data_1FLL
# 
_entry.id   1FLL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FLL         
RCSB  RCSB011692   
WWPDB D_1000011692 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1FLK 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FLL 
_pdbx_database_status.recvd_initial_deposition_date   2000-08-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ni, C.-Z.'    1 
'Welsh, K.'    2 
'Leo, E.'      3 
'Chiou, C.-K.' 4 
'Wu, H.'       5 
'Reed, J.C.'   6 
'Ely, K.R.'    7 
# 
_citation.id                        primary 
_citation.title                     'Molecular basis for CD40 signaling mediated by TRAF3.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            97 
_citation.page_first                10395 
_citation.page_last                 10399 
_citation.year                      2000 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10984535 
_citation.pdbx_database_id_DOI      10.1073/pnas.97.19.10395 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ni, C.Z.'    1 
primary 'Welsh, K.'   2 
primary 'Leo, E.'     3 
primary 'Chiou, C.K.' 4 
primary 'Wu, H.'      5 
primary 'Reed, J.C.'  6 
primary 'Ely, K.R.'   7 
# 
_cell.entry_id           1FLL 
_cell.length_a           83.760 
_cell.length_b           83.760 
_cell.length_c           212.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FLL 
_symmetry.space_group_name_H-M             'P 3 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                150 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TNF RECEPTOR ASSOCIATED FACTOR 3' 25885.521 2 ? ?              'TRAF DOMAIN'            ? 
2 polymer syn 'B-CELL SURFACE ANTIGEN CD40'      2195.341  2 ? 'N246K, C258S' 'CD40 (246-266) PEPTIDE' ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;RQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD
QGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
;
;RQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD
QGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPDP
;
A,B ? 
2 'polypeptide(L)' no no KTAAPVQETLHGSQPVTQEDG KTAAPVQETLHGSQPVTQEDG X,Y ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   GLN n 
1 3   ASN n 
1 4   TRP n 
1 5   GLU n 
1 6   GLU n 
1 7   ALA n 
1 8   ASP n 
1 9   SER n 
1 10  MET n 
1 11  LYS n 
1 12  SER n 
1 13  SER n 
1 14  VAL n 
1 15  GLU n 
1 16  SER n 
1 17  LEU n 
1 18  GLN n 
1 19  ASN n 
1 20  ARG n 
1 21  VAL n 
1 22  THR n 
1 23  GLU n 
1 24  LEU n 
1 25  GLU n 
1 26  SER n 
1 27  VAL n 
1 28  ASP n 
1 29  LYS n 
1 30  SER n 
1 31  ALA n 
1 32  GLY n 
1 33  GLN n 
1 34  VAL n 
1 35  ALA n 
1 36  ARG n 
1 37  ASN n 
1 38  THR n 
1 39  GLY n 
1 40  LEU n 
1 41  LEU n 
1 42  GLU n 
1 43  SER n 
1 44  GLN n 
1 45  LEU n 
1 46  SER n 
1 47  ARG n 
1 48  HIS n 
1 49  ASP n 
1 50  GLN n 
1 51  MET n 
1 52  LEU n 
1 53  SER n 
1 54  VAL n 
1 55  HIS n 
1 56  ASP n 
1 57  ILE n 
1 58  ARG n 
1 59  LEU n 
1 60  ALA n 
1 61  ASP n 
1 62  MET n 
1 63  ASP n 
1 64  LEU n 
1 65  ARG n 
1 66  PHE n 
1 67  GLN n 
1 68  VAL n 
1 69  LEU n 
1 70  GLU n 
1 71  THR n 
1 72  ALA n 
1 73  SER n 
1 74  TYR n 
1 75  ASN n 
1 76  GLY n 
1 77  VAL n 
1 78  LEU n 
1 79  ILE n 
1 80  TRP n 
1 81  LYS n 
1 82  ILE n 
1 83  ARG n 
1 84  ASP n 
1 85  TYR n 
1 86  LYS n 
1 87  ARG n 
1 88  ARG n 
1 89  LYS n 
1 90  GLN n 
1 91  GLU n 
1 92  ALA n 
1 93  VAL n 
1 94  MET n 
1 95  GLY n 
1 96  LYS n 
1 97  THR n 
1 98  LEU n 
1 99  SER n 
1 100 LEU n 
1 101 TYR n 
1 102 SER n 
1 103 GLN n 
1 104 PRO n 
1 105 PHE n 
1 106 TYR n 
1 107 THR n 
1 108 GLY n 
1 109 TYR n 
1 110 PHE n 
1 111 GLY n 
1 112 TYR n 
1 113 LYS n 
1 114 MET n 
1 115 CYS n 
1 116 ALA n 
1 117 ARG n 
1 118 VAL n 
1 119 TYR n 
1 120 LEU n 
1 121 ASN n 
1 122 GLY n 
1 123 ASP n 
1 124 GLY n 
1 125 MET n 
1 126 GLY n 
1 127 LYS n 
1 128 GLY n 
1 129 THR n 
1 130 HIS n 
1 131 LEU n 
1 132 SER n 
1 133 LEU n 
1 134 PHE n 
1 135 PHE n 
1 136 VAL n 
1 137 ILE n 
1 138 MET n 
1 139 ARG n 
1 140 GLY n 
1 141 GLU n 
1 142 TYR n 
1 143 ASP n 
1 144 ALA n 
1 145 LEU n 
1 146 LEU n 
1 147 PRO n 
1 148 TRP n 
1 149 PRO n 
1 150 PHE n 
1 151 LYS n 
1 152 GLN n 
1 153 LYS n 
1 154 VAL n 
1 155 THR n 
1 156 LEU n 
1 157 MET n 
1 158 LEU n 
1 159 MET n 
1 160 ASP n 
1 161 GLN n 
1 162 GLY n 
1 163 SER n 
1 164 SER n 
1 165 ARG n 
1 166 ARG n 
1 167 HIS n 
1 168 LEU n 
1 169 GLY n 
1 170 ASP n 
1 171 ALA n 
1 172 PHE n 
1 173 LYS n 
1 174 PRO n 
1 175 ASP n 
1 176 PRO n 
1 177 ASN n 
1 178 SER n 
1 179 SER n 
1 180 SER n 
1 181 PHE n 
1 182 LYS n 
1 183 LYS n 
1 184 PRO n 
1 185 THR n 
1 186 GLY n 
1 187 GLU n 
1 188 MET n 
1 189 ASN n 
1 190 ILE n 
1 191 ALA n 
1 192 SER n 
1 193 GLY n 
1 194 CYS n 
1 195 PRO n 
1 196 VAL n 
1 197 PHE n 
1 198 VAL n 
1 199 ALA n 
1 200 GLN n 
1 201 THR n 
1 202 VAL n 
1 203 LEU n 
1 204 GLU n 
1 205 ASN n 
1 206 GLY n 
1 207 THR n 
1 208 TYR n 
1 209 ILE n 
1 210 LYS n 
1 211 ASP n 
1 212 ASP n 
1 213 THR n 
1 214 ILE n 
1 215 PHE n 
1 216 ILE n 
1 217 LYS n 
1 218 VAL n 
1 219 ILE n 
1 220 VAL n 
1 221 ASP n 
1 222 THR n 
1 223 SER n 
1 224 ASP n 
1 225 LEU n 
1 226 PRO n 
1 227 ASP n 
1 228 PRO n 
2 1   LYS n 
2 2   THR n 
2 3   ALA n 
2 4   ALA n 
2 5   PRO n 
2 6   VAL n 
2 7   GLN n 
2 8   GLU n 
2 9   THR n 
2 10  LEU n 
2 11  HIS n 
2 12  GLY n 
2 13  SER n 
2 14  GLN n 
2 15  PRO n 
2 16  VAL n 
2 17  THR n 
2 18  GLN n 
2 19  GLU n 
2 20  ASP n 
2 21  GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET21B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'THIS PEPTIDE WAS CHEMICALLY SYNTHESIZED. THE SEQUENCE OF THIS PEPTIDE OCCURS NATURALLY IN HUMANS (HOMO SAPIENS)' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP TRAF3_HUMAN 1 ? ? Q13114 ? 
2 UNP TNR5_HUMAN  2 ? ? P25942 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FLL A 1 ? 228 ? Q13114 341 ? 568 ? 277 504 
2 1 1FLL B 1 ? 228 ? Q13114 341 ? 568 ? 277 504 
3 2 1FLL X 1 ? 21  ? P25942 246 ? 266 ? 246 266 
4 2 1FLL Y 1 ? 21  ? P25942 246 ? 266 ? 246 266 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1FLL LYS X 1  ? UNP P25942 ASN 246 ENGINEERED 246 1 
3 1FLL SER X 13 ? UNP P25942 CYS 258 ENGINEERED 258 2 
4 1FLL LYS Y 1  ? UNP P25942 ASN 246 ENGINEERED 246 3 
4 1FLL SER Y 13 ? UNP P25942 CYS 258 ENGINEERED 258 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FLL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.83 
_exptl_crystal.density_percent_sol   67.87 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'METHANOL, SODIUM CHLORIDE, TRIS BUFFER, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           108.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1999-05-27 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             0.98 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FLL 
_reflns.observed_criterion_sigma_I   2.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            3.500 
_reflns.number_obs                   29115 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         78.7 
_reflns.pdbx_Rmerge_I_obs            0.0780000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.0000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.000 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.50 
_reflns_shell.d_res_low              3.63 
_reflns_shell.percent_possible_all   74.5 
_reflns_shell.Rmerge_I_obs           0.2600000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1FLL 
_refine.ls_number_reflns_obs                     7586 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            3.50 
_refine.ls_percent_reflns_obs                    72.6 
_refine.ls_R_factor_obs                          0.1730000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1730000 
_refine.ls_R_factor_R_free                       0.3120000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  351 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3558 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3558 
_refine_hist.d_res_high                       3.50 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.55  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1FLL 
_struct.title                     'MOLECULAR BASIS FOR CD40 SIGNALING MEDIATED BY TRAF3' 
_struct.pdbx_descriptor           'TNF RECEPTOR ASSOCIATED FACTOR 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FLL 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'TRAF3 WITH CD40 PEPTIDE, TNF SIGNALING, APOPTOSIS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
1 
2 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  VAL A 27  ? GLY A 32  ? VAL A 303 GLY A 308 1 ? 6  
HELX_P HELX_P2  2  GLN A 33  ? ALA A 35  ? GLN A 309 ALA A 311 5 ? 3  
HELX_P HELX_P3  3  ASN A 37  ? GLU A 70  ? ASN A 313 GLU A 346 1 ? 34 
HELX_P HELX_P4  4  ASP A 84  ? LYS A 89  ? ASP A 360 LYS A 365 1 ? 6  
HELX_P HELX_P5  5  ALA A 199 ? GLU A 204 ? ALA A 475 GLU A 480 1 ? 6  
HELX_P HELX_P6  6  GLU C 25  ? LYS C 29  ? GLU B 301 LYS B 305 5 ? 5  
HELX_P HELX_P7  7  VAL C 34  ? SER C 53  ? VAL B 310 SER B 329 1 ? 20 
HELX_P HELX_P8  8  VAL C 54  ? GLU C 70  ? VAL B 330 GLU B 346 1 ? 17 
HELX_P HELX_P9  9  ASP C 84  ? MET C 94  ? ASP B 360 MET B 370 1 ? 11 
HELX_P HELX_P10 10 TYR C 142 ? LEU C 146 ? TYR B 418 LEU B 422 5 ? 5  
HELX_P HELX_P11 11 ALA C 199 ? ASN C 205 ? ALA B 475 ASN B 481 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 148 A . ? TRP 424 A PRO 149 A ? PRO 425 A 1 0.07 
2 TRP 148 C . ? TRP 424 B PRO 149 C ? PRO 425 B 1 0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 3 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 77  ? ARG A 83  ? VAL A 353 ARG A 359 
A 2 THR A 213 ? ILE A 219 ? THR A 489 ILE A 495 
A 3 THR A 155 ? MET A 159 ? THR A 431 MET A 435 
A 4 LEU A 168 ? ASP A 170 ? LEU A 444 ASP A 446 
B 1 LEU A 100 ? TYR A 101 ? LEU A 376 TYR A 377 
B 2 ALA A 116 ? TYR A 119 ? ALA A 392 TYR A 395 
B 3 LEU A 131 ? PHE A 135 ? LEU A 407 PHE A 411 
B 4 CYS A 194 ? VAL A 198 ? CYS A 470 VAL A 474 
C 1 ILE C 79  ? ARG C 83  ? ILE B 355 ARG B 359 
C 2 THR C 213 ? LYS C 217 ? THR B 489 LYS B 493 
C 3 THR C 155 ? MET C 159 ? THR B 431 MET B 435 
C 4 LEU C 168 ? ALA C 171 ? LEU B 444 ALA B 447 
D 1 LEU C 100 ? TYR C 101 ? LEU B 376 TYR B 377 
D 2 ARG C 117 ? TYR C 119 ? ARG B 393 TYR B 395 
D 3 SER C 132 ? LEU C 133 ? SER B 408 LEU B 409 
E 1 LYS C 113 ? MET C 114 ? LYS B 389 MET B 390 
E 2 ILE C 137 ? MET C 138 ? ILE B 413 MET B 414 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 82  ? O ILE A 358 N ILE A 214 ? N ILE A 490 
A 2 3 O ILE A 219 ? O ILE A 495 N THR A 155 ? N THR A 431 
A 3 4 N LEU A 158 ? N LEU A 434 O LEU A 168 ? O LEU A 444 
B 1 2 O LEU A 100 ? O LEU A 376 N VAL A 118 ? N VAL A 394 
B 2 3 N TYR A 119 ? N TYR A 395 O SER A 132 ? O SER A 408 
B 3 4 O LEU A 133 ? O LEU A 409 N CYS A 194 ? N CYS A 470 
C 1 2 N ILE C 82  ? N ILE B 358 O ILE C 214 ? O ILE B 490 
C 2 3 N LYS C 217 ? N LYS B 493 O MET C 157 ? O MET B 433 
C 3 4 O LEU C 158 ? O LEU B 434 N LEU C 168 ? N LEU B 444 
D 1 2 N LEU C 100 ? N LEU B 376 O VAL C 118 ? O VAL B 394 
D 2 3 N TYR C 119 ? N TYR B 395 O SER C 132 ? O SER B 408 
E 1 2 O LYS C 113 ? O LYS B 389 N MET C 138 ? N MET B 414 
# 
_database_PDB_matrix.entry_id          1FLL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FLL 
_atom_sites.fract_transf_matrix[1][1]   0.011939 
_atom_sites.fract_transf_matrix[1][2]   0.006893 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013786 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004704 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . LEU A 1 24  ? -0.527  40.866 -52.527 1.00 70.51 ? 300 LEU A N   1 
ATOM 2    C CA  . LEU A 1 24  ? -0.271  40.986 -51.064 1.00 70.77 ? 300 LEU A CA  1 
ATOM 3    C C   . LEU A 1 24  ? -1.275  40.203 -50.216 1.00 70.07 ? 300 LEU A C   1 
ATOM 4    O O   . LEU A 1 24  ? -2.469  40.506 -50.196 1.00 70.24 ? 300 LEU A O   1 
ATOM 5    C CB  . LEU A 1 24  ? -0.284  42.462 -50.645 1.00 70.08 ? 300 LEU A CB  1 
ATOM 6    C CG  . LEU A 1 24  ? 0.991   43.288 -50.874 1.00 70.48 ? 300 LEU A CG  1 
ATOM 7    C CD1 . LEU A 1 24  ? 1.480   43.149 -52.315 1.00 68.73 ? 300 LEU A CD1 1 
ATOM 8    C CD2 . LEU A 1 24  ? 0.708   44.748 -50.529 1.00 70.58 ? 300 LEU A CD2 1 
ATOM 9    N N   . GLU A 1 25  ? -0.770  39.187 -49.526 1.00 70.44 ? 301 GLU A N   1 
ATOM 10   C CA  . GLU A 1 25  ? -1.578  38.350 -48.647 1.00 69.76 ? 301 GLU A CA  1 
ATOM 11   C C   . GLU A 1 25  ? -0.680  37.301 -48.005 1.00 69.08 ? 301 GLU A C   1 
ATOM 12   O O   . GLU A 1 25  ? -1.064  36.643 -47.035 1.00 68.48 ? 301 GLU A O   1 
ATOM 13   C CB  . GLU A 1 25  ? -2.722  37.679 -49.414 1.00 71.07 ? 301 GLU A CB  1 
ATOM 14   C CG  . GLU A 1 25  ? -3.635  36.831 -48.528 1.00 70.11 ? 301 GLU A CG  1 
ATOM 15   C CD  . GLU A 1 25  ? -3.977  37.510 -47.206 1.00 70.13 ? 301 GLU A CD  1 
ATOM 16   O OE1 . GLU A 1 25  ? -4.498  38.649 -47.221 1.00 71.21 ? 301 GLU A OE1 1 
ATOM 17   O OE2 . GLU A 1 25  ? -3.725  36.896 -46.148 1.00 68.27 ? 301 GLU A OE2 1 
ATOM 18   N N   . SER A 1 26  ? 0.524   37.166 -48.557 1.00 69.17 ? 302 SER A N   1 
ATOM 19   C CA  . SER A 1 26  ? 1.529   36.224 -48.065 1.00 68.97 ? 302 SER A CA  1 
ATOM 20   C C   . SER A 1 26  ? 2.515   37.031 -47.232 1.00 69.59 ? 302 SER A C   1 
ATOM 21   O O   . SER A 1 26  ? 2.945   36.611 -46.153 1.00 70.86 ? 302 SER A O   1 
ATOM 22   C CB  . SER A 1 26  ? 2.255   35.577 -49.243 1.00 66.78 ? 302 SER A CB  1 
ATOM 23   O OG  . SER A 1 26  ? 2.762   36.571 -50.121 1.00 68.11 ? 302 SER A OG  1 
ATOM 24   N N   . VAL A 1 27  ? 2.867   38.197 -47.764 1.00 69.29 ? 303 VAL A N   1 
ATOM 25   C CA  . VAL A 1 27  ? 3.775   39.118 -47.100 1.00 68.41 ? 303 VAL A CA  1 
ATOM 26   C C   . VAL A 1 27  ? 2.914   40.259 -46.565 1.00 69.35 ? 303 VAL A C   1 
ATOM 27   O O   . VAL A 1 27  ? 3.404   41.158 -45.885 1.00 68.42 ? 303 VAL A O   1 
ATOM 28   C CB  . VAL A 1 27  ? 4.852   39.675 -48.079 1.00 66.86 ? 303 VAL A CB  1 
ATOM 29   C CG1 . VAL A 1 27  ? 5.864   40.542 -47.323 1.00 66.47 ? 303 VAL A CG1 1 
ATOM 30   C CG2 . VAL A 1 27  ? 5.567   38.523 -48.774 1.00 66.72 ? 303 VAL A CG2 1 
ATOM 31   N N   . ASP A 1 28  ? 1.624   40.224 -46.885 1.00 70.78 ? 304 ASP A N   1 
ATOM 32   C CA  . ASP A 1 28  ? 0.720   41.245 -46.382 1.00 72.66 ? 304 ASP A CA  1 
ATOM 33   C C   . ASP A 1 28  ? 0.677   40.941 -44.890 1.00 73.45 ? 304 ASP A C   1 
ATOM 34   O O   . ASP A 1 28  ? 0.406   41.812 -44.059 1.00 72.94 ? 304 ASP A O   1 
ATOM 35   C CB  . ASP A 1 28  ? -0.677  41.103 -47.010 1.00 75.10 ? 304 ASP A CB  1 
ATOM 36   C CG  . ASP A 1 28  ? -1.591  40.156 -46.232 1.00 77.43 ? 304 ASP A CG  1 
ATOM 37   O OD1 . ASP A 1 28  ? -1.143  39.040 -45.890 1.00 77.87 ? 304 ASP A OD1 1 
ATOM 38   O OD2 . ASP A 1 28  ? -2.765  40.523 -45.978 1.00 78.53 ? 304 ASP A OD2 1 
ATOM 39   N N   . LYS A 1 29  ? 0.968   39.681 -44.573 1.00 74.10 ? 305 LYS A N   1 
ATOM 40   C CA  . LYS A 1 29  ? 0.996   39.206 -43.200 1.00 73.95 ? 305 LYS A CA  1 
ATOM 41   C C   . LYS A 1 29  ? 2.299   39.662 -42.559 1.00 73.15 ? 305 LYS A C   1 
ATOM 42   O O   . LYS A 1 29  ? 2.463   39.580 -41.344 1.00 73.74 ? 305 LYS A O   1 
ATOM 43   C CB  . LYS A 1 29  ? 0.870   37.678 -43.163 1.00 74.81 ? 305 LYS A CB  1 
ATOM 44   C CG  . LYS A 1 29  ? -0.515  37.179 -43.566 1.00 76.99 ? 305 LYS A CG  1 
ATOM 45   C CD  . LYS A 1 29  ? -0.667  35.663 -43.450 1.00 78.42 ? 305 LYS A CD  1 
ATOM 46   C CE  . LYS A 1 29  ? 0.079   34.916 -44.551 1.00 78.30 ? 305 LYS A CE  1 
ATOM 47   N NZ  . LYS A 1 29  ? -0.178  33.443 -44.514 1.00 78.22 ? 305 LYS A NZ  1 
ATOM 48   N N   . SER A 1 30  ? 3.227   40.131 -43.391 1.00 71.91 ? 306 SER A N   1 
ATOM 49   C CA  . SER A 1 30  ? 4.509   40.649 -42.914 1.00 69.38 ? 306 SER A CA  1 
ATOM 50   C C   . SER A 1 30  ? 4.166   41.966 -42.248 1.00 67.13 ? 306 SER A C   1 
ATOM 51   O O   . SER A 1 30  ? 4.612   42.264 -41.139 1.00 65.61 ? 306 SER A O   1 
ATOM 52   C CB  . SER A 1 30  ? 5.465   40.907 -44.082 1.00 68.37 ? 306 SER A CB  1 
ATOM 53   O OG  . SER A 1 30  ? 6.386   41.940 -43.771 1.00 69.04 ? 306 SER A OG  1 
ATOM 54   N N   . ALA A 1 31  ? 3.370   42.757 -42.959 1.00 64.46 ? 307 ALA A N   1 
ATOM 55   C CA  . ALA A 1 31  ? 2.905   44.031 -42.448 1.00 62.54 ? 307 ALA A CA  1 
ATOM 56   C C   . ALA A 1 31  ? 1.982   43.600 -41.325 1.00 62.74 ? 307 ALA A C   1 
ATOM 57   O O   . ALA A 1 31  ? 1.828   44.298 -40.328 1.00 63.66 ? 307 ALA A O   1 
ATOM 58   C CB  . ALA A 1 31  ? 2.125   44.769 -43.521 1.00 60.27 ? 307 ALA A CB  1 
ATOM 59   N N   . GLY A 1 32  ? 1.386   42.422 -41.510 1.00 61.81 ? 308 GLY A N   1 
ATOM 60   C CA  . GLY A 1 32  ? 0.481   41.854 -40.525 1.00 61.60 ? 308 GLY A CA  1 
ATOM 61   C C   . GLY A 1 32  ? 1.239   41.265 -39.350 1.00 61.90 ? 308 GLY A C   1 
ATOM 62   O O   . GLY A 1 32  ? 0.656   40.955 -38.311 1.00 60.45 ? 308 GLY A O   1 
ATOM 63   N N   . GLN A 1 33  ? 2.545   41.100 -39.519 1.00 62.82 ? 309 GLN A N   1 
ATOM 64   C CA  . GLN A 1 33  ? 3.375   40.574 -38.452 1.00 65.04 ? 309 GLN A CA  1 
ATOM 65   C C   . GLN A 1 33  ? 3.390   41.641 -37.368 1.00 66.61 ? 309 GLN A C   1 
ATOM 66   O O   . GLN A 1 33  ? 3.525   41.340 -36.185 1.00 67.50 ? 309 GLN A O   1 
ATOM 67   C CB  . GLN A 1 33  ? 4.803   40.328 -38.945 1.00 66.29 ? 309 GLN A CB  1 
ATOM 68   C CG  . GLN A 1 33  ? 4.970   39.176 -39.923 1.00 68.37 ? 309 GLN A CG  1 
ATOM 69   C CD  . GLN A 1 33  ? 6.409   39.028 -40.395 1.00 70.93 ? 309 GLN A CD  1 
ATOM 70   O OE1 . GLN A 1 33  ? 7.335   38.945 -39.584 1.00 72.97 ? 309 GLN A OE1 1 
ATOM 71   N NE2 . GLN A 1 33  ? 6.603   38.994 -41.711 1.00 70.27 ? 309 GLN A NE2 1 
ATOM 72   N N   . VAL A 1 34  ? 3.249   42.893 -37.794 1.00 67.62 ? 310 VAL A N   1 
ATOM 73   C CA  . VAL A 1 34  ? 3.237   44.030 -36.879 1.00 67.16 ? 310 VAL A CA  1 
ATOM 74   C C   . VAL A 1 34  ? 1.917   44.043 -36.103 1.00 66.90 ? 310 VAL A C   1 
ATOM 75   O O   . VAL A 1 34  ? 1.781   44.733 -35.089 1.00 67.13 ? 310 VAL A O   1 
ATOM 76   C CB  . VAL A 1 34  ? 3.393   45.362 -37.653 1.00 67.79 ? 310 VAL A CB  1 
ATOM 77   C CG1 . VAL A 1 34  ? 4.261   45.142 -38.888 1.00 69.50 ? 310 VAL A CG1 1 
ATOM 78   C CG2 . VAL A 1 34  ? 2.025   45.920 -38.035 1.00 67.23 ? 310 VAL A CG2 1 
ATOM 79   N N   . ALA A 1 35  ? 0.947   43.283 -36.611 1.00 65.46 ? 311 ALA A N   1 
ATOM 80   C CA  . ALA A 1 35  ? -0.368  43.148 -35.991 1.00 64.06 ? 311 ALA A CA  1 
ATOM 81   C C   . ALA A 1 35  ? -0.258  41.973 -35.024 1.00 62.35 ? 311 ALA A C   1 
ATOM 82   O O   . ALA A 1 35  ? -0.959  41.910 -34.012 1.00 60.99 ? 311 ALA A O   1 
ATOM 83   C CB  . ALA A 1 35  ? -1.433  42.867 -37.052 1.00 64.81 ? 311 ALA A CB  1 
ATOM 84   N N   . ARG A 1 36  ? 0.639   41.044 -35.352 1.00 59.92 ? 312 ARG A N   1 
ATOM 85   C CA  . ARG A 1 36  ? 0.898   39.876 -34.516 1.00 58.86 ? 312 ARG A CA  1 
ATOM 86   C C   . ARG A 1 36  ? 1.731   40.410 -33.351 1.00 57.97 ? 312 ARG A C   1 
ATOM 87   O O   . ARG A 1 36  ? 2.414   39.667 -32.643 1.00 59.08 ? 312 ARG A O   1 
ATOM 88   C CB  . ARG A 1 36  ? 1.688   38.824 -35.304 1.00 58.76 ? 312 ARG A CB  1 
ATOM 89   C CG  . ARG A 1 36  ? 1.227   37.380 -35.094 1.00 59.43 ? 312 ARG A CG  1 
ATOM 90   C CD  . ARG A 1 36  ? 1.719   36.793 -33.780 1.00 58.70 ? 312 ARG A CD  1 
ATOM 91   N NE  . ARG A 1 36  ? 1.349   37.604 -32.624 1.00 61.11 ? 312 ARG A NE  1 
ATOM 92   C CZ  . ARG A 1 36  ? 0.102   37.928 -32.296 1.00 63.75 ? 312 ARG A CZ  1 
ATOM 93   N NH1 . ARG A 1 36  ? -0.918  37.512 -33.036 1.00 65.68 ? 312 ARG A NH1 1 
ATOM 94   N NH2 . ARG A 1 36  ? -0.122  38.682 -31.229 1.00 65.50 ? 312 ARG A NH2 1 
ATOM 95   N N   . ASN A 1 37  ? 1.666   41.729 -33.188 1.00 54.87 ? 313 ASN A N   1 
ATOM 96   C CA  . ASN A 1 37  ? 2.368   42.444 -32.136 1.00 52.59 ? 313 ASN A CA  1 
ATOM 97   C C   . ASN A 1 37  ? 1.333   42.906 -31.119 1.00 51.80 ? 313 ASN A C   1 
ATOM 98   O O   . ASN A 1 37  ? 1.602   42.939 -29.919 1.00 53.42 ? 313 ASN A O   1 
ATOM 99   C CB  . ASN A 1 37  ? 3.093   43.661 -32.716 1.00 52.44 ? 313 ASN A CB  1 
ATOM 100  C CG  . ASN A 1 37  ? 4.153   43.283 -33.730 1.00 55.24 ? 313 ASN A CG  1 
ATOM 101  O OD1 . ASN A 1 37  ? 4.763   44.149 -34.358 1.00 55.70 ? 313 ASN A OD1 1 
ATOM 102  N ND2 . ASN A 1 37  ? 4.382   41.988 -33.891 1.00 55.97 ? 313 ASN A ND2 1 
ATOM 103  N N   . THR A 1 38  ? 0.150   43.268 -31.611 1.00 49.18 ? 314 THR A N   1 
ATOM 104  C CA  . THR A 1 38  ? -0.934  43.718 -30.742 1.00 46.80 ? 314 THR A CA  1 
ATOM 105  C C   . THR A 1 38  ? -0.996  42.782 -29.532 1.00 43.68 ? 314 THR A C   1 
ATOM 106  O O   . THR A 1 38  ? -0.880  43.213 -28.379 1.00 45.36 ? 314 THR A O   1 
ATOM 107  C CB  . THR A 1 38  ? -2.310  43.672 -31.466 1.00 47.10 ? 314 THR A CB  1 
ATOM 108  O OG1 . THR A 1 38  ? -2.231  44.383 -32.708 1.00 47.09 ? 314 THR A OG1 1 
ATOM 109  C CG2 . THR A 1 38  ? -3.391  44.309 -30.597 1.00 50.53 ? 314 THR A CG2 1 
ATOM 110  N N   . GLY A 1 39  ? -1.162  41.493 -29.818 1.00 40.42 ? 315 GLY A N   1 
ATOM 111  C CA  . GLY A 1 39  ? -1.244  40.488 -28.773 1.00 38.41 ? 315 GLY A CA  1 
ATOM 112  C C   . GLY A 1 39  ? -0.072  40.494 -27.814 1.00 38.74 ? 315 GLY A C   1 
ATOM 113  O O   . GLY A 1 39  ? -0.133  39.876 -26.750 1.00 39.17 ? 315 GLY A O   1 
ATOM 114  N N   . LEU A 1 40  ? 1.001   41.183 -28.187 1.00 36.30 ? 316 LEU A N   1 
ATOM 115  C CA  . LEU A 1 40  ? 2.172   41.250 -27.332 1.00 35.13 ? 316 LEU A CA  1 
ATOM 116  C C   . LEU A 1 40  ? 1.960   42.297 -26.249 1.00 32.84 ? 316 LEU A C   1 
ATOM 117  O O   . LEU A 1 40  ? 2.121   42.007 -25.064 1.00 36.34 ? 316 LEU A O   1 
ATOM 118  C CB  . LEU A 1 40  ? 3.422   41.553 -28.164 1.00 36.03 ? 316 LEU A CB  1 
ATOM 119  C CG  . LEU A 1 40  ? 3.997   40.361 -28.945 1.00 35.24 ? 316 LEU A CG  1 
ATOM 120  C CD1 . LEU A 1 40  ? 4.448   39.279 -27.956 1.00 35.23 ? 316 LEU A CD1 1 
ATOM 121  C CD2 . LEU A 1 40  ? 2.955   39.806 -29.911 1.00 36.24 ? 316 LEU A CD2 1 
ATOM 122  N N   . LEU A 1 41  ? 1.593   43.510 -26.647 1.00 31.26 ? 317 LEU A N   1 
ATOM 123  C CA  . LEU A 1 41  ? 1.340   44.551 -25.658 1.00 28.01 ? 317 LEU A CA  1 
ATOM 124  C C   . LEU A 1 41  ? 0.242   43.950 -24.795 1.00 29.48 ? 317 LEU A C   1 
ATOM 125  O O   . LEU A 1 41  ? 0.396   43.771 -23.583 1.00 31.37 ? 317 LEU A O   1 
ATOM 126  C CB  . LEU A 1 41  ? 0.817   45.836 -26.312 1.00 25.65 ? 317 LEU A CB  1 
ATOM 127  C CG  . LEU A 1 41  ? 1.550   46.498 -27.486 1.00 24.15 ? 317 LEU A CG  1 
ATOM 128  C CD1 . LEU A 1 41  ? 3.001   46.752 -27.119 1.00 21.06 ? 317 LEU A CD1 1 
ATOM 129  C CD2 . LEU A 1 41  ? 1.460   45.616 -28.719 1.00 23.12 ? 317 LEU A CD2 1 
ATOM 130  N N   . GLU A 1 42  ? -0.860  43.618 -25.460 1.00 29.80 ? 318 GLU A N   1 
ATOM 131  C CA  . GLU A 1 42  ? -2.010  43.027 -24.810 1.00 31.78 ? 318 GLU A CA  1 
ATOM 132  C C   . GLU A 1 42  ? -1.553  42.132 -23.676 1.00 28.05 ? 318 GLU A C   1 
ATOM 133  O O   . GLU A 1 42  ? -1.434  42.573 -22.530 1.00 29.07 ? 318 GLU A O   1 
ATOM 134  C CB  . GLU A 1 42  ? -2.817  42.190 -25.808 1.00 36.57 ? 318 GLU A CB  1 
ATOM 135  C CG  . GLU A 1 42  ? -3.467  42.964 -26.948 1.00 51.04 ? 318 GLU A CG  1 
ATOM 136  C CD  . GLU A 1 42  ? -4.297  42.066 -27.873 1.00 57.15 ? 318 GLU A CD  1 
ATOM 137  O OE1 . GLU A 1 42  ? -4.923  42.594 -28.821 1.00 55.16 ? 318 GLU A OE1 1 
ATOM 138  O OE2 . GLU A 1 42  ? -4.323  40.833 -27.657 1.00 62.95 ? 318 GLU A OE2 1 
ATOM 139  N N   . SER A 1 43  ? -1.271  40.878 -24.028 1.00 24.67 ? 319 SER A N   1 
ATOM 140  C CA  . SER A 1 43  ? -0.857  39.836 -23.084 1.00 22.54 ? 319 SER A CA  1 
ATOM 141  C C   . SER A 1 43  ? -0.034  40.298 -21.888 1.00 24.48 ? 319 SER A C   1 
ATOM 142  O O   . SER A 1 43  ? -0.031  39.634 -20.842 1.00 25.78 ? 319 SER A O   1 
ATOM 143  C CB  . SER A 1 43  ? -0.128  38.705 -23.823 1.00 20.84 ? 319 SER A CB  1 
ATOM 144  O OG  . SER A 1 43  ? 0.936   39.203 -24.604 1.00 22.44 ? 319 SER A OG  1 
ATOM 145  N N   . GLN A 1 44  ? 0.663   41.421 -22.024 1.00 24.98 ? 320 GLN A N   1 
ATOM 146  C CA  . GLN A 1 44  ? 1.433   41.905 -20.897 1.00 22.95 ? 320 GLN A CA  1 
ATOM 147  C C   . GLN A 1 44  ? 0.470   42.589 -19.950 1.00 22.74 ? 320 GLN A C   1 
ATOM 148  O O   . GLN A 1 44  ? 0.326   42.181 -18.799 1.00 24.16 ? 320 GLN A O   1 
ATOM 149  C CB  . GLN A 1 44  ? 2.524   42.871 -21.346 1.00 25.80 ? 320 GLN A CB  1 
ATOM 150  C CG  . GLN A 1 44  ? 3.678   42.198 -22.077 1.00 23.36 ? 320 GLN A CG  1 
ATOM 151  C CD  . GLN A 1 44  ? 4.159   40.933 -21.386 1.00 21.61 ? 320 GLN A CD  1 
ATOM 152  O OE1 . GLN A 1 44  ? 4.362   40.904 -20.172 1.00 16.77 ? 320 GLN A OE1 1 
ATOM 153  N NE2 . GLN A 1 44  ? 4.352   39.878 -22.167 1.00 23.33 ? 320 GLN A NE2 1 
ATOM 154  N N   . LEU A 1 45  ? -0.208  43.615 -20.451 1.00 21.19 ? 321 LEU A N   1 
ATOM 155  C CA  . LEU A 1 45  ? -1.171  44.362 -19.652 1.00 23.23 ? 321 LEU A CA  1 
ATOM 156  C C   . LEU A 1 45  ? -1.964  43.445 -18.719 1.00 25.96 ? 321 LEU A C   1 
ATOM 157  O O   . LEU A 1 45  ? -2.284  43.818 -17.580 1.00 27.61 ? 321 LEU A O   1 
ATOM 158  C CB  . LEU A 1 45  ? -2.127  45.124 -20.578 1.00 21.29 ? 321 LEU A CB  1 
ATOM 159  C CG  . LEU A 1 45  ? -1.803  46.575 -20.963 1.00 19.01 ? 321 LEU A CG  1 
ATOM 160  C CD1 . LEU A 1 45  ? -2.545  46.952 -22.238 1.00 18.63 ? 321 LEU A CD1 1 
ATOM 161  C CD2 . LEU A 1 45  ? -2.187  47.512 -19.821 1.00 12.40 ? 321 LEU A CD2 1 
ATOM 162  N N   . SER A 1 46  ? -2.271  42.245 -19.212 1.00 28.43 ? 322 SER A N   1 
ATOM 163  C CA  . SER A 1 46  ? -3.031  41.257 -18.448 1.00 30.09 ? 322 SER A CA  1 
ATOM 164  C C   . SER A 1 46  ? -2.375  40.949 -17.113 1.00 30.65 ? 322 SER A C   1 
ATOM 165  O O   . SER A 1 46  ? -3.063  40.799 -16.087 1.00 30.72 ? 322 SER A O   1 
ATOM 166  C CB  . SER A 1 46  ? -3.169  39.953 -19.239 1.00 31.72 ? 322 SER A CB  1 
ATOM 167  O OG  . SER A 1 46  ? -3.694  38.912 -18.423 1.00 40.89 ? 322 SER A OG  1 
ATOM 168  N N   . ARG A 1 47  ? -1.044  40.843 -17.149 1.00 31.99 ? 323 ARG A N   1 
ATOM 169  C CA  . ARG A 1 47  ? -0.225  40.546 -15.973 1.00 32.47 ? 323 ARG A CA  1 
ATOM 170  C C   . ARG A 1 47  ? -0.347  41.604 -14.876 1.00 31.43 ? 323 ARG A C   1 
ATOM 171  O O   . ARG A 1 47  ? 0.043   41.368 -13.729 1.00 32.50 ? 323 ARG A O   1 
ATOM 172  C CB  . ARG A 1 47  ? 1.244   40.410 -16.383 1.00 36.17 ? 323 ARG A CB  1 
ATOM 173  C CG  . ARG A 1 47  ? 1.640   39.052 -16.948 1.00 39.97 ? 323 ARG A CG  1 
ATOM 174  C CD  . ARG A 1 47  ? 3.072   39.095 -17.473 1.00 34.02 ? 323 ARG A CD  1 
ATOM 175  N NE  . ARG A 1 47  ? 3.948   39.851 -16.581 1.00 31.33 ? 323 ARG A NE  1 
ATOM 176  C CZ  . ARG A 1 47  ? 4.298   39.460 -15.362 1.00 34.37 ? 323 ARG A CZ  1 
ATOM 177  N NH1 . ARG A 1 47  ? 3.859   38.309 -14.880 1.00 30.45 ? 323 ARG A NH1 1 
ATOM 178  N NH2 . ARG A 1 47  ? 5.066   40.237 -14.613 1.00 45.06 ? 323 ARG A NH2 1 
ATOM 179  N N   . HIS A 1 48  ? -0.897  42.764 -15.232 1.00 30.12 ? 324 HIS A N   1 
ATOM 180  C CA  . HIS A 1 48  ? -1.059  43.857 -14.284 1.00 28.48 ? 324 HIS A CA  1 
ATOM 181  C C   . HIS A 1 48  ? -2.455  43.955 -13.711 1.00 28.78 ? 324 HIS A C   1 
ATOM 182  O O   . HIS A 1 48  ? -2.608  44.093 -12.495 1.00 28.99 ? 324 HIS A O   1 
ATOM 183  C CB  . HIS A 1 48  ? -0.660  45.163 -14.948 1.00 29.90 ? 324 HIS A CB  1 
ATOM 184  C CG  . HIS A 1 48  ? 0.733   45.137 -15.475 1.00 26.17 ? 324 HIS A CG  1 
ATOM 185  N ND1 . HIS A 1 48  ? 1.830   45.102 -14.647 1.00 24.22 ? 324 HIS A ND1 1 
ATOM 186  C CD2 . HIS A 1 48  ? 1.206   45.010 -16.737 1.00 25.91 ? 324 HIS A CD2 1 
ATOM 187  C CE1 . HIS A 1 48  ? 2.921   44.947 -15.375 1.00 21.11 ? 324 HIS A CE1 1 
