data_1FD4
# 
_entry.id   1FD4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FD4         
RCSB  RCSB011492   
WWPDB D_1000011492 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1FD3 
_pdbx_database_related.details        'HUMAN BETA-DEFENSIN 2, ORTHORHOMBIC' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FD4 
_pdbx_database_status.recvd_initial_deposition_date   2000-07-19 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hoover, D.M.'  1 
'Lubkowski, J.' 2 
# 
_citation.id                        primary 
_citation.title                     'The structure of human beta-defensin-2 shows evidence of higher order oligomerization.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            275 
_citation.page_first                32911 
_citation.page_last                 32918 
_citation.year                      2000 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10906336 
_citation.pdbx_database_id_DOI      10.1074/jbc.M006098200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hoover, D.M.'      1 
primary 'Rajashankar, K.R.' 2 
primary 'Blumenthal, R.'    3 
primary 'Puri, A.'          4 
primary 'Oppenheim, J.J.'   5 
primary 'Chertov, O.'       6 
primary 'Lubkowski, J.'     7 
# 
_cell.entry_id           1FD4 
_cell.length_a           54.525 
_cell.length_b           79.950 
_cell.length_c           74.271 
_cell.angle_alpha        90.00 
_cell.angle_beta         105.30 
_cell.angle_gamma        90.00 
_cell.Z_PDB              32 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FD4 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'BETA-DEFENSIN 2' 4342.271 16  ? ? ? ? 
2 non-polymer syn 'SULFATE ION'     96.063   5   ? ? ? ? 
3 water       nat water             18.015   806 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'HBD-2, SKIN-ANTIMICROBIAL PEPTIDE 1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 
_entity_poly.pdbx_seq_one_letter_code_can   GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ILE n 
1 3  GLY n 
1 4  ASP n 
1 5  PRO n 
1 6  VAL n 
1 7  THR n 
1 8  CYS n 
1 9  LEU n 
1 10 LYS n 
1 11 SER n 
1 12 GLY n 
1 13 ALA n 
1 14 ILE n 
1 15 CYS n 
1 16 HIS n 
1 17 PRO n 
1 18 VAL n 
1 19 PHE n 
1 20 CYS n 
1 21 PRO n 
1 22 ARG n 
1 23 ARG n 
1 24 TYR n 
1 25 LYS n 
1 26 GLN n 
1 27 ILE n 
1 28 GLY n 
1 29 THR n 
1 30 CYS n 
1 31 GLY n 
1 32 LEU n 
1 33 PRO n 
1 34 GLY n 
1 35 THR n 
1 36 LYS n 
1 37 CYS n 
1 38 CYS n 
1 39 LYS n 
1 40 LYS n 
1 41 PRO n 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THIS PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THIS PEPTIDE OCCURS NATURALLY IN HUMANS (HOMO SAPIENS)' 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    BD02_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          O15263 
_struct_ref.pdbx_align_begin           24 
_struct_ref.pdbx_seq_one_letter_code   GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1FD4 A 1 ? 41 ? O15263 24 ? 64 ? 1 41 
2  1 1FD4 B 1 ? 41 ? O15263 24 ? 64 ? 1 41 
3  1 1FD4 C 1 ? 41 ? O15263 24 ? 64 ? 1 41 
4  1 1FD4 D 1 ? 41 ? O15263 24 ? 64 ? 1 41 
5  1 1FD4 E 1 ? 41 ? O15263 24 ? 64 ? 1 41 
6  1 1FD4 F 1 ? 41 ? O15263 24 ? 64 ? 1 41 
7  1 1FD4 G 1 ? 41 ? O15263 24 ? 64 ? 1 41 
8  1 1FD4 H 1 ? 41 ? O15263 24 ? 64 ? 1 41 
9  1 1FD4 I 1 ? 41 ? O15263 24 ? 64 ? 1 41 
10 1 1FD4 J 1 ? 41 ? O15263 24 ? 64 ? 1 41 
11 1 1FD4 K 1 ? 41 ? O15263 24 ? 64 ? 1 41 
12 1 1FD4 L 1 ? 41 ? O15263 24 ? 64 ? 1 41 
13 1 1FD4 M 1 ? 41 ? O15263 24 ? 64 ? 1 41 
14 1 1FD4 N 1 ? 41 ? O15263 24 ? 64 ? 1 41 
15 1 1FD4 O 1 ? 41 ? O15263 24 ? 64 ? 1 41 
16 1 1FD4 P 1 ? 41 ? O15263 24 ? 64 ? 1 41 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FD4 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1 
_exptl_crystal.density_percent_sol   45.21 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    'PEG 4000, tris, lithium sulfate, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   ADSC 
_diffrn_detector.pdbx_collection_date   1999-10-02 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             0.979 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FD4 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   65644 
_reflns.number_all                   65644 
_reflns.percent_possible_obs         96.3 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        24.2 
_reflns.B_iso_Wilson_estimate        10.2 
_reflns.pdbx_redundancy              2.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.273 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.7 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1FD4 
_refine.ls_number_reflns_obs                     57662 
_refine.ls_number_reflns_all                     57662 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    85.4 
_refine.ls_R_factor_obs                          0.1876 
_refine.ls_R_factor_all                          0.1876 
_refine.ls_R_factor_R_work                       0.1878 
_refine.ls_R_factor_R_free                       0.2639 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 11. 
_refine.ls_number_reflns_R_free                  6512 
_refine.ls_number_parameters                     2327 
_refine.ls_number_restraints                     2138 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'FREE R' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'HUMAN BETA-DEFESIN-2' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'ENGH AND HUBER' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1FD4 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      3 
_refine_analyze.occupancy_sum_hydrogen          0. 
_refine_analyze.occupancy_sum_non_hydrogen      5615. 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4979 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             814 
_refine_hist.number_atoms_total               5818 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        30.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
s_bond_d               0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
s_angle_d              0.02  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_dist         0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
s_from_restr_planes    0.444 ? ? ? 'X-RAY DIFFRACTION' ? 
s_zero_chiral_vol      0.03  ? ? ? 'X-RAY DIFFRACTION' ? 
s_non_zero_chiral_vol  0.04  ? ? ? 'X-RAY DIFFRACTION' ? 
s_anti_bump_dis_restr  0.01  ? ? ? 'X-RAY DIFFRACTION' ? 
s_rigid_bond_adp_cmpnt 0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
s_similar_adp_cmpnt    0.06  ? ? ? 'X-RAY DIFFRACTION' ? 
s_approx_iso_adps      0.00  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1FD4 
_pdbx_refine.R_factor_all_no_cutoff                      0.187 
_pdbx_refine.R_factor_obs_no_cutoff                      0.187 
_pdbx_refine.free_R_factor_no_cutoff                     0.263 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     11. 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            651 
_pdbx_refine.R_factor_all_4sig_cutoff                    0.187 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.181 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.254 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   11. 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          586 
_pdbx_refine.number_reflns_obs_4sig_cutoff               5189 
_pdbx_refine.number_reflns_obs_no_cutoff                 ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1FD4 
_struct.title                     'HUMAN BETA-DEFENSIN 2' 
_struct.pdbx_descriptor           'BETA-DEFENSIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FD4 
_struct_keywords.pdbx_keywords   'ANTIMICROBIAL PEPTIDE' 
_struct_keywords.text            'DEFENSIN, HUMAN BETA-DEFENSIN 2, BETA-DEFENSIN, ANTIMICROBIAL PEPTIDE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 3 ? 
X  N N 3 ? 
Y  N N 3 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 3 ? 
KA N N 3 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'The biological assembly is a dimer.' ? 
2 ?                                     ? 
3 ?                                     ? 
4 ?                                     ? 
5 ?                                     ? 
6 ?                                     ? 
7 ?                                     ? 
8 ?                                     ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 4 ? SER A 11 ? ASP A 4 SER A 11 1 ? 8 
HELX_P HELX_P2  2  ASP B 4 ? SER B 11 ? ASP B 4 SER B 11 1 ? 8 
HELX_P HELX_P3  3  ASP C 4 ? SER C 11 ? ASP C 4 SER C 11 1 ? 8 
HELX_P HELX_P4  4  ASP D 4 ? SER D 11 ? ASP D 4 SER D 11 1 ? 8 
HELX_P HELX_P5  5  ASP E 4 ? SER E 11 ? ASP E 4 SER E 11 1 ? 8 
HELX_P HELX_P6  6  ASP F 4 ? SER F 11 ? ASP F 4 SER F 11 1 ? 8 
HELX_P HELX_P7  7  ASP G 4 ? SER G 11 ? ASP G 4 SER G 11 1 ? 8 
HELX_P HELX_P8  8  ASP H 4 ? GLY H 12 ? ASP H 4 GLY H 12 1 ? 9 
HELX_P HELX_P9  9  ASP I 4 ? SER I 11 ? ASP I 4 SER I 11 1 ? 8 
HELX_P HELX_P10 10 ASP J 4 ? SER J 11 ? ASP J 4 SER J 11 1 ? 8 
HELX_P HELX_P11 11 ASP K 4 ? SER K 11 ? ASP K 4 SER K 11 1 ? 8 
HELX_P HELX_P12 12 ASP L 4 ? SER L 11 ? ASP L 4 SER L 11 1 ? 8 
HELX_P HELX_P13 13 ASP M 4 ? SER M 11 ? ASP M 4 SER M 11 1 ? 8 
HELX_P HELX_P14 14 ASP N 4 ? SER N 11 ? ASP N 4 SER N 11 1 ? 8 
HELX_P HELX_P15 15 ASP O 4 ? SER O 11 ? ASP O 4 SER O 11 1 ? 8 
HELX_P HELX_P16 16 ASP P 4 ? SER P 11 ? ASP P 4 SER P 11 1 ? 8 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 8  SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 8  A CYS 37 1_555 ? ? ? ? ? ? ? 2.055 ? 
disulf2  disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 15 A CYS 30 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf3  disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 20 A CYS 38 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf4  disulf ? ? B CYS 8  SG ? ? ? 1_555 B CYS 37 SG ? ? B CYS 8  B CYS 37 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf5  disulf ? ? B CYS 15 SG ? ? ? 1_555 B CYS 30 SG ? ? B CYS 15 B CYS 30 1_555 ? ? ? ? ? ? ? 2.058 ? 
disulf6  disulf ? ? B CYS 20 SG ? ? ? 1_555 B CYS 38 SG ? ? B CYS 20 B CYS 38 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf7  disulf ? ? C CYS 8  SG ? ? ? 1_555 C CYS 37 SG ? ? C CYS 8  C CYS 37 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf8  disulf ? ? C CYS 15 SG ? ? ? 1_555 C CYS 30 SG ? ? C CYS 15 C CYS 30 1_555 ? ? ? ? ? ? ? 2.023 ? 
disulf9  disulf ? ? C CYS 20 SG ? ? ? 1_555 C CYS 38 SG ? ? C CYS 20 C CYS 38 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf10 disulf ? ? D CYS 8  SG ? ? ? 1_555 D CYS 37 SG ? ? D CYS 8  D CYS 37 1_555 ? ? ? ? ? ? ? 2.048 ? 
disulf11 disulf ? ? D CYS 15 SG ? ? ? 1_555 D CYS 30 SG ? ? D CYS 15 D CYS 30 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf12 disulf ? ? D CYS 20 SG ? ? ? 1_555 D CYS 38 SG ? ? D CYS 20 D CYS 38 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf13 disulf ? ? E CYS 8  SG ? ? ? 1_555 E CYS 37 SG ? ? E CYS 8  E CYS 37 1_555 ? ? ? ? ? ? ? 2.049 ? 
disulf14 disulf ? ? E CYS 15 SG ? ? ? 1_555 E CYS 30 SG ? ? E CYS 15 E CYS 30 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf15 disulf ? ? E CYS 20 SG ? ? ? 1_555 E CYS 38 SG ? ? E CYS 20 E CYS 38 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf16 disulf ? ? F CYS 8  SG ? ? ? 1_555 F CYS 37 SG ? ? F CYS 8  F CYS 37 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf17 disulf ? ? F CYS 15 SG ? ? ? 1_555 F CYS 30 SG ? ? F CYS 15 F CYS 30 1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf18 disulf ? ? F CYS 20 SG ? ? ? 1_555 F CYS 38 SG ? ? F CYS 20 F CYS 38 1_555 ? ? ? ? ? ? ? 2.011 ? 
disulf19 disulf ? ? G CYS 8  SG ? ? ? 1_555 G CYS 37 SG ? ? G CYS 8  G CYS 37 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf20 disulf ? ? G CYS 15 SG ? ? ? 1_555 G CYS 30 SG ? ? G CYS 15 G CYS 30 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf21 disulf ? ? G CYS 20 SG ? ? ? 1_555 G CYS 38 SG ? ? G CYS 20 G CYS 38 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf22 disulf ? ? H CYS 8  SG ? ? ? 1_555 H CYS 37 SG ? ? H CYS 8  H CYS 37 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf23 disulf ? ? H CYS 15 SG ? ? ? 1_555 H CYS 30 SG ? ? H CYS 15 H CYS 30 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf24 disulf ? ? H CYS 20 SG ? ? ? 1_555 H CYS 38 SG ? ? H CYS 20 H CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf25 disulf ? ? I CYS 8  SG ? ? ? 1_555 I CYS 37 SG ? ? I CYS 8  I CYS 37 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf26 disulf ? ? I CYS 15 SG ? ? ? 1_555 I CYS 30 SG ? ? I CYS 15 I CYS 30 1_555 ? ? ? ? ? ? ? 2.047 ? 
disulf27 disulf ? ? I CYS 20 SG ? ? ? 1_555 I CYS 38 SG ? ? I CYS 20 I CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf28 disulf ? ? J CYS 8  SG ? ? ? 1_555 J CYS 37 SG ? ? J CYS 8  J CYS 37 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf29 disulf ? ? J CYS 15 SG ? ? ? 1_555 J CYS 30 SG ? ? J CYS 15 J CYS 30 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf30 disulf ? ? J CYS 20 SG ? ? ? 1_555 J CYS 38 SG ? ? J CYS 20 J CYS 38 1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf31 disulf ? ? K CYS 8  SG ? ? ? 1_555 K CYS 37 SG ? ? K CYS 8  K CYS 37 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf32 disulf ? ? K CYS 15 SG ? ? ? 1_555 K CYS 30 SG ? ? K CYS 15 K CYS 30 1_555 ? ? ? ? ? ? ? 2.027 ? 
disulf33 disulf ? ? K CYS 20 SG ? ? ? 1_555 K CYS 38 SG ? ? K CYS 20 K CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf34 disulf ? ? L CYS 8  SG ? ? ? 1_555 L CYS 37 SG ? ? L CYS 8  L CYS 37 1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf35 disulf ? ? L CYS 15 SG ? ? ? 1_555 L CYS 30 SG ? ? L CYS 15 L CYS 30 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf36 disulf ? ? L CYS 20 SG ? ? ? 1_555 L CYS 38 SG ? ? L CYS 20 L CYS 38 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf37 disulf ? ? M CYS 8  SG ? ? ? 1_555 M CYS 37 SG ? ? M CYS 8  M CYS 37 1_555 ? ? ? ? ? ? ? 2.071 ? 
disulf38 disulf ? ? M CYS 15 SG ? ? ? 1_555 M CYS 30 SG ? ? M CYS 15 M CYS 30 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf39 disulf ? ? M CYS 20 SG ? ? ? 1_555 M CYS 38 SG ? ? M CYS 20 M CYS 38 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf40 disulf ? ? N CYS 8  SG ? ? ? 1_555 N CYS 37 SG ? ? N CYS 8  N CYS 37 1_555 ? ? ? ? ? ? ? 2.025 ? 
disulf41 disulf ? ? N CYS 15 SG ? ? ? 1_555 N CYS 30 SG ? ? N CYS 15 N CYS 30 1_555 ? ? ? ? ? ? ? 2.043 ? 
disulf42 disulf ? ? N CYS 20 SG ? ? ? 1_555 N CYS 38 SG ? ? N CYS 20 N CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf43 disulf ? ? O CYS 8  SG ? ? ? 1_555 O CYS 37 SG ? ? O CYS 8  O CYS 37 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf44 disulf ? ? O CYS 15 SG ? ? ? 1_555 O CYS 30 SG ? ? O CYS 15 O CYS 30 1_555 ? ? ? ? ? ? ? 2.000 ? 
disulf45 disulf ? ? O CYS 20 SG ? ? ? 1_555 O CYS 38 SG ? ? O CYS 20 O CYS 38 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf46 disulf ? ? P CYS 8  SG ? ? ? 1_555 P CYS 37 SG ? ? P CYS 8  P CYS 37 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf47 disulf ? ? P CYS 15 SG ? ? ? 1_555 P CYS 30 SG ? ? P CYS 15 P CYS 30 1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf48 disulf ? ? P CYS 20 SG ? ? ? 1_555 P CYS 38 SG ? ? P CYS 20 P CYS 38 1_555 ? ? ? ? ? ? ? 2.041 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 3 ? 
C ? 3 ? 
D ? 3 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 3 ? 
I ? 4 ? 
J ? 3 ? 
K ? 3 ? 
L ? 3 ? 
M ? 4 ? 
N ? 4 ? 
O ? 3 ? 
P ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 2  ? GLY A 3  ? ILE A 2  GLY A 3  
A 2 LYS A 25 ? THR A 29 ? LYS A 25 THR A 29 
A 3 THR A 35 ? LYS A 39 ? THR A 35 LYS A 39 
A 4 ILE A 14 ? PRO A 17 ? ILE A 14 PRO A 17 
B 1 ILE B 14 ? HIS B 16 ? ILE B 14 HIS B 16 
B 2 LYS B 36 ? LYS B 39 ? LYS B 36 LYS B 39 
B 3 LYS B 25 ? GLY B 28 ? LYS B 25 GLY B 28 
C 1 ILE C 14 ? HIS C 16 ? ILE C 14 HIS C 16 
C 2 LYS C 36 ? LYS C 39 ? LYS C 36 LYS C 39 
C 3 LYS C 25 ? GLY C 28 ? LYS C 25 GLY C 28 
D 1 ILE D 14 ? HIS D 16 ? ILE D 14 HIS D 16 
D 2 LYS D 36 ? LYS D 39 ? LYS D 36 LYS D 39 
D 3 LYS D 25 ? THR D 29 ? LYS D 25 THR D 29 
E 1 ILE E 2  ? GLY E 3  ? ILE E 2  GLY E 3  
E 2 LYS E 25 ? THR E 29 ? LYS E 25 THR E 29 
E 3 LYS E 36 ? LYS E 39 ? LYS E 36 LYS E 39 
E 4 ILE E 14 ? HIS E 16 ? ILE E 14 HIS E 16 
F 1 ILE F 14 ? HIS F 16 ? ILE F 14 HIS F 16 
F 2 LYS F 36 ? LYS F 39 ? LYS F 36 LYS F 39 
F 3 LYS F 25 ? THR F 29 ? LYS F 25 THR F 29 
G 1 ILE G 2  ? GLY G 3  ? ILE G 2  GLY G 3  
G 2 LYS G 25 ? THR G 29 ? LYS G 25 THR G 29 
G 3 LYS G 36 ? LYS G 39 ? LYS G 36 LYS G 39 
G 4 ILE G 14 ? HIS G 16 ? ILE G 14 HIS G 16 
H 1 ILE H 14 ? HIS H 16 ? ILE H 14 HIS H 16 
H 2 LYS H 36 ? LYS H 39 ? LYS H 36 LYS H 39 
H 3 LYS H 25 ? GLY H 28 ? LYS H 25 GLY H 28 
I 1 ILE I 2  ? GLY I 3  ? ILE I 2  GLY I 3  
I 2 LYS I 25 ? THR I 29 ? LYS I 25 THR I 29 
I 3 LYS I 36 ? LYS I 39 ? LYS I 36 LYS I 39 
I 4 ILE I 14 ? HIS I 16 ? ILE I 14 HIS I 16 
J 1 ILE J 14 ? HIS J 16 ? ILE J 14 HIS J 16 
J 2 LYS J 36 ? LYS J 39 ? LYS J 36 LYS J 39 
J 3 LYS J 25 ? GLY J 28 ? LYS J 25 GLY J 28 
K 1 ILE K 14 ? HIS K 16 ? ILE K 14 HIS K 16 
K 2 LYS K 36 ? LYS K 39 ? LYS K 36 LYS K 39 
K 3 LYS K 25 ? GLY K 28 ? LYS K 25 GLY K 28 
L 1 ILE L 14 ? HIS L 16 ? ILE L 14 HIS L 16 
L 2 LYS L 36 ? LYS L 39 ? LYS L 36 LYS L 39 
L 3 LYS L 25 ? GLY L 28 ? LYS L 25 GLY L 28 
M 1 ILE M 2  ? GLY M 3  ? ILE M 2  GLY M 3  
M 2 LYS M 25 ? THR M 29 ? LYS M 25 THR M 29 
M 3 THR M 35 ? LYS M 39 ? THR M 35 LYS M 39 
M 4 ILE M 14 ? PRO M 17 ? ILE M 14 PRO M 17 
N 1 ILE N 2  ? GLY N 3  ? ILE N 2  GLY N 3  
N 2 LYS N 25 ? THR N 29 ? LYS N 25 THR N 29 
N 3 LYS N 36 ? LYS N 39 ? LYS N 36 LYS N 39 
N 4 ILE N 14 ? HIS N 16 ? ILE N 14 HIS N 16 
O 1 ILE O 14 ? HIS O 16 ? ILE O 14 HIS O 16 
O 2 LYS O 36 ? LYS O 39 ? LYS O 36 LYS O 39 
O 3 LYS O 25 ? GLY O 28 ? LYS O 25 GLY O 28 
P 1 ILE P 14 ? HIS P 16 ? ILE P 14 HIS P 16 
P 2 LYS P 36 ? LYS P 39 ? LYS P 36 LYS P 39 
P 3 LYS P 25 ? GLY P 28 ? LYS P 25 GLY P 28 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 2  ? N ILE A 2  O ILE A 27 ? O ILE A 27 
A 2 3 N ILE A 27 ? N ILE A 27 O CYS A 37 ? O CYS A 37 
A 3 4 O CYS A 38 ? O CYS A 38 N ILE A 14 ? N ILE A 14 
B 1 2 O HIS B 16 ? O HIS B 16 N LYS B 36 ? N LYS B 36 
B 2 3 O LYS B 39 ? O LYS B 39 N LYS B 25 ? N LYS B 25 
C 1 2 N HIS C 16 ? N HIS C 16 O LYS C 36 ? O LYS C 36 
C 2 3 N LYS C 39 ? N LYS C 39 O LYS C 25 ? O LYS C 25 
D 1 2 O HIS D 16 ? O HIS D 16 N LYS D 36 ? N LYS D 36 
D 2 3 O LYS D 39 ? O LYS D 39 N LYS D 25 ? N LYS D 25 
E 1 2 N ILE E 2  ? N ILE E 2  O ILE E 27 ? O ILE E 27 
E 2 3 N ILE E 27 ? N ILE E 27 O CYS E 37 ? O CYS E 37 
E 3 4 N CYS E 38 ? N CYS E 38 O ILE E 14 ? O ILE E 14 
F 1 2 N HIS F 16 ? N HIS F 16 O LYS F 36 ? O LYS F 36 
F 2 3 O LYS F 39 ? O LYS F 39 N LYS F 25 ? N LYS F 25 
G 1 2 N ILE G 2  ? N ILE G 2  O ILE G 27 ? O ILE G 27 
G 2 3 N ILE G 27 ? N ILE G 27 O CYS G 37 ? O CYS G 37 
G 3 4 O CYS G 38 ? O CYS G 38 N ILE G 14 ? N ILE G 14 
H 1 2 N HIS H 16 ? N HIS H 16 O LYS H 36 ? O LYS H 36 
H 2 3 O LYS H 39 ? O LYS H 39 N LYS H 25 ? N LYS H 25 
I 1 2 N ILE I 2  ? N ILE I 2  O ILE I 27 ? O ILE I 27 
I 2 3 N ILE I 27 ? N ILE I 27 O CYS I 37 ? O CYS I 37 
I 3 4 N CYS I 38 ? N CYS I 38 O ILE I 14 ? O ILE I 14 
J 1 2 N HIS J 16 ? N HIS J 16 O LYS J 36 ? O LYS J 36 
J 2 3 O LYS J 39 ? O LYS J 39 N LYS J 25 ? N LYS J 25 
K 1 2 O HIS K 16 ? O HIS K 16 N LYS K 36 ? N LYS K 36 
K 2 3 N LYS K 39 ? N LYS K 39 O LYS K 25 ? O LYS K 25 
L 1 2 O HIS L 16 ? O HIS L 16 N LYS L 36 ? N LYS L 36 
L 2 3 O LYS L 39 ? O LYS L 39 N LYS L 25 ? N LYS L 25 
M 1 2 N ILE M 2  ? N ILE M 2  O ILE M 27 ? O ILE M 27 
M 2 3 N ILE M 27 ? N ILE M 27 O CYS M 37 ? O CYS M 37 
M 3 4 O CYS M 38 ? O CYS M 38 N ILE M 14 ? N ILE M 14 
N 1 2 N ILE N 2  ? N ILE N 2  O ILE N 27 ? O ILE N 27 
N 2 3 N ILE N 27 ? N ILE N 27 O CYS N 37 ? O CYS N 37 
N 3 4 N CYS N 38 ? N CYS N 38 O ILE N 14 ? O ILE N 14 
O 1 2 N HIS O 16 ? N HIS O 16 O LYS O 36 ? O LYS O 36 
O 2 3 N LYS O 39 ? N LYS O 39 O LYS O 25 ? O LYS O 25 
P 1 2 O HIS P 16 ? O HIS P 16 N LYS P 36 ? N LYS P 36 
P 2 3 N LYS P 39 ? N LYS P 39 O LYS P 25 ? O LYS P 25 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 M 807' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 F 808' 
AC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE SO4 I 809' 
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 I 810' 
AC5 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 A 811' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 ARG I  22 ? ARG I 22  . ? 1_655 ? 
2  AC1 8 SO4 T  .  ? SO4 I 810 . ? 1_655 ? 
3  AC1 8 HOH DA .  ? HOH I 846 . ? 1_655 ? 
4  AC1 8 HOH DA .  ? HOH I 859 . ? 1_655 ? 
5  AC1 8 TYR M  24 ? TYR M 24  . ? 1_555 ? 
6  AC1 8 LYS M  40 ? LYS M 40  . ? 1_555 ? 
7  AC1 8 HOH HA .  ? HOH M 844 . ? 1_555 ? 
8  AC1 8 HOH IA .  ? HOH N 88  . ? 1_555 ? 
9  AC2 7 ARG E  23 ? ARG E 23  . ? 1_555 ? 
10 AC2 7 ARG F  23 ? ARG F 23  . ? 1_555 ? 
11 AC2 7 TYR F  24 ? TYR F 24  . ? 1_555 ? 
12 AC2 7 LYS F  40 ? LYS F 40  . ? 1_555 ? 
13 AC2 7 HOH AA .  ? HOH F 828 . ? 1_555 ? 
14 AC2 7 HOH AA .  ? HOH F 843 . ? 1_555 ? 
15 AC2 7 HOH AA .  ? HOH F 854 . ? 1_555 ? 
16 AC3 8 ARG I  22 ? ARG I 22  . ? 1_555 ? 
17 AC3 8 HOH DA .  ? HOH I 821 . ? 1_555 ? 
18 AC3 8 HOH DA .  ? HOH I 829 . ? 1_555 ? 
19 AC3 8 HOH DA .  ? HOH I 831 . ? 1_555 ? 
20 AC3 8 HOH DA .  ? HOH I 859 . ? 1_555 ? 
21 AC3 8 PRO N  21 ? PRO N 21  . ? 1_455 ? 
22 AC3 8 ARG N  22 ? ARG N 22  . ? 1_455 ? 
23 AC3 8 ARG N  23 ? ARG N 23  . ? 1_455 ? 
24 AC4 7 ARG I  22 ? ARG I 22  . ? 1_555 ? 
25 AC4 7 HOH DA .  ? HOH I 830 . ? 1_555 ? 
26 AC4 7 HOH DA .  ? HOH I 864 . ? 1_555 ? 
27 AC4 7 LYS M  40 ? LYS M 40  . ? 1_455 ? 
28 AC4 7 SO4 U  .  ? SO4 M 807 . ? 1_455 ? 
29 AC4 7 HOH HA .  ? HOH M 829 . ? 1_455 ? 
30 AC4 7 HOH HA .  ? HOH M 833 . ? 1_455 ? 
31 AC5 3 CYS A  20 ? CYS A 20  . ? 1_555 ? 
32 AC5 3 LYS A  25 ? LYS A 25  . ? 1_555 ? 
33 AC5 3 GLN A  26 ? GLN A 26  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1FD4 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.000000 
_database_PDB_matrix.origx_vector[2]   0.000000 
_database_PDB_matrix.origx_vector[3]   0.000000 
# 
_atom_sites.entry_id                    1FD4 
_atom_sites.fract_transf_matrix[1][1]   0.018340 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005017 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012508 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013959 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLY A  1 1  ? 12.876  8.416   28.389  1.00 25.25  ? 1   GLY A N   1 
ATOM   2    C CA  . GLY A  1 1  ? 14.178  8.116   27.816  1.00 20.71  ? 1   GLY A CA  1 
ATOM   3    C C   . GLY A  1 1  ? 14.047  7.843   26.319  1.00 18.63  ? 1   GLY A C   1 
ATOM   4    O O   . GLY A  1 1  ? 13.088  8.236   25.659  1.00 16.51  ? 1   GLY A O   1 
ATOM   5    N N   . ILE A  1 2  ? 15.049  7.150   25.796  1.00 11.33  ? 2   ILE A N   1 
ATOM   6    C CA  . ILE A  1 2  ? 14.979  6.768   24.381  1.00 11.91  ? 2   ILE A CA  1 
ATOM   7    C C   . ILE A  1 2  ? 14.305  5.398   24.272  1.00 14.13  ? 2   ILE A C   1 
ATOM   8    O O   . ILE A  1 2  ? 14.789  4.435   24.889  1.00 11.00  ? 2   ILE A O   1 
ATOM   9    C CB  . ILE A  1 2  ? 16.372  6.748   23.764  1.00 11.31  ? 2   ILE A CB  1 
ATOM   10   C CG1 . ILE A  1 2  ? 17.069  8.111   23.718  1.00 11.52  ? 2   ILE A CG1 1 
ATOM   11   C CG2 . ILE A  1 2  ? 16.350  6.131   22.366  1.00 11.80  ? 2   ILE A CG2 1 
ATOM   12   C CD1 . ILE A  1 2  ? 18.558  8.066   23.514  1.00 10.84  ? 2   ILE A CD1 1 
ATOM   13   N N   . GLY A  1 3  ? 13.223  5.361   23.486  1.00 13.60  ? 3   GLY A N   1 
ATOM   14   C CA  . GLY A  1 3  ? 12.369  4.169   23.429  1.00 9.06   ? 3   GLY A CA  1 
ATOM   15   C C   . GLY A  1 3  ? 11.790  3.870   22.069  1.00 8.99   ? 3   GLY A C   1 
ATOM   16   O O   . GLY A  1 3  ? 10.774  3.194   21.945  1.00 12.71  ? 3   GLY A O   1 
ATOM   17   N N   . ASP A  1 4  ? 12.446  4.376   21.024  1.00 12.55  ? 4   ASP A N   1 
ATOM   18   C CA  . ASP A  1 4  ? 12.021  4.083   19.663  1.00 12.90  ? 4   ASP A CA  1 
ATOM   19   C C   . ASP A  1 4  ? 13.236  4.215   18.750  1.00 8.61   ? 4   ASP A C   1 
ATOM   20   O O   . ASP A  1 4  ? 14.218  4.894   19.075  1.00 9.67   ? 4   ASP A O   1 
ATOM   21   C CB  . ASP A  1 4  ? 10.893  5.005   19.199  1.00 14.36  ? 4   ASP A CB  1 
ATOM   22   C CG  . ASP A  1 4  ? 11.415  6.381   18.841  1.00 13.76  ? 4   ASP A CG  1 
ATOM   23   O OD1 . ASP A  1 4  ? 11.386  7.284   19.706  1.00 10.70  ? 4   ASP A OD1 1 
ATOM   24   O OD2 . ASP A  1 4  ? 11.882  6.592   17.695  1.00 11.63  ? 4   ASP A OD2 1 
ATOM   25   N N   . PRO A  1 5  ? 13.207  3.564   17.600  1.00 11.00  ? 5   PRO A N   1 
ATOM   26   C CA  . PRO A  1 5  ? 14.427  3.567   16.775  1.00 15.50  ? 5   PRO A CA  1 
ATOM   27   C C   . PRO A  1 5  ? 14.802  4.926   16.210  1.00 10.32  ? 5   PRO A C   1 
ATOM   28   O O   . PRO A  1 5  ? 16.004  5.182   16.097  1.00 11.88  ? 5   PRO A O   1 
ATOM   29   C CB  . PRO A  1 5  ? 14.075  2.614   15.614  1.00 14.64  ? 5   PRO A CB  1 
ATOM   30   C CG  . PRO A  1 5  ? 12.900  1.834   16.107  1.00 17.52  ? 5   PRO A CG  1 
ATOM   31   C CD  . PRO A  1 5  ? 12.126  2.781   16.990  1.00 13.58  ? 5   PRO A CD  1 
ATOM   32   N N   . VAL A  1 6  ? 13.839  5.759   15.826  1.00 12.10  ? 6   VAL A N   1 
ATOM   33   C CA  . VAL A  1 6  ? 14.226  7.049   15.217  1.00 16.81  ? 6   VAL A CA  1 
ATOM   34   C C   . VAL A  1 6  ? 14.914  7.968   16.212  1.00 10.59  ? 6   VAL A C   1 
ATOM   35   O O   . VAL A  1 6  ? 15.940  8.572   15.914  1.00 11.84  ? 6   VAL A O   1 
ATOM   36   C CB  . VAL A  1 6  ? 13.013  7.758   14.591  1.00 15.90  ? 6   VAL A CB  1 
ATOM   37   C CG1 . VAL A  1 6  ? 13.402  9.137   14.066  1.00 13.44  ? 6   VAL A CG1 1 
ATOM   38   C CG2 . VAL A  1 6  ? 12.444  6.906   13.468  1.00 14.24  ? 6   VAL A CG2 1 
ATOM   39   N N   . THR A  1 7  ? 14.369  8.062   17.426  1.00 12.85  ? 7   THR A N   1 
ATOM   40   C CA  . THR A  1 7  ? 14.997  8.922   18.436  1.00 13.24  ? 7   THR A CA  1 
ATOM   41   C C   . THR A  1 7  ? 16.398  8.408   18.708  1.00 12.39  ? 7   THR A C   1 
ATOM   42   O O   . THR A  1 7  ? 17.328  9.202   18.884  1.00 12.15  ? 7   THR A O   1 
ATOM   43   C CB  . THR A  1 7  ? 14.150  8.949   19.730  1.00 12.57  ? 7   THR A CB  1 
ATOM   44   O OG1 . THR A  1 7  ? 12.864  9.485   19.397  1.00 11.37  ? 7   THR A OG1 1 
ATOM   45   C CG2 . THR A  1 7  ? 14.789  9.837   20.791  1.00 9.27   ? 7   THR A CG2 1 
ATOM   46   N N   . CYS A  1 8  ? 16.538  7.082   18.720  1.00 11.76  ? 8   CYS A N   1 
ATOM   47   C CA  . CYS A  1 8  ? 17.838  6.448   18.990  1.00 9.19   ? 8   CYS A CA  1 
ATOM   48   C C   . CYS A  1 8  ? 18.859  6.882   17.943  1.00 9.79   ? 8   CYS A C   1 
ATOM   49   O O   . CYS A  1 8  ? 19.956  7.356   18.209  1.00 11.63  ? 8   CYS A O   1 
ATOM   50   C CB  . CYS A  1 8  ? 17.762  4.923   19.010  1.00 14.01  ? 8   CYS A CB  1 
ATOM   51   S SG  . CYS A  1 8  ? 19.316  4.033   19.311  1.00 13.35  ? 8   CYS A SG  1 
ATOM   52   N N   . LEU A  1 9  ? 18.473  6.713   16.681  1.00 11.65  ? 9   LEU A N   1 
ATOM   53   C CA  . LEU A  1 9  ? 19.399  6.979   15.594  1.00 10.09  ? 9   LEU A CA  1 
ATOM   54   C C   . LEU A  1 9  ? 19.656  8.482   15.461  1.00 11.26  ? 9   LEU A C   1 
ATOM   55   O O   . LEU A  1 9  ? 20.771  8.852   15.126  1.00 11.70  ? 9   LEU A O   1 
ATOM   56   C CB  . LEU A  1 9  ? 18.826  6.405   14.287  1.00 10.61  ? 9   LEU A CB  1 
ATOM   57   C CG  . LEU A  1 9  ? 18.801  4.864   14.246  1.00 10.96  ? 9   LEU A CG  1 
ATOM   58   C CD1 . LEU A  1 9  ? 17.707  4.361   13.332  1.00 13.97  ? 9   LEU A CD1 1 
ATOM   59   C CD2 . LEU A  1 9  ? 20.177  4.342   13.850  1.00 14.19  ? 9   LEU A CD2 1 
ATOM   60   N N   . LYS A  1 10 ? 18.625  9.289   15.757  1.00 15.69  ? 10  LYS A N   1 
ATOM   61   C CA  . LYS A  1 10 ? 18.826  10.740  15.717  1.00 14.86  ? 10  LYS A CA  1 
ATOM   62   C C   . LYS A  1 10 ? 19.894  11.199  16.708  1.00 15.46  ? 10  LYS A C   1 
ATOM   63   O O   . LYS A  1 10 ? 20.591  12.188  16.436  1.00 14.10  ? 10  LYS A O   1 
ATOM   64   C CB  . LYS A  1 10 ? 17.524  11.510  15.993  1.00 12.36  ? 10  LYS A CB  1 
ATOM   65   C CG  . LYS A  1 10 ? 16.663  11.581  14.730  1.00 16.55  ? 10  LYS A CG  1 
ATOM   66   C CD  . LYS A  1 10 ? 15.370  12.337  15.032  1.00 19.81  ? 10  LYS A CD  1 
ATOM   67   C CE  . LYS A  1 10 ? 14.618  12.583  13.724  1.00 35.40  ? 10  LYS A CE  1 
ATOM   68   N NZ  . LYS A  1 10 ? 13.496  13.546  13.899  1.00 53.76  ? 10  LYS A NZ  1 
ATOM   69   N N   . SER A  1 11 ? 20.052  10.495  17.818  1.00 13.57  ? 11  SER A N   1 
ATOM   70   C CA  . SER A  1 11 ? 21.058  10.812  18.823  1.00 13.68  ? 11  SER A CA  1 
ATOM   71   C C   . SER A  1 11 ? 22.465  10.365  18.450  1.00 12.85  ? 11  SER A C   1 
ATOM   72   O O   . SER A  1 11 ? 23.440  10.636  19.175  1.00 16.35  ? 11  SER A O   1 
ATOM   73   C CB  . SER A  1 11 ? 20.654  10.193  20.173  1.00 19.19  ? 11  SER A CB  1 
ATOM   74   O OG  . SER A  1 11 ? 21.058  8.829   20.223  1.00 22.71  ? 11  SER A OG  1 
ATOM   75   N N   . GLY A  1 12 ? 22.600  9.690   17.322  1.00 15.21  ? 12  GLY A N   1 
ATOM   76   C CA  . GLY A  1 12 ? 23.827  9.177   16.772  1.00 11.31  ? 12  GLY A CA  1 
ATOM   77   C C   . GLY A  1 12 ? 24.182  7.781   17.271  1.00 14.67  ? 12  GLY A C   1 
ATOM   78   O O   . GLY A  1 12 ? 25.316  7.334   17.115  1.00 13.66  ? 12  GLY A O   1 
ATOM   79   N N   . ALA A  1 13 ? 23.228  7.110   17.889  1.00 12.91  ? 13  ALA A N   1 
ATOM   80   C CA  . ALA A  1 13 ? 23.391  5.773   18.438  1.00 12.35  ? 13  ALA A CA  1 
ATOM   81   C C   . ALA A  1 13 ? 23.036  4.715   17.400  1.00 16.13  ? 13  ALA A C   1 
ATOM   82   O O   . ALA A  1 13 ? 22.644  5.076   16.277  1.00 14.39  ? 13  ALA A O   1 
ATOM   83   C CB  . ALA A  1 13 ? 22.494  5.652   19.662  1.00 10.48  ? 13  ALA A CB  1 
ATOM   84   N N   . ILE A  1 14 ? 23.168  3.444   17.765  1.00 13.07  ? 14  ILE A N   1 
ATOM   85   C CA  . ILE A  1 14 ? 22.732  2.320   16.954  1.00 11.38  ? 14  ILE A CA  1 
ATOM   86   C C   . ILE A  1 14 ? 21.567  1.598   17.628  1.00 15.82  ? 14  ILE A C   1 
ATOM   87   O O   . ILE A  1 14 ? 21.433  1.675   18.858  1.00 14.38  ? 14  ILE A O   1 
ATOM   88   C CB  . ILE A  1 14 ? 23.867  1.315   16.676  1.00 9.69   ? 14  ILE A CB  1 
ATOM   89   C CG1 . ILE A  1 14 ? 24.293  0.525   17.911  1.00 16.25  ? 14  ILE A CG1 1 
ATOM   90   C CG2 . ILE A  1 14 ? 25.048  2.041   16.032  1.00 11.37  ? 14  ILE A CG2 1 
ATOM   91   C CD1 . ILE A  1 14 ? 25.239  -0.617  17.540  1.00 15.32  ? 14  ILE A CD1 1 
ATOM   92   N N   . CYS A  1 15 ? 20.732  0.909   16.850  1.00 11.56  ? 15  CYS A N   1 
ATOM   93   C CA  . CYS A  1 15 ? 19.727  0.001   17.401  1.00 11.28  ? 15  CYS A CA  1 
ATOM   94   C C   . CYS A  1 15 ? 20.199  -1.445  17.222  1.00 15.62  ? 15  CYS A C   1 
ATOM   95   O O   . CYS A  1 15 ? 20.410  -1.859  16.085  1.00 15.03  ? 15  CYS A O   1 
ATOM   96   C CB  . CYS A  1 15 ? 18.374  0.162   16.732  1.00 9.79   ? 15  CYS A CB  1 
ATOM   97   S SG  . CYS A  1 15 ? 17.472  1.662   17.174  1.00 15.13  ? 15  CYS A SG  1 
ATOM   98   N N   . HIS A  1 16 ? 20.387  -2.176  18.314  1.00 13.08  ? 16  HIS A N   1 
ATOM   99   C CA  . HIS A  1 16 ? 20.984  -3.509  18.255  1.00 15.30  ? 16  HIS A CA  1 
ATOM   100  C C   . HIS A  1 16 ? 20.077  -4.474  19.009  1.00 20.37  ? 16  HIS A C   1 
ATOM   101  O O   . HIS A  1 16 ? 19.758  -4.202  20.183  1.00 18.41  ? 16  HIS A O   1 
ATOM   102  C CB  . HIS A  1 16 ? 22.386  -3.528  18.873  1.00 11.46  ? 16  HIS A CB  1 
ATOM   103  C CG  . HIS A  1 16 ? 23.273  -4.651  18.435  1.00 11.10  ? 16  HIS A CG  1 
ATOM   104  N ND1 . HIS A  1 16 ? 23.067  -5.969  18.769  1.00 18.81  ? 16  HIS A ND1 1 
ATOM   105  C CD2 . HIS A  1 16 ? 24.390  -4.642  17.671  1.00 16.58  ? 16  HIS A CD2 1 
ATOM   106  C CE1 . HIS A  1 16 ? 24.018  -6.720  18.224  1.00 17.53  ? 16  HIS A CE1 1 
ATOM   107  N NE2 . HIS A  1 16 ? 24.841  -5.934  17.552  1.00 17.99  ? 16  HIS A NE2 1 
ATOM   108  N N   . PRO A  1 17 ? 19.656  -5.569  18.401  1.00 19.03  ? 17  PRO A N   1 
ATOM   109  C CA  . PRO A  1 17 ? 18.865  -6.544  19.173  1.00 16.88  ? 17  PRO A CA  1 
ATOM   110  C C   . PRO A  1 17 ? 19.683  -7.223  20.265  1.00 20.65  ? 17  PRO A C   1 
ATOM   111  O O   . PRO A  1 17 ? 20.867  -7.516  20.150  1.00 20.72  ? 17  PRO A O   1 
ATOM   112  C CB  . PRO A  1 17 ? 18.440  -7.579  18.131  1.00 21.42  ? 17  PRO A CB  1 
ATOM   113  C CG  . PRO A  1 17 ? 18.668  -6.917  16.808  1.00 23.55  ? 17  PRO A CG  1 
ATOM   114  C CD  . PRO A  1 17 ? 19.844  -5.992  17.004  1.00 21.28  ? 17  PRO A CD  1 
ATOM   115  N N   . VAL A  1 18 ? 19.026  -7.488  21.388  1.00 23.47  ? 18  VAL A N   1 
ATOM   116  C CA  . VAL A  1 18 ? 19.535  -8.344  22.445  1.00 24.33  ? 18  VAL A CA  1 
ATOM   117  C C   . VAL A  1 18 ? 20.641  -7.734  23.289  1.00 21.64  ? 18  VAL A C   1 
ATOM   118  O O   . VAL A  1 18 ? 20.551  -7.822  24.522  1.00 26.23  ? 18  VAL A O   1 
ATOM   119  C CB  . VAL A  1 18 ? 20.026  -9.685  21.843  1.00 22.08  ? 18  VAL A CB  1 
ATOM   120  C CG1 . VAL A  1 18 ? 20.512  -10.608 22.942  1.00 23.85  ? 18  VAL A CG1 1 
ATOM   121  C CG2 . VAL A  1 18 ? 18.902  -10.332 21.043  1.00 20.43  ? 18  VAL A CG2 1 
ATOM   122  N N   . PHE A  1 19 ? 21.657  -7.113  22.688  1.00 20.44  ? 19  PHE A N   1 
ATOM   123  C CA  . PHE A  1 19 ? 22.759  -6.555  23.455  1.00 18.74  ? 19  PHE A CA  1 
ATOM   124  C C   . PHE A  1 19 ? 23.423  -5.367  22.752  1.00 22.74  ? 19  PHE A C   1 
ATOM   125  O O   . PHE A  1 19 ? 23.128  -5.116  21.574  1.00 21.63  ? 19  PHE A O   1 
ATOM   126  C CB  . PHE A  1 19 ? 23.799  -7.646  23.755  1.00 21.89  ? 19  PHE A CB  1 
ATOM   127  C CG  . PHE A  1 19 ? 24.579  -8.134  22.542  1.00 14.10  ? 19  PHE A CG  1 
ATOM   128  C CD1 . PHE A  1 19 ? 25.807  -7.583  22.231  1.00 14.79  ? 19  PHE A CD1 1 
ATOM   129  C CD2 . PHE A  1 19 ? 24.072  -9.130  21.726  1.00 14.98  ? 19  PHE A CD2 1 
ATOM   130  C CE1 . PHE A  1 19 ? 26.528  -7.994  21.124  1.00 21.94  ? 19  PHE A CE1 1 
ATOM   131  C CE2 . PHE A  1 19 ? 24.792  -9.550  20.624  1.00 15.21  ? 19  PHE A CE2 1 
ATOM   132  C CZ  . PHE A  1 19 ? 26.013  -8.998  20.323  1.00 16.71  ? 19  PHE A CZ  1 
ATOM   133  N N   . CYS A  1 20 ? 24.290  -4.686  23.478  1.00 15.75  ? 20  CYS A N   1 
ATOM   134  C CA  . CYS A  1 20 ? 25.194  -3.654  22.981  1.00 11.23  ? 20  CYS A CA  1 
ATOM   135  C C   . CYS A  1 20 ? 26.587  -4.250  22.836  1.00 20.94  ? 20  CYS A C   1 
ATOM   136  O O   . CYS A  1 20 ? 27.160  -4.748  23.810  1.00 19.14  ? 20  CYS A O   1 
ATOM   137  C CB  . CYS A  1 20 ? 25.267  -2.417  23.873  1.00 14.70  ? 20  CYS A CB  1 
ATOM   138  S SG  . CYS A  1 20 ? 23.716  -1.498  24.027  1.00 19.00  ? 20  CYS A SG  1 
ATOM   139  N N   . PRO A  1 21 ? 27.124  -4.205  21.623  1.00 22.97  ? 21  PRO A N   1 
ATOM   140  C CA  . PRO A  1 21 ? 28.433  -4.796  21.375  1.00 15.60  ? 21  PRO A CA  1 
ATOM   141  C C   . PRO A  1 21 ? 29.559  -4.048  22.080  1.00 19.46  ? 21  PRO A C   1 
ATOM   142  O O   . PRO A  1 21 ? 29.394  -2.927  22.546  1.00 22.66  ? 21  PRO A O   1 
ATOM   143  C CB  . PRO A  1 21 ? 28.666  -4.623  19.863  1.00 23.16  ? 21  PRO A CB  1 
ATOM   144  C CG  . PRO A  1 21 ? 27.571  -3.756  19.362  1.00 22.79  ? 21  PRO A CG  1 
ATOM   145  C CD  . PRO A  1 21 ? 26.517  -3.610  20.419  1.00 24.43  ? 21  PRO A CD  1 
ATOM   146  N N   . ARG A  1 22 ? 30.706  -4.702  22.106  1.00 20.52  ? 22  ARG A N   1 
ATOM   147  C CA  . ARG A  1 22 ? 31.941  -4.173  22.658  1.00 28.53  ? 22  ARG A CA  1 
ATOM   148  C C   . ARG A  1 22 ? 32.170  -2.709  22.298  1.00 24.24  ? 22  ARG A C   1 
ATOM   149  O O   . ARG A  1 22 ? 32.034  -2.301  21.139  1.00 26.40  ? 22  ARG A O   1 
ATOM   150  C CB  . ARG A  1 22 ? 33.090  -5.046  22.138  1.00 33.77  ? 22  ARG A CB  1 
ATOM   151  C CG  . ARG A  1 22 ? 34.331  -4.994  23.009  1.00 48.44  ? 22  ARG A CG  1 
ATOM   152  C CD  . ARG A  1 22 ? 35.472  -5.796  22.387  1.00 51.13  ? 22  ARG A CD  1 
ATOM   153  N NE  . ARG A  1 22 ? 36.732  -5.492  23.064  1.00 56.88  ? 22  ARG A NE  1 
ATOM   154  C CZ  . ARG A  1 22 ? 37.214  -6.174  24.097  1.00 60.18  ? 22  ARG A CZ  1 
ATOM   155  N NH1 . ARG A  1 22 ? 36.540  -7.211  24.572  1.00 85.29  ? 22  ARG A NH1 1 
ATOM   156  N NH2 . ARG A  1 22 ? 38.371  -5.829  24.649  1.00 43.74  ? 22  ARG A NH2 1 
ATOM   157  N N   . ARG A  1 23 ? 32.510  -1.910  23.288  1.00 29.15  ? 23  ARG A N   1 
ATOM   158  C CA  . ARG A  1 23 ? 32.771  -0.481  23.213  1.00 30.09  ? 23  ARG A CA  1 
ATOM   159  C C   . ARG A  1 23 ? 31.468  0.321   23.280  1.00 25.49  ? 23  ARG A C   1 
ATOM   160  O O   . ARG A  1 23 ? 31.508  1.494   23.670  1.00 26.15  ? 23  ARG A O   1 
ATOM   161  C CB  . ARG A  1 23 ? 33.555  -0.098  21.957  1.00 34.40  ? 23  ARG A CB  1 
ATOM   162  C CG  . ARG A  1 23 ? 34.954  -0.685  21.883  1.00 42.82  ? 23  ARG A CG  1 
ATOM   163  C CD  . ARG A  1 23 ? 35.747  -0.119  20.717  1.00 52.03  ? 23  ARG A CD  1 
ATOM   164  N NE  . ARG A  1 23 ? 35.041  -0.262  19.448  1.00 65.52  ? 23  ARG A NE  1 
ATOM   165  C CZ  . ARG A  1 23 ? 35.173  0.610   18.448  1.00 75.43  ? 23  ARG A CZ  1 
ATOM   166  N NH1 . ARG A  1 23 ? 35.978  1.660   18.598  1.00 72.03  ? 23  ARG A NH1 1 
ATOM   167  N NH2 . ARG A  1 23 ? 34.507  0.431   17.317  1.00 84.53  ? 23  ARG A NH2 1 
ATOM   168  N N   . TYR A  1 24 ? 30.337  -0.286  22.934  1.00 17.82  ? 24  TYR A N   1 
ATOM   169  C CA  . TYR A  1 24 ? 29.051  0.403   23.012  1.00 18.50  ? 24  TYR A CA  1 
ATOM   170  C C   . TYR A  1 24 ? 28.408  0.263   24.389  1.00 18.20  ? 24  TYR A C   1 
ATOM   171  O O   . TYR A  1 24 ? 28.535  -0.811  24.981  1.00 19.86  ? 24  TYR A O   1 
ATOM   172  C CB  . TYR A  1 24 ? 28.122  -0.154  21.929  1.00 17.09  ? 24  TYR A CB  1 
ATOM   173  C CG  . TYR A  1 24 ? 28.474  0.350   20.538  1.00 18.83  ? 24  TYR A CG  1 
ATOM   174  C CD1 . TYR A  1 24 ? 29.510  -0.235  19.819  1.00 20.95  ? 24  TYR A CD1 1 
ATOM   175  C CD2 . TYR A  1 24 ? 27.768  1.398   19.951  1.00 16.18  ? 24  TYR A CD2 1 
ATOM   176  C CE1 . TYR A  1 24 ? 29.844  0.204   18.551  1.00 22.98  ? 24  TYR A CE1 1 
ATOM   177  C CE2 . TYR A  1 24 ? 28.103  1.840   18.690  1.00 15.68  ? 24  TYR A CE2 1 
ATOM   178  C CZ  . TYR A  1 24 ? 29.131  1.249   17.997  1.00 23.65  ? 24  TYR A CZ  1 
ATOM   179  O OH  . TYR A  1 24 ? 29.462  1.694   16.731  1.00 24.74  ? 24  TYR A OH  1 
ATOM   180  N N   . LYS A  1 25 ? 27.745  1.299   24.887  1.00 15.98  ? 25  LYS A N   1 
ATOM   181  C CA  . LYS A  1 25 ? 27.002  1.284   26.138  1.00 16.83  ? 25  LYS A CA  1 
ATOM   182  C C   . LYS A  1 25 ? 25.515  1.526   25.878  1.00 16.08  ? 25  LYS A C   1 
ATOM   183  O O   . LYS A  1 25 ? 25.173  2.256   24.952  1.00 15.22  ? 25  LYS A O   1 
ATOM   184  C CB  . LYS A  1 25 ? 27.549  2.300   27.137  1.00 25.02  ? 25  LYS A CB  1 
ATOM   185  C CG  . LYS A  1 25 ? 29.043  2.100   27.405  1.00 28.89  ? 25  LYS A CG  1 
ATOM   186  C CD  . LYS A  1 25 ? 29.422  2.644   28.768  1.00 39.79  ? 25  LYS A CD  1 
ATOM   187  C CE  . LYS A  1 25 ? 30.909  2.540   29.062  1.00 40.24  ? 25  LYS A CE  1 
ATOM   188  N NZ  . LYS A  1 25 ? 31.690  2.107   27.868  1.00 44.20  ? 25  LYS A NZ  1 
ATOM   189  N N   . GLN A  1 26 ? 24.636  0.929   26.670  1.00 13.38  ? 26  GLN A N   1 
ATOM   190  C CA  . GLN A  1 26 ? 23.199  1.141   26.493  1.00 18.32  ? 26  GLN A CA  1 
ATOM   191  C C   . GLN A  1 26 ? 22.765  2.525   26.980  1.00 21.47  ? 26  GLN A C   1 
ATOM   192  O O   . GLN A  1 26 ? 23.123  2.936   28.085  1.00 16.76  ? 26  GLN A O   1 
ATOM   193  C CB  . GLN A  1 26 ? 22.369  0.075   27.213  1.00 15.73  ? 26  GLN A CB  1 
ATOM   194  C CG  . GLN A  1 26 ? 20.872  0.287   27.124  1.00 8.84   ? 26  GLN A CG  1 
ATOM   195  C CD  . GLN A  1 26 ? 20.044  -0.896  27.575  1.00 19.22  ? 26  GLN A CD  1 
ATOM   196  O OE1 . GLN A  1 26 ? 20.571  -1.929  27.996  1.00 23.52  ? 26  GLN A OE1 1 
ATOM   197  N NE2 . GLN A  1 26 ? 18.728  -0.738  27.461  1.00 18.73  ? 26  GLN A NE2 1 
ATOM   198  N N   . ILE A  1 27 ? 21.981  3.230   26.162  1.00 12.51  ? 27  ILE A N   1 
ATOM   199  C CA  . ILE A  1 27 ? 21.493  4.559   26.525  1.00 13.44  ? 27  ILE A CA  1 
ATOM   200  C C   . ILE A  1 27 ? 19.978  4.599   26.427  1.00 15.61  ? 27  ILE A C   1 
ATOM   201  O O   . ILE A  1 27 ? 19.318  5.626   26.656  1.00 14.47  ? 27  ILE A O   1 
ATOM   202  C CB  . ILE A  1 27 ? 22.137  5.665   25.669  1.00 12.15  ? 27  ILE A CB  1 
ATOM   203  C CG1 . ILE A  1 27 ? 21.672  5.645   24.219  1.00 16.53  ? 27  ILE A CG1 1 
ATOM   204  C CG2 . ILE A  1 27 ? 23.666  5.631   25.768  1.00 9.25   ? 27  ILE A CG2 1 
ATOM   205  C CD1 . ILE A  1 27 ? 22.148  6.789   23.352  1.00 11.19  ? 27  ILE A CD1 1 
ATOM   206  N N   . GLY A  1 28 ? 19.383  3.449   26.086  1.00 11.65  ? 28  GLY A N   1 
ATOM   207  C CA  . GLY A  1 28 ? 17.960  3.297   25.954  1.00 11.47  ? 28  GLY A CA  1 
ATOM   208  C C   . GLY A  1 28 ? 17.529  2.040   25.233  1.00 9.79   ? 28  GLY A C   1 
ATOM   209  O O   . GLY A  1 28 ? 18.273  1.070   25.188  1.00 14.28  ? 28  GLY A O   1 
ATOM   210  N N   . THR A  1 29 ? 16.311  2.048   24.697  1.00 9.24   ? 29  THR A N   1 
ATOM   211  C CA  . THR A  1 29 ? 15.839  0.946   23.867  1.00 12.36  ? 29  THR A CA  1 
ATOM   212  C C   . THR A  1 29 ? 15.379  1.443   22.493  1.00 13.46  ? 29  THR A C   1 
ATOM   213  O O   . THR A  1 29 ? 15.265  2.655   22.292  1.00 11.78  ? 29  THR A O   1 
ATOM   214  C CB  . THR A  1 29 ? 14.664  0.181   24.512  1.00 17.15  ? 29  THR A CB  1 
ATOM   215  O OG1 . THR A  1 29 ? 13.471  0.958   24.383  1.00 15.40  ? 29  THR A OG1 1 
ATOM   216  C CG2 . THR A  1 29 ? 14.984  -0.049  25.985  1.00 13.53  ? 29  THR A CG2 1 
ATOM   217  N N   . CYS A  1 30 ? 15.113  0.523   21.560  1.00 12.60  ? 30  CYS A N   1 
ATOM   218  C CA  . CYS A  1 30 ? 14.491  0.973   20.300  1.00 12.00  ? 30  CYS A CA  1 
ATOM   219  C C   . CYS A  1 30 ? 13.048  0.525   20.201  1.00 14.90  ? 30  CYS A C   1 
ATOM   220  O O   . CYS A  1 30 ? 12.470  0.365   19.132  1.00 11.80  ? 30  CYS A O   1 
ATOM   221  C CB  . CYS A  1 30 ? 15.370  0.534   19.112  1.00 12.21  ? 30  CYS A CB  1 
ATOM   222  S SG  . CYS A  1 30 ? 16.962  1.386   19.137  1.00 13.89  ? 30  CYS A SG  1 
ATOM   223  N N   . GLY A  1 31 ? 12.388  0.338   21.345  1.00 10.13  ? 31  GLY A N   1 
ATOM   224  C CA  . GLY A  1 31 ? 10.965  0.096   21.431  1.00 11.22  ? 31  GLY A CA  1 
ATOM   225  C C   . GLY A  1 31 ? 10.580  -1.361  21.218  1.00 17.59  ? 31  GLY A C   1 
ATOM   226  O O   . GLY A  1 31 ? 9.827   -1.910  22.018  1.00 18.84  ? 31  GLY A O   1 
ATOM   227  N N   . LEU A  1 32 ? 11.086  -2.008  20.169  1.00 15.96  ? 32  LEU A N   1 
ATOM   228  C CA  . LEU A  1 32 ? 10.759  -3.412  19.946  1.00 16.91  ? 32  LEU A CA  1 
ATOM   229  C C   . LEU A  1 32 ? 11.422  -4.268  21.011  1.00 13.44  ? 32  LEU A C   1 
ATOM   230  O O   . LEU A  1 32 ? 12.472  -3.922  21.530  1.00 16.99  ? 32  LEU A O   1 
ATOM   231  C CB  . LEU A  1 32 ? 11.200  -3.884  18.568  1.00 23.18  ? 32  LEU A CB  1 
ATOM   232  C CG  . LEU A  1 32 ? 10.856  -2.966  17.400  1.00 24.25  ? 32  LEU A CG  1 
ATOM   233  C CD1 . LEU A  1 32 ? 11.533  -3.487  16.141  1.00 24.36  ? 32  LEU A CD1 1 
ATOM   234  C CD2 . LEU A  1 32 ? 9.351   -2.843  17.230  1.00 24.34  ? 32  LEU A CD2 1 
ATOM   235  N N   . PRO A  1 33 ? 10.782  -5.370  21.357  1.00 19.93  ? 33  PRO A N   1 
ATOM   236  C CA  . PRO A  1 33 ? 11.270  -6.205  22.457  1.00 19.13  ? 33  PRO A CA  1 
ATOM   237  C C   . PRO A  1 33 ? 12.742  -6.590  22.333  1.00 19.25  ? 33  PRO A C   1 
ATOM   238  O O   . PRO A  1 33 ? 13.169  -7.028  21.258  1.00 25.31  ? 33  PRO A O   1 
ATOM   239  C CB  . PRO A  1 33 ? 10.391  -7.459  22.320  1.00 26.68  ? 33  PRO A CB  1 
ATOM   240  C CG  . PRO A  1 33 ? 9.131   -6.960  21.689  1.00 23.26  ? 33  PRO A CG  1 
ATOM   241  C CD  . PRO A  1 33 ? 9.550   -5.875  20.728  1.00 18.88  ? 33  PRO A CD  1 
ATOM   242  N N   . GLY A  1 34 ? 13.500  -6.431  23.405  1.00 18.33  ? 34  GLY A N   1 
ATOM   243  C CA  . GLY A  1 34 ? 14.914  -6.647  23.533  1.00 17.67  ? 34  GLY A CA  1 
ATOM   244  C C   . GLY A  1 34 ? 15.838  -5.754  22.727  1.00 18.36  ? 34  GLY A C   1 
ATOM   245  O O   . GLY A  1 34 ? 17.064  -5.931  22.809  1.00 18.67  ? 34  GLY A O   1 
ATOM   246  N N   . THR A  1 35 ? 15.312  -4.813  21.943  1.00 14.92  ? 35  THR A N   1 
ATOM   247  C CA  . THR A  1 35 ? 16.177  -3.933  21.161  1.00 15.29  ? 35  THR A CA  1 
ATOM   248  C C   . THR A  1 35 ? 16.858  -2.928  22.094  1.00 13.37  ? 35  THR A C   1 
ATOM   249  O O   . THR A  1 35 ? 16.239  -2.356  22.999  1.00 17.64  ? 35  THR A O   1 
ATOM   250  C CB  . THR A  1 35 ? 15.439  -3.206  20.023  1.00 16.66  ? 35  THR A CB  1 
ATOM   251  O OG1 . THR A  1 35 ? 14.363  -2.385  20.502  1.00 15.70  ? 35  THR A OG1 1 
ATOM   252  C CG2 . THR A  1 35 ? 14.793  -4.210  19.072  1.00 17.05  ? 35  THR A CG2 1 
ATOM   253  N N   . LYS A  1 36 ? 18.144  -2.718  21.898  1.00 12.47  ? 36  LYS A N   1 
ATOM   254  C CA  . LYS A  1 36 ? 18.925  -1.820  22.728  1.00 10.53  ? 36  LYS A CA  1 
ATOM   255  C C   . LYS A  1 36 ? 19.346  -0.588  21.923  1.00 16.21  ? 36  LYS A C   1 
ATOM   256  O O   . LYS A  1 36 ? 19.774  -0.777  20.788  1.00 13.77  ? 36  LYS A O   1 
ATOM   257  C CB  . LYS A  1 36 ? 20.184  -2.519  23.255  1.00 14.17  ? 36  LYS A CB  1 
ATOM   258  C CG  . LYS A  1 36 ? 19.946  -3.867  23.921  1.00 17.52  ? 36  LYS A CG  1 
ATOM   259  C CD  . LYS A  1 36 ? 18.811  -3.788  24.935  1.00 23.26  ? 36  LYS A CD  1 
ATOM   260  C CE  . LYS A  1 36 ? 18.619  -5.155  25.599  1.00 31.52  ? 36  LYS A CE  1 
ATOM   261  N NZ  . LYS A  1 36 ? 17.673  -5.084  26.745  1.00 31.36  ? 36  LYS A NZ  1 
ATOM   262  N N   . CYS A  1 37 ? 19.250  0.603   22.497  1.00 14.13  ? 37  CYS A N   1 
ATOM   263  C CA  . CYS A  1 37 ? 19.864  1.794   21.917  1.00 9.61   ? 37  CYS A CA  1 
ATOM   264  C C   . CYS A  1 37 ? 21.280  1.898   22.493  1.00 13.23  ? 37  CYS A C   1 
ATOM   265  O O   . CYS A  1 37 ? 21.370  1.923   23.738  1.00 13.88  ? 37  CYS A O   1 
ATOM   266  C CB  . CYS A  1 37 ? 19.056  3.064   22.168  1.00 11.41  ? 37  CYS A CB  1 
ATOM   267  S SG  . CYS A  1 37 ? 19.722  4.507   21.269  1.00 13.27  ? 37  CYS A SG  1 
ATOM   268  N N   . CYS A  1 38 ? 22.276  1.919   21.626  1.00 12.54  ? 38  CYS A N   1 
ATOM   269  C CA  . CYS A  1 38 ? 23.666  1.746   22.072  1.00 15.20  ? 38  CYS A CA  1 
ATOM   270  C C   . CYS A  1 38 ? 24.607  2.782   21.478  1.00 16.99  ? 38  CYS A C   1 
ATOM   271  O O   . CYS A  1 38 ? 24.511  3.075   20.282  1.00 15.71  ? 38  CYS A O   1 
ATOM   272  C CB  . CYS A  1 38 ? 24.235  0.359   21.708  1.00 11.91  ? 38  CYS A CB  1 
ATOM   273  S SG  . CYS A  1 38 ? 23.194  -1.054  22.111  1.00 14.67  ? 38  CYS A SG  1 
ATOM   274  N N   . LYS A  1 39 ? 25.522  3.308   22.290  1.00 13.01  ? 39  LYS A N   1 
ATOM   275  C CA  . LYS A  1 39 ? 26.403  4.358   21.797  1.00 9.67   ? 39  LYS A CA  1 
ATOM   276  C C   . LYS A  1 39 ? 27.761  4.306   22.483  1.00 16.13  ? 39  LYS A C   1 
ATOM   277  O O   . LYS A  1 39 ? 27.834  4.019   23.679  1.00 17.87  ? 39  LYS A O   1 
ATOM   278  C CB  . LYS A  1 39 ? 25.738  5.723   22.014  1.00 9.87   ? 39  LYS A CB  1 
ATOM   279  C CG  . LYS A  1 39 ? 26.390  6.862   21.237  1.00 16.17  ? 39  LYS A CG  1 
ATOM   280  C CD  . LYS A  1 39 ? 25.513  8.113   21.307  1.00 16.90  ? 39  LYS A CD  1 
ATOM   281  C CE  . LYS A  1 39 ? 26.135  9.261   20.521  1.00 20.68  ? 39  LYS A CE  1 
ATOM   282  N NZ  . LYS A  1 39 ? 27.383  9.781   21.127  1.00 23.77  ? 39  LYS A NZ  1 
ATOM   283  N N   A LYS A  1 40 ? 28.837  4.576   21.737  0.50 15.69  ? 40  LYS A N   1 
ATOM   284  N N   B LYS A  1 40 ? 28.835  4.581   21.736  0.50 15.64  ? 40  LYS A N   1 
ATOM   285  C CA  A LYS A  1 40 ? 30.146  4.583   22.401  0.50 21.80  ? 40  LYS A CA  1 
ATOM   286  C CA  B LYS A  1 40 ? 30.141  4.594   22.402  0.50 21.86  ? 40  LYS A CA  1 
ATOM   287  C C   A LYS A  1 40 ? 30.260  5.832   23.269  0.50 23.20  ? 40  LYS A C   1 
ATOM   288  C C   B LYS A  1 40 ? 30.251  5.840   23.274  0.50 23.16  ? 40  LYS A C   1 
ATOM   289  O O   A LYS A  1 40 ? 29.933  6.929   22.810  0.50 22.91  ? 40  LYS A O   1 
ATOM   290  O O   B LYS A  1 40 ? 29.913  6.937   22.825  0.50 22.74  ? 40  LYS A O   1 
ATOM   291  C CB  A LYS A  1 40 ? 31.273  4.506   21.377  0.50 24.31  ? 40  LYS A CB  1 
ATOM   292  C CB  B LYS A  1 40 ? 31.271  4.536   21.379  0.50 24.07  ? 40  LYS A CB  1 
ATOM   293  C CG  A LYS A  1 40 ? 31.266  3.218   20.560  0.50 22.88  ? 40  LYS A CG  1 
ATOM   294  C CG  B LYS A  1 40 ? 31.317  3.213   20.616  0.50 23.22  ? 40  LYS A CG  1 
ATOM   295  C CD  A LYS A  1 40 ? 32.497  3.122   19.668  0.50 27.46  ? 40  LYS A CD  1 
ATOM   296  C CD  B LYS A  1 40 ? 32.512  3.187   19.672  0.50 27.37  ? 40  LYS A CD  1 
ATOM   297  C CE  A LYS A  1 40 ? 32.361  3.997   18.432  0.50 28.78  ? 40  LYS A CE  1 
ATOM   298  C CE  B LYS A  1 40 ? 32.526  4.422   18.781  0.50 28.15  ? 40  LYS A CE  1 
ATOM   299  N NZ  A LYS A  1 40 ? 33.068  3.430   17.248  0.50 27.77  ? 40  LYS A NZ  1 
ATOM   300  N NZ  B LYS A  1 40 ? 31.476  4.352   17.724  0.50 26.61  ? 40  LYS A NZ  1 
ATOM   301  N N   . PRO A  1 41 ? 30.705  5.675   24.507  1.00 28.76  ? 41  PRO A N   1 
ATOM   302  C CA  . PRO A  1 41 ? 30.779  6.807   25.438  1.00 33.41  ? 41  PRO A CA  1 
ATOM   303  C C   . PRO A  1 41 ? 31.916  7.753   25.069  1.00 40.73  ? 41  PRO A C   1 
ATOM   304  O O   . PRO A  1 41 ? 32.653  7.461   24.114  1.00 45.64  ? 41  PRO A O   1 
ATOM   305  C CB  . PRO A  1 41 ? 31.076  6.158   26.789  1.00 34.45  ? 41  PRO A CB  1 
ATOM   306  C CG  . PRO A  1 41 ? 30.894  4.695   26.581  1.00 39.65  ? 41  PRO A CG  1 
ATOM   307  C CD  . PRO A  1 41 ? 31.178  4.432   25.124  1.00 29.95  ? 41  PRO A CD  1 
ATOM   308  O OXT . PRO A  1 41 ? 32.034  8.780   25.767  1.00 42.84  ? 41  PRO A OXT 1 
ATOM   309  N N   A GLY B  1 1  ? 16.686  -4.234  0.695   0.50 21.84  ? 1   GLY B N   1 
ATOM   310  N N   B GLY B  1 1  ? 14.891  -2.956  -0.998  0.50 12.32  ? 1   GLY B N   1 
ATOM   311  C CA  A GLY B  1 1  ? 15.773  -3.190  0.266   0.50 20.10  ? 1   GLY B CA  1 
ATOM   312  C CA  B GLY B  1 1  ? 15.654  -3.175  0.221   0.50 21.10  ? 1   GLY B CA  1 
ATOM   313  C C   A GLY B  1 1  ? 14.941  -2.691  1.432   0.50 20.74  ? 1   GLY B C   1 
ATOM   314  C C   B GLY B  1 1  ? 14.903  -2.702  1.446   0.50 20.69  ? 1   GLY B C   1 
ATOM   315  O O   A GLY B  1 1  ? 13.865  -2.116  1.303   0.50 24.80  ? 1   GLY B O   1 
ATOM   316  O O   B GLY B  1 1  ? 13.814  -2.128  1.376   0.50 23.34  ? 1   GLY B O   1 
ATOM   317  N N   . ILE B  1 2  ? 15.470  -2.931  2.630   1.00 21.57  ? 2   ILE B N   1 
ATOM   318  C CA  . ILE B  1 2  ? 14.779  -2.431  3.823   1.00 21.35  ? 2   ILE B CA  1 
ATOM   319  C C   . ILE B  1 2  ? 14.691  -0.913  3.764   1.00 21.96  ? 2   ILE B C   1 
ATOM   320  O O   . ILE B  1 2  ? 15.631  -0.260  3.295   1.00 16.44  ? 2   ILE B O   1 
ATOM   321  C CB  . ILE B  1 2  ? 15.544  -2.871  5.077   1.00 19.42  ? 2   ILE B CB  1 
ATOM   322  C CG1 . ILE B  1 2  ? 15.748  -4.392  5.150   1.00 29.51  ? 2   ILE B CG1 1 
ATOM   323  C CG2 . ILE B  1 2  ? 14.871  -2.305  6.317   1.00 19.31  ? 2   ILE B CG2 1 
ATOM   324  C CD1 . ILE B  1 2  ? 14.559  -5.192  5.606   1.00 22.36  ? 2   ILE B CD1 1 
ATOM   325  N N   . GLY B  1 3  ? 13.603  -0.335  4.253   1.00 13.28  ? 3   GLY B N   1 
ATOM   326  C CA  . GLY B  1 3  ? 13.434  1.093   4.220   1.00 15.36  ? 3   GLY B CA  1 
ATOM   327  C C   . GLY B  1 3  ? 12.943  1.668   5.533   1.00 14.83  ? 3   GLY B C   1 
ATOM   328  O O   . GLY B  1 3  ? 12.642  2.854   5.568   1.00 20.90  ? 3   GLY B O   1 
ATOM   329  N N   . ASP B  1 4  ? 12.862  0.824   6.560   1.00 20.11  ? 4   ASP B N   1 
ATOM   330  C CA  . ASP B  1 4  ? 12.388  1.365   7.840   1.00 27.09  ? 4   ASP B CA  1 
ATOM   331  C C   . ASP B  1 4  ? 12.938  0.553   9.003   1.00 20.31  ? 4   ASP B C   1 
ATOM   332  O O   . ASP B  1 4  ? 13.258  -0.632  8.875   1.00 16.40  ? 4   ASP B O   1 
ATOM   333  C CB  . ASP B  1 4  ? 10.859  1.414   7.844   1.00 25.73  ? 4   ASP B CB  1 
ATOM   334  C CG  . ASP B  1 4  ? 10.335  0.047   8.273   1.00 34.80  ? 4   ASP B CG  1 
ATOM   335  O OD1 . ASP B  1 4  ? 10.233  -0.789  7.356   1.00 26.84  ? 4   ASP B OD1 1 
ATOM   336  O OD2 . ASP B  1 4  ? 10.087  -0.132  9.487   1.00 23.98  ? 4   ASP B OD2 1 
ATOM   337  N N   . PRO B  1 5  ? 13.057  1.201   10.168  1.00 19.02  ? 5   PRO B N   1 
ATOM   338  C CA  . PRO B  1 5  ? 13.825  0.616   11.269  1.00 18.22  ? 5   PRO B CA  1 
ATOM   339  C C   . PRO B  1 5  ? 13.154  -0.627  11.832  1.00 18.43  ? 5   PRO B C   1 
ATOM   340  O O   . PRO B  1 5  ? 13.815  -1.551  12.319  1.00 17.15  ? 5   PRO B O   1 
ATOM   341  C CB  . PRO B  1 5  ? 13.879  1.731   12.326  1.00 15.48  ? 5   PRO B CB  1 
ATOM   342  C CG  . PRO B  1 5  ? 12.761  2.662   11.981  1.00 16.35  ? 5   PRO B CG  1 
ATOM   343  C CD  . PRO B  1 5  ? 12.455  2.491   10.519  1.00 17.76  ? 5   PRO B CD  1 
ATOM   344  N N   . VAL B  1 6  ? 11.814  -0.670  11.786  1.00 21.52  ? 6   VAL B N   1 
ATOM   345  C CA  . VAL B  1 6  ? 11.147  -1.824  12.402  1.00 26.02  ? 6   VAL B CA  1 
ATOM   346  C C   . VAL B  1 6  ? 11.409  -3.097  11.603  1.00 20.80  ? 6   VAL B C   1 
ATOM   347  O O   . VAL B  1 6  ? 11.793  -4.138  12.149  1.00 19.53  ? 6   VAL B O   1 
ATOM   348  C CB  . VAL B  1 6  ? 9.626   -1.624  12.550  1.00 27.34  ? 6   VAL B CB  1 
ATOM   349  C CG1 . VAL B  1 6  ? 9.009   -2.933  13.036  1.00 20.89  ? 6   VAL B CG1 1 
ATOM   350  C CG2 . VAL B  1 6  ? 9.288   -0.486  13.494  1.00 15.78  ? 6   VAL B CG2 1 
ATOM   351  N N   . THR B  1 7  ? 11.238  -2.997  10.281  1.00 25.38  ? 7   THR B N   1 
ATOM   352  C CA  . THR B  1 7  ? 11.548  -4.144  9.421   1.00 24.32  ? 7   THR B CA  1 
ATOM   353  C C   . THR B  1 7  ? 12.987  -4.596  9.594   1.00 20.59  ? 7   THR B C   1 
ATOM   354  O O   . THR B  1 7  ? 13.327  -5.776  9.596   1.00 24.75  ? 7   THR B O   1 
ATOM   355  C CB  . THR B  1 7  ? 11.310  -3.801  7.935   1.00 20.81  ? 7   THR B CB  1 
ATOM   356  O OG1 . THR B  1 7  ? 10.017  -3.212  7.845   1.00 19.20  ? 7   THR B OG1 1 
ATOM   357  C CG2 . THR B  1 7  ? 11.350  -5.054  7.075   1.00 27.66  ? 7   THR B CG2 1 
ATOM   358  N N   . CYS B  1 8  ? 13.872  -3.610  9.763   1.00 21.62  ? 8   CYS B N   1 
ATOM   359  C CA  . CYS B  1 8  ? 15.286  -3.942  9.933   1.00 17.84  ? 8   CYS B CA  1 
ATOM   360  C C   . CYS B  1 8  ? 15.498  -4.786  11.174  1.00 17.09  ? 8   CYS B C   1 
ATOM   361  O O   . CYS B  1 8  ? 16.063  -5.873  11.178  1.00 18.43  ? 8   CYS B O   1 
ATOM   362  C CB  . CYS B  1 8  ? 16.107  -2.655  10.005  1.00 13.97  ? 8   CYS B CB  1 
ATOM   363  S SG  . CYS B  1 8  ? 17.901  -2.896  10.084  1.00 16.29  ? 8   CYS B SG  1 
ATOM   364  N N   . LEU B  1 9  ? 15.023  -4.236  12.296  1.00 14.09  ? 9   LEU B N   1 
ATOM   365  C CA  . LEU B  1 9  ? 15.257  -4.872  13.577  1.00 13.73  ? 9   LEU B CA  1 
ATOM   366  C C   . LEU B  1 9  ? 14.536  -6.206  13.727  1.00 14.19  ? 9   LEU B C   1 
ATOM   367  O O   . LEU B  1 9  ? 15.094  -7.173  14.267  1.00 18.89  ? 9   LEU B O   1 
ATOM   368  C CB  . LEU B  1 9  ? 14.846  -3.845  14.640  1.00 13.06  ? 9   LEU B CB  1 
ATOM   369  C CG  . LEU B  1 9  ? 15.796  -2.654  14.768  1.00 14.86  ? 9   LEU B CG  1 
ATOM   370  C CD1 . LEU B  1 9  ? 15.166  -1.617  15.693  1.00 14.18  ? 9   LEU B CD1 1 
ATOM   371  C CD2 . LEU B  1 9  ? 17.168  -3.065  15.286  1.00 12.28  ? 9   LEU B CD2 1 
ATOM   372  N N   . LYS B  1 10 ? 13.290  -6.291  13.268  1.00 21.65  ? 10  LYS B N   1 
ATOM   373  C CA  . LYS B  1 10 ? 12.563  -7.555  13.434  1.00 26.19  ? 10  LYS B CA  1 
ATOM   374  C C   . LYS B  1 10 ? 13.304  -8.715  12.766  1.00 27.69  ? 10  LYS B C   1 
ATOM   375  O O   . LYS B  1 10 ? 13.228  -9.849  13.250  1.00 24.00  ? 10  LYS B O   1 
ATOM   376  C CB  . LYS B  1 10 ? 11.133  -7.449  12.921  1.00 36.54  ? 10  LYS B CB  1 
ATOM   377  C CG  . LYS B  1 10 ? 10.928  -7.040  11.475  1.00 40.43  ? 10  LYS B CG  1 
ATOM   378  C CD  . LYS B  1 10 ? 9.437   -6.946  11.165  1.00 43.47  ? 10  LYS B CD  1 
ATOM   379  C CE  . LYS B  1 10 ? 9.151   -6.881  9.679   1.00 44.95  ? 10  LYS B CE  1 
ATOM   380  N NZ  . LYS B  1 10 ? 8.240   -5.739  9.336   1.00 52.88  ? 10  LYS B NZ  1 
ATOM   381  N N   . SER B  1 11 ? 14.021  -8.426  11.684  1.00 20.15  ? 11  SER B N   1 
ATOM   382  C CA  . SER B  1 11 ? 14.800  -9.437  10.977  1.00 17.24  ? 11  SER B CA  1 
ATOM   383  C C   . SER B  1 11 ? 16.066  -9.814  11.713  1.00 20.50  ? 11  SER B C   1 
ATOM   384  O O   . SER B  1 11 ? 16.780  -10.740 11.337  1.00 31.22  ? 11  SER B O   1 
ATOM   385  C CB  . SER B  1 11 ? 15.102  -8.917  9.561   1.00 21.63  ? 11  SER B CB  1 
ATOM   386  O OG  . SER B  1 11 ? 16.247  -8.087  9.552   1.00 21.03  ? 11  SER B OG  1 
ATOM   387  N N   . GLY B  1 12 ? 16.405  -9.131  12.810  1.00 20.05  ? 12  GLY B N   1 
ATOM   388  C CA  . GLY B  1 12 ? 17.650  -9.496  13.479  1.00 21.23  ? 12  GLY B CA  1 
ATOM   389  C C   . GLY B  1 12 ? 18.801  -8.620  13.026  1.00 22.91  ? 12  GLY B C   1 
ATOM   390  O O   . GLY B  1 12 ? 19.892  -8.738  13.594  1.00 28.14  ? 12  GLY B O   1 
ATOM   391  N N   . ALA B  1 13 ? 18.562  -7.773  12.022  1.00 19.40  ? 13  ALA B N   1 
ATOM   392  C CA  . ALA B  1 13 ? 19.591  -6.851  11.552  1.00 23.20  ? 13  ALA B CA  1 
ATOM   393  C C   . ALA B  1 13 ? 19.702  -5.667  12.516  1.00 18.84  ? 13  ALA B C   1 
ATOM   394  O O   . ALA B  1 13 ? 18.961  -5.568  13.491  1.00 19.08  ? 13  ALA B O   1 
ATOM   395  C CB  . ALA B  1 13 ? 19.323  -6.370  10.138  1.00 17.52  ? 13  ALA B CB  1 
ATOM   396  N N   A ILE B  1 14 ? 20.653  -4.790  12.230  0.50 14.90  ? 14  ILE B N   1 
ATOM   397  N N   B ILE B  1 14 ? 20.653  -4.797  12.216  0.50 14.98  ? 14  ILE B N   1 
ATOM   398  C CA  A ILE B  1 14 ? 21.031  -3.672  13.082  0.50 16.86  ? 14  ILE B CA  1 
ATOM   399  C CA  B ILE B  1 14 ? 20.952  -3.660  13.073  0.50 17.17  ? 14  ILE B CA  1 
ATOM   400  C C   A ILE B  1 14 ? 21.015  -2.342  12.335  0.50 16.55  ? 14  ILE B C   1 
ATOM   401  C C   B ILE B  1 14 ? 20.914  -2.350  12.293  0.50 16.99  ? 14  ILE B C   1 
ATOM   402  O O   A ILE B  1 14 ? 21.394  -2.255  11.167  0.50 15.90  ? 14  ILE B O   1 
ATOM   403  O O   B ILE B  1 14 ? 21.182  -2.296  11.095  0.50 14.88  ? 14  ILE B O   1 
ATOM   404  C CB  A ILE B  1 14 ? 22.440  -3.877  13.668  0.50 16.56  ? 14  ILE B CB  1 
ATOM   405  C CB  B ILE B  1 14 ? 22.340  -3.788  13.720  0.50 16.37  ? 14  ILE B CB  1 
ATOM   406  C CG1 A ILE B  1 14 ? 22.629  -5.198  14.426  0.50 12.92  ? 14  ILE B CG1 1 
ATOM   407  C CG1 B ILE B  1 14 ? 22.686  -2.639  14.660  0.50 22.75  ? 14  ILE B CG1 1 
ATOM   408  C CG2 A ILE B  1 14 ? 22.831  -2.701  14.549  0.50 26.49  ? 14  ILE B CG2 1 
ATOM   409  C CG2 B ILE B  1 14 ? 23.396  -3.943  12.640  0.50 13.46  ? 14  ILE B CG2 1 
ATOM   410  C CD1 A ILE B  1 14 ? 24.036  -5.734  14.281  0.50 21.56  ? 14  ILE B CD1 1 
ATOM   411  C CD1 B ILE B  1 14 ? 24.120  -2.590  15.113  0.50 30.79  ? 14  ILE B CD1 1 
ATOM   412  N N   . CYS B  1 15 ? 20.561  -1.299  13.027  1.00 10.96  ? 15  CYS B N   1 
ATOM   413  C CA  . CYS B  1 15 ? 20.511  0.032   12.442  1.00 13.53  ? 15  CYS B CA  1 
ATOM   414  C C   . CYS B  1 15 ? 21.730  0.836   12.896  1.00 14.46  ? 15  CYS B C   1 
ATOM   415  O O   . CYS B  1 15 ? 21.911  0.970   14.110  1.00 14.89  ? 15  CYS B O   1 
ATOM   416  C CB  . CYS B  1 15 ? 19.260  0.825   12.831  1.00 13.77  ? 15  CYS B CB  1 
ATOM   417  S SG  . CYS B  1 15 ? 17.688  0.166   12.213  1.00 15.00  ? 15  CYS B SG  1 
ATOM   418  N N   . HIS B  1 16 ? 22.453  1.354   11.920  1.00 11.82  ? 16  HIS B N   1 
ATOM   419  C CA  . HIS B  1 16 ? 23.582  2.253   12.178  1.00 12.61  ? 16  HIS B CA  1 
ATOM   420  C C   . HIS B  1 16 ? 23.240  3.644   11.647  1.00 12.31  ? 16  HIS B C   1 
ATOM   421  O O   . HIS B  1 16 ? 22.540  3.720   10.630  1.00 10.62  ? 16  HIS B O   1 
ATOM   422  C CB  . HIS B  1 16 ? 24.866  1.712   11.530  1.00 11.39  ? 16  HIS B CB  1 
ATOM   423  C CG  . HIS B  1 16 ? 25.559  0.761   12.460  1.00 17.52  ? 16  HIS B CG  1 
ATOM   424  N ND1 . HIS B  1 16 ? 26.707  1.080   13.156  1.00 15.87  ? 16  HIS B ND1 1 
ATOM   425  C CD2 . HIS B  1 16 ? 25.220  -0.505  12.812  1.00 16.88  ? 16  HIS B CD2 1 
ATOM   426  C CE1 . HIS B  1 16 ? 27.053  0.040   13.897  1.00 15.81  ? 16  HIS B CE1 1 
ATOM   427  N NE2 . HIS B  1 16 ? 26.173  -0.934  13.695  1.00 18.05  ? 16  HIS B NE2 1 
ATOM   428  N N   . PRO B  1 17 ? 23.682  4.701   12.315  1.00 13.38  ? 17  PRO B N   1 
ATOM   429  C CA  . PRO B  1 17 ? 23.313  6.061   11.896  1.00 11.26  ? 17  PRO B CA  1 
ATOM   430  C C   . PRO B  1 17 ? 23.929  6.550   10.585  1.00 15.06  ? 17  PRO B C   1 
ATOM   431  O O   . PRO B  1 17 ? 23.275  7.429   9.998   1.00 16.66  ? 17  PRO B O   1 
ATOM   432  C CB  . PRO B  1 17 ? 23.829  6.917   13.059  1.00 15.15  ? 17  PRO B CB  1 
ATOM   433  C CG  . PRO B  1 17 ? 25.000  6.159   13.596  1.00 13.57  ? 17  PRO B CG  1 
ATOM   434  C CD  . PRO B  1 17 ? 24.531  4.718   13.522  1.00 16.17  ? 17  PRO B CD  1 
ATOM   435  N N   . VAL B  1 18 ? 25.087  6.067   10.146  1.00 13.58  ? 18  VAL B N   1 
ATOM   436  C CA  . VAL B  1 18 ? 25.723  6.568   8.916   1.00 13.70  ? 18  VAL B CA  1 
ATOM   437  C C   . VAL B  1 18 ? 26.275  5.465   8.025   1.00 12.90  ? 18  VAL B C   1 
ATOM   438  O O   . VAL B  1 18 ? 26.066  5.409   6.808   1.00 17.28  ? 18  VAL B O   1 
ATOM   439  C CB  . VAL B  1 18 ? 26.871  7.531   9.303   1.00 22.23  ? 18  VAL B CB  1 
ATOM   440  C CG1 . VAL B  1 18 ? 27.630  8.035   8.088   1.00 20.42  ? 18  VAL B CG1 1 
ATOM   441  C CG2 . VAL B  1 18 ? 26.348  8.732   10.091  1.00 22.83  ? 18  VAL B CG2 1 
ATOM   442  N N   . PHE B  1 19 ? 27.034  4.519   8.601   1.00 15.36  ? 19  PHE B N   1 
ATOM   443  C CA  . PHE B  1 19 ? 27.616  3.451   7.791   1.00 16.75  ? 19  PHE B CA  1 
ATOM   444  C C   . PHE B  1 19 ? 27.582  2.126   8.553   1.00 14.25  ? 19  PHE B C   1 
ATOM   445  O O   . PHE B  1 19 ? 27.520  2.089   9.779   1.00 13.06  ? 19  PHE B O   1 
ATOM   446  C CB  . PHE B  1 19 ? 29.031  3.808   7.368   1.00 19.01  ? 19  PHE B CB  1 
ATOM   447  C CG  . PHE B  1 19 ? 29.942  4.264   8.479   1.00 28.80  ? 19  PHE B CG  1 
ATOM   448  C CD1 . PHE B  1 19 ? 30.687  3.337   9.185   1.00 38.20  ? 19  PHE B CD1 1 
ATOM   449  C CD2 . PHE B  1 19 ? 30.040  5.605   8.797   1.00 29.23  ? 19  PHE B CD2 1 
ATOM   450  C CE1 . PHE B  1 19 ? 31.532  3.735   10.206  1.00 42.06  ? 19  PHE B CE1 1 
ATOM   451  C CE2 . PHE B  1 19 ? 30.875  6.011   9.822   1.00 30.32  ? 19  PHE B CE2 1 
ATOM   452  C CZ  . PHE B  1 19 ? 31.614  5.079   10.521  1.00 37.73  ? 19  PHE B CZ  1 
ATOM   453  N N   . CYS B  1 20 ? 27.592  1.039   7.784   1.00 15.29  ? 20  CYS B N   1 
ATOM   454  C CA  . CYS B  1 20 ? 27.614  -0.290  8.368   1.00 15.43  ? 20  CYS B CA  1 
ATOM   455  C C   . CYS B  1 20 ? 29.027  -0.604  8.848   1.00 19.04  ? 20  CYS B C   1 
ATOM   456  O O   . CYS B  1 20 ? 29.987  -0.199  8.215   1.00 18.42  ? 20  CYS B O   1 
ATOM   457  C CB  . CYS B  1 20 ? 27.193  -1.387  7.386   1.00 15.07  ? 20  CYS B CB  1 
ATOM   458  S SG  . CYS B  1 20 ? 25.439  -1.375  6.982   1.00 14.61  ? 20  CYS B SG  1 
ATOM   459  N N   . PRO B  1 21 ? 29.143  -1.324  9.950   1.00 18.63  ? 21  PRO B N   1 
ATOM   460  C CA  . PRO B  1 21 ? 30.499  -1.618  10.444  1.00 20.92  ? 21  PRO B CA  1 
ATOM   461  C C   . PRO B  1 21 ? 31.183  -2.628  9.522   1.00 16.18  ? 21  PRO B C   1 
ATOM   462  O O   . PRO B  1 21 ? 30.527  -3.288  8.715   1.00 15.78  ? 21  PRO B O   1 
ATOM   463  C CB  . PRO B  1 21 ? 30.255  -2.200  11.823  1.00 23.12  ? 21  PRO B CB  1 
ATOM   464  C CG  . PRO B  1 21 ? 28.822  -2.585  11.885  1.00 25.69  ? 21  PRO B CG  1 
ATOM   465  C CD  . PRO B  1 21 ? 28.085  -1.894  10.781  1.00 19.35  ? 21  PRO B CD  1 
ATOM   466  N N   . ARG B  1 22 ? 32.497  -2.715  9.698   1.00 20.25  ? 22  ARG B N   1 
ATOM   467  C CA  . ARG B  1 22 ? 33.300  -3.649  8.930   1.00 24.15  ? 22  ARG B CA  1 
ATOM   468  C C   . ARG B  1 22 ? 32.694  -5.044  8.895   1.00 20.04  ? 22  ARG B C   1 
ATOM   469  O O   . ARG B  1 22 ? 32.247  -5.573  9.909   1.00 21.88  ? 22  ARG B O   1 
ATOM   470  C CB  . ARG B  1 22 ? 34.727  -3.738  9.502   1.00 33.35  ? 22  ARG B CB  1 
ATOM   471  C CG  . ARG B  1 22 ? 35.589  -4.739  8.736   1.00 46.04  ? 22  ARG B CG  1 
ATOM   472  C CD  . ARG B  1 22 ? 36.993  -4.808  9.320   1.00 56.90  ? 22  ARG B CD  1 
ATOM   473  N NE  . ARG B  1 22 ? 36.952  -4.905  10.777  1.00 61.76  ? 22  ARG B NE  1 
ATOM   474  C CZ  . ARG B  1 22 ? 37.846  -4.347  11.590  1.00 62.40  ? 22  ARG B CZ  1 
ATOM   475  N NH1 . ARG B  1 22 ? 38.855  -3.660  11.088  1.00 74.52  ? 22  ARG B NH1 1 
ATOM   476  N NH2 . ARG B  1 22 ? 37.720  -4.492  12.902  1.00 66.23  ? 22  ARG B NH2 1 
ATOM   477  N N   . ARG B  1 23 ? 32.693  -5.594  7.683   1.00 24.21  ? 23  ARG B N   1 
ATOM   478  C CA  . ARG B  1 23 ? 32.225  -6.939  7.416   1.00 20.61  ? 23  ARG B CA  1 
ATOM   479  C C   . ARG B  1 23 ? 30.706  -7.064  7.415   1.00 19.12  ? 23  ARG B C   1 
ATOM   480  O O   . ARG B  1 23 ? 30.208  -8.059  6.890   1.00 23.42  ? 23  ARG B O   1 
ATOM   481  C CB  . ARG B  1 23 ? 32.810  -7.898  8.456   1.00 40.14  ? 23  ARG B CB  1 
ATOM   482  C CG  . ARG B  1 23 ? 34.318  -8.069  8.360   1.00 50.18  ? 23  ARG B CG  1 
ATOM   483  C CD  . ARG B  1 23 ? 34.817  -8.908  9.531   1.00 58.90  ? 23  ARG B CD  1 
ATOM   484  N NE  . ARG B  1 23 ? 35.324  -8.058  10.604  1.00 69.43  ? 23  ARG B NE  1 
ATOM   485  C CZ  . ARG B  1 23 ? 36.302  -8.366  11.447  1.00 67.25  ? 23  ARG B CZ  1 
ATOM   486  N NH1 . ARG B  1 23 ? 36.918  -9.541  11.358  1.00 42.55  ? 23  ARG B NH1 1 
ATOM   487  N NH2 . ARG B  1 23 ? 36.670  -7.501  12.385  1.00 62.43  ? 23  ARG B NH2 1 
ATOM   488  N N   . TYR B  1 24 ? 29.976  -6.109  7.986   1.00 18.25  ? 24  TYR B N   1 
ATOM   489  C CA  . TYR B  1 24 ? 28.516  -6.151  7.911   1.00 13.67  ? 24  TYR B CA  1 
ATOM   490  C C   . TYR B  1 24 ? 28.061  -5.852  6.484   1.00 18.50  ? 24  TYR B C   1 
ATOM   491  O O   . TYR B  1 24 ? 28.763  -5.145  5.762   1.00 17.73  ? 24  TYR B O   1 
ATOM   492  C CB  . TYR B  1 24 ? 27.868  -5.146  8.879   1.00 20.64  ? 24  TYR B CB  1 
ATOM   493  C CG  . TYR B  1 24 ? 27.686  -5.813  10.233  1.00 27.53  ? 24  TYR B CG  1 
ATOM   494  C CD1 . TYR B  1 24 ? 28.790  -6.309  10.908  1.00 28.98  ? 24  TYR B CD1 1 
ATOM   495  C CD2 . TYR B  1 24 ? 26.435  -5.954  10.814  1.00 32.79  ? 24  TYR B CD2 1 
ATOM   496  C CE1 . TYR B  1 24 ? 28.654  -6.927  12.138  1.00 31.12  ? 24  TYR B CE1 1 
ATOM   497  C CE2 . TYR B  1 24 ? 26.291  -6.571  12.043  1.00 39.52  ? 24  TYR B CE2 1 
ATOM   498  C CZ  . TYR B  1 24 ? 27.403  -7.052  12.698  1.00 41.69  ? 24  TYR B CZ  1 
ATOM   499  O OH  . TYR B  1 24 ? 27.245  -7.665  13.922  1.00 49.29  ? 24  TYR B OH  1 
ATOM   500  N N   . LYS B  1 25 ? 26.913  -6.387  6.107   1.00 17.76  ? 25  LYS B N   1 
ATOM   501  C CA  . LYS B  1 25 ? 26.297  -6.120  4.816   1.00 23.59  ? 25  LYS B CA  1 
ATOM   502  C C   . LYS B  1 25 ? 25.157  -5.108  4.878   1.00 15.71  ? 25  LYS B C   1 
ATOM   503  O O   . LYS B  1 25 ? 24.193  -5.297  5.619   1.00 17.04  ? 25  LYS B O   1 
ATOM   504  C CB  . LYS B  1 25 ? 25.774  -7.441  4.228   1.00 21.77  ? 25  LYS B CB  1 
ATOM   505  C CG  . LYS B  1 25 ? 26.920  -8.404  3.922   1.00 42.64  ? 25  LYS B CG  1 
ATOM   506  C CD  . LYS B  1 25 ? 27.315  -9.182  5.171   1.00 57.92  ? 25  LYS B CD  1 
ATOM   507  C CE  . LYS B  1 25 ? 28.376  -10.231 4.860   1.00 67.42  ? 25  LYS B CE  1 
ATOM   508  N NZ  . LYS B  1 25 ? 27.788  -11.599 4.725   1.00 80.17  ? 25  LYS B NZ  1 
ATOM   509  N N   . GLN B  1 26 ? 25.256  -4.057  4.086   1.00 12.11  ? 26  GLN B N   1 
ATOM   510  C CA  . GLN B  1 26 ? 24.202  -3.071  3.923   1.00 13.75  ? 26  GLN B CA  1 
ATOM   511  C C   . GLN B  1 26 ? 22.996  -3.647  3.182   1.00 18.66  ? 26  GLN B C   1 
ATOM   512  O O   . GLN B  1 26 ? 23.102  -4.037  2.019   1.00 17.08  ? 26  GLN B O   1 
ATOM   513  C CB  . GLN B  1 26 ? 24.687  -1.853  3.142   1.00 17.26  ? 26  GLN B CB  1 
ATOM   514  C CG  . GLN B  1 26 ? 23.621  -0.748  3.125   1.00 16.19  ? 26  GLN B CG  1 
ATOM   515  C CD  . GLN B  1 26 ? 24.232  0.470   2.462   1.00 15.37  ? 26  GLN B CD  1 
ATOM   516  O OE1 . GLN B  1 26 ? 25.325  0.884   2.850   1.00 18.77  ? 26  GLN B OE1 1 
ATOM   517  N NE2 . GLN B  1 26 ? 23.558  1.017   1.468   1.00 15.69  ? 26  GLN B NE2 1 
ATOM   518  N N   A ILE B  1 27 ? 21.859  -3.653  3.864   0.50 14.21  ? 27  ILE B N   1 
ATOM   519  N N   B ILE B  1 27 ? 21.865  -3.720  3.890   0.50 13.80  ? 27  ILE B N   1 
ATOM   520  C CA  A ILE B  1 27 ? 20.671  -4.281  3.277   0.50 15.75  ? 27  ILE B CA  1 
ATOM   521  C CA  B ILE B  1 27 ? 20.687  -4.327  3.263   0.50 15.86  ? 27  ILE B CA  1 
ATOM   522  C C   A ILE B  1 27 ? 19.545  -3.305  3.021   0.50 18.43  ? 27  ILE B C   1 
ATOM   523  C C   B ILE B  1 27 ? 19.534  -3.339  3.134   0.50 18.66  ? 27  ILE B C   1 
ATOM   524  O O   A ILE B  1 27 ? 18.492  -3.627  2.468   0.50 16.42  ? 27  ILE B O   1 
ATOM   525  O O   B ILE B  1 27 ? 18.429  -3.740  2.749   0.50 14.14  ? 27  ILE B O   1 
ATOM   526  C CB  A ILE B  1 27 ? 20.260  -5.391  4.258   0.50 18.32  ? 27  ILE B CB  1 
ATOM   527  C CB  B ILE B  1 27 ? 20.268  -5.596  4.030   0.50 16.00  ? 27  ILE B CB  1 
ATOM   528  C CG1 A ILE B  1 27 ? 21.241  -6.583  4.172   0.50 17.39  ? 27  ILE B CG1 1 
ATOM   529  C CG1 B ILE B  1 27 ? 19.747  -5.365  5.453   0.50 8.70   ? 27  ILE B CG1 1 
ATOM   530  C CG2 A ILE B  1 27 ? 18.833  -5.855  4.121   0.50 30.98  ? 27  ILE B CG2 1 
ATOM   531  C CG2 B ILE B  1 27 ? 21.421  -6.601  4.076   0.50 12.42  ? 27  ILE B CG2 1 
ATOM   532  C CD1 A ILE B  1 27 ? 20.698  -7.696  5.031   0.50 29.61  ? 27  ILE B CD1 1 
ATOM   533  C CD1 B ILE B  1 27 ? 18.936  -6.535  5.973   0.50 8.64   ? 27  ILE B CD1 1 
ATOM   534  N N   . GLY B  1 28 ? 19.774  -2.060  3.433   1.00 16.43  ? 28  GLY B N   1 
ATOM   535  C CA  . GLY B  1 28 ? 18.799  -1.007  3.263   1.00 13.83  ? 28  GLY B CA  1 
ATOM   536  C C   . GLY B  1 28 ? 19.094  0.142   4.218   1.00 13.50  ? 28  GLY B C   1 
ATOM   537  O O   . GLY B  1 28 ? 20.220  0.250   4.683   1.00 15.49  ? 28  GLY B O   1 
ATOM   538  N N   . THR B  1 29 ? 18.076  0.963   4.476   1.00 15.63  ? 29  THR B N   1 
ATOM   539  C CA  . THR B  1 29 ? 18.210  2.071   5.419   1.00 14.66  ? 29  THR B CA  1 
ATOM   540  C C   . THR B  1 29 ? 17.369  1.801   6.665   1.00 16.05  ? 29  THR B C   1 
ATOM   541  O O   . THR B  1 29 ? 16.645  0.813   6.708   1.00 14.75  ? 29  THR B O   1 
ATOM   542  C CB  . THR B  1 29 ? 17.711  3.391   4.824   1.00 17.77  ? 29  THR B CB  1 
ATOM   543  O OG1 . THR B  1 29 ? 16.274  3.328   4.813   1.00 17.59  ? 29  THR B OG1 1 
ATOM   544  C CG2 . THR B  1 29 ? 18.162  3.527   3.373   1.00 17.99  ? 29  THR B CG2 1 
ATOM   545  N N   . CYS B  1 30 ? 17.459  2.699   7.645   1.00 14.90  ? 30  CYS B N   1 
ATOM   546  C CA  . CYS B  1 30 ? 16.516  2.567   8.769   1.00 14.84  ? 30  CYS B CA  1 
ATOM   547  C C   . CYS B  1 30 ? 15.588  3.783   8.821   1.00 13.65  ? 30  CYS B C   1 
ATOM   548  O O   . CYS B  1 30 ? 15.257  4.280   9.896   1.00 14.65  ? 30  CYS B O   1 
ATOM   549  C CB  . CYS B  1 30 ? 17.285  2.318   10.069  1.00 16.93  ? 30  CYS B CB  1 
ATOM   550  S SG  . CYS B  1 30 ? 17.808  0.580   10.201  1.00 14.91  ? 30  CYS B SG  1 
ATOM   551  N N   . GLY B  1 31 ? 15.181  4.253   7.640   1.00 16.31  ? 31  GLY B N   1 
ATOM   552  C CA  . GLY B  1 31 ? 14.205  5.317   7.503   1.00 18.10  ? 31  GLY B CA  1 
ATOM   553  C C   . GLY B  1 31 ? 14.770  6.714   7.583   1.00 16.70  ? 31  GLY B C   1 
ATOM   554  O O   . GLY B  1 31 ? 14.761  7.465   6.608   1.00 20.87  ? 31  GLY B O   1 
ATOM   555  N N   . LEU B  1 32 ? 15.282  7.071   8.756   1.00 14.12  ? 32  LEU B N   1 
ATOM   556  C CA  . LEU B  1 32 ? 15.917  8.363   8.978   1.00 11.66  ? 32  LEU B CA  1 
ATOM   557  C C   . LEU B  1 32 ? 17.015  8.561   7.951   1.00 19.15  ? 32  LEU B C   1 
ATOM   558  O O   . LEU B  1 32 ? 17.790  7.603   7.728   1.00 19.25  ? 32  LEU B O   1 
ATOM   559  C CB  . LEU B  1 32 ? 16.413  8.391   10.435  1.00 16.99  ? 32  LEU B CB  1 
ATOM   560  C CG  . LEU B  1 32 ? 17.008  9.734   10.882  1.00 19.18  ? 32  LEU B CG  1 
ATOM   561  C CD1 . LEU B  1 32 ? 15.884  10.733  11.144  1.00 15.07  ? 32  LEU B CD1 1 
ATOM   562  C CD2 . LEU B  1 32 ? 17.924  9.563   12.091  1.00 16.91  ? 32  LEU B CD2 1 
ATOM   563  N N   . PRO B  1 33 ? 17.106  9.712   7.299   1.00 14.34  ? 33  PRO B N   1 
ATOM   564  C CA  . PRO B  1 33 ? 18.109  9.886   6.243   1.00 18.00  ? 33  PRO B CA  1 
ATOM   565  C C   . PRO B  1 33 ? 19.514  9.583   6.775   1.00 16.81  ? 33  PRO B C   1 
ATOM   566  O O   . PRO B  1 33 ? 19.841  10.001  7.887   1.00 19.74  ? 33  PRO B O   1 
ATOM   567  C CB  . PRO B  1 33 ? 17.974  11.356  5.830   1.00 16.71  ? 33  PRO B CB  1 
ATOM   568  C CG  . PRO B  1 33 ? 16.551  11.682  6.171   1.00 19.06  ? 33  PRO B CG  1 
ATOM   569  C CD  . PRO B  1 33 ? 16.299  10.940  7.461   1.00 17.32  ? 33  PRO B CD  1 
ATOM   570  N N   . GLY B  1 34 ? 20.255  8.855   5.954   1.00 19.07  ? 34  GLY B N   1 
ATOM   571  C CA  . GLY B  1 34 ? 21.657  8.551   6.245   1.00 18.12  ? 34  GLY B CA  1 
ATOM   572  C C   . GLY B  1 34 ? 21.854  7.235   6.953   1.00 12.54  ? 34  GLY B C   1 
ATOM   573  O O   . GLY B  1 34 ? 22.945  6.641   6.910   1.00 15.47  ? 34  GLY B O   1 
ATOM   574  N N   . THR B  1 35 ? 20.805  6.735   7.602   1.00 13.48  ? 35  THR B N   1 
ATOM   575  C CA  . THR B  1 35 ? 20.899  5.510   8.388   1.00 13.23  ? 35  THR B CA  1 
ATOM   576  C C   . THR B  1 35 ? 20.973  4.254   7.526   1.00 16.22  ? 35  THR B C   1 
ATOM   577  O O   . THR B  1 35 ? 20.528  4.204   6.372   1.00 13.96  ? 35  THR B O   1 
ATOM   578  C CB  . THR B  1 35 ? 19.723  5.355   9.373   1.00 15.47  ? 35  THR B CB  1 
ATOM   579  O OG1 . THR B  1 35 ? 18.487  5.140   8.663   1.00 13.82  ? 35  THR B OG1 1 
ATOM   580  C CG2 . THR B  1 35 ? 19.589  6.634   10.189  1.00 13.85  ? 35  THR B CG2 1 
ATOM   581  N N   A LYS B  1 36 ? 21.571  3.223   8.121   0.50 11.52  ? 36  LYS B N   1 
ATOM   582  N N   B LYS B  1 36 ? 21.571  3.219   8.115   0.50 11.64  ? 36  LYS B N   1 
