.04 ? 361  HIS C C   1 
ATOM   8211  O O   . HIS C 1 359 ? 23.197  30.158  34.125  1.00 83.03 ? 361  HIS C O   1 
ATOM   8212  C CB  . HIS C 1 359 ? 21.569  31.357  36.867  1.00 83.77 ? 361  HIS C CB  1 
ATOM   8213  C CG  . HIS C 1 359 ? 21.506  32.408  37.941  1.00 84.80 ? 361  HIS C CG  1 
ATOM   8214  N ND1 . HIS C 1 359 ? 22.343  32.458  39.026  1.00 85.10 ? 361  HIS C ND1 1 
ATOM   8215  C CD2 . HIS C 1 359 ? 20.659  33.463  38.069  1.00 85.15 ? 361  HIS C CD2 1 
ATOM   8216  C CE1 . HIS C 1 359 ? 22.013  33.500  39.775  1.00 85.35 ? 361  HIS C CE1 1 
ATOM   8217  N NE2 . HIS C 1 359 ? 20.996  34.122  39.222  1.00 85.29 ? 361  HIS C NE2 1 
ATOM   8218  N N   . ALA C 1 360 ? 21.010  30.711  33.936  1.00 83.67 ? 362  ALA C N   1 
ATOM   8219  C CA  . ALA C 1 360 ? 20.711  29.805  32.819  1.00 84.28 ? 362  ALA C CA  1 
ATOM   8220  C C   . ALA C 1 360 ? 21.069  30.478  31.493  1.00 84.76 ? 362  ALA C C   1 
ATOM   8221  O O   . ALA C 1 360 ? 20.597  31.586  31.197  1.00 84.92 ? 362  ALA C O   1 
ATOM   8222  C CB  . ALA C 1 360 ? 19.245  29.402  32.847  1.00 84.30 ? 362  ALA C CB  1 
ATOM   8223  N N   . TYR C 1 361 ? 21.881  29.777  30.722  1.00 85.15 ? 363  TYR C N   1 
ATOM   8224  C CA  . TYR C 1 361 ? 22.388  30.259  29.430  1.00 85.50 ? 363  TYR C CA  1 
ATOM   8225  C C   . TYR C 1 361 ? 23.722  30.993  29.663  1.00 85.71 ? 363  TYR C C   1 
ATOM   8226  O O   . TYR C 1 361 ? 24.697  30.555  29.017  1.00 85.90 ? 363  TYR C O   1 
ATOM   8227  C CB  . TYR C 1 361 ? 21.409  31.170  28.704  1.00 85.88 ? 363  TYR C CB  1 
ATOM   8228  C CG  . TYR C 1 361 ? 20.232  30.562  28.000  1.00 86.02 ? 363  TYR C CG  1 
ATOM   8229  C CD1 . TYR C 1 361 ? 19.061  30.221  28.684  1.00 86.01 ? 363  TYR C CD1 1 
ATOM   8230  C CD2 . TYR C 1 361 ? 20.256  30.364  26.617  1.00 86.06 ? 363  TYR C CD2 1 
ATOM   8231  C CE1 . TYR C 1 361 ? 17.965  29.676  28.017  1.00 85.97 ? 363  TYR C CE1 1 
ATOM   8232  C CE2 . TYR C 1 361 ? 19.166  29.825  25.937  1.00 86.02 ? 363  TYR C CE2 1 
ATOM   8233  C CZ  . TYR C 1 361 ? 18.020  29.479  26.642  1.00 85.78 ? 363  TYR C CZ  1 
ATOM   8234  O OH  . TYR C 1 361 ? 16.971  28.947  25.947  1.00 85.18 ? 363  TYR C OH  1 
ATOM   8235  O OXT . TYR C 1 361 ? 23.715  31.947  30.457  1.00 85.93 ? 363  TYR C OXT 1 
HETATM 8236  C C   . ACE D 1 1   ? 1.345   23.471  28.516  1.00 10.39 ? 0    ACE D C   1 
HETATM 8237  O O   . ACE D 1 1   ? 1.036   24.322  29.361  1.00 11.22 ? 0    ACE D O   1 
HETATM 8238  C CH3 . ACE D 1 1   ? 0.759   22.103  28.486  1.00 9.90  ? 0    ACE D CH3 1 
ATOM   8239  N N   . THR D 1 2   ? 2.226   23.760  27.548  1.00 8.75  ? 1    THR D N   1 
ATOM   8240  C CA  . THR D 1 2   ? 2.805   25.062  27.371  1.00 8.25  ? 1    THR D CA  1 
ATOM   8241  C C   . THR D 1 2   ? 2.325   25.676  26.034  1.00 8.67  ? 1    THR D C   1 
ATOM   8242  O O   . THR D 1 2   ? 2.648   25.131  24.954  1.00 7.76  ? 1    THR D O   1 
ATOM   8243  C CB  . THR D 1 2   ? 4.388   24.978  27.354  1.00 8.43  ? 1    THR D CB  1 
ATOM   8244  O OG1 . THR D 1 2   ? 4.821   24.222  28.530  1.00 7.79  ? 1    THR D OG1 1 
ATOM   8245  C CG2 . THR D 1 2   ? 5.052   26.347  27.256  1.00 8.08  ? 1    THR D CG2 1 
ATOM   8246  N N   . THR D 1 3   ? 1.643   26.791  26.128  1.00 9.00  ? 2    THR D N   1 
ATOM   8247  C CA  . THR D 1 3   ? 1.026   27.399  24.916  1.00 9.65  ? 2    THR D CA  1 
ATOM   8248  C C   . THR D 1 3   ? 1.855   28.527  24.333  1.00 10.30 ? 2    THR D C   1 
ATOM   8249  O O   . THR D 1 3   ? 1.715   28.878  23.145  1.00 10.27 ? 2    THR D O   1 
ATOM   8250  C CB  . THR D 1 3   ? -0.456  27.850  25.204  1.00 8.78  ? 2    THR D CB  1 
ATOM   8251  O OG1 . THR D 1 3   ? -0.365  29.003  26.100  1.00 9.56  ? 2    THR D OG1 1 
ATOM   8252  C CG2 . THR D 1 3   ? -1.391  26.766  25.731  1.00 7.21  ? 2    THR D CG2 1 
ATOM   8253  N N   . TYR D 1 4   ? 2.710   29.127  25.166  1.00 10.65 ? 3    TYR D N   1 
ATOM   8254  C CA  . TYR D 1 4   ? 3.598   30.218  24.704  1.00 10.97 ? 3    TYR D CA  1 
ATOM   8255  C C   . TYR D 1 4   ? 4.960   29.607  24.371  1.00 11.43 ? 3    TYR D C   1 
ATOM   8256  O O   . TYR D 1 4   ? 5.710   29.211  25.288  1.00 11.33 ? 3    TYR D O   1 
ATOM   8257  C CB  . TYR D 1 4   ? 3.733   31.287  25.788  1.00 11.06 ? 3    TYR D CB  1 
ATOM   8258  C CG  . TYR D 1 4   ? 2.578   32.220  26.031  1.00 9.61  ? 3    TYR D CG  1 
ATOM   8259  C CD1 . TYR D 1 4   ? 2.325   33.284  25.170  1.00 9.55  ? 3    TYR D CD1 1 
ATOM   8260  C CD2 . TYR D 1 4   ? 1.756   32.082  27.152  1.00 8.51  ? 3    TYR D CD2 1 
ATOM   8261  C CE1 . TYR D 1 4   ? 1.271   34.172  25.392  1.00 9.70  ? 3    TYR D CE1 1 
ATOM   8262  C CE2 . TYR D 1 4   ? 0.702   32.958  27.388  1.00 8.56  ? 3    TYR D CE2 1 
ATOM   8263  C CZ  . TYR D 1 4   ? 0.465   34.011  26.517  1.00 8.82  ? 3    TYR D CZ  1 
ATOM   8264  O OH  . TYR D 1 4   ? -0.550  34.895  26.721  1.00 8.69  ? 3    TYR D OH  1 
ATOM   8265  N N   . PHE D 1 5   ? 5.243   29.486  23.089  1.00 11.08 ? 4    PHE D N   1 
ATOM   8266  C CA  . PHE D 1 5   ? 6.504   28.878  22.606  1.00 10.55 ? 4    PHE D CA  1 
ATOM   8267  C C   . PHE D 1 5   ? 6.769   29.353  21.166  1.00 11.13 ? 4    PHE D C   1 
ATOM   8268  O O   . PHE D 1 5   ? 5.888   29.964  20.548  1.00 11.56 ? 4    PHE D O   1 
ATOM   8269  C CB  . PHE D 1 5   ? 6.467   27.350  22.704  1.00 8.21  ? 4    PHE D CB  1 
ATOM   8270  C CG  . PHE D 1 5   ? 5.518   26.677  21.760  1.00 9.88  ? 4    PHE D CG  1 
ATOM   8271  C CD1 . PHE D 1 5   ? 4.197   26.434  22.114  1.00 9.13  ? 4    PHE D CD1 1 
ATOM   8272  C CD2 . PHE D 1 5   ? 5.973   26.294  20.493  1.00 9.94  ? 4    PHE D CD2 1 
ATOM   8273  C CE1 . PHE D 1 5   ? 3.315   25.819  21.224  1.00 10.17 ? 4    PHE D CE1 1 
ATOM   8274  C CE2 . PHE D 1 5   ? 5.118   25.672  19.586  1.00 10.79 ? 4    PHE D CE2 1 
ATOM   8275  C CZ  . PHE D 1 5   ? 3.796   25.434  19.954  1.00 10.42 ? 4    PHE D CZ  1 
ATOM   8276  N N   . ASN D 1 6   ? 7.952   29.041  20.670  1.00 11.73 ? 5    ASN D N   1 
ATOM   8277  C CA  . ASN D 1 6   ? 8.350   29.503  19.312  1.00 12.80 ? 5    ASN D CA  1 
ATOM   8278  C C   . ASN D 1 6   ? 8.451   28.340  18.336  1.00 12.42 ? 5    ASN D C   1 
ATOM   8279  O O   . ASN D 1 6   ? 9.140   27.346  18.666  1.00 13.87 ? 5    ASN D O   1 
ATOM   8280  C CB  . ASN D 1 6   ? 9.668   30.277  19.430  1.00 13.30 ? 5    ASN D CB  1 
ATOM   8281  C CG  . ASN D 1 6   ? 9.612   31.458  20.364  1.00 15.27 ? 5    ASN D CG  1 
ATOM   8282  O OD1 . ASN D 1 6   ? 8.793   32.379  20.235  1.00 17.33 ? 5    ASN D OD1 1 
ATOM   8283  N ND2 . ASN D 1 6   ? 10.526  31.492  21.347  1.00 17.70 ? 5    ASN D ND2 1 
ATOM   8284  N N   . TYR D 1 7   ? 7.782   28.440  17.197  1.00 12.55 ? 6    TYR D N   1 
ATOM   8285  C CA  . TYR D 1 7   ? 8.003   27.461  16.093  1.00 11.52 ? 6    TYR D CA  1 
ATOM   8286  C C   . TYR D 1 7   ? 9.420   27.756  15.553  1.00 10.92 ? 6    TYR D C   1 
ATOM   8287  O O   . TYR D 1 7   ? 9.913   28.861  15.753  1.00 10.45 ? 6    TYR D O   1 
ATOM   8288  C CB  . TYR D 1 7   ? 7.006   27.635  14.920  1.00 13.24 ? 6    TYR D CB  1 
ATOM   8289  C CG  . TYR D 1 7   ? 5.577   27.253  15.225  1.00 12.16 ? 6    TYR D CG  1 
ATOM   8290  C CD1 . TYR D 1 7   ? 5.241   25.982  15.687  1.00 12.87 ? 6    TYR D CD1 1 
ATOM   8291  C CD2 . TYR D 1 7   ? 4.550   28.180  15.060  1.00 13.63 ? 6    TYR D CD2 1 
ATOM   8292  C CE1 . TYR D 1 7   ? 3.917   25.638  15.970  1.00 12.67 ? 6    TYR D CE1 1 
ATOM   8293  C CE2 . TYR D 1 7   ? 3.229   27.856  15.338  1.00 13.37 ? 6    TYR D CE2 1 
ATOM   8294  C CZ  . TYR D 1 7   ? 2.917   26.589  15.802  1.00 13.15 ? 6    TYR D CZ  1 
ATOM   8295  O OH  . TYR D 1 7   ? 1.608   26.309  16.072  1.00 14.13 ? 6    TYR D OH  1 
ATOM   8296  N N   . PRO D 1 8   ? 10.005  26.770  14.906  1.00 11.33 ? 7    PRO D N   1 
ATOM   8297  C CA  . PRO D 1 8   ? 11.293  26.961  14.218  1.00 11.04 ? 7    PRO D CA  1 
ATOM   8298  C C   . PRO D 1 8   ? 11.102  28.044  13.147  1.00 11.04 ? 7    PRO D C   1 
ATOM   8299  O O   . PRO D 1 8   ? 9.958   28.281  12.722  1.00 10.54 ? 7    PRO D O   1 
ATOM   8300  C CB  . PRO D 1 8   ? 11.586  25.620  13.574  1.00 11.31 ? 7    PRO D CB  1 
ATOM   8301  C CG  . PRO D 1 8   ? 10.684  24.620  14.243  1.00 11.39 ? 7    PRO D CG  1 
ATOM   8302  C CD  . PRO D 1 8   ? 9.512   25.399  14.779  1.00 10.98 ? 7    PRO D CD  1 
ATOM   8303  N N   . SER D 1 9   ? 12.196  28.665  12.736  1.00 10.92 ? 8    SER D N   1 
ATOM   8304  C CA  . SER D 1 9   ? 12.104  29.649  11.626  1.00 10.85 ? 8    SER D CA  1 
ATOM   8305  C C   . SER D 1 9   ? 11.501  28.926  10.411  1.00 10.58 ? 8    SER D C   1 
ATOM   8306  O O   . SER D 1 9   ? 11.626  27.697  10.258  1.00 9.79  ? 8    SER D O   1 
ATOM   8307  C CB  . SER D 1 9   ? 13.489  30.186  11.288  1.00 10.59 ? 8    SER D CB  1 
ATOM   8308  O OG  . SER D 1 9   ? 14.244  29.100  10.750  1.00 11.41 ? 8    SER D OG  1 
ATOM   8309  N N   . LYS D 1 10  ? 10.890  29.708  9.538   1.00 10.60 ? 9    LYS D N   1 
ATOM   8310  C CA  . LYS D 1 10  ? 10.310  29.149  8.314   1.00 10.93 ? 9    LYS D CA  1 
ATOM   8311  C C   . LYS D 1 10  ? 11.392  28.427  7.511   1.00 10.67 ? 9    LYS D C   1 
ATOM   8312  O O   . LYS D 1 10  ? 11.119  27.350  6.952   1.00 9.75  ? 9    LYS D O   1 
ATOM   8313  C CB  . LYS D 1 10  ? 9.595   30.180  7.447   1.00 15.03 ? 9    LYS D CB  1 
ATOM   8314  C CG  . LYS D 1 10  ? 9.168   29.593  6.085   1.00 19.02 ? 9    LYS D CG  1 
ATOM   8315  C CD  . LYS D 1 10  ? 8.831   30.715  5.105   1.00 21.29 ? 9    LYS D CD  1 
ATOM   8316  C CE  . LYS D 1 10  ? 9.135   30.329  3.667   1.00 22.71 ? 9    LYS D CE  1 
ATOM   8317  N NZ  . LYS D 1 10  ? 8.590   28.979  3.358   1.00 22.59 ? 9    LYS D NZ  1 
ATOM   8318  N N   . GLU D 1 11  ? 12.592  28.989  7.493   1.00 10.20 ? 10   GLU D N   1 
ATOM   8319  C CA  . GLU D 1 11  ? 13.699  28.402  6.728   1.00 10.76 ? 10   GLU D CA  1 
ATOM   8320  C C   . GLU D 1 11  ? 14.086  27.031  7.247   1.00 10.00 ? 10   GLU D C   1 
ATOM   8321  O O   . GLU D 1 11  ? 14.307  26.097  6.447   1.00 9.73  ? 10   GLU D O   1 
ATOM   8322  C CB  . GLU D 1 11  ? 14.956  29.274  6.697   1.00 14.81 ? 10   GLU D CB  1 
ATOM   8323  C CG  . GLU D 1 11  ? 14.829  30.634  6.004   1.00 20.94 ? 10   GLU D CG  1 
ATOM   8324  C CD  . GLU D 1 11  ? 13.859  31.614  6.578   1.00 24.99 ? 10   GLU D CD  1 
ATOM   8325  O OE1 . GLU D 1 11  ? 13.635  31.777  7.769   1.00 26.26 ? 10   GLU D OE1 1 
ATOM   8326  O OE2 . GLU D 1 11  ? 13.262  32.284  5.688   1.00 27.57 ? 10   GLU D OE2 1 
ATOM   8327  N N   . LEU D 1 12  ? 14.170  26.906  8.571   1.00 8.82  ? 11   LEU D N   1 
ATOM   8328  C CA  . LEU D 1 12  ? 14.527  25.625  9.196   1.00 7.65  ? 11   LEU D CA  1 
ATOM   8329  C C   . LEU D 1 12  ? 13.430  24.583  8.989   1.00 6.43  ? 11   LEU D C   1 
ATOM   8330  O O   . LEU D 1 12  ? 13.741  23.420  8.699   1.00 5.17  ? 11   LEU D O   1 
ATOM   8331  C CB  . LEU D 1 12  ? 14.902  25.888  10.649  1.00 9.24  ? 11   LEU D CB  1 
ATOM   8332  C CG  . LEU D 1 12  ? 15.262  24.684  11.501  1.00 6.61  ? 11   LEU D CG  1 
ATOM   8333  C CD1 . LEU D 1 12  ? 16.486  23.957  10.967  1.00 6.85  ? 11   LEU D CD1 1 
ATOM   8334  C CD2 . LEU D 1 12  ? 15.536  25.197  12.920  1.00 8.90  ? 11   LEU D CD2 1 
ATOM   8335  N N   . GLN D 1 13  ? 12.185  25.013  9.130   1.00 6.34  ? 12   GLN D N   1 
ATOM   8336  C CA  . GLN D 1 13  ? 11.036  24.127  8.869   1.00 6.59  ? 12   GLN D CA  1 
ATOM   8337  C C   . GLN D 1 13  ? 11.178  23.468  7.486   1.00 6.03  ? 12   GLN D C   1 
ATOM   8338  O O   . GLN D 1 13  ? 11.062  22.242  7.375   1.00 5.70  ? 12   GLN D O   1 
ATOM   8339  C CB  . GLN D 1 13  ? 9.696   24.826  8.982   1.00 6.10  ? 12   GLN D CB  1 
ATOM   8340  C CG  . GLN D 1 13  ? 9.262   25.184  10.423  1.00 8.33  ? 12   GLN D CG  1 
ATOM   8341  C CD  . GLN D 1 13  ? 7.947   25.937  10.357  1.00 9.14  ? 12   GLN D CD  1 
ATOM   8342  O OE1 . GLN D 1 13  ? 7.038   25.502  9.647   1.00 10.10 ? 12   GLN D OE1 1 
ATOM   8343  N NE2 . GLN D 1 13  ? 7.847   27.069  11.034  1.00 7.69  ? 12   GLN D NE2 1 
ATOM   8344  N N   . ASP D 1 14  ? 11.345  24.309  6.480   1.00 7.13  ? 13   ASP D N   1 
ATOM   8345  C CA  . ASP D 1 14  ? 11.442  23.899  5.077   1.00 7.47  ? 13   ASP D CA  1 
ATOM   8346  C C   . ASP D 1 14  ? 12.593  22.936  4.842   1.00 6.17  ? 13   ASP D C   1 
ATOM   8347  O O   . ASP D 1 14  ? 12.428  21.895  4.171   1.00 6.05  ? 13   ASP D O   1 
ATOM   8348  C CB  . ASP D 1 14  ? 11.512  25.104  4.111   1.00 10.62 ? 13   ASP D CB  1 
ATOM   8349  C CG  . ASP D 1 14  ? 10.229  25.906  4.026   1.00 13.83 ? 13   ASP D CG  1 
ATOM   8350  O OD1 . ASP D 1 14  ? 9.149   25.489  4.460   1.00 14.38 ? 13   ASP D OD1 1 
ATOM   8351  O OD2 . ASP D 1 14  ? 10.335  27.051  3.536   1.00 14.72 ? 13   ASP D OD2 1 
ATOM   8352  N N   . GLU D 1 15  ? 13.762  23.267  5.407   1.00 6.05  ? 14   GLU D N   1 
ATOM   8353  C CA  . GLU D 1 15  ? 14.932  22.395  5.243   1.00 4.99  ? 14   GLU D CA  1 
ATOM   8354  C C   . GLU D 1 15  ? 14.722  21.020  5.842   1.00 4.33  ? 14   GLU D C   1 
ATOM   8355  O O   . GLU D 1 15  ? 14.991  19.999  5.184   1.00 3.37  ? 14   GLU D O   1 
ATOM   8356  C CB  . GLU D 1 15  ? 16.229  23.003  5.796   1.00 5.62  ? 14   GLU D CB  1 
ATOM   8357  C CG  . GLU D 1 15  ? 17.464  22.090  5.651   1.00 6.32  ? 14   GLU D CG  1 
ATOM   8358  C CD  . GLU D 1 15  ? 18.721  22.684  6.243   1.00 6.57  ? 14   GLU D CD  1 
ATOM   8359  O OE1 . GLU D 1 15  ? 18.743  23.711  6.894   1.00 9.69  ? 14   GLU D OE1 1 
ATOM   8360  O OE2 . GLU D 1 15  ? 19.722  22.000  5.960   1.00 8.20  ? 14   GLU D OE2 1 
ATOM   8361  N N   . LEU D 1 16  ? 14.222  20.958  7.078   1.00 5.19  ? 15   LEU D N   1 
ATOM   8362  C CA  . LEU D 1 16  ? 13.998  19.680  7.769   1.00 4.44  ? 15   LEU D CA  1 
ATOM   8363  C C   . LEU D 1 16  ? 12.923  18.864  7.046   1.00 4.16  ? 15   LEU D C   1 
ATOM   8364  O O   . LEU D 1 16  ? 13.062  17.648  6.888   1.00 4.39  ? 15   LEU D O   1 
ATOM   8365  C CB  . LEU D 1 16  ? 13.604  19.968  9.237   1.00 5.65  ? 15   LEU D CB  1 
ATOM   8366  C CG  . LEU D 1 16  ? 14.652  20.599  10.142  1.00 6.94  ? 15   LEU D CG  1 
ATOM   8367  C CD1 . LEU D 1 16  ? 14.071  20.958  11.515  1.00 9.74  ? 15   LEU D CD1 1 
ATOM   8368  C CD2 . LEU D 1 16  ? 15.798  19.610  10.326  1.00 7.85  ? 15   LEU D CD2 1 
ATOM   8369  N N   . ARG D 1 17  ? 11.859  19.548  6.664   1.00 5.04  ? 16   ARG D N   1 
ATOM   8370  C CA  . ARG D 1 17  ? 10.737  18.878  5.973   1.00 5.64  ? 16   ARG D CA  1 
ATOM   8371  C C   . ARG D 1 17  ? 11.199  18.281  4.644   1.00 5.64  ? 16   ARG D C   1 
ATOM   8372  O O   . ARG D 1 17  ? 10.871  17.138  4.306   1.00 4.47  ? 16   ARG D O   1 
ATOM   8373  C CB  . ARG D 1 17  ? 9.543   19.809  5.762   1.00 6.18  ? 16   ARG D CB  1 
ATOM   8374  C CG  . ARG D 1 17  ? 8.298   19.069  5.282   1.00 10.78 ? 16   ARG D CG  1 
ATOM   8375  C CD  . ARG D 1 17  ? 7.144   19.923  4.934   1.00 11.15 ? 16   ARG D CD  1 
ATOM   8376  N NE  . ARG D 1 17  ? 7.394   21.135  4.256   1.00 12.98 ? 16   ARG D NE  1 
ATOM   8377  C CZ  . ARG D 1 17  ? 7.623   22.392  4.519   1.00 12.90 ? 16   ARG D CZ  1 
ATOM   8378  N NH1 . ARG D 1 17  ? 7.688   22.944  5.721   1.00 10.94 ? 16   ARG D NH1 1 
ATOM   8379  N NH2 . ARG D 1 17  ? 7.793   23.225  3.463   1.00 13.91 ? 16   ARG D NH2 1 
ATOM   8380  N N   . GLU D 1 18  ? 11.972  19.083  3.921   1.00 6.52  ? 17   GLU D N   1 
ATOM   8381  C CA  . GLU D 1 18  ? 12.529  18.618  2.634   1.00 7.42  ? 17   GLU D CA  1 
ATOM   8382  C C   . GLU D 1 18  ? 13.418  17.412  2.756   1.00 6.29  ? 17   GLU D C   1 
ATOM   8383  O O   . GLU D 1 18  ? 13.274  16.457  1.962   1.00 7.08  ? 17   GLU D O   1 
ATOM   8384  C CB  . GLU D 1 18  ? 13.262  19.753  1.911   1.00 11.38 ? 17   GLU D CB  1 
ATOM   8385  C CG  . GLU D 1 18  ? 13.984  19.370  0.609   1.00 17.95 ? 17   GLU D CG  1 
ATOM   8386  C CD  . GLU D 1 18  ? 14.793  20.516  0.045   1.00 19.68 ? 17   GLU D CD  1 
ATOM   8387  O OE1 . GLU D 1 18  ? 14.064  21.454  -0.321  1.00 23.84 ? 17   GLU D OE1 1 
ATOM   8388  O OE2 . GLU D 1 18  ? 16.003  20.513  -0.004  1.00 23.19 ? 17   GLU D OE2 1 
ATOM   8389  N N   . ILE D 1 19  ? 14.359  17.364  3.684   1.00 6.01  ? 18   ILE D N   1 
ATOM   8390  C CA  . ILE D 1 19  ? 15.189  16.183  3.950   1.00 5.89  ? 18   ILE D CA  1 
ATOM   8391  C C   . ILE D 1 19  ? 14.354  14.954  4.276   1.00 5.51  ? 18   ILE D C   1 
ATOM   8392  O O   . ILE D 1 19  ? 14.579  13.847  3.723   1.00 5.35  ? 18   ILE D O   1 
ATOM   8393  C CB  . ILE D 1 19  ? 16.270  16.482  5.058   1.00 6.77  ? 18   ILE D CB  1 
ATOM   8394  C CG1 . ILE D 1 19  ? 17.295  17.524  4.546   1.00 8.55  ? 18   ILE D CG1 1 
ATOM   8395  C CG2 . ILE D 1 19  ? 17.017  15.194  5.513   1.00 8.70  ? 18   ILE D CG2 1 
ATOM   8396  C CD1 . ILE D 1 19  ? 18.062  18.228  5.717   1.00 9.97  ? 18   ILE D CD1 1 
ATOM   8397  N N   . ALA D 1 20  ? 13.383  15.123  5.175   1.00 4.52  ? 19   ALA D N   1 
ATOM   8398  C CA  . ALA D 1 20  ? 12.536  13.996  5.592   1.00 5.31  ? 19   ALA D CA  1 
ATOM   8399  C C   . ALA D 1 20  ? 11.821  13.404  4.375   1.00 5.54  ? 19   ALA D C   1 
ATOM   8400  O O   . ALA D 1 20  ? 11.765  12.182  4.208   1.00 5.27  ? 19   ALA D O   1 
ATOM   8401  C CB  . ALA D 1 20  ? 11.543  14.423  6.664   1.00 5.09  ? 19   ALA D CB  1 
ATOM   8402  N N   . GLN D 1 21  ? 11.295  14.307  3.562   1.00 6.86  ? 20   GLN D N   1 
ATOM   8403  C CA  . GLN D 1 21  ? 10.529  13.911  2.365   1.00 7.31  ? 20   GLN D CA  1 
ATOM   8404  C C   . GLN D 1 21  ? 11.401  13.140  1.371   1.00 6.63  ? 20   GLN D C   1 
ATOM   8405  O O   . GLN D 1 21  ? 10.927  12.156  0.771   1.00 5.25  ? 20   GLN D O   1 
ATOM   8406  C CB  . GLN D 1 21  ? 9.883   15.126  1.710   1.00 10.21 ? 20   GLN D CB  1 
ATOM   8407  C CG  . GLN D 1 21  ? 8.576   15.571  2.345   1.00 13.62 ? 20   GLN D CG  1 
ATOM   8408  C CD  . GLN D 1 21  ? 8.163   16.940  1.837   1.00 15.60 ? 20   GLN D CD  1 
ATOM   8409  O OE1 . GLN D 1 21  ? 8.857   17.524  1.003   1.00 17.92 ? 20   GLN D OE1 1 
ATOM   8410  N NE2 . GLN D 1 21  ? 7.052   17.434  2.351   1.00 15.71 ? 20   GLN D NE2 1 
ATOM   8411  N N   . LYS D 1 22  ? 12.630  13.602  1.202   1.00 7.33  ? 21   LYS D N   1 
ATOM   8412  C CA  . LYS D 1 22  ? 13.593  12.942  0.298   1.00 8.08  ? 21   LYS D CA  1 
ATOM   8413  C C   . LYS D 1 22  ? 13.920  11.531  0.754   1.00 7.56  ? 21   LYS D C   1 
ATOM   8414  O O   . LYS D 1 22  ? 14.008  10.597  -0.070  1.00 7.64  ? 21   LYS D O   1 
ATOM   8415  C CB  . LYS D 1 22  ? 14.869  13.734  0.104   1.00 9.91  ? 21   LYS D CB  1 
ATOM   8416  C CG  . LYS D 1 22  ? 14.673  14.965  -0.810  1.00 14.60 ? 21   LYS D CG  1 
ATOM   8417  C CD  . LYS D 1 22  ? 16.030  15.621  -1.021  1.00 17.27 ? 21   LYS D CD  1 
ATOM   8418  C CE  . LYS D 1 22  ? 15.909  17.054  -1.519  1.00 19.37 ? 21   LYS D CE  1 
ATOM   8419  N NZ  . LYS D 1 22  ? 17.298  17.593  -1.641  1.00 22.06 ? 21   LYS D NZ  1 
ATOM   8420  N N   . ILE D 1 23  ? 14.067  11.347  2.059   1.00 7.49  ? 22   ILE D N   1 
ATOM   8421  C CA  . ILE D 1 23  ? 14.376  10.017  2.611   1.00 6.97  ? 22   ILE D CA  1 
ATOM   8422  C C   . ILE D 1 23  ? 13.291  8.998   2.312   1.00 6.74  ? 22   ILE D C   1 
ATOM   8423  O O   . ILE D 1 23  ? 13.590  7.794   2.058   1.00 6.75  ? 22   ILE D O   1 
ATOM   8424  C CB  . ILE D 1 23  ? 14.722  10.100  4.138   1.00 7.99  ? 22   ILE D CB  1 
ATOM   8425  C CG1 . ILE D 1 23  ? 16.037  10.871  4.361   1.00 7.86  ? 22   ILE D CG1 1 
ATOM   8426  C CG2 . ILE D 1 23  ? 14.762  8.659   4.743   1.00 6.51  ? 22   ILE D CG2 1 
ATOM   8427  C CD1 . ILE D 1 23  ? 16.190  11.487  5.782   1.00 8.96  ? 22   ILE D CD1 1 
ATOM   8428  N N   . VAL D 1 24  ? 12.034  9.449   2.335   1.00 7.24  ? 23   VAL D N   1 
ATOM   8429  C CA  . VAL D 1 24  ? 10.906  8.536   2.078   1.00 7.52  ? 23   VAL D CA  1 
ATOM   8430  C C   . VAL D 1 24  ? 10.255  8.696   0.712   1.00 8.33  ? 23   VAL D C   1 
ATOM   8431  O O   . VAL D 1 24  ? 9.053   8.362   0.583   1.00 8.34  ? 23   VAL D O   1 
ATOM   8432  C CB  . VAL D 1 24  ? 9.897   8.586   3.252   1.00 5.61  ? 23   VAL D CB  1 
ATOM   8433  C CG1 . VAL D 1 24  ? 10.557  8.218   4.585   1.00 5.13  ? 23   VAL D CG1 1 
ATOM   8434  C CG2 . VAL D 1 24  ? 9.222   9.946   3.365   1.00 6.48  ? 23   VAL D CG2 1 
ATOM   8435  N N   . ALA D 1 25  ? 10.979  9.175   -0.277  1.00 9.87  ? 24   ALA D N   1 
ATOM   8436  C CA  . ALA D 1 25  ? 10.420  9.241   -1.667  1.00 10.51 ? 24   ALA D CA  1 
ATOM   8437  C C   . ALA D 1 25  ? 9.951   7.861   -2.078  1.00 10.48 ? 24   ALA D C   1 
ATOM   8438  O O   . ALA D 1 25  ? 10.456  6.815   -1.636  1.00 10.92 ? 24   ALA D O   1 
ATOM   8439  C CB  . ALA D 1 25  ? 11.463  9.824   -2.608  1.00 10.51 ? 24   ALA D CB  1 
ATOM   8440  N N   . PRO D 1 26  ? 8.918   7.815   -2.927  1.00 11.08 ? 25   PRO D N   1 
ATOM   8441  C CA  . PRO D 1 26  ? 8.359   6.559   -3.417  1.00 11.08 ? 25   PRO D CA  1 
ATOM   8442  C C   . PRO D 1 26  ? 9.423   5.592   -3.930  1.00 11.02 ? 25   PRO D C   1 
ATOM   8443  O O   . PRO D 1 26  ? 10.272  5.946   -4.763  1.00 11.23 ? 25   PRO D O   1 
ATOM   8444  C CB  . PRO D 1 26  ? 7.368   6.959   -4.500  1.00 11.43 ? 25   PRO D CB  1 
ATOM   8445  C CG  . PRO D 1 26  ? 7.085   8.406   -4.281  1.00 11.76 ? 25   PRO D CG  1 
ATOM   8446  C CD  . PRO D 1 26  ? 8.270   8.993   -3.529  1.00 11.41 ? 25   PRO D CD  1 
ATOM   8447  N N   . GLY D 1 27  ? 9.352   4.375   -3.434  1.00 10.10 ? 26   GLY D N   1 
ATOM   8448  C CA  . GLY D 1 27  ? 10.229  3.279   -3.792  1.00 10.35 ? 26   GLY D CA  1 
ATOM   8449  C C   . GLY D 1 27  ? 11.564  3.292   -3.068  1.00 10.08 ? 26   GLY D C   1 
ATOM   8450  O O   . GLY D 1 27  ? 12.387  2.410   -3.378  1.00 9.98  ? 26   GLY D O   1 
ATOM   8451  N N   . LYS D 1 28  ? 11.777  4.230   -2.147  1.00 9.77  ? 27   LYS D N   1 
ATOM   8452  C CA  . LYS D 1 28  ? 13.071  4.315   -1.452  1.00 9.49  ? 27   LYS D CA  1 
ATOM   8453  C C   . LYS D 1 28  ? 12.975  4.085   0.057   1.00 9.96  ? 27   LYS D C   1 
ATOM   8454  O O   . LYS D 1 28  ? 11.939  4.360   0.680   1.00 9.53  ? 27   LYS D O   1 
ATOM   8455  C CB  . LYS D 1 28  ? 13.739  5.668   -1.677  1.00 11.93 ? 27   LYS D CB  1 
ATOM   8456  C CG  . LYS D 1 28  ? 13.852  6.057   -3.154  1.00 12.78 ? 27   LYS D CG  1 
ATOM   8457  C CD  . LYS D 1 28  ? 14.887  7.163   -3.332  1.00 16.26 ? 27   LYS D CD  1 
ATOM   8458  C CE  . LYS D 1 28  ? 14.932  7.644   -4.776  1.00 16.72 ? 27   LYS D CE  1 
ATOM   8459  N NZ  . LYS D 1 28  ? 15.897  8.779   -4.875  1.00 19.80 ? 27   LYS D NZ  1 
ATOM   8460  N N   . GLY D 1 29  ? 14.095  3.608   0.583   1.00 9.10  ? 28   GLY D N   1 
ATOM   8461  C CA  . GLY D 1 29  ? 14.277  3.348   2.013   1.00 9.12  ? 28   GLY D CA  1 
ATOM   8462  C C   . GLY D 1 29  ? 15.751  3.506   2.398   1.00 8.59  ? 28   GLY D C   1 
ATOM   8463  O O   . GLY D 1 29  ? 16.642  3.864   1.595   1.00 7.50  ? 28   GLY D O   1 
ATOM   8464  N N   . ILE D 1 30  ? 16.003  3.190   3.654   1.00 7.76  ? 29   ILE D N   1 
ATOM   8465  C CA  . ILE D 1 30  ? 17.291  3.374   4.294   1.00 7.73  ? 29   ILE D CA  1 
ATOM   8466  C C   . ILE D 1 30  ? 18.020  2.046   4.480   1.00 7.14  ? 29   ILE D C   1 
ATOM   8467  O O   . ILE D 1 30  ? 17.434  1.014   4.822   1.00 6.19  ? 29   ILE D O   1 
ATOM   8468  C CB  . ILE D 1 30  ? 17.118  4.072   5.710   1.00 9.03  ? 29   ILE D CB  1 
ATOM   8469  C CG1 . ILE D 1 30  ? 16.482  5.460   5.565   1.00 9.63  ? 29   ILE D CG1 1 
ATOM   8470  C CG2 . ILE D 1 30  ? 18.479  4.144   6.460   1.00 6.86  ? 29   ILE D CG2 1 
ATOM   8471  C CD1 . ILE D 1 30  ? 15.821  5.980   6.892   1.00 10.85 ? 29   ILE D CD1 1 
ATOM   8472  N N   . LEU D 1 31  ? 19.322  2.131   4.288   1.00 7.61  ? 30   LEU D N   1 
ATOM   8473  C CA  . LEU D 1 31  ? 20.270  1.059   4.563   1.00 8.63  ? 30   LEU D CA  1 
ATOM   8474  C C   . LEU D 1 31  ? 21.006  1.432   5.866   1.00 9.45  ? 30   LEU D C   1 
ATOM   8475  O O   . LEU D 1 31  ? 21.767  2.407   5.828   1.00 9.48  ? 30   LEU D O   1 
ATOM   8476  C CB  . LEU D 1 31  ? 21.274  0.967   3.384   1.00 9.64  ? 30   LEU D CB  1 
ATOM   8477  C CG  . LEU D 1 31  ? 22.500  0.100   3.676   1.00 9.60  ? 30   LEU D CG  1 
ATOM   8478  C CD1 . LEU D 1 31  ? 22.113  -1.360  3.841   1.00 9.81  ? 30   LEU D CD1 1 
ATOM   8479  C CD2 . LEU D 1 31  ? 23.481  0.246   2.506   1.00 11.24 ? 30   LEU D CD2 1 
ATOM   8480  N N   . ALA D 1 32  ? 20.746  0.680   6.907   1.00 10.22 ? 31   ALA D N   1 
ATOM   8481  C CA  . ALA D 1 32  ? 21.402  0.939   8.218   1.00 10.70 ? 31   ALA D CA  1 
ATOM   8482  C C   . ALA D 1 32  ? 22.743  0.209   8.192   1.00 11.47 ? 31   ALA D C   1 
ATOM   8483  O O   . ALA D 1 32  ? 22.736  -1.021  8.251   1.00 12.26 ? 31   ALA D O   1 
ATOM   8484  C CB  . ALA D 1 32  ? 20.509  0.400   9.331   1.00 11.53 ? 31   ALA D CB  1 
ATOM   8485  N N   . ALA D 1 33  ? 23.822  0.944   8.055   1.00 12.23 ? 32   ALA D N   1 
ATOM   8486  C CA  . ALA D 1 33  ? 25.165  0.319   8.038   1.00 13.61 ? 32   ALA D CA  1 
ATOM   8487  C C   . ALA D 1 33  ? 25.965  0.819   9.241   1.00 14.28 ? 32   ALA D C   1 
ATOM   8488  O O   . ALA D 1 33  ? 27.180  1.024   9.126   1.00 13.66 ? 32   ALA D O   1 
ATOM   8489  C CB  . ALA D 1 33  ? 25.881  0.694   6.743   1.00 12.60 ? 32   ALA D CB  1 
ATOM   8490  N N   . ASP D 1 34  ? 25.263  0.980   10.364  1.00 15.70 ? 33   ASP D N   1 
ATOM   8491  C CA  . ASP D 1 34  ? 25.867  1.679   11.519  1.00 16.62 ? 33   ASP D CA  1 
ATOM   8492  C C   . ASP D 1 34  ? 26.420  0.726   12.562  1.00 17.97 ? 33   ASP D C   1 
ATOM   8493  O O   . ASP D 1 34  ? 26.555  1.139   13.739  1.00 18.58 ? 33   ASP D O   1 
ATOM   8494  C CB  . ASP D 1 34  ? 24.878  2.710   12.071  1.00 17.50 ? 33   ASP D CB  1 
ATOM   8495  C CG  . ASP D 1 34  ? 23.597  2.124   12.623  1.00 18.80 ? 33   ASP D CG  1 
ATOM   8496  O OD1 . ASP D 1 34  ? 23.024  1.172   12.069  1.00 19.37 ? 33   ASP D OD1 1 
ATOM   8497  O OD2 . ASP D 1 34  ? 23.135  2.663   13.663  1.00 19.58 ? 33   ASP D OD2 1 
ATOM   8498  N N   . GLU D 1 35  ? 26.763  -0.479  12.166  1.00 18.50 ? 34   GLU D N   1 
ATOM   8499  C CA  . GLU D 1 35  ? 27.329  -1.470  13.093  1.00 19.39 ? 34   GLU D CA  1 
ATOM   8500  C C   . GLU D 1 35  ? 28.687  -1.006  13.616  1.00 20.02 ? 34   GLU D C   1 
ATOM   8501  O O   . GLU D 1 35  ? 29.575  -0.569  12.868  1.00 18.90 ? 34   GLU D O   1 
ATOM   8502  C CB  . GLU D 1 35  ? 27.520  -2.841  12.468  1.00 19.77 ? 34   GLU D CB  1 
ATOM   8503  C CG  . GLU D 1 35  ? 26.308  -3.526  11.840  1.00 20.31 ? 34   GLU D CG  1 
ATOM   8504  C CD  . GLU D 1 35  ? 25.989  -3.137  10.423  1.00 20.45 ? 34   GLU D CD  1 
ATOM   8505  O OE1 . GLU D 1 35  ? 26.649  -2.174  10.001  1.00 19.61 ? 34   GLU D OE1 1 
ATOM   8506  O OE2 . GLU D 1 35  ? 25.156  -3.720  9.743   1.00 22.20 ? 34   GLU D OE2 1 
ATOM   8507  N N   . SER D 1 36  ? 28.809  -1.108  14.935  1.00 21.08 ? 35   SER D N   1 
ATOM   8508  C CA  . SER D 1 36  ? 30.075  -0.796  15.623  1.00 22.37 ? 35   SER D CA  1 
ATOM   8509  C C   . SER D 1 36  ? 31.055  -1.949  15.369  1.00 23.43 ? 35   SER D C   1 
ATOM   8510  O O   . SER D 1 36  ? 30.642  -3.039  14.942  1.00 23.73 ? 35   SER D O   1 
ATOM   8511  C CB  . SER D 1 36  ? 29.836  -0.662  17.128  1.00 22.19 ? 35   SER D CB  1 
ATOM   8512  O OG  . SER D 1 36  ? 29.495  -1.944  17.666  1.00 22.34 ? 35   SER D OG  1 
ATOM   8513  N N   . GLY D 1 37  ? 32.312  -1.682  15.651  1.00 24.73 ? 36   GLY D N   1 
ATOM   8514  C CA  . GLY D 1 37  ? 33.388  -2.676  15.531  1.00 26.09 ? 36   GLY D CA  1 
ATOM   8515  C C   . GLY D 1 37  ? 32.944  -4.056  16.000  1.00 26.92 ? 36   GLY D C   1 
ATOM   8516  O O   . GLY D 1 37  ? 32.888  -5.019  15.215  1.00 27.04 ? 36   GLY D O   1 
ATOM   8517  N N   . PRO D 1 38  ? 32.643  -4.138  17.291  1.00 27.54 ? 37   PRO D N   1 
ATOM   8518  C CA  . PRO D 1 38  ? 32.241  -5.392  17.933  1.00 27.92 ? 37   PRO D CA  1 
ATOM   8519  C C   . PRO D 1 38  ? 31.138  -6.109  17.184  1.00 28.31 ? 37   PRO D C   1 
ATOM   8520  O O   . PRO D 1 38  ? 31.245  -7.309  16.871  1.00 28.63 ? 37   PRO D O   1 
ATOM   8521  C CB  . PRO D 1 38  ? 31.847  -4.986  19.353  1.00 27.93 ? 37   PRO D CB  1 
ATOM   8522  C CG  . PRO D 1 38  ? 32.590  -3.710  19.614  1.00 27.76 ? 37   PRO D CG  1 
ATOM   8523  C CD  . PRO D 1 38  ? 32.736  -3.032  18.263  1.00 27.64 ? 37   PRO D CD  1 
ATOM   8524  N N   . THR D 1 39  ? 30.065  -5.393  16.895  1.00 29.17 ? 38   THR D N   1 
ATOM   8525  C CA  . THR D 1 39  ? 28.899  -5.938  16.197  1.00 29.54 ? 38   THR D CA  1 
ATOM   8526  C C   . THR D 1 39  ? 29.263  -6.401  14.791  1.00 29.85 ? 38   THR D C   1 
ATOM   8527  O O   . THR D 1 39  ? 28.857  -7.486  14.345  1.00 29.44 ? 38   THR D O   1 
ATOM   8528  C CB  . THR D 1 39  ? 27.715  -4.888  16.131  1.00 30.19 ? 38   THR D CB  1 
ATOM   8529  O OG1 . THR D 1 39  ? 27.461  -4.492  17.510  1.00 30.46 ? 38   THR D OG1 1 
ATOM   8530  C CG2 . THR D 1 39  ? 26.465  -5.440  15.439  1.00 30.47 ? 38   THR D CG2 1 
ATOM   8531  N N   . MET D 1 40  ? 30.006  -5.532  14.119  1.00 30.27 ? 39   MET D N   1 
ATOM   8532  C CA  . MET D 1 40  ? 30.465  -5.847  12.744  1.00 31.04 ? 39   MET D CA  1 
ATOM   8533  C C   . MET D 1 40  ? 31.298  -7.125  12.810  1.00 31.87 ? 39   MET D C   1 
ATOM   8534  O O   . MET D 1 40  ? 31.225  -7.986  11.920  1.00 32.15 ? 39   MET D O   1 
ATOM   8535  C CB  . MET D 1 40  ? 31.211  -4.670  12.152  1.00 30.81 ? 39   MET D CB  1 
ATOM   8536  C CG  . MET D 1 40  ? 31.613  -4.921  10.725  1.00 31.29 ? 39   MET D CG  1 
ATOM   8537  S SD  . MET D 1 40  ? 30.100  -4.875  9.699   1.00 30.47 ? 39   MET D SD  1 
ATOM   8538  C CE  . MET D 1 40  ? 30.166  -6.525  8.989   1.00 29.64 ? 39   MET D CE  1 
ATOM   8539  N N   . GLY D 1 41  ? 32.060  -7.221  13.887  1.00 32.60 ? 40   GLY D N   1 
ATOM   8540  C CA  . GLY D 1 41  ? 32.951  -8.347  14.166  1.00 33.42 ? 40   GLY D CA  1 
ATOM   8541  C C   . GLY D 1 41  ? 32.180  -9.656  14.244  1.00 34.05 ? 40   GLY D C   1 
ATOM   8542  O O   . GLY D 1 41  ? 32.652  -10.703 13.767  1.00 33.68 ? 40   GLY D O   1 
ATOM   8543  N N   . LYS D 1 42  ? 31.009  -9.576  14.854  1.00 34.96 ? 41   LYS D N   1 
ATOM   8544  C CA  . LYS D 1 42  ? 30.114  -10.737 14.975  1.00 36.41 ? 41   LYS D CA  1 
ATOM   8545  C C   . LYS D 1 42  ? 29.714  -11.215 13.576  1.00 37.17 ? 41   LYS D C   1 
ATOM   8546  O O   . LYS D 1 42  ? 29.704  -12.425 13.300  1.00 37.18 ? 41   LYS D O   1 
ATOM   8547  C CB  . LYS D 1 42  ? 28.871  -10.444 15.793  1.00 39.09 ? 41   LYS D CB  1 
ATOM   8548  C CG  . LYS D 1 42  ? 27.993  -11.678 16.017  1.00 41.54 ? 41   LYS D CG  1 
ATOM   8549  C CD  . LYS D 1 42  ? 26.579  -11.300 16.434  1.00 43.30 ? 41   LYS D CD  1 
ATOM   8550  C CE  . LYS D 1 42  ? 25.680  -12.527 16.523  1.00 44.27 ? 41   LYS D CE  1 
ATOM   8551  N NZ  . LYS D 1 42  ? 24.274  -12.126 16.774  1.00 44.98 ? 41   LYS D NZ  1 
ATOM   8552  N N   . ARG D 1 43  ? 29.402  -10.243 12.736  1.00 37.33 ? 42   ARG D N   1 
ATOM   8553  C CA  . ARG D 1 43  ? 28.982  -10.470 11.354  1.00 37.79 ? 42   ARG D CA  1 
ATOM   8554  C C   . ARG D 1 43  ? 30.090  -11.097 10.520  1.00 37.95 ? 42   ARG D C   1 
ATOM   8555  O O   . ARG D 1 43  ? 29.836  -12.086 9.802   1.00 37.70 ? 42   ARG D O   1 
ATOM   8556  C CB  . ARG D 1 43  ? 28.489  -9.184  10.687  1.00 38.76 ? 42   ARG D CB  1 
ATOM   8557  C CG  . ARG D 1 43  ? 27.318  -8.510  11.387  1.00 39.88 ? 42   ARG D CG  1 
ATOM   8558  C CD  . ARG D 1 43  ? 26.090  -9.357  11.359  1.00 41.17 ? 42   ARG D CD  1 
ATOM   8559  N NE  . ARG D 1 43  ? 25.298  -9.194  12.562  1.00 42.63 ? 42   ARG D NE  1 
ATOM   8560  C CZ  . ARG D 1 43  ? 24.746  -8.064  12.996  1.00 43.77 ? 42   ARG D CZ  1 
ATOM   8561  N NH1 . ARG D 1 43  ? 24.718  -6.940  12.281  1.00 43.55 ? 42   ARG D NH1 1 
ATOM   8562  N NH2 . ARG D 1 43  ? 24.228  -8.057  14.229  1.00 44.16 ? 42   ARG D NH2 1 
ATOM   8563  N N   . LEU D 1 44  ? 31.277  -10.531 10.619  1.00 38.38 ? 43   LEU D N   1 
ATOM   8564  C CA  . LEU D 1 44  ? 32.443  -11.024 9.869   1.00 39.24 ? 43   LEU D CA  1 
ATOM   8565  C C   . LEU D 1 44  ? 32.805  -12.446 10.286  1.00 40.10 ? 43   LEU D C   1 
ATOM   8566  O O   . LEU D 1 44  ? 33.222  -13.274 9.456   1.00 39.84 ? 43   LEU D O   1 
ATOM   8567  C CB  . LEU D 1 44  ? 33.587  -10.020 10.017  1.00 38.97 ? 43   LEU D CB  1 
ATOM   8568  C CG  . LEU D 1 44  ? 33.416  -8.642  9.413   1.00 38.98 ? 43   LEU D CG  1 
ATOM   8569  C CD1 . LEU D 1 44  ? 34.625  -7.762  9.704   1.00 39.00 ? 43   LEU D CD1 1 
ATOM   8570  C CD2 . LEU D 1 44  ? 33.229  -8.774  7.900   1.00 39.43 ? 43   LEU D CD2 1 
ATOM   8571  N N   . GLN D 1 45  ? 32.645  -12.708 11.569  1.00 41.11 ? 44   GLN D N   1 
ATOM   8572  C CA  . GLN D 1 45  ? 32.986  -14.001 12.168  1.00 42.50 ? 44   GLN D CA  1 
ATOM   8573  C C   . GLN D 1 45  ? 32.152  -15.116 11.545  1.00 43.05 ? 44   GLN D C   1 
ATOM   8574  O O   . GLN D 1 45  ? 32.700  -16.180 11.218  1.00 43.02 ? 44   GLN D O   1 
ATOM   8575  C CB  . GLN D 1 45  ? 32.840  -14.017 13.692  1.00 44.08 ? 44   GLN D CB  1 
ATOM   8576  C CG  . GLN D 1 45  ? 32.888  -15.435 14.243  1.00 46.55 ? 44   GLN D CG  1 
ATOM   8577  C CD  . GLN D 1 45  ? 32.650  -15.487 15.732  1.00 47.92 ? 44   GLN D CD  1 
ATOM   8578  O OE1 . GLN D 1 45  ? 32.651  -14.468 16.423  1.00 48.94 ? 44   GLN D OE1 1 