ATOM 188  N NE2 . HIS A 1 48  ? 2.570   44.887 -16.647 1.00 24.34 ? 324 HIS A NE2 1 
ATOM 189  N N   . ASP A 1 49  ? -3.481  43.887 -14.556 1.00 27.67 ? 325 ASP A N   1 
ATOM 190  C CA  . ASP A 1 49  ? -4.818  43.959 -13.992 1.00 26.81 ? 325 ASP A CA  1 
ATOM 191  C C   . ASP A 1 49  ? -4.839  42.842 -12.954 1.00 27.90 ? 325 ASP A C   1 
ATOM 192  O O   . ASP A 1 49  ? -5.468  42.968 -11.906 1.00 29.32 ? 325 ASP A O   1 
ATOM 193  C CB  . ASP A 1 49  ? -5.916  43.770 -15.054 1.00 29.32 ? 325 ASP A CB  1 
ATOM 194  C CG  . ASP A 1 49  ? -6.921  44.943 -15.078 1.00 31.86 ? 325 ASP A CG  1 
ATOM 195  O OD1 . ASP A 1 49  ? -7.461  45.303 -14.006 1.00 31.50 ? 325 ASP A OD1 1 
ATOM 196  O OD2 . ASP A 1 49  ? -7.170  45.505 -16.168 1.00 31.26 ? 325 ASP A OD2 1 
ATOM 197  N N   . GLN A 1 50  ? -4.115  41.762 -13.236 1.00 25.43 ? 326 GLN A N   1 
ATOM 198  C CA  . GLN A 1 50  ? -4.019  40.662 -12.287 1.00 26.78 ? 326 GLN A CA  1 
ATOM 199  C C   . GLN A 1 50  ? -3.469  41.228 -10.981 1.00 25.51 ? 326 GLN A C   1 
ATOM 200  O O   . GLN A 1 50  ? -4.160  41.269 -9.956  1.00 27.48 ? 326 GLN A O   1 
ATOM 201  C CB  . GLN A 1 50  ? -3.064  39.582 -12.806 1.00 32.87 ? 326 GLN A CB  1 
ATOM 202  C CG  . GLN A 1 50  ? -3.610  38.796 -13.966 1.00 41.66 ? 326 GLN A CG  1 
ATOM 203  C CD  . GLN A 1 50  ? -4.944  38.175 -13.630 1.00 47.10 ? 326 GLN A CD  1 
ATOM 204  O OE1 . GLN A 1 50  ? -5.883  38.876 -13.266 1.00 50.23 ? 326 GLN A OE1 1 
ATOM 205  N NE2 . GLN A 1 50  ? -5.036  36.856 -13.739 1.00 50.50 ? 326 GLN A NE2 1 
ATOM 206  N N   . MET A 1 51  ? -2.218  41.684 -11.053 1.00 24.23 ? 327 MET A N   1 
ATOM 207  C CA  . MET A 1 51  ? -1.496  42.250 -9.914  1.00 21.52 ? 327 MET A CA  1 
ATOM 208  C C   . MET A 1 51  ? -2.216  43.377 -9.214  1.00 19.51 ? 327 MET A C   1 
ATOM 209  O O   . MET A 1 51  ? -2.424  43.337 -7.999  1.00 22.91 ? 327 MET A O   1 
ATOM 210  C CB  . MET A 1 51  ? -0.111  42.764 -10.340 1.00 25.99 ? 327 MET A CB  1 
ATOM 211  C CG  . MET A 1 51  ? 1.019   41.749 -10.227 1.00 27.63 ? 327 MET A CG  1 
ATOM 212  S SD  . MET A 1 51  ? 2.635   42.538 -10.096 1.00 30.84 ? 327 MET A SD  1 
ATOM 213  C CE  . MET A 1 51  ? 2.811   42.660 -8.345  1.00 30.04 ? 327 MET A CE  1 
ATOM 214  N N   . LEU A 1 52  ? -2.582  44.399 -9.973  1.00 18.66 ? 328 LEU A N   1 
ATOM 215  C CA  . LEU A 1 52  ? -3.244  45.512 -9.342  1.00 17.53 ? 328 LEU A CA  1 
ATOM 216  C C   . LEU A 1 52  ? -4.391  44.938 -8.520  1.00 17.25 ? 328 LEU A C   1 
ATOM 217  O O   . LEU A 1 52  ? -4.586  45.339 -7.374  1.00 18.48 ? 328 LEU A O   1 
ATOM 218  C CB  . LEU A 1 52  ? -3.672  46.581 -10.383 1.00 16.23 ? 328 LEU A CB  1 
ATOM 219  C CG  . LEU A 1 52  ? -2.528  47.546 -10.841 1.00 12.40 ? 328 LEU A CG  1 
ATOM 220  C CD1 . LEU A 1 52  ? -2.982  48.447 -11.977 1.00 12.40 ? 328 LEU A CD1 1 
ATOM 221  C CD2 . LEU A 1 52  ? -2.026  48.408 -9.670  1.00 12.40 ? 328 LEU A CD2 1 
ATOM 222  N N   . SER A 1 53  ? -5.096  43.947 -9.065  1.00 15.40 ? 329 SER A N   1 
ATOM 223  C CA  . SER A 1 53  ? -6.208  43.316 -8.337  1.00 14.72 ? 329 SER A CA  1 
ATOM 224  C C   . SER A 1 53  ? -5.693  42.641 -7.086  1.00 15.87 ? 329 SER A C   1 
ATOM 225  O O   . SER A 1 53  ? -6.110  42.960 -5.968  1.00 18.55 ? 329 SER A O   1 
ATOM 226  C CB  . SER A 1 53  ? -6.889  42.244 -9.173  1.00 17.69 ? 329 SER A CB  1 
ATOM 227  O OG  . SER A 1 53  ? -8.005  41.689 -8.485  1.00 26.76 ? 329 SER A OG  1 
ATOM 228  N N   . VAL A 1 54  ? -4.794  41.686 -7.294  1.00 14.84 ? 330 VAL A N   1 
ATOM 229  C CA  . VAL A 1 54  ? -4.205  40.947 -6.199  1.00 13.54 ? 330 VAL A CA  1 
ATOM 230  C C   . VAL A 1 54  ? -3.654  41.931 -5.181  1.00 20.09 ? 330 VAL A C   1 
ATOM 231  O O   . VAL A 1 54  ? -3.773  41.734 -3.973  1.00 23.36 ? 330 VAL A O   1 
ATOM 232  C CB  . VAL A 1 54  ? -3.069  40.074 -6.702  1.00 12.68 ? 330 VAL A CB  1 
ATOM 233  C CG1 . VAL A 1 54  ? -2.843  38.916 -5.740  1.00 12.40 ? 330 VAL A CG1 1 
ATOM 234  C CG2 . VAL A 1 54  ? -3.381  39.584 -8.099  1.00 13.26 ? 330 VAL A CG2 1 
ATOM 235  N N   . HIS A 1 55  ? -3.044  42.994 -5.683  1.00 24.11 ? 331 HIS A N   1 
ATOM 236  C CA  . HIS A 1 55  ? -2.494  44.004 -4.815  1.00 22.42 ? 331 HIS A CA  1 
ATOM 237  C C   . HIS A 1 55  ? -3.634  44.709 -4.120  1.00 24.60 ? 331 HIS A C   1 
ATOM 238  O O   . HIS A 1 55  ? -3.620  44.886 -2.909  1.00 25.93 ? 331 HIS A O   1 
ATOM 239  C CB  . HIS A 1 55  ? -1.681  45.015 -5.618  1.00 20.90 ? 331 HIS A CB  1 
ATOM 240  C CG  . HIS A 1 55  ? -0.241  44.637 -5.798  1.00 19.29 ? 331 HIS A CG  1 
ATOM 241  N ND1 . HIS A 1 55  ? 0.733   45.559 -6.119  1.00 16.05 ? 331 HIS A ND1 1 
ATOM 242  C CD2 . HIS A 1 55  ? 0.392   43.442 -5.696  1.00 21.04 ? 331 HIS A CD2 1 
ATOM 243  C CE1 . HIS A 1 55  ? 1.902   44.948 -6.204  1.00 17.81 ? 331 HIS A CE1 1 
ATOM 244  N NE2 . HIS A 1 55  ? 1.723   43.664 -5.952  1.00 18.75 ? 331 HIS A NE2 1 
ATOM 245  N N   . ASP A 1 56  ? -4.629  45.103 -4.905  1.00 27.73 ? 332 ASP A N   1 
ATOM 246  C CA  . ASP A 1 56  ? -5.802  45.810 -4.392  1.00 29.00 ? 332 ASP A CA  1 
ATOM 247  C C   . ASP A 1 56  ? -6.494  44.997 -3.308  1.00 28.41 ? 332 ASP A C   1 
ATOM 248  O O   . ASP A 1 56  ? -6.838  45.518 -2.245  1.00 31.02 ? 332 ASP A O   1 
ATOM 249  C CB  . ASP A 1 56  ? -6.784  46.091 -5.539  1.00 33.27 ? 332 ASP A CB  1 
ATOM 250  C CG  . ASP A 1 56  ? -7.817  47.151 -5.186  1.00 38.00 ? 332 ASP A CG  1 
ATOM 251  O OD1 . ASP A 1 56  ? -8.551  47.581 -6.102  1.00 42.75 ? 332 ASP A OD1 1 
ATOM 252  O OD2 . ASP A 1 56  ? -7.900  47.553 -4.004  1.00 42.26 ? 332 ASP A OD2 1 
ATOM 253  N N   . ILE A 1 57  ? -6.701  43.716 -3.590  1.00 27.19 ? 333 ILE A N   1 
ATOM 254  C CA  . ILE A 1 57  ? -7.333  42.822 -2.636  1.00 25.86 ? 333 ILE A CA  1 
ATOM 255  C C   . ILE A 1 57  ? -6.448  42.802 -1.389  1.00 25.41 ? 333 ILE A C   1 
ATOM 256  O O   . ILE A 1 57  ? -6.931  42.677 -0.262  1.00 26.21 ? 333 ILE A O   1 
ATOM 257  C CB  . ILE A 1 57  ? -7.488  41.405 -3.252  1.00 26.42 ? 333 ILE A CB  1 
ATOM 258  C CG1 . ILE A 1 57  ? -8.312  41.507 -4.548  1.00 27.56 ? 333 ILE A CG1 1 
ATOM 259  C CG2 . ILE A 1 57  ? -8.154  40.466 -2.256  1.00 25.74 ? 333 ILE A CG2 1 
ATOM 260  C CD1 . ILE A 1 57  ? -8.637  40.186 -5.234  1.00 25.69 ? 333 ILE A CD1 1 
ATOM 261  N N   . ARG A 1 58  ? -5.144  42.957 -1.614  1.00 25.06 ? 334 ARG A N   1 
ATOM 262  C CA  . ARG A 1 58  ? -4.157  42.992 -0.536  1.00 22.95 ? 334 ARG A CA  1 
ATOM 263  C C   . ARG A 1 58  ? -4.185  44.356 0.148   1.00 22.35 ? 334 ARG A C   1 
ATOM 264  O O   . ARG A 1 58  ? -4.316  44.444 1.373   1.00 24.27 ? 334 ARG A O   1 
ATOM 265  C CB  . ARG A 1 58  ? -2.745  42.717 -1.073  1.00 23.20 ? 334 ARG A CB  1 
ATOM 266  C CG  . ARG A 1 58  ? -2.324  41.254 -0.999  1.00 23.57 ? 334 ARG A CG  1 
ATOM 267  C CD  . ARG A 1 58  ? -0.835  41.127 -0.641  1.00 24.70 ? 334 ARG A CD  1 
ATOM 268  N NE  . ARG A 1 58  ? 0.052   41.484 -1.748  1.00 24.98 ? 334 ARG A NE  1 
ATOM 269  C CZ  . ARG A 1 58  ? 1.379   41.522 -1.667  1.00 28.38 ? 334 ARG A CZ  1 
ATOM 270  N NH1 . ARG A 1 58  ? 1.986   41.230 -0.524  1.00 28.07 ? 334 ARG A NH1 1 
ATOM 271  N NH2 . ARG A 1 58  ? 2.100   41.839 -2.737  1.00 26.52 ? 334 ARG A NH2 1 
ATOM 272  N N   . LEU A 1 59  ? -4.049  45.420 -0.639  1.00 22.96 ? 335 LEU A N   1 
ATOM 273  C CA  . LEU A 1 59  ? -4.099  46.757 -0.068  1.00 22.10 ? 335 LEU A CA  1 
ATOM 274  C C   . LEU A 1 59  ? -5.359  46.752 0.794   1.00 26.49 ? 335 LEU A C   1 
ATOM 275  O O   . LEU A 1 59  ? -5.292  46.861 2.026   1.00 29.70 ? 335 LEU A O   1 
ATOM 276  C CB  . LEU A 1 59  ? -4.195  47.819 -1.175  1.00 19.89 ? 335 LEU A CB  1 
ATOM 277  C CG  . LEU A 1 59  ? -2.938  48.663 -1.427  1.00 18.39 ? 335 LEU A CG  1 
ATOM 278  C CD1 . LEU A 1 59  ? -3.134  49.532 -2.647  1.00 21.45 ? 335 LEU A CD1 1 
ATOM 279  C CD2 . LEU A 1 59  ? -2.630  49.507 -0.198  1.00 20.44 ? 335 LEU A CD2 1 
ATOM 280  N N   . ALA A 1 60  ? -6.500  46.574 0.134   1.00 29.14 ? 336 ALA A N   1 
ATOM 281  C CA  . ALA A 1 60  ? -7.785  46.523 0.811   1.00 29.51 ? 336 ALA A CA  1 
ATOM 282  C C   . ALA A 1 60  ? -7.678  45.587 2.007   1.00 31.75 ? 336 ALA A C   1 
ATOM 283  O O   . ALA A 1 60  ? -8.316  45.799 3.041   1.00 34.47 ? 336 ALA A O   1 
ATOM 284  C CB  . ALA A 1 60  ? -8.853  46.025 -0.149  1.00 27.36 ? 336 ALA A CB  1 
ATOM 285  N N   . ASP A 1 61  ? -6.857  44.554 1.861   1.00 34.11 ? 337 ASP A N   1 
ATOM 286  C CA  . ASP A 1 61  ? -6.672  43.583 2.928   1.00 35.24 ? 337 ASP A CA  1 
ATOM 287  C C   . ASP A 1 61  ? -5.898  44.234 4.077   1.00 33.64 ? 337 ASP A C   1 
ATOM 288  O O   . ASP A 1 61  ? -6.301  44.150 5.239   1.00 33.81 ? 337 ASP A O   1 
ATOM 289  C CB  . ASP A 1 61  ? -5.922  42.343 2.390   1.00 41.82 ? 337 ASP A CB  1 
ATOM 290  C CG  . ASP A 1 61  ? -6.365  41.027 3.062   1.00 48.86 ? 337 ASP A CG  1 
ATOM 291  O OD1 . ASP A 1 61  ? -7.570  40.683 2.991   1.00 55.38 ? 337 ASP A OD1 1 
ATOM 292  O OD2 . ASP A 1 61  ? -5.503  40.330 3.651   1.00 52.70 ? 337 ASP A OD2 1 
ATOM 293  N N   . MET A 1 62  ? -4.799  44.900 3.746   1.00 32.47 ? 338 MET A N   1 
ATOM 294  C CA  . MET A 1 62  ? -3.977  45.539 4.761   1.00 30.30 ? 338 MET A CA  1 
ATOM 295  C C   . MET A 1 62  ? -4.798  46.490 5.623   1.00 30.01 ? 338 MET A C   1 
ATOM 296  O O   . MET A 1 62  ? -4.453  46.751 6.783   1.00 30.84 ? 338 MET A O   1 
ATOM 297  C CB  . MET A 1 62  ? -2.829  46.302 4.099   1.00 31.55 ? 338 MET A CB  1 
ATOM 298  C CG  . MET A 1 62  ? -1.806  46.922 5.065   1.00 31.16 ? 338 MET A CG  1 
ATOM 299  S SD  . MET A 1 62  ? -0.488  45.806 5.552   1.00 30.66 ? 338 MET A SD  1 
ATOM 300  C CE  . MET A 1 62  ? 0.095   45.326 3.930   1.00 20.91 ? 338 MET A CE  1 
ATOM 301  N N   . ASP A 1 63  ? -5.888  47.002 5.050   1.00 28.67 ? 339 ASP A N   1 
ATOM 302  C CA  . ASP A 1 63  ? -6.773  47.942 5.748   1.00 26.85 ? 339 ASP A CA  1 
ATOM 303  C C   . ASP A 1 63  ? -7.406  47.309 6.982   1.00 26.68 ? 339 ASP A C   1 
ATOM 304  O O   . ASP A 1 63  ? -7.243  47.801 8.103   1.00 30.02 ? 339 ASP A O   1 
ATOM 305  C CB  . ASP A 1 63  ? -7.880  48.427 4.810   1.00 30.01 ? 339 ASP A CB  1 
ATOM 306  C CG  . ASP A 1 63  ? -7.340  48.990 3.513   1.00 33.48 ? 339 ASP A CG  1 
ATOM 307  O OD1 . ASP A 1 63  ? -8.157  49.384 2.657   1.00 41.49 ? 339 ASP A OD1 1 
ATOM 308  O OD2 . ASP A 1 63  ? -6.104  49.037 3.343   1.00 33.82 ? 339 ASP A OD2 1 
ATOM 309  N N   . LEU A 1 64  ? -8.133  46.216 6.761   1.00 25.25 ? 340 LEU A N   1 
ATOM 310  C CA  . LEU A 1 64  ? -8.794  45.497 7.841   1.00 25.14 ? 340 LEU A CA  1 
ATOM 311  C C   . LEU A 1 64  ? -7.775  45.234 8.956   1.00 26.51 ? 340 LEU A C   1 
ATOM 312  O O   . LEU A 1 64  ? -7.992  45.618 10.108  1.00 29.18 ? 340 LEU A O   1 
ATOM 313  C CB  . LEU A 1 64  ? -9.368  44.168 7.310   1.00 26.19 ? 340 LEU A CB  1 
ATOM 314  C CG  . LEU A 1 64  ? -10.757 43.658 7.748   1.00 25.35 ? 340 LEU A CG  1 
ATOM 315  C CD1 . LEU A 1 64  ? -10.819 43.476 9.269   1.00 26.78 ? 340 LEU A CD1 1 
ATOM 316  C CD2 . LEU A 1 64  ? -11.836 44.641 7.273   1.00 24.74 ? 340 LEU A CD2 1 
ATOM 317  N N   . ARG A 1 65  ? -6.657  44.595 8.599   1.00 26.45 ? 341 ARG A N   1 
ATOM 318  C CA  . ARG A 1 65  ? -5.604  44.279 9.565   1.00 21.35 ? 341 ARG A CA  1 
ATOM 319  C C   . ARG A 1 65  ? -5.121  45.552 10.275  1.00 22.36 ? 341 ARG A C   1 
ATOM 320  O O   . ARG A 1 65  ? -4.808  45.534 11.469  1.00 23.70 ? 341 ARG A O   1 
ATOM 321  C CB  . ARG A 1 65  ? -4.426  43.564 8.865   1.00 20.23 ? 341 ARG A CB  1 
ATOM 322  C CG  . ARG A 1 65  ? -3.446  42.841 9.818   1.00 19.74 ? 341 ARG A CG  1 
ATOM 323  C CD  . ARG A 1 65  ? -2.324  42.091 9.093   1.00 23.34 ? 341 ARG A CD  1 
ATOM 324  N NE  . ARG A 1 65  ? -1.504  41.322 10.032  1.00 22.55 ? 341 ARG A NE  1 
ATOM 325  C CZ  . ARG A 1 65  ? -0.589  40.411 9.690   1.00 26.44 ? 341 ARG A CZ  1 
ATOM 326  N NH1 . ARG A 1 65  ? -0.356  40.139 8.413   1.00 24.15 ? 341 ARG A NH1 1 
ATOM 327  N NH2 . ARG A 1 65  ? 0.089   39.751 10.628  1.00 24.76 ? 341 ARG A NH2 1 
ATOM 328  N N   . PHE A 1 66  ? -5.074  46.666 9.554   1.00 20.03 ? 342 PHE A N   1 
ATOM 329  C CA  . PHE A 1 66  ? -4.630  47.888 10.194  1.00 19.25 ? 342 PHE A CA  1 
ATOM 330  C C   . PHE A 1 66  ? -5.719  48.522 11.031  1.00 21.66 ? 342 PHE A C   1 
ATOM 331  O O   . PHE A 1 66  ? -5.432  49.254 11.981  1.00 21.49 ? 342 PHE A O   1 
ATOM 332  C CB  . PHE A 1 66  ? -4.106  48.902 9.180   1.00 19.82 ? 342 PHE A CB  1 
ATOM 333  C CG  . PHE A 1 66  ? -2.956  49.721 9.712   1.00 17.05 ? 342 PHE A CG  1 
ATOM 334  C CD1 . PHE A 1 66  ? -1.768  49.829 8.996   1.00 16.85 ? 342 PHE A CD1 1 
ATOM 335  C CD2 . PHE A 1 66  ? -3.034  50.315 10.972  1.00 12.40 ? 342 PHE A CD2 1 
ATOM 336  C CE1 . PHE A 1 66  ? -0.692  50.497 9.526   1.00 14.63 ? 342 PHE A CE1 1 
ATOM 337  C CE2 . PHE A 1 66  ? -1.954  50.987 11.506  1.00 12.40 ? 342 PHE A CE2 1 
ATOM 338  C CZ  . PHE A 1 66  ? -0.784  51.077 10.786  1.00 14.41 ? 342 PHE A CZ  1 
ATOM 339  N N   . GLN A 1 67  ? -6.967  48.227 10.675  1.00 22.77 ? 343 GLN A N   1 
ATOM 340  C CA  . GLN A 1 67  ? -8.139  48.739 11.389  1.00 23.99 ? 343 GLN A CA  1 
ATOM 341  C C   . GLN A 1 67  ? -8.383  47.836 12.593  1.00 24.17 ? 343 GLN A C   1 
ATOM 342  O O   . GLN A 1 67  ? -9.122  48.168 13.521  1.00 23.13 ? 343 GLN A O   1 
ATOM 343  C CB  . GLN A 1 67  ? -9.346  48.728 10.445  1.00 31.13 ? 343 GLN A CB  1 
ATOM 344  C CG  . GLN A 1 67  ? -10.641 49.230 11.035  1.00 42.15 ? 343 GLN A CG  1 
ATOM 345  C CD  . GLN A 1 67  ? -11.556 48.100 11.453  1.00 47.85 ? 343 GLN A CD  1 
ATOM 346  O OE1 . GLN A 1 67  ? -11.288 47.391 12.423  1.00 52.24 ? 343 GLN A OE1 1 
ATOM 347  N NE2 . GLN A 1 67  ? -12.643 47.920 10.713  1.00 49.70 ? 343 GLN A NE2 1 
ATOM 348  N N   . VAL A 1 68  ? -7.712  46.694 12.561  1.00 25.33 ? 344 VAL A N   1 
ATOM 349  C CA  . VAL A 1 68  ? -7.814  45.692 13.603  1.00 23.14 ? 344 VAL A CA  1 
ATOM 350  C C   . VAL A 1 68  ? -6.696  45.807 14.619  1.00 27.38 ? 344 VAL A C   1 
ATOM 351  O O   . VAL A 1 68  ? -6.904  45.624 15.821  1.00 29.95 ? 344 VAL A O   1 
ATOM 352  C CB  . VAL A 1 68  ? -7.782  44.275 12.990  1.00 22.36 ? 344 VAL A CB  1 
ATOM 353  C CG1 . VAL A 1 68  ? -7.484  43.247 14.071  1.00 21.20 ? 344 VAL A CG1 1 
ATOM 354  C CG2 . VAL A 1 68  ? -9.126  43.974 12.310  1.00 16.64 ? 344 VAL A CG2 1 
ATOM 355  N N   . LEU A 1 69  ? -5.500  46.098 14.134  1.00 29.27 ? 345 LEU A N   1 
ATOM 356  C CA  . LEU A 1 69  ? -4.374  46.210 15.032  1.00 28.00 ? 345 LEU A CA  1 
ATOM 357  C C   . LEU A 1 69  ? -4.543  47.405 15.957  1.00 28.61 ? 345 LEU A C   1 
ATOM 358  O O   . LEU A 1 69  ? -4.049  47.399 17.088  1.00 29.15 ? 345 LEU A O   1 
ATOM 359  C CB  . LEU A 1 69  ? -3.077  46.339 14.247  1.00 30.22 ? 345 LEU A CB  1 
ATOM 360  C CG  . LEU A 1 69  ? -1.890  46.480 15.191  1.00 30.59 ? 345 LEU A CG  1 
ATOM 361  C CD1 . LEU A 1 69  ? -1.835  45.293 16.119  1.00 30.93 ? 345 LEU A CD1 1 
ATOM 362  C CD2 . LEU A 1 69  ? -0.627  46.604 14.396  1.00 31.13 ? 345 LEU A CD2 1 
ATOM 363  N N   . GLU A 1 70  ? -5.256  48.418 15.464  1.00 27.45 ? 346 GLU A N   1 
ATOM 364  C CA  . GLU A 1 70  ? -5.517  49.653 16.207  1.00 26.48 ? 346 GLU A CA  1 
ATOM 365  C C   . GLU A 1 70  ? -6.522  49.473 17.347  1.00 27.38 ? 346 GLU A C   1 
ATOM 366  O O   . GLU A 1 70  ? -6.481  50.186 18.356  1.00 30.21 ? 346 GLU A O   1 
ATOM 367  C CB  . GLU A 1 70  ? -6.063  50.725 15.256  1.00 25.71 ? 346 GLU A CB  1 
ATOM 368  C CG  . GLU A 1 70  ? -5.120  51.158 14.149  1.00 29.82 ? 346 GLU A CG  1 
ATOM 369  C CD  . GLU A 1 70  ? -5.745  52.188 13.212  1.00 35.45 ? 346 GLU A CD  1 
ATOM 370  O OE1 . GLU A 1 70  ? -4.995  52.792 12.413  1.00 33.56 ? 346 GLU A OE1 1 
ATOM 371  O OE2 . GLU A 1 70  ? -6.981  52.393 13.266  1.00 41.07 ? 346 GLU A OE2 1 
ATOM 372  N N   . THR A 1 71  ? -7.418  48.505 17.176  1.00 28.19 ? 347 THR A N   1 
ATOM 373  C CA  . THR A 1 71  ? -8.479  48.247 18.143  1.00 24.67 ? 347 THR A CA  1 
ATOM 374  C C   . THR A 1 71  ? -8.470  46.940 18.973  1.00 24.28 ? 347 THR A C   1 
ATOM 375  O O   . THR A 1 71  ? -9.538  46.429 19.316  1.00 26.52 ? 347 THR A O   1 
ATOM 376  C CB  . THR A 1 71  ? -9.842  48.386 17.419  1.00 23.72 ? 347 THR A CB  1 
ATOM 377  O OG1 . THR A 1 71  ? -9.700  47.995 16.043  1.00 24.33 ? 347 THR A OG1 1 
ATOM 378  C CG2 . THR A 1 71  ? -10.326 49.828 17.474  1.00 25.60 ? 347 THR A CG2 1 
ATOM 379  N N   . ALA A 1 72  ? -7.283  46.421 19.318  1.00 22.44 ? 348 ALA A N   1 
ATOM 380  C CA  . ALA A 1 72  ? -7.159  45.186 20.120  1.00 19.02 ? 348 ALA A CA  1 
ATOM 381  C C   . ALA A 1 72  ? -6.645  45.423 21.557  1.00 18.00 ? 348 ALA A C   1 
ATOM 382  O O   . ALA A 1 72  ? -5.475  45.708 21.765  1.00 21.25 ? 348 ALA A O   1 
ATOM 383  C CB  . ALA A 1 72  ? -6.252  44.201 19.401  1.00 21.16 ? 348 ALA A CB  1 
ATOM 384  N N   . SER A 1 73  ? -7.526  45.285 22.543  1.00 17.72 ? 349 SER A N   1 
ATOM 385  C CA  . SER A 1 73  ? -7.175  45.509 23.941  1.00 18.90 ? 349 SER A CA  1 
ATOM 386  C C   . SER A 1 73  ? -6.136  44.563 24.515  1.00 17.94 ? 349 SER A C   1 
ATOM 387  O O   . SER A 1 73  ? -6.172  43.363 24.273  1.00 24.92 ? 349 SER A O   1 
ATOM 388  C CB  . SER A 1 73  ? -8.424  45.437 24.806  1.00 20.24 ? 349 SER A CB  1 
ATOM 389  O OG  . SER A 1 73  ? -8.071  45.436 26.173  1.00 23.45 ? 349 SER A OG  1 
ATOM 390  N N   . TYR A 1 74  ? -5.224  45.112 25.308  1.00 15.13 ? 350 TYR A N   1 
ATOM 391  C CA  . TYR A 1 74  ? -4.157  44.326 25.921  1.00 14.28 ? 350 TYR A CA  1 
ATOM 392  C C   . TYR A 1 74  ? -4.091  44.419 27.447  1.00 16.81 ? 350 TYR A C   1 
ATOM 393  O O   . TYR A 1 74  ? -3.037  44.750 28.003  1.00 19.89 ? 350 TYR A O   1 
ATOM 394  C CB  . TYR A 1 74  ? -2.783  44.729 25.348  1.00 12.40 ? 350 TYR A CB  1 
ATOM 395  C CG  . TYR A 1 74  ? -2.500  44.216 23.953  1.00 12.40 ? 350 TYR A CG  1 
ATOM 396  C CD1 . TYR A 1 74  ? -2.602  45.050 22.840  1.00 12.40 ? 350 TYR A CD1 1 
ATOM 397  C CD2 . TYR A 1 74  ? -2.182  42.889 23.742  1.00 12.40 ? 350 TYR A CD2 1 
ATOM 398  C CE1 . TYR A 1 74  ? -2.399  44.561 21.548  1.00 12.40 ? 350 TYR A CE1 1 
ATOM 399  C CE2 . TYR A 1 74  ? -1.981  42.387 22.468  1.00 12.49 ? 350 TYR A CE2 1 
ATOM 400  C CZ  . TYR A 1 74  ? -2.094  43.223 21.374  1.00 14.66 ? 350 TYR A CZ  1 
ATOM 401  O OH  . TYR A 1 74  ? -1.941  42.707 20.109  1.00 22.24 ? 350 TYR A OH  1 
ATOM 402  N N   . ASN A 1 75  ? -5.196  44.128 28.131  1.00 18.47 ? 351 ASN A N   1 
ATOM 403  C CA  . ASN A 1 75  ? -5.187  44.169 29.596  1.00 19.67 ? 351 ASN A CA  1 
ATOM 404  C C   . ASN A 1 75  ? -6.409  43.552 30.283  1.00 23.30 ? 351 ASN A C   1 
ATOM 405  O O   . ASN A 1 75  ? -6.848  44.039 31.334  1.00 26.76 ? 351 ASN A O   1 
ATOM 406  C CB  . ASN A 1 75  ? -4.977  45.608 30.089  1.00 21.28 ? 351 ASN A CB  1 
ATOM 407  C CG  . ASN A 1 75  ? -5.975  46.588 29.495  1.00 24.20 ? 351 ASN A CG  1 
ATOM 408  O OD1 . ASN A 1 75  ? -5.766  47.808 29.539  1.00 31.08 ? 351 ASN A OD1 1 
ATOM 409  N ND2 . ASN A 1 75  ? -7.070  46.065 28.945  1.00 25.97 ? 351 ASN A ND2 1 
ATOM 410  N N   . GLY A 1 76  ? -6.931  42.473 29.684  1.00 23.28 ? 352 GLY A N   1 
ATOM 411  C CA  . GLY A 1 76  ? -8.083  41.748 30.216  1.00 25.27 ? 352 GLY A CA  1 
ATOM 412  C C   . GLY A 1 76  ? -9.418  42.474 30.227  1.00 26.31 ? 352 GLY A C   1 
ATOM 413  O O   . GLY A 1 76  ? -10.112 42.473 31.242  1.00 27.16 ? 352 GLY A O   1 
ATOM 414  N N   . VAL A 1 77  ? -9.784  43.079 29.102  1.00 26.54 ? 353 VAL A N   1 
ATOM 415  C CA  . VAL A 1 77  ? -11.031 43.823 28.992  1.00 21.64 ? 353 VAL A CA  1 
ATOM 416  C C   . VAL A 1 77  ? -11.276 44.191 27.525  1.00 24.28 ? 353 VAL A C   1 
ATOM 417  O O   . VAL A 1 77  ? -10.324 44.296 26.748  1.00 27.15 ? 353 VAL A O   1 
ATOM 418  C CB  . VAL A 1 77  ? -10.983 45.125 29.848  1.00 22.35 ? 353 VAL A CB  1 
ATOM 419  C CG1 . VAL A 1 77  ? -12.085 46.073 29.426  1.00 21.34 ? 353 VAL A CG1 1 
ATOM 420  C CG2 . VAL A 1 77  ? -11.161 44.800 31.321  1.00 21.32 ? 353 VAL A CG2 1 
ATOM 421  N N   . LEU A 1 78  ? -12.550 44.382 27.154  1.00 25.57 ? 354 LEU A N   1 
ATOM 422  C CA  . LEU A 1 78  ? -12.931 44.738 25.780  1.00 24.63 ? 354 LEU A CA  1 
ATOM 423  C C   . LEU A 1 78  ? -14.057 45.754 25.711  1.00 25.98 ? 354 LEU A C   1 
ATOM 424  O O   . LEU A 1 78  ? -14.953 45.783 26.553  1.00 28.10 ? 354 LEU A O   1 
ATOM 425  C CB  . LEU A 1 78  ? -13.389 43.504 24.998  1.00 25.98 ? 354 LEU A CB  1 
ATOM 426  C CG  . LEU A 1 78  ? -13.245 43.491 23.466  1.00 27.51 ? 354 LEU A CG  1 
ATOM 427  C CD1 . LEU A 1 78  ? -14.120 42.382 22.910  1.00 33.16 ? 354 LEU A CD1 1 
ATOM 428  C CD2 . LEU A 1 78  ? -13.630 44.817 22.843  1.00 27.23 ? 354 LEU A CD2 1 
ATOM 429  N N   . ILE A 1 79  ? -13.996 46.586 24.683  1.00 26.44 ? 355 ILE A N   1 
ATOM 430  C CA  . ILE A 1 79  ? -15.018 47.584 24.430  1.00 25.17 ? 355 ILE A CA  1 
ATOM 431  C C   . ILE A 1 79  ? -15.191 47.608 22.902  1.00 24.43 ? 355 ILE A C   1 
ATOM 432  O O   . ILE A 1 79  ? -14.461 48.298 22.187  1.00 25.84 ? 355 ILE A O   1 
ATOM 433  C CB  . ILE A 1 79  ? -14.606 48.985 24.973  1.00 26.52 ? 355 ILE A CB  1 
ATOM 434  C CG1 . ILE A 1 79  ? -14.502 48.950 26.503  1.00 25.74 ? 355 ILE A CG1 1 
ATOM 435  C CG2 . ILE A 1 79  ? -15.613 50.031 24.552  1.00 25.89 ? 355 ILE A CG2 1 
ATOM 436  C CD1 . ILE A 1 79  ? -15.774 48.648 27.215  1.00 21.87 ? 355 ILE A CD1 1 
ATOM 437  N N   . TRP A 1 80  ? -16.145 46.808 22.417  1.00 22.67 ? 356 TRP A N   1 
ATOM 438  C CA  . TRP A 1 80  ? -16.447 46.707 20.987  1.00 19.59 ? 356 TRP A CA  1 
ATOM 439  C C   . TRP A 1 80  ? -17.552 47.704 20.621  1.00 22.12 ? 356 TRP A C   1 
ATOM 440  O O   . TRP A 1 80  ? -18.648 47.671 21.189  1.00 23.73 ? 356 TRP A O   1 
ATOM 441  C CB  . TRP A 1 80  ? -16.872 45.269 20.649  1.00 16.42 ? 356 TRP A CB  1 
ATOM 442  C CG  . TRP A 1 80  ? -17.358 45.056 19.232  1.00 15.24 ? 356 TRP A CG  1 
ATOM 443  C CD1 . TRP A 1 80  ? -16.970 45.744 18.109  1.00 14.68 ? 356 TRP A CD1 1 
ATOM 444  C CD2 . TRP A 1 80  ? -18.326 44.086 18.792  1.00 14.40 ? 356 TRP A CD2 1 
ATOM 445  N NE1 . TRP A 1 80  ? -17.643 45.266 17.003  1.00 21.20 ? 356 TRP A NE1 1 
ATOM 446  C CE2 . TRP A 1 80  ? -18.479 44.251 17.391  1.00 15.95 ? 356 TRP A CE2 1 
ATOM 447  C CE3 . TRP A 1 80  ? -19.078 43.097 19.444  1.00 12.40 ? 356 TRP A CE3 1 
ATOM 448  C CZ2 . TRP A 1 80  ? -19.354 43.468 16.636  1.00 18.22 ? 356 TRP A CZ2 1 
ATOM 449  C CZ3 . TRP A 1 80  ? -19.945 42.320 18.693  1.00 13.25 ? 356 TRP A CZ3 1 
ATOM 450  C CH2 . TRP A 1 80  ? -20.075 42.511 17.301  1.00 18.51 ? 356 TRP A CH2 1 
ATOM 451  N N   . LYS A 1 81  ? -17.245 48.594 19.675  1.00 22.08 ? 357 LYS A N   1 
ATOM 452  C CA  . LYS A 1 81  ? -18.172 49.635 19.222  1.00 21.21 ? 357 LYS A CA  1 
ATOM 453  C C   . LYS A 1 81  ? -18.960 49.225 17.983  1.00 24.75 ? 357 LYS A C   1 
ATOM 454  O O   . LYS A 1 81  ? -18.387 49.116 16.890  1.00 27.49 ? 357 LYS A O   1 
ATOM 455  C CB  . LYS A 1 81  ? -17.398 50.929 18.925  1.00 21.93 ? 357 LYS A CB  1 
ATOM 456  C CG  . LYS A 1 81  ? -18.192 51.986 18.176  1.00 21.38 ? 357 LYS A CG  1 
ATOM 457  C CD  . LYS A 1 81  ? -17.469 53.327 18.141  1.00 22.37 ? 357 LYS A CD  1 
ATOM 458  C CE  . LYS A 1 81  ? -18.354 54.409 17.545  1.00 24.12 ? 357 LYS A CE  1 
ATOM 459  N NZ  . LYS A 1 81  ? -17.831 55.774 17.789  1.00 22.15 ? 357 LYS A NZ  1 
ATOM 460  N N   . ILE A 1 82  ? -20.269 49.010 18.154  1.00 27.36 ? 358 ILE A N   1 
ATOM 461  C CA  . ILE A 1 82  ? -21.129 48.622 17.035  1.00 27.46 ? 358 ILE A CA  1 
ATOM 462  C C   . ILE A 1 82  ? -22.013 49.753 16.544  1.00 29.69 ? 358 ILE A C   1 
ATOM 463  O O   . ILE A 1 82  ? -22.744 50.372 17.314  1.00 30.78 ? 358 ILE A O   1 
ATOM 464  C CB  . ILE A 1 82  ? -22.045 47.439 17.368  1.00 26.44 ? 358 ILE A CB  1 
ATOM 465  C CG1 . ILE A 1 82  ? -21.219 46.218 17.788  1.00 20.84 ? 358 ILE A CG1 1 
ATOM 466  C CG2 . ILE A 1 82  ? -22.874 47.097 16.136  1.00 26.79 ? 358 ILE A CG2 1 
ATOM 467  C CD1 . ILE A 1 82  ? -22.054 45.055 18.277  1.00 19.23 ? 358 ILE A CD1 1 
ATOM 468  N N   . ARG A 1 83  ? -21.929 49.979 15.234  1.00 28.94 ? 359 ARG A N   1 
ATOM 469  C CA  . ARG A 1 83  ? -22.659 51.029 14.526  1.00 32.48 ? 359 ARG A CA  1 
ATOM 470  C C   . ARG A 1 83  ? -23.475 50.468 13.354  1.00 35.06 ? 359 ARG A C   1 
ATOM 471  O O   . ARG A 1 83  ? -23.654 49.250 13.253  1.00 36.65 ? 359 ARG A O   1 
ATOM 472  C CB  . ARG A 1 83  ? -21.670 52.099 14.020  1.00 35.41 ? 359 ARG A CB  1 
ATOM 473  C CG  . ARG A 1 83  ? -20.271 51.574 13.605  1.00 38.48 ? 359 ARG A CG  1 
ATOM 474  C CD  . ARG A 1 83  ? -19.385 52.710 13.067  1.00 46.68 ? 359 ARG A CD  1 
ATOM 475  N NE  . ARG A 1 83  ? -17.966 52.362 12.930  1.00 53.83 ? 359 ARG A NE  1 
ATOM 476  C CZ  . ARG A 1 83  ? -17.114 52.225 13.946  1.00 57.83 ? 359 ARG A CZ  1 
ATOM 477  N NH1 . ARG A 1 83  ? -17.523 52.399 15.194  1.00 58.35 ? 359 ARG A NH1 1 
ATOM 478  N NH2 . ARG A 1 83  ? -15.840 51.936 13.712  1.00 57.49 ? 359 ARG A NH2 1 
ATOM 479  N N   . ASP A 1 84  ? -23.957 51.359 12.480  1.00 38.59 ? 360 ASP A N   1 
ATOM 480  C CA  . ASP A 1 84  ? -24.772 50.976 11.320  1.00 39.26 ? 360 ASP A CA  1 
ATOM 481  C C   . ASP A 1 84  ? -25.779 49.931 11.799  1.00 38.13 ? 360 ASP A C   1 
ATOM 482  O O   . ASP A 1 84  ? -26.143 49.006 11.075  1.00 37.39 ? 360 ASP A O   1 
ATOM 483  C CB  . ASP A 1 84  ? -23.883 50.393 10.205  1.00 42.30 ? 360 ASP A CB  1 
ATOM 484  C CG  . ASP A 1 84  ? -23.255 51.465 9.316   1.00 47.63 ? 360 ASP A CG  1 
ATOM 485  O OD1 . ASP A 1 84  ? -22.739 52.461 9.851   1.00 51.34 ? 360 ASP A OD1 1 
ATOM 486  O OD2 . ASP A 1 84  ? -23.267 51.302 8.077   1.00 49.88 ? 360 ASP A OD2 1 
ATOM 487  N N   . TYR A 1 85  ? -26.226 50.110 13.037  1.00 37.28 ? 361 TYR A N   1 
ATOM 488  C CA  . TYR A 1 85  ? -27.145 49.194 13.696  1.00 37.51 ? 361 TYR A CA  1 
ATOM 489  C C   . TYR A 1 85  ? -28.421 48.780 12.975  1.00 39.86 ? 361 TYR A C   1 
ATOM 490  O O   . TYR A 1 85  ? -28.634 47.597 12.742  1.00 42.69 ? 361 TYR A O   1 
ATOM 491  C CB  . TYR A 1 85  ? -27.505 49.744 15.067  1.00 35.41 ? 361 TYR A CB  1 
ATOM 492  C CG  . TYR A 1 85  ? -28.329 48.794 15.885  1.00 33.97 ? 361 TYR A CG  1 
ATOM 493  C CD1 . TYR A 1 85  ? -29.653 48.535 15.563  1.00 34.38 ? 361 TYR A CD1 1 
ATOM 494  C CD2 . TYR A 1 85  ? -27.782 48.162 16.992  1.00 35.08 ? 361 TYR A CD2 1 
ATOM 495  C CE1 . TYR A 1 85  ? -30.409 47.680 16.325  1.00 37.07 ? 361 TYR A CE1 1 
ATOM 496  C CE2 . TYR A 1 85  ? -28.526 47.304 17.763  1.00 36.79 ? 361 TYR A CE2 1 
ATOM 497  C CZ  . TYR A 1 85  ? -29.841 47.066 17.429  1.00 37.88 ? 361 TYR A CZ  1 
ATOM 498  O OH  . TYR A 1 85  ? -30.592 46.226 18.216  1.00 35.04 ? 361 TYR A OH  1 
ATOM 499  N N   . LYS A 1 86  ? -29.289 49.727 12.648  1.00 41.53 ? 362 LYS A N   1 
ATOM 500  C CA  . LYS A 1 86  ? -30.521 49.365 11.964  1.00 42.30 ? 362 LYS A CA  1 
ATOM 501  C C   . LYS A 1 86  ? -30.183 48.710 10.632  1.00 41.67 ? 362 LYS A C   1 
ATOM 502  O O   . LYS A 1 86  ? -31.068 48.316 9.879   1.00 42.21 ? 362 LYS A O   1 
ATOM 503  C CB  . LYS A 1 86  ? -31.405 50.596 11.741  1.00 46.64 ? 362 LYS A CB  1 
ATOM 504  C CG  . LYS A 1 86  ? -32.792 50.278 11.176  1.00 50.57 ? 362 LYS A CG  1 
ATOM 505  C CD  . LYS A 1 86  ? -33.708 51.501 11.167  1.00 54.78 ? 362 LYS A CD  1 
ATOM 506  C CE  . LYS A 1 86  ? -35.070 51.191 10.541  1.00 59.69 ? 362 LYS A CE  1 
ATOM 507  N NZ  . LYS A 1 86  ? -34.951 50.840 9.100   1.00 58.64 ? 362 LYS A NZ  1 
ATOM 508  N N   . ARG A 1 87  ? -28.892 48.593 10.349  1.00 41.74 ? 363 ARG A N   1 
ATOM 509  C CA  . ARG A 1 87  ? -28.433 47.971 9.113   1.00 43.50 ? 363 ARG A CA  1 