ATOM   583  C CA  A LYS B  1 36 ? 21.786  1.963   7.421   0.50 13.12  ? 36  LYS B CA  1 
ATOM   584  C CA  B LYS B  1 36 ? 21.791  1.962   7.411   0.50 13.06  ? 36  LYS B CA  1 
ATOM   585  C C   A LYS B  1 36 ? 21.272  0.763   8.213   0.50 15.53  ? 36  LYS B C   1 
ATOM   586  C C   B LYS B  1 36 ? 21.305  0.750   8.201   0.50 15.41  ? 36  LYS B C   1 
ATOM   587  O O   A LYS B  1 36 ? 21.430  0.673   9.429   0.50 12.31  ? 36  LYS B O   1 
ATOM   588  O O   B LYS B  1 36 ? 21.514  0.636   9.408   0.50 13.32  ? 36  LYS B O   1 
ATOM   589  C CB  A LYS B  1 36 ? 23.279  1.791   7.134   0.50 10.00  ? 36  LYS B CB  1 
ATOM   590  C CB  B LYS B  1 36 ? 23.282  1.799   7.109   0.50 10.36  ? 36  LYS B CB  1 
ATOM   591  C CG  A LYS B  1 36 ? 23.929  2.989   6.452   0.50 12.11  ? 36  LYS B CG  1 
ATOM   592  C CG  B LYS B  1 36 ? 23.886  2.915   6.271   0.50 12.39  ? 36  LYS B CG  1 
ATOM   593  C CD  A LYS B  1 36 ? 23.718  2.956   4.955   0.50 16.53  ? 36  LYS B CD  1 
ATOM   594  C CD  B LYS B  1 36 ? 23.039  3.201   5.045   0.50 18.25  ? 36  LYS B CD  1 
ATOM   595  C CE  A LYS B  1 36 ? 24.401  4.095   4.227   0.50 16.02  ? 36  LYS B CE  1 
ATOM   596  C CE  B LYS B  1 36 ? 23.695  4.242   4.146   0.50 15.66  ? 36  LYS B CE  1 
ATOM   597  N NZ  A LYS B  1 36 ? 24.013  5.432   4.754   0.50 11.56  ? 36  LYS B NZ  1 
ATOM   598  N NZ  B LYS B  1 36 ? 25.060  3.813   3.741   0.50 23.59  ? 36  LYS B NZ  1 
ATOM   599  N N   . CYS B  1 37 ? 20.642  -0.153  7.490   1.00 15.14  ? 37  CYS B N   1 
ATOM   600  C CA  . CYS B  1 37 ? 20.238  -1.448  8.002   1.00 11.03  ? 37  CYS B CA  1 
ATOM   601  C C   . CYS B  1 37 ? 21.378  -2.415  7.644   1.00 15.99  ? 37  CYS B C   1 
ATOM   602  O O   . CYS B  1 37 ? 21.742  -2.531  6.468   1.00 13.79  ? 37  CYS B O   1 
ATOM   603  C CB  . CYS B  1 37 ? 18.907  -1.919  7.413   1.00 9.94   ? 37  CYS B CB  1 
ATOM   604  S SG  . CYS B  1 37 ? 18.379  -3.465  8.181   1.00 16.04  ? 37  CYS B SG  1 
ATOM   605  N N   . CYS B  1 38 ? 21.966  -3.043  8.639   1.00 14.63  ? 38  CYS B N   1 
ATOM   606  C CA  . CYS B  1 38 ? 23.210  -3.789  8.473   1.00 14.70  ? 38  CYS B CA  1 
ATOM   607  C C   . CYS B  1 38 ? 23.046  -5.210  8.979   1.00 18.11  ? 38  CYS B C   1 
ATOM   608  O O   . CYS B  1 38 ? 22.566  -5.372  10.099  1.00 19.17  ? 38  CYS B O   1 
ATOM   609  C CB  . CYS B  1 38 ? 24.323  -3.067  9.244   1.00 14.39  ? 38  CYS B CB  1 
ATOM   610  S SG  . CYS B  1 38 ? 24.494  -1.329  8.793   1.00 14.85  ? 38  CYS B SG  1 
ATOM   611  N N   . LYS B  1 39 ? 23.414  -6.227  8.193   1.00 18.54  ? 39  LYS B N   1 
ATOM   612  C CA  . LYS B  1 39 ? 23.274  -7.602  8.684   1.00 24.69  ? 39  LYS B CA  1 
ATOM   613  C C   . LYS B  1 39 ? 24.620  -8.299  8.857   1.00 33.33  ? 39  LYS B C   1 
ATOM   614  O O   . LYS B  1 39 ? 25.569  -8.031  8.130   1.00 28.56  ? 39  LYS B O   1 
ATOM   615  C CB  . LYS B  1 39 ? 22.421  -8.404  7.727   1.00 28.43  ? 39  LYS B CB  1 
ATOM   616  C CG  . LYS B  1 39 ? 22.215  -9.888  7.916   1.00 29.86  ? 39  LYS B CG  1 
ATOM   617  C CD  . LYS B  1 39 ? 21.406  -10.425 6.741   1.00 31.63  ? 39  LYS B CD  1 
ATOM   618  C CE  . LYS B  1 39 ? 20.609  -11.658 7.109   1.00 40.06  ? 39  LYS B CE  1 
ATOM   619  N NZ  . LYS B  1 39 ? 21.295  -12.912 6.710   1.00 47.32  ? 39  LYS B NZ  1 
ATOM   620  N N   . LYS B  1 40 ? 24.655  -9.185  9.840   1.00 43.24  ? 40  LYS B N   1 
ATOM   621  C CA  . LYS B  1 40 ? 25.822  -9.946  10.244  1.00 49.78  ? 40  LYS B CA  1 
ATOM   622  C C   . LYS B  1 40 ? 26.551  -10.592 9.070   1.00 45.82  ? 40  LYS B C   1 
ATOM   623  O O   . LYS B  1 40 ? 25.952  -11.054 8.101   1.00 43.68  ? 40  LYS B O   1 
ATOM   624  C CB  . LYS B  1 40 ? 25.402  -11.039 11.239  1.00 55.14  ? 40  LYS B CB  1 
ATOM   625  C CG  . LYS B  1 40 ? 25.836  -10.768 12.668  1.00 58.48  ? 40  LYS B CG  1 
ATOM   626  C CD  . LYS B  1 40 ? 25.239  -9.475  13.200  1.00 62.42  ? 40  LYS B CD  1 
ATOM   627  C CE  . LYS B  1 40 ? 25.255  -9.458  14.721  1.00 69.41  ? 40  LYS B CE  1 
ATOM   628  N NZ  . LYS B  1 40 ? 24.212  -8.554  15.282  1.00 73.40  ? 40  LYS B NZ  1 
ATOM   629  N N   . PRO B  1 41 ? 27.872  -10.613 9.188   1.00 50.56  ? 41  PRO B N   1 
ATOM   630  C CA  . PRO B  1 41 ? 28.749  -11.255 8.208   1.00 56.22  ? 41  PRO B CA  1 
ATOM   631  C C   . PRO B  1 41 ? 28.492  -12.753 8.064   1.00 57.09  ? 41  PRO B C   1 
ATOM   632  O O   . PRO B  1 41 ? 28.049  -13.398 9.028   1.00 47.49  ? 41  PRO B O   1 
ATOM   633  C CB  . PRO B  1 41 ? 30.150  -11.032 8.794   1.00 55.67  ? 41  PRO B CB  1 
ATOM   634  C CG  . PRO B  1 41 ? 29.987  -9.820  9.662   1.00 55.39  ? 41  PRO B CG  1 
ATOM   635  C CD  . PRO B  1 41 ? 28.628  -9.989  10.295  1.00 51.10  ? 41  PRO B CD  1 
ATOM   636  O OXT . PRO B  1 41 ? 28.746  -13.276 6.954   1.00 67.91  ? 41  PRO B OXT 1 
ATOM   637  N N   A GLY C  1 1  ? 9.761   17.320  28.300  0.50 9.94   ? 1   GLY C N   1 
ATOM   638  N N   B GLY C  1 1  ? 7.845   17.570  26.674  0.50 23.30  ? 1   GLY C N   1 
ATOM   639  C CA  A GLY C  1 1  ? 8.602   16.920  27.515  0.50 24.38  ? 1   GLY C CA  1 
ATOM   640  C CA  B GLY C  1 1  ? 8.486   16.920  27.798  0.50 24.58  ? 1   GLY C CA  1 
ATOM   641  C C   A GLY C  1 1  ? 8.590   15.420  27.288  0.50 15.22  ? 1   GLY C C   1 
ATOM   642  C C   B GLY C  1 1  ? 8.556   15.413  27.654  0.50 16.76  ? 1   GLY C C   1 
ATOM   643  O O   A GLY C  1 1  ? 9.635   14.826  27.047  0.50 20.13  ? 1   GLY C O   1 
ATOM   644  O O   B GLY C  1 1  ? 9.604   14.799  27.820  0.50 19.16  ? 1   GLY C O   1 
ATOM   645  N N   . ILE C  1 2  ? 7.421   14.791  27.357  1.00 14.53  ? 2   ILE C N   1 
ATOM   646  C CA  . ILE C  1 2  ? 7.385   13.331  27.207  1.00 11.28  ? 2   ILE C CA  1 
ATOM   647  C C   . ILE C  1 2  ? 7.702   12.992  25.759  1.00 15.36  ? 2   ILE C C   1 
ATOM   648  O O   . ILE C  1 2  ? 7.142   13.643  24.867  1.00 16.00  ? 2   ILE C O   1 
ATOM   649  C CB  . ILE C  1 2  ? 6.023   12.757  27.647  1.00 15.44  ? 2   ILE C CB  1 
ATOM   650  C CG1 . ILE C  1 2  ? 5.776   12.954  29.145  1.00 16.54  ? 2   ILE C CG1 1 
ATOM   651  C CG2 . ILE C  1 2  ? 5.889   11.294  27.222  1.00 14.85  ? 2   ILE C CG2 1 
ATOM   652  C CD1 . ILE C  1 2  ? 4.603   12.218  29.759  1.00 16.19  ? 2   ILE C CD1 1 
ATOM   653  N N   . GLY C  1 3  ? 8.578   12.016  25.563  1.00 11.82  ? 3   GLY C N   1 
ATOM   654  C CA  . GLY C  1 3  ? 9.079   11.695  24.236  1.00 11.42  ? 3   GLY C CA  1 
ATOM   655  C C   . GLY C  1 3  ? 9.271   10.225  23.981  1.00 11.89  ? 3   GLY C C   1 
ATOM   656  O O   . GLY C  1 3  ? 9.977   9.857   23.035  1.00 15.62  ? 3   GLY C O   1 
ATOM   657  N N   . ASP C  1 4  ? 8.679   9.367   24.802  1.00 11.95  ? 4   ASP C N   1 
ATOM   658  C CA  . ASP C  1 4  ? 8.778   7.908   24.581  1.00 12.44  ? 4   ASP C CA  1 
ATOM   659  C C   . ASP C  1 4  ? 7.472   7.264   25.043  1.00 9.42   ? 4   ASP C C   1 
ATOM   660  O O   . ASP C  1 4  ? 6.789   7.819   25.926  1.00 9.87   ? 4   ASP C O   1 
ATOM   661  C CB  . ASP C  1 4  ? 10.022  7.356   25.276  1.00 10.68  ? 4   ASP C CB  1 
ATOM   662  C CG  . ASP C  1 4  ? 9.828   7.159   26.776  1.00 12.66  ? 4   ASP C CG  1 
ATOM   663  O OD1 . ASP C  1 4  ? 10.124  8.119   27.517  1.00 13.78  ? 4   ASP C OD1 1 
ATOM   664  O OD2 . ASP C  1 4  ? 9.368   6.071   27.184  1.00 14.11  ? 4   ASP C OD2 1 
ATOM   665  N N   . PRO C  1 5  ? 7.066   6.145   24.459  1.00 12.76  ? 5   PRO C N   1 
ATOM   666  C CA  . PRO C  1 5  ? 5.790   5.504   24.793  1.00 14.58  ? 5   PRO C CA  1 
ATOM   667  C C   . PRO C  1 5  ? 5.704   5.059   26.255  1.00 13.30  ? 5   PRO C C   1 
ATOM   668  O O   . PRO C  1 5  ? 4.651   5.196   26.887  1.00 11.75  ? 5   PRO C O   1 
ATOM   669  C CB  . PRO C  1 5  ? 5.760   4.272   23.878  1.00 14.14  ? 5   PRO C CB  1 
ATOM   670  C CG  . PRO C  1 5  ? 6.689   4.626   22.765  1.00 15.57  ? 5   PRO C CG  1 
ATOM   671  C CD  . PRO C  1 5  ? 7.792   5.429   23.391  1.00 13.18  ? 5   PRO C CD  1 
ATOM   672  N N   . VAL C  1 6  ? 6.768   4.490   26.795  1.00 9.17   ? 6   VAL C N   1 
ATOM   673  C CA  . VAL C  1 6  ? 6.627   3.906   28.142  1.00 13.88  ? 6   VAL C CA  1 
ATOM   674  C C   . VAL C  1 6  ? 6.377   5.015   29.159  1.00 12.03  ? 6   VAL C C   1 
ATOM   675  O O   . VAL C  1 6  ? 5.502   4.845   30.012  1.00 16.00  ? 6   VAL C O   1 
ATOM   676  C CB  . VAL C  1 6  ? 7.822   3.020   28.521  1.00 16.52  ? 6   VAL C CB  1 
ATOM   677  C CG1 . VAL C  1 6  ? 7.761   2.645   30.001  1.00 17.81  ? 6   VAL C CG1 1 
ATOM   678  C CG2 . VAL C  1 6  ? 7.842   1.745   27.685  1.00 14.12  ? 6   VAL C CG2 1 
ATOM   679  N N   . THR C  1 7  ? 7.097   6.126   29.080  1.00 12.39  ? 7   THR C N   1 
ATOM   680  C CA  . THR C  1 7  ? 6.913   7.229   30.024  1.00 10.90  ? 7   THR C CA  1 
ATOM   681  C C   . THR C  1 7  ? 5.498   7.776   29.893  1.00 16.96  ? 7   THR C C   1 
ATOM   682  O O   . THR C  1 7  ? 4.811   8.111   30.854  1.00 13.27  ? 7   THR C O   1 
ATOM   683  C CB  . THR C  1 7  ? 7.972   8.323   29.810  1.00 14.14  ? 7   THR C CB  1 
ATOM   684  O OG1 . THR C  1 7  ? 9.282   7.756   30.028  1.00 15.21  ? 7   THR C OG1 1 
ATOM   685  C CG2 . THR C  1 7  ? 7.821   9.435   30.830  1.00 13.56  ? 7   THR C CG2 1 
ATOM   686  N N   . CYS C  1 8  ? 5.014   7.888   28.641  1.00 7.82   ? 8   CYS C N   1 
ATOM   687  C CA  . CYS C  1 8  ? 3.645   8.358   28.463  1.00 11.89  ? 8   CYS C CA  1 
ATOM   688  C C   . CYS C  1 8  ? 2.632   7.484   29.187  1.00 11.41  ? 8   CYS C C   1 
ATOM   689  O O   . CYS C  1 8  ? 1.783   7.964   29.939  1.00 12.91  ? 8   CYS C O   1 
ATOM   690  C CB  . CYS C  1 8  ? 3.348   8.365   26.954  1.00 8.56   ? 8   CYS C CB  1 
ATOM   691  S SG  . CYS C  1 8  ? 1.709   8.990   26.536  1.00 14.42  ? 8   CYS C SG  1 
ATOM   692  N N   . LEU C  1 9  ? 2.698   6.181   28.946  1.00 12.68  ? 9   LEU C N   1 
ATOM   693  C CA  . LEU C  1 9  ? 1.731   5.252   29.542  1.00 11.90  ? 9   LEU C CA  1 
ATOM   694  C C   . LEU C  1 9  ? 1.901   5.135   31.051  1.00 17.70  ? 9   LEU C C   1 
ATOM   695  O O   . LEU C  1 9  ? 0.933   5.036   31.809  1.00 15.12  ? 9   LEU C O   1 
ATOM   696  C CB  . LEU C  1 9  ? 1.896   3.895   28.873  1.00 14.44  ? 9   LEU C CB  1 
ATOM   697  C CG  . LEU C  1 9  ? 1.546   3.850   27.382  1.00 19.93  ? 9   LEU C CG  1 
ATOM   698  C CD1 . LEU C  1 9  ? 2.086   2.583   26.746  1.00 21.77  ? 9   LEU C CD1 1 
ATOM   699  C CD2 . LEU C  1 9  ? 0.046   3.946   27.157  1.00 16.77  ? 9   LEU C CD2 1 
ATOM   700  N N   . LYS C  1 10 ? 3.139   5.147   31.516  1.00 17.22  ? 10  LYS C N   1 
ATOM   701  C CA  . LYS C  1 10 ? 3.393   5.172   32.955  1.00 16.96  ? 10  LYS C CA  1 
ATOM   702  C C   . LYS C  1 10 ? 2.725   6.346   33.645  1.00 21.84  ? 10  LYS C C   1 
ATOM   703  O O   . LYS C  1 10 ? 2.320   6.249   34.809  1.00 18.39  ? 10  LYS C O   1 
ATOM   704  C CB  . LYS C  1 10 ? 4.907   5.259   33.205  1.00 16.57  ? 10  LYS C CB  1 
ATOM   705  C CG  . LYS C  1 10 ? 5.286   5.226   34.672  1.00 29.55  ? 10  LYS C CG  1 
ATOM   706  C CD  . LYS C  1 10 ? 6.797   5.199   34.870  1.00 30.10  ? 10  LYS C CD  1 
ATOM   707  C CE  . LYS C  1 10 ? 7.506   4.701   33.619  1.00 37.40  ? 10  LYS C CE  1 
ATOM   708  N NZ  . LYS C  1 10 ? 7.722   3.224   33.647  1.00 55.83  ? 10  LYS C NZ  1 
ATOM   709  N N   . SER C  1 11 ? 2.620   7.464   32.930  1.00 12.43  ? 11  SER C N   1 
ATOM   710  C CA  . SER C  1 11 ? 2.079   8.674   33.504  1.00 13.76  ? 11  SER C CA  1 
ATOM   711  C C   . SER C  1 11 ? 0.551   8.599   33.513  1.00 23.84  ? 11  SER C C   1 
ATOM   712  O O   . SER C  1 11 ? -0.078  9.479   34.095  1.00 18.93  ? 11  SER C O   1 
ATOM   713  C CB  . SER C  1 11 ? 2.557   9.907   32.735  1.00 16.99  ? 11  SER C CB  1 
ATOM   714  O OG  . SER C  1 11 ? 1.726   10.175  31.628  1.00 17.85  ? 11  SER C OG  1 
ATOM   715  N N   . GLY C  1 12 ? 0.021   7.545   32.888  1.00 16.38  ? 12  GLY C N   1 
ATOM   716  C CA  . GLY C  1 12 ? -1.402  7.282   32.802  1.00 19.66  ? 12  GLY C CA  1 
ATOM   717  C C   . GLY C  1 12 ? -2.042  7.893   31.559  1.00 19.21  ? 12  GLY C C   1 
ATOM   718  O O   . GLY C  1 12 ? -3.270  7.848   31.433  1.00 16.32  ? 12  GLY C O   1 
ATOM   719  N N   . ALA C  1 13 ? -1.203  8.444   30.684  1.00 15.94  ? 13  ALA C N   1 
ATOM   720  C CA  . ALA C  1 13 ? -1.629  9.010   29.417  1.00 14.86  ? 13  ALA C CA  1 
ATOM   721  C C   . ALA C  1 13 ? -1.739  7.920   28.349  1.00 19.05  ? 13  ALA C C   1 
ATOM   722  O O   . ALA C  1 13 ? -1.408  6.760   28.587  1.00 14.04  ? 13  ALA C O   1 
ATOM   723  C CB  . ALA C  1 13 ? -0.663  10.070  28.926  1.00 14.32  ? 13  ALA C CB  1 
ATOM   724  N N   A ILE C  1 14 ? -2.231  8.317   27.173  0.50 20.70  ? 14  ILE C N   1 
ATOM   725  N N   B ILE C  1 14 ? -2.196  8.342   27.173  0.50 20.75  ? 14  ILE C N   1 
ATOM   726  C CA  A ILE C  1 14 ? -2.406  7.328   26.107  0.50 19.61  ? 14  ILE C CA  1 
ATOM   727  C CA  B ILE C  1 14 ? -2.487  7.460   26.049  0.50 19.63  ? 14  ILE C CA  1 
ATOM   728  C C   A ILE C  1 14 ? -1.645  7.757   24.859  0.50 16.70  ? 14  ILE C C   1 
ATOM   729  C C   B ILE C  1 14 ? -1.631  7.790   24.838  0.50 16.64  ? 14  ILE C C   1 
ATOM   730  O O   A ILE C  1 14 ? -1.561  8.954   24.589  0.50 18.50  ? 14  ILE C O   1 
ATOM   731  O O   B ILE C  1 14 ? -1.443  8.973   24.542  0.50 20.17  ? 14  ILE C O   1 
ATOM   732  C CB  A ILE C  1 14 ? -3.892  7.107   25.786  0.50 22.82  ? 14  ILE C CB  1 
ATOM   733  C CB  B ILE C  1 14 ? -3.987  7.573   25.693  0.50 21.40  ? 14  ILE C CB  1 
ATOM   734  C CG1 A ILE C  1 14 ? -4.592  8.265   25.057  0.50 26.14  ? 14  ILE C CG1 1 
ATOM   735  C CG1 B ILE C  1 14 ? -4.941  7.398   26.870  0.50 17.09  ? 14  ILE C CG1 1 
ATOM   736  C CG2 A ILE C  1 14 ? -4.686  6.763   27.039  0.50 21.89  ? 14  ILE C CG2 1 
ATOM   737  C CG2 B ILE C  1 14 ? -4.361  6.598   24.581  0.50 14.53  ? 14  ILE C CG2 1 
ATOM   738  C CD1 A ILE C  1 14 ? -6.054  7.932   24.813  0.50 20.15  ? 14  ILE C CD1 1 
ATOM   739  C CD1 B ILE C  1 14 ? -5.124  8.609   27.755  0.50 27.44  ? 14  ILE C CD1 1 
ATOM   740  N N   . CYS C  1 15 ? -1.085  6.800   24.128  1.00 14.71  ? 15  CYS C N   1 
ATOM   741  C CA  . CYS C  1 15 ? -0.307  7.096   22.923  1.00 13.59  ? 15  CYS C CA  1 
ATOM   742  C C   . CYS C  1 15 ? -1.190  7.004   21.667  1.00 17.43  ? 15  CYS C C   1 
ATOM   743  O O   . CYS C  1 15 ? -1.766  5.947   21.430  1.00 18.41  ? 15  CYS C O   1 
ATOM   744  C CB  . CYS C  1 15 ? 0.884   6.169   22.683  1.00 16.98  ? 15  CYS C CB  1 
ATOM   745  S SG  . CYS C  1 15 ? 2.249   6.404   23.870  1.00 16.74  ? 15  CYS C SG  1 
ATOM   746  N N   . HIS C  1 16 ? -1.276  8.084   20.913  1.00 15.50  ? 16  HIS C N   1 
ATOM   747  C CA  . HIS C  1 16 ? -2.045  8.101   19.663  1.00 16.78  ? 16  HIS C CA  1 
ATOM   748  C C   . HIS C  1 16 ? -1.117  8.178   18.462  1.00 21.86  ? 16  HIS C C   1 
ATOM   749  O O   . HIS C  1 16 ? -0.123  8.895   18.433  1.00 23.10  ? 16  HIS C O   1 
ATOM   750  C CB  . HIS C  1 16 ? -3.030  9.276   19.664  1.00 17.74  ? 16  HIS C CB  1 
ATOM   751  C CG  . HIS C  1 16 ? -4.282  8.934   20.425  1.00 20.32  ? 16  HIS C CG  1 
ATOM   752  N ND1 . HIS C  1 16 ? -5.383  8.371   19.823  1.00 24.35  ? 16  HIS C ND1 1 
ATOM   753  C CD2 . HIS C  1 16 ? -4.598  9.067   21.732  1.00 28.68  ? 16  HIS C CD2 1 
ATOM   754  C CE1 . HIS C  1 16 ? -6.329  8.170   20.721  1.00 23.44  ? 16  HIS C CE1 1 
ATOM   755  N NE2 . HIS C  1 16 ? -5.876  8.586   21.893  1.00 26.77  ? 16  HIS C NE2 1 
ATOM   756  N N   . PRO C  1 17 ? -1.410  7.430   17.399  1.00 23.47  ? 17  PRO C N   1 
ATOM   757  C CA  . PRO C  1 17 ? -0.508  7.428   16.244  1.00 22.91  ? 17  PRO C CA  1 
ATOM   758  C C   . PRO C  1 17 ? -0.364  8.764   15.543  1.00 23.56  ? 17  PRO C C   1 
ATOM   759  O O   . PRO C  1 17 ? 0.719   9.032   14.993  1.00 25.58  ? 17  PRO C O   1 
ATOM   760  C CB  . PRO C  1 17 ? -1.167  6.411   15.291  1.00 27.67  ? 17  PRO C CB  1 
ATOM   761  C CG  . PRO C  1 17 ? -2.572  6.273   15.757  1.00 20.46  ? 17  PRO C CG  1 
ATOM   762  C CD  . PRO C  1 17 ? -2.585  6.565   17.234  1.00 22.82  ? 17  PRO C CD  1 
ATOM   763  N N   . VAL C  1 18 ? -1.357  9.653   15.472  1.00 22.88  ? 18  VAL C N   1 
ATOM   764  C CA  . VAL C  1 18 ? -1.239  10.893  14.713  1.00 20.99  ? 18  VAL C CA  1 
ATOM   765  C C   . VAL C  1 18 ? -1.833  12.135  15.366  1.00 15.86  ? 18  VAL C C   1 
ATOM   766  O O   . VAL C  1 18 ? -1.265  13.222  15.323  1.00 24.10  ? 18  VAL C O   1 
ATOM   767  C CB  . VAL C  1 18 ? -1.977  10.746  13.348  1.00 32.30  ? 18  VAL C CB  1 
ATOM   768  C CG1 . VAL C  1 18 ? -1.782  12.015  12.532  1.00 38.11  ? 18  VAL C CG1 1 
ATOM   769  C CG2 . VAL C  1 18 ? -1.527  9.527   12.568  1.00 33.03  ? 18  VAL C CG2 1 
ATOM   770  N N   . PHE C  1 19 ? -3.016  12.020  15.968  1.00 21.09  ? 19  PHE C N   1 
ATOM   771  C CA  . PHE C  1 19 ? -3.701  13.151  16.566  1.00 21.30  ? 19  PHE C CA  1 
ATOM   772  C C   . PHE C  1 19 ? -4.247  12.780  17.947  1.00 13.15  ? 19  PHE C C   1 
ATOM   773  O O   . PHE C  1 19 ? -4.733  11.654  18.093  1.00 19.44  ? 19  PHE C O   1 
ATOM   774  C CB  . PHE C  1 19 ? -4.917  13.633  15.752  1.00 17.17  ? 19  PHE C CB  1 
ATOM   775  C CG  . PHE C  1 19 ? -4.638  14.186  14.361  1.00 15.86  ? 19  PHE C CG  1 
ATOM   776  C CD1 . PHE C  1 19 ? -5.124  13.545  13.228  1.00 26.55  ? 19  PHE C CD1 1 
ATOM   777  C CD2 . PHE C  1 19 ? -3.908  15.346  14.186  1.00 19.82  ? 19  PHE C CD2 1 
ATOM   778  C CE1 . PHE C  1 19 ? -4.880  14.049  11.961  1.00 22.92  ? 19  PHE C CE1 1 
ATOM   779  C CE2 . PHE C  1 19 ? -3.647  15.860  12.924  1.00 28.06  ? 19  PHE C CE2 1 
ATOM   780  C CZ  . PHE C  1 19 ? -4.138  15.209  11.807  1.00 21.38  ? 19  PHE C CZ  1 
ATOM   781  N N   . CYS C  1 20 ? -4.208  13.706  18.903  1.00 17.14  ? 20  CYS C N   1 
ATOM   782  C CA  . CYS C  1 20 ? -4.928  13.408  20.151  1.00 15.15  ? 20  CYS C CA  1 
ATOM   783  C C   . CYS C  1 20 ? -6.434  13.452  19.913  1.00 21.80  ? 20  CYS C C   1 
ATOM   784  O O   . CYS C  1 20 ? -6.821  14.288  19.078  1.00 22.49  ? 20  CYS C O   1 
ATOM   785  C CB  . CYS C  1 20 ? -4.578  14.430  21.229  1.00 17.98  ? 20  CYS C CB  1 
ATOM   786  S SG  . CYS C  1 20 ? -2.928  14.243  21.948  1.00 19.04  ? 20  CYS C SG  1 
ATOM   787  N N   . PRO C  1 21 ? -7.282  12.696  20.580  1.00 23.05  ? 21  PRO C N   1 
ATOM   788  C CA  . PRO C  1 21 ? -8.737  12.898  20.453  1.00 24.99  ? 21  PRO C CA  1 
ATOM   789  C C   . PRO C  1 21 ? -9.148  14.294  20.893  1.00 27.56  ? 21  PRO C C   1 
ATOM   790  O O   . PRO C  1 21 ? -8.427  14.966  21.629  1.00 25.86  ? 21  PRO C O   1 
ATOM   791  C CB  . PRO C  1 21 ? -9.343  11.884  21.429  1.00 24.89  ? 21  PRO C CB  1 
ATOM   792  C CG  . PRO C  1 21 ? -8.285  10.830  21.524  1.00 23.64  ? 21  PRO C CG  1 
ATOM   793  C CD  . PRO C  1 21 ? -6.987  11.589  21.517  1.00 20.03  ? 21  PRO C CD  1 
ATOM   794  N N   . ARG C  1 22 ? -10.316 14.783  20.472  1.00 27.39  ? 22  ARG C N   1 
ATOM   795  C CA  . ARG C  1 22 ? -10.693 16.119  20.978  1.00 25.43  ? 22  ARG C CA  1 
ATOM   796  C C   . ARG C  1 22 ? -10.840 16.073  22.494  1.00 24.18  ? 22  ARG C C   1 
ATOM   797  O O   . ARG C  1 22 ? -11.089 15.003  23.054  1.00 40.26  ? 22  ARG C O   1 
ATOM   798  C CB  . ARG C  1 22 ? -11.980 16.579  20.307  1.00 27.89  ? 22  ARG C CB  1 
ATOM   799  C CG  . ARG C  1 22 ? -12.255 18.069  20.294  1.00 40.07  ? 22  ARG C CG  1 
ATOM   800  C CD  . ARG C  1 22 ? -13.160 18.428  19.120  1.00 58.24  ? 22  ARG C CD  1 
ATOM   801  N NE  . ARG C  1 22 ? -13.790 19.734  19.279  1.00 72.21  ? 22  ARG C NE  1 
ATOM   802  C CZ  . ARG C  1 22 ? -14.887 20.125  18.640  1.00 77.88  ? 22  ARG C CZ  1 
ATOM   803  N NH1 . ARG C  1 22 ? -15.468 19.290  17.786  1.00 73.52  ? 22  ARG C NH1 1 
ATOM   804  N NH2 . ARG C  1 22 ? -15.379 21.337  18.860  1.00 80.58  ? 22  ARG C NH2 1 
ATOM   805  N N   . ARG C  1 23 ? -10.665 17.198  23.174  1.00 26.64  ? 23  ARG C N   1 
ATOM   806  C CA  . ARG C  1 23 ? -10.853 17.286  24.618  1.00 31.12  ? 23  ARG C CA  1 
ATOM   807  C C   . ARG C  1 23 ? -9.661  16.708  25.360  1.00 34.47  ? 23  ARG C C   1 
ATOM   808  O O   . ARG C  1 23 ? -9.381  17.147  26.475  1.00 33.04  ? 23  ARG C O   1 
ATOM   809  C CB  . ARG C  1 23 ? -12.157 16.613  25.071  1.00 34.35  ? 23  ARG C CB  1 
ATOM   810  C CG  . ARG C  1 23 ? -13.385 17.210  24.394  1.00 38.03  ? 23  ARG C CG  1 
ATOM   811  C CD  . ARG C  1 23 ? -14.603 17.236  25.295  1.00 44.34  ? 23  ARG C CD  1 
ATOM   812  N NE  . ARG C  1 23 ? -15.797 17.700  24.586  1.00 57.35  ? 23  ARG C NE  1 
ATOM   813  C CZ  . ARG C  1 23 ? -16.132 18.967  24.395  1.00 56.52  ? 23  ARG C CZ  1 
ATOM   814  N NH1 . ARG C  1 23 ? -15.366 19.951  24.843  1.00 46.89  ? 23  ARG C NH1 1 
ATOM   815  N NH2 . ARG C  1 23 ? -17.246 19.279  23.740  1.00 70.66  ? 23  ARG C NH2 1 
ATOM   816  N N   . TYR C  1 24 ? -8.927  15.758  24.779  1.00 36.40  ? 24  TYR C N   1 
ATOM   817  C CA  . TYR C  1 24 ? -7.659  15.360  25.375  1.00 30.05  ? 24  TYR C CA  1 
ATOM   818  C C   . TYR C  1 24 ? -6.611  16.456  25.183  1.00 35.10  ? 24  TYR C C   1 
ATOM   819  O O   . TYR C  1 24 ? -6.684  17.290  24.275  1.00 37.44  ? 24  TYR C O   1 
ATOM   820  C CB  . TYR C  1 24 ? -7.097  14.080  24.768  1.00 25.37  ? 24  TYR C CB  1 
ATOM   821  C CG  . TYR C  1 24 ? -7.795  12.811  25.182  1.00 29.93  ? 24  TYR C CG  1 
ATOM   822  C CD1 . TYR C  1 24 ? -9.182  12.724  25.158  1.00 34.66  ? 24  TYR C CD1 1 
ATOM   823  C CD2 . TYR C  1 24 ? -7.062  11.706  25.594  1.00 25.00  ? 24  TYR C CD2 1 
ATOM   824  C CE1 . TYR C  1 24 ? -9.821  11.559  25.538  1.00 35.15  ? 24  TYR C CE1 1 
ATOM   825  C CE2 . TYR C  1 24 ? -7.706  10.538  25.972  1.00 24.96  ? 24  TYR C CE2 1 
ATOM   826  C CZ  . TYR C  1 24 ? -9.081  10.468  25.945  1.00 31.14  ? 24  TYR C CZ  1 
ATOM   827  O OH  . TYR C  1 24 ? -9.728  9.310   26.321  1.00 37.71  ? 24  TYR C OH  1 
ATOM   828  N N   . LYS C  1 25 ? -5.609  16.445  26.060  1.00 27.18  ? 25  LYS C N   1 
ATOM   829  C CA  . LYS C  1 25 ? -4.537  17.421  25.941  1.00 22.24  ? 25  LYS C CA  1 
ATOM   830  C C   . LYS C  1 25 ? -3.224  16.733  25.571  1.00 22.43  ? 25  LYS C C   1 
ATOM   831  O O   . LYS C  1 25 ? -2.925  15.717  26.183  1.00 20.24  ? 25  LYS C O   1 
ATOM   832  C CB  . LYS C  1 25 ? -4.373  18.185  27.262  1.00 26.76  ? 25  LYS C CB  1 
ATOM   833  C CG  . LYS C  1 25 ? -3.271  19.225  27.247  1.00 38.73  ? 25  LYS C CG  1 
ATOM   834  C CD  . LYS C  1 25 ? -2.770  19.532  28.649  1.00 48.61  ? 25  LYS C CD  1 
ATOM   835  C CE  . LYS C  1 25 ? -2.373  20.999  28.773  1.00 54.07  ? 25  LYS C CE  1 
ATOM   836  N NZ  . LYS C  1 25 ? -2.852  21.796  27.605  1.00 61.73  ? 25  LYS C NZ  1 
ATOM   837  N N   . GLN C  1 26 ? -2.482  17.278  24.623  1.00 20.99  ? 26  GLN C N   1 
ATOM   838  C CA  . GLN C  1 26 ? -1.162  16.820  24.228  1.00 24.23  ? 26  GLN C CA  1 
ATOM   839  C C   . GLN C  1 26 ? -0.059  17.271  25.185  1.00 22.48  ? 26  GLN C C   1 
ATOM   840  O O   . GLN C  1 26 ? 0.215   18.469  25.324  1.00 25.40  ? 26  GLN C O   1 
ATOM   841  C CB  . GLN C  1 26 ? -0.778  17.320  22.823  1.00 32.02  ? 26  GLN C CB  1 
ATOM   842  C CG  . GLN C  1 26 ? 0.525   16.665  22.364  1.00 34.79  ? 26  GLN C CG  1 
ATOM   843  C CD  . GLN C  1 26 ? 1.041   17.210  21.049  1.00 39.20  ? 26  GLN C CD  1 
ATOM   844  O OE1 . GLN C  1 26 ? 0.309   17.876  20.324  1.00 38.55  ? 26  GLN C OE1 1 
ATOM   845  N NE2 . GLN C  1 26 ? 2.301   16.924  20.741  1.00 31.78  ? 26  GLN C NE2 1 
ATOM   846  N N   . ILE C  1 27 ? 0.572   16.291  25.825  1.00 20.05  ? 27  ILE C N   1 
ATOM   847  C CA  . ILE C  1 27 ? 1.673   16.537  26.760  1.00 19.01  ? 27  ILE C CA  1 
ATOM   848  C C   . ILE C  1 27 ? 2.992   15.997  26.246  1.00 23.38  ? 27  ILE C C   1 
ATOM   849  O O   . ILE C  1 27 ? 4.003   15.985  26.948  1.00 27.61  ? 27  ILE C O   1 
ATOM   850  C CB  . ILE C  1 27 ? 1.354   15.905  28.136  1.00 19.13  ? 27  ILE C CB  1 
ATOM   851  C CG1 . ILE C  1 27 ? 1.300   14.384  28.157  1.00 21.38  ? 27  ILE C CG1 1 
ATOM   852  C CG2 . ILE C  1 27 ? 0.047   16.514  28.635  1.00 25.64  ? 27  ILE C CG2 1 
ATOM   853  C CD1 . ILE C  1 27 ? 0.861   13.797  29.484  1.00 15.42  ? 27  ILE C CD1 1 
ATOM   854  N N   . GLY C  1 28 ? 3.029   15.538  24.994  1.00 17.30  ? 28  GLY C N   1 
ATOM   855  C CA  . GLY C  1 28 ? 4.321   15.115  24.451  1.00 17.19  ? 28  GLY C CA  1 
ATOM   856  C C   . GLY C  1 28 ? 4.110   14.243  23.220  1.00 16.17  ? 28  GLY C C   1 
ATOM   857  O O   . GLY C  1 28 ? 3.072   14.334  22.582  1.00 18.11  ? 28  GLY C O   1 
ATOM   858  N N   . THR C  1 29 ? 5.086   13.413  22.900  1.00 13.62  ? 29  THR C N   1 
ATOM   859  C CA  . THR C  1 29 ? 5.011   12.412  21.857  1.00 13.63  ? 29  THR C CA  1 
ATOM   860  C C   . THR C  1 29 ? 5.218   11.022  22.443  1.00 15.85  ? 29  THR C C   1 
ATOM   861  O O   . THR C  1 29 ? 5.570   10.882  23.614  1.00 15.89  ? 29  THR C O   1 
ATOM   862  C CB  . THR C  1 29 ? 6.087   12.651  20.780  1.00 14.73  ? 29  THR C CB  1 
ATOM   863  O OG1 . THR C  1 29 ? 7.399   12.331  21.295  1.00 14.44  ? 29  THR C OG1 1 
ATOM   864  C CG2 . THR C  1 29 ? 6.120   14.128  20.391  1.00 17.13  ? 29  THR C CG2 1 
ATOM   865  N N   . CYS C  1 30 ? 5.042   9.998   21.614  1.00 11.06  ? 30  CYS C N   1 
ATOM   866  C CA  . CYS C  1 30 ? 5.469   8.660   22.026  1.00 11.31  ? 30  CYS C CA  1 
ATOM   867  C C   . CYS C  1 30 ? 6.639   8.183   21.166  1.00 14.31  ? 30  CYS C C   1 
ATOM   868  O O   . CYS C  1 30 ? 6.677   7.086   20.641  1.00 22.43  ? 30  CYS C O   1 
ATOM   869  C CB  . CYS C  1 30 ? 4.245   7.737   22.026  1.00 12.99  ? 30  CYS C CB  1 
ATOM   870  S SG  . CYS C  1 30 ? 3.025   8.182   23.297  1.00 15.26  ? 30  CYS C SG  1 
ATOM   871  N N   . GLY C  1 31 ? 7.634   9.061   21.016  1.00 19.61  ? 31  GLY C N   1 
ATOM   872  C CA  . GLY C  1 31 ? 8.872   8.761   20.344  1.00 22.55  ? 31  GLY C CA  1 
ATOM   873  C C   . GLY C  1 31 ? 8.805   8.741   18.827  1.00 16.98  ? 31  GLY C C   1 
ATOM   874  O O   . GLY C  1 31 ? 9.417   9.600   18.197  1.00 20.79  ? 31  GLY C O   1 
ATOM   875  N N   . LEU C  1 32 ? 8.106   7.782   18.237  1.00 15.85  ? 32  LEU C N   1 
ATOM   876  C CA  . LEU C  1 32 ? 8.046   7.731   16.774  1.00 17.91  ? 32  LEU C CA  1 
ATOM   877  C C   . LEU C  1 32 ? 7.505   9.043   16.216  1.00 22.16  ? 32  LEU C C   1 
ATOM   878  O O   . LEU C  1 32 ? 6.627   9.644   16.836  1.00 25.91  ? 32  LEU C O   1 
ATOM   879  C CB  . LEU C  1 32 ? 7.121   6.604   16.298  1.00 21.55  ? 32  LEU C CB  1 
ATOM   880  C CG  . LEU C  1 32 ? 7.581   5.180   16.592  1.00 19.39  ? 32  LEU C CG  1 
ATOM   881  C CD1 . LEU C  1 32 ? 6.466   4.162   16.420  1.00 23.66  ? 32  LEU C CD1 1 
ATOM   882  C CD2 . LEU C  1 32 ? 8.762   4.849   15.684  1.00 23.75  ? 32  LEU C CD2 1 
ATOM   883  N N   . PRO C  1 33 ? 8.000   9.492   15.077  1.00 17.21  ? 33  PRO C N   1 
ATOM   884  C CA  . PRO C  1 33 ? 7.516   10.764  14.518  1.00 19.93  ? 33  PRO C CA  1 
ATOM   885  C C   . PRO C  1 33 ? 5.996   10.715  14.327  1.00 15.43  ? 33  PRO C C   1 
ATOM   886  O O   . PRO C  1 33 ? 5.441   9.679   13.967  1.00 19.59  ? 33  PRO C O   1 
ATOM   887  C CB  . PRO C  1 33 ? 8.239   10.840  13.170  1.00 21.61  ? 33  PRO C CB  1 
ATOM   888  C CG  . PRO C  1 33 ? 9.453   9.979   13.339  1.00 22.40  ? 33  PRO C CG  1 
ATOM   889  C CD  . PRO C  1 33 ? 9.023   8.849   14.224  1.00 16.84  ? 33  PRO C CD  1 
ATOM   890  N N   . GLY C  1 34 ? 5.321   11.825  14.593  1.00 17.84  ? 34  GLY C N   1 
ATOM   891  C CA  . GLY C  1 34 ? 3.881   11.903  14.429  1.00 21.00  ? 34  GLY C CA  1 
ATOM   892  C C   . GLY C  1 34 ? 3.059   11.404  15.593  1.00 28.47  ? 34  GLY C C   1 
ATOM   893  O O   . GLY C  1 34 ? 1.871   11.731  15.739  1.00 26.19  ? 34  GLY C O   1 
ATOM   894  N N   . THR C  1 35 ? 3.674   10.591  16.458  1.00 17.96  ? 35  THR C N   1 
ATOM   895  C CA  . THR C  1 35 ? 2.890   10.071  17.582  1.00 17.10  ? 35  THR C CA  1 
ATOM   896  C C   . THR C  1 35 ? 2.676   11.152  18.638  1.00 13.35  ? 35  THR C C   1 
ATOM   897  O O   . THR C  1 35 ? 3.379   12.143  18.787  1.00 17.33  ? 35  THR C O   1 
ATOM   898  C CB  . THR C  1 35 ? 3.556   8.824   18.171  1.00 16.80  ? 35  THR C CB  1 
ATOM   899  O OG1 . THR C  1 35 ? 4.821   9.198   18.720  1.00 18.22  ? 35  THR C OG1 1 
ATOM   900  C CG2 . THR C  1 35 ? 3.813   7.777   17.095  1.00 17.22  ? 35  THR C CG2 1 
ATOM   901  N N   . LYS C  1 36 ? 1.621   10.994  19.425  1.00 17.13  ? 36  LYS C N   1 
ATOM   902  C CA  . LYS C  1 36 ? 1.205   11.977  20.396  1.00 9.97   ? 36  LYS C CA  1 
ATOM   903  C C   . LYS C  1 36 ? 0.970   11.314  21.760  1.00 12.02  ? 36  LYS C C   1 
ATOM   904  O O   . LYS C  1 36 ? 0.365   10.249  21.793  1.00 15.09  ? 36  LYS C O   1 
ATOM   905  C CB  . LYS C  1 36 ? -0.100  12.667  19.982  1.00 19.65  ? 36  LYS C CB  1 
ATOM   906  C CG  . LYS C  1 36 ? -0.020  13.420  18.656  1.00 16.07  ? 36  LYS C CG  1 
ATOM   907  C CD  . LYS C  1 36 ? 0.622   14.785  18.834  1.00 27.34  ? 36  LYS C CD  1 
ATOM   908  C CE  . LYS C  1 36 ? 0.598   15.537  17.501  1.00 31.06  ? 36  LYS C CE  1 
ATOM   909  N NZ  . LYS C  1 36 ? 1.111   14.651  16.416  1.00 22.88  ? 36  LYS C NZ  1 
ATOM   910  N N   . CYS C  1 37 ? 1.448   11.939  22.829  1.00 12.05  ? 37  CYS C N   1 
ATOM   911  C CA  . CYS C  1 37 ? 1.107   11.494  24.177  1.00 15.51  ? 37  CYS C CA  1 
ATOM   912  C C   . CYS C  1 37 ? -0.065  12.346  24.654  1.00 10.89  ? 37  CYS C C   1 
ATOM   913  O O   . CYS C  1 37 ? 0.093   13.572  24.696  1.00 12.01  ? 37  CYS C O   1 
ATOM   914  C CB  . CYS C  1 37 ? 2.279   11.614  25.162  1.00 11.37  ? 37  CYS C CB  1 
ATOM   915  S SG  . CYS C  1 37 ? 1.821   10.995  26.809  1.00 12.87  ? 37  CYS C SG  1 
ATOM   916  N N   . CYS C  1 38 ? -1.194  11.727  24.971  1.00 14.66  ? 38  CYS C N   1 
ATOM   917  C CA  . CYS C  1 38 ? -2.427  12.474  25.185  1.00 17.87  ? 38  CYS C CA  1 
ATOM   918  C C   . CYS C  1 38 ? -3.049  12.200  26.549  1.00 15.35  ? 38  CYS C C   1 
ATOM   919  O O   . CYS C  1 38 ? -3.246  11.035  26.903  1.00 15.40  ? 38  CYS C O   1 
ATOM   920  C CB  . CYS C  1 38 ? -3.450  12.131  24.083  1.00 16.41  ? 38  CYS C CB  1 
ATOM   921  S SG  . CYS C  1 38 ? -2.790  12.271  22.410  1.00 18.39  ? 38  CYS C SG  1 
ATOM   922  N N   . LYS C  1 39 ? -3.335  13.295  27.241  1.00 19.04  ? 39  LYS C N   1 
ATOM   923  C CA  . LYS C  1 39 ? -3.915  13.310  28.581  1.00 16.50  ? 39  LYS C CA  1 
ATOM   924  C C   . LYS C  1 39 ? -5.426  13.481  28.495  1.00 31.51  ? 39  LYS C C   1 
ATOM   925  O O   . LYS C  1 39 ? -5.890  14.430  27.860  1.00 33.58  ? 39  LYS C O   1 
ATOM   926  C CB  . LYS C  1 39 ? -3.260  14.446  29.368  1.00 18.98  ? 39  LYS C CB  1 
ATOM   927  C CG  . LYS C  1 39 ? -3.573  14.536  30.848  1.00 29.24  ? 39  LYS C CG  1 
ATOM   928  C CD  . LYS C  1 39 ? -2.928  15.789  31.437  1.00 30.12  ? 39  LYS C CD  1 
ATOM   929  C CE  . LYS C  1 39 ? -3.200  15.942  32.918  1.00 35.88  ? 39  LYS C CE  1 
ATOM   930  N NZ  . LYS C  1 39 ? -4.623  15.681  33.279  1.00 34.94  ? 39  LYS C NZ  1 
ATOM   931  N N   . LYS C  1 40 ? -6.181  12.585  29.108  1.00 35.78  ? 40  LYS C N   1 
ATOM   932  C CA  . LYS C  1 40 ? -7.638  12.563  29.051  1.00 46.89  ? 40  LYS C CA  1 
ATOM   933  C C   . LYS C  1 40 ? -8.312  13.593  29.947  1.00 54.38  ? 40  LYS C C   1 
ATOM   934  O O   . LYS C  1 40 ? -9.214  14.267  29.428  1.00 63.67  ? 40  LYS C O   1 
ATOM   935  C CB  . LYS C  1 40 ? -8.143  11.155  29.402  1.00 52.14  ? 40  LYS C CB  1 
ATOM   936  C CG  . LYS C  1 40 ? -9.545  11.104  29.985  1.00 52.83  ? 40  LYS C CG  1 
ATOM   937  C CD  . LYS C  1 40 ? -10.094 9.683   29.934  1.00 56.09  ? 40  LYS C CD  1 
ATOM   938  C CE  . LYS C  1 40 ? -11.443 9.563   30.623  1.00 61.42  ? 40  LYS C CE  1 
ATOM   939  N NZ  . LYS C  1 40 ? -12.132 10.876  30.783  1.00 65.09  ? 40  LYS C NZ  1 
ATOM   940  N N   . PRO C  1 41 ? -7.955  13.723  31.217  1.00 68.33  ? 41  PRO C N   1 
ATOM   941  C CA  . PRO C  1 41 ? -8.529  14.760  32.084  1.00 81.00  ? 41  PRO C CA  1 
ATOM   942  C C   . PRO C  1 41 ? -8.597  16.129  31.420  1.00 86.10  ? 41  PRO C C   1 
ATOM   943  O O   . PRO C  1 41 ? -7.694  16.956  31.624  1.00 95.10  ? 41  PRO C O   1 
ATOM   944  C CB  . PRO C  1 41 ? -7.544  14.818  33.261  1.00 80.46  ? 41  PRO C CB  1 
ATOM   945  C CG  . PRO C  1 41 ? -7.043  13.415  33.374  1.00 78.31  ? 41  PRO C CG  1 
ATOM   946  C CD  . PRO C  1 41 ? -7.006  12.880  31.972  1.00 75.98  ? 41  PRO C CD  1 
ATOM   947  O OXT . PRO C  1 41 ? -9.592  16.336  30.689  1.00 82.80  ? 41  PRO C OXT 1 
ATOM   948  N N   . GLY D  1 1  ? 2.626   -11.083 16.298  1.00 57.93  ? 1   GLY D N   1 
ATOM   949  C CA  . GLY D  1 1  ? 1.603   -10.241 16.884  1.00 60.58  ? 1   GLY D CA  1 
ATOM   950  C C   . GLY D  1 1  ? 2.198   -9.077  17.665  1.00 57.60  ? 1   GLY D C   1 
ATOM   951  O O   . GLY D  1 1  ? 3.395   -9.091  17.954  1.00 48.04  ? 1   GLY D O   1 
ATOM   952  N N   . ILE D  1 2  ? 1.358   -8.105  17.988  1.00 53.25  ? 2   ILE D N   1 
ATOM   953  C CA  . ILE D  1 2  ? 1.726   -6.854  18.630  1.00 48.10  ? 2   ILE D CA  1 
ATOM   954  C C   . ILE D  1 2  ? 1.858   -6.947  20.143  1.00 38.26  ? 2   ILE D C   1 
ATOM   955  O O   . ILE D  1 2  ? 0.887   -7.173  20.865  1.00 33.39  ? 2   ILE D O   1 
ATOM   956  C CB  . ILE D  1 2  ? 0.677   -5.763  18.314  1.00 47.84  ? 2   ILE D CB  1 
ATOM   957  C CG1 . ILE D  1 2  ? 0.403   -5.611  16.817  1.00 45.24  ? 2   ILE D CG1 1 
ATOM   958  C CG2 . ILE D  1 2  ? 1.066   -4.436  18.952  1.00 26.49  ? 2   ILE D CG2 1 
ATOM   959  C CD1 . ILE D  1 2  ? -0.889  -4.901  16.484  1.00 43.90  ? 2   ILE D CD1 1 
ATOM   960  N N   . GLY D  1 3  ? 3.071   -6.752  20.641  1.00 32.43  ? 3   GLY D N   1 
ATOM   961  C CA  . GLY D  1 3  ? 3.322   -6.748  22.072  1.00 25.14  ? 3   GLY D CA  1 
ATOM   962  C C   . GLY D  1 3  ? 4.314   -5.677  22.474  1.00 29.26  ? 3   GLY D C   1 
ATOM   963  O O   . GLY D  1 3  ? 5.097   -5.808  23.419  1.00 28.01  ? 3   GLY D O   1 
ATOM   964  N N   . ASP D  1 4  ? 4.293   -4.575  21.729  1.00 33.37  ? 4   ASP D N   1 
ATOM   965  C CA  . ASP D  1 4  ? 5.136   -3.431  22.084  1.00 25.10  ? 4   ASP D CA  1 
ATOM   966  C C   . ASP D  1 4  ? 4.508   -2.163  21.521  1.00 24.13  ? 4   ASP D C   1 
ATOM   967  O O   . ASP D  1 4  ? 3.707   -2.254  20.576  1.00 19.75  ? 4   ASP D O   1 
ATOM   968  C CB  . ASP D  1 4  ? 6.567   -3.631  21.587  1.00 24.36  ? 4   ASP D CB  1 
ATOM   969  C CG  . ASP D  1 4  ? 6.670   -3.363  20.101  1.00 24.31  ? 4   ASP D CG  1 
ATOM   970  O OD1 . ASP D  1 4  ? 6.546   -4.329  19.322  1.00 30.66  ? 4   ASP D OD1 1 
ATOM   971  O OD2 . ASP D  1 4  ? 6.868   -2.183  19.737  1.00 24.66  ? 4   ASP D OD2 1 
ATOM   972  N N   . PRO D  1 5  ? 4.857   -1.024  22.103  1.00 17.48  ? 5   PRO D N   1 
ATOM   973  C CA  . PRO D  1 5  ? 4.223   0.235   21.693  1.00 16.93  ? 5   PRO D CA  1 
ATOM   974  C C   . PRO D  1 5  ? 4.576   0.673   20.278  1.00 15.77  ? 5   PRO D C   1 
ATOM   975  O O   . PRO D  1 5  ? 3.694   1.256   19.637  1.00 17.69  ? 5   PRO D O   1 
ATOM   976  C CB  . PRO D  1 5  ? 4.774   1.258   22.686  1.00 21.32  ? 5   PRO D CB  1 
ATOM   977  C CG  . PRO D  1 5  ? 6.040   0.663   23.213  1.00 23.33  ? 5   PRO D CG  1 
ATOM   978  C CD  . PRO D  1 5  ? 5.853   -0.830  23.173  1.00 23.00  ? 5   PRO D CD  1 
ATOM   979  N N   . VAL D  1 6  ? 5.795   0.415   19.808  1.00 15.42  ? 6   VAL D N   1 
ATOM   980  C CA  . VAL D  1 6  ? 6.257   0.866   18.501  1.00 16.62  ? 6   VAL D CA  1 
ATOM   981  C C   . VAL D  1 6  ? 5.514   0.115   17.388  1.00 15.61  ? 6   VAL D C   1 
ATOM   982  O O   . VAL D  1 6  ? 4.993   0.704   16.454  1.00 21.63  ? 6   VAL D O   1 
ATOM   983  C CB  . VAL D  1 6  ? 7.766   0.685   18.269  1.00 18.60  ? 6   VAL D CB  1 
ATOM   984  C CG1 . VAL D  1 6  ? 8.102   0.956   16.804  1.00 20.98  ? 6   VAL D CG1 1 
ATOM   985  C CG2 . VAL D  1 6  ? 8.603   1.588   19.160  1.00 18.98  ? 6   VAL D CG2 1 
ATOM   986  N N   . THR D  1 7  ? 5.484   -1.209  17.537  1.00 17.14  ? 7   THR D N   1 
ATOM   987  C CA  . THR D  1 7  ? 4.708   -2.021  16.609  1.00 33.57  ? 7   THR D CA  1 
ATOM   988  C C   . THR D  1 7  ? 3.252   -1.554  16.582  1.00 27.13  ? 7   THR D C   1 
ATOM   989  O O   . THR D  1 7  ? 2.651   -1.421  15.519  1.00 26.87  ? 7   THR D O   1 
ATOM   990  C CB  . THR D  1 7  ? 4.795   -3.511  16.983  1.00 34.07  ? 7   THR D CB  1 
ATOM   991  O OG1 . THR D  1 7  ? 6.158   -3.953  16.919  1.00 26.75  ? 7   THR D OG1 1 
ATOM   992  C CG2 . THR D  1 7  ? 4.023   -4.337  15.963  1.00 49.51  ? 7   THR D CG2 1 
ATOM   993  N N   . CYS D  1 8  ? 2.698   -1.295  17.765  1.00 24.32  ? 8   CYS D N   1 
ATOM   994  C CA  . CYS D  1 8  ? 1.289   -0.942  17.914  1.00 24.31  ? 8   CYS D CA  1 
ATOM   995  C C   . CYS D  1 8  ? 0.987   0.365   17.196  1.00 22.59  ? 8   CYS D C   1 
ATOM   996  O O   . CYS D  1 8  ? 0.042   0.457   16.413  1.00 22.05  ? 8   CYS D O   1 
ATOM   997  C CB  . CYS D  1 8  ? 0.899   -0.867  19.392  1.00 17.67  ? 8   CYS D CB  1 
ATOM   998  S SG  . CYS D  1 8  ? -0.799  -0.317  19.709  1.00 23.38  ? 8   CYS D SG  1 
ATOM   999  N N   . LEU D  1 9  ? 1.806   1.382   17.449  1.00 19.88  ? 9   LEU D N   1 
ATOM   1000 C CA  . LEU D  1 9  ? 1.546   2.703   16.891  1.00 20.00  ? 9   LEU D CA  1 
ATOM   1001 C C   . LEU D  1 9  ? 1.817   2.736   15.397  1.00 16.57  ? 9   LEU D C   1 
ATOM   1002 O O   . LEU D  1 9  ? 1.171   3.460   14.631  1.00 25.38  ? 9   LEU D O   1 
ATOM   1003 C CB  . LEU D  1 9  ? 2.393   3.770   17.600  1.00 17.74  ? 9   LEU D CB  1 
ATOM   1004 C CG  . LEU D  1 9  ? 1.935   4.080   19.033  1.00 18.22  ? 9   LEU D CG  1 
ATOM   1005 C CD1 . LEU D  1 9  ? 3.004   4.861   19.800  1.00 20.71  ? 9   LEU D CD1 1 
ATOM   1006 C CD2 . LEU D  1 9  ? 0.597   4.808   19.023  1.00 18.59  ? 9   LEU D CD2 1 
ATOM   1007 N N   . LYS D  1 10 ? 2.796   1.941   14.995  1.00 23.59  ? 10  LYS D N   1 
ATOM   1008 C CA  . LYS D  1 10 ? 3.148   1.908   13.575  1.00 22.49  ? 10  LYS D CA  1 
ATOM   1009 C C   . LYS D  1 10 ? 1.983   1.366   12.756  1.00 29.23  ? 10  LYS D C   1 
ATOM   1010 O O   . LYS D  1 10 ? 1.799   1.724   11.590  1.00 30.51  ? 10  LYS D O   1 
ATOM   1011 C CB  . LYS D  1 10 ? 4.416   1.086   13.388  1.00 28.11  ? 10  LYS D CB  1 
ATOM   1012 C CG  . LYS D  1 10 ? 4.993   1.082   11.980  1.00 37.60  ? 10  LYS D CG  1 
ATOM   1013 C CD  . LYS D  1 10 ? 6.055   -0.011  11.850  1.00 38.87  ? 10  LYS D CD  1 
ATOM   1014 C CE  . LYS D  1 10 ? 5.942   -0.736  10.521  1.00 34.66  ? 10  LYS D CE  1 
ATOM   1015 N NZ  . LYS D  1 10 ? 6.782   -1.968  10.448  1.00 54.74  ? 10  LYS D NZ  1 
ATOM   1016 N N   . SER D  1 11 ? 1.176   0.502   13.376  1.00 26.47  ? 11  SER D N   1 
ATOM   1017 C CA  . SER D  1 11 ? 0.059   -0.076  12.621  1.00 30.98  ? 11  SER D CA  1 
ATOM   1018 C C   . SER D  1 11 ? -1.152  0.841   12.560  1.00 37.31  ? 11  SER D C   1 
ATOM   1019 O O   . SER D  1 11 ? -2.140  0.521   11.894  1.00 38.38  ? 11  SER D O   1 
ATOM   1020 C CB  . SER D  1 11 ? -0.342  -1.413  13.232  1.00 31.65  ? 11  SER D CB  1 
ATOM   1021 O OG  . SER D  1 11 ? -1.091  -1.237  14.416  1.00 24.20  ? 11  SER D OG  1 
ATOM   1022 N N   . GLY D  1 12 ? -1.105  1.979   13.236  1.00 26.27  ? 12  GLY D N   1 
ATOM   1023 C CA  . GLY D  1 12 ? -2.224  2.904   13.273  1.00 22.50  ? 12  GLY D CA  1 
ATOM   1024 C C   . GLY D  1 12 ? -3.063  2.729   14.514  1.00 26.03  ? 12  GLY D C   1 
ATOM   1025 O O   . GLY D  1 12 ? -4.056  3.420   14.739  1.00 33.29  ? 12  GLY D O   1 
ATOM   1026 N N   . ALA D  1 13 ? -2.676  1.786   15.384  1.00 28.68  ? 13  ALA D N   1 
ATOM   1027 C CA  . ALA D  1 13 ? -3.509  1.653   16.583  1.00 24.86  ? 13  ALA D CA  1 
ATOM   1028 C C   . ALA D  1 13 ? -2.983  2.608   17.662  1.00 26.15  ? 13  ALA D C   1 
ATOM   1029 O O   . ALA D  1 13 ? -2.119  3.439   17.405  1.00 27.18  ? 13  ALA D O   1 
ATOM   1030 C CB  . ALA D  1 13 ? -3.578  0.230   17.075  1.00 24.97  ? 13  ALA D CB  1 
ATOM   1031 N N   . ILE D  1 14 ? -3.536  2.463   18.858  1.00 27.65  ? 14  ILE D N   1 
ATOM   1032 C CA  . ILE D  1 14 ? -3.200  3.342   19.973  1.00 24.32  ? 14  ILE D CA  1 
ATOM   1033 C C   . ILE D  1 14 ? -2.899  2.531   21.218  1.00 22.50  ? 14  ILE D C   1 
ATOM   1034 O O   . ILE D  1 14 ? -3.476  1.468   21.440  1.00 24.00  ? 14  ILE D O   1 
ATOM   1035 C CB  . ILE D  1 14 ? -4.379  4.286   20.270  1.00 34.88  ? 14  ILE D CB  1 
ATOM   1036 C CG1 . ILE D  1 14 ? -5.456  3.611   21.127  1.00 33.47  ? 14  ILE D CG1 1 
ATOM   1037 C CG2 . ILE D  1 14 ? -4.980  4.867   18.996  1.00 26.28  ? 14  ILE D CG2 1 
ATOM   1038 C CD1 . ILE D  1 14 ? -6.681  4.470   21.340  1.00 46.79  ? 14  ILE D CD1 1 
ATOM   1039 N N   . CYS D  1 15 ? -1.984  3.010   22.063  1.00 14.97  ? 15  CYS D N   1 
ATOM   1040 C CA  . CYS D  1 15 ? -1.702  2.312   23.311  1.00 17.72  ? 15  CYS D CA  1 
ATOM   1041 C C   . CYS D  1 15 ? -2.428  2.964   24.489  1.00 24.15  ? 15  CYS D C   1 
ATOM   1042 O O   . CYS D  1 15 ? -2.243  4.172   24.664  1.00 20.48  ? 15  CYS D O   1 
ATOM   1043 C CB  . CYS D  1 15 ? -0.202  2.359   23.606  1.00 11.35  ? 15  CYS D CB  1 
ATOM   1044 S SG  . CYS D  1 15 ? 0.890   1.482   22.504  1.00 19.17  ? 15  CYS D SG  1 
ATOM   1045 N N   . HIS D  1 16 ? -3.191  2.206   25.251  1.00 20.41  ? 16  HIS D N   1 
ATOM   1046 C CA  . HIS D  1 16 ? -3.874  2.619   26.460  1.00 22.89  ? 16  HIS D CA  1 
ATOM   1047 C C   . HIS D  1 16 ? -3.134  2.038   27.661  1.00 23.97  ? 16  HIS D C   1 
ATOM   1048 O O   . HIS D  1 16 ? -2.719  0.880   27.561  1.00 27.85  ? 16  HIS D O   1 
ATOM   1049 C CB  . HIS D  1 16 ? -5.339  2.159   26.527  1.00 27.09  ? 16  HIS D CB  1 
ATOM   1050 C CG  . HIS D  1 16 ? -6.246  3.275   26.090  1.00 38.45  ? 16  HIS D CG  1 
ATOM   1051 N ND1 . HIS D  1 16 ? -6.785  4.194   26.958  1.00 35.74  ? 16  HIS D ND1 1 
ATOM   1052 C CD2 . HIS D  1 16 ? -6.687  3.626   24.858  1.00 45.20  ? 16  HIS D CD2 1 
ATOM   1053 C CE1 . HIS D  1 16 ? -7.525  5.057   26.291  1.00 41.58  ? 16  HIS D CE1 1 
ATOM   1054 N NE2 . HIS D  1 16 ? -7.486  4.734   25.009  1.00 43.07  ? 16  HIS D NE2 1 
ATOM   1055 N N   . PRO D  1 17 ? -2.972  2.796   28.732  1.00 21.50  ? 17  PRO D N   1 
ATOM   1056 C CA  . PRO D  1 17 ? -2.183  2.265   29.852  1.00 19.74  ? 17  PRO D CA  1 
ATOM   1057 C C   . PRO D  1 17 ? -2.867  1.088   30.527  1.00 30.36  ? 17  PRO D C   1 
ATOM   1058 O O   . PRO D  1 17 ? -2.172  0.204   31.038  1.00 33.45  ? 17  PRO D O   1 
ATOM   1059 C CB  . PRO D  1 17 ? -2.082  3.456   30.810  1.00 21.13  ? 17  PRO D CB  1 
ATOM   1060 C CG  . PRO D  1 17 ? -3.230  4.334   30.464  1.00 22.25  ? 17  PRO D CG  1 
ATOM   1061 C CD  . PRO D  1 17 ? -3.466  4.156   28.987  1.00 19.59  ? 17  PRO D CD  1 
ATOM   1062 N N   . VAL D  1 18 ? -4.202  1.065   30.554  1.00 33.42  ? 18  VAL D N   1 
ATOM   1063 C CA  . VAL D  1 18 ? -4.843  0.005   31.343  1.00 36.88  ? 18  VAL D CA  1 
ATOM   1064 C C   . VAL D  1 18 ? -5.981  -0.686  30.611  1.00 44.11  ? 18  VAL D C   1 
ATOM   1065 O O   . VAL D  1 18 ? -6.117  -1.916  30.706  1.00 36.72  ? 18  VAL D O   1 
ATOM   1066 C CB  . VAL D  1 18 ? -5.332  0.580   32.688  1.00 34.98  ? 18  VAL D CB  1 
ATOM   1067 C CG1 . VAL D  1 18 ? -6.241  -0.413  33.396  1.00 39.57  ? 18  VAL D CG1 1 
ATOM   1068 C CG2 . VAL D  1 18 ? -4.139  0.939   33.565  1.00 32.80  ? 18  VAL D CG2 1 
ATOM   1069 N N   . PHE D  1 19 ? -6.822  0.031   29.866  1.00 37.80  ? 19  PHE D N   1 
ATOM   1070 C CA  . PHE D  1 19 ? -7.863  -0.664  29.107  1.00 36.51  ? 19  PHE D CA  1 
ATOM   1071 C C   . PHE D  1 19 ? -8.249  0.071   27.835  1.00 37.84  ? 19  PHE D C   1 
ATOM   1072 O O   . PHE D  1 19 ? -8.058  1.286   27.705  1.00 50.68  ? 19  PHE D O   1 
ATOM   1073 C CB  . PHE D  1 19 ? -9.108  -0.839  29.992  1.00 38.25  ? 19  PHE D CB  1 
ATOM   1074 C CG  . PHE D  1 19 ? -9.675  0.500   30.445  1.00 41.48  ? 19  PHE D CG  1 
ATOM   1075 C CD1 . PHE D  1 19 ? -10.694 1.139   29.759  1.00 43.48  ? 19  PHE D CD1 1 
ATOM   1076 C CD2 . PHE D  1 19 ? -9.156  1.114   31.574  1.00 46.50  ? 19  PHE D CD2 1 
ATOM   1077 C CE1 . PHE D  1 19 ? -11.191 2.361   30.166  1.00 38.80  ? 19  PHE D CE1 1 
ATOM   1078 C CE2 . PHE D  1 19 ? -9.656  2.331   32.000  1.00 48.42  ? 19  PHE D CE2 1 
ATOM   1079 C CZ  . PHE D  1 19 ? -10.671 2.956   31.300  1.00 42.76  ? 19  PHE D CZ  1 
ATOM   1080 N N   . CYS D  1 20 ? -8.842  -0.631  26.870  1.00 37.95  ? 20  CYS D N   1 
ATOM   1081 C CA  . CYS D  1 20 ? -9.381  0.040   25.688  1.00 35.49  ? 20  CYS D CA  1 
ATOM   1082 C C   . CYS D  1 20 ? -10.731 0.681   25.983  1.00 37.49  ? 20  CYS D C   1 
ATOM   1083 O O   . CYS D  1 20 ? -11.644 0.011   26.477  1.00 51.12  ? 20  CYS D O   1 
ATOM   1084 C CB  . CYS D  1 20 ? -9.533  -0.956  24.537  1.00 26.75  ? 20  CYS D CB  1 
ATOM   1085 S SG  . CYS D  1 20 ? -8.005  -1.826  24.106  1.00 38.71  ? 20  CYS D SG  1 
ATOM   1086 N N   . PRO D  1 21 ? -10.890 1.967   25.699  1.00 39.30  ? 21  PRO D N   1 
ATOM   1087 C CA  . PRO D  1 21 ? -12.181 2.621   25.930  1.00 44.63  ? 21  PRO D CA  1 
ATOM   1088 C C   . PRO D  1 21 ? -13.296 1.875   25.202  1.00 51.61  ? 21  PRO D C   1 
ATOM   1089 O O   . PRO D  1 21 ? -13.012 1.254   24.182  1.00 41.84  ? 21  PRO D O   1 
ATOM   1090 C CB  . PRO D  1 21 ? -12.009 4.004   25.305  1.00 48.50  ? 21  PRO D CB  1 
ATOM   1091 C CG  . PRO D  1 21 ? -10.543 4.233   25.254  1.00 41.58  ? 21  PRO D CG  1 
ATOM   1092 C CD  . PRO D  1 21 ? -9.888  2.887   25.148  1.00 37.46  ? 21  PRO D CD  1 
ATOM   1093 N N   . ARG D  1 22 ? -14.518 1.954   25.686  1.00 61.44  ? 22  ARG D N   1 
ATOM   1094 C CA  . ARG D  1 22 ? -15.688 1.243   25.194  1.00 69.84  ? 22  ARG D CA  1 
ATOM   1095 C C   . ARG D  1 22 ? -16.077 1.561   23.758  1.00 72.68  ? 22  ARG D C   1 
ATOM   1096 O O   . ARG D  1 22 ? -17.264 1.766   23.476  1.00 79.98  ? 22  ARG D O   1 
ATOM   1097 C CB  . ARG D  1 22 ? -16.866 1.573   26.123  1.00 76.28  ? 22  ARG D CB  1 
ATOM   1098 C CG  . ARG D  1 22 ? -18.112 0.725   25.931  1.00 85.24  ? 22  ARG D CG  1 
ATOM   1099 C CD  . ARG D  1 22 ? -19.017 0.811   27.150  1.00 95.59  ? 22  ARG D CD  1 
ATOM   1100 N NE  . ARG D  1 22 ? -19.600 2.132   27.351  1.00 103.10 ? 22  ARG D NE  1 
ATOM   1101 C CZ  . ARG D  1 22 ? -19.031 3.121   28.038  1.00 105.70 ? 22  ARG D CZ  1 
ATOM   1102 N NH1 . ARG D  1 22 ? -17.846 2.926   28.607  1.00 101.99 ? 22  ARG D NH1 1 
ATOM   1103 N NH2 . ARG D  1 22 ? -19.640 4.290   28.166  1.00 108.12 ? 22  ARG D NH2 1 
ATOM   1104 N N   . ARG D  1 23 ? -15.123 1.625   22.843  1.00 74.22  ? 23  ARG D N   1 
ATOM   1105 C CA  . ARG D  1 23 ? -15.370 1.935   21.445  1.00 74.47  ? 23  ARG D CA  1 
ATOM   1106 C C   . ARG D  1 23 ? -14.242 1.409   20.554  1.00 67.82  ? 23  ARG D C   1 
ATOM   1107 O O   . ARG D  1 23 ? -14.320 1.603   19.342  1.00 53.09  ? 23  ARG D O   1 
ATOM   1108 C CB  . ARG D  1 23 ? -15.525 3.442   21.230  1.00 79.92  ? 23  ARG D CB  1 
ATOM   1109 C CG  . ARG D  1 23 ? -14.428 4.285   21.870  1.00 85.96  ? 23  ARG D CG  1 
ATOM   1110 C CD  . ARG D  1 23 ? -14.741 4.560   23.334  1.00 92.07  ? 23  ARG D CD  1 
ATOM   1111 N NE  . ARG D  1 23 ? -16.177 4.683   23.568  1.00 96.06  ? 23  ARG D NE  1 
ATOM   1112 C CZ  . ARG D  1 23 ? -16.758 4.622   24.760  1.00 98.16  ? 23  ARG D CZ  1 
ATOM   1113 N NH1 . ARG D  1 23 ? -16.016 4.432   25.844  1.00 99.38  ? 23  ARG D NH1 1 
ATOM   1114 N NH2 . ARG D  1 23 ? -18.074 4.745   24.868  1.00 96.67  ? 23  ARG D NH2 1 
ATOM   1115 N N   . TYR D  1 24 ? -13.250 0.770   21.162  1.00 62.75  ? 24  TYR D N   1 
ATOM   1116 C CA  . TYR D  1 24 ? -12.094 0.213   20.486  1.00 56.12  ? 24  TYR D CA  1 
ATOM   1117 C C   . TYR D  1 24 ? -11.974 -1.301  20.639  1.00 46.03  ? 24  TYR D C   1 
ATOM   1118 O O   . TYR D  1 24 ? -12.408 -1.889  21.624  1.00 43.63  ? 24  TYR D O   1 
ATOM   1119 C CB  . TYR D  1 24 ? -10.780 0.810   21.016  1.00 50.76  ? 24  TYR D CB  1 
ATOM   1120 C CG  . TYR D  1 24 ? -10.689 2.301   20.812  1.00 47.90  ? 24  TYR D CG  1 
ATOM   1121 C CD1 . TYR D  1 24 ? -11.149 3.167   21.794  1.00 56.71  ? 24  TYR D CD1 1 
ATOM   1122 C CD2 . TYR D  1 24 ? -10.138 2.827   19.652  1.00 47.50  ? 24  TYR D CD2 1 
ATOM   1123 C CE1 . TYR D  1 24 ? -11.073 4.536   21.620  1.00 57.07  ? 24  TYR D CE1 1 
ATOM   1124 C CE2 . TYR D  1 24 ? -10.054 4.196   19.473  1.00 46.75  ? 24  TYR D CE2 1 
ATOM   1125 C CZ  . TYR D  1 24 ? -10.531 5.039   20.458  1.00 48.75  ? 24  TYR D CZ  1 
ATOM   1126 O OH  . TYR D  1 24 ? -10.451 6.402   20.284  1.00 70.57  ? 24  TYR D OH  1 
ATOM   1127 N N   . LYS D  1 25 ? -11.345 -1.898  19.634  1.00 49.26  ? 25  LYS D N   1 
ATOM   1128 C CA  . LYS D  1 25 ? -11.084 -3.332  19.624  1.00 52.34  ? 25  LYS D CA  1 
ATOM   1129 C C   . LYS D  1 25 ? -9.633  -3.629  19.992  1.00 55.60  ? 25  LYS D C   1 
ATOM   1130 O O   . LYS D  1 25 ? -8.713  -3.261  19.256  1.00 67.43  ? 25  LYS D O   1 
ATOM   1131 C CB  . LYS D  1 25 ? -11.419 -3.912  18.248  1.00 48.68  ? 25  LYS D CB  1 
ATOM   1132 C CG  . LYS D  1 25 ? -10.580 -5.117  17.860  1.00 52.97  ? 25  LYS D CG  1 
ATOM   1133 C CD  . LYS D  1 25 ? -11.417 -6.390  17.897  1.00 59.74  ? 25  LYS D CD  1 
ATOM   1134 C CE  . LYS D  1 25 ? -12.898 -6.050  18.086  1.00 61.56  ? 25  LYS D CE  1 
ATOM   1135 N NZ  . LYS D  1 25 ? -13.729 -6.589  16.962  1.00 55.34  ? 25  LYS D NZ  1 
ATOM   1136 N N   . GLN D  1 26 ? -9.434  -4.291  21.132  1.00 49.96  ? 26  GLN D N   1 
ATOM   1137 C CA  . GLN D  1 26 ? -8.112  -4.693  21.576  1.00 41.14  ? 26  GLN D CA  1 
ATOM   1138 C C   . GLN D  1 26 ? -7.441  -5.632  20.579  1.00 45.59  ? 26  GLN D C   1 
ATOM   1139 O O   . GLN D  1 26 ? -7.993  -6.679  20.233  1.00 63.23  ? 26  GLN D O   1 
ATOM   1140 C CB  . GLN D  1 26 ? -8.169  -5.377  22.956  1.00 34.56  ? 26  GLN D CB  1 
ATOM   1141 C CG  . GLN D  1 26 ? -6.759  -5.689  23.445  1.00 31.64  ? 26  GLN D CG  1 
ATOM   1142 C CD  . GLN D  1 26 ? -6.676  -6.454  24.743  1.00 34.46  ? 26  GLN D CD  1 
ATOM   1143 O OE1 . GLN D  1 26 ? -5.702  -7.173  24.966  1.00 47.40  ? 26  GLN D OE1 1 
ATOM   1144 N NE2 . GLN D  1 26 ? -7.668  -6.311  25.611  1.00 58.87  ? 26  GLN D NE2 1 
ATOM   1145 N N   . ILE D  1 27 ? -6.249  -5.288  20.102  1.00 48.94  ? 27  ILE D N   1 
ATOM   1146 C CA  . ILE D  1 27 ? -5.568  -6.136  19.127  1.00 40.53  ? 27  ILE D CA  1 
ATOM   1147 C C   . ILE D  1 27 ? -4.207  -6.579  19.635  1.00 37.24  ? 27  ILE D C   1 
ATOM   1148 O O   . ILE D  1 27 ? -3.449  -7.156  18.859  1.00 42.14  ? 27  ILE D O   1 
ATOM   1149 C CB  . ILE D  1 27 ? -5.354  -5.416  17.782  1.00 45.83  ? 27  ILE D CB  1 
ATOM   1150 C CG1 . ILE D  1 27 ? -4.347  -4.269  17.858  1.00 39.79  ? 27  ILE D CG1 1 
ATOM   1151 C CG2 . ILE D  1 27 ? -6.681  -4.940  17.211  1.00 53.73  ? 27  ILE D CG2 1 
ATOM   1152 C CD1 . ILE D  1 27 ? -4.205  -3.453  16.596  1.00 30.35  ? 27  ILE D CD1 1 
ATOM   1153 N N   . GLY D  1 28 ? -3.906  -6.305  20.904  1.00 34.98  ? 28  GLY D N   1 
ATOM   1154 C CA  . GLY D  1 28 ? -2.607  -6.648  21.457  1.00 36.70  ? 28  GLY D CA  1 
ATOM   1155 C C   . GLY D  1 28 ? -2.259  -5.863  22.705  1.00 36.75  ? 28  GLY D C   1 
ATOM   1156 O O   . GLY D  1 28 ? -3.134  -5.342  23.403  1.00 33.28  ? 28  GLY D O   1 
ATOM   1157 N N   . THR D  1 29 ? -0.966  -5.755  23.010  1.00 33.78  ? 29  THR D N   1 
ATOM   1158 C CA  . THR D  1 29 ? -0.518  -4.971  24.157  1.00 37.32  ? 29  THR D CA  1 
ATOM   1159 C C   . THR D  1 29 ? 0.522   -3.937  23.744  1.00 37.24  ? 29  THR D C   1 
ATOM   1160 O O   . THR D  1 29 ? 0.953   -3.908  22.595  1.00 27.57  ? 29  THR D O   1 
ATOM   1161 C CB  . THR D  1 29 ? 0.164   -5.840  25.229  1.00 31.41  ? 29  THR D CB  1 
ATOM   1162 O OG1 . THR D  1 29 ? 1.404   -6.315  24.671  1.00 29.99  ? 29  THR D OG1 1 
ATOM   1163 C CG2 . THR D  1 29 ? -0.706  -7.030  25.592  1.00 29.41  ? 29  THR D CG2 1 
ATOM   1164 N N   . CYS D  1 30 ? 0.975   -3.115  24.693  1.00 31.33  ? 30  CYS D N   1 
ATOM   1165 C CA  . CYS D  1 30 ? 2.083   -2.233  24.323  1.00 25.86  ? 30  CYS D CA  1 
ATOM   1166 C C   . CYS D  1 30 ? 3.318   -2.498  25.168  1.00 23.33  ? 30  CYS D C   1 
ATOM   1167 O O   . CYS D  1 30 ? 4.008   -1.588  25.602  1.00 30.99  ? 30  CYS D O   1 
ATOM   1168 C CB  . CYS D  1 30 ? 1.614   -0.775  24.394  1.00 21.51  ? 30  CYS D CB  1 
ATOM   1169 S SG  . CYS D  1 30 ? 0.520   -0.466  22.985  1.00 21.73  ? 30  CYS D SG  1 
ATOM   1170 N N   . GLY D  1 31 ? 3.583   -3.792  25.360  1.00 34.48  ? 31  GLY D N   1 
ATOM   1171 C CA  . GLY D  1 31 ? 4.798   -4.238  26.005  1.00 38.96  ? 31  GLY D CA  1 
ATOM   1172 C C   . GLY D  1 31 ? 4.765   -4.182  27.512  1.00 41.93  ? 31  GLY D C   1 
ATOM   1173 O O   . GLY D  1 31 ? 4.666   -5.229  28.169  1.00 31.17  ? 31  GLY D O   1 
ATOM   1174 N N   . LEU D  1 32 ? 4.849   -2.969  28.080  1.00 42.87  ? 32  LEU D N   1 
ATOM   1175 C CA  . LEU D  1 32 ? 4.817   -2.915  29.547  1.00 48.04  ? 32  LEU D CA  1 
ATOM   1176 C C   . LEU D  1 32 ? 3.478   -3.492  30.012  1.00 48.83  ? 32  LEU D C   1 
ATOM   1177 O O   . LEU D  1 32 ? 2.422   -3.124  29.500  1.00 47.77  ? 32  LEU D O   1 
ATOM   1178 C CB  . LEU D  1 32 ? 5.065   -1.523  30.096  1.00 45.68  ? 32  LEU D CB  1 
ATOM   1179 C CG  . LEU D  1 32 ? 4.305   -0.357  29.479  1.00 42.80  ? 32  LEU D CG  1 
ATOM   1180 C CD1 . LEU D  1 32 ? 4.263   0.845   30.414  1.00 28.31  ? 32  LEU D CD1 1 
ATOM   1181 C CD2 . LEU D  1 32 ? 4.908   0.027   28.133  1.00 44.75  ? 32  LEU D CD2 1 
ATOM   1182 N N   . PRO D  1 33 ? 3.559   -4.414  30.964  1.00 48.26  ? 33  PRO D N   1 
ATOM   1183 C CA  . PRO D  1 33 ? 2.376   -5.158  31.411  1.00 48.36  ? 33  PRO D CA  1 
ATOM   1184 C C   . PRO D  1 33 ? 1.216   -4.238  31.767  1.00 45.17  ? 33  PRO D C   1 
ATOM   1185 O O   . PRO D  1 33 ? 1.412   -3.160  32.322  1.00 40.42  ? 33  PRO D O   1 
ATOM   1186 C CB  . PRO D  1 33 ? 2.886   -5.900  32.649  1.00 54.26  ? 33  PRO D CB  1 
ATOM   1187 C CG  . PRO D  1 33 ? 4.345   -6.087  32.370  1.00 55.92  ? 33  PRO D CG  1 
ATOM   1188 C CD  . PRO D  1 33 ? 4.777   -4.818  31.683  1.00 53.56  ? 33  PRO D CD  1 
ATOM   1189 N N   . GLY D  1 34 ? 0.010   -4.687  31.431  1.00 40.57  ? 34  GLY D N   1 
ATOM   1190 C CA  . GLY D  1 34 ? -1.200  -3.941  31.701  1.00 36.79  ? 34  GLY D CA  1 
ATOM   1191 C C   . GLY D  1 34 ? -1.571  -3.013  30.561  1.00 36.91  ? 34  GLY D C   1 
ATOM   1192 O O   . GLY D  1 34 ? -2.706  -2.529  30.492  1.00 32.96  ? 34  GLY D O   1 
ATOM   1193 N N   . THR D  1 35 ? -0.629  -2.747  29.657  1.00 30.73  ? 35  THR D N   1 
ATOM   1194 C CA  . THR D  1 35 ? -0.926  -1.820  28.570  1.00 20.14  ? 35  THR D CA  1 
ATOM   1195 C C   . THR D  1 35 ? -1.606  -2.534  27.407  1.00 21.62  ? 35  THR D C   1 
ATOM   1196 O O   . THR D  1 35 ? -1.331  -3.701  27.155  1.00 28.02  ? 35  THR D O   1 
ATOM   1197 C CB  . THR D  1 35 ? 0.345   -1.129  28.048  1.00 20.07  ? 35  THR D CB  1 
ATOM   1198 O OG1 . THR D  1 35 ? 1.224   -2.113  27.494  1.00 26.54  ? 35  THR D OG1 1 
ATOM   1199 C CG2 . THR D  1 35 ? 1.024   -0.446  29.225  1.00 21.82  ? 35  THR D CG2 1 
ATOM   1200 N N   . LYS D  1 36 ? -2.467  -1.804  26.720  1.00 20.99  ? 36  LYS D N   1 
ATOM   1201 C CA  . LYS D  1 36 ? -3.291  -2.371  25.670  1.00 25.01  ? 36  LYS D CA  1 
ATOM   1202 C C   . LYS D  1 36 ? -3.090  -1.719  24.314  1.00 29.80  ? 36  LYS D C   1 
ATOM   1203 O O   . LYS D  1 36 ? -3.056  -0.495  24.180  1.00 32.47  ? 36  LYS D O   1 
ATOM   1204 C CB  . LYS D  1 36 ? -4.772  -2.223  26.055  1.00 27.06  ? 36  LYS D CB  1 
ATOM   1205 C CG  . LYS D  1 36 ? -5.116  -2.760  27.430  1.00 33.03  ? 36  LYS D CG  1 
ATOM   1206 C CD  . LYS D  1 36 ? -5.474  -4.237  27.363  1.00 33.99  ? 36  LYS D CD  1 
ATOM   1207 C CE  . LYS D  1 36 ? -6.138  -4.685  28.650  1.00 35.39  ? 36  LYS D CE  1 
ATOM   1208 N NZ  . LYS D  1 36 ? -5.134  -4.864  29.738  1.00 29.35  ? 36  LYS D NZ  1 
ATOM   1209 N N   . CYS D  1 37 ? -2.987  -2.557  23.279  1.00 26.75  ? 37  CYS D N   1 
ATOM   1210 C CA  . CYS D  1 37 ? -2.948  -1.986  21.936  1.00 24.38  ? 37  CYS D CA  1 
ATOM   1211 C C   . CYS D  1 37 ? -4.382  -1.992  21.401  1.00 30.13  ? 37  CYS D C   1 
ATOM   1212 O O   . CYS D  1 37 ? -4.951  -3.050  21.152  1.00 31.46  ? 37  CYS D O   1 
ATOM   1213 C CB  . CYS D  1 37 ? -2.007  -2.750  21.009  1.00 23.42  ? 37  CYS D CB  1 
ATOM   1214 S SG  . CYS D  1 37 ? -1.930  -1.988  19.361  1.00 27.65  ? 37  CYS D SG  1 
ATOM   1215 N N   . CYS D  1 38 ? -4.980  -0.820  21.239  1.00 26.35  ? 38  CYS D N   1 
ATOM   1216 C CA  . CYS D  1 38 ? -6.407  -0.735  20.934  1.00 32.56  ? 38  CYS D CA  1 
ATOM   1217 C C   . CYS D  1 38 ? -6.676  -0.169  19.547  1.00 37.13  ? 38  CYS D C   1 
ATOM   1218 O O   . CYS D  1 38 ? -6.023  0.795   19.138  1.00 36.15  ? 38  CYS D O   1 
ATOM   1219 C CB  . CYS D  1 38 ? -7.107  0.138   21.983  1.00 29.84  ? 38  CYS D CB  1 
ATOM   1220 S SG  . CYS D  1 38 ? -6.709  -0.305  23.690  1.00 27.27  ? 38  CYS D SG  1 
ATOM   1221 N N   . LYS D  1 39 ? -7.630  -0.777  18.845  1.00 43.22  ? 39  LYS D N   1 
ATOM   1222 C CA  . LYS D  1 39 ? -7.965  -0.403  17.478  1.00 46.84  ? 39  LYS D CA  1 
ATOM   1223 C C   . LYS D  1 39 ? -9.472  -0.433  17.227  1.00 49.36  ? 39  LYS D C   1 
ATOM   1224 O O   . LYS D  1 39 ? -10.136 -1.434  17.497  1.00 56.01  ? 39  LYS D O   1 
ATOM   1225 C CB  . LYS D  1 39 ? -7.256  -1.336  16.491  1.00 50.31  ? 39  LYS D CB  1 
ATOM   1226 C CG  . LYS D  1 39 ? -7.575  -1.071  15.030  1.00 49.94  ? 39  LYS D CG  1 
ATOM   1227 C CD  . LYS D  1 39 ? -6.606  -0.065  14.428  1.00 48.42  ? 39  LYS D CD  1 
ATOM   1228 C CE  . LYS D  1 39 ? -6.274  -0.419  12.981  1.00 49.09  ? 39  LYS D CE  1 
ATOM   1229 N NZ  . LYS D  1 39 ? -5.799  0.766   12.216  1.00 44.14  ? 39  LYS D NZ  1 
ATOM   1230 N N   . LYS D  1 40 ? -9.994  0.669   16.708  1.00 43.62  ? 40  LYS D N   1 
ATOM   1231 C CA  . LYS D  1 40 ? -11.410 0.789   16.375  1.00 51.49  ? 40  LYS D CA  1 
ATOM   1232 C C   . LYS D  1 40 ? -11.735 -0.003  15.111  1.00 59.42  ? 40  LYS D C   1 
ATOM   1233 O O   . LYS D  1 40 ? -11.216 0.314   14.035  1.00 76.94  ? 40  LYS D O   1 
ATOM   1234 C CB  . LYS D  1 40 ? -11.772 2.261   16.215  1.00 51.36  ? 40  LYS D CB  1 
ATOM   1235 C CG  . LYS D  1 40 ? -13.212 2.542   15.815  1.00 58.30  ? 40  LYS D CG  1 
ATOM   1236 C CD  . LYS D  1 40 ? -13.540 4.024   15.963  1.00 55.67  ? 40  LYS D CD  1 
ATOM   1237 C CE  . LYS D  1 40 ? -13.777 4.393   17.424  1.00 46.38  ? 40  LYS D CE  1 
ATOM   1238 N NZ  . LYS D  1 40 ? -12.540 4.971   18.045  1.00 47.43  ? 40  LYS D NZ  1 
ATOM   1239 N N   . PRO D  1 41 ? -12.580 -1.020  15.230  1.00 62.34  ? 41  PRO D N   1 
ATOM   1240 C CA  . PRO D  1 41 ? -12.876 -1.912  14.108  1.00 64.09  ? 41  PRO D CA  1 
ATOM   1241 C C   . PRO D  1 41 ? -13.690 -1.242  13.000  1.00 61.58  ? 41  PRO D C   1 
ATOM   1242 O O   . PRO D  1 41 ? -14.270 -0.173  13.227  1.00 63.44  ? 41  PRO D O   1 
ATOM   1243 C CB  . PRO D  1 41 ? -13.716 -3.028  14.742  1.00 64.61  ? 41  PRO D CB  1 
ATOM   1244 C CG  . PRO D  1 41 ? -14.324 -2.411  15.952  1.00 68.45  ? 41  PRO D CG  1 
ATOM   1245 C CD  . PRO D  1 41 ? -13.327 -1.395  16.446  1.00 67.05  ? 41  PRO D CD  1 
ATOM   1246 O OXT . PRO D  1 41 ? -13.721 -1.829  11.895  1.00 72.45  ? 41  PRO D OXT 1 
ATOM   1247 N N   . GLY E  1 1  ? 12.933  10.028  30.538  1.00 20.05  ? 1   GLY E N   1 
ATOM   1248 C CA  . GLY E  1 1  ? 11.646  10.018  31.236  1.00 16.98  ? 1   GLY E CA  1 
ATOM   1249 C C   . GLY E  1 1  ? 11.274  11.424  31.667  1.00 23.53  ? 1   GLY E C   1 
ATOM   1250 O O   . GLY E  1 1  ? 11.747  12.389  31.063  1.00 20.76  ? 1   GLY E O   1 
ATOM   1251 N N   . ILE E  1 2  ? 10.447  11.514  32.706  1.00 17.73  ? 2   ILE E N   1 
ATOM   1252 C CA  . ILE E  1 2  ? 10.165  12.813  33.321  1.00 15.25  ? 2   ILE E CA  1 
ATOM   1253 C C   . ILE E  1 2  ? 11.311  13.216  34.240  1.00 14.58  ? 2   ILE E C   1 
ATOM   1254 O O   . ILE E  1 2  ? 11.637  12.458  35.163  1.00 16.88  ? 2   ILE E O   1 
ATOM   1255 C CB  . ILE E  1 2  ? 8.833   12.738  34.067  1.00 9.90   ? 2   ILE E CB  1 
ATOM   1256 C CG1 . ILE E  1 2  ? 7.680   12.468  33.091  1.00 10.77  ? 2   ILE E CG1 1 
ATOM   1257 C CG2 . ILE E  1 2  ? 8.605   13.985  34.917  1.00 10.24  ? 2   ILE E CG2 1 
ATOM   1258 C CD1 . ILE E  1 2  ? 6.393   11.996  33.738  1.00 20.63  ? 2   ILE E CD1 1 
ATOM   1259 N N   . GLY E  1 3  ? 11.899  14.376  33.975  1.00 13.01  ? 3   GLY E N   1 
ATOM   1260 C CA  . GLY E  1 3  ? 13.054  14.868  34.691  1.00 13.29  ? 3   GLY E CA  1 
ATOM   1261 C C   . GLY E  1 3  ? 13.008  16.367  34.985  1.00 10.07  ? 3   GLY E C   1 
ATOM   1262 O O   . GLY E  1 3  ? 14.067  16.981  35.208  1.00 14.98  ? 3   GLY E O   1 
ATOM   1263 N N   . ASP E  1 4  ? 11.805  16.930  35.020  1.00 13.54  ? 4   ASP E N   1 
ATOM   1264 C CA  . ASP E  1 4  ? 11.699  18.357  35.335  1.00 14.48  ? 4   ASP E CA  1 
ATOM   1265 C C   . ASP E  1 4  ? 10.296  18.611  35.864  1.00 12.16  ? 4   ASP E C   1 
ATOM   1266 O O   . ASP E  1 4  ? 9.365   17.828  35.590  1.00 11.73  ? 4   ASP E O   1 
ATOM   1267 C CB  . ASP E  1 4  ? 12.078  19.232  34.126  1.00 14.28  ? 4   ASP E CB  1 
ATOM   1268 C CG  . ASP E  1 4  ? 10.939  19.281  33.120  1.00 15.56  ? 4   ASP E CG  1 
ATOM   1269 O OD1 . ASP E  1 4  ? 10.929  18.475  32.161  1.00 11.60  ? 4   ASP E OD1 1 
ATOM   1270 O OD2 . ASP E  1 4  ? 10.025  20.105  33.315  1.00 12.18  ? 4   ASP E OD2 1 
ATOM   1271 N N   . PRO E  1 5  ? 10.110  19.671  36.651  1.00 11.69  ? 5   PRO E N   1 
ATOM   1272 C CA  . PRO E  1 5  ? 8.822   19.949  37.284  1.00 10.42  ? 5   PRO E CA  1 
ATOM   1273 C C   . PRO E  1 5  ? 7.694   20.219  36.315  1.00 16.17  ? 5   PRO E C   1 
ATOM   1274 O O   . PRO E  1 5  ? 6.574   19.784  36.542  1.00 11.19  ? 5   PRO E O   1 
ATOM   1275 C CB  . PRO E  1 5  ? 9.065   21.244  38.095  1.00 10.26  ? 5   PRO E CB  1 
ATOM   1276 C CG  . PRO E  1 5  ? 10.533  21.330  38.225  1.00 14.95  ? 5   PRO E CG  1 
ATOM   1277 C CD  . PRO E  1 5  ? 11.133  20.676  37.002  1.00 16.29  ? 5   PRO E CD  1 
ATOM   1278 N N   A VAL E  1 6  ? 7.999   20.936  35.223  0.50 12.89  ? 6   VAL E N   1 
ATOM   1279 N N   B VAL E  1 6  ? 7.923   20.942  35.208  0.50 13.07  ? 6   VAL E N   1 
ATOM   1280 C CA  A VAL E  1 6  ? 6.932   21.305  34.298  0.50 11.06  ? 6   VAL E CA  1 
ATOM   1281 C CA  B VAL E  1 6  ? 6.738   21.233  34.393  0.50 10.97  ? 6   VAL E CA  1 
ATOM   1282 C C   A VAL E  1 6  ? 6.353   20.066  33.616  0.50 10.91  ? 6   VAL E C   1 
ATOM   1283 C C   B VAL E  1 6  ? 6.284   20.001  33.625  0.50 10.72  ? 6   VAL E C   1 
ATOM   1284 O O   A VAL E  1 6  ? 5.134   19.912  33.568  0.50 13.23  ? 6   VAL E O   1 
ATOM   1285 O O   B VAL E  1 6  ? 5.080   19.772  33.505  0.50 15.99  ? 6   VAL E O   1 
ATOM   1286 C CB  A VAL E  1 6  ? 7.396   22.322  33.240  0.50 11.37  ? 6   VAL E CB  1 
ATOM   1287 C CB  B VAL E  1 6  ? 6.997   22.400  33.423  0.50 15.26  ? 6   VAL E CB  1 
ATOM   1288 C CG1 A VAL E  1 6  ? 6.254   22.598  32.267  0.50 3.87   ? 6   VAL E CG1 1 
ATOM   1289 C CG1 B VAL E  1 6  ? 7.259   23.692  34.180  0.50 6.72   ? 6   VAL E CG1 1 
ATOM   1290 C CG2 A VAL E  1 6  ? 7.873   23.622  33.883  0.50 10.16  ? 6   VAL E CG2 1 
ATOM   1291 C CG2 B VAL E  1 6  ? 8.157   22.028  32.519  0.50 19.62  ? 6   VAL E CG2 1 
ATOM   1292 N N   . THR E  1 7  ? 7.215   19.193  33.108  1.00 13.22  ? 7   THR E N   1 
ATOM   1293 C CA  . THR E  1 7  ? 6.762   17.961  32.448  1.00 8.90   ? 7   THR E CA  1 
ATOM   1294 C C   . THR E  1 7  ? 5.944   17.112  33.408  1.00 10.09  ? 7   THR E C   1 
ATOM   1295 O O   . THR E  1 7  ? 4.902   16.539  33.088  1.00 10.88  ? 7   THR E O   1 
ATOM   1296 C CB  . THR E  1 7  ? 7.973   17.203  31.875  1.00 11.48  ? 7   THR E CB  1 
ATOM   1297 O OG1 . THR E  1 7  ? 8.650   18.086  30.949  1.00 13.32  ? 7   THR E OG1 1 
ATOM   1298 C CG2 . THR E  1 7  ? 7.549   15.987  31.070  1.00 12.19  ? 7   THR E CG2 1 
ATOM   1299 N N   . CYS E  1 8  ? 6.449   17.040  34.646  1.00 10.86  ? 8   CYS E N   1 
ATOM   1300 C CA  . CYS E  1 8  ? 5.725   16.291  35.674  1.00 11.97  ? 8   CYS E CA  1 
ATOM   1301 C C   . CYS E  1 8  ? 4.333   16.828  35.893  1.00 8.76   ? 8   CYS E C   1 
ATOM   1302 O O   . CYS E  1 8  ? 3.313   16.156  35.863  1.00 12.69  ? 8   CYS E O   1 
ATOM   1303 C CB  . CYS E  1 8  ? 6.571   16.329  36.967  1.00 9.58   ? 8   CYS E CB  1 
ATOM   1304 S SG  . CYS E  1 8  ? 5.741   15.436  38.329  1.00 12.91  ? 8   CYS E SG  1 
ATOM   1305 N N   . LEU E  1 9  ? 4.191   18.125  36.121  1.00 7.69   ? 9   LEU E N   1 
ATOM   1306 C CA  . LEU E  1 9  ? 2.902   18.739  36.410  1.00 9.39   ? 9   LEU E CA  1 
ATOM   1307 C C   . LEU E  1 9  ? 1.920   18.689  35.236  1.00 12.55  ? 9   LEU E C   1 
ATOM   1308 O O   . LEU E  1 9  ? 0.726   18.515  35.436  1.00 13.35  ? 9   LEU E O   1 
ATOM   1309 C CB  . LEU E  1 9  ? 3.179   20.183  36.839  1.00 11.22  ? 9   LEU E CB  1 
ATOM   1310 C CG  . LEU E  1 9  ? 3.769   20.338  38.246  1.00 15.23  ? 9   LEU E CG  1 
ATOM   1311 C CD1 . LEU E  1 9  ? 4.338   21.736  38.433  1.00 14.33  ? 9   LEU E CD1 1 
ATOM   1312 C CD2 . LEU E  1 9  ? 2.680   20.014  39.268  1.00 13.13  ? 9   LEU E CD2 1 
ATOM   1313 N N   A LYS E  1 10 ? 2.455   18.839  34.026  0.50 12.84  ? 10  LYS E N   1 
ATOM   1314 N N   B LYS E  1 10 ? 2.455   18.840  34.028  0.50 12.88  ? 10  LYS E N   1 
ATOM   1315 C CA  A LYS E  1 10 ? 1.608   18.780  32.839  0.50 12.81  ? 10  LYS E CA  1 
ATOM   1316 C CA  B LYS E  1 10 ? 1.665   18.764  32.803  0.50 12.84  ? 10  LYS E CA  1 
ATOM   1317 C C   A LYS E  1 10 ? 1.024   17.386  32.641  0.50 10.72  ? 10  LYS E C   1 
ATOM   1318 C C   B LYS E  1 10 ? 1.024   17.390  32.649  0.50 10.74  ? 10  LYS E C   1 
ATOM   1319 O O   A LYS E  1 10 ? 0.001   17.239  31.979  0.50 16.29  ? 10  LYS E O   1 
ATOM   1320 O O   B LYS E  1 10 ? -0.029  17.259  32.035  0.50 16.09  ? 10  LYS E O   1 
ATOM   1321 C CB  A LYS E  1 10 ? 2.388   19.204  31.588  0.50 18.69  ? 10  LYS E CB  1 
ATOM   1322 C CB  B LYS E  1 10 ? 2.537   19.074  31.582  0.50 18.19  ? 10  LYS E CB  1 
ATOM   1323 C CG  A LYS E  1 10 ? 1.486   19.655  30.452  0.50 28.00  ? 10  LYS E CG  1 
ATOM   1324 C CG  B LYS E  1 10 ? 1.834   19.010  30.241  0.50 27.62  ? 10  LYS E CG  1 
ATOM   1325 C CD  A LYS E  1 10 ? 1.246   21.155  30.466  0.50 33.52  ? 10  LYS E CD  1 
ATOM   1326 C CD  B LYS E  1 10 ? 2.761   19.429  29.104  0.50 30.38  ? 10  LYS E CD  1 
ATOM   1327 C CE  A LYS E  1 10 ? 0.846   21.650  29.082  0.50 38.24  ? 10  LYS E CE  1 
ATOM   1328 C CE  B LYS E  1 10 ? 2.144   20.536  28.260  0.50 40.53  ? 10  LYS E CE  1 
ATOM   1329 N NZ  A LYS E  1 10 ? -0.032  22.854  29.135  0.50 43.20  ? 10  LYS E NZ  1 
ATOM   1330 N NZ  B LYS E  1 10 ? 2.896   20.747  26.987  0.50 44.70  ? 10  LYS E NZ  1 
ATOM   1331 N N   . SER E  1 11 ? 1.650   16.362  33.202  1.00 14.60  ? 11  SER E N   1 
ATOM   1332 C CA  . SER E  1 11 ? 1.140   14.994  33.093  1.00 9.35   ? 11  SER E CA  1 
ATOM   1333 C C   . SER E  1 11 ? 0.096   14.724  34.157  1.00 14.16  ? 11  SER E C   1 
ATOM   1334 O O   . SER E  1 11 ? -0.520  13.676  34.211  1.00 17.19  ? 11  SER E O   1 
ATOM   1335 C CB  . SER E  1 11 ? 2.288   13.993  33.177  1.00 14.51  ? 11  SER E CB  1 
ATOM   1336 O OG  . SER E  1 11 ? 2.593   13.689  34.537  1.00 21.04  ? 11  SER E OG  1 
ATOM   1337 N N   . GLY E  1 12 ? -0.140  15.719  35.029  1.00 13.32  ? 12  GLY E N   1 
ATOM   1338 C CA  . GLY E  1 12 ? -1.156  15.452  36.036  1.00 15.98  ? 12  GLY E CA  1 
ATOM   1339 C C   . GLY E  1 12 ? -0.551  14.951  37.339  1.00 18.87  ? 12  GLY E C   1 
ATOM   1340 O O   . GLY E  1 12 ? -1.315  14.596  38.251  1.00 17.80  ? 12  GLY E O   1 
ATOM   1341 N N   . ALA E  1 13 ? 0.781   14.908  37.423  1.00 13.04  ? 13  ALA E N   1 
ATOM   1342 C CA  . ALA E  1 13 ? 1.420   14.362  38.622  1.00 13.32  ? 13  ALA E CA  1 
ATOM   1343 C C   . ALA E  1 13 ? 1.855   15.482  39.557  1.00 13.19  ? 13  ALA E C   1 
ATOM   1344 O O   . ALA E  1 13 ? 1.649   16.660  39.273  1.00 11.81  ? 13  ALA E O   1 
ATOM   1345 C CB  . ALA E  1 13 ? 2.624   13.486  38.295  1.00 13.92  ? 13  ALA E CB  1 
ATOM   1346 N N   . ILE E  1 14 ? 2.464   15.027  40.660  1.00 12.52  ? 14  ILE E N   1 
ATOM   1347 C CA  . ILE E  1 14 ? 2.890   15.922  41.722  1.00 9.18   ? 14  ILE E CA  1 
ATOM   1348 C C   . ILE E  1 14 ? 4.405   15.922  41.870  1.00 11.74  ? 14  ILE E C   1 
ATOM   1349 O O   . ILE E  1 14 ? 4.993   14.839  41.744  1.00 14.26  ? 14  ILE E O   1 
ATOM   1350 C CB  . ILE E  1 14 ? 2.251   15.476  43.060  1.00 8.95   ? 14  ILE E CB  1 
ATOM   1351 C CG1 . ILE E  1 14 ? 0.737   15.599  43.136  1.00 12.53  ? 14  ILE E CG1 1 
ATOM   1352 C CG2 . ILE E  1 14 ? 2.917   16.228  44.198  1.00 20.52  ? 14  ILE E CG2 1 
ATOM   1353 C CD1 . ILE E  1 14 ? 0.074   14.561  44.023  1.00 20.07  ? 14  ILE E CD1 1 
ATOM   1354 N N   . CYS E  1 15 ? 5.012   17.067  42.157  1.00 10.74  ? 15  CYS E N   1 
ATOM   1355 C CA  . CYS E  1 15 ? 6.426   17.121  42.506  1.00 10.00  ? 15  CYS E CA  1 
ATOM   1356 C C   . CYS E  1 15 ? 6.583   17.142  44.031  1.00 13.53  ? 15  CYS E C   1 
ATOM   1357 O O   . CYS E  1 15 ? 6.186   18.112  44.678  1.00 15.04  ? 15  CYS E O   1 
ATOM   1358 C CB  . CYS E  1 15 ? 7.146   18.345  41.920  1.00 10.22  ? 15  CYS E CB  1 
ATOM   1359 S SG  . CYS E  1 15 ? 7.372   18.255  40.113  1.00 15.21  ? 15  CYS E SG  1 
ATOM   1360 N N   . HIS E  1 16 ? 7.152   16.068  44.555  1.00 13.98  ? 16  HIS E N   1 
ATOM   1361 C CA  . HIS E  1 16 ? 7.357   15.963  46.007  1.00 13.71  ? 16  HIS E CA  1 
ATOM   1362 C C   . HIS E  1 16 ? 8.837   15.927  46.338  1.00 17.65  ? 16  HIS E C   1 
ATOM   1363 O O   . HIS E  1 16 ? 9.614   15.220  45.699  1.00 17.22  ? 16  HIS E O   1 
ATOM   1364 C CB  . HIS E  1 16 ? 6.640   14.700  46.491  1.00 14.91  ? 16  HIS E CB  1 
ATOM   1365 C CG  . HIS E  1 16 ? 6.226   14.763  47.932  1.00 17.83  ? 16  HIS E CG  1 
ATOM   1366 N ND1 . HIS E  1 16 ? 7.115   14.496  48.951  1.00 22.69  ? 16  HIS E ND1 1 
ATOM   1367 C CD2 . HIS E  1 16 ? 5.048   15.063  48.519  1.00 19.62  ? 16  HIS E CD2 1 
ATOM   1368 C CE1 . HIS E  1 16 ? 6.499   14.622  50.123  1.00 20.97  ? 16  HIS E CE1 1 
ATOM   1369 N NE2 . HIS E  1 16 ? 5.247   14.968  49.887  1.00 17.43  ? 16  HIS E NE2 1 
ATOM   1370 N N   . PRO E  1 17 ? 9.280   16.683  47.341  1.00 13.13  ? 17  PRO E N   1 
ATOM   1371 C CA  . PRO E  1 17 ? 10.673  16.614  47.782  1.00 17.78  ? 17  PRO E CA  1 
ATOM   1372 C C   . PRO E  1 17 ? 11.003  15.222  48.310  1.00 21.40  ? 17  PRO E C   1 
ATOM   1373 O O   . PRO E  1 17 ? 10.140  14.595  48.935  1.00 21.94  ? 17  PRO E O   1 
ATOM   1374 C CB  . PRO E  1 17 ? 10.731  17.616  48.935  1.00 20.86  ? 17  PRO E CB  1 
ATOM   1375 C CG  . PRO E  1 17 ? 9.586   18.544  48.674  1.00 22.90  ? 17  PRO E CG  1 
ATOM   1376 C CD  . PRO E  1 17 ? 8.497   17.649  48.132  1.00 16.48  ? 17  PRO E CD  1 
ATOM   1377 N N   . VAL E  1 18 ? 12.224  14.788  48.062  1.00 22.20  ? 18  VAL E N   1 
ATOM   1378 C CA  . VAL E  1 18 ? 12.842  13.614  48.632  1.00 19.76  ? 18  VAL E CA  1 
ATOM   1379 C C   . VAL E  1 18 ? 12.237  12.265  48.262  1.00 15.24  ? 18  VAL E C   1 
ATOM   1380 O O   . VAL E  1 18 ? 13.034  11.439  47.774  1.00 27.36  ? 18  VAL E O   1 
ATOM   1381 C CB  . VAL E  1 18 ? 12.834  13.658  50.186  1.00 20.66  ? 18  VAL E CB  1 
ATOM   1382 C CG1 . VAL E  1 18 ? 13.693  12.507  50.684  1.00 19.75  ? 18  VAL E CG1 1 
ATOM   1383 C CG2 . VAL E  1 18 ? 13.316  14.989  50.712  1.00 30.03  ? 18  VAL E CG2 1 
ATOM   1384 N N   . PHE E  1 19 ? 10.966  11.986  48.464  1.00 18.44  ? 19  PHE E N   1 
ATOM   1385 C CA  . PHE E  1 19 ? 10.335  10.698  48.163  1.00 23.46  ? 19  PHE E CA  1 
ATOM   1386 C C   . PHE E  1 19 ? 8.890   10.866  47.726  1.00 19.54  ? 19  PHE E C   1 
ATOM   1387 O O   . PHE E  1 19 ? 8.276   11.914  47.955  1.00 24.88  ? 19  PHE E O   1 
ATOM   1388 C CB  . PHE E  1 19 ? 10.429  9.772   49.400  1.00 20.96  ? 19  PHE E CB  1 
ATOM   1389 C CG  . PHE E  1 19 ? 9.624   10.276  50.593  1.00 20.18  ? 19  PHE E CG  1 
ATOM   1390 C CD1 . PHE E  1 19 ? 8.306   9.906   50.806  1.00 21.96  ? 19  PHE E CD1 1 
ATOM   1391 C CD2 . PHE E  1 19 ? 10.230  11.145  51.491  1.00 23.79  ? 19  PHE E CD2 1 
ATOM   1392 C CE1 . PHE E  1 19 ? 7.568   10.400  51.863  1.00 18.17  ? 19  PHE E CE1 1 
ATOM   1393 C CE2 . PHE E  1 19 ? 9.510   11.650  52.557  1.00 19.98  ? 19  PHE E CE2 1 
ATOM   1394 C CZ  . PHE E  1 19 ? 8.192   11.273  52.734  1.00 21.37  ? 19  PHE E CZ  1 
ATOM   1395 N N   . CYS E  1 20 ? 8.217   9.874   47.155  1.00 21.18  ? 20  CYS E N   1 
ATOM   1396 C CA  . CYS E  1 20 ? 6.774   9.923   46.973  1.00 14.56  ? 20  CYS E CA  1 
ATOM   1397 C C   . CYS E  1 20 ? 6.056   9.244   48.136  1.00 20.33  ? 20  CYS E C   1 
ATOM   1398 O O   . CYS E  1 20 ? 6.365   8.054   48.309  1.00 21.56  ? 20  CYS E O   1 
ATOM   1399 C CB  . CYS E  1 20 ? 6.282   9.178   45.732  1.00 18.11  ? 20  CYS E CB  1 
ATOM   1400 S SG  . CYS E  1 20 ? 6.844   9.855   44.149  1.00 18.19  ? 20  CYS E SG  1 
ATOM   1401 N N   . PRO E  1 21 ? 5.198   9.949   48.845  1.00 21.78  ? 21  PRO E N   1 
ATOM   1402 C CA  . PRO E  1 21 ? 4.338   9.290   49.849  1.00 18.78  ? 21  PRO E CA  1 
ATOM   1403 C C   . PRO E  1 21 ? 3.749   8.012   49.260  1.00 27.85  ? 21  PRO E C   1 
ATOM   1404 O O   . PRO E  1 21 ? 3.546   7.938   48.041  1.00 27.38  ? 21  PRO E O   1 
ATOM   1405 C CB  . PRO E  1 21 ? 3.309   10.376  50.146  1.00 16.60  ? 21  PRO E CB  1 
ATOM   1406 C CG  . PRO E  1 21 ? 4.178   11.617  50.096  1.00 17.57  ? 21  PRO E CG  1 
ATOM   1407 C CD  . PRO E  1 21 ? 4.985   11.417  48.828  1.00 23.53  ? 21  PRO E CD  1 
ATOM   1408 N N   . ARG E  1 22 ? 3.555   7.011   50.112  1.00 16.96  ? 22  ARG E N   1 
ATOM   1409 C CA  . ARG E  1 22 ? 3.152   5.685   49.681  1.00 20.43  ? 22  ARG E CA  1 
ATOM   1410 C C   . ARG E  1 22 ? 1.872   5.688   48.862  1.00 21.86  ? 22  ARG E C   1 
ATOM   1411 O O   . ARG E  1 22 ? 1.645   4.780   48.052  1.00 25.21  ? 22  ARG E O   1 
ATOM   1412 C CB  . ARG E  1 22 ? 2.964   4.777   50.912  1.00 25.40  ? 22  ARG E CB  1 
ATOM   1413 C CG  . ARG E  1 22 ? 4.185   4.642   51.793  1.00 32.57  ? 22  ARG E CG  1 
ATOM   1414 C CD  . ARG E  1 22 ? 4.957   3.354   51.611  1.00 45.29  ? 22  ARG E CD  1 