ATOM   8579  N NE2 . GLN D 1 45  ? 32.443  -16.708 16.224  1.00 48.35 ? 44   GLN D NE2 1 
ATOM   8580  N N   . ASP D 1 46  ? 30.864  -14.845 11.402  1.00 43.85 ? 45   ASP D N   1 
ATOM   8581  C CA  . ASP D 1 46  ? 29.940  -15.843 10.850  1.00 44.78 ? 45   ASP D CA  1 
ATOM   8582  C C   . ASP D 1 46  ? 30.430  -16.326 9.470   1.00 44.90 ? 45   ASP D C   1 
ATOM   8583  O O   . ASP D 1 46  ? 30.062  -17.458 9.097   1.00 45.18 ? 45   ASP D O   1 
ATOM   8584  C CB  . ASP D 1 46  ? 28.496  -15.425 10.786  1.00 46.76 ? 45   ASP D CB  1 
ATOM   8585  C CG  . ASP D 1 46  ? 27.937  -14.300 11.583  1.00 48.23 ? 45   ASP D CG  1 
ATOM   8586  O OD1 . ASP D 1 46  ? 28.437  -13.161 11.592  1.00 49.35 ? 45   ASP D OD1 1 
ATOM   8587  O OD2 . ASP D 1 46  ? 26.874  -14.527 12.220  1.00 48.95 ? 45   ASP D OD2 1 
ATOM   8588  N N   . ILE D 1 47  ? 31.170  -15.494 8.758   1.00 44.80 ? 46   ILE D N   1 
ATOM   8589  C CA  . ILE D 1 47  ? 31.607  -15.869 7.401   1.00 44.87 ? 46   ILE D CA  1 
ATOM   8590  C C   . ILE D 1 47  ? 33.097  -16.152 7.322   1.00 45.00 ? 46   ILE D C   1 
ATOM   8591  O O   . ILE D 1 47  ? 33.638  -16.333 6.210   1.00 45.06 ? 46   ILE D O   1 
ATOM   8592  C CB  . ILE D 1 47  ? 31.121  -14.852 6.313   1.00 44.24 ? 46   ILE D CB  1 
ATOM   8593  C CG1 . ILE D 1 47  ? 31.697  -13.444 6.590   1.00 43.74 ? 46   ILE D CG1 1 
ATOM   8594  C CG2 . ILE D 1 47  ? 29.583  -14.833 6.144   1.00 43.85 ? 46   ILE D CG2 1 
ATOM   8595  C CD1 . ILE D 1 47  ? 31.788  -12.531 5.335   1.00 42.93 ? 46   ILE D CD1 1 
ATOM   8596  N N   . GLY D 1 48  ? 33.743  -16.187 8.465   1.00 45.15 ? 47   GLY D N   1 
ATOM   8597  C CA  . GLY D 1 48  ? 35.151  -16.527 8.616   1.00 45.19 ? 47   GLY D CA  1 
ATOM   8598  C C   . GLY D 1 48  ? 36.118  -15.420 8.262   1.00 45.34 ? 47   GLY D C   1 
ATOM   8599  O O   . GLY D 1 48  ? 37.206  -15.687 7.702   1.00 45.57 ? 47   GLY D O   1 
ATOM   8600  N N   . VAL D 1 49  ? 35.750  -14.199 8.590   1.00 45.24 ? 48   VAL D N   1 
ATOM   8601  C CA  . VAL D 1 49  ? 36.603  -13.020 8.345   1.00 45.25 ? 48   VAL D CA  1 
ATOM   8602  C C   . VAL D 1 49  ? 36.977  -12.413 9.699   1.00 45.40 ? 48   VAL D C   1 
ATOM   8603  O O   . VAL D 1 49  ? 36.097  -12.279 10.564  1.00 45.27 ? 48   VAL D O   1 
ATOM   8604  C CB  . VAL D 1 49  ? 35.895  -12.038 7.394   1.00 45.02 ? 48   VAL D CB  1 
ATOM   8605  C CG1 . VAL D 1 49  ? 36.659  -10.732 7.216   1.00 44.60 ? 48   VAL D CG1 1 
ATOM   8606  C CG2 . VAL D 1 49  ? 35.576  -12.670 6.051   1.00 44.55 ? 48   VAL D CG2 1 
ATOM   8607  N N   . GLU D 1 50  ? 38.242  -12.079 9.831   1.00 45.71 ? 49   GLU D N   1 
ATOM   8608  C CA  . GLU D 1 50  ? 38.797  -11.496 11.057  1.00 46.14 ? 49   GLU D CA  1 
ATOM   8609  C C   . GLU D 1 50  ? 38.360  -10.043 11.204  1.00 45.77 ? 49   GLU D C   1 
ATOM   8610  O O   . GLU D 1 50  ? 38.416  -9.262  10.244  1.00 45.55 ? 49   GLU D O   1 
ATOM   8611  C CB  . GLU D 1 50  ? 40.319  -11.545 11.097  1.00 48.36 ? 49   GLU D CB  1 
ATOM   8612  C CG  . GLU D 1 50  ? 41.026  -10.840 12.253  1.00 51.00 ? 49   GLU D CG  1 
ATOM   8613  C CD  . GLU D 1 50  ? 42.455  -11.210 12.515  1.00 52.44 ? 49   GLU D CD  1 
ATOM   8614  O OE1 . GLU D 1 50  ? 43.215  -11.663 11.678  1.00 53.27 ? 49   GLU D OE1 1 
ATOM   8615  O OE2 . GLU D 1 50  ? 42.790  -10.998 13.708  1.00 53.02 ? 49   GLU D OE2 1 
ATOM   8616  N N   . ASN D 1 51  ? 37.930  -9.718  12.413  1.00 45.43 ? 50   ASN D N   1 
ATOM   8617  C CA  . ASN D 1 51  ? 37.444  -8.380  12.751  1.00 45.12 ? 50   ASN D CA  1 
ATOM   8618  C C   . ASN D 1 51  ? 38.604  -7.394  12.911  1.00 44.90 ? 50   ASN D C   1 
ATOM   8619  O O   . ASN D 1 51  ? 39.104  -7.182  14.026  1.00 45.04 ? 50   ASN D O   1 
ATOM   8620  C CB  . ASN D 1 51  ? 36.526  -8.387  13.977  1.00 45.29 ? 50   ASN D CB  1 
ATOM   8621  C CG  . ASN D 1 51  ? 35.963  -6.992  14.225  1.00 45.54 ? 50   ASN D CG  1 
ATOM   8622  O OD1 . ASN D 1 51  ? 35.840  -6.203  13.272  1.00 45.73 ? 50   ASN D OD1 1 
ATOM   8623  N ND2 . ASN D 1 51  ? 35.638  -6.682  15.475  1.00 45.41 ? 50   ASN D ND2 1 
ATOM   8624  N N   . THR D 1 52  ? 38.984  -6.815  11.791  1.00 44.37 ? 51   THR D N   1 
ATOM   8625  C CA  . THR D 1 52  ? 40.041  -5.796  11.732  1.00 43.86 ? 51   THR D CA  1 
ATOM   8626  C C   . THR D 1 52  ? 39.409  -4.506  11.211  1.00 43.76 ? 51   THR D C   1 
ATOM   8627  O O   . THR D 1 52  ? 38.340  -4.578  10.571  1.00 43.74 ? 51   THR D O   1 
ATOM   8628  C CB  . THR D 1 52  ? 41.254  -6.262  10.845  1.00 43.91 ? 51   THR D CB  1 
ATOM   8629  O OG1 . THR D 1 52  ? 41.025  -5.723  9.503   1.00 44.10 ? 51   THR D OG1 1 
ATOM   8630  C CG2 . THR D 1 52  ? 41.444  -7.782  10.805  1.00 43.82 ? 51   THR D CG2 1 
ATOM   8631  N N   . GLU D 1 53  ? 40.066  -3.391  11.489  1.00 43.32 ? 52   GLU D N   1 
ATOM   8632  C CA  . GLU D 1 53  ? 39.588  -2.091  11.022  1.00 43.13 ? 52   GLU D CA  1 
ATOM   8633  C C   . GLU D 1 53  ? 39.470  -2.065  9.498   1.00 42.58 ? 52   GLU D C   1 
ATOM   8634  O O   . GLU D 1 53  ? 38.554  -1.437  8.944   1.00 42.56 ? 52   GLU D O   1 
ATOM   8635  C CB  . GLU D 1 53  ? 40.493  -0.924  11.411  1.00 44.43 ? 52   GLU D CB  1 
ATOM   8636  C CG  . GLU D 1 53  ? 39.972  0.465   11.055  1.00 46.19 ? 52   GLU D CG  1 
ATOM   8637  C CD  . GLU D 1 53  ? 40.844  1.631   11.390  1.00 47.14 ? 52   GLU D CD  1 
ATOM   8638  O OE1 . GLU D 1 53  ? 41.851  1.570   12.074  1.00 47.95 ? 52   GLU D OE1 1 
ATOM   8639  O OE2 . GLU D 1 53  ? 40.409  2.694   10.883  1.00 48.08 ? 52   GLU D OE2 1 
ATOM   8640  N N   . ASP D 1 54  ? 40.388  -2.763  8.850   1.00 41.97 ? 53   ASP D N   1 
ATOM   8641  C CA  . ASP D 1 54  ? 40.465  -2.746  7.381   1.00 41.02 ? 53   ASP D CA  1 
ATOM   8642  C C   . ASP D 1 54  ? 39.548  -3.779  6.749   1.00 39.64 ? 53   ASP D C   1 
ATOM   8643  O O   . ASP D 1 54  ? 39.111  -3.552  5.598   1.00 39.65 ? 53   ASP D O   1 
ATOM   8644  C CB  . ASP D 1 54  ? 41.916  -2.805  6.907   1.00 43.62 ? 53   ASP D CB  1 
ATOM   8645  C CG  . ASP D 1 54  ? 42.145  -1.940  5.677   1.00 45.52 ? 53   ASP D CG  1 
ATOM   8646  O OD1 . ASP D 1 54  ? 42.152  -0.699  5.861   1.00 46.62 ? 53   ASP D OD1 1 
ATOM   8647  O OD2 . ASP D 1 54  ? 42.297  -2.463  4.564   1.00 46.52 ? 53   ASP D OD2 1 
ATOM   8648  N N   . ASN D 1 55  ? 39.282  -4.868  7.445   1.00 37.96 ? 54   ASN D N   1 
ATOM   8649  C CA  . ASN D 1 55  ? 38.354  -5.893  6.894   1.00 36.05 ? 54   ASN D CA  1 
ATOM   8650  C C   . ASN D 1 55  ? 36.937  -5.289  6.907   1.00 34.59 ? 54   ASN D C   1 
ATOM   8651  O O   . ASN D 1 55  ? 36.138  -5.565  6.000   1.00 33.96 ? 54   ASN D O   1 
ATOM   8652  C CB  . ASN D 1 55  ? 38.457  -7.223  7.603   1.00 37.02 ? 54   ASN D CB  1 
ATOM   8653  C CG  . ASN D 1 55  ? 39.708  -8.003  7.243   1.00 37.54 ? 54   ASN D CG  1 
ATOM   8654  O OD1 . ASN D 1 55  ? 40.437  -7.610  6.322   1.00 38.19 ? 54   ASN D OD1 1 
ATOM   8655  N ND2 . ASN D 1 55  ? 39.958  -9.081  7.973   1.00 37.95 ? 54   ASN D ND2 1 
ATOM   8656  N N   . ARG D 1 56  ? 36.713  -4.506  7.951   1.00 32.50 ? 55   ARG D N   1 
ATOM   8657  C CA  . ARG D 1 56  ? 35.456  -3.778  8.142   1.00 30.86 ? 55   ARG D CA  1 
ATOM   8658  C C   . ARG D 1 56  ? 35.353  -2.693  7.065   1.00 29.27 ? 55   ARG D C   1 
ATOM   8659  O O   . ARG D 1 56  ? 34.270  -2.361  6.565   1.00 28.91 ? 55   ARG D O   1 
ATOM   8660  C CB  . ARG D 1 56  ? 35.361  -3.144  9.534   1.00 31.88 ? 55   ARG D CB  1 
ATOM   8661  C CG  . ARG D 1 56  ? 35.027  -4.118  10.652  1.00 33.76 ? 55   ARG D CG  1 
ATOM   8662  C CD  . ARG D 1 56  ? 34.666  -3.440  11.928  1.00 35.38 ? 55   ARG D CD  1 
ATOM   8663  N NE  . ARG D 1 56  ? 35.525  -2.299  12.211  1.00 37.94 ? 55   ARG D NE  1 
ATOM   8664  C CZ  . ARG D 1 56  ? 36.588  -2.332  13.009  1.00 38.46 ? 55   ARG D CZ  1 
ATOM   8665  N NH1 . ARG D 1 56  ? 37.063  -3.485  13.474  1.00 40.26 ? 55   ARG D NH1 1 
ATOM   8666  N NH2 . ARG D 1 56  ? 37.193  -1.203  13.365  1.00 39.07 ? 55   ARG D NH2 1 
ATOM   8667  N N   . ARG D 1 57  ? 36.526  -2.171  6.750   1.00 27.53 ? 56   ARG D N   1 
ATOM   8668  C CA  . ARG D 1 57  ? 36.679  -1.103  5.750   1.00 26.30 ? 56   ARG D CA  1 
ATOM   8669  C C   . ARG D 1 57  ? 36.408  -1.682  4.359   1.00 24.70 ? 56   ARG D C   1 
ATOM   8670  O O   . ARG D 1 57  ? 35.687  -1.075  3.558   1.00 24.75 ? 56   ARG D O   1 
ATOM   8671  C CB  . ARG D 1 57  ? 38.039  -0.439  5.839   1.00 27.58 ? 56   ARG D CB  1 
ATOM   8672  C CG  . ARG D 1 57  ? 38.138  0.976   5.315   1.00 29.24 ? 56   ARG D CG  1 
ATOM   8673  C CD  . ARG D 1 57  ? 39.527  1.531   5.551   1.00 31.33 ? 56   ARG D CD  1 
ATOM   8674  N NE  . ARG D 1 57  ? 39.971  2.157   4.289   1.00 32.53 ? 56   ARG D NE  1 
ATOM   8675  C CZ  . ARG D 1 57  ? 40.395  1.370   3.286   1.00 32.24 ? 56   ARG D CZ  1 
ATOM   8676  N NH1 . ARG D 1 57  ? 40.615  0.081   3.476   1.00 33.44 ? 56   ARG D NH1 1 
ATOM   8677  N NH2 . ARG D 1 57  ? 40.416  1.878   2.055   1.00 32.80 ? 56   ARG D NH2 1 
ATOM   8678  N N   . ALA D 1 58  ? 36.965  -2.845  4.129   1.00 22.90 ? 57   ALA D N   1 
ATOM   8679  C CA  . ALA D 1 58  ? 36.830  -3.607  2.898   1.00 21.51 ? 57   ALA D CA  1 
ATOM   8680  C C   . ALA D 1 58  ? 35.360  -3.937  2.621   1.00 20.17 ? 57   ALA D C   1 
ATOM   8681  O O   . ALA D 1 58  ? 34.879  -3.884  1.478   1.00 20.07 ? 57   ALA D O   1 
ATOM   8682  C CB  . ALA D 1 58  ? 37.673  -4.868  2.983   1.00 20.37 ? 57   ALA D CB  1 
ATOM   8683  N N   . TYR D 1 59  ? 34.666  -4.274  3.696   1.00 18.73 ? 58   TYR D N   1 
ATOM   8684  C CA  . TYR D 1 59  ? 33.255  -4.622  3.634   1.00 17.06 ? 58   TYR D CA  1 
ATOM   8685  C C   . TYR D 1 59  ? 32.423  -3.388  3.305   1.00 16.33 ? 58   TYR D C   1 
ATOM   8686  O O   . TYR D 1 59  ? 31.530  -3.490  2.453   1.00 16.24 ? 58   TYR D O   1 
ATOM   8687  C CB  . TYR D 1 59  ? 32.743  -5.353  4.888   1.00 15.66 ? 58   TYR D CB  1 
ATOM   8688  C CG  . TYR D 1 59  ? 31.239  -5.578  4.796   1.00 15.08 ? 58   TYR D CG  1 
ATOM   8689  C CD1 . TYR D 1 59  ? 30.722  -6.433  3.822   1.00 13.92 ? 58   TYR D CD1 1 
ATOM   8690  C CD2 . TYR D 1 59  ? 30.354  -4.894  5.629   1.00 14.03 ? 58   TYR D CD2 1 
ATOM   8691  C CE1 . TYR D 1 59  ? 29.350  -6.630  3.690   1.00 14.67 ? 58   TYR D CE1 1 
ATOM   8692  C CE2 . TYR D 1 59  ? 28.979  -5.097  5.511   1.00 15.23 ? 58   TYR D CE2 1 
ATOM   8693  C CZ  . TYR D 1 59  ? 28.482  -5.966  4.546   1.00 14.68 ? 58   TYR D CZ  1 
ATOM   8694  O OH  . TYR D 1 59  ? 27.138  -6.181  4.392   1.00 15.79 ? 58   TYR D OH  1 
ATOM   8695  N N   . ARG D 1 60  ? 32.729  -2.286  3.966   1.00 16.01 ? 59   ARG D N   1 
ATOM   8696  C CA  . ARG D 1 60  ? 32.025  -1.014  3.779   1.00 15.85 ? 59   ARG D CA  1 
ATOM   8697  C C   . ARG D 1 60  ? 32.305  -0.497  2.351   1.00 15.15 ? 59   ARG D C   1 
ATOM   8698  O O   . ARG D 1 60  ? 31.440  0.071   1.679   1.00 13.85 ? 59   ARG D O   1 
ATOM   8699  C CB  . ARG D 1 60  ? 32.354  0.050   4.807   1.00 17.86 ? 59   ARG D CB  1 
ATOM   8700  C CG  . ARG D 1 60  ? 31.947  -0.179  6.256   1.00 20.62 ? 59   ARG D CG  1 
ATOM   8701  C CD  . ARG D 1 60  ? 30.728  -0.976  6.420   1.00 23.14 ? 59   ARG D CD  1 
ATOM   8702  N NE  . ARG D 1 60  ? 30.208  -1.253  7.723   1.00 23.36 ? 59   ARG D NE  1 
ATOM   8703  C CZ  . ARG D 1 60  ? 30.593  -0.879  8.930   1.00 24.65 ? 59   ARG D CZ  1 
ATOM   8704  N NH1 . ARG D 1 60  ? 31.715  -0.209  9.189   1.00 24.99 ? 59   ARG D NH1 1 
ATOM   8705  N NH2 . ARG D 1 60  ? 29.756  -1.085  9.968   1.00 23.96 ? 59   ARG D NH2 1 
ATOM   8706  N N   . GLN D 1 61  ? 33.534  -0.754  1.929   1.00 14.86 ? 60   GLN D N   1 
ATOM   8707  C CA  . GLN D 1 61  ? 33.970  -0.377  0.560   1.00 14.92 ? 60   GLN D CA  1 
ATOM   8708  C C   . GLN D 1 61  ? 33.090  -1.072  -0.476  1.00 14.88 ? 60   GLN D C   1 
ATOM   8709  O O   . GLN D 1 61  ? 32.680  -0.430  -1.472  1.00 15.78 ? 60   GLN D O   1 
ATOM   8710  C CB  . GLN D 1 61  ? 35.451  -0.665  0.342   1.00 15.15 ? 60   GLN D CB  1 
ATOM   8711  C CG  . GLN D 1 61  ? 35.958  -0.286  -1.044  1.00 15.98 ? 60   GLN D CG  1 
ATOM   8712  C CD  . GLN D 1 61  ? 37.479  -0.300  -1.082  1.00 15.67 ? 60   GLN D CD  1 
ATOM   8713  O OE1 . GLN D 1 61  ? 38.125  0.609   -0.591  1.00 16.35 ? 60   GLN D OE1 1 
ATOM   8714  N NE2 . GLN D 1 61  ? 38.047  -1.363  -1.661  1.00 14.90 ? 60   GLN D NE2 1 
ATOM   8715  N N   . LEU D 1 62  ? 32.805  -2.338  -0.231  1.00 14.31 ? 61   LEU D N   1 
ATOM   8716  C CA  . LEU D 1 62  ? 31.968  -3.131  -1.139  1.00 14.10 ? 61   LEU D CA  1 
ATOM   8717  C C   . LEU D 1 62  ? 30.572  -2.522  -1.251  1.00 14.18 ? 61   LEU D C   1 
ATOM   8718  O O   . LEU D 1 62  ? 30.033  -2.308  -2.355  1.00 12.94 ? 61   LEU D O   1 
ATOM   8719  C CB  . LEU D 1 62  ? 31.968  -4.578  -0.675  1.00 15.37 ? 61   LEU D CB  1 
ATOM   8720  C CG  . LEU D 1 62  ? 31.302  -5.592  -1.603  1.00 17.39 ? 61   LEU D CG  1 
ATOM   8721  C CD1 . LEU D 1 62  ? 31.912  -6.967  -1.399  1.00 19.70 ? 61   LEU D CD1 1 
ATOM   8722  C CD2 . LEU D 1 62  ? 29.809  -5.649  -1.276  1.00 19.22 ? 61   LEU D CD2 1 
ATOM   8723  N N   . LEU D 1 63  ? 30.000  -2.282  -0.075  1.00 14.02 ? 62   LEU D N   1 
ATOM   8724  C CA  . LEU D 1 63  ? 28.642  -1.728  -0.006  1.00 14.11 ? 62   LEU D CA  1 
ATOM   8725  C C   . LEU D 1 63  ? 28.538  -0.421  -0.790  1.00 14.23 ? 62   LEU D C   1 
ATOM   8726  O O   . LEU D 1 63  ? 27.662  -0.263  -1.666  1.00 14.55 ? 62   LEU D O   1 
ATOM   8727  C CB  . LEU D 1 63  ? 28.288  -1.546  1.473   1.00 14.99 ? 62   LEU D CB  1 
ATOM   8728  C CG  . LEU D 1 63  ? 27.996  -2.753  2.322   1.00 15.70 ? 62   LEU D CG  1 
ATOM   8729  C CD1 . LEU D 1 63  ? 27.458  -2.309  3.687   1.00 14.68 ? 62   LEU D CD1 1 
ATOM   8730  C CD2 . LEU D 1 63  ? 26.965  -3.638  1.616   1.00 15.18 ? 62   LEU D CD2 1 
ATOM   8731  N N   . PHE D 1 64  ? 29.444  0.476   -0.453  1.00 13.52 ? 63   PHE D N   1 
ATOM   8732  C CA  . PHE D 1 64  ? 29.385  1.860   -0.924  1.00 14.21 ? 63   PHE D CA  1 
ATOM   8733  C C   . PHE D 1 64  ? 29.826  2.019   -2.377  1.00 13.76 ? 63   PHE D C   1 
ATOM   8734  O O   . PHE D 1 64  ? 29.434  3.039   -2.970  1.00 13.95 ? 63   PHE D O   1 
ATOM   8735  C CB  . PHE D 1 64  ? 30.097  2.819   0.028   1.00 13.63 ? 63   PHE D CB  1 
ATOM   8736  C CG  . PHE D 1 64  ? 29.663  2.713   1.470   1.00 13.25 ? 63   PHE D CG  1 
ATOM   8737  C CD1 . PHE D 1 64  ? 28.347  2.391   1.776   1.00 13.13 ? 63   PHE D CD1 1 
ATOM   8738  C CD2 . PHE D 1 64  ? 30.565  2.993   2.492   1.00 13.96 ? 63   PHE D CD2 1 
ATOM   8739  C CE1 . PHE D 1 64  ? 27.913  2.305   3.091   1.00 14.34 ? 63   PHE D CE1 1 
ATOM   8740  C CE2 . PHE D 1 64  ? 30.156  2.927   3.831   1.00 13.65 ? 63   PHE D CE2 1 
ATOM   8741  C CZ  . PHE D 1 64  ? 28.829  2.575   4.118   1.00 14.22 ? 63   PHE D CZ  1 
ATOM   8742  N N   . SER D 1 65  ? 30.555  1.065   -2.907  1.00 14.55 ? 64   SER D N   1 
ATOM   8743  C CA  . SER D 1 65  ? 31.059  1.215   -4.302  1.00 14.77 ? 64   SER D CA  1 
ATOM   8744  C C   . SER D 1 65  ? 30.069  0.601   -5.282  1.00 15.09 ? 64   SER D C   1 
ATOM   8745  O O   . SER D 1 65  ? 30.361  0.462   -6.480  1.00 14.99 ? 64   SER D O   1 
ATOM   8746  C CB  . SER D 1 65  ? 32.458  0.648   -4.453  1.00 13.86 ? 64   SER D CB  1 
ATOM   8747  O OG  . SER D 1 65  ? 32.491  -0.748  -4.249  1.00 15.20 ? 64   SER D OG  1 
ATOM   8748  N N   . THR D 1 66  ? 28.906  0.244   -4.756  1.00 14.77 ? 65   THR D N   1 
ATOM   8749  C CA  . THR D 1 66  ? 27.833  -0.361  -5.552  1.00 14.60 ? 65   THR D CA  1 
ATOM   8750  C C   . THR D 1 66  ? 27.349  0.595   -6.635  1.00 14.84 ? 65   THR D C   1 
ATOM   8751  O O   . THR D 1 66  ? 27.326  1.822   -6.479  1.00 15.08 ? 65   THR D O   1 
ATOM   8752  C CB  . THR D 1 66  ? 26.649  -0.845  -4.623  1.00 13.30 ? 65   THR D CB  1 
ATOM   8753  O OG1 . THR D 1 66  ? 27.222  -1.883  -3.755  1.00 11.71 ? 65   THR D OG1 1 
ATOM   8754  C CG2 . THR D 1 66  ? 25.436  -1.389  -5.381  1.00 12.94 ? 65   THR D CG2 1 
ATOM   8755  N N   . ASP D 1 67  ? 26.968  0.008   -7.748  1.00 15.81 ? 66   ASP D N   1 
ATOM   8756  C CA  . ASP D 1 67  ? 26.395  0.722   -8.916  1.00 16.36 ? 66   ASP D CA  1 
ATOM   8757  C C   . ASP D 1 67  ? 25.420  1.789   -8.439  1.00 16.54 ? 66   ASP D C   1 
ATOM   8758  O O   . ASP D 1 67  ? 24.583  1.521   -7.556  1.00 16.05 ? 66   ASP D O   1 
ATOM   8759  C CB  . ASP D 1 67  ? 25.752  -0.351  -9.800  1.00 19.75 ? 66   ASP D CB  1 
ATOM   8760  C CG  . ASP D 1 67  ? 25.270  0.143   -11.140 1.00 23.04 ? 66   ASP D CG  1 
ATOM   8761  O OD1 . ASP D 1 67  ? 25.437  1.309   -11.500 1.00 26.15 ? 66   ASP D OD1 1 
ATOM   8762  O OD2 . ASP D 1 67  ? 24.697  -0.703  -11.854 1.00 25.93 ? 66   ASP D OD2 1 
ATOM   8763  N N   . PRO D 1 68  ? 25.527  2.970   -9.031  1.00 16.17 ? 67   PRO D N   1 
ATOM   8764  C CA  . PRO D 1 68  ? 24.679  4.104   -8.689  1.00 16.11 ? 67   PRO D CA  1 
ATOM   8765  C C   . PRO D 1 68  ? 23.200  3.792   -8.861  1.00 15.83 ? 67   PRO D C   1 
ATOM   8766  O O   . PRO D 1 68  ? 22.360  4.636   -8.496  1.00 16.33 ? 67   PRO D O   1 
ATOM   8767  C CB  . PRO D 1 68  ? 25.128  5.248   -9.583  1.00 16.15 ? 67   PRO D CB  1 
ATOM   8768  C CG  . PRO D 1 68  ? 26.472  4.866   -10.102 1.00 16.63 ? 67   PRO D CG  1 
ATOM   8769  C CD  . PRO D 1 68  ? 26.697  3.401   -9.826  1.00 16.38 ? 67   PRO D CD  1 
ATOM   8770  N N   . LYS D 1 69  ? 22.912  2.641   -9.399  1.00 15.52 ? 68   LYS D N   1 
ATOM   8771  C CA  . LYS D 1 69  ? 21.540  2.144   -9.590  1.00 16.09 ? 68   LYS D CA  1 
ATOM   8772  C C   . LYS D 1 69  ? 20.864  1.993   -8.213  1.00 14.90 ? 68   LYS D C   1 
ATOM   8773  O O   . LYS D 1 69  ? 19.635  2.124   -8.062  1.00 14.31 ? 68   LYS D O   1 
ATOM   8774  C CB  . LYS D 1 69  ? 21.541  0.768   -10.255 1.00 18.38 ? 68   LYS D CB  1 
ATOM   8775  C CG  . LYS D 1 69  ? 20.187  0.361   -10.836 1.00 23.32 ? 68   LYS D CG  1 
ATOM   8776  C CD  . LYS D 1 69  ? 19.826  -1.077  -10.487 1.00 26.30 ? 68   LYS D CD  1 
ATOM   8777  C CE  . LYS D 1 69  ? 18.908  -1.149  -9.279  1.00 27.02 ? 68   LYS D CE  1 
ATOM   8778  N NZ  . LYS D 1 69  ? 18.750  -2.561  -8.819  1.00 29.03 ? 68   LYS D NZ  1 
ATOM   8779  N N   . LEU D 1 70  ? 21.714  1.707   -7.243  1.00 13.94 ? 69   LEU D N   1 
ATOM   8780  C CA  . LEU D 1 70  ? 21.284  1.503   -5.846  1.00 12.93 ? 69   LEU D CA  1 
ATOM   8781  C C   . LEU D 1 70  ? 20.458  2.684   -5.348  1.00 11.88 ? 69   LEU D C   1 
ATOM   8782  O O   . LEU D 1 70  ? 19.492  2.486   -4.571  1.00 11.99 ? 69   LEU D O   1 
ATOM   8783  C CB  . LEU D 1 70  ? 22.548  1.241   -4.998  1.00 13.31 ? 69   LEU D CB  1 
ATOM   8784  C CG  . LEU D 1 70  ? 22.298  0.882   -3.526  1.00 12.39 ? 69   LEU D CG  1 
ATOM   8785  C CD1 . LEU D 1 70  ? 21.791  -0.550  -3.424  1.00 13.78 ? 69   LEU D CD1 1 
ATOM   8786  C CD2 . LEU D 1 70  ? 23.631  1.001   -2.779  1.00 14.48 ? 69   LEU D CD2 1 
ATOM   8787  N N   . ALA D 1 71  ? 20.826  3.878   -5.761  1.00 11.39 ? 70   ALA D N   1 
ATOM   8788  C CA  . ALA D 1 71  ? 20.173  5.109   -5.302  1.00 11.67 ? 70   ALA D CA  1 
ATOM   8789  C C   . ALA D 1 71  ? 18.715  5.203   -5.728  1.00 12.07 ? 70   ALA D C   1 
ATOM   8790  O O   . ALA D 1 71  ? 17.979  6.085   -5.216  1.00 12.15 ? 70   ALA D O   1 
ATOM   8791  C CB  . ALA D 1 71  ? 20.947  6.355   -5.675  1.00 10.64 ? 70   ALA D CB  1 
ATOM   8792  N N   . GLU D 1 72  ? 18.312  4.348   -6.657  1.00 12.52 ? 71   GLU D N   1 
ATOM   8793  C CA  . GLU D 1 72  ? 16.899  4.301   -7.052  1.00 12.54 ? 71   GLU D CA  1 
ATOM   8794  C C   . GLU D 1 72  ? 16.048  3.766   -5.907  1.00 11.43 ? 71   GLU D C   1 
ATOM   8795  O O   . GLU D 1 72  ? 14.859  4.110   -5.854  1.00 10.83 ? 71   GLU D O   1 
ATOM   8796  C CB  . GLU D 1 72  ? 16.628  3.374   -8.250  1.00 14.77 ? 71   GLU D CB  1 
ATOM   8797  C CG  . GLU D 1 72  ? 16.916  4.005   -9.600  1.00 19.88 ? 71   GLU D CG  1 
ATOM   8798  C CD  . GLU D 1 72  ? 16.902  3.138   -10.812 1.00 22.58 ? 71   GLU D CD  1 
ATOM   8799  O OE1 . GLU D 1 72  ? 16.520  1.968   -10.619 1.00 25.53 ? 71   GLU D OE1 1 
ATOM   8800  O OE2 . GLU D 1 72  ? 17.246  3.565   -11.909 1.00 26.29 ? 71   GLU D OE2 1 
ATOM   8801  N N   . ASN D 1 73  ? 16.673  2.963   -5.059  1.00 10.57 ? 72   ASN D N   1 
ATOM   8802  C CA  . ASN D 1 73  ? 15.913  2.308   -3.973  1.00 10.82 ? 72   ASN D CA  1 
ATOM   8803  C C   . ASN D 1 73  ? 16.436  2.697   -2.594  1.00 10.77 ? 72   ASN D C   1 
ATOM   8804  O O   . ASN D 1 73  ? 15.696  2.512   -1.605  1.00 10.19 ? 72   ASN D O   1 
ATOM   8805  C CB  . ASN D 1 73  ? 15.831  0.800   -4.202  1.00 10.83 ? 72   ASN D CB  1 
ATOM   8806  C CG  . ASN D 1 73  ? 15.057  0.416   -5.467  1.00 12.60 ? 72   ASN D CG  1 
ATOM   8807  O OD1 . ASN D 1 73  ? 13.857  0.734   -5.611  1.00 13.44 ? 72   ASN D OD1 1 
ATOM   8808  N ND2 . ASN D 1 73  ? 15.737  -0.272  -6.361  1.00 10.71 ? 72   ASN D ND2 1 
ATOM   8809  N N   . ILE D 1 74  ? 17.656  3.190   -2.523  1.00 10.43 ? 73   ILE D N   1 
ATOM   8810  C CA  . ILE D 1 74  ? 18.260  3.621   -1.246  1.00 9.24  ? 73   ILE D CA  1 
ATOM   8811  C C   . ILE D 1 74  ? 18.426  5.131   -1.235  1.00 9.48  ? 73   ILE D C   1 
ATOM   8812  O O   . ILE D 1 74  ? 19.211  5.710   -2.016  1.00 8.69  ? 73   ILE D O   1 
ATOM   8813  C CB  . ILE D 1 74  ? 19.621  2.871   -1.014  1.00 10.70 ? 73   ILE D CB  1 
ATOM   8814  C CG1 . ILE D 1 74  ? 19.447  1.350   -1.044  1.00 8.72  ? 73   ILE D CG1 1 
ATOM   8815  C CG2 . ILE D 1 74  ? 20.322  3.358   0.293   1.00 10.70 ? 73   ILE D CG2 1 
ATOM   8816  C CD1 . ILE D 1 74  ? 18.513  0.786   0.068   1.00 7.91  ? 73   ILE D CD1 1 
ATOM   8817  N N   . SER D 1 75  ? 17.670  5.789   -0.344  1.00 8.33  ? 74   SER D N   1 
ATOM   8818  C CA  . SER D 1 75  ? 17.725  7.236   -0.223  1.00 7.77  ? 74   SER D CA  1 
ATOM   8819  C C   . SER D 1 75  ? 18.788  7.723   0.768   1.00 6.96  ? 74   SER D C   1 
ATOM   8820  O O   . SER D 1 75  ? 19.236  8.875   0.643   1.00 6.26  ? 74   SER D O   1 
ATOM   8821  C CB  . SER D 1 75  ? 16.375  7.821   0.238   1.00 9.05  ? 74   SER D CB  1 
ATOM   8822  O OG  . SER D 1 75  ? 16.076  7.260   1.514   1.00 7.71  ? 74   SER D OG  1 
ATOM   8823  N N   . GLY D 1 76  ? 19.079  6.886   1.733   1.00 6.73  ? 75   GLY D N   1 
ATOM   8824  C CA  . GLY D 1 76  ? 20.006  7.309   2.812   1.00 6.83  ? 75   GLY D CA  1 
ATOM   8825  C C   . GLY D 1 76  ? 20.677  6.098   3.414   1.00 6.15  ? 75   GLY D C   1 
ATOM   8826  O O   . GLY D 1 76  ? 20.201  4.980   3.286   1.00 6.80  ? 75   GLY D O   1 
ATOM   8827  N N   . VAL D 1 77  ? 21.805  6.368   4.064   1.00 6.28  ? 76   VAL D N   1 
ATOM   8828  C CA  . VAL D 1 77  ? 22.606  5.328   4.710   1.00 6.79  ? 76   VAL D CA  1 
ATOM   8829  C C   . VAL D 1 77  ? 22.926  5.867   6.122   1.00 6.47  ? 76   VAL D C   1 
ATOM   8830  O O   . VAL D 1 77  ? 23.332  7.018   6.223   1.00 6.46  ? 76   VAL D O   1 
ATOM   8831  C CB  . VAL D 1 77  ? 23.898  5.019   3.930   1.00 9.05  ? 76   VAL D CB  1 
ATOM   8832  C CG1 . VAL D 1 77  ? 24.832  4.089   4.695   1.00 9.16  ? 76   VAL D CG1 1 
ATOM   8833  C CG2 . VAL D 1 77  ? 23.614  4.464   2.539   1.00 8.81  ? 76   VAL D CG2 1 
ATOM   8834  N N   . ILE D 1 78  ? 22.690  5.005   7.085   1.00 7.37  ? 77   ILE D N   1 
ATOM   8835  C CA  . ILE D 1 78  ? 23.051  5.375   8.470   1.00 8.37  ? 77   ILE D CA  1 
ATOM   8836  C C   . ILE D 1 78  ? 24.454  4.815   8.715   1.00 8.42  ? 77   ILE D C   1 
ATOM   8837  O O   . ILE D 1 78  ? 24.652  3.621   8.512   1.00 9.84  ? 77   ILE D O   1 
ATOM   8838  C CB  . ILE D 1 78  ? 22.058  4.802   9.541   1.00 8.53  ? 77   ILE D CB  1 
ATOM   8839  C CG1 . ILE D 1 78  ? 20.607  5.125   9.123   1.00 8.35  ? 77   ILE D CG1 1 
ATOM   8840  C CG2 . ILE D 1 78  ? 22.423  5.421   10.944  1.00 8.05  ? 77   ILE D CG2 1 
ATOM   8841  C CD1 . ILE D 1 78  ? 19.547  4.342   9.984   1.00 9.02  ? 77   ILE D CD1 1 
ATOM   8842  N N   . LEU D 1 79  ? 25.315  5.703   9.151   1.00 9.96  ? 78   LEU D N   1 
ATOM   8843  C CA  . LEU D 1 79  ? 26.708  5.328   9.401   1.00 10.93 ? 78   LEU D CA  1 
ATOM   8844  C C   . LEU D 1 79  ? 27.017  5.380   10.909  1.00 11.92 ? 78   LEU D C   1 
ATOM   8845  O O   . LEU D 1 79  ? 26.395  6.131   11.663  1.00 10.57 ? 78   LEU D O   1 
ATOM   8846  C CB  . LEU D 1 79  ? 27.579  6.333   8.647   1.00 10.94 ? 78   LEU D CB  1 
ATOM   8847  C CG  . LEU D 1 79  ? 27.405  6.446   7.138   1.00 10.87 ? 78   LEU D CG  1 
ATOM   8848  C CD1 . LEU D 1 79  ? 28.211  7.624   6.630   1.00 11.69 ? 78   LEU D CD1 1 
ATOM   8849  C CD2 . LEU D 1 79  ? 27.878  5.151   6.491   1.00 10.95 ? 78   LEU D CD2 1 
ATOM   8850  N N   . PHE D 1 80  ? 28.010  4.572   11.199  1.00 12.74 ? 79   PHE D N   1 
ATOM   8851  C CA  . PHE D 1 80  ? 28.663  4.609   12.536  1.00 14.20 ? 79   PHE D CA  1 
ATOM   8852  C C   . PHE D 1 80  ? 29.746  5.684   12.427  1.00 14.76 ? 79   PHE D C   1 
ATOM   8853  O O   . PHE D 1 80  ? 30.305  5.868   11.319  1.00 14.08 ? 79   PHE D O   1 
ATOM   8854  C CB  . PHE D 1 80  ? 29.187  3.233   12.892  1.00 17.18 ? 79   PHE D CB  1 
ATOM   8855  C CG  . PHE D 1 80  ? 29.920  3.131   14.192  1.00 20.53 ? 79   PHE D CG  1 
ATOM   8856  C CD1 . PHE D 1 80  ? 29.239  3.302   15.395  1.00 21.76 ? 79   PHE D CD1 1 
ATOM   8857  C CD2 . PHE D 1 80  ? 31.294  2.874   14.196  1.00 21.28 ? 79   PHE D CD2 1 
ATOM   8858  C CE1 . PHE D 1 80  ? 29.916  3.207   16.621  1.00 22.30 ? 79   PHE D CE1 1 
ATOM   8859  C CE2 . PHE D 1 80  ? 31.986  2.782   15.397  1.00 22.78 ? 79   PHE D CE2 1 
ATOM   8860  C CZ  . PHE D 1 80  ? 31.298  2.944   16.610  1.00 23.85 ? 79   PHE D CZ  1 
ATOM   8861  N N   . HIS D 1 81  ? 29.993  6.372   13.510  1.00 14.03 ? 80   HIS D N   1 
ATOM   8862  C CA  . HIS D 1 81  ? 30.968  7.445   13.625  1.00 15.09 ? 80   HIS D CA  1 
ATOM   8863  C C   . HIS D 1 81  ? 32.276  7.110   12.906  1.00 15.49 ? 80   HIS D C   1 
ATOM   8864  O O   . HIS D 1 81  ? 32.715  7.927   12.083  1.00 15.36 ? 80   HIS D O   1 
ATOM   8865  C CB  . HIS D 1 81  ? 31.288  7.820   15.104  1.00 14.20 ? 80   HIS D CB  1 
ATOM   8866  C CG  . HIS D 1 81  ? 32.171  9.020   15.225  1.00 12.74 ? 80   HIS D CG  1 
ATOM   8867  N ND1 . HIS D 1 81  ? 31.722  10.295  15.369  1.00 11.95 ? 80   HIS D ND1 1 
ATOM   8868  C CD2 . HIS D 1 81  ? 33.527  9.100   15.222  1.00 12.64 ? 80   HIS D CD2 1 
ATOM   8869  C CE1 . HIS D 1 81  ? 32.755  11.123  15.446  1.00 13.66 ? 80   HIS D CE1 1 
ATOM   8870  N NE2 . HIS D 1 81  ? 33.854  10.425  15.357  1.00 13.31 ? 80   HIS D NE2 1 
ATOM   8871  N N   . GLU D 1 82  ? 32.859  5.960   13.201  1.00 16.23 ? 81   GLU D N   1 
ATOM   8872  C CA  . GLU D 1 82  ? 34.180  5.636   12.607  1.00 17.73 ? 81   GLU D CA  1 
ATOM   8873  C C   . GLU D 1 82  ? 34.131  5.703   11.086  1.00 17.22 ? 81   GLU D C   1 
ATOM   8874  O O   . GLU D 1 82  ? 35.000  6.313   10.423  1.00 17.32 ? 81   GLU D O   1 
ATOM   8875  C CB  . GLU D 1 82  ? 34.720  4.294   13.059  1.00 20.50 ? 81   GLU D CB  1 
ATOM   8876  C CG  . GLU D 1 82  ? 34.664  3.095   12.135  1.00 24.22 ? 81   GLU D CG  1 
ATOM   8877  C CD  . GLU D 1 82  ? 35.388  1.855   12.541  1.00 24.99 ? 81   GLU D CD  1 
ATOM   8878  O OE1 . GLU D 1 82  ? 36.298  1.809   13.354  1.00 26.56 ? 81   GLU D OE1 1 
ATOM   8879  O OE2 . GLU D 1 82  ? 34.957  0.842   11.939  1.00 26.37 ? 81   GLU D OE2 1 
ATOM   8880  N N   . THR D 1 83  ? 33.081  5.135   10.519  1.00 16.71 ? 82   THR D N   1 
ATOM   8881  C CA  . THR D 1 83  ? 32.909  5.032   9.071   1.00 15.82 ? 82   THR D CA  1 
ATOM   8882  C C   . THR D 1 83  ? 32.776  6.374   8.368   1.00 15.21 ? 82   THR D C   1 
ATOM   8883  O O   . THR D 1 83  ? 33.263  6.486   7.221   1.00 14.78 ? 82   THR D O   1 
ATOM   8884  C CB  . THR D 1 83  ? 31.729  4.072   8.654   1.00 15.42 ? 82   THR D CB  1 
ATOM   8885  O OG1 . THR D 1 83  ? 31.780  2.900   9.503   1.00 15.59 ? 82   THR D OG1 1 
ATOM   8886  C CG2 . THR D 1 83  ? 31.798  3.684   7.157   1.00 15.33 ? 82   THR D CG2 1 
ATOM   8887  N N   . LEU D 1 84  ? 32.125  7.335   8.998   1.00 14.56 ? 83   LEU D N   1 
ATOM   8888  C CA  . LEU D 1 84  ? 31.919  8.656   8.420   1.00 14.55 ? 83   LEU D CA  1 
ATOM   8889  C C   . LEU D 1 84  ? 33.236  9.312   8.000   1.00 14.75 ? 83   LEU D C   1 
ATOM   8890  O O   . LEU D 1 84  ? 33.250  10.156  7.092   1.00 14.32 ? 83   LEU D O   1 
ATOM   8891  C CB  . LEU D 1 84  ? 31.152  9.571   9.402   1.00 14.32 ? 83   LEU D CB  1 
ATOM   8892  C CG  . LEU D 1 84  ? 30.958  11.001  8.909   1.00 13.29 ? 83   LEU D CG  1 
ATOM   8893  C CD1 . LEU D 1 84  ? 30.006  11.036  7.715   1.00 12.97 ? 83   LEU D CD1 1 
ATOM   8894  C CD2 . LEU D 1 84  ? 30.422  11.875  10.038  1.00 14.79 ? 83   LEU D CD2 1 
ATOM   8895  N N   . TYR D 1 85  ? 34.291  8.928   8.704   1.00 15.13 ? 84   TYR D N   1 
ATOM   8896  C CA  . TYR D 1 85  ? 35.604  9.545   8.444   1.00 15.62 ? 84   TYR D CA  1 
ATOM   8897  C C   . TYR D 1 85  ? 36.562  8.618   7.734   1.00 16.06 ? 84   TYR D C   1 
ATOM   8898  O O   . TYR D 1 85  ? 37.743  9.005   7.605   1.00 17.18 ? 84   TYR D O   1 
ATOM   8899  C CB  . TYR D 1 85  ? 36.207  10.081  9.779   1.00 14.84 ? 84   TYR D CB  1 
ATOM   8900  C CG  . TYR D 1 85  ? 35.270  11.123  10.357  1.00 13.05 ? 84   TYR D CG  1 
ATOM   8901  C CD1 . TYR D 1 85  ? 35.208  12.380  9.769   1.00 13.08 ? 84   TYR D CD1 1 
ATOM   8902  C CD2 . TYR D 1 85  ? 34.416  10.840  11.420  1.00 13.51 ? 84   TYR D CD2 1 
ATOM   8903  C CE1 . TYR D 1 85  ? 34.338  13.359  10.229  1.00 13.75 ? 84   TYR D CE1 1 
ATOM   8904  C CE2 . TYR D 1 85  ? 33.534  11.814  11.902  1.00 12.54 ? 84   TYR D CE2 1 
ATOM   8905  C CZ  . TYR D 1 85  ? 33.500  13.060  11.307  1.00 11.77 ? 84   TYR D CZ  1 
ATOM   8906  O OH  . TYR D 1 85  ? 32.680  14.064  11.729  1.00 13.73 ? 84   TYR D OH  1 
ATOM   8907  N N   . GLN D 1 86  ? 36.097  7.485   7.268   1.00 16.05 ? 85   GLN D N   1 
ATOM   8908  C CA  . GLN D 1 86  ? 36.962  6.497   6.592   1.00 16.84 ? 85   GLN D CA  1 
ATOM   8909  C C   . GLN D 1 86  ? 37.032  6.769   5.092   1.00 17.03 ? 85   GLN D C   1 
ATOM   8910  O O   . GLN D 1 86  ? 36.191  7.467   4.510   1.00 16.85 ? 85   GLN D O   1 
ATOM   8911  C CB  . GLN D 1 86  ? 36.569  5.059   6.900   1.00 17.51 ? 85   GLN D CB  1 
ATOM   8912  C CG  . GLN D 1 86  ? 36.993  4.559   8.269   1.00 18.12 ? 85   GLN D CG  1 
ATOM   8913  C CD  . GLN D 1 86  ? 36.722  3.094   8.461   1.00 19.29 ? 85   GLN D CD  1 
ATOM   8914  O OE1 . GLN D 1 86  ? 37.456  2.361   9.133   1.00 21.48 ? 85   GLN D OE1 1 
ATOM   8915  N NE2 . GLN D 1 86  ? 35.652  2.611   7.828   1.00 18.81 ? 85   GLN D NE2 1 
ATOM   8916  N N   . LYS D 1 87  ? 38.081  6.214   4.493   1.00 17.38 ? 86   LYS D N   1 
ATOM   8917  C CA  . LYS D 1 87  ? 38.359  6.394   3.065   1.00 17.42 ? 86   LYS D CA  1 
ATOM   8918  C C   . LYS D 1 87  ? 38.437  5.046   2.354   1.00 17.51 ? 86   LYS D C   1 
ATOM   8919  O O   . LYS D 1 87  ? 38.832  4.032   2.953   1.00 17.46 ? 86   LYS D O   1 
ATOM   8920  C CB  . LYS D 1 87  ? 39.659  7.155   2.851   1.00 18.97 ? 86   LYS D CB  1 
ATOM   8921  C CG  . LYS D 1 87  ? 39.687  8.590   3.381   1.00 21.74 ? 86   LYS D CG  1 
ATOM   8922  C CD  . LYS D 1 87  ? 41.108  9.151   3.319   1.00 23.58 ? 86   LYS D CD  1 
ATOM   8923  C CE  . LYS D 1 87  ? 41.143  10.656  3.351   1.00 25.44 ? 86   LYS D CE  1 
ATOM   8924  N NZ  . LYS D 1 87  ? 42.527  11.154  3.101   1.00 28.45 ? 86   LYS D NZ  1 
ATOM   8925  N N   . ALA D 1 88  ? 38.034  5.065   1.088   1.00 17.27 ? 87   ALA D N   1 
ATOM   8926  C CA  . ALA D 1 88  ? 38.187  3.904   0.187   1.00 17.99 ? 87   ALA D CA  1 
ATOM   8927  C C   . ALA D 1 88  ? 39.694  3.733   -0.074  1.00 18.18 ? 87   ALA D C   1 
ATOM   8928  O O   . ALA D 1 88  ? 40.458  4.655   0.273   1.00 17.77 ? 87   ALA D O   1 
ATOM   8929  C CB  . ALA D 1 88  ? 37.416  4.131   -1.100  1.00 16.63 ? 87   ALA D CB  1 
ATOM   8930  N N   . ASP D 1 89  ? 40.069  2.615   -0.646  1.00 19.06 ? 88   ASP D N   1 
ATOM   8931  C CA  . ASP D 1 89  ? 41.472  2.246   -0.916  1.00 20.10 ? 88   ASP D CA  1 
ATOM   8932  C C   . ASP D 1 89  ? 42.205  3.309   -1.735  1.00 20.90 ? 88   ASP D C   1 
ATOM   8933  O O   . ASP D 1 89  ? 43.402  3.539   -1.501  1.00 21.69 ? 88   ASP D O   1 
ATOM   8934  C CB  . ASP D 1 89  ? 41.603  0.851   -1.508  1.00 19.14 ? 88   ASP D CB  1 
ATOM   8935  C CG  . ASP D 1 89  ? 41.478  -0.296  -0.545  1.00 19.23 ? 88   ASP D CG  1 
ATOM   8936  O OD1 . ASP D 1 89  ? 41.594  -0.070  0.683   1.00 19.81 ? 88   ASP D OD1 1 
ATOM   8937  O OD2 . ASP D 1 89  ? 41.270  -1.457  -0.958  1.00 19.46 ? 88   ASP D OD2 1 
ATOM   8938  N N   . ASP D 1 90  ? 41.513  3.957   -2.650  1.00 21.41 ? 89   ASP D N   1 
ATOM   8939  C CA  . ASP D 1 90  ? 42.122  4.947   -3.559  1.00 21.24 ? 89   ASP D CA  1 
ATOM   8940  C C   . ASP D 1 90  ? 42.311  6.289   -2.857  1.00 20.92 ? 89   ASP D C   1 
ATOM   8941  O O   . ASP D 1 90  ? 42.875  7.249   -3.420  1.00 20.20 ? 89   ASP D O   1 
ATOM   8942  C CB  . ASP D 1 90  ? 41.256  5.065   -4.815  1.00 23.64 ? 89   ASP D CB  1 
ATOM   8943  C CG  . ASP D 1 90  ? 39.881  5.631   -4.477  1.00 25.60 ? 89   ASP D CG  1 
ATOM   8944  O OD1 . ASP D 1 90  ? 39.569  5.841   -3.295  1.00 25.81 ? 89   ASP D OD1 1 
ATOM   8945  O OD2 . ASP D 1 90  ? 39.131  5.861   -5.440  1.00 28.27 ? 89   ASP D OD2 1 
ATOM   8946  N N   . GLY D 1 91  ? 41.790  6.359   -1.641  1.00 20.01 ? 90   GLY D N   1 
ATOM   8947  C CA  . GLY D 1 91  ? 41.888  7.565   -0.822  1.00 19.18 ? 90   GLY D CA  1 