ATOM 510  C C   . ARG A 1 87  ? -28.048 46.528 9.420   1.00 44.51 ? 363 ARG A C   1 
ATOM 511  O O   . ARG A 1 87  ? -28.306 45.622 8.622   1.00 47.58 ? 363 ARG A O   1 
ATOM 512  C CB  . ARG A 1 87  ? -27.219 48.732 8.561   1.00 43.89 ? 363 ARG A CB  1 
ATOM 513  C CG  . ARG A 1 87  ? -26.921 48.497 7.082   1.00 48.43 ? 363 ARG A CG  1 
ATOM 514  C CD  . ARG A 1 87  ? -26.271 47.147 6.798   1.00 51.28 ? 363 ARG A CD  1 
ATOM 515  N NE  . ARG A 1 87  ? -24.887 47.073 7.260   1.00 53.50 ? 363 ARG A NE  1 
ATOM 516  C CZ  . ARG A 1 87  ? -23.982 46.237 6.763   1.00 53.00 ? 363 ARG A CZ  1 
ATOM 517  N NH1 . ARG A 1 87  ? -24.313 45.404 5.787   1.00 52.97 ? 363 ARG A NH1 1 
ATOM 518  N NH2 . ARG A 1 87  ? -22.745 46.234 7.240   1.00 51.02 ? 363 ARG A NH2 1 
ATOM 519  N N   . ARG A 1 88  ? -27.443 46.335 10.593  1.00 45.34 ? 364 ARG A N   1 
ATOM 520  C CA  . ARG A 1 88  ? -26.986 45.024 11.064  1.00 45.79 ? 364 ARG A CA  1 
ATOM 521  C C   . ARG A 1 88  ? -27.997 44.239 11.925  1.00 44.87 ? 364 ARG A C   1 
ATOM 522  O O   . ARG A 1 88  ? -27.635 43.242 12.565  1.00 45.26 ? 364 ARG A O   1 
ATOM 523  C CB  . ARG A 1 88  ? -25.663 45.176 11.837  1.00 46.25 ? 364 ARG A CB  1 
ATOM 524  C CG  . ARG A 1 88  ? -24.419 44.717 11.071  1.00 50.31 ? 364 ARG A CG  1 
ATOM 525  C CD  . ARG A 1 88  ? -23.989 45.713 10.015  1.00 52.49 ? 364 ARG A CD  1 
ATOM 526  N NE  . ARG A 1 88  ? -23.195 46.803 10.580  1.00 54.35 ? 364 ARG A NE  1 
ATOM 527  C CZ  . ARG A 1 88  ? -21.952 46.671 11.037  1.00 54.97 ? 364 ARG A CZ  1 
ATOM 528  N NH1 . ARG A 1 88  ? -21.349 45.493 10.996  1.00 55.09 ? 364 ARG A NH1 1 
ATOM 529  N NH2 . ARG A 1 88  ? -21.309 47.718 11.537  1.00 54.90 ? 364 ARG A NH2 1 
ATOM 530  N N   . LYS A 1 89  ? -29.249 44.693 11.952  1.00 44.38 ? 365 LYS A N   1 
ATOM 531  C CA  . LYS A 1 89  ? -30.298 44.008 12.700  1.00 40.35 ? 365 LYS A CA  1 
ATOM 532  C C   . LYS A 1 89  ? -31.106 43.341 11.623  1.00 39.19 ? 365 LYS A C   1 
ATOM 533  O O   . LYS A 1 89  ? -31.514 42.194 11.736  1.00 38.94 ? 365 LYS A O   1 
ATOM 534  C CB  . LYS A 1 89  ? -31.189 44.997 13.449  1.00 39.10 ? 365 LYS A CB  1 
ATOM 535  C CG  . LYS A 1 89  ? -31.222 44.787 14.954  1.00 35.73 ? 365 LYS A CG  1 
ATOM 536  C CD  . LYS A 1 89  ? -31.814 43.446 15.322  1.00 33.27 ? 365 LYS A CD  1 
ATOM 537  C CE  . LYS A 1 89  ? -31.132 42.841 16.550  1.00 35.15 ? 365 LYS A CE  1 
ATOM 538  N NZ  . LYS A 1 89  ? -31.291 43.649 17.781  1.00 39.39 ? 365 LYS A NZ  1 
ATOM 539  N N   . GLN A 1 90  ? -31.315 44.087 10.555  1.00 37.70 ? 366 GLN A N   1 
ATOM 540  C CA  . GLN A 1 90  ? -32.062 43.597 9.422   1.00 40.43 ? 366 GLN A CA  1 
ATOM 541  C C   . GLN A 1 90  ? -31.229 42.562 8.692   1.00 42.40 ? 366 GLN A C   1 
ATOM 542  O O   . GLN A 1 90  ? -31.419 42.327 7.502   1.00 45.43 ? 366 GLN A O   1 
ATOM 543  C CB  . GLN A 1 90  ? -32.406 44.757 8.491   1.00 43.90 ? 366 GLN A CB  1 
ATOM 544  C CG  . GLN A 1 90  ? -33.169 45.855 9.189   1.00 49.71 ? 366 GLN A CG  1 
ATOM 545  C CD  . GLN A 1 90  ? -34.306 45.295 10.005  1.00 52.65 ? 366 GLN A CD  1 
ATOM 546  O OE1 . GLN A 1 90  ? -35.198 44.635 9.468   1.00 54.62 ? 366 GLN A OE1 1 
ATOM 547  N NE2 . GLN A 1 90  ? -34.280 45.541 11.311  1.00 52.49 ? 366 GLN A NE2 1 
ATOM 548  N N   . GLU A 1 91  ? -30.295 41.951 9.411   1.00 40.67 ? 367 GLU A N   1 
ATOM 549  C CA  . GLU A 1 91  ? -29.435 40.928 8.827   1.00 37.68 ? 367 GLU A CA  1 
ATOM 550  C C   . GLU A 1 91  ? -29.650 39.624 9.584   1.00 36.60 ? 367 GLU A C   1 
ATOM 551  O O   . GLU A 1 91  ? -29.467 38.537 9.038   1.00 38.29 ? 367 GLU A O   1 
ATOM 552  C CB  . GLU A 1 91  ? -27.965 41.366 8.892   1.00 39.09 ? 367 GLU A CB  1 
ATOM 553  C CG  . GLU A 1 91  ? -27.695 42.694 8.167   1.00 40.55 ? 367 GLU A CG  1 
ATOM 554  C CD  . GLU A 1 91  ? -26.215 43.014 7.983   1.00 41.98 ? 367 GLU A CD  1 
ATOM 555  O OE1 . GLU A 1 91  ? -25.486 43.146 8.991   1.00 43.80 ? 367 GLU A OE1 1 
ATOM 556  O OE2 . GLU A 1 91  ? -25.781 43.139 6.818   1.00 45.85 ? 367 GLU A OE2 1 
ATOM 557  N N   . ALA A 1 92  ? -30.057 39.755 10.843  1.00 34.02 ? 368 ALA A N   1 
ATOM 558  C CA  . ALA A 1 92  ? -30.338 38.612 11.704  1.00 34.11 ? 368 ALA A CA  1 
ATOM 559  C C   . ALA A 1 92  ? -31.843 38.398 11.674  1.00 36.34 ? 368 ALA A C   1 
ATOM 560  O O   . ALA A 1 92  ? -32.343 37.281 11.848  1.00 36.61 ? 368 ALA A O   1 
ATOM 561  C CB  . ALA A 1 92  ? -29.885 38.907 13.121  1.00 31.79 ? 368 ALA A CB  1 
ATOM 562  N N   . VAL A 1 93  ? -32.548 39.505 11.446  1.00 35.95 ? 369 VAL A N   1 
ATOM 563  C CA  . VAL A 1 93  ? -34.000 39.532 11.367  1.00 32.87 ? 369 VAL A CA  1 
ATOM 564  C C   . VAL A 1 93  ? -34.465 38.980 10.027  1.00 35.40 ? 369 VAL A C   1 
ATOM 565  O O   . VAL A 1 93  ? -35.422 38.207 9.966   1.00 39.02 ? 369 VAL A O   1 
ATOM 566  C CB  . VAL A 1 93  ? -34.523 40.962 11.538  1.00 32.78 ? 369 VAL A CB  1 
ATOM 567  C CG1 . VAL A 1 93  ? -35.994 41.014 11.211  1.00 33.18 ? 369 VAL A CG1 1 
ATOM 568  C CG2 . VAL A 1 93  ? -34.289 41.425 12.967  1.00 29.28 ? 369 VAL A CG2 1 
ATOM 569  N N   . MET A 1 94  ? -33.804 39.390 8.950   1.00 34.37 ? 370 MET A N   1 
ATOM 570  C CA  . MET A 1 94  ? -34.151 38.873 7.640   1.00 35.07 ? 370 MET A CA  1 
ATOM 571  C C   . MET A 1 94  ? -33.007 37.974 7.183   1.00 33.77 ? 370 MET A C   1 
ATOM 572  O O   . MET A 1 94  ? -32.519 38.073 6.057   1.00 33.77 ? 370 MET A O   1 
ATOM 573  C CB  . MET A 1 94  ? -34.383 39.999 6.644   1.00 38.41 ? 370 MET A CB  1 
ATOM 574  C CG  . MET A 1 94  ? -35.035 39.521 5.365   1.00 44.44 ? 370 MET A CG  1 
ATOM 575  S SD  . MET A 1 94  ? -35.751 40.875 4.422   1.00 56.66 ? 370 MET A SD  1 
ATOM 576  C CE  . MET A 1 94  ? -34.542 41.059 3.055   1.00 55.38 ? 370 MET A CE  1 
ATOM 577  N N   . GLY A 1 95  ? -32.600 37.102 8.106   1.00 33.82 ? 371 GLY A N   1 
ATOM 578  C CA  . GLY A 1 95  ? -31.538 36.131 7.896   1.00 33.89 ? 371 GLY A CA  1 
ATOM 579  C C   . GLY A 1 95  ? -30.622 36.261 6.698   1.00 33.65 ? 371 GLY A C   1 
ATOM 580  O O   . GLY A 1 95  ? -30.999 35.933 5.568   1.00 35.61 ? 371 GLY A O   1 
ATOM 581  N N   . LYS A 1 96  ? -29.403 36.723 6.963   1.00 35.08 ? 372 LYS A N   1 
ATOM 582  C CA  . LYS A 1 96  ? -28.386 36.900 5.932   1.00 35.78 ? 372 LYS A CA  1 
ATOM 583  C C   . LYS A 1 96  ? -27.014 37.206 6.533   1.00 34.47 ? 372 LYS A C   1 
ATOM 584  O O   . LYS A 1 96  ? -25.992 36.745 6.021   1.00 34.56 ? 372 LYS A O   1 
ATOM 585  C CB  . LYS A 1 96  ? -28.799 38.007 4.941   1.00 37.35 ? 372 LYS A CB  1 
ATOM 586  C CG  . LYS A 1 96  ? -29.191 39.363 5.542   1.00 36.60 ? 372 LYS A CG  1 
ATOM 587  C CD  . LYS A 1 96  ? -29.710 40.302 4.435   1.00 37.69 ? 372 LYS A CD  1 
ATOM 588  C CE  . LYS A 1 96  ? -30.389 41.560 4.984   1.00 38.08 ? 372 LYS A CE  1 
ATOM 589  N NZ  . LYS A 1 96  ? -31.058 42.383 3.927   1.00 39.53 ? 372 LYS A NZ  1 
ATOM 590  N N   . THR A 1 97  ? -27.000 37.973 7.623   1.00 34.44 ? 373 THR A N   1 
ATOM 591  C CA  . THR A 1 97  ? -25.758 38.341 8.307   1.00 34.28 ? 373 THR A CA  1 
ATOM 592  C C   . THR A 1 97  ? -25.990 38.228 9.818   1.00 34.71 ? 373 THR A C   1 
ATOM 593  O O   . THR A 1 97  ? -25.723 39.159 10.582  1.00 35.70 ? 373 THR A O   1 
ATOM 594  C CB  . THR A 1 97  ? -25.354 39.789 7.955   1.00 33.71 ? 373 THR A CB  1 
ATOM 595  O OG1 . THR A 1 97  ? -25.494 39.995 6.542   1.00 38.14 ? 373 THR A OG1 1 
ATOM 596  C CG2 . THR A 1 97  ? -23.912 40.061 8.367   1.00 32.03 ? 373 THR A CG2 1 
ATOM 597  N N   . LEU A 1 98  ? -26.485 37.067 10.232  1.00 35.05 ? 374 LEU A N   1 
ATOM 598  C CA  . LEU A 1 98  ? -26.808 36.798 11.627  1.00 36.35 ? 374 LEU A CA  1 
ATOM 599  C C   . LEU A 1 98  ? -25.878 37.412 12.665  1.00 38.13 ? 374 LEU A C   1 
ATOM 600  O O   . LEU A 1 98  ? -26.160 38.477 13.215  1.00 38.24 ? 374 LEU A O   1 
ATOM 601  C CB  . LEU A 1 98  ? -26.889 35.285 11.873  1.00 37.28 ? 374 LEU A CB  1 
ATOM 602  C CG  . LEU A 1 98  ? -27.755 34.372 10.985  1.00 37.27 ? 374 LEU A CG  1 
ATOM 603  C CD1 . LEU A 1 98  ? -28.168 33.144 11.823  1.00 38.29 ? 374 LEU A CD1 1 
ATOM 604  C CD2 . LEU A 1 98  ? -28.999 35.099 10.458  1.00 37.47 ? 374 LEU A CD2 1 
ATOM 605  N N   . SER A 1 99  ? -24.770 36.725 12.926  1.00 38.74 ? 375 SER A N   1 
ATOM 606  C CA  . SER A 1 99  ? -23.786 37.149 13.924  1.00 37.89 ? 375 SER A CA  1 
ATOM 607  C C   . SER A 1 99  ? -22.636 38.049 13.477  1.00 38.49 ? 375 SER A C   1 
ATOM 608  O O   . SER A 1 99  ? -22.170 38.004 12.340  1.00 41.58 ? 375 SER A O   1 
ATOM 609  C CB  . SER A 1 99  ? -23.180 35.918 14.602  1.00 38.33 ? 375 SER A CB  1 
ATOM 610  O OG  . SER A 1 99  ? -22.827 34.924 13.654  1.00 42.05 ? 375 SER A OG  1 
ATOM 611  N N   . LEU A 1 100 ? -22.176 38.869 14.406  1.00 36.37 ? 376 LEU A N   1 
ATOM 612  C CA  . LEU A 1 100 ? -21.062 39.744 14.139  1.00 31.68 ? 376 LEU A CA  1 
ATOM 613  C C   . LEU A 1 100 ? -20.057 39.425 15.225  1.00 29.73 ? 376 LEU A C   1 
ATOM 614  O O   . LEU A 1 100 ? -20.399 38.821 16.238  1.00 31.12 ? 376 LEU A O   1 
ATOM 615  C CB  . LEU A 1 100 ? -21.480 41.212 14.233  1.00 30.35 ? 376 LEU A CB  1 
ATOM 616  C CG  . LEU A 1 100 ? -22.567 41.706 13.279  1.00 30.13 ? 376 LEU A CG  1 
ATOM 617  C CD1 . LEU A 1 100 ? -22.636 43.207 13.381  1.00 27.74 ? 376 LEU A CD1 1 
ATOM 618  C CD2 . LEU A 1 100 ? -22.271 41.300 11.846  1.00 30.71 ? 376 LEU A CD2 1 
ATOM 619  N N   . TYR A 1 101 ? -18.811 39.813 15.007  1.00 30.11 ? 377 TYR A N   1 
ATOM 620  C CA  . TYR A 1 101 ? -17.777 39.578 15.993  1.00 27.59 ? 377 TYR A CA  1 
ATOM 621  C C   . TYR A 1 101 ? -17.086 40.900 16.288  1.00 29.60 ? 377 TYR A C   1 
ATOM 622  O O   . TYR A 1 101 ? -17.184 41.857 15.513  1.00 33.74 ? 377 TYR A O   1 
ATOM 623  C CB  . TYR A 1 101 ? -16.752 38.574 15.473  1.00 22.01 ? 377 TYR A CB  1 
ATOM 624  C CG  . TYR A 1 101 ? -17.303 37.213 15.137  1.00 17.72 ? 377 TYR A CG  1 
ATOM 625  C CD1 . TYR A 1 101 ? -18.041 37.005 13.972  1.00 14.92 ? 377 TYR A CD1 1 
ATOM 626  C CD2 . TYR A 1 101 ? -17.032 36.113 15.955  1.00 18.93 ? 377 TYR A CD2 1 
ATOM 627  C CE1 . TYR A 1 101 ? -18.485 35.731 13.622  1.00 15.66 ? 377 TYR A CE1 1 
ATOM 628  C CE2 . TYR A 1 101 ? -17.471 34.836 15.617  1.00 18.17 ? 377 TYR A CE2 1 
ATOM 629  C CZ  . TYR A 1 101 ? -18.191 34.652 14.446  1.00 17.96 ? 377 TYR A CZ  1 
ATOM 630  O OH  . TYR A 1 101 ? -18.570 33.383 14.077  1.00 22.20 ? 377 TYR A OH  1 
ATOM 631  N N   . SER A 1 102 ? -16.388 40.947 17.414  1.00 29.34 ? 378 SER A N   1 
ATOM 632  C CA  . SER A 1 102 ? -15.668 42.138 17.813  1.00 29.33 ? 378 SER A CA  1 
ATOM 633  C C   . SER A 1 102 ? -14.273 42.081 17.212  1.00 30.46 ? 378 SER A C   1 
ATOM 634  O O   . SER A 1 102 ? -14.096 41.929 16.004  1.00 33.92 ? 378 SER A O   1 
ATOM 635  C CB  . SER A 1 102 ? -15.573 42.200 19.340  1.00 29.52 ? 378 SER A CB  1 
ATOM 636  O OG  . SER A 1 102 ? -14.785 41.139 19.848  1.00 25.42 ? 378 SER A OG  1 
ATOM 637  N N   . GLN A 1 103 ? -13.287 42.213 18.081  1.00 31.11 ? 379 GLN A N   1 
ATOM 638  C CA  . GLN A 1 103 ? -11.891 42.164 17.698  1.00 28.27 ? 379 GLN A CA  1 
ATOM 639  C C   . GLN A 1 103 ? -11.275 41.269 18.750  1.00 28.01 ? 379 GLN A C   1 
ATOM 640  O O   . GLN A 1 103 ? -11.774 41.189 19.873  1.00 29.05 ? 379 GLN A O   1 
ATOM 641  C CB  . GLN A 1 103 ? -11.258 43.561 17.762  1.00 28.61 ? 379 GLN A CB  1 
ATOM 642  C CG  . GLN A 1 103 ? -11.354 44.212 19.122  1.00 29.72 ? 379 GLN A CG  1 
ATOM 643  C CD  . GLN A 1 103 ? -12.099 45.520 19.076  1.00 33.08 ? 379 GLN A CD  1 
ATOM 644  O OE1 . GLN A 1 103 ? -12.840 45.794 18.130  1.00 42.20 ? 379 GLN A OE1 1 
ATOM 645  N NE2 . GLN A 1 103 ? -11.922 46.336 20.108  1.00 31.89 ? 379 GLN A NE2 1 
ATOM 646  N N   . PRO A 1 104 ? -10.199 40.564 18.409  1.00 24.00 ? 380 PRO A N   1 
ATOM 647  C CA  . PRO A 1 104 ? -9.704  39.745 19.511  1.00 22.51 ? 380 PRO A CA  1 
ATOM 648  C C   . PRO A 1 104 ? -9.117  40.627 20.599  1.00 23.21 ? 380 PRO A C   1 
ATOM 649  O O   . PRO A 1 104 ? -8.543  41.674 20.309  1.00 26.99 ? 380 PRO A O   1 
ATOM 650  C CB  . PRO A 1 104 ? -8.663  38.860 18.833  1.00 22.44 ? 380 PRO A CB  1 
ATOM 651  C CG  . PRO A 1 104 ? -9.196  38.724 17.421  1.00 22.52 ? 380 PRO A CG  1 
ATOM 652  C CD  . PRO A 1 104 ? -9.635  40.132 17.117  1.00 24.32 ? 380 PRO A CD  1 
ATOM 653  N N   . PHE A 1 105 ? -9.301  40.226 21.851  1.00 20.89 ? 381 PHE A N   1 
ATOM 654  C CA  . PHE A 1 105 ? -8.736  40.980 22.960  1.00 21.24 ? 381 PHE A CA  1 
ATOM 655  C C   . PHE A 1 105 ? -8.004  40.020 23.897  1.00 23.58 ? 381 PHE A C   1 
ATOM 656  O O   . PHE A 1 105 ? -8.587  39.054 24.397  1.00 24.56 ? 381 PHE A O   1 
ATOM 657  C CB  . PHE A 1 105 ? -9.818  41.804 23.692  1.00 20.09 ? 381 PHE A CB  1 
ATOM 658  C CG  . PHE A 1 105 ? -10.544 41.073 24.799  1.00 16.38 ? 381 PHE A CG  1 
ATOM 659  C CD1 . PHE A 1 105 ? -11.525 40.129 24.512  1.00 15.95 ? 381 PHE A CD1 1 
ATOM 660  C CD2 . PHE A 1 105 ? -10.291 41.388 26.139  1.00 15.38 ? 381 PHE A CD2 1 
ATOM 661  C CE1 . PHE A 1 105 ? -12.249 39.513 25.543  1.00 15.44 ? 381 PHE A CE1 1 
ATOM 662  C CE2 . PHE A 1 105 ? -11.008 40.778 27.173  1.00 12.40 ? 381 PHE A CE2 1 
ATOM 663  C CZ  . PHE A 1 105 ? -11.989 39.841 26.871  1.00 12.40 ? 381 PHE A CZ  1 
ATOM 664  N N   . TYR A 1 106 ? -6.713  40.285 24.108  1.00 22.29 ? 382 TYR A N   1 
ATOM 665  C CA  . TYR A 1 106 ? -5.872  39.425 24.939  1.00 19.00 ? 382 TYR A CA  1 
ATOM 666  C C   . TYR A 1 106 ? -5.678  39.935 26.352  1.00 23.13 ? 382 TYR A C   1 
ATOM 667  O O   . TYR A 1 106 ? -6.040  41.073 26.675  1.00 26.01 ? 382 TYR A O   1 
ATOM 668  C CB  . TYR A 1 106 ? -4.493  39.239 24.296  1.00 18.06 ? 382 TYR A CB  1 
ATOM 669  C CG  . TYR A 1 106 ? -4.525  39.043 22.802  1.00 13.99 ? 382 TYR A CG  1 
ATOM 670  C CD1 . TYR A 1 106 ? -4.911  40.071 21.954  1.00 12.40 ? 382 TYR A CD1 1 
ATOM 671  C CD2 . TYR A 1 106 ? -4.181  37.830 22.234  1.00 19.39 ? 382 TYR A CD2 1 
ATOM 672  C CE1 . TYR A 1 106 ? -4.955  39.896 20.574  1.00 12.40 ? 382 TYR A CE1 1 
ATOM 673  C CE2 . TYR A 1 106 ? -4.225  37.644 20.854  1.00 20.51 ? 382 TYR A CE2 1 
ATOM 674  C CZ  . TYR A 1 106 ? -4.611  38.681 20.032  1.00 17.13 ? 382 TYR A CZ  1 
ATOM 675  O OH  . TYR A 1 106 ? -4.657  38.507 18.669  1.00 23.73 ? 382 TYR A OH  1 
ATOM 676  N N   . THR A 1 107 ? -5.107  39.063 27.184  1.00 25.82 ? 383 THR A N   1 
ATOM 677  C CA  . THR A 1 107 ? -4.798  39.359 28.584  1.00 29.03 ? 383 THR A CA  1 
ATOM 678  C C   . THR A 1 107 ? -3.534  40.225 28.528  1.00 31.46 ? 383 THR A C   1 
ATOM 679  O O   . THR A 1 107 ? -3.234  41.004 29.440  1.00 31.32 ? 383 THR A O   1 
ATOM 680  C CB  . THR A 1 107 ? -4.459  38.058 29.366  1.00 27.73 ? 383 THR A CB  1 
ATOM 681  O OG1 . THR A 1 107 ? -5.304  36.986 28.920  1.00 31.63 ? 383 THR A OG1 1 
ATOM 682  C CG2 . THR A 1 107 ? -4.639  38.269 30.864  1.00 27.14 ? 383 THR A CG2 1 
ATOM 683  N N   . GLY A 1 108 ? -2.806  40.054 27.427  1.00 31.52 ? 384 GLY A N   1 
ATOM 684  C CA  . GLY A 1 108 ? -1.568  40.768 27.178  1.00 32.48 ? 384 GLY A CA  1 
ATOM 685  C C   . GLY A 1 108 ? -1.293  40.732 25.684  1.00 33.36 ? 384 GLY A C   1 
ATOM 686  O O   . GLY A 1 108 ? -2.233  40.683 24.892  1.00 34.27 ? 384 GLY A O   1 
ATOM 687  N N   . TYR A 1 109 ? -0.018  40.717 25.298  1.00 34.80 ? 385 TYR A N   1 
ATOM 688  C CA  . TYR A 1 109 ? 0.376   40.720 23.887  1.00 34.12 ? 385 TYR A CA  1 
ATOM 689  C C   . TYR A 1 109 ? 0.571   39.331 23.286  1.00 33.61 ? 385 TYR A C   1 
ATOM 690  O O   . TYR A 1 109 ? 0.344   39.118 22.088  1.00 37.56 ? 385 TYR A O   1 
ATOM 691  C CB  . TYR A 1 109 ? 1.677   41.510 23.728  1.00 32.26 ? 385 TYR A CB  1 
ATOM 692  C CG  . TYR A 1 109 ? 1.792   42.678 24.674  1.00 28.13 ? 385 TYR A CG  1 
ATOM 693  C CD1 . TYR A 1 109 ? 1.861   42.482 26.057  1.00 28.96 ? 385 TYR A CD1 1 
ATOM 694  C CD2 . TYR A 1 109 ? 1.800   43.981 24.194  1.00 24.76 ? 385 TYR A CD2 1 
ATOM 695  C CE1 . TYR A 1 109 ? 1.929   43.562 26.936  1.00 30.24 ? 385 TYR A CE1 1 
ATOM 696  C CE2 . TYR A 1 109 ? 1.868   45.068 25.059  1.00 26.96 ? 385 TYR A CE2 1 
ATOM 697  C CZ  . TYR A 1 109 ? 1.931   44.856 26.428  1.00 28.20 ? 385 TYR A CZ  1 
ATOM 698  O OH  . TYR A 1 109 ? 1.995   45.945 27.272  1.00 32.64 ? 385 TYR A OH  1 
ATOM 699  N N   . PHE A 1 110 ? 1.000   38.398 24.134  1.00 28.34 ? 386 PHE A N   1 
ATOM 700  C CA  . PHE A 1 110 ? 1.283   37.018 23.736  1.00 25.77 ? 386 PHE A CA  1 
ATOM 701  C C   . PHE A 1 110 ? 0.478   36.022 24.558  1.00 26.63 ? 386 PHE A C   1 
ATOM 702  O O   . PHE A 1 110 ? 1.055   35.269 25.350  1.00 29.30 ? 386 PHE A O   1 
ATOM 703  C CB  . PHE A 1 110 ? 2.766   36.721 23.953  1.00 23.46 ? 386 PHE A CB  1 
ATOM 704  C CG  . PHE A 1 110 ? 3.671   37.882 23.645  1.00 16.97 ? 386 PHE A CG  1 
ATOM 705  C CD1 . PHE A 1 110 ? 4.483   38.422 24.636  1.00 12.43 ? 386 PHE A CD1 1 
ATOM 706  C CD2 . PHE A 1 110 ? 3.730   38.422 22.357  1.00 16.64 ? 386 PHE A CD2 1 
ATOM 707  C CE1 . PHE A 1 110 ? 5.343   39.475 24.352  1.00 14.78 ? 386 PHE A CE1 1 
ATOM 708  C CE2 . PHE A 1 110 ? 4.591   39.481 22.061  1.00 12.40 ? 386 PHE A CE2 1 
ATOM 709  C CZ  . PHE A 1 110 ? 5.398   40.006 23.062  1.00 12.40 ? 386 PHE A CZ  1 
ATOM 710  N N   . GLY A 1 111 ? -0.840  36.005 24.367  1.00 27.60 ? 387 GLY A N   1 
ATOM 711  C CA  . GLY A 1 111 ? -1.669  35.087 25.127  1.00 24.10 ? 387 GLY A CA  1 
ATOM 712  C C   . GLY A 1 111 ? -2.972  34.694 24.456  1.00 24.19 ? 387 GLY A C   1 
ATOM 713  O O   . GLY A 1 111 ? -3.035  34.612 23.228  1.00 22.82 ? 387 GLY A O   1 
ATOM 714  N N   . TYR A 1 112 ? -4.001  34.442 25.272  1.00 22.45 ? 388 TYR A N   1 
ATOM 715  C CA  . TYR A 1 112 ? -5.341  34.056 24.813  1.00 18.99 ? 388 TYR A CA  1 
ATOM 716  C C   . TYR A 1 112 ? -5.926  35.033 23.772  1.00 17.39 ? 388 TYR A C   1 
ATOM 717  O O   . TYR A 1 112 ? -6.031  36.231 24.045  1.00 20.35 ? 388 TYR A O   1 
ATOM 718  C CB  . TYR A 1 112 ? -6.304  34.065 25.981  1.00 16.33 ? 388 TYR A CB  1 
ATOM 719  C CG  . TYR A 1 112 ? -5.969  33.235 27.185  1.00 15.39 ? 388 TYR A CG  1 
ATOM 720  C CD1 . TYR A 1 112 ? -5.898  31.844 27.109  1.00 18.50 ? 388 TYR A CD1 1 
ATOM 721  C CD2 . TYR A 1 112 ? -5.909  33.829 28.444  1.00 14.84 ? 388 TYR A CD2 1 
ATOM 722  C CE1 . TYR A 1 112 ? -5.794  31.063 28.271  1.00 17.33 ? 388 TYR A CE1 1 
ATOM 723  C CE2 . TYR A 1 112 ? -5.813  33.063 29.604  1.00 15.53 ? 388 TYR A CE2 1 
ATOM 724  C CZ  . TYR A 1 112 ? -5.761  31.688 29.512  1.00 16.27 ? 388 TYR A CZ  1 
ATOM 725  O OH  . TYR A 1 112 ? -5.712  30.954 30.665  1.00 22.58 ? 388 TYR A OH  1 
ATOM 726  N N   . LYS A 1 113 ? -6.357  34.535 22.614  1.00 19.07 ? 389 LYS A N   1 
ATOM 727  C CA  . LYS A 1 113 ? -6.915  35.420 21.588  1.00 17.52 ? 389 LYS A CA  1 
ATOM 728  C C   . LYS A 1 113 ? -8.450  35.535 21.663  1.00 23.38 ? 389 LYS A C   1 
ATOM 729  O O   . LYS A 1 113 ? -9.139  35.447 20.648  1.00 26.89 ? 389 LYS A O   1 
ATOM 730  C CB  . LYS A 1 113 ? -6.493  34.933 20.197  1.00 12.40 ? 389 LYS A CB  1 
ATOM 731  C CG  . LYS A 1 113 ? -6.793  35.912 19.078  1.00 12.40 ? 389 LYS A CG  1 
ATOM 732  C CD  . LYS A 1 113 ? -6.577  35.296 17.704  1.00 12.40 ? 389 LYS A CD  1 
ATOM 733  C CE  . LYS A 1 113 ? -6.847  36.314 16.593  1.00 17.01 ? 389 LYS A CE  1 
ATOM 734  N NZ  . LYS A 1 113 ? -6.845  35.730 15.212  1.00 20.00 ? 389 LYS A NZ  1 
ATOM 735  N N   . MET A 1 114 ? -8.973  35.761 22.866  1.00 24.00 ? 390 MET A N   1 
ATOM 736  C CA  . MET A 1 114 ? -10.415 35.881 23.115  1.00 22.70 ? 390 MET A CA  1 
ATOM 737  C C   . MET A 1 114 ? -11.229 36.810 22.199  1.00 22.26 ? 390 MET A C   1 
ATOM 738  O O   . MET A 1 114 ? -11.262 38.015 22.423  1.00 23.62 ? 390 MET A O   1 
ATOM 739  C CB  . MET A 1 114 ? -10.614 36.343 24.547  1.00 21.62 ? 390 MET A CB  1 
ATOM 740  C CG  . MET A 1 114 ? -9.552  35.863 25.480  1.00 22.10 ? 390 MET A CG  1 
ATOM 741  S SD  . MET A 1 114 ? -9.844  36.489 27.115  1.00 26.93 ? 390 MET A SD  1 
ATOM 742  C CE  . MET A 1 114 ? -8.927  38.001 27.070  1.00 19.91 ? 390 MET A CE  1 
ATOM 743  N N   . CYS A 1 115 ? -11.905 36.267 21.190  1.00 21.81 ? 391 CYS A N   1 
ATOM 744  C CA  . CYS A 1 115 ? -12.712 37.102 20.298  1.00 23.31 ? 391 CYS A CA  1 
ATOM 745  C C   . CYS A 1 115 ? -14.062 37.310 20.957  1.00 24.49 ? 391 CYS A C   1 
ATOM 746  O O   . CYS A 1 115 ? -14.243 36.914 22.100  1.00 25.56 ? 391 CYS A O   1 
ATOM 747  C CB  . CYS A 1 115 ? -12.908 36.420 18.946  1.00 23.03 ? 391 CYS A CB  1 
ATOM 748  S SG  . CYS A 1 115 ? -13.604 37.463 17.629  1.00 27.00 ? 391 CYS A SG  1 
ATOM 749  N N   . ALA A 1 116 ? -15.002 37.931 20.242  1.00 23.09 ? 392 ALA A N   1 
ATOM 750  C CA  . ALA A 1 116 ? -16.356 38.183 20.760  1.00 20.86 ? 392 ALA A CA  1 
ATOM 751  C C   . ALA A 1 116 ? -17.377 38.357 19.625  1.00 22.33 ? 392 ALA A C   1 
ATOM 752  O O   . ALA A 1 116 ? -17.220 39.210 18.758  1.00 24.93 ? 392 ALA A O   1 
ATOM 753  C CB  . ALA A 1 116 ? -16.362 39.409 21.662  1.00 19.06 ? 392 ALA A CB  1 
ATOM 754  N N   . ARG A 1 117 ? -18.434 37.549 19.658  1.00 21.77 ? 393 ARG A N   1 
ATOM 755  C CA  . ARG A 1 117 ? -19.478 37.558 18.633  1.00 20.53 ? 393 ARG A CA  1 
ATOM 756  C C   . ARG A 1 117 ? -20.840 37.988 19.167  1.00 21.90 ? 393 ARG A C   1 
ATOM 757  O O   . ARG A 1 117 ? -21.228 37.583 20.266  1.00 22.44 ? 393 ARG A O   1 
ATOM 758  C CB  . ARG A 1 117 ? -19.594 36.153 18.048  1.00 22.24 ? 393 ARG A CB  1 
ATOM 759  C CG  . ARG A 1 117 ? -20.704 35.940 17.043  1.00 22.33 ? 393 ARG A CG  1 
ATOM 760  C CD  . ARG A 1 117 ? -20.788 34.465 16.725  1.00 24.20 ? 393 ARG A CD  1 
ATOM 761  N NE  . ARG A 1 117 ? -21.211 34.210 15.356  1.00 28.64 ? 393 ARG A NE  1 
ATOM 762  C CZ  . ARG A 1 117 ? -21.151 33.020 14.771  1.00 30.59 ? 393 ARG A CZ  1 
ATOM 763  N NH1 . ARG A 1 117 ? -20.683 31.973 15.441  1.00 29.21 ? 393 ARG A NH1 1 
ATOM 764  N NH2 . ARG A 1 117 ? -21.551 32.880 13.515  1.00 29.62 ? 393 ARG A NH2 1 
ATOM 765  N N   . VAL A 1 118 ? -21.566 38.784 18.374  1.00 23.21 ? 394 VAL A N   1 
ATOM 766  C CA  . VAL A 1 118 ? -22.903 39.269 18.753  1.00 23.60 ? 394 VAL A CA  1 
ATOM 767  C C   . VAL A 1 118 ? -24.086 38.778 17.895  1.00 24.19 ? 394 VAL A C   1 
ATOM 768  O O   . VAL A 1 118 ? -24.095 38.856 16.665  1.00 25.42 ? 394 VAL A O   1 
ATOM 769  C CB  . VAL A 1 118 ? -22.974 40.819 18.796  1.00 24.29 ? 394 VAL A CB  1 
ATOM 770  C CG1 . VAL A 1 118 ? -23.043 41.389 17.391  1.00 21.11 ? 394 VAL A CG1 1 
ATOM 771  C CG2 . VAL A 1 118 ? -24.183 41.254 19.599  1.00 26.15 ? 394 VAL A CG2 1 
ATOM 772  N N   . TYR A 1 119 ? -25.085 38.270 18.597  1.00 25.05 ? 395 TYR A N   1 
ATOM 773  C CA  . TYR A 1 119 ? -26.304 37.762 18.012  1.00 26.36 ? 395 TYR A CA  1 
ATOM 774  C C   . TYR A 1 119 ? -27.346 38.717 18.585  1.00 26.56 ? 395 TYR A C   1 
ATOM 775  O O   . TYR A 1 119 ? -28.076 38.374 19.507  1.00 27.33 ? 395 TYR A O   1 
ATOM 776  C CB  . TYR A 1 119 ? -26.537 36.336 18.516  1.00 27.67 ? 395 TYR A CB  1 
ATOM 777  C CG  . TYR A 1 119 ? -25.910 35.216 17.690  1.00 27.62 ? 395 TYR A CG  1 
ATOM 778  C CD1 . TYR A 1 119 ? -25.488 34.033 18.292  1.00 25.77 ? 395 TYR A CD1 1 
ATOM 779  C CD2 . TYR A 1 119 ? -25.850 35.292 16.299  1.00 29.43 ? 395 TYR A CD2 1 
ATOM 780  C CE1 . TYR A 1 119 ? -25.034 32.956 17.535  1.00 27.23 ? 395 TYR A CE1 1 
ATOM 781  C CE2 . TYR A 1 119 ? -25.400 34.211 15.533  1.00 29.37 ? 395 TYR A CE2 1 
ATOM 782  C CZ  . TYR A 1 119 ? -25.000 33.054 16.156  1.00 31.78 ? 395 TYR A CZ  1 
ATOM 783  O OH  . TYR A 1 119 ? -24.600 31.988 15.390  1.00 37.75 ? 395 TYR A OH  1 
ATOM 784  N N   . LEU A 1 120 ? -27.378 39.934 18.050  1.00 24.46 ? 396 LEU A N   1 
ATOM 785  C CA  . LEU A 1 120 ? -28.299 40.982 18.512  1.00 25.38 ? 396 LEU A CA  1 
ATOM 786  C C   . LEU A 1 120 ? -29.758 40.564 18.425  1.00 27.37 ? 396 LEU A C   1 
ATOM 787  O O   . LEU A 1 120 ? -30.554 40.909 19.292  1.00 30.56 ? 396 LEU A O   1 
ATOM 788  C CB  . LEU A 1 120 ? -28.084 42.285 17.715  1.00 24.98 ? 396 LEU A CB  1 
ATOM 789  C CG  . LEU A 1 120 ? -26.721 42.997 17.752  1.00 24.11 ? 396 LEU A CG  1 
ATOM 790  C CD1 . LEU A 1 120 ? -26.691 44.078 16.687  1.00 22.81 ? 396 LEU A CD1 1 
ATOM 791  C CD2 . LEU A 1 120 ? -26.462 43.583 19.127  1.00 17.97 ? 396 LEU A CD2 1 
ATOM 792  N N   . ASN A 1 121 ? -30.105 39.835 17.369  1.00 29.55 ? 397 ASN A N   1 
ATOM 793  C CA  . ASN A 1 121 ? -31.469 39.355 17.197  1.00 29.38 ? 397 ASN A CA  1 
ATOM 794  C C   . ASN A 1 121 ? -31.571 38.057 17.992  1.00 28.99 ? 397 ASN A C   1 
ATOM 795  O O   . ASN A 1 121 ? -32.595 37.772 18.615  1.00 31.36 ? 397 ASN A O   1 
ATOM 796  C CB  . ASN A 1 121 ? -31.762 39.104 15.716  1.00 32.46 ? 397 ASN A CB  1 
ATOM 797  C CG  . ASN A 1 121 ? -33.235 38.817 15.447  1.00 33.33 ? 397 ASN A CG  1 
ATOM 798  O OD1 . ASN A 1 121 ? -34.115 39.565 15.875  1.00 28.35 ? 397 ASN A OD1 1 
ATOM 799  N ND2 . ASN A 1 121 ? -33.505 37.736 14.723  1.00 37.29 ? 397 ASN A ND2 1 
ATOM 800  N N   . GLY A 1 122 ? -30.492 37.277 17.961  1.00 27.70 ? 398 GLY A N   1 
ATOM 801  C CA  . GLY A 1 122 ? -30.442 36.035 18.710  1.00 23.00 ? 398 GLY A CA  1 
ATOM 802  C C   . GLY A 1 122 ? -30.138 34.765 17.945  1.00 24.32 ? 398 GLY A C   1 
ATOM 803  O O   . GLY A 1 122 ? -30.115 34.737 16.716  1.00 26.26 ? 398 GLY A O   1 
ATOM 804  N N   . ASP A 1 123 ? -29.871 33.716 18.713  1.00 23.53 ? 399 ASP A N   1 
ATOM 805  C CA  . ASP A 1 123 ? -29.613 32.369 18.214  1.00 24.94 ? 399 ASP A CA  1 
ATOM 806  C C   . ASP A 1 123 ? -30.244 31.353 19.164  1.00 27.05 ? 399 ASP A C   1 
ATOM 807  O O   . ASP A 1 123 ? -29.825 31.220 20.320  1.00 30.28 ? 399 ASP A O   1 
ATOM 808  C CB  . ASP A 1 123 ? -28.118 32.082 18.104  1.00 27.62 ? 399 ASP A CB  1 
ATOM 809  C CG  . ASP A 1 123 ? -27.690 30.906 18.976  1.00 27.84 ? 399 ASP A CG  1 
ATOM 810  O OD1 . ASP A 1 123 ? -27.840 29.759 18.506  1.00 28.67 ? 399 ASP A OD1 1 
ATOM 811  O OD2 . ASP A 1 123 ? -27.212 31.126 20.117  1.00 26.55 ? 399 ASP A OD2 1 
ATOM 812  N N   . GLY A 1 124 ? -31.200 30.577 18.667  1.00 26.73 ? 400 GLY A N   1 
ATOM 813  C CA  . GLY A 1 124 ? -31.798 29.550 19.501  1.00 23.25 ? 400 GLY A CA  1 
ATOM 814  C C   . GLY A 1 124 ? -32.687 30.041 20.620  1.00 23.44 ? 400 GLY A C   1 
ATOM 815  O O   . GLY A 1 124 ? -33.583 30.843 20.373  1.00 23.99 ? 400 GLY A O   1 
ATOM 816  N N   . MET A 1 125 ? -32.438 29.576 21.846  1.00 23.29 ? 401 MET A N   1 
ATOM 817  C CA  . MET A 1 125 ? -33.265 29.946 22.998  1.00 21.55 ? 401 MET A CA  1 
ATOM 818  C C   . MET A 1 125 ? -33.183 31.416 23.392  1.00 22.07 ? 401 MET A C   1 
ATOM 819  O O   . MET A 1 125 ? -32.962 31.759 24.553  1.00 25.29 ? 401 MET A O   1 
ATOM 820  C CB  . MET A 1 125 ? -32.928 29.062 24.206  1.00 21.37 ? 401 MET A CB  1 
ATOM 821  C CG  . MET A 1 125 ? -34.134 28.810 25.145  1.00 20.12 ? 401 MET A CG  1 
ATOM 822  S SD  . MET A 1 125 ? -35.312 27.477 24.666  1.00 26.75 ? 401 MET A SD  1 
ATOM 823  C CE  . MET A 1 125 ? -35.531 27.751 22.880  1.00 19.19 ? 401 MET A CE  1 
ATOM 824  N N   . GLY A 1 126 ? -33.403 32.269 22.398  1.00 19.85 ? 402 GLY A N   1 
ATOM 825  C CA  . GLY A 1 126 ? -33.363 33.708 22.567  1.00 21.24 ? 402 GLY A CA  1 
ATOM 826  C C   . GLY A 1 126 ? -33.198 34.300 21.180  1.00 23.74 ? 402 GLY A C   1 
ATOM 827  O O   . GLY A 1 126 ? -32.416 35.225 20.971  1.00 27.59 ? 402 GLY A O   1 
ATOM 828  N N   . LYS A 1 127 ? -33.931 33.741 20.223  1.00 22.51 ? 403 LYS A N   1 
ATOM 829  C CA  . LYS A 1 127 ? -33.871 34.193 18.841  1.00 23.65 ? 403 LYS A CA  1 
ATOM 830  C C   . LYS A 1 127 ? -35.130 34.962 18.437  1.00 27.46 ? 403 LYS A C   1 