ATOM   1415 N NE  . ARG E  1 22 ? 4.144   2.154   51.725  1.00 50.85  ? 22  ARG E NE  1 
ATOM   1416 C CZ  . ARG E  1 22 ? 4.580   0.906   51.616  1.00 55.08  ? 22  ARG E CZ  1 
ATOM   1417 N NH1 . ARG E  1 22 ? 5.857   0.632   51.391  1.00 34.81  ? 22  ARG E NH1 1 
ATOM   1418 N NH2 . ARG E  1 22 ? 3.720   -0.102  51.737  1.00 60.47  ? 22  ARG E NH2 1 
ATOM   1419 N N   . ARG E  1 23 ? 1.021   6.698   49.046  1.00 23.65  ? 23  ARG E N   1 
ATOM   1420 C CA  . ARG E  1 23 ? -0.261  6.674   48.334  1.00 21.19  ? 23  ARG E CA  1 
ATOM   1421 C C   . ARG E  1 23 ? -0.062  6.998   46.856  1.00 25.44  ? 23  ARG E C   1 
ATOM   1422 O O   . ARG E  1 23 ? -0.985  6.881   46.056  1.00 24.15  ? 23  ARG E O   1 
ATOM   1423 C CB  . ARG E  1 23 ? -1.256  7.639   48.970  1.00 21.76  ? 23  ARG E CB  1 
ATOM   1424 C CG  . ARG E  1 23 ? -0.782  9.058   49.146  1.00 31.73  ? 23  ARG E CG  1 
ATOM   1425 C CD  . ARG E  1 23 ? -1.757  9.945   49.911  1.00 33.09  ? 23  ARG E CD  1 
ATOM   1426 N NE  . ARG E  1 23 ? -1.035  11.093  50.475  1.00 46.82  ? 23  ARG E NE  1 
ATOM   1427 C CZ  . ARG E  1 23 ? -1.219  12.355  50.121  1.00 53.71  ? 23  ARG E CZ  1 
ATOM   1428 N NH1 . ARG E  1 23 ? -2.120  12.643  49.186  1.00 71.55  ? 23  ARG E NH1 1 
ATOM   1429 N NH2 . ARG E  1 23 ? -0.515  13.333  50.685  1.00 28.26  ? 23  ARG E NH2 1 
ATOM   1430 N N   . TYR E  1 24 ? 1.161   7.414   46.496  1.00 21.95  ? 24  TYR E N   1 
ATOM   1431 C CA  . TYR E  1 24 ? 1.400   7.721   45.080  1.00 21.15  ? 24  TYR E CA  1 
ATOM   1432 C C   . TYR E  1 24 ? 2.401   6.746   44.474  1.00 21.68  ? 24  TYR E C   1 
ATOM   1433 O O   . TYR E  1 24 ? 3.050   5.983   45.186  1.00 18.99  ? 24  TYR E O   1 
ATOM   1434 C CB  . TYR E  1 24 ? 1.961   9.119   44.903  1.00 16.98  ? 24  TYR E CB  1 
ATOM   1435 C CG  . TYR E  1 24 ? 1.273   10.270  45.557  1.00 18.16  ? 24  TYR E CG  1 
ATOM   1436 C CD1 . TYR E  1 24 ? 1.921   10.974  46.579  1.00 27.72  ? 24  TYR E CD1 1 
ATOM   1437 C CD2 . TYR E  1 24 ? 0.004   10.692  45.195  1.00 24.57  ? 24  TYR E CD2 1 
ATOM   1438 C CE1 . TYR E  1 24 ? 1.318   12.049  47.208  1.00 25.77  ? 24  TYR E CE1 1 
ATOM   1439 C CE2 . TYR E  1 24 ? -0.607  11.763  45.819  1.00 23.29  ? 24  TYR E CE2 1 
ATOM   1440 C CZ  . TYR E  1 24 ? 0.055   12.436  46.821  1.00 26.27  ? 24  TYR E CZ  1 
ATOM   1441 O OH  . TYR E  1 24 ? -0.563  13.505  47.440  1.00 31.78  ? 24  TYR E OH  1 
ATOM   1442 N N   . LYS E  1 25 ? 2.531   6.811   43.153  1.00 15.23  ? 25  LYS E N   1 
ATOM   1443 C CA  . LYS E  1 25 ? 3.504   5.982   42.449  1.00 22.72  ? 25  LYS E CA  1 
ATOM   1444 C C   . LYS E  1 25 ? 4.479   6.901   41.716  1.00 20.31  ? 25  LYS E C   1 
ATOM   1445 O O   . LYS E  1 25 ? 4.082   7.833   41.003  1.00 15.11  ? 25  LYS E O   1 
ATOM   1446 C CB  . LYS E  1 25 ? 2.796   5.011   41.503  1.00 25.84  ? 25  LYS E CB  1 
ATOM   1447 C CG  . LYS E  1 25 ? 3.640   4.523   40.343  1.00 33.05  ? 25  LYS E CG  1 
ATOM   1448 C CD  . LYS E  1 25 ? 2.803   3.719   39.357  1.00 38.00  ? 25  LYS E CD  1 
ATOM   1449 C CE  . LYS E  1 25 ? 1.624   4.522   38.827  1.00 42.99  ? 25  LYS E CE  1 
ATOM   1450 N NZ  . LYS E  1 25 ? 0.698   3.643   38.048  1.00 41.61  ? 25  LYS E NZ  1 
ATOM   1451 N N   . GLN E  1 26 ? 5.752   6.620   41.952  1.00 17.15  ? 26  GLN E N   1 
ATOM   1452 C CA  . GLN E  1 26 ? 6.806   7.437   41.345  1.00 15.41  ? 26  GLN E CA  1 
ATOM   1453 C C   . GLN E  1 26 ? 6.860   7.195   39.844  1.00 12.91  ? 26  GLN E C   1 
ATOM   1454 O O   . GLN E  1 26 ? 6.885   6.029   39.443  1.00 16.59  ? 26  GLN E O   1 
ATOM   1455 C CB  . GLN E  1 26 ? 8.156   7.129   41.999  1.00 16.01  ? 26  GLN E CB  1 
ATOM   1456 C CG  . GLN E  1 26 ? 9.247   7.959   41.333  1.00 15.66  ? 26  GLN E CG  1 
ATOM   1457 C CD  . GLN E  1 26 ? 10.577  7.838   42.039  1.00 21.94  ? 26  GLN E CD  1 
ATOM   1458 O OE1 . GLN E  1 26 ? 10.611  7.525   43.226  1.00 20.84  ? 26  GLN E OE1 1 
ATOM   1459 N NE2 . GLN E  1 26 ? 11.638  8.091   41.290  1.00 23.48  ? 26  GLN E NE2 1 
ATOM   1460 N N   . ILE E  1 27 ? 6.858   8.252   39.043  1.00 14.94  ? 27  ILE E N   1 
ATOM   1461 C CA  . ILE E  1 27 ? 6.936   8.070   37.583  1.00 14.54  ? 27  ILE E CA  1 
ATOM   1462 C C   . ILE E  1 27 ? 8.129   8.806   37.010  1.00 17.21  ? 27  ILE E C   1 
ATOM   1463 O O   . ILE E  1 27 ? 8.389   8.817   35.796  1.00 15.83  ? 27  ILE E O   1 
ATOM   1464 C CB  . ILE E  1 27 ? 5.644   8.525   36.870  1.00 12.68  ? 27  ILE E CB  1 
ATOM   1465 C CG1 . ILE E  1 27 ? 5.299   9.999   37.080  1.00 15.12  ? 27  ILE E CG1 1 
ATOM   1466 C CG2 . ILE E  1 27 ? 4.470   7.647   37.269  1.00 15.06  ? 27  ILE E CG2 1 
ATOM   1467 C CD1 . ILE E  1 27 ? 4.071   10.489  36.314  1.00 13.36  ? 27  ILE E CD1 1 
ATOM   1468 N N   . GLY E  1 28 ? 8.918   9.450   37.873  1.00 13.09  ? 28  GLY E N   1 
ATOM   1469 C CA  . GLY E  1 28 ? 10.114  10.140  37.405  1.00 13.86  ? 28  GLY E CA  1 
ATOM   1470 C C   . GLY E  1 28 ? 10.643  11.082  38.481  1.00 13.14  ? 28  GLY E C   1 
ATOM   1471 O O   . GLY E  1 28 ? 10.325  10.855  39.642  1.00 16.10  ? 28  GLY E O   1 
ATOM   1472 N N   . THR E  1 29 ? 11.390  12.104  38.097  1.00 13.39  ? 29  THR E N   1 
ATOM   1473 C CA  . THR E  1 29 ? 11.866  13.109  39.033  1.00 14.47  ? 29  THR E CA  1 
ATOM   1474 C C   . THR E  1 29 ? 11.359  14.491  38.613  1.00 14.71  ? 29  THR E C   1 
ATOM   1475 O O   . THR E  1 29 ? 10.765  14.642  37.543  1.00 14.11  ? 29  THR E O   1 
ATOM   1476 C CB  . THR E  1 29 ? 13.400  13.159  39.117  1.00 19.66  ? 29  THR E CB  1 
ATOM   1477 O OG1 . THR E  1 29 ? 13.937  13.833  37.957  1.00 15.30  ? 29  THR E OG1 1 
ATOM   1478 C CG2 . THR E  1 29 ? 13.990  11.758  39.161  1.00 16.97  ? 29  THR E CG2 1 
ATOM   1479 N N   . CYS E  1 30 ? 11.638  15.494  39.436  1.00 12.07  ? 30  CYS E N   1 
ATOM   1480 C CA  . CYS E  1 30 ? 11.373  16.870  39.034  1.00 14.14  ? 30  CYS E CA  1 
ATOM   1481 C C   . CYS E  1 30 ? 12.667  17.654  38.906  1.00 11.35  ? 30  CYS E C   1 
ATOM   1482 O O   . CYS E  1 30 ? 12.739  18.874  39.061  1.00 11.64  ? 30  CYS E O   1 
ATOM   1483 C CB  . CYS E  1 30 ? 10.363  17.495  40.020  1.00 14.84  ? 30  CYS E CB  1 
ATOM   1484 S SG  . CYS E  1 30 ? 8.729   16.761  39.828  1.00 13.00  ? 30  CYS E SG  1 
ATOM   1485 N N   . GLY E  1 31 ? 13.740  16.956  38.593  1.00 13.06  ? 31  GLY E N   1 
ATOM   1486 C CA  . GLY E  1 31 ? 15.033  17.517  38.284  1.00 13.19  ? 31  GLY E CA  1 
ATOM   1487 C C   . GLY E  1 31 ? 15.870  17.989  39.455  1.00 19.85  ? 31  GLY E C   1 
ATOM   1488 O O   . GLY E  1 31 ? 17.066  17.685  39.484  1.00 20.75  ? 31  GLY E O   1 
ATOM   1489 N N   A LEU E  1 32 ? 15.297  18.736  40.390  0.50 15.84  ? 32  LEU E N   1 
ATOM   1490 N N   B LEU E  1 32 ? 15.280  18.714  40.395  0.50 15.84  ? 32  LEU E N   1 
ATOM   1491 C CA  A LEU E  1 32 ? 16.086  19.233  41.528  0.50 18.58  ? 32  LEU E CA  1 
ATOM   1492 C CA  B LEU E  1 32 ? 15.987  19.198  41.582  0.50 19.00  ? 32  LEU E CA  1 
ATOM   1493 C C   A LEU E  1 32 ? 16.405  18.075  42.465  0.50 22.40  ? 32  LEU E C   1 
ATOM   1494 C C   B LEU E  1 32 ? 16.425  18.022  42.450  0.50 22.33  ? 32  LEU E C   1 
ATOM   1495 O O   A LEU E  1 32 ? 15.685  17.073  42.473  0.50 20.12  ? 32  LEU E O   1 
ATOM   1496 O O   B LEU E  1 32 ? 15.808  16.955  42.392  0.50 20.48  ? 32  LEU E O   1 
ATOM   1497 C CB  A LEU E  1 32 ? 15.337  20.351  42.240  0.50 16.06  ? 32  LEU E CB  1 
ATOM   1498 C CB  B LEU E  1 32 ? 15.106  20.126  42.407  0.50 17.63  ? 32  LEU E CB  1 
ATOM   1499 C CG  A LEU E  1 32 ? 15.636  21.787  41.817  0.50 17.33  ? 32  LEU E CG  1 
ATOM   1500 C CG  B LEU E  1 32 ? 14.709  21.477  41.828  0.50 20.34  ? 32  LEU E CG  1 
ATOM   1501 C CD1 A LEU E  1 32 ? 15.239  22.013  40.358  0.50 11.00  ? 32  LEU E CD1 1 
ATOM   1502 C CD1 B LEU E  1 32 ? 14.267  22.436  42.930  0.50 7.70   ? 32  LEU E CD1 1 
ATOM   1503 C CD2 A LEU E  1 32 ? 14.926  22.784  42.730  0.50 13.78  ? 32  LEU E CD2 1 
ATOM   1504 C CD2 B LEU E  1 32 ? 15.854  22.073  41.017  0.50 26.79  ? 32  LEU E CD2 1 
ATOM   1505 N N   . PRO E  1 33 ? 17.468  18.198  43.254  1.00 17.70  ? 33  PRO E N   1 
ATOM   1506 C CA  . PRO E  1 33 ? 17.968  17.070  44.056  1.00 19.92  ? 33  PRO E CA  1 
ATOM   1507 C C   . PRO E  1 33 ? 16.876  16.443  44.922  1.00 14.91  ? 33  PRO E C   1 
ATOM   1508 O O   . PRO E  1 33 ? 16.179  17.129  45.649  1.00 17.78  ? 33  PRO E O   1 
ATOM   1509 C CB  . PRO E  1 33 ? 19.050  17.708  44.927  1.00 18.85  ? 33  PRO E CB  1 
ATOM   1510 C CG  . PRO E  1 33 ? 19.510  18.879  44.115  1.00 21.45  ? 33  PRO E CG  1 
ATOM   1511 C CD  . PRO E  1 33 ? 18.256  19.420  43.460  1.00 16.96  ? 33  PRO E CD  1 
ATOM   1512 N N   . GLY E  1 34 ? 16.744  15.129  44.782  1.00 15.27  ? 34  GLY E N   1 
ATOM   1513 C CA  . GLY E  1 34 ? 15.811  14.323  45.509  1.00 17.43  ? 34  GLY E CA  1 
ATOM   1514 C C   . GLY E  1 34 ? 14.364  14.460  45.116  1.00 16.98  ? 34  GLY E C   1 
ATOM   1515 O O   . GLY E  1 34 ? 13.551  13.698  45.637  1.00 18.14  ? 34  GLY E O   1 
ATOM   1516 N N   . THR E  1 35 ? 14.017  15.416  44.241  1.00 16.03  ? 35  THR E N   1 
ATOM   1517 C CA  . THR E  1 35 ? 12.595  15.635  43.967  1.00 15.89  ? 35  THR E CA  1 
ATOM   1518 C C   . THR E  1 35 ? 12.053  14.449  43.167  1.00 19.60  ? 35  THR E C   1 
ATOM   1519 O O   . THR E  1 35 ? 12.709  13.891  42.293  1.00 23.46  ? 35  THR E O   1 
ATOM   1520 C CB  . THR E  1 35 ? 12.263  16.944  43.231  1.00 13.34  ? 35  THR E CB  1 
ATOM   1521 O OG1 . THR E  1 35 ? 12.916  16.996  41.945  1.00 17.15  ? 35  THR E OG1 1 
ATOM   1522 C CG2 . THR E  1 35 ? 12.747  18.148  44.023  1.00 19.66  ? 35  THR E CG2 1 
ATOM   1523 N N   . LYS E  1 36 ? 10.826  14.057  43.479  1.00 13.15  ? 36  LYS E N   1 
ATOM   1524 C CA  . LYS E  1 36 ? 10.138  12.954  42.837  1.00 11.54  ? 36  LYS E CA  1 
ATOM   1525 C C   . LYS E  1 36 ? 8.859   13.411  42.128  1.00 12.08  ? 36  LYS E C   1 
ATOM   1526 O O   . LYS E  1 36 ? 8.160   14.288  42.634  1.00 12.79  ? 36  LYS E O   1 
ATOM   1527 C CB  . LYS E  1 36 ? 9.771   11.883  43.870  1.00 16.66  ? 36  LYS E CB  1 
ATOM   1528 C CG  . LYS E  1 36 ? 10.938  11.315  44.657  1.00 12.74  ? 36  LYS E CG  1 
ATOM   1529 C CD  . LYS E  1 36 ? 12.098  10.810  43.832  1.00 12.53  ? 36  LYS E CD  1 
ATOM   1530 C CE  . LYS E  1 36 ? 13.223  10.334  44.764  1.00 18.04  ? 36  LYS E CE  1 
ATOM   1531 N NZ  . LYS E  1 36 ? 14.462  10.027  44.010  1.00 43.22  ? 36  LYS E NZ  1 
ATOM   1532 N N   . CYS E  1 37 ? 8.577   12.826  40.966  1.00 12.66  ? 37  CYS E N   1 
ATOM   1533 C CA  . CYS E  1 37 ? 7.337   13.040  40.213  1.00 11.17  ? 37  CYS E CA  1 
ATOM   1534 C C   . CYS E  1 37 ? 6.393   11.902  40.590  1.00 12.30  ? 37  CYS E C   1 
ATOM   1535 O O   . CYS E  1 37 ? 6.669   10.735  40.270  1.00 14.82  ? 37  CYS E O   1 
ATOM   1536 C CB  . CYS E  1 37 ? 7.550   13.077  38.706  1.00 12.31  ? 37  CYS E CB  1 
ATOM   1537 S SG  . CYS E  1 37 ? 6.044   13.488  37.772  1.00 12.88  ? 37  CYS E SG  1 
ATOM   1538 N N   . CYS E  1 38 ? 5.332   12.254  41.314  1.00 10.70  ? 38  CYS E N   1 
ATOM   1539 C CA  . CYS E  1 38 ? 4.457   11.239  41.879  1.00 18.56  ? 38  CYS E CA  1 
ATOM   1540 C C   . CYS E  1 38 ? 3.052   11.298  41.293  1.00 16.57  ? 38  CYS E C   1 
ATOM   1541 O O   . CYS E  1 38 ? 2.362   12.321  41.253  1.00 13.71  ? 38  CYS E O   1 
ATOM   1542 C CB  . CYS E  1 38 ? 4.400   11.418  43.404  1.00 16.91  ? 38  CYS E CB  1 
ATOM   1543 S SG  . CYS E  1 38 ? 6.021   11.714  44.183  1.00 16.14  ? 38  CYS E SG  1 
ATOM   1544 N N   . LYS E  1 39 ? 2.640   10.123  40.838  1.00 17.88  ? 39  LYS E N   1 
ATOM   1545 C CA  . LYS E  1 39 ? 1.363   9.943   40.186  1.00 14.58  ? 39  LYS E CA  1 
ATOM   1546 C C   . LYS E  1 39 ? 0.281   9.556   41.184  1.00 23.76  ? 39  LYS E C   1 
ATOM   1547 O O   . LYS E  1 39 ? 0.438   8.634   41.971  1.00 19.83  ? 39  LYS E O   1 
ATOM   1548 C CB  . LYS E  1 39 ? 1.487   8.866   39.102  1.00 20.38  ? 39  LYS E CB  1 
ATOM   1549 C CG  . LYS E  1 39 ? 0.180   8.601   38.373  1.00 23.42  ? 39  LYS E CG  1 
ATOM   1550 C CD  . LYS E  1 39 ? 0.346   7.451   37.382  1.00 23.05  ? 39  LYS E CD  1 
ATOM   1551 C CE  . LYS E  1 39 ? -0.902  7.308   36.523  1.00 29.13  ? 39  LYS E CE  1 
ATOM   1552 N NZ  . LYS E  1 39 ? -2.077  6.893   37.336  1.00 28.39  ? 39  LYS E NZ  1 
ATOM   1553 N N   . LYS E  1 40 ? -0.823  10.286  41.114  1.00 28.50  ? 40  LYS E N   1 
ATOM   1554 C CA  . LYS E  1 40 ? -2.044  9.971   41.827  1.00 35.72  ? 40  LYS E CA  1 
ATOM   1555 C C   . LYS E  1 40 ? -2.601  8.640   41.332  1.00 44.96  ? 40  LYS E C   1 
ATOM   1556 O O   . LYS E  1 40 ? -2.451  8.282   40.158  1.00 41.30  ? 40  LYS E O   1 
ATOM   1557 C CB  . LYS E  1 40 ? -3.055  11.098  41.621  1.00 37.56  ? 40  LYS E CB  1 
ATOM   1558 C CG  . LYS E  1 40 ? -2.478  12.501  41.726  1.00 46.72  ? 40  LYS E CG  1 
ATOM   1559 C CD  . LYS E  1 40 ? -3.558  13.525  42.069  1.00 54.57  ? 40  LYS E CD  1 
ATOM   1560 C CE  . LYS E  1 40 ? -4.894  13.164  41.435  1.00 59.57  ? 40  LYS E CE  1 
ATOM   1561 N NZ  . LYS E  1 40 ? -5.808  14.337  41.314  1.00 53.46  ? 40  LYS E NZ  1 
ATOM   1562 N N   . PRO E  1 41 ? -3.234  7.876   42.212  1.00 46.24  ? 41  PRO E N   1 
ATOM   1563 C CA  . PRO E  1 41 ? -3.864  6.622   41.780  1.00 53.62  ? 41  PRO E CA  1 
ATOM   1564 C C   . PRO E  1 41 ? -5.128  6.894   40.970  1.00 53.11  ? 41  PRO E C   1 
ATOM   1565 O O   . PRO E  1 41 ? -5.692  7.996   41.053  1.00 56.40  ? 41  PRO E O   1 
ATOM   1566 C CB  . PRO E  1 41 ? -4.197  5.922   43.099  1.00 52.32  ? 41  PRO E CB  1 
ATOM   1567 C CG  . PRO E  1 41 ? -4.341  7.028   44.090  1.00 52.06  ? 41  PRO E CG  1 
ATOM   1568 C CD  . PRO E  1 41 ? -3.395  8.116   43.651  1.00 53.25  ? 41  PRO E CD  1 
ATOM   1569 O OXT . PRO E  1 41 ? -5.559  5.976   40.244  1.00 59.05  ? 41  PRO E OXT 1 
ATOM   1570 N N   . GLY F  1 1  ? 6.191   36.643  45.811  1.00 20.64  ? 1   GLY F N   1 
ATOM   1571 C CA  . GLY F  1 1  ? 5.473   35.380  45.962  1.00 19.15  ? 1   GLY F CA  1 
ATOM   1572 C C   . GLY F  1 1  ? 6.201   34.244  45.261  1.00 18.68  ? 1   GLY F C   1 
ATOM   1573 O O   . GLY F  1 1  ? 7.235   34.456  44.616  1.00 21.53  ? 1   GLY F O   1 
ATOM   1574 N N   . ILE F  1 2  ? 5.636   33.042  45.405  1.00 13.70  ? 2   ILE F N   1 
ATOM   1575 C CA  . ILE F  1 2  ? 6.183   31.883  44.694  1.00 14.45  ? 2   ILE F CA  1 
ATOM   1576 C C   . ILE F  1 2  ? 5.337   31.672  43.449  1.00 12.13  ? 2   ILE F C   1 
ATOM   1577 O O   . ILE F  1 2  ? 4.128   31.468  43.518  1.00 19.50  ? 2   ILE F O   1 
ATOM   1578 C CB  . ILE F  1 2  ? 6.194   30.629  45.584  1.00 22.51  ? 2   ILE F CB  1 
ATOM   1579 C CG1 . ILE F  1 2  ? 7.102   30.753  46.814  1.00 18.11  ? 2   ILE F CG1 1 
ATOM   1580 C CG2 . ILE F  1 2  ? 6.575   29.368  44.818  1.00 17.56  ? 2   ILE F CG2 1 
ATOM   1581 C CD1 . ILE F  1 2  ? 6.980   29.622  47.808  1.00 19.07  ? 2   ILE F CD1 1 
ATOM   1582 N N   . GLY F  1 3  ? 5.972   31.740  42.277  1.00 18.76  ? 3   GLY F N   1 
ATOM   1583 C CA  . GLY F  1 3  ? 5.242   31.612  41.034  1.00 15.21  ? 3   GLY F CA  1 
ATOM   1584 C C   . GLY F  1 3  ? 5.904   30.725  40.000  1.00 18.13  ? 3   GLY F C   1 
ATOM   1585 O O   . GLY F  1 3  ? 5.569   30.796  38.809  1.00 21.47  ? 3   GLY F O   1 
ATOM   1586 N N   . ASP F  1 4  ? 6.819   29.865  40.426  1.00 20.02  ? 4   ASP F N   1 
ATOM   1587 C CA  . ASP F  1 4  ? 7.434   28.888  39.542  1.00 16.90  ? 4   ASP F CA  1 
ATOM   1588 C C   . ASP F  1 4  ? 7.832   27.643  40.321  1.00 19.88  ? 4   ASP F C   1 
ATOM   1589 O O   . ASP F  1 4  ? 8.085   27.681  41.524  1.00 18.73  ? 4   ASP F O   1 
ATOM   1590 C CB  . ASP F  1 4  ? 8.651   29.487  38.838  1.00 18.68  ? 4   ASP F CB  1 
ATOM   1591 C CG  . ASP F  1 4  ? 9.853   29.692  39.724  1.00 20.69  ? 4   ASP F CG  1 
ATOM   1592 O OD1 . ASP F  1 4  ? 10.031  30.813  40.255  1.00 25.57  ? 4   ASP F OD1 1 
ATOM   1593 O OD2 . ASP F  1 4  ? 10.646  28.741  39.874  1.00 19.29  ? 4   ASP F OD2 1 
ATOM   1594 N N   . PRO F  1 5  ? 7.907   26.505  39.630  1.00 14.14  ? 5   PRO F N   1 
ATOM   1595 C CA  . PRO F  1 5  ? 8.146   25.235  40.325  1.00 14.89  ? 5   PRO F CA  1 
ATOM   1596 C C   . PRO F  1 5  ? 9.513   25.110  40.972  1.00 14.88  ? 5   PRO F C   1 
ATOM   1597 O O   . PRO F  1 5  ? 9.677   24.444  41.998  1.00 13.78  ? 5   PRO F O   1 
ATOM   1598 C CB  . PRO F  1 5  ? 8.019   24.203  39.191  1.00 18.14  ? 5   PRO F CB  1 
ATOM   1599 C CG  . PRO F  1 5  ? 8.310   24.974  37.942  1.00 17.05  ? 5   PRO F CG  1 
ATOM   1600 C CD  . PRO F  1 5  ? 7.773   26.360  38.163  1.00 17.36  ? 5   PRO F CD  1 
ATOM   1601 N N   . VAL F  1 6  ? 10.578  25.700  40.407  1.00 19.30  ? 6   VAL F N   1 
ATOM   1602 C CA  . VAL F  1 6  ? 11.900  25.544  41.011  1.00 17.73  ? 6   VAL F CA  1 
ATOM   1603 C C   . VAL F  1 6  ? 11.940  26.243  42.363  1.00 14.03  ? 6   VAL F C   1 
ATOM   1604 O O   . VAL F  1 6  ? 12.405  25.736  43.389  1.00 17.74  ? 6   VAL F O   1 
ATOM   1605 C CB  . VAL F  1 6  ? 13.007  26.097  40.095  1.00 28.60  ? 6   VAL F CB  1 
ATOM   1606 C CG1 . VAL F  1 6  ? 14.383  26.036  40.745  1.00 18.99  ? 6   VAL F CG1 1 
ATOM   1607 C CG2 . VAL F  1 6  ? 13.030  25.320  38.782  1.00 25.31  ? 6   VAL F CG2 1 
ATOM   1608 N N   . THR F  1 7  ? 11.397  27.460  42.394  1.00 14.05  ? 7   THR F N   1 
ATOM   1609 C CA  . THR F  1 7  ? 11.358  28.161  43.678  1.00 16.42  ? 7   THR F CA  1 
ATOM   1610 C C   . THR F  1 7  ? 10.518  27.412  44.694  1.00 18.99  ? 7   THR F C   1 
ATOM   1611 O O   . THR F  1 7  ? 10.877  27.295  45.864  1.00 16.36  ? 7   THR F O   1 
ATOM   1612 C CB  . THR F  1 7  ? 10.795  29.582  43.499  1.00 22.25  ? 7   THR F CB  1 
ATOM   1613 O OG1 . THR F  1 7  ? 11.620  30.279  42.564  1.00 20.92  ? 7   THR F OG1 1 
ATOM   1614 C CG2 . THR F  1 7  ? 10.869  30.339  44.817  1.00 24.41  ? 7   THR F CG2 1 
ATOM   1615 N N   . CYS F  1 8  ? 9.381   26.888  44.241  1.00 15.35  ? 8   CYS F N   1 
ATOM   1616 C CA  . CYS F  1 8  ? 8.527   26.126  45.142  1.00 14.29  ? 8   CYS F CA  1 
ATOM   1617 C C   . CYS F  1 8  ? 9.307   24.989  45.783  1.00 21.44  ? 8   CYS F C   1 
ATOM   1618 O O   . CYS F  1 8  ? 9.379   24.793  46.998  1.00 15.38  ? 8   CYS F O   1 
ATOM   1619 C CB  . CYS F  1 8  ? 7.323   25.578  44.384  1.00 14.96  ? 8   CYS F CB  1 
ATOM   1620 S SG  . CYS F  1 8  ? 6.189   24.657  45.431  1.00 13.96  ? 8   CYS F SG  1 
ATOM   1621 N N   . LEU F  1 9  ? 9.954   24.207  44.922  1.00 16.55  ? 9   LEU F N   1 
ATOM   1622 C CA  . LEU F  1 9  ? 10.641  23.030  45.423  1.00 18.86  ? 9   LEU F CA  1 
ATOM   1623 C C   . LEU F  1 9  ? 11.901  23.364  46.206  1.00 19.70  ? 9   LEU F C   1 
ATOM   1624 O O   . LEU F  1 9  ? 12.183  22.682  47.193  1.00 17.14  ? 9   LEU F O   1 
ATOM   1625 C CB  . LEU F  1 9  ? 10.993  22.131  44.221  1.00 16.80  ? 9   LEU F CB  1 
ATOM   1626 C CG  . LEU F  1 9  ? 9.766   21.490  43.553  1.00 12.39  ? 9   LEU F CG  1 
ATOM   1627 C CD1 . LEU F  1 9  ? 10.168  20.930  42.198  1.00 15.91  ? 9   LEU F CD1 1 
ATOM   1628 C CD2 . LEU F  1 9  ? 9.181   20.431  44.467  1.00 20.43  ? 9   LEU F CD2 1 
ATOM   1629 N N   . LYS F  1 10 ? 12.643  24.379  45.775  1.00 18.26  ? 10  LYS F N   1 
ATOM   1630 C CA  . LYS F  1 10 ? 13.824  24.807  46.524  1.00 19.21  ? 10  LYS F CA  1 
ATOM   1631 C C   . LYS F  1 10 ? 13.438  25.284  47.920  1.00 20.97  ? 10  LYS F C   1 
ATOM   1632 O O   . LYS F  1 10 ? 14.199  25.160  48.890  1.00 20.95  ? 10  LYS F O   1 
ATOM   1633 C CB  . LYS F  1 10 ? 14.572  25.893  45.748  1.00 23.74  ? 10  LYS F CB  1 
ATOM   1634 C CG  . LYS F  1 10 ? 15.729  26.473  46.550  1.00 29.73  ? 10  LYS F CG  1 
ATOM   1635 C CD  . LYS F  1 10 ? 16.969  25.608  46.389  1.00 45.20  ? 10  LYS F CD  1 
ATOM   1636 C CE  . LYS F  1 10 ? 18.238  26.437  46.578  1.00 51.47  ? 10  LYS F CE  1 
ATOM   1637 N NZ  . LYS F  1 10 ? 19.385  25.547  46.911  1.00 56.33  ? 10  LYS F NZ  1 
ATOM   1638 N N   . SER F  1 11 ? 12.236  25.840  48.080  1.00 24.34  ? 11  SER F N   1 
ATOM   1639 C CA  . SER F  1 11 ? 11.780  26.256  49.403  1.00 20.44  ? 11  SER F CA  1 
ATOM   1640 C C   . SER F  1 11 ? 11.356  25.075  50.277  1.00 22.12  ? 11  SER F C   1 
ATOM   1641 O O   . SER F  1 11 ? 10.962  25.255  51.434  1.00 25.64  ? 11  SER F O   1 
ATOM   1642 C CB  . SER F  1 11 ? 10.613  27.232  49.275  1.00 21.07  ? 11  SER F CB  1 
ATOM   1643 O OG  . SER F  1 11 ? 9.414   26.529  49.016  1.00 23.16  ? 11  SER F OG  1 
ATOM   1644 N N   . GLY F  1 12 ? 11.423  23.874  49.746  1.00 18.97  ? 12  GLY F N   1 
ATOM   1645 C CA  . GLY F  1 12 ? 11.073  22.635  50.393  1.00 18.60  ? 12  GLY F CA  1 
ATOM   1646 C C   . GLY F  1 12 ? 9.600   22.293  50.323  1.00 21.73  ? 12  GLY F C   1 
ATOM   1647 O O   . GLY F  1 12 ? 9.118   21.433  51.079  1.00 19.38  ? 12  GLY F O   1 
ATOM   1648 N N   . ALA F  1 13 ? 8.866   22.941  49.425  1.00 14.36  ? 13  ALA F N   1 
ATOM   1649 C CA  . ALA F  1 13 ? 7.428   22.727  49.261  1.00 14.53  ? 13  ALA F CA  1 
ATOM   1650 C C   . ALA F  1 13 ? 7.159   21.683  48.168  1.00 16.24  ? 13  ALA F C   1 
ATOM   1651 O O   . ALA F  1 13 ? 8.111   21.132  47.614  1.00 17.72  ? 13  ALA F O   1 
ATOM   1652 C CB  . ALA F  1 13 ? 6.734   24.054  48.981  1.00 11.86  ? 13  ALA F CB  1 
ATOM   1653 N N   A ILE F  1 14 ? 5.890   21.436  47.898  0.50 14.49  ? 14  ILE F N   1 
ATOM   1654 N N   B ILE F  1 14 ? 5.889   21.458  47.891  0.50 14.50  ? 14  ILE F N   1 
ATOM   1655 C CA  A ILE F  1 14 ? 5.435   20.485  46.895  0.50 11.29  ? 14  ILE F CA  1 
ATOM   1656 C CA  B ILE F  1 14 ? 5.317   20.504  46.959  0.50 11.28  ? 14  ILE F CA  1 
ATOM   1657 C C   A ILE F  1 14 ? 4.590   21.177  45.830  0.50 13.55  ? 14  ILE F C   1 
ATOM   1658 C C   B ILE F  1 14 ? 4.535   21.166  45.834  0.50 13.38  ? 14  ILE F C   1 
ATOM   1659 O O   A ILE F  1 14 ? 3.796   22.065  46.133  0.50 14.45  ? 14  ILE F O   1 
ATOM   1660 O O   B ILE F  1 14 ? 3.711   22.047  46.091  0.50 13.18  ? 14  ILE F O   1 
ATOM   1661 C CB  A ILE F  1 14 ? 4.601   19.384  47.559  0.50 15.54  ? 14  ILE F CB  1 
ATOM   1662 C CB  B ILE F  1 14 ? 4.369   19.572  47.745  0.50 14.61  ? 14  ILE F CB  1 
ATOM   1663 C CG1 A ILE F  1 14 ? 4.188   18.218  46.660  0.50 23.38  ? 14  ILE F CG1 1 
ATOM   1664 C CG1 B ILE F  1 14 ? 5.139   18.739  48.781  0.50 7.92   ? 14  ILE F CG1 1 
ATOM   1665 C CG2 A ILE F  1 14 ? 3.362   19.997  48.198  0.50 19.36  ? 14  ILE F CG2 1 
ATOM   1666 C CG2 B ILE F  1 14 ? 3.519   18.706  46.841  0.50 14.02  ? 14  ILE F CG2 1 
ATOM   1667 C CD1 A ILE F  1 14 ? 3.003   17.474  47.248  0.50 34.11  ? 14  ILE F CD1 1 
ATOM   1668 C CD1 B ILE F  1 14 ? 4.348   18.477  50.049  0.50 8.40   ? 14  ILE F CD1 1 
ATOM   1669 N N   . CYS F  1 15 ? 4.744   20.762  44.585  1.00 15.37  ? 15  CYS F N   1 
ATOM   1670 C CA  . CYS F  1 15 ? 3.892   21.270  43.506  1.00 15.96  ? 15  CYS F CA  1 
ATOM   1671 C C   . CYS F  1 15 ? 2.736   20.315  43.228  1.00 13.74  ? 15  CYS F C   1 
ATOM   1672 O O   . CYS F  1 15 ? 3.003   19.143  42.949  1.00 13.66  ? 15  CYS F O   1 
ATOM   1673 C CB  . CYS F  1 15 ? 4.698   21.466  42.217  1.00 11.99  ? 15  CYS F CB  1 
ATOM   1674 S SG  . CYS F  1 15 ? 5.807   22.870  42.222  1.00 16.54  ? 15  CYS F SG  1 
ATOM   1675 N N   . HIS F  1 16 ? 1.510   20.815  43.293  1.00 10.55  ? 16  HIS F N   1 
ATOM   1676 C CA  . HIS F  1 16 ? 0.308   20.070  42.947  1.00 12.45  ? 16  HIS F CA  1 
ATOM   1677 C C   . HIS F  1 16 ? -0.260  20.573  41.620  1.00 15.34  ? 16  HIS F C   1 
ATOM   1678 O O   . HIS F  1 16 ? -0.168  21.780  41.357  1.00 14.81  ? 16  HIS F O   1 
ATOM   1679 C CB  . HIS F  1 16 ? -0.750  20.152  44.053  1.00 15.04  ? 16  HIS F CB  1 
ATOM   1680 C CG  . HIS F  1 16 ? -0.603  19.008  45.009  1.00 16.29  ? 16  HIS F CG  1 
ATOM   1681 N ND1 . HIS F  1 16 ? -1.368  17.872  44.948  1.00 15.03  ? 16  HIS F ND1 1 
ATOM   1682 C CD2 . HIS F  1 16 ? 0.249   18.830  46.046  1.00 23.76  ? 16  HIS F CD2 1 
ATOM   1683 C CE1 . HIS F  1 16 ? -1.005  17.041  45.909  1.00 18.99  ? 16  HIS F CE1 1 
ATOM   1684 N NE2 . HIS F  1 16 ? -0.023  17.602  46.593  1.00 20.91  ? 16  HIS F NE2 1 
ATOM   1685 N N   . PRO F  1 17 ? -0.788  19.703  40.767  1.00 13.94  ? 17  PRO F N   1 
ATOM   1686 C CA  . PRO F  1 17 ? -1.225  20.187  39.445  1.00 15.03  ? 17  PRO F CA  1 
ATOM   1687 C C   . PRO F  1 17 ? -2.532  20.937  39.441  1.00 14.05  ? 17  PRO F C   1 
ATOM   1688 O O   . PRO F  1 17 ? -2.799  21.676  38.473  1.00 19.29  ? 17  PRO F O   1 
ATOM   1689 C CB  . PRO F  1 17 ? -1.407  18.876  38.659  1.00 18.90  ? 17  PRO F CB  1 
ATOM   1690 C CG  . PRO F  1 17 ? -1.779  17.869  39.692  1.00 17.63  ? 17  PRO F CG  1 
ATOM   1691 C CD  . PRO F  1 17 ? -0.972  18.253  40.904  1.00 12.96  ? 17  PRO F CD  1 
ATOM   1692 N N   . VAL F  1 18 ? -3.403  20.750  40.442  1.00 13.69  ? 18  VAL F N   1 
ATOM   1693 C CA  . VAL F  1 18 ? -4.670  21.482  40.400  1.00 17.71  ? 18  VAL F CA  1 
ATOM   1694 C C   . VAL F  1 18 ? -5.025  22.166  41.717  1.00 24.96  ? 18  VAL F C   1 
ATOM   1695 O O   . VAL F  1 18 ? -5.448  23.332  41.729  1.00 25.56  ? 18  VAL F O   1 
ATOM   1696 C CB  . VAL F  1 18 ? -5.836  20.573  39.972  1.00 23.61  ? 18  VAL F CB  1 
ATOM   1697 C CG1 . VAL F  1 18 ? -7.112  21.405  39.868  1.00 33.65  ? 18  VAL F CG1 1 
ATOM   1698 C CG2 . VAL F  1 18 ? -5.544  19.878  38.650  1.00 30.71  ? 18  VAL F CG2 1 
ATOM   1699 N N   . PHE F  1 19 ? -4.878  21.498  42.853  1.00 23.02  ? 19  PHE F N   1 
ATOM   1700 C CA  . PHE F  1 19 ? -5.208  22.122  44.139  1.00 20.02  ? 19  PHE F CA  1 
ATOM   1701 C C   . PHE F  1 19 ? -4.373  21.520  45.257  1.00 17.60  ? 19  PHE F C   1 
ATOM   1702 O O   . PHE F  1 19 ? -3.930  20.369  45.150  1.00 19.24  ? 19  PHE F O   1 
ATOM   1703 C CB  . PHE F  1 19 ? -6.703  21.956  44.436  1.00 18.03  ? 19  PHE F CB  1 
ATOM   1704 C CG  . PHE F  1 19 ? -7.071  20.505  44.687  1.00 22.75  ? 19  PHE F CG  1 
ATOM   1705 C CD1 . PHE F  1 19 ? -7.274  19.660  43.609  1.00 24.72  ? 19  PHE F CD1 1 
ATOM   1706 C CD2 . PHE F  1 19 ? -7.213  20.012  45.970  1.00 29.35  ? 19  PHE F CD2 1 
ATOM   1707 C CE1 . PHE F  1 19 ? -7.616  18.337  43.814  1.00 27.17  ? 19  PHE F CE1 1 
ATOM   1708 C CE2 . PHE F  1 19 ? -7.534  18.686  46.180  1.00 35.30  ? 19  PHE F CE2 1 
ATOM   1709 C CZ  . PHE F  1 19 ? -7.726  17.851  45.102  1.00 35.79  ? 19  PHE F CZ  1 
ATOM   1710 N N   . CYS F  1 20 ? -4.166  22.266  46.341  1.00 22.55  ? 20  CYS F N   1 
ATOM   1711 C CA  . CYS F  1 20 ? -3.502  21.732  47.523  1.00 17.62  ? 20  CYS F CA  1 
ATOM   1712 C C   . CYS F  1 20 ? -4.449  20.907  48.380  1.00 18.33  ? 20  CYS F C   1 
ATOM   1713 O O   . CYS F  1 20 ? -5.480  21.414  48.820  1.00 19.62  ? 20  CYS F O   1 
ATOM   1714 C CB  . CYS F  1 20 ? -2.949  22.863  48.401  1.00 18.39  ? 20  CYS F CB  1 
ATOM   1715 S SG  . CYS F  1 20 ? -1.652  23.870  47.663  1.00 18.67  ? 20  CYS F SG  1 
ATOM   1716 N N   . PRO F  1 21 ? -4.125  19.644  48.618  1.00 18.70  ? 21  PRO F N   1 
ATOM   1717 C CA  . PRO F  1 21 ? -4.901  18.865  49.595  1.00 18.68  ? 21  PRO F CA  1 
ATOM   1718 C C   . PRO F  1 21 ? -5.042  19.610  50.914  1.00 21.25  ? 21  PRO F C   1 
ATOM   1719 O O   . PRO F  1 21 ? -4.228  20.464  51.266  1.00 20.44  ? 21  PRO F O   1 
ATOM   1720 C CB  . PRO F  1 21 ? -4.023  17.624  49.783  1.00 21.25  ? 21  PRO F CB  1 
ATOM   1721 C CG  . PRO F  1 21 ? -3.309  17.472  48.475  1.00 23.11  ? 21  PRO F CG  1 
ATOM   1722 C CD  . PRO F  1 21 ? -3.040  18.878  47.997  1.00 18.43  ? 21  PRO F CD  1 
ATOM   1723 N N   . ARG F  1 22 ? -6.081  19.313  51.693  1.00 26.45  ? 22  ARG F N   1 
ATOM   1724 C CA  . ARG F  1 22 ? -6.377  20.080  52.900  1.00 28.52  ? 22  ARG F CA  1 
ATOM   1725 C C   . ARG F  1 22 ? -5.283  20.001  53.953  1.00 22.46  ? 22  ARG F C   1 
ATOM   1726 O O   . ARG F  1 22 ? -5.160  20.948  54.739  1.00 33.46  ? 22  ARG F O   1 
ATOM   1727 C CB  . ARG F  1 22 ? -7.706  19.671  53.535  1.00 28.71  ? 22  ARG F CB  1 
ATOM   1728 C CG  . ARG F  1 22 ? -8.001  18.194  53.662  1.00 41.15  ? 22  ARG F CG  1 
ATOM   1729 C CD  . ARG F  1 22 ? -9.254  18.002  54.510  1.00 44.00  ? 22  ARG F CD  1 
ATOM   1730 N NE  . ARG F  1 22 ? -9.564  16.607  54.791  1.00 42.40  ? 22  ARG F NE  1 
ATOM   1731 C CZ  . ARG F  1 22 ? -10.664 16.248  55.450  1.00 47.49  ? 22  ARG F CZ  1 
ATOM   1732 N NH1 . ARG F  1 22 ? -11.522 17.168  55.872  1.00 41.08  ? 22  ARG F NH1 1 
ATOM   1733 N NH2 . ARG F  1 22 ? -10.924 14.970  55.697  1.00 70.30  ? 22  ARG F NH2 1 
ATOM   1734 N N   . ARG F  1 23 ? -4.482  18.950  53.982  1.00 21.57  ? 23  ARG F N   1 
ATOM   1735 C CA  . ARG F  1 23 ? -3.404  18.908  54.972  1.00 14.00  ? 23  ARG F CA  1 
ATOM   1736 C C   . ARG F  1 23 ? -2.295  19.911  54.692  1.00 21.41  ? 23  ARG F C   1 
ATOM   1737 O O   . ARG F  1 23 ? -1.349  20.015  55.468  1.00 20.01  ? 23  ARG F O   1 
ATOM   1738 C CB  . ARG F  1 23 ? -2.837  17.490  55.047  1.00 19.53  ? 23  ARG F CB  1 
ATOM   1739 C CG  . ARG F  1 23 ? -1.847  17.128  53.948  1.00 26.42  ? 23  ARG F CG  1 
ATOM   1740 C CD  . ARG F  1 23 ? -2.324  15.897  53.201  1.00 39.58  ? 23  ARG F CD  1 
ATOM   1741 N NE  . ARG F  1 23 ? -1.771  14.655  53.691  1.00 38.73  ? 23  ARG F NE  1 
ATOM   1742 C CZ  . ARG F  1 23 ? -2.325  13.453  53.675  1.00 35.56  ? 23  ARG F CZ  1 
ATOM   1743 N NH1 . ARG F  1 23 ? -3.534  13.202  53.184  1.00 29.07  ? 23  ARG F NH1 1 
ATOM   1744 N NH2 . ARG F  1 23 ? -1.631  12.441  54.181  1.00 30.62  ? 23  ARG F NH2 1 
ATOM   1745 N N   . TYR F  1 24 ? -2.379  20.657  53.602  1.00 17.95  ? 24  TYR F N   1 
ATOM   1746 C CA  . TYR F  1 24 ? -1.426  21.671  53.226  1.00 14.86  ? 24  TYR F CA  1 
ATOM   1747 C C   . TYR F  1 24 ? -2.096  23.044  53.036  1.00 12.94  ? 24  TYR F C   1 
ATOM   1748 O O   . TYR F  1 24 ? -3.282  23.093  52.778  1.00 19.73  ? 24  TYR F O   1 
ATOM   1749 C CB  . TYR F  1 24 ? -0.760  21.416  51.867  1.00 19.76  ? 24  TYR F CB  1 
ATOM   1750 C CG  . TYR F  1 24 ? -0.233  20.020  51.656  1.00 12.86  ? 24  TYR F CG  1 
ATOM   1751 C CD1 . TYR F  1 24 ? -1.023  19.105  50.966  1.00 15.76  ? 24  TYR F CD1 1 
ATOM   1752 C CD2 . TYR F  1 24 ? 1.013   19.630  52.124  1.00 17.75  ? 24  TYR F CD2 1 
ATOM   1753 C CE1 . TYR F  1 24 ? -0.554  17.821  50.762  1.00 14.69  ? 24  TYR F CE1 1 
ATOM   1754 C CE2 . TYR F  1 24 ? 1.477   18.337  51.917  1.00 19.30  ? 24  TYR F CE2 1 
ATOM   1755 C CZ  . TYR F  1 24 ? 0.677   17.445  51.230  1.00 20.61  ? 24  TYR F CZ  1 
ATOM   1756 O OH  . TYR F  1 24 ? 1.098   16.149  50.998  1.00 21.70  ? 24  TYR F OH  1 
ATOM   1757 N N   A LYS F  1 25 ? -1.269  24.060  53.167  0.50 15.24  ? 25  LYS F N   1 
ATOM   1758 N N   B LYS F  1 25 ? -1.276  24.071  53.162  0.50 15.23  ? 25  LYS F N   1 
ATOM   1759 C CA  A LYS F  1 25 ? -1.575  25.446  52.884  0.50 20.08  ? 25  LYS F CA  1 
ATOM   1760 C CA  B LYS F  1 25 ? -1.688  25.437  52.870  0.50 20.20  ? 25  LYS F CA  1 
ATOM   1761 C C   A LYS F  1 25 ? -1.039  25.804  51.496  0.50 21.53  ? 25  LYS F C   1 
ATOM   1762 C C   B LYS F  1 25 ? -1.037  25.875  51.560  0.50 21.36  ? 25  LYS F C   1 
ATOM   1763 O O   A LYS F  1 25 ? 0.053   25.360  51.121  0.50 18.32  ? 25  LYS F O   1 
ATOM   1764 O O   B LYS F  1 25 ? 0.120   25.559  51.275  0.50 20.75  ? 25  LYS F O   1 
ATOM   1765 C CB  A LYS F  1 25 ? -0.958  26.375  53.927  0.50 19.92  ? 25  LYS F CB  1 
ATOM   1766 C CB  B LYS F  1 25 ? -1.347  26.368  54.029  0.50 21.19  ? 25  LYS F CB  1 
ATOM   1767 C CG  A LYS F  1 25 ? 0.559   26.304  53.983  0.50 28.18  ? 25  LYS F CG  1 
ATOM   1768 C CG  B LYS F  1 25 ? -2.441  26.390  55.098  0.50 20.19  ? 25  LYS F CG  1 
ATOM   1769 C CD  A LYS F  1 25 ? 1.058   26.092  55.406  0.50 32.65  ? 25  LYS F CD  1 
ATOM   1770 C CD  B LYS F  1 25 ? -2.123  27.386  56.197  0.50 30.56  ? 25  LYS F CD  1 
ATOM   1771 C CE  A LYS F  1 25 ? 2.401   26.777  55.612  0.50 34.10  ? 25  LYS F CE  1 
ATOM   1772 C CE  B LYS F  1 25 ? -3.065  28.581  56.177  0.50 35.80  ? 25  LYS F CE  1 
ATOM   1773 N NZ  A LYS F  1 25 ? 2.266   28.007  56.449  0.50 31.06  ? 25  LYS F NZ  1 
ATOM   1774 N NZ  B LYS F  1 25 ? -4.470  28.160  55.916  0.50 36.91  ? 25  LYS F NZ  1 
ATOM   1775 N N   . GLN F  1 26 ? -1.811  26.585  50.749  1.00 18.46  ? 26  GLN F N   1 
ATOM   1776 C CA  . GLN F  1 26 ? -1.303  27.058  49.460  1.00 20.44  ? 26  GLN F CA  1 
ATOM   1777 C C   . GLN F  1 26 ? -0.378  28.245  49.700  1.00 19.21  ? 26  GLN F C   1 
ATOM   1778 O O   . GLN F  1 26 ? -0.786  29.208  50.368  1.00 23.04  ? 26  GLN F O   1 
ATOM   1779 C CB  . GLN F  1 26 ? -2.449  27.431  48.526  1.00 19.25  ? 26  GLN F CB  1 
ATOM   1780 C CG  . GLN F  1 26 ? -1.956  27.887  47.156  1.00 18.16  ? 26  GLN F CG  1 
ATOM   1781 C CD  . GLN F  1 26 ? -3.125  28.231  46.255  1.00 19.05  ? 26  GLN F CD  1 
ATOM   1782 O OE1 . GLN F  1 26 ? -4.118  27.496  46.189  1.00 23.52  ? 26  GLN F OE1 1 
ATOM   1783 N NE2 . GLN F  1 26 ? -2.993  29.360  45.565  1.00 24.79  ? 26  GLN F NE2 1 
ATOM   1784 N N   . ILE F  1 27 ? 0.856   28.179  49.206  1.00 15.41  ? 27  ILE F N   1 
ATOM   1785 C CA  . ILE F  1 27 ? 1.818   29.244  49.456  1.00 18.31  ? 27  ILE F CA  1 
ATOM   1786 C C   . ILE F  1 27 ? 2.235   29.944  48.168  1.00 23.49  ? 27  ILE F C   1 
ATOM   1787 O O   . ILE F  1 27 ? 3.030   30.892  48.218  1.00 22.70  ? 27  ILE F O   1 
ATOM   1788 C CB  . ILE F  1 27 ? 3.067   28.720  50.211  1.00 16.04  ? 27  ILE F CB  1 
ATOM   1789 C CG1 . ILE F  1 27 ? 3.904   27.702  49.463  1.00 17.93  ? 27  ILE F CG1 1 
ATOM   1790 C CG2 . ILE F  1 27 ? 2.630   28.165  51.569  1.00 19.70  ? 27  ILE F CG2 1 
ATOM   1791 C CD1 . ILE F  1 27 ? 5.208   27.293  50.117  1.00 21.87  ? 27  ILE F CD1 1 
ATOM   1792 N N   . GLY F  1 28 ? 1.679   29.504  47.036  1.00 15.30  ? 28  GLY F N   1 
ATOM   1793 C CA  . GLY F  1 28 ? 1.958   30.096  45.746  1.00 18.20  ? 28  GLY F CA  1 
ATOM   1794 C C   . GLY F  1 28 ? 1.509   29.195  44.606  1.00 14.69  ? 28  GLY F C   1 
ATOM   1795 O O   . GLY F  1 28 ? 0.668   28.332  44.843  1.00 13.31  ? 28  GLY F O   1 
ATOM   1796 N N   . THR F  1 29 ? 2.095   29.395  43.434  1.00 14.07  ? 29  THR F N   1 
ATOM   1797 C CA  . THR F  1 29 ? 1.843   28.561  42.265  1.00 15.60  ? 29  THR F CA  1 
ATOM   1798 C C   . THR F  1 29 ? 3.138   27.941  41.772  1.00 13.91  ? 29  THR F C   1 
ATOM   1799 O O   . THR F  1 29 ? 4.237   28.308  42.178  1.00 17.90  ? 29  THR F O   1 
ATOM   1800 C CB  . THR F  1 29 ? 1.203   29.360  41.107  1.00 20.48  ? 29  THR F CB  1 
ATOM   1801 O OG1 . THR F  1 29 ? 2.218   30.218  40.556  1.00 22.41  ? 29  THR F OG1 1 
ATOM   1802 C CG2 . THR F  1 29 ? 0.082   30.248  41.590  1.00 19.20  ? 29  THR F CG2 1 
ATOM   1803 N N   . CYS F  1 30 ? 3.033   26.943  40.871  1.00 12.01  ? 30  CYS F N   1 
ATOM   1804 C CA  . CYS F  1 30 ? 4.252   26.385  40.299  1.00 13.51  ? 30  CYS F CA  1 
ATOM   1805 C C   . CYS F  1 30 ? 4.365   26.700  38.808  1.00 13.21  ? 30  CYS F C   1 
ATOM   1806 O O   . CYS F  1 30 ? 4.906   25.900  38.047  1.00 16.44  ? 30  CYS F O   1 
ATOM   1807 C CB  . CYS F  1 30 ? 4.312   24.856  40.514  1.00 15.58  ? 30  CYS F CB  1 
ATOM   1808 S SG  . CYS F  1 30 ? 4.594   24.516  42.291  1.00 15.41  ? 30  CYS F SG  1 
ATOM   1809 N N   . GLY F  1 31 ? 3.893   27.861  38.405  1.00 15.42  ? 31  GLY F N   1 
ATOM   1810 C CA  . GLY F  1 31 ? 4.193   28.413  37.091  1.00 15.75  ? 31  GLY F CA  1 
ATOM   1811 C C   . GLY F  1 31 ? 3.249   27.974  36.004  1.00 15.84  ? 31  GLY F C   1 
ATOM   1812 O O   . GLY F  1 31 ? 2.483   28.784  35.463  1.00 19.92  ? 31  GLY F O   1 
ATOM   1813 N N   . LEU F  1 32 ? 3.273   26.691  35.655  1.00 16.56  ? 32  LEU F N   1 
ATOM   1814 C CA  . LEU F  1 32 ? 2.249   26.133  34.762  1.00 20.27  ? 32  LEU F CA  1 
ATOM   1815 C C   . LEU F  1 32 ? 0.865   26.518  35.249  1.00 18.14  ? 32  LEU F C   1 
ATOM   1816 O O   . LEU F  1 32 ? 0.527   26.330  36.429  1.00 16.73  ? 32  LEU F O   1 
ATOM   1817 C CB  . LEU F  1 32 ? 2.412   24.606  34.734  1.00 14.67  ? 32  LEU F CB  1 
ATOM   1818 C CG  . LEU F  1 32 ? 1.495   23.847  33.765  1.00 16.16  ? 32  LEU F CG  1 
ATOM   1819 C CD1 . LEU F  1 32 ? 1.930   24.111  32.331  1.00 16.07  ? 32  LEU F CD1 1 
ATOM   1820 C CD2 . LEU F  1 32 ? 1.500   22.356  34.084  1.00 17.18  ? 32  LEU F CD2 1 
ATOM   1821 N N   . PRO F  1 33 ? 0.008   27.108  34.434  1.00 16.78  ? 33  PRO F N   1 
ATOM   1822 C CA  . PRO F  1 33 ? -1.310  27.567  34.880  1.00 20.58  ? 33  PRO F CA  1 
ATOM   1823 C C   . PRO F  1 33 ? -2.142  26.541  35.649  1.00 23.57  ? 33  PRO F C   1 
ATOM   1824 O O   . PRO F  1 33 ? -2.246  25.376  35.266  1.00 21.06  ? 33  PRO F O   1 
ATOM   1825 C CB  . PRO F  1 33 ? -1.996  27.873  33.536  1.00 26.92  ? 33  PRO F CB  1 
ATOM   1826 C CG  . PRO F  1 33 ? -0.859  28.321  32.666  1.00 20.20  ? 33  PRO F CG  1 
ATOM   1827 C CD  . PRO F  1 33 ? 0.266   27.384  33.001  1.00 18.74  ? 33  PRO F CD  1 
ATOM   1828 N N   . GLY F  1 34 ? -2.729  26.980  36.758  1.00 21.48  ? 34  GLY F N   1 
ATOM   1829 C CA  . GLY F  1 34 ? -3.492  26.116  37.641  1.00 21.32  ? 34  GLY F CA  1 
ATOM   1830 C C   . GLY F  1 34 ? -2.698  25.345  38.672  1.00 16.61  ? 34  GLY F C   1 
ATOM   1831 O O   . GLY F  1 34 ? -3.321  24.834  39.626  1.00 16.22  ? 34  GLY F O   1 
ATOM   1832 N N   . THR F  1 35 ? -1.381  25.223  38.529  1.00 13.78  ? 35  THR F N   1 
ATOM   1833 C CA  . THR F  1 35 ? -0.582  24.451  39.500  1.00 15.03  ? 35  THR F CA  1 
ATOM   1834 C C   . THR F  1 35 ? -0.416  25.248  40.791  1.00 11.22  ? 35  THR F C   1 
ATOM   1835 O O   . THR F  1 35 ? -0.373  26.479  40.729  1.00 13.57  ? 35  THR F O   1 
ATOM   1836 C CB  . THR F  1 35 ? 0.826   24.056  39.024  1.00 18.52  ? 35  THR F CB  1 
ATOM   1837 O OG1 . THR F  1 35 ? 1.638   25.222  38.795  1.00 13.18  ? 35  THR F OG1 1 
ATOM   1838 C CG2 . THR F  1 35 ? 0.760   23.282  37.702  1.00 18.37  ? 35  THR F CG2 1 
ATOM   1839 N N   . LYS F  1 36 ? -0.319  24.551  41.913  1.00 14.62  ? 36  LYS F N   1 
ATOM   1840 C CA  . LYS F  1 36 ? -0.219  25.151  43.237  1.00 14.02  ? 36  LYS F CA  1 
ATOM   1841 C C   . LYS F  1 36 ? 1.030   24.712  43.995  1.00 17.58  ? 36  LYS F C   1 
ATOM   1842 O O   . LYS F  1 36 ? 1.430   23.547  43.949  1.00 14.02  ? 36  LYS F O   1 
ATOM   1843 C CB  . LYS F  1 36 ? -1.457  24.746  44.052  1.00 20.00  ? 36  LYS F CB  1 
ATOM   1844 C CG  . LYS F  1 36 ? -2.780  25.074  43.362  1.00 20.64  ? 36  LYS F CG  1 
ATOM   1845 C CD  . LYS F  1 36 ? -2.709  26.499  42.802  1.00 25.55  ? 36  LYS F CD  1 
ATOM   1846 C CE  . LYS F  1 36 ? -3.976  26.827  42.022  1.00 31.85  ? 36  LYS F CE  1 
ATOM   1847 N NZ  . LYS F  1 36 ? -5.201  26.497  42.793  1.00 32.46  ? 36  LYS F NZ  1 
ATOM   1848 N N   . CYS F  1 37 ? 1.632   25.652  44.721  1.00 12.47  ? 37  CYS F N   1 
ATOM   1849 C CA  . CYS F  1 37 ? 2.737   25.348  45.621  1.00 12.84  ? 37  CYS F CA  1 
ATOM   1850 C C   . CYS F  1 37 ? 2.121   25.129  47.006  1.00 14.07  ? 37  CYS F C   1 
ATOM   1851 O O   . CYS F  1 37 ? 1.400   26.018  47.451  1.00 19.33  ? 37  CYS F O   1 
ATOM   1852 C CB  . CYS F  1 37 ? 3.763   26.468  45.658  1.00 17.80  ? 37  CYS F CB  1 
ATOM   1853 S SG  . CYS F  1 37 ? 5.270   26.055  46.577  1.00 14.36  ? 37  CYS F SG  1 
ATOM   1854 N N   . CYS F  1 38 ? 2.350   23.971  47.601  1.00 14.04  ? 38  CYS F N   1 
ATOM   1855 C CA  . CYS F  1 38 ? 1.707   23.539  48.829  1.00 15.55  ? 38  CYS F CA  1 
ATOM   1856 C C   . CYS F  1 38 ? 2.704   23.157  49.910  1.00 15.90  ? 38  CYS F C   1 
ATOM   1857 O O   . CYS F  1 38 ? 3.744   22.528  49.691  1.00 14.21  ? 38  CYS F O   1 
ATOM   1858 C CB  . CYS F  1 38 ? 0.807   22.316  48.541  1.00 10.78  ? 38  CYS F CB  1 
ATOM   1859 S SG  . CYS F  1 38 ? -0.247  22.552  47.087  1.00 15.57  ? 38  CYS F SG  1 
ATOM   1860 N N   . LYS F  1 39 ? 2.390   23.529  51.156  1.00 16.23  ? 39  LYS F N   1 
ATOM   1861 C CA  . LYS F  1 39 ? 3.310   23.115  52.218  1.00 19.52  ? 39  LYS F CA  1 
ATOM   1862 C C   . LYS F  1 39 ? 2.531   22.896  53.514  1.00 20.27  ? 39  LYS F C   1 
ATOM   1863 O O   . LYS F  1 39 ? 1.573   23.623  53.766  1.00 18.43  ? 39  LYS F O   1 
ATOM   1864 C CB  . LYS F  1 39 ? 4.402   24.168  52.393  1.00 19.21  ? 39  LYS F CB  1 
ATOM   1865 C CG  . LYS F  1 39 ? 5.562   23.647  53.252  1.00 25.15  ? 39  LYS F CG  1 
ATOM   1866 C CD  . LYS F  1 39 ? 6.735   24.589  53.119  1.00 24.27  ? 39  LYS F CD  1 
ATOM   1867 C CE  . LYS F  1 39 ? 7.975   24.057  53.814  1.00 29.67  ? 39  LYS F CE  1 
ATOM   1868 N NZ  . LYS F  1 39 ? 9.079   25.054  53.730  1.00 36.30  ? 39  LYS F NZ  1 
ATOM   1869 N N   . LYS F  1 40 ? 2.921   21.919  54.330  1.00 19.79  ? 40  LYS F N   1 
ATOM   1870 C CA  . LYS F  1 40 ? 2.263   21.756  55.624  1.00 16.94  ? 40  LYS F CA  1 
ATOM   1871 C C   . LYS F  1 40 ? 2.673   22.889  56.553  1.00 18.32  ? 40  LYS F C   1 
ATOM   1872 O O   . LYS F  1 40 ? 3.838   23.262  56.604  1.00 17.41  ? 40  LYS F O   1 
ATOM   1873 C CB  . LYS F  1 40 ? 2.635   20.421  56.268  1.00 18.53  ? 40  LYS F CB  1 
ATOM   1874 C CG  . LYS F  1 40 ? 2.125   19.230  55.482  1.00 16.58  ? 40  LYS F CG  1 
ATOM   1875 C CD  . LYS F  1 40 ? 2.615   17.927  56.115  1.00 17.06  ? 40  LYS F CD  1 
ATOM   1876 C CE  . LYS F  1 40 ? 1.974   16.735  55.404  1.00 20.79  ? 40  LYS F CE  1 
ATOM   1877 N NZ  . LYS F  1 40 ? 1.859   15.567  56.329  1.00 26.05  ? 40  LYS F NZ  1 
ATOM   1878 N N   . PRO F  1 41 ? 1.726   23.451  57.295  1.00 19.22  ? 41  PRO F N   1 
ATOM   1879 C CA  . PRO F  1 41 ? 2.061   24.524  58.242  1.00 29.33  ? 41  PRO F CA  1 
ATOM   1880 C C   . PRO F  1 41 ? 2.960   24.019  59.373  1.00 25.09  ? 41  PRO F C   1 
ATOM   1881 O O   . PRO F  1 41 ? 2.856   22.835  59.728  1.00 19.49  ? 41  PRO F O   1 
ATOM   1882 C CB  . PRO F  1 41 ? 0.699   24.927  58.803  1.00 33.40  ? 41  PRO F CB  1 
ATOM   1883 C CG  . PRO F  1 41 ? -0.310  24.369  57.863  1.00 29.69  ? 41  PRO F CG  1 
ATOM   1884 C CD  . PRO F  1 41 ? 0.307   23.116  57.288  1.00 22.98  ? 41  PRO F CD  1 
ATOM   1885 O OXT . PRO F  1 41 ? 3.778   24.809  59.902  1.00 29.72  ? 41  PRO F OXT 1 
ATOM   1886 N N   . GLY G  1 1  ? 11.481  11.522  20.983  1.00 18.41  ? 1   GLY G N   1 
ATOM   1887 C CA  . GLY G  1 1  ? 12.363  12.685  21.042  1.00 15.49  ? 1   GLY G CA  1 
ATOM   1888 C C   . GLY G  1 1  ? 12.881  12.842  22.465  1.00 19.42  ? 1   GLY G C   1 
ATOM   1889 O O   . GLY G  1 1  ? 12.171  12.525  23.423  1.00 24.63  ? 1   GLY G O   1 
ATOM   1890 N N   A ILE G  1 2  ? 14.104  13.337  22.598  0.50 17.96  ? 2   ILE G N   1 
ATOM   1891 N N   B ILE G  1 2  ? 14.111  13.316  22.621  0.50 18.22  ? 2   ILE G N   1 
ATOM   1892 C CA  A ILE G  1 2  ? 14.668  13.574  23.930  0.50 15.96  ? 2   ILE G CA  1 
ATOM   1893 C CA  B ILE G  1 2  ? 14.641  13.454  23.987  0.50 15.86  ? 2   ILE G CA  1 
ATOM   1894 C C   A ILE G  1 2  ? 13.892  14.664  24.646  0.50 15.06  ? 2   ILE G C   1 
ATOM   1895 C C   B ILE G  1 2  ? 14.001  14.644  24.678  0.50 15.21  ? 2   ILE G C   1 
ATOM   1896 O O   A ILE G  1 2  ? 13.595  15.700  24.045  0.50 15.23  ? 2   ILE G O   1 
ATOM   1897 O O   B ILE G  1 2  ? 13.910  15.717  24.081  0.50 14.57  ? 2   ILE G O   1 
ATOM   1898 C CB  A ILE G  1 2  ? 16.152  13.975  23.835  0.50 15.01  ? 2   ILE G CB  1 
ATOM   1899 C CB  B ILE G  1 2  ? 16.174  13.577  23.959  0.50 16.08  ? 2   ILE G CB  1 
ATOM   1900 C CG1 A ILE G  1 2  ? 16.986  13.041  22.958  0.50 13.76  ? 2   ILE G CG1 1 
ATOM   1901 C CG1 B ILE G  1 2  ? 16.867  12.290  23.517  0.50 13.49  ? 2   ILE G CG1 1 
ATOM   1902 C CG2 A ILE G  1 2  ? 16.763  14.109  25.225  0.50 12.73  ? 2   ILE G CG2 1 
ATOM   1903 C CG2 B ILE G  1 2  ? 16.695  14.053  25.308  0.50 11.58  ? 2   ILE G CG2 1 
ATOM   1904 C CD1 A ILE G  1 2  ? 17.049  11.615  23.457  0.50 11.99  ? 2   ILE G CD1 1 
ATOM   1905 C CD1 B ILE G  1 2  ? 18.376  12.338  23.465  0.50 10.65  ? 2   ILE G CD1 1 
ATOM   1906 N N   . GLY G  1 3  ? 13.553  14.485  25.925  1.00 13.14  ? 3   GLY G N   1 
ATOM   1907 C CA  . GLY G  1 3  ? 12.856  15.577  26.612  1.00 12.70  ? 3   GLY G CA  1 
ATOM   1908 C C   . GLY G  1 3  ? 13.220  15.679  28.082  1.00 18.32  ? 3   GLY G C   1 
ATOM   1909 O O   . GLY G  1 3  ? 12.445  16.157  28.917  1.00 14.69  ? 3   GLY G O   1 
ATOM   1910 N N   . ASP G  1 4  ? 14.409  15.232  28.458  1.00 14.93  ? 4   ASP G N   1 
ATOM   1911 C CA  . ASP G  1 4  ? 14.883  15.413  29.822  1.00 11.57  ? 4   ASP G CA  1 
ATOM   1912 C C   . ASP G  1 4  ? 16.402  15.454  29.799  1.00 10.52  ? 4   ASP G C   1 
ATOM   1913 O O   . ASP G  1 4  ? 17.061  14.873  28.921  1.00 10.38  ? 4   ASP G O   1 
ATOM   1914 C CB  . ASP G  1 4  ? 14.371  14.304  30.764  1.00 15.42  ? 4   ASP G CB  1 
ATOM   1915 C CG  . ASP G  1 4  ? 15.192  13.039  30.641  1.00 16.89  ? 4   ASP G CG  1 
ATOM   1916 O OD1 . ASP G  1 4  ? 14.780  12.185  29.827  1.00 18.69  ? 4   ASP G OD1 1 
ATOM   1917 O OD2 . ASP G  1 4  ? 16.239  12.873  31.312  1.00 16.26  ? 4   ASP G OD2 1 
ATOM   1918 N N   . PRO G  1 5  ? 16.975  16.174  30.757  1.00 13.26  ? 5   PRO G N   1 
ATOM   1919 C CA  . PRO G  1 5  ? 18.410  16.456  30.750  1.00 13.43  ? 5   PRO G CA  1 
ATOM   1920 C C   . PRO G  1 5  ? 19.273  15.230  30.957  1.00 12.05  ? 5   PRO G C   1 
ATOM   1921 O O   . PRO G  1 5  ? 20.370  15.118  30.386  1.00 15.59  ? 5   PRO G O   1 
ATOM   1922 C CB  . PRO G  1 5  ? 18.608  17.432  31.916  1.00 22.01  ? 5   PRO G CB  1 
ATOM   1923 C CG  . PRO G  1 5  ? 17.398  17.285  32.771  1.00 21.88  ? 5   PRO G CG  1 
ATOM   1924 C CD  . PRO G  1 5  ? 16.277  16.800  31.895  1.00 21.17  ? 5   PRO G CD  1 
ATOM   1925 N N   . VAL G  1 6  ? 18.788  14.274  31.754  1.00 11.95  ? 6   VAL G N   1 
ATOM   1926 C CA  . VAL G  1 6  ? 19.614  13.092  32.020  1.00 12.49  ? 6   VAL G CA  1 
ATOM   1927 C C   . VAL G  1 6  ? 19.786  12.256  30.748  1.00 14.12  ? 6   VAL G C   1 
ATOM   1928 O O   . VAL G  1 6  ? 20.914  11.877  30.451  1.00 13.41  ? 6   VAL G O   1 
ATOM   1929 C CB  . VAL G  1 6  ? 18.991  12.242  33.140  1.00 11.30  ? 6   VAL G CB  1 
ATOM   1930 C CG1 . VAL G  1 6  ? 19.813  10.989  33.396  1.00 23.18  ? 6   VAL G CG1 1 
ATOM   1931 C CG2 . VAL G  1 6  ? 18.878  13.086  34.402  1.00 21.59  ? 6   VAL G CG2 1 
ATOM   1932 N N   . THR G  1 7  ? 18.695  12.034  30.021  1.00 12.34  ? 7   THR G N   1 
ATOM   1933 C CA  . THR G  1 7  ? 18.779  11.286  28.755  1.00 13.11  ? 7   THR G CA  1 
ATOM   1934 C C   . THR G  1 7  ? 19.679  11.993  27.756  1.00 13.71  ? 7   THR G C   1 
ATOM   1935 O O   . THR G  1 7  ? 20.497  11.361  27.099  1.00 9.96   ? 7   THR G O   1 
ATOM   1936 C CB  . THR G  1 7  ? 17.369  11.113  28.178  1.00 14.83  ? 7   THR G CB  1 
ATOM   1937 O OG1 . THR G  1 7  ? 16.621  10.389  29.172  1.00 14.26  ? 7   THR G OG1 1 
ATOM   1938 C CG2 . THR G  1 7  ? 17.362  10.286  26.903  1.00 16.71  ? 7   THR G CG2 1 
ATOM   1939 N N   . CYS G  1 8  ? 19.511  13.311  27.670  1.00 13.21  ? 8   CYS G N   1 
ATOM   1940 C CA  . CYS G  1 8  ? 20.356  14.105  26.777  1.00 13.60  ? 8   CYS G CA  1 
ATOM   1941 C C   . CYS G  1 8  ? 21.837  13.849  27.019  1.00 14.12  ? 8   CYS G C   1 
ATOM   1942 O O   . CYS G  1 8  ? 22.652  13.537  26.138  1.00 14.19  ? 8   CYS G O   1 
ATOM   1943 C CB  . CYS G  1 8  ? 20.007  15.590  26.963  1.00 13.57  ? 8   CYS G CB  1 
ATOM   1944 S SG  . CYS G  1 8  ? 20.889  16.640  25.766  1.00 16.41  ? 8   CYS G SG  1 
ATOM   1945 N N   . LEU G  1 9  ? 22.258  13.972  28.280  1.00 14.00  ? 9   LEU G N   1 
ATOM   1946 C CA  . LEU G  1 9  ? 23.656  13.883  28.638  1.00 14.36  ? 9   LEU G CA  1 
ATOM   1947 C C   . LEU G  1 9  ? 24.177  12.465  28.456  1.00 16.17  ? 9   LEU G C   1 
ATOM   1948 O O   . LEU G  1 9  ? 25.322  12.231  28.030  1.00 19.79  ? 9   LEU G O   1 
ATOM   1949 C CB  . LEU G  1 9  ? 23.833  14.400  30.073  1.00 15.82  ? 9   LEU G CB  1 
ATOM   1950 C CG  . LEU G  1 9  ? 23.559  15.895  30.244  1.00 24.13  ? 9   LEU G CG  1 
ATOM   1951 C CD1 . LEU G  1 9  ? 23.656  16.313  31.704  1.00 26.24  ? 9   LEU G CD1 1 
ATOM   1952 C CD2 . LEU G  1 9  ? 24.517  16.722  29.392  1.00 18.92  ? 9   LEU G CD2 1 
ATOM   1953 N N   . LYS G  1 10 ? 23.300  11.519  28.763  1.00 14.54  ? 10  LYS G N   1 
ATOM   1954 C CA  . LYS G  1 10 ? 23.625  10.105  28.638  1.00 18.76  ? 10  LYS G CA  1 
ATOM   1955 C C   . LYS G  1 10 ? 23.968  9.763   27.187  1.00 18.46  ? 10  LYS G C   1 
ATOM   1956 O O   . LYS G  1 10 ? 24.842  8.929   26.966  1.00 15.90  ? 10  LYS G O   1 
ATOM   1957 C CB  . LYS G  1 10 ? 22.464  9.222   29.098  1.00 21.34  ? 10  LYS G CB  1 
ATOM   1958 C CG  . LYS G  1 10 ? 22.743  7.736   28.859  1.00 26.76  ? 10  LYS G CG  1 
ATOM   1959 C CD  . LYS G  1 10 ? 21.919  6.885   29.815  1.00 27.78  ? 10  LYS G CD  1 
ATOM   1960 C CE  . LYS G  1 10 ? 20.429  7.077   29.592  1.00 31.65  ? 10  LYS G CE  1 
ATOM   1961 N NZ  . LYS G  1 10 ? 19.627  6.132   30.428  1.00 38.01  ? 10  LYS G NZ  1 
ATOM   1962 N N   . SER G  1 11 ? 23.284  10.399  26.243  1.00 16.08  ? 11  SER G N   1 
ATOM   1963 C CA  . SER G  1 11 ? 23.513  10.164  24.822  1.00 14.61  ? 11  SER G CA  1 
ATOM   1964 C C   . SER G  1 11 ? 24.770  10.838  24.281  1.00 11.38  ? 11  SER G C   1 
ATOM   1965 O O   . SER G  1 11 ? 25.094  10.665  23.097  1.00 19.31  ? 11  SER G O   1 
ATOM   1966 C CB  . SER G  1 11 ? 22.317  10.657  23.987  1.00 13.64  ? 11  SER G CB  1 
ATOM   1967 O OG  . SER G  1 11 ? 22.281  12.067  23.902  1.00 15.47  ? 11  SER G OG  1 
ATOM   1968 N N   . GLY G  1 12 ? 25.466  11.588  25.118  1.00 13.63  ? 12  GLY G N   1 
ATOM   1969 C CA  . GLY G  1 12 ? 26.645  12.304  24.694  1.00 17.16  ? 12  GLY G CA  1 
ATOM   1970 C C   . GLY G  1 12 ? 26.334  13.671  24.110  1.00 18.53  ? 12  GLY G C   1 
ATOM   1971 O O   . GLY G  1 12 ? 27.240  14.273  23.539  1.00 19.48  ? 12  GLY G O   1 
ATOM   1972 N N   . ALA G  1 13 ? 25.110  14.157  24.253  1.00 14.93  ? 13  ALA G N   1 
ATOM   1973 C CA  . ALA G  1 13 ? 24.714  15.486  23.808  1.00 14.83  ? 13  ALA G CA  1 
ATOM   1974 C C   . ALA G  1 13 ? 24.895  16.475  24.965  1.00 16.66  ? 13  ALA G C   1 
ATOM   1975 O O   . ALA G  1 13 ? 25.224  16.057  26.084  1.00 16.29  ? 13  ALA G O   1 
ATOM   1976 C CB  . ALA G  1 13 ? 23.286  15.491  23.280  1.00 11.50  ? 13  ALA G CB  1 
ATOM   1977 N N   A ILE G  1 14 ? 24.690  17.756  24.697  0.50 17.10  ? 14  ILE G N   1 
ATOM   1978 N N   B ILE G  1 14 ? 24.689  17.754  24.689  0.50 17.10  ? 14  ILE G N   1 
ATOM   1979 C CA  A ILE G  1 14 ? 24.862  18.791  25.714  0.50 17.94  ? 14  ILE G CA  1 
ATOM   1980 C CA  B ILE G  1 14 ? 24.868  18.834  25.652  0.50 17.82  ? 14  ILE G CA  1 
ATOM   1981 C C   A ILE G  1 14 ? 23.588  19.600  25.866  0.50 17.16  ? 14  ILE G C   1 
ATOM   1982 C C   B ILE G  1 14 ? 23.583  19.615  25.857  0.50 17.13  ? 14  ILE G C   1 
ATOM   1983 O O   A ILE G  1 14 ? 22.917  19.875  24.869  0.50 20.41  ? 14  ILE G O   1 
ATOM   1984 O O   B ILE G  1 14 ? 22.890  19.899  24.876  0.50 20.17  ? 14  ILE G O   1 
ATOM   1985 C CB  A ILE G  1 14 ? 26.040  19.718  25.355  0.50 22.67  ? 14  ILE G CB  1 
ATOM   1986 C CB  B ILE G  1 14 ? 25.980  19.802  25.192  0.50 22.39  ? 14  ILE G CB  1 
ATOM   1987 C CG1 A ILE G  1 14 ? 26.210  20.940  26.260  0.50 27.53  ? 14  ILE G CG1 1 
ATOM   1988 C CG1 B ILE G  1 14 ? 27.375  19.181  25.106  0.50 24.06  ? 14  ILE G CG1 1 
ATOM   1989 C CG2 A ILE G  1 14 ? 25.910  20.146  23.904  0.50 8.94   ? 14  ILE G CG2 1 
ATOM   1990 C CG2 B ILE G  1 14 ? 26.008  21.040  26.082  0.50 35.37  ? 14  ILE G CG2 1 
ATOM   1991 C CD1 A ILE G  1 14 ? 27.548  21.629  26.113  0.50 49.35  ? 14  ILE G CD1 1 
ATOM   1992 C CD1 B ILE G  1 14 ? 28.409  20.096  24.482  0.50 35.66  ? 14  ILE G CD1 1 
ATOM   1993 N N   . CYS G  1 15 ? 23.224  19.980  27.091  1.00 15.40  ? 15  CYS G N   1 
ATOM   1994 C CA  . CYS G  1 15 ? 22.017  20.778  27.275  1.00 15.88  ? 15  CYS G CA  1 
ATOM   1995 C C   . CYS G  1 15 ? 22.310  22.285  27.212  1.00 23.58  ? 15  CYS G C   1 
ATOM   1996 O O   . CYS G  1 15 ? 23.213  22.759  27.922  1.00 21.79  ? 15  CYS G O   1 
ATOM   1997 C CB  . CYS G  1 15 ? 21.330  20.507  28.624  1.00 19.75  ? 15  CYS G CB  1 
ATOM   1998 S SG  . CYS G  1 15 ? 20.574  18.860  28.755  1.00 20.18  ? 15  CYS G SG  1 
ATOM   1999 N N   . HIS G  1 16 ? 21.547  23.013  26.421  1.00 24.72  ? 16  HIS G N   1 
ATOM   2000 C CA  . HIS G  1 16 ? 21.615  24.479  26.378  1.00 23.49  ? 16  HIS G CA  1 
ATOM   2001 C C   . HIS G  1 16 ? 20.327  25.107  26.871  1.00 23.07  ? 16  HIS G C   1 
ATOM   2002 O O   . HIS G  1 16 ? 19.214  24.620  26.717  1.00 16.82  ? 16  HIS G O   1 
ATOM   2003 C CB  . HIS G  1 16 ? 21.930  24.976  24.957  1.00 22.20  ? 16  HIS G CB  1 
ATOM   2004 C CG  . HIS G  1 16 ? 23.376  24.773  24.631  1.00 25.04  ? 16  HIS G CG  1 
ATOM   2005 N ND1 . HIS G  1 16 ? 24.298  25.799  24.617  1.00 29.10  ? 16  HIS G ND1 1 
ATOM   2006 C CD2 . HIS G  1 16 ? 24.059  23.641  24.312  1.00 25.12  ? 16  HIS G CD2 1 
ATOM   2007 C CE1 . HIS G  1 16 ? 25.488  25.314  24.301  1.00 23.05  ? 16  HIS G CE1 1 
ATOM   2008 N NE2 . HIS G  1 16 ? 25.366  24.007  24.114  1.00 27.49  ? 16  HIS G NE2 1 
ATOM   2009 N N   . PRO G  1 17 ? 20.448  26.254  27.536  1.00 23.20  ? 17  PRO G N   1 
ATOM   2010 C CA  . PRO G  1 17 ? 19.291  26.911  28.128  1.00 28.89  ? 17  PRO G CA  1 
ATOM   2011 C C   . PRO G  1 17 ? 18.308  27.493  27.128  1.00 27.33  ? 17  PRO G C   1 
ATOM   2012 O O   . PRO G  1 17 ? 17.109  27.528  27.429  1.00 29.38  ? 17  PRO G O   1 
ATOM   2013 C CB  . PRO G  1 17 ? 19.948  28.058  28.923  1.00 33.18  ? 17  PRO G CB  1 
ATOM   2014 C CG  . PRO G  1 17 ? 21.223  28.324  28.188  1.00 31.84  ? 17  PRO G CG  1 
ATOM   2015 C CD  . PRO G  1 17 ? 21.716  26.964  27.768  1.00 23.14  ? 17  PRO G CD  1 
ATOM   2016 N N   . VAL G  1 18 ? 18.734  27.965  25.956  1.00 23.48  ? 18  VAL G N   1 
ATOM   2017 C CA  . VAL G  1 18 ? 17.782  28.649  25.077  1.00 27.38  ? 18  VAL G CA  1 
ATOM   2018 C C   . VAL G  1 18 ? 17.936  28.222  23.620  1.00 17.48  ? 18  VAL G C   1 
ATOM   2019 O O   . VAL G  1 18 ? 16.930  27.934  22.955  1.00 23.74  ? 18  VAL G O   1 
ATOM   2020 C CB  . VAL G  1 18 ? 17.948  30.187  25.171  1.00 36.29  ? 18  VAL G CB  1 
ATOM   2021 C CG1 . VAL G  1 18 ? 16.993  30.912  24.235  1.00 33.84  ? 18  VAL G CG1 1 
ATOM   2022 C CG2 . VAL G  1 18 ? 17.732  30.690  26.589  1.00 41.49  ? 18  VAL G CG2 1 
ATOM   2023 N N   . PHE G  1 19 ? 19.160  28.200  23.135  1.00 21.24  ? 19  PHE G N   1 
ATOM   2024 C CA  . PHE G  1 19 ? 19.500  27.837  21.766  1.00 30.11  ? 19  PHE G CA  1 
ATOM   2025 C C   . PHE G  1 19 ? 20.681  26.875  21.661  1.00 20.73  ? 19  PHE G C   1 
ATOM   2026 O O   . PHE G  1 19 ? 21.673  26.984  22.384  1.00 22.36  ? 19  PHE G O   1 
ATOM   2027 C CB  . PHE G  1 19 ? 19.892  29.074  20.950  1.00 26.95  ? 19  PHE G CB  1 
ATOM   2028 C CG  . PHE G  1 19 ? 18.789  30.065  20.621  1.00 22.82  ? 19  PHE G CG  1 
ATOM   2029 C CD1 . PHE G  1 19 ? 18.858  31.352  21.129  1.00 25.67  ? 19  PHE G CD1 1 
ATOM   2030 C CD2 . PHE G  1 19 ? 17.723  29.714  19.817  1.00 27.35  ? 19  PHE G CD2 1 
ATOM   2031 C CE1 . PHE G  1 19 ? 17.867  32.274  20.827  1.00 20.91  ? 19  PHE G CE1 1 
ATOM   2032 C CE2 . PHE G  1 19 ? 16.725  30.625  19.518  1.00 26.56  ? 19  PHE G CE2 1 
ATOM   2033 C CZ  . PHE G  1 19 ? 16.805  31.901  20.032  1.00 25.77  ? 19  PHE G CZ  1 
ATOM   2034 N N   . CYS G  1 20 ? 20.626  25.927  20.725  1.00 20.32  ? 20  CYS G N   1 
ATOM   2035 C CA  . CYS G  1 20 ? 21.826  25.149  20.432  1.00 16.09  ? 20  CYS G CA  1 
ATOM   2036 C C   . CYS G  1 20 ? 22.841  26.043  19.718  1.00 20.67  ? 20  CYS G C   1 
ATOM   2037 O O   . CYS G  1 20 ? 22.414  26.920  18.977  1.00 19.06  ? 20  CYS G O   1 
ATOM   2038 C CB  . CYS G  1 20 ? 21.555  23.973  19.505  1.00 25.36  ? 20  CYS G CB  1 
ATOM   2039 S SG  . CYS G  1 20 ? 20.504  22.694  20.234  1.00 18.07  ? 20  CYS G SG  1 
ATOM   2040 N N   . PRO G  1 21 ? 24.118  25.802  19.942  1.00 20.96  ? 21  PRO G N   1 
ATOM   2041 C CA  . PRO G  1 21 ? 25.145  26.465  19.132  1.00 24.96  ? 21  PRO G CA  1 
ATOM   2042 C C   . PRO G  1 21 ? 24.910  26.183  17.650  1.00 25.26  ? 21  PRO G C   1 
ATOM   2043 O O   . PRO G  1 21 ? 24.512  25.073  17.280  1.00 22.42  ? 21  PRO G O   1 
ATOM   2044 C CB  . PRO G  1 21 ? 26.448  25.835  19.628  1.00 31.63  ? 21  PRO G CB  1 
ATOM   2045 C CG  . PRO G  1 21 ? 26.122  25.380  21.015  1.00 30.52  ? 21  PRO G CG  1 
ATOM   2046 C CD  . PRO G  1 21 ? 24.686  24.920  20.971  1.00 19.00  ? 21  PRO G CD  1 
ATOM   2047 N N   . ARG G  1 22 ? 25.161  27.208  16.837  1.00 33.00  ? 22  ARG G N   1 
ATOM   2048 C CA  . ARG G  1 22 ? 24.841  27.221  15.417  1.00 31.15  ? 22  ARG G CA  1 
ATOM   2049 C C   . ARG G  1 22 ? 25.226  25.919  14.718  1.00 32.48  ? 22  ARG G C   1 
ATOM   2050 O O   . ARG G  1 22 ? 24.430  25.409  13.929  1.00 33.82  ? 22  ARG G O   1 
ATOM   2051 C CB  . ARG G  1 22 ? 25.523  28.397  14.707  1.00 40.03  ? 22  ARG G CB  1 
ATOM   2052 C CG  . ARG G  1 22 ? 24.962  28.671  13.319  1.00 52.79  ? 22  ARG G CG  1 
ATOM   2053 C CD  . ARG G  1 22 ? 25.797  28.007  12.233  1.00 61.73  ? 22  ARG G CD  1 
ATOM   2054 N NE  . ARG G  1 22 ? 27.225  28.263  12.419  1.00 64.72  ? 22  ARG G NE  1 
ATOM   2055 C CZ  . ARG G  1 22 ? 27.864  29.261  11.826  1.00 64.82  ? 22  ARG G CZ  1 
ATOM   2056 N NH1 . ARG G  1 22 ? 27.199  30.070  11.003  1.00 73.54  ? 22  ARG G NH1 1 
ATOM   2057 N NH2 . ARG G  1 22 ? 29.160  29.450  12.026  1.00 53.15  ? 22  ARG G NH2 1 
ATOM   2058 N N   . ARG G  1 23 ? 26.409  25.398  15.020  1.00 30.97  ? 23  ARG G N   1 
ATOM   2059 C CA  . ARG G  1 23 ? 26.870  24.183  14.340  1.00 34.39  ? 23  ARG G CA  1 
ATOM   2060 C C   . ARG G  1 23 ? 26.447  22.899  15.025  1.00 35.68  ? 23  ARG G C   1 
ATOM   2061 O O   . ARG G  1 23 ? 26.686  21.785  14.542  1.00 29.75  ? 23  ARG G O   1 
ATOM   2062 C CB  . ARG G  1 23 ? 28.398  24.289  14.200  1.00 41.72  ? 23  ARG G CB  1 
ATOM   2063 C CG  . ARG G  1 23 ? 28.774  25.386  13.208  1.00 49.67  ? 23  ARG G CG  1 
ATOM   2064 C CD  . ARG G  1 23 ? 30.111  26.030  13.518  1.00 64.26  ? 23  ARG G CD  1 
ATOM   2065 N NE  . ARG G  1 23 ? 29.975  27.253  14.297  1.00 70.48  ? 23  ARG G NE  1 
ATOM   2066 C CZ  . ARG G  1 23 ? 30.869  28.232  14.396  1.00 66.19  ? 23  ARG G CZ  1 
ATOM   2067 N NH1 . ARG G  1 23 ? 32.019  28.154  13.758  1.00 47.45  ? 23  ARG G NH1 1 
ATOM   2068 N NH2 . ARG G  1 23 ? 30.545  29.263  15.166  1.00 69.61  ? 23  ARG G NH2 1 
ATOM   2069 N N   . TYR G  1 24 ? 25.784  22.980  16.177  1.00 31.00  ? 24  TYR G N   1 
ATOM   2070 C CA  . TYR G  1 24 ? 25.264  21.754  16.790  1.00 35.45  ? 24  TYR G CA  1 
ATOM   2071 C C   . TYR G  1 24 ? 23.898  21.408  16.208  1.00 30.62  ? 24  TYR G C   1 
ATOM   2072 O O   . TYR G  1 24 ? 23.270  22.254  15.571  1.00 23.70  ? 24  TYR G O   1 
ATOM   2073 C CB  . TYR G  1 24 ? 25.094  21.901  18.294  1.00 24.57  ? 24  TYR G CB  1 
ATOM   2074 C CG  . TYR G  1 24 ? 26.305  21.893  19.172  1.00 25.37  ? 24  TYR G CG  1 
ATOM   2075 C CD1 . TYR G  1 24 ? 27.411  22.696  18.929  1.00 33.23  ? 24  TYR G CD1 1 
ATOM   2076 C CD2 . TYR G  1 24 ? 26.343  21.068  20.293  1.00 31.19  ? 24  TYR G CD2 1 
ATOM   2077 C CE1 . TYR G  1 24 ? 28.517  22.671  19.762  1.00 33.94  ? 24  TYR G CE1 1 
ATOM   2078 C CE2 . TYR G  1 24 ? 27.440  21.039  21.126  1.00 31.63  ? 24  TYR G CE2 1 
ATOM   2079 C CZ  . TYR G  1 24 ? 28.527  21.841  20.859  1.00 35.75  ? 24  TYR G CZ  1 
ATOM   2080 O OH  . TYR G  1 24 ? 29.612  21.801  21.702  1.00 39.67  ? 24  TYR G OH  1 
ATOM   2081 N N   . LYS G  1 25 ? 23.410  20.187  16.430  1.00 30.64  ? 25  LYS G N   1 
ATOM   2082 C CA  . LYS G  1 25 ? 22.103  19.793  15.906  1.00 21.67  ? 25  LYS G CA  1 
ATOM   2083 C C   . LYS G  1 25 ? 21.110  19.513  17.031  1.00 15.83  ? 25  LYS G C   1 
ATOM   2084 O O   . LYS G  1 25 ? 21.424  18.731  17.935  1.00 16.59  ? 25  LYS G O   1 
ATOM   2085 C CB  . LYS G  1 25 ? 22.250  18.563  15.009  1.00 20.38  ? 25  LYS G CB  1 
ATOM   2086 C CG  . LYS G  1 25 ? 20.936  18.120  14.383  1.00 35.36  ? 25  LYS G CG  1 
ATOM   2087 C CD  . LYS G  1 25 ? 21.054  16.728  13.785  1.00 46.35  ? 25  LYS G CD  1 
ATOM   2088 C CE  . LYS G  1 25 ? 21.808  16.737  12.467  1.00 52.45  ? 25  LYS G CE  1 
ATOM   2089 N NZ  . LYS G  1 25 ? 22.991  15.827  12.499  1.00 64.90  ? 25  LYS G NZ  1 
ATOM   2090 N N   . GLN G  1 26 ? 19.949  20.151  16.991  1.00 17.68  ? 26  GLN G N   1 
ATOM   2091 C CA  . GLN G  1 26 ? 18.957  19.928  18.044  1.00 17.38  ? 26  GLN G CA  1 
ATOM   2092 C C   . GLN G  1 26 ? 18.358  18.536  17.957  1.00 23.63  ? 26  GLN G C   1 
ATOM   2093 O O   . GLN G  1 26 ? 17.925  18.076  16.900  1.00 20.24  ? 26  GLN G O   1 
ATOM   2094 C CB  . GLN G  1 26 ? 17.840  20.982  17.978  1.00 15.84  ? 26  GLN G CB  1 
ATOM   2095 C CG  . GLN G  1 26 ? 16.846  20.774  19.121  1.00 22.05  ? 26  GLN G CG  1 
ATOM   2096 C CD  . GLN G  1 26 ? 15.811  21.872  19.207  1.00 28.40  ? 26  GLN G CD  1 
ATOM   2097 O OE1 . GLN G  1 26 ? 15.932  22.908  18.546  1.00 29.74  ? 26  GLN G OE1 1 
ATOM   2098 N NE2 . GLN G  1 26 ? 14.788  21.647  20.020  1.00 22.75  ? 26  GLN G NE2 1 
ATOM   2099 N N   . ILE G  1 27 ? 18.311  17.814  19.079  1.00 19.34  ? 27  ILE G N   1 
ATOM   2100 C CA  . ILE G  1 27 ? 17.739  16.466  19.012  1.00 14.39  ? 27  ILE G CA  1 
ATOM   2101 C C   . ILE G  1 27 ? 16.630  16.326  20.046  1.00 17.69  ? 27  ILE G C   1 
ATOM   2102 O O   . ILE G  1 27 ? 16.084  15.258  20.291  1.00 23.75  ? 27  ILE G O   1 
ATOM   2103 C CB  . ILE G  1 27 ? 18.777  15.357  19.212  1.00 16.06  ? 27  ILE G CB  1 
ATOM   2104 C CG1 . ILE G  1 27 ? 19.542  15.445  20.531  1.00 16.35  ? 27  ILE G CG1 1 
ATOM   2105 C CG2 . ILE G  1 27 ? 19.733  15.337  18.019  1.00 22.20  ? 27  ILE G CG2 1 
ATOM   2106 C CD1 . ILE G  1 27 ? 20.331  14.196  20.878  1.00 22.81  ? 27  ILE G CD1 1 
ATOM   2107 N N   . GLY G  1 28 ? 16.299  17.465  20.649  1.00 17.82  ? 28  GLY G N   1 
ATOM   2108 C CA  . GLY G  1 28 ? 15.207  17.408  21.632  1.00 19.76  ? 28  GLY G CA  1 
ATOM   2109 C C   . GLY G  1 28 ? 15.330  18.582  22.599  1.00 16.80  ? 28  GLY G C   1 
ATOM   2110 O O   . GLY G  1 28 ? 15.950  19.576  22.236  1.00 17.89  ? 28  GLY G O   1 
ATOM   2111 N N   . THR G  1 29 ? 14.734  18.448  23.778  1.00 16.80  ? 29  THR G N   1 
ATOM   2112 C CA  . THR G  1 29 ? 14.833  19.476  24.812  1.00 16.14  ? 29  THR G CA  1 
ATOM   2113 C C   . THR G  1 29 ? 15.526  18.893  26.036  1.00 18.41  ? 29  THR G C   1 
ATOM   2114 O O   . THR G  1 29 ? 15.852  17.702  26.043  1.00 14.21  ? 29  THR G O   1 
ATOM   2115 C CB  . THR G  1 29 ? 13.457  20.022  25.225  1.00 21.82  ? 29  THR G CB  1 
ATOM   2116 O OG1 . THR G  1 29 ? 12.739  18.983  25.913  1.00 17.46  ? 29  THR G OG1 1 
ATOM   2117 C CG2 . THR G  1 29 ? 12.596  20.392  24.030  1.00 17.57  ? 29  THR G CG2 1 
ATOM   2118 N N   . CYS G  1 30 ? 15.735  19.718  27.058  1.00 13.77  ? 30  CYS G N   1 
ATOM   2119 C CA  . CYS G  1 30 ? 16.288  19.185  28.308  1.00 14.44  ? 30  CYS G CA  1 
ATOM   2120 C C   . CYS G  1 30 ? 15.368  19.441  29.486  1.00 18.65  ? 30  CYS G C   1 
ATOM   2121 O O   . CYS G  1 30 ? 15.785  19.766  30.594  1.00 30.41  ? 30  CYS G O   1 
ATOM   2122 C CB  . CYS G  1 30 ? 17.683  19.770  28.523  1.00 16.50  ? 30  CYS G CB  1 
ATOM   2123 S SG  . CYS G  1 30 ? 18.947  18.925  27.548  1.00 16.61  ? 30  CYS G SG  1 
ATOM   2124 N N   . GLY G  1 31 ? 14.076  19.274  29.242  1.00 14.97  ? 31  GLY G N   1 
ATOM   2125 C CA  . GLY G  1 31 ? 13.156  19.323  30.375  1.00 26.53  ? 31  GLY G CA  1 
ATOM   2126 C C   . GLY G  1 31 ? 12.353  20.605  30.407  1.00 12.43  ? 31  GLY G C   1 
ATOM   2127 O O   . GLY G  1 31 ? 11.270  20.659  29.832  1.00 16.73  ? 31  GLY G O   1 
ATOM   2128 N N   . LEU G  1 32 ? 12.879  21.590  31.128  1.00 14.56  ? 32  LEU G N   1 
ATOM   2129 C CA  . LEU G  1 32 ? 12.121  22.830  31.262  1.00 15.69  ? 32  LEU G CA  1 
ATOM   2130 C C   . LEU G  1 32 ? 11.913  23.493  29.891  1.00 14.18  ? 32  LEU G C   1 
ATOM   2131 O O   . LEU G  1 32 ? 12.743  23.348  28.999  1.00 19.36  ? 32  LEU G O   1 
ATOM   2132 C CB  . LEU G  1 32 ? 12.805  23.804  32.219  1.00 22.26  ? 32  LEU G CB  1 
ATOM   2133 C CG  . LEU G  1 32 ? 12.632  23.529  33.715  1.00 19.19  ? 32  LEU G CG  1 
ATOM   2134 C CD1 . LEU G  1 32 ? 13.434  24.513  34.550  1.00 21.79  ? 32  LEU G CD1 1 
ATOM   2135 C CD2 . LEU G  1 32 ? 11.163  23.594  34.110  1.00 15.64  ? 32  LEU G CD2 1 
ATOM   2136 N N   . PRO G  1 33 ? 10.797  24.208  29.778  1.00 19.85  ? 33  PRO G N   1 
ATOM   2137 C CA  . PRO G  1 33 ? 10.491  24.996  28.581  1.00 29.49  ? 33  PRO G CA  1 
ATOM   2138 C C   . PRO G  1 33 ? 11.701  25.779  28.086  1.00 22.21  ? 33  PRO G C   1 
ATOM   2139 O O   . PRO G  1 33 ? 12.420  26.400  28.872  1.00 15.94  ? 33  PRO G O   1 
ATOM   2140 C CB  . PRO G  1 33 ? 9.436   25.986  29.088  1.00 30.61  ? 33  PRO G CB  1 
ATOM   2141 C CG  . PRO G  1 33 ? 8.716   25.211  30.144  1.00 32.00  ? 33  PRO G CG  1 
ATOM   2142 C CD  . PRO G  1 33 ? 9.743   24.336  30.787  1.00 23.32  ? 33  PRO G CD  1 
ATOM   2143 N N   . GLY G  1 34 ? 11.935  25.739  26.771  1.00 24.27  ? 34  GLY G N   1 
ATOM   2144 C CA  . GLY G  1 34 ? 13.021  26.522  26.212  1.00 17.38  ? 34  GLY G CA  1 
ATOM   2145 C C   . GLY G  1 34 ? 14.374  25.884  26.148  1.00 20.27  ? 34  GLY G C   1 
ATOM   2146 O O   . GLY G  1 34 ? 15.249  26.330  25.398  1.00 20.91  ? 34  GLY G O   1 
ATOM   2147 N N   . THR G  1 35 ? 14.641  24.838  26.919  1.00 20.45  ? 35  THR G N   1 
ATOM   2148 C CA  . THR G  1 35 ? 15.949  24.187  26.928  1.00 13.24  ? 35  THR G CA  1 
ATOM   2149 C C   . THR G  1 35 ? 16.117  23.299  25.692  1.00 9.25   ? 35  THR G C   1 
ATOM   2150 O O   . THR G  1 35 ? 15.170  22.821  25.100  1.00 16.57  ? 35  THR G O   1 
ATOM   2151 C CB  . THR G  1 35 ? 16.163  23.332  28.191  1.00 15.47  ? 35  THR G CB  1 
ATOM   2152 O OG1 . THR G  1 35 ? 15.143  22.310  28.241  1.00 14.13  ? 35  THR G OG1 1 
ATOM   2153 C CG2 . THR G  1 35 ? 16.018  24.178  29.445  1.00 14.09  ? 35  THR G CG2 1 
ATOM   2154 N N   . LYS G  1 36 ? 17.369  23.102  25.294  1.00 14.94  ? 36  LYS G N   1 
ATOM   2155 C CA  . LYS G  1 36 ? 17.626  22.332  24.083  1.00 14.28  ? 36  LYS G CA  1 
ATOM   2156 C C   . LYS G  1 36 ? 18.653  21.234  24.336  1.00 16.18  ? 36  LYS G C   1 
ATOM   2157 O O   . LYS G  1 36 ? 19.645  21.407  25.060  1.00 15.17  ? 36  LYS G O   1 
ATOM   2158 C CB  . LYS G  1 36 ? 18.121  23.274  22.980  1.00 20.64  ? 36  LYS G CB  1 
ATOM   2159 C CG  . LYS G  1 36 ? 17.268  24.502  22.741  1.00 19.58  ? 36  LYS G CG  1 
ATOM   2160 C CD  . LYS G  1 36 ? 16.120  24.224  21.793  1.00 23.39  ? 36  LYS G CD  1 
ATOM   2161 C CE  . LYS G  1 36 ? 15.510  25.531  21.274  1.00 22.43  ? 36  LYS G CE  1 
ATOM   2162 N NZ  . LYS G  1 36 ? 14.856  26.265  22.398  1.00 29.26  ? 36  LYS G NZ  1 
ATOM   2163 N N   . CYS G  1 37 ? 18.403  20.078  23.727  1.00 14.02  ? 37  CYS G N   1 
ATOM   2164 C CA  . CYS G  1 37 ? 19.372  18.999  23.722  1.00 10.11  ? 37  CYS G CA  1 
ATOM   2165 C C   . CYS G  1 37 ? 20.114  19.035  22.382  1.00 9.87   ? 37  CYS G C   1 
ATOM   2166 O O   . CYS G  1 37 ? 19.443  18.850  21.368  1.00 13.40  ? 37  CYS G O   1 
ATOM   2167 C CB  . CYS G  1 37 ? 18.702  17.648  23.957  1.00 13.59  ? 37  CYS G CB  1 
ATOM   2168 S SG  . CYS G  1 37 ? 19.912  16.296  24.003  1.00 13.71  ? 37  CYS G SG  1 
ATOM   2169 N N   . CYS G  1 38 ? 21.398  19.320  22.422  1.00 15.55  ? 38  CYS G N   1 
ATOM   2170 C CA  . CYS G  1 38 ? 22.212  19.598  21.240  1.00 15.41  ? 38  CYS G CA  1 
ATOM   2171 C C   . CYS G  1 38 ? 23.375  18.658  21.073  1.00 14.93  ? 38  CYS G C   1 
ATOM   2172 O O   . CYS G  1 38 ? 24.146  18.373  21.996  1.00 17.70  ? 38  CYS G O   1 
ATOM   2173 C CB  . CYS G  1 38 ? 22.771  21.027  21.388  1.00 17.94  ? 38  CYS G CB  1 
ATOM   2174 S SG  . CYS G  1 38 ? 21.490  22.166  21.922  1.00 17.33  ? 38  CYS G SG  1 
ATOM   2175 N N   . LYS G  1 39 ? 23.577  18.136  19.862  1.00 17.37  ? 39  LYS G N   1 
ATOM   2176 C CA  . LYS G  1 39 ? 24.733  17.239  19.768  1.00 19.15  ? 39  LYS G CA  1 
ATOM   2177 C C   . LYS G  1 39 ? 25.807  17.900  18.913  1.00 19.23  ? 39  LYS G C   1 
ATOM   2178 O O   . LYS G  1 39 ? 25.474  18.540  17.916  1.00 25.30  ? 39  LYS G O   1 
ATOM   2179 C CB  . LYS G  1 39 ? 24.339  15.878  19.227  1.00 25.48  ? 39  LYS G CB  1 
ATOM   2180 C CG  . LYS G  1 39 ? 23.634  15.878  17.888  1.00 27.78  ? 39  LYS G CG  1 
ATOM   2181 C CD  . LYS G  1 39 ? 23.581  14.457  17.316  1.00 23.17  ? 39  LYS G CD  1 
ATOM   2182 C CE  . LYS G  1 39 ? 22.871  14.475  15.975  1.00 28.34  ? 39  LYS G CE  1 
ATOM   2183 N NZ  . LYS G  1 39 ? 23.157  13.254  15.169  1.00 37.27  ? 39  LYS G NZ  1 
ATOM   2184 N N   . LYS G  1 40 ? 27.051  17.760  19.325  1.00 24.59  ? 40  LYS G N   1 
ATOM   2185 C CA  . LYS G  1 40 ? 28.151  18.406  18.602  1.00 31.97  ? 40  LYS G CA  1 
ATOM   2186 C C   . LYS G  1 40 ? 28.159  18.037  17.122  1.00 34.54  ? 40  LYS G C   1 
ATOM   2187 O O   . LYS G  1 40 ? 27.562  17.039  16.713  1.00 32.67  ? 40  LYS G O   1 
ATOM   2188 C CB  . LYS G  1 40 ? 29.482  18.033  19.256  1.00 34.20  ? 40  LYS G CB  1 
ATOM   2189 C CG  . LYS G  1 40 ? 29.707  18.695  20.613  1.00 39.41  ? 40  LYS G CG  1 
ATOM   2190 C CD  . LYS G  1 40 ? 30.684  17.854  21.420  1.00 50.08  ? 40  LYS G CD  1 
ATOM   2191 C CE  . LYS G  1 40 ? 30.882  18.385  22.834  1.00 57.74  ? 40  LYS G CE  1 
ATOM   2192 N NZ  . LYS G  1 40 ? 32.100  17.791  23.460  1.00 54.11  ? 40  LYS G NZ  1 
ATOM   2193 N N   . PRO G  1 41 ? 28.850  18.851  16.332  1.00 37.57  ? 41  PRO G N   1 
ATOM   2194 C CA  . PRO G  1 41 ? 29.037  18.551  14.909  1.00 48.58  ? 41  PRO G CA  1 
ATOM   2195 C C   . PRO G  1 41 ? 30.246  17.651  14.688  1.00 59.11  ? 41  PRO G C   1 
ATOM   2196 O O   . PRO G  1 41 ? 31.004  17.881  13.733  1.00 94.79  ? 41  PRO G O   1 
ATOM   2197 C CB  . PRO G  1 41 ? 29.309  19.935  14.316  1.00 40.31  ? 41  PRO G CB  1 
ATOM   2198 C CG  . PRO G  1 41 ? 30.039  20.652  15.407  1.00 35.35  ? 41  PRO G CG  1 
ATOM   2199 C CD  . PRO G  1 41 ? 29.513  20.114  16.705  1.00 32.62  ? 41  PRO G CD  1 
ATOM   2200 O OXT . PRO G  1 41 ? 30.441  16.722  15.494  1.00 58.81  ? 41  PRO G OXT 1 
ATOM   2201 N N   . GLY H  1 1  ? 24.656  26.078  45.387  1.00 67.46  ? 1   GLY H N   1 
ATOM   2202 C CA  . GLY H  1 1  ? 25.447  25.865  44.188  1.00 71.71  ? 1   GLY H CA  1 
ATOM   2203 C C   . GLY H  1 1  ? 24.647  25.241  43.056  1.00 68.34  ? 1   GLY H C   1 
ATOM   2204 O O   . GLY H  1 1  ? 23.475  25.572  42.872  1.00 81.76  ? 1   GLY H O   1 
ATOM   2205 N N   . ILE H  1 2  ? 25.274  24.347  42.293  1.00 63.15  ? 2   ILE H N   1 
ATOM   2206 C CA  . ILE H  1 2  ? 24.631  23.596  41.226  1.00 55.47  ? 2   ILE H CA  1 
ATOM   2207 C C   . ILE H  1 2  ? 25.180  22.168  41.153  1.00 56.70  ? 2   ILE H C   1 
ATOM   2208 O O   . ILE H  1 2  ? 26.378  21.959  40.981  1.00 49.65  ? 2   ILE H O   1 
ATOM   2209 C CB  . ILE H  1 2  ? 24.789  24.226  39.829  1.00 49.25  ? 2   ILE H CB  1 
ATOM   2210 C CG1 . ILE H  1 2  ? 24.789  25.752  39.801  1.00 56.21  ? 2   ILE H CG1 1 
ATOM   2211 C CG2 . ILE H  1 2  ? 23.709  23.674  38.895  1.00 28.70  ? 2   ILE H CG2 1 
ATOM   2212 C CD1 . ILE H  1 2  ? 23.482  26.397  40.212  1.00 61.51  ? 2   ILE H CD1 1 
ATOM   2213 N N   . GLY H  1 3  ? 24.272  21.207  41.274  1.00 62.13  ? 3   GLY H N   1 
ATOM   2214 C CA  . GLY H  1 3  ? 24.583  19.793  41.163  1.00 61.61  ? 3   GLY H CA  1 
ATOM   2215 C C   . GLY H  1 3  ? 23.476  19.043  40.432  1.00 65.83  ? 3   GLY H C   1 
ATOM   2216 O O   . GLY H  1 3  ? 23.474  17.812  40.404  1.00 57.55  ? 3   GLY H O   1 
ATOM   2217 N N   . ASP H  1 4  ? 22.553  19.804  39.854  1.00 58.29  ? 4   ASP H N   1 
ATOM   2218 C CA  . ASP H  1 4  ? 21.434  19.302  39.072  1.00 40.26  ? 4   ASP H CA  1 
ATOM   2219 C C   . ASP H  1 4  ? 21.294  20.137  37.798  1.00 29.11  ? 4   ASP H C   1 
ATOM   2220 O O   . ASP H  1 4  ? 21.459  21.355  37.825  1.00 26.95  ? 4   ASP H O   1 
ATOM   2221 C CB  . ASP H  1 4  ? 20.135  19.293  39.882  1.00 24.42  ? 4   ASP H CB  1 
ATOM   2222 C CG  . ASP H  1 4  ? 19.305  20.545  39.763  1.00 25.19  ? 4   ASP H CG  1 
ATOM   2223 O OD1 . ASP H  1 4  ? 19.349  21.401  40.675  1.00 39.03  ? 4   ASP H OD1 1 
ATOM   2224 O OD2 . ASP H  1 4  ? 18.588  20.706  38.748  1.00 25.39  ? 4   ASP H OD2 1 
ATOM   2225 N N   . PRO H  1 5  ? 20.993  19.479  36.684  1.00 32.16  ? 5   PRO H N   1 
ATOM   2226 C CA  . PRO H  1 5  ? 20.962  20.170  35.398  1.00 23.51  ? 5   PRO H CA  1 
ATOM   2227 C C   . PRO H  1 5  ? 19.840  21.198  35.278  1.00 15.28  ? 5   PRO H C   1 
ATOM   2228 O O   . PRO H  1 5  ? 19.987  22.144  34.489  1.00 22.86  ? 5   PRO H O   1 
ATOM   2229 C CB  . PRO H  1 5  ? 20.724  19.045  34.390  1.00 25.70  ? 5   PRO H CB  1 
ATOM   2230 C CG  . PRO H  1 5  ? 20.227  17.881  35.166  1.00 34.45  ? 5   PRO H CG  1 
ATOM   2231 C CD  . PRO H  1 5  ? 20.678  18.048  36.586  1.00 28.93  ? 5   PRO H CD  1 
ATOM   2232 N N   . VAL H  1 6  ? 18.738  21.032  36.004  1.00 16.31  ? 6   VAL H N   1 
ATOM   2233 C CA  . VAL H  1 6  ? 17.586  21.923  35.869  1.00 15.29  ? 6   VAL H CA  1 
ATOM   2234 C C   . VAL H  1 6  ? 17.862  23.313  36.435  1.00 27.20  ? 6   VAL H C   1 
ATOM   2235 O O   . VAL H  1 6  ? 17.578  24.336  35.786  1.00 24.10  ? 6   VAL H O   1 
ATOM   2236 C CB  . VAL H  1 6  ? 16.342  21.297  36.519  1.00 21.96  ? 6   VAL H CB  1 
ATOM   2237 C CG1 . VAL H  1 6  ? 15.201  22.296  36.595  1.00 22.55  ? 6   VAL H CG1 1 
ATOM   2238 C CG2 . VAL H  1 6  ? 15.922  20.058  35.734  1.00 18.09  ? 6   VAL H CG2 1 
ATOM   2239 N N   . THR H  1 7  ? 18.427  23.380  37.636  1.00 33.45  ? 7   THR H N   1 
ATOM   2240 C CA  . THR H  1 7  ? 18.799  24.667  38.209  1.00 38.71  ? 7   THR H CA  1 
ATOM   2241 C C   . THR H  1 7  ? 19.877  25.341  37.347  1.00 35.92  ? 7   THR H C   1 
ATOM   2242 O O   . THR H  1 7  ? 19.715  26.531  37.066  1.00 37.84  ? 7   THR H O   1 
ATOM   2243 C CB  . THR H  1 7  ? 19.305  24.573  39.655  1.00 43.11  ? 7   THR H CB  1 
ATOM   2244 O OG1 . THR H  1 7  ? 18.446  23.751  40.456  1.00 38.41  ? 7   THR H OG1 1 
ATOM   2245 C CG2 . THR H  1 7  ? 19.269  25.960  40.298  1.00 39.02  ? 7   THR H CG2 1 
ATOM   2246 N N   . CYS H  1 8  ? 20.897  24.600  36.966  1.00 30.99  ? 8   CYS H N   1 
ATOM   2247 C CA  . CYS H  1 8  ? 21.966  25.020  36.054  1.00 39.70  ? 8   CYS H CA  1 