ATOM   8948  C C   . GLY D 1 91  ? 40.652  8.434   -0.861  1.00 18.86 ? 90   GLY D C   1 
ATOM   8949  O O   . GLY D 1 91  ? 40.673  9.531   -0.252  1.00 19.44 ? 90   GLY D O   1 
ATOM   8950  N N   . THR D 1 92  ? 39.604  8.001   -1.544  1.00 18.15 ? 91   THR D N   1 
ATOM   8951  C CA  . THR D 1 92  ? 38.352  8.791   -1.577  1.00 17.67 ? 91   THR D CA  1 
ATOM   8952  C C   . THR D 1 92  ? 37.520  8.527   -0.324  1.00 16.58 ? 91   THR D C   1 
ATOM   8953  O O   . THR D 1 92  ? 37.282  7.361   0.028   1.00 17.05 ? 91   THR D O   1 
ATOM   8954  C CB  . THR D 1 92  ? 37.500  8.465   -2.868  1.00 18.70 ? 91   THR D CB  1 
ATOM   8955  O OG1 . THR D 1 92  ? 38.407  8.682   -3.996  1.00 20.59 ? 91   THR D OG1 1 
ATOM   8956  C CG2 . THR D 1 92  ? 36.227  9.302   -2.979  1.00 17.58 ? 91   THR D CG2 1 
ATOM   8957  N N   . PRO D 1 93  ? 37.097  9.597   0.317   1.00 15.88 ? 92   PRO D N   1 
ATOM   8958  C CA  . PRO D 1 93  ? 36.229  9.487   1.498   1.00 15.50 ? 92   PRO D CA  1 
ATOM   8959  C C   . PRO D 1 93  ? 34.935  8.767   1.144   1.00 14.41 ? 92   PRO D C   1 
ATOM   8960  O O   . PRO D 1 93  ? 34.291  9.060   0.127   1.00 14.22 ? 92   PRO D O   1 
ATOM   8961  C CB  . PRO D 1 93  ? 35.990  10.925  1.934   1.00 15.49 ? 92   PRO D CB  1 
ATOM   8962  C CG  . PRO D 1 93  ? 37.194  11.666  1.396   1.00 16.09 ? 92   PRO D CG  1 
ATOM   8963  C CD  . PRO D 1 93  ? 37.477  10.996  0.057   1.00 16.06 ? 92   PRO D CD  1 
ATOM   8964  N N   . PHE D 1 94  ? 34.582  7.828   1.995   1.00 13.84 ? 93   PHE D N   1 
ATOM   8965  C CA  . PHE D 1 94  ? 33.283  7.125   1.896   1.00 13.68 ? 93   PHE D CA  1 
ATOM   8966  C C   . PHE D 1 94  ? 32.145  8.144   1.743   1.00 13.39 ? 93   PHE D C   1 
ATOM   8967  O O   . PHE D 1 94  ? 31.229  7.927   0.920   1.00 13.41 ? 93   PHE D O   1 
ATOM   8968  C CB  . PHE D 1 94  ? 33.104  6.136   3.028   1.00 11.35 ? 93   PHE D CB  1 
ATOM   8969  C CG  . PHE D 1 94  ? 33.861  4.842   3.022   1.00 13.30 ? 93   PHE D CG  1 
ATOM   8970  C CD1 . PHE D 1 94  ? 34.263  4.230   1.838   1.00 13.46 ? 93   PHE D CD1 1 
ATOM   8971  C CD2 . PHE D 1 94  ? 34.215  4.230   4.236   1.00 12.27 ? 93   PHE D CD2 1 
ATOM   8972  C CE1 . PHE D 1 94  ? 34.951  3.019   1.830   1.00 12.96 ? 93   PHE D CE1 1 
ATOM   8973  C CE2 . PHE D 1 94  ? 34.907  3.029   4.263   1.00 13.19 ? 93   PHE D CE2 1 
ATOM   8974  C CZ  . PHE D 1 94  ? 35.277  2.413   3.059   1.00 13.48 ? 93   PHE D CZ  1 
ATOM   8975  N N   . ALA D 1 95  ? 32.191  9.244   2.467   1.00 13.60 ? 94   ALA D N   1 
ATOM   8976  C CA  . ALA D 1 95  ? 31.138  10.267  2.473   1.00 14.36 ? 94   ALA D CA  1 
ATOM   8977  C C   . ALA D 1 95  ? 30.937  10.875  1.088   1.00 14.84 ? 94   ALA D C   1 
ATOM   8978  O O   . ALA D 1 95  ? 29.819  11.196  0.657   1.00 14.40 ? 94   ALA D O   1 
ATOM   8979  C CB  . ALA D 1 95  ? 31.367  11.347  3.513   1.00 13.11 ? 94   ALA D CB  1 
ATOM   8980  N N   . GLU D 1 96  ? 32.055  11.029  0.395   1.00 15.66 ? 95   GLU D N   1 
ATOM   8981  C CA  . GLU D 1 96  ? 32.060  11.628  -0.944  1.00 15.84 ? 95   GLU D CA  1 
ATOM   8982  C C   . GLU D 1 96  ? 31.527  10.663  -1.983  1.00 15.74 ? 95   GLU D C   1 
ATOM   8983  O O   . GLU D 1 96  ? 30.826  11.081  -2.937  1.00 16.49 ? 95   GLU D O   1 
ATOM   8984  C CB  . GLU D 1 96  ? 33.472  12.048  -1.291  1.00 19.58 ? 95   GLU D CB  1 
ATOM   8985  C CG  . GLU D 1 96  ? 33.708  12.944  -2.496  1.00 22.73 ? 95   GLU D CG  1 
ATOM   8986  C CD  . GLU D 1 96  ? 35.145  13.420  -2.575  1.00 25.01 ? 95   GLU D CD  1 
ATOM   8987  O OE1 . GLU D 1 96  ? 35.666  14.026  -1.656  1.00 27.22 ? 95   GLU D OE1 1 
ATOM   8988  O OE2 . GLU D 1 96  ? 35.680  13.093  -3.651  1.00 27.00 ? 95   GLU D OE2 1 
ATOM   8989  N N   . ILE D 1 97  ? 31.857  9.395   -1.827  1.00 15.01 ? 96   ILE D N   1 
ATOM   8990  C CA  . ILE D 1 97  ? 31.378  8.342   -2.733  1.00 14.99 ? 96   ILE D CA  1 
ATOM   8991  C C   . ILE D 1 97  ? 29.847  8.265   -2.664  1.00 15.08 ? 96   ILE D C   1 
ATOM   8992  O O   . ILE D 1 97  ? 29.163  8.185   -3.694  1.00 13.86 ? 96   ILE D O   1 
ATOM   8993  C CB  . ILE D 1 97  ? 32.041  6.966   -2.417  1.00 15.01 ? 96   ILE D CB  1 
ATOM   8994  C CG1 . ILE D 1 97  ? 33.576  7.046   -2.677  1.00 15.42 ? 96   ILE D CG1 1 
ATOM   8995  C CG2 . ILE D 1 97  ? 31.402  5.769   -3.164  1.00 15.91 ? 96   ILE D CG2 1 
ATOM   8996  C CD1 . ILE D 1 97  ? 34.352  5.873   -2.016  1.00 15.04 ? 96   ILE D CD1 1 
ATOM   8997  N N   . LEU D 1 98  ? 29.347  8.267   -1.424  1.00 14.56 ? 97   LEU D N   1 
ATOM   8998  C CA  . LEU D 1 98  ? 27.892  8.170   -1.220  1.00 14.91 ? 97   LEU D CA  1 
ATOM   8999  C C   . LEU D 1 98  ? 27.190  9.439   -1.682  1.00 14.93 ? 97   LEU D C   1 
ATOM   9000  O O   . LEU D 1 98  ? 26.107  9.336   -2.292  1.00 15.47 ? 97   LEU D O   1 
ATOM   9001  C CB  . LEU D 1 98  ? 27.603  7.774   0.237   1.00 13.51 ? 97   LEU D CB  1 
ATOM   9002  C CG  . LEU D 1 98  ? 28.086  6.414   0.694   1.00 13.79 ? 97   LEU D CG  1 
ATOM   9003  C CD1 . LEU D 1 98  ? 27.988  6.269   2.213   1.00 14.61 ? 97   LEU D CD1 1 
ATOM   9004  C CD2 . LEU D 1 98  ? 27.250  5.315   0.035   1.00 13.87 ? 97   LEU D CD2 1 
ATOM   9005  N N   . LYS D 1 99  ? 27.750  10.595  -1.394  1.00 16.02 ? 98   LYS D N   1 
ATOM   9006  C CA  . LYS D 1 99  ? 27.090  11.854  -1.794  1.00 17.83 ? 98   LYS D CA  1 
ATOM   9007  C C   . LYS D 1 99  ? 27.055  12.020  -3.301  1.00 18.42 ? 98   LYS D C   1 
ATOM   9008  O O   . LYS D 1 99  ? 26.055  12.529  -3.858  1.00 18.51 ? 98   LYS D O   1 
ATOM   9009  C CB  . LYS D 1 99  ? 27.645  13.076  -1.070  1.00 19.66 ? 98   LYS D CB  1 
ATOM   9010  C CG  . LYS D 1 99  ? 27.295  13.010  0.439   1.00 22.11 ? 98   LYS D CG  1 
ATOM   9011  C CD  . LYS D 1 99  ? 27.454  14.347  1.133   1.00 23.20 ? 98   LYS D CD  1 
ATOM   9012  C CE  . LYS D 1 99  ? 26.097  15.026  1.340   1.00 23.78 ? 98   LYS D CE  1 
ATOM   9013  N NZ  . LYS D 1 99  ? 26.284  16.388  1.893   1.00 26.07 ? 98   LYS D NZ  1 
ATOM   9014  N N   . LYS D 1 100 ? 28.103  11.564  -3.976  1.00 18.91 ? 99   LYS D N   1 
ATOM   9015  C CA  . LYS D 1 100 ? 28.179  11.682  -5.434  1.00 19.11 ? 99   LYS D CA  1 
ATOM   9016  C C   . LYS D 1 100 ? 27.038  10.928  -6.111  1.00 18.48 ? 99   LYS D C   1 
ATOM   9017  O O   . LYS D 1 100 ? 26.562  11.343  -7.181  1.00 18.71 ? 99   LYS D O   1 
ATOM   9018  C CB  . LYS D 1 100 ? 29.499  11.208  -6.039  1.00 21.94 ? 99   LYS D CB  1 
ATOM   9019  C CG  . LYS D 1 100 ? 29.538  11.489  -7.552  1.00 24.86 ? 99   LYS D CG  1 
ATOM   9020  C CD  . LYS D 1 100 ? 30.749  10.850  -8.217  1.00 27.64 ? 99   LYS D CD  1 
ATOM   9021  C CE  . LYS D 1 100 ? 30.773  11.137  -9.718  1.00 27.93 ? 99   LYS D CE  1 
ATOM   9022  N NZ  . LYS D 1 100 ? 31.826  10.321  -10.366 1.00 29.42 ? 99   LYS D NZ  1 
ATOM   9023  N N   . LYS D 1 101 ? 26.614  9.852   -5.477  1.00 17.46 ? 100  LYS D N   1 
ATOM   9024  C CA  . LYS D 1 101 ? 25.541  8.994   -5.953  1.00 16.60 ? 100  LYS D CA  1 
ATOM   9025  C C   . LYS D 1 101 ? 24.155  9.479   -5.557  1.00 15.59 ? 100  LYS D C   1 
ATOM   9026  O O   . LYS D 1 101 ? 23.170  8.793   -5.868  1.00 15.86 ? 100  LYS D O   1 
ATOM   9027  C CB  . LYS D 1 101 ? 25.711  7.552   -5.460  1.00 17.84 ? 100  LYS D CB  1 
ATOM   9028  C CG  . LYS D 1 101 ? 26.926  6.855   -6.072  1.00 20.68 ? 100  LYS D CG  1 
ATOM   9029  C CD  . LYS D 1 101 ? 27.117  5.471   -5.460  1.00 19.77 ? 100  LYS D CD  1 
ATOM   9030  C CE  . LYS D 1 101 ? 28.565  5.039   -5.592  1.00 20.42 ? 100  LYS D CE  1 
ATOM   9031  N NZ  . LYS D 1 101 ? 28.656  3.562   -5.531  1.00 19.89 ? 100  LYS D NZ  1 
ATOM   9032  N N   . GLY D 1 102 ? 24.072  10.583  -4.868  1.00 14.99 ? 101  GLY D N   1 
ATOM   9033  C CA  . GLY D 1 102 ? 22.832  11.210  -4.421  1.00 15.32 ? 101  GLY D CA  1 
ATOM   9034  C C   . GLY D 1 102 ? 22.228  10.579  -3.177  1.00 14.58 ? 101  GLY D C   1 
ATOM   9035  O O   . GLY D 1 102 ? 21.027  10.793  -2.913  1.00 14.79 ? 101  GLY D O   1 
ATOM   9036  N N   . ILE D 1 103 ? 23.017  9.829   -2.427  1.00 13.82 ? 102  ILE D N   1 
ATOM   9037  C CA  . ILE D 1 103 ? 22.517  9.220   -1.174  1.00 13.13 ? 102  ILE D CA  1 
ATOM   9038  C C   . ILE D 1 103 ? 22.725  10.204  -0.026  1.00 12.92 ? 102  ILE D C   1 
ATOM   9039  O O   . ILE D 1 103 ? 23.763  10.899  0.074   1.00 14.16 ? 102  ILE D O   1 
ATOM   9040  C CB  . ILE D 1 103 ? 23.163  7.813   -0.990  1.00 13.49 ? 102  ILE D CB  1 
ATOM   9041  C CG1 . ILE D 1 103 ? 22.658  6.841   -2.095  1.00 13.29 ? 102  ILE D CG1 1 
ATOM   9042  C CG2 . ILE D 1 103 ? 22.958  7.222   0.428   1.00 12.80 ? 102  ILE D CG2 1 
ATOM   9043  C CD1 . ILE D 1 103 ? 23.332  5.440   -2.078  1.00 13.41 ? 102  ILE D CD1 1 
ATOM   9044  N N   . ILE D 1 104 ? 21.739  10.333  0.842   1.00 11.52 ? 103  ILE D N   1 
ATOM   9045  C CA  . ILE D 1 104 ? 21.843  11.222  2.019   1.00 9.70  ? 103  ILE D CA  1 
ATOM   9046  C C   . ILE D 1 104 ? 22.534  10.449  3.141   1.00 8.64  ? 103  ILE D C   1 
ATOM   9047  O O   . ILE D 1 104 ? 22.340  9.232   3.256   1.00 8.43  ? 103  ILE D O   1 
ATOM   9048  C CB  . ILE D 1 104 ? 20.423  11.748  2.421   1.00 11.73 ? 103  ILE D CB  1 
ATOM   9049  C CG1 . ILE D 1 104 ? 19.822  12.604  1.269   1.00 13.00 ? 103  ILE D CG1 1 
ATOM   9050  C CG2 . ILE D 1 104 ? 20.437  12.564  3.750   1.00 9.36  ? 103  ILE D CG2 1 
ATOM   9051  C CD1 . ILE D 1 104 ? 18.270  12.644  1.269   1.00 14.51 ? 103  ILE D CD1 1 
ATOM   9052  N N   . LEU D 1 105 ? 23.319  11.128  3.950   1.00 8.90  ? 104  LEU D N   1 
ATOM   9053  C CA  . LEU D 1 105 ? 24.076  10.512  5.046   1.00 8.80  ? 104  LEU D CA  1 
ATOM   9054  C C   . LEU D 1 105 ? 23.374  10.727  6.407   1.00 8.09  ? 104  LEU D C   1 
ATOM   9055  O O   . LEU D 1 105 ? 22.958  11.842  6.723   1.00 7.81  ? 104  LEU D O   1 
ATOM   9056  C CB  . LEU D 1 105 ? 25.488  11.104  5.026   1.00 10.32 ? 104  LEU D CB  1 
ATOM   9057  C CG  . LEU D 1 105 ? 26.305  10.993  3.739   1.00 11.26 ? 104  LEU D CG  1 
ATOM   9058  C CD1 . LEU D 1 105 ? 27.753  11.380  4.046   1.00 12.82 ? 104  LEU D CD1 1 
ATOM   9059  C CD2 . LEU D 1 105 ? 26.252  9.555   3.240   1.00 11.30 ? 104  LEU D CD2 1 
ATOM   9060  N N   . GLY D 1 106 ? 23.290  9.645   7.144   1.00 8.64  ? 105  GLY D N   1 
ATOM   9061  C CA  . GLY D 1 106 ? 22.736  9.668   8.522   1.00 9.22  ? 105  GLY D CA  1 
ATOM   9062  C C   . GLY D 1 106 ? 23.850  9.237   9.484   1.00 9.17  ? 105  GLY D C   1 
ATOM   9063  O O   . GLY D 1 106 ? 24.819  8.581   9.050   1.00 9.31  ? 105  GLY D O   1 
ATOM   9064  N N   . ILE D 1 107 ? 23.690  9.597   10.746  1.00 8.58  ? 106  ILE D N   1 
ATOM   9065  C CA  . ILE D 1 107 ? 24.697  9.269   11.786  1.00 9.17  ? 106  ILE D CA  1 
ATOM   9066  C C   . ILE D 1 107 ? 24.009  8.795   13.078  1.00 8.26  ? 106  ILE D C   1 
ATOM   9067  O O   . ILE D 1 107 ? 23.048  9.430   13.541  1.00 7.99  ? 106  ILE D O   1 
ATOM   9068  C CB  . ILE D 1 107 ? 25.635  10.501  12.015  1.00 7.62  ? 106  ILE D CB  1 
ATOM   9069  C CG1 . ILE D 1 107 ? 26.694  10.222  13.116  1.00 7.87  ? 106  ILE D CG1 1 
ATOM   9070  C CG2 . ILE D 1 107 ? 24.871  11.814  12.350  1.00 9.27  ? 106  ILE D CG2 1 
ATOM   9071  C CD1 . ILE D 1 107 ? 27.819  9.222   12.760  1.00 9.42  ? 106  ILE D CD1 1 
ATOM   9072  N N   . LYS D 1 108 ? 24.510  7.703   13.607  1.00 9.01  ? 107  LYS D N   1 
ATOM   9073  C CA  . LYS D 1 108 ? 24.031  7.184   14.918  1.00 9.38  ? 107  LYS D CA  1 
ATOM   9074  C C   . LYS D 1 108 ? 24.672  8.034   16.010  1.00 9.35  ? 107  LYS D C   1 
ATOM   9075  O O   . LYS D 1 108 ? 25.912  8.137   16.100  1.00 8.86  ? 107  LYS D O   1 
ATOM   9076  C CB  . LYS D 1 108 ? 24.322  5.714   15.060  1.00 11.39 ? 107  LYS D CB  1 
ATOM   9077  C CG  . LYS D 1 108 ? 23.738  5.059   16.329  1.00 13.78 ? 107  LYS D CG  1 
ATOM   9078  C CD  . LYS D 1 108 ? 24.809  4.530   17.250  1.00 15.22 ? 107  LYS D CD  1 
ATOM   9079  C CE  . LYS D 1 108 ? 25.819  3.631   16.603  1.00 16.72 ? 107  LYS D CE  1 
ATOM   9080  N NZ  . LYS D 1 108 ? 25.290  2.285   16.277  1.00 20.52 ? 107  LYS D NZ  1 
ATOM   9081  N N   . VAL D 1 109 ? 23.829  8.678   16.819  1.00 8.80  ? 108  VAL D N   1 
ATOM   9082  C CA  . VAL D 1 109 ? 24.318  9.621   17.829  1.00 8.67  ? 108  VAL D CA  1 
ATOM   9083  C C   . VAL D 1 109 ? 24.041  9.168   19.270  1.00 9.25  ? 108  VAL D C   1 
ATOM   9084  O O   . VAL D 1 109 ? 24.516  9.911   20.166  1.00 9.20  ? 108  VAL D O   1 
ATOM   9085  C CB  . VAL D 1 109 ? 23.790  11.038  17.572  1.00 9.35  ? 108  VAL D CB  1 
ATOM   9086  C CG1 . VAL D 1 109 ? 24.163  11.637  16.211  1.00 8.95  ? 108  VAL D CG1 1 
ATOM   9087  C CG2 . VAL D 1 109 ? 22.263  11.069  17.739  1.00 8.43  ? 108  VAL D CG2 1 
ATOM   9088  N N   . ASP D 1 110 ? 23.340  8.079   19.496  1.00 8.99  ? 109  ASP D N   1 
ATOM   9089  C CA  . ASP D 1 110 ? 23.075  7.657   20.908  1.00 9.68  ? 109  ASP D CA  1 
ATOM   9090  C C   . ASP D 1 110 ? 24.357  7.019   21.472  1.00 9.75  ? 109  ASP D C   1 
ATOM   9091  O O   . ASP D 1 110 ? 25.263  6.635   20.718  1.00 8.36  ? 109  ASP D O   1 
ATOM   9092  C CB  . ASP D 1 110 ? 21.875  6.754   21.054  1.00 9.65  ? 109  ASP D CB  1 
ATOM   9093  C CG  . ASP D 1 110 ? 22.010  5.368   20.465  1.00 10.20 ? 109  ASP D CG  1 
ATOM   9094  O OD1 . ASP D 1 110 ? 22.659  4.500   21.099  1.00 10.01 ? 109  ASP D OD1 1 
ATOM   9095  O OD2 . ASP D 1 110 ? 21.457  5.085   19.381  1.00 10.26 ? 109  ASP D OD2 1 
ATOM   9096  N N   . LYS D 1 111 ? 24.368  6.919   22.802  1.00 9.84  ? 110  LYS D N   1 
ATOM   9097  C CA  . LYS D 1 111 ? 25.548  6.276   23.440  1.00 9.71  ? 110  LYS D CA  1 
ATOM   9098  C C   . LYS D 1 111 ? 25.142  5.011   24.163  1.00 9.90  ? 110  LYS D C   1 
ATOM   9099  O O   . LYS D 1 111 ? 25.729  4.643   25.204  1.00 10.64 ? 110  LYS D O   1 
ATOM   9100  C CB  . LYS D 1 111 ? 26.347  7.248   24.259  1.00 11.18 ? 110  LYS D CB  1 
ATOM   9101  C CG  . LYS D 1 111 ? 27.121  8.362   23.531  1.00 14.59 ? 110  LYS D CG  1 
ATOM   9102  C CD  . LYS D 1 111 ? 27.423  9.461   24.537  1.00 17.43 ? 110  LYS D CD  1 
ATOM   9103  C CE  . LYS D 1 111 ? 28.208  10.647  24.086  1.00 20.48 ? 110  LYS D CE  1 
ATOM   9104  N NZ  . LYS D 1 111 ? 28.165  11.722  25.158  1.00 21.45 ? 110  LYS D NZ  1 
ATOM   9105  N N   . GLY D 1 112 ? 24.163  4.309   23.634  1.00 8.19  ? 111  GLY D N   1 
ATOM   9106  C CA  . GLY D 1 112 ? 23.697  3.013   24.118  1.00 8.64  ? 111  GLY D CA  1 
ATOM   9107  C C   . GLY D 1 112 ? 22.725  3.157   25.308  1.00 8.40  ? 111  GLY D C   1 
ATOM   9108  O O   . GLY D 1 112 ? 22.451  4.261   25.783  1.00 8.60  ? 111  GLY D O   1 
ATOM   9109  N N   . VAL D 1 113 ? 22.290  2.025   25.791  1.00 9.06  ? 112  VAL D N   1 
ATOM   9110  C CA  . VAL D 1 113 ? 21.308  1.886   26.864  1.00 9.42  ? 112  VAL D CA  1 
ATOM   9111  C C   . VAL D 1 113 ? 21.999  1.761   28.238  1.00 9.67  ? 112  VAL D C   1 
ATOM   9112  O O   . VAL D 1 113 ? 23.159  1.340   28.357  1.00 8.45  ? 112  VAL D O   1 
ATOM   9113  C CB  . VAL D 1 113 ? 20.336  0.726   26.576  1.00 9.40  ? 112  VAL D CB  1 
ATOM   9114  C CG1 . VAL D 1 113 ? 19.666  0.824   25.208  1.00 10.01 ? 112  VAL D CG1 1 
ATOM   9115  C CG2 . VAL D 1 113 ? 20.965  -0.638  26.763  1.00 11.34 ? 112  VAL D CG2 1 
ATOM   9116  N N   . VAL D 1 114 ? 21.235  2.180   29.239  1.00 9.48  ? 113  VAL D N   1 
ATOM   9117  C CA  . VAL D 1 114 ? 21.665  2.125   30.656  1.00 8.90  ? 113  VAL D CA  1 
ATOM   9118  C C   . VAL D 1 114 ? 20.430  1.687   31.486  1.00 9.40  ? 113  VAL D C   1 
ATOM   9119  O O   . VAL D 1 114 ? 19.290  2.026   31.135  1.00 7.82  ? 113  VAL D O   1 
ATOM   9120  C CB  . VAL D 1 114 ? 22.284  3.434   31.121  1.00 7.31  ? 113  VAL D CB  1 
ATOM   9121  C CG1 . VAL D 1 114 ? 23.683  3.756   30.548  1.00 7.16  ? 113  VAL D CG1 1 
ATOM   9122  C CG2 . VAL D 1 114 ? 21.375  4.638   30.902  1.00 6.00  ? 113  VAL D CG2 1 
ATOM   9123  N N   . PRO D 1 115 ? 20.711  0.920   32.541  1.00 9.31  ? 114  PRO D N   1 
ATOM   9124  C CA  . PRO D 1 115 ? 19.673  0.418   33.437  1.00 9.41  ? 114  PRO D CA  1 
ATOM   9125  C C   . PRO D 1 115 ? 18.971  1.503   34.215  1.00 8.64  ? 114  PRO D C   1 
ATOM   9126  O O   . PRO D 1 115 ? 19.513  2.552   34.631  1.00 9.61  ? 114  PRO D O   1 
ATOM   9127  C CB  . PRO D 1 115 ? 20.430  -0.587  34.337  1.00 9.74  ? 114  PRO D CB  1 
ATOM   9128  C CG  . PRO D 1 115 ? 21.833  -0.046  34.374  1.00 10.32 ? 114  PRO D CG  1 
ATOM   9129  C CD  . PRO D 1 115 ? 22.065  0.492   32.958  1.00 9.24  ? 114  PRO D CD  1 
ATOM   9130  N N   . LEU D 1 116 ? 17.673  1.297   34.394  1.00 8.93  ? 115  LEU D N   1 
ATOM   9131  C CA  . LEU D 1 116 ? 16.826  2.160   35.243  1.00 8.85  ? 115  LEU D CA  1 
ATOM   9132  C C   . LEU D 1 116 ? 16.871  1.488   36.638  1.00 8.59  ? 115  LEU D C   1 
ATOM   9133  O O   . LEU D 1 116 ? 16.283  0.428   36.798  1.00 9.13  ? 115  LEU D O   1 
ATOM   9134  C CB  . LEU D 1 116 ? 15.430  2.243   34.631  1.00 10.32 ? 115  LEU D CB  1 
ATOM   9135  C CG  . LEU D 1 116 ? 15.258  3.095   33.375  1.00 8.70  ? 115  LEU D CG  1 
ATOM   9136  C CD1 . LEU D 1 116 ? 13.819  3.012   32.875  1.00 12.12 ? 115  LEU D CD1 1 
ATOM   9137  C CD2 . LEU D 1 116 ? 15.607  4.538   33.742  1.00 8.39  ? 115  LEU D CD2 1 
ATOM   9138  N N   . PHE D 1 117 ? 17.600  2.121   37.540  1.00 9.41  ? 116  PHE D N   1 
ATOM   9139  C CA  . PHE D 1 117 ? 17.797  1.521   38.895  1.00 9.75  ? 116  PHE D CA  1 
ATOM   9140  C C   . PHE D 1 117 ? 16.430  1.343   39.575  1.00 9.56  ? 116  PHE D C   1 
ATOM   9141  O O   . PHE D 1 117 ? 15.611  2.266   39.562  1.00 9.86  ? 116  PHE D O   1 
ATOM   9142  C CB  . PHE D 1 117 ? 18.788  2.365   39.666  1.00 12.22 ? 116  PHE D CB  1 
ATOM   9143  C CG  . PHE D 1 117 ? 19.190  1.848   41.020  1.00 13.48 ? 116  PHE D CG  1 
ATOM   9144  C CD1 . PHE D 1 117 ? 19.697  0.549   41.131  1.00 15.32 ? 116  PHE D CD1 1 
ATOM   9145  C CD2 . PHE D 1 117 ? 19.069  2.657   42.144  1.00 14.94 ? 116  PHE D CD2 1 
ATOM   9146  C CE1 . PHE D 1 117 ? 20.086  0.041   42.375  1.00 16.06 ? 116  PHE D CE1 1 
ATOM   9147  C CE2 . PHE D 1 117 ? 19.454  2.167   43.402  1.00 15.13 ? 116  PHE D CE2 1 
ATOM   9148  C CZ  . PHE D 1 117 ? 19.954  0.861   43.499  1.00 15.41 ? 116  PHE D CZ  1 
ATOM   9149  N N   . GLY D 1 118 ? 16.186  0.150   40.087  1.00 9.61  ? 117  GLY D N   1 
ATOM   9150  C CA  . GLY D 1 118 ? 14.968  -0.201  40.805  1.00 10.10 ? 117  GLY D CA  1 
ATOM   9151  C C   . GLY D 1 118 ? 13.892  -0.790  39.902  1.00 10.57 ? 117  GLY D C   1 
ATOM   9152  O O   . GLY D 1 118 ? 12.897  -1.368  40.407  1.00 11.07 ? 117  GLY D O   1 
ATOM   9153  N N   . SER D 1 119 ? 14.090  -0.698  38.608  1.00 10.13 ? 118  SER D N   1 
ATOM   9154  C CA  . SER D 1 119 ? 13.135  -1.215  37.611  1.00 9.80  ? 118  SER D CA  1 
ATOM   9155  C C   . SER D 1 119 ? 13.342  -2.713  37.472  1.00 10.47 ? 118  SER D C   1 
ATOM   9156  O O   . SER D 1 119 ? 14.371  -3.266  37.909  1.00 11.13 ? 118  SER D O   1 
ATOM   9157  C CB  . SER D 1 119 ? 13.288  -0.509  36.270  1.00 9.76  ? 118  SER D CB  1 
ATOM   9158  O OG  . SER D 1 119 ? 14.406  -1.036  35.555  1.00 8.54  ? 118  SER D OG  1 
ATOM   9159  N N   . GLU D 1 120 ? 12.376  -3.358  36.839  1.00 10.00 ? 119  GLU D N   1 
ATOM   9160  C CA  . GLU D 1 120 ? 12.444  -4.776  36.527  1.00 11.05 ? 119  GLU D CA  1 
ATOM   9161  C C   . GLU D 1 120 ? 13.156  -5.017  35.194  1.00 12.22 ? 119  GLU D C   1 
ATOM   9162  O O   . GLU D 1 120 ? 12.557  -5.401  34.186  1.00 12.81 ? 119  GLU D O   1 
ATOM   9163  C CB  . GLU D 1 120 ? 11.057  -5.421  36.518  1.00 11.25 ? 119  GLU D CB  1 
ATOM   9164  C CG  . GLU D 1 120 ? 10.293  -5.339  37.840  1.00 13.42 ? 119  GLU D CG  1 
ATOM   9165  C CD  . GLU D 1 120 ? 9.100   -6.210  38.034  1.00 16.37 ? 119  GLU D CD  1 
ATOM   9166  O OE1 . GLU D 1 120 ? 8.260   -6.197  37.116  1.00 17.37 ? 119  GLU D OE1 1 
ATOM   9167  O OE2 . GLU D 1 120 ? 8.918   -6.888  39.034  1.00 19.53 ? 119  GLU D OE2 1 
ATOM   9168  N N   . ASP D 1 121 ? 14.460  -4.800  35.236  1.00 12.40 ? 120  ASP D N   1 
ATOM   9169  C CA  . ASP D 1 121 ? 15.375  -5.018  34.117  1.00 13.12 ? 120  ASP D CA  1 
ATOM   9170  C C   . ASP D 1 121 ? 15.017  -4.177  32.881  1.00 11.93 ? 120  ASP D C   1 
ATOM   9171  O O   . ASP D 1 121 ? 15.069  -4.727  31.766  1.00 12.59 ? 120  ASP D O   1 
ATOM   9172  C CB  . ASP D 1 121 ? 15.451  -6.518  33.805  1.00 18.05 ? 120  ASP D CB  1 
ATOM   9173  C CG  . ASP D 1 121 ? 16.138  -7.289  34.923  1.00 22.73 ? 120  ASP D CG  1 
ATOM   9174  O OD1 . ASP D 1 121 ? 16.934  -6.723  35.699  1.00 26.39 ? 120  ASP D OD1 1 
ATOM   9175  O OD2 . ASP D 1 121 ? 15.859  -8.494  35.046  1.00 26.54 ? 120  ASP D OD2 1 
ATOM   9176  N N   . GLU D 1 122 ? 14.711  -2.924  33.080  1.00 10.43 ? 121  GLU D N   1 
ATOM   9177  C CA  . GLU D 1 122 ? 14.404  -1.960  32.027  1.00 10.61 ? 121  GLU D CA  1 
ATOM   9178  C C   . GLU D 1 122 ? 15.508  -0.925  31.871  1.00 9.51  ? 121  GLU D C   1 
ATOM   9179  O O   . GLU D 1 122 ? 16.347  -0.762  32.770  1.00 9.07  ? 121  GLU D O   1 
ATOM   9180  C CB  . GLU D 1 122 ? 13.071  -1.230  32.277  1.00 7.90  ? 121  GLU D CB  1 
ATOM   9181  C CG  . GLU D 1 122 ? 11.852  -2.180  32.214  1.00 8.27  ? 121  GLU D CG  1 
ATOM   9182  C CD  . GLU D 1 122 ? 10.515  -1.531  32.381  1.00 9.21  ? 121  GLU D CD  1 
ATOM   9183  O OE1 . GLU D 1 122 ? 10.329  -1.003  33.504  1.00 8.45  ? 121  GLU D OE1 1 
ATOM   9184  O OE2 . GLU D 1 122 ? 9.663   -1.485  31.510  1.00 10.88 ? 121  GLU D OE2 1 
ATOM   9185  N N   . VAL D 1 123 ? 15.487  -0.246  30.732  1.00 8.24  ? 122  VAL D N   1 
ATOM   9186  C CA  . VAL D 1 123 ? 16.558  0.689   30.364  1.00 8.18  ? 122  VAL D CA  1 
ATOM   9187  C C   . VAL D 1 123 ? 16.017  1.996   29.791  1.00 7.98  ? 122  VAL D C   1 
ATOM   9188  O O   . VAL D 1 123 ? 14.859  2.138   29.416  1.00 8.69  ? 122  VAL D O   1 
ATOM   9189  C CB  . VAL D 1 123 ? 17.482  0.008   29.312  1.00 8.75  ? 122  VAL D CB  1 
ATOM   9190  C CG1 . VAL D 1 123 ? 18.184  -1.245  29.808  1.00 7.14  ? 122  VAL D CG1 1 
ATOM   9191  C CG2 . VAL D 1 123 ? 16.680  -0.337  28.041  1.00 8.73  ? 122  VAL D CG2 1 
ATOM   9192  N N   . THR D 1 124 ? 16.951  2.927   29.694  1.00 7.36  ? 123  THR D N   1 
ATOM   9193  C CA  . THR D 1 124 ? 16.743  4.157   28.930  1.00 7.14  ? 123  THR D CA  1 
ATOM   9194  C C   . THR D 1 124 ? 17.993  4.346   28.059  1.00 6.54  ? 123  THR D C   1 
ATOM   9195  O O   . THR D 1 124 ? 18.913  3.522   28.180  1.00 6.52  ? 123  THR D O   1 
ATOM   9196  C CB  . THR D 1 124 ? 16.447  5.419   29.798  1.00 7.22  ? 123  THR D CB  1 
ATOM   9197  O OG1 . THR D 1 124 ? 16.083  6.453   28.840  1.00 7.53  ? 123  THR D OG1 1 
ATOM   9198  C CG2 . THR D 1 124 ? 17.596  5.881   30.718  1.00 8.36  ? 123  THR D CG2 1 
ATOM   9199  N N   . THR D 1 125 ? 17.975  5.394   27.263  1.00 6.25  ? 124  THR D N   1 
ATOM   9200  C CA  . THR D 1 125 ? 19.135  5.609   26.364  1.00 6.32  ? 124  THR D CA  1 
ATOM   9201  C C   . THR D 1 125 ? 19.884  6.859   26.718  1.00 5.45  ? 124  THR D C   1 
ATOM   9202  O O   . THR D 1 125 ? 19.250  7.887   26.986  1.00 7.04  ? 124  THR D O   1 
ATOM   9203  C CB  . THR D 1 125 ? 18.673  5.585   24.840  1.00 4.23  ? 124  THR D CB  1 
ATOM   9204  O OG1 . THR D 1 125 ? 18.197  4.217   24.638  1.00 6.12  ? 124  THR D OG1 1 
ATOM   9205  C CG2 . THR D 1 125 ? 19.854  5.933   23.909  1.00 5.36  ? 124  THR D CG2 1 
ATOM   9206  N N   . GLN D 1 126 ? 21.218  6.781   26.690  1.00 6.21  ? 125  GLN D N   1 
ATOM   9207  C CA  . GLN D 1 126 ? 22.061  7.966   26.965  1.00 6.17  ? 125  GLN D CA  1 
ATOM   9208  C C   . GLN D 1 126 ? 22.652  8.512   25.663  1.00 6.60  ? 125  GLN D C   1 
ATOM   9209  O O   . GLN D 1 126 ? 22.593  7.828   24.621  1.00 7.15  ? 125  GLN D O   1 
ATOM   9210  C CB  . GLN D 1 126 ? 23.128  7.642   28.006  1.00 6.98  ? 125  GLN D CB  1 
ATOM   9211  C CG  . GLN D 1 126 ? 24.093  6.552   27.620  1.00 7.70  ? 125  GLN D CG  1 
ATOM   9212  C CD  . GLN D 1 126 ? 25.381  6.546   28.429  1.00 11.62 ? 125  GLN D CD  1 
ATOM   9213  O OE1 . GLN D 1 126 ? 25.413  7.039   29.548  1.00 11.43 ? 125  GLN D OE1 1 
ATOM   9214  N NE2 . GLN D 1 126 ? 26.437  5.993   27.829  1.00 11.54 ? 125  GLN D NE2 1 
ATOM   9215  N N   . GLY D 1 127 ? 23.194  9.711   25.729  1.00 7.23  ? 126  GLY D N   1 
ATOM   9216  C CA  . GLY D 1 127 ? 23.825  10.399  24.611  1.00 7.43  ? 126  GLY D CA  1 
ATOM   9217  C C   . GLY D 1 127 ? 23.451  11.838  24.416  1.00 7.40  ? 126  GLY D C   1 
ATOM   9218  O O   . GLY D 1 127 ? 23.788  12.413  23.350  1.00 7.53  ? 126  GLY D O   1 
ATOM   9219  N N   . LEU D 1 128 ? 22.780  12.496  25.377  1.00 7.01  ? 127  LEU D N   1 
ATOM   9220  C CA  . LEU D 1 128 ? 22.423  13.901  25.215  1.00 6.75  ? 127  LEU D CA  1 
ATOM   9221  C C   . LEU D 1 128 ? 23.562  14.883  25.430  1.00 6.75  ? 127  LEU D C   1 
ATOM   9222  O O   . LEU D 1 128 ? 23.468  16.010  24.909  1.00 6.96  ? 127  LEU D O   1 
ATOM   9223  C CB  . LEU D 1 128 ? 21.235  14.281  26.131  1.00 5.62  ? 127  LEU D CB  1 
ATOM   9224  C CG  . LEU D 1 128 ? 19.985  13.425  26.016  1.00 6.86  ? 127  LEU D CG  1 
ATOM   9225  C CD1 . LEU D 1 128 ? 18.965  13.854  27.082  1.00 5.70  ? 127  LEU D CD1 1 
ATOM   9226  C CD2 . LEU D 1 128 ? 19.388  13.630  24.618  1.00 4.76  ? 127  LEU D CD2 1 
ATOM   9227  N N   . ASP D 1 129 ? 24.579  14.500  26.180  1.00 6.95  ? 128  ASP D N   1 
ATOM   9228  C CA  . ASP D 1 129 ? 25.631  15.456  26.569  1.00 6.90  ? 128  ASP D CA  1 
ATOM   9229  C C   . ASP D 1 129 ? 26.406  15.934  25.319  1.00 6.54  ? 128  ASP D C   1 
ATOM   9230  O O   . ASP D 1 129 ? 26.912  15.071  24.620  1.00 6.80  ? 128  ASP D O   1 
ATOM   9231  C CB  . ASP D 1 129 ? 26.555  14.873  27.638  1.00 7.41  ? 128  ASP D CB  1 
ATOM   9232  C CG  . ASP D 1 129 ? 25.829  14.567  28.947  1.00 9.11  ? 128  ASP D CG  1 
ATOM   9233  O OD1 . ASP D 1 129 ? 24.663  14.939  29.117  1.00 9.91  ? 128  ASP D OD1 1 
ATOM   9234  O OD2 . ASP D 1 129 ? 26.482  13.930  29.795  1.00 8.56  ? 128  ASP D OD2 1 
ATOM   9235  N N   . ASP D 1 130 ? 26.416  17.222  25.152  1.00 6.94  ? 129  ASP D N   1 
ATOM   9236  C CA  . ASP D 1 130 ? 27.106  17.944  24.069  1.00 9.13  ? 129  ASP D CA  1 
ATOM   9237  C C   . ASP D 1 130 ? 26.562  17.545  22.701  1.00 8.50  ? 129  ASP D C   1 
ATOM   9238  O O   . ASP D 1 130 ? 27.260  17.718  21.673  1.00 8.35  ? 129  ASP D O   1 
ATOM   9239  C CB  . ASP D 1 130 ? 28.631  17.805  24.201  1.00 10.46 ? 129  ASP D CB  1 
ATOM   9240  C CG  . ASP D 1 130 ? 29.148  18.367  25.524  1.00 12.63 ? 129  ASP D CG  1 
ATOM   9241  O OD1 . ASP D 1 130 ? 28.853  19.489  25.950  1.00 12.99 ? 129  ASP D OD1 1 
ATOM   9242  O OD2 . ASP D 1 130 ? 29.899  17.600  26.176  1.00 16.29 ? 129  ASP D OD2 1 
ATOM   9243  N N   . LEU D 1 131 ? 25.333  17.052  22.684  1.00 8.32  ? 130  LEU D N   1 
ATOM   9244  C CA  . LEU D 1 131 ? 24.745  16.597  21.402  1.00 8.46  ? 130  LEU D CA  1 
ATOM   9245  C C   . LEU D 1 131 ? 24.652  17.718  20.385  1.00 8.39  ? 130  LEU D C   1 
ATOM   9246  O O   . LEU D 1 131 ? 24.937  17.434  19.187  1.00 8.93  ? 130  LEU D O   1 
ATOM   9247  C CB  . LEU D 1 131 ? 23.465  15.791  21.627  1.00 5.93  ? 130  LEU D CB  1 
ATOM   9248  C CG  . LEU D 1 131 ? 22.805  15.218  20.364  1.00 5.00  ? 130  LEU D CG  1 
ATOM   9249  C CD1 . LEU D 1 131 ? 23.607  14.074  19.763  1.00 2.91  ? 130  LEU D CD1 1 
ATOM   9250  C CD2 . LEU D 1 131 ? 21.395  14.743  20.743  1.00 3.28  ? 130  LEU D CD2 1 
ATOM   9251  N N   . ALA D 1 132 ? 24.256  18.899  20.783  1.00 8.72  ? 131  ALA D N   1 
ATOM   9252  C CA  . ALA D 1 132 ? 24.141  20.061  19.905  1.00 9.72  ? 131  ALA D CA  1 
ATOM   9253  C C   . ALA D 1 132 ? 25.444  20.291  19.131  1.00 11.03 ? 131  ALA D C   1 
ATOM   9254  O O   . ALA D 1 132 ? 25.426  20.454  17.898  1.00 9.93  ? 131  ALA D O   1 
ATOM   9255  C CB  . ALA D 1 132 ? 23.715  21.304  20.663  1.00 9.00  ? 131  ALA D CB  1 
ATOM   9256  N N   . ALA D 1 133 ? 26.551  20.329  19.875  1.00 10.95 ? 132  ALA D N   1 
ATOM   9257  C CA  . ALA D 1 133 ? 27.874  20.516  19.256  1.00 11.25 ? 132  ALA D CA  1 
ATOM   9258  C C   . ALA D 1 133 ? 28.266  19.333  18.395  1.00 10.87 ? 132  ALA D C   1 
ATOM   9259  O O   . ALA D 1 133 ? 28.923  19.552  17.343  1.00 11.93 ? 132  ALA D O   1 
ATOM   9260  C CB  . ALA D 1 133 ? 28.915  20.861  20.318  1.00 11.75 ? 132  ALA D CB  1 
ATOM   9261  N N   . ARG D 1 134 ? 27.888  18.125  18.760  1.00 9.85  ? 133  ARG D N   1 
ATOM   9262  C CA  . ARG D 1 134 ? 28.179  16.923  17.982  1.00 9.90  ? 133  ARG D CA  1 
ATOM   9263  C C   . ARG D 1 134 ? 27.437  16.995  16.631  1.00 10.24 ? 133  ARG D C   1 
ATOM   9264  O O   . ARG D 1 134 ? 28.027  16.690  15.579  1.00 9.32  ? 133  ARG D O   1 
ATOM   9265  C CB  . ARG D 1 134 ? 27.878  15.626  18.701  1.00 10.10 ? 133  ARG D CB  1 
ATOM   9266  C CG  . ARG D 1 134 ? 28.736  15.329  19.943  1.00 12.06 ? 133  ARG D CG  1 
ATOM   9267  C CD  . ARG D 1 134 ? 28.326  14.041  20.579  1.00 12.23 ? 133  ARG D CD  1 
ATOM   9268  N NE  . ARG D 1 134 ? 28.565  12.913  19.683  1.00 15.29 ? 133  ARG D NE  1 
ATOM   9269  C CZ  . ARG D 1 134 ? 27.787  11.836  19.576  1.00 15.46 ? 133  ARG D CZ  1 
ATOM   9270  N NH1 . ARG D 1 134 ? 26.790  11.623  20.430  1.00 14.81 ? 133  ARG D NH1 1 
ATOM   9271  N NH2 . ARG D 1 134 ? 27.999  10.958  18.569  1.00 15.00 ? 133  ARG D NH2 1 
ATOM   9272  N N   . CYS D 1 135 ? 26.187  17.423  16.701  1.00 9.76  ? 134  CYS D N   1 
ATOM   9273  C CA  . CYS D 1 135 ? 25.290  17.541  15.552  1.00 9.48  ? 134  CYS D CA  1 
ATOM   9274  C C   . CYS D 1 135 ? 25.774  18.607  14.574  1.00 9.63  ? 134  CYS D C   1 
ATOM   9275  O O   . CYS D 1 135 ? 25.739  18.385  13.350  1.00 10.25 ? 134  CYS D O   1 
ATOM   9276  C CB  . CYS D 1 135 ? 23.843  17.794  16.013  1.00 8.70  ? 134  CYS D CB  1 
ATOM   9277  S SG  . CYS D 1 135 ? 22.993  16.270  16.524  1.00 10.31 ? 134  CYS D SG  1 
ATOM   9278  N N   . ALA D 1 136 ? 26.194  19.736  15.097  1.00 9.49  ? 135  ALA D N   1 
ATOM   9279  C CA  . ALA D 1 136 ? 26.711  20.850  14.314  1.00 9.24  ? 135  ALA D CA  1 
ATOM   9280  C C   . ALA D 1 136 ? 27.923  20.361  13.512  1.00 9.84  ? 135  ALA D C   1 
ATOM   9281  O O   . ALA D 1 136 ? 28.047  20.735  12.333  1.00 10.43 ? 135  ALA D O   1 
ATOM   9282  C CB  . ALA D 1 136 ? 27.034  22.059  15.170  1.00 10.12 ? 135  ALA D CB  1 
ATOM   9283  N N   . GLN D 1 137 ? 28.753  19.548  14.128  1.00 9.46  ? 136  GLN D N   1 
ATOM   9284  C CA  . GLN D 1 137 ? 29.947  19.006  13.467  1.00 9.80  ? 136  GLN D CA  1 
ATOM   9285  C C   . GLN D 1 137 ? 29.530  18.003  12.387  1.00 9.88  ? 136  GLN D C   1 
ATOM   9286  O O   . GLN D 1 137 ? 30.062  18.072  11.258  1.00 8.76  ? 136  GLN D O   1 
ATOM   9287  C CB  . GLN D 1 137 ? 30.972  18.399  14.409  1.00 10.26 ? 136  GLN D CB  1 
ATOM   9288  C CG  . GLN D 1 137 ? 32.233  17.861  13.774  1.00 12.05 ? 136  GLN D CG  1 
ATOM   9289  C CD  . GLN D 1 137 ? 33.166  18.923  13.244  1.00 14.36 ? 136  GLN D CD  1 
ATOM   9290  O OE1 . GLN D 1 137 ? 33.395  19.965  13.845  1.00 14.13 ? 136  GLN D OE1 1 
ATOM   9291  N NE2 . GLN D 1 137 ? 33.720  18.680  12.048  1.00 15.45 ? 136  GLN D NE2 1 
ATOM   9292  N N   . TYR D 1 138 ? 28.621  17.117  12.732  1.00 8.85  ? 137  TYR D N   1 
ATOM   9293  C CA  . TYR D 1 138 ? 28.131  16.089  11.814  1.00 9.31  ? 137  TYR D CA  1 
ATOM   9294  C C   . TYR D 1 138 ? 27.482  16.711  10.574  1.00 9.47  ? 137  TYR D C   1 
ATOM   9295  O O   . TYR D 1 138 ? 27.676  16.173  9.465   1.00 9.14  ? 137  TYR D O   1 
ATOM   9296  C CB  . TYR D 1 138 ? 27.193  15.083  12.496  1.00 8.39  ? 137  TYR D CB  1 
ATOM   9297  C CG  . TYR D 1 138 ? 27.840  14.097  13.428  1.00 8.01  ? 137  TYR D CG  1 
ATOM   9298  C CD1 . TYR D 1 138 ? 29.059  13.479  13.116  1.00 7.44  ? 137  TYR D CD1 1 
ATOM   9299  C CD2 . TYR D 1 138 ? 27.232  13.767  14.645  1.00 7.52  ? 137  TYR D CD2 1 
ATOM   9300  C CE1 . TYR D 1 138 ? 29.641  12.559  13.975  1.00 8.33  ? 137  TYR D CE1 1 
ATOM   9301  C CE2 . TYR D 1 138 ? 27.805  12.850  15.522  1.00 8.40  ? 137  TYR D CE2 1 
ATOM   9302  C CZ  . TYR D 1 138 ? 29.009  12.255  15.192  1.00 9.05  ? 137  TYR D CZ  1 
ATOM   9303  O OH  . TYR D 1 138 ? 29.544  11.340  16.045  1.00 9.52  ? 137  TYR D OH  1 
ATOM   9304  N N   . LYS D 1 139 ? 26.791  17.819  10.760  1.00 9.39  ? 138  LYS D N   1 
ATOM   9305  C CA  . LYS D 1 139 ? 26.100  18.544  9.687   1.00 9.48  ? 138  LYS D CA  1 
ATOM   9306  C C   . LYS D 1 139 ? 27.152  19.086  8.706   1.00 11.54 ? 138  LYS D C   1 
ATOM   9307  O O   . LYS D 1 139 ? 27.062  18.864  7.479   1.00 11.49 ? 138  LYS D O   1 
ATOM   9308  C CB  . LYS D 1 139 ? 25.243  19.666  10.218  1.00 7.60  ? 138  LYS D CB  1 
ATOM   9309  C CG  . LYS D 1 139 ? 24.451  20.537  9.262   1.00 7.70  ? 138  LYS D CG  1 
ATOM   9310  C CD  . LYS D 1 139 ? 23.281  19.763  8.630   1.00 7.01  ? 138  LYS D CD  1 
ATOM   9311  C CE  . LYS D 1 139 ? 22.583  20.634  7.572   1.00 7.22  ? 138  LYS D CE  1 
ATOM   9312  N NZ  . LYS D 1 139 ? 21.309  19.958  7.183   1.00 7.26  ? 138  LYS D NZ  1 
ATOM   9313  N N   . LYS D 1 140 ? 28.125  19.756  9.288   1.00 11.47 ? 139  LYS D N   1 
ATOM   9314  C CA  . LYS D 1 140 ? 29.270  20.312  8.545   1.00 13.62 ? 139  LYS D CA  1 
ATOM   9315  C C   . LYS D 1 140 ? 29.961  19.225  7.736   1.00 13.56 ? 139  LYS D C   1 