ATOM 831  O O   . LYS A 1 127 ? -36.164 34.356 18.144  1.00 32.96 ? 403 LYS A O   1 
ATOM 832  C CB  . LYS A 1 127 ? -33.678 32.994 17.904  1.00 19.57 ? 403 LYS A CB  1 
ATOM 833  C CG  . LYS A 1 127 ? -33.648 33.383 16.438  1.00 20.85 ? 403 LYS A CG  1 
ATOM 834  C CD  . LYS A 1 127 ? -33.324 32.223 15.522  1.00 28.25 ? 403 LYS A CD  1 
ATOM 835  C CE  . LYS A 1 127 ? -33.377 32.667 14.065  1.00 33.90 ? 403 LYS A CE  1 
ATOM 836  N NZ  . LYS A 1 127 ? -33.138 31.558 13.102  1.00 39.57 ? 403 LYS A NZ  1 
ATOM 837  N N   . GLY A 1 128 ? -35.036 36.293 18.418  1.00 30.83 ? 404 GLY A N   1 
ATOM 838  C CA  . GLY A 1 128 ? -36.175 37.123 18.051  1.00 29.21 ? 404 GLY A CA  1 
ATOM 839  C C   . GLY A 1 128 ? -37.070 37.443 19.238  1.00 27.98 ? 404 GLY A C   1 
ATOM 840  O O   . GLY A 1 128 ? -38.167 37.981 19.079  1.00 32.20 ? 404 GLY A O   1 
ATOM 841  N N   . THR A 1 129 ? -36.588 37.109 20.432  1.00 26.16 ? 405 THR A N   1 
ATOM 842  C CA  . THR A 1 129 ? -37.317 37.337 21.670  1.00 29.44 ? 405 THR A CA  1 
ATOM 843  C C   . THR A 1 129 ? -36.318 37.826 22.692  1.00 31.17 ? 405 THR A C   1 
ATOM 844  O O   . THR A 1 129 ? -36.650 38.053 23.851  1.00 32.04 ? 405 THR A O   1 
ATOM 845  C CB  . THR A 1 129 ? -37.901 36.045 22.208  1.00 32.03 ? 405 THR A CB  1 
ATOM 846  O OG1 . THR A 1 129 ? -36.837 35.222 22.696  1.00 34.40 ? 405 THR A OG1 1 
ATOM 847  C CG2 . THR A 1 129 ? -38.633 35.299 21.115  1.00 34.23 ? 405 THR A CG2 1 
ATOM 848  N N   . HIS A 1 130 ? -35.083 37.972 22.239  1.00 30.31 ? 406 HIS A N   1 
ATOM 849  C CA  . HIS A 1 130 ? -33.978 38.421 23.075  1.00 26.91 ? 406 HIS A CA  1 
ATOM 850  C C   . HIS A 1 130 ? -32.793 38.761 22.155  1.00 26.74 ? 406 HIS A C   1 
ATOM 851  O O   . HIS A 1 130 ? -32.828 38.495 20.948  1.00 29.01 ? 406 HIS A O   1 
ATOM 852  C CB  . HIS A 1 130 ? -33.565 37.292 24.033  1.00 21.22 ? 406 HIS A CB  1 
ATOM 853  C CG  . HIS A 1 130 ? -34.007 37.481 25.454  1.00 21.79 ? 406 HIS A CG  1 
ATOM 854  N ND1 . HIS A 1 130 ? -33.413 38.387 26.306  1.00 22.18 ? 406 HIS A ND1 1 
ATOM 855  C CD2 . HIS A 1 130 ? -34.924 36.817 26.197  1.00 24.72 ? 406 HIS A CD2 1 
ATOM 856  C CE1 . HIS A 1 130 ? -33.939 38.269 27.512  1.00 24.79 ? 406 HIS A CE1 1 
ATOM 857  N NE2 . HIS A 1 130 ? -34.858 37.323 27.473  1.00 25.96 ? 406 HIS A NE2 1 
ATOM 858  N N   . LEU A 1 131 ? -31.759 39.364 22.734  1.00 26.21 ? 407 LEU A N   1 
ATOM 859  C CA  . LEU A 1 131 ? -30.529 39.701 22.016  1.00 26.22 ? 407 LEU A CA  1 
ATOM 860  C C   . LEU A 1 131 ? -29.447 38.871 22.703  1.00 26.08 ? 407 LEU A C   1 
ATOM 861  O O   . LEU A 1 131 ? -29.148 39.077 23.883  1.00 25.17 ? 407 LEU A O   1 
ATOM 862  C CB  . LEU A 1 131 ? -30.208 41.196 22.135  1.00 28.57 ? 407 LEU A CB  1 
ATOM 863  C CG  . LEU A 1 131 ? -28.804 41.641 21.703  1.00 26.10 ? 407 LEU A CG  1 
ATOM 864  C CD1 . LEU A 1 131 ? -28.882 42.973 20.996  1.00 24.78 ? 407 LEU A CD1 1 
ATOM 865  C CD2 . LEU A 1 131 ? -27.883 41.735 22.922  1.00 21.77 ? 407 LEU A CD2 1 
ATOM 866  N N   . SER A 1 132 ? -28.876 37.923 21.968  1.00 24.57 ? 408 SER A N   1 
ATOM 867  C CA  . SER A 1 132 ? -27.858 37.042 22.517  1.00 23.44 ? 408 SER A CA  1 
ATOM 868  C C   . SER A 1 132 ? -26.448 37.562 22.257  1.00 23.71 ? 408 SER A C   1 
ATOM 869  O O   . SER A 1 132 ? -26.136 38.029 21.165  1.00 26.72 ? 408 SER A O   1 
ATOM 870  C CB  . SER A 1 132 ? -28.017 35.643 21.915  1.00 22.47 ? 408 SER A CB  1 
ATOM 871  O OG  . SER A 1 132 ? -29.381 35.258 21.831  1.00 26.35 ? 408 SER A OG  1 
ATOM 872  N N   . LEU A 1 133 ? -25.605 37.477 23.278  1.00 21.25 ? 409 LEU A N   1 
ATOM 873  C CA  . LEU A 1 133 ? -24.218 37.915 23.188  1.00 21.42 ? 409 LEU A CA  1 
ATOM 874  C C   . LEU A 1 133 ? -23.339 36.916 23.922  1.00 24.20 ? 409 LEU A C   1 
ATOM 875  O O   . LEU A 1 133 ? -23.561 36.623 25.096  1.00 24.32 ? 409 LEU A O   1 
ATOM 876  C CB  . LEU A 1 133 ? -24.053 39.307 23.805  1.00 20.39 ? 409 LEU A CB  1 
ATOM 877  C CG  . LEU A 1 133 ? -22.656 39.790 24.236  1.00 16.09 ? 409 LEU A CG  1 
ATOM 878  C CD1 . LEU A 1 133 ? -22.277 39.219 25.595  1.00 13.18 ? 409 LEU A CD1 1 
ATOM 879  C CD2 . LEU A 1 133 ? -21.639 39.408 23.180  1.00 14.79 ? 409 LEU A CD2 1 
ATOM 880  N N   . PHE A 1 134 ? -22.330 36.396 23.241  1.00 24.86 ? 410 PHE A N   1 
ATOM 881  C CA  . PHE A 1 134 ? -21.477 35.426 23.889  1.00 23.41 ? 410 PHE A CA  1 
ATOM 882  C C   . PHE A 1 134 ? -19.989 35.790 23.920  1.00 24.31 ? 410 PHE A C   1 
ATOM 883  O O   . PHE A 1 134 ? -19.517 36.688 23.213  1.00 27.28 ? 410 PHE A O   1 
ATOM 884  C CB  . PHE A 1 134 ? -21.645 34.055 23.230  1.00 23.00 ? 410 PHE A CB  1 
ATOM 885  C CG  . PHE A 1 134 ? -23.055 33.730 22.822  1.00 17.58 ? 410 PHE A CG  1 
ATOM 886  C CD1 . PHE A 1 134 ? -23.542 34.114 21.574  1.00 16.33 ? 410 PHE A CD1 1 
ATOM 887  C CD2 . PHE A 1 134 ? -23.886 33.001 23.660  1.00 13.90 ? 410 PHE A CD2 1 
ATOM 888  C CE1 . PHE A 1 134 ? -24.828 33.768 21.173  1.00 12.40 ? 410 PHE A CE1 1 
ATOM 889  C CE2 . PHE A 1 134 ? -25.175 32.655 23.261  1.00 12.40 ? 410 PHE A CE2 1 
ATOM 890  C CZ  . PHE A 1 134 ? -25.641 33.041 22.014  1.00 12.40 ? 410 PHE A CZ  1 
ATOM 891  N N   . PHE A 1 135 ? -19.266 35.056 24.762  1.00 23.80 ? 411 PHE A N   1 
ATOM 892  C CA  . PHE A 1 135 ? -17.831 35.204 24.947  1.00 25.27 ? 411 PHE A CA  1 
ATOM 893  C C   . PHE A 1 135 ? -17.075 34.059 24.255  1.00 28.07 ? 411 PHE A C   1 
ATOM 894  O O   . PHE A 1 135 ? -17.299 32.882 24.542  1.00 31.76 ? 411 PHE A O   1 
ATOM 895  C CB  . PHE A 1 135 ? -17.515 35.216 26.444  1.00 24.31 ? 411 PHE A CB  1 
ATOM 896  C CG  . PHE A 1 135 ? -16.063 35.020 26.761  1.00 26.25 ? 411 PHE A CG  1 
ATOM 897  C CD1 . PHE A 1 135 ? -15.096 35.828 26.188  1.00 25.17 ? 411 PHE A CD1 1 
ATOM 898  C CD2 . PHE A 1 135 ? -15.667 34.030 27.643  1.00 28.30 ? 411 PHE A CD2 1 
ATOM 899  C CE1 . PHE A 1 135 ? -13.770 35.651 26.490  1.00 23.04 ? 411 PHE A CE1 1 
ATOM 900  C CE2 . PHE A 1 135 ? -14.339 33.848 27.949  1.00 28.39 ? 411 PHE A CE2 1 
ATOM 901  C CZ  . PHE A 1 135 ? -13.389 34.659 27.372  1.00 26.92 ? 411 PHE A CZ  1 
ATOM 902  N N   . VAL A 1 136 ? -16.181 34.425 23.343  1.00 29.42 ? 412 VAL A N   1 
ATOM 903  C CA  . VAL A 1 136 ? -15.377 33.470 22.585  1.00 25.78 ? 412 VAL A CA  1 
ATOM 904  C C   . VAL A 1 136 ? -13.990 33.340 23.215  1.00 26.54 ? 412 VAL A C   1 
ATOM 905  O O   . VAL A 1 136 ? -13.682 34.001 24.207  1.00 28.00 ? 412 VAL A O   1 
ATOM 906  C CB  . VAL A 1 136 ? -15.219 33.937 21.100  1.00 25.87 ? 412 VAL A CB  1 
ATOM 907  C CG1 . VAL A 1 136 ? -14.392 32.941 20.292  1.00 28.64 ? 412 VAL A CG1 1 
ATOM 908  C CG2 . VAL A 1 136 ? -16.588 34.102 20.465  1.00 27.82 ? 412 VAL A CG2 1 
ATOM 909  N N   . ILE A 1 137 ? -13.181 32.456 22.636  1.00 25.72 ? 413 ILE A N   1 
ATOM 910  C CA  . ILE A 1 137 ? -11.803 32.197 23.042  1.00 21.96 ? 413 ILE A CA  1 
ATOM 911  C C   . ILE A 1 137 ? -11.194 31.647 21.767  1.00 24.24 ? 413 ILE A C   1 
ATOM 912  O O   . ILE A 1 137 ? -11.734 30.714 21.169  1.00 26.76 ? 413 ILE A O   1 
ATOM 913  C CB  . ILE A 1 137 ? -11.697 31.121 24.125  1.00 18.51 ? 413 ILE A CB  1 
ATOM 914  C CG1 . ILE A 1 137 ? -12.524 31.516 25.346  1.00 18.73 ? 413 ILE A CG1 1 
ATOM 915  C CG2 . ILE A 1 137 ? -10.250 30.950 24.524  1.00 21.60 ? 413 ILE A CG2 1 
ATOM 916  C CD1 . ILE A 1 137 ? -12.750 30.380 26.316  1.00 19.26 ? 413 ILE A CD1 1 
ATOM 917  N N   . MET A 1 138 ? -10.082 32.228 21.338  1.00 25.93 ? 414 MET A N   1 
ATOM 918  C CA  . MET A 1 138 ? -9.447  31.792 20.098  1.00 25.72 ? 414 MET A CA  1 
ATOM 919  C C   . MET A 1 138 ? -8.096  31.113 20.295  1.00 28.78 ? 414 MET A C   1 
ATOM 920  O O   . MET A 1 138 ? -7.502  31.126 21.379  1.00 27.74 ? 414 MET A O   1 
ATOM 921  C CB  . MET A 1 138 ? -9.256  32.987 19.140  1.00 25.13 ? 414 MET A CB  1 
ATOM 922  C CG  . MET A 1 138 ? -10.505 33.819 18.809  1.00 23.47 ? 414 MET A CG  1 
ATOM 923  S SD  . MET A 1 138 ? -10.061 35.429 18.065  1.00 29.15 ? 414 MET A SD  1 
ATOM 924  C CE  . MET A 1 138 ? -9.904  34.986 16.331  1.00 27.75 ? 414 MET A CE  1 
ATOM 925  N N   . ARG A 1 139 ? -7.618  30.532 19.206  1.00 31.26 ? 415 ARG A N   1 
ATOM 926  C CA  . ARG A 1 139 ? -6.339  29.856 19.187  1.00 32.91 ? 415 ARG A CA  1 
ATOM 927  C C   . ARG A 1 139 ? -5.324  30.906 18.741  1.00 33.06 ? 415 ARG A C   1 
ATOM 928  O O   . ARG A 1 139 ? -5.361  31.371 17.596  1.00 31.48 ? 415 ARG A O   1 
ATOM 929  C CB  . ARG A 1 139 ? -6.394  28.703 18.184  1.00 35.03 ? 415 ARG A CB  1 
ATOM 930  C CG  . ARG A 1 139 ? -5.175  27.816 18.113  1.00 33.99 ? 415 ARG A CG  1 
ATOM 931  C CD  . ARG A 1 139 ? -5.249  26.989 16.842  1.00 35.44 ? 415 ARG A CD  1 
ATOM 932  N NE  . ARG A 1 139 ? -5.312  27.849 15.657  1.00 34.76 ? 415 ARG A NE  1 
ATOM 933  C CZ  . ARG A 1 139 ? -5.618  27.434 14.429  1.00 36.29 ? 415 ARG A CZ  1 
ATOM 934  N NH1 . ARG A 1 139 ? -5.900  26.158 14.206  1.00 38.21 ? 415 ARG A NH1 1 
ATOM 935  N NH2 . ARG A 1 139 ? -5.643  28.296 13.420  1.00 36.61 ? 415 ARG A NH2 1 
ATOM 936  N N   . GLY A 1 140 ? -4.442  31.297 19.656  1.00 34.57 ? 416 GLY A N   1 
ATOM 937  C CA  . GLY A 1 140 ? -3.422  32.279 19.333  1.00 37.35 ? 416 GLY A CA  1 
ATOM 938  C C   . GLY A 1 140 ? -2.056  31.860 19.844  1.00 40.56 ? 416 GLY A C   1 
ATOM 939  O O   . GLY A 1 140 ? -1.821  31.891 21.047  1.00 41.83 ? 416 GLY A O   1 
ATOM 940  N N   . GLU A 1 141 ? -1.169  31.461 18.933  1.00 40.21 ? 417 GLU A N   1 
ATOM 941  C CA  . GLU A 1 141 ? 0.197   31.030 19.262  1.00 36.10 ? 417 GLU A CA  1 
ATOM 942  C C   . GLU A 1 141 ? 0.414   30.686 20.732  1.00 35.76 ? 417 GLU A C   1 
ATOM 943  O O   . GLU A 1 141 ? 0.497   29.520 21.113  1.00 37.91 ? 417 GLU A O   1 
ATOM 944  C CB  . GLU A 1 141 ? 1.205   32.116 18.883  1.00 34.88 ? 417 GLU A CB  1 
ATOM 945  C CG  . GLU A 1 141 ? 0.739   33.073 17.800  1.00 37.36 ? 417 GLU A CG  1 
ATOM 946  C CD  . GLU A 1 141 ? 0.593   32.412 16.451  1.00 39.88 ? 417 GLU A CD  1 
ATOM 947  O OE1 . GLU A 1 141 ? 0.160   33.092 15.497  1.00 37.82 ? 417 GLU A OE1 1 
ATOM 948  O OE2 . GLU A 1 141 ? 0.915   31.213 16.343  1.00 45.57 ? 417 GLU A OE2 1 
ATOM 949  N N   . TYR A 1 142 ? 0.511   31.727 21.548  1.00 31.07 ? 418 TYR A N   1 
ATOM 950  C CA  . TYR A 1 142 ? 0.740   31.578 22.973  1.00 31.16 ? 418 TYR A CA  1 
ATOM 951  C C   . TYR A 1 142 ? -0.408  30.935 23.756  1.00 33.47 ? 418 TYR A C   1 
ATOM 952  O O   . TYR A 1 142 ? -0.702  31.344 24.880  1.00 33.73 ? 418 TYR A O   1 
ATOM 953  C CB  . TYR A 1 142 ? 1.109   32.936 23.593  1.00 30.93 ? 418 TYR A CB  1 
ATOM 954  C CG  . TYR A 1 142 ? 1.944   33.804 22.678  1.00 29.65 ? 418 TYR A CG  1 
ATOM 955  C CD1 . TYR A 1 142 ? 1.345   34.555 21.675  1.00 28.80 ? 418 TYR A CD1 1 
ATOM 956  C CD2 . TYR A 1 142 ? 3.332   33.810 22.758  1.00 28.50 ? 418 TYR A CD2 1 
ATOM 957  C CE1 . TYR A 1 142 ? 2.099   35.286 20.765  1.00 28.40 ? 418 TYR A CE1 1 
ATOM 958  C CE2 . TYR A 1 142 ? 4.103   34.540 21.845  1.00 29.87 ? 418 TYR A CE2 1 
ATOM 959  C CZ  . TYR A 1 142 ? 3.473   35.273 20.845  1.00 30.66 ? 418 TYR A CZ  1 
ATOM 960  O OH  . TYR A 1 142 ? 4.206   35.955 19.895  1.00 35.13 ? 418 TYR A OH  1 
ATOM 961  N N   . ASP A 1 143 ? -1.076  29.950 23.163  1.00 36.19 ? 419 ASP A N   1 
ATOM 962  C CA  . ASP A 1 143 ? -2.121  29.240 23.894  1.00 34.69 ? 419 ASP A CA  1 
ATOM 963  C C   . ASP A 1 143 ? -1.272  28.228 24.636  1.00 34.22 ? 419 ASP A C   1 
ATOM 964  O O   . ASP A 1 143 ? -1.346  28.076 25.855  1.00 36.22 ? 419 ASP A O   1 
ATOM 965  C CB  . ASP A 1 143 ? -3.076  28.471 22.967  1.00 35.44 ? 419 ASP A CB  1 
ATOM 966  C CG  . ASP A 1 143 ? -4.178  29.342 22.375  1.00 36.95 ? 419 ASP A CG  1 
ATOM 967  O OD1 . ASP A 1 143 ? -4.776  30.165 23.107  1.00 39.72 ? 419 ASP A OD1 1 
ATOM 968  O OD2 . ASP A 1 143 ? -4.465  29.180 21.170  1.00 41.80 ? 419 ASP A OD2 1 
ATOM 969  N N   . ALA A 1 144 ? -0.433  27.569 23.847  1.00 33.80 ? 420 ALA A N   1 
ATOM 970  C CA  . ALA A 1 144 ? 0.480   26.534 24.297  1.00 33.01 ? 420 ALA A CA  1 
ATOM 971  C C   . ALA A 1 144 ? 1.058   26.739 25.691  1.00 31.93 ? 420 ALA A C   1 
ATOM 972  O O   . ALA A 1 144 ? 0.799   25.956 26.611  1.00 32.05 ? 420 ALA A O   1 
ATOM 973  C CB  . ALA A 1 144 ? 1.605   26.394 23.286  1.00 33.84 ? 420 ALA A CB  1 
ATOM 974  N N   . LEU A 1 145 ? 1.850   27.790 25.845  1.00 32.70 ? 421 LEU A N   1 
ATOM 975  C CA  . LEU A 1 145 ? 2.486   28.068 27.126  1.00 35.56 ? 421 LEU A CA  1 
ATOM 976  C C   . LEU A 1 145 ? 1.526   28.596 28.216  1.00 37.82 ? 421 LEU A C   1 
ATOM 977  O O   . LEU A 1 145 ? 1.802   28.462 29.413  1.00 40.20 ? 421 LEU A O   1 
ATOM 978  C CB  . LEU A 1 145 ? 3.668   29.046 26.916  1.00 33.38 ? 421 LEU A CB  1 
ATOM 979  C CG  . LEU A 1 145 ? 4.859   28.668 26.009  1.00 32.24 ? 421 LEU A CG  1 
ATOM 980  C CD1 . LEU A 1 145 ? 5.784   29.857 25.861  1.00 30.30 ? 421 LEU A CD1 1 
ATOM 981  C CD2 . LEU A 1 145 ? 5.624   27.505 26.592  1.00 30.87 ? 421 LEU A CD2 1 
ATOM 982  N N   . LEU A 1 146 ? 0.401   29.181 27.811  1.00 39.00 ? 422 LEU A N   1 
ATOM 983  C CA  . LEU A 1 146 ? -0.549  29.720 28.782  1.00 37.16 ? 422 LEU A CA  1 
ATOM 984  C C   . LEU A 1 146 ? -1.511  28.671 29.342  1.00 37.95 ? 422 LEU A C   1 
ATOM 985  O O   . LEU A 1 146 ? -2.070  27.874 28.596  1.00 38.60 ? 422 LEU A O   1 
ATOM 986  C CB  . LEU A 1 146 ? -1.344  30.883 28.171  1.00 37.29 ? 422 LEU A CB  1 
ATOM 987  C CG  . LEU A 1 146 ? -0.997  32.278 28.724  1.00 34.55 ? 422 LEU A CG  1 
ATOM 988  C CD1 . LEU A 1 146 ? 0.413   32.672 28.280  1.00 35.41 ? 422 LEU A CD1 1 
ATOM 989  C CD2 . LEU A 1 146 ? -2.009  33.315 28.248  1.00 35.13 ? 422 LEU A CD2 1 
ATOM 990  N N   . PRO A 1 147 ? -1.713  28.670 30.675  1.00 38.56 ? 423 PRO A N   1 
ATOM 991  C CA  . PRO A 1 147 ? -2.579  27.767 31.437  1.00 40.68 ? 423 PRO A CA  1 
ATOM 992  C C   . PRO A 1 147 ? -3.901  27.380 30.812  1.00 42.08 ? 423 PRO A C   1 
ATOM 993  O O   . PRO A 1 147 ? -4.716  28.223 30.454  1.00 41.39 ? 423 PRO A O   1 
ATOM 994  C CB  . PRO A 1 147 ? -2.756  28.503 32.748  1.00 40.40 ? 423 PRO A CB  1 
ATOM 995  C CG  . PRO A 1 147 ? -1.393  29.037 32.959  1.00 40.24 ? 423 PRO A CG  1 
ATOM 996  C CD  . PRO A 1 147 ? -1.027  29.596 31.593  1.00 38.91 ? 423 PRO A CD  1 
ATOM 997  N N   . TRP A 1 148 ? -4.096  26.074 30.700  1.00 43.24 ? 424 TRP A N   1 
ATOM 998  C CA  . TRP A 1 148 ? -5.302  25.500 30.133  1.00 43.36 ? 424 TRP A CA  1 
ATOM 999  C C   . TRP A 1 148 ? -5.937  24.519 31.105  1.00 44.92 ? 424 TRP A C   1 
ATOM 1000 O O   . TRP A 1 148 ? -5.242  23.891 31.916  1.00 48.24 ? 424 TRP A O   1 
ATOM 1001 C CB  . TRP A 1 148 ? -4.981  24.773 28.829  1.00 42.60 ? 424 TRP A CB  1 
ATOM 1002 C CG  . TRP A 1 148 ? -4.823  25.691 27.698  1.00 42.53 ? 424 TRP A CG  1 
ATOM 1003 C CD1 . TRP A 1 148 ? -3.686  25.937 26.998  1.00 43.22 ? 424 TRP A CD1 1 
ATOM 1004 C CD2 . TRP A 1 148 ? -5.829  26.541 27.150  1.00 44.11 ? 424 TRP A CD2 1 
ATOM 1005 N NE1 . TRP A 1 148 ? -3.917  26.896 26.041  1.00 44.69 ? 424 TRP A NE1 1 
ATOM 1006 C CE2 . TRP A 1 148 ? -5.228  27.284 26.114  1.00 45.10 ? 424 TRP A CE2 1 
ATOM 1007 C CE3 . TRP A 1 148 ? -7.181  26.749 27.434  1.00 46.05 ? 424 TRP A CE3 1 
ATOM 1008 C CZ2 . TRP A 1 148 ? -5.933  28.223 25.362  1.00 46.20 ? 424 TRP A CZ2 1 
ATOM 1009 C CZ3 . TRP A 1 148 ? -7.881  27.683 26.687  1.00 44.89 ? 424 TRP A CZ3 1 
ATOM 1010 C CH2 . TRP A 1 148 ? -7.255  28.408 25.664  1.00 44.53 ? 424 TRP A CH2 1 
ATOM 1011 N N   . PRO A 1 149 ? -7.275  24.372 31.030  1.00 43.93 ? 425 PRO A N   1 
ATOM 1012 C CA  . PRO A 1 149 ? -8.103  25.108 30.067  1.00 42.41 ? 425 PRO A CA  1 
ATOM 1013 C C   . PRO A 1 149 ? -8.440  26.486 30.614  1.00 42.41 ? 425 PRO A C   1 
ATOM 1014 O O   . PRO A 1 149 ? -8.128  26.798 31.764  1.00 43.13 ? 425 PRO A O   1 
ATOM 1015 C CB  . PRO A 1 149 ? -9.331  24.226 29.936  1.00 43.14 ? 425 PRO A CB  1 
ATOM 1016 C CG  . PRO A 1 149 ? -9.514  23.761 31.342  1.00 45.62 ? 425 PRO A CG  1 
ATOM 1017 C CD  . PRO A 1 149 ? -8.094  23.396 31.772  1.00 45.27 ? 425 PRO A CD  1 
ATOM 1018 N N   . PHE A 1 150 ? -9.073  27.311 29.791  1.00 41.42 ? 426 PHE A N   1 
ATOM 1019 C CA  . PHE A 1 150 ? -9.435  28.651 30.219  1.00 37.81 ? 426 PHE A CA  1 
ATOM 1020 C C   . PHE A 1 150 ? -10.094 28.489 31.584  1.00 37.59 ? 426 PHE A C   1 
ATOM 1021 O O   . PHE A 1 150 ? -10.861 27.554 31.800  1.00 37.72 ? 426 PHE A O   1 
ATOM 1022 C CB  . PHE A 1 150 ? -10.404 29.275 29.208  1.00 36.25 ? 426 PHE A CB  1 
ATOM 1023 C CG  . PHE A 1 150 ? -10.290 30.776 29.078  1.00 36.56 ? 426 PHE A CG  1 
ATOM 1024 C CD1 . PHE A 1 150 ? -10.382 31.601 30.191  1.00 38.10 ? 426 PHE A CD1 1 
ATOM 1025 C CD2 . PHE A 1 150 ? -10.149 31.361 27.829  1.00 37.53 ? 426 PHE A CD2 1 
ATOM 1026 C CE1 . PHE A 1 150 ? -10.342 32.979 30.056  1.00 35.99 ? 426 PHE A CE1 1 
ATOM 1027 C CE2 . PHE A 1 150 ? -10.109 32.735 27.688  1.00 36.40 ? 426 PHE A CE2 1 
ATOM 1028 C CZ  . PHE A 1 150 ? -10.207 33.545 28.803  1.00 34.11 ? 426 PHE A CZ  1 
ATOM 1029 N N   . LYS A 1 151 ? -9.772  29.385 32.508  1.00 38.45 ? 427 LYS A N   1 
ATOM 1030 C CA  . LYS A 1 151 ? -10.328 29.326 33.849  1.00 40.36 ? 427 LYS A CA  1 
ATOM 1031 C C   . LYS A 1 151 ? -10.414 30.719 34.451  1.00 39.87 ? 427 LYS A C   1 
ATOM 1032 O O   . LYS A 1 151 ? -10.053 30.924 35.609  1.00 41.66 ? 427 LYS A O   1 
ATOM 1033 C CB  . LYS A 1 151 ? -9.450  28.438 34.726  1.00 44.84 ? 427 LYS A CB  1 
ATOM 1034 C CG  . LYS A 1 151 ? -9.455  26.978 34.317  1.00 51.60 ? 427 LYS A CG  1 
ATOM 1035 C CD  . LYS A 1 151 ? -8.422  26.177 35.079  1.00 55.84 ? 427 LYS A CD  1 
ATOM 1036 C CE  . LYS A 1 151 ? -7.024  26.638 34.739  1.00 57.85 ? 427 LYS A CE  1 
ATOM 1037 N NZ  . LYS A 1 151 ? -6.007  25.809 35.432  1.00 59.76 ? 427 LYS A NZ  1 
ATOM 1038 N N   . GLN A 1 152 ? -10.908 31.671 33.662  1.00 39.28 ? 428 GLN A N   1 
ATOM 1039 C CA  . GLN A 1 152 ? -11.029 33.064 34.099  1.00 35.89 ? 428 GLN A CA  1 
ATOM 1040 C C   . GLN A 1 152 ? -12.450 33.636 34.031  1.00 35.23 ? 428 GLN A C   1 
ATOM 1041 O O   . GLN A 1 152 ? -13.197 33.371 33.086  1.00 34.26 ? 428 GLN A O   1 
ATOM 1042 C CB  . GLN A 1 152 ? -10.083 33.940 33.273  1.00 34.47 ? 428 GLN A CB  1 
ATOM 1043 C CG  . GLN A 1 152 ? -8.617  33.603 33.472  1.00 34.92 ? 428 GLN A CG  1 
ATOM 1044 C CD  . GLN A 1 152 ? -8.120  33.999 34.848  1.00 35.29 ? 428 GLN A CD  1 
ATOM 1045 O OE1 . GLN A 1 152 ? -8.708  33.633 35.863  1.00 35.43 ? 428 GLN A OE1 1 
ATOM 1046 N NE2 . GLN A 1 152 ? -7.026  34.753 34.887  1.00 34.29 ? 428 GLN A NE2 1 
ATOM 1047 N N   . LYS A 1 153 ? -12.806 34.422 35.045  1.00 34.65 ? 429 LYS A N   1 
ATOM 1048 C CA  . LYS A 1 153 ? -14.117 35.052 35.134  1.00 31.81 ? 429 LYS A CA  1 
ATOM 1049 C C   . LYS A 1 153 ? -14.287 35.871 33.872  1.00 30.01 ? 429 LYS A C   1 
ATOM 1050 O O   . LYS A 1 153 ? -13.308 36.336 33.307  1.00 32.14 ? 429 LYS A O   1 
ATOM 1051 C CB  . LYS A 1 153 ? -14.158 35.938 36.371  1.00 31.99 ? 429 LYS A CB  1 
ATOM 1052 C CG  . LYS A 1 153 ? -15.506 36.452 36.776  1.00 37.57 ? 429 LYS A CG  1 
ATOM 1053 C CD  . LYS A 1 153 ? -15.449 36.881 38.228  1.00 44.34 ? 429 LYS A CD  1 
ATOM 1054 C CE  . LYS A 1 153 ? -16.814 37.261 38.761  1.00 49.74 ? 429 LYS A CE  1 
ATOM 1055 N NZ  . LYS A 1 153 ? -16.760 37.602 40.211  1.00 48.74 ? 429 LYS A NZ  1 
ATOM 1056 N N   . VAL A 1 154 ? -15.520 36.043 33.422  1.00 29.51 ? 430 VAL A N   1 
ATOM 1057 C CA  . VAL A 1 154 ? -15.773 36.780 32.193  1.00 23.99 ? 430 VAL A CA  1 
ATOM 1058 C C   . VAL A 1 154 ? -17.076 37.571 32.257  1.00 26.49 ? 430 VAL A C   1 
ATOM 1059 O O   . VAL A 1 154 ? -18.110 37.071 31.821  1.00 27.70 ? 430 VAL A O   1 
ATOM 1060 C CB  . VAL A 1 154 ? -15.868 35.804 31.002  1.00 19.43 ? 430 VAL A CB  1 
ATOM 1061 C CG1 . VAL A 1 154 ? -16.061 36.566 29.712  1.00 12.40 ? 430 VAL A CG1 1 
ATOM 1062 C CG2 . VAL A 1 154 ? -14.632 34.941 30.936  1.00 20.12 ? 430 VAL A CG2 1 
ATOM 1063 N N   . THR A 1 155 ? -17.031 38.801 32.777  1.00 28.26 ? 431 THR A N   1 
ATOM 1064 C CA  . THR A 1 155 ? -18.236 39.639 32.895  1.00 29.17 ? 431 THR A CA  1 
ATOM 1065 C C   . THR A 1 155 ? -18.708 40.229 31.564  1.00 29.02 ? 431 THR A C   1 
ATOM 1066 O O   . THR A 1 155 ? -18.030 41.072 30.976  1.00 32.24 ? 431 THR A O   1 
ATOM 1067 C CB  . THR A 1 155 ? -18.016 40.800 33.874  1.00 28.72 ? 431 THR A CB  1 
ATOM 1068 O OG1 . THR A 1 155 ? -17.502 40.295 35.114  1.00 33.99 ? 431 THR A OG1 1 
ATOM 1069 C CG2 . THR A 1 155 ? -19.327 41.520 34.134  1.00 27.88 ? 431 THR A CG2 1 
ATOM 1070 N N   . LEU A 1 156 ? -19.882 39.790 31.107  1.00 31.15 ? 432 LEU A N   1 
ATOM 1071 C CA  . LEU A 1 156 ? -20.450 40.242 29.833  1.00 31.79 ? 432 LEU A CA  1 
ATOM 1072 C C   . LEU A 1 156 ? -21.516 41.316 30.005  1.00 30.14 ? 432 LEU A C   1 
ATOM 1073 O O   . LEU A 1 156 ? -22.644 40.989 30.374  1.00 29.72 ? 432 LEU A O   1 
ATOM 1074 C CB  . LEU A 1 156 ? -21.078 39.064 29.078  1.00 35.03 ? 432 LEU A CB  1 
ATOM 1075 C CG  . LEU A 1 156 ? -20.265 37.798 28.799  1.00 36.59 ? 432 LEU A CG  1 
ATOM 1076 C CD1 . LEU A 1 156 ? -21.031 36.968 27.782  1.00 40.52 ? 432 LEU A CD1 1 
ATOM 1077 C CD2 . LEU A 1 156 ? -18.881 38.129 28.262  1.00 35.47 ? 432 LEU A CD2 1 
ATOM 1078 N N   . MET A 1 157 ? -21.173 42.577 29.714  1.00 27.34 ? 433 MET A N   1 
ATOM 1079 C CA  . MET A 1 157 ? -22.124 43.684 29.855  1.00 26.48 ? 433 MET A CA  1 
ATOM 1080 C C   . MET A 1 157 ? -22.374 44.553 28.612  1.00 24.45 ? 433 MET A C   1 
ATOM 1081 O O   . MET A 1 157 ? -21.632 44.489 27.626  1.00 22.97 ? 433 MET A O   1 
ATOM 1082 C CB  . MET A 1 157 ? -21.721 44.560 31.051  1.00 25.52 ? 433 MET A CB  1 
ATOM 1083 C CG  . MET A 1 157 ? -20.240 44.891 31.139  1.00 28.12 ? 433 MET A CG  1 
ATOM 1084 S SD  . MET A 1 157 ? -19.628 44.940 32.860  1.00 30.61 ? 433 MET A SD  1 
ATOM 1085 C CE  . MET A 1 157 ? -20.366 46.465 33.465  1.00 25.66 ? 433 MET A CE  1 
ATOM 1086 N N   . LEU A 1 158 ? -23.447 45.348 28.681  1.00 26.27 ? 434 LEU A N   1 
ATOM 1087 C CA  . LEU A 1 158 ? -23.879 46.247 27.601  1.00 28.28 ? 434 LEU A CA  1 
ATOM 1088 C C   . LEU A 1 158 ? -23.738 47.735 27.956  1.00 29.83 ? 434 LEU A C   1 
ATOM 1089 O O   . LEU A 1 158 ? -24.383 48.244 28.873  1.00 32.17 ? 434 LEU A O   1 
ATOM 1090 C CB  . LEU A 1 158 ? -25.336 45.958 27.231  1.00 24.59 ? 434 LEU A CB  1 
ATOM 1091 C CG  . LEU A 1 158 ? -25.935 46.827 26.124  1.00 22.32 ? 434 LEU A CG  1 
ATOM 1092 C CD1 . LEU A 1 158 ? -25.338 46.468 24.770  1.00 18.79 ? 434 LEU A CD1 1 
ATOM 1093 C CD2 . LEU A 1 158 ? -27.435 46.621 26.108  1.00 18.37 ? 434 LEU A CD2 1 
ATOM 1094 N N   . MET A 1 159 ? -22.904 48.431 27.196  1.00 30.50 ? 435 MET A N   1 
ATOM 1095 C CA  . MET A 1 159 ? -22.650 49.838 27.438  1.00 28.39 ? 435 MET A CA  1 
ATOM 1096 C C   . MET A 1 159 ? -23.604 50.768 26.718  1.00 29.48 ? 435 MET A C   1 
ATOM 1097 O O   . MET A 1 159 ? -23.741 50.697 25.488  1.00 30.51 ? 435 MET A O   1 
ATOM 1098 C CB  . MET A 1 159 ? -21.217 50.189 27.030  1.00 26.56 ? 435 MET A CB  1 
ATOM 1099 C CG  . MET A 1 159 ? -20.160 49.471 27.835  1.00 22.66 ? 435 MET A CG  1 
ATOM 1100 S SD  . MET A 1 159 ? -20.470 49.641 29.598  1.00 26.15 ? 435 MET A SD  1 
ATOM 1101 C CE  . MET A 1 159 ? -20.117 51.427 29.811  1.00 26.87 ? 435 MET A CE  1 
ATOM 1102 N N   . ASP A 1 160 ? -24.245 51.649 27.492  1.00 30.45 ? 436 ASP A N   1 
ATOM 1103 C CA  . ASP A 1 160 ? -25.181 52.636 26.946  1.00 31.58 ? 436 ASP A CA  1 
ATOM 1104 C C   . ASP A 1 160 ? -24.458 53.969 26.716  1.00 32.94 ? 436 ASP A C   1 
ATOM 1105 O O   . ASP A 1 160 ? -23.554 54.346 27.467  1.00 33.24 ? 436 ASP A O   1 
ATOM 1106 C CB  . ASP A 1 160 ? -26.388 52.845 27.889  1.00 29.79 ? 436 ASP A CB  1 
ATOM 1107 C CG  . ASP A 1 160 ? -27.526 53.654 27.237  1.00 30.03 ? 436 ASP A CG  1 
ATOM 1108 O OD1 . ASP A 1 160 ? -28.011 53.253 26.163  1.00 30.88 ? 436 ASP A OD1 1 
ATOM 1109 O OD2 . ASP A 1 160 ? -27.938 54.688 27.803  1.00 24.06 ? 436 ASP A OD2 1 
ATOM 1110 N N   . GLN A 1 161 ? -24.875 54.670 25.668  1.00 34.45 ? 437 GLN A N   1 
ATOM 1111 C CA  . GLN A 1 161 ? -24.287 55.943 25.300  1.00 36.07 ? 437 GLN A CA  1 
ATOM 1112 C C   . GLN A 1 161 ? -24.787 57.053 26.209  1.00 41.02 ? 437 GLN A C   1 
ATOM 1113 O O   . GLN A 1 161 ? -24.050 57.985 26.527  1.00 41.94 ? 437 GLN A O   1 
ATOM 1114 C CB  . GLN A 1 161 ? -24.626 56.243 23.844  1.00 31.69 ? 437 GLN A CB  1 
ATOM 1115 C CG  . GLN A 1 161 ? -24.588 55.003 22.978  1.00 31.58 ? 437 GLN A CG  1 
ATOM 1116 C CD  . GLN A 1 161 ? -24.180 55.286 21.553  1.00 35.48 ? 437 GLN A CD  1 
ATOM 1117 O OE1 . GLN A 1 161 ? -23.060 55.730 21.292  1.00 38.63 ? 437 GLN A OE1 1 
ATOM 1118 N NE2 . GLN A 1 161 ? -25.080 55.022 20.619  1.00 34.36 ? 437 GLN A NE2 1 
ATOM 1119 N N   . GLY A 1 162 ? -26.042 56.945 26.631  1.00 45.45 ? 438 GLY A N   1 
ATOM 1120 C CA  . GLY A 1 162 ? -26.615 57.949 27.506  1.00 47.08 ? 438 GLY A CA  1 
ATOM 1121 C C   . GLY A 1 162 ? -25.852 58.101 28.810  1.00 50.44 ? 438 GLY A C   1 
ATOM 1122 O O   . GLY A 1 162 ? -24.682 57.734 28.898  1.00 51.11 ? 438 GLY A O   1 
ATOM 1123 N N   . SER A 1 163 ? -26.524 58.636 29.827  1.00 55.11 ? 439 SER A N   1 
ATOM 1124 C CA  . SER A 1 163 ? -25.916 58.850 31.137  1.00 58.63 ? 439 SER A CA  1 
ATOM 1125 C C   . SER A 1 163 ? -25.323 57.582 31.751  1.00 59.50 ? 439 SER A C   1 
ATOM 1126 O O   . SER A 1 163 ? -24.769 56.736 31.053  1.00 61.41 ? 439 SER A O   1 
ATOM 1127 C CB  . SER A 1 163 ? -26.940 59.472 32.103  1.00 58.06 ? 439 SER A CB  1 
ATOM 1128 O OG  . SER A 1 163 ? -28.136 58.716 32.183  1.00 59.91 ? 439 SER A OG  1 
ATOM 1129 N N   . SER A 1 164 ? -25.437 57.466 33.067  1.00 60.25 ? 440 SER A N   1 
ATOM 1130 C CA  . SER A 1 164 ? -24.911 56.315 33.788  1.00 61.75 ? 440 SER A CA  1 
ATOM 1131 C C   . SER A 1 164 ? -25.422 54.995 33.211  1.00 62.43 ? 440 SER A C   1 
ATOM 1132 O O   . SER A 1 164 ? -24.661 54.040 33.059  1.00 62.22 ? 440 SER A O   1 
ATOM 1133 C CB  . SER A 1 164 ? -25.304 56.412 35.263  1.00 63.75 ? 440 SER A CB  1 
ATOM 1134 O OG  . SER A 1 164 ? -24.993 57.692 35.785  1.00 66.74 ? 440 SER A OG  1 
ATOM 1135 N N   . ARG A 1 165 ? -26.715 54.960 32.897  1.00 62.67 ? 441 ARG A N   1 
ATOM 1136 C CA  . ARG A 1 165 ? -27.388 53.780 32.348  1.00 62.21 ? 441 ARG A CA  1 
ATOM 1137 C C   . ARG A 1 165 ? -26.807 52.435 32.753  1.00 62.02 ? 441 ARG A C   1 
ATOM 1138 O O   . ARG A 1 165 ? -25.753 52.019 32.261  1.00 60.85 ? 441 ARG A O   1 
ATOM 1139 C CB  . ARG A 1 165 ? -27.466 53.871 30.825  1.00 62.68 ? 441 ARG A CB  1 
ATOM 1140 C CG  . ARG A 1 165 ? -28.743 54.537 30.339  1.00 60.35 ? 441 ARG A CG  1 
ATOM 1141 C CD  . ARG A 1 165 ? -29.973 53.756 30.793  1.00 56.93 ? 441 ARG A CD  1 
ATOM 1142 N NE  . ARG A 1 165 ? -31.227 54.337 30.313  1.00 54.59 ? 441 ARG A NE  1 
ATOM 1143 C CZ  . ARG A 1 165 ? -31.538 54.512 29.032  1.00 55.29 ? 441 ARG A CZ  1 
ATOM 1144 N NH1 . ARG A 1 165 ? -30.687 54.156 28.077  1.00 52.86 ? 441 ARG A NH1 1 
ATOM 1145 N NH2 . ARG A 1 165 ? -32.711 55.038 28.706  1.00 56.12 ? 441 ARG A NH2 1 
ATOM 1146 N N   . ARG A 1 166 ? -27.524 51.758 33.649  1.00 59.16 ? 442 ARG A N   1 
ATOM 1147 C CA  . ARG A 1 166 ? -27.111 50.455 34.156  1.00 54.67 ? 442 ARG A CA  1 
ATOM 1148 C C   . ARG A 1 166 ? -26.433 49.645 33.063  1.00 50.51 ? 442 ARG A C   1 
ATOM 1149 O O   . ARG A 1 166 ? -26.889 49.630 31.919  1.00 49.55 ? 442 ARG A O   1 
ATOM 1150 C CB  . ARG A 1 166 ? -28.320 49.676 34.700  1.00 58.41 ? 442 ARG A CB  1 
ATOM 1151 C CG  . ARG A 1 166 ? -29.028 50.326 35.890  1.00 59.66 ? 442 ARG A CG  1 
ATOM 1152 C CD  . ARG A 1 166 ? -29.720 49.278 36.767  1.00 57.13 ? 442 ARG A CD  1 