ATOM   2248 C C   . CYS H  1 8  ? 21.379  25.714  34.828  1.00 46.63  ? 8   CYS H C   1 
ATOM   2249 O O   . CYS H  1 8  ? 21.881  26.774  34.449  1.00 39.90  ? 8   CYS H O   1 
ATOM   2250 C CB  . CYS H  1 8  ? 22.846  23.837  35.662  1.00 40.04  ? 8   CYS H CB  1 
ATOM   2251 S SG  . CYS H  1 8  ? 24.190  24.027  34.480  1.00 45.33  ? 8   CYS H SG  1 
ATOM   2252 N N   . LEU H  1 9  ? 20.334  25.162  34.212  1.00 43.84  ? 9   LEU H N   1 
ATOM   2253 C CA  . LEU H  1 9  ? 19.729  25.745  33.019  1.00 34.87  ? 9   LEU H CA  1 
ATOM   2254 C C   . LEU H  1 9  ? 18.729  26.844  33.350  1.00 40.39  ? 9   LEU H C   1 
ATOM   2255 O O   . LEU H  1 9  ? 18.579  27.810  32.594  1.00 40.69  ? 9   LEU H O   1 
ATOM   2256 C CB  . LEU H  1 9  ? 19.036  24.662  32.178  1.00 26.03  ? 9   LEU H CB  1 
ATOM   2257 C CG  . LEU H  1 9  ? 19.901  23.500  31.696  1.00 23.84  ? 9   LEU H CG  1 
ATOM   2258 C CD1 . LEU H  1 9  ? 19.061  22.286  31.306  1.00 17.86  ? 9   LEU H CD1 1 
ATOM   2259 C CD2 . LEU H  1 9  ? 20.769  23.907  30.505  1.00 22.79  ? 9   LEU H CD2 1 
ATOM   2260 N N   . LYS H  1 10 ? 18.005  26.744  34.467  1.00 39.31  ? 10  LYS H N   1 
ATOM   2261 C CA  . LYS H  1 10 ? 17.044  27.804  34.780  1.00 39.14  ? 10  LYS H CA  1 
ATOM   2262 C C   . LYS H  1 10 ? 17.762  29.132  35.015  1.00 41.21  ? 10  LYS H C   1 
ATOM   2263 O O   . LYS H  1 10 ? 17.168  30.205  34.895  1.00 47.84  ? 10  LYS H O   1 
ATOM   2264 C CB  . LYS H  1 10 ? 16.197  27.443  35.997  1.00 33.99  ? 10  LYS H CB  1 
ATOM   2265 C CG  . LYS H  1 10 ? 15.166  28.500  36.370  1.00 41.84  ? 10  LYS H CG  1 
ATOM   2266 C CD  . LYS H  1 10 ? 13.819  28.150  35.755  1.00 53.57  ? 10  LYS H CD  1 
ATOM   2267 C CE  . LYS H  1 10 ? 12.865  29.329  35.737  1.00 58.48  ? 10  LYS H CE  1 
ATOM   2268 N NZ  . LYS H  1 10 ? 12.335  29.652  37.087  1.00 61.92  ? 10  LYS H NZ  1 
ATOM   2269 N N   . SER H  1 11 ? 19.043  29.057  35.346  1.00 28.76  ? 11  SER H N   1 
ATOM   2270 C CA  . SER H  1 11 ? 19.867  30.223  35.649  1.00 39.25  ? 11  SER H CA  1 
ATOM   2271 C C   . SER H  1 11 ? 20.553  30.748  34.396  1.00 46.48  ? 11  SER H C   1 
ATOM   2272 O O   . SER H  1 11 ? 20.736  31.956  34.249  1.00 40.11  ? 11  SER H O   1 
ATOM   2273 C CB  . SER H  1 11 ? 20.893  29.870  36.729  1.00 43.00  ? 11  SER H CB  1 
ATOM   2274 O OG  . SER H  1 11 ? 22.061  29.275  36.192  1.00 51.94  ? 11  SER H OG  1 
ATOM   2275 N N   . GLY H  1 12 ? 20.931  29.847  33.488  1.00 45.53  ? 12  GLY H N   1 
ATOM   2276 C CA  . GLY H  1 12 ? 21.485  30.255  32.212  1.00 39.27  ? 12  GLY H CA  1 
ATOM   2277 C C   . GLY H  1 12 ? 22.830  29.665  31.862  1.00 32.10  ? 12  GLY H C   1 
ATOM   2278 O O   . GLY H  1 12 ? 23.463  30.135  30.910  1.00 41.68  ? 12  GLY H O   1 
ATOM   2279 N N   . ALA H  1 13 ? 23.297  28.654  32.577  1.00 29.87  ? 13  ALA H N   1 
ATOM   2280 C CA  . ALA H  1 13 ? 24.504  27.918  32.224  1.00 30.76  ? 13  ALA H CA  1 
ATOM   2281 C C   . ALA H  1 13 ? 24.125  26.707  31.368  1.00 36.46  ? 13  ALA H C   1 
ATOM   2282 O O   . ALA H  1 13 ? 22.944  26.608  31.008  1.00 28.94  ? 13  ALA H O   1 
ATOM   2283 C CB  . ALA H  1 13 ? 25.265  27.501  33.470  1.00 33.68  ? 13  ALA H CB  1 
ATOM   2284 N N   . ILE H  1 14 ? 25.065  25.825  31.062  1.00 35.47  ? 14  ILE H N   1 
ATOM   2285 C CA  . ILE H  1 14 ? 24.809  24.657  30.222  1.00 41.29  ? 14  ILE H CA  1 
ATOM   2286 C C   . ILE H  1 14 ? 25.296  23.356  30.846  1.00 41.41  ? 14  ILE H C   1 
ATOM   2287 O O   . ILE H  1 14 ? 26.140  23.383  31.744  1.00 35.92  ? 14  ILE H O   1 
ATOM   2288 C CB  . ILE H  1 14 ? 25.516  24.815  28.860  1.00 39.35  ? 14  ILE H CB  1 
ATOM   2289 C CG1 . ILE H  1 14 ? 27.037  24.660  28.936  1.00 36.53  ? 14  ILE H CG1 1 
ATOM   2290 C CG2 . ILE H  1 14 ? 25.136  26.136  28.218  1.00 36.75  ? 14  ILE H CG2 1 
ATOM   2291 C CD1 . ILE H  1 14 ? 27.694  24.577  27.572  1.00 52.27  ? 14  ILE H CD1 1 
ATOM   2292 N N   . CYS H  1 15 ? 24.794  22.216  30.375  1.00 37.72  ? 15  CYS H N   1 
ATOM   2293 C CA  . CYS H  1 15 ? 25.249  20.924  30.887  1.00 41.20  ? 15  CYS H CA  1 
ATOM   2294 C C   . CYS H  1 15 ? 26.001  20.116  29.832  1.00 40.79  ? 15  CYS H C   1 
ATOM   2295 O O   . CYS H  1 15 ? 25.497  19.855  28.737  1.00 34.43  ? 15  CYS H O   1 
ATOM   2296 C CB  . CYS H  1 15 ? 24.081  20.074  31.393  1.00 41.38  ? 15  CYS H CB  1 
ATOM   2297 S SG  . CYS H  1 15 ? 23.206  20.669  32.851  1.00 36.49  ? 15  CYS H SG  1 
ATOM   2298 N N   . HIS H  1 16 ? 27.217  19.697  30.155  1.00 43.30  ? 16  HIS H N   1 
ATOM   2299 C CA  . HIS H  1 16 ? 28.083  18.962  29.240  1.00 47.64  ? 16  HIS H CA  1 
ATOM   2300 C C   . HIS H  1 16 ? 28.285  17.525  29.712  1.00 51.93  ? 16  HIS H C   1 
ATOM   2301 O O   . HIS H  1 16 ? 28.413  17.265  30.908  1.00 60.09  ? 16  HIS H O   1 
ATOM   2302 C CB  . HIS H  1 16 ? 29.423  19.689  29.102  1.00 45.48  ? 16  HIS H CB  1 
ATOM   2303 C CG  . HIS H  1 16 ? 30.312  19.169  28.020  1.00 47.84  ? 16  HIS H CG  1 
ATOM   2304 N ND1 . HIS H  1 16 ? 30.936  17.941  28.094  1.00 50.51  ? 16  HIS H ND1 1 
ATOM   2305 C CD2 . HIS H  1 16 ? 30.686  19.709  26.837  1.00 43.64  ? 16  HIS H CD2 1 
ATOM   2306 C CE1 . HIS H  1 16 ? 31.657  17.742  27.003  1.00 52.34  ? 16  HIS H CE1 1 
ATOM   2307 N NE2 . HIS H  1 16 ? 31.523  18.804  26.223  1.00 52.25  ? 16  HIS H NE2 1 
ATOM   2308 N N   . PRO H  1 17 ? 28.297  16.600  28.760  1.00 53.77  ? 17  PRO H N   1 
ATOM   2309 C CA  . PRO H  1 17 ? 28.554  15.187  29.044  1.00 45.12  ? 17  PRO H CA  1 
ATOM   2310 C C   . PRO H  1 17 ? 29.749  14.996  29.964  1.00 49.20  ? 17  PRO H C   1 
ATOM   2311 O O   . PRO H  1 17 ? 29.646  14.267  30.955  1.00 65.75  ? 17  PRO H O   1 
ATOM   2312 C CB  . PRO H  1 17 ? 28.856  14.624  27.654  1.00 53.57  ? 17  PRO H CB  1 
ATOM   2313 C CG  . PRO H  1 17 ? 28.013  15.455  26.747  1.00 54.77  ? 17  PRO H CG  1 
ATOM   2314 C CD  . PRO H  1 17 ? 28.048  16.840  27.327  1.00 52.69  ? 17  PRO H CD  1 
ATOM   2315 N N   . VAL H  1 18 ? 30.890  15.625  29.681  1.00 55.23  ? 18  VAL H N   1 
ATOM   2316 C CA  . VAL H  1 18 ? 32.011  15.522  30.622  1.00 62.63  ? 18  VAL H CA  1 
ATOM   2317 C C   . VAL H  1 18 ? 32.681  16.881  30.839  1.00 67.69  ? 18  VAL H C   1 
ATOM   2318 O O   . VAL H  1 18 ? 32.140  17.742  31.533  1.00 72.54  ? 18  VAL H O   1 
ATOM   2319 C CB  . VAL H  1 18 ? 33.092  14.517  30.188  1.00 55.65  ? 18  VAL H CB  1 
ATOM   2320 C CG1 . VAL H  1 18 ? 34.082  14.279  31.323  1.00 32.10  ? 18  VAL H CG1 1 
ATOM   2321 C CG2 . VAL H  1 18 ? 32.494  13.188  29.757  1.00 59.06  ? 18  VAL H CG2 1 
ATOM   2322 N N   . PHE H  1 19 ? 33.855  17.047  30.240  1.00 71.36  ? 19  PHE H N   1 
ATOM   2323 C CA  . PHE H  1 19 ? 34.652  18.262  30.334  1.00 73.77  ? 19  PHE H CA  1 
ATOM   2324 C C   . PHE H  1 19 ? 33.906  19.434  29.719  1.00 70.31  ? 19  PHE H C   1 
ATOM   2325 O O   . PHE H  1 19 ? 32.934  19.237  28.994  1.00 60.28  ? 19  PHE H O   1 
ATOM   2326 C CB  . PHE H  1 19 ? 36.005  18.082  29.639  1.00 82.56  ? 19  PHE H CB  1 
ATOM   2327 C CG  . PHE H  1 19 ? 35.912  17.570  28.212  1.00 87.56  ? 19  PHE H CG  1 
ATOM   2328 C CD1 . PHE H  1 19 ? 35.704  18.445  27.153  1.00 84.75  ? 19  PHE H CD1 1 
ATOM   2329 C CD2 . PHE H  1 19 ? 36.037  16.217  27.939  1.00 90.41  ? 19  PHE H CD2 1 
ATOM   2330 C CE1 . PHE H  1 19 ? 35.620  17.980  25.857  1.00 83.60  ? 19  PHE H CE1 1 
ATOM   2331 C CE2 . PHE H  1 19 ? 35.955  15.743  26.642  1.00 87.82  ? 19  PHE H CE2 1 
ATOM   2332 C CZ  . PHE H  1 19 ? 35.741  16.628  25.599  1.00 85.69  ? 19  PHE H CZ  1 
ATOM   2333 N N   . CYS H  1 20 ? 34.342  20.660  29.987  1.00 71.59  ? 20  CYS H N   1 
ATOM   2334 C CA  . CYS H  1 20 ? 33.592  21.802  29.457  1.00 72.50  ? 20  CYS H CA  1 
ATOM   2335 C C   . CYS H  1 20 ? 34.102  22.217  28.086  1.00 77.92  ? 20  CYS H C   1 
ATOM   2336 O O   . CYS H  1 20 ? 35.221  21.865  27.699  1.00 66.33  ? 20  CYS H O   1 
ATOM   2337 C CB  . CYS H  1 20 ? 33.650  22.939  30.482  1.00 71.08  ? 20  CYS H CB  1 
ATOM   2338 S SG  . CYS H  1 20 ? 32.561  22.672  31.903  1.00 100.08 ? 20  CYS H SG  1 
ATOM   2339 N N   . PRO H  1 21 ? 33.288  22.951  27.330  1.00 83.45  ? 21  PRO H N   1 
ATOM   2340 C CA  . PRO H  1 21 ? 33.650  23.370  25.976  1.00 86.13  ? 21  PRO H CA  1 
ATOM   2341 C C   . PRO H  1 21 ? 34.946  24.174  25.889  1.00 90.17  ? 21  PRO H C   1 
ATOM   2342 O O   . PRO H  1 21 ? 36.013  23.681  26.248  1.00 98.49  ? 21  PRO H O   1 
ATOM   2343 C CB  . PRO H  1 21 ? 32.482  24.273  25.553  1.00 84.47  ? 21  PRO H CB  1 
ATOM   2344 C CG  . PRO H  1 21 ? 31.335  23.818  26.388  1.00 81.90  ? 21  PRO H CG  1 
ATOM   2345 C CD  . PRO H  1 21 ? 31.942  23.421  27.705  1.00 82.64  ? 21  PRO H CD  1 
ATOM   2346 N N   . ARG H  1 22 ? 34.818  25.395  25.386  1.00 91.38  ? 22  ARG H N   1 
ATOM   2347 C CA  . ARG H  1 22 ? 35.889  26.290  24.988  1.00 90.59  ? 22  ARG H CA  1 
ATOM   2348 C C   . ARG H  1 22 ? 36.238  27.331  26.045  1.00 89.54  ? 22  ARG H C   1 
ATOM   2349 O O   . ARG H  1 22 ? 37.057  27.095  26.933  1.00 72.74  ? 22  ARG H O   1 
ATOM   2350 C CB  . ARG H  1 22 ? 35.484  27.014  23.694  1.00 88.11  ? 22  ARG H CB  1 
ATOM   2351 C CG  . ARG H  1 22 ? 34.124  26.600  23.152  1.00 85.63  ? 22  ARG H CG  1 
ATOM   2352 C CD  . ARG H  1 22 ? 33.021  27.540  23.605  1.00 81.22  ? 22  ARG H CD  1 
ATOM   2353 N NE  . ARG H  1 22 ? 31.755  27.314  22.913  1.00 74.02  ? 22  ARG H NE  1 
ATOM   2354 C CZ  . ARG H  1 22 ? 30.768  28.199  22.828  1.00 66.18  ? 22  ARG H CZ  1 
ATOM   2355 N NH1 . ARG H  1 22 ? 30.884  29.395  23.395  1.00 58.91  ? 22  ARG H NH1 1 
ATOM   2356 N NH2 . ARG H  1 22 ? 29.652  27.897  22.174  1.00 41.36  ? 22  ARG H NH2 1 
ATOM   2357 N N   . ARG H  1 23 ? 35.601  28.490  25.911  1.00 92.02  ? 23  ARG H N   1 
ATOM   2358 C CA  . ARG H  1 23 ? 35.723  29.579  26.870  1.00 96.90  ? 23  ARG H CA  1 
ATOM   2359 C C   . ARG H  1 23 ? 34.696  29.370  27.981  1.00 90.62  ? 23  ARG H C   1 
ATOM   2360 O O   . ARG H  1 23 ? 33.907  30.246  28.322  1.00 90.15  ? 23  ARG H O   1 
ATOM   2361 C CB  . ARG H  1 23 ? 35.531  30.936  26.200  1.00 107.81 ? 23  ARG H CB  1 
ATOM   2362 C CG  . ARG H  1 23 ? 34.123  31.223  25.707  1.00 116.44 ? 23  ARG H CG  1 
ATOM   2363 C CD  . ARG H  1 23 ? 33.874  30.644  24.326  1.00 124.18 ? 23  ARG H CD  1 
ATOM   2364 N NE  . ARG H  1 23 ? 34.811  31.136  23.317  1.00 129.30 ? 23  ARG H NE  1 
ATOM   2365 C CZ  . ARG H  1 23 ? 35.044  30.564  22.142  1.00 130.73 ? 23  ARG H CZ  1 
ATOM   2366 N NH1 . ARG H  1 23 ? 34.411  29.451  21.791  1.00 131.93 ? 23  ARG H NH1 1 
ATOM   2367 N NH2 . ARG H  1 23 ? 35.919  31.101  21.300  1.00 129.47 ? 23  ARG H NH2 1 
ATOM   2368 N N   . TYR H  1 24 ? 34.729  28.157  28.525  1.00 81.60  ? 24  TYR H N   1 
ATOM   2369 C CA  . TYR H  1 24 ? 33.784  27.754  29.554  1.00 75.62  ? 24  TYR H CA  1 
ATOM   2370 C C   . TYR H  1 24 ? 34.475  27.225  30.797  1.00 62.12  ? 24  TYR H C   1 
ATOM   2371 O O   . TYR H  1 24 ? 35.413  26.434  30.729  1.00 50.58  ? 24  TYR H O   1 
ATOM   2372 C CB  . TYR H  1 24 ? 32.828  26.699  28.968  1.00 85.18  ? 24  TYR H CB  1 
ATOM   2373 C CG  . TYR H  1 24 ? 31.698  27.369  28.213  1.00 94.26  ? 24  TYR H CG  1 
ATOM   2374 C CD1 . TYR H  1 24 ? 31.918  27.928  26.962  1.00 99.17  ? 24  TYR H CD1 1 
ATOM   2375 C CD2 . TYR H  1 24 ? 30.423  27.444  28.756  1.00 98.74  ? 24  TYR H CD2 1 
ATOM   2376 C CE1 . TYR H  1 24 ? 30.890  28.542  26.271  1.00 103.75 ? 24  TYR H CE1 1 
ATOM   2377 C CE2 . TYR H  1 24 ? 29.393  28.057  28.069  1.00 104.87 ? 24  TYR H CE2 1 
ATOM   2378 C CZ  . TYR H  1 24 ? 29.633  28.606  26.826  1.00 105.40 ? 24  TYR H CZ  1 
ATOM   2379 O OH  . TYR H  1 24 ? 28.607  29.217  26.141  1.00 94.21  ? 24  TYR H OH  1 
ATOM   2380 N N   . LYS H  1 25 ? 34.008  27.670  31.963  1.00 61.08  ? 25  LYS H N   1 
ATOM   2381 C CA  . LYS H  1 25 ? 34.610  27.220  33.214  1.00 63.69  ? 25  LYS H CA  1 
ATOM   2382 C C   . LYS H  1 25 ? 33.610  26.456  34.078  1.00 60.76  ? 25  LYS H C   1 
ATOM   2383 O O   . LYS H  1 25 ? 32.522  26.950  34.380  1.00 43.86  ? 25  LYS H O   1 
ATOM   2384 C CB  . LYS H  1 25 ? 35.184  28.423  33.967  1.00 68.66  ? 25  LYS H CB  1 
ATOM   2385 C CG  . LYS H  1 25 ? 36.200  29.210  33.155  1.00 71.12  ? 25  LYS H CG  1 
ATOM   2386 C CD  . LYS H  1 25 ? 35.555  30.385  32.431  1.00 71.49  ? 25  LYS H CD  1 
ATOM   2387 C CE  . LYS H  1 25 ? 35.519  31.619  33.323  1.00 71.37  ? 25  LYS H CE  1 
ATOM   2388 N NZ  . LYS H  1 25 ? 34.393  31.541  34.311  1.00 78.81  ? 25  LYS H NZ  1 
ATOM   2389 N N   . GLN H  1 26 ? 34.000  25.247  34.467  1.00 58.48  ? 26  GLN H N   1 
ATOM   2390 C CA  . GLN H  1 26 ? 33.185  24.353  35.275  1.00 60.01  ? 26  GLN H CA  1 
ATOM   2391 C C   . GLN H  1 26 ? 32.827  24.992  36.613  1.00 60.04  ? 26  GLN H C   1 
ATOM   2392 O O   . GLN H  1 26 ? 33.715  25.251  37.425  1.00 56.84  ? 26  GLN H O   1 
ATOM   2393 C CB  . GLN H  1 26 ? 33.908  23.026  35.522  1.00 62.81  ? 26  GLN H CB  1 
ATOM   2394 C CG  . GLN H  1 26 ? 33.150  22.031  36.383  1.00 64.92  ? 26  GLN H CG  1 
ATOM   2395 C CD  . GLN H  1 26 ? 33.591  22.028  37.832  1.00 72.61  ? 26  GLN H CD  1 
ATOM   2396 O OE1 . GLN H  1 26 ? 34.784  22.069  38.134  1.00 89.14  ? 26  GLN H OE1 1 
ATOM   2397 N NE2 . GLN H  1 26 ? 32.624  21.982  38.745  1.00 76.90  ? 26  GLN H NE2 1 
ATOM   2398 N N   . ILE H  1 27 ? 31.538  25.219  36.823  1.00 63.78  ? 27  ILE H N   1 
ATOM   2399 C CA  . ILE H  1 27 ? 31.063  25.820  38.063  1.00 60.70  ? 27  ILE H CA  1 
ATOM   2400 C C   . ILE H  1 27 ? 30.474  24.772  39.006  1.00 60.75  ? 27  ILE H C   1 
ATOM   2401 O O   . ILE H  1 27 ? 30.508  24.962  40.224  1.00 66.94  ? 27  ILE H O   1 
ATOM   2402 C CB  . ILE H  1 27 ? 30.004  26.906  37.802  1.00 55.36  ? 27  ILE H CB  1 
ATOM   2403 C CG1 . ILE H  1 27 ? 28.674  26.395  37.238  1.00 52.52  ? 27  ILE H CG1 1 
ATOM   2404 C CG2 . ILE H  1 27 ? 30.580  27.990  36.897  1.00 73.08  ? 27  ILE H CG2 1 
ATOM   2405 C CD1 . ILE H  1 27 ? 27.767  27.523  36.777  1.00 42.09  ? 27  ILE H CD1 1 
ATOM   2406 N N   . GLY H  1 28 ? 29.955  23.689  38.435  1.00 56.25  ? 28  GLY H N   1 
ATOM   2407 C CA  . GLY H  1 28 ? 29.312  22.639  39.193  1.00 52.37  ? 28  GLY H CA  1 
ATOM   2408 C C   . GLY H  1 28 ? 29.081  21.364  38.412  1.00 53.26  ? 28  GLY H C   1 
ATOM   2409 O O   . GLY H  1 28 ? 29.897  20.946  37.591  1.00 45.58  ? 28  GLY H O   1 
ATOM   2410 N N   . THR H  1 29 ? 27.937  20.730  38.679  1.00 54.21  ? 29  THR H N   1 
ATOM   2411 C CA  . THR H  1 29 ? 27.570  19.511  37.977  1.00 53.16  ? 29  THR H CA  1 
ATOM   2412 C C   . THR H  1 29 ? 26.113  19.542  37.510  1.00 47.88  ? 29  THR H C   1 
ATOM   2413 O O   . THR H  1 29 ? 25.378  20.481  37.795  1.00 34.15  ? 29  THR H O   1 
ATOM   2414 C CB  . THR H  1 29 ? 27.765  18.261  38.854  1.00 61.47  ? 29  THR H CB  1 
ATOM   2415 O OG1 . THR H  1 29 ? 26.807  18.295  39.926  1.00 81.15  ? 29  THR H OG1 1 
ATOM   2416 C CG2 . THR H  1 29 ? 29.147  18.244  39.482  1.00 50.77  ? 29  THR H CG2 1 
ATOM   2417 N N   . CYS H  1 30 ? 25.738  18.485  36.796  1.00 47.98  ? 30  CYS H N   1 
ATOM   2418 C CA  . CYS H  1 30 ? 24.384  18.325  36.280  1.00 48.22  ? 30  CYS H CA  1 
ATOM   2419 C C   . CYS H  1 30 ? 23.869  16.924  36.582  1.00 44.71  ? 30  CYS H C   1 
ATOM   2420 O O   . CYS H  1 30 ? 23.066  16.340  35.852  1.00 44.63  ? 30  CYS H O   1 
ATOM   2421 C CB  . CYS H  1 30 ? 24.351  18.635  34.783  1.00 50.83  ? 30  CYS H CB  1 
ATOM   2422 S SG  . CYS H  1 30 ? 24.525  20.393  34.377  1.00 35.15  ? 30  CYS H SG  1 
ATOM   2423 N N   . GLY H  1 31 ? 24.326  16.356  37.699  1.00 41.16  ? 31  GLY H N   1 
ATOM   2424 C CA  . GLY H  1 31 ? 23.785  15.102  38.182  1.00 43.10  ? 31  GLY H CA  1 
ATOM   2425 C C   . GLY H  1 31 ? 24.728  13.921  38.125  1.00 49.55  ? 31  GLY H C   1 
ATOM   2426 O O   . GLY H  1 31 ? 25.705  13.875  38.873  1.00 44.66  ? 31  GLY H O   1 
ATOM   2427 N N   . LEU H  1 32 ? 24.448  12.961  37.250  1.00 61.06  ? 32  LEU H N   1 
ATOM   2428 C CA  . LEU H  1 32 ? 25.249  11.753  37.110  1.00 66.31  ? 32  LEU H CA  1 
ATOM   2429 C C   . LEU H  1 32 ? 26.744  12.055  37.020  1.00 67.85  ? 32  LEU H C   1 
ATOM   2430 O O   . LEU H  1 32 ? 27.176  13.087  36.507  1.00 63.34  ? 32  LEU H O   1 
ATOM   2431 C CB  . LEU H  1 32 ? 24.833  10.948  35.875  1.00 66.75  ? 32  LEU H CB  1 
ATOM   2432 C CG  . LEU H  1 32 ? 23.457  10.287  35.924  1.00 69.13  ? 32  LEU H CG  1 
ATOM   2433 C CD1 . LEU H  1 32 ? 22.389  11.221  35.394  1.00 78.00  ? 32  LEU H CD1 1 
ATOM   2434 C CD2 . LEU H  1 32 ? 23.457  8.960   35.159  1.00 68.63  ? 32  LEU H CD2 1 
ATOM   2435 N N   . PRO H  1 33 ? 27.533  11.121  37.543  1.00 69.44  ? 33  PRO H N   1 
ATOM   2436 C CA  . PRO H  1 33 ? 28.991  11.268  37.556  1.00 67.66  ? 33  PRO H CA  1 
ATOM   2437 C C   . PRO H  1 33 ? 29.540  11.487  36.153  1.00 59.94  ? 33  PRO H C   1 
ATOM   2438 O O   . PRO H  1 33 ? 29.071  10.885  35.183  1.00 80.00  ? 33  PRO H O   1 
ATOM   2439 C CB  . PRO H  1 33 ? 29.474  9.925   38.112  1.00 71.43  ? 33  PRO H CB  1 
ATOM   2440 C CG  . PRO H  1 33 ? 28.314  9.408   38.906  1.00 71.58  ? 33  PRO H CG  1 
ATOM   2441 C CD  . PRO H  1 33 ? 27.085  9.862   38.163  1.00 70.49  ? 33  PRO H CD  1 
ATOM   2442 N N   . GLY H  1 34 ? 30.543  12.358  36.041  1.00 49.76  ? 34  GLY H N   1 
ATOM   2443 C CA  . GLY H  1 34 ? 31.110  12.689  34.749  1.00 44.88  ? 34  GLY H CA  1 
ATOM   2444 C C   . GLY H  1 34 ? 30.584  14.013  34.225  1.00 40.17  ? 34  GLY H C   1 
ATOM   2445 O O   . GLY H  1 34 ? 31.373  14.860  33.805  1.00 35.42  ? 34  GLY H O   1 
ATOM   2446 N N   . THR H  1 35 ? 29.268  14.206  34.251  1.00 39.97  ? 35  THR H N   1 
ATOM   2447 C CA  . THR H  1 35 ? 28.658  15.423  33.718  1.00 37.54  ? 35  THR H CA  1 
ATOM   2448 C C   . THR H  1 35 ? 29.068  16.670  34.494  1.00 41.02  ? 35  THR H C   1 
ATOM   2449 O O   . THR H  1 35 ? 29.341  16.594  35.693  1.00 49.17  ? 35  THR H O   1 
ATOM   2450 C CB  . THR H  1 35 ? 27.120  15.321  33.731  1.00 35.04  ? 35  THR H CB  1 
ATOM   2451 O OG1 . THR H  1 35 ? 26.629  15.557  35.058  1.00 44.31  ? 35  THR H OG1 1 
ATOM   2452 C CG2 . THR H  1 35 ? 26.660  13.922  33.351  1.00 38.93  ? 35  THR H CG2 1 
ATOM   2453 N N   . LYS H  1 36 ? 29.100  17.818  33.823  1.00 39.27  ? 36  LYS H N   1 
ATOM   2454 C CA  . LYS H  1 36 ? 29.494  19.078  34.451  1.00 43.33  ? 36  LYS H CA  1 
ATOM   2455 C C   . LYS H  1 36 ? 28.584  20.247  34.097  1.00 43.24  ? 36  LYS H C   1 
ATOM   2456 O O   . LYS H  1 36 ? 27.976  20.269  33.021  1.00 55.17  ? 36  LYS H O   1 
ATOM   2457 C CB  . LYS H  1 36 ? 30.932  19.423  34.037  1.00 49.18  ? 36  LYS H CB  1 
ATOM   2458 C CG  . LYS H  1 36 ? 31.927  18.297  34.267  1.00 58.60  ? 36  LYS H CG  1 
ATOM   2459 C CD  . LYS H  1 36 ? 33.349  18.834  34.376  1.00 62.88  ? 36  LYS H CD  1 
ATOM   2460 C CE  . LYS H  1 36 ? 33.713  19.649  33.142  1.00 68.29  ? 36  LYS H CE  1 
ATOM   2461 N NZ  . LYS H  1 36 ? 34.963  20.437  33.335  1.00 69.07  ? 36  LYS H NZ  1 
ATOM   2462 N N   . CYS H  1 37 ? 28.472  21.248  34.971  1.00 36.51  ? 37  CYS H N   1 
ATOM   2463 C CA  . CYS H  1 37 ? 27.749  22.482  34.629  1.00 36.37  ? 37  CYS H CA  1 
ATOM   2464 C C   . CYS H  1 37 ? 28.803  23.537  34.287  1.00 44.30  ? 37  CYS H C   1 
ATOM   2465 O O   . CYS H  1 37 ? 29.690  23.809  35.094  1.00 48.40  ? 37  CYS H O   1 
ATOM   2466 C CB  . CYS H  1 37 ? 26.792  22.914  35.728  1.00 30.03  ? 37  CYS H CB  1 
ATOM   2467 S SG  . CYS H  1 37 ? 25.859  24.439  35.561  1.00 57.64  ? 37  CYS H SG  1 
ATOM   2468 N N   . CYS H  1 38 ? 28.717  24.096  33.085  1.00 50.98  ? 38  CYS H N   1 
ATOM   2469 C CA  . CYS H  1 38 ? 29.723  24.994  32.540  1.00 55.54  ? 38  CYS H CA  1 
ATOM   2470 C C   . CYS H  1 38 ? 29.201  26.414  32.359  1.00 62.35  ? 38  CYS H C   1 
ATOM   2471 O O   . CYS H  1 38 ? 28.030  26.606  32.030  1.00 54.33  ? 38  CYS H O   1 
ATOM   2472 C CB  . CYS H  1 38 ? 30.205  24.470  31.182  1.00 50.45  ? 38  CYS H CB  1 
ATOM   2473 S SG  . CYS H  1 38 ? 30.685  22.731  31.131  1.00 49.37  ? 38  CYS H SG  1 
ATOM   2474 N N   . LYS H  1 39 ? 30.051  27.421  32.550  1.00 67.21  ? 39  LYS H N   1 
ATOM   2475 C CA  . LYS H  1 39 ? 29.660  28.801  32.264  1.00 63.66  ? 39  LYS H CA  1 
ATOM   2476 C C   . LYS H  1 39 ? 30.883  29.711  32.128  1.00 77.35  ? 39  LYS H C   1 
ATOM   2477 O O   . LYS H  1 39 ? 32.004  29.236  31.929  1.00 82.53  ? 39  LYS H O   1 
ATOM   2478 C CB  . LYS H  1 39 ? 28.709  29.349  33.327  1.00 53.10  ? 39  LYS H CB  1 
ATOM   2479 C CG  . LYS H  1 39 ? 27.759  30.433  32.845  1.00 43.13  ? 39  LYS H CG  1 
ATOM   2480 C CD  . LYS H  1 39 ? 26.733  30.773  33.905  1.00 45.73  ? 39  LYS H CD  1 
ATOM   2481 C CE  . LYS H  1 39 ? 25.857  31.947  33.500  1.00 40.43  ? 39  LYS H CE  1 
ATOM   2482 N NZ  . LYS H  1 39 ? 26.664  33.192  33.323  1.00 67.14  ? 39  LYS H NZ  1 
ATOM   2483 N N   . LYS H  1 40 ? 30.639  31.006  32.263  1.00 83.59  ? 40  LYS H N   1 
ATOM   2484 C CA  . LYS H  1 40 ? 31.569  32.106  32.072  1.00 84.76  ? 40  LYS H CA  1 
ATOM   2485 C C   . LYS H  1 40 ? 31.477  33.122  33.200  1.00 90.06  ? 40  LYS H C   1 
ATOM   2486 O O   . LYS H  1 40 ? 30.583  33.010  34.051  1.00 91.01  ? 40  LYS H O   1 
ATOM   2487 C CB  . LYS H  1 40 ? 31.265  32.759  30.714  1.00 78.90  ? 40  LYS H CB  1 
ATOM   2488 C CG  . LYS H  1 40 ? 29.911  33.430  30.628  1.00 72.93  ? 40  LYS H CG  1 
ATOM   2489 C CD  . LYS H  1 40 ? 29.986  34.925  30.872  1.00 72.88  ? 40  LYS H CD  1 
ATOM   2490 C CE  . LYS H  1 40 ? 31.287  35.538  30.376  1.00 69.86  ? 40  LYS H CE  1 
ATOM   2491 N NZ  . LYS H  1 40 ? 31.073  36.924  29.858  1.00 59.60  ? 40  LYS H NZ  1 
ATOM   2492 N N   . PRO H  1 41 ? 32.357  34.116  33.273  1.00 91.58  ? 41  PRO H N   1 
ATOM   2493 C CA  . PRO H  1 41 ? 32.188  35.157  34.298  1.00 91.94  ? 41  PRO H CA  1 
ATOM   2494 C C   . PRO H  1 41 ? 30.988  36.060  34.024  1.00 91.42  ? 41  PRO H C   1 
ATOM   2495 O O   . PRO H  1 41 ? 29.945  35.902  34.688  1.00 92.49  ? 41  PRO H O   1 
ATOM   2496 C CB  . PRO H  1 41 ? 33.484  35.970  34.193  1.00 94.06  ? 41  PRO H CB  1 
ATOM   2497 C CG  . PRO H  1 41 ? 33.939  35.763  32.785  1.00 91.79  ? 41  PRO H CG  1 
ATOM   2498 C CD  . PRO H  1 41 ? 33.563  34.347  32.453  1.00 91.75  ? 41  PRO H CD  1 
ATOM   2499 O OXT . PRO H  1 41 ? 31.102  36.939  33.144  1.00 84.10  ? 41  PRO H OXT 1 
ATOM   2500 N N   . GLY I  1 1  ? 1.339   32.347  6.825   1.00 23.42  ? 1   GLY I N   1 
ATOM   2501 C CA  . GLY I  1 1  ? 0.064   32.246  7.503   1.00 22.62  ? 1   GLY I CA  1 
ATOM   2502 C C   . GLY I  1 1  ? -0.517  30.854  7.542   1.00 24.16  ? 1   GLY I C   1 
ATOM   2503 O O   . GLY I  1 1  ? 0.176   29.831  7.609   1.00 17.61  ? 1   GLY I O   1 
ATOM   2504 N N   . ILE I  1 2  ? -1.855  30.799  7.516   1.00 15.60  ? 2   ILE I N   1 
ATOM   2505 C CA  . ILE I  1 2  ? -2.506  29.485  7.405   1.00 13.57  ? 2   ILE I CA  1 
ATOM   2506 C C   . ILE I  1 2  ? -2.528  29.067  5.937   1.00 12.51  ? 2   ILE I C   1 
ATOM   2507 O O   . ILE I  1 2  ? -3.063  29.822  5.104   1.00 14.19  ? 2   ILE I O   1 
ATOM   2508 C CB  . ILE I  1 2  ? -3.911  29.502  8.003   1.00 15.98  ? 2   ILE I CB  1 
ATOM   2509 C CG1 . ILE I  1 2  ? -3.896  29.793  9.513   1.00 16.56  ? 2   ILE I CG1 1 
ATOM   2510 C CG2 . ILE I  1 2  ? -4.675  28.217  7.734   1.00 14.91  ? 2   ILE I CG2 1 
ATOM   2511 C CD1 . ILE I  1 2  ? -5.173  30.439  9.993   1.00 20.14  ? 2   ILE I CD1 1 
ATOM   2512 N N   . GLY I  1 3  ? -1.961  27.908  5.628   1.00 9.34   ? 3   GLY I N   1 
ATOM   2513 C CA  . GLY I  1 3  ? -1.886  27.483  4.227   1.00 10.18  ? 3   GLY I CA  1 
ATOM   2514 C C   . GLY I  1 3  ? -2.077  25.999  4.005   1.00 14.86  ? 3   GLY I C   1 
ATOM   2515 O O   . GLY I  1 3  ? -1.589  25.378  3.039   1.00 11.95  ? 3   GLY I O   1 
ATOM   2516 N N   . ASP I  1 4  ? -2.832  25.361  4.911   1.00 15.88  ? 4   ASP I N   1 
ATOM   2517 C CA  . ASP I  1 4  ? -3.101  23.922  4.807   1.00 10.89  ? 4   ASP I CA  1 
ATOM   2518 C C   . ASP I  1 4  ? -4.375  23.620  5.600   1.00 7.77   ? 4   ASP I C   1 
ATOM   2519 O O   . ASP I  1 4  ? -4.732  24.369  6.522   1.00 11.49  ? 4   ASP I O   1 
ATOM   2520 C CB  . ASP I  1 4  ? -1.918  23.087  5.292   1.00 12.66  ? 4   ASP I CB  1 
ATOM   2521 C CG  . ASP I  1 4  ? -1.857  22.969  6.804   1.00 16.75  ? 4   ASP I CG  1 
ATOM   2522 O OD1 . ASP I  1 4  ? -1.074  23.722  7.429   1.00 13.73  ? 4   ASP I OD1 1 
ATOM   2523 O OD2 . ASP I  1 4  ? -2.583  22.143  7.394   1.00 13.92  ? 4   ASP I OD2 1 
ATOM   2524 N N   . PRO I  1 5  ? -5.069  22.561  5.209   1.00 13.56  ? 5   PRO I N   1 
ATOM   2525 C CA  . PRO I  1 5  ? -6.373  22.275  5.816   1.00 13.87  ? 5   PRO I CA  1 
ATOM   2526 C C   . PRO I  1 5  ? -6.298  21.982  7.310   1.00 13.41  ? 5   PRO I C   1 
ATOM   2527 O O   . PRO I  1 5  ? -7.210  22.365  8.053   1.00 11.98  ? 5   PRO I O   1 
ATOM   2528 C CB  . PRO I  1 5  ? -6.833  21.032  5.053   1.00 14.68  ? 5   PRO I CB  1 
ATOM   2529 C CG  . PRO I  1 5  ? -6.009  20.939  3.827   1.00 16.86  ? 5   PRO I CG  1 
ATOM   2530 C CD  . PRO I  1 5  ? -4.698  21.614  4.150   1.00 14.66  ? 5   PRO I CD  1 
ATOM   2531 N N   . VAL I  1 6  ? -5.247  21.295  7.761   1.00 11.76  ? 6   VAL I N   1 
ATOM   2532 C CA  . VAL I  1 6  ? -5.232  20.922  9.181   1.00 14.87  ? 6   VAL I CA  1 
ATOM   2533 C C   . VAL I  1 6  ? -4.979  22.146  10.037  1.00 12.37  ? 6   VAL I C   1 
ATOM   2534 O O   . VAL I  1 6  ? -5.669  22.330  11.049  1.00 11.04  ? 6   VAL I O   1 
ATOM   2535 C CB  . VAL I  1 6  ? -4.204  19.814  9.466   1.00 16.17  ? 6   VAL I CB  1 
ATOM   2536 C CG1 . VAL I  1 6  ? -4.088  19.561  10.965  1.00 15.14  ? 6   VAL I CG1 1 
ATOM   2537 C CG2 . VAL I  1 6  ? -4.619  18.537  8.754   1.00 18.60  ? 6   VAL I CG2 1 
ATOM   2538 N N   . THR I  1 7  ? -4.035  23.015  9.683   1.00 10.45  ? 7   THR I N   1 
ATOM   2539 C CA  . THR I  1 7  ? -3.849  24.229  10.480  1.00 11.09  ? 7   THR I CA  1 
ATOM   2540 C C   . THR I  1 7  ? -5.109  25.077  10.484  1.00 16.01  ? 7   THR I C   1 
ATOM   2541 O O   . THR I  1 7  ? -5.485  25.668  11.494  1.00 10.78  ? 7   THR I O   1 
ATOM   2542 C CB  . THR I  1 7  ? -2.668  25.040  9.903   1.00 13.71  ? 7   THR I CB  1 
ATOM   2543 O OG1 . THR I  1 7  ? -1.520  24.178  9.930   1.00 12.71  ? 7   THR I OG1 1 
ATOM   2544 C CG2 . THR I  1 7  ? -2.366  26.285  10.705  1.00 17.55  ? 7   THR I CG2 1 
ATOM   2545 N N   . CYS I  1 8  ? -5.788  25.150  9.326   1.00 9.96   ? 8   CYS I N   1 
ATOM   2546 C CA  . CYS I  1 8  ? -7.040  25.900  9.269   1.00 9.50   ? 8   CYS I CA  1 
ATOM   2547 C C   . CYS I  1 8  ? -8.056  25.361  10.267  1.00 10.07  ? 8   CYS I C   1 
ATOM   2548 O O   . CYS I  1 8  ? -8.616  26.120  11.067  1.00 12.37  ? 8   CYS I O   1 
ATOM   2549 C CB  . CYS I  1 8  ? -7.627  25.858  7.849   1.00 11.53  ? 8   CYS I CB  1 
ATOM   2550 S SG  . CYS I  1 8  ? -9.165  26.786  7.641   1.00 12.59  ? 8   CYS I SG  1 
ATOM   2551 N N   . LEU I  1 9  ? -8.307  24.059  10.228  1.00 8.83   ? 9   LEU I N   1 
ATOM   2552 C CA  . LEU I  1 9  ? -9.332  23.419  11.046  1.00 7.42   ? 9   LEU I CA  1 
ATOM   2553 C C   . LEU I  1 9  ? -9.040  23.451  12.540  1.00 10.63  ? 9   LEU I C   1 
ATOM   2554 O O   . LEU I  1 9  ? -9.902  23.637  13.401  1.00 14.00  ? 9   LEU I O   1 
ATOM   2555 C CB  . LEU I  1 9  ? -9.474  21.964  10.578  1.00 9.17   ? 9   LEU I CB  1 
ATOM   2556 C CG  . LEU I  1 9  ? -10.166 21.797  9.218   1.00 7.19   ? 9   LEU I CG  1 
ATOM   2557 C CD1 . LEU I  1 9  ? -9.971  20.373  8.714   1.00 10.44  ? 9   LEU I CD1 1 
ATOM   2558 C CD2 . LEU I  1 9  ? -11.654 22.126  9.341   1.00 14.15  ? 9   LEU I CD2 1 
ATOM   2559 N N   . LYS I  1 10 ? -7.782  23.269  12.869  1.00 12.00  ? 10  LYS I N   1 
ATOM   2560 C CA  . LYS I  1 10 ? -7.333  23.395  14.251  1.00 12.09  ? 10  LYS I CA  1 
ATOM   2561 C C   . LYS I  1 10 ? -7.640  24.752  14.862  1.00 15.08  ? 10  LYS I C   1 
ATOM   2562 O O   . LYS I  1 10 ? -7.881  24.832  16.077  1.00 14.28  ? 10  LYS I O   1 
ATOM   2563 C CB  . LYS I  1 10 ? -5.820  23.176  14.259  1.00 12.94  ? 10  LYS I CB  1 
ATOM   2564 C CG  . LYS I  1 10 ? -5.389  21.738  14.471  1.00 20.20  ? 10  LYS I CG  1 
ATOM   2565 C CD  . LYS I  1 10 ? -3.876  21.737  14.724  1.00 24.86  ? 10  LYS I CD  1 
ATOM   2566 C CE  . LYS I  1 10 ? -3.238  20.419  14.350  1.00 34.30  ? 10  LYS I CE  1 
ATOM   2567 N NZ  . LYS I  1 10 ? -1.923  20.242  15.039  1.00 30.71  ? 10  LYS I NZ  1 
ATOM   2568 N N   . SER I  1 11 ? -7.591  25.819  14.065  1.00 12.81  ? 11  SER I N   1 
ATOM   2569 C CA  . SER I  1 11 ? -7.898  27.162  14.536  1.00 15.09  ? 11  SER I CA  1 
ATOM   2570 C C   . SER I  1 11 ? -9.406  27.363  14.685  1.00 18.61  ? 11  SER I C   1 
ATOM   2571 O O   . SER I  1 11 ? -9.853  28.376  15.220  1.00 20.04  ? 11  SER I O   1 
ATOM   2572 C CB  . SER I  1 11 ? -7.374  28.221  13.567  1.00 23.16  ? 11  SER I CB  1 
ATOM   2573 O OG  . SER I  1 11 ? -8.217  28.322  12.420  1.00 21.35  ? 11  SER I OG  1 
ATOM   2574 N N   . GLY I  1 12 ? -10.201 26.411  14.213  1.00 13.14  ? 12  GLY I N   1 
ATOM   2575 C CA  . GLY I  1 12 ? -11.650 26.500  14.399  1.00 15.77  ? 12  GLY I CA  1 
ATOM   2576 C C   . GLY I  1 12 ? -12.319 27.054  13.150  1.00 18.62  ? 12  GLY I C   1 
ATOM   2577 O O   . GLY I  1 12 ? -13.513 27.338  13.109  1.00 15.73  ? 12  GLY I O   1 
ATOM   2578 N N   . ALA I  1 13 ? -11.532 27.204  12.095  1.00 13.98  ? 13  ALA I N   1 
ATOM   2579 C CA  . ALA I  1 13 ? -12.091 27.723  10.843  1.00 12.93  ? 13  ALA I CA  1 
ATOM   2580 C C   . ALA I  1 13 ? -12.530 26.595  9.907   1.00 15.21  ? 13  ALA I C   1 
ATOM   2581 O O   . ALA I  1 13 ? -12.358 25.405  10.182  1.00 10.10  ? 13  ALA I O   1 
ATOM   2582 C CB  . ALA I  1 13 ? -11.057 28.623  10.203  1.00 8.72   ? 13  ALA I CB  1 
ATOM   2583 N N   . ILE I  1 14 ? -13.110 26.969  8.764   1.00 15.97  ? 14  ILE I N   1 
ATOM   2584 C CA  . ILE I  1 14 ? -13.546 26.024  7.741   1.00 10.37  ? 14  ILE I CA  1 
ATOM   2585 C C   . ILE I  1 14 ? -12.746 26.158  6.457   1.00 11.78  ? 14  ILE I C   1 
ATOM   2586 O O   . ILE I  1 14 ? -12.285 27.271  6.172   1.00 13.77  ? 14  ILE I O   1 
ATOM   2587 C CB  . ILE I  1 14 ? -15.028 26.314  7.418   1.00 12.12  ? 14  ILE I CB  1 
ATOM   2588 C CG1 . ILE I  1 14 ? -15.882 26.118  8.682   1.00 17.60  ? 14  ILE I CG1 1 
ATOM   2589 C CG2 . ILE I  1 14 ? -15.524 25.506  6.245   1.00 20.67  ? 14  ILE I CG2 1 
ATOM   2590 C CD1 . ILE I  1 14 ? -16.933 27.186  8.809   1.00 27.06  ? 14  ILE I CD1 1 
ATOM   2591 N N   . CYS I  1 15 ? -12.610 25.067  5.713   1.00 10.64  ? 15  CYS I N   1 
ATOM   2592 C CA  . CYS I  1 15 ? -11.989 25.148  4.396   1.00 9.00   ? 15  CYS I CA  1 
ATOM   2593 C C   . CYS I  1 15 ? -13.083 25.117  3.324   1.00 10.69  ? 15  CYS I C   1 
ATOM   2594 O O   . CYS I  1 15 ? -13.784 24.108  3.278   1.00 13.08  ? 15  CYS I O   1 
ATOM   2595 C CB  . CYS I  1 15 ? -11.013 24.001  4.136   1.00 11.61  ? 15  CYS I CB  1 
ATOM   2596 S SG  . CYS I  1 15 ? -9.491  24.016  5.115   1.00 13.94  ? 15  CYS I SG  1 
ATOM   2597 N N   . HIS I  1 16 ? -13.148 26.192  2.551   1.00 12.68  ? 16  HIS I N   1 
ATOM   2598 C CA  . HIS I  1 16 ? -14.151 26.341  1.504   1.00 15.79  ? 16  HIS I CA  1 
ATOM   2599 C C   . HIS I  1 16 ? -13.519 26.560  0.142   1.00 22.47  ? 16  HIS I C   1 
ATOM   2600 O O   . HIS I  1 16 ? -12.616 27.385  0.027   1.00 17.20  ? 16  HIS I O   1 
ATOM   2601 C CB  . HIS I  1 16 ? -15.053 27.542  1.815   1.00 17.02  ? 16  HIS I CB  1 
ATOM   2602 C CG  . HIS I  1 16 ? -16.401 27.494  1.165   1.00 22.90  ? 16  HIS I CG  1 
ATOM   2603 N ND1 . HIS I  1 16 ? -16.614 27.916  -0.134  1.00 29.54  ? 16  HIS I ND1 1 
ATOM   2604 C CD2 . HIS I  1 16 ? -17.602 27.069  1.610   1.00 19.92  ? 16  HIS I CD2 1 
ATOM   2605 C CE1 . HIS I  1 16 ? -17.885 27.761  -0.463  1.00 21.67  ? 16  HIS I CE1 1 
ATOM   2606 N NE2 . HIS I  1 16 ? -18.511 27.247  0.584   1.00 28.87  ? 16  HIS I NE2 1 
ATOM   2607 N N   . PRO I  1 17 ? -14.006 25.874  -0.895  1.00 17.98  ? 17  PRO I N   1 
ATOM   2608 C CA  . PRO I  1 17 ? -13.440 26.120  -2.232  1.00 22.41  ? 17  PRO I CA  1 
ATOM   2609 C C   . PRO I  1 17 ? -13.792 27.528  -2.716  1.00 23.48  ? 17  PRO I C   1 
ATOM   2610 O O   . PRO I  1 17 ? -14.885 28.070  -2.485  1.00 27.87  ? 17  PRO I O   1 
ATOM   2611 C CB  . PRO I  1 17 ? -14.086 25.037  -3.088  1.00 24.12  ? 17  PRO I CB  1 
ATOM   2612 C CG  . PRO I  1 17 ? -15.312 24.610  -2.356  1.00 24.23  ? 17  PRO I CG  1 
ATOM   2613 C CD  . PRO I  1 17 ? -15.090 24.900  -0.889  1.00 19.40  ? 17  PRO I CD  1 
ATOM   2614 N N   . VAL I  1 18 ? -12.840 28.142  -3.400  1.00 24.94  ? 18  VAL I N   1 
ATOM   2615 C CA  . VAL I  1 18 ? -12.914 29.382  -4.133  1.00 23.17  ? 18  VAL I CA  1 
ATOM   2616 C C   . VAL I  1 18 ? -13.181 30.625  -3.294  1.00 22.21  ? 18  VAL I C   1 
ATOM   2617 O O   . VAL I  1 18 ? -12.516 31.643  -3.497  1.00 20.89  ? 18  VAL I O   1 
ATOM   2618 C CB  . VAL I  1 18 ? -14.032 29.327  -5.213  1.00 29.51  ? 18  VAL I CB  1 
ATOM   2619 C CG1 . VAL I  1 18 ? -14.170 30.676  -5.900  1.00 30.53  ? 18  VAL I CG1 1 
ATOM   2620 C CG2 . VAL I  1 18 ? -13.729 28.230  -6.217  1.00 27.50  ? 18  VAL I CG2 1 
ATOM   2621 N N   . PHE I  1 19 ? -14.160 30.570  -2.395  1.00 20.74  ? 19  PHE I N   1 
ATOM   2622 C CA  . PHE I  1 19 ? -14.493 31.762  -1.623  1.00 26.04  ? 19  PHE I CA  1 
ATOM   2623 C C   . PHE I  1 19 ? -15.029 31.408  -0.240  1.00 22.35  ? 19  PHE I C   1 
ATOM   2624 O O   . PHE I  1 19 ? -15.572 30.319  -0.061  1.00 22.17  ? 19  PHE I O   1 
ATOM   2625 C CB  . PHE I  1 19 ? -15.526 32.606  -2.404  1.00 17.63  ? 19  PHE I CB  1 
ATOM   2626 C CG  . PHE I  1 19 ? -16.875 31.896  -2.506  1.00 22.22  ? 19  PHE I CG  1 
ATOM   2627 C CD1 . PHE I  1 19 ? -17.905 32.166  -1.634  1.00 19.62  ? 19  PHE I CD1 1 
ATOM   2628 C CD2 . PHE I  1 19 ? -17.092 30.941  -3.488  1.00 24.80  ? 19  PHE I CD2 1 
ATOM   2629 C CE1 . PHE I  1 19 ? -19.116 31.519  -1.693  1.00 22.35  ? 19  PHE I CE1 1 
ATOM   2630 C CE2 . PHE I  1 19 ? -18.297 30.270  -3.557  1.00 22.69  ? 19  PHE I CE2 1 
ATOM   2631 C CZ  . PHE I  1 19 ? -19.295 30.528  -2.646  1.00 22.55  ? 19  PHE I CZ  1 
ATOM   2632 N N   . CYS I  1 20 ? -14.926 32.317  0.720   1.00 18.99  ? 20  CYS I N   1 
ATOM   2633 C CA  . CYS I  1 20 ? -15.642 32.256  1.975   1.00 15.79  ? 20  CYS I CA  1 
ATOM   2634 C C   . CYS I  1 20 ? -17.068 32.770  1.829   1.00 18.67  ? 20  CYS I C   1 
ATOM   2635 O O   . CYS I  1 20 ? -17.273 33.828  1.230   1.00 23.80  ? 20  CYS I O   1 
ATOM   2636 C CB  . CYS I  1 20 ? -14.968 33.126  3.058   1.00 11.44  ? 20  CYS I CB  1 
ATOM   2637 S SG  . CYS I  1 20 ? -13.275 32.544  3.383   1.00 20.06  ? 20  CYS I SG  1 
ATOM   2638 N N   . PRO I  1 21 ? -18.035 32.090  2.419   1.00 23.42  ? 21  PRO I N   1 
ATOM   2639 C CA  . PRO I  1 21 ? -19.408 32.599  2.329   1.00 15.61  ? 21  PRO I CA  1 
ATOM   2640 C C   . PRO I  1 21 ? -19.460 33.983  2.984   1.00 17.25  ? 21  PRO I C   1 
ATOM   2641 O O   . PRO I  1 21 ? -18.534 34.353  3.724   1.00 20.11  ? 21  PRO I O   1 
ATOM   2642 C CB  . PRO I  1 21 ? -20.214 31.547  3.083   1.00 21.14  ? 21  PRO I CB  1 
ATOM   2643 C CG  . PRO I  1 21 ? -19.366 30.310  2.970   1.00 21.97  ? 21  PRO I CG  1 
ATOM   2644 C CD  . PRO I  1 21 ? -17.965 30.854  3.223   1.00 28.56  ? 21  PRO I CD  1 
ATOM   2645 N N   . ARG I  1 22 ? -20.514 34.737  2.713   1.00 21.42  ? 22  ARG I N   1 
ATOM   2646 C CA  . ARG I  1 22 ? -20.621 36.125  3.154   1.00 21.10  ? 22  ARG I CA  1 
ATOM   2647 C C   . ARG I  1 22 ? -20.381 36.312  4.647   1.00 24.99  ? 22  ARG I C   1 
ATOM   2648 O O   . ARG I  1 22 ? -19.664 37.258  5.006   1.00 29.59  ? 22  ARG I O   1 
ATOM   2649 C CB  . ARG I  1 22 ? -21.992 36.729  2.791   1.00 21.56  ? 22  ARG I CB  1 
ATOM   2650 C CG  . ARG I  1 22 ? -22.233 36.756  1.291   1.00 23.02  ? 22  ARG I CG  1 
ATOM   2651 C CD  . ARG I  1 22 ? -23.584 37.341  0.914   1.00 20.39  ? 22  ARG I CD  1 
ATOM   2652 N NE  . ARG I  1 22 ? -23.723 38.730  1.368   1.00 18.36  ? 22  ARG I NE  1 
ATOM   2653 C CZ  . ARG I  1 22 ? -24.881 39.367  1.306   1.00 14.88  ? 22  ARG I CZ  1 
ATOM   2654 N NH1 . ARG I  1 22 ? -25.937 38.742  0.818   1.00 19.33  ? 22  ARG I NH1 1 
ATOM   2655 N NH2 . ARG I  1 22 ? -24.973 40.630  1.722   1.00 20.26  ? 22  ARG I NH2 1 
ATOM   2656 N N   . ARG I  1 23 ? -20.970 35.465  5.489   1.00 23.44  ? 23  ARG I N   1 
ATOM   2657 C CA  . ARG I  1 23 ? -20.940 35.729  6.929   1.00 26.91  ? 23  ARG I CA  1 
ATOM   2658 C C   . ARG I  1 23 ? -19.601 35.322  7.543   1.00 26.59  ? 23  ARG I C   1 
ATOM   2659 O O   . ARG I  1 23 ? -19.428 35.374  8.764   1.00 35.41  ? 23  ARG I O   1 
ATOM   2660 C CB  . ARG I  1 23 ? -22.104 35.041  7.641   1.00 32.05  ? 23  ARG I CB  1 
ATOM   2661 C CG  . ARG I  1 23 ? -22.135 33.529  7.539   1.00 33.59  ? 23  ARG I CG  1 
ATOM   2662 C CD  . ARG I  1 23 ? -23.187 32.947  8.475   1.00 41.42  ? 23  ARG I CD  1 
ATOM   2663 N NE  . ARG I  1 23 ? -22.745 31.705  9.094   1.00 46.33  ? 23  ARG I NE  1 
ATOM   2664 C CZ  . ARG I  1 23 ? -22.278 31.531  10.324  1.00 51.69  ? 23  ARG I CZ  1 
ATOM   2665 N NH1 . ARG I  1 23 ? -22.151 32.537  11.186  1.00 40.63  ? 23  ARG I NH1 1 
ATOM   2666 N NH2 . ARG I  1 23 ? -21.920 30.310  10.712  1.00 36.13  ? 23  ARG I NH2 1 
ATOM   2667 N N   . TYR I  1 24 ? -18.659 34.919  6.693   1.00 16.57  ? 24  TYR I N   1 
ATOM   2668 C CA  . TYR I  1 24 ? -17.337 34.531  7.165   1.00 19.08  ? 24  TYR I CA  1 
ATOM   2669 C C   . TYR I  1 24 ? -16.263 35.534  6.773   1.00 24.80  ? 24  TYR I C   1 
ATOM   2670 O O   . TYR I  1 24 ? -16.449 36.335  5.863   1.00 27.23  ? 24  TYR I O   1 
ATOM   2671 C CB  . TYR I  1 24 ? -16.872 33.203  6.551   1.00 16.44  ? 24  TYR I CB  1 
ATOM   2672 C CG  . TYR I  1 24 ? -17.637 32.016  7.051   1.00 17.22  ? 24  TYR I CG  1 
ATOM   2673 C CD1 . TYR I  1 24 ? -18.734 31.535  6.354   1.00 30.89  ? 24  TYR I CD1 1 
ATOM   2674 C CD2 . TYR I  1 24 ? -17.259 31.376  8.227   1.00 31.93  ? 24  TYR I CD2 1 
ATOM   2675 C CE1 . TYR I  1 24 ? -19.454 30.444  6.794   1.00 36.27  ? 24  TYR I CE1 1 
ATOM   2676 C CE2 . TYR I  1 24 ? -17.983 30.289  8.664   1.00 40.25  ? 24  TYR I CE2 1 
ATOM   2677 C CZ  . TYR I  1 24 ? -19.070 29.821  7.959   1.00 37.34  ? 24  TYR I CZ  1 
ATOM   2678 O OH  . TYR I  1 24 ? -19.791 28.731  8.394   1.00 47.85  ? 24  TYR I OH  1 
ATOM   2679 N N   A LYS I  1 25 ? -15.138 35.445  7.474   0.50 18.63  ? 25  LYS I N   1 
ATOM   2680 N N   B LYS I  1 25 ? -15.137 35.441  7.471   0.50 18.63  ? 25  LYS I N   1 
ATOM   2681 C CA  A LYS I  1 25 ? -13.967 36.227  7.116   0.50 21.81  ? 25  LYS I CA  1 
ATOM   2682 C CA  B LYS I  1 25 ? -13.964 36.227  7.125   0.50 21.81  ? 25  LYS I CA  1 
ATOM   2683 C C   A LYS I  1 25 ? -12.841 35.296  6.682   0.50 17.73  ? 25  LYS I C   1 
ATOM   2684 C C   B LYS I  1 25 ? -12.838 35.299  6.685   0.50 17.73  ? 25  LYS I C   1 
ATOM   2685 O O   A LYS I  1 25 ? -12.588 34.271  7.313   0.50 21.61  ? 25  LYS I O   1 
ATOM   2686 O O   B LYS I  1 25 ? -12.583 34.274  7.314   0.50 21.73  ? 25  LYS I O   1 
ATOM   2687 C CB  A LYS I  1 25 ? -13.498 37.110  8.276   0.50 23.86  ? 25  LYS I CB  1 
ATOM   2688 C CB  B LYS I  1 25 ? -13.508 37.088  8.302   0.50 23.87  ? 25  LYS I CB  1 
ATOM   2689 C CG  A LYS I  1 25 ? -12.181 37.815  7.981   0.50 26.93  ? 25  LYS I CG  1 
ATOM   2690 C CG  B LYS I  1 25 ? -14.586 37.963  8.916   0.50 29.33  ? 25  LYS I CG  1 
ATOM   2691 C CD  A LYS I  1 25 ? -11.332 37.990  9.230   0.50 34.13  ? 25  LYS I CD  1 
ATOM   2692 C CD  B LYS I  1 25 ? -14.089 38.581  10.218  0.50 32.79  ? 25  LYS I CD  1 
ATOM   2693 C CE  A LYS I  1 25 ? -10.161 38.923  8.952   0.50 28.39  ? 25  LYS I CE  1 
ATOM   2694 C CE  B LYS I  1 25 ? -13.223 39.804  9.956   0.50 39.12  ? 25  LYS I CE  1 
ATOM   2695 N NZ  A LYS I  1 25 ? -9.065  38.213  8.238   0.50 18.35  ? 25  LYS I NZ  1 
ATOM   2696 N NZ  B LYS I  1 25 ? -13.364 40.831  11.042  0.50 35.14  ? 25  LYS I NZ  1 
ATOM   2697 N N   . GLN I  1 26 ? -12.163 35.653  5.592   1.00 21.20  ? 26  GLN I N   1 
ATOM   2698 C CA  . GLN I  1 26 ? -11.031 34.839  5.151   1.00 15.66  ? 26  GLN I CA  1 
ATOM   2699 C C   . GLN I  1 26 ? -9.804  35.125  6.016   1.00 20.63  ? 26  GLN I C   1 
ATOM   2700 O O   . GLN I  1 26 ? -9.482  36.296  6.233   1.00 19.21  ? 26  GLN I O   1 
ATOM   2701 C CB  . GLN I  1 26 ? -10.699 35.140  3.697   1.00 18.08  ? 26  GLN I CB  1 
ATOM   2702 C CG  . GLN I  1 26 ? -9.562  34.289  3.167   1.00 18.31  ? 26  GLN I CG  1 
ATOM   2703 C CD  . GLN I  1 26 ? -9.245  34.643  1.726   1.00 28.66  ? 26  GLN I CD  1 
ATOM   2704 O OE1 . GLN I  1 26 ? -10.166 34.777  0.923   1.00 28.63  ? 26  GLN I OE1 1 
ATOM   2705 N NE2 . GLN I  1 26 ? -7.961  34.773  1.439   1.00 33.87  ? 26  GLN I NE2 1 
ATOM   2706 N N   . ILE I  1 27 ? -9.134  34.083  6.494   1.00 15.98  ? 27  ILE I N   1 
ATOM   2707 C CA  . ILE I  1 27 ? -7.954  34.255  7.340   1.00 16.43  ? 27  ILE I CA  1 
ATOM   2708 C C   . ILE I  1 27 ? -6.753  33.497  6.794   1.00 19.49  ? 27  ILE I C   1 
ATOM   2709 O O   . ILE I  1 27 ? -5.678  33.459  7.405   1.00 18.59  ? 27  ILE I O   1 
ATOM   2710 C CB  . ILE I  1 27 ? -8.203  33.791  8.787   1.00 13.93  ? 27  ILE I CB  1 
ATOM   2711 C CG1 . ILE I  1 27 ? -8.546  32.297  8.911   1.00 24.18  ? 27  ILE I CG1 1 
ATOM   2712 C CG2 . ILE I  1 27 ? -9.289  34.628  9.448   1.00 18.11  ? 27  ILE I CG2 1 
ATOM   2713 C CD1 . ILE I  1 27 ? -8.692  31.798  10.333  1.00 13.71  ? 27  ILE I CD1 1 
ATOM   2714 N N   . GLY I  1 28 ? -6.927  32.896  5.617   1.00 19.11  ? 28  GLY I N   1 
ATOM   2715 C CA  . GLY I  1 28 ? -5.851  32.212  4.938   1.00 13.08  ? 28  GLY I CA  1 
ATOM   2716 C C   . GLY I  1 28 ? -6.354  31.312  3.826   1.00 20.51  ? 28  GLY I C   1 
ATOM   2717 O O   . GLY I  1 28 ? -7.455  31.574  3.316   1.00 13.42  ? 28  GLY I O   1 
ATOM   2718 N N   . THR I  1 29 ? -5.550  30.297  3.506   1.00 11.71  ? 29  THR I N   1 
ATOM   2719 C CA  . THR I  1 29 ? -5.952  29.299  2.533   1.00 12.57  ? 29  THR I CA  1 
ATOM   2720 C C   . THR I  1 29 ? -5.886  27.880  3.080   1.00 17.05  ? 29  THR I C   1 
ATOM   2721 O O   . THR I  1 29 ? -5.363  27.687  4.180   1.00 16.10  ? 29  THR I O   1 
ATOM   2722 C CB  . THR I  1 29 ? -5.039  29.323  1.287   1.00 17.49  ? 29  THR I CB  1 
ATOM   2723 O OG1 . THR I  1 29 ? -3.809  28.655  1.589   1.00 14.31  ? 29  THR I OG1 1 
ATOM   2724 C CG2 . THR I  1 29 ? -4.725  30.764  0.896   1.00 21.94  ? 29  THR I CG2 1 
ATOM   2725 N N   . CYS I  1 30 ? -6.358  26.884  2.308   1.00 15.80  ? 30  CYS I N   1 
ATOM   2726 C CA  . CYS I  1 30 ? -6.145  25.499  2.750   1.00 14.73  ? 30  CYS I CA  1 
ATOM   2727 C C   . CYS I  1 30 ? -5.237  24.707  1.820   1.00 10.40  ? 30  CYS I C   1 
ATOM   2728 O O   . CYS I  1 30 ? -5.317  23.497  1.649   1.00 13.05  ? 30  CYS I O   1 
ATOM   2729 C CB  . CYS I  1 30 ? -7.497  24.786  2.969   1.00 14.41  ? 30  CYS I CB  1 
ATOM   2730 S SG  . CYS I  1 30 ? -8.419  25.569  4.321   1.00 13.75  ? 30  CYS I SG  1 
ATOM   2731 N N   . GLY I  1 31 ? -4.295  25.422  1.209   1.00 13.96  ? 31  GLY I N   1 
ATOM   2732 C CA  . GLY I  1 31 ? -3.224  24.816  0.436   1.00 15.10  ? 31  GLY I CA  1 
ATOM   2733 C C   . GLY I  1 31 ? -3.623  24.584  -1.009  1.00 21.89  ? 31  GLY I C   1 
ATOM   2734 O O   . GLY I  1 31 ? -2.962  25.052  -1.942  1.00 21.24  ? 31  GLY I O   1 
ATOM   2735 N N   A LEU I  1 32 ? -4.713  23.843  -1.203  0.50 19.17  ? 32  LEU I N   1 
ATOM   2736 N N   B LEU I  1 32 ? -4.724  23.867  -1.191  0.50 19.13  ? 32  LEU I N   1 
ATOM   2737 C CA  A LEU I  1 32 ? -5.175  23.530  -2.556  0.50 21.29  ? 32  LEU I CA  1 
ATOM   2738 C CA  B LEU I  1 32 ? -5.215  23.570  -2.535  0.50 21.33  ? 32  LEU I CA  1 
ATOM   2739 C C   A LEU I  1 32 ? -5.588  24.812  -3.274  0.50 22.60  ? 32  LEU I C   1 
ATOM   2740 C C   B LEU I  1 32 ? -5.586  24.845  -3.273  0.50 22.65  ? 32  LEU I C   1 
ATOM   2741 O O   A LEU I  1 32 ? -6.042  25.788  -2.672  0.50 22.91  ? 32  LEU I O   1 
ATOM   2742 O O   B LEU I  1 32 ? -6.000  25.845  -2.680  0.50 22.02  ? 32  LEU I O   1 
ATOM   2743 C CB  A LEU I  1 32 ? -6.308  22.511  -2.521  0.50 19.39  ? 32  LEU I CB  1 
ATOM   2744 C CB  B LEU I  1 32 ? -6.392  22.598  -2.430  0.50 19.89  ? 32  LEU I CB  1 
ATOM   2745 C CG  A LEU I  1 32 ? -6.107  21.180  -1.805  0.50 24.15  ? 32  LEU I CG  1 
ATOM   2746 C CG  B LEU I  1 32 ? -5.998  21.128  -2.254  0.50 20.26  ? 32  LEU I CG  1 
ATOM   2747 C CD1 A LEU I  1 32 ? -6.930  20.073  -2.462  0.50 6.87   ? 32  LEU I CD1 1 
ATOM   2748 C CD1 B LEU I  1 32 ? -5.163  20.659  -3.434  0.50 36.49  ? 32  LEU I CD1 1 
ATOM   2749 C CD2 A LEU I  1 32 ? -4.639  20.785  -1.746  0.50 18.53  ? 32  LEU I CD2 1 
ATOM   2750 C CD2 B LEU I  1 32 ? -5.251  20.929  -0.939  0.50 18.25  ? 32  LEU I CD2 1 
ATOM   2751 N N   . PRO I  1 33 ? -5.416  24.835  -4.593  1.00 28.92  ? 33  PRO I N   1 
ATOM   2752 C CA  . PRO I  1 33 ? -5.713  26.051  -5.367  1.00 21.15  ? 33  PRO I CA  1 
ATOM   2753 C C   . PRO I  1 33 ? -7.169  26.457  -5.145  1.00 20.99  ? 33  PRO I C   1 
ATOM   2754 O O   . PRO I  1 33 ? -8.076  25.623  -5.097  1.00 24.04  ? 33  PRO I O   1 
ATOM   2755 C CB  . PRO I  1 33 ? -5.405  25.657  -6.802  1.00 24.66  ? 33  PRO I CB  1 
ATOM   2756 C CG  . PRO I  1 33 ? -4.523  24.460  -6.692  1.00 33.60  ? 33  PRO I CG  1 
ATOM   2757 C CD  . PRO I  1 33 ? -4.940  23.733  -5.439  1.00 34.60  ? 33  PRO I CD  1 
ATOM   2758 N N   . GLY I  1 34 ? -7.309  27.761  -4.978  1.00 20.89  ? 34  GLY I N   1 
ATOM   2759 C CA  . GLY I  1 34 ? -8.518  28.472  -4.676  1.00 22.97  ? 34  GLY I CA  1 
ATOM   2760 C C   . GLY I  1 34 ? -9.141  28.208  -3.327  1.00 21.91  ? 34  GLY I C   1 
ATOM   2761 O O   . GLY I  1 34 ? -10.150 28.849  -3.007  1.00 25.83  ? 34  GLY I O   1 
ATOM   2762 N N   . THR I  1 35 ? -8.602  27.298  -2.513  1.00 25.37  ? 35  THR I N   1 
ATOM   2763 C CA  . THR I  1 35 ? -9.270  27.001  -1.236  1.00 16.03  ? 35  THR I CA  1 
ATOM   2764 C C   . THR I  1 35 ? -9.008  28.085  -0.203  1.00 13.62  ? 35  THR I C   1 
ATOM   2765 O O   . THR I  1 35 ? -7.930  28.680  -0.109  1.00 19.00  ? 35  THR I O   1 
ATOM   2766 C CB  . THR I  1 35 ? -8.857  25.645  -0.633  1.00 15.61  ? 35  THR I CB  1 
ATOM   2767 O OG1 . THR I  1 35 ? -7.449  25.613  -0.331  1.00 24.07  ? 35  THR I OG1 1 
ATOM   2768 C CG2 . THR I  1 35 ? -9.103  24.500  -1.604  1.00 17.37  ? 35  THR I CG2 1 
ATOM   2769 N N   . LYS I  1 36 ? -10.031 28.360  0.599   1.00 13.45  ? 36  LYS I N   1 
ATOM   2770 C CA  . LYS I  1 36 ? -9.939  29.484  1.531   1.00 16.91  ? 36  LYS I CA  1 
ATOM   2771 C C   . LYS I  1 36 ? -10.178 28.989  2.953   1.00 16.89  ? 36  LYS I C   1 
ATOM   2772 O O   . LYS I  1 36 ? -11.030 28.126  3.157   1.00 14.48  ? 36  LYS I O   1 
ATOM   2773 C CB  . LYS I  1 36 ? -10.948 30.571  1.186   1.00 13.27  ? 36  LYS I CB  1 
ATOM   2774 C CG  . LYS I  1 36 ? -10.908 31.108  -0.238  1.00 14.44  ? 36  LYS I CG  1 
ATOM   2775 C CD  . LYS I  1 36 ? -9.521  31.572  -0.652  1.00 14.92  ? 36  LYS I CD  1 
ATOM   2776 C CE  . LYS I  1 36 ? -9.494  32.255  -2.010  1.00 19.63  ? 36  LYS I CE  1 
ATOM   2777 N NZ  . LYS I  1 36 ? -8.116  32.305  -2.588  1.00 26.46  ? 36  LYS I NZ  1 
ATOM   2778 N N   . CYS I  1 37 ? -9.417  29.514  3.900   1.00 14.59  ? 37  CYS I N   1 
ATOM   2779 C CA  . CYS I  1 37 ? -9.642  29.248  5.319   1.00 12.88  ? 37  CYS I CA  1 
ATOM   2780 C C   . CYS I  1 37 ? -10.549 30.366  5.823   1.00 11.89  ? 37  CYS I C   1 
ATOM   2781 O O   . CYS I  1 37 ? -10.159 31.545  5.736   1.00 16.44  ? 37  CYS I O   1 
ATOM   2782 C CB  . CYS I  1 37 ? -8.305  29.181  6.070   1.00 11.54  ? 37  CYS I CB  1 
ATOM   2783 S SG  . CYS I  1 37 ? -8.587  28.728  7.815   1.00 14.30  ? 37  CYS I SG  1 
ATOM   2784 N N   . CYS I  1 38 ? -11.728 30.019  6.284   1.00 11.24  ? 38  CYS I N   1 
ATOM   2785 C CA  . CYS I  1 38 ? -12.781 30.977  6.614   1.00 17.19  ? 38  CYS I CA  1 
ATOM   2786 C C   . CYS I  1 38 ? -13.208 30.881  8.067   1.00 14.64  ? 38  CYS I C   1 
ATOM   2787 O O   . CYS I  1 38 ? -13.603 29.820  8.528   1.00 14.17  ? 38  CYS I O   1 
ATOM   2788 C CB  . CYS I  1 38 ? -14.015 30.775  5.719   1.00 13.96  ? 38  CYS I CB  1 
ATOM   2789 S SG  . CYS I  1 38 ? -13.531 30.620  3.974   1.00 14.76  ? 38  CYS I SG  1 
ATOM   2790 N N   . LYS I  1 39 ? -13.115 32.021  8.726   1.00 20.60  ? 39  LYS I N   1 
ATOM   2791 C CA  . LYS I  1 39 ? -13.327 32.227  10.135  1.00 21.50  ? 39  LYS I CA  1 
ATOM   2792 C C   . LYS I  1 39 ? -14.750 32.680  10.427  1.00 24.13  ? 39  LYS I C   1 
ATOM   2793 O O   . LYS I  1 39 ? -15.185 33.674  9.849   1.00 19.96  ? 39  LYS I O   1 
ATOM   2794 C CB  . LYS I  1 39 ? -12.386 33.324  10.658  1.00 21.86  ? 39  LYS I CB  1 
ATOM   2795 C CG  . LYS I  1 39 ? -12.663 33.749  12.080  1.00 26.49  ? 39  LYS I CG  1 
ATOM   2796 C CD  . LYS I  1 39 ? -11.577 34.680  12.623  1.00 23.84  ? 39  LYS I CD  1 
ATOM   2797 C CE  . LYS I  1 39 ? -11.698 34.729  14.147  1.00 25.01  ? 39  LYS I CE  1 
ATOM   2798 N NZ  . LYS I  1 39 ? -13.118 34.954  14.552  1.00 24.61  ? 39  LYS I NZ  1 
ATOM   2799 N N   . LYS I  1 40 ? -15.372 31.922  11.323  1.00 25.41  ? 40  LYS I N   1 
ATOM   2800 C CA  . LYS I  1 40 ? -16.730 32.205  11.743  1.00 30.29  ? 40  LYS I CA  1 
ATOM   2801 C C   . LYS I  1 40 ? -16.786 33.567  12.426  1.00 39.52  ? 40  LYS I C   1 
ATOM   2802 O O   . LYS I  1 40 ? -15.839 33.977  13.104  1.00 41.30  ? 40  LYS I O   1 
ATOM   2803 C CB  . LYS I  1 40 ? -17.250 31.101  12.669  1.00 31.02  ? 40  LYS I CB  1 
ATOM   2804 C CG  . LYS I  1 40 ? -18.753 30.880  12.543  1.00 52.04  ? 40  LYS I CG  1 
ATOM   2805 C CD  . LYS I  1 40 ? -19.354 30.330  13.821  1.00 63.21  ? 40  LYS I CD  1 
ATOM   2806 C CE  . LYS I  1 40 ? -20.719 30.949  14.099  1.00 69.75  ? 40  LYS I CE  1 
ATOM   2807 N NZ  . LYS I  1 40 ? -21.462 30.230  15.156  1.00 87.21  ? 40  LYS I NZ  1 
ATOM   2808 N N   . PRO I  1 41 ? -17.907 34.252  12.238  1.00 39.04  ? 41  PRO I N   1 
ATOM   2809 C CA  . PRO I  1 41 ? -18.142 35.487  12.993  1.00 45.23  ? 41  PRO I CA  1 
ATOM   2810 C C   . PRO I  1 41 ? -18.414 35.096  14.450  1.00 47.36  ? 41  PRO I C   1 
ATOM   2811 O O   . PRO I  1 41 ? -19.104 34.083  14.644  1.00 32.84  ? 41  PRO I O   1 
ATOM   2812 C CB  . PRO I  1 41 ? -19.375 36.087  12.328  1.00 48.92  ? 41  PRO I CB  1 
ATOM   2813 C CG  . PRO I  1 41 ? -20.080 34.934  11.693  1.00 45.54  ? 41  PRO I CG  1 
ATOM   2814 C CD  . PRO I  1 41 ? -19.014 33.934  11.324  1.00 45.15  ? 41  PRO I CD  1 
ATOM   2815 O OXT . PRO I  1 41 ? -17.910 35.788  15.359  1.00 48.42  ? 41  PRO I OXT 1 
ATOM   2816 N N   . GLY J  1 1  ? -15.268 5.881   2.685   1.00 50.38  ? 1   GLY J N   1 
ATOM   2817 C CA  . GLY J  1 1  ? -15.513 7.221   3.214   1.00 39.58  ? 1   GLY J CA  1 
ATOM   2818 C C   . GLY J  1 1  ? -14.298 8.093   2.957   1.00 33.55  ? 1   GLY J C   1 
ATOM   2819 O O   . GLY J  1 1  ? -13.210 7.567   2.724   1.00 34.48  ? 1   GLY J O   1 
ATOM   2820 N N   . ILE J  1 2  ? -14.442 9.416   2.977   1.00 32.29  ? 2   ILE J N   1 
ATOM   2821 C CA  . ILE J  1 2  ? -13.215 10.231  2.923   1.00 26.65  ? 2   ILE J CA  1 
ATOM   2822 C C   . ILE J  1 2  ? -12.649 10.311  4.332   1.00 23.41  ? 2   ILE J C   1 
ATOM   2823 O O   . ILE J  1 2  ? -13.407 10.406  5.300   1.00 21.68  ? 2   ILE J O   1 
ATOM   2824 C CB  . ILE J  1 2  ? -13.494 11.608  2.319   1.00 28.77  ? 2   ILE J CB  1 
ATOM   2825 C CG1 . ILE J  1 2  ? -13.794 11.548  0.816   1.00 22.05  ? 2   ILE J CG1 1 
ATOM   2826 C CG2 . ILE J  1 2  ? -12.358 12.583  2.588   1.00 20.29  ? 2   ILE J CG2 1 
ATOM   2827 C CD1 . ILE J  1 2  ? -14.704 12.640  0.316   1.00 28.31  ? 2   ILE J CD1 1 
ATOM   2828 N N   . GLY J  1 3  ? -11.328 10.260  4.465   1.00 25.23  ? 3   GLY J N   1 
ATOM   2829 C CA  . GLY J  1 3  ? -10.723 10.317  5.782   1.00 27.51  ? 3   GLY J CA  1 
ATOM   2830 C C   . GLY J  1 3  ? -9.575  11.295  5.875   1.00 27.13  ? 3   GLY J C   1 
ATOM   2831 O O   . GLY J  1 3  ? -8.900  11.355  6.907   1.00 29.08  ? 3   GLY J O   1 
ATOM   2832 N N   . ASP J  1 4  ? -9.322  12.056  4.815   1.00 22.33  ? 4   ASP J N   1 
ATOM   2833 C CA  . ASP J  1 4  ? -8.236  13.034  4.873   1.00 26.41  ? 4   ASP J CA  1 
ATOM   2834 C C   . ASP J  1 4  ? -8.693  14.311  4.173   1.00 21.72  ? 4   ASP J C   1 
ATOM   2835 O O   . ASP J  1 4  ? -9.538  14.243  3.277   1.00 20.50  ? 4   ASP J O   1 
ATOM   2836 C CB  . ASP J  1 4  ? -6.948  12.499  4.256   1.00 27.97  ? 4   ASP J CB  1 
ATOM   2837 C CG  . ASP J  1 4  ? -6.954  12.609  2.743   1.00 27.65  ? 4   ASP J CG  1 
ATOM   2838 O OD1 . ASP J  1 4  ? -7.353  11.608  2.110   1.00 32.34  ? 4   ASP J OD1 1 
ATOM   2839 O OD2 . ASP J  1 4  ? -6.556  13.670  2.212   1.00 26.08  ? 4   ASP J OD2 1 
ATOM   2840 N N   . PRO J  1 5  ? -8.147  15.439  4.614   1.00 22.92  ? 5   PRO J N   1 
ATOM   2841 C CA  . PRO J  1 5  ? -8.621  16.754  4.196   1.00 19.27  ? 5   PRO J CA  1 
ATOM   2842 C C   . PRO J  1 5  ? -8.367  17.020  2.721   1.00 14.52  ? 5   PRO J C   1 
ATOM   2843 O O   . PRO J  1 5  ? -9.138  17.702  2.062   1.00 16.60  ? 5   PRO J O   1 
ATOM   2844 C CB  . PRO J  1 5  ? -7.776  17.742  5.015   1.00 16.89  ? 5   PRO J CB  1 
ATOM   2845 C CG  . PRO J  1 5  ? -6.571  16.956  5.409   1.00 21.52  ? 5   PRO J CG  1 
ATOM   2846 C CD  . PRO J  1 5  ? -7.013  15.530  5.557   1.00 24.01  ? 5   PRO J CD  1 
ATOM   2847 N N   . VAL J  1 6  ? -7.263  16.458  2.223   1.00 17.82  ? 6   VAL J N   1 
ATOM   2848 C CA  . VAL J  1 6  ? -6.892  16.690  0.833   1.00 17.10  ? 6   VAL J CA  1 
ATOM   2849 C C   . VAL J  1 6  ? -7.886  16.029  -0.119  1.00 17.52  ? 6   VAL J C   1 
ATOM   2850 O O   . VAL J  1 6  ? -8.343  16.655  -1.079  1.00 22.83  ? 6   VAL J O   1 
ATOM   2851 C CB  . VAL J  1 6  ? -5.447  16.214  0.572   1.00 22.55  ? 6   VAL J CB  1 
ATOM   2852 C CG1 . VAL J  1 6  ? -5.082  16.377  -0.894  1.00 26.83  ? 6   VAL J CG1 1 
ATOM   2853 C CG2 . VAL J  1 6  ? -4.493  16.973  1.476   1.00 19.86  ? 6   VAL J CG2 1 
ATOM   2854 N N   . THR J  1 7  ? -8.225  14.776  0.168   1.00 19.11  ? 7   THR J N   1 
ATOM   2855 C CA  . THR J  1 7  ? -9.257  14.081  -0.597  1.00 22.66  ? 7   THR J CA  1 
ATOM   2856 C C   . THR J  1 7  ? -10.591 14.801  -0.559  1.00 23.28  ? 7   THR J C   1 
ATOM   2857 O O   . THR J  1 7  ? -11.292 14.994  -1.556  1.00 26.06  ? 7   THR J O   1 
ATOM   2858 C CB  . THR J  1 7  ? -9.437  12.657  -0.042  1.00 25.01  ? 7   THR J CB  1 
ATOM   2859 O OG1 . THR J  1 7  ? -8.187  11.982  -0.256  1.00 35.55  ? 7   THR J OG1 1 
ATOM   2860 C CG2 . THR J  1 7  ? -10.517 11.905  -0.794  1.00 32.58  ? 7   THR J CG2 1 
ATOM   2861 N N   . CYS J  1 8  ? -10.962 15.218  0.644   1.00 20.35  ? 8   CYS J N   1 
ATOM   2862 C CA  . CYS J  1 8  ? -12.194 15.987  0.813   1.00 19.81  ? 8   CYS J CA  1 
ATOM   2863 C C   . CYS J  1 8  ? -12.233 17.190  -0.110  1.00 24.07  ? 8   CYS J C   1 
ATOM   2864 O O   . CYS J  1 8  ? -13.117 17.369  -0.947  1.00 25.63  ? 8   CYS J O   1 
ATOM   2865 C CB  . CYS J  1 8  ? -12.310 16.451  2.276   1.00 19.31  ? 8   CYS J CB  1 
ATOM   2866 S SG  . CYS J  1 8  ? -13.862 17.343  2.588   1.00 16.78  ? 8   CYS J SG  1 
ATOM   2867 N N   . LEU J  1 9  ? -11.249 18.072  0.022   1.00 17.63  ? 9   LEU J N   1 
ATOM   2868 C CA  . LEU J  1 9  ? -11.231 19.285  -0.789  1.00 21.81  ? 9   LEU J CA  1 
ATOM   2869 C C   . LEU J  1 9  ? -11.081 18.966  -2.266  1.00 28.26  ? 9   LEU J C   1 
ATOM   2870 O O   . LEU J  1 9  ? -11.679 19.631  -3.107  1.00 24.75  ? 9   LEU J O   1 
ATOM   2871 C CB  . LEU J  1 9  ? -10.116 20.219  -0.304  1.00 26.81  ? 9   LEU J CB  1 
ATOM   2872 C CG  . LEU J  1 9  ? -10.421 20.794  1.102   1.00 20.41  ? 9   LEU J CG  1 
ATOM   2873 C CD1 . LEU J  1 9  ? -9.188  21.421  1.722   1.00 17.94  ? 9   LEU J CD1 1 
ATOM   2874 C CD2 . LEU J  1 9  ? -11.559 21.779  0.957   1.00 17.39  ? 9   LEU J CD2 1 
ATOM   2875 N N   A LYS J  1 10 ? -10.296 17.938  -2.584  0.50 29.15  ? 10  LYS J N   1 
ATOM   2876 N N   B LYS J  1 10 ? -10.288 17.948  -2.604  0.50 29.22  ? 10  LYS J N   1 
ATOM   2877 C CA  A LYS J  1 10 ? -10.141 17.545  -3.982  0.50 29.02  ? 10  LYS J CA  1 
ATOM   2878 C CA  B LYS J  1 10 ? -10.172 17.620  -4.025  0.50 29.06  ? 10  LYS J CA  1 
ATOM   2879 C C   A LYS J  1 10 ? -11.487 17.175  -4.595  0.50 29.42  ? 10  LYS J C   1 
ATOM   2880 C C   B LYS J  1 10 ? -11.535 17.249  -4.599  0.50 28.97  ? 10  LYS J C   1 
ATOM   2881 O O   A LYS J  1 10 ? -11.706 17.352  -5.795  0.50 31.41  ? 10  LYS J O   1 
ATOM   2882 O O   B LYS J  1 10 ? -11.804 17.489  -5.776  0.50 33.15  ? 10  LYS J O   1 
ATOM   2883 C CB  A LYS J  1 10 ? -9.147  16.384  -4.088  0.50 26.62  ? 10  LYS J CB  1 
ATOM   2884 C CB  B LYS J  1 10 ? -9.170  16.482  -4.227  0.50 26.90  ? 10  LYS J CB  1 
ATOM   2885 C CG  A LYS J  1 10 ? -7.711  16.797  -3.802  0.50 28.84  ? 10  LYS J CG  1 
ATOM   2886 C CG  B LYS J  1 10 ? -9.760  15.106  -3.971  0.50 26.84  ? 10  LYS J CG  1 
ATOM   2887 C CD  A LYS J  1 10 ? -6.800  15.600  -3.594  0.50 34.49  ? 10  LYS J CD  1 
ATOM   2888 C CD  B LYS J  1 10 ? -9.289  14.089  -5.001  0.50 31.68  ? 10  LYS J CD  1 
ATOM   2889 C CE  A LYS J  1 10 ? -5.460  15.789  -4.296  0.50 38.15  ? 10  LYS J CE  1 
ATOM   2890 C CE  B LYS J  1 10 ? -7.936  13.511  -4.607  0.50 31.87  ? 10  LYS J CE  1 
ATOM   2891 N NZ  A LYS J  1 10 ? -4.503  14.681  -3.977  0.50 34.77  ? 10  LYS J NZ  1 
ATOM   2892 N NZ  B LYS J  1 10 ? -7.108  13.195  -5.801  0.50 40.70  ? 10  LYS J NZ  1 
ATOM   2893 N N   . SER J  1 11 ? -12.388 16.654  -3.769  1.00 27.23  ? 11  SER J N   1 
ATOM   2894 C CA  . SER J  1 11 ? -13.691 16.202  -4.242  1.00 27.88  ? 11  SER J CA  1 
ATOM   2895 C C   . SER J  1 11 ? -14.634 17.378  -4.473  1.00 28.60  ? 11  SER J C   1 
ATOM   2896 O O   . SER J  1 11 ? -15.742 17.210  -4.981  1.00 36.01  ? 11  SER J O   1 
ATOM   2897 C CB  . SER J  1 11 ? -14.288 15.186  -3.274  1.00 27.61  ? 11  SER J CB  1 
ATOM   2898 O OG  . SER J  1 11 ? -14.981 15.768  -2.183  1.00 26.63  ? 11  SER J OG  1 
ATOM   2899 N N   . GLY J  1 12 ? -14.204 18.578  -4.113  1.00 24.47  ? 12  GLY J N   1 
ATOM   2900 C CA  . GLY J  1 12 ? -15.049 19.756  -4.221  1.00 31.48  ? 12  GLY J CA  1 
ATOM   2901 C C   . GLY J  1 12 ? -15.827 20.071  -2.953  1.00 28.51  ? 12  GLY J C   1 
ATOM   2902 O O   . GLY J  1 12 ? -16.508 21.094  -2.898  1.00 23.63  ? 12  GLY J O   1 
ATOM   2903 N N   . ALA J  1 13 ? -15.724 19.224  -1.933  1.00 19.60  ? 13  ALA J N   1 
ATOM   2904 C CA  . ALA J  1 13 ? -16.444 19.390  -0.679  1.00 14.62  ? 13  ALA J CA  1 
ATOM   2905 C C   . ALA J  1 13 ? -15.781 20.436  0.211   1.00 21.24  ? 13  ALA J C   1 
ATOM   2906 O O   . ALA J  1 13 ? -14.774 21.065  -0.128  1.00 16.19  ? 13  ALA J O   1 
ATOM   2907 C CB  . ALA J  1 13 ? -16.534 18.052  0.025   1.00 13.90  ? 13  ALA J CB  1 
ATOM   2908 N N   . ILE J  1 14 ? -16.375 20.640  1.385   1.00 13.00  ? 14  ILE J N   1 
ATOM   2909 C CA  . ILE J  1 14 ? -15.756 21.566  2.339   1.00 14.46  ? 14  ILE J CA  1 
ATOM   2910 C C   . ILE J  1 14 ? -15.310 20.764  3.554   1.00 11.54  ? 14  ILE J C   1 
ATOM   2911 O O   . ILE J  1 14 ? -15.866 19.707  3.832   1.00 14.56  ? 14  ILE J O   1 
ATOM   2912 C CB  . ILE J  1 14 ? -16.702 22.696  2.792   1.00 23.71  ? 14  ILE J CB  1 
ATOM   2913 C CG1 . ILE J  1 14 ? -17.907 22.197  3.589   1.00 22.33  ? 14  ILE J CG1 1 
ATOM   2914 C CG2 . ILE J  1 14 ? -17.176 23.557  1.628   1.00 25.04  ? 14  ILE J CG2 1 
ATOM   2915 C CD1 . ILE J  1 14 ? -18.668 23.318  4.272   1.00 28.61  ? 14  ILE J CD1 1 
ATOM   2916 N N   . CYS J  1 15 ? -14.326 21.247  4.302   1.00 12.99  ? 15  CYS J N   1 
ATOM   2917 C CA  . CYS J  1 15 ? -14.015 20.681  5.604   1.00 13.53  ? 15  CYS J CA  1 
ATOM   2918 C C   . CYS J  1 15 ? -14.561 21.596  6.690   1.00 11.65  ? 15  CYS J C   1 
ATOM   2919 O O   . CYS J  1 15 ? -14.287 22.799  6.636   1.00 12.97  ? 15  CYS J O   1 
ATOM   2920 C CB  . CYS J  1 15 ? -12.499 20.564  5.813   1.00 14.93  ? 15  CYS J CB  1 
ATOM   2921 S SG  . CYS J  1 15 ? -11.717 19.265  4.835   1.00 17.11  ? 15  CYS J SG  1 
ATOM   2922 N N   A HIS J  1 16 ? -15.301 21.044  7.639   0.50 9.62   ? 16  HIS J N   1 
ATOM   2923 N N   B HIS J  1 16 ? -15.292 21.048  7.644   0.50 9.51   ? 16  HIS J N   1 
ATOM   2924 C CA  A HIS J  1 16 ? -15.852 21.814  8.751   0.50 10.87  ? 16  HIS J CA  1 
ATOM   2925 C CA  B HIS J  1 16 ? -15.843 21.844  8.744   0.50 10.39  ? 16  HIS J CA  1 
ATOM   2926 C C   A HIS J  1 16 ? -15.270 21.285  10.060  0.50 12.53  ? 16  HIS J C   1 
ATOM   2927 C C   B HIS J  1 16 ? -15.292 21.296  10.058  0.50 12.54  ? 16  HIS J C   1 
ATOM   2928 O O   A HIS J  1 16 ? -15.104 20.069  10.190  0.50 17.03  ? 16  HIS J O   1 
ATOM   2929 O O   B HIS J  1 16 ? -15.169 20.075  10.191  0.50 16.97  ? 16  HIS J O   1 
ATOM   2930 C CB  A HIS J  1 16 ? -17.372 21.704  8.803   0.50 13.21  ? 16  HIS J CB  1 
ATOM   2931 C CB  B HIS J  1 16 ? -17.358 21.764  8.731   0.50 13.06  ? 16  HIS J CB  1 
ATOM   2932 C CG  A HIS J  1 16 ? -18.073 23.010  8.623   0.50 15.27  ? 16  HIS J CG  1 
ATOM   2933 C CG  B HIS J  1 16 ? -18.097 22.874  9.386   0.50 14.23  ? 16  HIS J CG  1 
ATOM   2934 N ND1 A HIS J  1 16 ? -18.646 23.702  9.662   0.50 19.36  ? 16  HIS J ND1 1 
ATOM   2935 N ND1 B HIS J  1 16 ? -18.301 22.964  10.748  0.50 17.70  ? 16  HIS J ND1 1 
ATOM   2936 C CD2 A HIS J  1 16 ? -18.287 23.751  7.516   0.50 20.87  ? 16  HIS J CD2 1 
ATOM   2937 C CD2 B HIS J  1 16 ? -18.705 23.954  8.837   0.50 14.44  ? 16  HIS J CD2 1 
ATOM   2938 C CE1 A HIS J  1 16 ? -19.189 24.813  9.205   0.50 22.43  ? 16  HIS J CE1 1 
ATOM   2939 C CE1 B HIS J  1 16 ? -19.005 24.062  11.000  0.50 15.23  ? 16  HIS J CE1 1 
ATOM   2940 N NE2 A HIS J  1 16 ? -18.986 24.871  7.903   0.50 18.91  ? 16  HIS J NE2 1 
ATOM   2941 N NE2 B HIS J  1 16 ? -19.257 24.674  9.871   0.50 21.24  ? 16  HIS J NE2 1 
ATOM   2942 N N   . PRO J  1 17 ? -14.950 22.162  10.996  1.00 13.04  ? 17  PRO J N   1 
ATOM   2943 C CA  . PRO J  1 17 ? -14.332 21.721  12.249  1.00 21.42  ? 17  PRO J CA  1 
ATOM   2944 C C   . PRO J  1 17 ? -15.202 20.899  13.173  1.00 30.13  ? 17  PRO J C   1 
ATOM   2945 O O   . PRO J  1 17 ? -14.650 20.215  14.057  1.00 30.41  ? 17  PRO J O   1 
ATOM   2946 C CB  . PRO J  1 17 ? -13.958 23.053  12.931  1.00 18.08  ? 17  PRO J CB  1 
ATOM   2947 C CG  . PRO J  1 17 ? -14.907 24.046  12.350  1.00 20.33  ? 17  PRO J CG  1 
ATOM   2948 C CD  . PRO J  1 17 ? -15.090 23.629  10.918  1.00 17.53  ? 17  PRO J CD  1 
ATOM   2949 N N   . VAL J  1 18 ? -16.528 20.883  13.100  1.00 23.63  ? 18  VAL J N   1 
ATOM   2950 C CA  . VAL J  1 18 ? -17.209 20.071  14.122  1.00 28.21  ? 18  VAL J CA  1 
ATOM   2951 C C   . VAL J  1 18 ? -18.392 19.310  13.533  1.00 28.19  ? 18  VAL J C   1 
ATOM   2952 O O   . VAL J  1 18 ? -18.579 18.126  13.820  1.00 23.02  ? 18  VAL J O   1 
ATOM   2953 C CB  . VAL J  1 18 ? -17.697 20.934  15.298  1.00 36.51  ? 18  VAL J CB  1 
ATOM   2954 C CG1 . VAL J  1 18 ? -18.597 20.106  16.213  1.00 34.05  ? 18  VAL J CG1 1 
ATOM   2955 C CG2 . VAL J  1 18 ? -16.549 21.523  16.107  1.00 31.97  ? 18  VAL J CG2 1 
ATOM   2956 N N   . PHE J  1 19 ? -19.178 19.997  12.708  1.00 21.51  ? 19  PHE J N   1 
ATOM   2957 C CA  . PHE J  1 19 ? -20.370 19.407  12.104  1.00 25.12  ? 19  PHE J CA  1 
ATOM   2958 C C   . PHE J  1 19 ? -20.622 19.908  10.691  1.00 26.89  ? 19  PHE J C   1 
ATOM   2959 O O   . PHE J  1 19 ? -20.062 20.927  10.267  1.00 30.88  ? 19  PHE J O   1 
ATOM   2960 C CB  . PHE J  1 19 ? -21.586 19.755  12.989  1.00 26.50  ? 19  PHE J CB  1 
ATOM   2961 C CG  . PHE J  1 19 ? -21.669 21.258  13.223  1.00 22.15  ? 19  PHE J CG  1 
ATOM   2962 C CD1 . PHE J  1 19 ? -22.458 22.046  12.410  1.00 24.40  ? 19  PHE J CD1 1 
ATOM   2963 C CD2 . PHE J  1 19 ? -20.957 21.858  14.249  1.00 27.99  ? 19  PHE J CD2 1 
ATOM   2964 C CE1 . PHE J  1 19 ? -22.527 23.413  12.622  1.00 21.57  ? 19  PHE J CE1 1 
ATOM   2965 C CE2 . PHE J  1 19 ? -21.012 23.223  14.460  1.00 39.92  ? 19  PHE J CE2 1 
ATOM   2966 C CZ  . PHE J  1 19 ? -21.813 24.007  13.642  1.00 35.03  ? 19  PHE J CZ  1 
ATOM   2967 N N   . CYS J  1 20 ? -21.488 19.236  9.936   1.00 19.51  ? 20  CYS J N   1 
ATOM   2968 C CA  . CYS J  1 20 ? -21.857 19.737  8.616   1.00 18.39  ? 20  CYS J CA  1 
ATOM   2969 C C   . CYS J  1 20 ? -23.118 20.595  8.694   1.00 30.27  ? 20  CYS J C   1 
ATOM   2970 O O   . CYS J  1 20 ? -24.162 20.138  9.191   1.00 29.13  ? 20  CYS J O   1 
ATOM   2971 C CB  . CYS J  1 20 ? -22.118 18.608  7.622   1.00 21.15  ? 20  CYS J CB  1 
ATOM   2972 S SG  . CYS J  1 20 ? -20.701 17.620  7.105   1.00 18.24  ? 20  CYS J SG  1 
ATOM   2973 N N   . PRO J  1 21 ? -23.071 21.822  8.193   1.00 24.00  ? 21  PRO J N   1 
ATOM   2974 C CA  . PRO J  1 21 ? -24.315 22.615  8.211   1.00 24.23  ? 21  PRO J CA  1 
ATOM   2975 C C   . PRO J  1 21 ? -25.368 21.894  7.373   1.00 33.96  ? 21  PRO J C   1 
ATOM   2976 O O   . PRO J  1 21 ? -25.032 21.331  6.333   1.00 21.08  ? 21  PRO J O   1 
ATOM   2977 C CB  . PRO J  1 21 ? -23.945 23.939  7.571   1.00 21.92  ? 21  PRO J CB  1 
ATOM   2978 C CG  . PRO J  1 21 ? -22.450 23.984  7.591   1.00 32.99  ? 21  PRO J CG  1 
ATOM   2979 C CD  . PRO J  1 21 ? -21.954 22.561  7.602   1.00 26.54  ? 21  PRO J CD  1 
ATOM   2980 N N   . ARG J  1 22 ? -26.608 21.940  7.851   1.00 43.93  ? 22  ARG J N   1 
ATOM   2981 C CA  . ARG J  1 22 ? -27.702 21.277  7.148   1.00 45.44  ? 22  ARG J CA  1 
ATOM   2982 C C   . ARG J  1 22 ? -27.979 22.014  5.836   1.00 38.78  ? 22  ARG J C   1 
ATOM   2983 O O   . ARG J  1 22 ? -28.829 22.904  5.811   1.00 52.40  ? 22  ARG J O   1 
ATOM   2984 C CB  . ARG J  1 22 ? -28.953 21.207  8.019   1.00 55.93  ? 22  ARG J CB  1 
ATOM   2985 C CG  . ARG J  1 22 ? -29.475 22.545  8.505   1.00 64.96  ? 22  ARG J CG  1 
ATOM   2986 C CD  . ARG J  1 22 ? -30.340 22.394  9.744   1.00 73.72  ? 22  ARG J CD  1 
ATOM   2987 N NE  . ARG J  1 22 ? -29.743 21.473  10.710  1.00 81.13  ? 22  ARG J NE  1 
ATOM   2988 C CZ  . ARG J  1 22 ? -30.399 20.999  11.768  1.00 84.70  ? 22  ARG J CZ  1 
ATOM   2989 N NH1 . ARG J  1 22 ? -31.657 21.372  11.961  1.00 83.74  ? 22  ARG J NH1 1 
ATOM   2990 N NH2 . ARG J  1 22 ? -29.795 20.160  12.608  1.00 88.74  ? 22  ARG J NH2 1 
ATOM   2991 N N   . ARG J  1 23 ? -27.255 21.627  4.810   1.00 31.62  ? 23  ARG J N   1 
ATOM   2992 C CA  . ARG J  1 23 ? -27.244 22.179  3.462   1.00 37.15  ? 23  ARG J CA  1 
ATOM   2993 C C   . ARG J  1 23 ? -26.183 21.450  2.640   1.00 36.52  ? 23  ARG J C   1 
ATOM   2994 O O   . ARG J  1 23 ? -26.080 21.509  1.418   1.00 31.86  ? 23  ARG J O   1 
ATOM   2995 C CB  . ARG J  1 23 ? -26.992 23.678  3.501   1.00 48.00  ? 23  ARG J CB  1 
ATOM   2996 C CG  . ARG J  1 23 ? -25.806 24.159  2.648   1.00 54.13  ? 23  ARG J CG  1 
ATOM   2997 C CD  . ARG J  1 23 ? -25.600 25.654  2.858   1.00 63.33  ? 23  ARG J CD  1 
ATOM   2998 N NE  . ARG J  1 23 ? -24.758 25.925  4.020   1.00 72.00  ? 23  ARG J NE  1 
ATOM   2999 C CZ  . ARG J  1 23 ? -23.836 26.877  4.067   1.00 80.42  ? 23  ARG J CZ  1 
ATOM   3000 N NH1 . ARG J  1 23 ? -23.630 27.640  3.001   1.00 88.89  ? 23  ARG J NH1 1 
ATOM   3001 N NH2 . ARG J  1 23 ? -23.105 27.073  5.157   1.00 83.89  ? 23  ARG J NH2 1 
ATOM   3002 N N   . TYR J  1 24 ? -25.375 20.723  3.408   1.00 23.25  ? 24  TYR J N   1 
ATOM   3003 C CA  . TYR J  1 24 ? -24.397 19.784  2.918   1.00 24.10  ? 24  TYR J CA  1 
ATOM   3004 C C   . TYR J  1 24 ? -24.718 18.384  3.413   1.00 19.99  ? 24  TYR J C   1 
ATOM   3005 O O   . TYR J  1 24 ? -25.299 18.259  4.493   1.00 20.48  ? 24  TYR J O   1 
ATOM   3006 C CB  . TYR J  1 24 ? -22.984 20.143  3.420   1.00 25.01  ? 24  TYR J CB  1 
ATOM   3007 C CG  . TYR J  1 24 ? -22.487 21.480  2.924   1.00 24.51  ? 24  TYR J CG  1 
ATOM   3008 C CD1 . TYR J  1 24 ? -22.795 22.663  3.579   1.00 27.53  ? 24  TYR J CD1 1 
ATOM   3009 C CD2 . TYR J  1 24 ? -21.695 21.546  1.786   1.00 27.61  ? 24  TYR J CD2 1 
ATOM   3010 C CE1 . TYR J  1 24 ? -22.336 23.886  3.119   1.00 27.39  ? 24  TYR J CE1 1 
ATOM   3011 C CE2 . TYR J  1 24 ? -21.231 22.761  1.317   1.00 37.43  ? 24  TYR J CE2 1 
ATOM   3012 C CZ  . TYR J  1 24 ? -21.553 23.924  1.987   1.00 35.47  ? 24  TYR J CZ  1 
ATOM   3013 O OH  . TYR J  1 24 ? -21.081 25.121  1.502   1.00 35.01  ? 24  TYR J OH  1 
ATOM   3014 N N   . LYS J  1 25 ? -24.315 17.356  2.675   1.00 23.35  ? 25  LYS J N   1 
ATOM   3015 C CA  . LYS J  1 25 ? -24.325 16.025  3.281   1.00 27.72  ? 25  LYS J CA  1 
ATOM   3016 C C   . LYS J  1 25 ? -22.925 15.663  3.775   1.00 28.09  ? 25  LYS J C   1 
ATOM   3017 O O   . LYS J  1 25 ? -21.943 16.050  3.136   1.00 22.83  ? 25  LYS J O   1 
ATOM   3018 C CB  . LYS J  1 25 ? -24.801 14.947  2.304   1.00 37.19  ? 25  LYS J CB  1 
ATOM   3019 C CG  . LYS J  1 25 ? -24.972 13.599  2.999   1.00 48.59  ? 25  LYS J CG  1 
ATOM   3020 C CD  . LYS J  1 25 ? -25.325 12.488  2.023   1.00 52.12  ? 25  LYS J CD  1 
ATOM   3021 C CE  . LYS J  1 25 ? -26.821 12.224  1.985   1.00 43.10  ? 25  LYS J CE  1 
ATOM   3022 N NZ  . LYS J  1 25 ? -27.380 12.473  0.623   1.00 47.17  ? 25  LYS J NZ  1 
ATOM   3023 N N   . GLN J  1 26 ? -22.817 14.940  4.873   1.00 23.54  ? 26  GLN J N   1 
ATOM   3024 C CA  . GLN J  1 26 ? -21.547 14.437  5.375   1.00 22.67  ? 26  GLN J CA  1 
ATOM   3025 C C   . GLN J  1 26 ? -21.000 13.266  4.579   1.00 26.58  ? 26  GLN J C   1 
ATOM   3026 O O   . GLN J  1 26 ? -21.585 12.174  4.529   1.00 37.62  ? 26  GLN J O   1 
ATOM   3027 C CB  . GLN J  1 26 ? -21.721 14.017  6.852   1.00 21.88  ? 26  GLN J CB  1 
ATOM   3028 C CG  . GLN J  1 26 ? -20.396 13.617  7.482   1.00 29.94  ? 26  GLN J CG  1 
ATOM   3029 C CD  . GLN J  1 26 ? -20.459 13.390  8.975   1.00 27.83  ? 26  GLN J CD  1 
ATOM   3030 O OE1 . GLN J  1 26 ? -21.248 14.009  9.690   1.00 45.53  ? 26  GLN J OE1 1 
ATOM   3031 N NE2 . GLN J  1 26 ? -19.613 12.495  9.478   1.00 29.86  ? 26  GLN J NE2 1 
ATOM   3032 N N   . ILE J  1 27 ? -19.857 13.401  3.920   1.00 23.42  ? 27  ILE J N   1 
ATOM   3033 C CA  . ILE J  1 27 ? -19.310 12.262  3.156   1.00 26.51  ? 27  ILE J CA  1 
ATOM   3034 C C   . ILE J  1 27 ? -18.025 11.697  3.737   1.00 26.70  ? 27  ILE J C   1 
ATOM   3035 O O   . ILE J  1 27 ? -17.332 10.854  3.147   1.00 25.58  ? 27  ILE J O   1 
ATOM   3036 C CB  . ILE J  1 27 ? -19.085 12.696  1.699   1.00 28.19  ? 27  ILE J CB  1 
ATOM   3037 C CG1 . ILE J  1 27 ? -18.163 13.902  1.521   1.00 29.38  ? 27  ILE J CG1 1 
ATOM   3038 C CG2 . ILE J  1 27 ? -20.429 12.962  1.034   1.00 36.88  ? 27  ILE J CG2 1 
ATOM   3039 C CD1 . ILE J  1 27 ? -17.709 14.115  0.093   1.00 21.49  ? 27  ILE J CD1 1 
ATOM   3040 N N   . GLY J  1 28 ? -17.690 12.166  4.934   1.00 20.97  ? 28  GLY J N   1 
ATOM   3041 C CA  . GLY J  1 28 ? -16.511 11.677  5.627   1.00 25.49  ? 28  GLY J CA  1 
ATOM   3042 C C   . GLY J  1 28 ? -15.986 12.660  6.662   1.00 21.54  ? 28  GLY J C   1 
ATOM   3043 O O   . GLY J  1 28 ? -16.728 13.460  7.213   1.00 17.38  ? 28  GLY J O   1 
ATOM   3044 N N   . THR J  1 29 ? -14.688 12.591  6.928   1.00 21.37  ? 29  THR J N   1 
ATOM   3045 C CA  . THR J  1 29 ? -14.010 13.461  7.875   1.00 18.79  ? 29  THR J CA  1 
ATOM   3046 C C   . THR J  1 29 ? -12.840 14.145  7.179   1.00 18.23  ? 29  THR J C   1 
ATOM   3047 O O   . THR J  1 29 ? -12.534 13.811  6.027   1.00 18.10  ? 29  THR J O   1 
ATOM   3048 C CB  . THR J  1 29 ? -13.483 12.678  9.095   1.00 20.97  ? 29  THR J CB  1 
ATOM   3049 O OG1 . THR J  1 29 ? -12.335 11.922  8.684   1.00 25.91  ? 29  THR J OG1 1 
ATOM   3050 C CG2 . THR J  1 29 ? -14.513 11.687  9.600   1.00 23.94  ? 29  THR J CG2 1 
ATOM   3051 N N   . CYS J  1 30 ? -12.163 15.080  7.826   1.00 12.40  ? 30  CYS J N   1 
ATOM   3052 C CA  . CYS J  1 30 ? -10.986 15.714  7.250   1.00 13.29  ? 30  CYS J CA  1 
ATOM   3053 C C   . CYS J  1 30 ? -9.734  15.431  8.087   1.00 16.59  ? 30  CYS J C   1 
ATOM   3054 O O   . CYS J  1 30 ? -8.878  16.306  8.250   1.00 17.21  ? 30  CYS J O   1 
ATOM   3055 C CB  . CYS J  1 30 ? -11.188 17.227  7.071   1.00 11.21  ? 30  CYS J CB  1 
ATOM   3056 S SG  . CYS J  1 30 ? -12.374 17.561  5.725   1.00 15.23  ? 30  CYS J SG  1 
ATOM   3057 N N   . GLY J  1 31 ? -9.642  14.205  8.590   1.00 18.73  ? 31  GLY J N   1 
ATOM   3058 C CA  . GLY J  1 31 ? -8.415  13.780  9.273   1.00 17.44  ? 31  GLY J CA  1 
ATOM   3059 C C   . GLY J  1 31 ? -8.365  14.248  10.714  1.00 19.70  ? 31  GLY J C   1 
ATOM   3060 O O   . GLY J  1 31 ? -8.405  13.392  11.597  1.00 25.42  ? 31  GLY J O   1 
ATOM   3061 N N   . LEU J  1 32 ? -8.281  15.545  10.979  1.00 18.78  ? 32  LEU J N   1 
ATOM   3062 C CA  . LEU J  1 32 ? -8.242  16.035  12.367  1.00 19.48  ? 32  LEU J CA  1 
ATOM   3063 C C   . LEU J  1 32 ? -9.452  15.548  13.133  1.00 17.42  ? 32  LEU J C   1 
ATOM   3064 O O   . LEU J  1 32 ? -10.566 15.611  12.574  1.00 17.36  ? 32  LEU J O   1 
ATOM   3065 C CB  . LEU J  1 32 ? -8.166  17.560  12.352  1.00 20.61  ? 32  LEU J CB  1 
ATOM   3066 C CG  . LEU J  1 32 ? -8.018  18.240  13.722  1.00 17.23  ? 32  LEU J CG  1 
ATOM   3067 C CD1 . LEU J  1 32 ? -6.616  18.035  14.266  1.00 12.72  ? 32  LEU J CD1 1 
ATOM   3068 C CD2 . LEU J  1 32 ? -8.334  19.727  13.628  1.00 17.17  ? 32  LEU J CD2 1 
ATOM   3069 N N   . PRO J  1 33 ? -9.331  15.042  14.352  1.00 18.09  ? 33  PRO J N   1 
ATOM   3070 C CA  . PRO J  1 33 ? -10.493 14.517  15.079  1.00 20.67  ? 33  PRO J CA  1 
ATOM   3071 C C   . PRO J  1 33 ? -11.611 15.540  15.248  1.00 20.74  ? 33  PRO J C   1 
ATOM   3072 O O   . PRO J  1 33 ? -11.390 16.689  15.612  1.00 22.80  ? 33  PRO J O   1 
ATOM   3073 C CB  . PRO J  1 33 ? -9.904  14.159  16.461  1.00 19.15  ? 33  PRO J CB  1 
ATOM   3074 C CG  . PRO J  1 33 ? -8.486  13.808  16.113  1.00 15.65  ? 33  PRO J CG  1 
ATOM   3075 C CD  . PRO J  1 33 ? -8.086  14.904  15.152  1.00 17.74  ? 33  PRO J CD  1 
ATOM   3076 N N   . GLY J  1 34 ? -12.839 15.123  14.965  1.00 19.78  ? 34  GLY J N   1 
ATOM   3077 C CA  . GLY J  1 34 ? -13.977 16.014  15.026  1.00 20.65  ? 34  GLY J CA  1 
ATOM   3078 C C   . GLY J  1 34 ? -14.364 16.582  13.678  1.00 20.33  ? 34  GLY J C   1 
ATOM   3079 O O   . GLY J  1 34 ? -15.521 16.951  13.458  1.00 20.06  ? 34  GLY J O   1 