ATOM   9316  O O   . LYS D 1 140 ? 30.427  19.500  6.605   1.00 14.38 ? 139  LYS D O   1 
ATOM   9317  C CB  . LYS D 1 140 ? 30.260  20.913  9.548   1.00 17.05 ? 139  LYS D CB  1 
ATOM   9318  C CG  . LYS D 1 140 ? 31.180  22.010  9.069   1.00 21.15 ? 139  LYS D CG  1 
ATOM   9319  C CD  . LYS D 1 140 ? 31.732  22.802  10.269  1.00 24.28 ? 139  LYS D CD  1 
ATOM   9320  C CE  . LYS D 1 140 ? 30.600  23.458  11.048  1.00 26.27 ? 139  LYS D CE  1 
ATOM   9321  N NZ  . LYS D 1 140 ? 31.145  24.277  12.170  1.00 28.90 ? 139  LYS D NZ  1 
ATOM   9322  N N   . ASP D 1 141 ? 30.024  18.031  8.286   1.00 12.37 ? 140  ASP D N   1 
ATOM   9323  C CA  . ASP D 1 141 ? 30.729  16.885  7.717   1.00 12.77 ? 140  ASP D CA  1 
ATOM   9324  C C   . ASP D 1 141 ? 29.878  16.062  6.748   1.00 11.98 ? 140  ASP D C   1 
ATOM   9325  O O   . ASP D 1 141 ? 30.309  14.972  6.328   1.00 12.87 ? 140  ASP D O   1 
ATOM   9326  C CB  . ASP D 1 141 ? 31.371  16.027  8.817   1.00 14.33 ? 140  ASP D CB  1 
ATOM   9327  C CG  . ASP D 1 141 ? 32.580  16.694  9.467   1.00 15.42 ? 140  ASP D CG  1 
ATOM   9328  O OD1 . ASP D 1 141 ? 33.090  17.656  8.875   1.00 15.59 ? 140  ASP D OD1 1 
ATOM   9329  O OD2 . ASP D 1 141 ? 33.006  16.266  10.550  1.00 17.05 ? 140  ASP D OD2 1 
ATOM   9330  N N   . GLY D 1 142 ? 28.708  16.548  6.421   1.00 11.83 ? 141  GLY D N   1 
ATOM   9331  C CA  . GLY D 1 142 ? 27.833  16.003  5.407   1.00 11.41 ? 141  GLY D CA  1 
ATOM   9332  C C   . GLY D 1 142 ? 26.631  15.206  5.822   1.00 11.12 ? 141  GLY D C   1 
ATOM   9333  O O   . GLY D 1 142 ? 25.978  14.626  4.914   1.00 10.61 ? 141  GLY D O   1 
ATOM   9334  N N   . CYS D 1 143 ? 26.277  15.166  7.098   1.00 10.32 ? 142  CYS D N   1 
ATOM   9335  C CA  . CYS D 1 143 ? 25.134  14.362  7.577   1.00 10.12 ? 142  CYS D CA  1 
ATOM   9336  C C   . CYS D 1 143 ? 23.888  15.236  7.657   1.00 8.94  ? 142  CYS D C   1 
ATOM   9337  O O   . CYS D 1 143 ? 24.010  16.391  8.090   1.00 10.00 ? 142  CYS D O   1 
ATOM   9338  C CB  . CYS D 1 143 ? 25.427  13.758  8.956   1.00 10.79 ? 142  CYS D CB  1 
ATOM   9339  S SG  . CYS D 1 143 ? 26.742  12.538  8.946   1.00 11.64 ? 142  CYS D SG  1 
ATOM   9340  N N   . ASP D 1 144 ? 22.746  14.678  7.289   1.00 8.61  ? 143  ASP D N   1 
ATOM   9341  C CA  . ASP D 1 144 ? 21.493  15.446  7.315   1.00 8.65  ? 143  ASP D CA  1 
ATOM   9342  C C   . ASP D 1 144 ? 20.444  14.817  8.246   1.00 7.67  ? 143  ASP D C   1 
ATOM   9343  O O   . ASP D 1 144 ? 19.381  15.465  8.418   1.00 8.59  ? 143  ASP D O   1 
ATOM   9344  C CB  . ASP D 1 144 ? 20.906  15.659  5.920   1.00 7.67  ? 143  ASP D CB  1 
ATOM   9345  C CG  . ASP D 1 144 ? 21.729  16.614  5.065   1.00 8.11  ? 143  ASP D CG  1 
ATOM   9346  O OD1 . ASP D 1 144 ? 22.031  17.715  5.559   1.00 7.55  ? 143  ASP D OD1 1 
ATOM   9347  O OD2 . ASP D 1 144 ? 22.090  16.201  3.950   1.00 10.50 ? 143  ASP D OD2 1 
ATOM   9348  N N   . PHE D 1 145 ? 20.687  13.633  8.710   1.00 7.28  ? 144  PHE D N   1 
ATOM   9349  C CA  . PHE D 1 145 ? 19.708  12.961  9.604   1.00 6.95  ? 144  PHE D CA  1 
ATOM   9350  C C   . PHE D 1 145 ? 20.472  12.189  10.673  1.00 7.23  ? 144  PHE D C   1 
ATOM   9351  O O   . PHE D 1 145 ? 21.684  11.932  10.564  1.00 7.14  ? 144  PHE D O   1 
ATOM   9352  C CB  . PHE D 1 145 ? 18.677  12.152  8.842   1.00 4.79  ? 144  PHE D CB  1 
ATOM   9353  C CG  . PHE D 1 145 ? 19.083  10.902  8.149   1.00 5.22  ? 144  PHE D CG  1 
ATOM   9354  C CD1 . PHE D 1 145 ? 19.652  10.935  6.868   1.00 6.51  ? 144  PHE D CD1 1 
ATOM   9355  C CD2 . PHE D 1 145 ? 18.899  9.661   8.767   1.00 6.12  ? 144  PHE D CD2 1 
ATOM   9356  C CE1 . PHE D 1 145 ? 20.017  9.758   6.222   1.00 4.59  ? 144  PHE D CE1 1 
ATOM   9357  C CE2 . PHE D 1 145 ? 19.232  8.475   8.130   1.00 7.81  ? 144  PHE D CE2 1 
ATOM   9358  C CZ  . PHE D 1 145 ? 19.809  8.527   6.842   1.00 7.69  ? 144  PHE D CZ  1 
ATOM   9359  N N   . ALA D 1 146 ? 19.728  11.814  11.708  1.00 6.42  ? 145  ALA D N   1 
ATOM   9360  C CA  . ALA D 1 146 ? 20.340  11.118  12.859  1.00 6.82  ? 145  ALA D CA  1 
ATOM   9361  C C   . ALA D 1 146 ? 19.503  9.916   13.262  1.00 7.14  ? 145  ALA D C   1 
ATOM   9362  O O   . ALA D 1 146 ? 18.315  9.814   12.897  1.00 6.90  ? 145  ALA D O   1 
ATOM   9363  C CB  . ALA D 1 146 ? 20.503  12.114  14.012  1.00 5.54  ? 145  ALA D CB  1 
ATOM   9364  N N   . LYS D 1 147 ? 20.128  9.050   14.027  1.00 8.13  ? 146  LYS D N   1 
ATOM   9365  C CA  . LYS D 1 147 ? 19.527  7.815   14.548  1.00 9.45  ? 146  LYS D CA  1 
ATOM   9366  C C   . LYS D 1 147 ? 19.808  7.716   16.052  1.00 9.76  ? 146  LYS D C   1 
ATOM   9367  O O   . LYS D 1 147 ? 20.933  7.993   16.500  1.00 9.51  ? 146  LYS D O   1 
ATOM   9368  C CB  . LYS D 1 147 ? 20.086  6.609   13.810  1.00 11.78 ? 146  LYS D CB  1 
ATOM   9369  C CG  . LYS D 1 147 ? 19.513  5.269   14.270  1.00 14.51 ? 146  LYS D CG  1 
ATOM   9370  C CD  . LYS D 1 147 ? 20.454  4.539   15.203  1.00 16.91 ? 146  LYS D CD  1 
ATOM   9371  C CE  . LYS D 1 147 ? 19.954  3.141   15.512  1.00 19.92 ? 146  LYS D CE  1 
ATOM   9372  N NZ  . LYS D 1 147 ? 20.781  2.141   14.793  1.00 21.94 ? 146  LYS D NZ  1 
ATOM   9373  N N   . TRP D 1 148 ? 18.774  7.348   16.777  1.00 9.75  ? 147  TRP D N   1 
ATOM   9374  C CA  . TRP D 1 148 ? 18.798  7.190   18.250  1.00 9.80  ? 147  TRP D CA  1 
ATOM   9375  C C   . TRP D 1 148 ? 17.840  6.057   18.607  1.00 9.48  ? 147  TRP D C   1 
ATOM   9376  O O   . TRP D 1 148 ? 16.628  6.129   18.309  1.00 9.66  ? 147  TRP D O   1 
ATOM   9377  C CB  . TRP D 1 148 ? 18.474  8.515   18.933  1.00 7.91  ? 147  TRP D CB  1 
ATOM   9378  C CG  . TRP D 1 148 ? 18.322  8.503   20.426  1.00 9.21  ? 147  TRP D CG  1 
ATOM   9379  C CD1 . TRP D 1 148 ? 17.402  7.801   21.173  1.00 9.54  ? 147  TRP D CD1 1 
ATOM   9380  C CD2 . TRP D 1 148 ? 19.121  9.232   21.371  1.00 7.93  ? 147  TRP D CD2 1 
ATOM   9381  N NE1 . TRP D 1 148 ? 17.575  8.060   22.517  1.00 8.77  ? 147  TRP D NE1 1 
ATOM   9382  C CE2 . TRP D 1 148 ? 18.611  8.951   22.658  1.00 9.40  ? 147  TRP D CE2 1 
ATOM   9383  C CE3 . TRP D 1 148 ? 20.194  10.109  21.236  1.00 7.37  ? 147  TRP D CE3 1 
ATOM   9384  C CZ2 . TRP D 1 148 ? 19.172  9.487   23.811  1.00 7.49  ? 147  TRP D CZ2 1 
ATOM   9385  C CZ3 . TRP D 1 148 ? 20.756  10.637  22.381  1.00 9.97  ? 147  TRP D CZ3 1 
ATOM   9386  C CH2 . TRP D 1 148 ? 20.250  10.347  23.656  1.00 8.35  ? 147  TRP D CH2 1 
ATOM   9387  N N   . ARG D 1 149 ? 18.378  5.026   19.246  1.00 9.33  ? 148  ARG D N   1 
ATOM   9388  C CA  . ARG D 1 149 ? 17.607  3.832   19.583  1.00 10.09 ? 148  ARG D CA  1 
ATOM   9389  C C   . ARG D 1 149 ? 17.239  3.717   21.062  1.00 10.43 ? 148  ARG D C   1 
ATOM   9390  O O   . ARG D 1 149 ? 18.121  3.693   21.933  1.00 10.28 ? 148  ARG D O   1 
ATOM   9391  C CB  . ARG D 1 149 ? 18.336  2.552   19.156  1.00 10.02 ? 148  ARG D CB  1 
ATOM   9392  C CG  . ARG D 1 149 ? 17.509  1.279   19.309  1.00 12.33 ? 148  ARG D CG  1 
ATOM   9393  C CD  . ARG D 1 149 ? 18.298  0.090   18.888  1.00 15.83 ? 148  ARG D CD  1 
ATOM   9394  N NE  . ARG D 1 149 ? 17.600  -1.154  19.093  1.00 16.15 ? 148  ARG D NE  1 
ATOM   9395  C CZ  . ARG D 1 149 ? 18.152  -2.206  19.704  1.00 18.03 ? 148  ARG D CZ  1 
ATOM   9396  N NH1 . ARG D 1 149 ? 19.406  -2.118  20.135  1.00 17.67 ? 148  ARG D NH1 1 
ATOM   9397  N NH2 . ARG D 1 149 ? 17.457  -3.328  19.875  1.00 17.64 ? 148  ARG D NH2 1 
ATOM   9398  N N   . CYS D 1 150 ? 15.930  3.625   21.288  1.00 10.05 ? 149  CYS D N   1 
ATOM   9399  C CA  . CYS D 1 150 ? 15.385  3.273   22.621  1.00 9.73  ? 149  CYS D CA  1 
ATOM   9400  C C   . CYS D 1 150 ? 14.835  1.848   22.541  1.00 9.82  ? 149  CYS D C   1 
ATOM   9401  O O   . CYS D 1 150 ? 14.376  1.383   21.468  1.00 9.39  ? 149  CYS D O   1 
ATOM   9402  C CB  . CYS D 1 150 ? 14.335  4.250   23.093  1.00 8.16  ? 149  CYS D CB  1 
ATOM   9403  S SG  . CYS D 1 150 ? 14.897  5.828   23.686  1.00 8.87  ? 149  CYS D SG  1 
ATOM   9404  N N   . VAL D 1 151 ? 14.909  1.167   23.676  1.00 9.48  ? 150  VAL D N   1 
ATOM   9405  C CA  . VAL D 1 151 ? 14.493  -0.238  23.763  1.00 9.60  ? 150  VAL D CA  1 
ATOM   9406  C C   . VAL D 1 151 ? 13.460  -0.421  24.885  1.00 9.82  ? 150  VAL D C   1 
ATOM   9407  O O   . VAL D 1 151 ? 13.708  -0.027  26.038  1.00 8.56  ? 150  VAL D O   1 
ATOM   9408  C CB  . VAL D 1 151 ? 15.717  -1.154  23.926  1.00 12.12 ? 150  VAL D CB  1 
ATOM   9409  C CG1 . VAL D 1 151 ? 15.347  -2.630  24.107  1.00 12.72 ? 150  VAL D CG1 1 
ATOM   9410  C CG2 . VAL D 1 151 ? 16.697  -1.014  22.763  1.00 13.19 ? 150  VAL D CG2 1 
ATOM   9411  N N   . LEU D 1 152 ? 12.347  -1.008  24.485  1.00 9.45  ? 151  LEU D N   1 
ATOM   9412  C CA  . LEU D 1 152 ? 11.277  -1.411  25.402  1.00 10.63 ? 151  LEU D CA  1 
ATOM   9413  C C   . LEU D 1 152 ? 11.123  -2.921  25.319  1.00 10.60 ? 151  LEU D C   1 
ATOM   9414  O O   . LEU D 1 152 ? 11.189  -3.523  24.215  1.00 10.85 ? 151  LEU D O   1 
ATOM   9415  C CB  . LEU D 1 152 ? 10.005  -0.633  25.069  1.00 11.54 ? 151  LEU D CB  1 
ATOM   9416  C CG  . LEU D 1 152 ? 10.079  0.879   25.054  1.00 13.08 ? 151  LEU D CG  1 
ATOM   9417  C CD1 . LEU D 1 152 ? 8.750   1.447   24.586  1.00 17.04 ? 151  LEU D CD1 1 
ATOM   9418  C CD2 . LEU D 1 152 ? 10.352  1.381   26.482  1.00 15.05 ? 151  LEU D CD2 1 
ATOM   9419  N N   . LYS D 1 153 ? 10.949  -3.526  26.478  1.00 10.71 ? 152  LYS D N   1 
ATOM   9420  C CA  . LYS D 1 153 ? 10.847  -4.977  26.617  1.00 10.93 ? 152  LYS D CA  1 
ATOM   9421  C C   . LYS D 1 153 ? 9.461   -5.386  27.135  1.00 10.49 ? 152  LYS D C   1 
ATOM   9422  O O   . LYS D 1 153 ? 8.993   -4.789  28.117  1.00 9.59  ? 152  LYS D O   1 
ATOM   9423  C CB  . LYS D 1 153 ? 11.854  -5.538  27.621  1.00 15.85 ? 152  LYS D CB  1 
ATOM   9424  C CG  . LYS D 1 153 ? 13.232  -4.892  27.625  1.00 20.50 ? 152  LYS D CG  1 
ATOM   9425  C CD  . LYS D 1 153 ? 14.123  -5.578  28.679  1.00 23.01 ? 152  LYS D CD  1 
ATOM   9426  C CE  . LYS D 1 153 ? 15.477  -4.894  28.774  1.00 25.07 ? 152  LYS D CE  1 
ATOM   9427  N NZ  . LYS D 1 153 ? 16.385  -5.717  29.628  1.00 25.09 ? 152  LYS D NZ  1 
ATOM   9428  N N   . ILE D 1 154 ? 8.899   -6.374  26.465  1.00 9.95  ? 153  ILE D N   1 
ATOM   9429  C CA  . ILE D 1 154 ? 7.604   -6.927  26.877  1.00 10.38 ? 153  ILE D CA  1 
ATOM   9430  C C   . ILE D 1 154 ? 7.867   -8.107  27.815  1.00 10.03 ? 153  ILE D C   1 
ATOM   9431  O O   . ILE D 1 154 ? 8.545   -9.071  27.437  1.00 10.38 ? 153  ILE D O   1 
ATOM   9432  C CB  . ILE D 1 154 ? 6.717   -7.366  25.672  1.00 9.71  ? 153  ILE D CB  1 
ATOM   9433  C CG1 . ILE D 1 154 ? 6.484   -6.171  24.704  1.00 9.36  ? 153  ILE D CG1 1 
ATOM   9434  C CG2 . ILE D 1 154 ? 5.375   -8.000  26.134  1.00 10.49 ? 153  ILE D CG2 1 
ATOM   9435  C CD1 . ILE D 1 154 ? 5.543   -6.559  23.524  1.00 9.33  ? 153  ILE D CD1 1 
ATOM   9436  N N   . GLY D 1 155 ? 7.309   -7.986  29.003  1.00 10.65 ? 154  GLY D N   1 
ATOM   9437  C CA  . GLY D 1 155 ? 7.460   -9.041  30.037  1.00 9.52  ? 154  GLY D CA  1 
ATOM   9438  C C   . GLY D 1 155 ? 6.210   -9.027  30.912  1.00 9.92  ? 154  GLY D C   1 
ATOM   9439  O O   . GLY D 1 155 ? 5.171   -8.458  30.527  1.00 9.88  ? 154  GLY D O   1 
ATOM   9440  N N   . LYS D 1 156 ? 6.335   -9.661  32.069  1.00 9.86  ? 155  LYS D N   1 
ATOM   9441  C CA  . LYS D 1 156 ? 5.229   -9.737  33.025  1.00 10.38 ? 155  LYS D CA  1 
ATOM   9442  C C   . LYS D 1 156 ? 4.631   -8.366  33.312  1.00 9.09  ? 155  LYS D C   1 
ATOM   9443  O O   . LYS D 1 156 ? 3.414   -8.178  33.131  1.00 9.94  ? 155  LYS D O   1 
ATOM   9444  C CB  . LYS D 1 156 ? 5.631   -10.395 34.352  1.00 13.39 ? 155  LYS D CB  1 
ATOM   9445  C CG  . LYS D 1 156 ? 4.394   -10.809 35.173  1.00 17.24 ? 155  LYS D CG  1 
ATOM   9446  C CD  . LYS D 1 156 ? 4.821   -11.328 36.548  1.00 21.03 ? 155  LYS D CD  1 
ATOM   9447  C CE  . LYS D 1 156 ? 3.615   -11.762 37.358  1.00 24.67 ? 155  LYS D CE  1 
ATOM   9448  N NZ  . LYS D 1 156 ? 4.039   -12.564 38.541  1.00 28.06 ? 155  LYS D NZ  1 
ATOM   9449  N N   . ASN D 1 157 ? 5.440   -7.431  33.762  1.00 8.51  ? 156  ASN D N   1 
ATOM   9450  C CA  . ASN D 1 157 ? 4.966   -6.092  34.137  1.00 8.12  ? 156  ASN D CA  1 
ATOM   9451  C C   . ASN D 1 157 ? 5.572   -4.993  33.277  1.00 8.35  ? 156  ASN D C   1 
ATOM   9452  O O   . ASN D 1 157 ? 5.460   -3.802  33.631  1.00 7.75  ? 156  ASN D O   1 
ATOM   9453  C CB  . ASN D 1 157 ? 5.203   -5.839  35.638  1.00 8.11  ? 156  ASN D CB  1 
ATOM   9454  C CG  . ASN D 1 157 ? 4.710   -6.979  36.506  1.00 7.56  ? 156  ASN D CG  1 
ATOM   9455  O OD1 . ASN D 1 157 ? 3.548   -7.414  36.421  1.00 7.74  ? 156  ASN D OD1 1 
ATOM   9456  N ND2 . ASN D 1 157 ? 5.598   -7.486  37.354  1.00 6.66  ? 156  ASN D ND2 1 
ATOM   9457  N N   . THR D 1 158 ? 6.217   -5.387  32.191  1.00 8.23  ? 157  THR D N   1 
ATOM   9458  C CA  . THR D 1 158 ? 6.914   -4.393  31.350  1.00 7.88  ? 157  THR D CA  1 
ATOM   9459  C C   . THR D 1 158 ? 6.379   -4.367  29.923  1.00 6.97  ? 157  THR D C   1 
ATOM   9460  O O   . THR D 1 158 ? 5.888   -5.374  29.399  1.00 6.33  ? 157  THR D O   1 
ATOM   9461  C CB  . THR D 1 158 ? 8.482   -4.597  31.398  1.00 8.62  ? 157  THR D CB  1 
ATOM   9462  O OG1 . THR D 1 158 ? 8.758   -5.835  30.672  1.00 9.26  ? 157  THR D OG1 1 
ATOM   9463  C CG2 . THR D 1 158 ? 9.034   -4.618  32.833  1.00 7.41  ? 157  THR D CG2 1 
ATOM   9464  N N   . PRO D 1 159 ? 6.480   -3.206  29.277  1.00 6.73  ? 158  PRO D N   1 
ATOM   9465  C CA  . PRO D 1 159 ? 7.059   -1.968  29.783  1.00 6.95  ? 158  PRO D CA  1 
ATOM   9466  C C   . PRO D 1 159 ? 6.223   -1.281  30.847  1.00 7.04  ? 158  PRO D C   1 
ATOM   9467  O O   . PRO D 1 159 ? 4.984   -1.256  30.840  1.00 7.38  ? 158  PRO D O   1 
ATOM   9468  C CB  . PRO D 1 159 ? 7.215   -1.100  28.541  1.00 7.64  ? 158  PRO D CB  1 
ATOM   9469  C CG  . PRO D 1 159 ? 6.374   -1.694  27.474  1.00 7.63  ? 158  PRO D CG  1 
ATOM   9470  C CD  . PRO D 1 159 ? 5.952   -3.075  27.909  1.00 7.51  ? 158  PRO D CD  1 
ATOM   9471  N N   . SER D 1 160 ? 6.938   -0.675  31.797  1.00 7.87  ? 159  SER D N   1 
ATOM   9472  C CA  . SER D 1 160 ? 6.269   0.008   32.930  1.00 7.01  ? 159  SER D CA  1 
ATOM   9473  C C   . SER D 1 160 ? 5.971   1.452   32.554  1.00 6.89  ? 159  SER D C   1 
ATOM   9474  O O   . SER D 1 160 ? 6.493   1.988   31.562  1.00 6.97  ? 159  SER D O   1 
ATOM   9475  C CB  . SER D 1 160 ? 7.181   -0.054  34.159  1.00 7.39  ? 159  SER D CB  1 
ATOM   9476  O OG  . SER D 1 160 ? 8.350   0.717   33.916  1.00 6.54  ? 159  SER D OG  1 
ATOM   9477  N N   . TYR D 1 161 ? 5.105   2.069   33.361  1.00 6.14  ? 160  TYR D N   1 
ATOM   9478  C CA  . TYR D 1 161 ? 4.861   3.506   33.208  1.00 6.61  ? 160  TYR D CA  1 
ATOM   9479  C C   . TYR D 1 161 ? 6.195   4.250   33.215  1.00 6.69  ? 160  TYR D C   1 
ATOM   9480  O O   . TYR D 1 161 ? 6.407   5.138   32.368  1.00 5.51  ? 160  TYR D O   1 
ATOM   9481  C CB  . TYR D 1 161 ? 3.888   4.057   34.256  1.00 6.50  ? 160  TYR D CB  1 
ATOM   9482  C CG  . TYR D 1 161 ? 3.759   5.559   34.180  1.00 8.36  ? 160  TYR D CG  1 
ATOM   9483  C CD1 . TYR D 1 161 ? 3.121   6.157   33.083  1.00 9.33  ? 160  TYR D CD1 1 
ATOM   9484  C CD2 . TYR D 1 161 ? 4.260   6.375   35.186  1.00 8.56  ? 160  TYR D CD2 1 
ATOM   9485  C CE1 . TYR D 1 161 ? 2.996   7.532   33.006  1.00 9.76  ? 160  TYR D CE1 1 
ATOM   9486  C CE2 . TYR D 1 161 ? 4.131   7.763   35.138  1.00 7.95  ? 160  TYR D CE2 1 
ATOM   9487  C CZ  . TYR D 1 161 ? 3.503   8.331   34.027  1.00 10.25 ? 160  TYR D CZ  1 
ATOM   9488  O OH  . TYR D 1 161 ? 3.401   9.694   33.972  1.00 10.80 ? 160  TYR D OH  1 
ATOM   9489  N N   . GLN D 1 162 ? 7.063   3.907   34.165  1.00 5.85  ? 161  GLN D N   1 
ATOM   9490  C CA  . GLN D 1 162 ? 8.373   4.546   34.268  1.00 5.85  ? 161  GLN D CA  1 
ATOM   9491  C C   . GLN D 1 162 ? 9.147   4.499   32.930  1.00 5.68  ? 161  GLN D C   1 
ATOM   9492  O O   . GLN D 1 162 ? 9.670   5.538   32.513  1.00 5.79  ? 161  GLN D O   1 
ATOM   9493  C CB  . GLN D 1 162 ? 9.295   3.967   35.361  1.00 5.26  ? 161  GLN D CB  1 
ATOM   9494  C CG  . GLN D 1 162 ? 10.633  4.689   35.395  1.00 5.98  ? 161  GLN D CG  1 
ATOM   9495  C CD  . GLN D 1 162 ? 11.704  4.084   36.263  1.00 5.36  ? 161  GLN D CD  1 
ATOM   9496  O OE1 . GLN D 1 162 ? 12.694  4.768   36.623  1.00 8.34  ? 161  GLN D OE1 1 
ATOM   9497  N NE2 . GLN D 1 162 ? 11.564  2.822   36.590  1.00 4.26  ? 161  GLN D NE2 1 
ATOM   9498  N N   . SER D 1 163 ? 9.248   3.322   32.387  1.00 6.07  ? 162  SER D N   1 
ATOM   9499  C CA  . SER D 1 163 ? 9.979   3.065   31.142  1.00 7.22  ? 162  SER D CA  1 
ATOM   9500  C C   . SER D 1 163 ? 9.418   3.864   29.958  1.00 6.32  ? 162  SER D C   1 
ATOM   9501  O O   . SER D 1 163 ? 10.173  4.426   29.142  1.00 5.30  ? 162  SER D O   1 
ATOM   9502  C CB  . SER D 1 163 ? 9.979   1.580   30.802  1.00 9.58  ? 162  SER D CB  1 
ATOM   9503  O OG  . SER D 1 163 ? 11.078  1.340   29.937  1.00 17.22 ? 162  SER D OG  1 
ATOM   9504  N N   . ILE D 1 164 ? 8.102   3.880   29.892  1.00 6.29  ? 163  ILE D N   1 
ATOM   9505  C CA  . ILE D 1 164 ? 7.375   4.598   28.825  1.00 5.80  ? 163  ILE D CA  1 
ATOM   9506  C C   . ILE D 1 164 ? 7.603   6.078   28.930  1.00 6.17  ? 163  ILE D C   1 
ATOM   9507  O O   . ILE D 1 164 ? 8.015   6.736   27.927  1.00 5.52  ? 163  ILE D O   1 
ATOM   9508  C CB  . ILE D 1 164 ? 5.868   4.157   28.802  1.00 6.36  ? 163  ILE D CB  1 
ATOM   9509  C CG1 . ILE D 1 164 ? 5.769   2.674   28.391  1.00 7.37  ? 163  ILE D CG1 1 
ATOM   9510  C CG2 . ILE D 1 164 ? 5.019   5.092   27.888  1.00 6.20  ? 163  ILE D CG2 1 
ATOM   9511  C CD1 . ILE D 1 164 ? 4.385   2.013   28.610  1.00 7.63  ? 163  ILE D CD1 1 
ATOM   9512  N N   . LEU D 1 165 ? 7.381   6.631   30.127  1.00 5.20  ? 164  LEU D N   1 
ATOM   9513  C CA  . LEU D 1 165 ? 7.598   8.038   30.413  1.00 6.51  ? 164  LEU D CA  1 
ATOM   9514  C C   . LEU D 1 165 ? 9.019   8.505   30.062  1.00 5.86  ? 164  LEU D C   1 
ATOM   9515  O O   . LEU D 1 165 ? 9.201   9.576   29.461  1.00 5.55  ? 164  LEU D O   1 
ATOM   9516  C CB  . LEU D 1 165 ? 7.295   8.262   31.916  1.00 10.69 ? 164  LEU D CB  1 
ATOM   9517  C CG  . LEU D 1 165 ? 7.807   9.526   32.555  1.00 12.94 ? 164  LEU D CG  1 
ATOM   9518  C CD1 . LEU D 1 165 ? 7.138   10.765  31.965  1.00 15.14 ? 164  LEU D CD1 1 
ATOM   9519  C CD2 . LEU D 1 165 ? 7.511   9.486   34.069  1.00 16.07 ? 164  LEU D CD2 1 
ATOM   9520  N N   . GLU D 1 166 ? 9.984   7.716   30.499  1.00 5.81  ? 165  GLU D N   1 
ATOM   9521  C CA  . GLU D 1 166 ? 11.392  8.093   30.384  1.00 5.60  ? 165  GLU D CA  1 
ATOM   9522  C C   . GLU D 1 166 ? 11.892  7.986   28.936  1.00 4.81  ? 165  GLU D C   1 
ATOM   9523  O O   . GLU D 1 166 ? 12.579  8.918   28.496  1.00 3.42  ? 165  GLU D O   1 
ATOM   9524  C CB  . GLU D 1 166 ? 12.317  7.234   31.260  1.00 7.20  ? 165  GLU D CB  1 
ATOM   9525  C CG  . GLU D 1 166 ? 13.835  7.385   31.069  1.00 6.08  ? 165  GLU D CG  1 
ATOM   9526  C CD  . GLU D 1 166 ? 14.420  8.739   30.979  1.00 6.84  ? 165  GLU D CD  1 
ATOM   9527  O OE1 . GLU D 1 166 ? 13.967  9.784   31.427  1.00 7.76  ? 165  GLU D OE1 1 
ATOM   9528  O OE2 . GLU D 1 166 ? 15.538  8.729   30.371  1.00 7.46  ? 165  GLU D OE2 1 
ATOM   9529  N N   . ASN D 1 167 ? 11.583  6.875   28.312  1.00 4.76  ? 166  ASN D N   1 
ATOM   9530  C CA  . ASN D 1 167 ? 11.994  6.655   26.913  1.00 5.54  ? 166  ASN D CA  1 
ATOM   9531  C C   . ASN D 1 167 ? 11.338  7.703   26.009  1.00 5.66  ? 166  ASN D C   1 
ATOM   9532  O O   . ASN D 1 167 ? 12.017  8.168   25.079  1.00 5.10  ? 166  ASN D O   1 
ATOM   9533  C CB  . ASN D 1 167 ? 11.835  5.210   26.486  1.00 4.80  ? 166  ASN D CB  1 
ATOM   9534  C CG  . ASN D 1 167 ? 12.935  4.309   27.006  1.00 7.98  ? 166  ASN D CG  1 
ATOM   9535  O OD1 . ASN D 1 167 ? 14.050  4.276   26.454  1.00 8.07  ? 166  ASN D OD1 1 
ATOM   9536  N ND2 . ASN D 1 167 ? 12.656  3.605   28.117  1.00 6.75  ? 166  ASN D ND2 1 
ATOM   9537  N N   . ALA D 1 168 ? 10.083  8.074   26.305  1.00 4.34  ? 167  ALA D N   1 
ATOM   9538  C CA  . ALA D 1 168 ? 9.420   9.078   25.451  1.00 3.80  ? 167  ALA D CA  1 
ATOM   9539  C C   . ALA D 1 168 ? 10.086  10.420  25.611  1.00 3.44  ? 167  ALA D C   1 
ATOM   9540  O O   . ALA D 1 168 ? 10.338  11.159  24.641  1.00 2.00  ? 167  ALA D O   1 
ATOM   9541  C CB  . ALA D 1 168 ? 7.914   9.114   25.690  1.00 2.83  ? 167  ALA D CB  1 
ATOM   9542  N N   . ASN D 1 169 ? 10.411  10.769  26.875  1.00 3.21  ? 168  ASN D N   1 
ATOM   9543  C CA  . ASN D 1 169 ? 11.027  12.043  27.173  1.00 4.15  ? 168  ASN D CA  1 
ATOM   9544  C C   . ASN D 1 169 ? 12.425  12.175  26.555  1.00 4.02  ? 168  ASN D C   1 
ATOM   9545  O O   . ASN D 1 169 ? 12.793  13.270  26.103  1.00 4.42  ? 168  ASN D O   1 
ATOM   9546  C CB  . ASN D 1 169 ? 11.050  12.307  28.701  1.00 3.88  ? 168  ASN D CB  1 
ATOM   9547  C CG  . ASN D 1 169 ? 11.255  13.765  28.982  1.00 3.72  ? 168  ASN D CG  1 
ATOM   9548  O OD1 . ASN D 1 169 ? 10.331  14.588  28.885  1.00 5.92  ? 168  ASN D OD1 1 
ATOM   9549  N ND2 . ASN D 1 169 ? 12.498  14.116  29.340  1.00 6.20  ? 168  ASN D ND2 1 
ATOM   9550  N N   . VAL D 1 170 ? 13.161  11.076  26.610  1.00 4.85  ? 169  VAL D N   1 
ATOM   9551  C CA  . VAL D 1 170 ? 14.564  11.156  26.100  1.00 5.01  ? 169  VAL D CA  1 
ATOM   9552  C C   . VAL D 1 170 ? 14.524  11.317  24.562  1.00 4.72  ? 169  VAL D C   1 
ATOM   9553  O O   . VAL D 1 170 ? 15.395  11.994  24.000  1.00 3.92  ? 169  VAL D O   1 
ATOM   9554  C CB  . VAL D 1 170 ? 15.395  10.008  26.649  1.00 4.28  ? 169  VAL D CB  1 
ATOM   9555  C CG1 . VAL D 1 170 ? 15.385  8.696   25.875  1.00 5.94  ? 169  VAL D CG1 1 
ATOM   9556  C CG2 . VAL D 1 170 ? 16.836  10.458  26.912  1.00 5.66  ? 169  VAL D CG2 1 
ATOM   9557  N N   . LEU D 1 171 ? 13.564  10.666  23.947  1.00 4.97  ? 170  LEU D N   1 
ATOM   9558  C CA  . LEU D 1 171 ? 13.413  10.739  22.465  1.00 5.03  ? 170  LEU D CA  1 
ATOM   9559  C C   . LEU D 1 171 ? 13.097  12.161  22.059  1.00 4.40  ? 170  LEU D C   1 
ATOM   9560  O O   . LEU D 1 171 ? 13.656  12.670  21.069  1.00 4.16  ? 170  LEU D O   1 
ATOM   9561  C CB  . LEU D 1 171 ? 12.430  9.659   22.017  1.00 4.35  ? 170  LEU D CB  1 
ATOM   9562  C CG  . LEU D 1 171 ? 12.970  8.255   21.861  1.00 5.45  ? 170  LEU D CG  1 
ATOM   9563  C CD1 . LEU D 1 171 ? 11.875  7.243   21.520  1.00 7.13  ? 170  LEU D CD1 1 
ATOM   9564  C CD2 . LEU D 1 171 ? 13.982  8.251   20.708  1.00 6.07  ? 170  LEU D CD2 1 
ATOM   9565  N N   . ALA D 1 172 ? 12.218  12.812  22.822  1.00 3.86  ? 171  ALA D N   1 
ATOM   9566  C CA  . ALA D 1 172 ? 11.829  14.192  22.600  1.00 4.16  ? 171  ALA D CA  1 
ATOM   9567  C C   . ALA D 1 172 ? 12.984  15.154  22.770  1.00 4.04  ? 171  ALA D C   1 
ATOM   9568  O O   . ALA D 1 172 ? 13.119  16.138  21.993  1.00 3.33  ? 171  ALA D O   1 
ATOM   9569  C CB  . ALA D 1 172 ? 10.628  14.548  23.489  1.00 4.50  ? 171  ALA D CB  1 
ATOM   9570  N N   . ARG D 1 173 ? 13.826  14.920  23.795  1.00 3.69  ? 172  ARG D N   1 
ATOM   9571  C CA  . ARG D 1 173 ? 14.989  15.810  23.995  1.00 2.90  ? 172  ARG D CA  1 
ATOM   9572  C C   . ARG D 1 173 ? 15.977  15.670  22.812  1.00 3.51  ? 172  ARG D C   1 
ATOM   9573  O O   . ARG D 1 173 ? 16.496  16.676  22.305  1.00 3.94  ? 172  ARG D O   1 
ATOM   9574  C CB  . ARG D 1 173 ? 15.729  15.463  25.297  1.00 4.23  ? 172  ARG D CB  1 
ATOM   9575  C CG  . ARG D 1 173 ? 15.017  15.904  26.583  1.00 3.58  ? 172  ARG D CG  1 
ATOM   9576  C CD  . ARG D 1 173 ? 15.154  17.368  26.812  1.00 5.51  ? 172  ARG D CD  1 
ATOM   9577  N NE  . ARG D 1 173 ? 16.555  17.774  26.923  1.00 7.12  ? 172  ARG D NE  1 
ATOM   9578  C CZ  . ARG D 1 173 ? 17.106  18.729  26.177  1.00 7.52  ? 172  ARG D CZ  1 
ATOM   9579  N NH1 . ARG D 1 173 ? 16.388  19.322  25.218  1.00 8.15  ? 172  ARG D NH1 1 
ATOM   9580  N NH2 . ARG D 1 173 ? 18.385  19.086  26.294  1.00 8.54  ? 172  ARG D NH2 1 
ATOM   9581  N N   . TYR D 1 174 ? 16.253  14.444  22.451  1.00 3.49  ? 173  TYR D N   1 
ATOM   9582  C CA  . TYR D 1 174 ? 17.121  14.104  21.319  1.00 5.13  ? 173  TYR D CA  1 
ATOM   9583  C C   . TYR D 1 174 ? 16.604  14.739  20.017  1.00 5.43  ? 173  TYR D C   1 
ATOM   9584  O O   . TYR D 1 174 ? 17.409  15.354  19.291  1.00 5.21  ? 173  TYR D O   1 
ATOM   9585  C CB  . TYR D 1 174 ? 17.256  12.604  21.135  1.00 5.91  ? 173  TYR D CB  1 
ATOM   9586  C CG  . TYR D 1 174 ? 17.305  12.119  19.701  1.00 7.28  ? 173  TYR D CG  1 
ATOM   9587  C CD1 . TYR D 1 174 ? 18.475  12.211  18.937  1.00 8.21  ? 173  TYR D CD1 1 
ATOM   9588  C CD2 . TYR D 1 174 ? 16.166  11.595  19.096  1.00 7.36  ? 173  TYR D CD2 1 
ATOM   9589  C CE1 . TYR D 1 174 ? 18.513  11.741  17.621  1.00 9.09  ? 173  TYR D CE1 1 
ATOM   9590  C CE2 . TYR D 1 174 ? 16.184  11.123  17.784  1.00 8.76  ? 173  TYR D CE2 1 
ATOM   9591  C CZ  . TYR D 1 174 ? 17.363  11.211  17.045  1.00 9.30  ? 173  TYR D CZ  1 
ATOM   9592  O OH  . TYR D 1 174 ? 17.357  10.715  15.760  1.00 7.69  ? 173  TYR D OH  1 
ATOM   9593  N N   . ALA D 1 175 ? 15.305  14.574  19.774  1.00 5.32  ? 174  ALA D N   1 
ATOM   9594  C CA  . ALA D 1 175 ? 14.729  15.147  18.524  1.00 5.17  ? 174  ALA D CA  1 
ATOM   9595  C C   . ALA D 1 175 ? 14.828  16.642  18.499  1.00 5.32  ? 174  ALA D C   1 
ATOM   9596  O O   . ALA D 1 175 ? 15.147  17.222  17.437  1.00 3.81  ? 174  ALA D O   1 
ATOM   9597  C CB  . ALA D 1 175 ? 13.314  14.614  18.309  1.00 5.74  ? 174  ALA D CB  1 
ATOM   9598  N N   . SER D 1 176 ? 14.578  17.333  19.625  1.00 5.84  ? 175  SER D N   1 
ATOM   9599  C CA  . SER D 1 176 ? 14.621  18.790  19.642  1.00 6.49  ? 175  SER D CA  1 
ATOM   9600  C C   . SER D 1 176 ? 16.045  19.298  19.391  1.00 6.59  ? 175  SER D C   1 
ATOM   9601  O O   . SER D 1 176 ? 16.208  20.312  18.690  1.00 6.14  ? 175  SER D O   1 
ATOM   9602  C CB  . SER D 1 176 ? 14.034  19.440  20.891  1.00 7.97  ? 175  SER D CB  1 
ATOM   9603  O OG  . SER D 1 176 ? 14.833  19.187  22.023  1.00 16.63 ? 175  SER D OG  1 
ATOM   9604  N N   . ILE D 1 177 ? 17.013  18.610  19.975  1.00 6.43  ? 176  ILE D N   1 
ATOM   9605  C CA  . ILE D 1 177 ? 18.427  19.020  19.826  1.00 6.79  ? 176  ILE D CA  1 
ATOM   9606  C C   . ILE D 1 177 ? 18.833  18.902  18.343  1.00 6.49  ? 176  ILE D C   1 
ATOM   9607  O O   . ILE D 1 177 ? 19.406  19.875  17.804  1.00 6.97  ? 176  ILE D O   1 
ATOM   9608  C CB  . ILE D 1 177 ? 19.371  18.238  20.802  1.00 5.71  ? 176  ILE D CB  1 
ATOM   9609  C CG1 . ILE D 1 177 ? 19.190  18.722  22.277  1.00 7.51  ? 176  ILE D CG1 1 
ATOM   9610  C CG2 . ILE D 1 177 ? 20.871  18.412  20.406  1.00 6.28  ? 176  ILE D CG2 1 
ATOM   9611  C CD1 . ILE D 1 177 ? 19.856  17.708  23.283  1.00 6.07  ? 176  ILE D CD1 1 
ATOM   9612  N N   . CYS D 1 178 ? 18.489  17.784  17.750  1.00 5.96  ? 177  CYS D N   1 
ATOM   9613  C CA  . CYS D 1 178 ? 18.795  17.531  16.315  1.00 6.91  ? 177  CYS D CA  1 
ATOM   9614  C C   . CYS D 1 178 ? 18.239  18.638  15.428  1.00 6.05  ? 177  CYS D C   1 
ATOM   9615  O O   . CYS D 1 178 ? 18.979  19.243  14.616  1.00 6.32  ? 177  CYS D O   1 
ATOM   9616  C CB  . CYS D 1 178 ? 18.277  16.169  15.890  1.00 6.61  ? 177  CYS D CB  1 
ATOM   9617  S SG  . CYS D 1 178 ? 19.224  14.739  16.388  1.00 8.00  ? 177  CYS D SG  1 
ATOM   9618  N N   . GLN D 1 179 ? 16.951  18.906  15.579  1.00 5.92  ? 178  GLN D N   1 
ATOM   9619  C CA  . GLN D 1 179 ? 16.277  19.972  14.836  1.00 5.72  ? 178  GLN D CA  1 
ATOM   9620  C C   . GLN D 1 179 ? 16.951  21.312  14.991  1.00 5.73  ? 178  GLN D C   1 
ATOM   9621  O O   . GLN D 1 179 ? 17.069  22.020  13.954  1.00 5.52  ? 178  GLN D O   1 
ATOM   9622  C CB  . GLN D 1 179 ? 14.762  20.072  15.123  1.00 4.47  ? 178  GLN D CB  1 
ATOM   9623  C CG  . GLN D 1 179 ? 14.085  18.767  14.713  1.00 5.12  ? 178  GLN D CG  1 
ATOM   9624  C CD  . GLN D 1 179 ? 12.581  18.892  14.659  1.00 5.69  ? 178  GLN D CD  1 
ATOM   9625  O OE1 . GLN D 1 179 ? 11.989  19.663  15.397  1.00 5.27  ? 178  GLN D OE1 1 
ATOM   9626  N NE2 . GLN D 1 179 ? 11.991  18.118  13.748  1.00 4.71  ? 178  GLN D NE2 1 
ATOM   9627  N N   . SER D 1 180 ? 17.402  21.677  16.184  1.00 5.25  ? 179  SER D N   1 
ATOM   9628  C CA  . SER D 1 180 ? 18.044  22.961  16.419  1.00 5.06  ? 179  SER D CA  1 
ATOM   9629  C C   . SER D 1 180 ? 19.354  23.097  15.616  1.00 4.87  ? 179  SER D C   1 
ATOM   9630  O O   . SER D 1 180 ? 19.809  24.239  15.428  1.00 4.45  ? 179  SER D O   1 
ATOM   9631  C CB  . SER D 1 180 ? 18.343  23.242  17.892  1.00 5.57  ? 179  SER D CB  1 
ATOM   9632  O OG  . SER D 1 180 ? 19.434  22.468  18.346  1.00 7.05  ? 179  SER D OG  1 
ATOM   9633  N N   . GLN D 1 181 ? 19.909  22.010  15.187  1.00 4.85  ? 180  GLN D N   1 
ATOM   9634  C CA  . GLN D 1 181 ? 21.173  21.989  14.435  1.00 6.62  ? 180  GLN D CA  1 
ATOM   9635  C C   . GLN D 1 181 ? 20.954  21.579  12.979  1.00 6.60  ? 180  GLN D C   1 
ATOM   9636  O O   . GLN D 1 181 ? 21.930  21.152  12.321  1.00 7.91  ? 180  GLN D O   1 
ATOM   9637  C CB  . GLN D 1 181 ? 22.186  21.031  15.093  1.00 7.97  ? 180  GLN D CB  1 
ATOM   9638  C CG  . GLN D 1 181 ? 22.479  21.371  16.541  1.00 11.05 ? 180  GLN D CG  1 
ATOM   9639  C CD  . GLN D 1 181 ? 22.923  22.780  16.763  1.00 13.36 ? 180  GLN D CD  1 
ATOM   9640  O OE1 . GLN D 1 181 ? 23.833  23.312  16.114  1.00 14.66 ? 180  GLN D OE1 1 
ATOM   9641  N NE2 . GLN D 1 181 ? 22.270  23.433  17.721  1.00 14.98 ? 180  GLN D NE2 1 
ATOM   9642  N N   . ARG D 1 182 ? 19.725  21.663  12.508  1.00 7.12  ? 181  ARG D N   1 
ATOM   9643  C CA  . ARG D 1 182 ? 19.408  21.361  11.095  1.00 7.69  ? 181  ARG D CA  1 
ATOM   9644  C C   . ARG D 1 182 ? 19.576  19.895  10.762  1.00 7.87  ? 181  ARG D C   1 
ATOM   9645  O O   . ARG D 1 182 ? 20.003  19.562  9.637   1.00 8.93  ? 181  ARG D O   1 
ATOM   9646  C CB  . ARG D 1 182 ? 20.311  22.186  10.140  1.00 8.02  ? 181  ARG D CB  1 
ATOM   9647  C CG  . ARG D 1 182 ? 20.145  23.690  10.293  1.00 9.94  ? 181  ARG D CG  1 
ATOM   9648  C CD  . ARG D 1 182 ? 21.197  24.465  9.553   1.00 11.73 ? 181  ARG D CD  1 
ATOM   9649  N NE  . ARG D 1 182 ? 21.135  24.201  8.118   1.00 10.78 ? 181  ARG D NE  1 
ATOM   9650  C CZ  . ARG D 1 182 ? 22.173  24.312  7.282   1.00 12.24 ? 181  ARG D CZ  1 
ATOM   9651  N NH1 . ARG D 1 182 ? 23.378  24.687  7.688   1.00 11.54 ? 181  ARG D NH1 1 
ATOM   9652  N NH2 . ARG D 1 182 ? 22.000  23.985  5.999   1.00 11.08 ? 181  ARG D NH2 1 
ATOM   9653  N N   . ILE D 1 183 ? 19.273  19.003  11.684  1.00 6.99  ? 182  ILE D N   1 
ATOM   9654  C CA  . ILE D 1 183 ? 19.374  17.562  11.489  1.00 6.13  ? 182  ILE D CA  1 
ATOM   9655  C C   . ILE D 1 183 ? 18.000  16.920  11.713  1.00 6.27  ? 182  ILE D C   1 
ATOM   9656  O O   . ILE D 1 183 ? 17.361  17.214  12.734  1.00 6.00  ? 182  ILE D O   1 
ATOM   9657  C CB  . ILE D 1 183 ? 20.443  16.922  12.444  1.00 7.38  ? 182  ILE D CB  1 
ATOM   9658  C CG1 . ILE D 1 183 ? 21.877  17.429  12.133  1.00 8.78  ? 182  ILE D CG1 1 
ATOM   9659  C CG2 . ILE D 1 183 ? 20.405  15.369  12.357  1.00 6.06  ? 182  ILE D CG2 1 
ATOM   9660  C CD1 . ILE D 1 183 ? 22.628  16.631  11.050  1.00 10.08 ? 182  ILE D CD1 1 
ATOM   9661  N N   . VAL D 1 184 ? 17.555  16.076  10.793  1.00 6.28  ? 183  VAL D N   1 
ATOM   9662  C CA  . VAL D 1 184 ? 16.304  15.329  10.927  1.00 4.97  ? 183  VAL D CA  1 
ATOM   9663  C C   . VAL D 1 184 ? 16.495  14.118  11.840  1.00 4.40  ? 183  VAL D C   1 
ATOM   9664  O O   . VAL D 1 184 ? 17.246  13.199  11.538  1.00 4.10  ? 183  VAL D O   1 
ATOM   9665  C CB  . VAL D 1 184 ? 15.779  14.883  9.529   1.00 6.96  ? 183  VAL D CB  1 
ATOM   9666  C CG1 . VAL D 1 184 ? 14.600  13.920  9.644   1.00 5.31  ? 183  VAL D CG1 1 
ATOM   9667  C CG2 . VAL D 1 184 ? 15.420  16.093  8.663   1.00 5.62  ? 183  VAL D CG2 1 
ATOM   9668  N N   . PRO D 1 185 ? 15.767  14.123  12.954  1.00 4.06  ? 184  PRO D N   1 
ATOM   9669  C CA  . PRO D 1 185 ? 15.821  12.987  13.885  1.00 4.09  ? 184  PRO D CA  1 
ATOM   9670  C C   . PRO D 1 185 ? 14.930  11.847  13.454  1.00 4.53  ? 184  PRO D C   1 
ATOM   9671  O O   . PRO D 1 185 ? 13.727  12.043  13.123  1.00 4.05  ? 184  PRO D O   1 
ATOM   9672  C CB  . PRO D 1 185 ? 15.354  13.628  15.208  1.00 3.60  ? 184  PRO D CB  1 
ATOM   9673  C CG  . PRO D 1 185 ? 14.371  14.682  14.791  1.00 3.74  ? 184  PRO D CG  1 
ATOM   9674  C CD  . PRO D 1 185 ? 14.965  15.243  13.468  1.00 3.92  ? 184  PRO D CD  1 
ATOM   9675  N N   . ILE D 1 186 ? 15.484  10.649  13.392  1.00 4.71  ? 185  ILE D N   1 
ATOM   9676  C CA  . ILE D 1 186 ? 14.633  9.453   13.267  1.00 6.20  ? 185  ILE D CA  1 
ATOM   9677  C C   . ILE D 1 186 ? 14.350  8.996   14.722  1.00 6.35  ? 185  ILE D C   1 
ATOM   9678  O O   . ILE D 1 186 ? 15.303  8.602   15.401  1.00 7.18  ? 185  ILE D O   1 
ATOM   9679  C CB  . ILE D 1 186 ? 15.269  8.326   12.416  1.00 6.22  ? 185  ILE D CB  1 
ATOM   9680  C CG1 . ILE D 1 186 ? 15.614  8.864   10.993  1.00 7.13  ? 185  ILE D CG1 1 
ATOM   9681  C CG2 . ILE D 1 186 ? 14.402  7.051   12.359  1.00 7.13  ? 185  ILE D CG2 1 
ATOM   9682  C CD1 . ILE D 1 186 ? 16.190  7.736   10.079  1.00 10.88 ? 185  ILE D CD1 1 
ATOM   9683  N N   . VAL D 1 187 ? 13.109  9.100   15.111  1.00 6.67  ? 186  VAL D N   1 
ATOM   9684  C CA  . VAL D 1 187 ? 12.656  8.621   16.454  1.00 6.59  ? 186  VAL D CA  1 