ATOM 1153 N NE  . ARG A 1 166 ? -30.716 48.485 36.046  1.00 57.09 ? 442 ARG A NE  1 
ATOM 1154 C CZ  . ARG A 1 166 ? -31.905 48.939 35.662  1.00 56.62 ? 442 ARG A CZ  1 
ATOM 1155 N NH1 . ARG A 1 166 ? -32.256 50.186 35.928  1.00 56.25 ? 442 ARG A NH1 1 
ATOM 1156 N NH2 . ARG A 1 166 ? -32.750 48.148 35.017  1.00 56.32 ? 442 ARG A NH2 1 
ATOM 1157 N N   . HIS A 1 167 ? -25.335 48.987 33.421  1.00 46.83 ? 443 HIS A N   1 
ATOM 1158 C CA  . HIS A 1 167 ? -24.589 48.168 32.474  1.00 41.70 ? 443 HIS A CA  1 
ATOM 1159 C C   . HIS A 1 167 ? -25.116 46.735 32.516  1.00 40.67 ? 443 HIS A C   1 
ATOM 1160 O O   . HIS A 1 167 ? -24.638 45.886 33.274  1.00 40.89 ? 443 HIS A O   1 
ATOM 1161 C CB  . HIS A 1 167 ? -23.094 48.206 32.810  1.00 39.19 ? 443 HIS A CB  1 
ATOM 1162 C CG  . HIS A 1 167 ? -22.493 49.575 32.736  1.00 35.82 ? 443 HIS A CG  1 
ATOM 1163 N ND1 . HIS A 1 167 ? -23.257 50.723 32.735  1.00 35.55 ? 443 HIS A ND1 1 
ATOM 1164 C CD2 . HIS A 1 167 ? -21.202 49.980 32.679  1.00 33.71 ? 443 HIS A CD2 1 
ATOM 1165 C CE1 . HIS A 1 167 ? -22.463 51.777 32.678  1.00 34.63 ? 443 HIS A CE1 1 
ATOM 1166 N NE2 . HIS A 1 167 ? -21.211 51.355 32.643  1.00 31.04 ? 443 HIS A NE2 1 
ATOM 1167 N N   . LEU A 1 168 ? -26.122 46.482 31.690  1.00 36.99 ? 444 LEU A N   1 
ATOM 1168 C CA  . LEU A 1 168 ? -26.745 45.176 31.622  1.00 33.18 ? 444 LEU A CA  1 
ATOM 1169 C C   . LEU A 1 168 ? -25.748 44.103 31.219  1.00 36.96 ? 444 LEU A C   1 
ATOM 1170 O O   . LEU A 1 168 ? -24.988 44.268 30.265  1.00 39.23 ? 444 LEU A O   1 
ATOM 1171 C CB  . LEU A 1 168 ? -27.921 45.217 30.642  1.00 28.09 ? 444 LEU A CB  1 
ATOM 1172 C CG  . LEU A 1 168 ? -28.994 46.219 31.070  1.00 26.56 ? 444 LEU A CG  1 
ATOM 1173 C CD1 . LEU A 1 168 ? -30.098 46.263 30.037  1.00 25.98 ? 444 LEU A CD1 1 
ATOM 1174 C CD2 . LEU A 1 168 ? -29.535 45.829 32.444  1.00 26.28 ? 444 LEU A CD2 1 
ATOM 1175 N N   . GLY A 1 169 ? -25.757 43.006 31.970  1.00 37.43 ? 445 GLY A N   1 
ATOM 1176 C CA  . GLY A 1 169 ? -24.862 41.903 31.696  1.00 40.48 ? 445 GLY A CA  1 
ATOM 1177 C C   . GLY A 1 169 ? -24.306 41.291 32.960  1.00 40.73 ? 445 GLY A C   1 
ATOM 1178 O O   . GLY A 1 169 ? -24.378 41.883 34.039  1.00 42.58 ? 445 GLY A O   1 
ATOM 1179 N N   . ASP A 1 170 ? -23.739 40.098 32.819  1.00 40.63 ? 446 ASP A N   1 
ATOM 1180 C CA  . ASP A 1 170 ? -23.165 39.385 33.949  1.00 41.07 ? 446 ASP A CA  1 
ATOM 1181 C C   . ASP A 1 170 ? -21.936 38.617 33.503  1.00 39.02 ? 446 ASP A C   1 
ATOM 1182 O O   . ASP A 1 170 ? -21.586 38.600 32.323  1.00 38.52 ? 446 ASP A O   1 
ATOM 1183 C CB  . ASP A 1 170 ? -24.193 38.403 34.535  1.00 46.14 ? 446 ASP A CB  1 
ATOM 1184 C CG  . ASP A 1 170 ? -23.687 37.682 35.783  1.00 47.73 ? 446 ASP A CG  1 
ATOM 1185 O OD1 . ASP A 1 170 ? -24.323 36.685 36.199  1.00 49.21 ? 446 ASP A OD1 1 
ATOM 1186 O OD2 . ASP A 1 170 ? -22.664 38.114 36.353  1.00 48.61 ? 446 ASP A OD2 1 
ATOM 1187 N N   . ALA A 1 171 ? -21.298 37.984 34.479  1.00 38.19 ? 447 ALA A N   1 
ATOM 1188 C CA  . ALA A 1 171 ? -20.114 37.173 34.276  1.00 36.92 ? 447 ALA A CA  1 
ATOM 1189 C C   . ALA A 1 171 ? -20.537 35.716 34.382  1.00 37.00 ? 447 ALA A C   1 
ATOM 1190 O O   . ALA A 1 171 ? -21.654 35.353 34.007  1.00 41.30 ? 447 ALA A O   1 
ATOM 1191 C CB  . ALA A 1 171 ? -19.087 37.490 35.347  1.00 37.02 ? 447 ALA A CB  1 
ATOM 1192 N N   . PHE A 1 172 ? -19.631 34.892 34.895  1.00 34.18 ? 448 PHE A N   1 
ATOM 1193 C CA  . PHE A 1 172 ? -19.871 33.471 35.101  1.00 32.60 ? 448 PHE A CA  1 
ATOM 1194 C C   . PHE A 1 172 ? -18.550 32.735 35.111  1.00 33.64 ? 448 PHE A C   1 
ATOM 1195 O O   . PHE A 1 172 ? -17.722 32.941 34.227  1.00 35.80 ? 448 PHE A O   1 
ATOM 1196 C CB  . PHE A 1 172 ? -20.804 32.898 34.027  1.00 29.68 ? 448 PHE A CB  1 
ATOM 1197 C CG  . PHE A 1 172 ? -20.262 32.956 32.632  1.00 23.61 ? 448 PHE A CG  1 
ATOM 1198 C CD1 . PHE A 1 172 ? -19.348 32.016 32.188  1.00 24.38 ? 448 PHE A CD1 1 
ATOM 1199 C CD2 . PHE A 1 172 ? -20.727 33.905 31.738  1.00 21.44 ? 448 PHE A CD2 1 
ATOM 1200 C CE1 . PHE A 1 172 ? -18.915 32.020 30.878  1.00 22.07 ? 448 PHE A CE1 1 
ATOM 1201 C CE2 . PHE A 1 172 ? -20.298 33.913 30.428  1.00 16.76 ? 448 PHE A CE2 1 
ATOM 1202 C CZ  . PHE A 1 172 ? -19.391 32.969 29.994  1.00 19.10 ? 448 PHE A CZ  1 
ATOM 1203 N N   . LYS A 1 173 ? -18.354 31.892 36.127  1.00 34.55 ? 449 LYS A N   1 
ATOM 1204 C CA  . LYS A 1 173 ? -17.115 31.133 36.269  1.00 35.73 ? 449 LYS A CA  1 
ATOM 1205 C C   . LYS A 1 173 ? -17.070 29.983 35.277  1.00 38.19 ? 449 LYS A C   1 
ATOM 1206 O O   . LYS A 1 173 ? -18.068 29.289 35.057  1.00 41.50 ? 449 LYS A O   1 
ATOM 1207 C CB  . LYS A 1 173 ? -16.964 30.627 37.706  1.00 33.34 ? 449 LYS A CB  1 
ATOM 1208 C CG  . LYS A 1 173 ? -17.054 31.748 38.729  1.00 38.45 ? 449 LYS A CG  1 
ATOM 1209 C CD  . LYS A 1 173 ? -16.439 31.380 40.069  1.00 41.63 ? 449 LYS A CD  1 
ATOM 1210 C CE  . LYS A 1 173 ? -17.232 30.324 40.810  1.00 40.59 ? 449 LYS A CE  1 
ATOM 1211 N NZ  . LYS A 1 173 ? -16.641 30.069 42.157  1.00 39.52 ? 449 LYS A NZ  1 
ATOM 1212 N N   . PRO A 1 174 ? -15.906 29.783 34.644  1.00 40.19 ? 450 PRO A N   1 
ATOM 1213 C CA  . PRO A 1 174 ? -15.745 28.714 33.663  1.00 40.44 ? 450 PRO A CA  1 
ATOM 1214 C C   . PRO A 1 174 ? -15.742 27.339 34.294  1.00 40.98 ? 450 PRO A C   1 
ATOM 1215 O O   . PRO A 1 174 ? -15.029 27.099 35.268  1.00 41.45 ? 450 PRO A O   1 
ATOM 1216 C CB  . PRO A 1 174 ? -14.403 29.042 33.007  1.00 39.55 ? 450 PRO A CB  1 
ATOM 1217 C CG  . PRO A 1 174 ? -14.256 30.518 33.215  1.00 41.31 ? 450 PRO A CG  1 
ATOM 1218 C CD  . PRO A 1 174 ? -14.730 30.667 34.634  1.00 42.45 ? 450 PRO A CD  1 
ATOM 1219 N N   . ASP A 1 175 ? -16.565 26.450 33.745  1.00 42.49 ? 451 ASP A N   1 
ATOM 1220 C CA  . ASP A 1 175 ? -16.636 25.073 34.209  1.00 44.14 ? 451 ASP A CA  1 
ATOM 1221 C C   . ASP A 1 175 ? -15.701 24.377 33.229  1.00 42.78 ? 451 ASP A C   1 
ATOM 1222 O O   . ASP A 1 175 ? -16.128 23.927 32.170  1.00 44.78 ? 451 ASP A O   1 
ATOM 1223 C CB  . ASP A 1 175 ? -18.057 24.532 34.065  1.00 48.30 ? 451 ASP A CB  1 
ATOM 1224 C CG  . ASP A 1 175 ? -18.394 23.490 35.119  1.00 50.27 ? 451 ASP A CG  1 
ATOM 1225 O OD1 . ASP A 1 175 ? -18.096 23.741 36.309  1.00 53.66 ? 451 ASP A OD1 1 
ATOM 1226 O OD2 . ASP A 1 175 ? -18.966 22.432 34.762  1.00 49.46 ? 451 ASP A OD2 1 
ATOM 1227 N N   . PRO A 1 176 ? -14.404 24.305 33.572  1.00 41.42 ? 452 PRO A N   1 
ATOM 1228 C CA  . PRO A 1 176 ? -13.331 23.693 32.777  1.00 40.43 ? 452 PRO A CA  1 
ATOM 1229 C C   . PRO A 1 176 ? -13.721 22.498 31.925  1.00 40.16 ? 452 PRO A C   1 
ATOM 1230 O O   . PRO A 1 176 ? -12.983 22.109 31.016  1.00 41.63 ? 452 PRO A O   1 
ATOM 1231 C CB  . PRO A 1 176 ? -12.266 23.354 33.825  1.00 41.73 ? 452 PRO A CB  1 
ATOM 1232 C CG  . PRO A 1 176 ? -13.013 23.393 35.145  1.00 42.03 ? 452 PRO A CG  1 
ATOM 1233 C CD  . PRO A 1 176 ? -13.945 24.535 34.951  1.00 41.59 ? 452 PRO A CD  1 
ATOM 1234 N N   . ASN A 1 177 ? -14.879 21.919 32.227  1.00 41.41 ? 453 ASN A N   1 
ATOM 1235 C CA  . ASN A 1 177 ? -15.392 20.770 31.484  1.00 39.98 ? 453 ASN A CA  1 
ATOM 1236 C C   . ASN A 1 177 ? -16.194 21.269 30.275  1.00 40.53 ? 453 ASN A C   1 
ATOM 1237 O O   . ASN A 1 177 ? -16.563 20.496 29.380  1.00 40.77 ? 453 ASN A O   1 
ATOM 1238 C CB  . ASN A 1 177 ? -16.269 19.907 32.398  1.00 40.32 ? 453 ASN A CB  1 
ATOM 1239 C CG  . ASN A 1 177 ? -15.504 19.366 33.586  1.00 43.94 ? 453 ASN A CG  1 
ATOM 1240 O OD1 . ASN A 1 177 ? -14.628 18.513 33.433  1.00 49.29 ? 453 ASN A OD1 1 
ATOM 1241 N ND2 . ASN A 1 177 ? -15.818 19.870 34.779  1.00 43.34 ? 453 ASN A ND2 1 
ATOM 1242 N N   . SER A 1 178 ? -16.455 22.573 30.261  1.00 40.78 ? 454 SER A N   1 
ATOM 1243 C CA  . SER A 1 178 ? -17.182 23.186 29.169  1.00 40.50 ? 454 SER A CA  1 
ATOM 1244 C C   . SER A 1 178 ? -16.310 23.012 27.932  1.00 40.11 ? 454 SER A C   1 
ATOM 1245 O O   . SER A 1 178 ? -15.093 23.193 27.994  1.00 42.64 ? 454 SER A O   1 
ATOM 1246 C CB  . SER A 1 178 ? -17.408 24.675 29.452  1.00 41.12 ? 454 SER A CB  1 
ATOM 1247 O OG  . SER A 1 178 ? -18.104 24.878 30.672  1.00 44.39 ? 454 SER A OG  1 
ATOM 1248 N N   . SER A 1 179 ? -16.931 22.657 26.814  1.00 39.47 ? 455 SER A N   1 
ATOM 1249 C CA  . SER A 1 179 ? -16.203 22.449 25.568  1.00 37.40 ? 455 SER A CA  1 
ATOM 1250 C C   . SER A 1 179 ? -15.838 23.746 24.836  1.00 36.90 ? 455 SER A C   1 
ATOM 1251 O O   . SER A 1 179 ? -15.460 23.712 23.664  1.00 35.87 ? 455 SER A O   1 
ATOM 1252 C CB  . SER A 1 179 ? -17.025 21.550 24.646  1.00 38.24 ? 455 SER A CB  1 
ATOM 1253 O OG  . SER A 1 179 ? -17.431 20.381 25.331  1.00 43.07 ? 455 SER A OG  1 
ATOM 1254 N N   . SER A 1 180 ? -15.952 24.878 25.534  1.00 35.16 ? 456 SER A N   1 
ATOM 1255 C CA  . SER A 1 180 ? -15.645 26.203 24.977  1.00 34.65 ? 456 SER A CA  1 
ATOM 1256 C C   . SER A 1 180 ? -14.419 26.816 25.653  1.00 36.80 ? 456 SER A C   1 
ATOM 1257 O O   . SER A 1 180 ? -13.971 27.910 25.284  1.00 36.20 ? 456 SER A O   1 
ATOM 1258 C CB  . SER A 1 180 ? -16.825 27.154 25.184  1.00 34.39 ? 456 SER A CB  1 
ATOM 1259 O OG  . SER A 1 180 ? -18.001 26.667 24.573  1.00 31.84 ? 456 SER A OG  1 
ATOM 1260 N N   . PHE A 1 181 ? -13.894 26.095 26.644  1.00 36.94 ? 457 PHE A N   1 
ATOM 1261 C CA  . PHE A 1 181 ? -12.738 26.531 27.418  1.00 38.80 ? 457 PHE A CA  1 
ATOM 1262 C C   . PHE A 1 181 ? -11.524 25.613 27.267  1.00 40.90 ? 457 PHE A C   1 
ATOM 1263 O O   . PHE A 1 181 ? -10.592 25.660 28.072  1.00 41.79 ? 457 PHE A O   1 
ATOM 1264 C CB  . PHE A 1 181 ? -13.128 26.649 28.897  1.00 41.57 ? 457 PHE A CB  1 
ATOM 1265 C CG  . PHE A 1 181 ? -14.225 27.647 29.152  1.00 43.51 ? 457 PHE A CG  1 
ATOM 1266 C CD1 . PHE A 1 181 ? -14.032 29.001 28.879  1.00 44.91 ? 457 PHE A CD1 1 
ATOM 1267 C CD2 . PHE A 1 181 ? -15.456 27.236 29.648  1.00 45.12 ? 457 PHE A CD2 1 
ATOM 1268 C CE1 . PHE A 1 181 ? -15.044 29.931 29.092  1.00 45.17 ? 457 PHE A CE1 1 
ATOM 1269 C CE2 . PHE A 1 181 ? -16.485 28.158 29.867  1.00 44.95 ? 457 PHE A CE2 1 
ATOM 1270 C CZ  . PHE A 1 181 ? -16.275 29.509 29.587  1.00 45.68 ? 457 PHE A CZ  1 
ATOM 1271 N N   . LYS A 1 182 ? -11.538 24.774 26.239  1.00 41.40 ? 458 LYS A N   1 
ATOM 1272 C CA  . LYS A 1 182 ? -10.413 23.889 25.994  1.00 43.14 ? 458 LYS A CA  1 
ATOM 1273 C C   . LYS A 1 182 ? -9.276  24.721 25.390  1.00 42.72 ? 458 LYS A C   1 
ATOM 1274 O O   . LYS A 1 182 ? -9.443  25.916 25.164  1.00 43.04 ? 458 LYS A O   1 
ATOM 1275 C CB  . LYS A 1 182 ? -10.828 22.776 25.027  1.00 47.35 ? 458 LYS A CB  1 
ATOM 1276 C CG  . LYS A 1 182 ? -11.491 21.579 25.697  1.00 54.44 ? 458 LYS A CG  1 
ATOM 1277 C CD  . LYS A 1 182 ? -11.652 20.420 24.717  1.00 62.38 ? 458 LYS A CD  1 
ATOM 1278 C CE  . LYS A 1 182 ? -11.846 19.084 25.431  1.00 65.16 ? 458 LYS A CE  1 
ATOM 1279 N NZ  . LYS A 1 182 ? -13.003 19.076 26.365  1.00 67.88 ? 458 LYS A NZ  1 
ATOM 1280 N N   . LYS A 1 183 ? -8.123  24.097 25.148  1.00 40.99 ? 459 LYS A N   1 
ATOM 1281 C CA  . LYS A 1 183 ? -6.968  24.763 24.530  1.00 38.60 ? 459 LYS A CA  1 
ATOM 1282 C C   . LYS A 1 183 ? -7.177  24.628 23.018  1.00 36.71 ? 459 LYS A C   1 
ATOM 1283 O O   . LYS A 1 183 ? -6.775  23.638 22.422  1.00 35.03 ? 459 LYS A O   1 
ATOM 1284 C CB  . LYS A 1 183 ? -5.687  24.044 24.958  1.00 41.76 ? 459 LYS A CB  1 
ATOM 1285 C CG  . LYS A 1 183 ? -4.407  24.455 24.243  1.00 45.27 ? 459 LYS A CG  1 
ATOM 1286 C CD  . LYS A 1 183 ? -3.226  23.631 24.771  1.00 48.50 ? 459 LYS A CD  1 
ATOM 1287 C CE  . LYS A 1 183 ? -1.903  24.031 24.137  1.00 47.77 ? 459 LYS A CE  1 
ATOM 1288 N NZ  . LYS A 1 183 ? -1.901  23.837 22.658  1.00 47.73 ? 459 LYS A NZ  1 
ATOM 1289 N N   . PRO A 1 184 ? -7.797  25.637 22.382  1.00 34.88 ? 460 PRO A N   1 
ATOM 1290 C CA  . PRO A 1 184 ? -8.097  25.671 20.950  1.00 34.75 ? 460 PRO A CA  1 
ATOM 1291 C C   . PRO A 1 184 ? -7.281  24.758 20.066  1.00 34.96 ? 460 PRO A C   1 
ATOM 1292 O O   . PRO A 1 184 ? -6.098  24.535 20.307  1.00 35.41 ? 460 PRO A O   1 
ATOM 1293 C CB  . PRO A 1 184 ? -7.922  27.134 20.604  1.00 32.13 ? 460 PRO A CB  1 
ATOM 1294 C CG  . PRO A 1 184 ? -8.492  27.780 21.792  1.00 33.33 ? 460 PRO A CG  1 
ATOM 1295 C CD  . PRO A 1 184 ? -7.859  27.000 22.929  1.00 35.40 ? 460 PRO A CD  1 
ATOM 1296 N N   . THR A 1 185 ? -7.934  24.227 19.037  1.00 36.53 ? 461 THR A N   1 
ATOM 1297 C CA  . THR A 1 185 ? -7.304  23.320 18.082  1.00 40.12 ? 461 THR A CA  1 
ATOM 1298 C C   . THR A 1 185 ? -7.659  23.755 16.659  1.00 40.97 ? 461 THR A C   1 
ATOM 1299 O O   . THR A 1 185 ? -7.037  23.326 15.684  1.00 43.95 ? 461 THR A O   1 
ATOM 1300 C CB  . THR A 1 185 ? -7.780  21.868 18.316  1.00 40.62 ? 461 THR A CB  1 
ATOM 1301 O OG1 . THR A 1 185 ? -7.363  21.434 19.618  1.00 44.88 ? 461 THR A OG1 1 
ATOM 1302 C CG2 . THR A 1 185 ? -7.200  20.934 17.268  1.00 42.46 ? 461 THR A CG2 1 
ATOM 1303 N N   . GLY A 1 186 ? -8.666  24.618 16.562  1.00 40.57 ? 462 GLY A N   1 
ATOM 1304 C CA  . GLY A 1 186 ? -9.114  25.128 15.280  1.00 39.47 ? 462 GLY A CA  1 
ATOM 1305 C C   . GLY A 1 186 ? -9.327  26.621 15.394  1.00 40.56 ? 462 GLY A C   1 
ATOM 1306 O O   . GLY A 1 186 ? -9.550  27.130 16.494  1.00 42.17 ? 462 GLY A O   1 
ATOM 1307 N N   . GLU A 1 187 ? -9.271  27.316 14.262  1.00 41.14 ? 463 GLU A N   1 
ATOM 1308 C CA  . GLU A 1 187 ? -9.420  28.771 14.222  1.00 40.91 ? 463 GLU A CA  1 
ATOM 1309 C C   . GLU A 1 187 ? -10.170 29.458 15.368  1.00 41.12 ? 463 GLU A C   1 
ATOM 1310 O O   . GLU A 1 187 ? -9.737  30.516 15.836  1.00 42.99 ? 463 GLU A O   1 
ATOM 1311 C CB  . GLU A 1 187 ? -9.996  29.186 12.866  1.00 41.94 ? 463 GLU A CB  1 
ATOM 1312 C CG  . GLU A 1 187 ? -8.919  29.255 11.791  1.00 48.00 ? 463 GLU A CG  1 
ATOM 1313 C CD  . GLU A 1 187 ? -9.472  29.312 10.387  1.00 52.40 ? 463 GLU A CD  1 
ATOM 1314 O OE1 . GLU A 1 187 ? -10.340 30.170 10.110  1.00 55.98 ? 463 GLU A OE1 1 
ATOM 1315 O OE2 . GLU A 1 187 ? -9.025  28.494 9.556   1.00 52.85 ? 463 GLU A OE2 1 
ATOM 1316 N N   . MET A 1 188 ? -11.277 28.877 15.826  1.00 38.83 ? 464 MET A N   1 
ATOM 1317 C CA  . MET A 1 188 ? -12.021 29.467 16.940  1.00 33.84 ? 464 MET A CA  1 
ATOM 1318 C C   . MET A 1 188 ? -12.631 28.397 17.846  1.00 31.84 ? 464 MET A C   1 
ATOM 1319 O O   . MET A 1 188 ? -12.348 27.206 17.677  1.00 33.68 ? 464 MET A O   1 
ATOM 1320 C CB  . MET A 1 188 ? -13.117 30.402 16.426  1.00 35.76 ? 464 MET A CB  1 
ATOM 1321 C CG  . MET A 1 188 ? -13.255 31.668 17.262  1.00 35.39 ? 464 MET A CG  1 
ATOM 1322 S SD  . MET A 1 188 ? -14.592 32.730 16.720  1.00 35.88 ? 464 MET A SD  1 
ATOM 1323 C CE  . MET A 1 188 ? -14.284 32.828 14.928  1.00 34.68 ? 464 MET A CE  1 
ATOM 1324 N N   . ASN A 1 189 ? -13.457 28.822 18.808  1.00 27.98 ? 465 ASN A N   1 
ATOM 1325 C CA  . ASN A 1 189 ? -14.105 27.889 19.742  1.00 27.74 ? 465 ASN A CA  1 
ATOM 1326 C C   . ASN A 1 189 ? -15.635 27.820 19.711  1.00 32.16 ? 465 ASN A C   1 
ATOM 1327 O O   . ASN A 1 189 ? -16.310 28.397 18.851  1.00 31.75 ? 465 ASN A O   1 
ATOM 1328 C CB  . ASN A 1 189 ? -13.676 28.173 21.194  1.00 26.85 ? 465 ASN A CB  1 
ATOM 1329 C CG  . ASN A 1 189 ? -12.487 27.335 21.632  1.00 26.10 ? 465 ASN A CG  1 
ATOM 1330 O OD1 . ASN A 1 189 ? -12.302 27.074 22.821  1.00 30.26 ? 465 ASN A OD1 1 
ATOM 1331 N ND2 . ASN A 1 189 ? -11.673 26.919 20.675  1.00 30.17 ? 465 ASN A ND2 1 
ATOM 1332 N N   . ILE A 1 190 ? -16.155 27.073 20.677  1.00 35.83 ? 466 ILE A N   1 
ATOM 1333 C CA  . ILE A 1 190 ? -17.582 26.870 20.865  1.00 35.98 ? 466 ILE A CA  1 
ATOM 1334 C C   . ILE A 1 190 ? -18.048 28.065 21.688  1.00 37.26 ? 466 ILE A C   1 
ATOM 1335 O O   . ILE A 1 190 ? -17.561 28.262 22.798  1.00 36.65 ? 466 ILE A O   1 
ATOM 1336 C CB  . ILE A 1 190 ? -17.839 25.548 21.666  1.00 36.78 ? 466 ILE A CB  1 
ATOM 1337 C CG1 . ILE A 1 190 ? -17.644 24.320 20.763  1.00 38.64 ? 466 ILE A CG1 1 
ATOM 1338 C CG2 . ILE A 1 190 ? -19.216 25.561 22.289  1.00 37.43 ? 466 ILE A CG2 1 
ATOM 1339 C CD1 . ILE A 1 190 ? -18.726 24.117 19.711  1.00 39.15 ? 466 ILE A CD1 1 
ATOM 1340 N N   . ALA A 1 191 ? -18.960 28.873 21.149  1.00 38.00 ? 467 ALA A N   1 
ATOM 1341 C CA  . ALA A 1 191 ? -19.456 30.030 21.889  1.00 36.00 ? 467 ALA A CA  1 
ATOM 1342 C C   . ALA A 1 191 ? -19.843 29.535 23.277  1.00 35.95 ? 467 ALA A C   1 
ATOM 1343 O O   . ALA A 1 191 ? -19.969 28.332 23.484  1.00 40.68 ? 467 ALA A O   1 
ATOM 1344 C CB  . ALA A 1 191 ? -20.653 30.621 21.183  1.00 34.04 ? 467 ALA A CB  1 
ATOM 1345 N N   . SER A 1 192 ? -20.030 30.433 24.234  1.00 34.58 ? 468 SER A N   1 
ATOM 1346 C CA  . SER A 1 192 ? -20.391 29.977 25.576  1.00 33.57 ? 468 SER A CA  1 
ATOM 1347 C C   . SER A 1 192 ? -21.108 31.042 26.428  1.00 35.08 ? 468 SER A C   1 
ATOM 1348 O O   . SER A 1 192 ? -21.198 30.911 27.655  1.00 38.29 ? 468 SER A O   1 
ATOM 1349 C CB  . SER A 1 192 ? -19.127 29.484 26.293  1.00 32.62 ? 468 SER A CB  1 
ATOM 1350 O OG  . SER A 1 192 ? -19.431 28.574 27.336  1.00 34.23 ? 468 SER A OG  1 
ATOM 1351 N N   . GLY A 1 193 ? -21.630 32.079 25.766  1.00 35.54 ? 469 GLY A N   1 
ATOM 1352 C CA  . GLY A 1 193 ? -22.321 33.159 26.460  1.00 37.62 ? 469 GLY A CA  1 
ATOM 1353 C C   . GLY A 1 193 ? -23.792 32.917 26.758  1.00 36.77 ? 469 GLY A C   1 
ATOM 1354 O O   . GLY A 1 193 ? -24.202 31.784 27.020  1.00 40.44 ? 469 GLY A O   1 
ATOM 1355 N N   . CYS A 1 194 ? -24.585 33.988 26.715  1.00 36.21 ? 470 CYS A N   1 
ATOM 1356 C CA  . CYS A 1 194 ? -26.022 33.912 26.994  1.00 34.84 ? 470 CYS A CA  1 
ATOM 1357 C C   . CYS A 1 194 ? -26.906 34.217 25.786  1.00 33.67 ? 470 CYS A C   1 
ATOM 1358 O O   . CYS A 1 194 ? -26.864 35.321 25.236  1.00 34.24 ? 470 CYS A O   1 
ATOM 1359 C CB  . CYS A 1 194 ? -26.410 34.893 28.107  1.00 36.29 ? 470 CYS A CB  1 
ATOM 1360 S SG  . CYS A 1 194 ? -25.410 34.827 29.596  1.00 47.05 ? 470 CYS A SG  1 
ATOM 1361 N N   . PRO A 1 195 ? -27.717 33.240 25.353  1.00 33.04 ? 471 PRO A N   1 
ATOM 1362 C CA  . PRO A 1 195 ? -28.584 33.513 24.205  1.00 32.38 ? 471 PRO A CA  1 
ATOM 1363 C C   . PRO A 1 195 ? -29.592 34.532 24.726  1.00 33.71 ? 471 PRO A C   1 
ATOM 1364 O O   . PRO A 1 195 ? -30.265 35.239 23.972  1.00 34.38 ? 471 PRO A O   1 
ATOM 1365 C CB  . PRO A 1 195 ? -29.218 32.151 23.920  1.00 31.68 ? 471 PRO A CB  1 
ATOM 1366 C CG  . PRO A 1 195 ? -28.201 31.175 24.439  1.00 32.12 ? 471 PRO A CG  1 
ATOM 1367 C CD  . PRO A 1 195 ? -27.784 31.820 25.736  1.00 33.45 ? 471 PRO A CD  1 
ATOM 1368 N N   . VAL A 1 196 ? -29.672 34.586 26.050  1.00 32.20 ? 472 VAL A N   1 
ATOM 1369 C CA  . VAL A 1 196 ? -30.555 35.499 26.743  1.00 30.47 ? 472 VAL A CA  1 
ATOM 1370 C C   . VAL A 1 196 ? -29.723 36.628 27.336  1.00 30.85 ? 472 VAL A C   1 
ATOM 1371 O O   . VAL A 1 196 ? -28.871 36.394 28.198  1.00 30.55 ? 472 VAL A O   1 
ATOM 1372 C CB  . VAL A 1 196 ? -31.290 34.786 27.881  1.00 33.86 ? 472 VAL A CB  1 
ATOM 1373 C CG1 . VAL A 1 196 ? -32.196 33.717 27.311  1.00 36.63 ? 472 VAL A CG1 1 
ATOM 1374 C CG2 . VAL A 1 196 ? -30.285 34.175 28.845  1.00 31.35 ? 472 VAL A CG2 1 
ATOM 1375 N N   . PHE A 1 197 ? -29.950 37.851 26.866  1.00 29.64 ? 473 PHE A N   1 
ATOM 1376 C CA  . PHE A 1 197 ? -29.204 38.972 27.403  1.00 30.41 ? 473 PHE A CA  1 
ATOM 1377 C C   . PHE A 1 197 ? -30.120 40.131 27.754  1.00 32.30 ? 473 PHE A C   1 
ATOM 1378 O O   . PHE A 1 197 ? -30.476 40.338 28.916  1.00 37.35 ? 473 PHE A O   1 
ATOM 1379 C CB  . PHE A 1 197 ? -28.125 39.438 26.418  1.00 27.26 ? 473 PHE A CB  1 
ATOM 1380 C CG  . PHE A 1 197 ? -27.111 40.363 27.038  1.00 26.63 ? 473 PHE A CG  1 
ATOM 1381 C CD1 . PHE A 1 197 ? -26.327 39.934 28.110  1.00 23.67 ? 473 PHE A CD1 1 
ATOM 1382 C CD2 . PHE A 1 197 ? -26.995 41.683 26.612  1.00 25.61 ? 473 PHE A CD2 1 
ATOM 1383 C CE1 . PHE A 1 197 ? -25.457 40.803 28.750  1.00 21.86 ? 473 PHE A CE1 1 
ATOM 1384 C CE2 . PHE A 1 197 ? -26.122 42.561 27.252  1.00 24.08 ? 473 PHE A CE2 1 
ATOM 1385 C CZ  . PHE A 1 197 ? -25.356 42.116 28.322  1.00 24.37 ? 473 PHE A CZ  1 
ATOM 1386 N N   . VAL A 1 198 ? -30.500 40.898 26.751  1.00 31.02 ? 474 VAL A N   1 
ATOM 1387 C CA  . VAL A 1 198 ? -31.367 42.028 26.991  1.00 26.20 ? 474 VAL A CA  1 
ATOM 1388 C C   . VAL A 1 198 ? -32.535 41.898 26.034  1.00 27.81 ? 474 VAL A C   1 
ATOM 1389 O O   . VAL A 1 198 ? -32.338 41.854 24.819  1.00 29.98 ? 474 VAL A O   1 
ATOM 1390 C CB  . VAL A 1 198 ? -30.608 43.345 26.737  1.00 27.22 ? 474 VAL A CB  1 
ATOM 1391 C CG1 . VAL A 1 198 ? -31.553 44.529 26.798  1.00 27.71 ? 474 VAL A CG1 1 
ATOM 1392 C CG2 . VAL A 1 198 ? -29.519 43.508 27.775  1.00 32.31 ? 474 VAL A CG2 1 
ATOM 1393 N N   . ALA A 1 199 ? -33.748 41.816 26.573  1.00 26.96 ? 475 ALA A N   1 
ATOM 1394 C CA  . ALA A 1 199 ? -34.928 41.689 25.726  1.00 23.94 ? 475 ALA A CA  1 
ATOM 1395 C C   . ALA A 1 199 ? -34.878 42.777 24.688  1.00 24.29 ? 475 ALA A C   1 
ATOM 1396 O O   . ALA A 1 199 ? -34.874 43.949 25.034  1.00 26.55 ? 475 ALA A O   1 
ATOM 1397 C CB  . ALA A 1 199 ? -36.176 41.835 26.549  1.00 25.20 ? 475 ALA A CB  1 
ATOM 1398 N N   . GLN A 1 200 ? -34.830 42.403 23.419  1.00 23.55 ? 476 GLN A N   1 
ATOM 1399 C CA  . GLN A 1 200 ? -34.779 43.408 22.370  1.00 23.22 ? 476 GLN A CA  1 
ATOM 1400 C C   . GLN A 1 200 ? -35.748 44.573 22.647  1.00 25.86 ? 476 GLN A C   1 
ATOM 1401 O O   . GLN A 1 200 ? -35.531 45.705 22.200  1.00 30.91 ? 476 GLN A O   1 
ATOM 1402 C CB  . GLN A 1 200 ? -35.106 42.758 21.034  1.00 20.35 ? 476 GLN A CB  1 
ATOM 1403 C CG  . GLN A 1 200 ? -34.076 41.756 20.601  1.00 20.56 ? 476 GLN A CG  1 
ATOM 1404 C CD  . GLN A 1 200 ? -34.336 41.229 19.207  1.00 23.23 ? 476 GLN A CD  1 
ATOM 1405 O OE1 . GLN A 1 200 ? -34.654 41.993 18.298  1.00 27.70 ? 476 GLN A OE1 1 
ATOM 1406 N NE2 . GLN A 1 200 ? -34.187 39.917 19.024  1.00 24.82 ? 476 GLN A NE2 1 
ATOM 1407 N N   . THR A 1 201 ? -36.807 44.281 23.402  1.00 26.97 ? 477 THR A N   1 
ATOM 1408 C CA  . THR A 1 201 ? -37.836 45.258 23.762  1.00 27.47 ? 477 THR A CA  1 
ATOM 1409 C C   . THR A 1 201 ? -37.387 46.185 24.900  1.00 28.19 ? 477 THR A C   1 
ATOM 1410 O O   . THR A 1 201 ? -38.190 46.948 25.452  1.00 30.17 ? 477 THR A O   1 
ATOM 1411 C CB  . THR A 1 201 ? -39.147 44.527 24.151  1.00 30.24 ? 477 THR A CB  1 
ATOM 1412 O OG1 . THR A 1 201 ? -40.240 45.089 23.419  1.00 32.39 ? 477 THR A OG1 1 
ATOM 1413 C CG2 . THR A 1 201 ? -39.414 44.628 25.654  1.00 33.34 ? 477 THR A CG2 1 
ATOM 1414 N N   . VAL A 1 202 ? -36.100 46.103 25.243  1.00 28.32 ? 478 VAL A N   1 
ATOM 1415 C CA  . VAL A 1 202 ? -35.496 46.938 26.286  1.00 28.38 ? 478 VAL A CA  1 
ATOM 1416 C C   . VAL A 1 202 ? -34.288 47.620 25.671  1.00 32.13 ? 478 VAL A C   1 
ATOM 1417 O O   . VAL A 1 202 ? -34.018 48.788 25.942  1.00 32.40 ? 478 VAL A O   1 
ATOM 1418 C CB  . VAL A 1 202 ? -35.007 46.117 27.499  1.00 26.24 ? 478 VAL A CB  1 
ATOM 1419 C CG1 . VAL A 1 202 ? -34.476 47.050 28.571  1.00 22.08 ? 478 VAL A CG1 1 
ATOM 1420 C CG2 . VAL A 1 202 ? -36.135 45.274 28.053  1.00 24.75 ? 478 VAL A CG2 1 
ATOM 1421 N N   . LEU A 1 203 ? -33.564 46.876 24.840  1.00 35.60 ? 479 LEU A N   1 
ATOM 1422 C CA  . LEU A 1 203 ? -32.387 47.402 24.160  1.00 37.19 ? 479 LEU A CA  1 
ATOM 1423 C C   . LEU A 1 203 ? -32.782 48.592 23.298  1.00 40.17 ? 479 LEU A C   1 
ATOM 1424 O O   . LEU A 1 203 ? -32.138 49.645 23.332  1.00 42.41 ? 479 LEU A O   1 
ATOM 1425 C CB  . LEU A 1 203 ? -31.758 46.327 23.266  1.00 36.71 ? 479 LEU A CB  1 
ATOM 1426 C CG  . LEU A 1 203 ? -31.147 46.842 21.956  1.00 34.16 ? 479 LEU A CG  1 
ATOM 1427 C CD1 . LEU A 1 203 ? -29.999 47.771 22.239  1.00 32.09 ? 479 LEU A CD1 1 
ATOM 1428 C CD2 . LEU A 1 203 ? -30.679 45.687 21.130  1.00 34.83 ? 479 LEU A CD2 1 
ATOM 1429 N N   . GLU A 1 204 ? -33.841 48.400 22.514  1.00 42.15 ? 480 GLU A N   1 
ATOM 1430 C CA  . GLU A 1 204 ? -34.347 49.432 21.615  1.00 45.52 ? 480 GLU A CA  1 
ATOM 1431 C C   . GLU A 1 204 ? -35.369 50.335 22.327  1.00 49.14 ? 480 GLU A C   1 
ATOM 1432 O O   . GLU A 1 204 ? -35.919 51.275 21.735  1.00 49.73 ? 480 GLU A O   1 
ATOM 1433 C CB  . GLU A 1 204 ? -34.961 48.775 20.362  1.00 45.07 ? 480 GLU A CB  1 
ATOM 1434 C CG  . GLU A 1 204 ? -33.959 47.951 19.539  1.00 42.69 ? 480 GLU A CG  1 
ATOM 1435 C CD  . GLU A 1 204 ? -34.507 47.485 18.203  1.00 41.10 ? 480 GLU A CD  1 
ATOM 1436 O OE1 . GLU A 1 204 ? -33.747 46.870 17.433  1.00 41.79 ? 480 GLU A OE1 1 
ATOM 1437 O OE2 . GLU A 1 204 ? -35.692 47.730 17.914  1.00 37.49 ? 480 GLU A OE2 1 
ATOM 1438 N N   . ASN A 1 205 ? -35.604 50.043 23.604  1.00 53.47 ? 481 ASN A N   1 
ATOM 1439 C CA  . ASN A 1 205 ? -36.529 50.812 24.430  1.00 54.83 ? 481 ASN A CA  1 
ATOM 1440 C C   . ASN A 1 205 ? -35.692 51.777 25.263  1.00 53.32 ? 481 ASN A C   1 
ATOM 1441 O O   . ASN A 1 205 ? -36.124 52.253 26.319  1.00 54.67 ? 481 ASN A O   1 
ATOM 1442 C CB  . ASN A 1 205 ? -37.326 49.875 25.343  1.00 60.41 ? 481 ASN A CB  1 
ATOM 1443 C CG  . ASN A 1 205 ? -38.795 49.801 24.971  1.00 63.24 ? 481 ASN A CG  1 
ATOM 1444 O OD1 . ASN A 1 205 ? -39.152 49.718 23.795  1.00 67.87 ? 481 ASN A OD1 1 
ATOM 1445 N ND2 . ASN A 1 205 ? -39.655 49.815 25.979  1.00 63.59 ? 481 ASN A ND2 1 
ATOM 1446 N N   . GLY A 1 206 ? -34.484 52.051 24.771  1.00 48.83 ? 482 GLY A N   1 
ATOM 1447 C CA  . GLY A 1 206 ? -33.574 52.958 25.452  1.00 44.02 ? 482 GLY A CA  1 
ATOM 1448 C C   . GLY A 1 206 ? -32.664 53.763 24.533  1.00 38.86 ? 482 GLY A C   1 
ATOM 1449 O O   . GLY A 1 206 ? -32.986 54.054 23.377  1.00 37.71 ? 482 GLY A O   1 
ATOM 1450 N N   . THR A 1 207 ? -31.511 54.135 25.068  1.00 36.30 ? 483 THR A N   1 
ATOM 1451 C CA  . THR A 1 207 ? -30.537 54.908 24.318  1.00 32.25 ? 483 THR A CA  1 
ATOM 1452 C C   . THR A 1 207 ? -29.394 54.003 23.916  1.00 31.25 ? 483 THR A C   1 
ATOM 1453 O O   . THR A 1 207 ? -28.415 54.448 23.334  1.00 33.24 ? 483 THR A O   1 
ATOM 1454 C CB  . THR A 1 207 ? -29.964 56.056 25.166  1.00 32.33 ? 483 THR A CB  1 
ATOM 1455 O OG1 . THR A 1 207 ? -29.374 55.519 26.358  1.00 32.09 ? 483 THR A OG1 1 
ATOM 1456 C CG2 . THR A 1 207 ? -31.066 57.049 25.535  1.00 31.72 ? 483 THR A CG2 1 
ATOM 1457 N N   . TYR A 1 208 ? -29.524 52.725 24.245  1.00 29.26 ? 484 TYR A N   1 
ATOM 1458 C CA  . TYR A 1 208 ? -28.496 51.753 23.925  1.00 24.97 ? 484 TYR A CA  1 
ATOM 1459 C C   . TYR A 1 208 ? -28.128 51.838 22.455  1.00 29.09 ? 484 TYR A C   1 
ATOM 1460 O O   . TYR A 1 208 ? -27.155 51.225 22.022  1.00 31.81 ? 484 TYR A O   1 
ATOM 1461 C CB  . TYR A 1 208 ? -28.972 50.331 24.259  1.00 22.16 ? 484 TYR A CB  1 
ATOM 1462 C CG  . TYR A 1 208 ? -29.206 50.081 25.729  1.00 16.21 ? 484 TYR A CG  1 
ATOM 1463 C CD1 . TYR A 1 208 ? -28.197 50.297 26.662  1.00 15.43 ? 484 TYR A CD1 1 
ATOM 1464 C CD2 . TYR A 1 208 ? -30.451 49.674 26.191  1.00 17.84 ? 484 TYR A CD2 1 
ATOM 1465 C CE1 . TYR A 1 208 ? -28.428 50.122 28.024  1.00 12.40 ? 484 TYR A CE1 1 
ATOM 1466 C CE2 . TYR A 1 208 ? -30.691 49.497 27.553  1.00 15.85 ? 484 TYR A CE2 1 
ATOM 1467 C CZ  . TYR A 1 208 ? -29.680 49.725 28.466  1.00 13.60 ? 484 TYR A CZ  1 
ATOM 1468 O OH  . TYR A 1 208 ? -29.929 49.583 29.819  1.00 20.53 ? 484 TYR A OH  1 
ATOM 1469 N N   . ILE A 1 209 ? -28.893 52.604 21.686  1.00 32.31 ? 485 ILE A N   1 
ATOM 1470 C CA  . ILE A 1 209 ? -28.609 52.734 20.268  1.00 35.08 ? 485 ILE A CA  1 
ATOM 1471 C C   . ILE A 1 209 ? -28.512 54.197 19.808  1.00 36.99 ? 485 ILE A C   1 
ATOM 1472 O O   . ILE A 1 209 ? -29.074 54.567 18.775  1.00 39.31 ? 485 ILE A O   1 
ATOM 1473 C CB  . ILE A 1 209 ? -29.677 51.985 19.464  1.00 36.32 ? 485 ILE A CB  1 