ATOM   3080 N N   . THR J  1 35 ? -13.410 16.684  12.758  1.00 16.39  ? 35  THR J N   1 
ATOM   3081 C CA  . THR J  1 35 ? -13.723 17.397  11.507  1.00 17.81  ? 35  THR J CA  1 
ATOM   3082 C C   . THR J  1 35 ? -14.586 16.550  10.581  1.00 23.95  ? 35  THR J C   1 
ATOM   3083 O O   . THR J  1 35 ? -14.611 15.326  10.635  1.00 16.97  ? 35  THR J O   1 
ATOM   3084 C CB  . THR J  1 35 ? -12.448 17.867  10.786  1.00 12.60  ? 35  THR J CB  1 
ATOM   3085 O OG1 . THR J  1 35 ? -11.655 16.722  10.441  1.00 14.55  ? 35  THR J OG1 1 
ATOM   3086 C CG2 . THR J  1 35 ? -11.622 18.741  11.717  1.00 17.29  ? 35  THR J CG2 1 
ATOM   3087 N N   . LYS J  1 36 ? -15.323 17.247  9.717   1.00 16.27  ? 36  LYS J N   1 
ATOM   3088 C CA  . LYS J  1 36 ? -16.302 16.660  8.830   1.00 14.14  ? 36  LYS J CA  1 
ATOM   3089 C C   . LYS J  1 36 ? -16.091 17.104  7.395   1.00 14.33  ? 36  LYS J C   1 
ATOM   3090 O O   . LYS J  1 36 ? -15.842 18.286  7.187   1.00 16.18  ? 36  LYS J O   1 
ATOM   3091 C CB  . LYS J  1 36 ? -17.719 17.100  9.258   1.00 14.83  ? 36  LYS J CB  1 
ATOM   3092 C CG  . LYS J  1 36 ? -18.001 16.727  10.701  1.00 18.43  ? 36  LYS J CG  1 
ATOM   3093 C CD  . LYS J  1 36 ? -18.091 15.212  10.854  1.00 22.34  ? 36  LYS J CD  1 
ATOM   3094 C CE  . LYS J  1 36 ? -18.834 14.865  12.135  1.00 29.41  ? 36  LYS J CE  1 
ATOM   3095 N NZ  . LYS J  1 36 ? -18.009 15.088  13.355  1.00 34.24  ? 36  LYS J NZ  1 
ATOM   3096 N N   . CYS J  1 37 ? -16.215 16.153  6.473   1.00 12.53  ? 37  CYS J N   1 
ATOM   3097 C CA  . CYS J  1 37 ? -16.173 16.469  5.057   1.00 11.71  ? 37  CYS J CA  1 
ATOM   3098 C C   . CYS J  1 37 ? -17.636 16.616  4.586   1.00 14.86  ? 37  CYS J C   1 
ATOM   3099 O O   . CYS J  1 37 ? -18.417 15.688  4.779   1.00 20.99  ? 37  CYS J O   1 
ATOM   3100 C CB  . CYS J  1 37 ? -15.475 15.402  4.210   1.00 18.00  ? 37  CYS J CB  1 
ATOM   3101 S SG  . CYS J  1 37 ? -15.274 15.887  2.459   1.00 19.87  ? 37  CYS J SG  1 
ATOM   3102 N N   . CYS J  1 38 ? -17.944 17.768  4.019   1.00 15.63  ? 38  CYS J N   1 
ATOM   3103 C CA  . CYS J  1 38 ? -19.341 18.097  3.738   1.00 16.66  ? 38  CYS J CA  1 
ATOM   3104 C C   . CYS J  1 38 ? -19.505 18.476  2.280   1.00 19.14  ? 38  CYS J C   1 
ATOM   3105 O O   . CYS J  1 38 ? -18.763 19.277  1.724   1.00 17.58  ? 38  CYS J O   1 
ATOM   3106 C CB  . CYS J  1 38 ? -19.802 19.226  4.669   1.00 16.25  ? 38  CYS J CB  1 
ATOM   3107 S SG  . CYS J  1 38 ? -19.375 19.002  6.418   1.00 17.87  ? 38  CYS J SG  1 
ATOM   3108 N N   . LYS J  1 39 ? -20.505 17.900  1.610   1.00 26.21  ? 39  LYS J N   1 
ATOM   3109 C CA  . LYS J  1 39 ? -20.699 18.310  0.218   1.00 26.47  ? 39  LYS J CA  1 
ATOM   3110 C C   . LYS J  1 39 ? -22.184 18.479  -0.081  1.00 30.56  ? 39  LYS J C   1 
ATOM   3111 O O   . LYS J  1 39 ? -23.025 17.706  0.374   1.00 30.29  ? 39  LYS J O   1 
ATOM   3112 C CB  . LYS J  1 39 ? -20.106 17.329  -0.790  1.00 32.65  ? 39  LYS J CB  1 
ATOM   3113 C CG  . LYS J  1 39 ? -20.291 17.798  -2.232  1.00 37.73  ? 39  LYS J CG  1 
ATOM   3114 C CD  . LYS J  1 39 ? -19.675 16.810  -3.207  1.00 42.57  ? 39  LYS J CD  1 
ATOM   3115 C CE  . LYS J  1 39 ? -20.305 16.913  -4.584  1.00 45.00  ? 39  LYS J CE  1 
ATOM   3116 N NZ  . LYS J  1 39 ? -19.586 16.074  -5.583  1.00 53.81  ? 39  LYS J NZ  1 
ATOM   3117 N N   . LYS J  1 40 ? -22.472 19.511  -0.874  1.00 28.53  ? 40  LYS J N   1 
ATOM   3118 C CA  . LYS J  1 40 ? -23.891 19.676  -1.220  1.00 37.77  ? 40  LYS J CA  1 
ATOM   3119 C C   . LYS J  1 40 ? -24.390 18.448  -1.966  1.00 35.23  ? 40  LYS J C   1 
ATOM   3120 O O   . LYS J  1 40 ? -23.718 17.879  -2.832  1.00 26.57  ? 40  LYS J O   1 
ATOM   3121 C CB  . LYS J  1 40 ? -24.060 20.970  -2.007  1.00 43.15  ? 40  LYS J CB  1 
ATOM   3122 C CG  . LYS J  1 40 ? -24.075 22.202  -1.103  1.00 41.32  ? 40  LYS J CG  1 
ATOM   3123 C CD  . LYS J  1 40 ? -23.295 23.339  -1.750  1.00 48.10  ? 40  LYS J CD  1 
ATOM   3124 C CE  . LYS J  1 40 ? -23.749 24.694  -1.235  1.00 54.33  ? 40  LYS J CE  1 
ATOM   3125 N NZ  . LYS J  1 40 ? -23.250 25.809  -2.092  1.00 63.94  ? 40  LYS J NZ  1 
ATOM   3126 N N   . PRO J  1 41 ? -25.592 18.023  -1.595  1.00 49.65  ? 41  PRO J N   1 
ATOM   3127 C CA  . PRO J  1 41 ? -26.198 16.827  -2.185  1.00 59.74  ? 41  PRO J CA  1 
ATOM   3128 C C   . PRO J  1 41 ? -26.431 17.017  -3.684  1.00 54.72  ? 41  PRO J C   1 
ATOM   3129 O O   . PRO J  1 41 ? -26.439 18.171  -4.143  1.00 33.15  ? 41  PRO J O   1 
ATOM   3130 C CB  . PRO J  1 41 ? -27.537 16.709  -1.456  1.00 56.63  ? 41  PRO J CB  1 
ATOM   3131 C CG  . PRO J  1 41 ? -27.820 18.104  -0.993  1.00 54.40  ? 41  PRO J CG  1 
ATOM   3132 C CD  . PRO J  1 41 ? -26.476 18.657  -0.596  1.00 50.61  ? 41  PRO J CD  1 
ATOM   3133 O OXT . PRO J  1 41 ? -26.597 15.985  -4.367  1.00 55.74  ? 41  PRO J OXT 1 
ATOM   3134 N N   . GLY K  1 1  ? 7.977   30.516  14.036  1.00 18.05  ? 1   GLY K N   1 
ATOM   3135 C CA  . GLY K  1 1  ? 8.456   29.348  13.300  1.00 29.42  ? 1   GLY K CA  1 
ATOM   3136 C C   . GLY K  1 1  ? 7.769   29.251  11.954  1.00 21.45  ? 1   GLY K C   1 
ATOM   3137 O O   . GLY K  1 1  ? 6.637   29.702  11.781  1.00 28.41  ? 1   GLY K O   1 
ATOM   3138 N N   . ILE K  1 2  ? 8.409   28.672  10.939  1.00 15.37  ? 2   ILE K N   1 
ATOM   3139 C CA  . ILE K  1 2  ? 7.669   28.559  9.666   1.00 10.87  ? 2   ILE K CA  1 
ATOM   3140 C C   . ILE K  1 2  ? 6.676   27.424  9.741   1.00 10.56  ? 2   ILE K C   1 
ATOM   3141 O O   . ILE K  1 2  ? 6.980   26.309  10.181  1.00 11.70  ? 2   ILE K O   1 
ATOM   3142 C CB  . ILE K  1 2  ? 8.646   28.376  8.490   1.00 16.69  ? 2   ILE K CB  1 
ATOM   3143 C CG1 . ILE K  1 2  ? 9.586   29.575  8.309   1.00 15.08  ? 2   ILE K CG1 1 
ATOM   3144 C CG2 . ILE K  1 2  ? 7.854   28.050  7.226   1.00 16.37  ? 2   ILE K CG2 1 
ATOM   3145 C CD1 . ILE K  1 2  ? 10.615  29.468  7.210   1.00 18.37  ? 2   ILE K CD1 1 
ATOM   3146 N N   . GLY K  1 3  ? 5.429   27.650  9.303   1.00 13.58  ? 3   GLY K N   1 
ATOM   3147 C CA  . GLY K  1 3  ? 4.425   26.605  9.409   1.00 12.72  ? 3   GLY K CA  1 
ATOM   3148 C C   . GLY K  1 3  ? 3.558   26.450  8.186   1.00 15.42  ? 3   GLY K C   1 
ATOM   3149 O O   . GLY K  1 3  ? 2.479   25.856  8.253   1.00 16.16  ? 3   GLY K O   1 
ATOM   3150 N N   . ASP K  1 4  ? 4.030   26.998  7.059   1.00 12.69  ? 4   ASP K N   1 
ATOM   3151 C CA  . ASP K  1 4  ? 3.264   26.814  5.828   1.00 11.43  ? 4   ASP K CA  1 
ATOM   3152 C C   . ASP K  1 4  ? 4.230   26.721  4.660   1.00 16.88  ? 4   ASP K C   1 
ATOM   3153 O O   . ASP K  1 4  ? 5.319   27.313  4.672   1.00 14.04  ? 4   ASP K O   1 
ATOM   3154 C CB  . ASP K  1 4  ? 2.239   27.939  5.653   1.00 17.88  ? 4   ASP K CB  1 
ATOM   3155 C CG  . ASP K  1 4  ? 2.845   29.214  5.104   1.00 12.43  ? 4   ASP K CG  1 
ATOM   3156 O OD1 . ASP K  1 4  ? 3.241   30.083  5.907   1.00 14.97  ? 4   ASP K OD1 1 
ATOM   3157 O OD2 . ASP K  1 4  ? 2.902   29.311  3.863   1.00 13.76  ? 4   ASP K OD2 1 
ATOM   3158 N N   . PRO K  1 5  ? 3.867   25.938  3.651   1.00 12.95  ? 5   PRO K N   1 
ATOM   3159 C CA  . PRO K  1 5  ? 4.810   25.673  2.560   1.00 11.70  ? 5   PRO K CA  1 
ATOM   3160 C C   . PRO K  1 5  ? 5.173   26.896  1.728   1.00 9.66   ? 5   PRO K C   1 
ATOM   3161 O O   . PRO K  1 5  ? 6.308   26.965  1.247   1.00 9.92   ? 5   PRO K O   1 
ATOM   3162 C CB  . PRO K  1 5  ? 4.081   24.677  1.654   1.00 15.20  ? 5   PRO K CB  1 
ATOM   3163 C CG  . PRO K  1 5  ? 2.638   24.792  2.035   1.00 20.30  ? 5   PRO K CG  1 
ATOM   3164 C CD  . PRO K  1 5  ? 2.596   25.243  3.474   1.00 12.00  ? 5   PRO K CD  1 
ATOM   3165 N N   . VAL K  1 6  ? 4.237   27.826  1.562   1.00 10.52  ? 6   VAL K N   1 
ATOM   3166 C CA  . VAL K  1 6  ? 4.528   28.968  0.687   1.00 14.36  ? 6   VAL K CA  1 
ATOM   3167 C C   . VAL K  1 6  ? 5.629   29.819  1.313   1.00 15.72  ? 6   VAL K C   1 
ATOM   3168 O O   . VAL K  1 6  ? 6.597   30.210  0.646   1.00 12.61  ? 6   VAL K O   1 
ATOM   3169 C CB  . VAL K  1 6  ? 3.250   29.772  0.384   1.00 14.31  ? 6   VAL K CB  1 
ATOM   3170 C CG1 . VAL K  1 6  ? 3.571   31.058  -0.372  1.00 14.17  ? 6   VAL K CG1 1 
ATOM   3171 C CG2 . VAL K  1 6  ? 2.270   28.948  -0.430  1.00 17.90  ? 6   VAL K CG2 1 
ATOM   3172 N N   . THR K  1 7  ? 5.501   30.109  2.613   1.00 11.79  ? 7   THR K N   1 
ATOM   3173 C CA  . THR K  1 7  ? 6.530   30.827  3.361   1.00 12.85  ? 7   THR K CA  1 
ATOM   3174 C C   . THR K  1 7  ? 7.868   30.111  3.320   1.00 9.89   ? 7   THR K C   1 
ATOM   3175 O O   . THR K  1 7  ? 8.914   30.730  3.104   1.00 11.66  ? 7   THR K O   1 
ATOM   3176 C CB  . THR K  1 7  ? 6.083   31.016  4.829   1.00 15.45  ? 7   THR K CB  1 
ATOM   3177 O OG1 . THR K  1 7  ? 4.864   31.783  4.814   1.00 14.29  ? 7   THR K OG1 1 
ATOM   3178 C CG2 . THR K  1 7  ? 7.113   31.785  5.628   1.00 15.40  ? 7   THR K CG2 1 
ATOM   3179 N N   . CYS K  1 8  ? 7.828   28.786  3.504   1.00 9.47   ? 8   CYS K N   1 
ATOM   3180 C CA  . CYS K  1 8  ? 9.059   27.990  3.425   1.00 12.57  ? 8   CYS K CA  1 
ATOM   3181 C C   . CYS K  1 8  ? 9.809   28.237  2.117   1.00 9.62   ? 8   CYS K C   1 
ATOM   3182 O O   . CYS K  1 8  ? 10.979  28.579  2.082   1.00 12.41  ? 8   CYS K O   1 
ATOM   3183 C CB  . CYS K  1 8  ? 8.732   26.495  3.541   1.00 12.30  ? 8   CYS K CB  1 
ATOM   3184 S SG  . CYS K  1 8  ? 10.182  25.422  3.672   1.00 11.25  ? 8   CYS K SG  1 
ATOM   3185 N N   . LEU K  1 9  ? 9.079   28.076  1.021   1.00 11.28  ? 9   LEU K N   1 
ATOM   3186 C CA  . LEU K  1 9  ? 9.709   28.197  -0.298  1.00 16.72  ? 9   LEU K CA  1 
ATOM   3187 C C   . LEU K  1 9  ? 10.128  29.620  -0.634  1.00 12.83  ? 9   LEU K C   1 
ATOM   3188 O O   . LEU K  1 9  ? 11.124  29.826  -1.324  1.00 13.04  ? 9   LEU K O   1 
ATOM   3189 C CB  . LEU K  1 9  ? 8.737   27.688  -1.376  1.00 12.66  ? 9   LEU K CB  1 
ATOM   3190 C CG  . LEU K  1 9  ? 8.422   26.198  -1.209  1.00 16.17  ? 9   LEU K CG  1 
ATOM   3191 C CD1 . LEU K  1 9  ? 7.166   25.813  -1.978  1.00 15.56  ? 9   LEU K CD1 1 
ATOM   3192 C CD2 . LEU K  1 9  ? 9.612   25.336  -1.632  1.00 14.98  ? 9   LEU K CD2 1 
ATOM   3193 N N   A LYS K  1 10 ? 9.348   30.585  -0.157  0.50 11.62  ? 10  LYS K N   1 
ATOM   3194 N N   B LYS K  1 10 ? 9.343   30.573  -0.147  0.50 11.81  ? 10  LYS K N   1 
ATOM   3195 C CA  A LYS K  1 10 ? 9.693   31.993  -0.367  0.50 15.86  ? 10  LYS K CA  1 
ATOM   3196 C CA  B LYS K  1 10 ? 9.635   31.998  -0.305  0.50 16.37  ? 10  LYS K CA  1 
ATOM   3197 C C   A LYS K  1 10 ? 11.024  32.315  0.295   0.50 13.32  ? 10  LYS K C   1 
ATOM   3198 C C   B LYS K  1 10 ? 10.979  32.336  0.324   0.50 13.63  ? 10  LYS K C   1 
ATOM   3199 O O   A LYS K  1 10 ? 11.793  33.152  -0.182  0.50 13.37  ? 10  LYS K O   1 
ATOM   3200 O O   B LYS K  1 10 ? 11.714  33.202  -0.155  0.50 15.63  ? 10  LYS K O   1 
ATOM   3201 C CB  A LYS K  1 10 ? 8.544   32.847  0.159   0.50 12.64  ? 10  LYS K CB  1 
ATOM   3202 C CB  B LYS K  1 10 ? 8.475   32.780  0.299   0.50 11.47  ? 10  LYS K CB  1 
ATOM   3203 C CG  A LYS K  1 10 ? 8.688   34.353  0.065   0.50 18.21  ? 10  LYS K CG  1 
ATOM   3204 C CG  B LYS K  1 10 ? 8.540   34.290  0.363   0.50 18.34  ? 10  LYS K CG  1 
ATOM   3205 C CD  A LYS K  1 10 ? 7.333   35.008  0.317   0.50 19.72  ? 10  LYS K CD  1 
ATOM   3206 C CD  B LYS K  1 10 ? 7.565   34.799  1.419   0.50 23.45  ? 10  LYS K CD  1 
ATOM   3207 C CE  A LYS K  1 10 ? 7.373   36.490  -0.021  0.50 22.41  ? 10  LYS K CE  1 
ATOM   3208 C CE  B LYS K  1 10 ? 6.720   35.958  0.922   0.50 25.79  ? 10  LYS K CE  1 
ATOM   3209 N NZ  A LYS K  1 10 ? 6.019   37.112  0.042   0.50 24.10  ? 10  LYS K NZ  1 
ATOM   3210 N NZ  B LYS K  1 10 ? 5.525   36.195  1.774   0.50 17.83  ? 10  LYS K NZ  1 
ATOM   3211 N N   . SER K  1 11 ? 11.325  31.645  1.410   1.00 12.80  ? 11  SER K N   1 
ATOM   3212 C CA  . SER K  1 11 ? 12.590  31.872  2.096   1.00 14.03  ? 11  SER K CA  1 
ATOM   3213 C C   . SER K  1 11 ? 13.744  31.116  1.446   1.00 11.15  ? 11  SER K C   1 
ATOM   3214 O O   . SER K  1 11 ? 14.911  31.206  1.826   1.00 12.73  ? 11  SER K O   1 
ATOM   3215 C CB  . SER K  1 11 ? 12.473  31.442  3.569   1.00 13.82  ? 11  SER K CB  1 
ATOM   3216 O OG  . SER K  1 11 ? 12.684  30.029  3.629   1.00 14.35  ? 11  SER K OG  1 
ATOM   3217 N N   . GLY K  1 12 ? 13.469  30.315  0.419   1.00 12.55  ? 12  GLY K N   1 
ATOM   3218 C CA  . GLY K  1 12 ? 14.564  29.615  -0.243  1.00 14.92  ? 12  GLY K CA  1 
ATOM   3219 C C   . GLY K  1 12 ? 14.808  28.236  0.344   1.00 18.74  ? 12  GLY K C   1 
ATOM   3220 O O   . GLY K  1 12 ? 15.731  27.544  -0.095  1.00 14.35  ? 12  GLY K O   1 
ATOM   3221 N N   . ALA K  1 13 ? 14.005  27.818  1.313   1.00 13.97  ? 13  ALA K N   1 
ATOM   3222 C CA  . ALA K  1 13 ? 14.084  26.478  1.895   1.00 9.37   ? 13  ALA K CA  1 
ATOM   3223 C C   . ALA K  1 13 ? 13.311  25.467  1.042   1.00 11.95  ? 13  ALA K C   1 
ATOM   3224 O O   . ALA K  1 13 ? 12.613  25.836  0.107   1.00 12.56  ? 13  ALA K O   1 
ATOM   3225 C CB  . ALA K  1 13 ? 13.552  26.477  3.312   1.00 11.27  ? 13  ALA K CB  1 
ATOM   3226 N N   . ILE K  1 14 ? 13.443  24.195  1.366   1.00 11.36  ? 14  ILE K N   1 
ATOM   3227 C CA  . ILE K  1 14 ? 12.856  23.087  0.617   1.00 12.95  ? 14  ILE K CA  1 
ATOM   3228 C C   . ILE K  1 14 ? 11.844  22.343  1.486   1.00 14.82  ? 14  ILE K C   1 
ATOM   3229 O O   . ILE K  1 14 ? 12.139  22.092  2.670   1.00 14.07  ? 14  ILE K O   1 
ATOM   3230 C CB  . ILE K  1 14 ? 13.964  22.127  0.150   1.00 18.33  ? 14  ILE K CB  1 
ATOM   3231 C CG1 . ILE K  1 14 ? 15.074  22.816  -0.644  1.00 24.28  ? 14  ILE K CG1 1 
ATOM   3232 C CG2 . ILE K  1 14 ? 13.363  20.975  -0.644  1.00 15.85  ? 14  ILE K CG2 1 
ATOM   3233 C CD1 . ILE K  1 14 ? 16.400  22.103  -0.657  1.00 34.97  ? 14  ILE K CD1 1 
ATOM   3234 N N   . CYS K  1 15 ? 10.668  22.013  0.944   1.00 12.05  ? 15  CYS K N   1 
ATOM   3235 C CA  . CYS K  1 15 ? 9.680   21.256  1.721   1.00 12.13  ? 15  CYS K CA  1 
ATOM   3236 C C   . CYS K  1 15 ? 9.864   19.748  1.497   1.00 15.96  ? 15  CYS K C   1 
ATOM   3237 O O   . CYS K  1 15 ? 9.883   19.339  0.332   1.00 14.41  ? 15  CYS K O   1 
ATOM   3238 C CB  . CYS K  1 15 ? 8.229   21.599  1.375   1.00 11.63  ? 15  CYS K CB  1 
ATOM   3239 S SG  . CYS K  1 15 ? 7.657   23.234  1.923   1.00 14.53  ? 15  CYS K SG  1 
ATOM   3240 N N   . HIS K  1 16 ? 9.995   19.004  2.587   1.00 9.78   ? 16  HIS K N   1 
ATOM   3241 C CA  . HIS K  1 16 ? 10.102  17.538  2.550   1.00 14.48  ? 16  HIS K CA  1 
ATOM   3242 C C   . HIS K  1 16 ? 8.889   16.912  3.210   1.00 15.67  ? 16  HIS K C   1 
ATOM   3243 O O   . HIS K  1 16 ? 8.344   17.420  4.192   1.00 13.47  ? 16  HIS K O   1 
ATOM   3244 C CB  . HIS K  1 16 ? 11.425  17.082  3.180   1.00 13.90  ? 16  HIS K CB  1 
ATOM   3245 C CG  . HIS K  1 16 ? 12.583  17.316  2.253   1.00 14.46  ? 16  HIS K CG  1 
ATOM   3246 N ND1 . HIS K  1 16 ? 13.102  16.319  1.449   1.00 21.18  ? 16  HIS K ND1 1 
ATOM   3247 C CD2 . HIS K  1 16 ? 13.317  18.415  1.978   1.00 19.86  ? 16  HIS K CD2 1 
ATOM   3248 C CE1 . HIS K  1 16 ? 14.103  16.796  0.733   1.00 18.17  ? 16  HIS K CE1 1 
ATOM   3249 N NE2 . HIS K  1 16 ? 14.264  18.074  1.031   1.00 18.86  ? 16  HIS K NE2 1 
ATOM   3250 N N   . PRO K  1 17 ? 8.401   15.785  2.681   1.00 12.64  ? 17  PRO K N   1 
ATOM   3251 C CA  . PRO K  1 17 ? 7.156   15.221  3.204   1.00 13.50  ? 17  PRO K CA  1 
ATOM   3252 C C   . PRO K  1 17 ? 7.339   14.506  4.536   1.00 12.83  ? 17  PRO K C   1 
ATOM   3253 O O   . PRO K  1 17 ? 6.333   14.376  5.255   1.00 15.76  ? 17  PRO K O   1 
ATOM   3254 C CB  . PRO K  1 17 ? 6.732   14.232  2.105   1.00 14.64  ? 17  PRO K CB  1 
ATOM   3255 C CG  . PRO K  1 17 ? 7.971   13.869  1.368   1.00 15.55  ? 17  PRO K CG  1 
ATOM   3256 C CD  . PRO K  1 17 ? 8.958   14.985  1.583   1.00 17.38  ? 17  PRO K CD  1 
ATOM   3257 N N   . VAL K  1 18 ? 8.544   14.044  4.885   1.00 11.79  ? 18  VAL K N   1 
ATOM   3258 C CA  . VAL K  1 18 ? 8.721   13.258  6.106   1.00 18.04  ? 18  VAL K CA  1 
ATOM   3259 C C   . VAL K  1 18 ? 9.953   13.609  6.933   1.00 16.92  ? 18  VAL K C   1 
ATOM   3260 O O   . VAL K  1 18 ? 9.874   13.858  8.148   1.00 16.92  ? 18  VAL K O   1 
ATOM   3261 C CB  . VAL K  1 18 ? 8.782   11.733  5.805   1.00 21.56  ? 18  VAL K CB  1 
ATOM   3262 C CG1 . VAL K  1 18 ? 8.712   10.962  7.118   1.00 21.71  ? 18  VAL K CG1 1 
ATOM   3263 C CG2 . VAL K  1 18 ? 7.672   11.255  4.874   1.00 17.89  ? 18  VAL K CG2 1 
ATOM   3264 N N   . PHE K  1 19 ? 11.121  13.638  6.313   1.00 18.14  ? 19  PHE K N   1 
ATOM   3265 C CA  . PHE K  1 19 ? 12.389  13.977  6.934   1.00 15.38  ? 19  PHE K CA  1 
ATOM   3266 C C   . PHE K  1 19 ? 13.173  15.054  6.169   1.00 14.22  ? 19  PHE K C   1 
ATOM   3267 O O   . PHE K  1 19 ? 13.130  15.049  4.934   1.00 18.98  ? 19  PHE K O   1 
ATOM   3268 C CB  . PHE K  1 19 ? 13.293  12.741  6.984   1.00 15.15  ? 19  PHE K CB  1 
ATOM   3269 C CG  . PHE K  1 19 ? 12.843  11.652  7.944   1.00 16.29  ? 19  PHE K CG  1 
ATOM   3270 C CD1 . PHE K  1 19 ? 12.469  10.413  7.452   1.00 18.09  ? 19  PHE K CD1 1 
ATOM   3271 C CD2 . PHE K  1 19 ? 12.803  11.879  9.302   1.00 16.35  ? 19  PHE K CD2 1 
ATOM   3272 C CE1 . PHE K  1 19 ? 12.081  9.417   8.324   1.00 20.45  ? 19  PHE K CE1 1 
ATOM   3273 C CE2 . PHE K  1 19 ? 12.415  10.881  10.182  1.00 23.35  ? 19  PHE K CE2 1 
ATOM   3274 C CZ  . PHE K  1 19 ? 12.050  9.644   9.681   1.00 17.83  ? 19  PHE K CZ  1 
ATOM   3275 N N   . CYS K  1 20 ? 13.893  15.916  6.876   1.00 14.61  ? 20  CYS K N   1 
ATOM   3276 C CA  . CYS K  1 20 ? 14.854  16.785  6.210   1.00 14.82  ? 20  CYS K CA  1 
ATOM   3277 C C   . CYS K  1 20 ? 16.076  15.932  5.844   1.00 14.98  ? 20  CYS K C   1 
ATOM   3278 O O   . CYS K  1 20 ? 16.414  15.069  6.641   1.00 14.39  ? 20  CYS K O   1 
ATOM   3279 C CB  . CYS K  1 20 ? 15.367  17.943  7.061   1.00 14.82  ? 20  CYS K CB  1 
ATOM   3280 S SG  . CYS K  1 20 ? 14.185  19.278  7.369   1.00 15.56  ? 20  CYS K SG  1 
ATOM   3281 N N   . PRO K  1 21 ? 16.691  16.156  4.702   1.00 15.20  ? 21  PRO K N   1 
ATOM   3282 C CA  . PRO K  1 21 ? 17.963  15.499  4.399   1.00 18.61  ? 21  PRO K CA  1 
ATOM   3283 C C   . PRO K  1 21 ? 18.994  15.775  5.491   1.00 24.33  ? 21  PRO K C   1 
ATOM   3284 O O   . PRO K  1 21 ? 18.938  16.790  6.191   1.00 15.09  ? 21  PRO K O   1 
ATOM   3285 C CB  . PRO K  1 21 ? 18.394  16.174  3.094   1.00 16.46  ? 21  PRO K CB  1 
ATOM   3286 C CG  . PRO K  1 21 ? 17.099  16.593  2.451   1.00 20.47  ? 21  PRO K CG  1 
ATOM   3287 C CD  . PRO K  1 21 ? 16.238  17.049  3.611   1.00 16.68  ? 21  PRO K CD  1 
ATOM   3288 N N   . ARG K  1 22 ? 19.994  14.898  5.663   1.00 21.10  ? 22  ARG K N   1 
ATOM   3289 C CA  . ARG K  1 22 ? 21.059  15.334  6.573   1.00 19.34  ? 22  ARG K CA  1 
ATOM   3290 C C   . ARG K  1 22 ? 21.735  16.587  5.996   1.00 14.40  ? 22  ARG K C   1 
ATOM   3291 O O   . ARG K  1 22 ? 21.771  16.763  4.775   1.00 27.74  ? 22  ARG K O   1 
ATOM   3292 C CB  . ARG K  1 22 ? 22.086  14.243  6.831   1.00 41.84  ? 22  ARG K CB  1 
ATOM   3293 C CG  . ARG K  1 22 ? 21.590  12.825  6.578   1.00 50.28  ? 22  ARG K CG  1 
ATOM   3294 C CD  . ARG K  1 22 ? 22.786  11.927  6.268   1.00 57.23  ? 22  ARG K CD  1 
ATOM   3295 N NE  . ARG K  1 22 ? 23.838  12.128  7.263   1.00 63.84  ? 22  ARG K NE  1 
ATOM   3296 C CZ  . ARG K  1 22 ? 24.996  11.488  7.334   1.00 66.92  ? 22  ARG K CZ  1 
ATOM   3297 N NH1 . ARG K  1 22 ? 25.324  10.552  6.450   1.00 44.33  ? 22  ARG K NH1 1 
ATOM   3298 N NH2 . ARG K  1 22 ? 25.848  11.792  8.309   1.00 54.54  ? 22  ARG K NH2 1 
ATOM   3299 N N   . ARG K  1 23 ? 22.235  17.428  6.877   1.00 24.97  ? 23  ARG K N   1 
ATOM   3300 C CA  . ARG K  1 23 ? 22.933  18.658  6.529   1.00 31.18  ? 23  ARG K CA  1 
ATOM   3301 C C   . ARG K  1 23 ? 21.951  19.781  6.225   1.00 23.23  ? 23  ARG K C   1 
ATOM   3302 O O   . ARG K  1 23 ? 22.354  20.944  6.179   1.00 24.76  ? 23  ARG K O   1 
ATOM   3303 C CB  . ARG K  1 23 ? 23.899  18.463  5.353   1.00 24.19  ? 23  ARG K CB  1 
ATOM   3304 C CG  . ARG K  1 23 ? 25.048  17.519  5.721   1.00 31.34  ? 23  ARG K CG  1 
ATOM   3305 C CD  . ARG K  1 23 ? 25.956  17.251  4.528   1.00 34.86  ? 23  ARG K CD  1 
ATOM   3306 N NE  . ARG K  1 23 ? 25.158  17.015  3.327   1.00 45.99  ? 23  ARG K NE  1 
ATOM   3307 C CZ  . ARG K  1 23 ? 25.517  17.438  2.124   1.00 53.41  ? 23  ARG K CZ  1 
ATOM   3308 N NH1 . ARG K  1 23 ? 26.656  18.111  2.003   1.00 66.14  ? 23  ARG K NH1 1 
ATOM   3309 N NH2 . ARG K  1 23 ? 24.742  17.190  1.079   1.00 49.44  ? 23  ARG K NH2 1 
ATOM   3310 N N   . TYR K  1 24 ? 20.677  19.438  6.030   1.00 26.16  ? 24  TYR K N   1 
ATOM   3311 C CA  . TYR K  1 24 ? 19.664  20.485  5.897   1.00 25.43  ? 24  TYR K CA  1 
ATOM   3312 C C   . TYR K  1 24 ? 19.025  20.778  7.247   1.00 23.89  ? 24  TYR K C   1 
ATOM   3313 O O   . TYR K  1 24 ? 18.485  19.879  7.888   1.00 43.37  ? 24  TYR K O   1 
ATOM   3314 C CB  . TYR K  1 24 ? 18.589  20.067  4.892   1.00 21.99  ? 24  TYR K CB  1 
ATOM   3315 C CG  . TYR K  1 24 ? 19.074  20.121  3.460   1.00 19.26  ? 24  TYR K CG  1 
ATOM   3316 C CD1 . TYR K  1 24 ? 20.199  19.400  3.073   1.00 25.55  ? 24  TYR K CD1 1 
ATOM   3317 C CD2 . TYR K  1 24 ? 18.408  20.889  2.510   1.00 18.76  ? 24  TYR K CD2 1 
ATOM   3318 C CE1 . TYR K  1 24 ? 20.656  19.438  1.768   1.00 24.31  ? 24  TYR K CE1 1 
ATOM   3319 C CE2 . TYR K  1 24 ? 18.860  20.932  1.201   1.00 29.89  ? 24  TYR K CE2 1 
ATOM   3320 C CZ  . TYR K  1 24 ? 19.980  20.205  0.845   1.00 33.22  ? 24  TYR K CZ  1 
ATOM   3321 O OH  . TYR K  1 24 ? 20.437  20.245  -0.455  1.00 29.50  ? 24  TYR K OH  1 
ATOM   3322 N N   . LYS K  1 25 ? 19.073  22.023  7.709   1.00 16.16  ? 25  LYS K N   1 
ATOM   3323 C CA  . LYS K  1 25 ? 18.529  22.308  9.036   1.00 15.49  ? 25  LYS K CA  1 
ATOM   3324 C C   . LYS K  1 25 ? 17.023  22.509  8.975   1.00 20.00  ? 25  LYS K C   1 
ATOM   3325 O O   . LYS K  1 25 ? 16.545  23.246  8.115   1.00 20.16  ? 25  LYS K O   1 
ATOM   3326 C CB  . LYS K  1 25 ? 19.178  23.554  9.647   1.00 18.63  ? 25  LYS K CB  1 
ATOM   3327 C CG  . LYS K  1 25 ? 18.745  23.829  11.080  1.00 21.78  ? 25  LYS K CG  1 
ATOM   3328 C CD  . LYS K  1 25 ? 19.519  24.975  11.713  1.00 30.50  ? 25  LYS K CD  1 
ATOM   3329 C CE  . LYS K  1 25 ? 20.920  24.551  12.118  1.00 32.70  ? 25  LYS K CE  1 
ATOM   3330 N NZ  . LYS K  1 25 ? 21.604  25.587  12.937  1.00 36.83  ? 25  LYS K NZ  1 
ATOM   3331 N N   . GLN K  1 26 ? 16.302  21.848  9.877   1.00 20.50  ? 26  GLN K N   1 
ATOM   3332 C CA  . GLN K  1 26 ? 14.852  22.058  9.907   1.00 17.20  ? 26  GLN K CA  1 
ATOM   3333 C C   . GLN K  1 26 ? 14.562  23.421  10.517  1.00 19.69  ? 26  GLN K C   1 
ATOM   3334 O O   . GLN K  1 26 ? 15.163  23.713  11.561  1.00 22.50  ? 26  GLN K O   1 
ATOM   3335 C CB  . GLN K  1 26 ? 14.133  20.987  10.723  1.00 17.95  ? 26  GLN K CB  1 
ATOM   3336 C CG  . GLN K  1 26 ? 12.648  21.306  10.891  1.00 20.32  ? 26  GLN K CG  1 
ATOM   3337 C CD  . GLN K  1 26 ? 11.915  20.108  11.455  1.00 16.65  ? 26  GLN K CD  1 
ATOM   3338 O OE1 . GLN K  1 26 ? 12.552  19.085  11.713  1.00 22.18  ? 26  GLN K OE1 1 
ATOM   3339 N NE2 . GLN K  1 26 ? 10.609  20.264  11.645  1.00 21.46  ? 26  GLN K NE2 1 
ATOM   3340 N N   . ILE K  1 27 ? 13.679  24.188  9.886   1.00 14.52  ? 27  ILE K N   1 
ATOM   3341 C CA  . ILE K  1 27 ? 13.360  25.516  10.416  1.00 13.23  ? 27  ILE K CA  1 
ATOM   3342 C C   . ILE K  1 27 ? 11.863  25.700  10.597  1.00 17.43  ? 27  ILE K C   1 
ATOM   3343 O O   . ILE K  1 27 ? 11.388  26.792  10.899  1.00 18.38  ? 27  ILE K O   1 
ATOM   3344 C CB  . ILE K  1 27 ? 13.933  26.616  9.502   1.00 14.13  ? 27  ILE K CB  1 
ATOM   3345 C CG1 . ILE K  1 27 ? 13.422  26.547  8.065   1.00 17.22  ? 27  ILE K CG1 1 
ATOM   3346 C CG2 . ILE K  1 27 ? 15.455  26.598  9.549   1.00 14.28  ? 27  ILE K CG2 1 
ATOM   3347 C CD1 . ILE K  1 27 ? 13.743  27.749  7.203   1.00 15.78  ? 27  ILE K CD1 1 
ATOM   3348 N N   . GLY K  1 28 ? 11.124  24.604  10.403  1.00 15.16  ? 28  GLY K N   1 
ATOM   3349 C CA  . GLY K  1 28 ? 9.674   24.667  10.560  1.00 13.51  ? 28  GLY K CA  1 
ATOM   3350 C C   . GLY K  1 28 ? 9.014   23.492  9.855   1.00 15.47  ? 28  GLY K C   1 
ATOM   3351 O O   . GLY K  1 28 ? 9.700   22.491  9.595   1.00 16.25  ? 28  GLY K O   1 
ATOM   3352 N N   . THR K  1 29 ? 7.728   23.627  9.563   1.00 10.69  ? 29  THR K N   1 
ATOM   3353 C CA  . THR K  1 29 ? 7.003   22.578  8.851   1.00 10.57  ? 29  THR K CA  1 
ATOM   3354 C C   . THR K  1 29 ? 6.505   23.165  7.529   1.00 12.62  ? 29  THR K C   1 
ATOM   3355 O O   . THR K  1 29 ? 6.715   24.340  7.226   1.00 14.15  ? 29  THR K O   1 
ATOM   3356 C CB  . THR K  1 29 ? 5.793   22.022  9.614   1.00 14.07  ? 29  THR K CB  1 
ATOM   3357 O OG1 . THR K  1 29 ? 4.850   23.079  9.842   1.00 16.74  ? 29  THR K OG1 1 
ATOM   3358 C CG2 . THR K  1 29 ? 6.202   21.479  10.983  1.00 16.77  ? 29  THR K CG2 1 
ATOM   3359 N N   . CYS K  1 30 ? 5.831   22.332  6.747   1.00 12.36  ? 30  CYS K N   1 
ATOM   3360 C CA  . CYS K  1 30 ? 5.350   22.820  5.458   1.00 9.74   ? 30  CYS K CA  1 
ATOM   3361 C C   . CYS K  1 30 ? 3.854   22.546  5.291   1.00 15.03  ? 30  CYS K C   1 
ATOM   3362 O O   . CYS K  1 30 ? 3.392   22.183  4.217   1.00 15.41  ? 30  CYS K O   1 
ATOM   3363 C CB  . CYS K  1 30 ? 6.148   22.182  4.318   1.00 12.80  ? 30  CYS K CB  1 
ATOM   3364 S SG  . CYS K  1 30 ? 7.661   23.095  3.945   1.00 11.02  ? 30  CYS K SG  1 
ATOM   3365 N N   . GLY K  1 31 ? 3.135   22.763  6.383   1.00 13.51  ? 31  GLY K N   1 
ATOM   3366 C CA  . GLY K  1 31 ? 1.669   22.673  6.382   1.00 17.61  ? 31  GLY K CA  1 
ATOM   3367 C C   . GLY K  1 31 ? 1.164   21.462  7.143   1.00 14.43  ? 31  GLY K C   1 
ATOM   3368 O O   . GLY K  1 31 ? 1.097   21.500  8.380   1.00 14.00  ? 31  GLY K O   1 
ATOM   3369 N N   . LEU K  1 32 ? 0.786   20.409  6.429   1.00 13.44  ? 32  LEU K N   1 
ATOM   3370 C CA  . LEU K  1 32 ? 0.200   19.218  7.032   1.00 11.68  ? 32  LEU K CA  1 
ATOM   3371 C C   . LEU K  1 32 ? 1.192   18.542  7.974   1.00 19.89  ? 32  LEU K C   1 
ATOM   3372 O O   . LEU K  1 32 ? 2.413   18.640  7.810   1.00 15.21  ? 32  LEU K O   1 
ATOM   3373 C CB  . LEU K  1 32 ? -0.224  18.189  5.985   1.00 12.43  ? 32  LEU K CB  1 
ATOM   3374 C CG  . LEU K  1 32 ? -1.404  18.584  5.101   1.00 15.91  ? 32  LEU K CG  1 
ATOM   3375 C CD1 . LEU K  1 32 ? -1.736  17.471  4.119   1.00 25.28  ? 32  LEU K CD1 1 
ATOM   3376 C CD2 . LEU K  1 32 ? -2.602  18.923  5.986   1.00 23.15  ? 32  LEU K CD2 1 
ATOM   3377 N N   . PRO K  1 33 ? 0.660   17.841  8.960   1.00 15.40  ? 33  PRO K N   1 
ATOM   3378 C CA  . PRO K  1 33 ? 1.546   17.213  9.951   1.00 14.80  ? 33  PRO K CA  1 
ATOM   3379 C C   . PRO K  1 33 ? 2.559   16.284  9.285   1.00 13.74  ? 33  PRO K C   1 
ATOM   3380 O O   . PRO K  1 33 ? 2.225   15.555  8.353   1.00 16.62  ? 33  PRO K O   1 
ATOM   3381 C CB  . PRO K  1 33 ? 0.570   16.424  10.836  1.00 25.43  ? 33  PRO K CB  1 
ATOM   3382 C CG  . PRO K  1 33 ? -0.710  17.207  10.709  1.00 24.10  ? 33  PRO K CG  1 
ATOM   3383 C CD  . PRO K  1 33 ? -0.763  17.569  9.241   1.00 19.15  ? 33  PRO K CD  1 
ATOM   3384 N N   . GLY K  1 34 ? 3.786   16.399  9.778   1.00 13.38  ? 34  GLY K N   1 
ATOM   3385 C CA  . GLY K  1 34 ? 4.871   15.540  9.309   1.00 17.79  ? 34  GLY K CA  1 
ATOM   3386 C C   . GLY K  1 34 ? 5.740   16.215  8.262   1.00 15.41  ? 34  GLY K C   1 
ATOM   3387 O O   . GLY K  1 34 ? 6.875   15.805  8.053   1.00 15.60  ? 34  GLY K O   1 
ATOM   3388 N N   . THR K  1 35 ? 5.226   17.241  7.608   1.00 12.71  ? 35  THR K N   1 
ATOM   3389 C CA  . THR K  1 35 ? 5.997   17.906  6.556   1.00 11.65  ? 35  THR K CA  1 
ATOM   3390 C C   . THR K  1 35 ? 7.057   18.781  7.204   1.00 14.35  ? 35  THR K C   1 
ATOM   3391 O O   . THR K  1 35 ? 6.952   19.196  8.357   1.00 14.79  ? 35  THR K O   1 
ATOM   3392 C CB  . THR K  1 35 ? 5.127   18.727  5.597   1.00 9.71   ? 35  THR K CB  1 
ATOM   3393 O OG1 . THR K  1 35 ? 4.498   19.782  6.338   1.00 13.22  ? 35  THR K OG1 1 
ATOM   3394 C CG2 . THR K  1 35 ? 4.022   17.856  4.986   1.00 11.77  ? 35  THR K CG2 1 
ATOM   3395 N N   . LYS K  1 36 ? 8.136   19.059  6.482   1.00 12.44  ? 36  LYS K N   1 
ATOM   3396 C CA  . LYS K  1 36 ? 9.273   19.712  7.114   1.00 9.20   ? 36  LYS K CA  1 
ATOM   3397 C C   . LYS K  1 36 ? 9.786   20.833  6.211   1.00 10.78  ? 36  LYS K C   1 
ATOM   3398 O O   . LYS K  1 36 ? 9.932   20.613  5.008   1.00 9.94   ? 36  LYS K O   1 
ATOM   3399 C CB  . LYS K  1 36 ? 10.440  18.749  7.366   1.00 10.74  ? 36  LYS K CB  1 
ATOM   3400 C CG  . LYS K  1 36 ? 10.039  17.469  8.083   1.00 15.31  ? 36  LYS K CG  1 
ATOM   3401 C CD  . LYS K  1 36 ? 10.169  17.571  9.587   1.00 24.03  ? 36  LYS K CD  1 
ATOM   3402 C CE  . LYS K  1 36 ? 10.108  16.173  10.204  1.00 24.88  ? 36  LYS K CE  1 
ATOM   3403 N NZ  . LYS K  1 36 ? 8.708   15.664  10.249  1.00 21.56  ? 36  LYS K NZ  1 
ATOM   3404 N N   . CYS K  1 37 ? 10.060  21.984  6.801   1.00 12.49  ? 37  CYS K N   1 
ATOM   3405 C CA  . CYS K  1 37 ? 10.740  23.059  6.078   1.00 10.62  ? 37  CYS K CA  1 
ATOM   3406 C C   . CYS K  1 37 ? 12.242  22.942  6.338   1.00 10.82  ? 37  CYS K C   1 
ATOM   3407 O O   . CYS K  1 37 ? 12.596  23.043  7.505   1.00 10.83  ? 37  CYS K O   1 
ATOM   3408 C CB  . CYS K  1 37 ? 10.261  24.437  6.529   1.00 11.80  ? 37  CYS K CB  1 
ATOM   3409 S SG  . CYS K  1 37 ? 10.970  25.770  5.515   1.00 11.79  ? 37  CYS K SG  1 
ATOM   3410 N N   . CYS K  1 38 ? 12.996  22.682  5.279   1.00 10.55  ? 38  CYS K N   1 
ATOM   3411 C CA  . CYS K  1 38 ? 14.416  22.359  5.430   1.00 11.25  ? 38  CYS K CA  1 
ATOM   3412 C C   . CYS K  1 38 ? 15.315  23.380  4.759   1.00 13.46  ? 38  CYS K C   1 
ATOM   3413 O O   . CYS K  1 38 ? 15.250  23.626  3.556   1.00 12.76  ? 38  CYS K O   1 
ATOM   3414 C CB  . CYS K  1 38 ? 14.615  20.940  4.867   1.00 13.43  ? 38  CYS K CB  1 
ATOM   3415 S SG  . CYS K  1 38 ? 13.461  19.710  5.523   1.00 13.87  ? 38  CYS K SG  1 
ATOM   3416 N N   . LYS K  1 39 ? 16.179  24.003  5.577   1.00 11.25  ? 39  LYS K N   1 
ATOM   3417 C CA  . LYS K  1 39 ? 17.044  25.053  5.049   1.00 8.61   ? 39  LYS K CA  1 
ATOM   3418 C C   . LYS K  1 39 ? 18.236  24.479  4.283   1.00 15.89  ? 39  LYS K C   1 
ATOM   3419 O O   . LYS K  1 39 ? 18.919  23.574  4.773   1.00 13.33  ? 39  LYS K O   1 
ATOM   3420 C CB  . LYS K  1 39 ? 17.525  25.938  6.198   1.00 14.60  ? 39  LYS K CB  1 
ATOM   3421 C CG  . LYS K  1 39 ? 18.468  27.051  5.770   1.00 18.54  ? 39  LYS K CG  1 
ATOM   3422 C CD  . LYS K  1 39 ? 18.809  27.894  6.998   1.00 22.73  ? 39  LYS K CD  1 
ATOM   3423 C CE  . LYS K  1 39 ? 19.977  28.816  6.675   1.00 24.87  ? 39  LYS K CE  1 
ATOM   3424 N NZ  . LYS K  1 39 ? 20.517  29.390  7.948   1.00 47.80  ? 39  LYS K NZ  1 
ATOM   3425 N N   . LYS K  1 40 ? 18.455  25.056  3.099   1.00 16.53  ? 40  LYS K N   1 
ATOM   3426 C CA  . LYS K  1 40 ? 19.585  24.649  2.278   1.00 20.18  ? 40  LYS K CA  1 
ATOM   3427 C C   . LYS K  1 40 ? 20.874  25.102  2.971   1.00 21.45  ? 40  LYS K C   1 
ATOM   3428 O O   . LYS K  1 40 ? 21.010  26.245  3.398   1.00 24.66  ? 40  LYS K O   1 
ATOM   3429 C CB  . LYS K  1 40 ? 19.493  25.215  0.871   1.00 26.25  ? 40  LYS K CB  1 
ATOM   3430 C CG  . LYS K  1 40 ? 20.404  24.566  -0.158  1.00 32.73  ? 40  LYS K CG  1 
ATOM   3431 C CD  . LYS K  1 40 ? 20.526  25.448  -1.398  1.00 41.57  ? 40  LYS K CD  1 
ATOM   3432 C CE  . LYS K  1 40 ? 21.157  24.668  -2.540  1.00 51.47  ? 40  LYS K CE  1 
ATOM   3433 N NZ  . LYS K  1 40 ? 21.353  23.237  -2.158  1.00 51.95  ? 40  LYS K NZ  1 
ATOM   3434 N N   . PRO K  1 41 ? 21.800  24.172  3.084   1.00 23.36  ? 41  PRO K N   1 
ATOM   3435 C CA  . PRO K  1 41 ? 23.105  24.504  3.679   1.00 32.00  ? 41  PRO K CA  1 
ATOM   3436 C C   . PRO K  1 41 ? 23.722  25.706  2.976   1.00 27.82  ? 41  PRO K C   1 
ATOM   3437 O O   . PRO K  1 41 ? 23.613  25.816  1.746   1.00 47.99  ? 41  PRO K O   1 
ATOM   3438 C CB  . PRO K  1 41 ? 23.912  23.226  3.438   1.00 34.03  ? 41  PRO K CB  1 
ATOM   3439 C CG  . PRO K  1 41 ? 22.882  22.141  3.362   1.00 30.73  ? 41  PRO K CG  1 
ATOM   3440 C CD  . PRO K  1 41 ? 21.698  22.765  2.664   1.00 21.62  ? 41  PRO K CD  1 
ATOM   3441 O OXT . PRO K  1 41 ? 24.306  26.566  3.679   1.00 35.75  ? 41  PRO K OXT 1 
ATOM   3442 N N   . GLY L  1 1  ? -3.303  18.223  -12.443 1.00 44.27  ? 1   GLY L N   1 
ATOM   3443 C CA  . GLY L  1 1  ? -2.026  17.606  -12.111 1.00 54.15  ? 1   GLY L CA  1 
ATOM   3444 C C   . GLY L  1 1  ? -1.597  17.932  -10.688 1.00 53.40  ? 1   GLY L C   1 
ATOM   3445 O O   . GLY L  1 1  ? -2.352  17.629  -9.759  1.00 52.93  ? 1   GLY L O   1 
ATOM   3446 N N   . ILE L  1 2  ? -0.415  18.526  -10.547 1.00 39.13  ? 2   ILE L N   1 
ATOM   3447 C CA  . ILE L  1 2  ? 0.099   19.003  -9.269  1.00 26.62  ? 2   ILE L CA  1 
ATOM   3448 C C   . ILE L  1 2  ? 0.624   20.435  -9.410  1.00 31.70  ? 2   ILE L C   1 
ATOM   3449 O O   . ILE L  1 2  ? 1.630   20.660  -10.091 1.00 28.77  ? 2   ILE L O   1 
ATOM   3450 C CB  . ILE L  1 2  ? 1.215   18.119  -8.689  1.00 30.66  ? 2   ILE L CB  1 
ATOM   3451 C CG1 . ILE L  1 2  ? 0.814   16.672  -8.417  1.00 33.33  ? 2   ILE L CG1 1 
ATOM   3452 C CG2 . ILE L  1 2  ? 1.776   18.754  -7.418  1.00 32.74  ? 2   ILE L CG2 1 
ATOM   3453 C CD1 . ILE L  1 2  ? 1.986   15.717  -8.344  1.00 32.39  ? 2   ILE L CD1 1 
ATOM   3454 N N   . GLY L  1 3  ? -0.076  21.371  -8.767  1.00 29.78  ? 3   GLY L N   1 
ATOM   3455 C CA  . GLY L  1 3  ? 0.208   22.789  -8.843  1.00 26.06  ? 3   GLY L CA  1 
ATOM   3456 C C   . GLY L  1 3  ? 0.072   23.507  -7.516  1.00 28.73  ? 3   GLY L C   1 
ATOM   3457 O O   . GLY L  1 3  ? -0.179  24.711  -7.473  1.00 25.11  ? 3   GLY L O   1 
ATOM   3458 N N   . ASP L  1 4  ? 0.261   22.776  -6.420  1.00 27.91  ? 4   ASP L N   1 
ATOM   3459 C CA  . ASP L  1 4  ? 0.336   23.378  -5.099  1.00 24.42  ? 4   ASP L CA  1 
ATOM   3460 C C   . ASP L  1 4  ? 1.166   22.493  -4.176  1.00 15.54  ? 4   ASP L C   1 
ATOM   3461 O O   . ASP L  1 4  ? 1.327   21.290  -4.392  1.00 18.59  ? 4   ASP L O   1 
ATOM   3462 C CB  . ASP L  1 4  ? -1.060  23.591  -4.516  1.00 25.66  ? 4   ASP L CB  1 
ATOM   3463 C CG  . ASP L  1 4  ? -1.649  22.273  -4.051  1.00 26.72  ? 4   ASP L CG  1 
ATOM   3464 O OD1 . ASP L  1 4  ? -2.438  21.666  -4.809  1.00 28.04  ? 4   ASP L OD1 1 
ATOM   3465 O OD2 . ASP L  1 4  ? -1.312  21.839  -2.935  1.00 23.08  ? 4   ASP L OD2 1 
ATOM   3466 N N   . PRO L  1 5  ? 1.729   23.086  -3.125  1.00 15.18  ? 5   PRO L N   1 
ATOM   3467 C CA  . PRO L  1 5  ? 2.646   22.291  -2.309  1.00 16.02  ? 5   PRO L CA  1 
ATOM   3468 C C   . PRO L  1 5  ? 1.982   21.202  -1.473  1.00 16.59  ? 5   PRO L C   1 
ATOM   3469 O O   . PRO L  1 5  ? 2.598   20.172  -1.161  1.00 13.02  ? 5   PRO L O   1 
ATOM   3470 C CB  . PRO L  1 5  ? 3.269   23.341  -1.388  1.00 15.12  ? 5   PRO L CB  1 
ATOM   3471 C CG  . PRO L  1 5  ? 2.478   24.587  -1.493  1.00 18.05  ? 5   PRO L CG  1 
ATOM   3472 C CD  . PRO L  1 5  ? 1.571   24.470  -2.682  1.00 24.53  ? 5   PRO L CD  1 
ATOM   3473 N N   . VAL L  1 6  ? 0.725   21.411  -1.055  1.00 13.84  ? 6   VAL L N   1 
ATOM   3474 C CA  . VAL L  1 6  ? 0.078   20.417  -0.198  1.00 13.31  ? 6   VAL L CA  1 
ATOM   3475 C C   . VAL L  1 6  ? -0.147  19.122  -0.960  1.00 15.15  ? 6   VAL L C   1 
ATOM   3476 O O   . VAL L  1 6  ? 0.199   18.027  -0.515  1.00 16.84  ? 6   VAL L O   1 
ATOM   3477 C CB  . VAL L  1 6  ? -1.233  20.979  0.383   1.00 19.07  ? 6   VAL L CB  1 
ATOM   3478 C CG1 . VAL L  1 6  ? -1.916  19.972  1.295   1.00 17.22  ? 6   VAL L CG1 1 
ATOM   3479 C CG2 . VAL L  1 6  ? -0.953  22.253  1.178   1.00 21.42  ? 6   VAL L CG2 1 
ATOM   3480 N N   . THR L  1 7  ? -0.734  19.260  -2.155  1.00 15.31  ? 7   THR L N   1 
ATOM   3481 C CA  . THR L  1 7  ? -0.807  18.098  -3.042  1.00 20.48  ? 7   THR L CA  1 
ATOM   3482 C C   . THR L  1 7  ? 0.540   17.447  -3.322  1.00 16.69  ? 7   THR L C   1 
ATOM   3483 O O   . THR L  1 7  ? 0.683   16.223  -3.250  1.00 21.88  ? 7   THR L O   1 
ATOM   3484 C CB  . THR L  1 7  ? -1.427  18.542  -4.390  1.00 24.81  ? 7   THR L CB  1 
ATOM   3485 O OG1 . THR L  1 7  ? -2.753  19.013  -4.128  1.00 20.94  ? 7   THR L OG1 1 
ATOM   3486 C CG2 . THR L  1 7  ? -1.522  17.381  -5.364  1.00 17.54  ? 7   THR L CG2 1 
ATOM   3487 N N   . CYS L  1 8  ? 1.553   18.243  -3.654  1.00 17.83  ? 8   CYS L N   1 
ATOM   3488 C CA  . CYS L  1 8  ? 2.879   17.707  -3.934  1.00 16.39  ? 8   CYS L CA  1 
ATOM   3489 C C   . CYS L  1 8  ? 3.417   16.819  -2.826  1.00 13.47  ? 8   CYS L C   1 
ATOM   3490 O O   . CYS L  1 8  ? 3.776   15.658  -3.000  1.00 17.73  ? 8   CYS L O   1 
ATOM   3491 C CB  . CYS L  1 8  ? 3.866   18.867  -4.163  1.00 24.41  ? 8   CYS L CB  1 
ATOM   3492 S SG  . CYS L  1 8  ? 5.556   18.373  -4.549  1.00 17.92  ? 8   CYS L SG  1 
ATOM   3493 N N   . LEU L  1 9  ? 3.494   17.389  -1.616  1.00 18.85  ? 9   LEU L N   1 
ATOM   3494 C CA  . LEU L  1 9  ? 3.994   16.712  -0.435  1.00 15.72  ? 9   LEU L CA  1 
ATOM   3495 C C   . LEU L  1 9  ? 3.176   15.497  -0.037  1.00 17.64  ? 9   LEU L C   1 
ATOM   3496 O O   . LEU L  1 9  ? 3.729   14.488  0.398   1.00 15.51  ? 9   LEU L O   1 
ATOM   3497 C CB  . LEU L  1 9  ? 4.058   17.715  0.755   1.00 13.13  ? 9   LEU L CB  1 
ATOM   3498 C CG  . LEU L  1 9  ? 5.054   18.861  0.499   1.00 16.06  ? 9   LEU L CG  1 
ATOM   3499 C CD1 . LEU L  1 9  ? 4.790   20.044  1.418   1.00 10.87  ? 9   LEU L CD1 1 
ATOM   3500 C CD2 . LEU L  1 9  ? 6.487   18.330  0.604   1.00 13.72  ? 9   LEU L CD2 1 
ATOM   3501 N N   . LYS L  1 10 ? 1.860   15.600  -0.175  1.00 21.10  ? 10  LYS L N   1 
ATOM   3502 C CA  . LYS L  1 10 ? 0.990   14.461  0.132   1.00 19.65  ? 10  LYS L CA  1 
ATOM   3503 C C   . LYS L  1 10 ? 1.398   13.256  -0.708  1.00 18.54  ? 10  LYS L C   1 
ATOM   3504 O O   . LYS L  1 10 ? 1.359   12.109  -0.242  1.00 21.82  ? 10  LYS L O   1 
ATOM   3505 C CB  . LYS L  1 10 ? -0.453  14.892  -0.102  1.00 22.58  ? 10  LYS L CB  1 
ATOM   3506 C CG  . LYS L  1 10 ? -1.500  14.360  0.854   1.00 38.13  ? 10  LYS L CG  1 
ATOM   3507 C CD  . LYS L  1 10 ? -1.455  12.855  0.995   1.00 39.29  ? 10  LYS L CD  1 
ATOM   3508 C CE  . LYS L  1 10 ? -2.662  12.314  1.733   1.00 39.48  ? 10  LYS L CE  1 
ATOM   3509 N NZ  . LYS L  1 10 ? -3.918  12.546  0.973   1.00 37.35  ? 10  LYS L NZ  1 
ATOM   3510 N N   . SER L  1 11 ? 1.794   13.499  -1.958  1.00 20.41  ? 11  SER L N   1 
ATOM   3511 C CA  . SER L  1 11 ? 2.105   12.418  -2.893  1.00 21.07  ? 11  SER L CA  1 
ATOM   3512 C C   . SER L  1 11 ? 3.473   11.786  -2.654  1.00 24.15  ? 11  SER L C   1 
ATOM   3513 O O   . SER L  1 11 ? 3.855   10.828  -3.339  1.00 21.54  ? 11  SER L O   1 
ATOM   3514 C CB  . SER L  1 11 ? 2.036   12.921  -4.334  1.00 22.92  ? 11  SER L CB  1 
ATOM   3515 O OG  . SER L  1 11 ? 3.135   13.769  -4.644  1.00 28.07  ? 11  SER L OG  1 
ATOM   3516 N N   . GLY L  1 12 ? 4.210   12.318  -1.679  1.00 17.60  ? 12  GLY L N   1 
ATOM   3517 C CA  . GLY L  1 12 ? 5.539   11.877  -1.330  1.00 20.21  ? 12  GLY L CA  1 
ATOM   3518 C C   . GLY L  1 12 ? 6.661   12.580  -2.062  1.00 18.81  ? 12  GLY L C   1 
ATOM   3519 O O   . GLY L  1 12 ? 7.840   12.236  -1.930  1.00 18.47  ? 12  GLY L O   1 
ATOM   3520 N N   . ALA L  1 13 ? 6.318   13.596  -2.848  1.00 20.41  ? 13  ALA L N   1 
ATOM   3521 C CA  . ALA L  1 13 ? 7.302   14.381  -3.578  1.00 12.10  ? 13  ALA L CA  1 
ATOM   3522 C C   . ALA L  1 13 ? 7.842   15.489  -2.681  1.00 22.98  ? 13  ALA L C   1 
ATOM   3523 O O   . ALA L  1 13 ? 7.373   15.643  -1.540  1.00 18.07  ? 13  ALA L O   1 
ATOM   3524 C CB  . ALA L  1 13 ? 6.636   14.934  -4.832  1.00 14.42  ? 13  ALA L CB  1 
ATOM   3525 N N   . ILE L  1 14 ? 8.797   16.261  -3.155  1.00 17.78  ? 14  ILE L N   1 
ATOM   3526 C CA  . ILE L  1 14 ? 9.351   17.361  -2.362  1.00 13.23  ? 14  ILE L CA  1 
ATOM   3527 C C   . ILE L  1 14 ? 9.092   18.679  -3.080  1.00 17.07  ? 14  ILE L C   1 
ATOM   3528 O O   . ILE L  1 14 ? 8.867   18.655  -4.303  1.00 20.59  ? 14  ILE L O   1 
ATOM   3529 C CB  . ILE L  1 14 ? 10.862  17.201  -2.127  1.00 19.41  ? 14  ILE L CB  1 
ATOM   3530 C CG1 . ILE L  1 14 ? 11.676  17.382  -3.412  1.00 19.09  ? 14  ILE L CG1 1 
ATOM   3531 C CG2 . ILE L  1 14 ? 11.169  15.876  -1.453  1.00 17.48  ? 14  ILE L CG2 1 
ATOM   3532 C CD1 . ILE L  1 14 ? 13.115  17.781  -3.144  1.00 30.47  ? 14  ILE L CD1 1 
ATOM   3533 N N   . CYS L  1 15 ? 9.090   19.816  -2.380  1.00 12.82  ? 15  CYS L N   1 
ATOM   3534 C CA  . CYS L  1 15 ? 8.917   21.080  -3.106  1.00 16.38  ? 15  CYS L CA  1 
ATOM   3535 C C   . CYS L  1 15 ? 10.253  21.826  -3.111  1.00 14.89  ? 15  CYS L C   1 
ATOM   3536 O O   . CYS L  1 15 ? 10.769  22.041  -2.003  1.00 14.87  ? 15  CYS L O   1 
ATOM   3537 C CB  . CYS L  1 15 ? 7.858   22.023  -2.529  1.00 14.48  ? 15  CYS L CB  1 
ATOM   3538 S SG  . CYS L  1 15 ? 6.144   21.473  -2.771  1.00 16.82  ? 15  CYS L SG  1 
ATOM   3539 N N   . HIS L  1 16 ? 10.741  22.168  -4.298  1.00 14.62  ? 16  HIS L N   1 
ATOM   3540 C CA  . HIS L  1 16 ? 11.953  22.983  -4.399  1.00 17.41  ? 16  HIS L CA  1 
ATOM   3541 C C   . HIS L  1 16 ? 11.628  24.406  -4.844  1.00 21.22  ? 16  HIS L C   1 
ATOM   3542 O O   . HIS L  1 16 ? 10.829  24.614  -5.766  1.00 18.70  ? 16  HIS L O   1 
ATOM   3543 C CB  . HIS L  1 16 ? 12.966  22.387  -5.380  1.00 17.60  ? 16  HIS L CB  1 
ATOM   3544 C CG  . HIS L  1 16 ? 14.187  21.850  -4.707  1.00 26.08  ? 16  HIS L CG  1 
ATOM   3545 N ND1 . HIS L  1 16 ? 15.358  22.552  -4.574  1.00 32.33  ? 16  HIS L ND1 1 
ATOM   3546 C CD2 . HIS L  1 16 ? 14.406  20.653  -4.110  1.00 30.35  ? 16  HIS L CD2 1 
ATOM   3547 C CE1 . HIS L  1 16 ? 16.248  21.817  -3.938  1.00 32.09  ? 16  HIS L CE1 1 
ATOM   3548 N NE2 . HIS L  1 16 ? 15.695  20.649  -3.637  1.00 32.04  ? 16  HIS L NE2 1 
ATOM   3549 N N   . PRO L  1 17 ? 12.227  25.414  -4.226  1.00 20.59  ? 17  PRO L N   1 
ATOM   3550 C CA  . PRO L  1 17 ? 11.875  26.779  -4.642  1.00 19.84  ? 17  PRO L CA  1 
ATOM   3551 C C   . PRO L  1 17 ? 12.339  27.136  -6.048  1.00 24.97  ? 17  PRO L C   1 
ATOM   3552 O O   . PRO L  1 17 ? 11.754  28.067  -6.628  1.00 23.67  ? 17  PRO L O   1 
ATOM   3553 C CB  . PRO L  1 17 ? 12.614  27.669  -3.639  1.00 14.78  ? 17  PRO L CB  1 
ATOM   3554 C CG  . PRO L  1 17 ? 13.763  26.830  -3.180  1.00 15.87  ? 17  PRO L CG  1 
ATOM   3555 C CD  . PRO L  1 17 ? 13.220  25.414  -3.143  1.00 16.97  ? 17  PRO L CD  1 
ATOM   3556 N N   . VAL L  1 18 ? 13.355  26.492  -6.614  1.00 18.42  ? 18  VAL L N   1 
ATOM   3557 C CA  . VAL L  1 18 ? 13.867  27.008  -7.890  1.00 24.11  ? 18  VAL L CA  1 
ATOM   3558 C C   . VAL L  1 18 ? 14.035  25.948  -8.971  1.00 25.09  ? 18  VAL L C   1 
ATOM   3559 O O   . VAL L  1 18 ? 13.585  26.141  -10.109 1.00 23.76  ? 18  VAL L O   1 
ATOM   3560 C CB  . VAL L  1 18 ? 15.217  27.721  -7.694  1.00 26.61  ? 18  VAL L CB  1 
ATOM   3561 C CG1 . VAL L  1 18 ? 15.728  28.314  -9.003  1.00 27.86  ? 18  VAL L CG1 1 
ATOM   3562 C CG2 . VAL L  1 18 ? 15.098  28.832  -6.652  1.00 29.04  ? 18  VAL L CG2 1 
ATOM   3563 N N   . PHE L  1 19 ? 14.670  24.836  -8.635  1.00 25.02  ? 19  PHE L N   1 
ATOM   3564 C CA  . PHE L  1 19 ? 14.888  23.757  -9.592  1.00 24.55  ? 19  PHE L CA  1 
ATOM   3565 C C   . PHE L  1 19 ? 14.979  22.408  -8.900  1.00 20.40  ? 19  PHE L C   1 
ATOM   3566 O O   . PHE L  1 19 ? 15.497  22.288  -7.789  1.00 19.83  ? 19  PHE L O   1 
ATOM   3567 C CB  . PHE L  1 19 ? 16.193  24.034  -10.346 1.00 19.24  ? 19  PHE L CB  1 
ATOM   3568 C CG  . PHE L  1 19 ? 16.182  23.650  -11.812 1.00 20.92  ? 19  PHE L CG  1 
ATOM   3569 C CD1 . PHE L  1 19 ? 15.523  24.430  -12.746 1.00 21.92  ? 19  PHE L CD1 1 
ATOM   3570 C CD2 . PHE L  1 19 ? 16.849  22.514  -12.246 1.00 28.93  ? 19  PHE L CD2 1 
ATOM   3571 C CE1 . PHE L  1 19 ? 15.524  24.080  -14.083 1.00 32.03  ? 19  PHE L CE1 1 
ATOM   3572 C CE2 . PHE L  1 19 ? 16.848  22.156  -13.581 1.00 23.94  ? 19  PHE L CE2 1 
ATOM   3573 C CZ  . PHE L  1 19 ? 16.198  22.950  -14.508 1.00 29.11  ? 19  PHE L CZ  1 
ATOM   3574 N N   . CYS L  1 20 ? 14.486  21.368  -9.556  1.00 20.15  ? 20  CYS L N   1 
ATOM   3575 C CA  . CYS L  1 20 ? 14.624  20.034  -8.990  1.00 22.18  ? 20  CYS L CA  1 
ATOM   3576 C C   . CYS L  1 20 ? 16.082  19.618  -8.842  1.00 23.69  ? 20  CYS L C   1 
ATOM   3577 O O   . CYS L  1 20 ? 16.912  19.852  -9.711  1.00 17.79  ? 20  CYS L O   1 
ATOM   3578 C CB  . CYS L  1 20 ? 13.905  19.014  -9.878  1.00 22.01  ? 20  CYS L CB  1 
ATOM   3579 S SG  . CYS L  1 20 ? 12.105  19.160  -9.796  1.00 22.05  ? 20  CYS L SG  1 
ATOM   3580 N N   . PRO L  1 21 ? 16.414  18.972  -7.736  1.00 21.90  ? 21  PRO L N   1 
ATOM   3581 C CA  . PRO L  1 21 ? 17.773  18.434  -7.614  1.00 25.48  ? 21  PRO L CA  1 
ATOM   3582 C C   . PRO L  1 21 ? 17.960  17.389  -8.705  1.00 23.26  ? 21  PRO L C   1 
ATOM   3583 O O   . PRO L  1 21 ? 16.983  16.774  -9.122  1.00 22.40  ? 21  PRO L O   1 
ATOM   3584 C CB  . PRO L  1 21 ? 17.784  17.794  -6.231  1.00 26.03  ? 21  PRO L CB  1 
ATOM   3585 C CG  . PRO L  1 21 ? 16.645  18.423  -5.503  1.00 23.25  ? 21  PRO L CG  1 
ATOM   3586 C CD  . PRO L  1 21 ? 15.591  18.697  -6.551  1.00 20.39  ? 21  PRO L CD  1 
ATOM   3587 N N   . ARG L  1 22 ? 19.195  17.171  -9.153  1.00 24.74  ? 22  ARG L N   1 
ATOM   3588 C CA  . ARG L  1 22 ? 19.358  16.057  -10.103 1.00 32.86  ? 22  ARG L CA  1 
ATOM   3589 C C   . ARG L  1 22 ? 18.933  14.781  -9.374  1.00 36.57  ? 22  ARG L C   1 
ATOM   3590 O O   . ARG L  1 22 ? 18.883  14.815  -8.135  1.00 37.72  ? 22  ARG L O   1 
ATOM   3591 C CB  . ARG L  1 22 ? 20.788  16.070  -10.633 1.00 25.98  ? 22  ARG L CB  1 
ATOM   3592 C CG  . ARG L  1 22 ? 21.205  17.469  -11.084 1.00 23.26  ? 22  ARG L CG  1 
ATOM   3593 C CD  . ARG L  1 22 ? 22.631  17.498  -11.611 1.00 27.74  ? 22  ARG L CD  1 
ATOM   3594 N NE  . ARG L  1 22 ? 23.019  18.847  -12.038 1.00 22.00  ? 22  ARG L NE  1 
ATOM   3595 C CZ  . ARG L  1 22 ? 24.283  19.203  -12.250 1.00 29.69  ? 22  ARG L CZ  1 
ATOM   3596 N NH1 . ARG L  1 22 ? 25.261  18.316  -12.081 1.00 21.85  ? 22  ARG L NH1 1 
ATOM   3597 N NH2 . ARG L  1 22 ? 24.569  20.442  -12.634 1.00 24.53  ? 22  ARG L NH2 1 
ATOM   3598 N N   . ARG L  1 23 ? 18.617  13.717  -10.082 1.00 45.04  ? 23  ARG L N   1 
ATOM   3599 C CA  . ARG L  1 23 ? 18.111  12.452  -9.565  1.00 46.68  ? 23  ARG L CA  1 
ATOM   3600 C C   . ARG L  1 23 ? 16.593  12.530  -9.409  1.00 46.27  ? 23  ARG L C   1 
ATOM   3601 O O   . ARG L  1 23 ? 15.889  11.555  -9.669  1.00 50.88  ? 23  ARG L O   1 
ATOM   3602 C CB  . ARG L  1 23 ? 18.755  12.033  -8.244  1.00 54.49  ? 23  ARG L CB  1 
ATOM   3603 C CG  . ARG L  1 23 ? 20.274  11.970  -8.289  1.00 59.41  ? 23  ARG L CG  1 
ATOM   3604 C CD  . ARG L  1 23 ? 20.789  10.634  -7.777  1.00 67.33  ? 23  ARG L CD  1 
ATOM   3605 N NE  . ARG L  1 23 ? 21.363  9.801   -8.836  1.00 69.09  ? 23  ARG L NE  1 
ATOM   3606 C CZ  . ARG L  1 23 ? 20.650  9.085   -9.698  1.00 73.77  ? 23  ARG L CZ  1 
ATOM   3607 N NH1 . ARG L  1 23 ? 19.319  9.088   -9.635  1.00 96.31  ? 23  ARG L NH1 1 
ATOM   3608 N NH2 . ARG L  1 23 ? 21.253  8.352   -10.627 1.00 74.72  ? 23  ARG L NH2 1 
ATOM   3609 N N   . TYR L  1 24 ? 16.101  13.700  -9.008  1.00 30.38  ? 24  TYR L N   1 
ATOM   3610 C CA  . TYR L  1 24 ? 14.669  13.957  -8.993  1.00 26.52  ? 24  TYR L CA  1 
ATOM   3611 C C   . TYR L  1 24 ? 14.180  14.407  -10.366 1.00 37.24  ? 24  TYR L C   1 
ATOM   3612 O O   . TYR L  1 24 ? 14.951  15.003  -11.123 1.00 49.38  ? 24  TYR L O   1 
ATOM   3613 C CB  . TYR L  1 24 ? 14.293  15.056  -7.987  1.00 24.55  ? 24  TYR L CB  1 
ATOM   3614 C CG  . TYR L  1 24 ? 14.475  14.641  -6.547  1.00 30.41  ? 24  TYR L CG  1 
ATOM   3615 C CD1 . TYR L  1 24 ? 15.744  14.575  -5.987  1.00 33.78  ? 24  TYR L CD1 1 
ATOM   3616 C CD2 . TYR L  1 24 ? 13.369  14.327  -5.762  1.00 32.83  ? 24  TYR L CD2 1 
ATOM   3617 C CE1 . TYR L  1 24 ? 15.929  14.198  -4.669  1.00 32.84  ? 24  TYR L CE1 1 
ATOM   3618 C CE2 . TYR L  1 24 ? 13.542  13.946  -4.442  1.00 31.57  ? 24  TYR L CE2 1 
ATOM   3619 C CZ  . TYR L  1 24 ? 14.819  13.886  -3.918  1.00 34.76  ? 24  TYR L CZ  1 
ATOM   3620 O OH  . TYR L  1 24 ? 14.979  13.509  -2.606  1.00 29.63  ? 24  TYR L OH  1 
ATOM   3621 N N   . LYS L  1 25 ? 12.910  14.129  -10.647 1.00 33.30  ? 25  LYS L N   1 
ATOM   3622 C CA  . LYS L  1 25 ? 12.279  14.648  -11.855 1.00 35.54  ? 25  LYS L CA  1 
ATOM   3623 C C   . LYS L  1 25 ? 11.136  15.595  -11.516 1.00 29.92  ? 25  LYS L C   1 
ATOM   3624 O O   . LYS L  1 25 ? 10.396  15.340  -10.570 1.00 26.66  ? 25  LYS L O   1 
ATOM   3625 C CB  . LYS L  1 25 ? 11.770  13.495  -12.728 1.00 33.60  ? 25  LYS L CB  1 
ATOM   3626 C CG  . LYS L  1 25 ? 12.894  12.645  -13.305 1.00 46.62  ? 25  LYS L CG  1 
ATOM   3627 C CD  . LYS L  1 25 ? 13.865  13.466  -14.138 1.00 52.08  ? 25  LYS L CD  1 
ATOM   3628 C CE  . LYS L  1 25 ? 15.078  12.649  -14.560 1.00 51.68  ? 25  LYS L CE  1 
ATOM   3629 N NZ  . LYS L  1 25 ? 16.145  13.492  -15.162 1.00 47.05  ? 25  LYS L NZ  1 
ATOM   3630 N N   . GLN L  1 26 ? 10.960  16.681  -12.267 1.00 29.29  ? 26  GLN L N   1 
ATOM   3631 C CA  . GLN L  1 26 ? 9.816   17.557  -12.011 1.00 28.80  ? 26  GLN L CA  1 
ATOM   3632 C C   . GLN L  1 26 ? 8.503   16.868  -12.345 1.00 27.03  ? 26  GLN L C   1 
ATOM   3633 O O   . GLN L  1 26 ? 8.405   16.311  -13.443 1.00 34.07  ? 26  GLN L O   1 
ATOM   3634 C CB  . GLN L  1 26 ? 9.929   18.836  -12.840 1.00 21.52  ? 26  GLN L CB  1 
ATOM   3635 C CG  . GLN L  1 26 ? 8.620   19.619  -12.888 1.00 25.22  ? 26  GLN L CG  1 
ATOM   3636 C CD  . GLN L  1 26 ? 8.909   21.050  -13.316 1.00 27.57  ? 26  GLN L CD  1 
ATOM   3637 O OE1 . GLN L  1 26 ? 9.985   21.286  -13.867 1.00 26.71  ? 26  GLN L OE1 1 
ATOM   3638 N NE2 . GLN L  1 26 ? 7.979   21.955  -13.062 1.00 42.39  ? 26  GLN L NE2 1 
ATOM   3639 N N   . ILE L  1 27 ? 7.508   16.881  -11.466 1.00 33.93  ? 27  ILE L N   1 
ATOM   3640 C CA  . ILE L  1 27 ? 6.216   16.246  -11.731 1.00 26.27  ? 27  ILE L CA  1 
ATOM   3641 C C   . ILE L  1 27 ? 5.063   17.240  -11.615 1.00 28.57  ? 27  ILE L C   1 
ATOM   3642 O O   . ILE L  1 27 ? 3.903   16.896  -11.854 1.00 40.27  ? 27  ILE L O   1 
ATOM   3643 C CB  . ILE L  1 27 ? 5.922   15.081  -10.762 1.00 32.19  ? 27  ILE L CB  1 
ATOM   3644 C CG1 . ILE L  1 27 ? 5.831   15.486  -9.291  1.00 25.20  ? 27  ILE L CG1 1 
ATOM   3645 C CG2 . ILE L  1 27 ? 6.964   13.988  -10.955 1.00 51.61  ? 27  ILE L CG2 1 
ATOM   3646 C CD1 . ILE L  1 27 ? 5.401   14.399  -8.336  1.00 18.55  ? 27  ILE L CD1 1 
ATOM   3647 N N   . GLY L  1 28 ? 5.389   18.465  -11.243 1.00 25.88  ? 28  GLY L N   1 
ATOM   3648 C CA  . GLY L  1 28 ? 4.495   19.592  -11.137 1.00 25.53  ? 28  GLY L CA  1 
ATOM   3649 C C   . GLY L  1 28 ? 5.210   20.805  -10.560 1.00 24.71  ? 28  GLY L C   1 
ATOM   3650 O O   . GLY L  1 28 ? 6.444   20.832  -10.535 1.00 25.65  ? 28  GLY L O   1 
ATOM   3651 N N   . THR L  1 29 ? 4.433   21.780  -10.112 1.00 23.28  ? 29  THR L N   1 
ATOM   3652 C CA  . THR L  1 29 ? 4.921   22.954  -9.411  1.00 23.83  ? 29  THR L CA  1 
ATOM   3653 C C   . THR L  1 29 ? 4.318   22.951  -7.997  1.00 18.29  ? 29  THR L C   1 
ATOM   3654 O O   . THR L  1 29 ? 3.415   22.156  -7.755  1.00 23.92  ? 29  THR L O   1 
ATOM   3655 C CB  . THR L  1 29 ? 4.582   24.294  -10.073 1.00 26.85  ? 29  THR L CB  1 
ATOM   3656 O OG1 . THR L  1 29 ? 3.193   24.602  -9.900  1.00 28.45  ? 29  THR L OG1 1 
ATOM   3657 C CG2 . THR L  1 29 ? 4.819   24.236  -11.574 1.00 37.32  ? 29  THR L CG2 1 
ATOM   3658 N N   . CYS L  1 30 ? 4.825   23.818  -7.141  1.00 21.07  ? 30  CYS L N   1 
ATOM   3659 C CA  . CYS L  1 30 ? 4.278   23.944  -5.782  1.00 19.20  ? 30  CYS L CA  1 
ATOM   3660 C C   . CYS L  1 30 ? 3.679   25.323  -5.550  1.00 27.76  ? 30  CYS L C   1 
ATOM   3661 O O   . CYS L  1 30 ? 3.862   25.968  -4.507  1.00 23.06  ? 30  CYS L O   1 
ATOM   3662 C CB  . CYS L  1 30 ? 5.380   23.608  -4.770  1.00 20.19  ? 30  CYS L CB  1 
ATOM   3663 S SG  . CYS L  1 30 ? 5.799   21.848  -4.740  1.00 18.16  ? 30  CYS L SG  1 
ATOM   3664 N N   . GLY L  1 31 ? 2.928   25.808  -6.546  1.00 26.82  ? 31  GLY L N   1 
ATOM   3665 C CA  . GLY L  1 31 ? 2.234   27.072  -6.419  1.00 30.61  ? 31  GLY L CA  1 
ATOM   3666 C C   . GLY L  1 31 ? 2.887   28.239  -7.121  1.00 36.32  ? 31  GLY L C   1 
ATOM   3667 O O   . GLY L  1 31 ? 2.676   28.441  -8.314  1.00 36.98  ? 31  GLY L O   1 
ATOM   3668 N N   . LEU L  1 32 ? 3.684   29.037  -6.414  1.00 43.00  ? 32  LEU L N   1 
ATOM   3669 C CA  . LEU L  1 32 ? 4.307   30.219  -7.008  1.00 45.95  ? 32  LEU L CA  1 
ATOM   3670 C C   . LEU L  1 32 ? 5.122   29.846  -8.240  1.00 52.94  ? 32  LEU L C   1 
ATOM   3671 O O   . LEU L  1 32 ? 5.657   28.736  -8.312  1.00 42.09  ? 32  LEU L O   1 
ATOM   3672 C CB  . LEU L  1 32 ? 5.201   30.922  -5.995  1.00 47.96  ? 32  LEU L CB  1 
ATOM   3673 C CG  . LEU L  1 32 ? 4.571   31.660  -4.823  1.00 49.09  ? 32  LEU L CG  1 
ATOM   3674 C CD1 . LEU L  1 32 ? 5.652   32.214  -3.907  1.00 58.45  ? 32  LEU L CD1 1 
ATOM   3675 C CD2 . LEU L  1 32 ? 3.660   32.773  -5.319  1.00 73.69  ? 32  LEU L CD2 1 
ATOM   3676 N N   . PRO L  1 33 ? 5.237   30.748  -9.211  1.00 55.12  ? 33  PRO L N   1 
ATOM   3677 C CA  . PRO L  1 33 ? 5.999   30.404  -10.417 1.00 50.38  ? 33  PRO L CA  1 
ATOM   3678 C C   . PRO L  1 33 ? 7.459   30.172  -10.047 1.00 51.30  ? 33  PRO L C   1 
ATOM   3679 O O   . PRO L  1 33 ? 8.050   30.923  -9.270  1.00 39.26  ? 33  PRO L O   1 
ATOM   3680 C CB  . PRO L  1 33 ? 5.851   31.625  -11.320 1.00 48.82  ? 33  PRO L CB  1 
ATOM   3681 C CG  . PRO L  1 33 ? 5.382   32.732  -10.444 1.00 49.69  ? 33  PRO L CG  1 
ATOM   3682 C CD  . PRO L  1 33 ? 4.699   32.110  -9.267  1.00 52.78  ? 33  PRO L CD  1 
ATOM   3683 N N   . GLY L  1 34 ? 8.053   29.118  -10.607 1.00 38.20  ? 34  GLY L N   1 
ATOM   3684 C CA  . GLY L  1 34 ? 9.446   28.861  -10.263 1.00 33.40  ? 34  GLY L CA  1 
ATOM   3685 C C   . GLY L  1 34 ? 9.544   27.676  -9.318  1.00 26.79  ? 34  GLY L C   1 
ATOM   3686 O O   . GLY L  1 34 ? 10.498  26.907  -9.396  1.00 26.56  ? 34  GLY L O   1 
ATOM   3687 N N   . THR L  1 35 ? 8.563   27.545  -8.425  1.00 21.77  ? 35  THR L N   1 
ATOM   3688 C CA  . THR L  1 35 ? 8.601   26.418  -7.498  1.00 19.39  ? 35  THR L CA  1 
ATOM   3689 C C   . THR L  1 35 ? 8.293   25.127  -8.243  1.00 18.66  ? 35  THR L C   1 
ATOM   3690 O O   . THR L  1 35 ? 7.494   25.130  -9.172  1.00 21.60  ? 35  THR L O   1 
ATOM   3691 C CB  . THR L  1 35 ? 7.588   26.515  -6.345  1.00 17.86  ? 35  THR L CB  1 
ATOM   3692 O OG1 . THR L  1 35 ? 6.256   26.413  -6.854  1.00 20.04  ? 35  THR L OG1 1 
ATOM   3693 C CG2 . THR L  1 35 ? 7.764   27.867  -5.663  1.00 19.73  ? 35  THR L CG2 1 
ATOM   3694 N N   . LYS L  1 36 ? 8.940   24.068  -7.787  1.00 20.58  ? 36  LYS L N   1 
ATOM   3695 C CA  . LYS L  1 36 ? 8.814   22.791  -8.469  1.00 21.69  ? 36  LYS L CA  1 
ATOM   3696 C C   . LYS L  1 36 ? 8.435   21.651  -7.538  1.00 18.75  ? 36  LYS L C   1 
ATOM   3697 O O   . LYS L  1 36 ? 8.943   21.630  -6.428  1.00 20.46  ? 36  LYS L O   1 
ATOM   3698 C CB  . LYS L  1 36 ? 10.164  22.473  -9.124  1.00 17.58  ? 36  LYS L CB  1 
ATOM   3699 C CG  . LYS L  1 36 ? 10.521  23.551  -10.143 1.00 22.63  ? 36  LYS L CG  1 
ATOM   3700 C CD  . LYS L  1 36 ? 11.415  23.033  -11.249 1.00 28.40  ? 36  LYS L CD  1 
ATOM   3701 C CE  . LYS L  1 36 ? 11.500  24.051  -12.375 1.00 32.10  ? 36  LYS L CE  1 
ATOM   3702 N NZ  . LYS L  1 36 ? 11.227  25.438  -11.910 1.00 29.27  ? 36  LYS L NZ  1 
ATOM   3703 N N   . CYS L  1 37 ? 7.586   20.746  -8.021  1.00 22.88  ? 37  CYS L N   1 
ATOM   3704 C CA  . CYS L  1 37 ? 7.285   19.513  -7.301  1.00 17.60  ? 37  CYS L CA  1 
ATOM   3705 C C   . CYS L  1 37 ? 8.193   18.431  -7.867  1.00 20.61  ? 37  CYS L C   1 
ATOM   3706 O O   . CYS L  1 37 ? 8.165   18.247  -9.091  1.00 22.70  ? 37  CYS L O   1 
ATOM   3707 C CB  . CYS L  1 37 ? 5.813   19.109  -7.421  1.00 16.89  ? 37  CYS L CB  1 
ATOM   3708 S SG  . CYS L  1 37 ? 5.423   17.618  -6.460  1.00 18.87  ? 37  CYS L SG  1 
ATOM   3709 N N   . CYS L  1 38 ? 8.990   17.763  -7.047  1.00 15.11  ? 38  CYS L N   1 
ATOM   3710 C CA  . CYS L  1 38 ? 10.033  16.882  -7.574  1.00 16.22  ? 38  CYS L CA  1 
ATOM   3711 C C   . CYS L  1 38 ? 9.980   15.519  -6.903  1.00 17.75  ? 38  CYS L C   1 
ATOM   3712 O O   . CYS L  1 38 ? 9.851   15.327  -5.706  1.00 17.85  ? 38  CYS L O   1 
ATOM   3713 C CB  . CYS L  1 38 ? 11.436  17.450  -7.384  1.00 20.14  ? 38  CYS L CB  1 
ATOM   3714 S SG  . CYS L  1 38 ? 11.719  19.177  -7.788  1.00 20.62  ? 38  CYS L SG  1 
ATOM   3715 N N   . LYS L  1 39 ? 10.099  14.489  -7.741  1.00 23.47  ? 39  LYS L N   1 
ATOM   3716 C CA  . LYS L  1 39 ? 10.036  13.133  -7.229  1.00 22.45  ? 39  LYS L CA  1 
ATOM   3717 C C   . LYS L  1 39 ? 11.045  12.263  -7.979  1.00 30.33  ? 39  LYS L C   1 
ATOM   3718 O O   . LYS L  1 39 ? 11.163  12.410  -9.197  1.00 27.16  ? 39  LYS L O   1 
ATOM   3719 C CB  . LYS L  1 39 ? 8.624   12.558  -7.363  1.00 27.59  ? 39  LYS L CB  1 
ATOM   3720 C CG  . LYS L  1 39 ? 8.512   11.171  -6.738  1.00 27.91  ? 39  LYS L CG  1 
ATOM   3721 C CD  . LYS L  1 39 ? 7.661   11.197  -5.481  1.00 34.00  ? 39  LYS L CD  1 
ATOM   3722 C CE  . LYS L  1 39 ? 7.411   9.785   -4.959  1.00 34.55  ? 39  LYS L CE  1 
ATOM   3723 N NZ  . LYS L  1 39 ? 8.470   9.372   -3.994  1.00 50.31  ? 39  LYS L NZ  1 
ATOM   3724 N N   . LYS L  1 40 ? 11.752  11.411  -7.258  1.00 28.31  ? 40  LYS L N   1 
ATOM   3725 C CA  . LYS L  1 40 ? 12.701  10.501  -7.900  1.00 39.40  ? 40  LYS L CA  1 
ATOM   3726 C C   . LYS L  1 40 ? 11.973  9.542   -8.837  1.00 49.42  ? 40  LYS L C   1 
ATOM   3727 O O   . LYS L  1 40 ? 10.890  9.043   -8.523  1.00 55.13  ? 40  LYS L O   1 
ATOM   3728 C CB  . LYS L  1 40 ? 13.490  9.737   -6.838  1.00 38.12  ? 40  LYS L CB  1 
ATOM   3729 C CG  . LYS L  1 40 ? 14.108  10.632  -5.775  1.00 40.04  ? 40  LYS L CG  1 
ATOM   3730 C CD  . LYS L  1 40 ? 14.746  9.818   -4.662  1.00 44.30  ? 40  LYS L CD  1 
ATOM   3731 C CE  . LYS L  1 40 ? 16.177  10.253  -4.395  1.00 41.94  ? 40  LYS L CE  1 
ATOM   3732 N NZ  . LYS L  1 40 ? 16.272  11.283  -3.326  1.00 42.99  ? 40  LYS L NZ  1 
ATOM   3733 N N   . PRO L  1 41 ? 12.555  9.288   -10.002 1.00 53.69  ? 41  PRO L N   1 
ATOM   3734 C CA  . PRO L  1 41 ? 11.956  8.369   -10.972 1.00 59.91  ? 41  PRO L CA  1 
ATOM   3735 C C   . PRO L  1 41 ? 11.851  6.942   -10.434 1.00 65.70  ? 41  PRO L C   1 
ATOM   3736 O O   . PRO L  1 41 ? 12.520  6.610   -9.444  1.00 54.66  ? 41  PRO L O   1 
ATOM   3737 C CB  . PRO L  1 41 ? 12.933  8.408   -12.150 1.00 53.19  ? 41  PRO L CB  1 
ATOM   3738 C CG  . PRO L  1 41 ? 13.688  9.686   -11.982 1.00 53.81  ? 41  PRO L CG  1 
ATOM   3739 C CD  . PRO L  1 41 ? 13.820  9.864   -10.491 1.00 55.82  ? 41  PRO L CD  1 
ATOM   3740 O OXT . PRO L  1 41 ? 11.079  6.162   -11.035 1.00 65.06  ? 41  PRO L OXT 1 
ATOM   3741 N N   . GLY M  1 1  ? 3.101   34.002  8.021   1.00 22.84  ? 1   GLY M N   1 
ATOM   3742 C CA  . GLY M  1 1  ? 4.449   33.748  7.537   1.00 17.13  ? 1   GLY M CA  1 
ATOM   3743 C C   . GLY M  1 1  ? 5.501   34.198  8.530   1.00 16.51  ? 1   GLY M C   1 
ATOM   3744 O O   . GLY M  1 1  ? 5.276   34.043  9.738   1.00 21.71  ? 1   GLY M O   1 
ATOM   3745 N N   . ILE M  1 2  ? 6.630   34.738  8.088   1.00 12.98  ? 2   ILE M N   1 
ATOM   3746 C CA  . ILE M  1 2  ? 7.683   35.192  9.016   1.00 9.52   ? 2   ILE M CA  1 
ATOM   3747 C C   . ILE M  1 2  ? 7.341   36.559  9.585   1.00 9.41   ? 2   ILE M C   1 
ATOM   3748 O O   . ILE M  1 2  ? 7.128   37.536  8.865   1.00 14.31  ? 2   ILE M O   1 
ATOM   3749 C CB  . ILE M  1 2  ? 9.044   35.202  8.280   1.00 10.69  ? 2   ILE M CB  1 
ATOM   3750 C CG1 . ILE M  1 2  ? 9.424   33.809  7.767   1.00 13.72  ? 2   ILE M CG1 1 
ATOM   3751 C CG2 . ILE M  1 2  ? 10.134  35.801  9.140   1.00 12.45  ? 2   ILE M CG2 1 
ATOM   3752 C CD1 . ILE M  1 2  ? 10.454  33.706  6.666   1.00 11.20  ? 2   ILE M CD1 1 
ATOM   3753 N N   . GLY M  1 3  ? 7.257   36.672  10.910  1.00 10.09  ? 3   GLY M N   1 
ATOM   3754 C CA  . GLY M  1 3  ? 6.813   37.875  11.588  1.00 9.07   ? 3   GLY M CA  1 
ATOM   3755 C C   . GLY M  1 3  ? 7.553   38.145  12.900  1.00 9.60   ? 3   GLY M C   1 
ATOM   3756 O O   . GLY M  1 3  ? 7.029   38.796  13.798  1.00 16.66  ? 3   GLY M O   1 
ATOM   3757 N N   . ASP M  1 4  ? 8.760   37.648  13.033  1.00 12.24  ? 4   ASP M N   1 
ATOM   3758 C CA  . ASP M  1 4  ? 9.619   37.870  14.200  1.00 12.43  ? 4   ASP M CA  1 
ATOM   3759 C C   . ASP M  1 4  ? 11.069  37.714  13.779  1.00 6.44   ? 4   ASP M C   1 
ATOM   3760 O O   . ASP M  1 4  ? 11.378  37.000  12.806  1.00 9.89   ? 4   ASP M O   1 
ATOM   3761 C CB  . ASP M  1 4  ? 9.285   36.919  15.352  1.00 12.61  ? 4   ASP M CB  1 
ATOM   3762 C CG  . ASP M  1 4  ? 9.876   35.537  15.149  1.00 13.93  ? 4   ASP M CG  1 
ATOM   3763 O OD1 . ASP M  1 4  ? 9.182   34.675  14.578  1.00 14.04  ? 4   ASP M OD1 1 
ATOM   3764 O OD2 . ASP M  1 4  ? 11.043  35.325  15.534  1.00 10.92  ? 4   ASP M OD2 1 
ATOM   3765 N N   . PRO M  1 5  ? 11.983  38.375  14.492  1.00 11.42  ? 5   PRO M N   1 
ATOM   3766 C CA  . PRO M  1 5  ? 13.408  38.362  14.137  1.00 9.42   ? 5   PRO M CA  1 
ATOM   3767 C C   . PRO M  1 5  ? 14.060  36.989  14.153  1.00 13.01  ? 5   PRO M C   1 
ATOM   3768 O O   . PRO M  1 5  ? 14.936  36.683  13.333  1.00 9.49   ? 5   PRO M O   1 
ATOM   3769 C CB  . PRO M  1 5  ? 14.040  39.228  15.240  1.00 12.83  ? 5   PRO M CB  1 
ATOM   3770 C CG  . PRO M  1 5  ? 12.923  40.063  15.765  1.00 17.11  ? 5   PRO M CG  1 
ATOM   3771 C CD  . PRO M  1 5  ? 11.700  39.175  15.692  1.00 14.93  ? 5   PRO M CD  1 
ATOM   3772 N N   . VAL M  1 6  ? 13.673  36.116  15.102  1.00 11.71  ? 6   VAL M N   1 
ATOM   3773 C CA  . VAL M  1 6  ? 14.368  34.825  15.196  1.00 10.95  ? 6   VAL M CA  1 
ATOM   3774 C C   . VAL M  1 6  ? 14.012  33.875  14.045  1.00 7.17   ? 6   VAL M C   1 
ATOM   3775 O O   . VAL M  1 6  ? 14.901  33.285  13.453  1.00 10.82  ? 6   VAL M O   1 
ATOM   3776 C CB  . VAL M  1 6  ? 14.090  34.114  16.538  1.00 15.38  ? 6   VAL M CB  1 
ATOM   3777 C CG1 . VAL M  1 6  ? 14.694  32.719  16.528  1.00 11.73  ? 6   VAL M CG1 1 
ATOM   3778 C CG2 . VAL M  1 6  ? 14.643  34.932  17.697  1.00 15.91  ? 6   VAL M CG2 1 
ATOM   3779 N N   . THR M  1 7  ? 12.716  33.793  13.743  1.00 13.28  ? 7   THR M N   1 
ATOM   3780 C CA  . THR M  1 7  ? 12.302  33.004  12.583  1.00 11.86  ? 7   THR M CA  1 
ATOM   3781 C C   . THR M  1 7  ? 12.987  33.546  11.326  1.00 9.61   ? 7   THR M C   1 
ATOM   3782 O O   . THR M  1 7  ? 13.475  32.749  10.527  1.00 11.22  ? 7   THR M O   1 
ATOM   3783 C CB  . THR M  1 7  ? 10.769  33.027  12.445  1.00 13.01  ? 7   THR M CB  1 
ATOM   3784 O OG1 . THR M  1 7  ? 10.184  32.543  13.677  1.00 12.46  ? 7   THR M OG1 1 
ATOM   3785 C CG2 . THR M  1 7  ? 10.329  32.135  11.304  1.00 9.72   ? 7   THR M CG2 1 
ATOM   3786 N N   . CYS M  1 8  ? 13.016  34.860  11.172  1.00 10.31  ? 8   CYS M N   1 
ATOM   3787 C CA  . CYS M  1 8  ? 13.703  35.484  10.039  1.00 10.44  ? 8   CYS M CA  1 
ATOM   3788 C C   . CYS M  1 8  ? 15.147  35.042  9.944   1.00 9.85   ? 8   CYS M C   1 
ATOM   3789 O O   . CYS M  1 8  ? 15.592  34.541  8.920   1.00 10.37  ? 8   CYS M O   1 
ATOM   3790 C CB  . CYS M  1 8  ? 13.640  37.016  10.132  1.00 7.36   ? 8   CYS M CB  1 
ATOM   3791 S SG  . CYS M  1 8  ? 14.436  37.834  8.735   1.00 10.90  ? 8   CYS M SG  1 
ATOM   3792 N N   . LEU M  1 9  ? 15.924  35.202  11.021  1.00 8.57   ? 9   LEU M N   1 
ATOM   3793 C CA  . LEU M  1 9  ? 17.341  34.870  10.975  1.00 9.94   ? 9   LEU M CA  1 
ATOM   3794 C C   . LEU M  1 9  ? 17.580  33.374  10.799  1.00 10.16  ? 9   LEU M C   1 
ATOM   3795 O O   . LEU M  1 9  ? 18.491  32.946  10.082  1.00 11.86  ? 9   LEU M O   1 
ATOM   3796 C CB  . LEU M  1 9  ? 17.992  35.385  12.267  1.00 10.34  ? 9   LEU M CB  1 
ATOM   3797 C CG  . LEU M  1 9  ? 18.067  36.904  12.388  1.00 11.29  ? 9   LEU M CG  1 
ATOM   3798 C CD1 . LEU M  1 9  ? 18.262  37.369  13.815  1.00 9.75   ? 9   LEU M CD1 1 
ATOM   3799 C CD2 . LEU M  1 9  ? 19.197  37.420  11.487  1.00 18.69  ? 9   LEU M CD2 1 
ATOM   3800 N N   . LYS M  1 10 ? 16.729  32.558  11.437  1.00 11.93  ? 10  LYS M N   1 
ATOM   3801 C CA  . LYS M  1 10 ? 16.868  31.118  11.300  1.00 15.64  ? 10  LYS M CA  1 
ATOM   3802 C C   . LYS M  1 10 ? 16.783  30.674  9.833   1.00 13.99  ? 10  LYS M C   1 
ATOM   3803 O O   . LYS M  1 10 ? 17.427  29.679  9.475   1.00 14.48  ? 10  LYS M O   1 
ATOM   3804 C CB  . LYS M  1 10 ? 15.782  30.374  12.082  1.00 13.09  ? 10  LYS M CB  1 
ATOM   3805 C CG  . LYS M  1 10 ? 16.094  30.223  13.565  1.00 22.64  ? 10  LYS M CG  1 
ATOM   3806 C CD  . LYS M  1 10 ? 14.919  29.534  14.264  1.00 28.36  ? 10  LYS M CD  1 
ATOM   3807 C CE  . LYS M  1 10 ? 15.212  29.330  15.736  1.00 34.35  ? 10  LYS M CE  1 
ATOM   3808 N NZ  . LYS M  1 10 ? 14.307  28.324  16.355  1.00 45.57  ? 10  LYS M NZ  1 
ATOM   3809 N N   . SER M  1 11 ? 15.998  31.422  9.061   1.00 13.21  ? 11  SER M N   1 
ATOM   3810 C CA  . SER M  1 11 ? 15.823  31.088  7.641   1.00 8.45   ? 11  SER M CA  1 
ATOM   3811 C C   . SER M  1 11 ? 17.023  31.513  6.811   1.00 10.66  ? 11  SER M C   1 
ATOM   3812 O O   . SER M  1 11 ? 17.079  31.162  5.618   1.00 16.23  ? 11  SER M O   1 
ATOM   3813 C CB  . SER M  1 11 ? 14.536  31.687  7.071   1.00 14.53  ? 11  SER M CB  1 
ATOM   3814 O OG  . SER M  1 11 ? 14.754  33.045  6.717   1.00 15.76  ? 11  SER M OG  1 
ATOM   3815 N N   . GLY M  1 12 ? 17.971  32.231  7.405   1.00 10.69  ? 12  GLY M N   1 
ATOM   3816 C CA  . GLY M  1 12 ? 19.164  32.656  6.697   1.00 10.16  ? 12  GLY M CA  1 
ATOM   3817 C C   . GLY M  1 12 ? 19.039  34.047  6.110   1.00 9.91   ? 12  GLY M C   1 
ATOM   3818 O O   . GLY M  1 12 ? 19.904  34.472  5.329   1.00 13.13  ? 12  GLY M O   1 
ATOM   3819 N N   . ALA M  1 13 ? 17.964  34.725  6.456   1.00 10.17  ? 13  ALA M N   1 
ATOM   3820 C CA  . ALA M  1 13 ? 17.639  36.072  6.023   1.00 8.20   ? 13  ALA M CA  1 
ATOM   3821 C C   . ALA M  1 13 ? 18.201  37.126  6.982   1.00 16.76  ? 13  ALA M C   1 
ATOM   3822 O O   . ALA M  1 13 ? 18.667  36.801  8.077   1.00 11.92  ? 13  ALA M O   1 
ATOM   3823 C CB  . ALA M  1 13 ? 16.132  36.202  5.937   1.00 11.35  ? 13  ALA M CB  1 
ATOM   3824 N N   . ILE M  1 14 ? 18.144  38.386  6.597   1.00 11.61  ? 14  ILE M N   1 
ATOM   3825 C CA  . ILE M  1 14 ? 18.441  39.498  7.492   1.00 13.44  ? 14  ILE M CA  1 
ATOM   3826 C C   . ILE M  1 14 ? 17.196  40.250  7.949   1.00 15.97  ? 14  ILE M C   1 
ATOM   3827 O O   . ILE M  1 14 ? 16.136  40.273  7.335   1.00 14.09  ? 14  ILE M O   1 
ATOM   3828 C CB  . ILE M  1 14 ? 19.347  40.539  6.809   1.00 10.32  ? 14  ILE M CB  1 
ATOM   3829 C CG1 . ILE M  1 14 ? 18.658  41.352  5.711   1.00 16.08  ? 14  ILE M CG1 1 
ATOM   3830 C CG2 . ILE M  1 14 ? 20.594  39.877  6.270   1.00 15.23  ? 14  ILE M CG2 1 
ATOM   3831 C CD1 . ILE M  1 14 ? 19.623  42.384  5.119   1.00 17.95  ? 14  ILE M CD1 1 
ATOM   3832 N N   . CYS M  1 15 ? 17.267  40.917  9.100   1.00 17.62  ? 15  CYS M N   1 
ATOM   3833 C CA  . CYS M  1 15 ? 16.236  41.844  9.569   1.00 13.53  ? 15  CYS M CA  1 
ATOM   3834 C C   . CYS M  1 15 ? 16.788  43.269  9.348   1.00 14.41  ? 15  CYS M C   1 
ATOM   3835 O O   . CYS M  1 15 ? 17.814  43.610  9.949   1.00 15.78  ? 15  CYS M O   1 
ATOM   3836 C CB  . CYS M  1 15 ? 15.856  41.697  11.036  1.00 12.59  ? 15  CYS M CB  1 
ATOM   3837 S SG  . CYS M  1 15 ? 14.959  40.186  11.484  1.00 13.78  ? 15  CYS M SG  1 
ATOM   3838 N N   . HIS M  1 16 ? 16.110  44.010  8.501   1.00 12.78  ? 16  HIS M N   1 
ATOM   3839 C CA  . HIS M  1 16 ? 16.492  45.359  8.091   1.00 13.19  ? 16  HIS M CA  1 
ATOM   3840 C C   . HIS M  1 16 ? 15.321  46.316  8.234   1.00 16.77  ? 16  HIS M C   1 
ATOM   3841 O O   . HIS M  1 16 ? 14.221  45.998  7.764   1.00 17.96  ? 16  HIS M O   1 
ATOM   3842 C CB  . HIS M  1 16 ? 16.957  45.302  6.629   1.00 21.24  ? 16  HIS M CB  1 
ATOM   3843 C CG  . HIS M  1 16 ? 17.743  46.494  6.184   1.00 22.12  ? 16  HIS M CG  1 
ATOM   3844 N ND1 . HIS M  1 16 ? 17.189  47.735  5.997   1.00 19.45  ? 16  HIS M ND1 1 
ATOM   3845 C CD2 . HIS M  1 16 ? 19.059  46.623  5.909   1.00 29.41  ? 16  HIS M CD2 1 
ATOM   3846 C CE1 . HIS M  1 16 ? 18.132  48.585  5.616   1.00 23.86  ? 16  HIS M CE1 1 
ATOM   3847 N NE2 . HIS M  1 16 ? 19.283  47.929  5.552   1.00 22.31  ? 16  HIS M NE2 1 
ATOM   3848 N N   . PRO M  1 17 ? 15.563  47.456  8.872   1.00 18.09  ? 17  PRO M N   1 
ATOM   3849 C CA  . PRO M  1 17 ? 14.516  48.455  9.090   1.00 26.71  ? 17  PRO M CA  1 
ATOM   3850 C C   . PRO M  1 17 ? 14.085  49.148  7.803   1.00 24.49  ? 17  PRO M C   1 
ATOM   3851 O O   . PRO M  1 17 ? 14.875  49.387  6.889   1.00 30.44  ? 17  PRO M O   1 
ATOM   3852 C CB  . PRO M  1 17 ? 15.188  49.463  10.034  1.00 32.22  ? 17  PRO M CB  1 
ATOM   3853 C CG  . PRO M  1 17 ? 16.646  49.315  9.778   1.00 29.13  ? 17  PRO M CG  1 
ATOM   3854 C CD  . PRO M  1 17 ? 16.863  47.868  9.427   1.00 24.18  ? 17  PRO M CD  1 
ATOM   3855 N N   . VAL M  1 18 ? 12.809  49.464  7.730   1.00 21.11  ? 18  VAL M N   1 
ATOM   3856 C CA  . VAL M  1 18 ? 12.138  50.204  6.684   1.00 28.73  ? 18  VAL M CA  1 
ATOM   3857 C C   . VAL M  1 18 ? 12.104  49.551  5.313   1.00 23.36  ? 18  VAL M C   1 
ATOM   3858 O O   . VAL M  1 18 ? 11.048  49.523  4.667   1.00 32.52  ? 18  VAL M O   1 
ATOM   3859 C CB  . VAL M  1 18 ? 12.788  51.605  6.522   1.00 33.94  ? 18  VAL M CB  1 
ATOM   3860 C CG1 . VAL M  1 18 ? 12.086  52.366  5.416   1.00 35.53  ? 18  VAL M CG1 1 
ATOM   3861 C CG2 . VAL M  1 18 ? 12.731  52.352  7.842   1.00 39.72  ? 18  VAL M CG2 1 
ATOM   3862 N N   . PHE M  1 19 ? 13.203  49.030  4.790   1.00 26.78  ? 19  PHE M N   1 
ATOM   3863 C CA  . PHE M  1 19 ? 13.186  48.414  3.471   1.00 19.54  ? 19  PHE M CA  1 
ATOM   3864 C C   . PHE M  1 19 ? 14.199  47.292  3.342   1.00 23.63  ? 19  PHE M C   1 
ATOM   3865 O O   . PHE M  1 19 ? 15.074  47.104  4.194   1.00 23.40  ? 19  PHE M O   1 
ATOM   3866 C CB  . PHE M  1 19 ? 13.456  49.487  2.399   1.00 28.00  ? 19  PHE M CB  1 
ATOM   3867 C CG  . PHE M  1 19 ? 14.869  50.056  2.425   1.00 20.81  ? 19  PHE M CG  1 
ATOM   3868 C CD1 . PHE M  1 19 ? 15.856  49.574  1.586   1.00 22.68  ? 19  PHE M CD1 1 
ATOM   3869 C CD2 . PHE M  1 19 ? 15.200  51.068  3.306   1.00 21.46  ? 19  PHE M CD2 1 
ATOM   3870 C CE1 . PHE M  1 19 ? 17.141  50.083  1.617   1.00 21.63  ? 19  PHE M CE1 1 
ATOM   3871 C CE2 . PHE M  1 19 ? 16.481  51.593  3.355   1.00 19.96  ? 19  PHE M CE2 1 
ATOM   3872 C CZ  . PHE M  1 19 ? 17.458  51.090  2.512   1.00 18.21  ? 19  PHE M CZ  1 
ATOM   3873 N N   . CYS M  1 20 ? 14.133  46.518  2.267   1.00 19.01  ? 20  CYS M N   1 
ATOM   3874 C CA  . CYS M  1 20 ? 15.171  45.554  1.939   1.00 15.70  ? 20  CYS M CA  1 
ATOM   3875 C C   . CYS M  1 20 ? 16.203  46.171  0.988   1.00 21.14  ? 20  CYS M C   1 
ATOM   3876 O O   . CYS M  1 20 ? 15.808  46.742  -0.039  1.00 22.13  ? 20  CYS M O   1 
ATOM   3877 C CB  . CYS M  1 20 ? 14.600  44.300  1.290   1.00 19.44  ? 20  CYS M CB  1 
ATOM   3878 S SG  . CYS M  1 20 ? 13.550  43.295  2.375   1.00 18.45  ? 20  CYS M SG  1 
ATOM   3879 N N   . PRO M  1 21 ? 17.480  46.059  1.323   1.00 17.31  ? 21  PRO M N   1 
ATOM   3880 C CA  . PRO M  1 21 ? 18.516  46.715  0.511   1.00 15.70  ? 21  PRO M CA  1 
ATOM   3881 C C   . PRO M  1 21 ? 18.559  46.052  -0.863  1.00 26.28  ? 21  PRO M C   1 
ATOM   3882 O O   . PRO M  1 21 ? 18.077  44.936  -1.037  1.00 28.48  ? 21  PRO M O   1 
ATOM   3883 C CB  . PRO M  1 21 ? 19.807  46.504  1.288   1.00 23.90  ? 21  PRO M CB  1 
ATOM   3884 C CG  . PRO M  1 21 ? 19.548  45.398  2.248   1.00 21.93  ? 21  PRO M CG  1 
ATOM   3885 C CD  . PRO M  1 21 ? 18.065  45.305  2.439   1.00 22.82  ? 21  PRO M CD  1 
ATOM   3886 N N   . ARG M  1 22 ? 19.122  46.785  -1.814  1.00 30.40  ? 22  ARG M N   1 
ATOM   3887 C CA  . ARG M  1 22 ? 19.367  46.336  -3.170  1.00 30.51  ? 22  ARG M CA  1 
ATOM   3888 C C   . ARG M  1 22 ? 19.790  44.874  -3.238  1.00 18.21  ? 22  ARG M C   1 
ATOM   3889 O O   . ARG M  1 22 ? 20.674  44.477  -2.481  1.00 27.91  ? 22  ARG M O   1 
ATOM   3890 C CB  . ARG M  1 22 ? 20.470  47.196  -3.802  1.00 38.43  ? 22  ARG M CB  1 
ATOM   3891 C CG  . ARG M  1 22 ? 20.204  47.551  -5.255  1.00 54.42  ? 22  ARG M CG  1 
ATOM   3892 C CD  . ARG M  1 22 ? 19.938  49.047  -5.425  1.00 60.18  ? 22  ARG M CD  1 
ATOM   3893 N NE  . ARG M  1 22 ? 19.727  49.351  -6.845  1.00 69.21  ? 22  ARG M NE  1 
ATOM   3894 C CZ  . ARG M  1 22 ? 20.735  49.591  -7.690  1.00 70.20  ? 22  ARG M CZ  1 
ATOM   3895 N NH1 . ARG M  1 22 ? 21.997  49.573  -7.250  1.00 76.13  ? 22  ARG M NH1 1 
ATOM   3896 N NH2 . ARG M  1 22 ? 20.462  49.850  -8.964  1.00 71.57  ? 22  ARG M NH2 1 
ATOM   3897 N N   . ARG M  1 23 ? 19.188  44.087  -4.113  1.00 20.62  ? 23  ARG M N   1 
ATOM   3898 C CA  . ARG M  1 23 ? 19.492  42.672  -4.302  1.00 24.79  ? 23  ARG M CA  1 
ATOM   3899 C C   . ARG M  1 23 ? 18.787  41.787  -3.260  1.00 30.56  ? 23  ARG M C   1 
ATOM   3900 O O   . ARG M  1 23 ? 18.628  40.583  -3.466  1.00 22.46  ? 23  ARG M O   1 
ATOM   3901 C CB  . ARG M  1 23 ? 20.975  42.330  -4.245  1.00 23.78  ? 23  ARG M CB  1 
ATOM   3902 C CG  . ARG M  1 23 ? 21.942  43.169  -5.055  1.00 33.33  ? 23  ARG M CG  1 
ATOM   3903 C CD  . ARG M  1 23 ? 21.469  43.388  -6.480  1.00 31.26  ? 23  ARG M CD  1 
ATOM   3904 N NE  . ARG M  1 23 ? 21.770  42.227  -7.316  1.00 42.58  ? 23  ARG M NE  1 
ATOM   3905 C CZ  . ARG M  1 23 ? 21.026  41.813  -8.333  1.00 51.46  ? 23  ARG M CZ  1 
ATOM   3906 N NH1 . ARG M  1 23 ? 19.918  42.472  -8.647  1.00 68.10  ? 23  ARG M NH1 1 
ATOM   3907 N NH2 . ARG M  1 23 ? 21.379  40.745  -9.036  1.00 54.03  ? 23  ARG M NH2 1 
ATOM   3908 N N   . TYR M  1 24 ? 18.356  42.356  -2.142  1.00 22.29  ? 24  TYR M N   1 
ATOM   3909 C CA  . TYR M  1 24 ? 17.573  41.575  -1.183  1.00 28.12  ? 24  TYR M CA  1 
ATOM   3910 C C   . TYR M  1 24 ? 16.079  41.726  -1.485  1.00 24.82  ? 24  TYR M C   1 
ATOM   3911 O O   . TYR M  1 24 ? 15.613  42.772  -1.942  1.00 24.31  ? 24  TYR M O   1 