ATOM   9685  C C   . VAL D 1 187 ? 12.475  7.116   16.423  1.00 6.13  ? 186  VAL D C   1 
ATOM   9686  O O   . VAL D 1 187 ? 11.614  6.578   15.692  1.00 5.79  ? 186  VAL D O   1 
ATOM   9687  C CB  . VAL D 1 187 ? 11.354  9.390   16.788  1.00 8.45  ? 186  VAL D CB  1 
ATOM   9688  C CG1 . VAL D 1 187 ? 10.711  8.913   18.096  1.00 9.15  ? 186  VAL D CG1 1 
ATOM   9689  C CG2 . VAL D 1 187 ? 11.571  10.892  16.822  1.00 7.21  ? 186  VAL D CG2 1 
ATOM   9690  N N   . GLU D 1 188 ? 13.239  6.375   17.225  1.00 6.02  ? 187  GLU D N   1 
ATOM   9691  C CA  . GLU D 1 188 ? 13.187  4.920   17.204  1.00 6.82  ? 187  GLU D CA  1 
ATOM   9692  C C   . GLU D 1 188 ? 12.902  4.309   18.572  1.00 7.48  ? 187  GLU D C   1 
ATOM   9693  O O   . GLU D 1 188 ? 13.812  4.078   19.378  1.00 6.97  ? 187  GLU D O   1 
ATOM   9694  C CB  . GLU D 1 188 ? 14.484  4.289   16.680  1.00 7.73  ? 187  GLU D CB  1 
ATOM   9695  C CG  . GLU D 1 188 ? 14.619  2.811   16.555  1.00 8.17  ? 187  GLU D CG  1 
ATOM   9696  C CD  . GLU D 1 188 ? 15.906  2.250   15.991  1.00 10.04 ? 187  GLU D CD  1 
ATOM   9697  O OE1 . GLU D 1 188 ? 16.652  3.121   15.519  1.00 11.25 ? 187  GLU D OE1 1 
ATOM   9698  O OE2 . GLU D 1 188 ? 16.180  1.080   15.986  1.00 8.93  ? 187  GLU D OE2 1 
ATOM   9699  N N   . PRO D 1 189 ? 11.626  4.070   18.795  1.00 7.91  ? 188  PRO D N   1 
ATOM   9700  C CA  . PRO D 1 189 ? 11.173  3.384   20.027  1.00 8.21  ? 188  PRO D CA  1 
ATOM   9701  C C   . PRO D 1 189 ? 10.949  1.922   19.707  1.00 8.42  ? 188  PRO D C   1 
ATOM   9702  O O   . PRO D 1 189 ? 9.826   1.518   19.353  1.00 9.54  ? 188  PRO D O   1 
ATOM   9703  C CB  . PRO D 1 189 ? 9.916   4.151   20.402  1.00 8.38  ? 188  PRO D CB  1 
ATOM   9704  C CG  . PRO D 1 189 ? 9.383   4.756   19.131  1.00 8.82  ? 188  PRO D CG  1 
ATOM   9705  C CD  . PRO D 1 189 ? 10.470  4.611   18.065  1.00 8.15  ? 188  PRO D CD  1 
ATOM   9706  N N   . GLU D 1 190 ? 11.998  1.100   19.815  1.00 7.64  ? 189  GLU D N   1 
ATOM   9707  C CA  . GLU D 1 190 ? 11.871  -0.303  19.472  1.00 7.88  ? 189  GLU D CA  1 
ATOM   9708  C C   . GLU D 1 190 ? 11.279  -1.159  20.593  1.00 7.93  ? 189  GLU D C   1 
ATOM   9709  O O   . GLU D 1 190 ? 11.906  -1.248  21.665  1.00 7.52  ? 189  GLU D O   1 
ATOM   9710  C CB  . GLU D 1 190 ? 13.208  -0.984  19.120  1.00 8.62  ? 189  GLU D CB  1 
ATOM   9711  C CG  . GLU D 1 190 ? 13.062  -2.423  18.652  1.00 10.48 ? 189  GLU D CG  1 
ATOM   9712  C CD  . GLU D 1 190 ? 14.307  -3.111  18.149  1.00 11.66 ? 189  GLU D CD  1 
ATOM   9713  O OE1 . GLU D 1 190 ? 15.387  -2.578  18.120  1.00 13.51 ? 189  GLU D OE1 1 
ATOM   9714  O OE2 . GLU D 1 190 ? 14.085  -4.289  17.798  1.00 13.95 ? 189  GLU D OE2 1 
ATOM   9715  N N   . VAL D 1 191 ? 10.112  -1.715  20.315  1.00 7.50  ? 190  VAL D N   1 
ATOM   9716  C CA  . VAL D 1 191 ? 9.524   -2.756  21.183  1.00 8.45  ? 190  VAL D CA  1 
ATOM   9717  C C   . VAL D 1 191 ? 10.119  -4.092  20.718  1.00 9.72  ? 190  VAL D C   1 
ATOM   9718  O O   . VAL D 1 191 ? 9.795   -4.565  19.614  1.00 9.31  ? 190  VAL D O   1 
ATOM   9719  C CB  . VAL D 1 191 ? 7.986   -2.710  21.145  1.00 8.92  ? 190  VAL D CB  1 
ATOM   9720  C CG1 . VAL D 1 191 ? 7.342   -3.838  21.944  1.00 7.82  ? 190  VAL D CG1 1 
ATOM   9721  C CG2 . VAL D 1 191 ? 7.447   -1.363  21.596  1.00 7.25  ? 190  VAL D CG2 1 
ATOM   9722  N N   . LEU D 1 192 ? 10.991  -4.664  21.547  1.00 9.60  ? 191  LEU D N   1 
ATOM   9723  C CA  . LEU D 1 192 ? 11.621  -5.946  21.239  1.00 11.37 ? 191  LEU D CA  1 
ATOM   9724  C C   . LEU D 1 192 ? 10.595  -7.046  20.996  1.00 11.86 ? 191  LEU D C   1 
ATOM   9725  O O   . LEU D 1 192 ? 9.515   -7.065  21.596  1.00 12.43 ? 191  LEU D O   1 
ATOM   9726  C CB  . LEU D 1 192 ? 12.564  -6.322  22.388  1.00 10.92 ? 191  LEU D CB  1 
ATOM   9727  C CG  . LEU D 1 192 ? 13.687  -5.353  22.704  1.00 13.19 ? 191  LEU D CG  1 
ATOM   9728  C CD1 . LEU D 1 192 ? 14.454  -5.860  23.930  1.00 12.13 ? 191  LEU D CD1 1 
ATOM   9729  C CD2 . LEU D 1 192 ? 14.607  -5.288  21.486  1.00 12.79 ? 191  LEU D CD2 1 
ATOM   9730  N N   . PRO D 1 193 ? 10.989  -7.967  20.121  1.00 12.70 ? 192  PRO D N   1 
ATOM   9731  C CA  . PRO D 1 193 ? 10.152  -9.130  19.809  1.00 13.08 ? 192  PRO D CA  1 
ATOM   9732  C C   . PRO D 1 193 ? 10.392  -10.284 20.770  1.00 13.09 ? 192  PRO D C   1 
ATOM   9733  O O   . PRO D 1 193 ? 9.680   -11.298 20.715  1.00 13.88 ? 192  PRO D O   1 
ATOM   9734  C CB  . PRO D 1 193 ? 10.581  -9.487  18.381  1.00 13.38 ? 192  PRO D CB  1 
ATOM   9735  C CG  . PRO D 1 193 ? 12.045  -9.123  18.377  1.00 13.11 ? 192  PRO D CG  1 
ATOM   9736  C CD  . PRO D 1 193 ? 12.076  -7.796  19.131  1.00 12.47 ? 192  PRO D CD  1 
ATOM   9737  N N   . ASP D 1 194 ? 11.375  -10.135 21.641  1.00 13.60 ? 193  ASP D N   1 
ATOM   9738  C CA  . ASP D 1 194 ? 11.737  -11.203 22.604  1.00 14.69 ? 193  ASP D CA  1 
ATOM   9739  C C   . ASP D 1 194 ? 10.522  -11.597 23.447  1.00 14.79 ? 193  ASP D C   1 
ATOM   9740  O O   . ASP D 1 194 ? 9.821   -10.720 23.975  1.00 15.43 ? 193  ASP D O   1 
ATOM   9741  C CB  . ASP D 1 194 ? 12.909  -10.739 23.461  1.00 17.31 ? 193  ASP D CB  1 
ATOM   9742  C CG  . ASP D 1 194 ? 14.192  -10.399 22.756  1.00 19.18 ? 193  ASP D CG  1 
ATOM   9743  O OD1 . ASP D 1 194 ? 14.189  -9.491  21.899  1.00 18.76 ? 193  ASP D OD1 1 
ATOM   9744  O OD2 . ASP D 1 194 ? 15.248  -11.003 23.048  1.00 21.60 ? 193  ASP D OD2 1 
ATOM   9745  N N   . GLY D 1 195 ? 10.277  -12.887 23.589  1.00 14.78 ? 194  GLY D N   1 
ATOM   9746  C CA  . GLY D 1 195 ? 9.203   -13.378 24.475  1.00 14.78 ? 194  GLY D CA  1 
ATOM   9747  C C   . GLY D 1 195 ? 8.220   -14.260 23.732  1.00 14.41 ? 194  GLY D C   1 
ATOM   9748  O O   . GLY D 1 195 ? 8.394   -14.553 22.541  1.00 13.68 ? 194  GLY D O   1 
ATOM   9749  N N   . ASP D 1 196 ? 7.177   -14.654 24.447  1.00 14.73 ? 195  ASP D N   1 
ATOM   9750  C CA  . ASP D 1 196 ? 6.151   -15.562 23.947  1.00 14.63 ? 195  ASP D CA  1 
ATOM   9751  C C   . ASP D 1 196 ? 4.756   -14.937 23.979  1.00 13.96 ? 195  ASP D C   1 
ATOM   9752  O O   . ASP D 1 196 ? 3.772   -15.699 23.913  1.00 14.11 ? 195  ASP D O   1 
ATOM   9753  C CB  . ASP D 1 196 ? 6.201   -16.922 24.662  1.00 18.18 ? 195  ASP D CB  1 
ATOM   9754  C CG  . ASP D 1 196 ? 5.780   -16.861 26.120  1.00 21.29 ? 195  ASP D CG  1 
ATOM   9755  O OD1 . ASP D 1 196 ? 5.605   -15.779 26.711  1.00 21.52 ? 195  ASP D OD1 1 
ATOM   9756  O OD2 . ASP D 1 196 ? 5.602   -17.965 26.697  1.00 24.49 ? 195  ASP D OD2 1 
ATOM   9757  N N   . HIS D 1 197 ? 4.690   -13.628 24.010  1.00 13.43 ? 196  HIS D N   1 
ATOM   9758  C CA  . HIS D 1 197 ? 3.424   -12.880 23.968  1.00 12.62 ? 196  HIS D CA  1 
ATOM   9759  C C   . HIS D 1 197 ? 2.755   -13.010 22.604  1.00 12.45 ? 196  HIS D C   1 
ATOM   9760  O O   . HIS D 1 197 ? 3.381   -13.359 21.583  1.00 11.81 ? 196  HIS D O   1 
ATOM   9761  C CB  . HIS D 1 197 ? 3.634   -11.373 24.312  1.00 11.26 ? 196  HIS D CB  1 
ATOM   9762  C CG  . HIS D 1 197 ? 4.767   -10.788 23.520  1.00 11.17 ? 196  HIS D CG  1 
ATOM   9763  N ND1 . HIS D 1 197 ? 6.092   -10.906 23.839  1.00 10.53 ? 196  HIS D ND1 1 
ATOM   9764  C CD2 . HIS D 1 197 ? 4.717   -10.111 22.333  1.00 10.28 ? 196  HIS D CD2 1 
ATOM   9765  C CE1 . HIS D 1 197 ? 6.815   -10.310 22.888  1.00 10.88 ? 196  HIS D CE1 1 
ATOM   9766  N NE2 . HIS D 1 197 ? 6.011   -9.840  21.975  1.00 9.15  ? 196  HIS D NE2 1 
ATOM   9767  N N   . ASP D 1 198 ? 1.460   -12.713 22.590  1.00 11.92 ? 197  ASP D N   1 
ATOM   9768  C CA  . ASP D 1 198 ? 0.662   -12.819 21.346  1.00 11.79 ? 197  ASP D CA  1 
ATOM   9769  C C   . ASP D 1 198 ? 0.611   -11.470 20.625  1.00 10.54 ? 197  ASP D C   1 
ATOM   9770  O O   . ASP D 1 198 ? 1.133   -10.461 21.117  1.00 9.82  ? 197  ASP D O   1 
ATOM   9771  C CB  . ASP D 1 198 ? -0.688  -13.461 21.631  1.00 12.31 ? 197  ASP D CB  1 
ATOM   9772  C CG  . ASP D 1 198 ? -1.600  -12.623 22.502  1.00 12.20 ? 197  ASP D CG  1 
ATOM   9773  O OD1 . ASP D 1 198 ? -1.291  -11.515 22.922  1.00 12.73 ? 197  ASP D OD1 1 
ATOM   9774  O OD2 . ASP D 1 198 ? -2.726  -13.125 22.749  1.00 17.06 ? 197  ASP D OD2 1 
ATOM   9775  N N   . LEU D 1 199 ? -0.017  -11.484 19.451  1.00 9.47  ? 198  LEU D N   1 
ATOM   9776  C CA  . LEU D 1 199 ? -0.158  -10.277 18.635  1.00 8.43  ? 198  LEU D CA  1 
ATOM   9777  C C   . LEU D 1 199 ? -0.958  -9.208  19.388  1.00 7.94  ? 198  LEU D C   1 
ATOM   9778  O O   . LEU D 1 199 ? -0.662  -8.024  19.270  1.00 7.66  ? 198  LEU D O   1 
ATOM   9779  C CB  . LEU D 1 199 ? -0.837  -10.645 17.298  1.00 9.56  ? 198  LEU D CB  1 
ATOM   9780  C CG  . LEU D 1 199 ? -0.919  -9.529  16.267  1.00 9.62  ? 198  LEU D CG  1 
ATOM   9781  C CD1 . LEU D 1 199 ? 0.467   -9.062  15.862  1.00 9.20  ? 198  LEU D CD1 1 
ATOM   9782  C CD2 . LEU D 1 199 ? -1.669  -10.059 15.031  1.00 9.52  ? 198  LEU D CD2 1 
ATOM   9783  N N   . ASP D 1 200 ? -1.972  -9.670  20.100  1.00 8.23  ? 199  ASP D N   1 
ATOM   9784  C CA  . ASP D 1 200 ? -2.848  -8.751  20.857  1.00 8.45  ? 199  ASP D CA  1 
ATOM   9785  C C   . ASP D 1 200 ? -2.019  -7.921  21.829  1.00 7.55  ? 199  ASP D C   1 
ATOM   9786  O O   . ASP D 1 200 ? -2.147  -6.690  21.861  1.00 6.58  ? 199  ASP D O   1 
ATOM   9787  C CB  . ASP D 1 200 ? -4.006  -9.527  21.486  1.00 10.76 ? 199  ASP D CB  1 
ATOM   9788  C CG  . ASP D 1 200 ? -4.868  -8.621  22.364  1.00 13.48 ? 199  ASP D CG  1 
ATOM   9789  O OD1 . ASP D 1 200 ? -5.585  -7.800  21.756  1.00 13.60 ? 199  ASP D OD1 1 
ATOM   9790  O OD2 . ASP D 1 200 ? -4.781  -8.713  23.597  1.00 14.08 ? 199  ASP D OD2 1 
ATOM   9791  N N   . ARG D 1 201 ? -1.182  -8.609  22.600  1.00 7.92  ? 200  ARG D N   1 
ATOM   9792  C CA  . ARG D 1 201 ? -0.326  -7.926  23.593  1.00 7.73  ? 200  ARG D CA  1 
ATOM   9793  C C   . ARG D 1 201 ? 0.647   -6.973  22.912  1.00 7.70  ? 200  ARG D C   1 
ATOM   9794  O O   . ARG D 1 201 ? 0.828   -5.815  23.336  1.00 7.49  ? 200  ARG D O   1 
ATOM   9795  C CB  . ARG D 1 201 ? 0.395   -8.935  24.493  1.00 8.38  ? 200  ARG D CB  1 
ATOM   9796  C CG  . ARG D 1 201 ? 1.467   -8.343  25.398  1.00 7.83  ? 200  ARG D CG  1 
ATOM   9797  C CD  . ARG D 1 201 ? 1.133   -8.352  26.836  1.00 11.16 ? 200  ARG D CD  1 
ATOM   9798  N NE  . ARG D 1 201 ? 2.279   -7.965  27.694  1.00 10.80 ? 200  ARG D NE  1 
ATOM   9799  C CZ  . ARG D 1 201 ? 2.250   -6.780  28.326  1.00 10.21 ? 200  ARG D CZ  1 
ATOM   9800  N NH1 . ARG D 1 201 ? 1.200   -5.984  28.211  1.00 8.83  ? 200  ARG D NH1 1 
ATOM   9801  N NH2 . ARG D 1 201 ? 3.286   -6.421  29.086  1.00 8.90  ? 200  ARG D NH2 1 
ATOM   9802  N N   . ALA D 1 202 ? 1.258   -7.427  21.822  1.00 7.31  ? 201  ALA D N   1 
ATOM   9803  C CA  . ALA D 1 202 ? 2.246   -6.585  21.107  1.00 7.35  ? 201  ALA D CA  1 
ATOM   9804  C C   . ALA D 1 202 ? 1.582   -5.328  20.559  1.00 6.15  ? 201  ALA D C   1 
ATOM   9805  O O   . ALA D 1 202 ? 2.197   -4.256  20.589  1.00 6.39  ? 201  ALA D O   1 
ATOM   9806  C CB  . ALA D 1 202 ? 2.973   -7.386  20.041  1.00 6.44  ? 201  ALA D CB  1 
ATOM   9807  N N   . GLN D 1 203 ? 0.319   -5.440  20.134  1.00 6.09  ? 202  GLN D N   1 
ATOM   9808  C CA  . GLN D 1 203 ? -0.384  -4.274  19.562  1.00 4.77  ? 202  GLN D CA  1 
ATOM   9809  C C   . GLN D 1 203 ? -0.699  -3.253  20.656  1.00 4.66  ? 202  GLN D C   1 
ATOM   9810  O O   . GLN D 1 203 ? -0.526  -2.046  20.471  1.00 3.70  ? 202  GLN D O   1 
ATOM   9811  C CB  . GLN D 1 203 ? -1.639  -4.655  18.784  1.00 5.75  ? 202  GLN D CB  1 
ATOM   9812  C CG  . GLN D 1 203 ? -2.384  -3.493  18.159  1.00 7.64  ? 202  GLN D CG  1 
ATOM   9813  C CD  . GLN D 1 203 ? -3.519  -3.946  17.263  1.00 8.79  ? 202  GLN D CD  1 
ATOM   9814  O OE1 . GLN D 1 203 ? -3.726  -5.131  17.045  1.00 11.62 ? 202  GLN D OE1 1 
ATOM   9815  N NE2 . GLN D 1 203 ? -4.263  -2.976  16.763  1.00 9.78  ? 202  GLN D NE2 1 
ATOM   9816  N N   . LYS D 1 204 ? -1.205  -3.759  21.770  1.00 4.54  ? 203  LYS D N   1 
ATOM   9817  C CA  . LYS D 1 204 ? -1.567  -2.868  22.902  1.00 4.83  ? 203  LYS D CA  1 
ATOM   9818  C C   . LYS D 1 204 ? -0.337  -2.153  23.427  1.00 4.13  ? 203  LYS D C   1 
ATOM   9819  O O   . LYS D 1 204 ? -0.393  -0.939  23.707  1.00 4.24  ? 203  LYS D O   1 
ATOM   9820  C CB  . LYS D 1 204 ? -2.269  -3.654  24.016  1.00 4.72  ? 203  LYS D CB  1 
ATOM   9821  C CG  . LYS D 1 204 ? -3.740  -3.969  23.677  1.00 5.93  ? 203  LYS D CG  1 
ATOM   9822  C CD  . LYS D 1 204 ? -4.234  -5.164  24.502  1.00 6.03  ? 203  LYS D CD  1 
ATOM   9823  C CE  . LYS D 1 204 ? -5.734  -5.375  24.238  1.00 5.65  ? 203  LYS D CE  1 
ATOM   9824  N NZ  . LYS D 1 204 ? -6.175  -6.623  24.926  1.00 6.98  ? 203  LYS D NZ  1 
ATOM   9825  N N   . VAL D 1 205 ? 0.763   -2.864  23.569  1.00 5.29  ? 204  VAL D N   1 
ATOM   9826  C CA  . VAL D 1 205 ? 2.035   -2.279  24.031  1.00 5.07  ? 204  VAL D CA  1 
ATOM   9827  C C   . VAL D 1 205 ? 2.480   -1.192  23.037  1.00 5.71  ? 204  VAL D C   1 
ATOM   9828  O O   . VAL D 1 205 ? 2.792   -0.071  23.458  1.00 6.30  ? 204  VAL D O   1 
ATOM   9829  C CB  . VAL D 1 205 ? 3.127   -3.338  24.260  1.00 2.77  ? 204  VAL D CB  1 
ATOM   9830  C CG1 . VAL D 1 205 ? 4.493   -2.700  24.510  1.00 3.98  ? 204  VAL D CG1 1 
ATOM   9831  C CG2 . VAL D 1 205 ? 2.796   -4.282  25.409  1.00 6.16  ? 204  VAL D CG2 1 
ATOM   9832  N N   . THR D 1 206 ? 2.493   -1.554  21.763  1.00 5.33  ? 205  THR D N   1 
ATOM   9833  C CA  . THR D 1 206 ? 2.907   -0.605  20.715  1.00 5.75  ? 205  THR D CA  1 
ATOM   9834  C C   . THR D 1 206 ? 2.085   0.666   20.722  1.00 4.97  ? 205  THR D C   1 
ATOM   9835  O O   . THR D 1 206 ? 2.664   1.779   20.673  1.00 5.28  ? 205  THR D O   1 
ATOM   9836  C CB  . THR D 1 206 ? 2.983   -1.251  19.277  1.00 5.62  ? 205  THR D CB  1 
ATOM   9837  O OG1 . THR D 1 206 ? 4.046   -2.239  19.298  1.00 9.43  ? 205  THR D OG1 1 
ATOM   9838  C CG2 . THR D 1 206 ? 3.282   -0.206  18.177  1.00 8.26  ? 205  THR D CG2 1 
ATOM   9839  N N   . GLU D 1 207 ? 0.763   0.555   20.777  1.00 4.74  ? 206  GLU D N   1 
ATOM   9840  C CA  . GLU D 1 207 ? -0.104  1.750   20.822  1.00 4.91  ? 206  GLU D CA  1 
ATOM   9841  C C   . GLU D 1 207 ? 0.128   2.594   22.058  1.00 5.01  ? 206  GLU D C   1 
ATOM   9842  O O   . GLU D 1 207 ? 0.112   3.845   21.993  1.00 4.49  ? 206  GLU D O   1 
ATOM   9843  C CB  . GLU D 1 207 ? -1.597  1.389   20.732  1.00 7.16  ? 206  GLU D CB  1 
ATOM   9844  C CG  . GLU D 1 207 ? -2.042  0.675   19.447  1.00 7.50  ? 206  GLU D CG  1 
ATOM   9845  C CD  . GLU D 1 207 ? -3.411  0.078   19.447  1.00 9.83  ? 206  GLU D CD  1 
ATOM   9846  O OE1 . GLU D 1 207 ? -4.155  0.027   20.423  1.00 11.25 ? 206  GLU D OE1 1 
ATOM   9847  O OE2 . GLU D 1 207 ? -3.759  -0.398  18.343  1.00 6.69  ? 206  GLU D OE2 1 
ATOM   9848  N N   . THR D 1 208 ? 0.328   1.939   23.197  1.00 4.96  ? 207  THR D N   1 
ATOM   9849  C CA  . THR D 1 208 ? 0.638   2.661   24.458  1.00 5.24  ? 207  THR D CA  1 
ATOM   9850  C C   . THR D 1 208 ? 1.942   3.444   24.339  1.00 4.54  ? 207  THR D C   1 
ATOM   9851  O O   . THR D 1 208 ? 1.975   4.635   24.693  1.00 5.19  ? 207  THR D O   1 
ATOM   9852  C CB  . THR D 1 208 ? 0.702   1.684   25.694  1.00 5.10  ? 207  THR D CB  1 
ATOM   9853  O OG1 . THR D 1 208 ? -0.481  0.837   25.642  1.00 6.49  ? 207  THR D OG1 1 
ATOM   9854  C CG2 . THR D 1 208 ? 0.827   2.404   27.041  1.00 5.78  ? 207  THR D CG2 1 
ATOM   9855  N N   . VAL D 1 209 ? 2.989   2.802   23.871  1.00 4.97  ? 208  VAL D N   1 
ATOM   9856  C CA  . VAL D 1 209 ? 4.309   3.414   23.704  1.00 4.57  ? 208  VAL D CA  1 
ATOM   9857  C C   . VAL D 1 209 ? 4.228   4.642   22.788  1.00 4.44  ? 208  VAL D C   1 
ATOM   9858  O O   . VAL D 1 209 ? 4.742   5.708   23.138  1.00 4.59  ? 208  VAL D O   1 
ATOM   9859  C CB  . VAL D 1 209 ? 5.342   2.391   23.222  1.00 5.26  ? 208  VAL D CB  1 
ATOM   9860  C CG1 . VAL D 1 209 ? 6.631   3.049   22.725  1.00 7.10  ? 208  VAL D CG1 1 
ATOM   9861  C CG2 . VAL D 1 209 ? 5.668   1.304   24.232  1.00 6.89  ? 208  VAL D CG2 1 
ATOM   9862  N N   . LEU D 1 210 ? 3.592   4.480   21.642  1.00 4.68  ? 209  LEU D N   1 
ATOM   9863  C CA  . LEU D 1 210 ? 3.565   5.571   20.631  1.00 4.25  ? 209  LEU D CA  1 
ATOM   9864  C C   . LEU D 1 210 ? 2.746   6.747   21.107  1.00 3.16  ? 209  LEU D C   1 
ATOM   9865  O O   . LEU D 1 210 ? 3.082   7.881   20.753  1.00 2.84  ? 209  LEU D O   1 
ATOM   9866  C CB  . LEU D 1 210 ? 3.144   4.998   19.277  1.00 5.20  ? 209  LEU D CB  1 
ATOM   9867  C CG  . LEU D 1 210 ? 4.096   4.019   18.582  1.00 9.07  ? 209  LEU D CG  1 
ATOM   9868  C CD1 . LEU D 1 210 ? 3.539   3.644   17.208  1.00 7.71  ? 209  LEU D CD1 1 
ATOM   9869  C CD2 . LEU D 1 210 ? 5.460   4.677   18.429  1.00 10.01 ? 209  LEU D CD2 1 
ATOM   9870  N N   . ALA D 1 211 ? 1.677   6.499   21.868  1.00 2.91  ? 210  ALA D N   1 
ATOM   9871  C CA  . ALA D 1 211 ? 0.873   7.625   22.357  1.00 3.13  ? 210  ALA D CA  1 
ATOM   9872  C C   . ALA D 1 211 ? 1.748   8.510   23.250  1.00 2.53  ? 210  ALA D C   1 
ATOM   9873  O O   . ALA D 1 211 ? 1.661   9.741   23.172  1.00 2.03  ? 210  ALA D O   1 
ATOM   9874  C CB  . ALA D 1 211 ? -0.418  7.210   23.041  1.00 3.57  ? 210  ALA D CB  1 
ATOM   9875  N N   . ALA D 1 212 ? 2.542   7.834   24.089  1.00 2.30  ? 211  ALA D N   1 
ATOM   9876  C CA  . ALA D 1 212 ? 3.447   8.571   24.996  1.00 2.55  ? 211  ALA D CA  1 
ATOM   9877  C C   . ALA D 1 212 ? 4.526   9.295   24.193  1.00 2.18  ? 211  ALA D C   1 
ATOM   9878  O O   . ALA D 1 212 ? 4.868   10.435  24.513  1.00 2.68  ? 211  ALA D O   1 
ATOM   9879  C CB  . ALA D 1 212 ? 4.092   7.611   25.996  1.00 2.00  ? 211  ALA D CB  1 
ATOM   9880  N N   . VAL D 1 213 ? 5.059   8.607   23.190  1.00 3.15  ? 212  VAL D N   1 
ATOM   9881  C CA  . VAL D 1 213 ? 6.098   9.248   22.357  1.00 3.36  ? 212  VAL D CA  1 
ATOM   9882  C C   . VAL D 1 213 ? 5.592   10.562  21.767  1.00 2.91  ? 212  VAL D C   1 
ATOM   9883  O O   . VAL D 1 213 ? 6.302   11.569  21.895  1.00 2.67  ? 212  VAL D O   1 
ATOM   9884  C CB  . VAL D 1 213 ? 6.669   8.300   21.295  1.00 3.68  ? 212  VAL D CB  1 
ATOM   9885  C CG1 . VAL D 1 213 ? 7.497   9.085   20.267  1.00 6.17  ? 212  VAL D CG1 1 
ATOM   9886  C CG2 . VAL D 1 213 ? 7.506   7.168   21.885  1.00 5.70  ? 212  VAL D CG2 1 
ATOM   9887  N N   . TYR D 1 214 ? 4.440   10.553  21.086  1.00 2.71  ? 213  TYR D N   1 
ATOM   9888  C CA  . TYR D 1 214 ? 3.910   11.802  20.509  1.00 2.39  ? 213  TYR D CA  1 
ATOM   9889  C C   . TYR D 1 214 ? 3.476   12.838  21.506  1.00 2.19  ? 213  TYR D C   1 
ATOM   9890  O O   . TYR D 1 214 ? 3.545   14.038  21.204  1.00 2.17  ? 213  TYR D O   1 
ATOM   9891  C CB  . TYR D 1 214 ? 2.861   11.550  19.371  1.00 3.61  ? 213  TYR D CB  1 
ATOM   9892  C CG  . TYR D 1 214 ? 3.697   10.996  18.201  1.00 3.22  ? 213  TYR D CG  1 
ATOM   9893  C CD1 . TYR D 1 214 ? 4.480   11.866  17.461  1.00 4.70  ? 213  TYR D CD1 1 
ATOM   9894  C CD2 . TYR D 1 214 ? 3.799   9.630   18.006  1.00 4.64  ? 213  TYR D CD2 1 
ATOM   9895  C CE1 . TYR D 1 214 ? 5.322   11.361  16.443  1.00 4.90  ? 213  TYR D CE1 1 
ATOM   9896  C CE2 . TYR D 1 214 ? 4.625   9.118   17.000  1.00 5.33  ? 213  TYR D CE2 1 
ATOM   9897  C CZ  . TYR D 1 214 ? 5.385   9.996   16.238  1.00 4.73  ? 213  TYR D CZ  1 
ATOM   9898  O OH  . TYR D 1 214 ? 6.223   9.529   15.262  1.00 4.27  ? 213  TYR D OH  1 
ATOM   9899  N N   . LYS D 1 215 ? 3.009   12.432  22.690  1.00 2.30  ? 214  LYS D N   1 
ATOM   9900  C CA  . LYS D 1 215 ? 2.717   13.463  23.725  1.00 2.34  ? 214  LYS D CA  1 
ATOM   9901  C C   . LYS D 1 215 ? 4.000   14.161  24.135  1.00 2.01  ? 214  LYS D C   1 
ATOM   9902  O O   . LYS D 1 215 ? 4.012   15.402  24.305  1.00 2.31  ? 214  LYS D O   1 
ATOM   9903  C CB  . LYS D 1 215 ? 1.965   12.869  24.926  1.00 2.00  ? 214  LYS D CB  1 
ATOM   9904  C CG  . LYS D 1 215 ? 1.649   13.913  26.017  1.00 2.00  ? 214  LYS D CG  1 
ATOM   9905  C CD  . LYS D 1 215 ? 0.870   15.090  25.506  1.00 3.07  ? 214  LYS D CD  1 
ATOM   9906  C CE  . LYS D 1 215 ? 0.082   15.859  26.562  1.00 6.28  ? 214  LYS D CE  1 
ATOM   9907  N NZ  . LYS D 1 215 ? 0.986   16.481  27.568  1.00 3.87  ? 214  LYS D NZ  1 
ATOM   9908  N N   . ALA D 1 216 ? 5.078   13.416  24.326  1.00 3.65  ? 215  ALA D N   1 
ATOM   9909  C CA  . ALA D 1 216 ? 6.380   14.045  24.701  1.00 3.35  ? 215  ALA D CA  1 
ATOM   9910  C C   . ALA D 1 216 ? 6.907   14.960  23.611  1.00 3.33  ? 215  ALA D C   1 
ATOM   9911  O O   . ALA D 1 216 ? 7.467   16.045  23.895  1.00 3.20  ? 215  ALA D O   1 
ATOM   9912  C CB  . ALA D 1 216 ? 7.386   12.960  25.089  1.00 3.18  ? 215  ALA D CB  1 
ATOM   9913  N N   . LEU D 1 217 ? 6.754   14.578  22.354  1.00 3.45  ? 216  LEU D N   1 
ATOM   9914  C CA  . LEU D 1 217 ? 7.229   15.427  21.236  1.00 3.58  ? 216  LEU D CA  1 
ATOM   9915  C C   . LEU D 1 217 ? 6.486   16.763  21.267  1.00 2.88  ? 216  LEU D C   1 
ATOM   9916  O O   . LEU D 1 217 ? 7.072   17.812  21.041  1.00 2.95  ? 216  LEU D O   1 
ATOM   9917  C CB  . LEU D 1 217 ? 7.065   14.661  19.912  1.00 3.39  ? 216  LEU D CB  1 
ATOM   9918  C CG  . LEU D 1 217 ? 8.038   13.555  19.604  1.00 7.42  ? 216  LEU D CG  1 
ATOM   9919  C CD1 . LEU D 1 217 ? 7.874   13.062  18.163  1.00 8.28  ? 216  LEU D CD1 1 
ATOM   9920  C CD2 . LEU D 1 217 ? 9.470   14.060  19.777  1.00 8.05  ? 216  LEU D CD2 1 
ATOM   9921  N N   . SER D 1 218 ? 5.197   16.694  21.548  1.00 2.54  ? 217  SER D N   1 
ATOM   9922  C CA  . SER D 1 218 ? 4.374   17.909  21.684  1.00 2.00  ? 217  SER D CA  1 
ATOM   9923  C C   . SER D 1 218 ? 4.815   18.770  22.867  1.00 2.58  ? 217  SER D C   1 
ATOM   9924  O O   . SER D 1 218 ? 5.000   19.993  22.756  1.00 2.59  ? 217  SER D O   1 
ATOM   9925  C CB  . SER D 1 218 ? 2.913   17.465  21.861  1.00 2.17  ? 217  SER D CB  1 
ATOM   9926  O OG  . SER D 1 218 ? 2.134   18.586  22.239  1.00 2.25  ? 217  SER D OG  1 
ATOM   9927  N N   . ASP D 1 219 ? 4.980   18.111  24.010  1.00 2.86  ? 218  ASP D N   1 
ATOM   9928  C CA  . ASP D 1 219 ? 5.440   18.809  25.249  1.00 3.77  ? 218  ASP D CA  1 
ATOM   9929  C C   . ASP D 1 219 ? 6.741   19.562  24.985  1.00 3.71  ? 218  ASP D C   1 
ATOM   9930  O O   . ASP D 1 219 ? 6.953   20.677  25.503  1.00 5.23  ? 218  ASP D O   1 
ATOM   9931  C CB  . ASP D 1 219 ? 5.591   17.787  26.388  1.00 4.74  ? 218  ASP D CB  1 
ATOM   9932  C CG  . ASP D 1 219 ? 4.250   17.305  26.929  1.00 6.27  ? 218  ASP D CG  1 
ATOM   9933  O OD1 . ASP D 1 219 ? 3.186   17.826  26.593  1.00 6.60  ? 218  ASP D OD1 1 
ATOM   9934  O OD2 . ASP D 1 219 ? 4.296   16.336  27.718  1.00 6.37  ? 218  ASP D OD2 1 
ATOM   9935  N N   . HIS D 1 220 ? 7.605   18.975  24.187  1.00 4.31  ? 219  HIS D N   1 
ATOM   9936  C CA  . HIS D 1 220 ? 8.913   19.579  23.861  1.00 4.90  ? 219  HIS D CA  1 
ATOM   9937  C C   . HIS D 1 220 ? 8.920   20.375  22.569  1.00 5.28  ? 219  HIS D C   1 
ATOM   9938  O O   . HIS D 1 220 ? 9.994   20.819  22.082  1.00 5.35  ? 219  HIS D O   1 
ATOM   9939  C CB  . HIS D 1 220 ? 10.053  18.534  23.863  1.00 4.40  ? 219  HIS D CB  1 
ATOM   9940  C CG  . HIS D 1 220 ? 10.335  17.968  25.221  1.00 4.19  ? 219  HIS D CG  1 
ATOM   9941  N ND1 . HIS D 1 220 ? 11.291  18.495  26.072  1.00 7.62  ? 219  HIS D ND1 1 
ATOM   9942  C CD2 . HIS D 1 220 ? 9.788   16.920  25.868  1.00 6.68  ? 219  HIS D CD2 1 
ATOM   9943  C CE1 . HIS D 1 220 ? 11.291  17.784  27.201  1.00 4.70  ? 219  HIS D CE1 1 
ATOM   9944  N NE2 . HIS D 1 220 ? 10.430  16.798  27.093  1.00 5.02  ? 219  HIS D NE2 1 
ATOM   9945  N N   . HIS D 1 221 ? 7.763   20.552  21.958  1.00 5.33  ? 220  HIS D N   1 
ATOM   9946  C CA  . HIS D 1 221 ? 7.610   21.430  20.790  1.00 5.81  ? 220  HIS D CA  1 
ATOM   9947  C C   . HIS D 1 221 ? 8.439   20.993  19.569  1.00 6.10  ? 220  HIS D C   1 
ATOM   9948  O O   . HIS D 1 221 ? 8.991   21.863  18.867  1.00 7.72  ? 220  HIS D O   1 
ATOM   9949  C CB  . HIS D 1 221 ? 7.921   22.902  21.107  1.00 7.74  ? 220  HIS D CB  1 
ATOM   9950  C CG  . HIS D 1 221 ? 7.175   23.454  22.291  1.00 9.82  ? 220  HIS D CG  1 
ATOM   9951  N ND1 . HIS D 1 221 ? 5.815   23.312  22.465  1.00 11.78 ? 220  HIS D ND1 1 
ATOM   9952  C CD2 . HIS D 1 221 ? 7.611   24.121  23.371  1.00 8.96  ? 220  HIS D CD2 1 
ATOM   9953  C CE1 . HIS D 1 221 ? 5.460   23.868  23.614  1.00 11.98 ? 220  HIS D CE1 1 
ATOM   9954  N NE2 . HIS D 1 221 ? 6.532   24.392  24.170  1.00 12.32 ? 220  HIS D NE2 1 
ATOM   9955  N N   . VAL D 1 222 ? 8.501   19.715  19.329  1.00 6.30  ? 221  VAL D N   1 
ATOM   9956  C CA  . VAL D 1 222 ? 9.211   19.121  18.177  1.00 6.33  ? 221  VAL D CA  1 
ATOM   9957  C C   . VAL D 1 222 ? 8.357   19.284  16.909  1.00 6.16  ? 221  VAL D C   1 
ATOM   9958  O O   . VAL D 1 222 ? 7.144   18.993  16.943  1.00 6.74  ? 221  VAL D O   1 
ATOM   9959  C CB  . VAL D 1 222 ? 9.595   17.680  18.465  1.00 6.15  ? 221  VAL D CB  1 
ATOM   9960  C CG1 . VAL D 1 222 ? 10.100  16.916  17.229  1.00 5.41  ? 221  VAL D CG1 1 
ATOM   9961  C CG2 . VAL D 1 222 ? 10.644  17.572  19.579  1.00 6.30  ? 221  VAL D CG2 1 
ATOM   9962  N N   . TYR D 1 223 ? 9.019   19.721  15.854  1.00 5.61  ? 222  TYR D N   1 
ATOM   9963  C CA  . TYR D 1 223 ? 8.364   19.927  14.529  1.00 5.12  ? 222  TYR D CA  1 
ATOM   9964  C C   . TYR D 1 223 ? 8.232   18.611  13.809  1.00 4.63  ? 222  TYR D C   1 
ATOM   9965  O O   . TYR D 1 223 ? 9.184   18.051  13.199  1.00 5.23  ? 222  TYR D O   1 
ATOM   9966  C CB  . TYR D 1 223 ? 9.137   21.010  13.758  1.00 5.79  ? 222  TYR D CB  1 
ATOM   9967  C CG  . TYR D 1 223 ? 8.668   21.243  12.336  1.00 7.21  ? 222  TYR D CG  1 
ATOM   9968  C CD1 . TYR D 1 223 ? 7.434   21.818  12.090  1.00 7.26  ? 222  TYR D CD1 1 
ATOM   9969  C CD2 . TYR D 1 223 ? 9.487   20.888  11.241  1.00 7.08  ? 222  TYR D CD2 1 
ATOM   9970  C CE1 . TYR D 1 223 ? 6.973   22.047  10.774  1.00 9.97  ? 222  TYR D CE1 1 
ATOM   9971  C CE2 . TYR D 1 223 ? 9.043   21.121  9.937   1.00 7.23  ? 222  TYR D CE2 1 
ATOM   9972  C CZ  . TYR D 1 223 ? 7.802   21.693  9.708   1.00 9.16  ? 222  TYR D CZ  1 
ATOM   9973  O OH  . TYR D 1 223 ? 7.328   21.951  8.442   1.00 10.33 ? 222  TYR D OH  1 
ATOM   9974  N N   . LEU D 1 224 ? 7.019   18.033  13.887  1.00 4.16  ? 223  LEU D N   1 
ATOM   9975  C CA  . LEU D 1 224 ? 6.756   16.677  13.409  1.00 3.56  ? 223  LEU D CA  1 
ATOM   9976  C C   . LEU D 1 224 ? 7.065   16.474  11.920  1.00 3.46  ? 223  LEU D C   1 
ATOM   9977  O O   . LEU D 1 224 ? 7.479   15.371  11.522  1.00 2.90  ? 223  LEU D O   1 
ATOM   9978  C CB  . LEU D 1 224 ? 5.282   16.315  13.711  1.00 4.03  ? 223  LEU D CB  1 
ATOM   9979  C CG  . LEU D 1 224 ? 4.855   16.343  15.170  1.00 5.33  ? 223  LEU D CG  1 
ATOM   9980  C CD1 . LEU D 1 224 ? 3.368   15.939  15.288  1.00 6.16  ? 223  LEU D CD1 1 
ATOM   9981  C CD2 . LEU D 1 224 ? 5.703   15.338  15.944  1.00 4.58  ? 223  LEU D CD2 1 
ATOM   9982  N N   . GLU D 1 225 ? 6.815   17.503  11.140  1.00 4.44  ? 224  GLU D N   1 
ATOM   9983  C CA  . GLU D 1 225 ? 7.000   17.388  9.663   1.00 5.35  ? 224  GLU D CA  1 
ATOM   9984  C C   . GLU D 1 225 ? 8.463   17.194  9.312   1.00 6.48  ? 224  GLU D C   1 
ATOM   9985  O O   . GLU D 1 225 ? 8.840   16.670  8.232   1.00 6.51  ? 224  GLU D O   1 
ATOM   9986  C CB  . GLU D 1 225 ? 6.407   18.620  8.998   1.00 5.87  ? 224  GLU D CB  1 
ATOM   9987  C CG  . GLU D 1 225 ? 4.900   18.790  9.045   1.00 5.99  ? 224  GLU D CG  1 
ATOM   9988  C CD  . GLU D 1 225 ? 4.276   19.399  10.277  1.00 6.86  ? 224  GLU D CD  1 
ATOM   9989  O OE1 . GLU D 1 225 ? 4.986   19.399  11.298  1.00 5.11  ? 224  GLU D OE1 1 
ATOM   9990  O OE2 . GLU D 1 225 ? 3.138   19.836  10.267  1.00 6.92  ? 224  GLU D OE2 1 
ATOM   9991  N N   . GLY D 1 226 ? 9.314   17.576  10.253  1.00 6.34  ? 225  GLY D N   1 
ATOM   9992  C CA  . GLY D 1 226 ? 10.762  17.402  10.147  1.00 6.96  ? 225  GLY D CA  1 
ATOM   9993  C C   . GLY D 1 226 ? 11.265  16.201  10.944  1.00 6.89  ? 225  GLY D C   1 
ATOM   9994  O O   . GLY D 1 226 ? 12.380  16.280  11.501  1.00 7.92  ? 225  GLY D O   1 
ATOM   9995  N N   . THR D 1 227 ? 10.487  15.151  11.019  1.00 7.07  ? 226  THR D N   1 
ATOM   9996  C CA  . THR D 1 227 ? 10.897  13.923  11.706  1.00 6.74  ? 226  THR D CA  1 
ATOM   9997  C C   . THR D 1 227 ? 10.428  12.689  10.951  1.00 6.84  ? 226  THR D C   1 
ATOM   9998  O O   . THR D 1 227 ? 9.479   12.777  10.151  1.00 7.69  ? 226  THR D O   1 
ATOM   9999  C CB  . THR D 1 227 ? 10.338  13.821  13.189  1.00 7.34  ? 226  THR D CB  1 
ATOM   10000 O OG1 . THR D 1 227 ? 8.939   13.413  13.092  1.00 6.89  ? 226  THR D OG1 1 
ATOM   10001 C CG2 . THR D 1 227 ? 10.493  15.069  14.045  1.00 7.04  ? 226  THR D CG2 1 
ATOM   10002 N N   . LEU D 1 228 ? 11.050  11.571  11.272  1.00 5.78  ? 227  LEU D N   1 
ATOM   10003 C CA  . LEU D 1 228 ? 10.630  10.251  10.833  1.00 6.06  ? 227  LEU D CA  1 
ATOM   10004 C C   . LEU D 1 228 ? 10.472  9.378   12.097  1.00 6.19  ? 227  LEU D C   1 
ATOM   10005 O O   . LEU D 1 228 ? 11.052  9.713   13.149  1.00 5.44  ? 227  LEU D O   1 
ATOM   10006 C CB  . LEU D 1 228 ? 11.628  9.645   9.836   1.00 6.33  ? 227  LEU D CB  1 
ATOM   10007 C CG  . LEU D 1 228 ? 11.939  10.489  8.592   1.00 6.55  ? 227  LEU D CG  1 
ATOM   10008 C CD1 . LEU D 1 228 ? 13.102  9.895   7.801   1.00 7.67  ? 227  LEU D CD1 1 
ATOM   10009 C CD2 . LEU D 1 228 ? 10.682  10.463  7.715   1.00 6.48  ? 227  LEU D CD2 1 
ATOM   10010 N N   . LEU D 1 229 ? 9.701   8.333   11.928  1.00 6.31  ? 228  LEU D N   1 
ATOM   10011 C CA  . LEU D 1 229 ? 9.503   7.322   12.984  1.00 6.64  ? 228  LEU D CA  1 
ATOM   10012 C C   . LEU D 1 229 ? 10.064  5.993   12.498  1.00 6.55  ? 228  LEU D C   1 
ATOM   10013 O O   . LEU D 1 229 ? 9.809   5.565   11.352  1.00 7.48  ? 228  LEU D O   1 
ATOM   10014 C CB  . LEU D 1 229 ? 7.998   7.248   13.324  1.00 4.56  ? 228  LEU D CB  1 
ATOM   10015 C CG  . LEU D 1 229 ? 7.611   6.111   14.281  1.00 6.31  ? 228  LEU D CG  1 
ATOM   10016 C CD1 . LEU D 1 229 ? 8.137   6.401   15.689  1.00 7.52  ? 228  LEU D CD1 1 
ATOM   10017 C CD2 . LEU D 1 229 ? 6.085   5.999   14.324  1.00 6.29  ? 228  LEU D CD2 1 
ATOM   10018 N N   . LYS D 1 230 ? 10.805  5.335   13.371  1.00 5.95  ? 229  LYS D N   1 
ATOM   10019 C CA  . LYS D 1 230 ? 11.345  3.996   13.119  1.00 6.40  ? 229  LYS D CA  1 
ATOM   10020 C C   . LYS D 1 230 ? 10.862  3.035   14.206  1.00 7.29  ? 229  LYS D C   1 
ATOM   10021 O O   . LYS D 1 230 ? 11.564  2.805   15.201  1.00 7.25  ? 229  LYS D O   1 
ATOM   10022 C CB  . LYS D 1 230 ? 12.871  4.013   13.031  1.00 4.66  ? 229  LYS D CB  1 
ATOM   10023 C CG  . LYS D 1 230 ? 13.571  2.680   12.791  1.00 7.86  ? 229  LYS D CG  1 
ATOM   10024 C CD  . LYS D 1 230 ? 15.038  2.858   12.350  1.00 7.52  ? 229  LYS D CD  1 
ATOM   10025 C CE  . LYS D 1 230 ? 15.692  1.496   12.166  1.00 9.61  ? 229  LYS D CE  1 
ATOM   10026 N NZ  . LYS D 1 230 ? 17.006  1.577   11.482  1.00 12.97 ? 229  LYS D NZ  1 
ATOM   10027 N N   . PRO D 1 231 ? 9.687   2.453   13.991  1.00 8.12  ? 230  PRO D N   1 
ATOM   10028 C CA  . PRO D 1 231 ? 9.112   1.472   14.923  1.00 8.71  ? 230  PRO D CA  1 
ATOM   10029 C C   . PRO D 1 231 ? 9.274   0.052   14.432  1.00 9.60  ? 230  PRO D C   1 
ATOM   10030 O O   . PRO D 1 231 ? 9.633   -0.246  13.277  1.00 9.91  ? 230  PRO D O   1 
ATOM   10031 C CB  . PRO D 1 231 ? 7.616   1.891   14.918  1.00 8.13  ? 230  PRO D CB  1 
ATOM   10032 C CG  . PRO D 1 231 ? 7.414   2.121   13.418  1.00 8.15  ? 230  PRO D CG  1 
ATOM   10033 C CD  . PRO D 1 231 ? 8.685   2.871   12.993  1.00 7.50  ? 230  PRO D CD  1 
ATOM   10034 N N   . ASN D 1 232 ? 9.017   -0.869  15.352  1.00 10.11 ? 231  ASN D N   1 
ATOM   10035 C CA  . ASN D 1 232 ? 8.902   -2.296  15.064  1.00 10.03 ? 231  ASN D CA  1 
ATOM   10036 C C   . ASN D 1 232 ? 7.550   -2.483  14.326  1.00 9.71  ? 231  ASN D C   1 
ATOM   10037 O O   . ASN D 1 232 ? 6.650   -1.682  14.564  1.00 9.78  ? 231  ASN D O   1 
ATOM   10038 C CB  . ASN D 1 232 ? 8.845   -3.075  16.413  1.00 13.59 ? 231  ASN D CB  1 
ATOM   10039 C CG  . ASN D 1 232 ? 7.952   -2.342  17.415  1.00 15.05 ? 231  ASN D CG  1 
ATOM   10040 O OD1 . ASN D 1 232 ? 8.357   -1.304  17.968  1.00 14.69 ? 231  ASN D OD1 1 
ATOM   10041 N ND2 . ASN D 1 232 ? 6.721   -2.832  17.613  1.00 14.92 ? 231  ASN D ND2 1 
ATOM   10042 N N   . MET D 1 233 ? 7.473   -3.500  13.487  1.00 9.57  ? 232  MET D N   1 
ATOM   10043 C CA  . MET D 1 233 ? 6.144   -3.937  12.998  1.00 9.29  ? 232  MET D CA  1 
ATOM   10044 C C   . MET D 1 233 ? 5.510   -4.638  14.232  1.00 8.97  ? 232  MET D C   1 
ATOM   10045 O O   . MET D 1 233 ? 6.250   -5.105  15.123  1.00 9.18  ? 232  MET D O   1 
ATOM   10046 C CB  . MET D 1 233 ? 6.217   -4.912  11.843  1.00 9.33  ? 232  MET D CB  1 
ATOM   10047 C CG  . MET D 1 233 ? 6.940   -4.309  10.656  1.00 9.60  ? 232  MET D CG  1 
ATOM   10048 S SD  . MET D 1 233 ? 7.064   -5.625  9.376   1.00 11.48 ? 232  MET D SD  1 
ATOM   10049 C CE  . MET D 1 233 ? 8.090   -4.697  8.203   1.00 10.90 ? 232  MET D CE  1 
ATOM   10050 N N   . VAL D 1 234 ? 4.197   -4.681  14.208  1.00 8.56  ? 233  VAL D N   1 
ATOM   10051 C CA  . VAL D 1 234 ? 3.447   -5.361  15.288  1.00 8.53  ? 233  VAL D CA  1 
ATOM   10052 C C   . VAL D 1 234 ? 3.368   -6.846  14.944  1.00 8.31  ? 233  VAL D C   1 