ATOM 1474 C CG1 . ILE A 1 209 ? -29.812 50.573 20.023  1.00 40.92 ? 485 ILE A CG1 1 
ATOM 1475 C CG2 . ILE A 1 209 ? -29.295 51.922 18.006  1.00 33.28 ? 485 ILE A CG2 1 
ATOM 1476 C CD1 . ILE A 1 209 ? -30.857 49.753 19.358  1.00 42.96 ? 485 ILE A CD1 1 
ATOM 1477 N N   . LYS A 1 210 ? -27.782 55.018 20.571  1.00 36.52 ? 486 LYS A N   1 
ATOM 1478 C CA  . LYS A 1 210 ? -27.600 56.441 20.259  1.00 37.39 ? 486 LYS A CA  1 
ATOM 1479 C C   . LYS A 1 210 ? -26.852 56.640 18.950  1.00 37.41 ? 486 LYS A C   1 
ATOM 1480 O O   . LYS A 1 210 ? -26.046 55.791 18.563  1.00 39.40 ? 486 LYS A O   1 
ATOM 1481 C CB  . LYS A 1 210 ? -26.839 57.152 21.382  1.00 35.80 ? 486 LYS A CB  1 
ATOM 1482 C CG  . LYS A 1 210 ? -27.637 57.360 22.655  1.00 38.75 ? 486 LYS A CG  1 
ATOM 1483 C CD  . LYS A 1 210 ? -27.091 58.535 23.464  1.00 39.75 ? 486 LYS A CD  1 
ATOM 1484 C CE  . LYS A 1 210 ? -28.044 58.940 24.581  1.00 40.90 ? 486 LYS A CE  1 
ATOM 1485 N NZ  . LYS A 1 210 ? -27.626 60.208 25.235  1.00 41.50 ? 486 LYS A NZ  1 
ATOM 1486 N N   . ASP A 1 211 ? -27.114 57.767 18.283  1.00 41.66 ? 487 ASP A N   1 
ATOM 1487 C CA  . ASP A 1 211 ? -26.492 58.084 16.989  1.00 44.33 ? 487 ASP A CA  1 
ATOM 1488 C C   . ASP A 1 211 ? -26.500 56.816 16.127  1.00 42.19 ? 487 ASP A C   1 
ATOM 1489 O O   . ASP A 1 211 ? -25.810 56.732 15.103  1.00 43.58 ? 487 ASP A O   1 
ATOM 1490 C CB  . ASP A 1 211 ? -25.037 58.572 17.160  1.00 47.76 ? 487 ASP A CB  1 
ATOM 1491 C CG  . ASP A 1 211 ? -24.931 59.962 17.802  1.00 50.27 ? 487 ASP A CG  1 
ATOM 1492 O OD1 . ASP A 1 211 ? -25.107 60.068 19.037  1.00 50.09 ? 487 ASP A OD1 1 
ATOM 1493 O OD2 . ASP A 1 211 ? -24.665 60.947 17.071  1.00 53.06 ? 487 ASP A OD2 1 
ATOM 1494 N N   . ASP A 1 212 ? -27.309 55.846 16.557  1.00 40.02 ? 488 ASP A N   1 
ATOM 1495 C CA  . ASP A 1 212 ? -27.442 54.542 15.916  1.00 38.47 ? 488 ASP A CA  1 
ATOM 1496 C C   . ASP A 1 212 ? -26.131 53.797 16.114  1.00 36.31 ? 488 ASP A C   1 
ATOM 1497 O O   . ASP A 1 212 ? -25.395 53.537 15.156  1.00 34.90 ? 488 ASP A O   1 
ATOM 1498 C CB  . ASP A 1 212 ? -27.752 54.683 14.423  1.00 39.68 ? 488 ASP A CB  1 
ATOM 1499 C CG  . ASP A 1 212 ? -28.067 53.354 13.775  1.00 43.41 ? 488 ASP A CG  1 
ATOM 1500 O OD1 . ASP A 1 212 ? -28.885 52.616 14.348  1.00 43.79 ? 488 ASP A OD1 1 
ATOM 1501 O OD2 . ASP A 1 212 ? -27.508 53.045 12.703  1.00 44.20 ? 488 ASP A OD2 1 
ATOM 1502 N N   . THR A 1 213 ? -25.843 53.467 17.371  1.00 33.68 ? 489 THR A N   1 
ATOM 1503 C CA  . THR A 1 213 ? -24.616 52.765 17.729  1.00 31.81 ? 489 THR A CA  1 
ATOM 1504 C C   . THR A 1 213 ? -24.711 52.164 19.129  1.00 31.76 ? 489 THR A C   1 
ATOM 1505 O O   . THR A 1 213 ? -25.282 52.781 20.028  1.00 31.14 ? 489 THR A O   1 
ATOM 1506 C CB  . THR A 1 213 ? -23.423 53.722 17.724  1.00 33.60 ? 489 THR A CB  1 
ATOM 1507 O OG1 . THR A 1 213 ? -23.775 54.902 18.457  1.00 33.17 ? 489 THR A OG1 1 
ATOM 1508 C CG2 . THR A 1 213 ? -23.020 54.091 16.297  1.00 32.09 ? 489 THR A CG2 1 
ATOM 1509 N N   . ILE A 1 214 ? -24.141 50.968 19.308  1.00 31.25 ? 490 ILE A N   1 
ATOM 1510 C CA  . ILE A 1 214 ? -24.157 50.285 20.603  1.00 31.38 ? 490 ILE A CA  1 
ATOM 1511 C C   . ILE A 1 214 ? -22.758 49.918 21.000  1.00 31.01 ? 490 ILE A C   1 
ATOM 1512 O O   . ILE A 1 214 ? -21.869 49.822 20.157  1.00 32.44 ? 490 ILE A O   1 
ATOM 1513 C CB  . ILE A 1 214 ? -24.944 48.960 20.575  1.00 33.00 ? 490 ILE A CB  1 
ATOM 1514 C CG1 . ILE A 1 214 ? -24.282 47.983 19.601  1.00 34.40 ? 490 ILE A CG1 1 
ATOM 1515 C CG2 . ILE A 1 214 ? -26.382 49.212 20.192  1.00 31.20 ? 490 ILE A CG2 1 
ATOM 1516 C CD1 . ILE A 1 214 ? -24.946 46.616 19.526  1.00 34.91 ? 490 ILE A CD1 1 
ATOM 1517 N N   . PHE A 1 215 ? -22.576 49.690 22.292  1.00 29.43 ? 491 PHE A N   1 
ATOM 1518 C CA  . PHE A 1 215 ? -21.275 49.309 22.807  1.00 28.40 ? 491 PHE A CA  1 
ATOM 1519 C C   . PHE A 1 215 ? -21.406 48.201 23.834  1.00 27.77 ? 491 PHE A C   1 
ATOM 1520 O O   . PHE A 1 215 ? -22.318 48.232 24.664  1.00 28.90 ? 491 PHE A O   1 
ATOM 1521 C CB  . PHE A 1 215 ? -20.579 50.501 23.468  1.00 33.73 ? 491 PHE A CB  1 
ATOM 1522 C CG  . PHE A 1 215 ? -20.027 51.511 22.498  1.00 37.43 ? 491 PHE A CG  1 
ATOM 1523 C CD1 . PHE A 1 215 ? -20.876 52.302 21.732  1.00 37.26 ? 491 PHE A CD1 1 
ATOM 1524 C CD2 . PHE A 1 215 ? -18.656 51.694 22.379  1.00 37.62 ? 491 PHE A CD2 1 
ATOM 1525 C CE1 . PHE A 1 215 ? -20.371 53.261 20.869  1.00 36.42 ? 491 PHE A CE1 1 
ATOM 1526 C CE2 . PHE A 1 215 ? -18.145 52.649 21.519  1.00 36.97 ? 491 PHE A CE2 1 
ATOM 1527 C CZ  . PHE A 1 215 ? -19.006 53.434 20.765  1.00 37.65 ? 491 PHE A CZ  1 
ATOM 1528 N N   . ILE A 1 216 ? -20.482 47.235 23.769  1.00 27.10 ? 492 ILE A N   1 
ATOM 1529 C CA  . ILE A 1 216 ? -20.436 46.100 24.700  1.00 25.54 ? 492 ILE A CA  1 
ATOM 1530 C C   . ILE A 1 216 ? -19.070 46.035 25.405  1.00 25.59 ? 492 ILE A C   1 
ATOM 1531 O O   . ILE A 1 216 ? -18.010 46.127 24.769  1.00 28.01 ? 492 ILE A O   1 
ATOM 1532 C CB  . ILE A 1 216 ? -20.663 44.723 23.995  1.00 24.25 ? 492 ILE A CB  1 
ATOM 1533 C CG1 . ILE A 1 216 ? -21.327 44.919 22.636  1.00 24.61 ? 492 ILE A CG1 1 
ATOM 1534 C CG2 . ILE A 1 216 ? -21.531 43.819 24.876  1.00 24.84 ? 492 ILE A CG2 1 
ATOM 1535 C CD1 . ILE A 1 216 ? -21.211 43.714 21.751  1.00 21.68 ? 492 ILE A CD1 1 
ATOM 1536 N N   . LYS A 1 217 ? -19.122 45.877 26.726  1.00 24.96 ? 493 LYS A N   1 
ATOM 1537 C CA  . LYS A 1 217 ? -17.932 45.779 27.560  1.00 24.21 ? 493 LYS A CA  1 
ATOM 1538 C C   . LYS A 1 217 ? -17.758 44.350 28.073  1.00 25.11 ? 493 LYS A C   1 
ATOM 1539 O O   . LYS A 1 217 ? -18.678 43.764 28.663  1.00 28.90 ? 493 LYS A O   1 
ATOM 1540 C CB  . LYS A 1 217 ? -18.023 46.737 28.754  1.00 23.36 ? 493 LYS A CB  1 
ATOM 1541 C CG  . LYS A 1 217 ? -16.879 46.580 29.752  1.00 24.81 ? 493 LYS A CG  1 
ATOM 1542 C CD  . LYS A 1 217 ? -16.876 47.664 30.827  1.00 22.27 ? 493 LYS A CD  1 
ATOM 1543 C CE  . LYS A 1 217 ? -18.079 47.568 31.742  1.00 25.14 ? 493 LYS A CE  1 
ATOM 1544 N NZ  . LYS A 1 217 ? -18.080 48.597 32.825  1.00 26.49 ? 493 LYS A NZ  1 
ATOM 1545 N N   . VAL A 1 218 ? -16.568 43.802 27.826  1.00 25.75 ? 494 VAL A N   1 
ATOM 1546 C CA  . VAL A 1 218 ? -16.198 42.456 28.247  1.00 20.97 ? 494 VAL A CA  1 
ATOM 1547 C C   . VAL A 1 218 ? -15.154 42.634 29.347  1.00 19.25 ? 494 VAL A C   1 
ATOM 1548 O O   . VAL A 1 218 ? -14.326 43.539 29.281  1.00 22.19 ? 494 VAL A O   1 
ATOM 1549 C CB  . VAL A 1 218 ? -15.617 41.651 27.069  1.00 22.15 ? 494 VAL A CB  1 
ATOM 1550 C CG1 . VAL A 1 218 ? -15.048 40.352 27.566  1.00 22.76 ? 494 VAL A CG1 1 
ATOM 1551 C CG2 . VAL A 1 218 ? -16.706 41.382 26.041  1.00 19.03 ? 494 VAL A CG2 1 
ATOM 1552 N N   . ILE A 1 219 ? -15.208 41.779 30.360  1.00 19.94 ? 495 ILE A N   1 
ATOM 1553 C CA  . ILE A 1 219 ? -14.299 41.889 31.487  1.00 23.02 ? 495 ILE A CA  1 
ATOM 1554 C C   . ILE A 1 219 ? -13.809 40.544 31.944  1.00 24.74 ? 495 ILE A C   1 
ATOM 1555 O O   . ILE A 1 219 ? -14.563 39.785 32.533  1.00 27.79 ? 495 ILE A O   1 
ATOM 1556 C CB  . ILE A 1 219 ? -15.001 42.551 32.672  1.00 25.70 ? 495 ILE A CB  1 
ATOM 1557 C CG1 . ILE A 1 219 ? -15.286 44.025 32.345  1.00 24.69 ? 495 ILE A CG1 1 
ATOM 1558 C CG2 . ILE A 1 219 ? -14.176 42.365 33.931  1.00 23.28 ? 495 ILE A CG2 1 
ATOM 1559 C CD1 . ILE A 1 219 ? -16.288 44.727 33.287  1.00 22.81 ? 495 ILE A CD1 1 
ATOM 1560 N N   . VAL A 1 220 ? -12.537 40.263 31.691  1.00 27.48 ? 496 VAL A N   1 
ATOM 1561 C CA  . VAL A 1 220 ? -11.921 38.994 32.082  1.00 31.92 ? 496 VAL A CA  1 
ATOM 1562 C C   . VAL A 1 220 ? -11.208 39.104 33.435  1.00 34.61 ? 496 VAL A C   1 
ATOM 1563 O O   . VAL A 1 220 ? -10.013 39.402 33.494  1.00 36.79 ? 496 VAL A O   1 
ATOM 1564 C CB  . VAL A 1 220 ? -10.908 38.541 31.016  1.00 29.19 ? 496 VAL A CB  1 
ATOM 1565 C CG1 . VAL A 1 220 ? -10.365 37.169 31.360  1.00 31.73 ? 496 VAL A CG1 1 
ATOM 1566 C CG2 . VAL A 1 220 ? -11.575 38.529 29.657  1.00 30.06 ? 496 VAL A CG2 1 
ATOM 1567 N N   . ASP A 1 221 ? -11.950 38.847 34.510  1.00 37.07 ? 497 ASP A N   1 
ATOM 1568 C CA  . ASP A 1 221 ? -11.436 38.935 35.877  1.00 39.31 ? 497 ASP A CA  1 
ATOM 1569 C C   . ASP A 1 221 ? -10.094 38.222 36.053  1.00 43.02 ? 497 ASP A C   1 
ATOM 1570 O O   . ASP A 1 221 ? -10.039 37.057 36.459  1.00 46.45 ? 497 ASP A O   1 
ATOM 1571 C CB  . ASP A 1 221 ? -12.468 38.365 36.859  1.00 38.04 ? 497 ASP A CB  1 
ATOM 1572 C CG  . ASP A 1 221 ? -12.483 39.092 38.199  1.00 38.53 ? 497 ASP A CG  1 
ATOM 1573 O OD1 . ASP A 1 221 ? -13.064 40.196 38.287  1.00 43.05 ? 497 ASP A OD1 1 
ATOM 1574 O OD2 . ASP A 1 221 ? -11.909 38.553 39.166  1.00 36.58 ? 497 ASP A OD2 1 
ATOM 1575 N N   . THR A 1 222 ? -9.018  38.945 35.747  1.00 45.93 ? 498 THR A N   1 
ATOM 1576 C CA  . THR A 1 222 ? -7.655  38.433 35.856  1.00 47.27 ? 498 THR A CA  1 
ATOM 1577 C C   . THR A 1 222 ? -7.155  38.567 37.296  1.00 50.90 ? 498 THR A C   1 
ATOM 1578 O O   . THR A 1 222 ? -6.241  37.850 37.715  1.00 50.97 ? 498 THR A O   1 
ATOM 1579 C CB  . THR A 1 222 ? -6.688  39.211 34.913  1.00 43.40 ? 498 THR A CB  1 
ATOM 1580 O OG1 . THR A 1 222 ? -6.735  40.610 35.219  1.00 42.63 ? 498 THR A OG1 1 
ATOM 1581 C CG2 . THR A 1 222 ? -7.082  39.023 33.459  1.00 39.65 ? 498 THR A CG2 1 
ATOM 1582 N N   . SER A 1 223 ? -7.775  39.494 38.030  1.00 54.44 ? 499 SER A N   1 
ATOM 1583 C CA  . SER A 1 223 ? -7.464  39.811 39.429  1.00 57.43 ? 499 SER A CA  1 
ATOM 1584 C C   . SER A 1 223 ? -6.389  38.964 40.104  1.00 58.55 ? 499 SER A C   1 
ATOM 1585 O O   . SER A 1 223 ? -5.196  39.298 40.072  1.00 60.20 ? 499 SER A O   1 
ATOM 1586 C CB  . SER A 1 223 ? -8.742  39.745 40.277  1.00 57.86 ? 499 SER A CB  1 
ATOM 1587 O OG  . SER A 1 223 ? -8.475  40.029 41.642  1.00 61.71 ? 499 SER A OG  1 
ATOM 1588 N N   . ASP A 1 224 ? -6.837  37.872 40.722  1.00 58.82 ? 500 ASP A N   1 
ATOM 1589 C CA  . ASP A 1 224 ? -5.966  36.945 41.443  1.00 58.30 ? 500 ASP A CA  1 
ATOM 1590 C C   . ASP A 1 224 ? -5.402  35.857 40.518  1.00 60.24 ? 500 ASP A C   1 
ATOM 1591 O O   . ASP A 1 224 ? -5.978  34.773 40.393  1.00 58.72 ? 500 ASP A O   1 
ATOM 1592 C CB  . ASP A 1 224 ? -6.755  36.294 42.592  1.00 56.27 ? 500 ASP A CB  1 
ATOM 1593 C CG  . ASP A 1 224 ? -7.547  37.310 43.419  1.00 54.27 ? 500 ASP A CG  1 
ATOM 1594 O OD1 . ASP A 1 224 ? -6.915  38.150 44.095  1.00 53.29 ? 500 ASP A OD1 1 
ATOM 1595 O OD2 . ASP A 1 224 ? -8.800  37.266 43.389  1.00 54.77 ? 500 ASP A OD2 1 
ATOM 1596 N N   . LEU A 1 225 ? -4.276  36.153 39.876  1.00 62.35 ? 501 LEU A N   1 
ATOM 1597 C CA  . LEU A 1 225 ? -3.631  35.209 38.963  1.00 64.89 ? 501 LEU A CA  1 
ATOM 1598 C C   . LEU A 1 225 ? -2.127  35.302 39.252  1.00 64.80 ? 501 LEU A C   1 
ATOM 1599 O O   . LEU A 1 225 ? -1.653  36.343 39.704  1.00 64.35 ? 501 LEU A O   1 
ATOM 1600 C CB  . LEU A 1 225 ? -3.956  35.611 37.509  1.00 66.84 ? 501 LEU A CB  1 
ATOM 1601 C CG  . LEU A 1 225 ? -3.825  34.653 36.313  1.00 68.35 ? 501 LEU A CG  1 
ATOM 1602 C CD1 . LEU A 1 225 ? -2.397  34.583 35.822  1.00 68.60 ? 501 LEU A CD1 1 
ATOM 1603 C CD2 . LEU A 1 225 ? -4.334  33.283 36.709  1.00 68.66 ? 501 LEU A CD2 1 
ATOM 1604 N N   . PRO A 1 226 ? -1.365  34.212 39.037  1.00 66.29 ? 502 PRO A N   1 
ATOM 1605 C CA  . PRO A 1 226 ? 0.079   34.260 39.298  1.00 67.73 ? 502 PRO A CA  1 
ATOM 1606 C C   . PRO A 1 226 ? 0.800   35.356 38.516  1.00 69.41 ? 502 PRO A C   1 
ATOM 1607 O O   . PRO A 1 226 ? 0.746   35.394 37.285  1.00 70.35 ? 502 PRO A O   1 
ATOM 1608 C CB  . PRO A 1 226 ? 0.546   32.864 38.899  1.00 67.92 ? 502 PRO A CB  1 
ATOM 1609 C CG  . PRO A 1 226 ? -0.613  32.016 39.282  1.00 66.92 ? 502 PRO A CG  1 
ATOM 1610 C CD  . PRO A 1 226 ? -1.794  32.827 38.768  1.00 66.23 ? 502 PRO A CD  1 
ATOM 1611 N N   . ASP A 1 227 ? 1.474   36.240 39.249  1.00 70.64 ? 503 ASP A N   1 
ATOM 1612 C CA  . ASP A 1 227 ? 2.225   37.351 38.663  1.00 71.45 ? 503 ASP A CA  1 
ATOM 1613 C C   . ASP A 1 227 ? 3.728   37.246 38.984  1.00 71.79 ? 503 ASP A C   1 
ATOM 1614 O O   . ASP A 1 227 ? 4.122   36.626 39.977  1.00 72.94 ? 503 ASP A O   1 
ATOM 1615 C CB  . ASP A 1 227 ? 1.674   38.695 39.175  1.00 72.43 ? 503 ASP A CB  1 
ATOM 1616 C CG  . ASP A 1 227 ? 0.350   39.089 38.513  1.00 73.51 ? 503 ASP A CG  1 
ATOM 1617 O OD1 . ASP A 1 227 ? 0.300   39.134 37.265  1.00 75.31 ? 503 ASP A OD1 1 
ATOM 1618 O OD2 . ASP A 1 227 ? -0.635  39.367 39.236  1.00 76.52 ? 503 ASP A OD2 1 
ATOM 1619 N N   . PRO A 1 228 ? 4.587   37.847 38.137  1.00 72.86 ? 504 PRO A N   1 
ATOM 1620 C CA  . PRO A 1 228 ? 6.040   37.814 38.336  1.00 71.38 ? 504 PRO A CA  1 
ATOM 1621 C C   . PRO A 1 228 ? 6.450   38.320 39.711  1.00 71.56 ? 504 PRO A C   1 
ATOM 1622 O O   . PRO A 1 228 ? 6.969   37.512 40.506  1.00 71.02 ? 504 PRO A O   1 
ATOM 1623 C CB  . PRO A 1 228 ? 6.560   38.716 37.222  1.00 71.69 ? 504 PRO A CB  1 
ATOM 1624 C CG  . PRO A 1 228 ? 5.550   38.514 36.134  1.00 71.54 ? 504 PRO A CG  1 
ATOM 1625 C CD  . PRO A 1 228 ? 4.250   38.566 36.894  1.00 71.50 ? 504 PRO A CD  1 
ATOM 1626 O OXT . PRO A 1 228 ? 6.243   39.520 39.975  1.00 33.68 ? 504 PRO A OXT 1 
ATOM 1627 N N   . LYS B 2 1   ? -15.918 23.642 42.027  1.00 19.95 ? 246 LYS X N   1 
ATOM 1628 C CA  . LYS B 2 1   ? -16.893 24.525 42.733  1.00 16.79 ? 246 LYS X CA  1 
ATOM 1629 C C   . LYS B 2 1   ? -17.042 25.801 41.921  1.00 13.35 ? 246 LYS X C   1 
ATOM 1630 O O   . LYS B 2 1   ? -17.155 26.897 42.479  1.00 14.33 ? 246 LYS X O   1 
ATOM 1631 C CB  . LYS B 2 1   ? -16.386 24.877 44.141  1.00 19.39 ? 246 LYS X CB  1 
ATOM 1632 C CG  . LYS B 2 1   ? -17.306 24.463 45.296  1.00 23.11 ? 246 LYS X CG  1 
ATOM 1633 C CD  . LYS B 2 1   ? -16.829 25.079 46.611  1.00 26.07 ? 246 LYS X CD  1 
ATOM 1634 C CE  . LYS B 2 1   ? -17.677 24.662 47.813  1.00 27.80 ? 246 LYS X CE  1 
ATOM 1635 N NZ  . LYS B 2 1   ? -17.496 23.232 48.201  1.00 33.52 ? 246 LYS X NZ  1 
ATOM 1636 N N   . THR B 2 2   ? -17.050 25.658 40.600  1.00 11.24 ? 247 THR X N   1 
ATOM 1637 C CA  . THR B 2 2   ? -17.168 26.815 39.721  1.00 9.59  ? 247 THR X CA  1 
ATOM 1638 C C   . THR B 2 2   ? -18.589 27.200 39.276  1.00 10.03 ? 247 THR X C   1 
ATOM 1639 O O   . THR B 2 2   ? -19.427 27.628 40.083  1.00 16.83 ? 247 THR X O   1 
ATOM 1640 C CB  . THR B 2 2   ? -16.270 26.633 38.470  1.00 13.65 ? 247 THR X CB  1 
ATOM 1641 O OG1 . THR B 2 2   ? -16.281 25.255 38.064  1.00 14.23 ? 247 THR X OG1 1 
ATOM 1642 C CG2 . THR B 2 2   ? -14.841 27.086 38.772  1.00 17.91 ? 247 THR X CG2 1 
ATOM 1643 N N   . ALA B 2 3   ? -18.840 27.053 37.979  1.00 21.61 ? 248 ALA X N   1 
ATOM 1644 C CA  . ALA B 2 3   ? -20.124 27.401 37.404  1.00 14.83 ? 248 ALA X CA  1 
ATOM 1645 C C   . ALA B 2 3   ? -20.448 26.551 36.172  1.00 15.77 ? 248 ALA X C   1 
ATOM 1646 O O   . ALA B 2 3   ? -19.588 26.351 35.312  1.00 13.50 ? 248 ALA X O   1 
ATOM 1647 C CB  . ALA B 2 3   ? -20.127 28.894 37.038  1.00 14.24 ? 248 ALA X CB  1 
ATOM 1648 N N   . ALA B 2 4   ? -21.700 26.077 36.105  1.00 25.46 ? 249 ALA X N   1 
ATOM 1649 C CA  . ALA B 2 4   ? -22.216 25.242 35.004  1.00 15.82 ? 249 ALA X CA  1 
ATOM 1650 C C   . ALA B 2 4   ? -23.010 26.054 33.966  1.00 13.82 ? 249 ALA X C   1 
ATOM 1651 O O   . ALA B 2 4   ? -24.207 26.309 34.142  1.00 14.20 ? 249 ALA X O   1 
ATOM 1652 C CB  . ALA B 2 4   ? -23.098 24.120 35.571  1.00 15.92 ? 249 ALA X CB  1 
ATOM 1653 N N   . PRO B 2 5   ? -22.342 26.466 32.869  1.00 8.93  ? 250 PRO X N   1 
ATOM 1654 C CA  . PRO B 2 5   ? -22.915 27.251 31.770  1.00 14.22 ? 250 PRO X CA  1 
ATOM 1655 C C   . PRO B 2 5   ? -23.255 26.433 30.523  1.00 15.92 ? 250 PRO X C   1 
ATOM 1656 O O   . PRO B 2 5   ? -23.269 25.208 30.550  1.00 13.81 ? 250 PRO X O   1 
ATOM 1657 C CB  . PRO B 2 5   ? -21.809 28.244 31.482  1.00 10.05 ? 250 PRO X CB  1 
ATOM 1658 C CG  . PRO B 2 5   ? -20.593 27.331 31.541  1.00 16.13 ? 250 PRO X CG  1 
ATOM 1659 C CD  . PRO B 2 5   ? -20.864 26.488 32.790  1.00 18.69 ? 250 PRO X CD  1 
ATOM 1660 N N   . VAL B 2 6   ? -23.510 27.129 29.421  1.00 10.83 ? 251 VAL X N   1 
ATOM 1661 C CA  . VAL B 2 6   ? -23.838 26.467 28.167  1.00 12.24 ? 251 VAL X CA  1 
ATOM 1662 C C   . VAL B 2 6   ? -22.607 26.386 27.280  1.00 14.89 ? 251 VAL X C   1 
ATOM 1663 O O   . VAL B 2 6   ? -21.705 27.216 27.375  1.00 10.13 ? 251 VAL X O   1 
ATOM 1664 C CB  . VAL B 2 6   ? -24.954 27.232 27.361  1.00 17.46 ? 251 VAL X CB  1 
ATOM 1665 C CG1 . VAL B 2 6   ? -25.951 27.875 28.320  1.00 12.81 ? 251 VAL X CG1 1 
ATOM 1666 C CG2 . VAL B 2 6   ? -24.333 28.276 26.423  1.00 10.65 ? 251 VAL X CG2 1 
ATOM 1667 N N   . GLN B 2 7   ? -22.571 25.369 26.429  1.00 13.49 ? 252 GLN X N   1 
ATOM 1668 C CA  . GLN B 2 7   ? -21.486 25.200 25.464  1.00 12.00 ? 252 GLN X CA  1 
ATOM 1669 C C   . GLN B 2 7   ? -22.182 25.543 24.148  1.00 14.69 ? 252 GLN X C   1 
ATOM 1670 O O   . GLN B 2 7   ? -22.884 26.561 24.048  1.00 11.05 ? 252 GLN X O   1 
ATOM 1671 C CB  . GLN B 2 7   ? -20.987 23.741 25.409  1.00 14.50 ? 252 GLN X CB  1 
ATOM 1672 C CG  . GLN B 2 7   ? -20.056 23.290 26.534  1.00 13.08 ? 252 GLN X CG  1 
ATOM 1673 C CD  . GLN B 2 7   ? -20.751 23.119 27.883  1.00 10.32 ? 252 GLN X CD  1 
ATOM 1674 O OE1 . GLN B 2 7   ? -20.204 22.488 28.796  1.00 13.44 ? 252 GLN X OE1 1 
ATOM 1675 N NE2 . GLN B 2 7   ? -21.951 23.683 28.020  1.00 18.82 ? 252 GLN X NE2 1 
ATOM 1676 N N   . GLU B 2 8   ? -21.988 24.682 23.154  1.00 14.84 ? 253 GLU X N   1 
ATOM 1677 C CA  . GLU B 2 8   ? -22.626 24.821 21.853  1.00 9.67  ? 253 GLU X CA  1 
ATOM 1678 C C   . GLU B 2 8   ? -22.627 23.440 21.184  1.00 11.07 ? 253 GLU X C   1 
ATOM 1679 O O   . GLU B 2 8   ? -22.276 22.424 21.810  1.00 9.09  ? 253 GLU X O   1 
ATOM 1680 C CB  . GLU B 2 8   ? -21.907 25.866 20.985  1.00 12.96 ? 253 GLU X CB  1 
ATOM 1681 C CG  . GLU B 2 8   ? -22.780 27.070 20.568  1.00 16.02 ? 253 GLU X CG  1 
ATOM 1682 C CD  . GLU B 2 8   ? -23.145 28.019 21.726  1.00 13.85 ? 253 GLU X CD  1 
ATOM 1683 O OE1 . GLU B 2 8   ? -22.229 28.552 22.386  1.00 14.62 ? 253 GLU X OE1 1 
ATOM 1684 O OE2 . GLU B 2 8   ? -24.351 28.247 21.972  1.00 12.19 ? 253 GLU X OE2 1 
ATOM 1685 N N   . THR B 2 9   ? -22.997 23.404 19.909  1.00 15.87 ? 254 THR X N   1 
ATOM 1686 C CA  . THR B 2 9   ? -23.101 22.139 19.192  1.00 17.04 ? 254 THR X CA  1 
ATOM 1687 C C   . THR B 2 9   ? -21.833 21.982 18.358  1.00 24.35 ? 254 THR X C   1 
ATOM 1688 O O   . THR B 2 9   ? -20.759 21.638 18.869  1.00 16.18 ? 254 THR X O   1 
ATOM 1689 C CB  . THR B 2 9   ? -24.318 22.119 18.211  1.00 12.18 ? 254 THR X CB  1 
ATOM 1690 O OG1 . THR B 2 9   ? -25.455 22.731 18.842  1.00 13.72 ? 254 THR X OG1 1 
ATOM 1691 C CG2 . THR B 2 9   ? -24.653 20.680 17.745  1.00 10.36 ? 254 THR X CG2 1 
ATOM 1692 N N   . LEU B 2 10  ? -22.002 22.130 17.041  1.00 15.68 ? 255 LEU X N   1 
ATOM 1693 C CA  . LEU B 2 10  ? -20.919 22.052 16.056  1.00 13.31 ? 255 LEU X CA  1 
ATOM 1694 C C   . LEU B 2 10  ? -21.443 22.019 14.617  1.00 9.18  ? 255 LEU X C   1 
ATOM 1695 O O   . LEU B 2 10  ? -22.163 21.105 14.217  1.00 9.65  ? 255 LEU X O   1 
ATOM 1696 C CB  . LEU B 2 10  ? -20.014 20.842 16.293  1.00 10.92 ? 255 LEU X CB  1 
ATOM 1697 C CG  . LEU B 2 10  ? -18.871 20.757 15.269  1.00 14.35 ? 255 LEU X CG  1 
ATOM 1698 C CD1 . LEU B 2 10  ? -18.106 22.081 15.218  1.00 14.52 ? 255 LEU X CD1 1 
ATOM 1699 C CD2 . LEU B 2 10  ? -17.941 19.607 15.634  1.00 15.26 ? 255 LEU X CD2 1 
ATOM 1700 N N   . HIS B 2 11  ? -21.046 23.039 13.858  1.00 13.13 ? 256 HIS X N   1 
ATOM 1701 C CA  . HIS B 2 11  ? -21.421 23.249 12.455  1.00 14.13 ? 256 HIS X CA  1 
ATOM 1702 C C   . HIS B 2 11  ? -21.400 22.002 11.576  1.00 10.13 ? 256 HIS X C   1 
ATOM 1703 O O   . HIS B 2 11  ? -20.815 20.970 11.931  1.00 13.27 ? 256 HIS X O   1 
ATOM 1704 C CB  . HIS B 2 11  ? -20.505 24.324 11.841  1.00 20.35 ? 256 HIS X CB  1 
ATOM 1705 C CG  . HIS B 2 11  ? -21.238 25.474 11.214  1.00 19.31 ? 256 HIS X CG  1 
ATOM 1706 N ND1 . HIS B 2 11  ? -21.632 25.478 9.890   1.00 20.13 ? 256 HIS X ND1 1 
ATOM 1707 C CD2 . HIS B 2 11  ? -21.614 26.674 11.720  1.00 9.61  ? 256 HIS X CD2 1 
ATOM 1708 C CE1 . HIS B 2 11  ? -22.212 26.631 9.606   1.00 12.13 ? 256 HIS X CE1 1 
ATOM 1709 N NE2 . HIS B 2 11  ? -22.213 27.375 10.699  1.00 15.13 ? 256 HIS X NE2 1 
ATOM 1710 N N   . GLY B 2 12  ? -22.036 22.132 10.412  1.00 17.09 ? 257 GLY X N   1 
ATOM 1711 C CA  . GLY B 2 12  ? -22.122 21.034 9.468   1.00 11.16 ? 257 GLY X CA  1 
ATOM 1712 C C   . GLY B 2 12  ? -21.650 21.309 8.045   1.00 13.33 ? 257 GLY X C   1 
ATOM 1713 O O   . GLY B 2 12  ? -20.443 21.271 7.771   1.00 12.90 ? 257 GLY X O   1 
ATOM 1714 N N   . SER B 2 13  ? -22.592 21.573 7.136   1.00 12.82 ? 258 SER X N   1 
ATOM 1715 C CA  . SER B 2 13  ? -22.267 21.823 5.731   1.00 13.83 ? 258 SER X CA  1 
ATOM 1716 C C   . SER B 2 13  ? -23.504 22.213 4.941   1.00 13.46 ? 258 SER X C   1 
ATOM 1717 O O   . SER B 2 13  ? -23.422 22.969 3.975   1.00 11.73 ? 258 SER X O   1 
ATOM 1718 C CB  . SER B 2 13  ? -21.655 20.566 5.101   1.00 15.56 ? 258 SER X CB  1 
ATOM 1719 O OG  . SER B 2 13  ? -21.656 20.645 3.686   1.00 19.17 ? 258 SER X OG  1 
ATOM 1720 N N   . GLN B 2 14  ? -24.648 21.679 5.359   1.00 19.03 ? 259 GLN X N   1 
ATOM 1721 C CA  . GLN B 2 14  ? -25.926 21.935 4.693   1.00 17.57 ? 259 GLN X CA  1 
ATOM 1722 C C   . GLN B 2 14  ? -26.638 23.158 5.260   1.00 10.13 ? 259 GLN X C   1 
ATOM 1723 O O   . GLN B 2 14  ? -26.149 23.807 6.194   1.00 16.00 ? 259 GLN X O   1 
ATOM 1724 C CB  . GLN B 2 14  ? -26.859 20.720 4.839   1.00 8.65  ? 259 GLN X CB  1 
ATOM 1725 C CG  . GLN B 2 14  ? -26.349 19.446 4.217   1.00 19.44 ? 259 GLN X CG  1 
ATOM 1726 C CD  . GLN B 2 14  ? -25.076 18.982 4.863   1.00 14.03 ? 259 GLN X CD  1 
ATOM 1727 O OE1 . GLN B 2 14  ? -24.996 18.879 6.089   1.00 19.19 ? 259 GLN X OE1 1 
ATOM 1728 N NE2 . GLN B 2 14  ? -24.062 18.699 4.046   1.00 13.08 ? 259 GLN X NE2 1 
ATOM 1729 N N   . PRO B 2 15  ? -27.800 23.500 4.680   1.00 16.13 ? 260 PRO X N   1 
ATOM 1730 C CA  . PRO B 2 15  ? -28.551 24.652 5.177   1.00 20.13 ? 260 PRO X CA  1 
ATOM 1731 C C   . PRO B 2 15  ? -29.098 24.260 6.543   1.00 15.13 ? 260 PRO X C   1 
ATOM 1732 O O   . PRO B 2 15  ? -29.303 23.073 6.804   1.00 12.13 ? 260 PRO X O   1 
ATOM 1733 C CB  . PRO B 2 15  ? -29.647 24.819 4.131   1.00 13.13 ? 260 PRO X CB  1 
ATOM 1734 C CG  . PRO B 2 15  ? -29.854 23.413 3.627   1.00 10.13 ? 260 PRO X CG  1 
ATOM 1735 C CD  . PRO B 2 15  ? -28.442 22.932 3.479   1.00 17.13 ? 260 PRO X CD  1 
ATOM 1736 N N   . VAL B 2 16  ? -29.305 25.246 7.413   1.00 10.13 ? 261 VAL X N   1 
ATOM 1737 C CA  . VAL B 2 16  ? -29.835 25.008 8.762   1.00 16.13 ? 261 VAL X CA  1 
ATOM 1738 C C   . VAL B 2 16  ? -29.532 26.202 9.659   1.00 15.13 ? 261 VAL X C   1 
ATOM 1739 O O   . VAL B 2 16  ? -28.789 27.094 9.257   1.00 19.13 ? 261 VAL X O   1 
ATOM 1740 C CB  . VAL B 2 16  ? -29.237 23.711 9.393   1.00 20.13 ? 261 VAL X CB  1 
ATOM 1741 C CG1 . VAL B 2 16  ? -27.724 23.740 9.321   1.00 18.13 ? 261 VAL X CG1 1 
ATOM 1742 C CG2 . VAL B 2 16  ? -29.713 23.545 10.826  1.00 10.13 ? 261 VAL X CG2 1 
ATOM 1743 N N   . THR B 2 17  ? -30.130 26.243 10.851  1.00 20.13 ? 262 THR X N   1 
ATOM 1744 C CA  . THR B 2 17  ? -29.862 27.353 11.764  1.00 19.10 ? 262 THR X CA  1 
ATOM 1745 C C   . THR B 2 17  ? -28.921 26.980 12.880  1.00 10.89 ? 262 THR X C   1 
ATOM 1746 O O   . THR B 2 17  ? -28.887 25.834 13.346  1.00 11.46 ? 262 THR X O   1 
ATOM 1747 C CB  . THR B 2 17  ? -31.104 27.920 12.542  1.00 21.55 ? 262 THR X CB  1 
ATOM 1748 O OG1 . THR B 2 17  ? -31.416 27.070 13.656  1.00 16.52 ? 262 THR X OG1 1 
ATOM 1749 C CG2 . THR B 2 17  ? -32.285 28.060 11.665  1.00 20.52 ? 262 THR X CG2 1 
ATOM 1750 N N   . GLN B 2 18  ? -28.141 27.978 13.282  1.00 20.27 ? 263 GLN X N   1 
ATOM 1751 C CA  . GLN B 2 18  ? -27.268 27.850 14.449  1.00 19.06 ? 263 GLN X CA  1 
ATOM 1752 C C   . GLN B 2 18  ? -28.084 27.366 15.648  1.00 19.42 ? 263 GLN X C   1 
ATOM 1753 O O   . GLN B 2 18  ? -28.627 28.176 16.405  1.00 14.24 ? 263 GLN X O   1 
ATOM 1754 C CB  . GLN B 2 18  ? -26.641 29.210 14.781  1.00 9.13  ? 263 GLN X CB  1 
ATOM 1755 C CG  . GLN B 2 18  ? -25.486 29.628 13.849  1.00 16.30 ? 263 GLN X CG  1 
ATOM 1756 C CD  . GLN B 2 18  ? -24.113 29.122 14.315  1.00 10.96 ? 263 GLN X CD  1 
ATOM 1757 O OE1 . GLN B 2 18  ? -23.613 29.514 15.381  1.00 13.05 ? 263 GLN X OE1 1 
ATOM 1758 N NE2 . GLN B 2 18  ? -23.498 28.252 13.512  1.00 11.80 ? 263 GLN X NE2 1 
ATOM 1759 N N   . GLU B 2 19  ? -28.165 26.046 15.820  1.00 12.26 ? 264 GLU X N   1 
ATOM 1760 C CA  . GLU B 2 19  ? -28.748 25.474 17.026  1.00 15.30 ? 264 GLU X CA  1 
ATOM 1761 C C   . GLU B 2 19  ? -27.748 24.631 17.838  1.00 14.68 ? 264 GLU X C   1 
ATOM 1762 O O   . GLU B 2 19  ? -26.888 23.936 17.284  1.00 16.83 ? 264 GLU X O   1 
ATOM 1763 C CB  . GLU B 2 19  ? -29.983 24.648 16.642  1.00 10.91 ? 264 GLU X CB  1 
ATOM 1764 C CG  . GLU B 2 19  ? -31.229 25.494 16.357  1.00 13.93 ? 264 GLU X CG  1 
ATOM 1765 C CD  . GLU B 2 19  ? -32.012 25.859 17.607  1.00 15.45 ? 264 GLU X CD  1 
ATOM 1766 O OE1 . GLU B 2 19  ? -32.967 26.660 17.500  1.00 15.45 ? 264 GLU X OE1 1 
ATOM 1767 O OE2 . GLU B 2 19  ? -31.675 25.343 18.694  1.00 15.38 ? 264 GLU X OE2 1 
ATOM 1768 N N   . ASP B 2 20  ? -27.887 24.705 19.163  1.00 18.90 ? 265 ASP X N   1 
ATOM 1769 C CA  . ASP B 2 20  ? -27.550 23.605 20.079  1.00 10.25 ? 265 ASP X CA  1 
ATOM 1770 C C   . ASP B 2 20  ? -28.523 23.500 21.287  1.00 14.00 ? 265 ASP X C   1 
ATOM 1771 O O   . ASP B 2 20  ? -28.574 24.389 22.146  1.00 14.92 ? 265 ASP X O   1 
ATOM 1772 C CB  . ASP B 2 20  ? -26.105 23.802 20.566  1.00 20.13 ? 265 ASP X CB  1 
ATOM 1773 C CG  . ASP B 2 20  ? -25.692 22.787 21.598  1.00 12.13 ? 265 ASP X CG  1 
ATOM 1774 O OD1 . ASP B 2 20  ? -25.225 21.695 21.205  1.00 8.18  ? 265 ASP X OD1 1 
ATOM 1775 O OD2 . ASP B 2 20  ? -25.832 23.091 22.803  1.00 18.18 ? 265 ASP X OD2 1 
ATOM 1776 N N   . GLY B 2 21  ? -29.260 22.398 21.385  1.00 46.87 ? 266 GLY X N   1 
ATOM 1777 C CA  . GLY B 2 21  ? -30.179 22.258 22.507  1.00 47.30 ? 266 GLY X CA  1 
ATOM 1778 C C   . GLY B 2 21  ? -29.613 21.534 23.724  1.00 47.28 ? 266 GLY X C   1 
ATOM 1779 O O   . GLY B 2 21  ? -30.354 20.732 24.334  1.00 49.18 ? 266 GLY X O   1 
ATOM 1780 N N   . LEU C 1 24  ? 38.060  18.781 55.480  1.00 70.51 ? 300 LEU B N   1 
ATOM 1781 C CA  . LEU C 1 24  ? 37.840  20.220 55.144  1.00 70.77 ? 300 LEU B CA  1 
ATOM 1782 C C   . LEU C 1 24  ? 36.355  20.563 55.222  1.00 70.07 ? 300 LEU B C   1 
ATOM 1783 O O   . LEU C 1 24  ? 35.957  21.721 55.061  1.00 70.24 ? 300 LEU B O   1 
ATOM 1784 C CB  . LEU C 1 24  ? 38.363  20.521 53.735  1.00 70.08 ? 300 LEU B CB  1 
ATOM 1785 C CG  . LEU C 1 24  ? 39.825  20.206 53.400  1.00 70.48 ? 300 LEU B CG  1 
ATOM 1786 C CD1 . LEU C 1 24  ? 40.105  20.649 51.970  1.00 68.73 ? 300 LEU B CD1 1 
ATOM 1787 C CD2 . LEU C 1 24  ? 40.767  20.908 54.372  1.00 70.58 ? 300 LEU B CD2 1 
ATOM 1788 N N   . GLU C 1 25  ? 35.541  19.541 55.465  1.00 70.44 ? 301 GLU B N   1 
ATOM 1789 C CA  . GLU C 1 25  ? 34.097  19.703 55.578  1.00 69.76 ? 301 GLU B CA  1 
ATOM 1790 C C   . GLU C 1 25  ? 33.610  18.861 56.751  1.00 69.08 ? 301 GLU B C   1 
ATOM 1791 O O   . GLU C 1 25  ? 32.813  19.312 57.576  1.00 68.48 ? 301 GLU B O   1 
ATOM 1792 C CB  . GLU C 1 25  ? 33.418  19.255 54.282  1.00 71.07 ? 301 GLU B CB  1 
ATOM 1793 C CG  . GLU C 1 25  ? 31.906  19.359 54.288  1.00 70.11 ? 301 GLU B CG  1 
ATOM 1794 C CD  . GLU C 1 25  ? 31.313  19.184 52.906  1.00 70.13 ? 301 GLU B CD  1 
ATOM 1795 O OE1 . GLU C 1 25  ? 30.096  18.925 52.808  1.00 71.21 ? 301 GLU B OE1 1 