ATOM   3912 C CB  . TYR M  1 24 ? 17.819  41.979  0.265   1.00 23.49  ? 24  TYR M CB  1 
ATOM   3913 C CG  . TYR M  1 24 ? 19.139  41.583  0.870   1.00 25.07  ? 24  TYR M CG  1 
ATOM   3914 C CD1 . TYR M  1 24 ? 20.301  42.299  0.583   1.00 17.92  ? 24  TYR M CD1 1 
ATOM   3915 C CD2 . TYR M  1 24 ? 19.234  40.485  1.726   1.00 19.52  ? 24  TYR M CD2 1 
ATOM   3916 C CE1 . TYR M  1 24 ? 21.520  41.932  1.136   1.00 19.30  ? 24  TYR M CE1 1 
ATOM   3917 C CE2 . TYR M  1 24 ? 20.441  40.120  2.280   1.00 19.11  ? 24  TYR M CE2 1 
ATOM   3918 C CZ  . TYR M  1 24 ? 21.581  40.847  1.982   1.00 18.28  ? 24  TYR M CZ  1 
ATOM   3919 O OH  . TYR M  1 24 ? 22.777  40.470  2.548   1.00 24.27  ? 24  TYR M OH  1 
ATOM   3920 N N   . LYS M  1 25 ? 15.359  40.643  -1.228  1.00 18.86  ? 25  LYS M N   1 
ATOM   3921 C CA  . LYS M  1 25 ? 13.931  40.536  -1.465  1.00 19.38  ? 25  LYS M CA  1 
ATOM   3922 C C   . LYS M  1 25 ? 13.206  40.273  -0.138  1.00 17.47  ? 25  LYS M C   1 
ATOM   3923 O O   . LYS M  1 25 ? 13.711  39.523  0.692   1.00 16.25  ? 25  LYS M O   1 
ATOM   3924 C CB  . LYS M  1 25 ? 13.567  39.408  -2.432  1.00 22.57  ? 25  LYS M CB  1 
ATOM   3925 C CG  . LYS M  1 25 ? 14.140  39.578  -3.829  1.00 39.15  ? 25  LYS M CG  1 
ATOM   3926 C CD  . LYS M  1 25 ? 13.683  40.894  -4.446  1.00 42.09  ? 25  LYS M CD  1 
ATOM   3927 C CE  . LYS M  1 25 ? 14.477  41.219  -5.709  1.00 50.98  ? 25  LYS M CE  1 
ATOM   3928 N NZ  . LYS M  1 25 ? 14.137  42.574  -6.236  1.00 53.65  ? 25  LYS M NZ  1 
ATOM   3929 N N   . GLN M  1 26 ? 12.047  40.901  -0.025  1.00 15.57  ? 26  GLN M N   1 
ATOM   3930 C CA  . GLN M  1 26 ? 11.271  40.772  1.201   1.00 15.07  ? 26  GLN M CA  1 
ATOM   3931 C C   . GLN M  1 26 ? 10.590  39.401  1.256   1.00 20.10  ? 26  GLN M C   1 
ATOM   3932 O O   . GLN M  1 26 ? 9.928   38.994  0.294   1.00 15.03  ? 26  GLN M O   1 
ATOM   3933 C CB  . GLN M  1 26 ? 10.225  41.885  1.310   1.00 17.68  ? 26  GLN M CB  1 
ATOM   3934 C CG  . GLN M  1 26 ? 9.401   41.757  2.589   1.00 23.30  ? 26  GLN M CG  1 
ATOM   3935 C CD  . GLN M  1 26 ? 8.533   42.964  2.879   1.00 25.25  ? 26  GLN M CD  1 
ATOM   3936 O OE1 . GLN M  1 26 ? 8.750   44.045  2.328   1.00 25.61  ? 26  GLN M OE1 1 
ATOM   3937 N NE2 . GLN M  1 26 ? 7.542   42.805  3.749   1.00 23.78  ? 26  GLN M NE2 1 
ATOM   3938 N N   . ILE M  1 27 ? 10.764  38.719  2.386   1.00 12.97  ? 27  ILE M N   1 
ATOM   3939 C CA  . ILE M  1 27 ? 10.150  37.407  2.572   1.00 12.87  ? 27  ILE M CA  1 
ATOM   3940 C C   . ILE M  1 27 ? 9.265   37.364  3.810   1.00 12.91  ? 27  ILE M C   1 
ATOM   3941 O O   . ILE M  1 27 ? 8.638   36.337  4.081   1.00 14.03  ? 27  ILE M O   1 
ATOM   3942 C CB  . ILE M  1 27 ? 11.209  36.300  2.673   1.00 13.79  ? 27  ILE M CB  1 
ATOM   3943 C CG1 . ILE M  1 27 ? 12.119  36.454  3.896   1.00 10.56  ? 27  ILE M CG1 1 
ATOM   3944 C CG2 . ILE M  1 27 ? 12.038  36.211  1.399   1.00 16.33  ? 27  ILE M CG2 1 
ATOM   3945 C CD1 . ILE M  1 27 ? 12.989  35.228  4.129   1.00 12.51  ? 27  ILE M CD1 1 
ATOM   3946 N N   . GLY M  1 28 ? 9.214   38.455  4.539   1.00 13.67  ? 28  GLY M N   1 
ATOM   3947 C CA  . GLY M  1 28 ? 8.406   38.594  5.749   1.00 8.61   ? 28  GLY M CA  1 
ATOM   3948 C C   . GLY M  1 28 ? 8.739   39.873  6.481   1.00 12.12  ? 28  GLY M C   1 
ATOM   3949 O O   . GLY M  1 28 ? 9.321   40.792  5.902   1.00 15.77  ? 28  GLY M O   1 
ATOM   3950 N N   . THR M  1 29 ? 8.372   39.962  7.761   1.00 11.92  ? 29  THR M N   1 
ATOM   3951 C CA  . THR M  1 29 ? 8.780   41.041  8.628   1.00 9.97   ? 29  THR M CA  1 
ATOM   3952 C C   . THR M  1 29 ? 9.581   40.507  9.815   1.00 14.75  ? 29  THR M C   1 
ATOM   3953 O O   . THR M  1 29 ? 9.703   39.302  10.023  1.00 12.94  ? 29  THR M O   1 
ATOM   3954 C CB  . THR M  1 29 ? 7.596   41.864  9.189   1.00 15.27  ? 29  THR M CB  1 
ATOM   3955 O OG1 . THR M  1 29 ? 6.939   41.082  10.200  1.00 15.54  ? 29  THR M OG1 1 
ATOM   3956 C CG2 . THR M  1 29 ? 6.583   42.188  8.097   1.00 20.90  ? 29  THR M CG2 1 
ATOM   3957 N N   . CYS M  1 30 ? 10.112  41.430  10.618  1.00 11.97  ? 30  CYS M N   1 
ATOM   3958 C CA  . CYS M  1 30 ? 10.702  40.962  11.877  1.00 13.00  ? 30  CYS M CA  1 
ATOM   3959 C C   . CYS M  1 30 ? 9.915   41.452  13.096  1.00 16.99  ? 30  CYS M C   1 
ATOM   3960 O O   . CYS M  1 30 ? 10.435  41.589  14.208  1.00 14.19  ? 30  CYS M O   1 
ATOM   3961 C CB  . CYS M  1 30 ? 12.176  41.353  11.920  1.00 16.20  ? 30  CYS M CB  1 
ATOM   3962 S SG  . CYS M  1 30 ? 13.126  40.467  10.655  1.00 12.80  ? 30  CYS M SG  1 
ATOM   3963 N N   . GLY M  1 31 ? 8.637   41.683  12.895  1.00 15.37  ? 31  GLY M N   1 
ATOM   3964 C CA  . GLY M  1 31 ? 7.608   41.893  13.903  1.00 14.55  ? 31  GLY M CA  1 
ATOM   3965 C C   . GLY M  1 31 ? 7.549   43.344  14.360  1.00 19.59  ? 31  GLY M C   1 
ATOM   3966 O O   . GLY M  1 31 ? 6.462   43.939  14.435  1.00 18.95  ? 31  GLY M O   1 
ATOM   3967 N N   . LEU M  1 32 ? 8.688   43.936  14.671  1.00 17.31  ? 32  LEU M N   1 
ATOM   3968 C CA  . LEU M  1 32 ? 8.738   45.339  15.072  1.00 24.82  ? 32  LEU M CA  1 
ATOM   3969 C C   . LEU M  1 32 ? 8.340   46.220  13.887  1.00 21.31  ? 32  LEU M C   1 
ATOM   3970 O O   . LEU M  1 32 ? 8.566   45.874  12.729  1.00 19.66  ? 32  LEU M O   1 
ATOM   3971 C CB  . LEU M  1 32 ? 10.114  45.766  15.581  1.00 21.92  ? 32  LEU M CB  1 
ATOM   3972 C CG  . LEU M  1 32 ? 10.741  44.882  16.662  1.00 31.19  ? 32  LEU M CG  1 
ATOM   3973 C CD1 . LEU M  1 32 ? 12.112  45.400  17.065  1.00 19.10  ? 32  LEU M CD1 1 
ATOM   3974 C CD2 . LEU M  1 32 ? 9.825   44.777  17.869  1.00 27.25  ? 32  LEU M CD2 1 
ATOM   3975 N N   . PRO M  1 33 ? 7.734   47.349  14.201  1.00 20.08  ? 33  PRO M N   1 
ATOM   3976 C CA  . PRO M  1 33 ? 7.218   48.231  13.149  1.00 19.33  ? 33  PRO M CA  1 
ATOM   3977 C C   . PRO M  1 33 ? 8.279   48.572  12.109  1.00 16.19  ? 33  PRO M C   1 
ATOM   3978 O O   . PRO M  1 33 ? 9.422   48.885  12.455  1.00 21.95  ? 33  PRO M O   1 
ATOM   3979 C CB  . PRO M  1 33 ? 6.809   49.484  13.936  1.00 25.86  ? 33  PRO M CB  1 
ATOM   3980 C CG  . PRO M  1 33 ? 6.501   48.957  15.299  1.00 26.54  ? 33  PRO M CG  1 
ATOM   3981 C CD  . PRO M  1 33 ? 7.492   47.855  15.565  1.00 19.39  ? 33  PRO M CD  1 
ATOM   3982 N N   . GLY M  1 34 ? 7.877   48.461  10.845  1.00 19.54  ? 34  GLY M N   1 
ATOM   3983 C CA  . GLY M  1 34 ? 8.727   48.741  9.713   1.00 19.93  ? 34  GLY M CA  1 
ATOM   3984 C C   . GLY M  1 34 ? 9.836   47.774  9.424   1.00 21.80  ? 34  GLY M C   1 
ATOM   3985 O O   . GLY M  1 34 ? 10.522  47.891  8.401   1.00 21.04  ? 34  GLY M O   1 
ATOM   3986 N N   . THR M  1 35 ? 10.067  46.793  10.307  1.00 17.10  ? 35  THR M N   1 
ATOM   3987 C CA  . THR M  1 35 ? 11.180  45.889  10.044  1.00 17.50  ? 35  THR M CA  1 
ATOM   3988 C C   . THR M  1 35 ? 10.832  44.864  8.965   1.00 18.96  ? 35  THR M C   1 
ATOM   3989 O O   . THR M  1 35 ? 9.722   44.324  8.917   1.00 18.30  ? 35  THR M O   1 
ATOM   3990 C CB  . THR M  1 35 ? 11.632  45.103  11.296  1.00 17.64  ? 35  THR M CB  1 
ATOM   3991 O OG1 . THR M  1 35 ? 10.529  44.338  11.796  1.00 18.09  ? 35  THR M OG1 1 
ATOM   3992 C CG2 . THR M  1 35 ? 12.084  46.071  12.383  1.00 17.73  ? 35  THR M CG2 1 
ATOM   3993 N N   . LYS M  1 36 ? 11.820  44.611  8.106   1.00 13.96  ? 36  LYS M N   1 
ATOM   3994 C CA  . LYS M  1 36 ? 11.558  43.665  7.026   1.00 14.35  ? 36  LYS M CA  1 
ATOM   3995 C C   . LYS M  1 36 ? 12.489  42.468  7.147   1.00 13.46  ? 36  LYS M C   1 
ATOM   3996 O O   . LYS M  1 36 ? 13.645  42.644  7.500   1.00 13.27  ? 36  LYS M O   1 
ATOM   3997 C CB  . LYS M  1 36 ? 11.745  44.327  5.654   1.00 16.52  ? 36  LYS M CB  1 
ATOM   3998 C CG  . LYS M  1 36 ? 11.067  45.692  5.554   1.00 16.03  ? 36  LYS M CG  1 
ATOM   3999 C CD  . LYS M  1 36 ? 9.547   45.536  5.658   1.00 19.78  ? 36  LYS M CD  1 
ATOM   4000 C CE  . LYS M  1 36 ? 8.851   46.884  5.587   1.00 20.90  ? 36  LYS M CE  1 
ATOM   4001 N NZ  . LYS M  1 36 ? 7.393   46.716  5.843   1.00 32.32  ? 36  LYS M NZ  1 
ATOM   4002 N N   . CYS M  1 37 ? 11.970  41.286  6.839   1.00 11.78  ? 37  CYS M N   1 
ATOM   4003 C CA  . CYS M  1 37 ? 12.823  40.111  6.697   1.00 10.34  ? 37  CYS M CA  1 
ATOM   4004 C C   . CYS M  1 37 ? 13.246  39.993  5.238   1.00 15.03  ? 37  CYS M C   1 
ATOM   4005 O O   . CYS M  1 37 ? 12.348  39.911  4.399   1.00 11.67  ? 37  CYS M O   1 
ATOM   4006 C CB  . CYS M  1 37 ? 12.100  38.832  7.109   1.00 10.50  ? 37  CYS M CB  1 
ATOM   4007 S SG  . CYS M  1 37 ? 13.149  37.380  7.177   1.00 12.52  ? 37  CYS M SG  1 
ATOM   4008 N N   . CYS M  1 38 ? 14.549  40.012  4.984   1.00 14.00  ? 38  CYS M N   1 
ATOM   4009 C CA  . CYS M  1 38 ? 15.030  40.138  3.603   1.00 14.00  ? 38  CYS M CA  1 
ATOM   4010 C C   . CYS M  1 38 ? 16.055  39.093  3.224   1.00 15.77  ? 38  CYS M C   1 
ATOM   4011 O O   . CYS M  1 38 ? 16.891  38.767  4.068   1.00 13.12  ? 38  CYS M O   1 
ATOM   4012 C CB  . CYS M  1 38 ? 15.693  41.505  3.448   1.00 13.56  ? 38  CYS M CB  1 
ATOM   4013 S SG  . CYS M  1 38 ? 14.742  42.936  3.981   1.00 14.26  ? 38  CYS M SG  1 
ATOM   4014 N N   . LYS M  1 39 ? 16.034  38.583  1.985   1.00 12.35  ? 39  LYS M N   1 
ATOM   4015 C CA  . LYS M  1 39 ? 16.956  37.511  1.618   1.00 13.51  ? 39  LYS M CA  1 
ATOM   4016 C C   . LYS M  1 39 ? 17.307  37.594  0.140   1.00 18.28  ? 39  LYS M C   1 
ATOM   4017 O O   . LYS M  1 39 ? 16.437  37.931  -0.668  1.00 17.01  ? 39  LYS M O   1 
ATOM   4018 C CB  . LYS M  1 39 ? 16.333  36.144  1.932   1.00 18.43  ? 39  LYS M CB  1 
ATOM   4019 C CG  . LYS M  1 39 ? 17.362  35.039  2.097   1.00 30.11  ? 39  LYS M CG  1 
ATOM   4020 C CD  . LYS M  1 39 ? 16.790  33.803  2.770   1.00 21.50  ? 39  LYS M CD  1 
ATOM   4021 C CE  . LYS M  1 39 ? 17.750  32.627  2.612   1.00 22.95  ? 39  LYS M CE  1 
ATOM   4022 N NZ  . LYS M  1 39 ? 17.937  32.278  1.173   1.00 31.36  ? 39  LYS M NZ  1 
ATOM   4023 N N   A LYS M  1 40 ? 18.556  37.293  -0.204  0.50 20.51  ? 40  LYS M N   1 
ATOM   4024 N N   B LYS M  1 40 ? 18.557  37.296  -0.205  0.50 20.51  ? 40  LYS M N   1 
ATOM   4025 C CA  A LYS M  1 40 ? 18.914  37.266  -1.623  0.50 21.89  ? 40  LYS M CA  1 
ATOM   4026 C CA  B LYS M  1 40 ? 18.956  37.254  -1.613  0.50 21.94  ? 40  LYS M CA  1 
ATOM   4027 C C   A LYS M  1 40 ? 18.393  35.981  -2.264  0.50 21.76  ? 40  LYS M C   1 
ATOM   4028 C C   B LYS M  1 40 ? 18.399  35.986  -2.265  0.50 21.87  ? 40  LYS M C   1 
ATOM   4029 O O   A LYS M  1 40 ? 18.374  34.932  -1.629  0.50 20.62  ? 40  LYS M O   1 
ATOM   4030 O O   B LYS M  1 40 ? 18.360  34.937  -1.628  0.50 20.58  ? 40  LYS M O   1 
ATOM   4031 C CB  A LYS M  1 40 ? 20.423  37.364  -1.821  0.50 20.87  ? 40  LYS M CB  1 
ATOM   4032 C CB  B LYS M  1 40 ? 20.473  37.285  -1.774  0.50 20.92  ? 40  LYS M CB  1 
ATOM   4033 C CG  A LYS M  1 40 ? 21.130  38.298  -0.848  0.50 19.43  ? 40  LYS M CG  1 
ATOM   4034 C CG  B LYS M  1 40 ? 21.156  38.614  -1.499  0.50 21.52  ? 40  LYS M CG  1 
ATOM   4035 C CD  A LYS M  1 40 ? 22.620  38.382  -1.129  0.50 22.13  ? 40  LYS M CD  1 
ATOM   4036 C CD  B LYS M  1 40 ? 22.670  38.521  -1.584  0.50 23.15  ? 40  LYS M CD  1 
ATOM   4037 C CE  A LYS M  1 40 ? 23.342  37.141  -0.649  0.50 26.20  ? 40  LYS M CE  1 
ATOM   4038 C CE  B LYS M  1 40 ? 23.349  39.792  -1.104  0.50 25.83  ? 40  LYS M CE  1 
ATOM   4039 N NZ  A LYS M  1 40 ? 23.238  36.938  0.825   0.50 24.21  ? 40  LYS M NZ  1 
ATOM   4040 N NZ  B LYS M  1 40 ? 24.822  39.801  -1.321  0.50 14.68  ? 40  LYS M NZ  1 
ATOM   4041 N N   . PRO M  1 41 ? 17.982  36.068  -3.520  1.00 26.17  ? 41  PRO M N   1 
ATOM   4042 C CA  . PRO M  1 41 ? 17.562  34.877  -4.264  1.00 32.60  ? 41  PRO M CA  1 
ATOM   4043 C C   . PRO M  1 41 ? 18.571  33.734  -4.176  1.00 46.17  ? 41  PRO M C   1 
ATOM   4044 O O   . PRO M  1 41 ? 19.778  33.994  -4.044  1.00 43.52  ? 41  PRO M O   1 
ATOM   4045 C CB  . PRO M  1 41 ? 17.523  35.371  -5.709  1.00 31.84  ? 41  PRO M CB  1 
ATOM   4046 C CG  . PRO M  1 41 ? 17.352  36.845  -5.632  1.00 36.99  ? 41  PRO M CG  1 
ATOM   4047 C CD  . PRO M  1 41 ? 17.879  37.307  -4.306  1.00 28.50  ? 41  PRO M CD  1 
ATOM   4048 O OXT . PRO M  1 41 ? 18.124  32.564  -4.243  1.00 47.12  ? 41  PRO M OXT 1 
ATOM   4049 N N   . GLY N  1 1  ? 25.712  44.335  26.825  1.00 25.59  ? 1   GLY N N   1 
ATOM   4050 C CA  . GLY N  1 1  ? 25.782  44.742  25.430  1.00 24.49  ? 1   GLY N CA  1 
ATOM   4051 C C   . GLY N  1 1  ? 24.707  44.048  24.615  1.00 22.18  ? 1   GLY N C   1 
ATOM   4052 O O   . GLY N  1 1  ? 24.065  43.126  25.120  1.00 26.52  ? 1   GLY N O   1 
ATOM   4053 N N   . ILE N  1 2  ? 24.503  44.465  23.371  1.00 19.51  ? 2   ILE N N   1 
ATOM   4054 C CA  . ILE N  1 2  ? 23.407  43.900  22.573  1.00 15.67  ? 2   ILE N CA  1 
ATOM   4055 C C   . ILE N  1 2  ? 23.572  42.410  22.328  1.00 17.08  ? 2   ILE N C   1 
ATOM   4056 O O   . ILE N  1 2  ? 24.564  41.956  21.736  1.00 18.08  ? 2   ILE N O   1 
ATOM   4057 C CB  . ILE N  1 2  ? 23.272  44.666  21.245  1.00 17.53  ? 2   ILE N CB  1 
ATOM   4058 C CG1 . ILE N  1 2  ? 23.062  46.175  21.466  1.00 19.29  ? 2   ILE N CG1 1 
ATOM   4059 C CG2 . ILE N  1 2  ? 22.145  44.106  20.405  1.00 16.54  ? 2   ILE N CG2 1 
ATOM   4060 C CD1 . ILE N  1 2  ? 23.248  47.012  20.227  1.00 15.74  ? 2   ILE N CD1 1 
ATOM   4061 N N   . GLY N  1 3  ? 22.588  41.643  22.821  1.00 13.10  ? 3   GLY N N   1 
ATOM   4062 C CA  . GLY N  1 3  ? 22.587  40.203  22.671  1.00 16.60  ? 3   GLY N CA  1 
ATOM   4063 C C   . GLY N  1 3  ? 21.243  39.590  22.337  1.00 21.57  ? 3   GLY N C   1 
ATOM   4064 O O   . GLY N  1 3  ? 20.980  38.399  22.576  1.00 22.68  ? 3   GLY N O   1 
ATOM   4065 N N   . ASP N  1 4  ? 20.344  40.375  21.764  1.00 17.51  ? 4   ASP N N   1 
ATOM   4066 C CA  . ASP N  1 4  ? 19.022  39.921  21.381  1.00 17.13  ? 4   ASP N CA  1 
ATOM   4067 C C   . ASP N  1 4  ? 18.526  40.784  20.224  1.00 22.57  ? 4   ASP N C   1 
ATOM   4068 O O   . ASP N  1 4  ? 18.863  41.948  20.111  1.00 16.44  ? 4   ASP N O   1 
ATOM   4069 C CB  . ASP N  1 4  ? 18.018  39.977  22.534  1.00 21.81  ? 4   ASP N CB  1 
ATOM   4070 C CG  . ASP N  1 4  ? 17.389  41.335  22.745  1.00 27.96  ? 4   ASP N CG  1 
ATOM   4071 O OD1 . ASP N  1 4  ? 17.959  42.115  23.545  1.00 22.59  ? 4   ASP N OD1 1 
ATOM   4072 O OD2 . ASP N  1 4  ? 16.328  41.632  22.143  1.00 28.43  ? 4   ASP N OD2 1 
ATOM   4073 N N   . PRO N  1 5  ? 17.697  40.195  19.382  1.00 20.66  ? 5   PRO N N   1 
ATOM   4074 C CA  . PRO N  1 5  ? 17.351  40.834  18.118  1.00 17.88  ? 5   PRO N CA  1 
ATOM   4075 C C   . PRO N  1 5  ? 16.453  42.044  18.294  1.00 15.52  ? 5   PRO N C   1 
ATOM   4076 O O   . PRO N  1 5  ? 16.605  42.990  17.506  1.00 18.61  ? 5   PRO N O   1 
ATOM   4077 C CB  . PRO N  1 5  ? 16.632  39.690  17.380  1.00 14.78  ? 5   PRO N CB  1 
ATOM   4078 C CG  . PRO N  1 5  ? 15.977  38.917  18.490  1.00 17.01  ? 5   PRO N CG  1 
ATOM   4079 C CD  . PRO N  1 5  ? 17.015  38.906  19.586  1.00 17.19  ? 5   PRO N CD  1 
ATOM   4080 N N   . VAL N  1 6  ? 15.547  42.066  19.284  1.00 14.39  ? 6   VAL N N   1 
ATOM   4081 C CA  . VAL N  1 6  ? 14.699  43.253  19.446  1.00 14.69  ? 6   VAL N CA  1 
ATOM   4082 C C   . VAL N  1 6  ? 15.556  44.438  19.863  1.00 13.37  ? 6   VAL N C   1 
ATOM   4083 O O   . VAL N  1 6  ? 15.405  45.564  19.376  1.00 19.82  ? 6   VAL N O   1 
ATOM   4084 C CB  . VAL N  1 6  ? 13.550  42.969  20.427  1.00 17.97  ? 6   VAL N CB  1 
ATOM   4085 C CG1 . VAL N  1 6  ? 12.674  44.198  20.666  1.00 17.47  ? 6   VAL N CG1 1 
ATOM   4086 C CG2 . VAL N  1 6  ? 12.654  41.831  19.943  1.00 23.57  ? 6   VAL N CG2 1 
ATOM   4087 N N   . THR N  1 7  ? 16.512  44.216  20.777  1.00 17.20  ? 7   THR N N   1 
ATOM   4088 C CA  . THR N  1 7  ? 17.356  45.335  21.186  1.00 19.82  ? 7   THR N CA  1 
ATOM   4089 C C   . THR N  1 7  ? 18.164  45.887  20.015  1.00 22.32  ? 7   THR N C   1 
ATOM   4090 O O   . THR N  1 7  ? 18.327  47.094  19.823  1.00 21.40  ? 7   THR N O   1 
ATOM   4091 C CB  . THR N  1 7  ? 18.321  44.911  22.321  1.00 17.46  ? 7   THR N CB  1 
ATOM   4092 O OG1 . THR N  1 7  ? 17.552  44.372  23.401  1.00 22.15  ? 7   THR N OG1 1 
ATOM   4093 C CG2 . THR N  1 7  ? 19.083  46.107  22.855  1.00 22.50  ? 7   THR N CG2 1 
ATOM   4094 N N   . CYS N  1 8  ? 18.685  44.956  19.224  1.00 15.78  ? 8   CYS N N   1 
ATOM   4095 C CA  . CYS N  1 8  ? 19.456  45.322  18.044  1.00 17.76  ? 8   CYS N CA  1 
ATOM   4096 C C   . CYS N  1 8  ? 18.648  46.228  17.126  1.00 24.91  ? 8   CYS N C   1 
ATOM   4097 O O   . CYS N  1 8  ? 19.079  47.314  16.768  1.00 22.60  ? 8   CYS N O   1 
ATOM   4098 C CB  . CYS N  1 8  ? 19.869  44.070  17.253  1.00 16.25  ? 8   CYS N CB  1 
ATOM   4099 S SG  . CYS N  1 8  ? 20.849  44.476  15.769  1.00 15.22  ? 8   CYS N SG  1 
ATOM   4100 N N   . LEU N  1 9  ? 17.468  45.758  16.713  1.00 14.00  ? 9   LEU N N   1 
ATOM   4101 C CA  . LEU N  1 9  ? 16.656  46.545  15.793  1.00 10.66  ? 9   LEU N CA  1 
ATOM   4102 C C   . LEU N  1 9  ? 16.166  47.834  16.434  1.00 16.52  ? 9   LEU N C   1 
ATOM   4103 O O   . LEU N  1 9  ? 15.989  48.848  15.759  1.00 21.16  ? 9   LEU N O   1 
ATOM   4104 C CB  . LEU N  1 9  ? 15.494  45.669  15.340  1.00 14.81  ? 9   LEU N CB  1 
ATOM   4105 C CG  . LEU N  1 9  ? 15.869  44.522  14.392  1.00 20.42  ? 9   LEU N CG  1 
ATOM   4106 C CD1 . LEU N  1 9  ? 14.737  43.502  14.383  1.00 12.83  ? 9   LEU N CD1 1 
ATOM   4107 C CD2 . LEU N  1 9  ? 16.209  45.076  13.011  1.00 15.69  ? 9   LEU N CD2 1 
ATOM   4108 N N   . LYS N  1 10 ? 15.939  47.803  17.757  1.00 18.16  ? 10  LYS N N   1 
ATOM   4109 C CA  . LYS N  1 10 ? 15.513  49.043  18.416  1.00 20.04  ? 10  LYS N CA  1 
ATOM   4110 C C   . LYS N  1 10 ? 16.693  49.996  18.610  1.00 31.50  ? 10  LYS N C   1 
ATOM   4111 O O   . LYS N  1 10 ? 16.493  51.175  18.904  1.00 33.21  ? 10  LYS N O   1 
ATOM   4112 C CB  . LYS N  1 10 ? 14.844  48.773  19.762  1.00 21.40  ? 10  LYS N CB  1 
ATOM   4113 C CG  . LYS N  1 10 ? 13.387  48.349  19.649  1.00 33.51  ? 10  LYS N CG  1 
ATOM   4114 C CD  . LYS N  1 10 ? 12.728  48.169  21.006  1.00 42.40  ? 10  LYS N CD  1 
ATOM   4115 C CE  . LYS N  1 10 ? 11.501  47.269  20.928  1.00 46.21  ? 10  LYS N CE  1 
ATOM   4116 N NZ  . LYS N  1 10 ? 10.232  48.047  20.876  1.00 33.04  ? 10  LYS N NZ  1 
ATOM   4117 N N   A SER N  1 11 ? 17.903  49.477  18.451  0.50 27.87  ? 11  SER N N   1 
ATOM   4118 N N   B SER N  1 11 ? 17.904  49.485  18.441  0.50 27.90  ? 11  SER N N   1 
ATOM   4119 C CA  A SER N  1 11 ? 19.119  50.266  18.611  0.50 24.67  ? 11  SER N CA  1 
ATOM   4120 C CA  B SER N  1 11 ? 19.121  50.272  18.594  0.50 24.67  ? 11  SER N CA  1 
ATOM   4121 C C   A SER N  1 11 ? 19.583  50.833  17.271  0.50 27.98  ? 11  SER N C   1 
ATOM   4122 C C   B SER N  1 11 ? 19.588  50.851  17.264  0.50 27.98  ? 11  SER N C   1 
ATOM   4123 O O   A SER N  1 11 ? 20.730  51.267  17.147  0.50 28.92  ? 11  SER N O   1 
ATOM   4124 O O   B SER N  1 11 ? 20.727  51.301  17.143  0.50 29.08  ? 11  SER N O   1 
ATOM   4125 C CB  A SER N  1 11 ? 20.225  49.431  19.254  0.50 25.39  ? 11  SER N CB  1 
ATOM   4126 C CB  B SER N  1 11 ? 20.234  49.421  19.205  0.50 25.53  ? 11  SER N CB  1 
ATOM   4127 O OG  A SER N  1 11 ? 19.931  49.047  20.588  0.50 11.35  ? 11  SER N OG  1 
ATOM   4128 O OG  B SER N  1 11 ? 21.510  49.870  18.787  0.50 32.26  ? 11  SER N OG  1 
ATOM   4129 N N   . GLY N  1 12 ? 18.709  50.849  16.267  1.00 30.81  ? 12  GLY N N   1 
ATOM   4130 C CA  . GLY N  1 12 ? 19.014  51.446  14.972  1.00 34.96  ? 12  GLY N CA  1 
ATOM   4131 C C   . GLY N  1 12 ? 19.951  50.635  14.103  1.00 31.39  ? 12  GLY N C   1 
ATOM   4132 O O   . GLY N  1 12 ? 20.679  51.131  13.238  1.00 33.49  ? 12  GLY N O   1 
ATOM   4133 N N   . ALA N  1 13 ? 19.975  49.320  14.324  1.00 18.19  ? 13  ALA N N   1 
ATOM   4134 C CA  . ALA N  1 13 ? 20.924  48.481  13.595  1.00 15.76  ? 13  ALA N CA  1 
ATOM   4135 C C   . ALA N  1 13 ? 20.191  47.379  12.829  1.00 18.24  ? 13  ALA N C   1 
ATOM   4136 O O   . ALA N  1 13 ? 18.963  47.347  12.846  1.00 21.29  ? 13  ALA N O   1 
ATOM   4137 C CB  . ALA N  1 13 ? 21.895  47.844  14.567  1.00 12.63  ? 13  ALA N CB  1 
ATOM   4138 N N   A ILE N  1 14 ? 20.961  46.497  12.205  0.50 16.05  ? 14  ILE N N   1 
ATOM   4139 N N   B ILE N  1 14 ? 20.969  46.511  12.195  0.50 15.86  ? 14  ILE N N   1 
ATOM   4140 C CA  A ILE N  1 14 ? 20.350  45.390  11.468  0.50 14.72  ? 14  ILE N CA  1 
ATOM   4141 C CA  B ILE N  1 14 ? 20.514  45.387  11.388  0.50 14.24  ? 14  ILE N CA  1 
ATOM   4142 C C   A ILE N  1 14 ? 20.911  44.055  11.922  0.50 15.80  ? 14  ILE N C   1 
ATOM   4143 C C   B ILE N  1 14 ? 20.917  44.046  11.976  0.50 15.72  ? 14  ILE N C   1 
ATOM   4144 O O   A ILE N  1 14 ? 22.040  43.960  12.394  0.50 14.01  ? 14  ILE N O   1 
ATOM   4145 O O   B ILE N  1 14 ? 21.962  43.933  12.607  0.50 13.92  ? 14  ILE N O   1 
ATOM   4146 C CB  A ILE N  1 14 ? 20.583  45.589  9.960   0.50 14.90  ? 14  ILE N CB  1 
ATOM   4147 C CB  B ILE N  1 14 ? 21.104  45.485  9.964   0.50 14.06  ? 14  ILE N CB  1 
ATOM   4148 C CG1 A ILE N  1 14 ? 22.026  45.299  9.548   0.50 16.68  ? 14  ILE N CG1 1 
ATOM   4149 C CG1 B ILE N  1 14 ? 20.781  46.800  9.253   0.50 14.61  ? 14  ILE N CG1 1 
ATOM   4150 C CG2 A ILE N  1 14 ? 20.145  46.983  9.548   0.50 13.44  ? 14  ILE N CG2 1 
ATOM   4151 C CG2 B ILE N  1 14 ? 20.690  44.299  9.107   0.50 15.66  ? 14  ILE N CG2 1 
ATOM   4152 C CD1 A ILE N  1 14 ? 22.901  46.537  9.503   0.50 34.26  ? 14  ILE N CD1 1 
ATOM   4153 C CD1 B ILE N  1 14 ? 21.706  47.092  8.086   0.50 20.81  ? 14  ILE N CD1 1 
ATOM   4154 N N   . CYS N  1 15 ? 20.131  42.981  11.795  1.00 14.67  ? 15  CYS N N   1 
ATOM   4155 C CA  . CYS N  1 15 ? 20.624  41.662  12.181  1.00 8.13   ? 15  CYS N CA  1 
ATOM   4156 C C   . CYS N  1 15 ? 21.054  40.874  10.941  1.00 6.75   ? 15  CYS N C   1 
ATOM   4157 O O   . CYS N  1 15 ? 20.192  40.786  10.045  1.00 16.02  ? 15  CYS N O   1 
ATOM   4158 C CB  . CYS N  1 15 ? 19.524  40.871  12.893  1.00 12.69  ? 15  CYS N CB  1 
ATOM   4159 S SG  . CYS N  1 15 ? 19.038  41.522  14.515  1.00 15.96  ? 15  CYS N SG  1 
ATOM   4160 N N   . HIS N  1 16 ? 22.241  40.333  10.910  1.00 9.67   ? 16  HIS N N   1 
ATOM   4161 C CA  . HIS N  1 16 ? 22.749  39.442  9.865   1.00 11.83  ? 16  HIS N CA  1 
ATOM   4162 C C   . HIS N  1 16 ? 22.910  38.049  10.443  1.00 14.60  ? 16  HIS N C   1 
ATOM   4163 O O   . HIS N  1 16 ? 23.273  37.894  11.601  1.00 13.73  ? 16  HIS N O   1 
ATOM   4164 C CB  . HIS N  1 16 ? 24.073  39.954  9.276   1.00 14.58  ? 16  HIS N CB  1 
ATOM   4165 C CG  . HIS N  1 16 ? 23.829  40.857  8.102   1.00 13.87  ? 16  HIS N CG  1 
ATOM   4166 N ND1 . HIS N  1 16 ? 24.146  40.506  6.806   1.00 16.96  ? 16  HIS N ND1 1 
ATOM   4167 C CD2 . HIS N  1 16 ? 23.275  42.087  8.035   1.00 14.81  ? 16  HIS N CD2 1 
ATOM   4168 C CE1 . HIS N  1 16 ? 23.797  41.499  5.994   1.00 15.62  ? 16  HIS N CE1 1 
ATOM   4169 N NE2 . HIS N  1 16 ? 23.272  42.471  6.706   1.00 16.01  ? 16  HIS N NE2 1 
ATOM   4170 N N   . PRO N  1 17 ? 22.586  37.002  9.684   1.00 11.21  ? 17  PRO N N   1 
ATOM   4171 C CA  . PRO N  1 17 ? 22.630  35.657  10.242  1.00 11.03  ? 17  PRO N CA  1 
ATOM   4172 C C   . PRO N  1 17 ? 24.014  35.131  10.608  1.00 17.70  ? 17  PRO N C   1 
ATOM   4173 O O   . PRO N  1 17 ? 24.102  34.254  11.477  1.00 17.78  ? 17  PRO N O   1 
ATOM   4174 C CB  . PRO N  1 17 ? 22.037  34.799  9.105   1.00 12.04  ? 17  PRO N CB  1 
ATOM   4175 C CG  . PRO N  1 17 ? 22.182  35.614  7.851   1.00 13.57  ? 17  PRO N CG  1 
ATOM   4176 C CD  . PRO N  1 17 ? 22.120  37.046  8.284   1.00 15.33  ? 17  PRO N CD  1 
ATOM   4177 N N   . VAL N  1 18 ? 25.123  35.569  10.011  1.00 12.43  ? 18  VAL N N   1 
ATOM   4178 C CA  . VAL N  1 18 ? 26.384  34.876  10.290  1.00 16.30  ? 18  VAL N CA  1 
ATOM   4179 C C   . VAL N  1 18 ? 27.522  35.859  10.522  1.00 21.13  ? 18  VAL N C   1 
ATOM   4180 O O   . VAL N  1 18 ? 28.293  35.752  11.476  1.00 20.96  ? 18  VAL N O   1 
ATOM   4181 C CB  . VAL N  1 18 ? 26.848  33.973  9.128   1.00 25.37  ? 18  VAL N CB  1 
ATOM   4182 C CG1 . VAL N  1 18 ? 28.215  33.367  9.453   1.00 29.21  ? 18  VAL N CG1 1 
ATOM   4183 C CG2 . VAL N  1 18 ? 25.854  32.868  8.817   1.00 29.01  ? 18  VAL N CG2 1 
ATOM   4184 N N   . PHE N  1 19 ? 27.615  36.832  9.621   1.00 17.74  ? 19  PHE N N   1 
ATOM   4185 C CA  . PHE N  1 19 ? 28.680  37.822  9.811   1.00 21.72  ? 19  PHE N CA  1 
ATOM   4186 C C   . PHE N  1 19 ? 28.246  39.192  9.341   1.00 14.25  ? 19  PHE N C   1 
ATOM   4187 O O   . PHE N  1 19 ? 27.374  39.381  8.490   1.00 20.43  ? 19  PHE N O   1 
ATOM   4188 C CB  . PHE N  1 19 ? 29.950  37.335  9.095   1.00 20.31  ? 19  PHE N CB  1 
ATOM   4189 C CG  . PHE N  1 19 ? 29.810  37.463  7.589   1.00 17.58  ? 19  PHE N CG  1 
ATOM   4190 C CD1 . PHE N  1 19 ? 30.351  38.521  6.893   1.00 22.89  ? 19  PHE N CD1 1 
ATOM   4191 C CD2 . PHE N  1 19 ? 29.105  36.493  6.891   1.00 22.25  ? 19  PHE N CD2 1 
ATOM   4192 C CE1 . PHE N  1 19 ? 30.193  38.632  5.528   1.00 21.42  ? 19  PHE N CE1 1 
ATOM   4193 C CE2 . PHE N  1 19 ? 28.957  36.589  5.523   1.00 24.05  ? 19  PHE N CE2 1 
ATOM   4194 C CZ  . PHE N  1 19 ? 29.507  37.656  4.829   1.00 28.65  ? 19  PHE N CZ  1 
ATOM   4195 N N   . CYS N  1 20 ? 28.843  40.256  9.904   1.00 19.57  ? 20  CYS N N   1 
ATOM   4196 C CA  . CYS N  1 20 ? 28.578  41.584  9.360   1.00 20.88  ? 20  CYS N CA  1 
ATOM   4197 C C   . CYS N  1 20 ? 29.532  41.797  8.178   1.00 18.70  ? 20  CYS N C   1 
ATOM   4198 O O   . CYS N  1 20 ? 30.743  41.615  8.329   1.00 19.68  ? 20  CYS N O   1 
ATOM   4199 C CB  . CYS N  1 20 ? 28.833  42.759  10.301  1.00 15.60  ? 20  CYS N CB  1 
ATOM   4200 S SG  . CYS N  1 20 ? 27.888  42.863  11.831  1.00 17.26  ? 20  CYS N SG  1 
ATOM   4201 N N   . PRO N  1 21 ? 29.021  42.190  7.034   1.00 22.88  ? 21  PRO N N   1 
ATOM   4202 C CA  . PRO N  1 21 ? 29.939  42.523  5.926   1.00 27.18  ? 21  PRO N CA  1 
ATOM   4203 C C   . PRO N  1 21 ? 30.738  43.776  6.301   1.00 34.85  ? 21  PRO N C   1 
ATOM   4204 O O   . PRO N  1 21 ? 30.198  44.547  7.107   1.00 21.75  ? 21  PRO N O   1 
ATOM   4205 C CB  . PRO N  1 21 ? 28.995  42.762  4.754   1.00 25.60  ? 21  PRO N CB  1 
ATOM   4206 C CG  . PRO N  1 21 ? 27.705  42.117  5.150   1.00 32.09  ? 21  PRO N CG  1 
ATOM   4207 C CD  . PRO N  1 21 ? 27.617  42.358  6.642   1.00 30.38  ? 21  PRO N CD  1 
ATOM   4208 N N   . ARG N  1 22 ? 31.929  43.955  5.764   1.00 29.53  ? 22  ARG N N   1 
ATOM   4209 C CA  . ARG N  1 22 ? 32.915  44.979  6.063   1.00 42.48  ? 22  ARG N CA  1 
ATOM   4210 C C   . ARG N  1 22 ? 32.442  46.416  6.244   1.00 33.90  ? 22  ARG N C   1 
ATOM   4211 O O   . ARG N  1 22 ? 33.086  47.166  6.997   1.00 26.23  ? 22  ARG N O   1 
ATOM   4212 C CB  . ARG N  1 22 ? 33.974  45.036  4.931   1.00 49.47  ? 22  ARG N CB  1 
ATOM   4213 C CG  . ARG N  1 22 ? 35.155  45.926  5.273   1.00 65.47  ? 22  ARG N CG  1 
ATOM   4214 C CD  . ARG N  1 22 ? 35.144  47.264  4.562   1.00 78.70  ? 22  ARG N CD  1 
ATOM   4215 N NE  . ARG N  1 22 ? 34.837  47.165  3.138   1.00 90.21  ? 22  ARG N NE  1 
ATOM   4216 C CZ  . ARG N  1 22 ? 35.750  47.135  2.175   1.00 96.11  ? 22  ARG N CZ  1 
ATOM   4217 N NH1 . ARG N  1 22 ? 37.043  47.186  2.479   1.00 95.48  ? 22  ARG N NH1 1 
ATOM   4218 N NH2 . ARG N  1 22 ? 35.378  47.043  0.904   1.00 102.55 ? 22  ARG N NH2 1 
ATOM   4219 N N   . ARG N  1 23 ? 31.389  46.897  5.594   1.00 30.46  ? 23  ARG N N   1 
ATOM   4220 C CA  . ARG N  1 23 ? 31.061  48.320  5.716   1.00 29.11  ? 23  ARG N CA  1 
ATOM   4221 C C   . ARG N  1 23 ? 30.196  48.607  6.935   1.00 25.39  ? 23  ARG N C   1 
ATOM   4222 O O   . ARG N  1 23 ? 29.823  49.730  7.229   1.00 19.57  ? 23  ARG N O   1 
ATOM   4223 C CB  . ARG N  1 23 ? 30.353  48.792  4.450   1.00 37.23  ? 23  ARG N CB  1 
ATOM   4224 C CG  . ARG N  1 23 ? 29.328  47.782  3.970   1.00 51.25  ? 23  ARG N CG  1 
ATOM   4225 C CD  . ARG N  1 23 ? 29.815  47.024  2.750   1.00 70.01  ? 23  ARG N CD  1 
ATOM   4226 N NE  . ARG N  1 23 ? 31.045  46.260  2.978   1.00 74.09  ? 23  ARG N NE  1 
ATOM   4227 C CZ  . ARG N  1 23 ? 31.641  45.589  1.991   1.00 74.21  ? 23  ARG N CZ  1 
ATOM   4228 N NH1 . ARG N  1 23 ? 31.098  45.624  0.781   1.00 70.26  ? 23  ARG N NH1 1 
ATOM   4229 N NH2 . ARG N  1 23 ? 32.751  44.899  2.200   1.00 71.07  ? 23  ARG N NH2 1 
ATOM   4230 N N   . TYR N  1 24 ? 29.880  47.537  7.665   1.00 26.07  ? 24  TYR N N   1 
ATOM   4231 C CA  . TYR N  1 24 ? 29.189  47.693  8.933   1.00 21.92  ? 24  TYR N CA  1 
ATOM   4232 C C   . TYR N  1 24 ? 30.152  47.340  10.061  1.00 15.60  ? 24  TYR N C   1 
ATOM   4233 O O   . TYR N  1 24 ? 31.105  46.580  9.863   1.00 18.95  ? 24  TYR N O   1 
ATOM   4234 C CB  . TYR N  1 24 ? 27.984  46.775  9.048   1.00 21.18  ? 24  TYR N CB  1 
ATOM   4235 C CG  . TYR N  1 24 ? 26.913  46.861  7.996   1.00 25.42  ? 24  TYR N CG  1 
ATOM   4236 C CD1 . TYR N  1 24 ? 26.617  45.742  7.215   1.00 22.35  ? 24  TYR N CD1 1 
ATOM   4237 C CD2 . TYR N  1 24 ? 26.192  48.023  7.783   1.00 18.77  ? 24  TYR N CD2 1 
ATOM   4238 C CE1 . TYR N  1 24 ? 25.635  45.784  6.241   1.00 27.75  ? 24  TYR N CE1 1 
ATOM   4239 C CE2 . TYR N  1 24 ? 25.211  48.069  6.809   1.00 24.07  ? 24  TYR N CE2 1 
ATOM   4240 C CZ  . TYR N  1 24 ? 24.936  46.960  6.047   1.00 26.18  ? 24  TYR N CZ  1 
ATOM   4241 O OH  . TYR N  1 24 ? 23.953  47.023  5.079   1.00 25.04  ? 24  TYR N OH  1 
ATOM   4242 N N   . LYS N  1 25 ? 29.859  47.871  11.250  1.00 19.07  ? 25  LYS N N   1 
ATOM   4243 C CA  . LYS N  1 25 ? 30.594  47.445  12.437  1.00 13.69  ? 25  LYS N CA  1 
ATOM   4244 C C   . LYS N  1 25 ? 29.729  46.522  13.283  1.00 16.90  ? 25  LYS N C   1 
ATOM   4245 O O   . LYS N  1 25 ? 28.529  46.763  13.451  1.00 16.95  ? 25  LYS N O   1 
ATOM   4246 C CB  . LYS N  1 25 ? 31.008  48.670  13.261  1.00 16.39  ? 25  LYS N CB  1 
ATOM   4247 C CG  . LYS N  1 25 ? 31.641  48.320  14.601  1.00 27.49  ? 25  LYS N CG  1 
ATOM   4248 C CD  . LYS N  1 25 ? 32.510  49.466  15.089  1.00 31.03  ? 25  LYS N CD  1 
ATOM   4249 C CE  . LYS N  1 25 ? 33.596  49.012  16.046  1.00 37.36  ? 25  LYS N CE  1 
ATOM   4250 N NZ  . LYS N  1 25 ? 34.499  50.152  16.392  1.00 36.60  ? 25  LYS N NZ  1 
ATOM   4251 N N   . GLN N  1 26 ? 30.321  45.459  13.825  1.00 13.23  ? 26  GLN N N   1 
ATOM   4252 C CA  . GLN N  1 26 ? 29.531  44.581  14.690  1.00 10.76  ? 26  GLN N CA  1 
ATOM   4253 C C   . GLN N  1 26 ? 29.380  45.257  16.049  1.00 14.92  ? 26  GLN N C   1 
ATOM   4254 O O   . GLN N  1 26 ? 30.380  45.680  16.645  1.00 16.78  ? 26  GLN N O   1 
ATOM   4255 C CB  . GLN N  1 26 ? 30.203  43.222  14.864  1.00 15.18  ? 26  GLN N CB  1 
ATOM   4256 C CG  . GLN N  1 26 ? 29.423  42.300  15.798  1.00 18.01  ? 26  GLN N CG  1 
ATOM   4257 C CD  . GLN N  1 26 ? 30.140  40.982  15.982  1.00 22.81  ? 26  GLN N CD  1 
ATOM   4258 O OE1 . GLN N  1 26 ? 30.893  40.543  15.114  1.00 26.17  ? 26  GLN N OE1 1 
ATOM   4259 N NE2 . GLN N  1 26 ? 29.900  40.331  17.114  1.00 37.75  ? 26  GLN N NE2 1 
ATOM   4260 N N   . ILE N  1 27 ? 28.158  45.362  16.528  1.00 15.53  ? 27  ILE N N   1 
ATOM   4261 C CA  . ILE N  1 27 ? 27.959  46.018  17.830  1.00 17.52  ? 27  ILE N CA  1 
ATOM   4262 C C   . ILE N  1 27 ? 27.356  45.018  18.796  1.00 21.00  ? 27  ILE N C   1 
ATOM   4263 O O   . ILE N  1 27 ? 27.074  45.336  19.944  1.00 18.51  ? 27  ILE N O   1 
ATOM   4264 C CB  . ILE N  1 27 ? 27.043  47.246  17.697  1.00 17.59  ? 27  ILE N CB  1 
ATOM   4265 C CG1 . ILE N  1 27 ? 25.639  46.927  17.178  1.00 17.99  ? 27  ILE N CG1 1 
ATOM   4266 C CG2 . ILE N  1 27 ? 27.730  48.317  16.849  1.00 19.41  ? 27  ILE N CG2 1 
ATOM   4267 C CD1 . ILE N  1 27 ? 24.595  48.000  17.389  1.00 18.50  ? 27  ILE N CD1 1 
ATOM   4268 N N   . GLY N  1 28 ? 27.134  43.793  18.293  1.00 17.91  ? 28  GLY N N   1 
ATOM   4269 C CA  . GLY N  1 28 ? 26.579  42.775  19.189  1.00 15.26  ? 28  GLY N CA  1 
ATOM   4270 C C   . GLY N  1 28 ? 26.095  41.577  18.398  1.00 15.15  ? 28  GLY N C   1 
ATOM   4271 O O   . GLY N  1 28 ? 26.598  41.316  17.312  1.00 19.57  ? 28  GLY N O   1 
ATOM   4272 N N   . THR N  1 29 ? 25.131  40.857  18.967  1.00 18.56  ? 29  THR N N   1 
ATOM   4273 C CA  . THR N  1 29 ? 24.551  39.715  18.272  1.00 15.33  ? 29  THR N CA  1 
ATOM   4274 C C   . THR N  1 29 ? 23.048  39.902  18.254  1.00 16.58  ? 29  THR N C   1 
ATOM   4275 O O   . THR N  1 29 ? 22.567  40.831  18.897  1.00 16.46  ? 29  THR N O   1 
ATOM   4276 C CB  . THR N  1 29 ? 24.840  38.391  18.993  1.00 16.73  ? 29  THR N CB  1 
ATOM   4277 O OG1 . THR N  1 29 ? 23.943  38.313  20.125  1.00 24.05  ? 29  THR N OG1 1 
ATOM   4278 C CG2 . THR N  1 29 ? 26.265  38.364  19.500  1.00 20.75  ? 29  THR N CG2 1 
ATOM   4279 N N   . CYS N  1 30 ? 22.333  39.021  17.545  1.00 13.15  ? 30  CYS N N   1 
ATOM   4280 C CA  . CYS N  1 30 ? 20.879  39.108  17.609  1.00 11.69  ? 30  CYS N CA  1 
ATOM   4281 C C   . CYS N  1 30 ? 20.254  37.887  18.287  1.00 19.39  ? 30  CYS N C   1 
ATOM   4282 O O   . CYS N  1 30 ? 19.207  37.404  17.855  1.00 14.09  ? 30  CYS N O   1 
ATOM   4283 C CB  . CYS N  1 30 ? 20.290  39.339  16.203  1.00 15.76  ? 30  CYS N CB  1 
ATOM   4284 S SG  . CYS N  1 30 ? 20.639  41.064  15.698  1.00 15.52  ? 30  CYS N SG  1 
ATOM   4285 N N   . GLY N  1 31 ? 20.886  37.420  19.353  1.00 18.06  ? 31  GLY N N   1 
ATOM   4286 C CA  . GLY N  1 31 ? 20.325  36.351  20.176  1.00 23.77  ? 31  GLY N CA  1 
ATOM   4287 C C   . GLY N  1 31 ? 20.578  34.954  19.646  1.00 20.78  ? 31  GLY N C   1 
ATOM   4288 O O   . GLY N  1 31 ? 21.330  34.158  20.217  1.00 18.02  ? 31  GLY N O   1 
ATOM   4289 N N   . LEU N  1 32 ? 19.939  34.618  18.522  1.00 15.04  ? 32  LEU N N   1 
ATOM   4290 C CA  . LEU N  1 32 ? 20.205  33.354  17.844  1.00 16.14  ? 32  LEU N CA  1 
ATOM   4291 C C   . LEU N  1 32 ? 21.691  33.174  17.623  1.00 15.18  ? 32  LEU N C   1 
ATOM   4292 O O   . LEU N  1 32 ? 22.336  34.078  17.072  1.00 13.70  ? 32  LEU N O   1 
ATOM   4293 C CB  . LEU N  1 32 ? 19.455  33.338  16.510  1.00 14.05  ? 32  LEU N CB  1 
ATOM   4294 C CG  . LEU N  1 32 ? 19.538  32.036  15.696  1.00 15.28  ? 32  LEU N CG  1 
ATOM   4295 C CD1 . LEU N  1 32 ? 18.723  30.930  16.344  1.00 20.06  ? 32  LEU N CD1 1 
ATOM   4296 C CD2 . LEU N  1 32 ? 19.046  32.294  14.279  1.00 15.90  ? 32  LEU N CD2 1 
ATOM   4297 N N   . PRO N  1 33 ? 22.288  32.074  18.060  1.00 20.83  ? 33  PRO N N   1 
ATOM   4298 C CA  . PRO N  1 33 ? 23.737  31.896  17.914  1.00 20.87  ? 33  PRO N CA  1 
ATOM   4299 C C   . PRO N  1 33 ? 24.231  32.053  16.483  1.00 15.75  ? 33  PRO N C   1 
ATOM   4300 O O   . PRO N  1 33 ? 23.666  31.541  15.514  1.00 19.51  ? 33  PRO N O   1 
ATOM   4301 C CB  . PRO N  1 33 ? 23.957  30.448  18.391  1.00 22.48  ? 33  PRO N CB  1 
ATOM   4302 C CG  . PRO N  1 33 ? 22.881  30.279  19.412  1.00 21.11  ? 33  PRO N CG  1 
ATOM   4303 C CD  . PRO N  1 33 ? 21.678  30.926  18.755  1.00 22.45  ? 33  PRO N CD  1 
ATOM   4304 N N   . GLY N  1 34 ? 25.342  32.779  16.368  1.00 13.59  ? 34  GLY N N   1 
ATOM   4305 C CA  . GLY N  1 34 ? 25.963  33.095  15.102  1.00 19.93  ? 34  GLY N CA  1 
ATOM   4306 C C   . GLY N  1 34 ? 25.501  34.415  14.525  1.00 17.64  ? 34  GLY N C   1 
ATOM   4307 O O   . GLY N  1 34 ? 26.177  34.972  13.649  1.00 17.25  ? 34  GLY N O   1 
ATOM   4308 N N   . THR N  1 35 ? 24.352  34.913  14.979  1.00 11.00  ? 35  THR N N   1 
ATOM   4309 C CA  . THR N  1 35 ? 23.813  36.136  14.394  1.00 13.31  ? 35  THR N CA  1 
ATOM   4310 C C   . THR N  1 35 ? 24.568  37.353  14.934  1.00 19.04  ? 35  THR N C   1 
ATOM   4311 O O   . THR N  1 35 ? 25.103  37.368  16.037  1.00 16.08  ? 35  THR N O   1 
ATOM   4312 C CB  . THR N  1 35 ? 22.320  36.390  14.631  1.00 12.85  ? 35  THR N CB  1 
ATOM   4313 O OG1 . THR N  1 35 ? 22.072  36.489  16.049  1.00 15.64  ? 35  THR N OG1 1 
ATOM   4314 C CG2 . THR N  1 35 ? 21.476  35.234  14.101  1.00 15.17  ? 35  THR N CG2 1 
ATOM   4315 N N   . LYS N  1 36 ? 24.551  38.378  14.099  1.00 11.57  ? 36  LYS N N   1 
ATOM   4316 C CA  . LYS N  1 36 ? 25.278  39.609  14.375  1.00 16.63  ? 36  LYS N CA  1 
ATOM   4317 C C   . LYS N  1 36 ? 24.390  40.837  14.257  1.00 14.12  ? 36  LYS N C   1 
ATOM   4318 O O   . LYS N  1 36 ? 23.617  40.953  13.309  1.00 12.18  ? 36  LYS N O   1 
ATOM   4319 C CB  . LYS N  1 36 ? 26.451  39.751  13.402  1.00 12.09  ? 36  LYS N CB  1 
ATOM   4320 C CG  . LYS N  1 36 ? 27.329  38.502  13.311  1.00 17.41  ? 36  LYS N CG  1 
ATOM   4321 C CD  . LYS N  1 36 ? 28.269  38.358  14.491  1.00 19.95  ? 36  LYS N CD  1 
ATOM   4322 C CE  . LYS N  1 36 ? 28.891  36.964  14.538  1.00 31.92  ? 36  LYS N CE  1 
ATOM   4323 N NZ  . LYS N  1 36 ? 29.755  36.682  13.363  1.00 50.88  ? 36  LYS N NZ  1 
ATOM   4324 N N   . CYS N  1 37 ? 24.545  41.744  15.212  1.00 9.66   ? 37  CYS N N   1 
ATOM   4325 C CA  . CYS N  1 37 ? 23.961  43.054  15.197  1.00 11.41  ? 37  CYS N CA  1 
ATOM   4326 C C   . CYS N  1 37 ? 24.981  43.986  14.519  1.00 12.63  ? 37  CYS N C   1 
ATOM   4327 O O   . CYS N  1 37 ? 26.084  44.100  15.021  1.00 12.74  ? 37  CYS N O   1 
ATOM   4328 C CB  . CYS N  1 37 ? 23.602  43.586  16.592  1.00 13.17  ? 37  CYS N CB  1 
ATOM   4329 S SG  . CYS N  1 37 ? 22.613  45.091  16.551  1.00 15.76  ? 37  CYS N SG  1 
ATOM   4330 N N   . CYS N  1 38 ? 24.580  44.577  13.409  1.00 15.88  ? 38  CYS N N   1 
ATOM   4331 C CA  . CYS N  1 38 ? 25.467  45.344  12.546  1.00 16.45  ? 38  CYS N CA  1 
ATOM   4332 C C   . CYS N  1 38 ? 24.995  46.774  12.358  1.00 14.24  ? 38  CYS N C   1 
ATOM   4333 O O   . CYS N  1 38 ? 23.809  47.029  12.129  1.00 16.69  ? 38  CYS N O   1 
ATOM   4334 C CB  . CYS N  1 38 ? 25.504  44.648  11.172  1.00 17.30  ? 38  CYS N CB  1 
ATOM   4335 S SG  . CYS N  1 38 ? 25.946  42.897  11.245  1.00 15.60  ? 38  CYS N SG  1 
ATOM   4336 N N   . LYS N  1 39 ? 25.906  47.745  12.440  1.00 13.71  ? 39  LYS N N   1 
ATOM   4337 C CA  . LYS N  1 39 ? 25.519  49.142  12.320  1.00 17.11  ? 39  LYS N CA  1 
ATOM   4338 C C   . LYS N  1 39 ? 26.656  49.949  11.708  1.00 20.48  ? 39  LYS N C   1 
ATOM   4339 O O   . LYS N  1 39 ? 27.839  49.721  11.992  1.00 23.80  ? 39  LYS N O   1 
ATOM   4340 C CB  . LYS N  1 39 ? 25.142  49.676  13.707  1.00 22.43  ? 39  LYS N CB  1 
ATOM   4341 C CG  . LYS N  1 39 ? 24.545  51.071  13.729  1.00 29.71  ? 39  LYS N CG  1 
ATOM   4342 C CD  . LYS N  1 39 ? 24.889  51.800  15.013  1.00 34.61  ? 39  LYS N CD  1 
ATOM   4343 C CE  . LYS N  1 39 ? 24.205  53.157  15.090  1.00 43.12  ? 39  LYS N CE  1 
ATOM   4344 N NZ  . LYS N  1 39 ? 22.901  53.146  14.371  1.00 53.03  ? 39  LYS N NZ  1 
ATOM   4345 N N   . LYS N  1 40 ? 26.336  50.919  10.858  1.00 24.63  ? 40  LYS N N   1 
ATOM   4346 C CA  . LYS N  1 40 ? 27.395  51.793  10.339  1.00 30.10  ? 40  LYS N CA  1 
ATOM   4347 C C   . LYS N  1 40 ? 28.070  52.575  11.462  1.00 30.22  ? 40  LYS N C   1 
ATOM   4348 O O   . LYS N  1 40 ? 27.402  53.093  12.355  1.00 25.99  ? 40  LYS N O   1 
ATOM   4349 C CB  . LYS N  1 40 ? 26.811  52.728  9.288   1.00 38.63  ? 40  LYS N CB  1 
ATOM   4350 C CG  . LYS N  1 40 ? 26.306  52.026  8.038   1.00 47.75  ? 40  LYS N CG  1 
ATOM   4351 C CD  . LYS N  1 40 ? 25.512  52.989  7.164   1.00 51.10  ? 40  LYS N CD  1 
ATOM   4352 C CE  . LYS N  1 40 ? 24.923  52.298  5.945   1.00 47.69  ? 40  LYS N CE  1 
ATOM   4353 N NZ  . LYS N  1 40 ? 25.569  50.974  5.686   1.00 52.77  ? 40  LYS N NZ  1 
ATOM   4354 N N   . PRO N  1 41 ? 29.399  52.634  11.411  1.00 31.20  ? 41  PRO N N   1 
ATOM   4355 C CA  . PRO N  1 41 ? 30.237  53.296  12.411  1.00 33.09  ? 41  PRO N CA  1 
ATOM   4356 C C   . PRO N  1 41 ? 29.870  54.749  12.675  1.00 31.06  ? 41  PRO N C   1 
ATOM   4357 O O   . PRO N  1 41 ? 29.298  55.413  11.800  1.00 27.47  ? 41  PRO N O   1 
ATOM   4358 C CB  . PRO N  1 41 ? 31.641  53.245  11.785  1.00 35.69  ? 41  PRO N CB  1 
ATOM   4359 C CG  . PRO N  1 41 ? 31.602  52.045  10.900  1.00 32.66  ? 41  PRO N CG  1 
ATOM   4360 C CD  . PRO N  1 41 ? 30.205  52.014  10.335  1.00 28.96  ? 41  PRO N CD  1 
ATOM   4361 O OXT . PRO N  1 41 ? 30.169  55.208  13.804  1.00 32.71  ? 41  PRO N OXT 1 
ATOM   4362 N N   A GLY O  1 1  ? 0.504   24.556  14.111  0.50 30.04  ? 1   GLY O N   1 
ATOM   4363 N N   B GLY O  1 1  ? 1.249   24.874  10.558  0.50 10.21  ? 1   GLY O N   1 
ATOM   4364 C CA  A GLY O  1 1  ? 0.695   25.014  12.750  0.50 17.86  ? 1   GLY O CA  1 
ATOM   4365 C CA  B GLY O  1 1  ? 0.986   25.414  11.876  0.50 16.56  ? 1   GLY O CA  1 
ATOM   4366 C C   A GLY O  1 1  ? 1.064   26.480  12.641  0.50 19.21  ? 1   GLY O C   1 
ATOM   4367 C C   B GLY O  1 1  ? 1.147   26.910  12.021  0.50 15.24  ? 1   GLY O C   1 
ATOM   4368 O O   A GLY O  1 1  ? 1.952   26.842  11.864  0.50 16.73  ? 1   GLY O O   1 
ATOM   4369 O O   B GLY O  1 1  ? 1.857   27.581  11.283  0.50 19.52  ? 1   GLY O O   1 
ATOM   4370 N N   A ILE O  1 2  ? 0.397   27.353  13.396  0.50 10.86  ? 2   ILE O N   1 
ATOM   4371 N N   B ILE O  1 2  ? 0.489   27.500  13.024  0.50 12.68  ? 2   ILE O N   1 
ATOM   4372 C CA  A ILE O  1 2  ? 0.676   28.788  13.271  0.50 11.26  ? 2   ILE O CA  1 
ATOM   4373 C CA  B ILE O  1 2  ? 0.603   28.945  13.236  0.50 11.31  ? 2   ILE O CA  1 
ATOM   4374 C C   A ILE O  1 2  ? 2.018   29.142  13.891  0.50 14.65  ? 2   ILE O C   1 
ATOM   4375 C C   B ILE O  1 2  ? 1.918   29.256  13.935  0.50 13.87  ? 2   ILE O C   1 
ATOM   4376 O O   A ILE O  1 2  ? 2.469   28.538  14.866  0.50 15.63  ? 2   ILE O O   1 
ATOM   4377 O O   B ILE O  1 2  ? 2.235   28.705  14.989  0.50 14.81  ? 2   ILE O O   1 
ATOM   4378 C CB  A ILE O  1 2  ? -0.461  29.615  13.898  0.50 14.46  ? 2   ILE O CB  1 
ATOM   4379 C CB  B ILE O  1 2  ? -0.607  29.477  14.023  0.50 14.72  ? 2   ILE O CB  1 
ATOM   4380 C CG1 A ILE O  1 2  ? -1.699  29.716  12.988  0.50 15.43  ? 2   ILE O CG1 1 
ATOM   4381 C CG1 B ILE O  1 2  ? -1.925  29.227  13.274  0.50 11.79  ? 2   ILE O CG1 1 
ATOM   4382 C CG2 A ILE O  1 2  ? -0.005  31.003  14.316  0.50 17.44  ? 2   ILE O CG2 1 
ATOM   4383 C CG2 B ILE O  1 2  ? -0.458  30.943  14.400  0.50 12.22  ? 2   ILE O CG2 1 
ATOM   4384 C CD1 A ILE O  1 2  ? -2.642  28.544  13.093  0.50 28.37  ? 2   ILE O CD1 1 
ATOM   4385 C CD1 B ILE O  1 2  ? -3.101  30.063  13.708  0.50 7.25   ? 2   ILE O CD1 1 
ATOM   4386 N N   . GLY O  1 3  ? 2.686   30.132  13.298  1.00 13.12  ? 3   GLY O N   1 
ATOM   4387 C CA  . GLY O  1 3  ? 4.033   30.455  13.724  1.00 13.11  ? 3   GLY O CA  1 
ATOM   4388 C C   . GLY O  1 3  ? 4.332   31.933  13.761  1.00 11.01  ? 3   GLY O C   1 
ATOM   4389 O O   . GLY O  1 3  ? 5.502   32.291  13.892  1.00 15.44  ? 3   GLY O O   1 
ATOM   4390 N N   . ASP O  1 4  ? 3.330   32.791  13.672  1.00 11.67  ? 4   ASP O N   1 
ATOM   4391 C CA  . ASP O  1 4  ? 3.562   34.234  13.780  1.00 14.08  ? 4   ASP O CA  1 
ATOM   4392 C C   . ASP O  1 4  ? 2.378   34.898  14.481  1.00 14.83  ? 4   ASP O C   1 
ATOM   4393 O O   . ASP O  1 4  ? 1.256   34.350  14.449  1.00 14.56  ? 4   ASP O O   1 
ATOM   4394 C CB  . ASP O  1 4  ? 3.823   34.847  12.405  1.00 12.09  ? 4   ASP O CB  1 
ATOM   4395 C CG  . ASP O  1 4  ? 2.530   35.072  11.638  1.00 13.10  ? 4   ASP O CG  1 
ATOM   4396 O OD1 . ASP O  1 4  ? 2.172   34.141  10.878  1.00 18.67  ? 4   ASP O OD1 1 
ATOM   4397 O OD2 . ASP O  1 4  ? 1.898   36.134  11.814  1.00 12.23  ? 4   ASP O OD2 1 
ATOM   4398 N N   . PRO O  1 5  ? 2.609   36.025  15.143  1.00 12.25  ? 5   PRO O N   1 
ATOM   4399 C CA  . PRO O  1 5  ? 1.574   36.626  15.996  1.00 17.52  ? 5   PRO O CA  1 
ATOM   4400 C C   . PRO O  1 5  ? 0.362   37.111  15.221  1.00 15.84  ? 5   PRO O C   1 
ATOM   4401 O O   . PRO O  1 5  ? -0.782  37.007  15.669  1.00 15.29  ? 5   PRO O O   1 
ATOM   4402 C CB  . PRO O  1 5  ? 2.242   37.869  16.610  1.00 21.34  ? 5   PRO O CB  1 
ATOM   4403 C CG  . PRO O  1 5  ? 3.688   37.720  16.353  1.00 20.67  ? 5   PRO O CG  1 
ATOM   4404 C CD  . PRO O  1 5  ? 3.853   36.820  15.161  1.00 17.06  ? 5   PRO O CD  1 
ATOM   4405 N N   . VAL O  1 6  ? 0.609   37.672  14.037  1.00 11.77  ? 6   VAL O N   1 
ATOM   4406 C CA  . VAL O  1 6  ? -0.525  38.236  13.278  1.00 13.71  ? 6   VAL O CA  1 
ATOM   4407 C C   . VAL O  1 6  ? -1.488  37.166  12.812  1.00 10.30  ? 6   VAL O C   1 
ATOM   4408 O O   . VAL O  1 6  ? -2.714  37.335  12.947  1.00 16.02  ? 6   VAL O O   1 
ATOM   4409 C CB  . VAL O  1 6  ? 0.002   39.022  12.065  1.00 16.39  ? 6   VAL O CB  1 
ATOM   4410 C CG1 . VAL O  1 6  ? -1.170  39.609  11.292  1.00 15.76  ? 6   VAL O CG1 1 
ATOM   4411 C CG2 . VAL O  1 6  ? 0.955   40.103  12.533  1.00 19.89  ? 6   VAL O CG2 1 
ATOM   4412 N N   . THR O  1 7  ? -0.949  36.048  12.318  1.00 11.53  ? 7   THR O N   1 
ATOM   4413 C CA  . THR O  1 7  ? -1.821  34.938  11.913  1.00 13.44  ? 7   THR O CA  1 
ATOM   4414 C C   . THR O  1 7  ? -2.620  34.421  13.099  1.00 11.80  ? 7   THR O C   1 
ATOM   4415 O O   . THR O  1 7  ? -3.786  34.064  13.041  1.00 11.82  ? 7   THR O O   1 
ATOM   4416 C CB  . THR O  1 7  ? -0.971  33.827  11.267  1.00 15.00  ? 7   THR O CB  1 
ATOM   4417 O OG1 . THR O  1 7  ? -0.321  34.388  10.112  1.00 13.46  ? 7   THR O OG1 1 
ATOM   4418 C CG2 . THR O  1 7  ? -1.820  32.664  10.778  1.00 12.21  ? 7   THR O CG2 1 
ATOM   4419 N N   . CYS O  1 8  ? -1.948  34.335  14.249  1.00 11.28  ? 8   CYS O N   1 
ATOM   4420 C CA  . CYS O  1 8  ? -2.616  33.831  15.452  1.00 11.97  ? 8   CYS O CA  1 
ATOM   4421 C C   . CYS O  1 8  ? -3.817  34.683  15.802  1.00 10.77  ? 8   CYS O C   1 
ATOM   4422 O O   . CYS O  1 8  ? -4.940  34.193  15.947  1.00 15.59  ? 8   CYS O O   1 
ATOM   4423 C CB  . CYS O  1 8  ? -1.625  33.789  16.625  1.00 11.36  ? 8   CYS O CB  1 
ATOM   4424 S SG  . CYS O  1 8  ? -2.388  33.187  18.159  1.00 14.09  ? 8   CYS O SG  1 
ATOM   4425 N N   . LEU O  1 9  ? -3.597  35.983  15.930  1.00 12.71  ? 9   LEU O N   1 
ATOM   4426 C CA  . LEU O  1 9  ? -4.653  36.940  16.249  1.00 13.92  ? 9   LEU O CA  1 
ATOM   4427 C C   . LEU O  1 9  ? -5.743  37.006  15.190  1.00 10.23  ? 9   LEU O C   1 
ATOM   4428 O O   . LEU O  1 9  ? -6.959  37.066  15.483  1.00 14.19  ? 9   LEU O O   1 
ATOM   4429 C CB  . LEU O  1 9  ? -3.973  38.313  16.460  1.00 12.85  ? 9   LEU O CB  1 
ATOM   4430 C CG  . LEU O  1 9  ? -3.116  38.355  17.736  1.00 22.15  ? 9   LEU O CG  1 
ATOM   4431 C CD1 . LEU O  1 9  ? -2.218  39.579  17.748  1.00 21.49  ? 9   LEU O CD1 1 
ATOM   4432 C CD2 . LEU O  1 9  ? -4.034  38.283  18.948  1.00 15.55  ? 9   LEU O CD2 1 
ATOM   4433 N N   . LYS O  1 10 ? -5.358  36.963  13.932  1.00 13.73  ? 10  LYS O N   1 
ATOM   4434 C CA  . LYS O  1 10 ? -6.299  36.974  12.814  1.00 16.92  ? 10  LYS O CA  1 
ATOM   4435 C C   . LYS O  1 10 ? -7.289  35.814  12.915  1.00 19.08  ? 10  LYS O C   1 
ATOM   4436 O O   . LYS O  1 10 ? -8.467  35.949  12.568  1.00 17.16  ? 10  LYS O O   1 
ATOM   4437 C CB  . LYS O  1 10 ? -5.558  36.856  11.489  1.00 21.16  ? 10  LYS O CB  1 
ATOM   4438 C CG  . LYS O  1 10 ? -5.447  38.115  10.658  1.00 40.55  ? 10  LYS O CG  1 
ATOM   4439 C CD  . LYS O  1 10 ? -4.433  37.893  9.539   1.00 44.28  ? 10  LYS O CD  1 
ATOM   4440 C CE  . LYS O  1 10 ? -3.701  39.191  9.217   1.00 54.60  ? 10  LYS O CE  1 
ATOM   4441 N NZ  . LYS O  1 10 ? -3.584  39.420  7.747   1.00 65.51  ? 10  LYS O NZ  1 
ATOM   4442 N N   . SER O  1 11 ? -6.796  34.673  13.389  1.00 14.87  ? 11  SER O N   1 
ATOM   4443 C CA  . SER O  1 11 ? -7.595  33.471  13.501  1.00 13.14  ? 11  SER O CA  1 
ATOM   4444 C C   . SER O  1 11 ? -8.542  33.535  14.696  1.00 15.96  ? 11  SER O C   1 
ATOM   4445 O O   . SER O  1 11 ? -9.428  32.693  14.798  1.00 23.27  ? 11  SER O O   1 
ATOM   4446 C CB  . SER O  1 11 ? -6.718  32.230  13.613  1.00 12.69  ? 11  SER O CB  1 
ATOM   4447 O OG  . SER O  1 11 ? -6.251  32.019  14.928  1.00 16.46  ? 11  SER O OG  1 
ATOM   4448 N N   . GLY O  1 12 ? -8.358  34.509  15.565  1.00 14.35  ? 12  GLY O N   1 
ATOM   4449 C CA  . GLY O  1 12 ? -9.205  34.695  16.743  1.00 14.95  ? 12  GLY O CA  1 
ATOM   4450 C C   . GLY O  1 12 ? -8.584  34.052  17.964  1.00 16.45  ? 12  GLY O C   1 
ATOM   4451 O O   . GLY O  1 12 ? -9.240  33.990  19.005  1.00 21.11  ? 12  GLY O O   1 
ATOM   4452 N N   . ALA O  1 13 ? -7.353  33.576  17.850  1.00 16.70  ? 13  ALA O N   1 
ATOM   4453 C CA  . ALA O  1 13 ? -6.643  32.998  18.992  1.00 17.24  ? 13  ALA O CA  1 
ATOM   4454 C C   . ALA O  1 13 ? -5.895  34.119  19.719  1.00 15.47  ? 13  ALA O C   1 
ATOM   4455 O O   . ALA O  1 13 ? -5.928  35.271  19.295  1.00 13.61  ? 13  ALA O O   1 
ATOM   4456 C CB  . ALA O  1 13 ? -5.684  31.896  18.592  1.00 15.43  ? 13  ALA O CB  1 
ATOM   4457 N N   A ILE O  1 14 ? -5.244  33.767  20.825  0.50 12.65  ? 14  ILE O N   1 
ATOM   4458 N N   B ILE O  1 14 ? -5.249  33.768  20.828  0.50 12.76  ? 14  ILE O N   1 
ATOM   4459 C CA  A ILE O  1 14 ? -4.608  34.779  21.670  0.50 19.23  ? 14  ILE O CA  1 
ATOM   4460 C CA  B ILE O  1 14 ? -4.616  34.769  21.684  0.50 19.29  ? 14  ILE O CA  1 
ATOM   4461 C C   A ILE O  1 14 ? -3.152  34.414  21.888  0.50 14.43  ? 14  ILE O C   1 
ATOM   4462 C C   B ILE O  1 14 ? -3.153  34.414  21.884  0.50 14.46  ? 14  ILE O C   1 
ATOM   4463 O O   A ILE O  1 14 ? -2.845  33.244  22.105  0.50 16.50  ? 14  ILE O O   1 
ATOM   4464 O O   B ILE O  1 14 ? -2.842  33.243  22.090  0.50 16.40  ? 14  ILE O O   1 
ATOM   4465 C CB  A ILE O  1 14 ? -5.352  34.894  23.015  0.50 23.76  ? 14  ILE O CB  1 
ATOM   4466 C CB  B ILE O  1 14 ? -5.330  34.855  23.045  0.50 23.60  ? 14  ILE O CB  1 
ATOM   4467 C CG1 A ILE O  1 14 ? -5.073  36.175  23.793  0.50 27.62  ? 14  ILE O CG1 1 
ATOM   4468 C CG1 B ILE O  1 14 ? -6.865  34.884  22.957  0.50 22.34  ? 14  ILE O CG1 1 
ATOM   4469 C CG2 A ILE O  1 14 ? -5.081  33.675  23.883  0.50 30.70  ? 14  ILE O CG2 1 
ATOM   4470 C CG2 B ILE O  1 14 ? -4.835  36.042  23.852  0.50 31.09  ? 14  ILE O CG2 1 
ATOM   4471 C CD1 A ILE O  1 14 ? -5.333  36.094  25.278  0.50 26.39  ? 14  ILE O CD1 1 
ATOM   4472 C CD1 B ILE O  1 14 ? -7.517  34.705  24.313  0.50 35.26  ? 14  ILE O CD1 1 
ATOM   4473 N N   . CYS O  1 15 ? -2.241  35.382  21.812  1.00 17.07  ? 15  CYS O N   1 
ATOM   4474 C CA  . CYS O  1 15 ? -0.835  35.087  22.011  1.00 13.56  ? 15  CYS O CA  1 
ATOM   4475 C C   . CYS O  1 15 ? -0.439  35.188  23.491  1.00 16.46  ? 15  CYS O C   1 
ATOM   4476 O O   . CYS O  1 15 ? -0.621  36.240  24.091  1.00 17.24  ? 15  CYS O O   1 
ATOM   4477 C CB  . CYS O  1 15 ? 0.069   36.040  21.222  1.00 14.82  ? 15  CYS O CB  1 
ATOM   4478 S SG  . CYS O  1 15 ? 0.059   35.755  19.432  1.00 16.95  ? 15  CYS O SG  1 
ATOM   4479 N N   . HIS O  1 16 ? 0.119   34.124  24.042  1.00 17.24  ? 16  HIS O N   1 
ATOM   4480 C CA  . HIS O  1 16 ? 0.666   34.236  25.409  1.00 19.30  ? 16  HIS O CA  1 
ATOM   4481 C C   . HIS O  1 16 ? 2.176   34.146  25.390  1.00 14.62  ? 16  HIS O C   1 
ATOM   4482 O O   . HIS O  1 16 ? 2.766   33.490  24.522  1.00 17.60  ? 16  HIS O O   1 
ATOM   4483 C CB  . HIS O  1 16 ? 0.044   33.141  26.278  1.00 16.49  ? 16  HIS O CB  1 
ATOM   4484 C CG  . HIS O  1 16 ? -1.371  33.455  26.640  1.00 20.25  ? 16  HIS O CG  1 
ATOM   4485 N ND1 . HIS O  1 16 ? -1.716  33.929  27.889  1.00 22.20  ? 16  HIS O ND1 1 
ATOM   4486 C CD2 . HIS O  1 16 ? -2.520  33.374  25.939  1.00 24.07  ? 16  HIS O CD2 1 
ATOM   4487 C CE1 . HIS O  1 16 ? -3.023  34.120  27.933  1.00 28.96  ? 16  HIS O CE1 1 
ATOM   4488 N NE2 . HIS O  1 16 ? -3.537  33.793  26.761  1.00 26.35  ? 16  HIS O NE2 1 
ATOM   4489 N N   . PRO O  1 17 ? 2.885   34.786  26.326  1.00 20.53  ? 17  PRO O N   1 
ATOM   4490 C CA  . PRO O  1 17 ? 4.347   34.761  26.326  1.00 19.37  ? 17  PRO O CA  1 
ATOM   4491 C C   . PRO O  1 17 ? 5.009   33.477  26.780  1.00 20.78  ? 17  PRO O C   1 
ATOM   4492 O O   . PRO O  1 17 ? 6.126   33.193  26.358  1.00 20.44  ? 17  PRO O O   1 
ATOM   4493 C CB  . PRO O  1 17 ? 4.707   35.845  27.376  1.00 18.72  ? 17  PRO O CB  1 
ATOM   4494 C CG  . PRO O  1 17 ? 3.511   35.949  28.248  1.00 19.99  ? 17  PRO O CG  1 
ATOM   4495 C CD  . PRO O  1 17 ? 2.317   35.601  27.411  1.00 20.40  ? 17  PRO O CD  1 
ATOM   4496 N N   . VAL O  1 18 ? 4.359   32.698  27.656  1.00 18.13  ? 18  VAL O N   1 
ATOM   4497 C CA  . VAL O  1 18 ? 4.999   31.519  28.204  1.00 24.04  ? 18  VAL O CA  1 
ATOM   4498 C C   . VAL O  1 18 ? 4.110   30.277  28.183  1.00 17.98  ? 18  VAL O C   1 
ATOM   4499 O O   . VAL O  1 18 ? 4.549   29.244  27.693  1.00 20.05  ? 18  VAL O O   1 
ATOM   4500 C CB  . VAL O  1 18 ? 5.442   31.722  29.676  1.00 26.85  ? 18  VAL O CB  1 
ATOM   4501 C CG1 . VAL O  1 18 ? 6.424   30.618  30.052  1.00 28.32  ? 18  VAL O CG1 1 
ATOM   4502 C CG2 . VAL O  1 18 ? 6.037   33.093  29.893  1.00 34.06  ? 18  VAL O CG2 1 
ATOM   4503 N N   . PHE O  1 19 ? 2.902   30.398  28.723  1.00 22.10  ? 19  PHE O N   1 
ATOM   4504 C CA  . PHE O  1 19 ? 1.949   29.305  28.784  1.00 18.90  ? 19  PHE O CA  1 
ATOM   4505 C C   . PHE O  1 19 ? 0.558   29.708  28.277  1.00 15.87  ? 19  PHE O C   1 
ATOM   4506 O O   . PHE O  1 19 ? 0.090   30.817  28.507  1.00 19.87  ? 19  PHE O O   1 
ATOM   4507 C CB  . PHE O  1 19 ? 1.762   28.787  30.212  1.00 15.15  ? 19  PHE O CB  1 
ATOM   4508 C CG  . PHE O  1 19 ? 2.986   28.151  30.856  1.00 18.13  ? 19  PHE O CG  1 
ATOM   4509 C CD1 . PHE O  1 19 ? 3.515   28.707  32.008  1.00 23.61  ? 19  PHE O CD1 1 
ATOM   4510 C CD2 . PHE O  1 19 ? 3.582   27.030  30.312  1.00 21.59  ? 19  PHE O CD2 1 
ATOM   4511 C CE1 . PHE O  1 19 ? 4.616   28.140  32.619  1.00 17.21  ? 19  PHE O CE1 1 
ATOM   4512 C CE2 . PHE O  1 19 ? 4.681   26.440  30.925  1.00 23.04  ? 19  PHE O CE2 1 
ATOM   4513 C CZ  . PHE O  1 19 ? 5.186   27.008  32.078  1.00 19.28  ? 19  PHE O CZ  1 
ATOM   4514 N N   . CYS O  1 20 ? -0.099  28.757  27.631  1.00 20.47  ? 20  CYS O N   1 
ATOM   4515 C CA  . CYS O  1 20 ? -1.525  28.887  27.352  1.00 25.61  ? 20  CYS O CA  1 
ATOM   4516 C C   . CYS O  1 20 ? -2.297  28.774  28.676  1.00 24.50  ? 20  CYS O C   1 
ATOM   4517 O O   . CYS O  1 20 ? -1.897  27.971  29.515  1.00 21.55  ? 20  CYS O O   1 
ATOM   4518 C CB  . CYS O  1 20 ? -2.058  27.817  26.413  1.00 19.77  ? 20  CYS O CB  1 
ATOM   4519 S SG  . CYS O  1 20 ? -1.594  28.015  24.672  1.00 18.88  ? 20  CYS O SG  1 
ATOM   4520 N N   . PRO O  1 21 ? -3.359  29.526  28.844  1.00 20.63  ? 21  PRO O N   1 
ATOM   4521 C CA  . PRO O  1 21 ? -4.192  29.298  30.041  1.00 24.28  ? 21  PRO O CA  1 
ATOM   4522 C C   . PRO O  1 21 ? -4.713  27.869  30.019  1.00 24.40  ? 21  PRO O C   1 
ATOM   4523 O O   . PRO O  1 21 ? -4.805  27.221  28.980  1.00 24.45  ? 21  PRO O O   1 
ATOM   4524 C CB  . PRO O  1 21 ? -5.327  30.307  29.887  1.00 31.64  ? 21  PRO O CB  1 
ATOM   4525 C CG  . PRO O  1 21 ? -4.764  31.365  28.984  1.00 32.37  ? 21  PRO O CG  1 
ATOM   4526 C CD  . PRO O  1 21 ? -3.904  30.604  28.007  1.00 22.31  ? 21  PRO O CD  1 
ATOM   4527 N N   . ARG O  1 22 ? -5.065  27.334  31.193  1.00 25.96  ? 22  ARG O N   1 
ATOM   4528 C CA  . ARG O  1 22 ? -5.662  25.990  31.169  1.00 39.24  ? 22  ARG O CA  1 
ATOM   4529 C C   . ARG O  1 22 ? -7.057  26.083  30.537  1.00 29.48  ? 22  ARG O C   1 
ATOM   4530 O O   . ARG O  1 22 ? -7.753  27.069  30.787  1.00 40.07  ? 22  ARG O O   1 
ATOM   4531 C CB  . ARG O  1 22 ? -5.723  25.377  32.561  1.00 42.90  ? 22  ARG O CB  1 
ATOM   4532 C CG  . ARG O  1 22 ? -5.643  23.856  32.593  1.00 57.88  ? 22  ARG O CG  1 
ATOM   4533 C CD  . ARG O  1 22 ? -5.719  23.360  34.026  1.00 66.06  ? 22  ARG O CD  1 
ATOM   4534 N NE  . ARG O  1 22 ? -5.833  21.914  34.158  1.00 71.68  ? 22  ARG O NE  1 
ATOM   4535 C CZ  . ARG O  1 22 ? -6.722  21.308  34.942  1.00 74.47  ? 22  ARG O CZ  1 
ATOM   4536 N NH1 . ARG O  1 22 ? -7.560  22.034  35.667  1.00 75.46  ? 22  ARG O NH1 1 
ATOM   4537 N NH2 . ARG O  1 22 ? -6.776  19.984  35.021  1.00 76.47  ? 22  ARG O NH2 1 
ATOM   4538 N N   . ARG O  1 23 ? -7.395  25.076  29.763  1.00 36.60  ? 23  ARG O N   1 
ATOM   4539 C CA  . ARG O  1 23 ? -8.629  24.921  29.014  1.00 48.18  ? 23  ARG O CA  1 
ATOM   4540 C C   . ARG O  1 23 ? -8.448  25.485  27.603  1.00 43.42  ? 23  ARG O C   1 
ATOM   4541 O O   . ARG O  1 23 ? -9.177  25.077  26.696  1.00 31.31  ? 23  ARG O O   1 
ATOM   4542 C CB  . ARG O  1 23 ? -9.838  25.570  29.691  1.00 59.99  ? 23  ARG O CB  1 
ATOM   4543 C CG  . ARG O  1 23 ? -10.131 25.013  31.075  1.00 74.77  ? 23  ARG O CG  1 
ATOM   4544 C CD  . ARG O  1 23 ? -10.754 26.056  31.992  1.00 89.83  ? 23  ARG O CD  1 
ATOM   4545 N NE  . ARG O  1 23 ? -11.660 25.442  32.952  1.00 102.77 ? 23  ARG O NE  1 
ATOM   4546 C CZ  . ARG O  1 23 ? -12.468 26.033  33.818  1.00 107.13 ? 23  ARG O CZ  1 
ATOM   4547 N NH1 . ARG O  1 23 ? -12.539 27.356  33.906  1.00 118.65 ? 23  ARG O NH1 1 
ATOM   4548 N NH2 . ARG O  1 23 ? -13.229 25.293  34.621  1.00 95.48  ? 23  ARG O NH2 1 
ATOM   4549 N N   . TYR O  1 24 ? -7.479  26.396  27.459  1.00 34.31  ? 24  TYR O N   1 
ATOM   4550 C CA  . TYR O  1 24 ? -7.148  26.859  26.110  1.00 33.37  ? 24  TYR O CA  1 
ATOM   4551 C C   . TYR O  1 24 ? -6.352  25.737  25.437  1.00 32.84  ? 24  TYR O C   1 
ATOM   4552 O O   . TYR O  1 24 ? -5.576  25.090  26.146  1.00 36.26  ? 24  TYR O O   1 
ATOM   4553 C CB  . TYR O  1 24 ? -6.345  28.145  26.077  1.00 29.08  ? 24  TYR O CB  1 
ATOM   4554 C CG  . TYR O  1 24 ? -7.097  29.433  26.300  1.00 26.45  ? 24  TYR O CG  1 
ATOM   4555 C CD1 . TYR O  1 24 ? -6.961  30.500  25.431  1.00 26.18  ? 24  TYR O CD1 1 
ATOM   4556 C CD2 . TYR O  1 24 ? -7.956  29.611  27.378  1.00 31.24  ? 24  TYR O CD2 1 
ATOM   4557 C CE1 . TYR O  1 24 ? -7.641  31.687  25.618  1.00 32.21  ? 24  TYR O CE1 1 
ATOM   4558 C CE2 . TYR O  1 24 ? -8.640  30.795  27.573  1.00 27.09  ? 24  TYR O CE2 1 
ATOM   4559 C CZ  . TYR O  1 24 ? -8.489  31.838  26.695  1.00 35.40  ? 24  TYR O CZ  1 
ATOM   4560 O OH  . TYR O  1 24 ? -9.165  33.021  26.882  1.00 36.66  ? 24  TYR O OH  1 
ATOM   4561 N N   . LYS O  1 25 ? -6.570  25.545  24.147  1.00 22.60  ? 25  LYS O N   1 
ATOM   4562 C CA  . LYS O  1 25 ? -5.789  24.627  23.340  1.00 28.37  ? 25  LYS O CA  1 
ATOM   4563 C C   . LYS O  1 25 ? -4.678  25.374  22.591  1.00 29.42  ? 25  LYS O C   1 
ATOM   4564 O O   . LYS O  1 25 ? -4.953  26.402  21.967  1.00 20.13  ? 25  LYS O O   1 
ATOM   4565 C CB  . LYS O  1 25 ? -6.665  23.888  22.327  1.00 26.16  ? 25  LYS O CB  1 
ATOM   4566 C CG  . LYS O  1 25 ? -5.874  23.015  21.365  1.00 38.09  ? 25  LYS O CG  1 
ATOM   4567 C CD  . LYS O  1 25 ? -6.805  22.104  20.577  1.00 49.07  ? 25  LYS O CD  1 
ATOM   4568 C CE  . LYS O  1 25 ? -7.604  21.220  21.514  1.00 51.34  ? 25  LYS O CE  1 
ATOM   4569 N NZ  . LYS O  1 25 ? -8.686  20.482  20.796  1.00 51.17  ? 25  LYS O NZ  1 
ATOM   4570 N N   . GLN O  1 26 ? -3.457  24.855  22.660  1.00 24.32  ? 26  GLN O N   1 
ATOM   4571 C CA  . GLN O  1 26 ? -2.358  25.461  21.915  1.00 22.20  ? 26  GLN O CA  1 
ATOM   4572 C C   . GLN O  1 26 ? -2.424  25.018  20.457  1.00 22.53  ? 26  GLN O C   1 
ATOM   4573 O O   . GLN O  1 26 ? -2.430  23.823  20.188  1.00 26.67  ? 26  GLN O O   1 
ATOM   4574 C CB  . GLN O  1 26 ? -0.990  25.126  22.516  1.00 22.30  ? 26  GLN O CB  1 
ATOM   4575 C CG  . GLN O  1 26 ? 0.122   25.962  21.906  1.00 18.54  ? 26  GLN O CG  1 
ATOM   4576 C CD  . GLN O  1 26 ? 1.505   25.488  22.297  1.00 30.79  ? 26  GLN O CD  1 
ATOM   4577 O OE1 . GLN O  1 26 ? 1.705   24.953  23.385  1.00 31.35  ? 26  GLN O OE1 1 
ATOM   4578 N NE2 . GLN O  1 26 ? 2.469   25.686  21.399  1.00 28.89  ? 26  GLN O NE2 1 
ATOM   4579 N N   . ILE O  1 27 ? -2.490  25.974  19.534  1.00 17.73  ? 27  ILE O N   1 
ATOM   4580 C CA  . ILE O  1 27 ? -2.481  25.663  18.110  1.00 19.50  ? 27  ILE O CA  1 
ATOM   4581 C C   . ILE O  1 27 ? -1.224  26.154  17.404  1.00 21.14  ? 27  ILE O C   1 
ATOM   4582 O O   . ILE O  1 27 ? -1.184  26.195  16.183  1.00 23.18  ? 27  ILE O O   1 
ATOM   4583 C CB  . ILE O  1 27 ? -3.718  26.267  17.414  1.00 17.53  ? 27  ILE O CB  1 
ATOM   4584 C CG1 . ILE O  1 27 ? -3.775  27.790  17.357  1.00 18.98  ? 27  ILE O CG1 1 
ATOM   4585 C CG2 . ILE O  1 27 ? -4.974  25.699  18.088  1.00 21.22  ? 27  ILE O CG2 1 
ATOM   4586 C CD1 . ILE O  1 27 ? -5.090  28.376  16.883  1.00 20.26  ? 27  ILE O CD1 1 
ATOM   4587 N N   . GLY O  1 28 ? -0.181  26.556  18.126  1.00 17.55  ? 28  GLY O N   1 
ATOM   4588 C CA  . GLY O  1 28 ? 1.069   26.966  17.494  1.00 20.72  ? 28  GLY O CA  1 
ATOM   4589 C C   . GLY O  1 28 ? 1.806   27.999  18.321  1.00 17.55  ? 28  GLY O C   1 
ATOM   4590 O O   . GLY O  1 28 ? 1.586   28.109  19.531  1.00 14.91  ? 28  GLY O O   1 
ATOM   4591 N N   . THR O  1 29 ? 2.696   28.772  17.689  1.00 11.66  ? 29  THR O N   1 
ATOM   4592 C CA  . THR O  1 29 ? 3.423   29.788  18.445  1.00 12.47  ? 29  THR O CA  1 
ATOM   4593 C C   . THR O  1 29 ? 3.086   31.178  17.927  1.00 17.70  ? 29  THR O C   1 
ATOM   4594 O O   . THR O  1 29 ? 2.299   31.365  16.991  1.00 14.72  ? 29  THR O O   1 
ATOM   4595 C CB  . THR O  1 29 ? 4.938   29.564  18.364  1.00 14.81  ? 29  THR O CB  1 
ATOM   4596 O OG1 . THR O  1 29 ? 5.354   29.733  16.996  1.00 15.96  ? 29  THR O OG1 1 
ATOM   4597 C CG2 . THR O  1 29 ? 5.313   28.160  18.796  1.00 17.73  ? 29  THR O CG2 1 
ATOM   4598 N N   . CYS O  1 30 ? 3.692   32.164  18.564  1.00 10.74  ? 30  CYS O N   1 
ATOM   4599 C CA  . CYS O  1 30 ? 3.469   33.545  18.165  1.00 11.14  ? 30  CYS O CA  1 
ATOM   4600 C C   . CYS O  1 30 ? 4.781   34.260  17.837  1.00 14.99  ? 30  CYS O C   1 
ATOM   4601 O O   . CYS O  1 30 ? 4.925   35.425  18.143  1.00 25.50  ? 30  CYS O O   1 
ATOM   4602 C CB  . CYS O  1 30 ? 2.699   34.325  19.232  1.00 16.14  ? 30  CYS O CB  1 
ATOM   4603 S SG  . CYS O  1 30 ? 0.917   33.977  19.111  1.00 15.64  ? 30  CYS O SG  1 
ATOM   4604 N N   . GLY O  1 31 ? 5.648   33.504  17.198  1.00 15.55  ? 31  GLY O N   1 
ATOM   4605 C CA  . GLY O  1 31 ? 6.888   34.001  16.645  1.00 22.79  ? 31  GLY O CA  1 
ATOM   4606 C C   . GLY O  1 31 ? 8.097   33.638  17.484  1.00 12.70  ? 31  GLY O C   1 
ATOM   4607 O O   . GLY O  1 31 ? 8.702   32.581  17.301  1.00 16.26  ? 31  GLY O O   1 
ATOM   4608 N N   . LEU O  1 32 ? 8.453   34.544  18.380  1.00 15.24  ? 32  LEU O N   1 
ATOM   4609 C CA  . LEU O  1 32 ? 9.634   34.377  19.212  1.00 13.40  ? 32  LEU O CA  1 
ATOM   4610 C C   . LEU O  1 32 ? 9.498   33.077  20.005  1.00 20.08  ? 32  LEU O C   1 
ATOM   4611 O O   . LEU O  1 32 ? 8.401   32.695  20.420  1.00 16.51  ? 32  LEU O O   1 
ATOM   4612 C CB  . LEU O  1 32 ? 9.821   35.588  20.129  1.00 20.55  ? 32  LEU O CB  1 
ATOM   4613 C CG  . LEU O  1 32 ? 10.508  36.810  19.500  1.00 18.56  ? 32  LEU O CG  1 
ATOM   4614 C CD1 . LEU O  1 32 ? 10.928  37.842  20.525  1.00 22.42  ? 32  LEU O CD1 1 
ATOM   4615 C CD2 . LEU O  1 32 ? 11.722  36.380  18.689  1.00 22.17  ? 32  LEU O CD2 1 
ATOM   4616 N N   . PRO O  1 33 ? 10.611  32.405  20.208  1.00 18.95  ? 33  PRO O N   1 
ATOM   4617 C CA  . PRO O  1 33 ? 10.614  31.190  21.040  1.00 18.61  ? 33  PRO O CA  1 
ATOM   4618 C C   . PRO O  1 33 ? 9.907   31.393  22.379  1.00 15.01  ? 33  PRO O C   1 
ATOM   4619 O O   . PRO O  1 33 ? 10.013  32.409  23.059  1.00 20.63  ? 33  PRO O O   1 
ATOM   4620 C CB  . PRO O  1 33 ? 12.103  30.942  21.250  1.00 25.56  ? 33  PRO O CB  1 
ATOM   4621 C CG  . PRO O  1 33 ? 12.776  31.549  20.059  1.00 27.80  ? 33  PRO O CG  1 
ATOM   4622 C CD  . PRO O  1 33 ? 11.946  32.740  19.667  1.00 23.54  ? 33  PRO O CD  1 
ATOM   4623 N N   . GLY O  1 34 ? 9.141   30.375  22.761  1.00 22.30  ? 34  GLY O N   1 
ATOM   4624 C CA  . GLY O  1 34 ? 8.417   30.307  24.009  1.00 20.83  ? 34  GLY O CA  1 
ATOM   4625 C C   . GLY O  1 34 ? 6.998   30.819  23.925  1.00 23.09  ? 34  GLY O C   1 
ATOM   4626 O O   . GLY O  1 34 ? 6.142   30.448  24.730  1.00 19.27  ? 34  GLY O O   1 
ATOM   4627 N N   . THR O  1 35 ? 6.738   31.693  22.946  1.00 16.84  ? 35  THR O N   1 
ATOM   4628 C CA  . THR O  1 35 ? 5.390   32.243  22.819  1.00 14.18  ? 35  THR O CA  1 
ATOM   4629 C C   . THR O  1 35 ? 4.434   31.166  22.307  1.00 16.34  ? 35  THR O C   1 
ATOM   4630 O O   . THR O  1 35 ? 4.788   30.239  21.577  1.00 15.75  ? 35  THR O O   1 
ATOM   4631 C CB  . THR O  1 35 ? 5.358   33.464  21.893  1.00 16.86  ? 35  THR O CB  1 
ATOM   4632 O OG1 . THR O  1 35 ? 5.653   33.012  20.557  1.00 14.41  ? 35  THR O OG1 1 
ATOM   4633 C CG2 . THR O  1 35 ? 6.413   34.479  22.336  1.00 12.13  ? 35  THR O CG2 1 
ATOM   4634 N N   . LYS O  1 36 ? 3.174   31.311  22.712  1.00 19.83  ? 36  LYS O N   1 
ATOM   4635 C CA  . LYS O  1 36 ? 2.137   30.352  22.368  1.00 14.81  ? 36  LYS O CA  1 
ATOM   4636 C C   . LYS O  1 36 ? 0.905   31.018  21.749  1.00 12.08  ? 36  LYS O C   1 
ATOM   4637 O O   . LYS O  1 36 ? 0.418   32.055  22.195  1.00 14.23  ? 36  LYS O O   1 
ATOM   4638 C CB  . LYS O  1 36 ? 1.685   29.561  23.598  1.00 16.12  ? 36  LYS O CB  1 
ATOM   4639 C CG  . LYS O  1 36 ? 2.817   29.033  24.464  1.00 24.48  ? 36  LYS O CG  1 
ATOM   4640 C CD  . LYS O  1 36 ? 3.439   27.777  23.872  1.00 26.58  ? 36  LYS O CD  1 
ATOM   4641 C CE  . LYS O  1 36 ? 4.286   27.057  24.920  1.00 23.36  ? 36  LYS O CE  1 
ATOM   4642 N NZ  . LYS O  1 36 ? 5.290   27.976  25.543  1.00 25.73  ? 36  LYS O NZ  1 
ATOM   4643 N N   . CYS O  1 37 ? 0.398   30.362  20.709  1.00 14.33  ? 37  CYS O N   1 
ATOM   4644 C CA  . CYS O  1 37 ? -0.875  30.731  20.105  1.00 11.89  ? 37  CYS O CA  1 
ATOM   4645 C C   . CYS O  1 37 ? -1.917  29.799  20.729  1.00 11.38  ? 37  CYS O C   1 
ATOM   4646 O O   . CYS O  1 37 ? -1.801  28.586  20.572  1.00 12.17  ? 37  CYS O O   1 
ATOM   4647 C CB  . CYS O  1 37 ? -0.866  30.608  18.580  1.00 10.31  ? 37  CYS O CB  1 
ATOM   4648 S SG  . CYS O  1 37 ? -2.393  31.185  17.814  1.00 13.68  ? 37  CYS O SG  1 
ATOM   4649 N N   . CYS O  1 38 ? -2.856  30.391  21.451  1.00 13.34  ? 38  CYS O N   1 
ATOM   4650 C CA  . CYS O  1 38 ? -3.790  29.676  22.307  1.00 11.63  ? 38  CYS O CA  1 
ATOM   4651 C C   . CYS O  1 38 ? -5.241  29.943  21.907  1.00 20.65  ? 38  CYS O C   1 
ATOM   4652 O O   . CYS O  1 38 ? -5.660  31.099  21.868  1.00 18.06  ? 38  CYS O O   1 
ATOM   4653 C CB  . CYS O  1 38 ? -3.584  30.082  23.766  1.00 14.97  ? 38  CYS O CB  1 
ATOM   4654 S SG  . CYS O  1 38 ? -1.869  29.997  24.336  1.00 17.14  ? 38  CYS O SG  1 
ATOM   4655 N N   . LYS O  1 39 ? -5.990  28.883  21.626  1.00 20.54  ? 39  LYS O N   1 
ATOM   4656 C CA  . LYS O  1 39 ? -7.380  29.005  21.186  1.00 18.87  ? 39  LYS O CA  1 
ATOM   4657 C C   . LYS O  1 39 ? -8.335  28.905  22.367  1.00 22.82  ? 39  LYS O C   1 
ATOM   4658 O O   . LYS O  1 39 ? -8.267  27.966  23.158  1.00 23.63  ? 39  LYS O O   1 
ATOM   4659 C CB  . LYS O  1 39 ? -7.666  27.915  20.147  1.00 19.21  ? 39  LYS O CB  1 
ATOM   4660 C CG  . LYS O  1 39 ? -9.117  27.861  19.681  1.00 26.12  ? 39  LYS O CG  1 
ATOM   4661 C CD  . LYS O  1 39 ? -9.301  26.663  18.753  1.00 32.99  ? 39  LYS O CD  1 
ATOM   4662 C CE  . LYS O  1 39 ? -10.761 26.523  18.343  1.00 45.68  ? 39  LYS O CE  1 
ATOM   4663 N NZ  . LYS O  1 39 ? -11.190 25.089  18.330  1.00 76.19  ? 39  LYS O NZ  1 
ATOM   4664 N N   . LYS O  1 40 ? -9.237  29.871  22.537  1.00 22.68  ? 40  LYS O N   1 
ATOM   4665 C CA  . LYS O  1 40 ? -10.081 29.825  23.739  1.00 26.38  ? 40  LYS O CA  1 
ATOM   4666 C C   . LYS O  1 40 ? -11.123 28.720  23.631  1.00 26.30  ? 40  LYS O C   1 
ATOM   4667 O O   . LYS O  1 40 ? -11.437 28.202  22.559  1.00 35.12  ? 40  LYS O O   1 
ATOM   4668 C CB  . LYS O  1 40 ? -10.667 31.209  23.987  1.00 37.57  ? 40  LYS O CB  1 
ATOM   4669 C CG  . LYS O  1 40 ? -11.653 31.707  22.954  1.00 40.85  ? 40  LYS O CG  1 
ATOM   4670 C CD  . LYS O  1 40 ? -12.339 32.974  23.435  1.00 35.60  ? 40  LYS O CD  1 
ATOM   4671 C CE  . LYS O  1 40 ? -11.576 34.214  23.001  1.00 34.47  ? 40  LYS O CE  1 
ATOM   4672 N NZ  . LYS O  1 40 ? -10.490 34.538  23.968  1.00 37.98  ? 40  LYS O NZ  1 
ATOM   4673 N N   . PRO O  1 41 ? -11.664 28.289  24.764  1.00 38.84  ? 41  PRO O N   1 
ATOM   4674 C CA  . PRO O  1 41 ? -12.585 27.146  24.772  1.00 41.17  ? 41  PRO O CA  1 
ATOM   4675 C C   . PRO O  1 41 ? -13.870 27.385  23.982  1.00 45.15  ? 41  PRO O C   1 
ATOM   4676 O O   . PRO O  1 41 ? -14.258 26.494  23.211  1.00 50.30  ? 41  PRO O O   1 
ATOM   4677 C CB  . PRO O  1 41 ? -12.910 26.954  26.258  1.00 38.84  ? 41  PRO O CB  1 
ATOM   4678 C CG  . PRO O  1 41 ? -11.815 27.655  26.988  1.00 44.88  ? 41  PRO O CG  1 
ATOM   4679 C CD  . PRO O  1 41 ? -11.434 28.822  26.118  1.00 40.79  ? 41  PRO O CD  1 
ATOM   4680 O OXT . PRO O  1 41 ? -14.505 28.451  24.124  1.00 48.43  ? 41  PRO O OXT 1 
ATOM   4681 N N   . GLY P  1 1  ? 4.762   54.005  22.350  1.00 74.34  ? 1   GLY P N   1 
ATOM   4682 C CA  . GLY P  1 1  ? 4.228   52.981  23.234  1.00 65.91  ? 1   GLY P CA  1 
ATOM   4683 C C   . GLY P  1 1  ? 4.366   51.590  22.636  1.00 57.75  ? 1   GLY P C   1 
ATOM   4684 O O   . GLY P  1 1  ? 5.240   51.382  21.787  1.00 57.66  ? 1   GLY P O   1 
ATOM   4685 N N   . ILE P  1 2  ? 3.519   50.658  23.071  1.00 45.12  ? 2   ILE P N   1 
ATOM   4686 C CA  . ILE P  1 2  ? 3.561   49.292  22.560  1.00 36.45  ? 2   ILE P CA  1 
ATOM   4687 C C   . ILE P  1 2  ? 2.727   49.132  21.300  1.00 39.81  ? 2   ILE P C   1 
ATOM   4688 O O   . ILE P  1 2  ? 1.498   49.119  21.336  1.00 48.09  ? 2   ILE P O   1 
ATOM   4689 C CB  . ILE P  1 2  ? 3.057   48.281  23.603  1.00 36.02  ? 2   ILE P CB  1 
ATOM   4690 C CG1 . ILE P  1 2  ? 4.031   48.020  24.751  1.00 43.20  ? 2   ILE P CG1 1 
ATOM   4691 C CG2 . ILE P  1 2  ? 2.675   46.981  22.906  1.00 32.15  ? 2   ILE P CG2 1 
ATOM   4692 C CD1 . ILE P  1 2  ? 3.485   48.420  26.109  1.00 55.35  ? 2   ILE P CD1 1 
ATOM   4693 N N   . GLY P  1 3  ? 3.387   49.010  20.147  1.00 44.06  ? 3   GLY P N   1 
ATOM   4694 C CA  . GLY P  1 3  ? 2.643   48.966  18.908  1.00 43.06  ? 3   GLY P CA  1 
ATOM   4695 C C   . GLY P  1 3  ? 2.658   47.636  18.195  1.00 38.43  ? 3   GLY P C   1 
ATOM   4696 O O   . GLY P  1 3  ? 2.034   47.514  17.141  1.00 41.20  ? 3   GLY P O   1 
ATOM   4697 N N   . ASP P  1 4  ? 3.353   46.638  18.741  1.00 38.03  ? 4   ASP P N   1 
ATOM   4698 C CA  . ASP P  1 4  ? 3.458   45.374  18.002  1.00 39.65  ? 4   ASP P CA  1 
ATOM   4699 C C   . ASP P  1 4  ? 3.443   44.177  18.945  1.00 38.07  ? 4   ASP P C   1 
ATOM   4700 O O   . ASP P  1 4  ? 3.779   44.293  20.125  1.00 32.70  ? 4   ASP P O   1 
ATOM   4701 C CB  . ASP P  1 4  ? 4.716   45.398  17.133  1.00 33.39  ? 4   ASP P CB  1 
ATOM   4702 C CG  . ASP P  1 4  ? 5.997   45.211  17.909  1.00 25.91  ? 4   ASP P CG  1 
ATOM   4703 O OD1 . ASP P  1 4  ? 6.611   46.194  18.355  1.00 24.24  ? 4   ASP P OD1 1 
ATOM   4704 O OD2 . ASP P  1 4  ? 6.433   44.056  18.089  1.00 28.39  ? 4   ASP P OD2 1 
ATOM   4705 N N   . PRO P  1 5  ? 3.054   43.020  18.421  1.00 31.78  ? 5   PRO P N   1 
ATOM   4706 C CA  . PRO P  1 5  ? 2.916   41.824  19.251  1.00 28.01  ? 5   PRO P CA  1 
ATOM   4707 C C   . PRO P  1 5  ? 4.243   41.344  19.820  1.00 19.93  ? 5   PRO P C   1 
ATOM   4708 O O   . PRO P  1 5  ? 4.324   40.777  20.909  1.00 16.85  ? 5   PRO P O   1 
ATOM   4709 C CB  . PRO P  1 5  ? 2.384   40.759  18.279  1.00 21.22  ? 5   PRO P CB  1 
ATOM   4710 C CG  . PRO P  1 5  ? 2.676   41.275  16.910  1.00 21.15  ? 5   PRO P CG  1 
ATOM   4711 C CD  . PRO P  1 5  ? 2.734   42.768  17.006  1.00 27.05  ? 5   PRO P CD  1 
ATOM   4712 N N   . VAL P  1 6  ? 5.318   41.558  19.062  1.00 19.86  ? 6   VAL P N   1 
ATOM   4713 C CA  . VAL P  1 6  ? 6.624   41.026  19.435  1.00 17.80  ? 6   VAL P CA  1 
ATOM   4714 C C   . VAL P  1 6  ? 7.181   41.780  20.650  1.00 24.63  ? 6   VAL P C   1 
ATOM   4715 O O   . VAL P  1 6  ? 7.701   41.149  21.566  1.00 25.44  ? 6   VAL P O   1 
ATOM   4716 C CB  . VAL P  1 6  ? 7.639   41.077  18.281  1.00 17.72  ? 6   VAL P CB  1 
ATOM   4717 C CG1 . VAL P  1 6  ? 9.024   40.686  18.776  1.00 28.94  ? 6   VAL P CG1 1 
ATOM   4718 C CG2 . VAL P  1 6  ? 7.197   40.163  17.151  1.00 22.99  ? 6   VAL P CG2 1 
ATOM   4719 N N   . THR P  1 7  ? 7.036   43.096  20.623  1.00 20.82  ? 7   THR P N   1 
ATOM   4720 C CA  . THR P  1 7  ? 7.382   43.944  21.760  1.00 30.77  ? 7   THR P CA  1 
ATOM   4721 C C   . THR P  1 7  ? 6.477   43.600  22.945  1.00 20.55  ? 7   THR P C   1 
ATOM   4722 O O   . THR P  1 7  ? 6.917   43.359  24.067  1.00 30.93  ? 7   THR P O   1 
ATOM   4723 C CB  . THR P  1 7  ? 7.214   45.435  21.410  1.00 33.63  ? 7   THR P CB  1 
ATOM   4724 O OG1 . THR P  1 7  ? 8.110   45.831  20.367  1.00 30.33  ? 7   THR P OG1 1 
ATOM   4725 C CG2 . THR P  1 7  ? 7.562   46.319  22.602  1.00 29.62  ? 7   THR P CG2 1 
ATOM   4726 N N   . CYS P  1 8  ? 5.183   43.583  22.668  1.00 24.11  ? 8   CYS P N   1 
ATOM   4727 C CA  . CYS P  1 8  ? 4.179   43.210  23.661  1.00 21.71  ? 8   CYS P CA  1 
ATOM   4728 C C   . CYS P  1 8  ? 4.551   41.901  24.346  1.00 23.69  ? 8   CYS P C   1 
ATOM   4729 O O   . CYS P  1 8  ? 4.737   41.870  25.568  1.00 30.00  ? 8   CYS P O   1 
ATOM   4730 C CB  . CYS P  1 8  ? 2.801   43.098  23.008  1.00 20.42  ? 8   CYS P CB  1 
ATOM   4731 S SG  . CYS P  1 8  ? 1.504   42.602  24.170  1.00 25.25  ? 8   CYS P SG  1 
ATOM   4732 N N   . LEU P  1 9  ? 4.681   40.833  23.567  1.00 18.76  ? 9   LEU P N   1 
ATOM   4733 C CA  . LEU P  1 9  ? 5.029   39.527  24.126  1.00 22.21  ? 9   LEU P CA  1 
ATOM   4734 C C   . LEU P  1 9  ? 6.361   39.510  24.848  1.00 26.81  ? 9   LEU P C   1 
ATOM   4735 O O   . LEU P  1 9  ? 6.549   38.818  25.856  1.00 28.40  ? 9   LEU P O   1 
ATOM   4736 C CB  . LEU P  1 9  ? 4.997   38.493  22.977  1.00 22.94  ? 9   LEU P CB  1 
ATOM   4737 C CG  . LEU P  1 9  ? 3.592   38.056  22.556  1.00 20.88  ? 9   LEU P CG  1 
ATOM   4738 C CD1 . LEU P  1 9  ? 3.575   37.380  21.186  1.00 22.97  ? 9   LEU P CD1 1 
ATOM   4739 C CD2 . LEU P  1 9  ? 2.964   37.100  23.570  1.00 28.06  ? 9   LEU P CD2 1 
ATOM   4740 N N   . LYS P  1 10 ? 7.350   40.265  24.368  1.00 25.20  ? 10  LYS P N   1 
ATOM   4741 C CA  . LYS P  1 10 ? 8.672   40.190  24.994  1.00 24.15  ? 10  LYS P CA  1 
ATOM   4742 C C   . LYS P  1 10 ? 8.639   40.771  26.404  1.00 25.58  ? 10  LYS P C   1 
ATOM   4743 O O   . LYS P  1 10 ? 9.434   40.386  27.264  1.00 31.70  ? 10  LYS P O   1 