ATOM   10053 O O   . VAL D 1 234 ? 2.697   -7.216  13.958  1.00 8.14  ? 233  VAL D O   1 
ATOM   10054 C CB  . VAL D 1 234 ? 2.052   -4.734  15.494  1.00 7.88  ? 233  VAL D CB  1 
ATOM   10055 C CG1 . VAL D 1 234 ? 1.273   -5.526  16.559  1.00 8.14  ? 233  VAL D CG1 1 
ATOM   10056 C CG2 . VAL D 1 234 ? 2.088   -3.256  15.828  1.00 7.08  ? 233  VAL D CG2 1 
ATOM   10057 N N   . THR D 1 235 ? 3.990   -7.664  15.760  1.00 8.19  ? 234  THR D N   1 
ATOM   10058 C CA  . THR D 1 235 ? 4.019   -9.109  15.600  1.00 9.03  ? 234  THR D CA  1 
ATOM   10059 C C   . THR D 1 235 ? 3.967   -9.762  16.995  1.00 9.45  ? 234  THR D C   1 
ATOM   10060 O O   . THR D 1 235 ? 4.314   -9.090  17.975  1.00 9.22  ? 234  THR D O   1 
ATOM   10061 C CB  . THR D 1 235 ? 5.309   -9.649  14.859  1.00 9.75  ? 234  THR D CB  1 
ATOM   10062 O OG1 . THR D 1 235 ? 6.368   -9.652  15.869  1.00 10.10 ? 234  THR D OG1 1 
ATOM   10063 C CG2 . THR D 1 235 ? 5.742   -8.847  13.630  1.00 8.91  ? 234  THR D CG2 1 
ATOM   10064 N N   . ALA D 1 236 ? 3.569   -11.012 17.010  1.00 10.11 ? 235  ALA D N   1 
ATOM   10065 C CA  . ALA D 1 236 ? 3.654   -11.817 18.260  1.00 11.03 ? 235  ALA D CA  1 
ATOM   10066 C C   . ALA D 1 236 ? 5.138   -11.991 18.596  1.00 11.42 ? 235  ALA D C   1 
ATOM   10067 O O   . ALA D 1 236 ? 6.026   -11.649 17.788  1.00 11.12 ? 235  ALA D O   1 
ATOM   10068 C CB  . ALA D 1 236 ? 2.940   -13.144 18.076  1.00 10.80 ? 235  ALA D CB  1 
ATOM   10069 N N   . GLY D 1 237 ? 5.412   -12.494 19.790  1.00 11.76 ? 236  GLY D N   1 
ATOM   10070 C CA  . GLY D 1 237 ? 6.789   -12.736 20.239  1.00 12.92 ? 236  GLY D CA  1 
ATOM   10071 C C   . GLY D 1 237 ? 7.434   -13.833 19.378  1.00 14.36 ? 236  GLY D C   1 
ATOM   10072 O O   . GLY D 1 237 ? 6.769   -14.640 18.714  1.00 14.24 ? 236  GLY D O   1 
ATOM   10073 N N   . GLN D 1 238 ? 8.741   -13.826 19.423  1.00 16.01 ? 237  GLN D N   1 
ATOM   10074 C CA  . GLN D 1 238 ? 9.659   -14.729 18.739  1.00 17.65 ? 237  GLN D CA  1 
ATOM   10075 C C   . GLN D 1 238 ? 9.404   -16.190 19.100  1.00 18.38 ? 237  GLN D C   1 
ATOM   10076 O O   . GLN D 1 238 ? 9.571   -17.076 18.242  1.00 17.93 ? 237  GLN D O   1 
ATOM   10077 C CB  . GLN D 1 238 ? 11.112  -14.335 19.055  1.00 21.01 ? 237  GLN D CB  1 
ATOM   10078 C CG  . GLN D 1 238 ? 12.123  -14.996 18.138  1.00 25.42 ? 237  GLN D CG  1 
ATOM   10079 C CD  . GLN D 1 238 ? 12.095  -14.366 16.760  1.00 27.56 ? 237  GLN D CD  1 
ATOM   10080 O OE1 . GLN D 1 238 ? 11.767  -13.192 16.596  1.00 29.87 ? 237  GLN D OE1 1 
ATOM   10081 N NE2 . GLN D 1 238 ? 12.439  -15.182 15.769  1.00 29.92 ? 237  GLN D NE2 1 
ATOM   10082 N N   . SER D 1 239 ? 8.987   -16.437 20.333  1.00 18.53 ? 238  SER D N   1 
ATOM   10083 C CA  . SER D 1 239 ? 8.696   -17.798 20.809  1.00 19.27 ? 238  SER D CA  1 
ATOM   10084 C C   . SER D 1 239 ? 7.210   -18.118 20.840  1.00 19.80 ? 238  SER D C   1 
ATOM   10085 O O   . SER D 1 239 ? 6.787   -19.059 21.545  1.00 20.36 ? 238  SER D O   1 
ATOM   10086 C CB  . SER D 1 239 ? 9.307   -18.041 22.187  1.00 19.58 ? 238  SER D CB  1 
ATOM   10087 O OG  . SER D 1 239 ? 10.675  -17.677 22.197  1.00 20.90 ? 238  SER D OG  1 
ATOM   10088 N N   . ALA D 1 240 ? 6.413   -17.356 20.121  1.00 19.89 ? 240  ALA D N   1 
ATOM   10089 C CA  . ALA D 1 240 ? 4.971   -17.642 19.999  1.00 19.97 ? 240  ALA D CA  1 
ATOM   10090 C C   . ALA D 1 240 ? 4.729   -18.076 18.548  1.00 20.37 ? 240  ALA D C   1 
ATOM   10091 O O   . ALA D 1 240 ? 5.631   -17.930 17.708  1.00 19.96 ? 240  ALA D O   1 
ATOM   10092 C CB  . ALA D 1 240 ? 4.144   -16.416 20.357  1.00 19.60 ? 240  ALA D CB  1 
ATOM   10093 N N   . LYS D 1 241 ? 3.546   -18.590 18.309  1.00 21.26 ? 241  LYS D N   1 
ATOM   10094 C CA  . LYS D 1 241 ? 3.118   -18.972 16.958  1.00 22.41 ? 241  LYS D CA  1 
ATOM   10095 C C   . LYS D 1 241 ? 3.197   -17.743 16.045  1.00 22.51 ? 241  LYS D C   1 
ATOM   10096 O O   . LYS D 1 241 ? 2.834   -16.624 16.458  1.00 22.36 ? 241  LYS D O   1 
ATOM   10097 C CB  . LYS D 1 241 ? 1.699   -19.517 16.937  1.00 26.17 ? 241  LYS D CB  1 
ATOM   10098 C CG  . LYS D 1 241 ? 1.396   -20.329 15.673  1.00 29.23 ? 241  LYS D CG  1 
ATOM   10099 C CD  . LYS D 1 241 ? -0.093  -20.354 15.354  1.00 32.29 ? 241  LYS D CD  1 
ATOM   10100 C CE  . LYS D 1 241 ? -0.400  -21.385 14.274  1.00 33.65 ? 241  LYS D CE  1 
ATOM   10101 N NZ  . LYS D 1 241 ? -1.866  -21.489 14.060  1.00 35.49 ? 241  LYS D NZ  1 
ATOM   10102 N N   . LYS D 1 242 ? 3.667   -17.986 14.842  1.00 22.28 ? 242  LYS D N   1 
ATOM   10103 C CA  . LYS D 1 242 ? 3.789   -16.975 13.791  1.00 22.34 ? 242  LYS D CA  1 
ATOM   10104 C C   . LYS D 1 242 ? 2.434   -16.524 13.276  1.00 21.93 ? 242  LYS D C   1 
ATOM   10105 O O   . LYS D 1 242 ? 1.457   -17.291 13.199  1.00 23.03 ? 242  LYS D O   1 
ATOM   10106 C CB  . LYS D 1 242 ? 4.649   -17.475 12.621  1.00 24.73 ? 242  LYS D CB  1 
ATOM   10107 C CG  . LYS D 1 242 ? 6.151   -17.350 12.920  1.00 28.11 ? 242  LYS D CG  1 
ATOM   10108 C CD  . LYS D 1 242 ? 6.934   -17.055 11.649  1.00 30.34 ? 242  LYS D CD  1 
ATOM   10109 C CE  . LYS D 1 242 ? 8.345   -16.586 11.954  1.00 31.83 ? 242  LYS D CE  1 
ATOM   10110 N NZ  . LYS D 1 242 ? 8.350   -15.145 12.326  1.00 33.12 ? 242  LYS D NZ  1 
ATOM   10111 N N   . ASN D 1 243 ? 2.381   -15.246 12.935  1.00 21.00 ? 243  ASN D N   1 
ATOM   10112 C CA  . ASN D 1 243 ? 1.166   -14.618 12.375  1.00 19.81 ? 243  ASN D CA  1 
ATOM   10113 C C   . ASN D 1 243 ? 1.327   -14.625 10.847  1.00 18.09 ? 243  ASN D C   1 
ATOM   10114 O O   . ASN D 1 243 ? 2.470   -14.739 10.378  1.00 18.54 ? 243  ASN D O   1 
ATOM   10115 C CB  . ASN D 1 243 ? 0.990   -13.206 12.942  1.00 19.87 ? 243  ASN D CB  1 
ATOM   10116 C CG  . ASN D 1 243 ? 1.213   -13.114 14.446  1.00 20.77 ? 243  ASN D CG  1 
ATOM   10117 O OD1 . ASN D 1 243 ? 2.266   -12.614 14.899  1.00 20.62 ? 243  ASN D OD1 1 
ATOM   10118 N ND2 . ASN D 1 243 ? 0.238   -13.592 15.211  1.00 18.17 ? 243  ASN D ND2 1 
ATOM   10119 N N   . THR D 1 244 ? 0.221   -14.484 10.152  1.00 16.84 ? 244  THR D N   1 
ATOM   10120 C CA  . THR D 1 244 ? 0.293   -14.307 8.673   1.00 14.56 ? 244  THR D CA  1 
ATOM   10121 C C   . THR D 1 244 ? 0.694   -12.861 8.402   1.00 13.88 ? 244  THR D C   1 
ATOM   10122 O O   . THR D 1 244 ? 0.493   -11.998 9.272   1.00 13.86 ? 244  THR D O   1 
ATOM   10123 C CB  . THR D 1 244 ? -1.097  -14.630 8.012   1.00 15.19 ? 244  THR D CB  1 
ATOM   10124 O OG1 . THR D 1 244 ? -1.988  -13.564 8.484   1.00 14.14 ? 244  THR D OG1 1 
ATOM   10125 C CG2 . THR D 1 244 ? -1.649  -16.020 8.350   1.00 15.54 ? 244  THR D CG2 1 
ATOM   10126 N N   . PRO D 1 245 ? 1.235   -12.612 7.222   1.00 13.21 ? 245  PRO D N   1 
ATOM   10127 C CA  . PRO D 1 245 ? 1.608   -11.262 6.796   1.00 12.74 ? 245  PRO D CA  1 
ATOM   10128 C C   . PRO D 1 245 ? 0.423   -10.314 6.892   1.00 12.08 ? 245  PRO D C   1 
ATOM   10129 O O   . PRO D 1 245 ? 0.582   -9.144  7.236   1.00 10.84 ? 245  PRO D O   1 
ATOM   10130 C CB  . PRO D 1 245 ? 2.137   -11.439 5.375   1.00 12.89 ? 245  PRO D CB  1 
ATOM   10131 C CG  . PRO D 1 245 ? 2.638   -12.876 5.361   1.00 12.90 ? 245  PRO D CG  1 
ATOM   10132 C CD  . PRO D 1 245 ? 1.605   -13.625 6.202   1.00 13.24 ? 245  PRO D CD  1 
ATOM   10133 N N   . GLU D 1 246 ? -0.767  -10.840 6.598   1.00 12.45 ? 246  GLU D N   1 
ATOM   10134 C CA  . GLU D 1 246 ? -1.991  -10.026 6.618   1.00 13.04 ? 246  GLU D CA  1 
ATOM   10135 C C   . GLU D 1 246 ? -2.377  -9.611  8.031   1.00 12.09 ? 246  GLU D C   1 
ATOM   10136 O O   . GLU D 1 246 ? -2.844  -8.479  8.255   1.00 12.04 ? 246  GLU D O   1 
ATOM   10137 C CB  . GLU D 1 246 ? -3.171  -10.760 5.980   1.00 17.07 ? 246  GLU D CB  1 
ATOM   10138 C CG  . GLU D 1 246 ? -3.121  -10.970 4.473   1.00 21.07 ? 246  GLU D CG  1 
ATOM   10139 C CD  . GLU D 1 246 ? -1.944  -11.696 3.904   1.00 24.28 ? 246  GLU D CD  1 
ATOM   10140 O OE1 . GLU D 1 246 ? -1.667  -12.784 4.478   1.00 22.50 ? 246  GLU D OE1 1 
ATOM   10141 O OE2 . GLU D 1 246 ? -1.315  -11.258 2.937   1.00 26.40 ? 246  GLU D OE2 1 
ATOM   10142 N N   . GLU D 1 247 ? -2.144  -10.510 8.972   1.00 11.93 ? 247  GLU D N   1 
ATOM   10143 C CA  . GLU D 1 247 ? -2.453  -10.253 10.392  1.00 11.25 ? 247  GLU D CA  1 
ATOM   10144 C C   . GLU D 1 247 ? -1.508  -9.201  10.953  1.00 10.54 ? 247  GLU D C   1 
ATOM   10145 O O   . GLU D 1 247 ? -1.934  -8.258  11.652  1.00 9.27  ? 247  GLU D O   1 
ATOM   10146 C CB  . GLU D 1 247 ? -2.397  -11.512 11.229  1.00 12.87 ? 247  GLU D CB  1 
ATOM   10147 C CG  . GLU D 1 247 ? -3.549  -12.512 11.057  1.00 16.12 ? 247  GLU D CG  1 
ATOM   10148 C CD  . GLU D 1 247 ? -3.259  -13.890 11.579  1.00 18.52 ? 247  GLU D CD  1 
ATOM   10149 O OE1 . GLU D 1 247 ? -2.174  -14.260 11.977  1.00 18.94 ? 247  GLU D OE1 1 
ATOM   10150 O OE2 . GLU D 1 247 ? -4.276  -14.616 11.574  1.00 20.62 ? 247  GLU D OE2 1 
ATOM   10151 N N   . ILE D 1 248 ? -0.231  -9.369  10.628  1.00 9.50  ? 248  ILE D N   1 
ATOM   10152 C CA  . ILE D 1 248 ? 0.813   -8.423  11.045  1.00 8.27  ? 248  ILE D CA  1 
ATOM   10153 C C   . ILE D 1 248 ? 0.535   -7.046  10.479  1.00 7.76  ? 248  ILE D C   1 
ATOM   10154 O O   . ILE D 1 248 ? 0.587   -6.032  11.187  1.00 7.35  ? 248  ILE D O   1 
ATOM   10155 C CB  . ILE D 1 248 ? 2.236   -8.972  10.651  1.00 8.73  ? 248  ILE D CB  1 
ATOM   10156 C CG1 . ILE D 1 248 ? 2.588   -10.185 11.548  1.00 8.64  ? 248  ILE D CG1 1 
ATOM   10157 C CG2 . ILE D 1 248 ? 3.325   -7.875  10.685  1.00 8.16  ? 248  ILE D CG2 1 
ATOM   10158 C CD1 . ILE D 1 248 ? 3.773   -11.038 11.005  1.00 10.44 ? 248  ILE D CD1 1 
ATOM   10159 N N   . ALA D 1 249 ? 0.250   -7.012  9.178   1.00 7.14  ? 249  ALA D N   1 
ATOM   10160 C CA  . ALA D 1 249 ? -0.046  -5.762  8.475   1.00 6.61  ? 249  ALA D CA  1 
ATOM   10161 C C   . ALA D 1 249 ? -1.223  -5.004  9.090   1.00 6.45  ? 249  ALA D C   1 
ATOM   10162 O O   . ALA D 1 249 ? -1.136  -3.782  9.291   1.00 5.45  ? 249  ALA D O   1 
ATOM   10163 C CB  . ALA D 1 249 ? -0.282  -6.044  6.991   1.00 5.82  ? 249  ALA D CB  1 
ATOM   10164 N N   . LEU D 1 250 ? -2.328  -5.690  9.333   1.00 6.40  ? 250  LEU D N   1 
ATOM   10165 C CA  . LEU D 1 250 ? -3.515  -5.032  9.909   1.00 6.56  ? 250  LEU D CA  1 
ATOM   10166 C C   . LEU D 1 250 ? -3.190  -4.447  11.293  1.00 5.93  ? 250  LEU D C   1 
ATOM   10167 O O   . LEU D 1 250 ? -3.483  -3.259  11.524  1.00 6.63  ? 250  LEU D O   1 
ATOM   10168 C CB  . LEU D 1 250 ? -4.696  -6.004  9.901   1.00 8.07  ? 250  LEU D CB  1 
ATOM   10169 C CG  . LEU D 1 250 ? -5.986  -5.407  10.487  1.00 10.24 ? 250  LEU D CG  1 
ATOM   10170 C CD1 . LEU D 1 250 ? -6.335  -4.118  9.750   1.00 10.60 ? 250  LEU D CD1 1 
ATOM   10171 C CD2 . LEU D 1 250 ? -7.102  -6.426  10.295  1.00 11.48 ? 250  LEU D CD2 1 
ATOM   10172 N N   . ALA D 1 251 ? -2.605  -5.242  12.149  1.00 6.50  ? 251  ALA D N   1 
ATOM   10173 C CA  . ALA D 1 251 ? -2.226  -4.822  13.522  1.00 5.83  ? 251  ALA D CA  1 
ATOM   10174 C C   . ALA D 1 251 ? -1.291  -3.631  13.482  1.00 5.60  ? 251  ALA D C   1 
ATOM   10175 O O   . ALA D 1 251 ? -1.473  -2.654  14.237  1.00 5.11  ? 251  ALA D O   1 
ATOM   10176 C CB  . ALA D 1 251 ? -1.620  -5.991  14.281  1.00 5.34  ? 251  ALA D CB  1 
ATOM   10177 N N   . THR D 1 252 ? -0.279  -3.697  12.604  1.00 5.02  ? 252  THR D N   1 
ATOM   10178 C CA  . THR D 1 252 ? 0.670   -2.591  12.456  1.00 4.69  ? 252  THR D CA  1 
ATOM   10179 C C   . THR D 1 252 ? 0.006   -1.304  12.003  1.00 4.70  ? 252  THR D C   1 
ATOM   10180 O O   . THR D 1 252 ? 0.224   -0.256  12.640  1.00 5.10  ? 252  THR D O   1 
ATOM   10181 C CB  . THR D 1 252 ? 1.919   -2.917  11.548  1.00 4.23  ? 252  THR D CB  1 
ATOM   10182 O OG1 . THR D 1 252 ? 2.528   -4.136  12.038  1.00 4.72  ? 252  THR D OG1 1 
ATOM   10183 C CG2 . THR D 1 252 ? 2.894   -1.748  11.394  1.00 4.28  ? 252  THR D CG2 1 
ATOM   10184 N N   . VAL D 1 253 ? -0.787  -1.353  10.930  1.00 4.77  ? 253  VAL D N   1 
ATOM   10185 C CA  . VAL D 1 253 ? -1.419  -0.143  10.392  1.00 3.72  ? 253  VAL D CA  1 
ATOM   10186 C C   . VAL D 1 253 ? -2.463  0.412   11.359  1.00 3.63  ? 253  VAL D C   1 
ATOM   10187 O O   . VAL D 1 253 ? -2.585  1.641   11.461  1.00 3.54  ? 253  VAL D O   1 
ATOM   10188 C CB  . VAL D 1 253 ? -1.975  -0.391  8.963   1.00 4.89  ? 253  VAL D CB  1 
ATOM   10189 C CG1 . VAL D 1 253 ? -2.865  0.744   8.467   1.00 4.73  ? 253  VAL D CG1 1 
ATOM   10190 C CG2 . VAL D 1 253 ? -0.837  -0.648  7.993   1.00 4.99  ? 253  VAL D CG2 1 
ATOM   10191 N N   . GLN D 1 254 ? -3.163  -0.483  12.052  1.00 3.99  ? 254  GLN D N   1 
ATOM   10192 C CA  . GLN D 1 254 ? -4.125  0.014   13.078  1.00 4.18  ? 254  GLN D CA  1 
ATOM   10193 C C   . GLN D 1 254 ? -3.358  0.810   14.142  1.00 4.16  ? 254  GLN D C   1 
ATOM   10194 O O   . GLN D 1 254 ? -3.755  1.932   14.470  1.00 4.13  ? 254  GLN D O   1 
ATOM   10195 C CB  . GLN D 1 254 ? -4.940  -1.116  13.701  1.00 3.98  ? 254  GLN D CB  1 
ATOM   10196 C CG  . GLN D 1 254 ? -6.052  -1.597  12.755  1.00 8.45  ? 254  GLN D CG  1 
ATOM   10197 C CD  . GLN D 1 254 ? -6.859  -2.723  13.369  1.00 11.27 ? 254  GLN D CD  1 
ATOM   10198 O OE1 . GLN D 1 254 ? -7.931  -3.078  12.885  1.00 13.72 ? 254  GLN D OE1 1 
ATOM   10199 N NE2 . GLN D 1 254 ? -6.315  -3.282  14.446  1.00 11.47 ? 254  GLN D NE2 1 
ATOM   10200 N N   . ALA D 1 255 ? -2.305  0.209   14.663  1.00 4.79  ? 255  ALA D N   1 
ATOM   10201 C CA  . ALA D 1 255 ? -1.485  0.828   15.722  1.00 5.10  ? 255  ALA D CA  1 
ATOM   10202 C C   . ALA D 1 255 ? -0.953  2.180   15.331  1.00 5.11  ? 255  ALA D C   1 
ATOM   10203 O O   . ALA D 1 255 ? -1.003  3.147   16.142  1.00 5.54  ? 255  ALA D O   1 
ATOM   10204 C CB  . ALA D 1 255 ? -0.402  -0.158  16.163  1.00 6.34  ? 255  ALA D CB  1 
ATOM   10205 N N   . LEU D 1 256 ? -0.451  2.332   14.102  1.00 4.69  ? 256  LEU D N   1 
ATOM   10206 C CA  . LEU D 1 256 ? 0.046   3.615   13.612  1.00 4.70  ? 256  LEU D CA  1 
ATOM   10207 C C   . LEU D 1 256 ? -1.082  4.616   13.404  1.00 4.29  ? 256  LEU D C   1 
ATOM   10208 O O   . LEU D 1 256 ? -0.953  5.789   13.760  1.00 3.49  ? 256  LEU D O   1 
ATOM   10209 C CB  . LEU D 1 256 ? 0.930   3.420   12.369  1.00 6.58  ? 256  LEU D CB  1 
ATOM   10210 C CG  . LEU D 1 256 ? 2.115   2.470   12.446  1.00 8.89  ? 256  LEU D CG  1 
ATOM   10211 C CD1 . LEU D 1 256 ? 2.805   2.365   11.074  1.00 8.65  ? 256  LEU D CD1 1 
ATOM   10212 C CD2 . LEU D 1 256 ? 3.131   2.973   13.453  1.00 8.20  ? 256  LEU D CD2 1 
ATOM   10213 N N   . ARG D 1 257 ? -2.177  4.184   12.784  1.00 4.35  ? 257  ARG D N   1 
ATOM   10214 C CA  . ARG D 1 257 ? -3.315  5.083   12.564  1.00 5.06  ? 257  ARG D CA  1 
ATOM   10215 C C   . ARG D 1 257 ? -3.812  5.677   13.890  1.00 5.21  ? 257  ARG D C   1 
ATOM   10216 O O   . ARG D 1 257 ? -4.295  6.815   13.913  1.00 4.35  ? 257  ARG D O   1 
ATOM   10217 C CB  . ARG D 1 257 ? -4.486  4.341   11.883  1.00 7.56  ? 257  ARG D CB  1 
ATOM   10218 C CG  . ARG D 1 257 ? -4.275  4.197   10.366  1.00 7.99  ? 257  ARG D CG  1 
ATOM   10219 C CD  . ARG D 1 257 ? -5.242  3.217   9.781   1.00 8.39  ? 257  ARG D CD  1 
ATOM   10220 N NE  . ARG D 1 257 ? -6.611  3.453   10.215  1.00 8.26  ? 257  ARG D NE  1 
ATOM   10221 C CZ  . ARG D 1 257 ? -7.354  4.473   9.777   1.00 8.77  ? 257  ARG D CZ  1 
ATOM   10222 N NH1 . ARG D 1 257 ? -6.861  5.339   8.887   1.00 8.82  ? 257  ARG D NH1 1 
ATOM   10223 N NH2 . ARG D 1 257 ? -8.595  4.625   10.227  1.00 8.10  ? 257  ARG D NH2 1 
ATOM   10224 N N   . ARG D 1 258 ? -3.654  4.892   14.954  1.00 4.93  ? 258  ARG D N   1 
ATOM   10225 C CA  . ARG D 1 258 ? -4.210  5.348   16.256  1.00 5.57  ? 258  ARG D CA  1 
ATOM   10226 C C   . ARG D 1 258 ? -3.312  6.289   17.017  1.00 5.75  ? 258  ARG D C   1 
ATOM   10227 O O   . ARG D 1 258 ? -3.802  6.966   17.979  1.00 5.67  ? 258  ARG D O   1 
ATOM   10228 C CB  . ARG D 1 258 ? -4.592  4.125   17.100  1.00 4.89  ? 258  ARG D CB  1 
ATOM   10229 C CG  . ARG D 1 258 ? -5.925  3.476   16.707  1.00 4.40  ? 258  ARG D CG  1 
ATOM   10230 C CD  . ARG D 1 258 ? -5.920  2.032   17.121  1.00 4.54  ? 258  ARG D CD  1 
ATOM   10231 N NE  . ARG D 1 258 ? -7.026  1.284   16.586  1.00 4.35  ? 258  ARG D NE  1 
ATOM   10232 C CZ  . ARG D 1 258 ? -7.333  0.024   16.840  1.00 4.54  ? 258  ARG D CZ  1 
ATOM   10233 N NH1 . ARG D 1 258 ? -6.622  -0.740  17.676  1.00 6.38  ? 258  ARG D NH1 1 
ATOM   10234 N NH2 . ARG D 1 258 ? -8.392  -0.527  16.250  1.00 5.68  ? 258  ARG D NH2 1 
ATOM   10235 N N   . THR D 1 259 ? -2.065  6.440   16.586  1.00 4.90  ? 259  THR D N   1 
ATOM   10236 C CA  . THR D 1 259 ? -1.095  7.184   17.402  1.00 5.49  ? 259  THR D CA  1 
ATOM   10237 C C   . THR D 1 259 ? -0.172  8.149   16.704  1.00 5.44  ? 259  THR D C   1 
ATOM   10238 O O   . THR D 1 259 ? 0.286   9.130   17.340  1.00 6.14  ? 259  THR D O   1 
ATOM   10239 C CB  . THR D 1 259 ? -0.216  6.123   18.221  1.00 4.68  ? 259  THR D CB  1 
ATOM   10240 O OG1 . THR D 1 259 ? 0.425   5.276   17.211  1.00 6.57  ? 259  THR D OG1 1 
ATOM   10241 C CG2 . THR D 1 259 ? -1.013  5.301   19.229  1.00 6.55  ? 259  THR D CG2 1 
ATOM   10242 N N   . VAL D 1 260 ? 0.209   7.848   15.477  1.00 5.06  ? 260  VAL D N   1 
ATOM   10243 C CA  . VAL D 1 260 ? 1.210   8.694   14.760  1.00 4.38  ? 260  VAL D CA  1 
ATOM   10244 C C   . VAL D 1 260 ? 0.523   9.748   13.925  1.00 4.02  ? 260  VAL D C   1 
ATOM   10245 O O   . VAL D 1 260 ? -0.071  9.366   12.875  1.00 4.48  ? 260  VAL D O   1 
ATOM   10246 C CB  . VAL D 1 260 ? 2.038   7.727   13.854  1.00 3.07  ? 260  VAL D CB  1 
ATOM   10247 C CG1 . VAL D 1 260 ? 3.125   8.529   13.097  1.00 2.23  ? 260  VAL D CG1 1 
ATOM   10248 C CG2 . VAL D 1 260 ? 2.598   6.539   14.571  1.00 4.45  ? 260  VAL D CG2 1 
ATOM   10249 N N   . PRO D 1 261 ? 0.624   11.012  14.291  1.00 4.77  ? 261  PRO D N   1 
ATOM   10250 C CA  . PRO D 1 261 ? -0.037  12.095  13.560  1.00 5.10  ? 261  PRO D CA  1 
ATOM   10251 C C   . PRO D 1 261 ? 0.384   12.109  12.085  1.00 5.67  ? 261  PRO D C   1 
ATOM   10252 O O   . PRO D 1 261 ? 1.549   11.838  11.770  1.00 4.73  ? 261  PRO D O   1 
ATOM   10253 C CB  . PRO D 1 261 ? 0.407   13.387  14.246  1.00 4.83  ? 261  PRO D CB  1 
ATOM   10254 C CG  . PRO D 1 261 ? 0.902   12.932  15.597  1.00 5.14  ? 261  PRO D CG  1 
ATOM   10255 C CD  . PRO D 1 261 ? 1.452   11.534  15.390  1.00 4.46  ? 261  PRO D CD  1 
ATOM   10256 N N   . ALA D 1 262 ? -0.574  12.501  11.255  1.00 5.52  ? 262  ALA D N   1 
ATOM   10257 C CA  . ALA D 1 262 ? -0.400  12.630  9.821   1.00 5.48  ? 262  ALA D CA  1 
ATOM   10258 C C   . ALA D 1 262 ? 0.750   13.567  9.470   1.00 5.46  ? 262  ALA D C   1 
ATOM   10259 O O   . ALA D 1 262 ? 1.355   13.404  8.387   1.00 6.02  ? 262  ALA D O   1 
ATOM   10260 C CB  . ALA D 1 262 ? -1.702  13.100  9.147   1.00 3.84  ? 262  ALA D CB  1 
ATOM   10261 N N   . ALA D 1 263 ? 1.034   14.541  10.309  1.00 5.65  ? 263  ALA D N   1 
ATOM   10262 C CA  . ALA D 1 263 ? 2.150   15.472  10.109  1.00 6.19  ? 263  ALA D CA  1 
ATOM   10263 C C   . ALA D 1 263 ? 3.506   14.784  10.036  1.00 6.24  ? 263  ALA D C   1 
ATOM   10264 O O   . ALA D 1 263 ? 4.440   15.378  9.449   1.00 6.57  ? 263  ALA D O   1 
ATOM   10265 C CB  . ALA D 1 263 ? 2.144   16.568  11.168  1.00 7.62  ? 263  ALA D CB  1 
ATOM   10266 N N   . VAL D 1 264 ? 3.651   13.623  10.628  1.00 6.07  ? 264  VAL D N   1 
ATOM   10267 C CA  . VAL D 1 264 ? 4.925   12.873  10.586  1.00 7.03  ? 264  VAL D CA  1 
ATOM   10268 C C   . VAL D 1 264 ? 5.131   12.472  9.107   1.00 7.48  ? 264  VAL D C   1 
ATOM   10269 O O   . VAL D 1 264 ? 4.269   11.803  8.531   1.00 6.64  ? 264  VAL D O   1 
ATOM   10270 C CB  . VAL D 1 264 ? 4.953   11.689  11.555  1.00 6.80  ? 264  VAL D CB  1 
ATOM   10271 C CG1 . VAL D 1 264 ? 6.171   10.784  11.324  1.00 7.33  ? 264  VAL D CG1 1 
ATOM   10272 C CG2 . VAL D 1 264 ? 4.947   12.135  13.020  1.00 5.43  ? 264  VAL D CG2 1 
ATOM   10273 N N   . THR D 1 265 ? 6.282   12.873  8.583   1.00 7.45  ? 265  THR D N   1 
ATOM   10274 C CA  . THR D 1 265 ? 6.532   12.682  7.125   1.00 6.96  ? 265  THR D CA  1 
ATOM   10275 C C   . THR D 1 265 ? 6.616   11.244  6.709   1.00 7.14  ? 265  THR D C   1 
ATOM   10276 O O   . THR D 1 265 ? 6.149   10.852  5.585   1.00 8.10  ? 265  THR D O   1 
ATOM   10277 C CB  . THR D 1 265 ? 7.793   13.538  6.697   1.00 4.91  ? 265  THR D CB  1 
ATOM   10278 O OG1 . THR D 1 265 ? 7.453   14.930  6.875   1.00 7.47  ? 265  THR D OG1 1 
ATOM   10279 C CG2 . THR D 1 265 ? 8.267   13.237  5.260   1.00 5.24  ? 265  THR D CG2 1 
ATOM   10280 N N   . GLY D 1 266 ? 7.197   10.364  7.526   1.00 5.53  ? 266  GLY D N   1 
ATOM   10281 C CA  . GLY D 1 266 ? 7.294   8.953   7.164   1.00 5.21  ? 266  GLY D CA  1 
ATOM   10282 C C   . GLY D 1 266 ? 7.689   8.017   8.295   1.00 5.02  ? 266  GLY D C   1 
ATOM   10283 O O   . GLY D 1 266 ? 8.170   8.454   9.361   1.00 5.27  ? 266  GLY D O   1 
ATOM   10284 N N   . VAL D 1 267 ? 7.440   6.754   8.038   1.00 5.13  ? 267  VAL D N   1 
ATOM   10285 C CA  . VAL D 1 267 ? 7.715   5.609   8.890   1.00 6.55  ? 267  VAL D CA  1 
ATOM   10286 C C   . VAL D 1 267 ? 8.684   4.651   8.178   1.00 7.35  ? 267  VAL D C   1 
ATOM   10287 O O   . VAL D 1 267 ? 8.390   4.125   7.072   1.00 7.70  ? 267  VAL D O   1 
ATOM   10288 C CB  . VAL D 1 267 ? 6.427   4.855   9.291   1.00 5.66  ? 267  VAL D CB  1 
ATOM   10289 C CG1 . VAL D 1 267 ? 6.703   3.696   10.255  1.00 5.88  ? 267  VAL D CG1 1 
ATOM   10290 C CG2 . VAL D 1 267 ? 5.386   5.801   9.869   1.00 6.06  ? 267  VAL D CG2 1 
ATOM   10291 N N   . THR D 1 268 ? 9.798   4.440   8.847   1.00 7.16  ? 268  THR D N   1 
ATOM   10292 C CA  . THR D 1 268 ? 10.854  3.559   8.241   1.00 7.10  ? 268  THR D CA  1 
ATOM   10293 C C   . THR D 1 268 ? 11.017  2.377   9.177   1.00 7.26  ? 268  THR D C   1 
ATOM   10294 O O   . THR D 1 268 ? 11.680  2.539   10.232  1.00 7.66  ? 268  THR D O   1 
ATOM   10295 C CB  . THR D 1 268 ? 12.149  4.388   7.986   1.00 7.43  ? 268  THR D CB  1 
ATOM   10296 O OG1 . THR D 1 268 ? 12.696  4.769   9.305   1.00 7.50  ? 268  THR D OG1 1 
ATOM   10297 C CG2 . THR D 1 268 ? 11.949  5.670   7.144   1.00 7.18  ? 268  THR D CG2 1 
ATOM   10298 N N   . PHE D 1 269 ? 10.432  1.251   8.824   1.00 6.64  ? 269  PHE D N   1 
ATOM   10299 C CA  . PHE D 1 269 ? 10.342  0.115   9.748   1.00 7.96  ? 269  PHE D CA  1 
ATOM   10300 C C   . PHE D 1 269 ? 11.699  -0.550  10.012  1.00 9.04  ? 269  PHE D C   1 
ATOM   10301 O O   . PHE D 1 269 ? 12.510  -0.699  9.100   1.00 7.99  ? 269  PHE D O   1 
ATOM   10302 C CB  . PHE D 1 269 ? 9.338   -0.943  9.298   1.00 7.49  ? 269  PHE D CB  1 
ATOM   10303 C CG  . PHE D 1 269 ? 7.894   -0.546  9.343   1.00 8.49  ? 269  PHE D CG  1 
ATOM   10304 C CD1 . PHE D 1 269 ? 7.190   -0.587  10.550  1.00 7.89  ? 269  PHE D CD1 1 
ATOM   10305 C CD2 . PHE D 1 269 ? 7.250   -0.128  8.180   1.00 6.93  ? 269  PHE D CD2 1 
ATOM   10306 C CE1 . PHE D 1 269 ? 5.847   -0.236  10.604  1.00 6.09  ? 269  PHE D CE1 1 
ATOM   10307 C CE2 . PHE D 1 269 ? 5.905   0.236   8.210   1.00 7.63  ? 269  PHE D CE2 1 
ATOM   10308 C CZ  . PHE D 1 269 ? 5.208   0.165   9.428   1.00 6.86  ? 269  PHE D CZ  1 
ATOM   10309 N N   . LEU D 1 270 ? 11.854  -0.944  11.284  1.00 9.37  ? 270  LEU D N   1 
ATOM   10310 C CA  . LEU D 1 270 ? 12.970  -1.876  11.614  1.00 10.29 ? 270  LEU D CA  1 
ATOM   10311 C C   . LEU D 1 270 ? 12.453  -3.282  11.314  1.00 11.17 ? 270  LEU D C   1 
ATOM   10312 O O   . LEU D 1 270 ? 11.218  -3.483  11.295  1.00 11.19 ? 270  LEU D O   1 
ATOM   10313 C CB  . LEU D 1 270 ? 13.451  -1.613  13.022  1.00 11.20 ? 270  LEU D CB  1 
ATOM   10314 C CG  . LEU D 1 270 ? 12.456  -1.843  14.154  1.00 11.63 ? 270  LEU D CG  1 
ATOM   10315 C CD1 . LEU D 1 270 ? 12.498  -3.279  14.633  1.00 11.92 ? 270  LEU D CD1 1 
ATOM   10316 C CD2 . LEU D 1 270 ? 12.814  -0.870  15.274  1.00 11.82 ? 270  LEU D CD2 1 
ATOM   10317 N N   . SER D 1 271 ? 13.345  -4.222  11.067  1.00 11.75 ? 271  SER D N   1 
ATOM   10318 C CA  . SER D 1 271 ? 12.932  -5.592  10.758  1.00 12.69 ? 271  SER D CA  1 
ATOM   10319 C C   . SER D 1 271 ? 12.998  -6.543  11.942  1.00 13.47 ? 271  SER D C   1 
ATOM   10320 O O   . SER D 1 271 ? 12.545  -7.690  11.810  1.00 13.21 ? 271  SER D O   1 
ATOM   10321 C CB  . SER D 1 271 ? 13.753  -6.144  9.588   1.00 11.34 ? 271  SER D CB  1 
ATOM   10322 O OG  . SER D 1 271 ? 15.126  -6.131  9.946   1.00 13.97 ? 271  SER D OG  1 
ATOM   10323 N N   . GLY D 1 272 ? 13.585  -6.131  13.050  1.00 15.18 ? 272  GLY D N   1 
ATOM   10324 C CA  . GLY D 1 272 ? 13.661  -6.977  14.262  1.00 16.49 ? 272  GLY D CA  1 
ATOM   10325 C C   . GLY D 1 272 ? 14.470  -8.239  13.977  1.00 17.72 ? 272  GLY D C   1 
ATOM   10326 O O   . GLY D 1 272 ? 15.623  -8.163  13.500  1.00 18.99 ? 272  GLY D O   1 
ATOM   10327 N N   . GLY D 1 273 ? 13.864  -9.383  14.244  1.00 17.89 ? 273  GLY D N   1 
ATOM   10328 C CA  . GLY D 1 273 ? 14.534  -10.675 13.993  1.00 17.91 ? 273  GLY D CA  1 
ATOM   10329 C C   . GLY D 1 273 ? 13.972  -11.387 12.774  1.00 17.15 ? 273  GLY D C   1 
ATOM   10330 O O   . GLY D 1 273 ? 14.189  -12.614 12.647  1.00 18.33 ? 273  GLY D O   1 
ATOM   10331 N N   . GLN D 1 274 ? 13.291  -10.675 11.901  1.00 16.64 ? 274  GLN D N   1 
ATOM   10332 C CA  . GLN D 1 274 ? 12.666  -11.255 10.692  1.00 16.13 ? 274  GLN D CA  1 
ATOM   10333 C C   . GLN D 1 274 ? 13.741  -11.574 9.637   1.00 15.77 ? 274  GLN D C   1 
ATOM   10334 O O   . GLN D 1 274 ? 14.737  -10.847 9.545   1.00 16.37 ? 274  GLN D O   1 
ATOM   10335 C CB  . GLN D 1 274 ? 11.626  -10.331 10.060  1.00 16.06 ? 274  GLN D CB  1 
ATOM   10336 C CG  . GLN D 1 274 ? 10.446  -9.954  10.930  1.00 16.59 ? 274  GLN D CG  1 
ATOM   10337 C CD  . GLN D 1 274 ? 9.562   -8.923  10.279  1.00 16.84 ? 274  GLN D CD  1 
ATOM   10338 O OE1 . GLN D 1 274 ? 9.118   -9.079  9.140   1.00 18.64 ? 274  GLN D OE1 1 
ATOM   10339 N NE2 . GLN D 1 274 ? 9.307   -7.828  10.979  1.00 17.69 ? 274  GLN D NE2 1 
ATOM   10340 N N   . SER D 1 275 ? 13.505  -12.626 8.885   1.00 15.52 ? 275  SER D N   1 
ATOM   10341 C CA  . SER D 1 275 ? 14.392  -13.038 7.776   1.00 15.29 ? 275  SER D CA  1 
ATOM   10342 C C   . SER D 1 275 ? 14.274  -11.991 6.664   1.00 15.23 ? 275  SER D C   1 
ATOM   10343 O O   . SER D 1 275 ? 13.319  -11.189 6.677   1.00 14.73 ? 275  SER D O   1 
ATOM   10344 C CB  . SER D 1 275 ? 14.022  -14.427 7.281   1.00 15.71 ? 275  SER D CB  1 
ATOM   10345 O OG  . SER D 1 275 ? 12.861  -14.395 6.458   1.00 14.68 ? 275  SER D OG  1 
ATOM   10346 N N   . GLU D 1 276 ? 15.225  -11.982 5.750   1.00 15.12 ? 276  GLU D N   1 
ATOM   10347 C CA  . GLU D 1 276 ? 15.206  -11.048 4.610   1.00 14.66 ? 276  GLU D CA  1 
ATOM   10348 C C   . GLU D 1 276 ? 13.880  -11.071 3.867   1.00 13.84 ? 276  GLU D C   1 
ATOM   10349 O O   . GLU D 1 276 ? 13.317  -9.989  3.625   1.00 13.16 ? 276  GLU D O   1 
ATOM   10350 C CB  . GLU D 1 276 ? 16.326  -11.310 3.598   1.00 15.56 ? 276  GLU D CB  1 
ATOM   10351 C CG  . GLU D 1 276 ? 17.729  -10.887 4.032   1.00 17.81 ? 276  GLU D CG  1 
ATOM   10352 C CD  . GLU D 1 276 ? 18.877  -11.321 3.174   1.00 18.27 ? 276  GLU D CD  1 
ATOM   10353 O OE1 . GLU D 1 276 ? 18.680  -12.435 2.648   1.00 18.60 ? 276  GLU D OE1 1 
ATOM   10354 O OE2 . GLU D 1 276 ? 19.891  -10.652 3.016   1.00 18.79 ? 276  GLU D OE2 1 
ATOM   10355 N N   . GLU D 1 277 ? 13.387  -12.241 3.519   1.00 14.13 ? 277  GLU D N   1 
ATOM   10356 C CA  . GLU D 1 277 ? 12.130  -12.413 2.782   1.00 14.60 ? 277  GLU D CA  1 
ATOM   10357 C C   . GLU D 1 277 ? 10.902  -11.960 3.569   1.00 13.93 ? 277  GLU D C   1 
ATOM   10358 O O   . GLU D 1 277 ? 10.029  -11.274 3.009   1.00 13.05 ? 277  GLU D O   1 
ATOM   10359 C CB  . GLU D 1 277 ? 11.838  -13.852 2.361   1.00 16.16 ? 277  GLU D CB  1 
ATOM   10360 C CG  . GLU D 1 277 ? 11.710  -14.192 0.898   1.00 19.81 ? 277  GLU D CG  1 
ATOM   10361 C CD  . GLU D 1 277 ? 10.869  -13.338 0.013   1.00 18.63 ? 277  GLU D CD  1 
ATOM   10362 O OE1 . GLU D 1 277 ? 11.494  -12.328 -0.381  1.00 20.07 ? 277  GLU D OE1 1 
ATOM   10363 O OE2 . GLU D 1 277 ? 9.722   -13.592 -0.321  1.00 20.04 ? 277  GLU D OE2 1 
ATOM   10364 N N   . GLU D 1 278 ? 10.859  -12.354 4.828   1.00 14.46 ? 278  GLU D N   1 
ATOM   10365 C CA  . GLU D 1 278 ? 9.769   -11.972 5.742   1.00 13.98 ? 278  GLU D CA  1 
ATOM   10366 C C   . GLU D 1 278 ? 9.621   -10.463 5.859   1.00 13.34 ? 278  GLU D C   1 
ATOM   10367 O O   . GLU D 1 278 ? 8.491   -9.951  5.833   1.00 12.67 ? 278  GLU D O   1 
ATOM   10368 C CB  . GLU D 1 278 ? 9.946   -12.472 7.171   1.00 16.60 ? 278  GLU D CB  1 
ATOM   10369 C CG  . GLU D 1 278 ? 9.467   -13.864 7.537   1.00 21.72 ? 278  GLU D CG  1 
ATOM   10370 C CD  . GLU D 1 278 ? 9.727   -14.319 8.946   1.00 23.05 ? 278  GLU D CD  1 
ATOM   10371 O OE1 . GLU D 1 278 ? 10.779  -13.862 9.442   1.00 24.89 ? 278  GLU D OE1 1 
ATOM   10372 O OE2 . GLU D 1 278 ? 8.977   -15.060 9.553   1.00 26.21 ? 278  GLU D OE2 1 
ATOM   10373 N N   . ALA D 1 279 ? 10.737  -9.781  6.039   1.00 12.52 ? 279  ALA D N   1 
ATOM   10374 C CA  . ALA D 1 279 ? 10.750  -8.317  6.151   1.00 12.14 ? 279  ALA D CA  1 
ATOM   10375 C C   . ALA D 1 279 ? 10.187  -7.638  4.907   1.00 11.89 ? 279  ALA D C   1 
ATOM   10376 O O   . ALA D 1 279 ? 9.520   -6.596  5.000   1.00 11.05 ? 279  ALA D O   1 
ATOM   10377 C CB  . ALA D 1 279 ? 12.144  -7.808  6.506   1.00 12.31 ? 279  ALA D CB  1 
ATOM   10378 N N   . THR D 1 280 ? 10.461  -8.220  3.746   1.00 11.31 ? 280  THR D N   1 
ATOM   10379 C CA  . THR D 1 280 ? 9.946   -7.714  2.482   1.00 10.76 ? 280  THR D CA  1 
ATOM   10380 C C   . THR D 1 280 ? 8.446   -8.003  2.328   1.00 9.89  ? 280  THR D C   1 
ATOM   10381 O O   . THR D 1 280 ? 7.690   -7.078  2.023   1.00 10.65 ? 280  THR D O   1 
ATOM   10382 C CB  . THR D 1 280 ? 10.734  -8.317  1.245   1.00 11.08 ? 280  THR D CB  1 
ATOM   10383 O OG1 . THR D 1 280 ? 12.140  -8.088  1.574   1.00 11.18 ? 280  THR D OG1 1 
ATOM   10384 C CG2 . THR D 1 280 ? 10.324  -7.657  -0.071  1.00 10.60 ? 280  THR D CG2 1 
ATOM   10385 N N   . VAL D 1 281 ? 8.093   -9.246  2.523   1.00 10.65 ? 281  VAL D N   1 
ATOM   10386 C CA  . VAL D 1 281 ? 6.689   -9.703  2.391   1.00 10.38 ? 281  VAL D CA  1 
ATOM   10387 C C   . VAL D 1 281 ? 5.828   -8.876  3.357   1.00 9.92  ? 281  VAL D C   1 
ATOM   10388 O O   . VAL D 1 281 ? 4.787   -8.345  2.963   1.00 9.75  ? 281  VAL D O   1 
ATOM   10389 C CB  . VAL D 1 281 ? 6.572   -11.210 2.558   1.00 10.83 ? 281  VAL D CB  1 
ATOM   10390 C CG1 . VAL D 1 281 ? 5.125   -11.677 2.795   1.00 13.05 ? 281  VAL D CG1 1 
ATOM   10391 C CG2 . VAL D 1 281 ? 7.157   -11.982 1.389   1.00 12.37 ? 281  VAL D CG2 1 
ATOM   10392 N N   . ASN D 1 282 ? 6.328   -8.744  4.583   1.00 9.97  ? 282  ASN D N   1 
ATOM   10393 C CA  . ASN D 1 282 ? 5.539   -7.986  5.602   1.00 9.81  ? 282  ASN D CA  1 
ATOM   10394 C C   . ASN D 1 282 ? 5.367   -6.546  5.188   1.00 8.83  ? 282  ASN D C   1 
ATOM   10395 O O   . ASN D 1 282 ? 4.230   -6.018  5.302   1.00 8.64  ? 282  ASN D O   1 
ATOM   10396 C CB  . ASN D 1 282 ? 6.085   -8.229  7.012   1.00 9.71  ? 282  ASN D CB  1 
ATOM   10397 C CG  . ASN D 1 282 ? 5.762   -9.609  7.543   1.00 10.99 ? 282  ASN D CG  1 
ATOM   10398 O OD1 . ASN D 1 282 ? 4.822   -10.284 7.078   1.00 12.27 ? 282  ASN D OD1 1 
ATOM   10399 N ND2 . ASN D 1 282 ? 6.544   -10.093 8.515   1.00 12.00 ? 282  ASN D ND2 1 
ATOM   10400 N N   . LEU D 1 283 ? 6.412   -5.881  4.717   1.00 8.28  ? 283  LEU D N   1 
ATOM   10401 C CA  . LEU D 1 283 ? 6.309   -4.484  4.300   1.00 7.92  ? 283  LEU D CA  1 
ATOM   10402 C C   . LEU D 1 283 ? 5.309   -4.321  3.150   1.00 7.38  ? 283  LEU D C   1 
ATOM   10403 O O   . LEU D 1 283 ? 4.546   -3.345  3.125   1.00 7.16  ? 283  LEU D O   1 
ATOM   10404 C CB  . LEU D 1 283 ? 7.696   -3.904  3.960   1.00 9.12  ? 283  LEU D CB  1 
ATOM   10405 C CG  . LEU D 1 283 ? 7.717   -2.457  3.490   1.00 9.25  ? 283  LEU D CG  1 
ATOM   10406 C CD1 . LEU D 1 283 ? 7.144   -1.514  4.546   1.00 10.27 ? 283  LEU D CD1 1 
ATOM   10407 C CD2 . LEU D 1 283 ? 9.166   -2.039  3.187   1.00 10.64 ? 283  LEU D CD2 1 
ATOM   10408 N N   . SER D 1 284 ? 5.315   -5.274  2.220   1.00 8.35  ? 284  SER D N   1 
ATOM   10409 C CA  . SER D 1 284 ? 4.394   -5.202  1.077   1.00 7.79  ? 284  SER D CA  1 
ATOM   10410 C C   . SER D 1 284 ? 2.940   -5.289  1.557   1.00 7.65  ? 284  SER D C   1 
ATOM   10411 O O   . SER D 1 284 ? 2.085   -4.565  1.039   1.00 8.43  ? 284  SER D O   1 
ATOM   10412 C CB  . SER D 1 284 ? 4.702   -6.276  0.041   1.00 9.74  ? 284  SER D CB  1 
ATOM   10413 O OG  . SER D 1 284 ? 4.361   -5.828  -1.268  1.00 8.95  ? 284  SER D OG  1 
ATOM   10414 N N   . ALA D 1 285 ? 2.680   -6.197  2.470   1.00 8.18  ? 285  ALA D N   1 
ATOM   10415 C CA  . ALA D 1 285 ? 1.309   -6.399  3.025   1.00 8.39  ? 285  ALA D CA  1 
ATOM   10416 C C   . ALA D 1 285 ? 0.832   -5.131  3.726   1.00 8.64  ? 285  ALA D C   1 
ATOM   10417 O O   . ALA D 1 285 ? -0.347  -4.734  3.614   1.00 8.50  ? 285  ALA D O   1 
ATOM   10418 C CB  . ALA D 1 285 ? 1.327   -7.617  3.914   1.00 8.55  ? 285  ALA D CB  1 
ATOM   10419 N N   . ILE D 1 286 ? 1.730   -4.519  4.480   1.00 8.26  ? 286  ILE D N   1 
ATOM   10420 C CA  . ILE D 1 286 ? 1.434   -3.236  5.157   1.00 7.70  ? 286  ILE D CA  1 
ATOM   10421 C C   . ILE D 1 286 ? 0.972   -2.171  4.177   1.00 8.17  ? 286  ILE D C   1 