ATOM 1796 O OE2 . GLU C 1 25  ? 32.062  19.316 51.916  1.00 68.27 ? 301 GLU B OE2 1 
ATOM 1797 N N   . SER C 1 26  ? 34.114  17.636 56.820  1.00 69.17 ? 302 SER B N   1 
ATOM 1798 C CA  . SER C 1 26  ? 33.757  16.711 57.885  1.00 68.97 ? 302 SER B CA  1 
ATOM 1799 C C   . SER C 1 26  ? 34.500  17.082 59.175  1.00 69.59 ? 302 SER B C   1 
ATOM 1800 O O   . SER C 1 26  ? 33.952  16.983 60.276  1.00 70.86 ? 302 SER B O   1 
ATOM 1801 C CB  . SER C 1 26  ? 34.118  15.281 57.456  1.00 66.78 ? 302 SER B CB  1 
ATOM 1802 O OG  . SER C 1 26  ? 33.759  14.319 58.439  1.00 68.11 ? 302 SER B OG  1 
ATOM 1803 N N   . VAL C 1 27  ? 35.745  17.524 59.017  1.00 69.29 ? 303 VAL B N   1 
ATOM 1804 C CA  . VAL C 1 27  ? 36.617  17.896 60.132  1.00 68.41 ? 303 VAL B CA  1 
ATOM 1805 C C   . VAL C 1 27  ? 36.057  18.948 61.087  1.00 69.35 ? 303 VAL B C   1 
ATOM 1806 O O   . VAL C 1 27  ? 36.721  19.340 62.050  1.00 68.42 ? 303 VAL B O   1 
ATOM 1807 C CB  . VAL C 1 27  ? 37.988  18.393 59.609  1.00 66.86 ? 303 VAL B CB  1 
ATOM 1808 C CG1 . VAL C 1 27  ? 38.702  17.266 58.869  1.00 66.47 ? 303 VAL B CG1 1 
ATOM 1809 C CG2 . VAL C 1 27  ? 37.797  19.594 58.689  1.00 66.72 ? 303 VAL B CG2 1 
ATOM 1810 N N   . ASP C 1 28  ? 34.837  19.399 60.826  1.00 70.78 ? 304 ASP B N   1 
ATOM 1811 C CA  . ASP C 1 28  ? 34.209  20.409 61.669  1.00 72.66 ? 304 ASP B CA  1 
ATOM 1812 C C   . ASP C 1 28  ? 33.866  19.845 63.049  1.00 73.45 ? 304 ASP B C   1 
ATOM 1813 O O   . ASP C 1 28  ? 34.081  20.504 64.069  1.00 72.94 ? 304 ASP B O   1 
ATOM 1814 C CB  . ASP C 1 28  ? 32.951  20.948 60.985  1.00 75.10 ? 304 ASP B CB  1 
ATOM 1815 C CG  . ASP C 1 28  ? 32.405  22.176 61.669  1.00 77.43 ? 304 ASP B CG  1 
ATOM 1816 O OD1 . ASP C 1 28  ? 31.905  22.041 62.806  1.00 77.87 ? 304 ASP B OD1 1 
ATOM 1817 O OD2 . ASP C 1 28  ? 32.489  23.274 61.074  1.00 78.53 ? 304 ASP B OD2 1 
ATOM 1818 N N   . LYS C 1 29  ? 33.330  18.627 63.071  1.00 74.10 ? 305 LYS B N   1 
ATOM 1819 C CA  . LYS C 1 29  ? 32.979  17.964 64.322  1.00 73.95 ? 305 LYS B CA  1 
ATOM 1820 C C   . LYS C 1 29  ? 33.603  16.569 64.408  1.00 73.15 ? 305 LYS B C   1 
ATOM 1821 O O   . LYS C 1 29  ? 33.736  16.011 65.499  1.00 73.74 ? 305 LYS B O   1 
ATOM 1822 C CB  . LYS C 1 29  ? 31.460  17.860 64.473  1.00 74.81 ? 305 LYS B CB  1 
ATOM 1823 C CG  . LYS C 1 29  ? 31.012  17.107 65.730  1.00 76.99 ? 305 LYS B CG  1 
ATOM 1824 C CD  . LYS C 1 29  ? 31.579  17.731 67.008  1.00 78.42 ? 305 LYS B CD  1 
ATOM 1825 C CE  . LYS C 1 29  ? 31.168  16.936 68.246  1.00 78.30 ? 305 LYS B CE  1 
ATOM 1826 N NZ  . LYS C 1 29  ? 31.726  17.496 69.511  1.00 78.22 ? 305 LYS B NZ  1 
ATOM 1827 N N   . SER C 1 30  ? 33.976  16.004 63.262  1.00 71.91 ? 306 SER B N   1 
ATOM 1828 C CA  . SER C 1 30  ? 34.609  14.686 63.241  1.00 69.38 ? 306 SER B CA  1 
ATOM 1829 C C   . SER C 1 30  ? 36.107  14.849 63.516  1.00 67.13 ? 306 SER B C   1 
ATOM 1830 O O   . SER C 1 30  ? 36.760  13.948 64.048  1.00 65.61 ? 306 SER B O   1 
ATOM 1831 C CB  . SER C 1 30  ? 34.385  14.002 61.888  1.00 68.37 ? 306 SER B CB  1 
ATOM 1832 O OG  . SER C 1 30  ? 33.042  13.566 61.751  1.00 69.04 ? 306 SER B OG  1 
ATOM 1833 N N   . ALA C 1 31  ? 36.641  16.008 63.141  1.00 64.46 ? 307 ALA B N   1 
ATOM 1834 C CA  . ALA C 1 31  ? 38.045  16.338 63.372  1.00 62.54 ? 307 ALA B CA  1 
ATOM 1835 C C   . ALA C 1 31  ? 38.048  17.637 64.179  1.00 62.74 ? 307 ALA B C   1 
ATOM 1836 O O   . ALA C 1 31  ? 39.090  18.121 64.630  1.00 63.66 ? 307 ALA B O   1 
ATOM 1837 C CB  . ALA C 1 31  ? 38.778  16.522 62.051  1.00 60.27 ? 307 ALA B CB  1 
ATOM 1838 N N   . GLY C 1 32  ? 36.854  18.196 64.345  1.00 61.81 ? 308 GLY B N   1 
ATOM 1839 C CA  . GLY C 1 32  ? 36.701  19.405 65.122  1.00 61.60 ? 308 GLY B CA  1 
ATOM 1840 C C   . GLY C 1 32  ? 36.444  18.967 66.549  1.00 61.90 ? 308 GLY B C   1 
ATOM 1841 O O   . GLY C 1 32  ? 35.548  19.475 67.223  1.00 60.45 ? 308 GLY B O   1 
ATOM 1842 N N   . GLN C 1 33  ? 37.232  17.998 67.003  1.00 62.82 ? 309 GLN B N   1 
ATOM 1843 C CA  . GLN C 1 33  ? 37.099  17.475 68.357  1.00 65.04 ? 309 GLN B CA  1 
ATOM 1844 C C   . GLN C 1 33  ? 37.905  18.361 69.308  1.00 66.61 ? 309 GLN B C   1 
ATOM 1845 O O   . GLN C 1 33  ? 38.787  17.889 70.028  1.00 67.50 ? 309 GLN B O   1 
ATOM 1846 C CB  . GLN C 1 33  ? 37.606  16.026 68.416  1.00 66.29 ? 309 GLN B CB  1 
ATOM 1847 C CG  . GLN C 1 33  ? 36.758  15.079 69.280  1.00 68.37 ? 309 GLN B CG  1 
ATOM 1848 C CD  . GLN C 1 33  ? 35.448  14.678 68.618  1.00 70.93 ? 309 GLN B CD  1 
ATOM 1849 O OE1 . GLN C 1 33  ? 35.441  14.071 67.548  1.00 72.97 ? 309 GLN B OE1 1 
ATOM 1850 N NE2 . GLN C 1 33  ? 34.333  15.014 69.257  1.00 70.27 ? 309 GLN B NE2 1 
ATOM 1851 N N   . VAL C 1 34  ? 37.590  19.654 69.289  1.00 67.62 ? 310 VAL B N   1 
ATOM 1852 C CA  . VAL C 1 34  ? 38.261  20.639 70.132  1.00 67.16 ? 310 VAL B CA  1 
ATOM 1853 C C   . VAL C 1 34  ? 37.499  20.852 71.437  1.00 66.90 ? 310 VAL B C   1 
ATOM 1854 O O   . VAL C 1 34  ? 38.078  20.764 72.521  1.00 67.13 ? 310 VAL B O   1 
ATOM 1855 C CB  . VAL C 1 34  ? 38.389  22.013 69.415  1.00 67.79 ? 310 VAL B CB  1 
ATOM 1856 C CG1 . VAL C 1 34  ? 39.323  21.895 68.219  1.00 69.50 ? 310 VAL B CG1 1 
ATOM 1857 C CG2 . VAL C 1 34  ? 37.011  22.505 68.968  1.00 67.23 ? 310 VAL B CG2 1 
ATOM 1858 N N   . ALA C 1 35  ? 36.202  21.130 71.323  1.00 65.46 ? 311 ALA B N   1 
ATOM 1859 C CA  . ALA C 1 35  ? 35.353  21.372 72.485  1.00 64.06 ? 311 ALA B CA  1 
ATOM 1860 C C   . ALA C 1 35  ? 35.195  20.155 73.399  1.00 62.35 ? 311 ALA B C   1 
ATOM 1861 O O   . ALA C 1 35  ? 34.628  20.273 74.484  1.00 60.99 ? 311 ALA B O   1 
ATOM 1862 C CB  . ALA C 1 35  ? 33.982  21.871 72.031  1.00 64.81 ? 311 ALA B CB  1 
ATOM 1863 N N   . ARG C 1 36  ? 35.680  18.992 72.963  1.00 59.92 ? 312 ARG B N   1 
ATOM 1864 C CA  . ARG C 1 36  ? 35.596  17.779 73.782  1.00 58.86 ? 312 ARG B CA  1 
ATOM 1865 C C   . ARG C 1 36  ? 36.696  17.863 74.819  1.00 57.97 ? 312 ARG B C   1 
ATOM 1866 O O   . ARG C 1 36  ? 36.479  17.585 75.999  1.00 59.08 ? 312 ARG B O   1 
ATOM 1867 C CB  . ARG C 1 36  ? 35.770  16.521 72.930  1.00 58.76 ? 312 ARG B CB  1 
ATOM 1868 C CG  . ARG C 1 36  ? 34.626  16.288 71.956  1.00 59.43 ? 312 ARG B CG  1 
ATOM 1869 C CD  . ARG C 1 36  ? 33.315  15.928 72.661  1.00 58.70 ? 312 ARG B CD  1 
ATOM 1870 N NE  . ARG C 1 36  ? 32.952  16.851 73.735  1.00 61.11 ? 312 ARG B NE  1 
ATOM 1871 C CZ  . ARG C 1 36  ? 31.780  16.845 74.362  1.00 63.75 ? 312 ARG B CZ  1 
ATOM 1872 N NH1 . ARG C 1 36  ? 30.849  15.964 74.019  1.00 65.68 ? 312 ARG B NH1 1 
ATOM 1873 N NH2 . ARG C 1 36  ? 31.539  17.709 75.341  1.00 65.50 ? 312 ARG B NH2 1 
ATOM 1874 N N   . ASN C 1 37  ? 37.883  18.247 74.365  1.00 54.87 ? 313 ASN B N   1 
ATOM 1875 C CA  . ASN C 1 37  ? 39.002  18.426 75.271  1.00 52.59 ? 313 ASN B CA  1 
ATOM 1876 C C   . ASN C 1 37  ? 38.456  19.466 76.244  1.00 51.80 ? 313 ASN B C   1 
ATOM 1877 O O   . ASN C 1 37  ? 38.534  19.306 77.460  1.00 53.42 ? 313 ASN B O   1 
ATOM 1878 C CB  . ASN C 1 37  ? 40.218  18.990 74.520  1.00 52.44 ? 313 ASN B CB  1 
ATOM 1879 C CG  . ASN C 1 37  ? 40.579  18.170 73.284  1.00 55.24 ? 313 ASN B CG  1 
ATOM 1880 O OD1 . ASN C 1 37  ? 39.780  18.053 72.350  1.00 55.70 ? 313 ASN B OD1 1 
ATOM 1881 N ND2 . ASN C 1 37  ? 41.787  17.598 73.274  1.00 55.97 ? 313 ASN B ND2 1 
ATOM 1882 N N   . THR C 1 38  ? 37.861  20.514 75.675  1.00 49.18 ? 314 THR B N   1 
ATOM 1883 C CA  . THR C 1 38  ? 37.266  21.606 76.444  1.00 46.80 ? 314 THR B CA  1 
ATOM 1884 C C   . THR C 1 38  ? 36.214  21.042 77.382  1.00 43.68 ? 314 THR B C   1 
ATOM 1885 O O   . THR C 1 38  ? 36.226  21.319 78.583  1.00 45.36 ? 314 THR B O   1 
ATOM 1886 C CB  . THR C 1 38  ? 36.544  22.641 75.537  1.00 47.10 ? 314 THR B CB  1 
ATOM 1887 O OG1 . THR C 1 38  ? 37.239  22.772 74.292  1.00 47.09 ? 314 THR B OG1 1 
ATOM 1888 C CG2 . THR C 1 38  ? 36.491  24.006 76.227  1.00 50.53 ? 314 THR B CG2 1 
ATOM 1889 N N   . GLY C 1 39  ? 35.297  20.264 76.811  1.00 40.42 ? 315 GLY B N   1 
ATOM 1890 C CA  . GLY C 1 39  ? 34.231  19.670 77.590  1.00 38.41 ? 315 GLY B CA  1 
ATOM 1891 C C   . GLY C 1 39  ? 34.761  19.297 78.949  1.00 38.74 ? 315 GLY B C   1 
ATOM 1892 O O   . GLY C 1 39  ? 34.248  19.740 79.978  1.00 39.17 ? 315 GLY B O   1 
ATOM 1893 N N   . LEU C 1 40  ? 35.816  18.490 78.941  1.00 36.30 ? 316 LEU B N   1 
ATOM 1894 C CA  . LEU C 1 40  ? 36.437  18.054 80.175  1.00 35.13 ? 316 LEU B CA  1 
ATOM 1895 C C   . LEU C 1 40  ? 37.071  19.248 80.876  1.00 32.84 ? 316 LEU B C   1 
ATOM 1896 O O   . LEU C 1 40  ? 37.040  19.342 82.102  1.00 36.34 ? 316 LEU B O   1 
ATOM 1897 C CB  . LEU C 1 40  ? 37.490  16.981 79.890  1.00 36.03 ? 316 LEU B CB  1 
ATOM 1898 C CG  . LEU C 1 40  ? 37.018  15.602 79.414  1.00 35.24 ? 316 LEU B CG  1 
ATOM 1899 C CD1 . LEU C 1 40  ? 36.038  15.028 80.420  1.00 35.23 ? 316 LEU B CD1 1 
ATOM 1900 C CD2 . LEU C 1 40  ? 36.381  15.707 78.048  1.00 36.24 ? 316 LEU B CD2 1 
ATOM 1901 N N   . LEU C 1 41  ? 37.632  20.167 80.097  1.00 31.26 ? 317 LEU B N   1 
ATOM 1902 C CA  . LEU C 1 41  ? 38.265  21.346 80.669  1.00 28.01 ? 317 LEU B CA  1 
ATOM 1903 C C   . LEU C 1 41  ? 37.296  22.228 81.460  1.00 29.48 ? 317 LEU B C   1 
ATOM 1904 O O   . LEU C 1 41  ? 37.419  22.345 82.681  1.00 31.37 ? 317 LEU B O   1 
ATOM 1905 C CB  . LEU C 1 41  ? 38.962  22.172 79.581  1.00 25.65 ? 317 LEU B CB  1 
ATOM 1906 C CG  . LEU C 1 41  ? 40.458  21.924 79.332  1.00 24.15 ? 317 LEU B CG  1 
ATOM 1907 C CD1 . LEU C 1 41  ? 41.203  21.882 80.654  1.00 21.06 ? 317 LEU B CD1 1 
ATOM 1908 C CD2 . LEU C 1 41  ? 40.656  20.637 78.580  1.00 23.12 ? 317 LEU B CD2 1 
ATOM 1909 N N   . GLU C 1 42  ? 36.338  22.853 80.783  1.00 29.80 ? 318 GLU B N   1 
ATOM 1910 C CA  . GLU C 1 42  ? 35.373  23.707 81.482  1.00 31.78 ? 318 GLU B CA  1 
ATOM 1911 C C   . GLU C 1 42  ? 34.817  22.948 82.705  1.00 28.05 ? 318 GLU B C   1 
ATOM 1912 O O   . GLU C 1 42  ? 34.679  23.503 83.805  1.00 29.07 ? 318 GLU B O   1 
ATOM 1913 C CB  . GLU C 1 42  ? 34.211  24.089 80.542  1.00 36.57 ? 318 GLU B CB  1 
ATOM 1914 C CG  . GLU C 1 42  ? 34.613  24.701 79.188  1.00 51.04 ? 318 GLU B CG  1 
ATOM 1915 C CD  . GLU C 1 42  ? 33.420  24.911 78.243  1.00 57.15 ? 318 GLU B CD  1 
ATOM 1916 O OE1 . GLU C 1 42  ? 32.607  23.978 78.090  1.00 55.16 ? 318 GLU B OE1 1 
ATOM 1917 O OE2 . GLU C 1 42  ? 33.294  26.001 77.643  1.00 62.95 ? 318 GLU B OE2 1 
ATOM 1918 N N   . SER C 1 43  ? 34.525  21.664 82.487  1.00 24.67 ? 319 SER B N   1 
ATOM 1919 C CA  . SER C 1 43  ? 33.964  20.761 83.500  1.00 22.54 ? 319 SER B CA  1 
ATOM 1920 C C   . SER C 1 43  ? 34.858  20.444 84.709  1.00 24.48 ? 319 SER B C   1 
ATOM 1921 O O   . SER C 1 43  ? 34.579  20.891 85.831  1.00 25.78 ? 319 SER B O   1 
ATOM 1922 C CB  . SER C 1 43  ? 33.543  19.452 82.829  1.00 20.84 ? 319 SER B CB  1 
ATOM 1923 O OG  . SER C 1 43  ? 34.641  18.875 82.156  1.00 22.44 ? 319 SER B OG  1 
ATOM 1924 N N   . GLN C 1 44  ? 35.907  19.650 84.490  1.00 24.98 ? 320 GLN B N   1 
ATOM 1925 C CA  . GLN C 1 44  ? 36.816  19.308 85.575  1.00 22.95 ? 320 GLN B CA  1 
ATOM 1926 C C   . GLN C 1 44  ? 37.166  20.595 86.284  1.00 22.74 ? 320 GLN B C   1 
ATOM 1927 O O   . GLN C 1 44  ? 37.333  20.624 87.505  1.00 24.16 ? 320 GLN B O   1 
ATOM 1928 C CB  . GLN C 1 44  ? 38.081  18.637 85.040  1.00 25.80 ? 320 GLN B CB  1 
ATOM 1929 C CG  . GLN C 1 44  ? 37.994  17.130 85.079  1.00 23.36 ? 320 GLN B CG  1 
ATOM 1930 C CD  . GLN C 1 44  ? 37.608  16.623 86.460  1.00 21.61 ? 320 GLN B CD  1 
ATOM 1931 O OE1 . GLN C 1 44  ? 38.421  16.615 87.384  1.00 16.77 ? 320 GLN B OE1 1 
ATOM 1932 N NE2 . GLN C 1 44  ? 36.354  16.212 86.608  1.00 23.33 ? 320 GLN B NE2 1 
ATOM 1933 N N   . LEU C 1 45  ? 37.253  21.661 85.493  1.00 21.19 ? 321 LEU B N   1 
ATOM 1934 C CA  . LEU C 1 45  ? 37.553  22.993 85.995  1.00 23.23 ? 321 LEU B CA  1 
ATOM 1935 C C   . LEU C 1 45  ? 36.563  23.338 87.105  1.00 25.96 ? 321 LEU B C   1 
ATOM 1936 O O   . LEU C 1 45  ? 36.960  23.720 88.213  1.00 27.61 ? 321 LEU B O   1 
ATOM 1937 C CB  . LEU C 1 45  ? 37.435  24.011 84.858  1.00 21.29 ? 321 LEU B CB  1 
ATOM 1938 C CG  . LEU C 1 45  ? 38.683  24.813 84.484  1.00 19.01 ? 321 LEU B CG  1 
ATOM 1939 C CD1 . LEU C 1 45  ? 38.431  25.555 83.181  1.00 18.63 ? 321 LEU B CD1 1 
ATOM 1940 C CD2 . LEU C 1 45  ? 39.042  25.777 85.617  1.00 12.40 ? 321 LEU B CD2 1 
ATOM 1941 N N   . SER C 1 46  ? 35.273  23.192 86.799  1.00 28.43 ? 322 SER B N   1 
ATOM 1942 C CA  . SER C 1 46  ? 34.224  23.488 87.765  1.00 30.09 ? 322 SER B CA  1 
ATOM 1943 C C   . SER C 1 46  ? 34.302  22.589 88.998  1.00 30.65 ? 322 SER B C   1 
ATOM 1944 O O   . SER C 1 46  ? 33.972  23.030 90.106  1.00 30.72 ? 322 SER B O   1 
ATOM 1945 C CB  . SER C 1 46  ? 32.845  23.351 87.117  1.00 31.72 ? 322 SER B CB  1 
ATOM 1946 O OG  . SER C 1 46  ? 31.810  23.695 88.033  1.00 40.89 ? 322 SER B OG  1 
ATOM 1947 N N   . ARG C 1 47  ? 34.726  21.333 88.807  1.00 31.99 ? 323 ARG B N   1 
ATOM 1948 C CA  . ARG C 1 47  ? 34.842  20.400 89.932  1.00 32.47 ? 323 ARG B CA  1 
ATOM 1949 C C   . ARG C 1 47  ? 35.885  20.958 90.885  1.00 31.43 ? 323 ARG B C   1 
ATOM 1950 O O   . ARG C 1 47  ? 35.891  20.632 92.077  1.00 32.50 ? 323 ARG B O   1 
ATOM 1951 C CB  . ARG C 1 47  ? 35.258  18.999 89.479  1.00 36.17 ? 323 ARG B CB  1 
ATOM 1952 C CG  . ARG C 1 47  ? 35.042  17.946 90.572  1.00 39.97 ? 323 ARG B CG  1 
ATOM 1953 C CD  . ARG C 1 47  ? 35.530  16.576 90.145  1.00 34.02 ? 323 ARG B CD  1 
ATOM 1954 N NE  . ARG C 1 47  ? 36.945  16.615 89.785  1.00 31.33 ? 323 ARG B NE  1 
ATOM 1955 C CZ  . ARG C 1 47  ? 37.921  16.966 90.620  1.00 34.37 ? 323 ARG B CZ  1 
ATOM 1956 N NH1 . ARG C 1 47  ? 37.640  17.306 91.871  1.00 30.45 ? 323 ARG B NH1 1 
ATOM 1957 N NH2 . ARG C 1 47  ? 39.180  16.981 90.204  1.00 45.06 ? 323 ARG B NH2 1 
ATOM 1958 N N   . HIS C 1 48  ? 36.770  21.791 90.335  1.00 30.12 ? 324 HIS B N   1 
ATOM 1959 C CA  . HIS C 1 48  ? 37.807  22.462 91.109  1.00 28.48 ? 324 HIS B CA  1 
ATOM 1960 C C   . HIS C 1 48  ? 37.076  23.643 91.707  1.00 28.78 ? 324 HIS B C   1 
ATOM 1961 O O   . HIS C 1 48  ? 37.260  23.984 92.875  1.00 28.99 ? 324 HIS B O   1 
ATOM 1962 C CB  . HIS C 1 48  ? 38.917  22.983 90.201  1.00 29.90 ? 324 HIS B CB  1 
ATOM 1963 C CG  . HIS C 1 48  ? 39.737  21.910 89.559  1.00 26.17 ? 324 HIS B CG  1 
ATOM 1964 N ND1 . HIS C 1 48  ? 40.555  21.067 90.280  1.00 24.22 ? 324 HIS B ND1 1 
ATOM 1965 C CD2 . HIS C 1 48  ? 39.891  21.564 88.259  1.00 25.91 ? 324 HIS B CD2 1 
ATOM 1966 C CE1 . HIS C 1 48  ? 41.179  20.251 89.449  1.00 21.11 ? 324 HIS B CE1 1 
ATOM 1967 N NE2 . HIS C 1 48  ? 40.795  20.532 88.217  1.00 24.34 ? 324 HIS B NE2 1 
ATOM 1968 N N   . ASP C 1 49  ? 36.236  24.251 90.871  1.00 27.67 ? 325 ASP B N   1 
ATOM 1969 C CA  . ASP C 1 49  ? 35.430  25.411 91.243  1.00 26.81 ? 325 ASP B CA  1 
ATOM 1970 C C   . ASP C 1 49  ? 34.548  25.158 92.456  1.00 27.90 ? 325 ASP B C   1 
ATOM 1971 O O   . ASP C 1 49  ? 34.254  26.074 93.229  1.00 29.32 ? 325 ASP B O   1 
ATOM 1972 C CB  . ASP C 1 49  ? 34.541  25.834 90.073  1.00 29.32 ? 325 ASP B CB  1 
ATOM 1973 C CG  . ASP C 1 49  ? 35.139  26.955 89.264  1.00 31.86 ? 325 ASP B CG  1 
ATOM 1974 O OD1 . ASP C 1 49  ? 35.545  27.965 89.874  1.00 31.50 ? 325 ASP B OD1 1 
ATOM 1975 O OD2 . ASP C 1 49  ? 35.187  26.840 88.024  1.00 31.26 ? 325 ASP B OD2 1 
ATOM 1976 N N   . GLN C 1 50  ? 34.125  23.910 92.614  1.00 25.43 ? 326 GLN B N   1 
ATOM 1977 C CA  . GLN C 1 50  ? 33.257  23.544 93.719  1.00 26.78 ? 326 GLN B CA  1 
ATOM 1978 C C   . GLN C 1 50  ? 34.029  23.136 94.968  1.00 25.51 ? 326 GLN B C   1 
ATOM 1979 O O   . GLN C 1 50  ? 33.823  23.691 96.046  1.00 27.48 ? 326 GLN B O   1 
ATOM 1980 C CB  . GLN C 1 50  ? 32.343  22.395 93.293  1.00 32.87 ? 326 GLN B CB  1 
ATOM 1981 C CG  . GLN C 1 50  ? 31.688  22.587 91.944  1.00 41.66 ? 326 GLN B CG  1 
ATOM 1982 C CD  . GLN C 1 50  ? 30.893  21.372 91.527  1.00 47.10 ? 326 GLN B CD  1 
ATOM 1983 O OE1 . GLN C 1 50  ? 30.008  20.922 92.254  1.00 50.23 ? 326 GLN B OE1 1 
ATOM 1984 N NE2 . GLN C 1 50  ? 31.203  20.830 90.351  1.00 50.50 ? 326 GLN B NE2 1 
ATOM 1985 N N   . MET C 1 51  ? 34.913  22.157 94.814  1.00 24.23 ? 327 MET B N   1 
ATOM 1986 C CA  . MET C 1 51  ? 35.697  21.650 95.932  1.00 21.52 ? 327 MET B CA  1 
ATOM 1987 C C   . MET C 1 51  ? 36.463  22.757 96.642  1.00 19.51 ? 327 MET B C   1 
ATOM 1988 O O   . MET C 1 51  ? 36.656  22.718 97.858  1.00 22.91 ? 327 MET B O   1 
ATOM 1989 C CB  . MET C 1 51  ? 36.671  20.573 95.445  1.00 25.99 ? 327 MET B CB  1 
ATOM 1990 C CG  . MET C 1 51  ? 36.468  19.212 96.076  1.00 27.63 ? 327 MET B CG  1 
ATOM 1991 S SD  . MET C 1 51  ? 38.050  18.382 96.294  1.00 30.84 ? 327 MET B SD  1 
ATOM 1992 C CE  . MET C 1 51  ? 38.146  17.371 94.802  1.00 30.04 ? 327 MET B CE  1 
ATOM 1993 N N   . LEU C 1 52  ? 36.908  23.744 95.877  1.00 18.66 ? 328 LEU B N   1 
ATOM 1994 C CA  . LEU C 1 52  ? 37.638  24.842 96.474  1.00 17.53 ? 328 LEU B CA  1 
ATOM 1995 C C   . LEU C 1 52  ? 36.670  25.617 97.361  1.00 17.25 ? 328 LEU B C   1 
ATOM 1996 O O   . LEU C 1 52  ? 36.943  25.830 98.552  1.00 18.48 ? 328 LEU B O   1 
ATOM 1997 C CB  . LEU C 1 52  ? 38.258  25.733 95.382  1.00 16.23 ? 328 LEU B CB  1 
ATOM 1998 C CG  . LEU C 1 52  ? 39.508  25.172 94.654  1.00 12.40 ? 328 LEU B CG  1 
ATOM 1999 C CD1 . LEU C 1 52  ? 39.991  26.183 93.600  1.00 12.40 ? 328 LEU B CD1 1 
ATOM 2000 C CD2 . LEU C 1 52  ? 40.646  24.865 95.665  1.00 12.40 ? 328 LEU B CD2 1 
ATOM 2001 N N   . SER C 1 53  ? 35.529  25.996 96.777  1.00 15.40 ? 329 SER B N   1 
ATOM 2002 C CA  . SER C 1 53  ? 34.452  26.735 97.473  1.00 14.72 ? 329 SER B CA  1 
ATOM 2003 C C   . SER C 1 53  ? 33.822  25.890 98.589  1.00 15.87 ? 329 SER B C   1 
ATOM 2004 O O   . SER C 1 53  ? 32.601  25.888 98.775  1.00 18.55 ? 329 SER B O   1 
ATOM 2005 C CB  . SER C 1 53  ? 33.355  27.148 96.474  1.00 17.69 ? 329 SER B CB  1 
ATOM 2006 O OG  . SER C 1 53  ? 32.249  27.746 97.129  1.00 26.76 ? 329 SER B OG  1 
ATOM 2007 N N   . VAL C 1 54  ? 34.680  25.183 99.327  1.00 14.84 ? 330 VAL B N   1 
ATOM 2008 C CA  . VAL C 1 54  ? 34.266  24.305 100.417 1.00 13.54 ? 330 VAL B CA  1 
ATOM 2009 C C   . VAL C 1 54  ? 35.244  24.432 101.575 1.00 20.09 ? 330 VAL B C   1 
ATOM 2010 O O   . VAL C 1 54  ? 35.012  23.906 102.666 1.00 23.36 ? 330 VAL B O   1 
ATOM 2011 C CB  . VAL C 1 54  ? 34.268  22.830 99.960  1.00 12.68 ? 330 VAL B CB  1 
ATOM 2012 C CG1 . VAL C 1 54  ? 33.818  21.926 101.103 1.00 12.40 ? 330 VAL B CG1 1 
ATOM 2013 C CG2 . VAL C 1 54  ? 33.379  22.667 98.731  1.00 13.26 ? 330 VAL B CG2 1 
ATOM 2014 N N   . HIS C 1 55  ? 36.344  25.131 101.328 1.00 24.11 ? 331 HIS B N   1 
ATOM 2015 C CA  . HIS C 1 55  ? 37.344  25.288 102.362 1.00 22.42 ? 331 HIS B CA  1 
ATOM 2016 C C   . HIS C 1 55  ? 37.416  26.698 102.904 1.00 24.60 ? 331 HIS B C   1 
ATOM 2017 O O   . HIS C 1 55  ? 37.777  26.895 104.064 1.00 25.93 ? 331 HIS B O   1 
ATOM 2018 C CB  . HIS C 1 55  ? 38.704  24.850 101.838 1.00 20.90 ? 331 HIS B CB  1 
ATOM 2019 C CG  . HIS C 1 55  ? 38.700  23.476 101.243 1.00 19.29 ? 331 HIS B CG  1 
ATOM 2020 N ND1 . HIS C 1 55  ? 39.727  22.578 101.437 1.00 16.05 ? 331 HIS B ND1 1 
ATOM 2021 C CD2 . HIS C 1 55  ? 37.810  22.864 100.426 1.00 21.04 ? 331 HIS B CD2 1 
ATOM 2022 C CE1 . HIS C 1 55  ? 39.471  21.472 100.763 1.00 17.81 ? 331 HIS B CE1 1 
ATOM 2023 N NE2 . HIS C 1 55  ? 38.314  21.620 100.141 1.00 18.75 ? 331 HIS B NE2 1 
ATOM 2024 N N   . ASP C 1 56  ? 37.093  27.683 102.068 1.00 27.73 ? 332 ASP B N   1 
ATOM 2025 C CA  . ASP C 1 56  ? 37.100  29.064 102.533 1.00 29.00 ? 332 ASP B CA  1 
ATOM 2026 C C   . ASP C 1 56  ? 36.079  29.026 103.651 1.00 28.41 ? 332 ASP B C   1 
ATOM 2027 O O   . ASP C 1 56  ? 36.193  29.725 104.651 1.00 31.02 ? 332 ASP B O   1 
ATOM 2028 C CB  . ASP C 1 56  ? 36.644  30.021 101.429 1.00 33.27 ? 332 ASP B CB  1 
ATOM 2029 C CG  . ASP C 1 56  ? 37.723  30.277 100.396 1.00 38.00 ? 332 ASP B CG  1 
ATOM 2030 O OD1 . ASP C 1 56  ? 38.823  30.727 100.777 1.00 42.75 ? 332 ASP B OD1 1 
ATOM 2031 O OD2 . ASP C 1 56  ? 37.471  30.037 99.201  1.00 42.26 ? 332 ASP B OD2 1 
ATOM 2032 N N   . ILE C 1 57  ? 35.097  28.152 103.454 1.00 27.19 ? 333 ILE B N   1 
ATOM 2033 C CA  . ILE C 1 57  ? 34.007  27.921 104.393 1.00 25.86 ? 333 ILE B CA  1 
ATOM 2034 C C   . ILE C 1 57  ? 34.518  27.022 105.522 1.00 25.41 ? 333 ILE B C   1 
ATOM 2035 O O   . ILE C 1 57  ? 34.454  27.384 106.705 1.00 26.21 ? 333 ILE B O   1 
ATOM 2036 C CB  . ILE C 1 57  ? 32.842  27.200 103.688 1.00 26.42 ? 333 ILE B CB  1 
ATOM 2037 C CG1 . ILE C 1 57  ? 32.650  27.787 102.286 1.00 27.56 ? 333 ILE B CG1 1 
ATOM 2038 C CG2 . ILE C 1 57  ? 31.575  27.317 104.525 1.00 25.74 ? 333 ILE B CG2 1 
ATOM 2039 C CD1 . ILE C 1 57  ? 31.660  27.031 101.424 1.00 25.69 ? 333 ILE B CD1 1 
ATOM 2040 N N   . ARG C 1 58  ? 35.020  25.846 105.133 1.00 25.06 ? 334 ARG B N   1 
ATOM 2041 C CA  . ARG C 1 58  ? 35.563  24.862 106.070 1.00 22.95 ? 334 ARG B CA  1 
ATOM 2042 C C   . ARG C 1 58  ? 36.588  25.501 107.000 1.00 22.35 ? 334 ARG B C   1 
ATOM 2043 O O   . ARG C 1 58  ? 36.524  25.330 108.222 1.00 24.27 ? 334 ARG B O   1 
ATOM 2044 C CB  . ARG C 1 58  ? 36.210  23.693 105.312 1.00 23.20 ? 334 ARG B CB  1 
ATOM 2045 C CG  . ARG C 1 58  ? 35.297  22.485 105.134 1.00 23.57 ? 334 ARG B CG  1 
ATOM 2046 C CD  . ARG C 1 58  ? 34.684  22.076 106.480 1.00 24.70 ? 334 ARG B CD  1 
ATOM 2047 N NE  . ARG C 1 58  ? 35.629  21.422 107.388 1.00 24.98 ? 334 ARG B NE  1 
ATOM 2048 C CZ  . ARG C 1 58  ? 35.529  21.434 108.717 1.00 28.38 ? 334 ARG B CZ  1 
ATOM 2049 N NH1 . ARG C 1 58  ? 34.532  22.073 109.317 1.00 28.07 ? 334 ARG B NH1 1 
ATOM 2050 N NH2 . ARG C 1 58  ? 36.424  20.789 109.450 1.00 26.52 ? 334 ARG B NH2 1 
ATOM 2051 N N   . LEU C 1 59  ? 37.536  26.230 106.413 1.00 22.96 ? 335 LEU B N   1 
ATOM 2052 C CA  . LEU C 1 59  ? 38.561  26.918 107.189 1.00 22.10 ? 335 LEU B CA  1 
ATOM 2053 C C   . LEU C 1 59  ? 37.892  28.108 107.875 1.00 26.49 ? 335 LEU B C   1 
ATOM 2054 O O   . LEU C 1 59  ? 38.238  28.456 109.008 1.00 29.70 ? 335 LEU B O   1 
ATOM 2055 C CB  . LEU C 1 59  ? 39.694  27.387 106.272 1.00 19.89 ? 335 LEU B CB  1 
ATOM 2056 C CG  . LEU C 1 59  ? 40.460  26.256 105.582 1.00 18.39 ? 335 LEU B CG  1 
ATOM 2057 C CD1 . LEU C 1 59  ? 41.091  26.767 104.306 1.00 21.45 ? 335 LEU B CD1 1 
ATOM 2058 C CD2 . LEU C 1 59  ? 41.500  25.681 106.533 1.00 20.44 ? 335 LEU B CD2 1 
ATOM 2059 N N   . ALA C 1 60  ? 36.922  28.712 107.186 1.00 29.14 ? 336 ALA B N   1 
ATOM 2060 C CA  . ALA C 1 60  ? 36.188  29.845 107.724 1.00 29.51 ? 336 ALA B CA  1 
ATOM 2061 C C   . ALA C 1 60  ? 35.732  29.501 109.125 1.00 31.75 ? 336 ALA B C   1 
ATOM 2062 O O   . ALA C 1 60  ? 36.252  30.014 110.117 1.00 34.47 ? 336 ALA B O   1 
ATOM 2063 C CB  . ALA C 1 60  ? 34.991  30.136 106.869 1.00 27.36 ? 336 ALA B CB  1 
ATOM 2064 N N   . ASP C 1 61  ? 34.748  28.616 109.189 1.00 34.11 ? 337 ASP B N   1 
ATOM 2065 C CA  . ASP C 1 61  ? 34.194  28.174 110.457 1.00 35.24 ? 337 ASP B CA  1 
ATOM 2066 C C   . ASP C 1 61  ? 35.310  27.609 111.330 1.00 33.64 ? 337 ASP B C   1 
ATOM 2067 O O   . ASP C 1 61  ? 35.402  27.925 112.516 1.00 33.81 ? 337 ASP B O   1 
ATOM 2068 C CB  . ASP C 1 61  ? 33.135  27.093 110.210 1.00 41.82 ? 337 ASP B CB  1 
ATOM 2069 C CG  . ASP C 1 61  ? 32.063  27.533 109.223 1.00 48.86 ? 337 ASP B CG  1 
ATOM 2070 O OD1 . ASP C 1 61  ? 31.141  28.279 109.622 1.00 55.38 ? 337 ASP B OD1 1 
ATOM 2071 O OD2 . ASP C 1 61  ? 32.149  27.138 108.039 1.00 52.70 ? 337 ASP B OD2 1 
ATOM 2072 N N   . MET C 1 62  ? 36.154  26.776 110.721 1.00 32.47 ? 338 MET B N   1 
ATOM 2073 C CA  . MET C 1 62  ? 37.275  26.119 111.390 1.00 30.30 ? 338 MET B CA  1 
ATOM 2074 C C   . MET C 1 62  ? 38.031  27.005 112.364 1.00 30.01 ? 338 MET B C   1 
ATOM 2075 O O   . MET C 1 62  ? 38.231  26.646 113.528 1.00 30.84 ? 338 MET B O   1 
ATOM 2076 C CB  . MET C 1 62  ? 38.245  25.584 110.343 1.00 31.55 ? 338 MET B CB  1 
ATOM 2077 C CG  . MET C 1 62  ? 39.567  25.114 110.909 1.00 31.16 ? 338 MET B CG  1 
ATOM 2078 S SD  . MET C 1 62  ? 39.357  23.947 112.244 1.00 30.66 ? 338 MET B SD  1 
ATOM 2079 C CE  . MET C 1 62  ? 38.753  22.540 111.328 1.00 20.91 ? 338 MET B CE  1 
ATOM 2080 N N   . ASP C 1 63  ? 38.463  28.157 111.865 1.00 28.67 ? 339 ASP B N   1 
ATOM 2081 C CA  . ASP C 1 63  ? 39.204  29.131 112.661 1.00 26.85 ? 339 ASP B CA  1 
ATOM 2082 C C   . ASP C 1 63  ? 38.264  29.713 113.732 1.00 26.68 ? 339 ASP B C   1 
ATOM 2083 O O   . ASP C 1 63  ? 38.681  29.992 114.865 1.00 30.02 ? 339 ASP B O   1 
ATOM 2084 C CB  . ASP C 1 63  ? 39.752  30.233 111.728 1.00 30.01 ? 339 ASP B CB  1 
ATOM 2085 C CG  . ASP C 1 63  ? 40.982  30.957 112.302 1.00 33.48 ? 339 ASP B CG  1 
ATOM 2086 O OD1 . ASP C 1 63  ? 40.793  31.920 113.085 1.00 41.49 ? 339 ASP B OD1 1 
ATOM 2087 O OD2 . ASP C 1 63  ? 42.133  30.565 111.968 1.00 33.82 ? 339 ASP B OD2 1 
ATOM 2088 N N   . LEU C 1 64  ? 36.991  29.869 113.364 1.00 25.25 ? 340 LEU B N   1 
ATOM 2089 C CA  . LEU C 1 64  ? 35.963  30.395 114.265 1.00 25.14 ? 340 LEU B CA  1 
ATOM 2090 C C   . LEU C 1 64  ? 35.861  29.534 115.531 1.00 26.51 ? 340 LEU B C   1 
ATOM 2091 O O   . LEU C 1 64  ? 35.655  30.048 116.631 1.00 29.18 ? 340 LEU B O   1 
ATOM 2092 C CB  . LEU C 1 64  ? 34.603  30.428 113.541 1.00 26.19 ? 340 LEU B CB  1 
ATOM 2093 C CG  . LEU C 1 64  ? 33.359  31.174 114.077 1.00 25.35 ? 340 LEU B CG  1 
ATOM 2094 C CD1 . LEU C 1 64  ? 32.853  30.532 115.360 1.00 26.78 ? 340 LEU B CD1 1 
ATOM 2095 C CD2 . LEU C 1 64  ? 33.679  32.653 114.294 1.00 24.74 ? 340 LEU B CD2 1 
ATOM 2096 N N   . ARG C 1 65  ? 36.017  28.224 115.372 1.00 26.45 ? 341 ARG B N   1 
ATOM 2097 C CA  . ARG C 1 65  ? 35.925  27.294 116.491 1.00 21.35 ? 341 ARG B CA  1 
ATOM 2098 C C   . ARG C 1 65  ? 37.076  27.458 117.465 1.00 22.36 ? 341 ARG B C   1 
ATOM 2099 O O   . ARG C 1 65  ? 36.928  27.268 118.674 1.00 23.70 ? 341 ARG B O   1 
ATOM 2100 C CB  . ARG C 1 65  ? 35.923  25.876 115.958 1.00 20.23 ? 341 ARG B CB  1 
ATOM 2101 C CG  . ARG C 1 65  ? 35.511  24.817 116.949 1.00 19.74 ? 341 ARG B CG  1 
ATOM 2102 C CD  . ARG C 1 65  ? 35.602  23.489 116.248 1.00 23.34 ? 341 ARG B CD  1 
ATOM 2103 N NE  . ARG C 1 65  ? 35.058  22.387 117.015 1.00 22.55 ? 341 ARG B NE  1 
ATOM 2104 C CZ  . ARG C 1 65  ? 35.080  21.142 116.578 1.00 26.44 ? 341 ARG B CZ  1 
ATOM 2105 N NH1 . ARG C 1 65  ? 35.623  20.887 115.400 1.00 24.15 ? 341 ARG B NH1 1 
ATOM 2106 N NH2 . ARG C 1 65  ? 34.555  20.164 117.298 1.00 24.76 ? 341 ARG B NH2 1 
ATOM 2107 N N   . PHE C 1 66  ? 38.234  27.796 116.923 1.00 20.03 ? 342 PHE B N   1 
ATOM 2108 C CA  . PHE C 1 66  ? 39.406  27.983 117.748 1.00 19.25 ? 342 PHE B CA  1 
ATOM 2109 C C   . PHE C 1 66  ? 39.099  28.987 118.832 1.00 21.66 ? 342 PHE B C   1 
ATOM 2110 O O   . PHE C 1 66  ? 38.990  28.639 120.004 1.00 21.49 ? 342 PHE B O   1 
ATOM 2111 C CB  . PHE C 1 66  ? 40.568  28.483 116.898 1.00 19.82 ? 342 PHE B CB  1 
ATOM 2112 C CG  . PHE C 1 66  ? 41.680  27.485 116.749 1.00 17.05 ? 342 PHE B CG  1 
ATOM 2113 C CD1 . PHE C 1 66  ? 42.042  27.011 115.493 1.00 16.85 ? 342 PHE B CD1 1 
ATOM 2114 C CD2 . PHE C 1 66  ? 42.383  27.038 117.861 1.00 12.40 ? 342 PHE B CD2 1 
ATOM 2115 C CE1 . PHE C 1 66  ? 43.089  26.112 115.348 1.00 14.63 ? 342 PHE B CE1 1 
ATOM 2116 C CE2 . PHE C 1 66  ? 43.425  26.143 117.722 1.00 12.40 ? 342 PHE B CE2 1 