ATOM   4744 C CB  . LYS P  1 10 ? 9.714   40.908  24.136  1.00 33.83  ? 10  LYS P CB  1 
ATOM   4745 C CG  . LYS P  1 10 ? 11.034  41.215  24.822  1.00 39.35  ? 10  LYS P CG  1 
ATOM   4746 C CD  . LYS P  1 10 ? 12.187  41.280  23.835  1.00 34.54  ? 10  LYS P CD  1 
ATOM   4747 C CE  . LYS P  1 10 ? 13.534  41.346  24.545  1.00 43.18  ? 10  LYS P CE  1 
ATOM   4748 N NZ  . LYS P  1 10 ? 14.354  42.490  24.048  1.00 47.29  ? 10  LYS P NZ  1 
ATOM   4749 N N   . SER P  1 11 ? 7.725   41.700  26.637  1.00 29.81  ? 11  SER P N   1 
ATOM   4750 C CA  . SER P  1 11 ? 7.592   42.331  27.943  1.00 37.84  ? 11  SER P CA  1 
ATOM   4751 C C   . SER P  1 11 ? 6.770   41.482  28.913  1.00 42.59  ? 11  SER P C   1 
ATOM   4752 O O   . SER P  1 11 ? 6.412   41.973  29.990  1.00 41.90  ? 11  SER P O   1 
ATOM   4753 C CB  . SER P  1 11 ? 6.941   43.706  27.776  1.00 38.58  ? 11  SER P CB  1 
ATOM   4754 O OG  . SER P  1 11 ? 5.544   43.582  27.548  1.00 32.74  ? 11  SER P OG  1 
ATOM   4755 N N   . GLY P  1 12 ? 6.462   40.249  28.540  1.00 32.80  ? 12  GLY P N   1 
ATOM   4756 C CA  . GLY P  1 12 ? 5.667   39.305  29.297  1.00 27.49  ? 12  GLY P CA  1 
ATOM   4757 C C   . GLY P  1 12 ? 4.192   39.631  29.327  1.00 28.72  ? 12  GLY P C   1 
ATOM   4758 O O   . GLY P  1 12 ? 3.445   39.115  30.163  1.00 50.80  ? 12  GLY P O   1 
ATOM   4759 N N   . ALA P  1 13 ? 3.718   40.483  28.433  1.00 26.25  ? 13  ALA P N   1 
ATOM   4760 C CA  . ALA P  1 13 ? 2.314   40.839  28.290  1.00 22.52  ? 13  ALA P CA  1 
ATOM   4761 C C   . ALA P  1 13 ? 1.630   39.911  27.288  1.00 24.79  ? 13  ALA P C   1 
ATOM   4762 O O   . ALA P  1 13 ? 2.365   39.167  26.630  1.00 22.79  ? 13  ALA P O   1 
ATOM   4763 C CB  . ALA P  1 13 ? 2.228   42.296  27.862  1.00 21.03  ? 13  ALA P CB  1 
ATOM   4764 N N   . ILE P  1 14 ? 0.316   39.928  27.151  1.00 20.88  ? 14  ILE P N   1 
ATOM   4765 C CA  . ILE P  1 14 ? -0.421  39.096  26.201  1.00 31.77  ? 14  ILE P CA  1 
ATOM   4766 C C   . ILE P  1 14 ? -1.082  39.853  25.065  1.00 33.02  ? 14  ILE P C   1 
ATOM   4767 O O   . ILE P  1 14 ? -1.433  41.029  25.171  1.00 30.35  ? 14  ILE P O   1 
ATOM   4768 C CB  . ILE P  1 14 ? -1.483  38.306  27.000  1.00 29.28  ? 14  ILE P CB  1 
ATOM   4769 C CG1 . ILE P  1 14 ? -0.857  37.704  28.273  1.00 32.22  ? 14  ILE P CG1 1 
ATOM   4770 C CG2 . ILE P  1 14 ? -2.169  37.248  26.182  1.00 27.94  ? 14  ILE P CG2 1 
ATOM   4771 C CD1 . ILE P  1 14 ? -1.857  36.963  29.122  1.00 37.06  ? 14  ILE P CD1 1 
ATOM   4772 N N   . CYS P  1 15 ? -1.273  39.207  23.907  1.00 31.56  ? 15  CYS P N   1 
ATOM   4773 C CA  . CYS P  1 15 ? -1.989  39.868  22.817  1.00 25.30  ? 15  CYS P CA  1 
ATOM   4774 C C   . CYS P  1 15 ? -3.387  39.288  22.653  1.00 27.11  ? 15  CYS P C   1 
ATOM   4775 O O   . CYS P  1 15 ? -3.519  38.075  22.459  1.00 26.08  ? 15  CYS P O   1 
ATOM   4776 C CB  . CYS P  1 15 ? -1.271  39.715  21.472  1.00 21.95  ? 15  CYS P CB  1 
ATOM   4777 S SG  . CYS P  1 15 ? 0.264   40.646  21.294  1.00 29.35  ? 15  CYS P SG  1 
ATOM   4778 N N   . HIS P  1 16 ? -4.425  40.103  22.682  1.00 26.83  ? 16  HIS P N   1 
ATOM   4779 C CA  . HIS P  1 16 ? -5.784  39.566  22.499  1.00 36.60  ? 16  HIS P CA  1 
ATOM   4780 C C   . HIS P  1 16 ? -6.339  40.097  21.187  1.00 33.79  ? 16  HIS P C   1 
ATOM   4781 O O   . HIS P  1 16 ? -5.931  41.185  20.759  1.00 44.88  ? 16  HIS P O   1 
ATOM   4782 C CB  . HIS P  1 16 ? -6.612  39.940  23.715  1.00 38.56  ? 16  HIS P CB  1 
ATOM   4783 C CG  . HIS P  1 16 ? -7.829  39.154  24.048  1.00 49.10  ? 16  HIS P CG  1 
ATOM   4784 N ND1 . HIS P  1 16 ? -9.026  39.366  23.380  1.00 49.29  ? 16  HIS P ND1 1 
ATOM   4785 C CD2 . HIS P  1 16 ? -8.092  38.204  24.978  1.00 44.74  ? 16  HIS P CD2 1 
ATOM   4786 C CE1 . HIS P  1 16 ? -9.950  38.559  23.872  1.00 46.96  ? 16  HIS P CE1 1 
ATOM   4787 N NE2 . HIS P  1 16 ? -9.414  37.842  24.844  1.00 42.09  ? 16  HIS P NE2 1 
ATOM   4788 N N   . PRO P  1 17 ? -7.226  39.372  20.517  1.00 29.50  ? 17  PRO P N   1 
ATOM   4789 C CA  . PRO P  1 17 ? -7.686  39.794  19.190  1.00 33.27  ? 17  PRO P CA  1 
ATOM   4790 C C   . PRO P  1 17 ? -8.718  40.910  19.229  1.00 38.99  ? 17  PRO P C   1 
ATOM   4791 O O   . PRO P  1 17 ? -8.829  41.677  18.270  1.00 40.13  ? 17  PRO P O   1 
ATOM   4792 C CB  . PRO P  1 17 ? -8.338  38.532  18.615  1.00 29.81  ? 17  PRO P CB  1 
ATOM   4793 C CG  . PRO P  1 17 ? -8.183  37.456  19.618  1.00 23.87  ? 17  PRO P CG  1 
ATOM   4794 C CD  . PRO P  1 17 ? -7.850  38.110  20.924  1.00 23.89  ? 17  PRO P CD  1 
ATOM   4795 N N   . VAL P  1 18 ? -9.510  41.044  20.293  1.00 44.91  ? 18  VAL P N   1 
ATOM   4796 C CA  . VAL P  1 18 ? -10.424 42.183  20.299  1.00 48.42  ? 18  VAL P CA  1 
ATOM   4797 C C   . VAL P  1 18 ? -10.444 42.912  21.632  1.00 46.98  ? 18  VAL P C   1 
ATOM   4798 O O   . VAL P  1 18 ? -10.504 44.143  21.691  1.00 50.44  ? 18  VAL P O   1 
ATOM   4799 C CB  . VAL P  1 18 ? -11.876 41.781  19.969  1.00 47.18  ? 18  VAL P CB  1 
ATOM   4800 C CG1 . VAL P  1 18 ? -12.730 43.044  19.899  1.00 46.74  ? 18  VAL P CG1 1 
ATOM   4801 C CG2 . VAL P  1 18 ? -11.966 40.996  18.673  1.00 27.90  ? 18  VAL P CG2 1 
ATOM   4802 N N   . PHE P  1 19 ? -10.420 42.196  22.755  1.00 47.11  ? 19  PHE P N   1 
ATOM   4803 C CA  . PHE P  1 19 ? -10.559 42.939  24.011  1.00 51.50  ? 19  PHE P CA  1 
ATOM   4804 C C   . PHE P  1 19 ? -9.708  42.332  25.113  1.00 53.30  ? 19  PHE P C   1 
ATOM   4805 O O   . PHE P  1 19 ? -9.496  41.121  25.096  1.00 42.43  ? 19  PHE P O   1 
ATOM   4806 C CB  . PHE P  1 19 ? -12.033 42.944  24.437  1.00 41.41  ? 19  PHE P CB  1 
ATOM   4807 C CG  . PHE P  1 19 ? -12.466 41.576  24.943  1.00 46.30  ? 19  PHE P CG  1 
ATOM   4808 C CD1 . PHE P  1 19 ? -12.721 40.560  24.036  1.00 54.09  ? 19  PHE P CD1 1 
ATOM   4809 C CD2 . PHE P  1 19 ? -12.607 41.319  26.296  1.00 52.02  ? 19  PHE P CD2 1 
ATOM   4810 C CE1 . PHE P  1 19 ? -13.105 39.307  24.474  1.00 58.13  ? 19  PHE P CE1 1 
ATOM   4811 C CE2 . PHE P  1 19 ? -12.981 40.065  26.745  1.00 57.53  ? 19  PHE P CE2 1 
ATOM   4812 C CZ  . PHE P  1 19 ? -13.225 39.058  25.830  1.00 60.46  ? 19  PHE P CZ  1 
ATOM   4813 N N   . CYS P  1 20 ? -9.252  43.121  26.075  1.00 51.53  ? 20  CYS P N   1 
ATOM   4814 C CA  . CYS P  1 20 ? -8.425  42.572  27.147  1.00 56.02  ? 20  CYS P CA  1 
ATOM   4815 C C   . CYS P  1 20 ? -9.195  41.591  28.029  1.00 63.40  ? 20  CYS P C   1 
ATOM   4816 O O   . CYS P  1 20 ? -10.373 41.774  28.325  1.00 79.01  ? 20  CYS P O   1 
ATOM   4817 C CB  . CYS P  1 20 ? -7.836  43.721  27.974  1.00 51.98  ? 20  CYS P CB  1 
ATOM   4818 S SG  . CYS P  1 20 ? -6.386  44.489  27.202  1.00 54.93  ? 20  CYS P SG  1 
ATOM   4819 N N   . PRO P  1 21 ? -8.493  40.533  28.435  1.00 61.68  ? 21  PRO P N   1 
ATOM   4820 C CA  . PRO P  1 21 ? -9.040  39.481  29.288  1.00 68.56  ? 21  PRO P CA  1 
ATOM   4821 C C   . PRO P  1 21 ? -9.419  39.954  30.694  1.00 70.91  ? 21  PRO P C   1 
ATOM   4822 O O   . PRO P  1 21 ? -9.457  41.150  30.969  1.00 60.22  ? 21  PRO P O   1 
ATOM   4823 C CB  . PRO P  1 21 ? -7.900  38.467  29.402  1.00 70.46  ? 21  PRO P CB  1 
ATOM   4824 C CG  . PRO P  1 21 ? -6.673  39.146  28.912  1.00 66.63  ? 21  PRO P CG  1 
ATOM   4825 C CD  . PRO P  1 21 ? -7.089  40.297  28.051  1.00 61.56  ? 21  PRO P CD  1 
ATOM   4826 N N   . ARG P  1 22 ? -9.699  38.991  31.564  1.00 80.05  ? 22  ARG P N   1 
ATOM   4827 C CA  . ARG P  1 22 ? -10.229 39.208  32.903  1.00 85.33  ? 22  ARG P CA  1 
ATOM   4828 C C   . ARG P  1 22 ? -9.152  39.582  33.915  1.00 80.99  ? 22  ARG P C   1 
ATOM   4829 O O   . ARG P  1 22 ? -8.243  38.791  34.174  1.00 88.78  ? 22  ARG P O   1 
ATOM   4830 C CB  . ARG P  1 22 ? -10.965 37.954  33.388  1.00 94.02  ? 22  ARG P CB  1 
ATOM   4831 C CG  . ARG P  1 22 ? -11.840 38.173  34.623  1.00 98.24  ? 22  ARG P CG  1 
ATOM   4832 C CD  . ARG P  1 22 ? -12.567 36.906  35.026  1.00 99.46  ? 22  ARG P CD  1 
ATOM   4833 N NE  . ARG P  1 22 ? -12.960 36.877  36.429  1.00 102.52 ? 22  ARG P NE  1 
ATOM   4834 C CZ  . ARG P  1 22 ? -12.212 36.443  37.446  1.00 103.31 ? 22  ARG P CZ  1 
ATOM   4835 N NH1 . ARG P  1 22 ? -10.978 35.958  37.250  1.00 96.23  ? 22  ARG P NH1 1 
ATOM   4836 N NH2 . ARG P  1 22 ? -12.698 36.485  38.681  1.00 105.99 ? 22  ARG P NH2 1 
ATOM   4837 N N   . ARG P  1 23 ? -9.282  40.782  34.474  1.00 74.11  ? 23  ARG P N   1 
ATOM   4838 C CA  . ARG P  1 23 ? -8.358  41.315  35.466  1.00 70.57  ? 23  ARG P CA  1 
ATOM   4839 C C   . ARG P  1 23 ? -7.093  41.872  34.813  1.00 71.71  ? 23  ARG P C   1 
ATOM   4840 O O   . ARG P  1 23 ? -6.125  42.186  35.507  1.00 82.75  ? 23  ARG P O   1 
ATOM   4841 C CB  . ARG P  1 23 ? -7.996  40.248  36.501  1.00 69.06  ? 23  ARG P CB  1 
ATOM   4842 C CG  . ARG P  1 23 ? -9.204  39.651  37.208  1.00 71.98  ? 23  ARG P CG  1 
ATOM   4843 C CD  . ARG P  1 23 ? -8.793  38.707  38.324  1.00 76.86  ? 23  ARG P CD  1 
ATOM   4844 N NE  . ARG P  1 23 ? -7.856  37.686  37.866  1.00 81.09  ? 23  ARG P NE  1 
ATOM   4845 C CZ  . ARG P  1 23 ? -7.197  36.827  38.629  1.00 74.38  ? 23  ARG P CZ  1 
ATOM   4846 N NH1 . ARG P  1 23 ? -7.353  36.830  39.947  1.00 52.16  ? 23  ARG P NH1 1 
ATOM   4847 N NH2 . ARG P  1 23 ? -6.377  35.948  38.061  1.00 63.56  ? 23  ARG P NH2 1 
ATOM   4848 N N   . TYR P  1 24 ? -7.127  41.989  33.490  1.00 61.95  ? 24  TYR P N   1 
ATOM   4849 C CA  . TYR P  1 24 ? -6.056  42.563  32.695  1.00 48.43  ? 24  TYR P CA  1 
ATOM   4850 C C   . TYR P  1 24 ? -6.380  44.012  32.328  1.00 45.90  ? 24  TYR P C   1 
ATOM   4851 O O   . TYR P  1 24 ? -7.548  44.398  32.312  1.00 36.25  ? 24  TYR P O   1 
ATOM   4852 C CB  . TYR P  1 24 ? -5.820  41.779  31.401  1.00 43.97  ? 24  TYR P CB  1 
ATOM   4853 C CG  . TYR P  1 24 ? -5.202  40.414  31.570  1.00 37.53  ? 24  TYR P CG  1 
ATOM   4854 C CD1 . TYR P  1 24 ? -5.929  39.366  32.115  1.00 34.71  ? 24  TYR P CD1 1 
ATOM   4855 C CD2 . TYR P  1 24 ? -3.889  40.167  31.182  1.00 39.85  ? 24  TYR P CD2 1 
ATOM   4856 C CE1 . TYR P  1 24 ? -5.370  38.111  32.271  1.00 36.83  ? 24  TYR P CE1 1 
ATOM   4857 C CE2 . TYR P  1 24 ? -3.326  38.913  31.339  1.00 40.26  ? 24  TYR P CE2 1 
ATOM   4858 C CZ  . TYR P  1 24 ? -4.066  37.889  31.883  1.00 37.86  ? 24  TYR P CZ  1 
ATOM   4859 O OH  . TYR P  1 24 ? -3.509  36.639  32.040  1.00 39.92  ? 24  TYR P OH  1 
ATOM   4860 N N   . LYS P  1 25 ? -5.343  44.778  32.017  1.00 47.89  ? 25  LYS P N   1 
ATOM   4861 C CA  . LYS P  1 25 ? -5.503  46.150  31.547  1.00 51.28  ? 25  LYS P CA  1 
ATOM   4862 C C   . LYS P  1 25 ? -4.685  46.362  30.279  1.00 46.54  ? 25  LYS P C   1 
ATOM   4863 O O   . LYS P  1 25 ? -3.551  45.897  30.188  1.00 39.88  ? 25  LYS P O   1 
ATOM   4864 C CB  . LYS P  1 25 ? -5.106  47.147  32.633  1.00 57.53  ? 25  LYS P CB  1 
ATOM   4865 C CG  . LYS P  1 25 ? -5.766  46.907  33.982  1.00 64.65  ? 25  LYS P CG  1 
ATOM   4866 C CD  . LYS P  1 25 ? -7.279  46.828  33.860  1.00 67.17  ? 25  LYS P CD  1 
ATOM   4867 C CE  . LYS P  1 25 ? -7.958  46.920  35.217  1.00 64.64  ? 25  LYS P CE  1 
ATOM   4868 N NZ  . LYS P  1 25 ? -7.303  47.920  36.100  1.00 64.48  ? 25  LYS P NZ  1 
ATOM   4869 N N   . GLN P  1 26 ? -5.253  47.051  29.298  1.00 48.79  ? 26  GLN P N   1 
ATOM   4870 C CA  . GLN P  1 26 ? -4.543  47.274  28.038  1.00 54.96  ? 26  GLN P CA  1 
ATOM   4871 C C   . GLN P  1 26 ? -3.385  48.246  28.237  1.00 52.90  ? 26  GLN P C   1 
ATOM   4872 O O   . GLN P  1 26 ? -3.576  49.345  28.763  1.00 40.41  ? 26  GLN P O   1 
ATOM   4873 C CB  . GLN P  1 26 ? -5.516  47.783  26.980  1.00 62.46  ? 26  GLN P CB  1 
ATOM   4874 C CG  . GLN P  1 26 ? -4.890  48.329  25.704  1.00 67.28  ? 26  GLN P CG  1 
ATOM   4875 C CD  . GLN P  1 26 ? -5.949  48.958  24.803  1.00 71.40  ? 26  GLN P CD  1 
ATOM   4876 O OE1 . GLN P  1 26 ? -6.975  49.440  25.293  1.00 86.44  ? 26  GLN P OE1 1 
ATOM   4877 N NE2 . GLN P  1 26 ? -5.725  48.951  23.494  1.00 50.52  ? 26  GLN P NE2 1 
ATOM   4878 N N   . ILE P  1 27 ? -2.202  47.815  27.808  1.00 47.04  ? 27  ILE P N   1 
ATOM   4879 C CA  . ILE P  1 27 ? -0.976  48.590  27.899  1.00 44.37  ? 27  ILE P CA  1 
ATOM   4880 C C   . ILE P  1 27 ? -0.398  48.944  26.529  1.00 44.56  ? 27  ILE P C   1 
ATOM   4881 O O   . ILE P  1 27 ? 0.760   49.354  26.435  1.00 40.41  ? 27  ILE P O   1 
ATOM   4882 C CB  . ILE P  1 27 ? 0.097   47.833  28.705  1.00 43.20  ? 27  ILE P CB  1 
ATOM   4883 C CG1 . ILE P  1 27 ? 0.335   46.390  28.246  1.00 38.64  ? 27  ILE P CG1 1 
ATOM   4884 C CG2 . ILE P  1 27 ? -0.232  47.874  30.189  1.00 52.83  ? 27  ILE P CG2 1 
ATOM   4885 C CD1 . ILE P  1 27 ? 1.649   45.824  28.745  1.00 63.15  ? 27  ILE P CD1 1 
ATOM   4886 N N   . GLY P  1 28 ? -1.194  48.788  25.479  1.00 44.08  ? 28  GLY P N   1 
ATOM   4887 C CA  . GLY P  1 28 ? -0.785  49.015  24.104  1.00 40.83  ? 28  GLY P CA  1 
ATOM   4888 C C   . GLY P  1 28 ? -1.614  48.198  23.132  1.00 36.47  ? 28  GLY P C   1 
ATOM   4889 O O   . GLY P  1 28 ? -2.715  47.748  23.457  1.00 35.96  ? 28  GLY P O   1 
ATOM   4890 N N   . THR P  1 29 ? -1.116  47.979  21.916  1.00 34.31  ? 29  THR P N   1 
ATOM   4891 C CA  . THR P  1 29 ? -1.824  47.111  20.985  1.00 31.80  ? 29  THR P CA  1 
ATOM   4892 C C   . THR P  1 29 ? -0.856  46.053  20.459  1.00 27.39  ? 29  THR P C   1 
ATOM   4893 O O   . THR P  1 29 ? 0.308   46.008  20.843  1.00 40.36  ? 29  THR P O   1 
ATOM   4894 C CB  . THR P  1 29 ? -2.440  47.845  19.785  1.00 32.26  ? 29  THR P CB  1 
ATOM   4895 O OG1 . THR P  1 29 ? -1.386  48.439  19.008  1.00 50.83  ? 29  THR P OG1 1 
ATOM   4896 C CG2 . THR P  1 29 ? -3.357  48.975  20.231  1.00 30.34  ? 29  THR P CG2 1 
ATOM   4897 N N   . CYS P  1 30 ? -1.363  45.201  19.571  1.00 27.82  ? 30  CYS P N   1 
ATOM   4898 C CA  . CYS P  1 30 ? -0.424  44.256  18.971  1.00 23.08  ? 30  CYS P CA  1 
ATOM   4899 C C   . CYS P  1 30 ? -0.519  44.376  17.454  1.00 29.70  ? 30  CYS P C   1 
ATOM   4900 O O   . CYS P  1 30 ? -0.593  43.379  16.743  1.00 47.17  ? 30  CYS P O   1 
ATOM   4901 C CB  . CYS P  1 30 ? -0.679  42.841  19.471  1.00 26.45  ? 30  CYS P CB  1 
ATOM   4902 S SG  . CYS P  1 30 ? -0.350  42.593  21.244  1.00 27.43  ? 30  CYS P SG  1 
ATOM   4903 N N   . GLY P  1 31 ? -0.504  45.625  16.991  1.00 35.76  ? 31  GLY P N   1 
ATOM   4904 C CA  . GLY P  1 31 ? -0.344  45.955  15.599  1.00 45.00  ? 31  GLY P CA  1 
ATOM   4905 C C   . GLY P  1 31 ? -1.601  46.269  14.826  1.00 53.06  ? 31  GLY P C   1 
ATOM   4906 O O   . GLY P  1 31 ? -2.086  47.403  14.816  1.00 44.65  ? 31  GLY P O   1 
ATOM   4907 N N   . LEU P  1 32 ? -2.156  45.261  14.140  1.00 53.44  ? 32  LEU P N   1 
ATOM   4908 C CA  . LEU P  1 32 ? -3.362  45.568  13.368  1.00 68.86  ? 32  LEU P CA  1 
ATOM   4909 C C   . LEU P  1 32 ? -4.492  45.936  14.325  1.00 73.10  ? 32  LEU P C   1 
ATOM   4910 O O   . LEU P  1 32 ? -4.578  45.456  15.453  1.00 67.83  ? 32  LEU P O   1 
ATOM   4911 C CB  . LEU P  1 32 ? -3.760  44.424  12.444  1.00 74.70  ? 32  LEU P CB  1 
ATOM   4912 C CG  . LEU P  1 32 ? -4.285  43.142  13.091  1.00 75.77  ? 32  LEU P CG  1 
ATOM   4913 C CD1 . LEU P  1 32 ? -4.888  42.218  12.042  1.00 66.76  ? 32  LEU P CD1 1 
ATOM   4914 C CD2 . LEU P  1 32 ? -3.170  42.448  13.857  1.00 87.98  ? 32  LEU P CD2 1 
ATOM   4915 N N   . PRO P  1 33 ? -5.364  46.822  13.856  1.00 75.13  ? 33  PRO P N   1 
ATOM   4916 C CA  . PRO P  1 33 ? -6.469  47.295  14.689  1.00 71.86  ? 33  PRO P CA  1 
ATOM   4917 C C   . PRO P  1 33 ? -7.280  46.125  15.242  1.00 64.16  ? 33  PRO P C   1 
ATOM   4918 O O   . PRO P  1 33 ? -7.368  45.063  14.628  1.00 56.27  ? 33  PRO P O   1 
ATOM   4919 C CB  . PRO P  1 33 ? -7.305  48.119  13.710  1.00 78.03  ? 33  PRO P CB  1 
ATOM   4920 C CG  . PRO P  1 33 ? -6.325  48.574  12.679  1.00 79.33  ? 33  PRO P CG  1 
ATOM   4921 C CD  . PRO P  1 33 ? -5.358  47.432  12.517  1.00 76.68  ? 33  PRO P CD  1 
ATOM   4922 N N   . GLY P  1 34 ? -7.852  46.357  16.415  1.00 61.61  ? 34  GLY P N   1 
ATOM   4923 C CA  . GLY P  1 34 ? -8.647  45.367  17.122  1.00 63.89  ? 34  GLY P CA  1 
ATOM   4924 C C   . GLY P  1 34 ? -7.843  44.696  18.227  1.00 58.44  ? 34  GLY P C   1 
ATOM   4925 O O   . GLY P  1 34 ? -8.351  44.487  19.330  1.00 44.68  ? 34  GLY P O   1 
ATOM   4926 N N   . THR P  1 35 ? -6.599  44.375  17.900  1.00 53.11  ? 35  THR P N   1 
ATOM   4927 C CA  . THR P  1 35 ? -5.660  43.718  18.794  1.00 48.27  ? 35  THR P CA  1 
ATOM   4928 C C   . THR P  1 35 ? -5.362  44.570  20.024  1.00 46.69  ? 35  THR P C   1 
ATOM   4929 O O   . THR P  1 35 ? -5.232  45.792  19.928  1.00 35.90  ? 35  THR P O   1 
ATOM   4930 C CB  . THR P  1 35 ? -4.323  43.407  18.088  1.00 41.24  ? 35  THR P CB  1 
ATOM   4931 O OG1 . THR P  1 35 ? -3.727  44.635  17.647  1.00 35.90  ? 35  THR P OG1 1 
ATOM   4932 C CG2 . THR P  1 35 ? -4.555  42.560  16.849  1.00 39.74  ? 35  THR P CG2 1 
ATOM   4933 N N   . LYS P  1 36 ? -5.245  43.904  21.172  1.00 41.62  ? 36  LYS P N   1 
ATOM   4934 C CA  . LYS P  1 36 ? -4.902  44.597  22.407  1.00 41.22  ? 36  LYS P CA  1 
ATOM   4935 C C   . LYS P  1 36 ? -3.740  43.949  23.143  1.00 41.02  ? 36  LYS P C   1 
ATOM   4936 O O   . LYS P  1 36 ? -3.797  42.790  23.562  1.00 41.54  ? 36  LYS P O   1 
ATOM   4937 C CB  . LYS P  1 36 ? -6.122  44.650  23.347  1.00 37.91  ? 36  LYS P CB  1 
ATOM   4938 C CG  . LYS P  1 36 ? -7.338  45.264  22.665  1.00 39.33  ? 36  LYS P CG  1 
ATOM   4939 C CD  . LYS P  1 36 ? -8.122  46.149  23.616  1.00 42.15  ? 36  LYS P CD  1 
ATOM   4940 C CE  . LYS P  1 36 ? -9.145  46.997  22.872  1.00 42.99  ? 36  LYS P CE  1 
ATOM   4941 N NZ  . LYS P  1 36 ? -8.687  47.364  21.503  1.00 49.43  ? 36  LYS P NZ  1 
ATOM   4942 N N   . CYS P  1 37 ? -2.669  44.727  23.324  1.00 35.12  ? 37  CYS P N   1 
ATOM   4943 C CA  . CYS P  1 37 ? -1.648  44.272  24.265  1.00 32.55  ? 37  CYS P CA  1 
ATOM   4944 C C   . CYS P  1 37 ? -2.207  44.481  25.679  1.00 35.60  ? 37  CYS P C   1 
ATOM   4945 O O   . CYS P  1 37 ? -2.549  45.611  26.028  1.00 40.30  ? 37  CYS P O   1 
ATOM   4946 C CB  . CYS P  1 37 ? -0.314  44.988  24.094  1.00 35.76  ? 37  CYS P CB  1 
ATOM   4947 S SG  . CYS P  1 37 ? 1.017   44.324  25.145  1.00 30.75  ? 37  CYS P SG  1 
ATOM   4948 N N   . CYS P  1 38 ? -2.303  43.407  26.447  1.00 42.30  ? 38  CYS P N   1 
ATOM   4949 C CA  . CYS P  1 38 ? -2.827  43.430  27.807  1.00 38.74  ? 38  CYS P CA  1 
ATOM   4950 C C   . CYS P  1 38 ? -1.804  42.890  28.802  1.00 43.92  ? 38  CYS P C   1 
ATOM   4951 O O   . CYS P  1 38 ? -1.134  41.884  28.547  1.00 42.92  ? 38  CYS P O   1 
ATOM   4952 C CB  . CYS P  1 38 ? -4.118  42.616  27.927  1.00 25.49  ? 38  CYS P CB  1 
ATOM   4953 S SG  . CYS P  1 38 ? -5.284  42.891  26.571  1.00 42.90  ? 38  CYS P SG  1 
ATOM   4954 N N   . LYS P  1 39 ? -1.697  43.578  29.935  1.00 41.83  ? 39  LYS P N   1 
ATOM   4955 C CA  . LYS P  1 39 ? -0.766  43.155  30.970  1.00 44.11  ? 39  LYS P CA  1 
ATOM   4956 C C   . LYS P  1 39 ? -1.504  42.737  32.243  1.00 55.80  ? 39  LYS P C   1 
ATOM   4957 O O   . LYS P  1 39 ? -2.475  43.373  32.647  1.00 44.04  ? 39  LYS P O   1 
ATOM   4958 C CB  . LYS P  1 39 ? 0.243   44.261  31.291  1.00 34.47  ? 39  LYS P CB  1 
ATOM   4959 C CG  . LYS P  1 39 ? 1.334   43.829  32.258  1.00 37.97  ? 39  LYS P CG  1 
ATOM   4960 C CD  . LYS P  1 39 ? 2.121   42.646  31.714  1.00 37.22  ? 39  LYS P CD  1 
ATOM   4961 C CE  . LYS P  1 39 ? 3.056   42.039  32.743  1.00 26.24  ? 39  LYS P CE  1 
ATOM   4962 N NZ  . LYS P  1 39 ? 4.488   42.261  32.416  1.00 40.07  ? 39  LYS P NZ  1 
ATOM   4963 N N   . LYS P  1 40 ? -1.007  41.664  32.845  1.00 65.35  ? 40  LYS P N   1 
ATOM   4964 C CA  . LYS P  1 40 ? -1.467  41.192  34.143  1.00 68.36  ? 40  LYS P CA  1 
ATOM   4965 C C   . LYS P  1 40 ? -0.518  41.708  35.226  1.00 66.94  ? 40  LYS P C   1 
ATOM   4966 O O   . LYS P  1 40 ? 0.518   41.112  35.518  1.00 73.71  ? 40  LYS P O   1 
ATOM   4967 C CB  . LYS P  1 40 ? -1.561  39.669  34.189  1.00 70.19  ? 40  LYS P CB  1 
ATOM   4968 C CG  . LYS P  1 40 ? -2.503  39.152  35.264  1.00 72.08  ? 40  LYS P CG  1 
ATOM   4969 C CD  . LYS P  1 40 ? -2.114  37.753  35.715  1.00 73.45  ? 40  LYS P CD  1 
ATOM   4970 C CE  . LYS P  1 40 ? -3.278  37.044  36.397  1.00 71.78  ? 40  LYS P CE  1 
ATOM   4971 N NZ  . LYS P  1 40 ? -3.443  35.640  35.925  1.00 53.34  ? 40  LYS P NZ  1 
ATOM   4972 N N   . PRO P  1 41 ? -0.895  42.842  35.804  1.00 66.34  ? 41  PRO P N   1 
ATOM   4973 C CA  . PRO P  1 41 ? -0.082  43.521  36.812  1.00 70.60  ? 41  PRO P CA  1 
ATOM   4974 C C   . PRO P  1 41 ? 0.421   42.575  37.903  1.00 72.04  ? 41  PRO P C   1 
ATOM   4975 O O   . PRO P  1 41 ? -0.032  41.424  37.966  1.00 65.55  ? 41  PRO P O   1 
ATOM   4976 C CB  . PRO P  1 41 ? -1.040  44.549  37.417  1.00 68.91  ? 41  PRO P CB  1 
ATOM   4977 C CG  . PRO P  1 41 ? -2.378  44.295  36.821  1.00 72.12  ? 41  PRO P CG  1 
ATOM   4978 C CD  . PRO P  1 41 ? -2.147  43.566  35.527  1.00 68.70  ? 41  PRO P CD  1 
ATOM   4979 O OXT . PRO P  1 41 ? 1.282   43.022  38.694  1.00 76.19  ? 41  PRO P OXT 1 
HETATM 4980 S S   . SO4 Q  2 .  ? 25.843  -2.024  28.461  1.00 43.30  ? 811 SO4 A S   1 
HETATM 4981 O O1  . SO4 Q  2 .  ? 27.294  -2.299  28.411  1.00 44.40  ? 811 SO4 A O1  1 
HETATM 4982 O O2  . SO4 Q  2 .  ? 25.271  -2.256  27.117  1.00 39.43  ? 811 SO4 A O2  1 
HETATM 4983 O O3  . SO4 Q  2 .  ? 25.201  -2.939  29.427  1.00 56.28  ? 811 SO4 A O3  1 
HETATM 4984 O O4  . SO4 Q  2 .  ? 25.612  -0.629  28.873  1.00 32.57  ? 811 SO4 A O4  1 
HETATM 4985 S S   . SO4 R  2 .  ? 2.025   12.978  53.849  1.00 33.35  ? 808 SO4 F S   1 
HETATM 4986 O O1  . SO4 R  2 .  ? 2.060   11.498  53.897  1.00 37.70  ? 808 SO4 F O1  1 
HETATM 4987 O O2  . SO4 R  2 .  ? 1.485   13.390  52.536  1.00 27.54  ? 808 SO4 F O2  1 
HETATM 4988 O O3  . SO4 R  2 .  ? 1.147   13.485  54.920  1.00 37.15  ? 808 SO4 F O3  1 
HETATM 4989 O O4  . SO4 R  2 .  ? 3.381   13.513  54.030  1.00 25.87  ? 808 SO4 F O4  1 
HETATM 4990 S S   . SO4 S  2 .  ? -21.688 41.858  2.777   1.00 26.87  ? 809 SO4 I S   1 
HETATM 4991 O O1  . SO4 S  2 .  ? -20.500 42.529  2.207   1.00 40.57  ? 809 SO4 I O1  1 
HETATM 4992 O O2  . SO4 S  2 .  ? -22.899 42.599  2.393   1.00 23.94  ? 809 SO4 I O2  1 
HETATM 4993 O O3  . SO4 S  2 .  ? -21.757 40.471  2.306   1.00 24.01  ? 809 SO4 I O3  1 
HETATM 4994 O O4  . SO4 S  2 .  ? -21.567 41.864  4.262   1.00 28.43  ? 809 SO4 I O4  1 
HETATM 4995 S S   . SO4 T  2 .  ? -27.971 36.135  -1.068  1.00 34.63  ? 810 SO4 I S   1 
HETATM 4996 O O1  . SO4 T  2 .  ? -29.158 35.245  -1.035  1.00 51.61  ? 810 SO4 I O1  1 
HETATM 4997 O O2  . SO4 T  2 .  ? -27.546 36.291  -2.481  1.00 25.75  ? 810 SO4 I O2  1 
HETATM 4998 O O3  . SO4 T  2 .  ? -26.885 35.527  -0.289  1.00 33.84  ? 810 SO4 I O3  1 
HETATM 4999 O O4  . SO4 T  2 .  ? -28.334 37.452  -0.517  1.00 36.06  ? 810 SO4 I O4  1 
HETATM 5000 S S   . SO4 U  2 .  ? 25.826  41.700  1.180   1.00 23.95  ? 807 SO4 M S   1 
HETATM 5001 O O1  . SO4 U  2 .  ? 24.878  42.174  2.203   1.00 28.16  ? 807 SO4 M O1  1 
HETATM 5002 O O2  . SO4 U  2 .  ? 25.330  42.128  -0.155  1.00 36.24  ? 807 SO4 M O2  1 
HETATM 5003 O O3  . SO4 U  2 .  ? 25.936  40.241  1.221   1.00 25.89  ? 807 SO4 M O3  1 
HETATM 5004 O O4  . SO4 U  2 .  ? 27.152  42.318  1.409   1.00 18.64  ? 807 SO4 M O4  1 
HETATM 5005 O O   . HOH V  3 .  ? 23.824  12.546  21.043  1.00 17.00  ? 812 HOH A O   1 
HETATM 5006 O O   . HOH V  3 .  ? 11.504  7.433   22.444  1.00 11.60  ? 813 HOH A O   1 
HETATM 5007 O O   . HOH V  3 .  ? 28.837  5.431   19.246  1.00 20.77  ? 814 HOH A O   1 
HETATM 5008 O O   . HOH V  3 .  ? 11.571  -0.101  25.732  1.00 22.39  ? 815 HOH A O   1 
HETATM 5009 O O   . HOH V  3 .  ? 26.841  5.030   17.396  1.00 14.76  ? 816 HOH A O   1 
HETATM 5010 O O   . HOH V  3 .  ? 16.883  6.250   27.807  1.00 16.87  ? 817 HOH A O   1 
HETATM 5011 O O   . HOH V  3 .  ? 27.641  5.658   25.813  1.00 22.01  ? 818 HOH A O   1 
HETATM 5012 O O   . HOH V  3 .  ? 21.960  10.225  13.149  1.00 26.50  ? 819 HOH A O   1 
HETATM 5013 O O   . HOH V  3 .  ? 12.203  10.905  25.853  1.00 23.13  ? 820 HOH A O   1 
HETATM 5014 O O   . HOH V  3 .  ? 28.191  3.714   15.375  1.00 21.61  ? 821 HOH A O   1 
HETATM 5015 O O   . HOH V  3 .  ? 28.403  9.201   23.544  1.00 23.24  ? 822 HOH A O   1 
HETATM 5016 O O   . HOH V  3 .  ? 13.841  3.556   27.360  1.00 23.31  ? 823 HOH A O   1 
HETATM 5017 O O   . HOH V  3 .  ? 29.758  5.505   15.265  1.00 41.55  ? 824 HOH A O   1 
HETATM 5018 O O   . HOH V  3 .  ? 9.109   -0.289  24.504  1.00 21.91  ? 825 HOH A O   1 
HETATM 5019 O O   . HOH V  3 .  ? 16.821  -2.916  28.400  1.00 27.42  ? 826 HOH A O   1 
HETATM 5020 O O   . HOH V  3 .  ? 9.222   2.176   23.982  1.00 17.14  ? 827 HOH A O   1 
HETATM 5021 O O   . HOH V  3 .  ? 27.649  8.685   16.421  1.00 26.30  ? 828 HOH A O   1 
HETATM 5022 O O   . HOH V  3 .  ? 30.640  -0.122  15.060  1.00 28.58  ? 829 HOH A O   1 
HETATM 5023 O O   . HOH V  3 .  ? 30.029  10.536  25.359  1.00 35.67  ? 830 HOH A O   1 
HETATM 5024 O O   . HOH V  3 .  ? 9.748   -3.944  24.022  1.00 27.84  ? 831 HOH A O   1 
HETATM 5025 O O   . HOH V  3 .  ? 17.566  11.817  19.431  1.00 30.98  ? 832 HOH A O   1 
HETATM 5026 O O   . HOH V  3 .  ? 12.131  -2.513  23.906  1.00 32.99  ? 833 HOH A O   1 
HETATM 5027 O O   . HOH V  3 .  ? 15.275  -3.855  25.097  1.00 23.77  ? 834 HOH A O   1 
HETATM 5028 O O   . HOH V  3 .  ? 15.567  -10.479 24.275  1.00 37.20  ? 835 HOH A O   1 
HETATM 5029 O O   . HOH V  3 .  ? 32.197  6.716   16.060  1.00 40.57  ? 836 HOH A O   1 
HETATM 5030 O O   . HOH V  3 .  ? 16.314  3.992   29.582  1.00 38.69  ? 837 HOH A O   1 
HETATM 5031 O O   . HOH V  3 .  ? 29.011  9.843   27.685  1.00 32.66  ? 838 HOH A O   1 
HETATM 5032 O O   . HOH V  3 .  ? 12.294  -7.244  18.739  1.00 34.81  ? 839 HOH A O   1 
HETATM 5033 O O   . HOH V  3 .  ? 31.897  7.913   18.502  1.00 65.08  ? 840 HOH A O   1 
HETATM 5034 O O   . HOH V  3 .  ? 15.685  -7.693  19.998  1.00 41.01  ? 841 HOH A O   1 
HETATM 5035 O O   . HOH V  3 .  ? 12.156  5.608   28.845  1.00 33.90  ? 842 HOH A O   1 
HETATM 5036 O O   . HOH V  3 .  ? 30.659  -2.534  15.929  1.00 44.63  ? 843 HOH A O   1 
HETATM 5037 O O   . HOH V  3 .  ? 31.230  -4.670  14.880  1.00 46.81  ? 844 HOH A O   1 
HETATM 5038 O O   . HOH V  3 .  ? 16.364  1.410   28.342  1.00 35.39  ? 845 HOH A O   1 
HETATM 5039 O O   . HOH V  3 .  ? 12.676  11.862  17.674  1.00 45.20  ? 846 HOH A O   1 
HETATM 5040 O O   . HOH V  3 .  ? 19.244  13.265  12.239  1.00 42.39  ? 847 HOH A O   1 
HETATM 5041 O O   . HOH V  3 .  ? 17.298  14.513  11.665  1.00 40.61  ? 848 HOH A O   1 
HETATM 5042 O O   . HOH V  3 .  ? 26.689  12.793  20.372  1.00 30.78  ? 849 HOH A O   1 
HETATM 5043 O O   . HOH V  3 .  ? 27.234  9.018   14.190  1.00 34.09  ? 850 HOH A O   1 
HETATM 5044 O O   . HOH V  3 .  ? 30.052  8.038   16.099  1.00 36.31  ? 851 HOH A O   1 
HETATM 5045 O O   . HOH V  3 .  ? 17.811  -9.075  25.268  1.00 35.72  ? 852 HOH A O   1 
HETATM 5046 O O   . HOH V  3 .  ? 32.421  -2.509  26.310  1.00 34.29  ? 853 HOH A O   1 
HETATM 5047 O O   . HOH V  3 .  ? 36.458  4.946   18.518  1.00 72.46  ? 854 HOH A O   1 
HETATM 5048 O O   . HOH V  3 .  ? 29.605  8.072   19.958  1.00 39.03  ? 855 HOH A O   1 
HETATM 5049 O O   . HOH V  3 .  ? 39.358  7.171   25.951  1.00 49.50  ? 856 HOH A O   1 
HETATM 5050 O O   . HOH V  3 .  ? 10.955  13.120  11.920  1.00 35.72  ? 857 HOH A O   1 
HETATM 5051 O O   . HOH V  3 .  ? 11.444  2.295   27.700  1.00 28.47  ? 858 HOH A O   1 
HETATM 5052 O O   . HOH V  3 .  ? 12.001  -5.117  26.199  1.00 39.30  ? 859 HOH A O   1 
HETATM 5053 O O   . HOH V  3 .  ? 19.623  -10.794 27.693  1.00 38.93  ? 860 HOH A O   1 
HETATM 5054 O O   . HOH V  3 .  ? 34.318  5.720   23.355  1.00 43.76  ? 861 HOH A O   1 
HETATM 5055 O O   . HOH V  3 .  ? 19.508  14.282  14.618  1.00 36.13  ? 862 HOH A O   1 
HETATM 5056 O O   . HOH V  3 .  ? 31.550  1.697   13.265  1.00 31.16  ? 863 HOH A O   1 
HETATM 5057 O O   . HOH V  3 .  ? 31.624  -2.887  18.208  1.00 42.28  ? 864 HOH A O   1 
HETATM 5058 O O   . HOH V  3 .  ? 31.969  4.343   14.309  1.00 44.14  ? 865 HOH A O   1 
HETATM 5059 O O   . HOH V  3 .  ? 41.228  -6.596  24.928  1.00 86.17  ? 866 HOH A O   1 
HETATM 5060 O O   . HOH V  3 .  ? 19.489  1.549   29.314  1.00 61.22  ? 867 HOH A O   1 
HETATM 5061 O O   . HOH V  3 .  ? 12.740  15.022  12.031  1.00 37.50  ? 868 HOH A O   1 
HETATM 5062 O O   . HOH V  3 .  ? 34.414  3.250   23.792  1.00 37.43  ? 869 HOH A O   1 
HETATM 5063 O O   . HOH W  3 .  ? 27.311  4.830   11.603  1.00 14.04  ? 42  HOH B O   1 
HETATM 5064 O O   . HOH W  3 .  ? 21.074  5.606   4.168   1.00 20.19  ? 43  HOH B O   1 
HETATM 5065 O O   . HOH W  3 .  ? 22.437  -9.288  11.496  1.00 35.30  ? 44  HOH B O   1 
HETATM 5066 O O   . HOH W  3 .  ? 25.300  -11.575 5.668   1.00 47.53  ? 45  HOH B O   1 
HETATM 5067 O O   . HOH W  3 .  ? 19.068  -4.700  0.102   1.00 21.50  ? 46  HOH B O   1 
HETATM 5068 O O   . HOH W  3 .  ? 33.676  -1.031  12.666  1.00 38.86  ? 47  HOH B O   1 
HETATM 5069 O O   . HOH W  3 .  ? 26.217  -10.875 16.989  1.00 38.90  ? 48  HOH B O   1 
HETATM 5070 O O   . HOH W  3 .  ? 21.316  4.240   1.774   1.00 30.54  ? 49  HOH B O   1 
HETATM 5071 O O   . HOH W  3 .  ? 14.207  -0.109  -1.037  1.00 40.13  ? 50  HOH B O   1 
HETATM 5072 O O   . HOH W  3 .  ? 11.832  -0.713  1.595   1.00 36.67  ? 51  HOH B O   1 
HETATM 5073 O O   . HOH W  3 .  ? 10.689  -3.883  3.269   1.00 23.76  ? 52  HOH B O   1 
HETATM 5074 O O   . HOH W  3 .  ? 11.929  -8.154  8.864   1.00 26.92  ? 53  HOH B O   1 
HETATM 5075 O O   . HOH W  3 .  ? 27.121  -3.200  15.338  1.00 25.01  ? 54  HOH B O   1 
HETATM 5076 O O   . HOH W  3 .  ? 28.578  7.158   12.591  1.00 25.91  ? 55  HOH B O   1 
HETATM 5077 O O   . HOH W  3 .  ? 19.070  12.273  9.391   1.00 25.04  ? 56  HOH B O   1 
HETATM 5078 O O   . HOH W  3 .  ? 16.359  -15.265 11.669  1.00 43.99  ? 57  HOH B O   1 
HETATM 5079 O O   . HOH W  3 .  ? 17.647  -11.517 6.899   1.00 23.45  ? 58  HOH B O   1 
HETATM 5080 O O   . HOH W  3 .  ? 26.628  3.085   1.217   1.00 29.19  ? 59  HOH B O   1 
HETATM 5081 O O   . HOH W  3 .  ? 16.648  -15.233 5.812   1.00 34.74  ? 60  HOH B O   1 
HETATM 5082 O O   . HOH W  3 .  ? 11.957  -10.744 9.742   1.00 38.73  ? 61  HOH B O   1 
HETATM 5083 O O   . HOH W  3 .  ? 27.414  -5.877  15.733  1.00 36.46  ? 62  HOH B O   1 
HETATM 5084 O O   . HOH W  3 .  ? 17.521  -11.213 17.275  1.00 38.66  ? 63  HOH B O   1 
HETATM 5085 O O   . HOH W  3 .  ? 15.942  0.998   1.049   1.00 26.85  ? 64  HOH B O   1 
HETATM 5086 O O   . HOH W  3 .  ? 9.857   4.158   11.050  1.00 38.21  ? 65  HOH B O   1 
HETATM 5087 O O   . HOH W  3 .  ? 6.872   4.980   8.650   1.00 41.54  ? 66  HOH B O   1 
HETATM 5088 O O   . HOH W  3 .  ? 19.450  -12.782 12.302  1.00 38.79  ? 67  HOH B O   1 
HETATM 5089 O O   . HOH W  3 .  ? 20.294  -10.350 10.286  1.00 39.49  ? 68  HOH B O   1 
HETATM 5090 O O   . HOH W  3 .  ? 19.630  -14.126 9.902   1.00 43.80  ? 69  HOH B O   1 
HETATM 5091 O O   . HOH W  3 .  ? 17.109  -13.310 13.038  1.00 36.03  ? 70  HOH B O   1 
HETATM 5092 O O   . HOH W  3 .  ? 20.641  0.001   0.516   1.00 26.12  ? 71  HOH B O   1 
HETATM 5093 O O   . HOH W  3 .  ? 15.141  8.805   3.521   1.00 66.10  ? 72  HOH B O   1 
HETATM 5094 O O   . HOH W  3 .  ? 17.881  -17.673 16.428  1.00 49.69  ? 73  HOH B O   1 
HETATM 5095 O O   . HOH W  3 .  ? 7.148   4.881   11.344  1.00 43.16  ? 74  HOH B O   1 
HETATM 5096 O O   . HOH W  3 .  ? 17.052  -12.810 4.622   1.00 27.38  ? 75  HOH B O   1 
HETATM 5097 O O   . HOH W  3 .  ? 11.100  -2.213  5.025   1.00 31.98  ? 76  HOH B O   1 
HETATM 5098 O O   . HOH W  3 .  ? 18.556  -9.474  8.278   1.00 28.69  ? 77  HOH B O   1 
HETATM 5099 O O   . HOH W  3 .  ? 14.943  4.966   3.011   1.00 32.95  ? 78  HOH B O   1 
HETATM 5100 O O   . HOH W  3 .  ? 10.762  5.407   8.583   1.00 37.27  ? 79  HOH B O   1 
HETATM 5101 O O   . HOH W  3 .  ? 31.099  0.358   5.693   1.00 29.72  ? 80  HOH B O   1 
HETATM 5102 O O   . HOH W  3 .  ? 29.257  -8.933  14.486  1.00 42.70  ? 81  HOH B O   1 
HETATM 5103 O O   . HOH W  3 .  ? 28.889  2.673   12.534  1.00 27.27  ? 82  HOH B O   1 
HETATM 5104 O O   . HOH W  3 .  ? 36.184  -12.703 11.451  1.00 40.61  ? 83  HOH B O   1 
HETATM 5105 O O   . HOH W  3 .  ? 18.091  1.866   -0.198  1.00 61.08  ? 84  HOH B O   1 
HETATM 5106 O O   . HOH W  3 .  ? 28.150  -11.169 18.519  1.00 32.20  ? 85  HOH B O   1 
HETATM 5107 O O   . HOH W  3 .  ? 14.773  -14.243 17.767  1.00 52.08  ? 86  HOH B O   1 
HETATM 5108 O O   . HOH W  3 .  ? 29.463  -6.388  16.636  1.00 43.11  ? 87  HOH B O   1 
HETATM 5109 O O   . HOH W  3 .  ? 13.271  -12.804 10.410  1.00 54.26  ? 88  HOH B O   1 
HETATM 5110 O O   . HOH W  3 .  ? 16.262  -12.698 9.367   1.00 35.18  ? 89  HOH B O   1 
HETATM 5111 O O   . HOH W  3 .  ? 33.059  -5.148  12.214  1.00 48.87  ? 90  HOH B O   1 
HETATM 5112 O O   . HOH W  3 .  ? 30.724  6.596   5.517   1.00 40.81  ? 91  HOH B O   1 
HETATM 5113 O O   . HOH W  3 .  ? 23.425  -12.782 9.516   1.00 36.19  ? 92  HOH B O   1 
HETATM 5114 O O   . HOH W  3 .  ? 13.294  10.541  3.857   1.00 37.70  ? 93  HOH B O   1 
HETATM 5115 O O   A HOH W  3 .  ? 21.828  9.756   10.312  0.50 22.61  ? 94  HOH B O   1 
HETATM 5116 O O   B HOH W  3 .  ? 21.755  9.534   10.140  0.50 23.22  ? 94  HOH B O   1 
HETATM 5117 O O   . HOH W  3 .  ? 12.598  5.339   3.702   1.00 42.18  ? 95  HOH B O   1 
HETATM 5118 O O   . HOH W  3 .  ? 30.084  8.711   11.273  1.00 41.75  ? 96  HOH B O   1 
HETATM 5119 O O   . HOH W  3 .  ? 29.807  0.619   3.748   1.00 42.98  ? 97  HOH B O   1 
HETATM 5120 O O   . HOH W  3 .  ? 8.378   2.978   8.723   1.00 59.70  ? 98  HOH B O   1 
HETATM 5121 O O   . HOH W  3 .  ? 9.459   7.559   7.807   1.00 64.44  ? 99  HOH B O   1 
HETATM 5122 O O   . HOH W  3 .  ? 24.006  -10.270 17.065  1.00 71.46  ? 100 HOH B O   1 
HETATM 5123 O O   . HOH W  3 .  ? 19.036  7.658   3.405   1.00 35.37  ? 101 HOH B O   1 
HETATM 5124 O O   . HOH W  3 .  ? 8.858   2.091   10.933  1.00 50.06  ? 102 HOH B O   1 
HETATM 5125 O O   . HOH X  3 .  ? 9.835   3.891   25.884  1.00 18.25  ? 42  HOH C O   1 
HETATM 5126 O O   . HOH X  3 .  ? 9.856   10.811  27.963  1.00 16.29  ? 43  HOH C O   1 
HETATM 5127 O O   . HOH X  3 .  ? 10.110  6.753   32.157  1.00 23.77  ? 44  HOH C O   1 
HETATM 5128 O O   . HOH X  3 .  ? 11.326  12.825  28.318  1.00 29.90  ? 45  HOH C O   1 
HETATM 5129 O O   . HOH X  3 .  ? -16.652 17.750  16.215  1.00 54.99  ? 46  HOH C O   1 
HETATM 5130 O O   . HOH X  3 .  ? 9.274   12.466  19.637  1.00 25.30  ? 47  HOH C O   1 
HETATM 5131 O O   . HOH X  3 .  ? 3.963   14.327  17.246  1.00 29.71  ? 48  HOH C O   1 
HETATM 5132 O O   . HOH X  3 .  ? -0.168  3.584   33.837  1.00 25.48  ? 49  HOH C O   1 
HETATM 5133 O O   . HOH X  3 .  ? 11.942  1.218   35.375  1.00 55.76  ? 50  HOH C O   1 
HETATM 5134 O O   . HOH X  3 .  ? -6.701  16.719  17.754  1.00 31.62  ? 51  HOH C O   1 
HETATM 5135 O O   . HOH X  3 .  ? -6.117  8.543   17.442  1.00 29.88  ? 52  HOH C O   1 
HETATM 5136 O O   . HOH X  3 .  ? -3.500  21.034  23.815  1.00 39.78  ? 53  HOH C O   1 
HETATM 5137 O O   . HOH X  3 .  ? 5.920   17.754  19.672  1.00 57.88  ? 54  HOH C O   1 
HETATM 5138 O O   . HOH X  3 .  ? 6.744   14.384  16.019  1.00 54.84  ? 55  HOH C O   1 
HETATM 5139 O O   . HOH X  3 .  ? -6.992  17.367  21.213  1.00 28.23  ? 56  HOH C O   1 
HETATM 5140 O O   . HOH X  3 .  ? -13.333 10.308  26.089  1.00 60.76  ? 57  HOH C O   1 
HETATM 5141 O O   . HOH X  3 .  ? 4.136   16.999  18.436  1.00 37.27  ? 58  HOH C O   1 
HETATM 5142 O O   . HOH X  3 .  ? -4.465  9.175   15.907  1.00 31.90  ? 59  HOH C O   1 
HETATM 5143 O O   . HOH X  3 .  ? 1.335   12.285  11.634  1.00 37.12  ? 60  HOH C O   1 
HETATM 5144 O O   . HOH X  3 .  ? 7.591   17.001  22.574  1.00 63.79  ? 61  HOH C O   1 
HETATM 5145 O O   . HOH X  3 .  ? -5.317  10.233  30.865  1.00 31.55  ? 62  HOH C O   1 
HETATM 5146 O O   . HOH X  3 .  ? -2.818  17.079  18.410  1.00 38.15  ? 63  HOH C O   1 
HETATM 5147 O O   . HOH X  3 .  ? -9.099  7.906   24.617  1.00 57.65  ? 64  HOH C O   1 
HETATM 5148 O O   . HOH X  3 .  ? -12.087 13.007  19.182  1.00 30.28  ? 65  HOH C O   1 
HETATM 5149 O O   . HOH X  3 .  ? -4.166  18.337  21.878  1.00 44.78  ? 66  HOH C O   1 
HETATM 5150 O O   . HOH X  3 .  ? -2.662  23.120  25.508  1.00 43.66  ? 67  HOH C O   1 
HETATM 5151 O O   . HOH X  3 .  ? -5.466  22.128  27.058  1.00 59.11  ? 68  HOH C O   1 
HETATM 5152 O O   . HOH X  3 .  ? 8.995   16.067  19.650  1.00 38.07  ? 69  HOH C O   1 
HETATM 5153 O O   . HOH X  3 .  ? 8.018   12.248  17.598  1.00 41.20  ? 70  HOH C O   1 
HETATM 5154 O O   . HOH X  3 .  ? -5.214  7.339   13.190  1.00 42.92  ? 71  HOH C O   1 
HETATM 5155 O O   . HOH X  3 .  ? -14.606 14.188  26.768  1.00 73.11  ? 72  HOH C O   1 
HETATM 5156 O O   A HOH X  3 .  ? 5.589   20.661  20.543  0.50 45.70  ? 73  HOH C O   1 
HETATM 5157 O O   B HOH X  3 .  ? 7.502   20.154  19.459  0.50 35.29  ? 73  HOH C O   1 
HETATM 5158 O O   . HOH X  3 .  ? 2.799   8.507   13.316  1.00 41.18  ? 74  HOH C O   1 
HETATM 5159 O O   . HOH X  3 .  ? -11.434 13.776  31.848  1.00 68.44  ? 75  HOH C O   1 
HETATM 5160 O O   . HOH X  3 .  ? 10.429  14.848  24.346  1.00 40.83  ? 76  HOH C O   1 
HETATM 5161 O O   . HOH X  3 .  ? -7.744  19.703  24.034  1.00 61.48  ? 77  HOH C O   1 
HETATM 5162 O O   . HOH X  3 .  ? -10.041 10.331  18.283  1.00 45.10  ? 78  HOH C O   1 
HETATM 5163 O O   . HOH X  3 .  ? 8.618   14.961  22.378  1.00 45.38  ? 79  HOH C O   1 
HETATM 5164 O O   . HOH X  3 .  ? -7.325  10.482  17.215  1.00 36.51  ? 80  HOH C O   1 
HETATM 5165 O O   . HOH Y  3 .  ? 5.623   -3.291  12.221  1.00 35.56  ? 104 HOH D O   1 
HETATM 5166 O O   . HOH Y  3 .  ? -6.406  2.710   29.982  1.00 42.33  ? 286 HOH D O   1 
HETATM 5167 O O   . HOH Y  3 .  ? -0.455  6.464   11.603  1.00 56.15  ? 343 HOH D O   1 
HETATM 5168 O O   . HOH Y  3 .  ? 3.148   -2.255  12.758  1.00 37.56  ? 344 HOH D O   1 
HETATM 5169 O O   . HOH Y  3 .  ? -4.593  -10.691 24.162  1.00 42.81  ? 345 HOH D O   1 
HETATM 5170 O O   . HOH Y  3 .  ? 7.501   -1.731  26.350  1.00 30.90  ? 368 HOH D O   1 
HETATM 5171 O O   . HOH Y  3 .  ? -1.850  -8.507  16.797  1.00 65.25  ? 430 HOH D O   1 
HETATM 5172 O O   . HOH Y  3 .  ? 5.479   -8.092  17.398  1.00 68.48  ? 458 HOH D O   1 
HETATM 5173 O O   . HOH Y  3 .  ? -18.514 3.483   20.912  1.00 34.80  ? 479 HOH D O   1 
HETATM 5174 O O   . HOH Y  3 .  ? 7.349   -5.525  15.322  1.00 31.42  ? 481 HOH D O   1 
HETATM 5175 O O   . HOH Y  3 .  ? 5.642   -6.559  19.239  1.00 37.93  ? 496 HOH D O   1 
HETATM 5176 O O   . HOH Y  3 .  ? 5.937   -9.094  21.613  1.00 39.79  ? 519 HOH D O   1 
HETATM 5177 O O   . HOH Y  3 .  ? 3.167   -1.810  34.039  1.00 42.38  ? 574 HOH D O   1 
HETATM 5178 O O   . HOH Y  3 .  ? 3.072   -7.901  15.284  1.00 42.41  ? 590 HOH D O   1 
HETATM 5179 O O   . HOH Y  3 .  ? -8.968  -10.179 25.215  1.00 61.16  ? 634 HOH D O   1 
HETATM 5180 O O   . HOH Y  3 .  ? -14.958 3.945   28.038  1.00 34.95  ? 665 HOH D O   1 
HETATM 5181 O O   . HOH Y  3 .  ? -6.614  4.571   32.260  1.00 33.38  ? 667 HOH D O   1 
HETATM 5182 O O   . HOH Y  3 .  ? 1.429   4.714   12.472  1.00 35.91  ? 696 HOH D O   1 
HETATM 5183 O O   . HOH Y  3 .  ? 2.782   -14.590 17.914  1.00 76.97  ? 743 HOH D O   1 
HETATM 5184 O O   . HOH Y  3 .  ? -9.406  6.659   17.711  1.00 47.63  ? 754 HOH D O   1 
HETATM 5185 O O   . HOH Y  3 .  ? -9.833  -2.411  14.260  1.00 118.73 ? 769 HOH D O   1 
HETATM 5186 O O   . HOH Z  3 .  ? 11.871  15.999  31.676  1.00 20.68  ? 42  HOH E O   1 
HETATM 5187 O O   . HOH Z  3 .  ? -1.809  19.609  34.772  1.00 30.31  ? 43  HOH E O   1 
HETATM 5188 O O   . HOH Z  3 .  ? 16.114  20.367  45.570  1.00 32.57  ? 44  HOH E O   1 
HETATM 5189 O O   . HOH Z  3 .  ? 16.690  15.845  35.380  1.00 25.64  ? 45  HOH E O   1 
HETATM 5190 O O   . HOH Z  3 .  ? 3.869   7.736   53.008  1.00 16.85  ? 46  HOH E O   1 
HETATM 5191 O O   . HOH Z  3 .  ? 7.445   20.488  29.733  1.00 32.22  ? 47  HOH E O   1 
HETATM 5192 O O   . HOH Z  3 .  ? -4.153  14.092  49.274  1.00 45.48  ? 48  HOH E O   1 
HETATM 5193 O O   . HOH Z  3 .  ? -3.091  14.014  47.019  1.00 24.22  ? 49  HOH E O   1 
HETATM 5194 O O   . HOH Z  3 .  ? 9.903   7.838   46.063  1.00 20.82  ? 50  HOH E O   1 
HETATM 5195 O O   . HOH Z  3 .  ? 10.250  9.148   33.960  1.00 24.03  ? 51  HOH E O   1 
HETATM 5196 O O   . HOH Z  3 .  ? 15.203  12.472  42.809  1.00 24.75  ? 52  HOH E O   1 
HETATM 5197 O O   . HOH Z  3 .  ? 18.207  13.365  42.491  1.00 43.36  ? 53  HOH E O   1 
HETATM 5198 O O   . HOH Z  3 .  ? 14.396  7.861   42.465  1.00 28.57  ? 54  HOH E O   1 
HETATM 5199 O O   . HOH Z  3 .  ? -0.742  11.831  32.140  1.00 22.81  ? 55  HOH E O   1 
HETATM 5200 O O   . HOH Z  3 .  ? 9.641   15.148  51.920  1.00 26.84  ? 56  HOH E O   1 
HETATM 5201 O O   . HOH Z  3 .  ? 0.582   11.632  36.033  1.00 21.35  ? 57  HOH E O   1 
HETATM 5202 O O   . HOH Z  3 .  ? -3.224  11.296  32.791  1.00 34.51  ? 58  HOH E O   1 
HETATM 5203 O O   . HOH Z  3 .  ? 11.506  5.170   44.235  1.00 42.27  ? 59  HOH E O   1 
HETATM 5204 O O   . HOH Z  3 .  ? -2.630  11.314  36.941  1.00 61.43  ? 60  HOH E O   1 
HETATM 5205 O O   . HOH Z  3 .  ? -1.052  12.018  38.822  1.00 31.70  ? 61  HOH E O   1 
HETATM 5206 O O   . HOH Z  3 .  ? -1.172  4.927   44.065  1.00 44.04  ? 62  HOH E O   1 
HETATM 5207 O O   . HOH Z  3 .  ? 14.008  16.762  47.366  1.00 19.47  ? 63  HOH E O   1 
HETATM 5208 O O   . HOH Z  3 .  ? 5.441   5.928   46.549  1.00 28.41  ? 64  HOH E O   1 
HETATM 5209 O O   . HOH Z  3 .  ? -0.267  6.453   52.588  1.00 41.03  ? 65  HOH E O   1 
HETATM 5210 O O   . HOH Z  3 .  ? 11.729  7.431   38.434  1.00 35.03  ? 66  HOH E O   1 
HETATM 5211 O O   . HOH Z  3 .  ? 1.239   8.500   51.858  1.00 51.47  ? 67  HOH E O   1 
HETATM 5212 O O   . HOH Z  3 .  ? 15.528  6.737   44.445  1.00 25.82  ? 68  HOH E O   1 
HETATM 5213 O O   . HOH Z  3 .  ? -0.495  5.959   41.804  1.00 29.45  ? 69  HOH E O   1 
HETATM 5214 O O   . HOH Z  3 .  ? 16.331  13.180  36.538  1.00 25.11  ? 70  HOH E O   1 
HETATM 5215 O O   . HOH Z  3 .  ? -1.229  19.421  31.058  1.00 38.67  ? 71  HOH E O   1 
HETATM 5216 O O   . HOH Z  3 .  ? 2.232   4.065   36.135  1.00 40.25  ? 72  HOH E O   1 
HETATM 5217 O O   . HOH Z  3 .  ? 14.093  10.977  35.230  1.00 38.25  ? 73  HOH E O   1 
HETATM 5218 O O   . HOH Z  3 .  ? 18.309  15.744  37.580  1.00 35.32  ? 74  HOH E O   1 
HETATM 5219 O O   . HOH Z  3 .  ? 14.011  7.084   31.932  1.00 51.12  ? 75  HOH E O   1 
HETATM 5220 O O   . HOH Z  3 .  ? -3.691  9.854   35.178  1.00 54.36  ? 76  HOH E O   1 
HETATM 5221 O O   . HOH Z  3 .  ? 15.687  14.461  40.590  1.00 41.57  ? 77  HOH E O   1 
HETATM 5222 O O   . HOH Z  3 .  ? 12.149  5.259   35.187  1.00 50.07  ? 78  HOH E O   1 
HETATM 5223 O O   . HOH Z  3 .  ? -5.331  10.215  38.913  1.00 42.44  ? 79  HOH E O   1 
HETATM 5224 O O   . HOH Z  3 .  ? 12.711  4.860   39.029  1.00 60.74  ? 80  HOH E O   1 
HETATM 5225 O O   . HOH Z  3 .  ? 4.128   3.002   46.912  1.00 56.59  ? 81  HOH E O   1 
HETATM 5226 O O   . HOH Z  3 .  ? -5.444  16.979  40.556  1.00 34.60  ? 82  HOH E O   1 
HETATM 5227 O O   . HOH Z  3 .  ? 5.966   7.174   50.743  1.00 51.32  ? 83  HOH E O   1 
HETATM 5228 O O   . HOH Z  3 .  ? -4.504  15.253  45.703  1.00 48.97  ? 84  HOH E O   1 
HETATM 5229 O O   . HOH Z  3 .  ? 15.022  18.264  49.551  1.00 58.75  ? 85  HOH E O   1 
HETATM 5230 O O   . HOH Z  3 .  ? 19.777  13.872  44.551  1.00 49.99  ? 86  HOH E O   1 
HETATM 5231 O O   . HOH Z  3 .  ? 3.615   1.726   35.441  1.00 59.72  ? 87  HOH E O   1 
HETATM 5232 O O   . HOH AA 3 .  ? -0.471  19.115  57.848  1.00 20.68  ? 809 HOH F O   1 
HETATM 5233 O O   . HOH AA 3 .  ? -3.907  18.674  42.256  1.00 21.37  ? 810 HOH F O   1 
HETATM 5234 O O   . HOH AA 3 .  ? 5.105   20.087  53.520  1.00 20.27  ? 811 HOH F O   1 
HETATM 5235 O O   . HOH AA 3 .  ? 4.195   32.800  37.597  1.00 32.15  ? 812 HOH F O   1 
HETATM 5236 O O   . HOH AA 3 .  ? 1.161   15.619  48.245  1.00 21.64  ? 813 HOH F O   1 
HETATM 5237 O O   . HOH AA 3 .  ? 11.643  26.282  53.371  1.00 34.17  ? 814 HOH F O   1 
HETATM 5238 O O   . HOH AA 3 .  ? 4.164   32.372  50.127  1.00 26.97  ? 815 HOH F O   1 
HETATM 5239 O O   . HOH AA 3 .  ? -8.073  23.507  52.429  1.00 49.27  ? 816 HOH F O   1 
HETATM 5240 O O   . HOH AA 3 .  ? -5.194  25.024  46.716  1.00 23.87  ? 817 HOH F O   1 
HETATM 5241 O O   . HOH AA 3 .  ? -5.346  23.258  50.965  1.00 27.75  ? 818 HOH F O   1 
HETATM 5242 O O   . HOH AA 3 .  ? -1.864  24.240  32.512  1.00 25.42  ? 819 HOH F O   1 
HETATM 5243 O O   . HOH AA 3 .  ? 3.210   33.254  46.633  1.00 25.56  ? 820 HOH F O   1 
HETATM 5244 O O   . HOH AA 3 .  ? -2.457  28.149  39.887  1.00 25.18  ? 821 HOH F O   1 
HETATM 5245 O O   . HOH AA 3 .  ? 0.999   20.825  59.577  1.00 28.63  ? 822 HOH F O   1 
HETATM 5246 O O   . HOH AA 3 .  ? -6.665  17.005  57.075  1.00 38.74  ? 823 HOH F O   1 
HETATM 5247 O O   . HOH AA 3 .  ? -6.253  21.321  59.313  1.00 31.98  ? 824 HOH F O   1 
HETATM 5248 O O   . HOH AA 3 .  ? 5.441   31.201  52.262  1.00 29.38  ? 825 HOH F O   1 
HETATM 5249 O O   . HOH AA 3 .  ? 11.008  23.628  54.430  1.00 56.96  ? 826 HOH F O   1 
HETATM 5250 O O   . HOH AA 3 .  ? 7.447   27.324  57.454  1.00 74.29  ? 827 HOH F O   1 
HETATM 5251 O O   . HOH AA 3 .  ? 3.594   15.719  52.008  1.00 18.31  ? 828 HOH F O   1 
HETATM 5252 O O   . HOH AA 3 .  ? 12.601  33.865  44.162  1.00 48.21  ? 829 HOH F O   1 
HETATM 5253 O O   . HOH AA 3 .  ? -4.373  27.512  51.961  1.00 34.06  ? 830 HOH F O   1 
HETATM 5254 O O   . HOH AA 3 .  ? 4.345   11.656  56.835  1.00 49.09  ? 831 HOH F O   1 
HETATM 5255 O O   . HOH AA 3 .  ? -1.700  31.239  36.221  1.00 51.07  ? 832 HOH F O   1 
HETATM 5256 O O   . HOH AA 3 .  ? -3.781  17.472  44.466  1.00 33.58  ? 833 HOH F O   1 
HETATM 5257 O O   . HOH AA 3 .  ? 9.348   17.602  54.300  1.00 54.15  ? 834 HOH F O   1 
HETATM 5258 O O   . HOH AA 3 .  ? 2.243   33.240  42.659  1.00 31.45  ? 835 HOH F O   1 
HETATM 5259 O O   . HOH AA 3 .  ? 7.492   33.840  39.432  1.00 41.26  ? 836 HOH F O   1 
HETATM 5260 O O   . HOH AA 3 .  ? 7.010   34.850  41.621  1.00 48.96  ? 837 HOH F O   1 
HETATM 5261 O O   . HOH AA 3 .  ? 4.103   35.268  42.255  1.00 35.83  ? 838 HOH F O   1 
HETATM 5262 O O   . HOH AA 3 .  ? 7.280   17.290  52.289  1.00 34.99  ? 839 HOH F O   1 
HETATM 5263 O O   . HOH AA 3 .  ? -2.421  22.448  36.057  1.00 30.80  ? 840 HOH F O   1 
HETATM 5264 O O   . HOH AA 3 .  ? 8.115   26.747  51.819  1.00 24.76  ? 841 HOH F O   1 
HETATM 5265 O O   . HOH AA 3 .  ? 10.254  34.628  45.281  1.00 27.13  ? 842 HOH F O   1 
HETATM 5266 O O   . HOH AA 3 .  ? 4.372   10.184  53.533  1.00 27.73  ? 843 HOH F O   1 
HETATM 5267 O O   . HOH AA 3 .  ? -5.371  16.172  52.918  1.00 34.28  ? 844 HOH F O   1 
HETATM 5268 O O   . HOH AA 3 .  ? 5.219   17.372  53.300  1.00 30.33  ? 845 HOH F O   1 
HETATM 5269 O O   . HOH AA 3 .  ? -5.627  25.547  49.955  1.00 31.98  ? 846 HOH F O   1 
HETATM 5270 O O   . HOH AA 3 .  ? -2.653  9.523   53.752  1.00 35.25  ? 847 HOH F O   1 
HETATM 5271 O O   . HOH AA 3 .  ? 12.918  28.037  52.274  1.00 32.63  ? 848 HOH F O   1 
HETATM 5272 O O   . HOH AA 3 .  ? 14.879  25.723  51.399  1.00 38.52  ? 849 HOH F O   1 
HETATM 5273 O O   . HOH AA 3 .  ? -7.808  17.265  50.360  1.00 37.23  ? 850 HOH F O   1 
HETATM 5274 O O   . HOH AA 3 .  ? 1.472   33.764  45.221  1.00 40.53  ? 851 HOH F O   1 
HETATM 5275 O O   . HOH AA 3 .  ? -2.489  29.636  37.667  1.00 41.60  ? 852 HOH F O   1 
HETATM 5276 O O   . HOH AA 3 .  ? 16.738  23.540  48.759  1.00 31.66  ? 853 HOH F O   1 
HETATM 5277 O O   . HOH AA 3 .  ? 6.065   13.299  54.536  1.00 51.73  ? 854 HOH F O   1 
HETATM 5278 O O   . HOH AA 3 .  ? 1.435   31.964  52.184  1.00 59.25  ? 855 HOH F O   1 
HETATM 5279 O O   . HOH AA 3 .  ? 3.594   21.695  61.997  1.00 42.03  ? 856 HOH F O   1 
HETATM 5280 O O   . HOH AA 3 .  ? -1.310  33.082  39.479  1.00 38.96  ? 857 HOH F O   1 
HETATM 5281 O O   . HOH AA 3 .  ? -6.938  24.365  38.964  1.00 41.58  ? 858 HOH F O   1 
HETATM 5282 O O   . HOH AA 3 .  ? 10.643  34.418  42.128  1.00 65.65  ? 859 HOH F O   1 
HETATM 5283 O O   . HOH AA 3 .  ? 4.782   27.891  54.532  1.00 40.38  ? 860 HOH F O   1 
HETATM 5284 O O   . HOH AA 3 .  ? -0.488  30.250  53.060  1.00 68.72  ? 861 HOH F O   1 
HETATM 5285 O O   . HOH AA 3 .  ? 8.943   35.934  39.403  1.00 45.78  ? 862 HOH F O   1 
HETATM 5286 O O   . HOH AA 3 .  ? 7.160   20.568  51.919  1.00 31.83  ? 863 HOH F O   1 
HETATM 5287 O O   . HOH AA 3 .  ? 3.772   30.821  35.029  1.00 50.27  ? 864 HOH F O   1 
HETATM 5288 O O   . HOH AA 3 .  ? 19.771  28.924  43.707  1.00 86.73  ? 865 HOH F O   1 
HETATM 5289 O O   . HOH AA 3 .  ? 13.908  23.767  53.150  1.00 36.33  ? 866 HOH F O   1 
HETATM 5290 O O   . HOH AA 3 .  ? 6.000   24.802  56.942  1.00 55.78  ? 867 HOH F O   1 
HETATM 5291 O O   . HOH AA 3 .  ? 8.629   32.596  41.637  1.00 39.54  ? 868 HOH F O   1 
HETATM 5292 O O   . HOH AA 3 .  ? -0.407  25.995  62.281  1.00 41.18  ? 869 HOH F O   1 
HETATM 5293 O O   . HOH AA 3 .  ? 13.120  30.566  53.333  1.00 35.63  ? 870 HOH F O   1 
HETATM 5294 O O   . HOH AA 3 .  ? -6.517  23.342  54.237  1.00 49.69  ? 871 HOH F O   1 
HETATM 5295 O O   . HOH AA 3 .  ? -6.537  15.056  54.554  1.00 51.78  ? 872 HOH F O   1 
HETATM 5296 O O   . HOH AA 3 .  ? -6.936  15.438  48.123  1.00 46.79  ? 873 HOH F O   1 
HETATM 5297 O O   . HOH AA 3 .  ? 0.219   16.483  57.973  1.00 38.11  ? 874 HOH F O   1 
HETATM 5298 O O   . HOH AA 3 .  ? 6.536   21.956  56.461  1.00 44.59  ? 875 HOH F O   1 
HETATM 5299 O O   . HOH AA 3 .  ? 10.272  19.373  52.878  1.00 38.62  ? 876 HOH F O   1 
HETATM 5300 O O   . HOH BA 3 .  ? 14.117  11.916  27.085  1.00 17.47  ? 42  HOH G O   1 
HETATM 5301 O O   . HOH BA 3 .  ? 13.013  24.071  23.582  1.00 22.94  ? 43  HOH G O   1 
HETATM 5302 O O   . HOH BA 3 .  ? 26.405  7.955   24.915  1.00 32.28  ? 44  HOH G O   1 
HETATM 5303 O O   . HOH BA 3 .  ? 11.788  27.686  31.360  1.00 29.77  ? 45  HOH G O   1 
HETATM 5304 O O   . HOH BA 3 .  ? 18.383  25.688  19.073  1.00 29.84  ? 46  HOH G O   1 
HETATM 5305 O O   . HOH BA 3 .  ? 27.070  28.949  18.085  1.00 35.19  ? 47  HOH G O   1 
HETATM 5306 O O   . HOH BA 3 .  ? 21.026  27.518  16.863  1.00 35.15  ? 48  HOH G O   1 
HETATM 5307 O O   . HOH BA 3 .  ? 15.940  13.777  33.706  1.00 29.68  ? 49  HOH G O   1 
HETATM 5308 O O   . HOH BA 3 .  ? 25.494  12.422  15.247  1.00 34.12  ? 50  HOH G O   1 
HETATM 5309 O O   . HOH BA 3 .  ? 10.468  19.794  27.255  1.00 24.39  ? 51  HOH G O   1 
HETATM 5310 O O   . HOH BA 3 .  ? 24.895  10.590  13.361  1.00 24.14  ? 52  HOH G O   1 
HETATM 5311 O O   . HOH BA 3 .  ? 17.356  8.060   30.133  1.00 22.16  ? 53  HOH G O   1 
HETATM 5312 O O   . HOH BA 3 .  ? 20.081  3.762   29.372  1.00 32.56  ? 54  HOH G O   1 
HETATM 5313 O O   . HOH BA 3 .  ? 23.093  11.935  32.332  1.00 27.38  ? 55  HOH G O   1 
HETATM 5314 O O   . HOH BA 3 .  ? 21.677  28.816  25.067  1.00 23.24  ? 56  HOH G O   1 
HETATM 5315 O O   . HOH BA 3 .  ? 19.727  23.433  16.327  1.00 46.96  ? 57  HOH G O   1 
HETATM 5316 O O   . HOH BA 3 .  ? 15.069  21.650  15.503  1.00 64.01  ? 58  HOH G O   1 
HETATM 5317 O O   . HOH BA 3 .  ? 11.134  21.994  27.328  1.00 43.38  ? 59  HOH G O   1 
HETATM 5318 O O   . HOH BA 3 .  ? 15.126  15.290  16.528  1.00 37.88  ? 60  HOH G O   1 
HETATM 5319 O O   . HOH BA 3 .  ? 28.089  23.201  23.850  1.00 29.96  ? 61  HOH G O   1 
HETATM 5320 O O   . HOH BA 3 .  ? 23.703  28.855  22.610  1.00 40.07  ? 62  HOH G O   1 
HETATM 5321 O O   . HOH BA 3 .  ? 23.733  32.191  22.549  1.00 59.94  ? 63  HOH G O   1 
HETATM 5322 O O   . HOH BA 3 .  ? 26.961  11.514  17.403  1.00 41.47  ? 64  HOH G O   1 
HETATM 5323 O O   . HOH BA 3 .  ? 27.888  14.334  17.909  1.00 40.07  ? 65  HOH G O   1 
HETATM 5324 O O   . HOH BA 3 .  ? 15.263  10.397  32.604  1.00 45.07  ? 66  HOH G O   1 
HETATM 5325 O O   . HOH BA 3 .  ? 17.051  8.279   33.288  1.00 41.03  ? 67  HOH G O   1 
HETATM 5326 O O   . HOH BA 3 .  ? 15.340  21.722  32.657  1.00 22.35  ? 68  HOH G O   1 
HETATM 5327 O O   . HOH BA 3 .  ? 10.766  17.351  23.833  1.00 37.17  ? 69  HOH G O   1 
HETATM 5328 O O   . HOH BA 3 .  ? 26.525  8.802   31.071  1.00 27.49  ? 70  HOH G O   1 
HETATM 5329 O O   . HOH BA 3 .  ? 12.247  27.448  19.452  1.00 62.69  ? 71  HOH G O   1 
HETATM 5330 O O   . HOH BA 3 .  ? 27.293  24.724  10.128  1.00 39.96  ? 72  HOH G O   1 
HETATM 5331 O O   . HOH BA 3 .  ? 27.254  5.617   28.488  1.00 29.49  ? 73  HOH G O   1 
HETATM 5332 O O   . HOH BA 3 .  ? 28.753  29.693  8.370   1.00 51.45  ? 74  HOH G O   1 
HETATM 5333 O O   . HOH BA 3 .  ? 17.161  15.595  15.281  1.00 42.35  ? 75  HOH G O   1 
HETATM 5334 O O   . HOH BA 3 .  ? 28.326  26.859  16.842  1.00 37.51  ? 76  HOH G O   1 
HETATM 5335 O O   . HOH BA 3 .  ? 32.417  18.668  17.084  1.00 40.01  ? 77  HOH G O   1 
HETATM 5336 O O   . HOH BA 3 .  ? 12.958  23.140  21.018  1.00 46.55  ? 78  HOH G O   1 
HETATM 5337 O O   . HOH BA 3 .  ? 11.760  25.012  19.306  1.00 37.32  ? 79  HOH G O   1 
HETATM 5338 O O   . HOH BA 3 .  ? 30.190  31.715  14.865  1.00 46.63  ? 80  HOH G O   1 
HETATM 5339 O O   . HOH BA 3 .  ? 26.880  7.828   28.991  1.00 44.02  ? 81  HOH G O   1 
HETATM 5340 O O   . HOH BA 3 .  ? 27.851  25.287  7.972   1.00 37.39  ? 82  HOH G O   1 
HETATM 5341 O O   . HOH BA 3 .  ? 16.816  28.130  30.065  1.00 42.60  ? 83  HOH G O   1 
HETATM 5342 O O   . HOH BA 3 .  ? 17.498  9.596   36.019  1.00 41.63  ? 84  HOH G O   1 
HETATM 5343 O O   . HOH BA 3 .  ? 21.423  32.580  28.928  1.00 61.23  ? 85  HOH G O   1 
HETATM 5344 O O   . HOH BA 3 .  ? 29.325  10.755  31.481  1.00 61.24  ? 86  HOH G O   1 
HETATM 5345 O O   . HOH BA 3 .  ? 24.097  23.946  12.189  1.00 55.49  ? 87  HOH G O   1 
HETATM 5346 O O   . HOH BA 3 .  ? 20.251  10.686  37.116  1.00 79.08  ? 88  HOH G O   1 
HETATM 5347 O O   . HOH BA 3 .  ? 29.084  13.882  21.650  1.00 70.65  ? 89  HOH G O   1 
HETATM 5348 O O   . HOH BA 3 .  ? 21.827  30.732  26.304  1.00 58.87  ? 90  HOH G O   1 
HETATM 5349 O O   . HOH BA 3 .  ? 9.138   19.061  23.642  1.00 52.15  ? 91  HOH G O   1 
HETATM 5350 O O   . HOH BA 3 .  ? 11.427  21.217  20.426  1.00 37.63  ? 92  HOH G O   1 
HETATM 5351 O O   . HOH BA 3 .  ? 23.909  28.331  24.837  1.00 34.34  ? 93  HOH G O   1 
HETATM 5352 O O   . HOH BA 3 .  ? 10.917  24.016  24.944  1.00 34.67  ? 94  HOH G O   1 
HETATM 5353 O O   . HOH BA 3 .  ? 25.645  11.097  31.733  1.00 41.10  ? 95  HOH G O   1 
HETATM 5354 O O   . HOH BA 3 .  ? 12.348  19.067  19.932  1.00 34.63  ? 96  HOH G O   1 
HETATM 5355 O O   . HOH BA 3 .  ? 25.723  29.501  21.725  1.00 39.60  ? 97  HOH G O   1 
HETATM 5356 O O   . HOH BA 3 .  ? 32.967  16.331  13.907  1.00 37.20  ? 98  HOH G O   1 
HETATM 5357 O O   . HOH BA 3 .  ? 21.873  16.288  9.709   1.00 42.50  ? 99  HOH G O   1 
HETATM 5358 O O   . HOH BA 3 .  ? 14.013  28.335  28.574  1.00 40.08  ? 100 HOH G O   1 
HETATM 5359 O O   . HOH BA 3 .  ? 32.369  21.919  18.306  1.00 39.46  ? 101 HOH G O   1 
HETATM 5360 O O   . HOH BA 3 .  ? 24.096  26.291  10.819  1.00 73.70  ? 102 HOH G O   1 
HETATM 5361 O O   . HOH BA 3 .  ? 25.800  16.950  15.108  1.00 43.77  ? 103 HOH G O   1 
HETATM 5362 O O   . HOH BA 3 .  ? 32.073  16.766  11.434  1.00 43.87  ? 104 HOH G O   1 
HETATM 5363 O O   . HOH BA 3 .  ? 10.165  25.411  22.599  1.00 76.21  ? 105 HOH G O   1 
HETATM 5364 O O   . HOH CA 3 .  ? 25.430  29.918  26.397  1.00 47.08  ? 171 HOH H O   1 
HETATM 5365 O O   . HOH CA 3 .  ? 10.068  27.657  35.849  1.00 28.25  ? 172 HOH H O   1 
HETATM 5366 O O   . HOH CA 3 .  ? 31.002  15.704  37.012  1.00 42.26  ? 243 HOH H O   1 
HETATM 5367 O O   . HOH CA 3 .  ? 28.750  23.330  42.467  1.00 40.07  ? 255 HOH H O   1 
HETATM 5368 O O   . HOH CA 3 .  ? 22.256  29.844  47.889  1.00 45.62  ? 279 HOH H O   1 
HETATM 5369 O O   . HOH CA 3 .  ? 29.713  38.943  29.347  1.00 54.21  ? 350 HOH H O   1 
HETATM 5370 O O   . HOH CA 3 .  ? 24.523  27.171  36.291  1.00 25.44  ? 363 HOH H O   1 
HETATM 5371 O O   . HOH CA 3 .  ? 22.213  27.360  46.237  1.00 39.36  ? 445 HOH H O   1 
HETATM 5372 O O   . HOH CA 3 .  ? 14.446  30.504  32.742  1.00 44.00  ? 474 HOH H O   1 
HETATM 5373 O O   . HOH CA 3 .  ? 27.483  26.368  40.218  1.00 72.65  ? 488 HOH H O   1 
HETATM 5374 O O   . HOH CA 3 .  ? 27.447  27.315  47.938  1.00 45.59  ? 516 HOH H O   1 
HETATM 5375 O O   . HOH CA 3 .  ? 8.350   28.434  31.289  1.00 26.87  ? 518 HOH H O   1 
HETATM 5376 O O   . HOH CA 3 .  ? 20.406  22.559  42.938  1.00 33.00  ? 568 HOH H O   1 
HETATM 5377 O O   . HOH CA 3 .  ? 15.535  26.049  32.494  1.00 33.56  ? 571 HOH H O   1 
HETATM 5378 O O   . HOH CA 3 .  ? 28.954  25.898  23.668  1.00 53.81  ? 586 HOH H O   1 
HETATM 5379 O O   . HOH CA 3 .  ? 7.302   28.374  35.472  1.00 40.18  ? 594 HOH H O   1 
HETATM 5380 O O   . HOH CA 3 .  ? 34.639  38.497  29.329  1.00 62.41  ? 597 HOH H O   1 
HETATM 5381 O O   . HOH CA 3 .  ? 28.111  18.741  42.690  1.00 47.52  ? 607 HOH H O   1 
HETATM 5382 O O   . HOH CA 3 .  ? 17.364  24.361  43.069  1.00 65.64  ? 636 HOH H O   1 
HETATM 5383 O O   . HOH CA 3 .  ? 26.785  29.783  39.990  1.00 64.91  ? 639 HOH H O   1 
HETATM 5384 O O   A HOH CA 3 .  ? 20.523  14.861  37.555  0.50 18.38  ? 659 HOH H O   1 
HETATM 5385 O O   B HOH CA 3 .  ? 20.847  12.892  37.286  0.50 19.35  ? 659 HOH H O   1 
HETATM 5386 O O   . HOH CA 3 .  ? 16.470  24.087  33.239  1.00 42.00  ? 674 HOH H O   1 
HETATM 5387 O O   . HOH CA 3 .  ? 32.170  16.532  39.374  1.00 39.61  ? 675 HOH H O   1 
HETATM 5388 O O   . HOH CA 3 .  ? 8.005   30.120  32.809  1.00 44.32  ? 731 HOH H O   1 
HETATM 5389 O O   . HOH CA 3 .  ? 32.532  19.482  37.362  1.00 71.87  ? 749 HOH H O   1 
HETATM 5390 O O   . HOH CA 3 .  ? 20.791  27.705  38.727  1.00 51.32  ? 756 HOH H O   1 
HETATM 5391 O O   . HOH CA 3 .  ? 34.347  33.203  27.816  1.00 49.31  ? 760 HOH H O   1 
HETATM 5392 O O   . HOH DA 3 .  ? 0.112   26.680  1.121   1.00 18.35  ? 811 HOH I O   1 
HETATM 5393 O O   . HOH DA 3 .  ? -0.090  26.176  6.872   1.00 14.90  ? 812 HOH I O   1 
HETATM 5394 O O   . HOH DA 3 .  ? -12.407 34.527  -2.655  1.00 23.12  ? 813 HOH I O   1 
HETATM 5395 O O   . HOH DA 3 .  ? -3.052  33.114  7.285   1.00 21.89  ? 814 HOH I O   1 
HETATM 5396 O O   . HOH DA 3 .  ? -10.960 22.486  15.685  1.00 24.22  ? 815 HOH I O   1 
HETATM 5397 O O   . HOH DA 3 .  ? -13.280 37.507  3.663   1.00 28.11  ? 816 HOH I O   1 
HETATM 5398 O O   . HOH DA 3 .  ? -16.678 36.181  3.078   1.00 26.77  ? 817 HOH I O   1 
HETATM 5399 O O   . HOH DA 3 .  ? -6.778  29.863  -2.347  1.00 24.63  ? 818 HOH I O   1 
HETATM 5400 O O   . HOH DA 3 .  ? -8.286  23.109  17.650  1.00 29.79  ? 819 HOH I O   1 
HETATM 5401 O O   . HOH DA 3 .  ? -13.025 34.589  0.075   1.00 20.83  ? 820 HOH I O   1 
HETATM 5402 O O   . HOH DA 3 .  ? -20.129 40.004  5.933   1.00 45.98  ? 821 HOH I O   1 
HETATM 5403 O O   . HOH DA 3 .  ? -22.918 33.486  4.498   1.00 30.93  ? 822 HOH I O   1 
HETATM 5404 O O   . HOH DA 3 .  ? -5.737  35.183  3.192   1.00 32.18  ? 823 HOH I O   1 
HETATM 5405 O O   . HOH DA 3 .  ? -2.287  29.155  -0.625  1.00 37.78  ? 824 HOH I O   1 
HETATM 5406 O O   . HOH DA 3 .  ? -1.024  21.458  10.505  1.00 45.31  ? 825 HOH I O   1 
HETATM 5407 O O   . HOH DA 3 .  ? -9.779  38.467  3.594   1.00 66.73  ? 826 HOH I O   1 
HETATM 5408 O O   . HOH DA 3 .  ? -8.470  30.279  16.611  1.00 21.75  ? 827 HOH I O   1 
HETATM 5409 O O   . HOH DA 3 .  ? -0.669  26.961  -1.298  1.00 22.63  ? 828 HOH I O   1 
HETATM 5410 O O   . HOH DA 3 .  ? -23.061 43.506  -0.462  1.00 41.56  ? 829 HOH I O   1 
HETATM 5411 O O   . HOH DA 3 .  ? -24.461 34.228  -0.638  1.00 27.52  ? 830 HOH I O   1 
HETATM 5412 O O   . HOH DA 3 .  ? -19.009 39.268  2.772   1.00 29.03  ? 831 HOH I O   1 
HETATM 5413 O O   . HOH DA 3 .  ? 1.375   35.468  5.460   1.00 47.11  ? 832 HOH I O   1 
HETATM 5414 O O   . HOH DA 3 .  ? -25.484 34.070  3.146   1.00 42.81  ? 833 HOH I O   1 
HETATM 5415 O O   . HOH DA 3 .  ? -18.900 33.003  19.163  1.00 52.48  ? 834 HOH I O   1 
HETATM 5416 O O   . HOH DA 3 .  ? -12.187 30.665  14.761  1.00 41.53  ? 835 HOH I O   1 
HETATM 5417 O O   . HOH DA 3 .  ? -18.810 38.266  0.078   1.00 26.03  ? 836 HOH I O   1 
HETATM 5418 O O   . HOH DA 3 .  ? -12.562 36.617  16.986  1.00 44.92  ? 837 HOH I O   1 
HETATM 5419 O O   . HOH DA 3 .  ? -3.353  30.380  -3.762  1.00 45.44  ? 838 HOH I O   1 
HETATM 5420 O O   . HOH DA 3 .  ? -11.763 25.708  -7.191  1.00 47.76  ? 839 HOH I O   1 
HETATM 5421 O O   . HOH DA 3 .  ? -12.631 28.891  17.167  1.00 36.34  ? 840 HOH I O   1 
HETATM 5422 O O   . HOH DA 3 .  ? -11.102 26.101  -4.327  1.00 26.03  ? 841 HOH I O   1 
HETATM 5423 O O   . HOH DA 3 .  ? -24.668 31.128  -1.205  1.00 42.64  ? 842 HOH I O   1 
HETATM 5424 O O   . HOH DA 3 .  ? -15.382 39.752  4.921   1.00 41.83  ? 843 HOH I O   1 
HETATM 5425 O O   . HOH DA 3 .  ? -22.669 33.435  1.124   1.00 38.40  ? 844 HOH I O   1 
HETATM 5426 O O   . HOH DA 3 .  ? -10.857 41.136  7.145   1.00 56.10  ? 845 HOH I O   1 
HETATM 5427 O O   . HOH DA 3 .  ? -30.408 38.424  2.618   1.00 52.20  ? 846 HOH I O   1 
HETATM 5428 O O   . HOH DA 3 .  ? -13.406 30.074  12.775  1.00 36.55  ? 847 HOH I O   1 
HETATM 5429 O O   . HOH DA 3 .  ? -8.694  36.211  -1.381  1.00 62.36  ? 848 HOH I O   1 
HETATM 5430 O O   . HOH DA 3 .  ? -22.649 30.697  0.803   1.00 31.30  ? 849 HOH I O   1 
HETATM 5431 O O   . HOH DA 3 .  ? -15.166 26.683  15.042  1.00 35.28  ? 850 HOH I O   1 
HETATM 5432 O O   . HOH DA 3 .  ? -4.351  19.439  17.891  1.00 46.38  ? 851 HOH I O   1 
HETATM 5433 O O   . HOH DA 3 .  ? -11.219 31.930  -5.807  1.00 43.96  ? 852 HOH I O   1 
HETATM 5434 O O   . HOH DA 3 .  ? -3.459  33.982  2.502   1.00 39.64  ? 853 HOH I O   1 
HETATM 5435 O O   . HOH DA 3 .  ? -16.393 37.782  14.662  1.00 48.22  ? 854 HOH I O   1 
HETATM 5436 O O   . HOH DA 3 .  ? -8.958  33.365  -4.740  1.00 38.52  ? 855 HOH I O   1 
HETATM 5437 O O   . HOH DA 3 .  ? -1.960  31.466  3.442   1.00 26.27  ? 856 HOH I O   1 
HETATM 5438 O O   . HOH DA 3 .  ? -4.842  29.877  -5.817  1.00 40.37  ? 857 HOH I O   1 
HETATM 5439 O O   . HOH DA 3 .  ? -23.165 30.591  5.327   1.00 45.25  ? 858 HOH I O   1 
HETATM 5440 O O   . HOH DA 3 .  ? -24.834 43.273  1.351   1.00 60.17  ? 859 HOH I O   1 
HETATM 5441 O O   . HOH DA 3 .  ? -8.430  23.381  -5.464  1.00 32.91  ? 860 HOH I O   1 
HETATM 5442 O O   . HOH DA 3 .  ? -5.994  36.150  5.259   1.00 34.61  ? 861 HOH I O   1 
HETATM 5443 O O   . HOH DA 3 .  ? -17.799 30.373  0.492   1.00 157.91 ? 862 HOH I O   1 
HETATM 5444 O O   . HOH DA 3 .  ? -6.657  34.583  -1.290  1.00 45.10  ? 863 HOH I O   1 
HETATM 5445 O O   . HOH DA 3 .  ? -26.653 35.832  2.207   1.00 37.56  ? 864 HOH I O   1 
HETATM 5446 O O   . HOH EA 3 .  ? -9.528  17.914  16.900  1.00 28.61  ? 42  HOH J O   1 
HETATM 5447 O O   . HOH EA 3 .  ? -32.304 27.015  9.711   1.00 34.99  ? 43  HOH J O   1 
HETATM 5448 O O   . HOH EA 3 .  ? -17.570 24.577  14.817  1.00 46.02  ? 44  HOH J O   1 
HETATM 5449 O O   . HOH EA 3 .  ? -13.533 12.179  14.242  1.00 48.13  ? 45  HOH J O   1 
HETATM 5450 O O   . HOH EA 3 .  ? -5.825  12.302  7.627   1.00 38.91  ? 46  HOH J O   1 
HETATM 5451 O O   . HOH EA 3 .  ? -8.765  10.224  9.982   1.00 45.65  ? 47  HOH J O   1 
HETATM 5452 O O   . HOH EA 3 .  ? -17.285 27.312  4.368   1.00 35.20  ? 48  HOH J O   1 
HETATM 5453 O O   . HOH EA 3 .  ? -19.210 10.754  11.576  1.00 38.38  ? 49  HOH J O   1 
HETATM 5454 O O   . HOH EA 3 .  ? -11.523 10.289  10.323  1.00 33.44  ? 50  HOH J O   1 
HETATM 5455 O O   . HOH EA 3 .  ? -9.355  9.549   2.537   1.00 33.20  ? 51  HOH J O   1 
HETATM 5456 O O   . HOH EA 3 .  ? -3.799  12.200  9.683   1.00 39.69  ? 52  HOH J O   1 
HETATM 5457 O O   . HOH EA 3 .  ? -20.174 24.640  -3.651  1.00 58.46  ? 53  HOH J O   1 
HETATM 5458 O O   . HOH EA 3 .  ? -17.995 22.889  13.321  1.00 43.47  ? 54  HOH J O   1 
HETATM 5459 O O   . HOH EA 3 .  ? -15.372 13.462  12.663  1.00 36.75  ? 55  HOH J O   1 
HETATM 5460 O O   . HOH EA 3 .  ? -16.735 26.948  18.527  1.00 60.92  ? 56  HOH J O   1 
HETATM 5461 O O   . HOH EA 3 .  ? -8.502  10.909  -5.465  1.00 35.71  ? 57  HOH J O   1 
HETATM 5462 O O   . HOH EA 3 .  ? -25.737 18.132  7.181   1.00 29.34  ? 58  HOH J O   1 
HETATM 5463 O O   . HOH EA 3 .  ? -23.278 15.966  -1.299  1.00 60.01  ? 59  HOH J O   1 
HETATM 5464 O O   . HOH EA 3 .  ? -23.817 24.240  17.040  1.00 31.76  ? 60  HOH J O   1 
HETATM 5465 O O   . HOH EA 3 .  ? -11.280 12.288  12.168  1.00 40.45  ? 61  HOH J O   1 
HETATM 5466 O O   . HOH EA 3 .  ? -15.231 14.254  17.746  1.00 53.80  ? 62  HOH J O   1 
HETATM 5467 O O   . HOH EA 3 .  ? -19.771 26.389  5.107   1.00 33.76  ? 63  HOH J O   1 
HETATM 5468 O O   . HOH EA 3 .  ? -14.304 8.742   7.598   1.00 36.55  ? 64  HOH J O   1 
HETATM 5469 O O   . HOH EA 3 .  ? -14.312 12.188  16.832  1.00 50.98  ? 65  HOH J O   1 
HETATM 5470 O O   . HOH EA 3 .  ? -12.030 19.620  15.210  1.00 30.35  ? 66  HOH J O   1 
HETATM 5471 O O   . HOH EA 3 .  ? -18.625 22.137  -1.313  1.00 31.40  ? 67  HOH J O   1 
HETATM 5472 O O   . HOH EA 3 .  ? -8.040  20.336  17.017  1.00 52.21  ? 68  HOH J O   1 
HETATM 5473 O O   . HOH EA 3 .  ? -22.612 28.309  7.235   1.00 33.55  ? 69  HOH J O   1 
HETATM 5474 O O   . HOH EA 3 .  ? -22.158 27.580  0.975   1.00 54.32  ? 70  HOH J O   1 
HETATM 5475 O O   . HOH EA 3 .  ? -24.007 27.431  -0.348  1.00 41.92  ? 71  HOH J O   1 
HETATM 5476 O O   . HOH EA 3 .  ? -30.438 13.729  0.639   1.00 37.50  ? 72  HOH J O   1 
HETATM 5477 O O   . HOH EA 3 .  ? -13.065 21.342  -2.349  1.00 32.58  ? 73  HOH J O   1 
HETATM 5478 O O   . HOH EA 3 .  ? -26.232 25.009  5.809   1.00 85.91  ? 74  HOH J O   1 
HETATM 5479 O O   . HOH EA 3 .  ? -21.636 27.787  -3.169  1.00 53.77  ? 75  HOH J O   1 
HETATM 5480 O O   . HOH EA 3 .  ? -19.586 26.760  -3.040  1.00 40.09  ? 76  HOH J O   1 
HETATM 5481 O O   . HOH EA 3 .  ? -18.939 26.689  13.517  1.00 52.13  ? 77  HOH J O   1 
HETATM 5482 O O   . HOH EA 3 .  ? -28.344 18.446  8.789   1.00 42.41  ? 78  HOH J O   1 
HETATM 5483 O O   . HOH EA 3 .  ? -25.526 14.039  6.260   1.00 51.57  ? 79  HOH J O   1 
HETATM 5484 O O   . HOH EA 3 .  ? -18.935 25.132  17.094  1.00 44.72  ? 80  HOH J O   1 
HETATM 5485 O O   . HOH FA 3 .  ? 6.780   17.905  10.684  1.00 18.14  ? 42  HOH K O   1 
HETATM 5486 O O   . HOH FA 3 .  ? 4.881   30.046  8.117   1.00 20.04  ? 43  HOH K O   1 
HETATM 5487 O O   . HOH FA 3 .  ? 14.484  34.075  -0.197  1.00 25.04  ? 44  HOH K O   1 
HETATM 5488 O O   . HOH FA 3 .  ? 3.581   14.301  4.552   1.00 25.11  ? 45  HOH K O   1 
HETATM 5489 O O   . HOH FA 3 .  ? 17.256  27.718  2.496   1.00 17.03  ? 46  HOH K O   1 
HETATM 5490 O O   . HOH FA 3 .  ? 10.871  13.044  3.594   1.00 18.14  ? 47  HOH K O   1 
HETATM 5491 O O   . HOH FA 3 .  ? 16.931  28.269  -2.534  1.00 28.96  ? 48  HOH K O   1 
HETATM 5492 O O   . HOH FA 3 .  ? 12.743  13.723  1.622   1.00 22.08  ? 49  HOH K O   1 
HETATM 5493 O O   . HOH FA 3 .  ? 20.446  12.931  3.286   1.00 28.87  ? 50  HOH K O   1 
HETATM 5494 O O   . HOH FA 3 .  ? 2.364   22.398  10.683  1.00 28.23  ? 51  HOH K O   1 
HETATM 5495 O O   . HOH FA 3 .  ? 8.990   11.854  10.120  1.00 29.66  ? 52  HOH K O   1 
HETATM 5496 O O   . HOH FA 3 .  ? 21.054  23.509  6.618   1.00 29.23  ? 53  HOH K O   1 
HETATM 5497 O O   . HOH FA 3 .  ? 11.710  31.194  -3.600  1.00 33.20  ? 54  HOH K O   1 
HETATM 5498 O O   . HOH FA 3 .  ? 26.983  25.869  -0.991  1.00 41.23  ? 55  HOH K O   1 
HETATM 5499 O O   . HOH FA 3 .  ? 8.775   9.426   9.739   1.00 36.29  ? 56  HOH K O   1 
HETATM 5500 O O   . HOH FA 3 .  ? 14.923  13.140  3.441   1.00 32.81  ? 57  HOH K O   1 
HETATM 5501 O O   . HOH FA 3 .  ? 4.593   34.097  3.654   1.00 20.95  ? 58  HOH K O   1 
HETATM 5502 O O   . HOH FA 3 .  ? 16.869  18.693  10.497  1.00 34.32  ? 59  HOH K O   1 
HETATM 5503 O O   . HOH FA 3 .  ? 0.871   28.753  2.335   1.00 30.10  ? 60  HOH K O   1 
HETATM 5504 O O   . HOH FA 3 .  ? 16.127  25.966  13.098  1.00 36.65  ? 61  HOH K O   1 
HETATM 5505 O O   . HOH FA 3 .  ? -0.346  14.305  7.453   1.00 28.33  ? 62  HOH K O   1 
HETATM 5506 O O   . HOH FA 3 .  ? 4.486   18.435  11.954  1.00 25.46  ? 63  HOH K O   1 
HETATM 5507 O O   . HOH FA 3 .  ? 24.138  27.533  -0.387  1.00 48.33  ? 64  HOH K O   1 
HETATM 5508 O O   . HOH FA 3 .  ? 5.375   24.861  12.636  1.00 27.84  ? 65  HOH K O   1 
HETATM 5509 O O   . HOH FA 3 .  ? 13.677  15.525  9.916   1.00 26.61  ? 66  HOH K O   1 
HETATM 5510 O O   . HOH FA 3 .  ? 1.165   20.510  3.644   1.00 16.17  ? 67  HOH K O   1 
HETATM 5511 O O   . HOH FA 3 .  ? 8.499   30.771  -3.478  1.00 20.86  ? 68  HOH K O   1 
HETATM 5512 O O   . HOH FA 3 .  ? 10.973  10.446  2.332   1.00 29.83  ? 69  HOH K O   1 
HETATM 5513 O O   . HOH FA 3 .  ? 6.376   29.977  -2.390  1.00 27.67  ? 70  HOH K O   1 
HETATM 5514 O O   . HOH FA 3 .  ? 17.297  26.372  -4.200  1.00 50.18  ? 71  HOH K O   1 
HETATM 5515 O O   . HOH FA 3 .  ? 20.629  19.423  -4.281  1.00 37.77  ? 72  HOH K O   1 
HETATM 5516 O O   . HOH FA 3 .  ? 2.988   13.496  6.874   1.00 30.46  ? 73  HOH K O   1 
HETATM 5517 O O   . HOH FA 3 .  ? 22.055  15.543  2.858   1.00 35.32  ? 74  HOH K O   1 
HETATM 5518 O O   . HOH FA 3 .  ? 9.360   7.296   11.599  1.00 39.89  ? 75  HOH K O   1 
HETATM 5519 O O   . HOH FA 3 .  ? 22.215  26.095  7.390   1.00 39.79  ? 76  HOH K O   1 
HETATM 5520 O O   . HOH FA 3 .  ? 24.430  14.491  2.773   1.00 33.50  ? 77  HOH K O   1 
HETATM 5521 O O   . HOH FA 3 .  ? -3.078  15.426  7.529   1.00 40.73  ? 78  HOH K O   1 
HETATM 5522 O O   . HOH FA 3 .  ? 16.790  13.872  8.991   1.00 25.04  ? 79  HOH K O   1 
HETATM 5523 O O   . HOH FA 3 .  ? 11.087  34.620  -2.449  1.00 30.31  ? 80  HOH K O   1 
HETATM 5524 O O   . HOH FA 3 .  ? 1.930   31.950  3.193   1.00 41.60  ? 81  HOH K O   1 
HETATM 5525 O O   . HOH FA 3 .  ? 21.709  24.708  15.637  1.00 28.38  ? 82  HOH K O   1 
HETATM 5526 O O   . HOH FA 3 .  ? 6.534   38.572  1.973   1.00 33.76  ? 83  HOH K O   1 
HETATM 5527 O O   . HOH FA 3 .  ? 8.967   33.705  -4.003  1.00 24.43  ? 84  HOH K O   1 
HETATM 5528 O O   . HOH FA 3 .  ? 18.668  17.162  8.507   1.00 23.34  ? 85  HOH K O   1 
HETATM 5529 O O   . HOH FA 3 .  ? -3.421  14.024  4.589   1.00 27.23  ? 86  HOH K O   1 
HETATM 5530 O O   . HOH FA 3 .  ? 22.326  31.097  8.148   1.00 25.70  ? 87  HOH K O   1 
HETATM 5531 O O   . HOH FA 3 .  ? 28.740  10.853  5.449   1.00 45.95  ? 88  HOH K O   1 
HETATM 5532 O O   . HOH FA 3 .  ? 2.266   14.302  12.556  1.00 42.65  ? 89  HOH K O   1 
HETATM 5533 O O   . HOH FA 3 .  ? -0.585  30.524  1.379   1.00 38.72  ? 90  HOH K O   1 
HETATM 5534 O O   . HOH FA 3 .  ? 20.197  28.303  13.576  1.00 33.67  ? 91  HOH K O   1 
HETATM 5535 O O   . HOH FA 3 .  ? 3.480   36.426  -4.467  1.00 43.21  ? 92  HOH K O   1 
HETATM 5536 O O   . HOH FA 3 .  ? 16.329  22.350  13.635  1.00 30.94  ? 93  HOH K O   1 
HETATM 5537 O O   . HOH FA 3 .  ? 5.401   12.221  9.958   1.00 49.74  ? 94  HOH K O   1 
HETATM 5538 O O   . HOH FA 3 .  ? 19.123  21.463  13.838  1.00 45.54  ? 95  HOH K O   1 
HETATM 5539 O O   . HOH FA 3 .  ? -0.406  14.055  4.836   1.00 28.24  ? 96  HOH K O   1 
HETATM 5540 O O   . HOH FA 3 .  ? 11.970  28.834  12.480  1.00 39.13  ? 97  HOH K O   1 
HETATM 5541 O O   . HOH FA 3 .  ? 20.456  20.752  11.886  1.00 36.76  ? 98  HOH K O   1 
HETATM 5542 O O   . HOH FA 3 .  ? 16.578  19.150  0.213   1.00 37.43  ? 99  HOH K O   1 
HETATM 5543 O O   . HOH FA 3 .  ? 23.411  17.368  -4.292  1.00 63.42  ? 100 HOH K O   1 
HETATM 5544 O O   . HOH FA 3 .  ? 23.466  24.352  -0.867  1.00 47.47  ? 101 HOH K O   1 
HETATM 5545 O O   A HOH FA 3 .  ? 11.764  12.234  -0.372  0.50 28.53  ? 102 HOH K O   1 
HETATM 5546 O O   B HOH FA 3 .  ? 12.946  12.670  -0.872  0.50 17.29  ? 102 HOH K O   1 
HETATM 5547 O O   . HOH FA 3 .  ? 17.710  20.500  12.300  1.00 41.76  ? 103 HOH K O   1 
HETATM 5548 O O   . HOH FA 3 .  ? 25.019  20.176  1.926   1.00 38.69  ? 104 HOH K O   1 
HETATM 5549 O O   . HOH FA 3 .  ? 5.333   12.747  7.441   1.00 30.83  ? 105 HOH K O   1 
HETATM 5550 O O   . HOH FA 3 .  ? 18.625  23.558  -2.870  1.00 51.40  ? 106 HOH K O   1 
HETATM 5551 O O   . HOH FA 3 .  ? 11.930  20.153  16.370  1.00 49.55  ? 107 HOH K O   1 
HETATM 5552 O O   . HOH FA 3 .  ? 22.138  28.139  4.768   1.00 67.31  ? 108 HOH K O   1 
HETATM 5553 O O   . HOH FA 3 .  ? 21.288  19.253  10.344  1.00 47.29  ? 109 HOH K O   1 
HETATM 5554 O O   . HOH FA 3 .  ? 25.024  13.314  4.672   1.00 54.66  ? 110 HOH K O   1 
HETATM 5555 O O   . HOH FA 3 .  ? 8.940   18.180  12.704  1.00 46.87  ? 111 HOH K O   1 
HETATM 5556 O O   . HOH FA 3 .  ? 7.714   25.113  13.247  1.00 36.30  ? 112 HOH K O   1 
HETATM 5557 O O   . HOH FA 3 .  ? 14.458  17.907  11.093  1.00 47.31  ? 113 HOH K O   1 
HETATM 5558 O O   . HOH FA 3 .  ? 6.958   13.370  11.198  1.00 56.27  ? 114 HOH K O   1 
HETATM 5559 O O   . HOH FA 3 .  ? 6.740   15.046  13.282  1.00 45.24  ? 115 HOH K O   1 
HETATM 5560 O O   . HOH FA 3 .  ? 12.167  23.065  13.018  1.00 36.31  ? 116 HOH K O   1 
HETATM 5561 O O   . HOH FA 3 .  ? 18.964  19.895  -2.764  1.00 45.13  ? 117 HOH K O   1 
HETATM 5562 O O   . HOH GA 3 .  ? -2.500  20.993  -7.318  1.00 26.72  ? 56  HOH L O   1 
HETATM 5563 O O   . HOH GA 3 .  ? 11.526  10.900  -4.735  1.00 36.96  ? 86  HOH L O   1 
HETATM 5564 O O   . HOH GA 3 .  ? -1.058  13.399  -11.274 1.00 56.15  ? 113 HOH L O   1 
HETATM 5565 O O   . HOH GA 3 .  ? -0.876  26.945  -5.893  1.00 36.19  ? 116 HOH L O   1 
HETATM 5566 O O   . HOH GA 3 .  ? 4.183   28.613  -3.673  1.00 21.89  ? 127 HOH L O   1 
HETATM 5567 O O   . HOH GA 3 .  ? -2.357  14.616  -8.276  1.00 39.17  ? 164 HOH L O   1 
HETATM 5568 O O   . HOH GA 3 .  ? 19.228  20.875  -9.824  1.00 23.55  ? 168 HOH L O   1 
HETATM 5569 O O   . HOH GA 3 .  ? -1.274  14.390  -3.674  1.00 24.02  ? 176 HOH L O   1 
HETATM 5570 O O   . HOH GA 3 .  ? 0.478   31.821  -3.063  1.00 32.34  ? 179 HOH L O   1 
HETATM 5571 O O   . HOH GA 3 .  ? 3.410   12.713  2.304   1.00 26.85  ? 189 HOH L O   1 
HETATM 5572 O O   . HOH GA 3 .  ? 1.529   15.689  3.396   1.00 20.12  ? 219 HOH L O   1 
HETATM 5573 O O   . HOH GA 3 .  ? 1.127   18.110  2.319   1.00 20.39  ? 224 HOH L O   1 
HETATM 5574 O O   . HOH GA 3 .  ? 1.569   18.307  -12.583 1.00 38.35  ? 260 HOH L O   1 
HETATM 5575 O O   . HOH GA 3 .  ? 10.614  12.378  -2.840  1.00 25.80  ? 262 HOH L O   1 
HETATM 5576 O O   . HOH GA 3 .  ? 7.038   33.174  -6.145  1.00 48.52  ? 263 HOH L O   1 