ATOM   10422 O O   . ILE D 1 286 ? 0.064   -1.350  4.486   1.00 7.13  ? 286  ILE D O   1 
ATOM   10423 C CB  . ILE D 1 286 ? 2.707   -2.805  5.973   1.00 6.91  ? 286  ILE D CB  1 
ATOM   10424 C CG1 . ILE D 1 286 ? 2.878   -3.697  7.235   1.00 5.70  ? 286  ILE D CG1 1 
ATOM   10425 C CG2 . ILE D 1 286 ? 2.726   -1.299  6.309   1.00 7.12  ? 286  ILE D CG2 1 
ATOM   10426 C CD1 . ILE D 1 286 ? 4.234   -3.364  7.973   1.00 3.71  ? 286  ILE D CD1 1 
ATOM   10427 N N   . ASN D 1 287 ? 1.616   -2.115  3.005   1.00 7.77  ? 287  ASN D N   1 
ATOM   10428 C CA  . ASN D 1 287 ? 1.271   -1.100  1.995   1.00 8.51  ? 287  ASN D CA  1 
ATOM   10429 C C   . ASN D 1 287 ? 0.008   -1.468  1.202   1.00 8.96  ? 287  ASN D C   1 
ATOM   10430 O O   . ASN D 1 287 ? -0.342  -0.725  0.256   1.00 9.70  ? 287  ASN D O   1 
ATOM   10431 C CB  . ASN D 1 287 ? 2.457   -0.754  1.088   1.00 6.61  ? 287  ASN D CB  1 
ATOM   10432 C CG  . ASN D 1 287 ? 3.365   0.289   1.702   1.00 6.57  ? 287  ASN D CG  1 
ATOM   10433 O OD1 . ASN D 1 287 ? 3.065   1.491   1.684   1.00 9.38  ? 287  ASN D OD1 1 
ATOM   10434 N ND2 . ASN D 1 287 ? 4.486   -0.150  2.243   1.00 5.98  ? 287  ASN D ND2 1 
ATOM   10435 N N   . ASN D 1 288 ? -0.657  -2.513  1.570   1.00 8.88  ? 288  ASN D N   1 
ATOM   10436 C CA  . ASN D 1 288 ? -1.886  -2.970  0.915   1.00 9.87  ? 288  ASN D CA  1 
ATOM   10437 C C   . ASN D 1 288 ? -3.069  -3.029  1.894   1.00 10.14 ? 288  ASN D C   1 
ATOM   10438 O O   . ASN D 1 288 ? -4.138  -3.506  1.450   1.00 10.27 ? 288  ASN D O   1 
ATOM   10439 C CB  . ASN D 1 288 ? -1.672  -4.315  0.228   1.00 11.32 ? 288  ASN D CB  1 
ATOM   10440 C CG  . ASN D 1 288 ? -1.026  -4.171  -1.143  1.00 14.14 ? 288  ASN D CG  1 
ATOM   10441 O OD1 . ASN D 1 288 ? -1.605  -3.502  -1.998  1.00 16.44 ? 288  ASN D OD1 1 
ATOM   10442 N ND2 . ASN D 1 288 ? 0.143   -4.776  -1.309  1.00 15.30 ? 288  ASN D ND2 1 
ATOM   10443 N N   . VAL D 1 289 ? -2.894  -2.562  3.115   1.00 9.31  ? 289  VAL D N   1 
ATOM   10444 C CA  . VAL D 1 289 ? -4.010  -2.539  4.092   1.00 8.90  ? 289  VAL D CA  1 
ATOM   10445 C C   . VAL D 1 289 ? -5.038  -1.516  3.594   1.00 8.55  ? 289  VAL D C   1 
ATOM   10446 O O   . VAL D 1 289 ? -4.683  -0.375  3.279   1.00 8.51  ? 289  VAL D O   1 
ATOM   10447 C CB  . VAL D 1 289 ? -3.483  -2.216  5.511   1.00 9.50  ? 289  VAL D CB  1 
ATOM   10448 C CG1 . VAL D 1 289 ? -4.623  -1.914  6.486   1.00 8.32  ? 289  VAL D CG1 1 
ATOM   10449 C CG2 . VAL D 1 289 ? -2.595  -3.325  6.072   1.00 8.18  ? 289  VAL D CG2 1 
ATOM   10450 N N   . PRO D 1 290 ? -6.300  -1.942  3.536   1.00 8.95  ? 290  PRO D N   1 
ATOM   10451 C CA  . PRO D 1 290 ? -7.368  -1.092  2.996   1.00 9.74  ? 290  PRO D CA  1 
ATOM   10452 C C   . PRO D 1 290 ? -7.855  -0.023  3.950   1.00 9.64  ? 290  PRO D C   1 
ATOM   10453 O O   . PRO D 1 290 ? -9.064  0.162   4.203   1.00 10.28 ? 290  PRO D O   1 
ATOM   10454 C CB  . PRO D 1 290 ? -8.449  -2.088  2.572   1.00 9.45  ? 290  PRO D CB  1 
ATOM   10455 C CG  . PRO D 1 290 ? -8.225  -3.292  3.440   1.00 10.12 ? 290  PRO D CG  1 
ATOM   10456 C CD  . PRO D 1 290 ? -6.729  -3.341  3.680   1.00 9.52  ? 290  PRO D CD  1 
ATOM   10457 N N   . LEU D 1 291 ? -6.925  0.735   4.506   1.00 9.47  ? 291  LEU D N   1 
ATOM   10458 C CA  . LEU D 1 291 ? -7.229  1.845   5.418   1.00 8.95  ? 291  LEU D CA  1 
ATOM   10459 C C   . LEU D 1 291 ? -6.320  3.006   5.000   1.00 9.05  ? 291  LEU D C   1 
ATOM   10460 O O   . LEU D 1 291 ? -5.269  2.732   4.368   1.00 10.53 ? 291  LEU D O   1 
ATOM   10461 C CB  . LEU D 1 291 ? -6.973  1.417   6.868   1.00 8.93  ? 291  LEU D CB  1 
ATOM   10462 C CG  . LEU D 1 291 ? -7.723  0.252   7.453   1.00 7.71  ? 291  LEU D CG  1 
ATOM   10463 C CD1 . LEU D 1 291 ? -7.122  -0.165  8.798   1.00 7.96  ? 291  LEU D CD1 1 
ATOM   10464 C CD2 . LEU D 1 291 ? -9.189  0.625   7.657   1.00 10.54 ? 291  LEU D CD2 1 
ATOM   10465 N N   . ILE D 1 292 ? -6.717  4.184   5.375   1.00 8.53  ? 292  ILE D N   1 
ATOM   10466 C CA  . ILE D 1 292 ? -5.977  5.407   5.032   1.00 7.91  ? 292  ILE D CA  1 
ATOM   10467 C C   . ILE D 1 292 ? -4.631  5.361   5.789   1.00 8.61  ? 292  ILE D C   1 
ATOM   10468 O O   . ILE D 1 292 ? -4.644  5.118   7.005   1.00 7.79  ? 292  ILE D O   1 
ATOM   10469 C CB  . ILE D 1 292 ? -6.815  6.664   5.342   1.00 8.08  ? 292  ILE D CB  1 
ATOM   10470 C CG1 . ILE D 1 292 ? -8.112  6.638   4.464   1.00 9.39  ? 292  ILE D CG1 1 
ATOM   10471 C CG2 . ILE D 1 292 ? -6.050  8.005   5.203   1.00 5.78  ? 292  ILE D CG2 1 
ATOM   10472 C CD1 . ILE D 1 292 ? -9.031  7.847   4.748   1.00 10.29 ? 292  ILE D CD1 1 
ATOM   10473 N N   . ARG D 1 293 ? -3.591  5.552   5.019   1.00 7.62  ? 293  ARG D N   1 
ATOM   10474 C CA  . ARG D 1 293 ? -2.197  5.584   5.484   1.00 8.68  ? 293  ARG D CA  1 
ATOM   10475 C C   . ARG D 1 293 ? -1.590  6.907   5.031   1.00 8.66  ? 293  ARG D C   1 
ATOM   10476 O O   . ARG D 1 293 ? -1.098  7.032   3.901   1.00 8.79  ? 293  ARG D O   1 
ATOM   10477 C CB  . ARG D 1 293 ? -1.422  4.388   4.925   1.00 11.97 ? 293  ARG D CB  1 
ATOM   10478 C CG  . ARG D 1 293 ? -1.957  3.052   5.439   1.00 14.45 ? 293  ARG D CG  1 
ATOM   10479 C CD  . ARG D 1 293 ? -1.478  1.888   4.638   1.00 18.60 ? 293  ARG D CD  1 
ATOM   10480 N NE  . ARG D 1 293 ? -2.493  1.429   3.703   1.00 22.14 ? 293  ARG D NE  1 
ATOM   10481 C CZ  . ARG D 1 293 ? -2.457  1.582   2.387   1.00 24.45 ? 293  ARG D CZ  1 
ATOM   10482 N NH1 . ARG D 1 293 ? -1.289  1.820   1.792   1.00 25.43 ? 293  ARG D NH1 1 
ATOM   10483 N NH2 . ARG D 1 293 ? -3.552  1.452   1.636   1.00 26.17 ? 293  ARG D NH2 1 
ATOM   10484 N N   . PRO D 1 294 ? -1.641  7.888   5.932   1.00 7.96  ? 294  PRO D N   1 
ATOM   10485 C CA  . PRO D 1 294 ? -1.264  9.246   5.605   1.00 7.74  ? 294  PRO D CA  1 
ATOM   10486 C C   . PRO D 1 294 ? 0.231   9.494   5.480   1.00 7.92  ? 294  PRO D C   1 
ATOM   10487 O O   . PRO D 1 294 ? 0.595   10.612  5.085   1.00 8.78  ? 294  PRO D O   1 
ATOM   10488 C CB  . PRO D 1 294 ? -1.896  10.092  6.710   1.00 7.97  ? 294  PRO D CB  1 
ATOM   10489 C CG  . PRO D 1 294 ? -2.016  9.163   7.880   1.00 7.80  ? 294  PRO D CG  1 
ATOM   10490 C CD  . PRO D 1 294 ? -2.230  7.769   7.289   1.00 7.75  ? 294  PRO D CD  1 
ATOM   10491 N N   . TRP D 1 295 ? 1.064   8.534   5.815   1.00 7.13  ? 295  TRP D N   1 
ATOM   10492 C CA  . TRP D 1 295 ? 2.522   8.687   5.756   1.00 6.48  ? 295  TRP D CA  1 
ATOM   10493 C C   . TRP D 1 295 ? 3.121   7.610   4.855   1.00 6.81  ? 295  TRP D C   1 
ATOM   10494 O O   . TRP D 1 295 ? 2.539   6.526   4.709   1.00 6.04  ? 295  TRP D O   1 
ATOM   10495 C CB  . TRP D 1 295 ? 3.138   8.538   7.164   1.00 4.93  ? 295  TRP D CB  1 
ATOM   10496 C CG  . TRP D 1 295 ? 2.180   8.442   8.303   1.00 3.94  ? 295  TRP D CG  1 
ATOM   10497 C CD1 . TRP D 1 295 ? 1.944   9.387   9.274   1.00 3.39  ? 295  TRP D CD1 1 
ATOM   10498 C CD2 . TRP D 1 295 ? 1.363   7.309   8.635   1.00 4.33  ? 295  TRP D CD2 1 
ATOM   10499 N NE1 . TRP D 1 295 ? 1.006   8.906   10.168  1.00 3.42  ? 295  TRP D NE1 1 
ATOM   10500 C CE2 . TRP D 1 295 ? 0.652   7.635   9.805   1.00 4.05  ? 295  TRP D CE2 1 
ATOM   10501 C CE3 . TRP D 1 295 ? 1.156   6.059   8.043   1.00 4.57  ? 295  TRP D CE3 1 
ATOM   10502 C CZ2 . TRP D 1 295 ? -0.259  6.760   10.383  1.00 4.43  ? 295  TRP D CZ2 1 
ATOM   10503 C CZ3 . TRP D 1 295 ? 0.259   5.184   8.630   1.00 6.35  ? 295  TRP D CZ3 1 
ATOM   10504 C CH2 . TRP D 1 295 ? -0.460  5.538   9.779   1.00 6.16  ? 295  TRP D CH2 1 
ATOM   10505 N N   . ALA D 1 296 ? 4.301   7.912   4.326   1.00 7.45  ? 296  ALA D N   1 
ATOM   10506 C CA  . ALA D 1 296 ? 5.071   6.839   3.618   1.00 7.56  ? 296  ALA D CA  1 
ATOM   10507 C C   . ALA D 1 296 ? 5.386   5.715   4.598   1.00 7.88  ? 296  ALA D C   1 
ATOM   10508 O O   . ALA D 1 296 ? 5.657   5.973   5.789   1.00 8.58  ? 296  ALA D O   1 
ATOM   10509 C CB  . ALA D 1 296 ? 6.321   7.452   3.029   1.00 7.64  ? 296  ALA D CB  1 
ATOM   10510 N N   . LEU D 1 297 ? 5.314   4.485   4.151   1.00 6.82  ? 297  LEU D N   1 
ATOM   10511 C CA  . LEU D 1 297 ? 5.611   3.282   4.921   1.00 7.61  ? 297  LEU D CA  1 
ATOM   10512 C C   . LEU D 1 297 ? 6.721   2.506   4.197   1.00 7.95  ? 297  LEU D C   1 
ATOM   10513 O O   . LEU D 1 297 ? 6.453   1.815   3.207   1.00 7.57  ? 297  LEU D O   1 
ATOM   10514 C CB  . LEU D 1 297 ? 4.315   2.453   5.056   1.00 7.76  ? 297  LEU D CB  1 
ATOM   10515 C CG  . LEU D 1 297 ? 3.243   3.171   5.874   1.00 8.10  ? 297  LEU D CG  1 
ATOM   10516 C CD1 . LEU D 1 297 ? 1.875   2.585   5.611   1.00 6.78  ? 297  LEU D CD1 1 
ATOM   10517 C CD2 . LEU D 1 297 ? 3.641   2.983   7.354   1.00 8.65  ? 297  LEU D CD2 1 
ATOM   10518 N N   . THR D 1 298 ? 7.927   2.700   4.730   1.00 7.68  ? 298  THR D N   1 
ATOM   10519 C CA  . THR D 1 298 ? 9.090   2.107   4.059   1.00 7.29  ? 298  THR D CA  1 
ATOM   10520 C C   . THR D 1 298 ? 9.986   1.396   5.052   1.00 7.61  ? 298  THR D C   1 
ATOM   10521 O O   . THR D 1 298 ? 9.550   1.059   6.184   1.00 6.31  ? 298  THR D O   1 
ATOM   10522 C CB  . THR D 1 298 ? 9.791   3.197   3.150   1.00 7.61  ? 298  THR D CB  1 
ATOM   10523 O OG1 . THR D 1 298 ? 10.800  2.509   2.371   1.00 7.40  ? 298  THR D OG1 1 
ATOM   10524 C CG2 . THR D 1 298 ? 10.324  4.393   3.944   1.00 8.70  ? 298  THR D CG2 1 
ATOM   10525 N N   . PHE D 1 299 ? 11.204  1.161   4.611   1.00 6.57  ? 299  PHE D N   1 
ATOM   10526 C CA  . PHE D 1 299 ? 12.178  0.361   5.342   1.00 6.91  ? 299  PHE D CA  1 
ATOM   10527 C C   . PHE D 1 299 ? 13.392  1.190   5.767   1.00 7.07  ? 299  PHE D C   1 
ATOM   10528 O O   . PHE D 1 299 ? 13.810  2.177   5.157   1.00 6.53  ? 299  PHE D O   1 
ATOM   10529 C CB  . PHE D 1 299 ? 12.611  -0.865  4.513   1.00 6.25  ? 299  PHE D CB  1 
ATOM   10530 C CG  . PHE D 1 299 ? 13.312  -0.513  3.220   1.00 6.55  ? 299  PHE D CG  1 
ATOM   10531 C CD1 . PHE D 1 299 ? 12.571  -0.259  2.072   1.00 8.25  ? 299  PHE D CD1 1 
ATOM   10532 C CD2 . PHE D 1 299 ? 14.696  -0.423  3.180   1.00 7.04  ? 299  PHE D CD2 1 
ATOM   10533 C CE1 . PHE D 1 299 ? 13.218  0.078   0.861   1.00 7.09  ? 299  PHE D CE1 1 
ATOM   10534 C CE2 . PHE D 1 299 ? 15.368  -0.101  2.000   1.00 7.52  ? 299  PHE D CE2 1 
ATOM   10535 C CZ  . PHE D 1 299 ? 14.625  0.150   0.847   1.00 7.57  ? 299  PHE D CZ  1 
ATOM   10536 N N   . SER D 1 300 ? 13.949  0.703   6.861   1.00 8.25  ? 300  SER D N   1 
ATOM   10537 C CA  . SER D 1 300 ? 15.269  1.151   7.379   1.00 8.45  ? 300  SER D CA  1 
ATOM   10538 C C   . SER D 1 300 ? 15.911  -0.143  7.875   1.00 8.87  ? 300  SER D C   1 
ATOM   10539 O O   . SER D 1 300 ? 15.814  -0.504  9.053   1.00 8.63  ? 300  SER D O   1 
ATOM   10540 C CB  . SER D 1 300 ? 15.168  2.184   8.472   1.00 9.02  ? 300  SER D CB  1 
ATOM   10541 O OG  . SER D 1 300 ? 16.475  2.466   9.001   1.00 13.02 ? 300  SER D OG  1 
ATOM   10542 N N   . TYR D 1 301 ? 16.492  -0.879  6.920   1.00 9.20  ? 301  TYR D N   1 
ATOM   10543 C CA  . TYR D 1 301 ? 16.965  -2.223  7.189   1.00 9.63  ? 301  TYR D CA  1 
ATOM   10544 C C   . TYR D 1 301 ? 18.493  -2.322  7.227   1.00 10.50 ? 301  TYR D C   1 
ATOM   10545 O O   . TYR D 1 301 ? 19.225  -1.692  6.467   1.00 9.07  ? 301  TYR D O   1 
ATOM   10546 C CB  . TYR D 1 301 ? 16.378  -3.240  6.210   1.00 9.25  ? 301  TYR D CB  1 
ATOM   10547 C CG  . TYR D 1 301 ? 14.897  -3.476  6.208   1.00 10.43 ? 301  TYR D CG  1 
ATOM   10548 C CD1 . TYR D 1 301 ? 14.055  -3.052  7.243   1.00 9.28  ? 301  TYR D CD1 1 
ATOM   10549 C CD2 . TYR D 1 301 ? 14.319  -4.229  5.171   1.00 10.39 ? 301  TYR D CD2 1 
ATOM   10550 C CE1 . TYR D 1 301 ? 12.692  -3.312  7.216   1.00 10.56 ? 301  TYR D CE1 1 
ATOM   10551 C CE2 . TYR D 1 301 ? 12.949  -4.500  5.137   1.00 10.73 ? 301  TYR D CE2 1 
ATOM   10552 C CZ  . TYR D 1 301 ? 12.137  -4.044  6.168   1.00 10.97 ? 301  TYR D CZ  1 
ATOM   10553 O OH  . TYR D 1 301 ? 10.805  -4.341  6.111   1.00 11.00 ? 301  TYR D OH  1 
ATOM   10554 N N   . GLY D 1 302 ? 18.913  -3.163  8.161   1.00 11.46 ? 302  GLY D N   1 
ATOM   10555 C CA  . GLY D 1 302 ? 20.354  -3.437  8.378   1.00 12.39 ? 302  GLY D CA  1 
ATOM   10556 C C   . GLY D 1 302 ? 20.631  -4.855  7.900   1.00 13.42 ? 302  GLY D C   1 
ATOM   10557 O O   . GLY D 1 302 ? 20.927  -5.070  6.703   1.00 14.09 ? 302  GLY D O   1 
ATOM   10558 N N   . ARG D 1 303 ? 20.503  -5.801  8.814   1.00 13.58 ? 303  ARG D N   1 
ATOM   10559 C CA  . ARG D 1 303 ? 20.732  -7.214  8.522   1.00 14.51 ? 303  ARG D CA  1 
ATOM   10560 C C   . ARG D 1 303 ? 19.829  -7.748  7.412   1.00 14.53 ? 303  ARG D C   1 
ATOM   10561 O O   . ARG D 1 303 ? 20.273  -8.623  6.625   1.00 14.41 ? 303  ARG D O   1 
ATOM   10562 C CB  . ARG D 1 303 ? 20.607  -8.090  9.784   1.00 18.82 ? 303  ARG D CB  1 
ATOM   10563 C CG  . ARG D 1 303 ? 21.822  -8.027  10.703  1.00 22.35 ? 303  ARG D CG  1 
ATOM   10564 C CD  . ARG D 1 303 ? 21.856  -9.133  11.703  1.00 24.79 ? 303  ARG D CD  1 
ATOM   10565 N NE  . ARG D 1 303 ? 22.301  -10.383 11.126  1.00 27.85 ? 303  ARG D NE  1 
ATOM   10566 C CZ  . ARG D 1 303 ? 22.319  -11.569 11.720  1.00 29.19 ? 303  ARG D CZ  1 
ATOM   10567 N NH1 . ARG D 1 303 ? 21.923  -11.767 12.979  1.00 30.84 ? 303  ARG D NH1 1 
ATOM   10568 N NH2 . ARG D 1 303 ? 22.743  -12.625 11.020  1.00 31.07 ? 303  ARG D NH2 1 
ATOM   10569 N N   . ALA D 1 304 ? 18.604  -7.269  7.340   1.00 13.84 ? 304  ALA D N   1 
ATOM   10570 C CA  . ALA D 1 304 ? 17.614  -7.703  6.355   1.00 14.03 ? 304  ALA D CA  1 
ATOM   10571 C C   . ALA D 1 304 ? 17.996  -7.280  4.940   1.00 13.48 ? 304  ALA D C   1 
ATOM   10572 O O   . ALA D 1 304 ? 17.381  -7.736  3.953   1.00 14.34 ? 304  ALA D O   1 
ATOM   10573 C CB  . ALA D 1 304 ? 16.208  -7.210  6.730   1.00 14.31 ? 304  ALA D CB  1 
ATOM   10574 N N   . LEU D 1 305 ? 18.965  -6.388  4.828   1.00 13.49 ? 305  LEU D N   1 
ATOM   10575 C CA  . LEU D 1 305 ? 19.510  -5.940  3.551   1.00 13.27 ? 305  LEU D CA  1 
ATOM   10576 C C   . LEU D 1 305 ? 20.878  -6.578  3.292   1.00 13.41 ? 305  LEU D C   1 
ATOM   10577 O O   . LEU D 1 305 ? 21.288  -6.651  2.114   1.00 14.23 ? 305  LEU D O   1 
ATOM   10578 C CB  . LEU D 1 305 ? 19.520  -4.418  3.509   1.00 12.54 ? 305  LEU D CB  1 
ATOM   10579 C CG  . LEU D 1 305 ? 18.350  -3.654  2.930   1.00 12.00 ? 305  LEU D CG  1 
ATOM   10580 C CD1 . LEU D 1 305 ? 18.551  -2.138  3.023   1.00 12.62 ? 305  LEU D CD1 1 
ATOM   10581 C CD2 . LEU D 1 305 ? 18.222  -4.038  1.447   1.00 13.37 ? 305  LEU D CD2 1 
ATOM   10582 N N   . GLN D 1 306 ? 21.552  -7.057  4.315   1.00 13.05 ? 306  GLN D N   1 
ATOM   10583 C CA  . GLN D 1 306 ? 22.958  -7.480  4.190   1.00 13.78 ? 306  GLN D CA  1 
ATOM   10584 C C   . GLN D 1 306 ? 23.281  -8.939  4.401   1.00 13.60 ? 306  GLN D C   1 
ATOM   10585 O O   . GLN D 1 306 ? 24.409  -9.364  4.024   1.00 12.97 ? 306  GLN D O   1 
ATOM   10586 C CB  . GLN D 1 306 ? 23.854  -6.651  5.138   1.00 14.22 ? 306  GLN D CB  1 
ATOM   10587 C CG  . GLN D 1 306 ? 23.767  -5.162  4.977   1.00 14.70 ? 306  GLN D CG  1 
ATOM   10588 C CD  . GLN D 1 306 ? 24.551  -4.405  6.019   1.00 16.91 ? 306  GLN D CD  1 
ATOM   10589 O OE1 . GLN D 1 306 ? 25.760  -4.565  6.150   1.00 18.79 ? 306  GLN D OE1 1 
ATOM   10590 N NE2 . GLN D 1 306 ? 23.867  -3.546  6.776   1.00 17.39 ? 306  GLN D NE2 1 
ATOM   10591 N N   . ALA D 1 307 ? 22.409  -9.737  4.986   1.00 14.04 ? 307  ALA D N   1 
ATOM   10592 C CA  . ALA D 1 307 ? 22.739  -11.140 5.288   1.00 14.54 ? 307  ALA D CA  1 
ATOM   10593 C C   . ALA D 1 307 ? 23.287  -11.859 4.058   1.00 14.90 ? 307  ALA D C   1 
ATOM   10594 O O   . ALA D 1 307 ? 24.377  -12.472 4.098   1.00 15.21 ? 307  ALA D O   1 
ATOM   10595 C CB  . ALA D 1 307 ? 21.545  -11.857 5.880   1.00 16.07 ? 307  ALA D CB  1 
ATOM   10596 N N   . SER D 1 308 ? 22.534  -11.791 2.970   1.00 14.29 ? 308  SER D N   1 
ATOM   10597 C CA  . SER D 1 308 ? 22.902  -12.467 1.725   1.00 14.55 ? 308  SER D CA  1 
ATOM   10598 C C   . SER D 1 308 ? 24.149  -11.850 1.090   1.00 14.16 ? 308  SER D C   1 
ATOM   10599 O O   . SER D 1 308 ? 24.875  -12.590 0.397   1.00 14.40 ? 308  SER D O   1 
ATOM   10600 C CB  . SER D 1 308 ? 21.743  -12.505 0.740   1.00 14.81 ? 308  SER D CB  1 
ATOM   10601 O OG  . SER D 1 308 ? 20.781  -13.451 1.192   1.00 16.87 ? 308  SER D OG  1 
ATOM   10602 N N   . VAL D 1 309 ? 24.364  -10.576 1.325   1.00 14.20 ? 309  VAL D N   1 
ATOM   10603 C CA  . VAL D 1 309 ? 25.538  -9.866  0.773   1.00 14.78 ? 309  VAL D CA  1 
ATOM   10604 C C   . VAL D 1 309 ? 26.805  -10.505 1.348   1.00 15.53 ? 309  VAL D C   1 
ATOM   10605 O O   . VAL D 1 309 ? 27.721  -10.899 0.601   1.00 15.01 ? 309  VAL D O   1 
ATOM   10606 C CB  . VAL D 1 309 ? 25.485  -8.354  0.986   1.00 13.45 ? 309  VAL D CB  1 
ATOM   10607 C CG1 . VAL D 1 309 ? 26.759  -7.649  0.488   1.00 13.34 ? 309  VAL D CG1 1 
ATOM   10608 C CG2 . VAL D 1 309 ? 24.267  -7.690  0.358   1.00 13.89 ? 309  VAL D CG2 1 
ATOM   10609 N N   . LEU D 1 310 ? 26.812  -10.592 2.667   1.00 16.01 ? 310  LEU D N   1 
ATOM   10610 C CA  . LEU D 1 310 ? 27.957  -11.145 3.407   1.00 17.10 ? 310  LEU D CA  1 
ATOM   10611 C C   . LEU D 1 310 ? 28.267  -12.562 2.924   1.00 17.54 ? 310  LEU D C   1 
ATOM   10612 O O   . LEU D 1 310 ? 29.443  -12.909 2.673   1.00 17.06 ? 310  LEU D O   1 
ATOM   10613 C CB  . LEU D 1 310 ? 27.645  -11.041 4.907   1.00 16.31 ? 310  LEU D CB  1 
ATOM   10614 C CG  . LEU D 1 310 ? 27.790  -9.654  5.513   1.00 17.88 ? 310  LEU D CG  1 
ATOM   10615 C CD1 . LEU D 1 310 ? 26.993  -9.510  6.802   1.00 17.36 ? 310  LEU D CD1 1 
ATOM   10616 C CD2 . LEU D 1 310 ? 29.270  -9.383  5.789   1.00 17.42 ? 310  LEU D CD2 1 
ATOM   10617 N N   . ARG D 1 311 ? 27.211  -13.338 2.799   1.00 18.14 ? 311  ARG D N   1 
ATOM   10618 C CA  . ARG D 1 311 ? 27.308  -14.744 2.381   1.00 19.97 ? 311  ARG D CA  1 
ATOM   10619 C C   . ARG D 1 311 ? 27.861  -14.873 0.962   1.00 19.76 ? 311  ARG D C   1 
ATOM   10620 O O   . ARG D 1 311 ? 28.722  -15.746 0.717   1.00 19.77 ? 311  ARG D O   1 
ATOM   10621 C CB  . ARG D 1 311 ? 25.968  -15.460 2.523   1.00 23.63 ? 311  ARG D CB  1 
ATOM   10622 C CG  . ARG D 1 311 ? 26.052  -16.982 2.621   1.00 29.14 ? 311  ARG D CG  1 
ATOM   10623 C CD  . ARG D 1 311 ? 24.784  -17.520 3.229   1.00 32.77 ? 311  ARG D CD  1 
ATOM   10624 N NE  . ARG D 1 311 ? 24.593  -16.993 4.578   1.00 36.67 ? 311  ARG D NE  1 
ATOM   10625 C CZ  . ARG D 1 311 ? 24.621  -17.746 5.677   1.00 38.44 ? 311  ARG D CZ  1 
ATOM   10626 N NH1 . ARG D 1 311 ? 24.729  -19.072 5.564   1.00 40.28 ? 311  ARG D NH1 1 
ATOM   10627 N NH2 . ARG D 1 311 ? 24.499  -17.228 6.901   1.00 40.06 ? 311  ARG D NH2 1 
ATOM   10628 N N   . ALA D 1 312 ? 27.381  -14.034 0.059   1.00 19.24 ? 312  ALA D N   1 
ATOM   10629 C CA  . ALA D 1 312 ? 27.846  -14.071 -1.343  1.00 19.29 ? 312  ALA D CA  1 
ATOM   10630 C C   . ALA D 1 312 ? 29.295  -13.611 -1.450  1.00 19.32 ? 312  ALA D C   1 
ATOM   10631 O O   . ALA D 1 312 ? 30.093  -14.203 -2.210  1.00 19.61 ? 312  ALA D O   1 
ATOM   10632 C CB  . ALA D 1 312 ? 26.908  -13.295 -2.243  1.00 17.82 ? 312  ALA D CB  1 
ATOM   10633 N N   . TRP D 1 313 ? 29.648  -12.604 -0.685  1.00 19.54 ? 313  TRP D N   1 
ATOM   10634 C CA  . TRP D 1 313 ? 30.999  -12.012 -0.674  1.00 19.78 ? 313  TRP D CA  1 
ATOM   10635 C C   . TRP D 1 313 ? 32.027  -12.989 -0.119  1.00 19.98 ? 313  TRP D C   1 
ATOM   10636 O O   . TRP D 1 313 ? 33.081  -13.251 -0.740  1.00 19.32 ? 313  TRP D O   1 
ATOM   10637 C CB  . TRP D 1 313 ? 30.968  -10.689 0.079   1.00 19.60 ? 313  TRP D CB  1 
ATOM   10638 C CG  . TRP D 1 313 ? 32.270  -10.010 0.296   1.00 20.15 ? 313  TRP D CG  1 
ATOM   10639 C CD1 . TRP D 1 313 ? 33.198  -9.656  -0.648  1.00 20.39 ? 313  TRP D CD1 1 
ATOM   10640 C CD2 . TRP D 1 313 ? 32.819  -9.586  1.557   1.00 19.94 ? 313  TRP D CD2 1 
ATOM   10641 N NE1 . TRP D 1 313 ? 34.270  -9.034  -0.056  1.00 20.80 ? 313  TRP D NE1 1 
ATOM   10642 C CE2 . TRP D 1 313 ? 34.068  -8.982  1.289   1.00 19.90 ? 313  TRP D CE2 1 
ATOM   10643 C CE3 . TRP D 1 313 ? 32.367  -9.677  2.871   1.00 20.58 ? 313  TRP D CE3 1 
ATOM   10644 C CZ2 . TRP D 1 313 ? 34.867  -8.451  2.292   1.00 20.60 ? 313  TRP D CZ2 1 
ATOM   10645 C CZ3 . TRP D 1 313 ? 33.159  -9.156  3.875   1.00 20.48 ? 313  TRP D CZ3 1 
ATOM   10646 C CH2 . TRP D 1 313 ? 34.386  -8.550  3.595   1.00 21.07 ? 313  TRP D CH2 1 
ATOM   10647 N N   . ALA D 1 314 ? 31.718  -13.484 1.070   1.00 19.59 ? 314  ALA D N   1 
ATOM   10648 C CA  . ALA D 1 314 ? 32.534  -14.449 1.789   1.00 19.96 ? 314  ALA D CA  1 
ATOM   10649 C C   . ALA D 1 314 ? 33.972  -13.956 1.975   1.00 20.14 ? 314  ALA D C   1 
ATOM   10650 O O   . ALA D 1 314 ? 34.902  -14.770 2.046   1.00 20.56 ? 314  ALA D O   1 
ATOM   10651 C CB  . ALA D 1 314 ? 32.500  -15.812 1.108   1.00 19.63 ? 314  ALA D CB  1 
ATOM   10652 N N   . GLY D 1 315 ? 34.125  -12.654 2.075   1.00 19.93 ? 315  GLY D N   1 
ATOM   10653 C CA  . GLY D 1 315 ? 35.374  -11.979 2.335   1.00 20.06 ? 315  GLY D CA  1 
ATOM   10654 C C   . GLY D 1 315 ? 36.347  -11.930 1.184   1.00 20.32 ? 315  GLY D C   1 
ATOM   10655 O O   . GLY D 1 315 ? 37.500  -11.494 1.383   1.00 19.97 ? 315  GLY D O   1 
ATOM   10656 N N   . LYS D 1 316 ? 35.902  -12.307 -0.008  1.00 20.45 ? 316  LYS D N   1 
ATOM   10657 C CA  . LYS D 1 316 ? 36.777  -12.420 -1.179  1.00 20.23 ? 316  LYS D CA  1 
ATOM   10658 C C   . LYS D 1 316 ? 36.541  -11.354 -2.239  1.00 19.98 ? 316  LYS D C   1 
ATOM   10659 O O   . LYS D 1 316 ? 35.416  -11.112 -2.706  1.00 18.77 ? 316  LYS D O   1 
ATOM   10660 C CB  . LYS D 1 316 ? 36.609  -13.798 -1.838  1.00 22.20 ? 316  LYS D CB  1 
ATOM   10661 C CG  . LYS D 1 316 ? 36.972  -14.944 -0.902  1.00 24.61 ? 316  LYS D CG  1 
ATOM   10662 C CD  . LYS D 1 316 ? 36.465  -16.277 -1.414  1.00 26.78 ? 316  LYS D CD  1 
ATOM   10663 C CE  . LYS D 1 316 ? 37.250  -17.427 -0.800  1.00 29.32 ? 316  LYS D CE  1 
ATOM   10664 N NZ  . LYS D 1 316 ? 36.624  -18.728 -1.164  1.00 31.66 ? 316  LYS D NZ  1 
ATOM   10665 N N   . LYS D 1 317 ? 37.657  -10.741 -2.631  1.00 19.36 ? 317  LYS D N   1 
ATOM   10666 C CA  . LYS D 1 317 ? 37.652  -9.694  -3.661  1.00 19.73 ? 317  LYS D CA  1 
ATOM   10667 C C   . LYS D 1 317 ? 37.060  -10.204 -4.971  1.00 19.23 ? 317  LYS D C   1 
ATOM   10668 O O   . LYS D 1 317 ? 36.520  -9.404  -5.762  1.00 18.80 ? 317  LYS D O   1 
ATOM   10669 C CB  . LYS D 1 317 ? 39.054  -9.137  -3.894  1.00 20.35 ? 317  LYS D CB  1 
ATOM   10670 C CG  . LYS D 1 317 ? 39.277  -7.697  -3.453  1.00 22.00 ? 317  LYS D CG  1 
ATOM   10671 C CD  . LYS D 1 317 ? 39.500  -7.525  -1.985  1.00 23.29 ? 317  LYS D CD  1 
ATOM   10672 C CE  . LYS D 1 317 ? 39.956  -6.164  -1.557  1.00 22.61 ? 317  LYS D CE  1 
ATOM   10673 N NZ  . LYS D 1 317 ? 38.943  -5.110  -1.633  1.00 22.27 ? 317  LYS D NZ  1 
ATOM   10674 N N   . GLU D 1 318 ? 37.118  -11.503 -5.190  1.00 19.71 ? 318  GLU D N   1 
ATOM   10675 C CA  . GLU D 1 318 ? 36.616  -12.119 -6.419  1.00 20.64 ? 318  GLU D CA  1 
ATOM   10676 C C   . GLU D 1 318 ? 35.083  -12.152 -6.439  1.00 20.48 ? 318  GLU D C   1 
ATOM   10677 O O   . GLU D 1 318 ? 34.500  -12.274 -7.531  1.00 20.39 ? 318  GLU D O   1 
ATOM   10678 C CB  . GLU D 1 318 ? 37.076  -13.545 -6.664  1.00 23.43 ? 318  GLU D CB  1 
ATOM   10679 C CG  . GLU D 1 318 ? 38.560  -13.869 -6.512  1.00 28.05 ? 318  GLU D CG  1 
ATOM   10680 C CD  . GLU D 1 318 ? 39.026  -13.942 -5.078  1.00 29.81 ? 318  GLU D CD  1 
ATOM   10681 O OE1 . GLU D 1 318 ? 38.561  -14.725 -4.268  1.00 31.81 ? 318  GLU D OE1 1 
ATOM   10682 O OE2 . GLU D 1 318 ? 39.930  -13.121 -4.827  1.00 31.64 ? 318  GLU D OE2 1 
ATOM   10683 N N   . ASN D 1 319 ? 34.505  -12.029 -5.256  1.00 19.33 ? 319  ASN D N   1 
ATOM   10684 C CA  . ASN D 1 319 ? 33.054  -12.104 -5.065  1.00 18.57 ? 319  ASN D CA  1 
ATOM   10685 C C   . ASN D 1 319 ? 32.393  -10.741 -4.921  1.00 17.21 ? 319  ASN D C   1 
ATOM   10686 O O   . ASN D 1 319 ? 31.211  -10.694 -4.500  1.00 17.12 ? 319  ASN D O   1 
ATOM   10687 C CB  . ASN D 1 319 ? 32.726  -13.024 -3.874  1.00 18.88 ? 319  ASN D CB  1 
ATOM   10688 C CG  . ASN D 1 319 ? 33.240  -14.434 -4.059  1.00 21.00 ? 319  ASN D CG  1 
ATOM   10689 O OD1 . ASN D 1 319 ? 33.618  -14.812 -5.190  1.00 20.82 ? 319  ASN D OD1 1 
ATOM   10690 N ND2 . ASN D 1 319 ? 33.277  -15.211 -2.983  1.00 18.86 ? 319  ASN D ND2 1 
ATOM   10691 N N   . ILE D 1 320 ? 33.097  -9.680  -5.250  1.00 16.32 ? 320  ILE D N   1 
ATOM   10692 C CA  . ILE D 1 320 ? 32.554  -8.319  -5.171  1.00 15.82 ? 320  ILE D CA  1 
ATOM   10693 C C   . ILE D 1 320 ? 31.281  -8.185  -6.018  1.00 16.00 ? 320  ILE D C   1 
ATOM   10694 O O   . ILE D 1 320 ? 30.305  -7.565  -5.546  1.00 15.67 ? 320  ILE D O   1 
ATOM   10695 C CB  . ILE D 1 320 ? 33.629  -7.250  -5.532  1.00 14.05 ? 320  ILE D CB  1 
ATOM   10696 C CG1 . ILE D 1 320 ? 34.720  -7.190  -4.414  1.00 15.57 ? 320  ILE D CG1 1 
ATOM   10697 C CG2 . ILE D 1 320 ? 33.054  -5.835  -5.802  1.00 14.66 ? 320  ILE D CG2 1 
ATOM   10698 C CD1 . ILE D 1 320 ? 35.831  -6.151  -4.730  1.00 14.36 ? 320  ILE D CD1 1 
ATOM   10699 N N   . ALA D 1 321 ? 31.322  -8.696  -7.236  1.00 14.81 ? 321  ALA D N   1 
ATOM   10700 C CA  . ALA D 1 321 ? 30.159  -8.597  -8.149  1.00 14.37 ? 321  ALA D CA  1 
ATOM   10701 C C   . ALA D 1 321 ? 28.958  -9.321  -7.543  1.00 13.47 ? 321  ALA D C   1 
ATOM   10702 O O   . ALA D 1 321 ? 27.853  -8.748  -7.500  1.00 14.03 ? 321  ALA D O   1 
ATOM   10703 C CB  . ALA D 1 321 ? 30.475  -9.147  -9.531  1.00 13.04 ? 321  ALA D CB  1 
ATOM   10704 N N   . ALA D 1 322 ? 29.201  -10.512 -7.052  1.00 13.34 ? 322  ALA D N   1 
ATOM   10705 C CA  . ALA D 1 322 ? 28.166  -11.362 -6.458  1.00 13.34 ? 322  ALA D CA  1 
ATOM   10706 C C   . ALA D 1 322 ? 27.547  -10.668 -5.236  1.00 13.52 ? 322  ALA D C   1 
ATOM   10707 O O   . ALA D 1 322 ? 26.309  -10.626 -5.111  1.00 12.67 ? 322  ALA D O   1 
ATOM   10708 C CB  . ALA D 1 322 ? 28.714  -12.734 -6.130  1.00 12.93 ? 322  ALA D CB  1 
ATOM   10709 N N   . GLY D 1 323 ? 28.406  -10.135 -4.394  1.00 13.50 ? 323  GLY D N   1 
ATOM   10710 C CA  . GLY D 1 323 ? 28.017  -9.375  -3.203  1.00 13.71 ? 323  GLY D CA  1 
ATOM   10711 C C   . GLY D 1 323 ? 27.152  -8.170  -3.536  1.00 14.03 ? 323  GLY D C   1 
ATOM   10712 O O   . GLY D 1 323 ? 26.038  -8.024  -2.982  1.00 14.25 ? 323  GLY D O   1 
ATOM   10713 N N   . GLN D 1 324 ? 27.625  -7.309  -4.418  1.00 13.88 ? 324  GLN D N   1 
ATOM   10714 C CA  . GLN D 1 324 ? 26.895  -6.098  -4.815  1.00 14.44 ? 324  GLN D CA  1 
ATOM   10715 C C   . GLN D 1 324 ? 25.555  -6.445  -5.467  1.00 15.14 ? 324  GLN D C   1 
ATOM   10716 O O   . GLN D 1 324 ? 24.583  -5.683  -5.296  1.00 14.89 ? 324  GLN D O   1 
ATOM   10717 C CB  . GLN D 1 324 ? 27.711  -5.125  -5.644  1.00 14.09 ? 324  GLN D CB  1 
ATOM   10718 C CG  . GLN D 1 324 ? 28.988  -4.663  -4.931  1.00 13.93 ? 324  GLN D CG  1 
ATOM   10719 C CD  . GLN D 1 324 ? 29.777  -3.677  -5.736  1.00 13.89 ? 324  GLN D CD  1 
ATOM   10720 O OE1 . GLN D 1 324 ? 29.659  -3.628  -6.967  1.00 16.12 ? 324  GLN D OE1 1 
ATOM   10721 N NE2 . GLN D 1 324 ? 30.590  -2.855  -5.078  1.00 12.61 ? 324  GLN D NE2 1 
ATOM   10722 N N   . ASN D 1 325 ? 25.513  -7.556  -6.171  1.00 15.76 ? 325  ASN D N   1 
ATOM   10723 C CA  . ASN D 1 325 ? 24.309  -8.036  -6.855  1.00 16.79 ? 325  ASN D CA  1 
ATOM   10724 C C   . ASN D 1 325 ? 23.211  -8.413  -5.873  1.00 16.32 ? 325  ASN D C   1 
ATOM   10725 O O   . ASN D 1 325 ? 22.031  -8.112  -6.131  1.00 16.10 ? 325  ASN D O   1 
ATOM   10726 C CB  . ASN D 1 325 ? 24.673  -9.154  -7.842  1.00 21.74 ? 325  ASN D CB  1 
ATOM   10727 C CG  . ASN D 1 325 ? 24.870  -8.552  -9.234  1.00 25.38 ? 325  ASN D CG  1 
ATOM   10728 O OD1 . ASN D 1 325 ? 23.864  -8.151  -9.854  1.00 30.38 ? 325  ASN D OD1 1 
ATOM   10729 N ND2 . ASN D 1 325 ? 26.097  -8.486  -9.704  1.00 27.47 ? 325  ASN D ND2 1 
ATOM   10730 N N   . GLU D 1 326 ? 23.606  -9.071  -4.794  1.00 15.40 ? 326  GLU D N   1 
ATOM   10731 C CA  . GLU D 1 326 ? 22.687  -9.376  -3.697  1.00 15.09 ? 326  GLU D CA  1 
ATOM   10732 C C   . GLU D 1 326 ? 22.114  -8.112  -3.075  1.00 14.27 ? 326  GLU D C   1 
ATOM   10733 O O   . GLU D 1 326 ? 20.905  -8.095  -2.742  1.00 14.05 ? 326  GLU D O   1 
ATOM   10734 C CB  . GLU D 1 326 ? 23.312  -10.255 -2.624  1.00 16.14 ? 326  GLU D CB  1 
ATOM   10735 C CG  . GLU D 1 326 ? 23.625  -11.706 -2.993  1.00 18.66 ? 326  GLU D CG  1 
ATOM   10736 C CD  . GLU D 1 326 ? 22.447  -12.512 -3.450  1.00 19.86 ? 326  GLU D CD  1 
ATOM   10737 O OE1 . GLU D 1 326 ? 21.333  -12.460 -2.953  1.00 19.31 ? 326  GLU D OE1 1 
ATOM   10738 O OE2 . GLU D 1 326 ? 22.732  -13.260 -4.412  1.00 21.98 ? 326  GLU D OE2 1 
ATOM   10739 N N   . LEU D 1 327 ? 22.916  -7.064  -2.927  1.00 13.58 ? 327  LEU D N   1 
ATOM   10740 C CA  . LEU D 1 327 ? 22.430  -5.795  -2.380  1.00 13.12 ? 327  LEU D CA  1 
ATOM   10741 C C   . LEU D 1 327 ? 21.391  -5.157  -3.321  1.00 12.82 ? 327  LEU D C   1 
ATOM   10742 O O   . LEU D 1 327 ? 20.326  -4.697  -2.861  1.00 11.63 ? 327  LEU D O   1 
ATOM   10743 C CB  . LEU D 1 327 ? 23.579  -4.835  -2.052  1.00 13.41 ? 327  LEU D CB  1 
ATOM   10744 C CG  . LEU D 1 327 ? 23.173  -3.486  -1.452  1.00 12.89 ? 327  LEU D CG  1 
ATOM   10745 C CD1 . LEU D 1 327 ? 22.531  -3.680  -0.081  1.00 13.01 ? 327  LEU D CD1 1 
ATOM   10746 C CD2 . LEU D 1 327 ? 24.388  -2.584  -1.325  1.00 13.09 ? 327  LEU D CD2 1 
ATOM   10747 N N   . LEU D 1 328 ? 21.756  -5.131  -4.598  1.00 12.20 ? 328  LEU D N   1 
ATOM   10748 C CA  . LEU D 1 328 ? 20.854  -4.537  -5.605  1.00 12.87 ? 328  LEU D CA  1 
ATOM   10749 C C   . LEU D 1 328 ? 19.520  -5.263  -5.603  1.00 12.29 ? 328  LEU D C   1 
ATOM   10750 O O   . LEU D 1 328 ? 18.475  -4.578  -5.625  1.00 13.22 ? 328  LEU D O   1 
ATOM   10751 C CB  . LEU D 1 328 ? 21.552  -4.453  -6.960  1.00 13.97 ? 328  LEU D CB  1 
ATOM   10752 C CG  . LEU D 1 328 ? 22.738  -3.519  -7.109  1.00 13.97 ? 328  LEU D CG  1 
ATOM   10753 C CD1 . LEU D 1 328 ? 23.475  -3.773  -8.420  1.00 16.34 ? 328  LEU D CD1 1 
ATOM   10754 C CD2 . LEU D 1 328 ? 22.277  -2.072  -7.063  1.00 14.33 ? 328  LEU D CD2 1 
ATOM   10755 N N   . LYS D 1 329 ? 19.558  -6.578  -5.565  1.00 12.58 ? 329  LYS D N   1 
ATOM   10756 C CA  . LYS D 1 329 ? 18.377  -7.431  -5.611  1.00 13.58 ? 329  LYS D CA  1 
ATOM   10757 C C   . LYS D 1 329 ? 17.420  -7.137  -4.447  1.00 13.41 ? 329  LYS D C   1 
ATOM   10758 O O   . LYS D 1 329 ? 16.201  -7.038  -4.649  1.00 12.37 ? 329  LYS D O   1 
ATOM   10759 C CB  . LYS D 1 329 ? 18.694  -8.925  -5.572  1.00 16.35 ? 329  LYS D CB  1 
ATOM   10760 C CG  . LYS D 1 329 ? 19.100  -9.541  -6.907  1.00 21.25 ? 329  LYS D CG  1 
ATOM   10761 C CD  . LYS D 1 329 ? 19.666  -10.946 -6.736  1.00 24.60 ? 329  LYS D CD  1 
ATOM   10762 C CE  . LYS D 1 329 ? 18.812  -11.793 -5.800  1.00 27.11 ? 329  LYS D CE  1 
ATOM   10763 N NZ  . LYS D 1 329 ? 19.346  -13.185 -5.750  1.00 29.28 ? 329  LYS D NZ  1 
ATOM   10764 N N   . ARG D 1 330 ? 17.996  -7.043  -3.259  1.00 13.07 ? 330  ARG D N   1 
ATOM   10765 C CA  . ARG D 1 330 ? 17.194  -6.828  -2.046  1.00 13.77 ? 330  ARG D CA  1 
ATOM   10766 C C   . ARG D 1 330 ? 16.711  -5.418  -1.871  1.00 13.15 ? 330  ARG D C   1 
ATOM   10767 O O   . ARG D 1 330 ? 15.604  -5.236  -1.304  1.00 13.44 ? 330  ARG D O   1 
ATOM   10768 C CB  . ARG D 1 330 ? 17.916  -7.368  -0.795  1.00 16.89 ? 330  ARG D CB  1 
ATOM   10769 C CG  . ARG D 1 330 ? 17.951  -8.887  -0.814  1.00 20.79 ? 330  ARG D CG  1 
ATOM   10770 C CD  . ARG D 1 330 ? 16.885  -9.560  -0.093  1.00 24.67 ? 330  ARG D CD  1 
ATOM   10771 N NE  . ARG D 1 330 ? 15.484  -9.284  -0.310  1.00 24.57 ? 330  ARG D NE  1 
ATOM   10772 C CZ  . ARG D 1 330 ? 14.595  -10.300 -0.215  1.00 25.72 ? 330  ARG D CZ  1 
ATOM   10773 N NH1 . ARG D 1 330 ? 15.034  -11.560 -0.333  1.00 26.06 ? 330  ARG D NH1 1 
ATOM   10774 N NH2 . ARG D 1 330 ? 13.286  -10.097 -0.126  1.00 24.14 ? 330  ARG D NH2 1 
ATOM   10775 N N   . ALA D 1 331 ? 17.475  -4.447  -2.318  1.00 12.14 ? 331  ALA D N   1 
ATOM   10776 C CA  . ALA D 1 331 ? 17.082  -3.039  -2.299  1.00 12.00 ? 331  ALA D CA  1 
ATOM   10777 C C   . ALA D 1 331 ? 15.859  -2.819  -3.203  1.00 11.99 ? 331  ALA D C   1 
ATOM   10778 O O   . ALA D 1 331 ? 14.920  -2.101  -2.838  1.00 12.43 ? 331  ALA D O   1 
ATOM   10779 C CB  . ALA D 1 331 ? 18.242  -2.141  -2.716  1.00 9.76  ? 331  ALA D CB  1 
ATOM   10780 N N   . LYS D 1 332 ? 15.911  -3.434  -4.372  1.00 11.65 ? 332  LYS D N   1 
ATOM   10781 C CA  . LYS D 1 332 ? 14.812  -3.401  -5.335  1.00 10.89 ? 332  LYS D CA  1 
ATOM   10782 C C   . LYS D 1 332 ? 13.545  -4.019  -4.750  1.00 10.29 ? 332  LYS D C   1 
ATOM   10783 O O   . LYS D 1 332 ? 12.454  -3.434  -4.826  1.00 9.63  ? 332  LYS D O   1 
ATOM   10784 C CB  . LYS D 1 332 ? 15.175  -4.137  -6.631  1.00 13.12 ? 332  LYS D CB  1 
ATOM   10785 C CG  . LYS D 1 332 ? 14.019  -3.993  -7.671  1.00 16.18 ? 332  LYS D CG  1 
ATOM   10786 C CD  . LYS D 1 332 ? 13.788  -2.509  -7.921  1.00 19.34 ? 332  LYS D CD  1 
ATOM   10787 C CE  . LYS D 1 332 ? 12.352  -2.137  -8.187  1.00 22.52 ? 332  LYS D CE  1 
ATOM   10788 N NZ  . LYS D 1 332 ? 11.847  -1.179  -7.138  1.00 22.86 ? 332  LYS D NZ  1 
ATOM   10789 N N   . ALA D 1 333 ? 13.711  -5.197  -4.182  1.00 10.22 ? 333  ALA D N   1 
ATOM   10790 C CA  . ALA D 1 333 ? 12.619  -5.967  -3.578  1.00 10.84 ? 333  ALA D CA  1 
ATOM   10791 C C   . ALA D 1 333 ? 11.949  -5.164  -2.457  1.00 11.52 ? 333  ALA D C   1 
ATOM   10792 O O   . ALA D 1 333 ? 10.725  -5.302  -2.285  1.00 12.30 ? 333  ALA D O   1 
ATOM   10793 C CB  . ALA D 1 333 ? 13.149  -7.288  -3.055  1.00 9.60  ? 333  ALA D CB  1 
ATOM   10794 N N   . ASN D 1 334 ? 12.748  -4.394  -1.733  1.00 10.55 ? 334  ASN D N   1 
ATOM   10795 C CA  . ASN D 1 334 ? 12.239  -3.559  -0.629  1.00 10.43 ? 334  ASN D CA  1 
ATOM   10796 C C   . ASN D 1 334 ? 11.623  -2.269  -1.131  1.00 9.93  ? 334  ASN D C   1 
ATOM   10797 O O   . ASN D 1 334 ? 10.699  -1.768  -0.462  1.00 11.54 ? 334  ASN D O   1 
ATOM   10798 C CB  . ASN D 1 334 ? 13.295  -3.378  0.474   1.00 10.94 ? 334  ASN D CB  1 
ATOM   10799 C CG  . ASN D 1 334 ? 13.376  -4.602  1.371   1.00 11.89 ? 334  ASN D CG  1 
ATOM   10800 O OD1 . ASN D 1 334 ? 12.343  -5.057  1.894   1.00 12.70 ? 334  ASN D OD1 1 
ATOM   10801 N ND2 . ASN D 1 334 ? 14.560  -5.189  1.559   1.00 10.29 ? 334  ASN D ND2 1 
ATOM   10802 N N   . GLY D 1 335 ? 12.085  -1.745  -2.239  1.00 9.22  ? 335  GLY D N   1 
ATOM   10803 C CA  . GLY D 1 335 ? 11.545  -0.532  -2.881  1.00 9.42  ? 335  GLY D CA  1 
ATOM   10804 C C   . GLY D 1 335 ? 10.149  -0.870  -3.444  1.00 9.03  ? 335  GLY D C   1 
ATOM   10805 O O   . GLY D 1 335 ? 9.267   -0.014  -3.348  1.00 8.60  ? 335  GLY D O   1 
ATOM   10806 N N   . ASP D 1 336 ? 10.027  -2.078  -3.963  1.00 8.66  ? 336  ASP D N   1 
ATOM   10807 C CA  . ASP D 1 336 ? 8.770   -2.611  -4.484  1.00 9.45  ? 336  ASP D CA  1 
ATOM   10808 C C   . ASP D 1 336 ? 7.769   -2.802  -3.311  1.00 9.69  ? 336  ASP D C   1 
ATOM   10809 O O   . ASP D 1 336 ? 6.598   -2.421  -3.460  1.00 9.65  ? 336  ASP D O   1 
ATOM   10810 C CB  . ASP D 1 336 ? 8.916   -3.901  -5.269  1.00 10.74 ? 336  ASP D CB  1 
ATOM   10811 C CG  . ASP D 1 336 ? 9.501   -3.740  -6.668  1.00 10.75 ? 336  ASP D CG  1 
ATOM   10812 O OD1 . ASP D 1 336 ? 9.545   -2.650  -7.223  1.00 12.66 ? 336  ASP D OD1 1 
ATOM   10813 O OD2 . ASP D 1 336 ? 9.928   -4.793  -7.164  1.00 13.48 ? 336  ASP D OD2 1 
ATOM   10814 N N   . ALA D 1 337 ? 8.272   -3.391  -2.236  1.00 9.35  ? 337  ALA D N   1 
ATOM   10815 C CA  . ALA D 1 337 ? 7.485   -3.595  -1.014  1.00 9.30  ? 337  ALA D CA  1 
ATOM   10816 C C   . ALA D 1 337 ? 6.947   -2.292  -0.435  1.00 9.53  ? 337  ALA D C   1 
ATOM   10817 O O   . ALA D 1 337 ? 5.787   -2.263  0.039   1.00 9.27  ? 337  ALA D O   1 
ATOM   10818 C CB  . ALA D 1 337 ? 8.321   -4.339  0.037   1.00 8.20  ? 337  ALA D CB  1 
ATOM   10819 N N   . ALA D 1 338 ? 7.763   -1.251  -0.479  1.00 9.29  ? 338  ALA D N   1 
ATOM   10820 C CA  . ALA D 1 338 ? 7.431   0.067   0.050   1.00 10.50 ? 338  ALA D CA  1 
ATOM   10821 C C   . ALA D 1 338 ? 6.335   0.712   -0.810  1.00 11.10 ? 338  ALA D C   1 
ATOM   10822 O O   . ALA D 1 338 ? 5.802   1.781   -0.458  1.00 10.40 ? 338  ALA D O   1 
ATOM   10823 C CB  . ALA D 1 338 ? 8.656   0.957   0.158   1.00 10.29 ? 338  ALA D CB  1 
ATOM   10824 N N   . GLN D 1 339 ? 6.039   0.028   -1.901  1.00 11.77 ? 339  GLN D N   1 
ATOM   10825 C CA  . GLN D 1 339 ? 4.986   0.481   -2.835  1.00 12.80 ? 339  GLN D CA  1 
ATOM   10826 C C   . GLN D 1 339 ? 3.825   -0.500  -2.865  1.00 12.60 ? 339  GLN D C   1 
ATOM   10827 O O   . GLN D 1 339 ? 2.855   -0.289  -3.615  1.00 12.26 ? 339  GLN D O   1 
ATOM   10828 C CB  . GLN D 1 339 ? 5.552   0.689   -4.254  1.00 15.19 ? 339  GLN D CB  1 
ATOM   10829 C CG  . GLN D 1 339 ? 6.427   1.929   -4.315  1.00 17.71 ? 339  GLN D CG  1 
ATOM   10830 C CD  . GLN D 1 339 ? 7.151   2.094   -5.631  1.00 20.14 ? 339  GLN D CD  1 
ATOM   10831 O OE1 . GLN D 1 339 ? 6.885   3.059   -6.340  1.00 22.65 ? 339  GLN D OE1 1 
ATOM   10832 N NE2 . GLN D 1 339 ? 8.060   1.174   -5.947  1.00 19.59 ? 339  GLN D NE2 1 
ATOM   10833 N N   . GLY D 1 340 ? 3.956   -1.557  -2.088  1.00 12.84 ? 340  GLY D N   1 
ATOM   10834 C CA  . GLY D 1 340 ? 2.914   -2.595  -1.985  1.00 13.81 ? 340  GLY D CA  1 
ATOM   10835 C C   . GLY D 1 340 ? 2.898   -3.473  -3.233  1.00 15.18 ? 340  GLY D C   1 
ATOM   10836 O O   . GLY D 1 340 ? 1.881   -4.142  -3.512  1.00 14.82 ? 340  GLY D O   1 
ATOM   10837 N N   . LYS D 1 341 ? 4.004   -3.473  -3.963  1.00 16.09 ? 341  LYS D N   1 
ATOM   10838 C CA  . LYS D 1 341 ? 4.123   -4.216  -5.221  1.00 17.09 ? 341  LYS D CA  1 
ATOM   10839 C C   . LYS D 1 341 ? 5.039   -5.407  -5.202  1.00 17.28 ? 341  LYS D C   1 
ATOM   10840 O O   . LYS D 1 341 ? 5.361   -5.885  -6.326  1.00 17.58 ? 341  LYS D O   1 
ATOM   10841 C CB  . LYS D 1 341 ? 4.651   -3.282  -6.335  1.00 19.23 ? 341  LYS D CB  1 
ATOM   10842 C CG  . LYS D 1 341 ? 3.709   -2.138  -6.657  1.00 22.63 ? 341  LYS D CG  1 
ATOM   10843 C CD  . LYS D 1 341 ? 4.137   -1.327  -7.861  1.00 26.36 ? 341  LYS D CD  1 
ATOM   10844 C CE  . LYS D 1 341 ? 5.611   -0.962  -7.839  1.00 27.83 ? 341  LYS D CE  1 
ATOM   10845 N NZ  . LYS D 1 341 ? 5.893   0.063   -8.878  1.00 29.96 ? 341  LYS D NZ  1 
ATOM   10846 N N   . TYR D 1 342 ? 5.480   -5.918  -4.063  1.00 16.95 ? 342  TYR D N   1 
ATOM   10847 C CA  . TYR D 1 342 ? 6.413   -7.052  -4.065  1.00 17.48 ? 342  TYR D CA  1 
ATOM   10848 C C   . TYR D 1 342 ? 5.684   -8.378  -4.276  1.00 18.28 ? 342  TYR D C   1 
ATOM   10849 O O   . TYR D 1 342 ? 4.644   -8.633  -3.657  1.00 18.64 ? 342  TYR D O   1 
ATOM   10850 C CB  . TYR D 1 342 ? 7.294   -7.131  -2.815  1.00 14.95 ? 342  TYR D CB  1 
ATOM   10851 C CG  . TYR D 1 342 ? 8.237   -8.314  -2.782  1.00 14.24 ? 342  TYR D CG  1 
ATOM   10852 C CD1 . TYR D 1 342 ? 9.380   -8.343  -3.605  1.00 14.45 ? 342  TYR D CD1 1 
ATOM   10853 C CD2 . TYR D 1 342 ? 8.001   -9.397  -1.950  1.00 13.53 ? 342  TYR D CD2 1 
ATOM   10854 C CE1 . TYR D 1 342 ? 10.250  -9.435  -3.578  1.00 13.09 ? 342  TYR D CE1 1 
ATOM   10855 C CE2 . TYR D 1 342 ? 8.862   -10.489 -1.904  1.00 14.05 ? 342  TYR D CE2 1 
ATOM   10856 C CZ  . TYR D 1 342 ? 9.987   -10.503 -2.729  1.00 13.18 ? 342  TYR D CZ  1 
ATOM   10857 O OH  . TYR D 1 342 ? 10.802  -11.588 -2.650  1.00 15.13 ? 342  TYR D OH  1 
ATOM   10858 N N   . VAL D 1 343 ? 6.281   -9.189  -5.135  1.00 19.49 ? 343  VAL D N   1 
ATOM   10859 C CA  . VAL D 1 343 ? 5.801   -10.545 -5.421  1.00 21.71 ? 343  VAL D CA  1 
ATOM   10860 C C   . VAL D 1 343 ? 6.631   -11.562 -4.631  1.00 22.69 ? 343  VAL D C   1 
ATOM   10861 O O   . VAL D 1 343 ? 7.807   -11.769 -4.958  1.00 22.75 ? 343  VAL D O   1 
ATOM   10862 C CB  . VAL D 1 343 ? 5.822   -10.864 -6.931  1.00 21.43 ? 343  VAL D CB  1 
ATOM   10863 C CG1 . VAL D 1 343 ? 5.296   -12.288 -7.175  1.00 23.29 ? 343  VAL D CG1 1 
ATOM   10864 C CG2 . VAL D 1 343 ? 5.065   -9.854  -7.763  1.00 23.14 ? 343  VAL D CG2 1 
ATOM   10865 N N   . ALA D 1 344 ? 5.999   -12.173 -3.654  1.00 24.19 ? 345  ALA D N   1 
ATOM   10866 C CA  . ALA D 1 344 ? 6.631   -13.111 -2.733  1.00 25.62 ? 345  ALA D CA  1 
ATOM   10867 C C   . ALA D 1 344 ? 7.500   -14.130 -3.463  1.00 27.19 ? 345  ALA D C   1 
ATOM   10868 O O   . ALA D 1 344 ? 7.059   -14.784 -4.421  1.00 27.22 ? 345  ALA D O   1 
ATOM   10869 C CB  . ALA D 1 344 ? 5.583   -13.807 -1.873  1.00 25.80 ? 345  ALA D CB  1 
ATOM   10870 N N   . GLY D 1 345 ? 8.725   -14.251 -2.973  1.00 28.30 ? 346  GLY D N   1 
ATOM   10871 C CA  . GLY D 1 345 ? 9.711   -15.189 -3.486  1.00 30.34 ? 346  GLY D CA  1 
ATOM   10872 C C   . GLY D 1 345 ? 10.454  -14.708 -4.717  1.00 31.40 ? 346  GLY D C   1 
ATOM   10873 O O   . GLY D 1 345 ? 11.458  -15.347 -5.111  1.00 31.97 ? 346  GLY D O   1 
ATOM   10874 N N   . SER D 1 346 ? 10.029  -13.611 -5.309  1.00 32.32 ? 347  SER D N   1 
ATOM   10875 C CA  . SER D 1 346 ? 10.651  -13.100 -6.539  1.00 33.69 ? 347  SER D CA  1 
ATOM   10876 C C   . SER D 1 346 ? 12.104  -12.699 -6.348  1.00 34.83 ? 347  SER D C   1 
ATOM   10877 O O   . SER D 1 346 ? 12.871  -12.682 -7.340  1.00 34.79 ? 347  SER D O   1 
ATOM   10878 C CB  . SER D 1 346 ? 9.829   -11.991 -7.177  1.00 33.75 ? 347  SER D CB  1 
ATOM   10879 O OG  . SER D 1 346 ? 9.852   -10.793 -6.438  1.00 34.37 ? 347  SER D OG  1 
ATOM   10880 N N   . ALA D 1 347 ? 12.491  -12.376 -5.125  1.00 35.67 ? 348  ALA D N   1 
ATOM   10881 C CA  . ALA D 1 347 ? 13.876  -11.963 -4.842  1.00 36.83 ? 348  ALA D CA  1 
ATOM   10882 C C   . ALA D 1 347 ? 14.678  -13.112 -4.243  1.00 37.58 ? 348  ALA D C   1 
ATOM   10883 O O   . ALA D 1 347 ? 15.814  -12.920 -3.769  1.00 37.62 ? 348  ALA D O   1 
ATOM   10884 C CB  . ALA D 1 347 ? 13.909  -10.715 -3.980  1.00 36.57 ? 348  ALA D CB  1 
ATOM   10885 N N   . GLY D 1 348 ? 14.085  -14.293 -4.282  1.00 38.48 ? 349  GLY D N   1 
ATOM   10886 C CA  . GLY D 1 348 ? 14.722  -15.515 -3.782  1.00 39.40 ? 349  GLY D CA  1 
ATOM   10887 C C   . GLY D 1 348 ? 14.347  -15.779 -2.325  1.00 40.40 ? 349  GLY D C   1 
ATOM   10888 O O   . GLY D 1 348 ? 13.621  -15.005 -1.684  1.00 40.22 ? 349  GLY D O   1 
ATOM   10889 N N   . ALA D 1 349 ? 14.876  -16.888 -1.845  1.00 41.39 ? 351  ALA D N   1 
ATOM   10890 C CA  . ALA D 1 349 ? 14.628  -17.427 -0.509  1.00 42.50 ? 351  ALA D CA  1 
ATOM   10891 C C   . ALA D 1 349 ? 15.170  -16.502 0.573   1.00 43.23 ? 351  ALA D C   1 
ATOM   10892 O O   . ALA D 1 349 ? 14.479  -16.211 1.559   1.00 43.30 ? 351  ALA D O   1 
ATOM   10893 C CB  . ALA D 1 349 ? 15.218  -18.829 -0.398  1.00 42.74 ? 351  ALA D CB  1 
ATOM   10894 N N   . GLY D 1 350 ? 16.406  -16.076 0.368   1.00 43.82 ? 352  GLY D N   1 
ATOM   10895 C CA  . GLY D 1 350 ? 17.075  -15.128 1.269   1.00 44.66 ? 352  GLY D CA  1 
ATOM   10896 C C   . GLY D 1 350 ? 17.625  -15.852 2.493   1.00 45.22 ? 352  GLY D C   1 
ATOM   10897 O O   . GLY D 1 350 ? 17.829  -17.076 2.483   1.00 45.20 ? 352  GLY D O   1 
ATOM   10898 N N   . SER D 1 351 ? 17.836  -15.071 3.532   1.00 45.81 ? 353  SER D N   1 
ATOM   10899 C CA  . SER D 1 351 ? 18.451  -15.515 4.782   1.00 46.64 ? 353  SER D CA  1 
ATOM   10900 C C   . SER D 1 351 ? 17.510  -16.398 5.604   1.00 47.44 ? 353  SER D C   1 
ATOM   10901 O O   . SER D 1 351 ? 16.291  -16.406 5.393   1.00 47.63 ? 353  SER D O   1 
ATOM   10902 C CB  . SER D 1 351 ? 18.829  -14.295 5.638   1.00 45.99 ? 353  SER D CB  1 
ATOM   10903 O OG  . SER D 1 351 ? 17.648  -13.755 6.216   1.00 43.93 ? 353  SER D OG  1 
ATOM   10904 N N   . GLY D 1 352 ? 18.142  -17.128 6.513   1.00 48.05 ? 354  GLY D N   1 
ATOM   10905 C CA  . GLY D 1 352 ? 17.357  -17.833 7.565   1.00 49.18 ? 354  GLY D CA  1 
ATOM   10906 C C   . GLY D 1 352 ? 16.902  -16.707 8.520   1.00 50.01 ? 354  GLY D C   1 
ATOM   10907 O O   . GLY D 1 352 ? 16.864  -15.534 8.100   1.00 49.85 ? 354  GLY D O   1 
ATOM   10908 N N   . SER D 1 353 ? 16.589  -17.072 9.744   1.00 50.95 ? 355  SER D N   1 
ATOM   10909 C CA  . SER D 1 353 ? 16.186  -16.065 10.753  1.00 52.13 ? 355  SER D CA  1 
ATOM   10910 C C   . SER D 1 353 ? 17.451  -15.371 11.262  1.00 52.80 ? 355  SER D C   1 
ATOM   10911 O O   . SER D 1 353 ? 18.475  -16.027 11.517  1.00 52.86 ? 355  SER D O   1 
ATOM   10912 C CB  . SER D 1 353 ? 15.373  -16.683 11.871  1.00 52.63 ? 355  SER D CB  1 
ATOM   10913 O OG  . SER D 1 353 ? 15.184  -15.784 12.954  1.00 52.74 ? 355  SER D OG  1 
ATOM   10914 N N   . LEU D 1 354 ? 17.350  -14.064 11.397  1.00 53.49 ? 356  LEU D N   1 
ATOM   10915 C CA  . LEU D 1 354 ? 18.461  -13.208 11.843  1.00 54.44 ? 356  LEU D CA  1 
ATOM   10916 C C   . LEU D 1 354 ? 18.177  -12.696 13.258  1.00 55.28 ? 356  LEU D C   1 
ATOM   10917 O O   . LEU D 1 354 ? 18.665  -11.616 13.642  1.00 55.18 ? 356  LEU D O   1 
ATOM   10918 C CB  . LEU D 1 354 ? 18.527  -12.043 10.838  1.00 54.39 ? 356  LEU D CB  1 
ATOM   10919 C CG  . LEU D 1 354 ? 18.690  -12.347 9.366   1.00 54.21 ? 356  LEU D CG  1 
ATOM   10920 C CD1 . LEU D 1 354 ? 18.142  -11.204 8.512   1.00 53.76 ? 356  LEU D CD1 1 
ATOM   10921 C CD2 . LEU D 1 354 ? 20.180  -12.536 9.076   1.00 53.86 ? 356  LEU D CD2 1 
ATOM   10922 N N   . PHE D 1 355 ? 17.368  -13.456 13.977  1.00 56.20 ? 357  PHE D N   1 
ATOM   10923 C CA  . PHE D 1 355 ? 16.978  -13.045 15.340  1.00 57.39 ? 357  PHE D CA  1 
ATOM   10924 C C   . PHE D 1 355 ? 18.165  -13.260 16.287  1.00 58.84 ? 357  PHE D C   1 
ATOM   10925 O O   . PHE D 1 355 ? 18.756  -14.345 16.343  1.00 58.68 ? 357  PHE D O   1 
ATOM   10926 C CB  . PHE D 1 355 ? 15.710  -13.718 15.835  1.00 56.09 ? 357  PHE D CB  1 
ATOM   10927 C CG  . PHE D 1 355 ? 15.392  -13.520 17.288  1.00 55.31 ? 357  PHE D CG  1 
ATOM   10928 C CD1 . PHE D 1 355 ? 14.642  -12.418 17.701  1.00 55.08 ? 357  PHE D CD1 1 
ATOM   10929 C CD2 . PHE D 1 355 ? 15.843  -14.432 18.239  1.00 55.24 ? 357  PHE D CD2 1 
ATOM   10930 C CE1 . PHE D 1 355 ? 14.338  -12.222 19.040  1.00 55.11 ? 357  PHE D CE1 1 
ATOM   10931 C CE2 . PHE D 1 355 ? 15.552  -14.255 19.599  1.00 55.10 ? 357  PHE D CE2 1 
ATOM   10932 C CZ  . PHE D 1 355 ? 14.793  -13.137 19.993  1.00 54.79 ? 357  PHE D CZ  1 
ATOM   10933 N N   . VAL D 1 356 ? 18.471  -12.184 16.982  1.00 60.57 ? 358  VAL D N   1 
ATOM   10934 C CA  . VAL D 1 356 ? 19.475  -12.182 18.055  1.00 62.51 ? 358  VAL D CA  1 
ATOM   10935 C C   . VAL D 1 356 ? 18.763  -11.651 19.311  1.00 64.09 ? 358  VAL D C   1 
ATOM   10936 O O   . VAL D 1 356 ? 18.186  -10.557 19.281  1.00 63.99 ? 358  VAL D O   1 
ATOM   10937 C CB  . VAL D 1 356 ? 20.739  -11.413 17.666  1.00 62.42 ? 358  VAL D CB  1 
ATOM   10938 C CG1 . VAL D 1 356 ? 21.763  -11.347 18.802  1.00 62.39 ? 358  VAL D CG1 1 
ATOM   10939 C CG2 . VAL D 1 356 ? 21.388  -11.975 16.409  1.00 62.26 ? 358  VAL D CG2 1 
ATOM   10940 N N   . ALA D 1 357 ? 18.811  -12.472 20.340  1.00 65.96 ? 359  ALA D N   1 
ATOM   10941 C CA  . ALA D 1 357 ? 18.170  -12.154 21.621  1.00 68.21 ? 359  ALA D CA  1 
ATOM   10942 C C   . ALA D 1 357 ? 19.034  -11.144 22.374  1.00 69.98 ? 359  ALA D C   1 
ATOM   10943 O O   . ALA D 1 357 ? 20.263  -11.112 22.193  1.00 70.10 ? 359  ALA D O   1 
ATOM   10944 C CB  . ALA D 1 357 ? 17.961  -13.416 22.444  1.00 68.21 ? 359  ALA D CB  1 
ATOM   10945 N N   . ASN D 1 358 ? 18.357  -10.362 23.186  1.00 71.90 ? 360  ASN D N   1 
ATOM   10946 C CA  . ASN D 1 358 ? 18.972  -9.350  24.047  1.00 74.11 ? 360  ASN D CA  1 
ATOM   10947 C C   . ASN D 1 358 ? 18.377  -7.973  23.718  1.00 75.59 ? 360  ASN D C   1 
ATOM   10948 O O   . ASN D 1 358 ? 17.165  -7.835  23.524  1.00 75.65 ? 360  ASN D O   1 
ATOM   10949 C CB  . ASN D 1 358 ? 20.489  -9.378  24.009  1.00 75.13 ? 360  ASN D CB  1 
ATOM   10950 C CG  . ASN D 1 358 ? 21.142  -10.000 25.225  1.00 76.11 ? 360  ASN D CG  1 
ATOM   10951 O OD1 . ASN D 1 358 ? 21.360  -9.324  26.249  1.00 76.57 ? 360  ASN D OD1 1 
ATOM   10952 N ND2 . ASN D 1 358 ? 21.479  -11.288 25.142  1.00 76.58 ? 360  ASN D ND2 1 
ATOM   10953 N N   . HIS D 1 359 ? 19.284  -7.019  23.652  1.00 77.19 ? 361  HIS D N   1 
ATOM   10954 C CA  . HIS D 1 359 ? 18.957  -5.596  23.513  1.00 78.85 ? 361  HIS D CA  1 
ATOM   10955 C C   . HIS D 1 359 ? 18.569  -5.102  24.913  1.00 79.77 ? 361  HIS D C   1 
ATOM   10956 O O   . HIS D 1 359 ? 17.974  -5.868  25.694  1.00 79.77 ? 361  HIS D O   1 
ATOM   10957 C CB  . HIS D 1 359 ? 17.853  -5.263  22.503  1.00 80.19 ? 361  HIS D CB  1 
ATOM   10958 C CG  . HIS D 1 359 ? 18.162  -5.750  21.118  1.00 81.37 ? 361  HIS D CG  1 
ATOM   10959 N ND1 . HIS D 1 359 ? 19.013  -5.118  20.249  1.00 81.87 ? 361  HIS D ND1 1 
ATOM   10960 C CD2 . HIS D 1 359 ? 17.697  -6.842  20.465  1.00 81.77 ? 361  HIS D CD2 1 
ATOM   10961 C CE1 . HIS D 1 359 ? 19.061  -5.802  19.114  1.00 82.23 ? 361  HIS D CE1 1 
ATOM   10962 N NE2 . HIS D 1 359 ? 18.273  -6.853  19.222  1.00 82.14 ? 361  HIS D NE2 1 
ATOM   10963 N N   . ALA D 1 360 ? 18.937  -3.865  25.184  1.00 80.71 ? 362  ALA D N   1 
ATOM   10964 C CA  . ALA D 1 360 ? 18.673  -3.246  26.496  1.00 81.73 ? 362  ALA D CA  1 
ATOM   10965 C C   . ALA D 1 360 ? 19.447  -4.017  27.569  1.00 82.42 ? 362  ALA D C   1 
ATOM   10966 O O   . ALA D 1 360 ? 18.989  -5.059  28.055  1.00 82.41 ? 362  ALA D O   1 
ATOM   10967 C CB  . ALA D 1 360 ? 17.183  -3.240  26.784  1.00 81.71 ? 362  ALA D CB  1 
ATOM   10968 N N   . TYR D 1 361 ? 20.593  -3.467  27.902  1.00 83.23 ? 363  TYR D N   1 
ATOM   10969 C CA  . TYR D 1 361 ? 21.537  -4.013  28.875  1.00 84.07 ? 363  TYR D CA  1 
ATOM   10970 C C   . TYR D 1 361 ? 22.809  -4.480  28.159  1.00 84.28 ? 363  TYR D C   1 
ATOM   10971 O O   . TYR D 1 361 ? 23.604  -3.565  27.833  1.00 84.37 ? 363  TYR D O   1 
ATOM   10972 C CB  . TYR D 1 361 ? 20.920  -5.131  29.728  1.00 85.90 ? 363  TYR D CB  1 
ATOM   10973 C CG  . TYR D 1 361 ? 20.142  -4.664  30.937  1.00 87.20 ? 363  TYR D CG  1 
ATOM   10974 C CD1 . TYR D 1 361 ? 18.777  -4.388  30.847  1.00 87.54 ? 363  TYR D CD1 1 
ATOM   10975 C CD2 . TYR D 1 361 ? 20.760  -4.492  32.180  1.00 87.67 ? 363  TYR D CD2 1 
ATOM   10976 C CE1 . TYR D 1 361 ? 18.045  -3.953  31.947  1.00 87.80 ? 363  TYR D CE1 1 
ATOM   10977 C CE2 . TYR D 1 361 ? 20.041  -4.057  33.291  1.00 88.03 ? 363  TYR D CE2 1 
ATOM   10978 C CZ  . TYR D 1 361 ? 18.680  -3.788  33.171  1.00 88.00 ? 363  TYR D CZ  1 
ATOM   10979 O OH  . TYR D 1 361 ? 17.930  -3.355  34.229  1.00 87.99 ? 363  TYR D OH  1 
ATOM   10980 O OXT . TYR D 1 361 ? 22.961  -5.689  27.940  1.00 84.65 ? 363  TYR D OXT 1 
HETATM 10981 O O   . HOH E 2 .   ? -3.674  4.348   30.972  1.00 7.72  ? 364  HOH A O   1 
HETATM 10982 O O   . HOH E 2 .   ? -2.253  3.871   28.579  1.00 13.11 ? 365  HOH A O   1 
HETATM 10983 O O   . HOH E 2 .   ? -1.753  6.125   27.142  1.00 8.77  ? 366  HOH A O   1 
HETATM 10984 O O   . HOH E 2 .   ? -5.308  2.792   25.256  1.00 19.49 ? 367  HOH A O   1 
HETATM 10985 O O   . HOH E 2 .   ? -0.430  -2.332  32.304  1.00 8.79  ? 368  HOH A O   1 
HETATM 10986 O O   . HOH E 2 .   ? -13.359 -1.848  26.283  1.00 31.35 ? 369  HOH A O   1 
HETATM 10987 O O   . HOH E 2 .   ? -17.100 -4.590  24.794  1.00 15.95 ? 370  HOH A O   1 
HETATM 10988 O O   . HOH E 2 .   ? -14.010 -3.990  14.253  1.00 32.85 ? 371  HOH A O   1 
HETATM 10989 O O   . HOH E 2 .   ? -22.947 -3.582  19.357  1.00 18.87 ? 372  HOH A O   1 
HETATM 10990 O O   . HOH E 2 .   ? -27.020 1.070   25.576  1.00 15.06 ? 373  HOH A O   1 
HETATM 10991 O O   . HOH E 2 .   ? -25.694 9.498   6.374   1.00 19.98 ? 374  HOH A O   1 
HETATM 10992 O O   . HOH E 2 .   ? -18.972 14.887  5.473   1.00 9.20  ? 375  HOH A O   1 
HETATM 10993 O O   . HOH E 2 .   ? -17.652 15.472  3.052   1.00 23.92 ? 376  HOH A O   1 
HETATM 10994 O O   . HOH E 2 .   ? -23.072 10.812  0.916   1.00 20.09 ? 377  HOH A O   1 
HETATM 10995 O O   . HOH E 2 .   ? -33.013 24.613  17.274  1.00 17.63 ? 378  HOH A O   1 
HETATM 10996 O O   . HOH E 2 .   ? -35.104 23.673  24.054  1.00 22.23 ? 379  HOH A O   1 
HETATM 10997 O O   . HOH E 2 .   ? -39.715 27.863  29.392  1.00 37.73 ? 380  HOH A O   1 
HETATM 10998 O O   . HOH E 2 .   ? -44.256 25.017  13.187  1.00 28.10 ? 381  HOH A O   1 
HETATM 10999 O O   . HOH E 2 .   ? -48.205 18.395  12.432  1.00 36.70 ? 382  HOH A O   1 
HETATM 11000 O O   . HOH E 2 .   ? -40.139 12.758  19.809  1.00 18.56 ? 383  HOH A O   1 
HETATM 11001 O O   . HOH E 2 .   ? -40.527 16.909  26.451  1.00 19.09 ? 384  HOH A O   1 
HETATM 11002 O O   . HOH E 2 .   ? -30.163 17.621  26.871  1.00 15.53 ? 385  HOH A O   1 
HETATM 11003 O O   . HOH E 2 .   ? -29.201 11.670  5.881   1.00 14.31 ? 386  HOH A O   1 
HETATM 11004 O O   . HOH E 2 .   ? -28.190 9.850   7.973   1.00 22.27 ? 387  HOH A O   1 
HETATM 11005 O O   . HOH E 2 .   ? -23.458 28.239  7.513   1.00 11.53 ? 388  HOH A O   1 
HETATM 11006 O O   . HOH E 2 .   ? -27.763 17.169  29.881  1.00 19.67 ? 389  HOH A O   1 
HETATM 11007 O O   . HOH E 2 .   ? -30.013 18.125  29.346  1.00 40.38 ? 390  HOH A O   1 
HETATM 11008 O O   . HOH E 2 .   ? -18.544 13.022  38.630  1.00 5.48  ? 391  HOH A O   1 
HETATM 11009 O O   . HOH E 2 .   ? -22.781 26.305  31.308  1.00 28.73 ? 392  HOH A O   1 
HETATM 11010 O O   . HOH E 2 .   ? -15.302 23.163  30.127  1.00 5.63  ? 393  HOH A O   1 
HETATM 11011 O O   . HOH E 2 .   ? -15.854 23.172  40.333  1.00 12.95 ? 394  HOH A O   1 
HETATM 11012 O O   . HOH E 2 .   ? -18.260 24.017  41.437  1.00 12.34 ? 395  HOH A O   1 
HETATM 11013 O O   . HOH E 2 .   ? -16.993 17.062  36.000  1.00 4.09  ? 396  HOH A O   1 
HETATM 11014 O O   . HOH E 2 .   ? -14.359 16.892  36.680  1.00 7.52  ? 397  HOH A O   1 
HETATM 11015 O O   . HOH E 2 .   ? -9.163  23.839  41.332  1.00 13.96 ? 398  HOH A O   1 
HETATM 11016 O O   . HOH E 2 .   ? -31.111 3.322   31.934  1.00 23.15 ? 399  HOH A O   1 
HETATM 11017 O O   . HOH E 2 .   ? -11.746 26.420  30.881  1.00 8.71  ? 400  HOH A O   1 
HETATM 11018 O O   . HOH E 2 .   ? -9.437  27.697  29.961  1.00 12.59 ? 401  HOH A O   1 
HETATM 11019 O O   . HOH E 2 .   ? -10.614 32.847  23.944  1.00 10.98 ? 402  HOH A O   1 
HETATM 11020 O O   . HOH E 2 .   ? -7.342  36.458  24.138  1.00 12.93 ? 403  HOH A O   1 
HETATM 11021 O O   . HOH E 2 .   ? -3.371  35.727  24.836  1.00 20.04 ? 404  HOH A O   1 
HETATM 11022 O O   . HOH E 2 .   ? -4.918  34.714  32.667  1.00 9.95  ? 405  HOH A O   1 
HETATM 11023 O O   . HOH E 2 .   ? -13.887 1.855   25.138  1.00 49.73 ? 406  HOH A O   1 
HETATM 11024 O O   . HOH E 2 .   ? -12.295 12.102  18.604  1.00 12.14 ? 407  HOH A O   1 
HETATM 11025 O O   . HOH E 2 .   ? -14.576 28.523  18.940  1.00 9.32  ? 408  HOH A O   1 
HETATM 11026 O O   . HOH E 2 .   ? -11.817 30.000  16.138  1.00 13.00 ? 409  HOH A O   1 
HETATM 11027 O O   . HOH E 2 .   ? -10.942 29.937  18.628  1.00 16.69 ? 410  HOH A O   1 
HETATM 11028 O O   . HOH E 2 .   ? -9.527  32.388  18.430  1.00 18.45 ? 411  HOH A O   1 
HETATM 11029 O O   . HOH E 2 .   ? -15.503 32.221  15.883  1.00 19.43 ? 412  HOH A O   1 
HETATM 11030 O O   . HOH E 2 .   ? -0.768  19.423  25.888  1.00 3.72  ? 413  HOH A O   1 
HETATM 11031 O O   . HOH E 2 .   ? -10.126 22.440  19.756  1.00 17.12 ? 414  HOH A O   1 
HETATM 11032 O O   . HOH E 2 .   ? 0.156   14.958  19.465  1.00 29.23 ? 415  HOH A O   1 
HETATM 11033 O O   . HOH E 2 .   ? -0.568  13.722  22.173  1.00 9.38  ? 416  HOH A O   1 
HETATM 11034 O O   . HOH E 2 .   ? -5.480  12.689  32.118  1.00 20.33 ? 417  HOH A O   1 
HETATM 11035 O O   . HOH E 2 .   ? -3.812  14.604  28.482  1.00 8.18  ? 418  HOH A O   1 
HETATM 11036 O O   . HOH E 2 .   ? -5.927  8.687   21.655  1.00 7.31  ? 419  HOH A O   1 
HETATM 11037 O O   . HOH E 2 .   ? -8.630  3.128   18.759  1.00 6.58  ? 420  HOH A O   1 
HETATM 11038 O O   . HOH E 2 .   ? -6.401  4.092   20.190  1.00 16.86 ? 421  HOH A O   1 
HETATM 11039 O O   . HOH E 2 .   ? -9.784  0.787   22.708  1.00 21.57 ? 422  HOH A O   1 
HETATM 11040 O O   . HOH E 2 .   ? -7.460  2.450   23.090  1.00 21.70 ? 423  HOH A O   1 
HETATM 11041 O O   . HOH E 2 .   ? -10.987 -0.652  14.163  1.00 9.77  ? 424  HOH A O   1 
HETATM 11042 O O   . HOH E 2 .   ? -22.916 24.082  18.302  1.00 36.12 ? 425  HOH A O   1 
HETATM 11043 O O   . HOH E 2 .   ? -21.496 25.350  15.625  1.00 23.37 ? 426  HOH A O   1 
HETATM 11044 O O   . HOH E 2 .   ? -23.423 21.875  25.433  1.00 18.39 ? 427  HOH A O   1 
HETATM 11045 O O   . HOH E 2 .   ? -24.631 22.700  28.631  1.00 26.50 ? 428  HOH A O   1 
HETATM 11046 O O   . HOH E 2 .   ? -23.503 27.541  14.555  1.00 22.62 ? 429  HOH A O   1 
HETATM 11047 O O   . HOH E 2 .   ? -20.229 27.180  17.586  1.00 23.92 ? 430  HOH A O   1 
HETATM 11048 O O   . HOH E 2 .   ? -13.847 34.513  9.243   1.00 37.11 ? 431  HOH A O   1 
HETATM 11049 O O   . HOH E 2 .   ? -10.079 35.872  11.824  1.00 22.56 ? 432  HOH A O   1 
HETATM 11050 O O   . HOH E 2 .   ? -10.439 37.826  13.755  1.00 26.40 ? 433  HOH A O   1 
HETATM 11051 O O   . HOH E 2 .   ? -14.803 27.649  14.449  1.00 9.86  ? 434  HOH A O   1 
HETATM 11052 O O   . HOH E 2 .   ? -3.661  37.069  13.152  1.00 14.72 ? 435  HOH A O   1 
HETATM 11053 O O   . HOH E 2 .   ? -2.094  30.249  8.253   1.00 18.81 ? 436  HOH A O   1 
HETATM 11054 O O   . HOH E 2 .   ? -12.394 35.708  7.505   1.00 35.53 ? 437  HOH A O   1 
HETATM 11055 O O   . HOH E 2 .   ? -7.407  26.430  1.202   1.00 14.21 ? 438  HOH A O   1 
HETATM 11056 O O   . HOH E 2 .   ? -4.913  27.228  2.546   1.00 20.56 ? 439  HOH A O   1 
HETATM 11057 O O   . HOH E 2 .   ? -0.398  28.260  9.810   1.00 20.01 ? 440  HOH A O   1 
HETATM 11058 O O   . HOH E 2 .   ? -3.062  13.343  12.036  1.00 8.53  ? 441  HOH A O   1 
HETATM 11059 O O   . HOH E 2 .   ? -7.993  7.860   8.189   1.00 19.03 ? 442  HOH A O   1 
HETATM 11060 O O   . HOH E 2 .   ? -11.805 5.420   11.321  1.00 13.99 ? 443  HOH A O   1 
HETATM 11061 O O   . HOH E 2 .   ? -30.201 30.665  4.111   1.00 15.24 ? 444  HOH A O   1 
HETATM 11062 O O   . HOH E 2 .   ? -21.579 31.072  14.208  1.00 15.72 ? 445  HOH A O   1 
HETATM 11063 O O   . HOH E 2 .   ? -30.096 29.527  7.800   1.00 33.17 ? 446  HOH A O   1 
HETATM 11064 O O   . HOH E 2 .   ? -13.625 28.989  0.165   1.00 11.93 ? 447  HOH A O   1 
HETATM 11065 O O   . HOH E 2 .   ? 0.740   16.340  3.217   1.00 8.28  ? 448  HOH A O   1 
HETATM 11066 O O   . HOH E 2 .   ? -10.807 15.086  4.006   1.00 18.63 ? 449  HOH A O   1 
HETATM 11067 O O   . HOH E 2 .   ? -14.119 16.465  4.039   1.00 11.77 ? 450  HOH A O   1 
HETATM 11068 O O   . HOH E 2 .   ? -30.586 7.571   15.663  1.00 7.37  ? 451  HOH A O   1 
HETATM 11069 O O   . HOH E 2 .   ? -30.715 3.983   18.958  1.00 13.95 ? 452  HOH A O   1 
HETATM 11070 O O   . HOH E 2 .   ? -39.750 22.388  3.292   1.00 31.14 ? 453  HOH A O   1 
HETATM 11071 O O   . HOH E 2 .   ? -21.489 26.770  -4.721  1.00 16.68 ? 454  HOH A O   1 
HETATM 11072 O O   . HOH E 2 .   ? -13.329 26.579  -1.842  1.00 33.15 ? 455  HOH A O   1 
HETATM 11073 O O   . HOH E 2 .   ? -15.673 29.423  -1.338  1.00 24.03 ? 456  HOH A O   1 
HETATM 11074 O O   . HOH E 2 .   ? -27.500 26.815  -1.664  1.00 18.63 ? 457  HOH A O   1 
HETATM 11075 O O   . HOH E 2 .   ? -23.586 35.430  6.526   1.00 23.13 ? 458  HOH A O   1 
HETATM 11076 O O   . HOH E 2 .   ? -15.630 38.102  25.988  1.00 42.70 ? 459  HOH A O   1 
HETATM 11077 O O   . HOH E 2 .   ? -16.184 33.171  29.878  1.00 45.17 ? 460  HOH A O   1 
HETATM 11078 O O   . HOH E 2 .   ? -4.478  -3.325  33.915  1.00 7.84  ? 461  HOH A O   1 
HETATM 11079 O O   . HOH E 2 .   ? -13.711 13.991  36.567  1.00 12.24 ? 462  HOH A O   1 
HETATM 11080 O O   . HOH E 2 .   ? -20.930 22.436  28.562  1.00 8.63  ? 463  HOH A O   1 
HETATM 11081 O O   . HOH E 2 .   ? -17.840 9.114   36.567  1.00 10.95 ? 464  HOH A O   1 
HETATM 11082 O O   . HOH E 2 .   ? -11.746 14.833  34.638  1.00 8.98  ? 465  HOH A O   1 
HETATM 11083 O O   . HOH E 2 .   ? -29.929 0.842   25.649  1.00 15.78 ? 466  HOH A O   1 
HETATM 11084 O O   . HOH E 2 .   ? -5.769  29.371  35.950  1.00 3.92  ? 467  HOH A O   1 
HETATM 11085 O O   . HOH E 2 .   ? -1.633  37.200  20.238  1.00 24.12 ? 468  HOH A O   1 
HETATM 11086 O O   . HOH E 2 .   ? -5.118  27.208  37.562  1.00 11.66 ? 469  HOH A O   1 
HETATM 11087 O O   . HOH E 2 .   ? -5.973  14.010  1.756   1.00 19.57 ? 470  HOH A O   1 
HETATM 11088 O O   . HOH E 2 .   ? -1.649  13.218  18.958  1.00 21.95 ? 471  HOH A O   1 
HETATM 11089 O O   . HOH E 2 .   ? -33.534 19.961  20.482  1.00 13.52 ? 472  HOH A O   1 
HETATM 11090 O O   . HOH E 2 .   ? -0.720  15.446  31.683  1.00 16.67 ? 473  HOH A O   1 
HETATM 11091 O O   . HOH E 2 .   ? -23.322 24.093  34.979  1.00 19.52 ? 474  HOH A O   1 
HETATM 11092 O O   . HOH E 2 .   ? -23.329 -2.536  13.255  1.00 42.13 ? 475  HOH A O   1 
HETATM 11093 O O   . HOH E 2 .   ? -38.069 21.805  22.180  1.00 19.49 ? 476  HOH A O   1 
HETATM 11094 O O   . HOH E 2 .   ? -34.368 9.935   28.916  1.00 19.74 ? 477  HOH A O   1 
HETATM 11095 O O   . HOH E 2 .   ? -18.551 35.187  0.523   1.00 27.11 ? 478  HOH A O   1 
HETATM 11096 O O   . HOH E 2 .   ? -2.578  16.920  29.968  1.00 18.55 ? 479  HOH A O   1 
HETATM 11097 O O   . HOH E 2 .   ? -44.963 17.420  22.354  1.00 20.33 ? 480  HOH A O   1 
HETATM 11098 O O   . HOH E 2 .   ? 3.398   26.281  12.295  1.00 25.56 ? 481  HOH A O   1 
HETATM 11099 O O   . HOH E 2 .   ? -12.149 35.686  14.965  1.00 34.76 ? 482  HOH A O   1 
HETATM 11100 O O   . HOH E 2 .   ? -4.572  -7.230  27.673  1.00 14.95 ? 483  HOH A O   1 
HETATM 11101 O O   . HOH E 2 .   ? -21.579 3.163   7.859   1.00 26.59 ? 484  HOH A O   1 
HETATM 11102 O O   . HOH E 2 .   ? -25.388 12.579  33.562  1.00 20.01 ? 485  HOH A O   1 
HETATM 11103 O O   . HOH E 2 .   ? -30.090 20.034  1.218   1.00 33.69 ? 486  HOH A O   1 
HETATM 11104 O O   . HOH E 2 .   ? -17.916 33.284  22.604  1.00 24.65 ? 487  HOH A O   1 
HETATM 11105 O O   . HOH E 2 .   ? -12.175 31.194  -0.456  1.00 32.83 ? 488  HOH A O   1 
HETATM 11106 O O   . HOH E 2 .   ? 1.735   22.054  0.560   1.00 15.31 ? 489  HOH A O   1 
HETATM 11107 O O   . HOH E 2 .   ? -17.874 8.255   6.019   1.00 27.63 ? 490  HOH A O   1 
HETATM 11108 O O   . HOH E 2 .   ? -0.925  30.607  12.852  1.00 38.88 ? 491  HOH A O   1 
HETATM 11109 O O   . HOH E 2 .   ? -22.097 -4.852  15.326  1.00 24.72 ? 492  HOH A O   1 
HETATM 11110 O O   . HOH E 2 .   ? -32.229 34.840  16.961  1.00 39.58 ? 493  HOH A O   1 
HETATM 11111 O O   . HOH E 2 .   ? -10.626 9.142   9.279   1.00 15.98 ? 494  HOH A O   1 
HETATM 11112 O O   . HOH E 2 .   ? -31.745 9.647   29.961  1.00 16.11 ? 495  HOH A O   1 
HETATM 11113 O O   . HOH E 2 .   ? -20.343 37.444  6.721   1.00 29.01 ? 496  HOH A O   1 
HETATM 11114 O O   . HOH E 2 .   ? -23.423 18.555  -1.725  1.00 34.96 ? 497  HOH A O   1 
HETATM 11115 O O   . HOH E 2 .   ? -20.370 25.840  40.881  1.00 29.81 ? 498  HOH A O   1 
HETATM 11116 O O   . HOH E 2 .   ? -12.048 -7.322  21.371  1.00 37.32 ? 499  HOH A O   1 
HETATM 11117 O O   . HOH E 2 .   ? -27.304 25.103  18.572  1.00 39.55 ? 500  HOH A O   1 
HETATM 11118 O O   . HOH E 2 .   ? -4.840  16.326  -0.128  1.00 39.00 ? 501  HOH A O   1 
HETATM 11119 O O   . HOH E 2 .   ? -37.699 8.935   21.534  1.00 36.01 ? 502  HOH A O   1 
HETATM 11120 O O   . HOH E 2 .   ? -36.750 32.381  2.354   1.00 32.09 ? 503  HOH A O   1 
HETATM 11121 O O   . HOH E 2 .   ? -10.156 0.162   11.602  1.00 24.56 ? 504  HOH A O   1 
HETATM 11122 O O   . HOH E 2 .   ? -19.986 26.322  20.350  1.00 25.45 ? 505  HOH A O   1 
HETATM 11123 O O   . HOH E 2 .   ? -32.164 1.664   29.868  1.00 43.47 ? 506  HOH A O   1 
HETATM 11124 O O   . HOH E 2 .   ? -44.478 23.368  11.111  1.00 38.49 ? 507  HOH A O   1 
HETATM 11125 O O   . HOH E 2 .   ? -20.451 33.201  19.750  1.00 38.69 ? 508  HOH A O   1 
HETATM 11126 O O   . HOH E 2 .   ? -0.582  35.409  13.531  1.00 20.65 ? 509  HOH A O   1 
HETATM 11127 O O   . HOH E 2 .   ? -18.833 -0.925  11.081  1.00 41.43 ? 510  HOH A O   1 
HETATM 11128 O O   . HOH E 2 .   ? -16.885 38.186  6.643   1.00 45.61 ? 511  HOH A O   1 
HETATM 11129 O O   . HOH E 2 .   ? -5.580  24.218  -3.595  1.00 45.12 ? 512  HOH A O   1 
HETATM 11130 O O   . HOH E 2 .   ? -19.968 -7.352  14.163  1.00 41.92 ? 513  HOH A O   1 
HETATM 11131 O O   . HOH E 2 .   ? -10.553 36.311  26.065  1.00 44.27 ? 514  HOH A O   1 
HETATM 11132 O O   . HOH E 2 .   ? -9.208  33.664  31.184  1.00 35.71 ? 515  HOH A O   1 
HETATM 11133 O O   . HOH E 2 .   ? -41.291 34.666  1.582   1.00 39.04 ? 516  HOH A O   1 
HETATM 11134 O O   . HOH E 2 .   ? -31.368 28.753  16.961  1.00 34.13 ? 517  HOH A O   1 
HETATM 11135 O O   . HOH E 2 .   ? -39.138 15.920  28.729  1.00 32.98 ? 518  HOH A O   1 
HETATM 11136 O O   . HOH E 2 .   ? -20.745 -6.355  22.607  1.00 40.52 ? 519  HOH A O   1 
HETATM 11137 O O   . HOH E 2 .   ? -38.076 7.248   27.781  1.00 33.76 ? 520  HOH A O   1 
HETATM 11138 O O   . HOH E 2 .   ? -0.902  31.547  5.853   1.00 40.56 ? 521  HOH A O   1 
HETATM 11139 O O   . HOH E 2 .   ? -29.402 31.684  15.314  1.00 33.55 ? 522  HOH A O   1 
HETATM 11140 O O   . HOH E 2 .   ? -24.861 27.173  -3.526  1.00 46.37 ? 523  HOH A O   1 
HETATM 11141 O O   . HOH E 2 .   ? -40.028 21.131  29.083  1.00 43.29 ? 524  HOH A O   1 
HETATM 11142 O O   . HOH E 2 .   ? -43.917 23.715  4.473   1.00 49.75 ? 525  HOH A O   1 
HETATM 11143 O O   . HOH E 2 .   ? -3.108  39.235  23.270  1.00 54.22 ? 526  HOH A O   1 
HETATM 11144 O O   . HOH E 2 .   ? -38.344 15.161  -1.649  1.00 45.79 ? 527  HOH A O   1 
HETATM 11145 O O   . HOH E 2 .   ? -24.256 38.382  17.184  1.00 43.17 ? 528  HOH A O   1 
HETATM 11146 O O   . HOH E 2 .   ? -40.026 24.322  1.238   1.00 39.92 ? 529  HOH A O   1 
HETATM 11147 O O   . HOH E 2 .   ? -26.961 7.984   41.595  1.00 30.70 ? 530  HOH A O   1 
HETATM 11148 O O   . HOH E 2 .   ? 1.684   30.690  13.149  1.00 18.01 ? 531  HOH A O   1 
HETATM 11149 O O   . HOH E 2 .   ? -13.704 9.387   7.315   1.00 33.75 ? 532  HOH A O   1 
HETATM 11150 O O   . HOH E 2 .   ? -14.770 35.396  0.995   1.00 46.82 ? 533  HOH A O   1 
HETATM 11151 O O   . HOH E 2 .   ? 3.118   27.430  7.375   1.00 33.99 ? 534  HOH A O   1 
HETATM 11152 O O   . HOH E 2 .   ? -11.920 31.631  39.597  1.00 33.09 ? 535  HOH A O   1 
HETATM 11153 O O   . HOH E 2 .   ? -9.057  36.415  34.722  1.00 47.16 ? 536  HOH A O   1 
HETATM 11154 O O   . HOH E 2 .   ? -4.743  39.631  10.159  1.00 44.87 ? 537  HOH A O   1 
HETATM 11155 O O   . HOH E 2 .   ? -45.020 17.791  11.001  1.00 38.11 ? 538  HOH A O   1 
HETATM 11156 O O   . HOH E 2 .   ? -47.208 29.430  23.714  1.00 38.44 ? 539  HOH A O   1 
HETATM 11157 O O   . HOH E 2 .   ? -44.770 14.734  24.503  1.00 40.71 ? 540  HOH A O   1 
HETATM 11158 O O   . HOH E 2 .   ? -5.315  39.131  13.241  1.0