HETATM 5577 O O   . HOH GA 3 .  ? 18.263  22.658  -7.045  1.00 28.41  ? 284 HOH L O   1 
HETATM 5578 O O   . HOH GA 3 .  ? 29.978  21.129  -13.631 1.00 43.03  ? 292 HOH L O   1 
HETATM 5579 O O   . HOH GA 3 .  ? 26.506  23.168  -10.701 1.00 72.15  ? 294 HOH L O   1 
HETATM 5580 O O   . HOH GA 3 .  ? 16.787  18.108  -1.825  1.00 35.82  ? 295 HOH L O   1 
HETATM 5581 O O   . HOH GA 3 .  ? 20.437  14.514  -4.172  1.00 49.55  ? 296 HOH L O   1 
HETATM 5582 O O   . HOH GA 3 .  ? 0.816   11.741  3.356   1.00 44.26  ? 326 HOH L O   1 
HETATM 5583 O O   . HOH GA 3 .  ? 0.391   27.594  -3.687  1.00 27.72  ? 366 HOH L O   1 
HETATM 5584 O O   . HOH GA 3 .  ? 15.501  24.783  -5.751  1.00 21.87  ? 398 HOH L O   1 
HETATM 5585 O O   . HOH GA 3 .  ? 7.642   9.826   1.333   1.00 41.73  ? 402 HOH L O   1 
HETATM 5586 O O   . HOH GA 3 .  ? 1.416   29.831  -3.728  1.00 28.70  ? 406 HOH L O   1 
HETATM 5587 O O   . HOH GA 3 .  ? 2.054   14.794  -12.117 1.00 56.10  ? 431 HOH L O   1 
HETATM 5588 O O   . HOH GA 3 .  ? 10.229  30.172  -5.457  1.00 33.67  ? 434 HOH L O   1 
HETATM 5589 O O   . HOH GA 3 .  ? 16.954  18.647  -12.286 1.00 38.21  ? 455 HOH L O   1 
HETATM 5590 O O   . HOH GA 3 .  ? 5.347   10.298  2.257   1.00 33.38  ? 457 HOH L O   1 
HETATM 5591 O O   . HOH GA 3 .  ? 8.189   9.529   -0.876  1.00 38.43  ? 469 HOH L O   1 
HETATM 5592 O O   . HOH GA 3 .  ? 27.719  19.997  -13.715 1.00 47.41  ? 490 HOH L O   1 
HETATM 5593 O O   . HOH GA 3 .  ? 11.548  33.849  -7.025  1.00 38.62  ? 506 HOH L O   1 
HETATM 5594 O O   . HOH GA 3 .  ? 7.539   7.948   -8.011  1.00 36.48  ? 524 HOH L O   1 
HETATM 5595 O O   . HOH GA 3 .  ? 21.311  18.629  -7.809  1.00 55.66  ? 529 HOH L O   1 
HETATM 5596 O O   . HOH GA 3 .  ? 4.557   8.571   -0.484  1.00 29.37  ? 535 HOH L O   1 
HETATM 5597 O O   . HOH GA 3 .  ? 4.452   8.970   4.320   1.00 35.67  ? 554 HOH L O   1 
HETATM 5598 O O   . HOH GA 3 .  ? 3.549   12.943  -13.212 1.00 49.47  ? 562 HOH L O   1 
HETATM 5599 O O   . HOH GA 3 .  ? 10.926  22.968  -15.268 1.00 45.02  ? 563 HOH L O   1 
HETATM 5600 O O   . HOH GA 3 .  ? -0.933  10.119  1.570   1.00 64.73  ? 609 HOH L O   1 
HETATM 5601 O O   . HOH GA 3 .  ? -1.230  11.561  -3.103  1.00 30.54  ? 618 HOH L O   1 
HETATM 5602 O O   . HOH GA 3 .  ? 1.647   8.952   -4.148  1.00 41.03  ? 621 HOH L O   1 
HETATM 5603 O O   . HOH GA 3 .  ? 1.101   22.572  -12.676 1.00 76.41  ? 630 HOH L O   1 
HETATM 5604 O O   A HOH GA 3 .  ? 17.624  9.442   -7.582  0.50 23.21  ? 660 HOH L O   1 
HETATM 5605 O O   B HOH GA 3 .  ? 18.715  8.413   -7.091  0.50 25.59  ? 660 HOH L O   1 
HETATM 5606 O O   . HOH GA 3 .  ? 15.958  14.977  -1.154  1.00 69.09  ? 685 HOH L O   1 
HETATM 5607 O O   . HOH GA 3 .  ? -1.077  13.423  -6.620  1.00 50.31  ? 715 HOH L O   1 
HETATM 5608 O O   . HOH GA 3 .  ? 12.302  30.584  -8.530  1.00 55.10  ? 732 HOH L O   1 
HETATM 5609 O O   . HOH GA 3 .  ? 21.005  15.765  -6.506  1.00 49.50  ? 740 HOH L O   1 
HETATM 5610 O O   . HOH GA 3 .  ? 1.875   10.778  1.558   1.00 45.86  ? 755 HOH L O   1 
HETATM 5611 O O   . HOH GA 3 .  ? 4.035   9.419   6.596   1.00 69.23  ? 757 HOH L O   1 
HETATM 5612 O O   . HOH GA 3 .  ? 7.282   4.600   -7.475  1.00 47.14  ? 758 HOH L O   1 
HETATM 5613 O O   . HOH GA 3 .  ? 7.650   30.248  -7.122  1.00 58.04  ? 762 HOH L O   1 
HETATM 5614 O O   . HOH GA 3 .  ? 15.268  16.822  -12.699 1.00 38.24  ? 782 HOH L O   1 
HETATM 5615 O O   . HOH GA 3 .  ? 27.144  20.039  -15.935 1.00 46.11  ? 787 HOH L O   1 
HETATM 5616 O O   . HOH HA 3 .  ? 15.698  29.311  4.223   1.00 13.42  ? 808 HOH M O   1 
HETATM 5617 O O   . HOH HA 3 .  ? 6.465   35.744  5.278   1.00 16.24  ? 809 HOH M O   1 
HETATM 5618 O O   . HOH HA 3 .  ? 7.039   34.634  12.886  1.00 12.86  ? 810 HOH M O   1 
HETATM 5619 O O   . HOH HA 3 .  ? 16.546  32.690  -1.161  1.00 23.41  ? 811 HOH M O   1 
HETATM 5620 O O   . HOH HA 3 .  ? 4.510   39.941  13.676  1.00 17.81  ? 812 HOH M O   1 
HETATM 5621 O O   . HOH HA 3 .  ? 20.719  36.822  4.138   1.00 13.45  ? 813 HOH M O   1 
HETATM 5622 O O   . HOH HA 3 .  ? 27.167  41.151  -4.820  1.00 19.77  ? 814 HOH M O   1 
HETATM 5623 O O   . HOH HA 3 .  ? 4.119   42.467  13.666  1.00 25.63  ? 815 HOH M O   1 
HETATM 5624 O O   . HOH HA 3 .  ? 20.352  49.364  -1.146  1.00 34.18  ? 816 HOH M O   1 
HETATM 5625 O O   . HOH HA 3 .  ? 12.153  46.986  0.468   1.00 26.67  ? 817 HOH M O   1 
HETATM 5626 O O   . HOH HA 3 .  ? 4.606   31.358  10.466  1.00 21.81  ? 818 HOH M O   1 
HETATM 5627 O O   . HOH HA 3 .  ? 2.992   44.267  8.076   1.00 42.34  ? 819 HOH M O   1 
HETATM 5628 O O   . HOH HA 3 .  ? 21.265  36.020  -5.044  1.00 26.99  ? 820 HOH M O   1 
HETATM 5629 O O   . HOH HA 3 .  ? 14.554  36.060  -1.670  1.00 27.54  ? 821 HOH M O   1 
HETATM 5630 O O   . HOH HA 3 .  ? 5.817   45.017  4.916   1.00 22.18  ? 822 HOH M O   1 
HETATM 5631 O O   . HOH HA 3 .  ? 19.143  29.509  1.721   1.00 31.93  ? 823 HOH M O   1 
HETATM 5632 O O   . HOH HA 3 .  ? 11.636  30.794  15.257  1.00 27.94  ? 824 HOH M O   1 
HETATM 5633 O O   . HOH HA 3 .  ? 21.390  31.418  2.854   1.00 36.68  ? 825 HOH M O   1 
HETATM 5634 O O   . HOH HA 3 .  ? 22.577  32.603  -3.351  1.00 32.49  ? 826 HOH M O   1 
HETATM 5635 O O   . HOH HA 3 .  ? 23.135  38.062  4.715   1.00 29.29  ? 827 HOH M O   1 
HETATM 5636 O O   . HOH HA 3 .  ? 20.900  38.784  -5.606  1.00 34.33  ? 828 HOH M O   1 
HETATM 5637 O O   . HOH HA 3 .  ? 25.615  38.191  -4.208  1.00 20.22  ? 829 HOH M O   1 
HETATM 5638 O O   . HOH HA 3 .  ? 20.608  36.531  1.251   1.00 28.45  ? 830 HOH M O   1 
HETATM 5639 O O   . HOH HA 3 .  ? 3.600   40.025  9.948   1.00 30.32  ? 831 HOH M O   1 
HETATM 5640 O O   . HOH HA 3 .  ? 12.111  49.589  11.179  1.00 26.29  ? 832 HOH M O   1 
HETATM 5641 O O   . HOH HA 3 .  ? 23.888  35.165  -3.304  1.00 34.53  ? 833 HOH M O   1 
HETATM 5642 O O   . HOH HA 3 .  ? 20.662  31.324  10.491  1.00 19.72  ? 834 HOH M O   1 
HETATM 5643 O O   . HOH HA 3 .  ? 24.005  37.349  -5.904  1.00 29.46  ? 835 HOH M O   1 
HETATM 5644 O O   . HOH HA 3 .  ? 4.598   38.601  8.201   1.00 30.03  ? 836 HOH M O   1 
HETATM 5645 O O   . HOH HA 3 .  ? 7.245   45.814  8.658   1.00 22.14  ? 837 HOH M O   1 
HETATM 5646 O O   . HOH HA 3 .  ? 4.628   42.156  10.937  1.00 24.07  ? 838 HOH M O   1 
HETATM 5647 O O   . HOH HA 3 .  ? 2.438   36.563  7.935   1.00 35.51  ? 839 HOH M O   1 
HETATM 5648 O O   . HOH HA 3 .  ? 19.462  28.739  10.583  1.00 34.71  ? 840 HOH M O   1 
HETATM 5649 O O   . HOH HA 3 .  ? 11.684  44.338  -0.715  1.00 36.25  ? 841 HOH M O   1 
HETATM 5650 O O   . HOH HA 3 .  ? 21.886  33.105  4.377   1.00 29.12  ? 842 HOH M O   1 
HETATM 5651 O O   . HOH HA 3 .  ? 20.613  34.289  0.139   1.00 36.19  ? 843 HOH M O   1 
HETATM 5652 O O   . HOH HA 3 .  ? 26.418  38.338  3.424   1.00 34.03  ? 844 HOH M O   1 
HETATM 5653 O O   . HOH HA 3 .  ? 19.206  45.856  -8.623  1.00 49.00  ? 845 HOH M O   1 
HETATM 5654 O O   . HOH HA 3 .  ? 20.058  50.339  7.670   1.00 45.23  ? 846 HOH M O   1 
HETATM 5655 O O   . HOH HA 3 .  ? 5.424   40.140  4.347   1.00 42.45  ? 847 HOH M O   1 
HETATM 5656 O O   . HOH HA 3 .  ? 17.251  49.881  -8.089  1.00 43.92  ? 848 HOH M O   1 
HETATM 5657 O O   . HOH HA 3 .  ? 6.063   49.063  6.799   1.00 33.60  ? 849 HOH M O   1 
HETATM 5658 O O   . HOH HA 3 .  ? 16.154  30.543  -3.219  1.00 33.83  ? 850 HOH M O   1 
HETATM 5659 O O   . HOH HA 3 .  ? 9.111   40.214  -1.802  1.00 31.69  ? 851 HOH M O   1 
HETATM 5660 O O   . HOH HA 3 .  ? 10.697  42.771  -2.311  1.00 38.59  ? 852 HOH M O   1 
HETATM 5661 O O   . HOH HA 3 .  ? 1.694   43.814  13.400  1.00 31.94  ? 853 HOH M O   1 
HETATM 5662 O O   . HOH HA 3 .  ? 0.000   41.818  5.160   1.00 45.22  ? 854 HOH M O   1 
HETATM 5663 O O   . HOH HA 3 .  ? 17.249  45.838  -6.419  1.00 49.31  ? 855 HOH M O   1 
HETATM 5664 O O   . HOH HA 3 .  ? 7.575   46.547  2.921   1.00 35.64  ? 856 HOH M O   1 
HETATM 5665 O O   . HOH HA 3 .  ? 4.828   46.757  10.053  1.00 49.10  ? 857 HOH M O   1 
HETATM 5666 O O   . HOH HA 3 .  ? 4.776   46.093  13.518  1.00 36.90  ? 858 HOH M O   1 
HETATM 5667 O O   . HOH HA 3 .  ? 10.632  49.187  14.673  1.00 50.76  ? 859 HOH M O   1 
HETATM 5668 O O   . HOH HA 3 .  ? 23.554  32.742  5.912   1.00 42.88  ? 860 HOH M O   1 
HETATM 5669 O O   . HOH HA 3 .  ? 12.232  44.359  -2.941  1.00 43.12  ? 861 HOH M O   1 
HETATM 5670 O O   . HOH HA 3 .  ? 18.701  39.956  -5.983  1.00 40.14  ? 862 HOH M O   1 
HETATM 5671 O O   . HOH HA 3 .  ? 4.514   38.118  5.279   1.00 51.66  ? 863 HOH M O   1 
HETATM 5672 O O   . HOH HA 3 .  ? 3.639   47.159  4.243   1.00 42.83  ? 864 HOH M O   1 
HETATM 5673 O O   . HOH HA 3 .  ? 16.218  43.321  -5.102  1.00 43.88  ? 865 HOH M O   1 
HETATM 5674 O O   . HOH IA 3 .  ? 22.541  44.709  5.215   1.00 22.81  ? 42  HOH N O   1 
HETATM 5675 O O   . HOH IA 3 .  ? 28.427  44.954  27.383  1.00 20.21  ? 43  HOH N O   1 
HETATM 5676 O O   . HOH IA 3 .  ? 22.687  32.153  12.604  1.00 21.79  ? 44  HOH N O   1 
HETATM 5677 O O   . HOH IA 3 .  ? 26.312  38.659  6.004   1.00 22.46  ? 45  HOH N O   1 
HETATM 5678 O O   . HOH IA 3 .  ? 14.542  39.813  21.252  1.00 26.32  ? 46  HOH N O   1 
HETATM 5679 O O   . HOH IA 3 .  ? 21.952  29.398  15.052  1.00 20.44  ? 47  HOH N O   1 
HETATM 5680 O O   . HOH IA 3 .  ? 30.707  40.230  11.561  1.00 26.37  ? 48  HOH N O   1 
HETATM 5681 O O   . HOH IA 3 .  ? 21.443  50.414  10.463  1.00 38.31  ? 49  HOH N O   1 
HETATM 5682 O O   . HOH IA 3 .  ? 20.917  48.961  23.013  1.00 28.41  ? 50  HOH N O   1 
HETATM 5683 O O   . HOH IA 3 .  ? 27.398  35.788  16.791  1.00 24.65  ? 51  HOH N O   1 
HETATM 5684 O O   . HOH IA 3 .  ? 25.434  36.738  7.457   1.00 22.13  ? 52  HOH N O   1 
HETATM 5685 O O   . HOH IA 3 .  ? 22.504  47.497  24.633  1.00 22.99  ? 53  HOH N O   1 
HETATM 5686 O O   . HOH IA 3 .  ? 33.330  40.614  8.816   1.00 44.07  ? 54  HOH N O   1 
HETATM 5687 O O   . HOH IA 3 .  ? 10.291  49.013  18.070  1.00 58.77  ? 55  HOH N O   1 
HETATM 5688 O O   . HOH IA 3 .  ? 24.670  49.802  2.701   1.00 56.41  ? 56  HOH N O   1 
HETATM 5689 O O   . HOH IA 3 .  ? 35.460  41.420  10.384  1.00 46.35  ? 57  HOH N O   1 
HETATM 5690 O O   . HOH IA 3 .  ? 27.051  48.076  -2.581  1.00 41.57  ? 58  HOH N O   1 
HETATM 5691 O O   . HOH IA 3 .  ? 32.426  37.474  11.960  1.00 24.78  ? 59  HOH N O   1 
HETATM 5692 O O   . HOH IA 3 .  ? 20.600  42.666  24.601  1.00 24.40  ? 60  HOH N O   1 
HETATM 5693 O O   . HOH IA 3 .  ? 19.144  48.793  25.397  1.00 25.93  ? 61  HOH N O   1 
HETATM 5694 O O   . HOH IA 3 .  ? 18.361  53.868  18.402  1.00 39.17  ? 62  HOH N O   1 
HETATM 5695 O O   . HOH IA 3 .  ? 20.060  54.475  16.981  1.00 42.43  ? 63  HOH N O   1 
HETATM 5696 O O   . HOH IA 3 .  ? 21.449  45.106  25.679  1.00 36.15  ? 64  HOH N O   1 
HETATM 5697 O O   . HOH IA 3 .  ? 25.686  34.223  6.195   1.00 38.27  ? 65  HOH N O   1 
HETATM 5698 O O   . HOH IA 3 .  ? 33.248  44.717  16.787  1.00 47.14  ? 66  HOH N O   1 
HETATM 5699 O O   . HOH IA 3 .  ? 32.205  43.881  9.754   1.00 25.60  ? 67  HOH N O   1 
HETATM 5700 O O   . HOH IA 3 .  ? 29.705  55.231  8.957   1.00 37.25  ? 68  HOH N O   1 
HETATM 5701 O O   . HOH IA 3 .  ? 33.048  44.913  13.226  1.00 46.32  ? 69  HOH N O   1 
HETATM 5702 O O   . HOH IA 3 .  ? 31.146  35.163  11.487  1.00 33.19  ? 70  HOH N O   1 
HETATM 5703 O O   . HOH IA 3 .  ? 21.967  48.592  5.003   1.00 31.52  ? 71  HOH N O   1 
HETATM 5704 O O   . HOH IA 3 .  ? 27.039  41.356  23.081  1.00 41.99  ? 72  HOH N O   1 
HETATM 5705 O O   . HOH IA 3 .  ? 24.243  36.655  22.259  1.00 43.87  ? 73  HOH N O   1 
HETATM 5706 O O   . HOH IA 3 .  ? 22.899  48.484  2.348   1.00 50.80  ? 74  HOH N O   1 
HETATM 5707 O O   . HOH IA 3 .  ? 23.639  51.089  10.492  1.00 36.66  ? 75  HOH N O   1 
HETATM 5708 O O   . HOH IA 3 .  ? 24.432  34.908  20.168  1.00 39.98  ? 76  HOH N O   1 
HETATM 5709 O O   . HOH IA 3 .  ? 26.694  41.087  25.934  1.00 35.30  ? 77  HOH N O   1 
HETATM 5710 O O   . HOH IA 3 .  ? 32.553  42.136  12.136  1.00 36.93  ? 78  HOH N O   1 
HETATM 5711 O O   . HOH IA 3 .  ? 28.479  56.405  15.997  1.00 41.76  ? 79  HOH N O   1 
HETATM 5712 O O   . HOH IA 3 .  ? 30.821  33.863  14.393  1.00 29.31  ? 80  HOH N O   1 
HETATM 5713 O O   . HOH IA 3 .  ? 23.956  40.385  26.448  1.00 57.05  ? 81  HOH N O   1 
HETATM 5714 O O   . HOH IA 3 .  ? 25.680  51.909  1.969   1.00 42.93  ? 82  HOH N O   1 
HETATM 5715 O O   . HOH IA 3 .  ? 17.616  36.641  22.033  1.00 47.78  ? 83  HOH N O   1 
HETATM 5716 O O   . HOH IA 3 .  ? 22.946  50.265  7.205   1.00 46.42  ? 84  HOH N O   1 
HETATM 5717 O O   . HOH IA 3 .  ? 13.820  48.837  14.086  1.00 39.40  ? 85  HOH N O   1 
HETATM 5718 O O   . HOH IA 3 .  ? 23.128  47.991  -0.638  1.00 56.77  ? 86  HOH N O   1 
HETATM 5719 O O   A HOH IA 3 .  ? 26.490  46.160  22.637  0.50 19.98  ? 87  HOH N O   1 
HETATM 5720 O O   B HOH IA 3 .  ? 27.122  45.621  22.740  0.50 14.15  ? 87  HOH N O   1 
HETATM 5721 O O   A HOH IA 3 .  ? 26.942  47.050  2.716   0.50 14.19  ? 88  HOH N O   1 
HETATM 5722 O O   B HOH IA 3 .  ? 27.776  44.921  2.510   0.50 16.01  ? 88  HOH N O   1 
HETATM 5723 O O   . HOH IA 3 .  ? 31.933  47.963  0.541   1.00 65.57  ? 89  HOH N O   1 
HETATM 5724 O O   . HOH IA 3 .  ? 28.703  45.459  5.383   1.00 82.45  ? 90  HOH N O   1 
HETATM 5725 O O   . HOH IA 3 .  ? 17.640  51.046  26.200  1.00 41.34  ? 91  HOH N O   1 
HETATM 5726 O O   . HOH IA 3 .  ? 16.775  49.128  13.446  1.00 36.81  ? 92  HOH N O   1 
HETATM 5727 O O   . HOH IA 3 .  ? 29.164  43.544  23.215  1.00 53.08  ? 93  HOH N O   1 
HETATM 5728 O O   . HOH IA 3 .  ? 26.700  33.747  19.548  1.00 51.12  ? 94  HOH N O   1 
HETATM 5729 O O   . HOH IA 3 .  ? 24.650  54.518  11.967  1.00 41.94  ? 95  HOH N O   1 
HETATM 5730 O O   . HOH IA 3 .  ? 29.042  42.667  28.851  1.00 50.33  ? 96  HOH N O   1 
HETATM 5731 O O   . HOH IA 3 .  ? 33.564  38.150  9.729   1.00 35.57  ? 97  HOH N O   1 
HETATM 5732 O O   . HOH IA 3 .  ? 29.089  37.314  18.171  1.00 41.08  ? 98  HOH N O   1 
HETATM 5733 O O   . HOH JA 3 .  ? 2.274   33.055  29.396  1.00 24.14  ? 42  HOH O O   1 
HETATM 5734 O O   . HOH JA 3 .  ? -0.937  31.741  31.095  1.00 31.13  ? 43  HOH O O   1 
HETATM 5735 O O   . HOH JA 3 .  ? 1.606   31.399  10.967  1.00 19.07  ? 44  HOH O O   1 
HETATM 5736 O O   . HOH JA 3 .  ? -0.911  25.636  30.132  1.00 37.38  ? 45  HOH O O   1 
HETATM 5737 O O   . HOH JA 3 .  ? -9.705  38.193  11.615  1.00 28.57  ? 46  HOH O O   1 
HETATM 5738 O O   . HOH JA 3 .  ? -0.170  34.009  30.160  1.00 24.79  ? 47  HOH O O   1 
HETATM 5739 O O   . HOH JA 3 .  ? 4.639   27.329  12.988  1.00 30.33  ? 48  HOH O O   1 
HETATM 5740 O O   . HOH JA 3 .  ? 6.484   28.001  22.377  1.00 24.88  ? 49  HOH O O   1 
HETATM 5741 O O   . HOH JA 3 .  ? -1.559  35.438  5.617   1.00 48.68  ? 50  HOH O O   1 
HETATM 5742 O O   . HOH JA 3 .  ? -3.938  18.310  35.609  1.00 27.67  ? 51  HOH O O   1 
HETATM 5743 O O   . HOH JA 3 .  ? -1.431  35.539  7.910   1.00 27.05  ? 52  HOH O O   1 
HETATM 5744 O O   . HOH JA 3 .  ? 3.260   38.199  12.086  1.00 39.81  ? 53  HOH O O   1 
HETATM 5745 O O   . HOH JA 3 .  ? -10.498 30.513  13.217  1.00 24.88  ? 54  HOH O O   1 
HETATM 5746 O O   . HOH JA 3 .  ? 1.059   26.020  27.407  1.00 30.07  ? 55  HOH O O   1 
HETATM 5747 O O   . HOH JA 3 .  ? 7.077   24.323  25.727  1.00 37.30  ? 56  HOH O O   1 
HETATM 5748 O O   . HOH JA 3 .  ? 12.110  34.582  23.341  1.00 31.41  ? 57  HOH O O   1 
HETATM 5749 O O   . HOH JA 3 .  ? 7.902   30.181  16.873  1.00 29.93  ? 58  HOH O O   1 
HETATM 5750 O O   . HOH JA 3 .  ? 5.022   26.986  15.374  1.00 30.85  ? 59  HOH O O   1 
HETATM 5751 O O   . HOH JA 3 .  ? 13.249  32.627  25.344  1.00 34.82  ? 60  HOH O O   1 
HETATM 5752 O O   . HOH JA 3 .  ? -3.945  25.117  28.676  1.00 45.11  ? 61  HOH O O   1 
HETATM 5753 O O   . HOH JA 3 .  ? 7.046   37.035  19.046  1.00 22.02  ? 62  HOH O O   1 
HETATM 5754 O O   . HOH JA 3 .  ? 3.467   25.443  16.064  1.00 41.75  ? 63  HOH O O   1 
HETATM 5755 O O   . HOH JA 3 .  ? 7.885   35.218  25.301  1.00 33.81  ? 64  HOH O O   1 
HETATM 5756 O O   . HOH JA 3 .  ? -10.265 31.081  18.110  1.00 35.12  ? 65  HOH O O   1 
HETATM 5757 O O   . HOH JA 3 .  ? -6.433  34.773  27.446  1.00 32.57  ? 66  HOH O O   1 
HETATM 5758 O O   . HOH JA 3 .  ? -5.560  29.766  33.229  1.00 35.10  ? 67  HOH O O   1 
HETATM 5759 O O   . HOH JA 3 .  ? 0.611   32.167  33.534  1.00 37.36  ? 68  HOH O O   1 
HETATM 5760 O O   . HOH JA 3 .  ? 5.376   25.526  21.782  1.00 41.51  ? 69  HOH O O   1 
HETATM 5761 O O   . HOH JA 3 .  ? -9.751  32.048  20.887  1.00 42.38  ? 70  HOH O O   1 
HETATM 5762 O O   . HOH JA 3 .  ? 0.649   23.412  18.595  1.00 41.43  ? 71  HOH O O   1 
HETATM 5763 O O   . HOH JA 3 .  ? 8.408   26.790  24.823  1.00 39.96  ? 72  HOH O O   1 
HETATM 5764 O O   . HOH JA 3 .  ? 8.745   36.870  23.644  1.00 26.25  ? 73  HOH O O   1 
HETATM 5765 O O   . HOH JA 3 .  ? -13.781 23.940  16.657  1.00 45.59  ? 74  HOH O O   1 
HETATM 5766 O O   . HOH JA 3 .  ? -9.804  25.328  22.250  1.00 33.92  ? 75  HOH O O   1 
HETATM 5767 O O   . HOH JA 3 .  ? 9.168   33.412  25.900  1.00 58.55  ? 76  HOH O O   1 
HETATM 5768 O O   . HOH JA 3 .  ? 12.683  30.414  25.599  1.00 39.75  ? 77  HOH O O   1 
HETATM 5769 O O   . HOH JA 3 .  ? 9.646   29.629  27.403  1.00 39.58  ? 78  HOH O O   1 
HETATM 5770 O O   . HOH JA 3 .  ? -11.540 35.653  19.456  1.00 45.86  ? 79  HOH O O   1 
HETATM 5771 O O   . HOH JA 3 .  ? 11.615  36.705  24.056  1.00 35.87  ? 80  HOH O O   1 
HETATM 5772 O O   . HOH JA 3 .  ? -3.017  32.293  31.900  1.00 45.11  ? 81  HOH O O   1 
HETATM 5773 O O   . HOH JA 3 .  ? -10.914 23.209  26.709  1.00 38.32  ? 82  HOH O O   1 
HETATM 5774 O O   . HOH JA 3 .  ? 8.799   28.005  20.656  1.00 54.28  ? 83  HOH O O   1 
HETATM 5775 O O   A HOH JA 3 .  ? 14.128  35.272  21.763  0.50 29.82  ? 84  HOH O O   1 
HETATM 5776 O O   B HOH JA 3 .  ? 15.104  36.942  21.391  0.50 28.55  ? 84  HOH O O   1 
HETATM 5777 O O   . HOH JA 3 .  ? -9.295  38.390  14.784  1.00 37.70  ? 85  HOH O O   1 
HETATM 5778 O O   . HOH JA 3 .  ? 15.123  32.915  22.833  1.00 42.76  ? 86  HOH O O   1 
HETATM 5779 O O   . HOH JA 3 .  ? -11.982 36.672  21.571  1.00 61.80  ? 87  HOH O O   1 
HETATM 5780 O O   . HOH JA 3 .  ? 2.758   29.583  10.038  1.00 53.16  ? 88  HOH O O   1 
HETATM 5781 O O   . HOH JA 3 .  ? 7.635   28.228  26.436  1.00 41.14  ? 89  HOH O O   1 
HETATM 5782 O O   . HOH JA 3 .  ? -4.746  22.806  36.590  1.00 35.00  ? 90  HOH O O   1 
HETATM 5783 O O   . HOH JA 3 .  ? -3.674  36.720  7.115   1.00 54.07  ? 91  HOH O O   1 
HETATM 5784 O O   . HOH JA 3 .  ? 8.295   29.979  19.128  1.00 32.86  ? 92  HOH O O   1 
HETATM 5785 O O   . HOH JA 3 .  ? 5.997   25.952  27.539  1.00 50.82  ? 93  HOH O O   1 
HETATM 5786 O O   . HOH KA 3 .  ? -7.290  41.219  14.961  1.00 54.63  ? 42  HOH P O   1 
HETATM 5787 O O   . HOH KA 3 .  ? -0.939  43.543  12.301  1.00 32.74  ? 43  HOH P O   1 
HETATM 5788 O O   . HOH KA 3 .  ? 5.769   48.588  19.124  1.00 40.68  ? 44  HOH P O   1 
HETATM 5789 O O   . HOH KA 3 .  ? 7.537   38.476  21.473  1.00 32.79  ? 45  HOH P O   1 
HETATM 5790 O O   . HOH KA 3 .  ? 7.226   47.498  25.700  1.00 44.16  ? 46  HOH P O   1 
HETATM 5791 O O   . HOH KA 3 .  ? 13.564  45.933  29.767  1.00 33.59  ? 47  HOH P O   1 
HETATM 5792 O O   . HOH KA 3 .  ? 8.839   44.827  25.148  1.00 28.18  ? 48  HOH P O   1 
HETATM 5793 O O   . HOH KA 3 .  ? -5.737  34.711  31.193  1.00 53.19  ? 49  HOH P O   1 
HETATM 5794 O O   . HOH KA 3 .  ? -11.641 47.412  15.518  1.00 32.54  ? 50  HOH P O   1 
HETATM 5795 O O   . HOH KA 3 .  ? -7.091  48.606  30.320  1.00 41.45  ? 51  HOH P O   1 
HETATM 5796 O O   . HOH KA 3 .  ? -8.004  40.438  11.779  1.00 44.61  ? 52  HOH P O   1 
HETATM 5797 O O   . HOH KA 3 .  ? 5.025   36.547  31.775  1.00 42.14  ? 53  HOH P O   1 
HETATM 5798 O O   . HOH KA 3 .  ? 5.603   45.239  34.828  1.00 58.29  ? 54  HOH P O   1 
HETATM 5799 O O   . HOH KA 3 .  ? -16.942 35.936  32.060  1.00 54.01  ? 55  HOH P O   1 
HETATM 5800 O O   . HOH KA 3 .  ? -14.693 33.244  31.911  1.00 43.38  ? 56  HOH P O   1 
HETATM 5801 O O   . HOH KA 3 .  ? 9.532   45.538  29.502  1.00 44.42  ? 57  HOH P O   1 
HETATM 5802 O O   . HOH KA 3 .  ? -10.004 46.456  29.674  1.00 50.06  ? 58  HOH P O   1 
HETATM 5803 O O   . HOH KA 3 .  ? -0.255  36.297  31.340  1.00 33.49  ? 59  HOH P O   1 
HETATM 5804 O O   . HOH KA 3 .  ? 0.851   38.414  31.031  1.00 43.22  ? 60  HOH P O   1 
HETATM 5805 O O   . HOH KA 3 .  ? -11.987 45.988  26.918  1.00 35.73  ? 61  HOH P O   1 
HETATM 5806 O O   . HOH KA 3 .  ? -8.548  47.769  27.800  1.00 55.78  ? 62  HOH P O   1 
HETATM 5807 O O   . HOH KA 3 .  ? -8.378  32.531  31.044  1.00 43.11  ? 63  HOH P O   1 
HETATM 5808 O O   . HOH KA 3 .  ? 11.768  46.443  32.729  1.00 41.69  ? 64  HOH P O   1 
HETATM 5809 O O   . HOH KA 3 .  ? 0.538   55.725  20.737  1.00 94.65  ? 65  HOH P O   1 
HETATM 5810 O O   . HOH KA 3 .  ? -9.481  45.763  26.235  1.00 65.85  ? 66  HOH P O   1 
HETATM 5811 O O   . HOH KA 3 .  ? 7.574   50.332  23.121  1.00 62.42  ? 67  HOH P O   1 
HETATM 5812 O O   . HOH KA 3 .  ? -9.004  42.874  12.540  1.00 43.25  ? 68  HOH P O   1 
HETATM 5813 O O   . HOH KA 3 .  ? 2.413   50.759  27.191  1.00 42.66  ? 69  HOH P O   1 
HETATM 5814 O O   . HOH KA 3 .  ? 3.413   44.647  26.917  1.00 78.67  ? 70  HOH P O   1 
HETATM 5815 O O   . HOH KA 3 .  ? -9.381  49.466  15.275  1.00 68.51  ? 71  HOH P O   1 
HETATM 5816 O O   . HOH KA 3 .  ? -11.515 39.300  21.212  1.00 70.98  ? 72  HOH P O   1 
HETATM 5817 O O   . HOH KA 3 .  ? 11.025  37.387  26.990  1.00 38.85  ? 73  HOH P O   1 
HETATM 5818 O O   . HOH KA 3 .  ? -9.286  35.483  40.776  1.00 52.00  ? 74  HOH P O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  ILE 2  2  2  ILE ILE A . n 
A 1 3  GLY 3  3  3  GLY GLY A . n 
A 1 4  ASP 4  4  4  ASP ASP A . n 
A 1 5  PRO 5  5  5  PRO PRO A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  THR 7  7  7  THR THR A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 LYS 10 10 10 LYS LYS A . n 
A 1 11 SER 11 11 11 SER SER A . n 
A 1 12 GLY 12 12 12 GLY GLY A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 ILE 14 14 14 ILE ILE A . n 
A 1 15 CYS 15 15 15 CYS CYS A . n 
A 1 16 HIS 16 16 16 HIS HIS A . n 
A 1 17 PRO 17 17 17 PRO PRO A . n 
A 1 18 VAL 18 18 18 VAL VAL A . n 
A 1 19 PHE 19 19 19 PHE PHE A . n 
A 1 20 CYS 20 20 20 CYS CYS A . n 
A 1 21 PRO 21 21 21 PRO PRO A . n 
A 1 22 ARG 22 22 22 ARG ARG A . n 
A 1 23 ARG 23 23 23 ARG ARG A . n 
A 1 24 TYR 24 24 24 TYR TYR A . n 
A 1 25 LYS 25 25 25 LYS LYS A . n 
A 1 26 GLN 26 26 26 GLN GLN A . n 
A 1 27 ILE 27 27 27 ILE ILE A . n 
A 1 28 GLY 28 28 28 GLY GLY A . n 
A 1 29 THR 29 29 29 THR THR A . n 
A 1 30 CYS 30 30 30 CYS CYS A . n 
A 1 31 GLY 31 31 31 GLY GLY A . n 
A 1 32 LEU 32 32 32 LEU LEU A . n 
A 1 33 PRO 33 33 33 PRO PRO A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 THR 35 35 35 THR THR A . n 
A 1 36 LYS 36 36 36 LYS LYS A . n 
A 1 37 CYS 37 37 37 CYS CYS A . n 
A 1 38 CYS 38 38 38 CYS CYS A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 PRO 41 41 41 PRO PRO A . n 
B 1 1  GLY 1  1  1  GLY GLY B . n 
B 1 2  ILE 2  2  2  ILE ILE B . n 
B 1 3  GLY 3  3  3  GLY GLY B . n 
B 1 4  ASP 4  4  4  ASP ASP B . n 
B 1 5  PRO 5  5  5  PRO PRO B . n 
B 1 6  VAL 6  6  6  VAL VAL B . n 
B 1 7  THR 7  7  7  THR THR B . n 
B 1 8  CYS 8  8  8  CYS CYS B . n 
B 1 9  LEU 9  9  9  LEU LEU B . n 
B 1 10 LYS 10 10 10 LYS LYS B . n 
B 1 11 SER 11 11 11 SER SER B . n 
B 1 12 GLY 12 12 12 GLY GLY B . n 
B 1 13 ALA 13 13 13 ALA ALA B . n 
B 1 14 ILE 14 14 14 ILE ILE B . n 
B 1 15 CYS 15 15 15 CYS CYS B . n 
B 1 16 HIS 16 16 16 HIS HIS B . n 
B 1 17 PRO 17 17 17 PRO PRO B . n 
B 1 18 VAL 18 18 18 VAL VAL B . n 
B 1 19 PHE 19 19 19 PHE PHE B . n 
B 1 20 CYS 20 20 20 CYS CYS B . n 
B 1 21 PRO 21 21 21 PRO PRO B . n 
B 1 22 ARG 22 22 22 ARG ARG B . n 
B 1 23 ARG 23 23 23 ARG ARG B . n 
B 1 24 TYR 24 24 24 TYR TYR B . n 
B 1 25 LYS 25 25 25 LYS LYS B . n 
B 1 26 GLN 26 26 26 GLN GLN B . n 
B 1 27 ILE 27 27 27 ILE ILE B . n 
B 1 28 GLY 28 28 28 GLY GLY B . n 
B 1 29 THR 29 29 29 THR THR B . n 
B 1 30 CYS 30 30 30 CYS CYS B . n 
B 1 31 GLY 31 31 31 GLY GLY B . n 
B 1 32 LEU 32 32 32 LEU LEU B . n 
B 1 33 PRO 33 33 33 PRO PRO B . n 
B 1 34 GLY 34 34 34 GLY GLY B . n 
B 1 35 THR 35 35 35 THR THR B . n 
B 1 36 LYS 36 36 36 LYS LYS B . n 
B 1 37 CYS 37 37 37 CYS CYS B . n 
B 1 38 CYS 38 38 38 CYS CYS B . n 
B 1 39 LYS 39 39 39 LYS LYS B . n 
B 1 40 LYS 40 40 40 LYS LYS B . n 
B 1 41 PRO 41 41 41 PRO PRO B . n 
C 1 1  GLY 1  1  1  GLY GLY C . n 
C 1 2  ILE 2  2  2  ILE ILE C . n 
C 1 3  GLY 3  3  3  GLY GLY C . n 
C 1 4  ASP 4  4  4  ASP ASP C . n 
C 1 5  PRO 5  5  5  PRO PRO C . n 
C 1 6  VAL 6  6  6  VAL VAL C . n 
C 1 7  THR 7  7  7  THR THR C . n 
C 1 8  CYS 8  8  8  CYS CYS C . n 
C 1 9  LEU 9  9  9  LEU LEU C . n 
C 1 10 LYS 10 10 10 LYS LYS C . n 
C 1 11 SER 11 11 11 SER SER C . n 
C 1 12 GLY 12 12 12 GLY GLY C . n 
C 1 13 ALA 13 13 13 ALA ALA C . n 
C 1 14 ILE 14 14 14 ILE ILE C . n 
C 1 15 CYS 15 15 15 CYS CYS C . n 
C 1 16 HIS 16 16 16 HIS HIS C . n 
C 1 17 PRO 17 17 17 PRO PRO C . n 
C 1 18 VAL 18 18 18 VAL VAL C . n 
C 1 19 PHE 19 19 19 PHE PHE C . n 
C 1 20 CYS 20 20 20 CYS CYS C . n 
C 1 21 PRO 21 21 21 PRO PRO C . n 
C 1 22 ARG 22 22 22 ARG ARG C . n 
C 1 23 ARG 23 23 23 ARG ARG C . n 
C 1 24 TYR 24 24 24 TYR TYR C . n 
C 1 25 LYS 25 25 25 LYS LYS C . n 
C 1 26 GLN 26 26 26 GLN GLN C . n 
C 1 27 ILE 27 27 27 ILE ILE C . n 
C 1 28 GLY 28 28 28 GLY GLY C . n 
C 1 29 THR 29 29 29 THR THR C . n 
C 1 30 CYS 30 30 30 CYS CYS C . n 
C 1 31 GLY 31 31 31 GLY GLY C . n 
C 1 32 LEU 32 32 32 LEU LEU C . n 
C 1 33 PRO 33 33 33 PRO PRO C . n 
C 1 34 GLY 34 34 34 GLY GLY C . n 
C 1 35 THR 35 35 35 THR THR C . n 
C 1 36 LYS 36 36 36 LYS LYS C . n 
C 1 37 CYS 37 37 37 CYS CYS C . n 
C 1 38 CYS 38 38 38 CYS CYS C . n 
C 1 39 LYS 39 39 39 LYS LYS C . n 
C 1 40 LYS 40 40 40 LYS LYS C . n 
C 1 41 PRO 41 41 41 PRO PRO C . n 
D 1 1  GLY 1  1  1  GLY GLY D . n 
D 1 2  ILE 2  2  2  ILE ILE D . n 
D 1 3  GLY 3  3  3  GLY GLY D . n 
D 1 4  ASP 4  4  4  ASP ASP D . n 
D 1 5  PRO 5  5  5  PRO PRO D . n 
D 1 6  VAL 6  6  6  VAL VAL D . n 
D 1 7  THR 7  7  7  THR THR D . n 
D 1 8  CYS 8  8  8  CYS CYS D . n 
D 1 9  LEU 9  9  9  LEU LEU D . n 
D 1 10 LYS 10 10 10 LYS LYS D . n 
D 1 11 SER 11 11 11 SER SER D . n 
D 1 12 GLY 12 12 12 GLY GLY D . n 
D 1 13 ALA 13 13 13 ALA ALA D . n 
D 1 14 ILE 14 14 14 ILE ILE D . n 
D 1 15 CYS 15 15 15 CYS CYS D . n 
D 1 16 HIS 16 16 16 HIS HIS D . n 
D 1 17 PRO 17 17 17 PRO PRO D . n 
D 1 18 VAL 18 18 18 VAL VAL D . n 
D 1 19 PHE 19 19 19 PHE PHE D . n 
D 1 20 CYS 20 20 20 CYS CYS D . n 
D 1 21 PRO 21 21 21 PRO PRO D . n 
D 1 22 ARG 22 22 22 ARG ARG D . n 
D 1 23 ARG 23 23 23 ARG ARG D . n 
D 1 24 TYR 24 24 24 TYR TYR D . n 
D 1 25 LYS 25 25 25 LYS LYS D . n 
D 1 26 GLN 26 26 26 GLN GLN D . n 
D 1 27 ILE 27 27 27 ILE ILE D . n 
D 1 28 GLY 28 28 28 GLY GLY D . n 
D 1 29 THR 29 29 29 THR THR D . n 
D 1 30 CYS 30 30 30 CYS CYS D . n 
D 1 31 GLY 31 31 31 GLY GLY D . n 
D 1 32 LEU 32 32 32 LEU LEU D . n 
D 1 33 PRO 33 33 33 PRO PRO D . n 
D 1 34 GLY 34 34 34 GLY GLY D . n 
D 1 35 THR 35 35 35 THR THR D . n 
D 1 36 LYS 36 36 36 LYS LYS D . n 
D 1 37 CYS 37 37 37 CYS CYS D . n 
D 1 38 CYS 38 38 38 CYS CYS D . n 
D 1 39 LYS 39 39 39 LYS LYS D . n 
D 1 40 LYS 40 40 40 LYS LYS D . n 
D 1 41 PRO 41 41 41 PRO PRO D . n 
E 1 1  GLY 1  1  1  GLY GLY E . n 
E 1 2  ILE 2  2  2  ILE ILE E . n 
E 1 3  GLY 3  3  3  GLY GLY E . n 
E 1 4  ASP 4  4  4  ASP ASP E . n 
E 1 5  PRO 5  5  5  PRO PRO E . n 
E 1 6  VAL 6  6  6  VAL VAL E . n 
E 1 7  THR 7  7  7  THR THR E . n 
E 1 8  CYS 8  8  8  CYS CYS E . n 
E 1 9  LEU 9  9  9  LEU LEU E . n 
E 1 10 LYS 10 10 10 LYS LYS E . n 
E 1 11 SER 11 11 11 SER SER E . n 
E 1 12 GLY 12 12 12 GLY GLY E . n 
E 1 13 ALA 13 13 13 ALA ALA E . n 
E 1 14 ILE 14 14 14 ILE ILE E . n 
E 1 15 CYS 15 15 15 CYS CYS E . n 
E 1 16 HIS 16 16 16 HIS HIS E . n 
E 1 17 PRO 17 17 17 PRO PRO E . n 
E 1 18 VAL 18 18 18 VAL VAL E . n 
E 1 19 PHE 19 19 19 PHE PHE E . n 
E 1 20 CYS 20 20 20 CYS CYS E . n 
E 1 21 PRO 21 21 21 PRO PRO E . n 
E 1 22 ARG 22 22 22 ARG ARG E . n 
E 1 23 ARG 23 23 23 ARG ARG E . n 
E 1 24 TYR 24 24 24 TYR TYR E . n 
E 1 25 LYS 25 25 25 LYS LYS E . n 
E 1 26 GLN 26 26 26 GLN GLN E . n 
E 1 27 ILE 27 27 27 ILE ILE E . n 
E 1 28 GLY 28 28 28 GLY GLY E . n 
E 1 29 THR 29 29 29 THR THR E . n 
E 1 30 CYS 30 30 30 CYS CYS E . n 
E 1 31 GLY 31 31 31 GLY GLY E . n 
E 1 32 LEU 32 32 32 LEU LEU E . n 
E 1 33 PRO 33 33 33 PRO PRO E . n 
E 1 34 GLY 34 34 34 GLY GLY E . n 
E 1 35 THR 35 35 35 THR THR E . n 
E 1 36 LYS 36 36 36 LYS LYS E . n 
E 1 37 CYS 37 37 37 CYS CYS E . n 
E 1 38 CYS 38 38 38 CYS CYS E . n 
E 1 39 LYS 39 39 39 LYS LYS E . n 
E 1 40 LYS 40 40 40 LYS LYS E . n 
E 1 41 PRO 41 41 41 PRO PRO E . n 
F 1 1  GLY 1  1  1  GLY GLY F . n 
F 1 2  ILE 2  2  2  ILE ILE F . n 
F 1 3  GLY 3  3  3  GLY GLY F . n 
F 1 4  ASP 4  4  4  ASP ASP F . n 
F 1 5  PRO 5  5  5  PRO PRO F . n 
F 1 6  VAL 6  6  6  VAL VAL F . n 
F 1 7  THR 7  7  7  THR THR F . n 
F 1 8  CYS 8  8  8  CYS CYS F . n 
F 1 9  LEU 9  9  9  LEU LEU F . n 
F 1 10 LYS 10 10 10 LYS LYS F . n 
F 1 11 SER 11 11 11 SER SER F . n 
F 1 12 GLY 12 12 12 GLY GLY F . n 
F 1 13 ALA 13 13 13 ALA ALA F . n 
F 1 14 ILE 14 14 14 ILE ILE F . n 
F 1 15 CYS 15 15 15 CYS CYS F . n 
F 1 16 HIS 16 16 16 HIS HIS F . n 
F 1 17 PRO 17 17 17 PRO PRO F . n 
F 1 18 VAL 18 18 18 VAL VAL F . n 
F 1 19 PHE 19 19 19 PHE PHE F . n 
F 1 20 CYS 20 20 20 CYS CYS F . n 
F 1 21 PRO 21 21 21 PRO PRO F . n 
F 1 22 ARG 22 22 22 ARG ARG F . n 
F 1 23 ARG 23 23 23 ARG ARG F . n 
F 1 24 TYR 24 24 24 TYR TYR F . n 
F 1 25 LYS 25 25 25 LYS LYS F . n 
F 1 26 GLN 26 26 26 GLN GLN F . n 
F 1 27 ILE 27 27 27 ILE ILE F . n 
F 1 28 GLY 28 28 28 GLY GLY F . n 
F 1 29 THR 29 29 29 THR THR F . n 
F 1 30 CYS 30 30 30 CYS CYS F . n 
F 1 31 GLY 31 31 31 GLY GLY F . n 
F 1 32 LEU 32 32 32 LEU LEU F . n 
F 1 33 PRO 33 33 33 PRO PRO F . n 
F 1 34 GLY 34 34 34 GLY GLY F . n 
F 1 35 THR 35 35 35 THR THR F . n 
F 1 36 LYS 36 36 36 LYS LYS F . n 
F 1 37 CYS 37 37 37 CYS CYS F . n 
F 1 38 CYS 38 38 38 CYS CYS F . n 
F 1 39 LYS 39 39 39 LYS LYS F . n 
F 1 40 LYS 40 40 40 LYS LYS F . n 
F 1 41 PRO 41 41 41 PRO PRO F . n 
G 1 1  GLY 1  1  1  GLY GLY G . n 
G 1 2  ILE 2  2  2  ILE ILE G . n 
G 1 3  GLY 3  3  3  GLY GLY G . n 
G 1 4  ASP 4  4  4  ASP ASP G . n 
G 1 5  PRO 5  5  5  PRO PRO G . n 
G 1 6  VAL 6  6  6  VAL VAL G . n 
G 1 7  THR 7  7  7  THR THR G . n 
G 1 8  CYS 8  8  8  CYS CYS G . n 
G 1 9  LEU 9  9  9  LEU LEU G . n 
G 1 10 LYS 10 10 10 LYS LYS G . n 
G 1 11 SER 11 11 11 SER SER G . n 
G 1 12 GLY 12 12 12 GLY GLY G . n 
G 1 13 ALA 13 13 13 ALA ALA G . n 
G 1 14 ILE 14 14 14 ILE ILE G . n 
G 1 15 CYS 15 15 15 CYS CYS G . n 
G 1 16 HIS 16 16 16 HIS HIS G . n 
G 1 17 PRO 17 17 17 PRO PRO G . n 
G 1 18 VAL 18 18 18 VAL VAL G . n 
G 1 19 PHE 19 19 19 PHE PHE G . n 
G 1 20 CYS 20 20 20 CYS CYS G . n 
G 1 21 PRO 21 21 21 PRO PRO G . n 
G 1 22 ARG 22 22 22 ARG ARG G . n 
G 1 23 ARG 23 23 23 ARG ARG G . n 
G 1 24 TYR 24 24 24 TYR TYR G . n 
G 1 25 LYS 25 25 25 LYS LYS G . n 
G 1 26 GLN 26 26 26 GLN GLN G . n 
G 1 27 ILE 27 27 27 ILE ILE G . n 
G 1 28 GLY 28 28 28 GLY GLY G . n 
G 1 29 THR 29 29 29 THR THR G . n 
G 1 30 CYS 30 30 30 CYS CYS G . n 
G 1 31 GLY 31 31 31 GLY GLY G . n 
G 1 32 LEU 32 32 32 LEU LEU G . n 
G 1 33 PRO 33 33 33 PRO PRO G . n 
G 1 34 GLY 34 34 34 GLY GLY G . n 
G 1 35 THR 35 35 35 THR THR G . n 
G 1 36 LYS 36 36 36 LYS LYS G . n 
G 1 37 CYS 37 37 37 CYS CYS G . n 
G 1 38 CYS 38 38 38 CYS CYS G . n 
G 1 39 LYS 39 39 39 LYS LYS G . n 
G 1 40 LYS 40 40 40 LYS LYS G . n 
G 1 41 PRO 41 41 41 PRO PRO G . n 
H 1 1  GLY 1  1  1  GLY GLY H . n 
H 1 2  ILE 2  2  2  ILE ILE H . n 
H 1 3  GLY 3  3  3  GLY GLY H . n 
H 1 4  ASP 4  4  4  ASP ASP H . n 
H 1 5  PRO 5  5  5  PRO PRO H . n 
H 1 6  VAL 6  6  6  VAL VAL H . n 
H 1 7  THR 7  7  7  THR THR H . n 
H 1 8  CYS 8  8  8  CYS CYS H . n 
H 1 9  LEU 9  9  9  LEU LEU H . n 
H 1 10 LYS 10 10 10 LYS LYS H . n 
H 1 11 SER 11 11 11 SER SER H . n 
H 1 12 GLY 12 12 12 GLY GLY H . n 
H 1 13 ALA 13 13 13 ALA ALA H . n 
H 1 14 ILE 14 14 14 ILE ILE H . n 
H 1 15 CYS 15 15 15 CYS CYS H . n 
H 1 16 HIS 16 16 16 HIS HIS H . n 
H 1 17 PRO 17 17 17 PRO PRO H . n 
H 1 18 VAL 18 18 18 VAL VAL H . n 
H 1 19 PHE 19 19 19 PHE PHE H . n 
H 1 20 CYS 20 20 20 CYS CYS H . n 
H 1 21 PRO 21 21 21 PRO PRO H . n 
H 1 22 ARG 22 22 22 ARG ARG H . n 
H 1 23 ARG 23 23 23 ARG ARG H . n 
H 1 24 TYR 24 24 24 TYR TYR H . n 
H 1 25 LYS 25 25 25 LYS LYS H . n 
H 1 26 GLN 26 26 26 GLN GLN H . n 
H 1 27 ILE 27 27 27 ILE ILE H . n 
H 1 28 GLY 28 28 28 GLY GLY H . n 
H 1 29 THR 29 29 29 THR THR H . n 
H 1 30 CYS 30 30 30 CYS CYS H . n 
H 1 31 GLY 31 31 31 GLY GLY H . n 
H 1 32 LEU 32 32 32 LEU LEU H . n 
H 1 33 PRO 33 33 33 PRO PRO H . n 
H 1 34 GLY 34 34 34 GLY GLY H . n 
H 1 35 THR 35 35 35 THR THR H . n 
H 1 36 LYS 36 36 36 LYS LYS H . n 
H 1 37 CYS 37 37 37 CYS CYS H . n 
H 1 38 CYS 38 38 38 CYS CYS H . n 
H 1 39 LYS 39 39 39 LYS LYS H . n 
H 1 40 LYS 40 40 40 LYS LYS H . n 
H 1 41 PRO 41 41 41 PRO PRO H . n 
I 1 1  GLY 1  1  1  GLY GLY I . n 
I 1 2  ILE 2  2  2  ILE ILE I . n 
I 1 3  GLY 3  3  3  GLY GLY I . n 
I 1 4  ASP 4  4  4  ASP ASP I . n 
I 1 5  PRO 5  5  5  PRO PRO I . n 
I 1 6  VAL 6  6  6  VAL VAL I . n 
I 1 7  THR 7  7  7  THR THR I . n 
I 1 8  CYS 8  8  8  CYS CYS I . n 
I 1 9  LEU 9  9  9  LEU LEU I . n 
I 1 10 LYS 10 10 10 LYS LYS I . n 
I 1 11 SER 11 11 11 SER SER I . n 
I 1 12 GLY 12 12 12 GLY GLY I . n 
I 1 13 ALA 13 13 13 ALA ALA I . n 
I 1 14 ILE 14 14 14 ILE ILE I . n 
I 1 15 CYS 15 15 15 CYS CYS I . n 
I 1 16 HIS 16 16 16 HIS HIS I . n 
I 1 17 PRO 17 17 17 PRO PRO I . n 
I 1 18 VAL 18 18 18 VAL VAL I . n 
I 1 19 PHE 19 19 19 PHE PHE I . n 
I 1 20 CYS 20 20 20 CYS CYS I . n 
I 1 21 PRO 21 21 21 PRO PRO I . n 
I 1 22 ARG 22 22 22 ARG ARG I . n 
I 1 23 ARG 23 23 23 ARG ARG I . n 
I 1 24 TYR 24 24 24 TYR TYR I . n 
I 1 25 LYS 25 25 25 LYS LYS I . n 
I 1 26 GLN 26 26 26 GLN GLN I . n 
I 1 27 ILE 27 27 27 ILE ILE I . n 
I 1 28 GLY 28 28 28 GLY GLY I . n 
I 1 29 THR 29 29 29 THR THR I . n 
I 1 30 CYS 30 30 30 CYS CYS I . n 
I 1 31 GLY 31 31 31 GLY GLY I . n 
I 1 32 LEU 32 32 32 LEU LEU I . n 
I 1 33 PRO 33 33 33 PRO PRO I . n 
I 1 34 GLY 34 34 34 GLY GLY I . n 
I 1 35 THR 35 35 35 THR THR I . n 
I 1 36 LYS 36 36 36 LYS LYS I . n 
I 1 37 CYS 37 37 37 CYS CYS I . n 
I 1 38 CYS 38 38 38 CYS CYS I . n 
I 1 39 LYS 39 39 39 LYS LYS I . n 
I 1 40 LYS 40 40 40 LYS LYS I . n 
I 1 41 PRO 41 41 41 PRO PRO I . n 
J 1 1  GLY 1  1  1  GLY GLY J . n 
J 1 2  ILE 2  2  2  ILE ILE J . n 
J 1 3  GLY 3  3  3  GLY GLY J . n 
J 1 4  ASP 4  4  4  ASP ASP J . n 
J 1 5  PRO 5  5  5  PRO PRO J . n 
J 1 6  VAL 6  6  6  VAL VAL J . n 
J 1 7  THR 7  7  7  THR THR J . n 
J 1 8  CYS 8  8  8  CYS CYS J . n 
J 1 9  LEU 9  9  9  LEU LEU J . n 
J 1 10 LYS 10 10 10 LYS LYS J . n 
J 1 11 SER 11 11 11 SER SER J . n 
J 1 12 GLY 12 12 12 GLY GLY J . n 
J 1 13 ALA 13 13 13 ALA ALA J . n 
J 1 14 ILE 14 14 14 ILE ILE J . n 
J 1 15 CYS 15 15 15 CYS CYS J . n 
J 1 16 HIS 16 16 16 HIS HIS J . n 
J 1 17 PRO 17 17 17 PRO PRO J . n 
J 1 18 VAL 18 18 18 VAL VAL J . n 
J 1 19 PHE 19 19 19 PHE PHE J . n 
J 1 20 CYS 20 20 20 CYS CYS J . n 
J 1 21 PRO 21 21 21 PRO PRO J . n 
J 1 22 ARG 22 22 22 ARG ARG J . n 
J 1 23 ARG 23 23 23 ARG ARG J . n 
J 1 24 TYR 24 24 24 TYR TYR J . n 
J 1 25 LYS 25 25 25 LYS LYS J . n 
J 1 26 GLN 26 26 26 GLN GLN J . n 
J 1 27 ILE 27 27 27 ILE ILE J . n 
J 1 28 GLY 28 28 28 GLY GLY J . n 
J 1 29 THR 29 29 29 THR THR J . n 
J 1 30 CYS 30 30 30 CYS CYS J . n 
J 1 31 GLY 31 31 31 GLY GLY J . n 
J 1 32 LEU 32 32 32 LEU LEU J . n 
J 1 33 PRO 33 33 33 PRO PRO J . n 
J 1 34 GLY 34 34 34 GLY GLY J . n 
J 1 35 THR 35 35 35 THR THR J . n 
J 1 36 LYS 36 36 36 LYS LYS J . n 
J 1 37 CYS 37 37 37 CYS CYS J . n 
J 1 38 CYS 38 38 38 CYS CYS J . n 
J 1 39 LYS 39 39 39 LYS LYS J . n 
J 1 40 LYS 40 40 40 LYS LYS J . n 
J 1 41 PRO 41 41 41 PRO PRO J . n 
K 1 1  GLY 1  1  1  GLY GLY K . n 
K 1 2  ILE 2  2  2  ILE ILE K . n 
K 1 3  GLY 3  3  3  GLY GLY K . n 
K 1 4  ASP 4  4  4  ASP ASP K . n 
K 1 5  PRO 5  5  5  PRO PRO K . n 
K 1 6  VAL 6  6  6  VAL VAL K . n 
K 1 7  THR 7  7  7  THR THR K . n 
K 1 8  CYS 8  8  8  CYS CYS K . n 
K 1 9  LEU 9  9  9  LEU LEU K . n 
K 1 10 LYS 10 10 10 LYS LYS K . n 
K 1 11 SER 11 11 11 SER SER K . n 
K 1 12 GLY 12 12 12 GLY GLY K . n 
K 1 13 ALA 13 13 13 ALA ALA K . n 
K 1 14 ILE 14 14 14 ILE ILE K . n 
K 1 15 CYS 15 15 15 CYS CYS K . n 
K 1 16 HIS 16 16 16 HIS HIS K . n 
K 1 17 PRO 17 17 17 PRO PRO K . n 
K 1 18 VAL 18 18 18 VAL VAL K . n 
K 1 19 PHE 19 19 19 PHE PHE K . n 
K 1 20 CYS 20 20 20 CYS CYS K . n 
K 1 21 PRO 21 21 21 PRO PRO K . n 
K 1 22 ARG 22 22 22 ARG ARG K . n 
K 1 23 ARG 23 23 23 ARG ARG K . n 
K 1 24 TYR 24 24 24 TYR TYR K . n 
K 1 25 LYS 25 25 25 LYS LYS K . n 
K 1 26 GLN 26 26 26 GLN GLN K . n 
K 1 27 ILE 27 27 27 ILE ILE K . n 
K 1 28 GLY 28 28 28 GLY GLY K . n 
K 1 29 THR 29 29 29 THR THR K . n 
K 1 30 CYS 30 30 30 CYS CYS K . n 
K 1 31 GLY 31 31 31 GLY GLY K . n 
K 1 32 LEU 32 32 32 LEU LEU K . n 
K 1 33 PRO 33 33 33 PRO PRO K . n 
K 1 34 GLY 34 34 34 GLY GLY K . n 
K 1 35 THR 35 35 35 THR THR K . n 
K 1 36 LYS 36 36 36 LYS LYS K . n 
K 1 37 CYS 37 37 37 CYS CYS K . n 
K 1 38 CYS 38 38 38 CYS CYS K . n 
K 1 39 LYS 39 39 39 LYS LYS K . n 
K 1 40 LYS 40 40 40 LYS LYS K . n 
K 1 41 PRO 41 41 41 PRO PRO K . n 
L 1 1  GLY 1  1  1  GLY GLY L . n 
L 1 2  ILE 2  2  2  ILE ILE L . n 
L 1 3  GLY 3  3  3  GLY GLY L . n 
L 1 4  ASP 4  4  4  ASP ASP L . n 
L 1 5  PRO 5  5  5  PRO PRO L . n 
L 1 6  VAL 6  6  6  VAL VAL L . n 
L 1 7  THR 7  7  7  THR THR L . n 
L 1 8  CYS 8  8  8  CYS CYS L . n 
L 1 9  LEU 9  9  9  LEU LEU L . n 
L 1 10 LYS 10 10 10 LYS LYS L . n 
L 1 11 SER 11 11 11 SER SER L . n 
L 1 12 GLY 12 12 12 GLY GLY L . n 
L 1 13 ALA 13 13 13 ALA ALA L . n 
L 1 14 ILE 14 14 14 ILE ILE L . n 
L 1 15 CYS 15 15 15 CYS CYS L . n 
L 1 16 HIS 16 16 16 HIS HIS L . n 
L 1 17 PRO 17 17 17 PRO PRO L . n 
L 1 18 VAL 18 18 18 VAL VAL L . n 
L 1 19 PHE 19 19 19 PHE PHE L . n 
L 1 20 CYS 20 20 20 CYS CYS L . n 
L 1 21 PRO 21 21 21 PRO PRO L . n 
L 1 22 ARG 22 22 22 ARG ARG L . n 
L 1 23 ARG 23 23 23 ARG ARG L . n 
L 1 24 TYR 24 24 24 TYR TYR L . n 
L 1 25 LYS 25 25 25 LYS LYS L . n 
L 1 26 GLN 26 26 26 GLN GLN L . n 
L 1 27 ILE 27 27 27 ILE ILE L . n 
L 1 28 GLY 28 28 28 GLY GLY L . n 
L 1 29 THR 29 29 29 THR THR L . n 
L 1 30 CYS 30 30 30 CYS CYS L . n 
L 1 31 GLY 31 31 31 GLY GLY L . n 
L 1 32 LEU 32 32 32 LEU LEU L . n 
L 1 33 PRO 33 33 33 PRO PRO L . n 
L 1 34 GLY 34 34 34 GLY GLY L . n 
L 1 35 THR 35 35 35 THR THR L . n 
L 1 36 LYS 36 36 36 LYS LYS L . n 
L 1 37 CYS 37 37 37 CYS CYS L . n 
L 1 38 CYS 38 38 38 CYS CYS L . n 
L 1 39 LYS 39 39 39 LYS LYS L . n 
L 1 40 LYS 40 40 40 LYS LYS L . n 
L 1 41 PRO 41 41 41 PRO PRO L . n 
M 1 1  GLY 1  1  1  GLY GLY M . n 
M 1 2  ILE 2  2  2  ILE ILE M . n 
M 1 3  GLY 3  3  3  GLY GLY M . n 
M 1 4  ASP 4  4  4  ASP ASP M . n 
M 1 5  PRO 5  5  5  PRO PRO M . n 
M 1 6  VAL 6  6  6  VAL VAL M . n 
M 1 7  THR 7  7  7  THR THR M . n 
M 1 8  CYS 8  8  8  CYS CYS M . n 
M 1 9  LEU 9  9  9  LEU LEU M . n 
M 1 10 LYS 10 10 10 LYS LYS M . n 
M 1 11 SER 11 11 11 SER SER M . n 
M 1 12 GLY 12 12 12 GLY GLY M . n 
M 1 13 ALA 13 13 13 ALA ALA M . n 
M 1 14 ILE 14 14 14 ILE ILE M . n 
M 1 15 CYS 15 15 15 CYS CYS M . n 
M 1 16 HIS 16 16 16 HIS HIS M . n 
M 1 17 PRO 17 17 17 PRO PRO M . n 
M 1 18 VAL 18 18 18 VAL VAL M . n 
M 1 19 PHE 19 19 19 PHE PHE M . n 
M 1 20 CYS 20 20 20 CYS CYS M . n 
M 1 21 PRO 21 21 21 PRO PRO M . n 
M 1 22 ARG 22 22 22 ARG ARG M . n 
M 1 23 ARG 23 23 23 ARG ARG M . n 
M 1 24 TYR 24 24 24 TYR TYR M . n 
M 1 25 LYS 25 25 25 LYS LYS M . n 
M 1 26 GLN 26 26 26 GLN GLN M . n 
M 1 27 ILE 27 27 27 ILE ILE M . n 
M 1 28 GLY 28 28 28 GLY GLY M . n 
M 1 29 THR 29 29 29 THR THR M . n 
M 1 30 CYS 30 30 30 CYS CYS M . n 
M 1 31 GLY 31 31 31 GLY GLY M . n 
M 1 32 LEU 32 32 32 LEU LEU M . n 
M 1 33 PRO 33 33 33 PRO PRO M . n 
M 1 34 GLY 34 34 34 GLY GLY M . n 
M 1 35 THR 35 35 35 THR THR M . n 
M 1 36 LYS 36 36 36 LYS LYS M . n 
M 1 37 CYS 37 37 37 CYS CYS M . n 
M 1 38 CYS 38 38 38 CYS CYS M . n 
M 1 39 LYS 39 39 39 LYS LYS M . n 
M 1 40 LYS 40 40 40 LYS LYS M . n 
M 1 41 PRO 41 41 41 PRO PRO M . n 
N 1 1  GLY 1  1  1  GLY GLY N . n 
N 1 2  ILE 2  2  2  ILE ILE N . n 
N 1 3  GLY 3  3  3  GLY GLY N . n 
N 1 4  ASP 4  4  4  ASP ASP N . n 
N 1 5  PRO 5  5  5  PRO PRO N . n 
N 1 6  VAL 6  6  6  VAL VAL N . n 
N 1 7  THR 7  7  7  THR THR N . n 
N 1 8  CYS 8  8  8  CYS CYS N . n 
N 1 9  LEU 9  9  9  LEU LEU N . n 
N 1 10 LYS 10 10 10 LYS LYS N . n 
N 1 11 SER 11 11 11 SER SER N . n 
N 1 12 GLY 12 12 12 GLY GLY N . n 
N 1 13 ALA 13 13 13 ALA ALA N . n 
N 1 14 ILE 14 14 14 ILE ILE N . n 
N 1 15 CYS 15 15 15 CYS CYS N . n 
N 1 16 HIS 16 16 16 HIS HIS N . n 
N 1 17 PRO 17 17 17 PRO PRO N . n 
N 1 18 VAL 18 18 18 VAL VAL N . n 
N 1 19 PHE 19 19 19 PHE PHE N . n 
N 1 20 CYS 20 20 20 CYS CYS N . n 
N 1 21 PRO 21 21 21 PRO PRO N . n 
N 1 22 ARG 22 22 22 ARG ARG N . n 
N 1 23 ARG 23 23 23 ARG ARG N . n 
N 1 24 TYR 24 24 24 TYR TYR N . n 
N 1 25 LYS 25 25 25 LYS LYS N . n 
N 1 26 GLN 26 26 26 GLN GLN N . n 
N 1 27 ILE 27 27 27 ILE ILE N . n 
N 1 28 GLY 28 28 28 GLY GLY N . n 
N 1 29 THR 29 29 29 THR THR N . n 
N 1 30 CYS 30 30 30 CYS CYS N . n 
N 1 31 GLY 31 31 31 GLY GLY N . n 
N 1 32 LEU 32 32 32 LEU LEU N . n 
N 1 33 PRO 33 33 33 PRO PRO N . n 
N 1 34 GLY 34 34 34 GLY GLY N . n 
N 1 35 THR 35 35 35 THR THR N . n 
N 1 36 LYS 36 36 36 LYS LYS N . n 
N 1 37 CYS 37 37 37 CYS CYS N . n 
N 1 38 CYS 38 38 38 CYS CYS N . n 
N 1 39 LYS 39 39 39 LYS LYS N . n 
N 1 40 LYS 40 40 40 LYS LYS N . n 
N 1 41 PRO 41 41 41 PRO PRO N . n 
O 1 1  GLY 1  1  1  GLY GLY O . n 
O 1 2  ILE 2  2  2  ILE ILE O . n 
O 1 3  GLY 3  3  3  GLY GLY O . n 
O 1 4  ASP 4  4  4  ASP ASP O . n 
O 1 5  PRO 5  5  5  PRO PRO O . n 
O 1 6  VAL 6  6  6  VAL VAL O . n 
O 1 7  THR 7  7  7  THR THR O . n 
O 1 8  CYS 8  8  8  CYS CYS O . n 
O 1 9  LEU 9  9  9  LEU LEU O . n 
O 1 10 LYS 10 10 10 LYS LYS O . n 
O 1 11 SER 11 11 11 SER SER O . n 
O 1 12 GLY 12 12 12 GLY GLY O . n 
O 1 13 ALA 13 13 13 ALA ALA O . n 
O 1 14 ILE 14 14 14 ILE ILE O . n 
O 1 15 CYS 15 15 15 CYS CYS O . n 
O 1 16 HIS 16 16 16 HIS HIS O . n 
O 1 17 PRO 17 17 17 PRO PRO O . n 
O 1 18 VAL 18 18 18 VAL VAL O . n 
O 1 19 PHE 19 19 19 PHE PHE O . n 
O 1 20 CYS 20 20 20 CYS CYS O . n 
O 1 21 PRO 21 21 21 PRO PRO O . n 
O 1 22 ARG 22 22 22 ARG ARG O . n 
O 1 23 ARG 23 23 23 ARG ARG O . n 
O 1 24 TYR 24 24 24 TYR TYR O . n 
O 1 25 LYS 25 25 25 LYS LYS O . n 
O 1 26 GLN 26 26 26 GLN GLN O . n 
O 1 27 ILE 27 27 27 ILE ILE O . n 
O 1 28 GLY 28 28 28 GLY GLY O . n 
O 1 29 THR 29 29 29 THR THR O . n 
O 1 30 CYS 30 30 30 CYS CYS O . n 
O 1 31 GLY 31 31 31 GLY GLY O . n 
O 1 32 LEU 32 32 32 LEU LEU O . n 
O 1 33 PRO 33 33 33 PRO PRO O . n 
O 1 34 GLY 34 34 34 GLY GLY O . n 
O 1 35 THR 35 35 35 THR THR O . n 
O 1 36 LYS 36 36 36 LYS LYS O . n 
O 1 37 CYS 37 37 37 CYS CYS O . n 
O 1 38 CYS 38 38 38 CYS CYS O . n 
O 1 39 LYS 39 39 39 LYS LYS O . n 
O 1 40 LYS 40 40 40 LYS LYS O . n 
O 1 41 PRO 41 41 41 PRO PRO O . n 
P 1 1  GLY 1  1  1  GLY GLY P . n 
P 1 2  ILE 2  2  2  ILE ILE P . n 
P 1 3  GLY 3  3  3  GLY GLY P . n 
P 1 4  ASP 4  4  4  ASP ASP P . n 
P 1 5  PRO 5  5  5  PRO PRO P . n 
P 1 6  VAL 6  6  6  VAL VAL P . n 
P 1 7  THR 7  7  7  THR THR P . n 
P 1 8  CYS 8  8  8  CYS CYS P . n 
P 1 9  LEU 9  9  9  LEU LEU P . n 
P 1 10 LYS 10 10 10 LYS LYS P . n 
P 1 11 SER 11 11 11 SER SER P . n 
P 1 12 GLY 12 12 12 GLY GLY P . n 
P 1 13 ALA 13 13 13 ALA ALA P . n 
P 1 14 ILE 14 14 14 ILE ILE P . n 
P 1 15 CYS 15 15 15 CYS CYS P . n 
P 1 16 HIS 16 16 16 HIS HIS P . n 
P 1 17 PRO 17 17 17 PRO PRO P . n 
P 1 18 VAL 18 18 18 VAL VAL P . n 
P 1 19 PHE 19 19 19 PHE PHE P . n 
P 1 20 CYS 20 20 20 CYS CYS P . n 
P 1 21 PRO 21 21 21 PRO PRO P . n 
P 1 22 ARG 22 22 22 ARG ARG P . n 
P 1 23 ARG 23 23 23 ARG ARG P . n 
P 1 24 TYR 24 24 24 TYR TYR P . n 
P 1 25 LYS 25 25 25 LYS LYS P . n 
P 1 26 GLN 26 26 26 GLN GLN P . n 
P 1 27 ILE 27 27 27 ILE ILE P . n 
P 1 28 GLY 28 28 28 GLY GLY P . n 
P 1 29 THR 29 29 29 THR THR P . n 
P 1 30 CYS 30 30 30 CYS CYS P . n 
P 1 31 GLY 31 31 31 GLY GLY P . n 
P 1 32 LEU 32 32 32 LEU LEU P . n 
P 1 33 PRO 33 33 33 PRO PRO P . n 
P 1 34 GLY 34 34 34 GLY GLY P . n 
P 1 35 THR 35 35 35 THR THR P . n 
P 1 36 LYS 36 36 36 LYS LYS P . n 
P 1 37 CYS 37 37 37 CYS CYS P . n 
P 1 38 CYS 38 38 38 CYS CYS P . n 
P 1 39 LYS 39 39 39 LYS LYS P . n 
P 1 40 LYS 40 40 40 LYS LYS P . n 
P 1 41 PRO 41 41 41 PRO PRO P . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
4 author_and_software_defined_assembly PISA dimeric 2 
5 author_and_software_defined_assembly PISA dimeric 2 
6 author_and_software_defined_assembly PISA dimeric 2 
7 author_and_software_defined_assembly PISA dimeric 2 
8 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,Q,V,W     
2 1 C,D,X,Y       
3 1 E,F,R,Z,AA    
4 1 G,H,BA,CA     
5 1 I,J,S,T,DA,EA 
6 1 K,L,FA,GA     
7 1 M,N,U,HA,IA   
8 1 O,P,JA,KA     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1290 ? 
1 MORE         -30  ? 
1 'SSA (A^2)'  4830 ? 
2 'ABSA (A^2)' 1010 ? 
2 MORE         -13  ? 
2 'SSA (A^2)'  4890 ? 
3 'ABSA (A^2)' 1450 ? 
3 MORE         -24  ? 
3 'SSA (A^2)'  4650 ? 
4 'ABSA (A^2)' 1140 ? 
4 MORE         -11  ? 
4 'SSA (A^2)'  4770 ? 
5 'ABSA (A^2)' 1070 ? 
5 MORE         -11  ? 
5 'SSA (A^2)'  4710 ? 
6 'ABSA (A^2)' 1000 ? 
6 MORE         -13  ? 
6 'SSA (A^2)'  5090 ? 
7 'ABSA (A^2)' 1380 ? 
7 MORE         -38  ? 
7 'SSA (A^2)'  4860 ? 
8 'ABSA (A^2)' 1040 ? 
8 MORE         -12  ? 
8 'SSA (A^2)'  4930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-11-01 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
AMoRE     phasing          . ? 3 
SHELXL-97 refinement       . ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE F ARG 23 ? ? CZ F ARG 23 ? ? NH1 F ARG 23 ? ? 123.84 120.30 3.54  0.50 N 
2 1 NE G ARG 23 ? ? CZ G ARG 23 ? ? NH2 G ARG 23 ? ? 116.82 120.30 -3.48 0.50 N 
3 1 CA H CYS 8  ? ? CB H CYS 8  ? ? SG  H CYS 8  ? ? 121.17 114.20 6.97  1.10 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 18 ? ? 73.98   -46.52  
2  1 ARG A 23 ? ? 83.36   -22.76  
3  1 VAL B 18 ? ? -136.21 -48.37  
4  1 ARG B 23 ? ? 76.05   -17.89  
5  1 VAL C 18 ? ? -139.29 -42.39  
6  1 ARG C 23 ? ? 77.96   -27.50  
7  1 VAL D 18 ? ? -133.83 -39.99  
8  1 ARG D 22 ? ? -61.56  44.07   
9  1 ARG D 23 ? ? -157.40 0.26    
10 1 VAL E 18 ? ? 65.54   -55.91  
11 1 VAL F 18 ? ? -132.37 -44.76  
12 1 VAL G 18 ? ? -136.72 -47.36  
13 1 VAL H 18 ? ? -136.12 -105.17 
14 1 PRO H 21 ? ? -57.33  -120.24 
15 1 ARG H 22 ? ? -98.11  -93.12  
16 1 LYS H 39 ? ? -162.02 -160.96 
17 1 VAL I 18 ? ? 64.70   -47.16  
18 1 VAL J 18 ? ? -140.08 -43.82  
19 1 ARG J 22 ? ? -69.00  87.03   
20 1 ARG J 23 ? ? 176.87  -12.96  
21 1 VAL K 18 ? ? -137.40 -51.89  
22 1 ARG K 23 ? ? 81.77   -14.15  
23 1 VAL L 18 ? ? -131.27 -48.61  
24 1 ARG L 23 ? ? 85.62   -36.69  
25 1 VAL M 18 ? ? 64.69   -47.14  
26 1 ARG M 22 ? ? -37.43  132.03  
27 1 ARG M 23 ? ? 81.72   -19.52  
28 1 VAL N 18 ? ? -136.28 -47.51  
29 1 VAL O 18 ? ? -133.44 -52.25  
30 1 ARG O 23 ? ? 92.08   -23.19  
31 1 VAL P 18 ? ? -134.98 -40.71  
32 1 PRO P 21 ? ? -65.13  -168.84 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION' SO4 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
Q  2 SO4 1  811 811 SO4 SO4 A . 
R  2 SO4 1  808 808 SO4 SO4 F . 
S  2 SO4 1  809 809 SO4 SO4 I . 
T  2 SO4 1  810 810 SO4 SO4 I . 
U  2 SO4 1  807 807 SO4 SO4 M . 
V  3 HOH 1  812 1   HOH HOH A . 
V  3 HOH 2  813 4   HOH HOH A . 
V  3 HOH 3  814 8   HOH HOH A . 
V  3 HOH 4  815 13  HOH HOH A . 
V  3 HOH 5  816 15  HOH HOH A . 
V  3 HOH 6  817 23  HOH HOH A . 
V  3 HOH 7  818 43  HOH HOH A . 
V  3 HOH 8  819 58  HOH HOH A . 
V  3 HOH 9  820 60  HOH HOH A . 
V  3 HOH 10 821 62  HOH HOH A . 
V  3 HOH 11 822 63  HOH HOH A . 
V  3 HOH 12 823 67  HOH HOH A . 
V  3 HOH 13 824 74  HOH HOH A . 
V  3 HOH 14 825 76  HOH HOH A . 
V  3 HOH 15 826 79  HOH HOH A . 
V  3 HOH 16 827 125 HOH HOH A . 
V  3 HOH 17 828 152 HOH HOH A . 
V  3 HOH 18 829 155 HOH HOH A . 
V  3 HOH 19 830 180 HOH HOH A . 
V  3 HOH 20 831 182 HOH HOH A . 
V  3 HOH 21 832 202 HOH HOH A . 
V  3 HOH 22 833 212 HOH HOH A . 
V  3 HOH 23 834 241 HOH HOH A . 
V  3 HOH 24 835 259 HOH HOH A . 
V  3 HOH 25 836 261 HOH HOH A . 
V  3 HOH 26 837 265 HOH HOH A . 
V  3 HOH 27 838 276 HOH HOH A . 
V  3 HOH 28 839 280 HOH HOH A . 
V  3 HOH 29 840 291 HOH HOH A . 
V  3 HOH 30 841 301 HOH HOH A . 
V  3 HOH 31 842 302 HOH HOH A . 
V  3 HOH 32 843 307 HOH HOH A . 
V  3 HOH 33 844 308 HOH HOH A . 
V  3 HOH 34 845 310 HOH HOH A . 
V  3 HOH 35 846 311 HOH HOH A . 
V  3 HOH 36 847 312 HOH HOH A . 
V  3 HOH 37 848 313 HOH HOH A . 
V  3 HOH 38 849 314 HOH HOH A . 
V  3 HOH 39 850 317 HOH HOH A . 
V  3 HOH 40 851 318 HOH HOH A . 
V  3 HOH 41 852 320 HOH HOH A . 
V  3 HOH 42 853 321 HOH HOH A . 
V  3 HOH 43 854 322 HOH HOH A . 
V  3 HOH 44 855 323 HOH HOH A . 
V  3 HOH 45 856 324 HOH HOH A . 
V  3 HOH 46 857 340 HOH HOH A . 
V  3 HOH 47 858 380 HOH HOH A . 
V  3 HOH 48 859 418 HOH HOH A . 
V  3 HOH 49 860 470 HOH HOH A . 
V  3 HOH 50 861 475 HOH HOH A . 
V  3 HOH 51 862 492 HOH HOH A . 
V  3 HOH 52 863 508 HOH HOH A . 
V  3 HOH 53 864 544 HOH HOH A . 
V  3 HOH 54 865 580 HOH HOH A . 
V  3 HOH 55 866 593 HOH HOH A . 
V  3 HOH 56 867 614 HOH HOH A . 
V  3 HOH 57 868 619 HOH HOH A . 
V  3 HOH 58 869 765 HOH HOH A . 
W  3 HOH 1  42  3   HOH HOH B . 
W  3 HOH 2  43  17  HOH HOH B . 
W  3 HOH 3  44  30  HOH HOH B . 
W  3 HOH 4  45  42  HOH HOH B . 
W  3 HOH 5  46  50  HOH HOH B . 
W  3 HOH 6  47  66  HOH HOH B . 
W  3 HOH 7  48  75  HOH HOH B . 
W  3 HOH 8  49  77  HOH HOH B . 
W  3 HOH 9  50  94  HOH HOH B . 
W  3 HOH 10 51  102 HOH HOH B . 
W  3 HOH 11 52  133 HOH HOH B . 
W  3 HOH 12 53  144 HOH HOH B . 
W  3 HOH 13 54  150 HOH HOH B . 
W  3 HOH 14 55  161 HOH HOH B . 
W  3 HOH 15 56  222 HOH HOH B . 
W  3 HOH 16 57  223 HOH HOH B . 
W  3 HOH 17 58  226 HOH HOH B . 
W  3 HOH 18 59  244 HOH HOH B . 
W  3 HOH 19 60  256 HOH HOH B . 
W  3 HOH 20 61  283 HOH HOH B . 
W  3 HOH 21 62  300 HOH HOH B . 
W  3 HOH 22 63  319 HOH HOH B . 
W  3 HOH 23 64  325 HOH HOH B . 
W  3 HOH 24 65  327 HOH HOH B . 
W  3 HOH 25 66  328 HOH HOH B . 
W  3 HOH 26 67  329 HOH HOH B . 
W  3 HOH 27 68  330 HOH HOH B . 
W  3 HOH 28 69  331 HOH HOH B . 
W  3 HOH 29 70  332 HOH HOH B . 
W  3 HOH 30 71  333 HOH HOH B . 
W  3 HOH 31 72  334 HOH HOH B . 
W  3 HOH 32 73  335 HOH HOH B . 
W  3 HOH 33 74  342 HOH HOH B . 
W  3 HOH 34 75  358 HOH HOH B . 
W  3 HOH 35 76  362 HOH HOH B . 
W  3 HOH 36 77  364 HOH HOH B . 
W  3 HOH 37 78  386 HOH HOH B . 
W  3 HOH 38 79  399 HOH HOH B . 
W  3 HOH 39 80  412 HOH HOH B . 
W  3 HOH 40 81  415 HOH HOH B . 
W  3 HOH 41 82  417 HOH HOH B . 
W  3 HOH 42 83  429 HOH HOH B . 
W  3 HOH 43 84  437 HOH HOH B . 
W  3 HOH 44 85  454 HOH HOH B . 
W  3 HOH 45 86  460 HOH HOH B . 
W  3 HOH 46 87  482 HOH HOH B . 
W  3 HOH 47 88  486 HOH HOH B . 
W  3 HOH 48 89  498 HOH HOH B . 
W  3 HOH 49 90  499 HOH HOH B . 
W  3 HOH 50 91  503 HOH HOH B . 
W  3 HOH 51 92  517 HOH HOH B . 
W  3 HOH 52 93  537 HOH HOH B . 
W  3 HOH 53 94  653 HOH HOH B . 
W  3 HOH 54 95  682 HOH HOH B . 
W  3 HOH 55 96  705 HOH HOH B . 
W  3 HOH 56 97  728 HOH HOH B . 
W  3 HOH 57 98  729 HOH HOH B . 
W  3 HOH 58 99  742 HOH HOH B . 
W  3 HOH 59 100 783 HOH HOH B . 
W  3 HOH 60 101 788 HOH HOH B . 
W  3 HOH 61 102 791 HOH HOH B . 
X  3 HOH 1  42  6   HOH HOH C . 
X  3 HOH 2  43  29  HOH HOH C . 
X  3 HOH 3  44  59  HOH HOH C . 
X  3 HOH 4  45  85  HOH HOH C . 
X  3 HOH 5  46  114 HOH HOH C . 
X  3 HOH 6  47  118 HOH HOH C . 
X  3 HOH 7  48  136 HOH HOH C . 
X  3 HOH 8  49  145 HOH HOH C . 
X  3 HOH 9  50  147 HOH HOH C . 
X  3 HOH 10 51  149 HOH HOH C . 
X  3 HOH 11 52  190 HOH HOH C . 
X  3 HOH 12 53  195 HOH HOH C . 
X  3 HOH 13 54  245 HOH HOH C . 
X  3 HOH 14 55  249 HOH HOH C . 
X  3 HOH 15 56  264 HOH HOH C . 
X  3 HOH 16 57  274 HOH HOH C . 
X  3 HOH 17 58  277 HOH HOH C . 
X  3 HOH 18 59  285 HOH HOH C . 
X  3 HOH 19 60  306 HOH HOH C . 
X  3 HOH 20 61  336 HOH HOH C . 
X  3 HOH 21 62  337 HOH HOH C . 
X  3 HOH 22 63  413 HOH HOH C . 
X  3 HOH 23 64  491 HOH HOH C . 
X  3 HOH 24 65  501 HOH HOH C . 
X  3 HOH 25 66  512 HOH HOH C . 
X  3 HOH 26 67  523 HOH HOH C . 
X  3 HOH 27 68  585 HOH HOH C . 
X  3 HOH 28 69  635 HOH HOH C . 
X  3 HOH 29 70  638 HOH HOH C . 
X  3 HOH 30 71  642 HOH HOH C . 
X  3 HOH 31 72  647 HOH HOH C . 
X  3 HOH 32 73  658 HOH HOH C . 
X  3 HOH 33 74  684 HOH HOH C . 
X  3 HOH 34 75  718 HOH HOH C . 
X  3 HOH 35 76  733 HOH HOH C . 
X  3 HOH 36 77  753 HOH HOH C . 
X  3 HOH 37 78  761 HOH HOH C . 
X  3 HOH 38 79  763 HOH HOH C . 
X  3 HOH 39 80  773 HOH HOH C . 
Y  3 HOH 1  104 104 HOH HOH D . 
Y  3 HOH 2  286 286 HOH HOH D . 
Y  3 HOH 3  343 343 HOH HOH D . 
Y  3 HOH 4  344 344 HOH HOH D . 
Y  3 HOH 5  345 345 HOH HOH D . 
Y  3 HOH 6  368 368 HOH HOH D . 
Y  3 HOH 7  430 430 HOH HOH D . 
Y  3 HOH 8  458 458 HOH HOH D . 
Y  3 HOH 9  479 479 HOH HOH D . 
Y  3 HOH 10 481 481 HOH HOH D . 
Y  3 HOH 11 496 496 HOH HOH D . 
Y  3 HOH 12 519 519 HOH HOH D . 
Y  3 HOH 13 574 574 HOH HOH D . 
Y  3 HOH 14 590 590 HOH HOH D . 
Y  3 HOH 15 634 634 HOH HOH D . 
Y  3 HOH 16 665 665 HOH HOH D . 
Y  3 HOH 17 667 667 HOH HOH D . 
Y  3 HOH 18 696 696 HOH HOH D . 
Y  3 HOH 19 743 743 HOH HOH D . 
Y  3 HOH 20 754 754 HOH HOH D . 
Y  3 HOH 21 769 769 HOH HOH D . 
Z  3 HOH 1  42  9   HOH HOH E . 
Z  3 HOH 2  43  32  HOH HOH E . 
Z  3 HOH 3  44  37  HOH HOH E . 
Z  3 HOH 4  45  48  HOH HOH E . 
Z  3 HOH 5  46  69  HOH HOH E . 
Z  3 HOH 6  47  83  HOH HOH E . 
Z  3 HOH 7  48  87  HOH HOH E . 
Z  3 HOH 8  49  128 HOH HOH E . 
Z  3 HOH 9  50  132 HOH HOH E . 
Z  3 HOH 10 51  138 HOH HOH E . 
Z  3 HOH 11 52  162 HOH HOH E . 
Z  3 HOH 12 53  200 HOH HOH E . 
Z  3 HOH 13 54  204 HOH HOH E . 
Z  3 HOH 14 55  218 HOH HOH E . 
Z  3 HOH 15 56  220 HOH HOH E . 
Z  3 HOH 16 57  227 HOH HOH E . 
Z  3 HOH 17 58  258 HOH HOH E . 
Z  3 HOH 18 59  273 HOH HOH E . 
Z  3 HOH 19 60  338 HOH HOH E . 
Z  3 HOH 20 61  339 HOH HOH E . 
Z  3 HOH 21 62  349 HOH HOH E . 
Z  3 HOH 22 63  361 HOH HOH E . 
Z  3 HOH 23 64  371 HOH HOH E . 
Z  3 HOH 24 65  377 HOH HOH E . 
Z  3 HOH 25 66  394 HOH HOH E . 
Z  3 HOH 26 67  403 HOH HOH E . 
Z  3 HOH 27 68  420 HOH HOH E . 
Z  3 HOH 28 69  426 HOH HOH E . 
Z  3 HOH 29 70  436 HOH HOH E . 
Z  3 HOH 30 71  456 HOH HOH E . 
Z  3 HOH 31 72  477 HOH HOH E . 
Z  3 HOH 32 73  528 HOH HOH E . 
Z  3 HOH 33 74  558 HOH HOH E . 
Z  3 HOH 34 75  603 HOH HOH E . 
Z  3 HOH 35 76  628 HOH HOH E . 
Z  3 HOH 36 77  641 HOH HOH E . 
Z  3 HOH 37 78  645 HOH HOH E . 
Z  3 HOH 38 79  646 HOH HOH E . 
Z  3 HOH 39 80  648 HOH HOH E . 
Z  3 HOH 40 81  677 HOH HOH E . 
Z  3 HOH 41 82  699 HOH HOH E . 
Z  3 HOH 42 83  710 HOH HOH E . 
Z  3 HOH 43 84  739 HOH HOH E . 
Z  3 HOH 44 85  744 HOH HOH E . 
Z  3 HOH 45 86  767 HOH HOH E . 
Z  3 HOH 46 87  798 HOH HOH E . 
AA 3 HOH 1  809 20  HOH HOH F . 
AA 3 HOH 2  810 25  HOH HOH F . 
AA 3 HOH 3  811 36  HOH HOH F . 
AA 3 HOH 4  812 38  HOH HOH F . 
AA 3 HOH 5  813 46  HOH HOH F . 
AA 3 HOH 6  814 47  HOH HOH F . 
AA 3 HOH 7  815 52  HOH HOH F . 
AA 3 HOH 8  816 68  HOH HOH F . 
AA 3 HOH 9  817 91  HOH HOH F . 
AA 3 HOH 10 818 111 HOH HOH F . 
AA 3 HOH 11 819 112 HOH HOH F . 
AA 3 HOH 12 820 129 HOH HOH F . 
AA 3 HOH 13 821 154 HOH HOH F . 
AA 3 HOH 14 822 160 HOH HOH F . 
AA 3 HOH 15 823 167 HOH HOH F . 
AA 3 HOH 16 824 169 HOH HOH F . 
AA 3 HOH 17 825 183 HOH HOH F . 
AA 3 HOH 18 826 191 HOH HOH F . 
AA 3 HOH 19 827 217 HOH HOH F . 
AA 3 HOH 20 828 230 HOH HOH F . 
AA 3 HOH 21 829 232 HOH HOH F . 
AA 3 HOH 22 830 246 HOH HOH F . 
AA 3 HOH 23 831 247 HOH HOH F . 
AA 3 HOH 24 832 269 HOH HOH F . 
AA 3 HOH 25 833 287 HOH HOH F . 
AA 3 HOH 26 834 348 HOH HOH F . 
AA 3 HOH 27 835 351 HOH HOH F . 
AA 3 HOH 28 836 352 HOH HOH F . 
AA 3 HOH 29 837 353 HOH HOH F . 
AA 3 HOH 30 838 354 HOH HOH F . 
AA 3 HOH 31 839 355 HOH HOH F . 
AA 3 HOH 32 840 356 HOH HOH F . 
AA 3 HOH 33 841 357 HOH HOH F . 
AA 3 HOH 34 842 360 HOH HOH F . 
AA 3 HOH 35 843 367 HOH HOH F . 
AA 3 HOH 36 844 370 HOH HOH F . 
AA 3 HOH 37 845 387 HOH HOH F . 
AA 3 HOH 38 846 388 HOH HOH F . 
AA 3 HOH 39 847 414 HOH HOH F . 
AA 3 HOH 40 848 427 HOH HOH F . 
AA 3 HOH 41 849 435 HOH HOH F . 
AA 3 HOH 42 850 441 HOH HOH F . 
AA 3 HOH 43 851 450 HOH HOH F . 
AA 3 HOH 44 852 468 HOH HOH F . 
AA 3 HOH 45 853 513 HOH HOH F . 
AA 3 HOH 46 854 550 HOH HOH F . 
AA 3 HOH 47 855 555 HOH HOH F . 
AA 3 HOH 48 856 565 HOH HOH F . 
AA 3 HOH 49 857 592 HOH HOH F . 
AA 3 HOH 50 858 595 HOH HOH F . 
AA 3 HOH 51 859 610 HOH HOH F . 
AA 3 HOH 52 860 683 HOH HOH F . 
AA 3 HOH 53 861 688 HOH HOH F . 
AA 3 HOH 54 862 693 HOH HOH F . 
AA 3 HOH 55 863 694 HOH HOH F . 
AA 3 HOH 56 864 700 HOH HOH F . 
AA 3 HOH 57 865 707 HOH HOH F . 
AA 3 HOH 58 866 709 HOH HOH F . 
AA 3 HOH 59 867 712 HOH HOH F . 
AA 3 HOH 60 868 723 HOH HOH F . 
AA 3 HOH 61 869 724 HOH HOH F . 
AA 3 HOH 62 870 736 HOH HOH F . 
AA 3 HOH 63 871 737 HOH HOH F . 
AA 3 HOH 64 872 746 HOH HOH F . 
AA 3 HOH 65 873 776 HOH HOH F . 
AA 3 HOH 66 874 796 HOH HOH F . 
AA 3 HOH 67 875 801 HOH HOH F . 
AA 3 HOH 68 876 806 HOH HOH F . 
BA 3 HOH 1  42  22  HOH HOH G . 
BA 3 HOH 2  43  33  HOH HOH G . 
BA 3 HOH 3  44  41  HOH HOH G . 
BA 3 HOH 4  45  49  HOH HOH G . 
BA 3 HOH 5  46  80  HOH HOH G . 
BA 3 HOH 6  47  88  HOH HOH G . 
BA 3 HOH 7  48  97  HOH HOH G . 
BA 3 HOH 8  49  99  HOH HOH G . 
BA 3 HOH 9  50  105 HOH HOH G . 
BA 3 HOH 10 51  117 HOH HOH G . 
BA 3 HOH 11 52  131 HOH HOH G . 
BA 3 HOH 12 53  141 HOH HOH G . 
BA 3 HOH 13 54  170 HOH HOH G . 
BA 3 HOH 14 55  177 HOH HOH G . 
BA 3 HOH 15 56  187 HOH HOH G . 
BA 3 HOH 16 57  231 HOH HOH G . 
BA 3 HOH 17 58  237 HOH HOH G . 
BA 3 HOH 18 59  253 HOH HOH G . 
BA 3 HOH 19 60  268 HOH HOH G . 
BA 3 HOH 20 61  288 HOH HOH G . 
BA 3 HOH 21 62  289 HOH HOH G . 
BA 3 HOH 22 63  290 HOH HOH G . 
BA 3 HOH 23 64  315 HOH HOH G . 
BA 3 HOH 24 65  316 HOH HOH G . 
BA 3 HOH 25 66  346 HOH HOH G . 
BA 3 HOH 26 67  347 HOH HOH G . 
BA 3 HOH 27 68  378 HOH HOH G . 
BA 3 HOH 28 69  391 HOH HOH G . 
BA 3 HOH 29 70  428 HOH HOH G . 
BA 3 HOH 30 71  448 HOH HOH G . 
BA 3 HOH 31 72  465 HOH HOH G . 
BA 3 HOH 32 73  471 HOH HOH G . 
BA 3 HOH 33 74  473 HOH HOH G . 
BA 3 HOH 34 75  493 HOH HOH G . 
BA 3 HOH 35 76  511 HOH HOH G . 
BA 3 HOH 36 77  525 HOH HOH G . 
BA 3 HOH 37 78  541 HOH HOH G . 
BA 3 HOH 38 79  547 HOH HOH G . 
BA 3 HOH 39 80  587 HOH HOH G . 
BA 3 HOH 40 81  588 HOH HOH G . 
BA 3 HOH 41 82  596 HOH HOH G . 
BA 3 HOH 42 83  602 HOH HOH G . 
BA 3 HOH 43 84  604 HOH HOH G . 
BA 3 HOH 44 85  606 HOH HOH G . 
BA 3 HOH 45 86  626 HOH HOH G . 
BA 3 HOH 46 87  627 HOH HOH G . 
BA 3 HOH 47 88  629 HOH HOH G . 
BA 3 HOH 48 89  631 HOH HOH G . 
BA 3 HOH 49 90  632 HOH HOH G . 
BA 3 HOH 50 91  633 HOH HOH G . 
BA 3 HOH 51 92  640 HOH HOH G . 
BA 3 HOH 52 93  662 HOH HOH G . 
BA 3 HOH 53 94  666 HOH HOH G . 
BA 3 HOH 54 95  687 HOH HOH G . 
BA 3 HOH 55 96  717 HOH HOH G . 
BA 3 HOH 56 97  722 HOH HOH G . 
BA 3 HOH 57 98  751 HOH HOH G . 
BA 3 HOH 58 99  759 HOH HOH G . 
BA 3 HOH 59 100 775 HOH HOH G . 
BA 3 HOH 60 101 777 HOH HOH G . 
BA 3 HOH 61 102 780 HOH HOH G . 
BA 3 HOH 62 103 784 HOH HOH G . 
BA 3 HOH 63 104 789 HOH HOH G . 
BA 3 HOH 64 105 802 HOH HOH G . 
CA 3 HOH 1  171 171 HOH HOH H . 
CA 3 HOH 2  172 172 HOH HOH H . 
CA 3 HOH 3  243 243 HOH HOH H . 
CA 3 HOH 4  255 255 HOH HOH H . 
CA 3 HOH 5  279 279 HOH HOH H . 
CA 3 HOH 6  350 350 HOH HOH H . 
CA 3 HOH 7  363 363 HOH HOH H . 
CA 3 HOH 8  445 445 HOH HOH H . 
CA 3 HOH 9  474 474 HOH HOH H . 
CA 3 HOH 10 488 488 HOH HOH H . 
CA 3 HOH 11 516 516 HOH HOH H . 
CA 3 HOH 12 518 518 HOH HOH H . 
CA 3 HOH 13 568 568 HOH HOH H . 
CA 3 HOH 14 571 571 HOH HOH H . 
CA 3 HOH 15 586 586 HOH HOH H . 
CA 3 HOH 16 594 594 HOH HOH H . 
CA 3 HOH 17 597 597 HOH HOH H . 
CA 3 HOH 18 607 607 HOH HOH H . 
CA 3 HOH 19 636 636 HOH HOH H . 
CA 3 HOH 20 639 639 HOH HOH H . 
CA 3 HOH 21 659 659 HOH HOH H . 
CA 3 HOH 22 674 674 HOH HOH H . 
CA 3 HOH 23 675 675 HOH HOH H . 
CA 3 HOH 24 731 731 HOH HOH H . 
CA 3 HOH 25 749 749 HOH HOH H . 
CA 3 HOH 26 756 756 HOH HOH H . 
CA 3 HOH 27 760 760 HOH HOH H . 
DA 3 HOH 1  811 10  HOH HOH I . 
DA 3 HOH 2  812 11  HOH HOH I . 
DA 3 HOH 3  813 19  HOH HOH I . 
DA 3 HOH 4  814 61  HOH HOH I . 
DA 3 HOH 5  815 64  HOH HOH I . 
DA 3 HOH 6  816 65  HOH HOH I . 
DA 3 HOH 7  817 89  HOH HOH I . 
DA 3 HOH 8  818 101 HOH HOH I . 
DA 3 HOH 9  819 110 HOH HOH I . 
DA 3 HOH 10 820 134 HOH HOH I . 
DA 3 HOH 11 821 166 HOH HOH I . 
DA 3 HOH 12 822 175 HOH HOH I . 
DA 3 HOH 13 823 197 HOH HOH I . 
DA 3 HOH 14 824 205 HOH HOH I . 
DA 3 HOH 15 825 213 HOH HOH I . 
DA 3 HOH 16 826 216 HOH HOH I . 
DA 3 HOH 17 827 228 HOH HOH I . 
DA 3 HOH 18 828 238 HOH HOH I . 
DA 3 HOH 19 829 257 HOH HOH I . 
DA 3 HOH 20 830 270 HOH HOH I . 
DA 3 HOH 21 831 272 HOH HOH I . 
DA 3 HOH 22 832 278 HOH HOH I . 
DA 3 HOH 23 833 281 HOH HOH I . 
DA 3 HOH 24 834 299 HOH HOH I . 
DA 3 HOH 25 835 373 HOH HOH I . 
DA 3 HOH 26 836 390 HOH HOH I . 
DA 3 HOH 27 837 404 HOH HOH I . 
DA 3 HOH 28 838 439 HOH HOH I . 
DA 3 HOH 29 839 444 HOH HOH I . 
DA 3 HOH 30 840 447 HOH HOH I . 
DA 3 HOH 31 841 453 HOH HOH I . 
DA 3 HOH 32 842 485 HOH HOH I . 
DA 3 HOH 33 843 497 HOH HOH I . 
DA 3 HOH 34 844 500 HOH HOH I . 
DA 3 HOH 35 845 526 HOH HOH I . 
DA 3 HOH 36 846 538 HOH HOH I . 
DA 3 HOH 37 847 543 HOH HOH I . 
DA 3 HOH 38 848 557 HOH HOH I . 
DA 3 HOH 39 849 564 HOH HOH I . 
DA 3 HOH 40 850 577 HOH HOH I . 
DA 3 HOH 41 851 578 HOH HOH I . 
DA 3 HOH 42 852 582 HOH HOH I . 
DA 3 HOH 43 853 615 HOH HOH I . 
DA 3 HOH 44 854 623 HOH HOH I . 
DA 3 HOH 45 855 625 HOH HOH I . 
DA 3 HOH 46 856 652 HOH HOH I . 
DA 3 HOH 47 857 661 HOH HOH I . 
DA 3 HOH 48 858 670 HOH HOH I . 
DA 3 HOH 49 859 679 HOH HOH I . 
DA 3 HOH 50 860 703 HOH HOH I . 
DA 3 HOH 51 861 726 HOH HOH I . 
DA 3 HOH 52 862 770 HOH HOH I . 
DA 3 HOH 53 863 771 HOH HOH I . 
DA 3 HOH 54 864 772 HOH HOH I . 
EA 3 HOH 1  42  31  HOH HOH J . 
EA 3 HOH 2  43  44  HOH HOH J . 
EA 3 HOH 3  44  57  HOH HOH J . 
EA 3 HOH 4  45  70  HOH HOH J . 
EA 3 HOH 5  46  121 HOH HOH J . 
EA 3 HOH 6  47  193 HOH HOH J . 
EA 3 HOH 7  48  242 HOH HOH J . 
EA 3 HOH 8  49  250 HOH HOH J . 
EA 3 HOH 9  50  254 HOH HOH J . 
EA 3 HOH 10 51  271 HOH HOH J . 
EA 3 HOH 11 52  304 HOH HOH J . 
EA 3 HOH 12 53  365 HOH HOH J . 
EA 3 HOH 13 54  369 HOH HOH J . 
EA 3 HOH 14 55  375 HOH HOH J . 
EA 3 HOH 15 56  385 HOH HOH J . 
EA 3 HOH 16 57  393 HOH HOH J . 
EA 3 HOH 17 58  438 HOH HOH J . 
EA 3 HOH 18 59  443 HOH HOH J . 
EA 3 HOH 19 60  452 HOH HOH J . 
EA 3 HOH 20 61  463 HOH HOH J . 
EA 3 HOH 21 62  502 HOH HOH J . 
EA 3 HOH 22 63  505 HOH HOH J . 
EA 3 HOH 23 64  509 HOH HOH J . 
EA 3 HOH 24 65  546 HOH HOH J . 
EA 3 HOH 25 66  573 HOH HOH J . 
EA 3 HOH 26 67  601 HOH HOH J . 
EA 3 HOH 27 68  608 HOH HOH J . 
EA 3 HOH 28 69  651 HOH HOH J . 
EA 3 HOH 29 70  663 HOH HOH J . 
EA 3 HOH 30 71  678 HOH HOH J . 
EA 3 HOH 31 72  680 HOH HOH J . 
EA 3 HOH 32 73  714 HOH HOH J . 
EA 3 HOH 33 74  720 HOH HOH J . 
EA 3 HOH 34 75  725 HOH HOH J . 
EA 3 HOH 35 76  727 HOH HOH J . 
EA 3 HOH 36 77  745 HOH HOH J . 
EA 3 HOH 37 78  752 HOH HOH J . 
EA 3 HOH 38 79  766 HOH HOH J . 
EA 3 HOH 39 80  805 HOH HOH J . 
FA 3 HOH 1  42  14  HOH HOH K . 
FA 3 HOH 2  43  21  HOH HOH K . 
FA 3 HOH 3  44  26  HOH HOH K . 
FA 3 HOH 4  45  28  HOH HOH K . 
FA 3 HOH 5  46  34  HOH HOH K . 
FA 3 HOH 6  47  35  HOH HOH K . 
FA 3 HOH 7  48  51  HOH HOH K . 
FA 3 HOH 8  49  73  HOH HOH K . 
FA 3 HOH 9  50  78  HOH HOH K . 
FA 3 HOH 10 51  93  HOH HOH K . 
FA 3 HOH 11 52  103 HOH HOH K . 
FA 3 HOH 12 53  109 HOH HOH K . 
FA 3 HOH 13 54  139 HOH HOH K . 
FA 3 HOH 14 55  140 HOH HOH K . 
FA 3 HOH 15 56  146 HOH HOH K . 
FA 3 HOH 16 57  156 HOH HOH K . 
FA 3 HOH 17 58  163 HOH HOH K . 
FA 3 HOH 18 59  178 HOH HOH K . 
FA 3 HOH 19 60  181 HOH HOH K . 
FA 3 HOH 20 61  199 HOH HOH K . 
FA 3 HOH 21 62  201 HOH HOH K . 
FA 3 HOH 22 63  207 HOH HOH K . 
FA 3 HOH 23 64  208 HOH HOH K . 
FA 3 HOH 24 65  209 HOH HOH K . 
FA 3 HOH 25 66  210 HOH HOH K . 
FA 3 HOH 26 67  221 HOH HOH K . 
FA 3 HOH 27 68  229 HOH HOH K . 
FA 3 HOH 28 69  235 HOH HOH K . 
FA 3 HOH 29 70  282 HOH HOH K . 
FA 3 HOH 30 71  293 HOH HOH K . 
FA 3 HOH 31 72  297 HOH HOH K . 
FA 3 HOH 32 73  305 HOH HOH K . 
FA 3 HOH 33 74  309 HOH HOH K . 
FA 3 HOH 34 75  341 HOH HOH K . 
FA 3 HOH 35 76  372 HOH HOH K . 
FA 3 HOH 36 77  376 HOH HOH K . 
FA 3 HOH 37 78  381 HOH HOH K . 
FA 3 HOH 38 79  397 HOH HOH K . 
FA 3 HOH 39 80  400 HOH HOH K . 
FA 3 HOH 40 81  405 HOH HOH K . 
FA 3 HOH 41 82  409 HOH HOH K . 
FA 3 HOH 42 83  410 HOH HOH K . 
FA 3 HOH 43 84  411 HOH HOH K . 
FA 3 HOH 44 85  416 HOH HOH K . 
FA 3 HOH 45 86  423 HOH HOH K . 
FA 3 HOH 46 87  424 HOH HOH K . 
FA 3 HOH 47 88  462 HOH HOH K . 
FA 3 HOH 48 89  514 HOH HOH K . 
FA 3 HOH 49 90  531 HOH HOH K . 
FA 3 HOH 50 91  556 HOH HOH K . 
FA 3 HOH 51 92  561 HOH HOH K . 
FA 3 HOH 52 93  566 HOH HOH K . 
FA 3 HOH 53 94  576 HOH HOH K . 
FA 3 HOH 54 95  579 HOH HOH K . 
FA 3 HOH 55 96  583 HOH HOH K . 
FA 3 HOH 56 97  591 HOH HOH K . 
FA 3 HOH 57 98  598 HOH HOH K . 
FA 3 HOH 58 99  599 HOH HOH K . 
FA 3 HOH 59 100 613 HOH HOH K . 
FA 3 HOH 60 101 644 HOH HOH K . 
FA 3 HOH 61 102 655 HOH HOH K . 
FA 3 HOH 62 103 671 HOH HOH K . 
FA 3 HOH 63 104 676 HOH HOH K . 
FA 3 HOH 64 105 690 HOH HOH K . 
FA 3 HOH 65 106 692 HOH HOH K . 
FA 3 HOH 66 107 697 HOH HOH K . 
FA 3 HOH 67 108 702 HOH HOH K . 
FA 3 HOH 68 109 706 HOH HOH K . 
FA 3 HOH 69 110 708 HOH HOH K . 
FA 3 HOH 70 111 713 HOH HOH K . 
FA 3 HOH 71 112 735 HOH HOH K . 
FA 3 HOH 72 113 750 HOH HOH K . 
FA 3 HOH 73 114 786 HOH HOH K . 
FA 3 HOH 74 115 799 HOH HOH K . 
FA 3 HOH 75 116 803 HOH HOH K . 
FA 3 HOH 76 117 804 HOH HOH K . 
GA 3 HOH 1  56  56  HOH HOH L . 
GA 3 HOH 2  86  86  HOH HOH L . 
GA 3 HOH 3  113 113 HOH HOH L . 
GA 3 HOH 4  116 116 HOH HOH L . 
GA 3 HOH 5  127 127 HOH HOH L . 
GA 3 HOH 6  164 164 HOH HOH L . 
GA 3 HOH 7  168 168 HOH HOH L . 
GA 3 HOH 8  176 176 HOH HOH L . 
GA 3 HOH 9  179 179 HOH HOH L . 
GA 3 HOH 10 189 189 HOH HOH L . 
GA 3 HOH 11 219 219 HOH HOH L . 
GA 3 HOH 12 224 224 HOH HOH L . 
GA 3 HOH 13 260 260 HOH HOH L . 
GA 3 HOH 14 262 262 HOH HOH L . 
GA 3 HOH 15 263 263 HOH HOH L . 
GA 3 HOH 16 284 284 HOH HOH L . 
GA 3 HOH 17 292 292 HOH HOH L . 
GA 3 HOH 18 294 294 HOH HOH L . 
GA 3 HOH 19 295 295 HOH HOH L . 
GA 3 HOH 20 296 296 HOH HOH L . 
GA 3 HOH 21 326 326 HOH HOH L . 
GA 3 HOH 22 366 366 HOH HOH L . 
GA 3 HOH 23 398 398 HOH HOH L . 
GA 3 HOH 24 402 402 HOH HOH L . 
GA 3 HOH 25 406 406 HOH HOH L . 
GA 3 HOH 26 431 431 HOH HOH L . 
GA 3 HOH 27 434 434 HOH HOH L . 
GA 3 HOH 28 455 455 HOH HOH L . 
GA 3 HOH 29 457 457 HOH HOH L . 
GA 3 HOH 30 469 469 HOH HOH L . 
GA 3 HOH 31 490 490 HOH HOH L . 
GA 3 HOH 32 506 506 HOH HOH L . 
GA 3 HOH 33 524 524 HOH HOH L . 
GA 3 HOH 34 529 529 HOH HOH L . 
GA 3 HOH 35 535 535 HOH HOH L . 
GA 3 HOH 36 554 554 HOH HOH L . 
GA 3 HOH 37 562 562 HOH HOH L . 
GA 3 HOH 38 563 563 HOH HOH L . 
GA 3 HOH 39 609 609 HOH HOH L . 
GA 3 HOH 40 618 618 HOH HOH L . 
GA 3 HOH 41 621 621 HOH HOH L . 
GA 3 HOH 42 630 630 HOH HOH L . 
GA 3 HOH 43 660 660 HOH HOH L . 
GA 3 HOH 44 685 685 HOH HOH L . 
GA 3 HOH 45 715 715 HOH HOH L . 
GA 3 HOH 46 732 732 HOH HOH L . 
GA 3 HOH 47 740 740 HOH HOH L . 
GA 3 HOH 48 755 755 HOH HOH L . 
GA 3 HOH 49 757 757 HOH HOH L . 
GA 3 HOH 50 758 758 HOH HOH L . 
GA 3 HOH 51 762 762 HOH HOH L . 
GA 3 HOH 52 782 782 HOH HOH L . 
GA 3 HOH 53 787 787 HOH HOH L . 
HA 3 HOH 1  808 2   HOH HOH M . 
HA 3 HOH 2  809 5   HOH HOH M . 
HA 3 HOH 3  810 7   HOH HOH M . 
HA 3 HOH 4  811 16  HOH HOH M . 
HA 3 HOH 5  812 18  HOH HOH M . 
HA 3 HOH 6  813 27  HOH HOH M . 
HA 3 HOH 7  814 45  HOH HOH M . 
HA 3 HOH 8  815 55  HOH HOH M . 
HA 3 HOH 9  816 72  HOH HOH M . 
HA 3 HOH 10 817 92  HOH HOH M . 
HA 3 HOH 11 818 100 HOH HOH M . 
HA 3 HOH 12 819 108 HOH HOH M . 
HA 3 HOH 13 820 124 HOH HOH M . 
HA 3 HOH 14 821 130 HOH HOH M . 
HA 3 HOH 15 822 137 HOH HOH M . 
HA 3 HOH 16 823 159 HOH HOH M . 
HA 3 HOH 17 824 173 HOH HOH M . 
HA 3 HOH 18 825 184 HOH HOH M . 
HA 3 HOH 19 826 185 HOH HOH M . 
HA 3 HOH 20 827 196 HOH HOH M . 
HA 3 HOH 21 828 211 HOH HOH M . 
HA 3 HOH 22 829 225 HOH HOH M . 
HA 3 HOH 23 830 233 HOH HOH M . 
HA 3 HOH 24 831 359 HOH HOH M . 
HA 3 HOH 25 832 374 HOH HOH M . 
HA 3 HOH 26 833 379 HOH HOH M . 
HA 3 HOH 27 834 382 HOH HOH M . 
HA 3 HOH 28 835 396 HOH HOH M . 
HA 3 HOH 29 836 407 HOH HOH M . 
HA 3 HOH 30 837 408 HOH HOH M . 
HA 3 HOH 31 838 419 HOH HOH M . 
HA 3 HOH 32 839 425 HOH HOH M . 
HA 3 HOH 33 840 433 HOH HOH M . 
HA 3 HOH 34 841 446 HOH HOH M . 
HA 3 HOH 35 842 451 HOH HOH M . 
HA 3 HOH 36 843 467 HOH HOH M . 
HA 3 HOH 37 844 476 HOH HOH M . 
HA 3 HOH 38 845 478 HOH HOH M . 
HA 3 HOH 39 846 494 HOH HOH M . 
HA 3 HOH 40 847 504 HOH HOH M . 
HA 3 HOH 41 848 510 HOH HOH M . 
HA 3 HOH 42 849 534 HOH HOH M . 
HA 3 HOH 43 850 542 HOH HOH M . 
HA 3 HOH 44 851 575 HOH HOH M . 
HA 3 HOH 45 852 589 HOH HOH M . 
HA 3 HOH 46 853 600 HOH HOH M . 
HA 3 HOH 47 854 605 HOH HOH M . 
HA 3 HOH 48 855 612 HOH HOH M . 
HA 3 HOH 49 856 617 HOH HOH M . 
HA 3 HOH 50 857 664 HOH HOH M . 
HA 3 HOH 51 858 669 HOH HOH M . 
HA 3 HOH 52 859 686 HOH HOH M . 
HA 3 HOH 53 860 689 HOH HOH M . 
HA 3 HOH 54 861 704 HOH HOH M . 
HA 3 HOH 55 862 719 HOH HOH M . 
HA 3 HOH 56 863 730 HOH HOH M . 
HA 3 HOH 57 864 764 HOH HOH M . 
HA 3 HOH 58 865 800 HOH HOH M . 
IA 3 HOH 1  42  39  HOH HOH N . 
IA 3 HOH 2  43  40  HOH HOH N . 
IA 3 HOH 3  44  54  HOH HOH N . 
IA 3 HOH 4  45  82  HOH HOH N . 
IA 3 HOH 5  46  84  HOH HOH N . 
IA 3 HOH 6  47  95  HOH HOH N . 
IA 3 HOH 7  48  96  HOH HOH N . 
IA 3 HOH 8  49  98  HOH HOH N . 
IA 3 HOH 9  50  106 HOH HOH N . 
IA 3 HOH 10 51  107 HOH HOH N . 
IA 3 HOH 11 52  126 HOH HOH N . 
IA 3 HOH 12 53  135 HOH HOH N . 
IA 3 HOH 13 54  143 HOH HOH N . 
IA 3 HOH 14 55  157 HOH HOH N . 
IA 3 HOH 15 56  186 HOH HOH N . 
IA 3 HOH 16 57  192 HOH HOH N . 
IA 3 HOH 17 58  206 HOH HOH N . 
IA 3 HOH 18 59  214 HOH HOH N . 
IA 3 HOH 19 60  215 HOH HOH N . 
IA 3 HOH 20 61  239 HOH HOH N . 
IA 3 HOH 21 62  248 HOH HOH N . 
IA 3 HOH 22 63  266 HOH HOH N . 
IA 3 HOH 23 64  383 HOH HOH N . 
IA 3 HOH 24 65  384 HOH HOH N . 
IA 3 HOH 25 66  389 HOH HOH N . 
IA 3 HOH 26 67  392 HOH HOH N . 
IA 3 HOH 27 68  422 HOH HOH N . 
IA 3 HOH 28 69  432 HOH HOH N . 
IA 3 HOH 29 70  461 HOH HOH N . 
IA 3 HOH 30 71  472 HOH HOH N . 
IA 3 HOH 31 72  480 HOH HOH N . 
IA 3 HOH 32 73  483 HOH HOH N . 
IA 3 HOH 33 74  495 HOH HOH N . 
IA 3 HOH 34 75  507 HOH HOH N . 
IA 3 HOH 35 76  520 HOH HOH N . 
IA 3 HOH 36 77  527 HOH HOH N . 
IA 3 HOH 37 78  533 HOH HOH N . 
IA 3 HOH 38 79  539 HOH HOH N . 
IA 3 HOH 39 80  545 HOH HOH N . 
IA 3 HOH 40 81  551 HOH HOH N . 
IA 3 HOH 41 82  553 HOH HOH N . 
IA 3 HOH 42 83  567 HOH HOH N . 
IA 3 HOH 43 84  622 HOH HOH N . 
IA 3 HOH 44 85  624 HOH HOH N . 
IA 3 HOH 45 86  650 HOH HOH N . 
IA 3 HOH 46 87  654 HOH HOH N . 
IA 3 HOH 47 88  657 HOH HOH N . 
IA 3 HOH 48 89  668 HOH HOH N . 
IA 3 HOH 49 90  672 HOH HOH N . 
IA 3 HOH 50 91  698 HOH HOH N . 
IA 3 HOH 51 92  701 HOH HOH N . 
IA 3 HOH 52 93  721 HOH HOH N . 
IA 3 HOH 53 94  734 HOH HOH N . 
IA 3 HOH 54 95  747 HOH HOH N . 
IA 3 HOH 55 96  779 HOH HOH N . 
IA 3 HOH 56 97  793 HOH HOH N . 
IA 3 HOH 57 98  795 HOH HOH N . 
JA 3 HOH 1  42  12  HOH HOH O . 
JA 3 HOH 2  43  53  HOH HOH O . 
JA 3 HOH 3  44  71  HOH HOH O . 
JA 3 HOH 4  45  81  HOH HOH O . 
JA 3 HOH 5  46  90  HOH HOH O . 
JA 3 HOH 6  47  115 HOH HOH O . 
JA 3 HOH 7  48  120 HOH HOH O . 
JA 3 HOH 8  49  122 HOH HOH O . 
JA 3 HOH 9  50  123 HOH HOH O . 
JA 3 HOH 10 51  142 HOH HOH O . 
JA 3 HOH 11 52  148 HOH HOH O . 
JA 3 HOH 12 53  151 HOH HOH O . 
JA 3 HOH 13 54  153 HOH HOH O . 
JA 3 HOH 14 55  158 HOH HOH O . 
JA 3 HOH 15 56  165 HOH HOH O . 
JA 3 HOH 16 57  188 HOH HOH O . 
JA 3 HOH 17 58  194 HOH HOH O . 
JA 3 HOH 18 59  203 HOH HOH O . 
JA 3 HOH 19 60  236 HOH HOH O . 
JA 3 HOH 20 61  240 HOH HOH O . 
JA 3 HOH 21 62  251 HOH HOH O . 
JA 3 HOH 22 63  252 HOH HOH O . 
JA 3 HOH 23 64  267 HOH HOH O . 
JA 3 HOH 24 65  275 HOH HOH O . 
JA 3 HOH 25 66  298 HOH HOH O . 
JA 3 HOH 26 67  395 HOH HOH O . 
JA 3 HOH 27 68  401 HOH HOH O . 
JA 3 HOH 28 69  440 HOH HOH O . 
JA 3 HOH 29 70  449 HOH HOH O . 
JA 3 HOH 30 71  459 HOH HOH O . 
JA 3 HOH 31 72  466 HOH HOH O . 
JA 3 HOH 32 73  484 HOH HOH O . 
JA 3 HOH 33 74  487 HOH HOH O . 
JA 3 HOH 34 75  489 HOH HOH O . 
JA 3 HOH 35 76  515 HOH HOH O . 
JA 3 HOH 36 77  540 HOH HOH O . 
JA 3 HOH 37 78  548 HOH HOH O . 
JA 3 HOH 38 79  560 HOH HOH O . 
JA 3 HOH 39 80  572 HOH HOH O . 
JA 3 HOH 40 81  581 HOH HOH O . 
JA 3 HOH 41 82  584 HOH HOH O . 
JA 3 HOH 42 83  620 HOH HOH O . 
JA 3 HOH 43 84  656 HOH HOH O . 
JA 3 HOH 44 85  681 HOH HOH O . 
JA 3 HOH 45 86  691 HOH HOH O . 
JA 3 HOH 46 87  716 HOH HOH O . 
JA 3 HOH 47 88  738 HOH HOH O . 
JA 3 HOH 48 89  748 HOH HOH O . 
JA 3 HOH 49 90  768 HOH HOH O . 
JA 3 HOH 50 91  781 HOH HOH O . 
JA 3 HOH 51 92  785 HOH HOH O . 
JA 3 HOH 52 93  797 HOH HOH O . 
KA 3 HOH 1  42  24  HOH HOH P . 
KA 3 HOH 2  43  119 HOH HOH P . 
KA 3 HOH 3  44  174 HOH HOH P . 
KA 3 HOH 4  45  198 HOH HOH P . 
KA 3 HOH 5  46  234 HOH HOH P . 
KA 3 HOH 6  47  303 HOH HOH P . 
KA 3 HOH 7  48  421 HOH HOH P . 
KA 3 HOH 8  49  442 HOH HOH P . 
KA 3 HOH 9  50  464 HOH HOH P . 
KA 3 HOH 10 51  521 HOH HOH P . 
KA 3 HOH 11 52  522 HOH HOH P . 
KA 3 HOH 12 53  530 HOH HOH P . 
KA 3 HOH 13 54  532 HOH HOH P . 
KA 3 HOH 14 55  536 HOH HOH P . 
KA 3 HOH 15 56  549 HOH HOH P . 
KA 3 HOH 16 57  552 HOH HOH P . 
KA 3 HOH 17 58  559 HOH HOH P . 
KA 3 HOH 18 59  569 HOH HOH P . 
KA 3 HOH 19 60  570 HOH HOH P . 
KA 3 HOH 20 61  611 HOH HOH P . 
KA 3 HOH 21 62  616 HOH HOH P . 
KA 3 HOH 22 63  637 HOH HOH P . 
KA 3 HOH 23 64  643 HOH HOH P . 
KA 3 HOH 24 65  649 HOH HOH P . 
KA 3 HOH 25 66  673 HOH HOH P . 
KA 3 HOH 26 67  695 HOH HOH P . 
KA 3 HOH 27 68  711 HOH HOH P . 
KA 3 HOH 28 69  741 HOH HOH P . 
KA 3 HOH 29 70  774 HOH HOH P . 
KA 3 HOH 30 71  778 HOH HOH P . 
KA 3 HOH 31 72  790 HOH HOH P . 
KA 3 HOH 32 73  792 HOH HOH P . 
KA 3 HOH 33 74  794 HOH HOH P . 
#