ATOM 2117 C CZ  . PHE C 1 66  ? 43.777  25.682 116.460 1.00 14.41 ? 342 PHE B CZ  1 
ATOM 2118 N N   . GLN C 1 67  ? 38.948  30.235 118.406 1.00 22.77 ? 343 GLN B N   1 
ATOM 2119 C CA  . GLN C 1 67  ? 38.661  31.360 119.285 1.00 23.99 ? 343 GLN B CA  1 
ATOM 2120 C C   . GLN C 1 67  ? 37.605  31.041 120.336 1.00 24.17 ? 343 GLN B C   1 
ATOM 2121 O O   . GLN C 1 67  ? 37.632  31.594 121.431 1.00 23.13 ? 343 GLN B O   1 
ATOM 2122 C CB  . GLN C 1 67  ? 38.240  32.559 118.428 1.00 31.13 ? 343 GLN B CB  1 
ATOM 2123 C CG  . GLN C 1 67  ? 38.002  33.861 119.181 1.00 42.15 ? 343 GLN B CG  1 
ATOM 2124 C CD  . GLN C 1 67  ? 38.195  35.089 118.294 1.00 47.85 ? 343 GLN B CD  1 
ATOM 2125 O OE1 . GLN C 1 67  ? 37.814  35.094 117.119 1.00 52.24 ? 343 GLN B OE1 1 
ATOM 2126 N NE2 . GLN C 1 67  ? 38.778  36.140 118.860 1.00 49.70 ? 343 GLN B NE2 1 
ATOM 2127 N N   . VAL C 1 68  ? 36.681  30.146 120.001 1.00 25.33 ? 344 VAL B N   1 
ATOM 2128 C CA  . VAL C 1 68  ? 35.631  29.752 120.938 1.00 23.14 ? 344 VAL B CA  1 
ATOM 2129 C C   . VAL C 1 68  ? 36.258  28.868 122.003 1.00 27.38 ? 344 VAL B C   1 
ATOM 2130 O O   . VAL C 1 68  ? 35.858  28.897 123.173 1.00 29.95 ? 344 VAL B O   1 
ATOM 2131 C CB  . VAL C 1 68  ? 34.507  28.953 120.248 1.00 22.36 ? 344 VAL B CB  1 
ATOM 2132 C CG1 . VAL C 1 68  ? 33.390  28.657 121.253 1.00 21.20 ? 344 VAL B CG1 1 
ATOM 2133 C CG2 . VAL C 1 68  ? 33.973  29.729 119.056 1.00 16.64 ? 344 VAL B CG2 1 
ATOM 2134 N N   . LEU C 1 69  ? 37.235  28.072 121.574 1.00 29.27 ? 345 LEU B N   1 
ATOM 2135 C CA  . LEU C 1 69  ? 37.962  27.182 122.463 1.00 28.00 ? 345 LEU B CA  1 
ATOM 2136 C C   . LEU C 1 69  ? 39.050  28.007 123.144 1.00 28.61 ? 345 LEU B C   1 
ATOM 2137 O O   . LEU C 1 69  ? 39.505  27.685 124.243 1.00 29.15 ? 345 LEU B O   1 
ATOM 2138 C CB  . LEU C 1 69  ? 38.569  26.031 121.661 1.00 30.22 ? 345 LEU B CB  1 
ATOM 2139 C CG  . LEU C 1 69  ? 39.429  25.016 122.416 1.00 30.59 ? 345 LEU B CG  1 
ATOM 2140 C CD1 . LEU C 1 69  ? 38.781  24.641 123.734 1.00 30.93 ? 345 LEU B CD1 1 
ATOM 2141 C CD2 . LEU C 1 69  ? 39.626  23.796 121.541 1.00 31.13 ? 345 LEU B CD2 1 
ATOM 2142 N N   . GLU C 1 70  ? 39.449  29.083 122.474 1.00 27.45 ? 346 GLU B N   1 
ATOM 2143 C CA  . GLU C 1 70  ? 40.457  29.998 122.996 1.00 26.48 ? 346 GLU B CA  1 
ATOM 2144 C C   . GLU C 1 70  ? 39.790  30.907 124.034 1.00 27.38 ? 346 GLU B C   1 
ATOM 2145 O O   . GLU C 1 70  ? 40.461  31.668 124.748 1.00 30.21 ? 346 GLU B O   1 
ATOM 2146 C CB  . GLU C 1 70  ? 41.031  30.886 121.872 1.00 25.71 ? 346 GLU B CB  1 
ATOM 2147 C CG  . GLU C 1 70  ? 41.750  30.173 120.709 1.00 29.82 ? 346 GLU B CG  1 
ATOM 2148 C CD  . GLU C 1 70  ? 42.659  31.121 119.912 1.00 35.45 ? 346 GLU B CD  1 
ATOM 2149 O OE1 . GLU C 1 70  ? 42.234  32.259 119.618 1.00 33.56 ? 346 GLU B OE1 1 
ATOM 2150 O OE2 . GLU C 1 70  ? 43.799  30.727 119.581 1.00 41.07 ? 346 GLU B OE2 1 
ATOM 2151 N N   . THR C 1 71  ? 38.463  30.819 124.100 1.00 28.19 ? 347 THR B N   1 
ATOM 2152 C CA  . THR C 1 71  ? 37.653  31.635 125.003 1.00 24.67 ? 347 THR B CA  1 
ATOM 2153 C C   . THR C 1 71  ? 36.913  30.857 126.091 1.00 24.28 ? 347 THR B C   1 
ATOM 2154 O O   . THR C 1 71  ? 36.460  31.444 127.077 1.00 26.52 ? 347 THR B O   1 
ATOM 2155 C CB  . THR C 1 71  ? 36.610  32.424 124.204 1.00 23.72 ? 347 THR B CB  1 
ATOM 2156 O OG1 . THR C 1 71  ? 35.969  31.545 123.275 1.00 24.33 ? 347 THR B OG1 1 
ATOM 2157 C CG2 . THR C 1 71  ? 37.264  33.557 123.438 1.00 25.60 ? 347 THR B CG2 1 
ATOM 2158 N N   . ALA C 1 72  ? 36.800  29.542 125.911 1.00 22.44 ? 348 ALA B N   1 
ATOM 2159 C CA  . ALA C 1 72  ? 36.091  28.676 126.851 1.00 19.02 ? 348 ALA B CA  1 
ATOM 2160 C C   . ALA C 1 72  ? 36.639  28.635 128.278 1.00 18.00 ? 348 ALA B C   1 
ATOM 2161 O O   . ALA C 1 72  ? 37.808  28.939 128.515 1.00 21.25 ? 348 ALA B O   1 
ATOM 2162 C CB  . ALA C 1 72  ? 36.028  27.276 126.291 1.00 21.16 ? 348 ALA B CB  1 
ATOM 2163 N N   . SER C 1 73  ? 35.772  28.256 129.221 1.00 17.72 ? 349 SER B N   1 
ATOM 2164 C CA  . SER C 1 73  ? 36.134  28.139 130.632 1.00 18.90 ? 349 SER B CA  1 
ATOM 2165 C C   . SER C 1 73  ? 35.418  26.960 131.275 1.00 17.94 ? 349 SER B C   1 
ATOM 2166 O O   . SER C 1 73  ? 34.298  26.620 130.892 1.00 24.92 ? 349 SER B O   1 
ATOM 2167 C CB  . SER C 1 73  ? 35.789  29.408 131.401 1.00 20.24 ? 349 SER B CB  1 
ATOM 2168 O OG  . SER C 1 73  ? 36.164  29.262 132.760 1.00 23.45 ? 349 SER B OG  1 
ATOM 2169 N N   . TYR C 1 74  ? 36.084  26.345 132.252 1.00 15.13 ? 350 TYR B N   1 
ATOM 2170 C CA  . TYR C 1 74  ? 35.563  25.179 132.964 1.00 14.28 ? 350 TYR B CA  1 
ATOM 2171 C C   . TYR C 1 74  ? 35.755  25.273 134.477 1.00 16.81 ? 350 TYR B C   1 
ATOM 2172 O O   . TYR C 1 74  ? 36.465  24.450 135.072 1.00 19.89 ? 350 TYR B O   1 
ATOM 2173 C CB  . TYR C 1 74  ? 36.249  23.888 132.502 1.00 12.40 ? 350 TYR B CB  1 
ATOM 2174 C CG  . TYR C 1 74  ? 36.527  23.782 131.028 1.00 12.40 ? 350 TYR B CG  1 
ATOM 2175 C CD1 . TYR C 1 74  ? 37.365  24.684 130.398 1.00 12.40 ? 350 TYR B CD1 1 
ATOM 2176 C CD2 . TYR C 1 74  ? 36.001  22.748 130.274 1.00 12.40 ? 350 TYR B CD2 1 
ATOM 2177 C CE1 . TYR C 1 74  ? 37.679  24.561 129.057 1.00 12.40 ? 350 TYR B CE1 1 
ATOM 2178 C CE2 . TYR C 1 74  ? 36.310  22.615 128.927 1.00 12.49 ? 350 TYR B CE2 1 
ATOM 2179 C CZ  . TYR C 1 74  ? 37.154  23.529 128.328 1.00 14.66 ? 350 TYR B CZ  1 
ATOM 2180 O OH  . TYR C 1 74  ? 37.502  23.413 127.006 1.00 22.24 ? 350 TYR B OH  1 
ATOM 2181 N N   . ASN C 1 75  ? 35.142  26.283 135.091 1.00 18.47 ? 351 ASN B N   1 
ATOM 2182 C CA  . ASN C 1 75  ? 35.197  26.451 136.544 1.00 19.67 ? 351 ASN B CA  1 
ATOM 2183 C C   . ASN C 1 75  ? 33.992  27.277 137.040 1.00 23.30 ? 351 ASN B C   1 
ATOM 2184 O O   . ASN C 1 75  ? 33.946  27.722 138.189 1.00 26.76 ? 351 ASN B O   1 
ATOM 2185 C CB  . ASN C 1 75  ? 36.562  27.047 137.005 1.00 21.28 ? 351 ASN B CB  1 
ATOM 2186 C CG  . ASN C 1 75  ? 36.695  28.553 136.764 1.00 24.20 ? 351 ASN B CG  1 
ATOM 2187 O OD1 . ASN C 1 75  ? 36.733  29.342 137.715 1.00 31.08 ? 351 ASN B OD1 1 
ATOM 2188 N ND2 . ASN C 1 75  ? 36.785  28.952 135.496 1.00 25.97 ? 351 ASN B ND2 1 
ATOM 2189 N N   . GLY C 1 76  ? 33.003  27.447 136.163 1.00 23.28 ? 352 GLY B N   1 
ATOM 2190 C CA  . GLY C 1 76  ? 31.809  28.182 136.527 1.00 25.27 ? 352 GLY B CA  1 
ATOM 2191 C C   . GLY C 1 76  ? 31.817  29.646 136.150 1.00 26.31 ? 352 GLY B C   1 
ATOM 2192 O O   . GLY C 1 76  ? 30.784  30.302 136.204 1.00 27.16 ? 352 GLY B O   1 
ATOM 2193 N N   . VAL C 1 77  ? 32.971  30.168 135.764 1.00 26.54 ? 353 VAL B N   1 
ATOM 2194 C CA  . VAL C 1 77  ? 33.061  31.570 135.392 1.00 21.64 ? 353 VAL B CA  1 
ATOM 2195 C C   . VAL C 1 77  ? 33.050  31.787 133.876 1.00 24.28 ? 353 VAL B C   1 
ATOM 2196 O O   . VAL C 1 77  ? 33.581  30.983 133.110 1.00 27.15 ? 353 VAL B O   1 
ATOM 2197 C CB  . VAL C 1 77  ? 34.322  32.209 136.009 1.00 22.35 ? 353 VAL B CB  1 
ATOM 2198 C CG1 . VAL C 1 77  ? 34.452  33.651 135.571 1.00 21.34 ? 353 VAL B CG1 1 
ATOM 2199 C CG2 . VAL C 1 77  ? 34.247  32.131 137.522 1.00 21.32 ? 353 VAL B CG2 1 
ATOM 2200 N N   . LEU C 1 78  ? 32.430  32.887 133.459 1.00 25.57 ? 354 LEU B N   1 
ATOM 2201 C CA  . LEU C 1 78  ? 32.306  33.244 132.048 1.00 24.63 ? 354 LEU B CA  1 
ATOM 2202 C C   . LEU C 1 78  ? 32.430  34.745 131.857 1.00 25.98 ? 354 LEU B C   1 
ATOM 2203 O O   . LEU C 1 78  ? 31.618  35.501 132.380 1.00 28.10 ? 354 LEU B O   1 
ATOM 2204 C CB  . LEU C 1 78  ? 30.943  32.773 131.507 1.00 25.98 ? 354 LEU B CB  1 
ATOM 2205 C CG  . LEU C 1 78  ? 30.216  33.323 130.261 1.00 27.51 ? 354 LEU B CG  1 
ATOM 2206 C CD1 . LEU C 1 78  ? 29.591  34.663 130.567 1.00 33.16 ? 354 LEU B CD1 1 
ATOM 2207 C CD2 . LEU C 1 78  ? 31.158  33.420 129.089 1.00 27.23 ? 354 LEU B CD2 1 
ATOM 2208 N N   . ILE C 1 79  ? 33.454  35.181 131.133 1.00 26.44 ? 355 ILE B N   1 
ATOM 2209 C CA  . ILE C 1 79  ? 33.608  36.604 130.863 1.00 25.17 ? 355 ILE B CA  1 
ATOM 2210 C C   . ILE C 1 79  ? 33.183  36.797 129.409 1.00 24.43 ? 355 ILE B C   1 
ATOM 2211 O O   . ILE C 1 79  ? 33.586  36.021 128.526 1.00 25.84 ? 355 ILE B O   1 
ATOM 2212 C CB  . ILE C 1 79  ? 35.076  37.110 131.067 1.00 26.52 ? 355 ILE B CB  1 
ATOM 2213 C CG1 . ILE C 1 79  ? 35.459  37.064 132.554 1.00 25.74 ? 355 ILE B CG1 1 
ATOM 2214 C CG2 . ILE C 1 79  ? 35.230  38.534 130.540 1.00 25.89 ? 355 ILE B CG2 1 
ATOM 2215 C CD1 . ILE C 1 79  ? 34.631  37.936 133.465 1.00 21.87 ? 355 ILE B CD1 1 
ATOM 2216 N N   . TRP C 1 80  ? 32.338  37.809 129.183 1.00 22.67 ? 356 TRP B N   1 
ATOM 2217 C CA  . TRP C 1 80  ? 31.833  38.136 127.847 1.00 19.59 ? 356 TRP B CA  1 
ATOM 2218 C C   . TRP C 1 80  ? 32.349  39.509 127.395 1.00 22.12 ? 356 TRP B C   1 
ATOM 2219 O O   . TRP C 1 80  ? 32.020  40.545 127.980 1.00 23.73 ? 356 TRP B O   1 
ATOM 2220 C CB  . TRP C 1 80  ? 30.297  38.126 127.827 1.00 16.42 ? 356 TRP B CB  1 
ATOM 2221 C CG  . TRP C 1 80  ? 29.688  38.022 126.430 1.00 15.24 ? 356 TRP B CG  1 
ATOM 2222 C CD1 . TRP C 1 80  ? 30.358  37.957 125.228 1.00 14.68 ? 356 TRP B CD1 1 
ATOM 2223 C CD2 . TRP C 1 80  ? 28.285  37.969 126.104 1.00 14.40 ? 356 TRP B CD2 1 
ATOM 2224 N NE1 . TRP C 1 80  ? 29.458  37.870 124.184 1.00 21.20 ? 356 TRP B NE1 1 
ATOM 2225 C CE2 . TRP C 1 80  ? 28.184  37.874 124.692 1.00 15.95 ? 356 TRP B CE2 1 
ATOM 2226 C CE3 . TRP C 1 80  ? 27.102  37.991 126.871 1.00 12.40 ? 356 TRP B CE3 1 
ATOM 2227 C CZ2 . TRP C 1 80  ? 26.948  37.802 124.035 1.00 18.22 ? 356 TRP B CZ2 1 
ATOM 2228 C CZ3 . TRP C 1 80  ? 25.875  37.917 126.215 1.00 13.25 ? 356 TRP B CZ3 1 
ATOM 2229 C CH2 . TRP C 1 80  ? 25.809  37.825 124.813 1.00 18.51 ? 356 TRP B CH2 1 
ATOM 2230 N N   . LYS C 1 81  ? 33.173  39.490 126.349 1.00 22.08 ? 357 LYS B N   1 
ATOM 2231 C CA  . LYS C 1 81  ? 33.759  40.694 125.778 1.00 21.21 ? 357 LYS B CA  1 
ATOM 2232 C C   . LYS C 1 81  ? 33.030  40.995 124.480 1.00 24.75 ? 357 LYS B C   1 
ATOM 2233 O O   . LYS C 1 81  ? 33.301  40.375 123.444 1.00 27.49 ? 357 LYS B O   1 
ATOM 2234 C CB  . LYS C 1 81  ? 35.236  40.460 125.487 1.00 21.93 ? 357 LYS B CB  1 
ATOM 2235 C CG  . LYS C 1 81  ? 35.960  41.668 124.937 1.00 21.38 ? 357 LYS B CG  1 
ATOM 2236 C CD  . LYS C 1 81  ? 36.866  41.275 123.783 1.00 22.37 ? 357 LYS B CD  1 
ATOM 2237 C CE  . LYS C 1 81  ? 37.901  42.342 123.518 1.00 24.12 ? 357 LYS B CE  1 
ATOM 2238 N NZ  . LYS C 1 81  ? 38.733  42.574 124.731 1.00 22.15 ? 357 LYS B NZ  1 
ATOM 2239 N N   . ILE C 1 82  ? 32.102  41.944 124.550 1.00 27.36 ? 358 ILE B N   1 
ATOM 2240 C CA  . ILE C 1 82  ? 31.312  42.341 123.395 1.00 27.46 ? 358 ILE B CA  1 
ATOM 2241 C C   . ILE C 1 82  ? 31.923  43.622 122.854 1.00 29.69 ? 358 ILE B C   1 
ATOM 2242 O O   . ILE C 1 82  ? 32.036  44.608 123.577 1.00 30.78 ? 358 ILE B O   1 
ATOM 2243 C CB  . ILE C 1 82  ? 29.855  42.594 123.804 1.00 26.44 ? 358 ILE B CB  1 
ATOM 2244 C CG1 . ILE C 1 82  ? 29.325  41.411 124.624 1.00 20.84 ? 358 ILE B CG1 1 
ATOM 2245 C CG2 . ILE C 1 82  ? 29.005  42.789 122.572 1.00 26.79 ? 358 ILE B CG2 1 
ATOM 2246 C CD1 . ILE C 1 82  ? 27.968  41.646 125.239 1.00 19.23 ? 358 ILE B CD1 1 
ATOM 2247 N N   . ARG C 1 83  ? 32.316  43.605 121.582 1.00 28.94 ? 359 ARG B N   1 
ATOM 2248 C CA  . ARG C 1 83  ? 32.962  44.768 120.974 1.00 32.48 ? 359 ARG B CA  1 
ATOM 2249 C C   . ARG C 1 83  ? 32.200  45.432 119.834 1.00 35.06 ? 359 ARG B C   1 
ATOM 2250 O O   . ARG C 1 83  ? 31.600  44.770 118.990 1.00 36.65 ? 359 ARG B O   1 
ATOM 2251 C CB  . ARG C 1 83  ? 34.364  44.396 120.469 1.00 35.41 ? 359 ARG B CB  1 
ATOM 2252 C CG  . ARG C 1 83  ? 35.274  45.598 120.213 1.00 38.48 ? 359 ARG B CG  1 
ATOM 2253 C CD  . ARG C 1 83  ? 36.270  45.322 119.100 1.00 46.68 ? 359 ARG B CD  1 
ATOM 2254 N NE  . ARG C 1 83  ? 36.740  43.941 119.125 1.00 53.83 ? 359 ARG B NE  1 
ATOM 2255 C CZ  . ARG C 1 83  ? 37.722  43.471 118.364 1.00 57.83 ? 359 ARG B CZ  1 
ATOM 2256 N NH1 . ARG C 1 83  ? 38.350  44.272 117.512 1.00 58.35 ? 359 ARG B NH1 1 
ATOM 2257 N NH2 . ARG C 1 83  ? 38.077  42.198 118.460 1.00 57.49 ? 359 ARG B NH2 1 
ATOM 2258 N N   . ASP C 1 84  ? 32.278  46.758 119.819 1.00 38.59 ? 360 ASP B N   1 
ATOM 2259 C CA  . ASP C 1 84  ? 31.624  47.610 118.838 1.00 39.26 ? 360 ASP B CA  1 
ATOM 2260 C C   . ASP C 1 84  ? 30.162  47.831 119.233 1.00 38.13 ? 360 ASP B C   1 
ATOM 2261 O O   . ASP C 1 84  ? 29.240  47.659 118.429 1.00 37.39 ? 360 ASP B O   1 
ATOM 2262 C CB  . ASP C 1 84  ? 31.723  47.014 117.431 1.00 42.30 ? 360 ASP B CB  1 
ATOM 2263 C CG  . ASP C 1 84  ? 31.494  48.051 116.350 1.00 47.63 ? 360 ASP B CG  1 
ATOM 2264 O OD1 . ASP C 1 84  ? 30.400  48.655 116.317 1.00 51.34 ? 360 ASP B OD1 1 
ATOM 2265 O OD2 . ASP C 1 84  ? 32.411  48.269 115.535 1.00 49.88 ? 360 ASP B OD2 1 
ATOM 2266 N N   . TYR C 1 85  ? 29.973  48.215 120.494 1.00 37.28 ? 361 TYR B N   1 
ATOM 2267 C CA  . TYR C 1 85  ? 28.658  48.492 121.044 1.00 37.51 ? 361 TYR B CA  1 
ATOM 2268 C C   . TYR C 1 85  ? 27.925  49.358 120.040 1.00 39.86 ? 361 TYR B C   1 
ATOM 2269 O O   . TYR C 1 85  ? 26.702  49.399 120.022 1.00 42.69 ? 361 TYR B O   1 
ATOM 2270 C CB  . TYR C 1 85  ? 28.801  49.241 122.361 1.00 35.41 ? 361 TYR B CB  1 
ATOM 2271 C CG  . TYR C 1 85  ? 27.548  49.309 123.193 1.00 33.97 ? 361 TYR B CG  1 
ATOM 2272 C CD1 . TYR C 1 85  ? 26.369  49.842 122.681 1.00 34.38 ? 361 TYR B CD1 1 
ATOM 2273 C CD2 . TYR C 1 85  ? 27.555  48.877 124.516 1.00 35.08 ? 361 TYR B CD2 1 
ATOM 2274 C CE1 . TYR C 1 85  ? 25.227  49.949 123.468 1.00 37.07 ? 361 TYR B CE1 1 
ATOM 2275 C CE2 . TYR C 1 85  ? 26.423  48.977 125.312 1.00 36.79 ? 361 TYR B CE2 1 
ATOM 2276 C CZ  . TYR C 1 85  ? 25.264  49.517 124.787 1.00 37.88 ? 361 TYR B CZ  1 
ATOM 2277 O OH  . TYR C 1 85  ? 24.158  49.654 125.593 1.00 35.04 ? 361 TYR B OH  1 
ATOM 2278 N N   . LYS C 1 86  ? 28.688  50.060 119.210 1.00 41.53 ? 362 LYS B N   1 
ATOM 2279 C CA  . LYS C 1 86  ? 28.101  50.905 118.190 1.00 42.30 ? 362 LYS B CA  1 
ATOM 2280 C C   . LYS C 1 86  ? 27.098  50.083 117.392 1.00 41.67 ? 362 LYS B C   1 
ATOM 2281 O O   . LYS C 1 86  ? 25.943  49.974 117.789 1.00 42.21 ? 362 LYS B O   1 
ATOM 2282 C CB  . LYS C 1 86  ? 29.187  51.468 117.273 1.00 46.64 ? 362 LYS B CB  1 
ATOM 2283 C CG  . LYS C 1 86  ? 29.905  52.701 117.834 1.00 50.57 ? 362 LYS B CG  1 
ATOM 2284 C CD  . LYS C 1 86  ? 28.983  53.940 117.903 1.00 54.78 ? 362 LYS B CD  1 
ATOM 2285 C CE  . LYS C 1 86  ? 29.745  55.201 118.342 1.00 59.69 ? 362 LYS B CE  1 
ATOM 2286 N NZ  . LYS C 1 86  ? 28.887  56.424 118.432 1.00 58.64 ? 362 LYS B NZ  1 
ATOM 2287 N N   . ARG C 1 87  ? 27.528  49.496 116.278 1.00 41.74 ? 363 ARG B N   1 
ATOM 2288 C CA  . ARG C 1 87  ? 26.613  48.689 115.469 1.00 43.50 ? 363 ARG B CA  1 
ATOM 2289 C C   . ARG C 1 87  ? 25.940  47.643 116.344 1.00 44.51 ? 363 ARG B C   1 
ATOM 2290 O O   . ARG C 1 87  ? 24.726  47.440 116.263 1.00 47.58 ? 363 ARG B O   1 
ATOM 2291 C CB  . ARG C 1 87  ? 27.353  47.976 114.329 1.00 43.89 ? 363 ARG B CB  1 
ATOM 2292 C CG  . ARG C 1 87  ? 27.879  48.888 113.234 1.00 48.43 ? 363 ARG B CG  1 
ATOM 2293 C CD  . ARG C 1 87  ? 28.441  48.073 112.072 1.00 51.28 ? 363 ARG B CD  1 
ATOM 2294 N NE  . ARG C 1 87  ? 29.517  47.164 112.475 1.00 53.50 ? 363 ARG B NE  1 
ATOM 2295 C CZ  . ARG C 1 87  ? 30.729  47.550 112.868 1.00 53.00 ? 363 ARG B CZ  1 
ATOM 2296 N NH1 . ARG C 1 87  ? 31.041  48.839 112.916 1.00 52.97 ? 363 ARG B NH1 1 
ATOM 2297 N NH2 . ARG C 1 87  ? 31.634  46.644 113.211 1.00 51.02 ? 363 ARG B NH2 1 
ATOM 2298 N N   . ARG C 1 88  ? 26.747  46.996 117.187 1.00 45.34 ? 364 ARG B N   1 
ATOM 2299 C CA  . ARG C 1 88  ? 26.286  45.948 118.095 1.00 45.79 ? 364 ARG B CA  1 
ATOM 2300 C C   . ARG C 1 88  ? 24.995  46.340 118.808 1.00 44.87 ? 364 ARG B C   1 
ATOM 2301 O O   . ARG C 1 88  ? 24.255  45.482 119.291 1.00 45.26 ? 364 ARG B O   1 
ATOM 2302 C CB  . ARG C 1 88  ? 27.378  45.642 119.124 1.00 46.25 ? 364 ARG B CB  1 
ATOM 2303 C CG  . ARG C 1 88  ? 27.261  44.274 119.767 1.00 50.31 ? 364 ARG B CG  1 
ATOM 2304 C CD  . ARG C 1 88  ? 27.316  43.164 118.722 1.00 52.49 ? 364 ARG B CD  1 
ATOM 2305 N NE  . ARG C 1 88  ? 28.632  43.047 118.104 1.00 54.35 ? 364 ARG B NE  1 
ATOM 2306 C CZ  . ARG C 1 88  ? 29.718  42.581 118.720 1.00 54.97 ? 364 ARG B CZ  1 
ATOM 2307 N NH1 . ARG C 1 88  ? 29.654  42.178 119.981 1.00 55.09 ? 364 ARG B NH1 1 
ATOM 2308 N NH2 . ARG C 1 88  ? 30.877  42.515 118.074 1.00 54.90 ? 364 ARG B NH2 1 
ATOM 2309 N N   . LYS C 1 89  ? 24.739  47.645 118.856 1.00 44.38 ? 365 LYS B N   1 
ATOM 2310 C CA  . LYS C 1 89  ? 23.545  48.208 119.491 1.00 40.35 ? 365 LYS B CA  1 
ATOM 2311 C C   . LYS C 1 89  ? 22.506  48.651 118.449 1.00 39.19 ? 365 LYS B C   1 
ATOM 2312 O O   . LYS C 1 89  ? 21.362  48.195 118.466 1.00 38.94 ? 365 LYS B O   1 
ATOM 2313 C CB  . LYS C 1 89  ? 23.942  49.404 120.372 1.00 39.10 ? 365 LYS B CB  1 
ATOM 2314 C CG  . LYS C 1 89  ? 22.788  50.219 120.938 1.00 35.73 ? 365 LYS B CG  1 
ATOM 2315 C CD  . LYS C 1 89  ? 21.977  49.435 121.947 1.00 33.27 ? 365 LYS B CD  1 
ATOM 2316 C CE  . LYS C 1 89  ? 21.031  50.358 122.701 1.00 35.15 ? 365 LYS B CE  1 
ATOM 2317 N NZ  . LYS C 1 89  ? 20.159  51.182 121.805 1.00 39.39 ? 365 LYS B NZ  1 
ATOM 2318 N N   . GLN C 1 90  ? 22.908  49.541 117.545 1.00 37.70 ? 366 GLN B N   1 
ATOM 2319 C CA  . GLN C 1 90  ? 22.005  50.028 116.515 1.00 40.43 ? 366 GLN B CA  1 
ATOM 2320 C C   . GLN C 1 90  ? 21.413  48.880 115.713 1.00 42.40 ? 366 GLN B C   1 
ATOM 2321 O O   . GLN C 1 90  ? 20.299  48.990 115.206 1.00 45.43 ? 366 GLN B O   1 
ATOM 2322 C CB  . GLN C 1 90  ? 22.726  50.997 115.571 1.00 43.90 ? 366 GLN B CB  1 
ATOM 2323 C CG  . GLN C 1 90  ? 22.531  52.482 115.897 1.00 49.71 ? 366 GLN B CG  1 
ATOM 2324 C CD  . GLN C 1 90  ? 21.066  52.928 115.839 1.00 52.65 ? 366 GLN B CD  1 
ATOM 2325 O OE1 . GLN C 1 90  ? 20.334  52.598 114.896 1.00 54.62 ? 366 GLN B OE1 1 
ATOM 2326 N NE2 . GLN C 1 90  ? 20.642  53.696 116.843 1.00 52.49 ? 366 GLN B NE2 1 
ATOM 2327 N N   . GLU C 1 91  ? 22.147  47.780 115.591 1.00 40.67 ? 367 GLU B N   1 
ATOM 2328 C CA  . GLU C 1 91  ? 21.634  46.640 114.839 1.00 37.68 ? 367 GLU B CA  1 
ATOM 2329 C C   . GLU C 1 91  ? 20.490  45.986 115.600 1.00 36.60 ? 367 GLU B C   1 
ATOM 2330 O O   . GLU C 1 91  ? 19.604  45.380 115.004 1.00 38.29 ? 367 GLU B O   1 
ATOM 2331 C CB  . GLU C 1 91  ? 22.752  45.635 114.567 1.00 39.09 ? 367 GLU B CB  1 
ATOM 2332 C CG  . GLU C 1 91  ? 23.856  46.199 113.685 1.00 40.55 ? 367 GLU B CG  1 
ATOM 2333 C CD  . GLU C 1 91  ? 24.795  45.132 113.179 1.00 41.98 ? 367 GLU B CD  1 
ATOM 2334 O OE1 . GLU C 1 91  ? 25.337  44.383 114.018 1.00 43.80 ? 367 GLU B OE1 1 
ATOM 2335 O OE2 . GLU C 1 91  ? 24.989  45.043 111.946 1.00 45.85 ? 367 GLU B OE2 1 
ATOM 2336 N N   . ALA C 1 92  ? 20.520  46.104 116.922 1.00 34.02 ? 368 ALA B N   1 
ATOM 2337 C CA  . ALA C 1 92  ? 19.449  45.567 117.738 1.00 34.11 ? 368 ALA B CA  1 
ATOM 2338 C C   . ALA C 1 92  ? 18.292  46.458 117.327 1.00 36.34 ? 368 ALA B C   1 
ATOM 2339 O O   . ALA C 1 92  ? 17.287  45.994 116.785 1.00 36.61 ? 368 ALA B O   1 
ATOM 2340 C CB  . ALA C 1 92  ? 19.759  45.751 119.212 1.00 31.79 ? 368 ALA B CB  1 
ATOM 2341 N N   . VAL C 1 93  ? 18.474  47.752 117.575 1.00 35.95 ? 369 VAL B N   1 
ATOM 2342 C CA  . VAL C 1 93  ? 17.509  48.793 117.233 1.00 32.87 ? 369 VAL B CA  1 
ATOM 2343 C C   . VAL C 1 93  ? 16.902  48.551 115.846 1.00 35.40 ? 369 VAL B C   1 
ATOM 2344 O O   . VAL C 1 93  ? 15.740  48.148 115.735 1.00 39.02 ? 369 VAL B O   1 
ATOM 2345 C CB  . VAL C 1 93  ? 18.206  50.178 117.278 1.00 32.78 ? 369 VAL B CB  1 
ATOM 2346 C CG1 . VAL C 1 93  ? 17.491  51.176 116.399 1.00 33.18 ? 369 VAL B CG1 1 
ATOM 2347 C CG2 . VAL C 1 93  ? 18.254  50.671 118.708 1.00 29.28 ? 369 VAL B CG2 1 
ATOM 2348 N N   . MET C 1 94  ? 17.699  48.780 114.802 1.00 34.37 ? 370 MET B N   1 
ATOM 2349 C CA  . MET C 1 94  ? 17.267  48.606 113.410 1.00 35.07 ? 370 MET B CA  1 
ATOM 2350 C C   . MET C 1 94  ? 16.523  47.293 113.124 1.00 33.77 ? 370 MET B C   1 
ATOM 2351 O O   . MET C 1 94  ? 15.836  47.171 112.108 1.00 33.77 ? 370 MET B O   1 
ATOM 2352 C CB  . MET C 1 94  ? 18.480  48.743 112.454 1.00 38.41 ? 370 MET B CB  1 
ATOM 2353 C CG  . MET C 1 94  ? 18.937  50.211 112.172 1.00 44.44 ? 370 MET B CG  1 
ATOM 2354 S SD  . MET C 1 94  ? 20.354  50.486 111.013 1.00 56.66 ? 370 MET B SD  1 
ATOM 2355 C CE  . MET C 1 94  ? 19.531  50.695 109.398 1.00 55.38 ? 370 MET B CE  1 
ATOM 2356 N N   . GLY C 1 95  ? 16.650  46.323 114.026 1.00 33.82 ? 371 GLY B N   1 
ATOM 2357 C CA  . GLY C 1 95  ? 15.992  45.042 113.830 1.00 33.89 ? 371 GLY B CA  1 
ATOM 2358 C C   . GLY C 1 95  ? 16.701  44.242 112.753 1.00 33.65 ? 371 GLY B C   1 
ATOM 2359 O O   . GLY C 1 95  ? 16.138  43.949 111.694 1.00 35.61 ? 371 GLY B O   1 
ATOM 2360 N N   . LYS C 1 96  ? 17.954  43.898 113.024 1.00 35.08 ? 372 LYS B N   1 
ATOM 2361 C CA  . LYS C 1 96  ? 18.765  43.145 112.080 1.00 35.78 ? 372 LYS B CA  1 
ATOM 2362 C C   . LYS C 1 96  ? 19.753  42.258 112.840 1.00 34.47 ? 372 LYS B C   1 
ATOM 2363 O O   . LYS C 1 96  ? 20.434  41.416 112.254 1.00 34.56 ? 372 LYS B O   1 
ATOM 2364 C CB  . LYS C 1 96  ? 19.494  44.115 111.144 1.00 37.35 ? 372 LYS B CB  1 
ATOM 2365 C CG  . LYS C 1 96  ? 20.590  44.953 111.798 1.00 36.60 ? 372 LYS B CG  1 
ATOM 2366 C CD  . LYS C 1 96  ? 21.965  44.316 111.588 1.00 37.69 ? 372 LYS B CD  1 
ATOM 2367 C CE  . LYS C 1 96  ? 22.345  44.236 110.101 1.00 38.08 ? 372 LYS B CE  1 
ATOM 2368 N NZ  . LYS C 1 96  ? 23.629  43.509 109.867 1.00 39.53 ? 372 LYS B NZ  1 
ATOM 2369 N N   . THR C 1 97  ? 19.818  42.466 114.152 1.00 34.44 ? 373 THR B N   1 
ATOM 2370 C CA  . THR C 1 97  ? 20.670  41.687 115.056 1.00 34.28 ? 373 THR B CA  1 
ATOM 2371 C C   . THR C 1 97  ? 20.141  42.008 116.463 1.00 34.71 ? 373 THR B C   1 
ATOM 2372 O O   . THR C 1 97  ? 20.584  42.961 117.109 1.00 35.70 ? 373 THR B O   1 
ATOM 2373 C CB  . THR C 1 97  ? 22.166  42.082 114.912 1.00 33.71 ? 373 THR B CB  1 
ATOM 2374 O OG1 . THR C 1 97  ? 22.504  42.165 113.521 1.00 38.14 ? 373 THR B OG1 1 
ATOM 2375 C CG2 . THR C 1 97  ? 23.070  41.019 115.554 1.00 32.03 ? 373 THR B CG2 1 
ATOM 2376 N N   . LEU C 1 98  ? 19.189  41.193 116.925 1.00 35.05 ? 374 LEU B N   1 
ATOM 2377 C CA  . LEU C 1 98  ? 18.521  41.414 118.207 1.00 36.35 ? 374 LEU B CA  1 
ATOM 2378 C C   . LEU C 1 98  ? 19.121  40.796 119.471 1.00 38.13 ? 374 LEU B C   1 
ATOM 2379 O O   . LEU C 1 98  ? 19.224  41.470 120.500 1.00 38.24 ? 374 LEU B O   1 
ATOM 2380 C CB  . LEU C 1 98  ? 17.051  40.977 118.096 1.00 37.28 ? 374 LEU B CB  1 
ATOM 2381 C CG  . LEU C 1 98  ? 16.279  41.220 116.783 1.00 37.27 ? 374 LEU B CG  1 
ATOM 2382 C CD1 . LEU C 1 98  ? 14.823  40.799 116.984 1.00 38.29 ? 374 LEU B CD1 1 
ATOM 2383 C CD2 . LEU C 1 98  ? 16.355  42.688 116.352 1.00 37.47 ? 374 LEU B CD2 1 
ATOM 2384 N N   . SER C 1 99  ? 19.487  39.518 119.408 1.00 38.74 ? 375 SER B N   1 
ATOM 2385 C CA  . SER C 1 99  ? 20.058  38.827 120.567 1.00 37.89 ? 375 SER B CA  1 
ATOM 2386 C C   . SER C 1 99  ? 21.525  38.448 120.372 1.00 38.49 ? 375 SER B C   1 
ATOM 2387 O O   . SER C 1 99  ? 22.015  38.406 119.245 1.00 41.58 ? 375 SER B O   1 
ATOM 2388 C CB  . SER C 1 99  ? 19.221  37.577 120.897 1.00 38.33 ? 375 SER B CB  1 
ATOM 2389 O OG  . SER C 1 99  ? 18.701  36.953 119.733 1.00 42.05 ? 375 SER B OG  1 
ATOM 2390 N N   . LEU C 1 100 ? 22.234  38.185 121.465 1.00 36.37 ? 376 LEU B N   1 
ATOM 2391 C CA  . LEU C 1 100 ? 23.644  37.807 121.360 1.00 31.68 ? 376 LEU B CA  1 
ATOM 2392 C C   . LEU C 1 100 ? 24.008  36.573 122.177 1.00 29.73 ? 376 LEU B C   1 
ATOM 2393 O O   . LEU C 1 100 ? 23.565  36.406 123.314 1.00 31.12 ? 376 LEU B O   1 
ATOM 2394 C CB  . LEU C 1 100 ? 24.544  38.975 121.762 1.00 30.35 ? 376 LEU B CB  1 
ATOM 2395 C CG  . LEU C 1 100 ? 24.602  40.148 120.788 1.00 30.13 ? 376 LEU B CG  1 
ATOM 2396 C CD1 . LEU C 1 100 ? 25.674  41.090 121.265 1.00 27.74 ? 376 LEU B CD1 1 
ATOM 2397 C CD2 . LEU C 1 100 ? 24.904  39.666 119.374 1.00 30.71 ? 376 LEU B CD2 1 
ATOM 2398 N N   . TYR C 1 101 ? 24.838  35.720 121.593 1.00 30.11 ? 377 TYR B N   1 
ATOM 2399 C CA  . TYR C 1 101 ? 25.231  34.491 122.252 1.00 27.59 ? 377 TYR B CA  1 
ATOM 2400 C C   . TYR C 1 101 ? 26.720  34.455 122.609 1.00 29.60 ? 377 TYR B C   1 
ATOM 2401 O O   . TYR C 1 101 ? 27.570  34.799 121.790 1.00 33.74 ? 377 TYR B O   1 
ATOM 2402 C CB  . TYR C 1 101 ? 24.831  33.320 121.350 1.00 22.01 ? 377 TYR B CB  1 
ATOM 2403 C CG  . TYR C 1 101 ? 23.319  33.230 121.123 1.00 17.72 ? 377 TYR B CG  1 
ATOM 2404 C CD1 . TYR C 1 101 ? 22.789  32.928 119.854 1.00 14.92 ? 377 TYR B CD1 1 
ATOM 2405 C CD2 . TYR C 1 101 ? 22.412  33.426 122.185 1.00 18.93 ? 377 TYR B CD2 1 
ATOM 2406 C CE1 . TYR C 1 101 ? 21.396  32.824 119.654 1.00 15.66 ? 377 TYR B CE1 1 
ATOM 2407 C CE2 . TYR C 1 101 ? 21.021  33.320 121.991 1.00 18.17 ? 377 TYR B CE2 1 
ATOM 2408 C CZ  . TYR C 1 101 ? 20.526  33.019 120.728 1.00 17.96 ? 377 TYR B CZ  1 
ATOM 2409 O OH  . TYR C 1 101 ? 19.168  32.887 120.540 1.00 22.20 ? 377 TYR B OH  1 
ATOM 2410 N N   . SER C 1 102 ? 27.019  34.036 123.841 1.00 29.34 ? 378 SER B N   1 
ATOM 2411 C CA  . SER C 1 102 ? 28.392  33.966 124.347 1.00 29.33 ? 378 SER B CA  1 
ATOM 2412 C C   . SER C 1 102 ? 29.074  32.631 124.113 1.00 30.46 ? 378 SER B C   1 
ATOM 2413 O O   . SER C 1 102 ? 28.437  31.644 123.741 1.00 33.92 ? 378 SER B O   1 
ATOM 2414 C CB  . SER C 1 102 ? 28.430  34.238 125.853 1.00 29.52 ? 378 SER B CB  1 
ATOM 2415 O OG  . SER C 1 102 ? 28.341  33.026 126.587 1.00 25.42 ? 378 SER B OG  1 
ATOM 2416 N N   . GLN C 1 103 ? 30.383  32.625 124.363 1.00 31.11 ? 379 GLN B N   1 
ATOM 2417 C CA  . GLN C 1 103 ? 31.225  31.440 124.223 1.00 28.27 ? 379 GLN B CA  1 
ATOM 2418 C C   . GLN C 1 103 ? 30.966  30.481 125.385 1.00 28.01 ? 379 GLN B C   1 
ATOM 2419 O O   . GLN C 1 103 ? 31.600  30.576 126.436 1.00 29.05 ? 379 GLN B O   1 
ATOM 2420 C CB  . GLN C 1 103 ? 32.708  31.837 124.180 1.00 28.61 ? 379 GLN B CB  1 
ATOM 2421 C CG  . GLN C 1 103 ? 33.105  33.040 125.036 1.00 29.72 ? 379 GLN B CG  1 
ATOM 2422 C CD  . GLN C 1 103 ? 32.956  34.365 124.301 1.00 33.08 ? 379 GLN B CD  1 
ATOM 2423 O OE1 . GLN C 1 103 ? 33.189  34.445 123.091 1.00 42.20 ? 379 GLN B OE1 1 
ATOM 2424 N NE2 . GLN C 1 103 ? 32.592  35.417 125.034 1.00 31.89 ? 379 GLN B NE2 1 
ATOM 2425 N N   . PRO C 1 104 ? 30.038  29.527 125.190 1.00 24.00 ? 380 PRO B N   1 
ATOM 2426 C CA  . PRO C 1 104 ? 29.652  28.532 126.193 1.00 22.51 ? 380 PRO B CA  1 
ATOM 2427 C C   . PRO C 1 104 ? 30.665  28.265 127.289 1.00 23.21 ? 380 PRO B C   1 
ATOM 2428 O O   . PRO C 1 104 ? 31.775  27.804 127.026 1.00 26.99 ? 380 PRO B O   1 
ATOM 2429 C CB  . PRO C 1 104 ? 29.364  27.300 125.349 1.00 22.44 ? 380 PRO B CB  1 
ATOM 2430 C CG  . PRO C 1 104 ? 28.691  27.904 124.156 1.00 22.52 ? 380 PRO B CG  1 
ATOM 2431 C CD  . PRO C 1 104 ? 29.563  29.115 123.852 1.00 24.32 ? 380 PRO B CD  1 
ATOM 2432 N N   . PHE C 1 105 ? 30.280  28.576 128.520 1.00 20.89 ? 381 PHE B N   1 
ATOM 2433 C CA  . PHE C 1 105 ? 31.158  28.333 129.647 1.00 21.24 ? 381 PHE B CA  1 
ATOM 2434 C C   . PHE C 1 105 ? 30.619  27.088 130.339 1.00 23.58 ? 381 PHE B C   1 
ATOM 2435 O O   . PHE C 1 105 ? 29.424  26.794 130.245 1.00 24.56 ? 381 PHE B O   1 
ATOM 2436 C CB  . PHE C 1 105 ? 31.196  29.549 130.592 1.00 20.09 ? 381 PHE B CB  1 
ATOM 2437 C CG  . PHE C 1 105 ? 30.109  29.569 131.636 1.00 16.38 ? 381 PHE B CG  1 
ATOM 2438 C CD1 . PHE C 1 105 ? 28.768  29.612 131.272 1.00 15.95 ? 381 PHE B CD1 1 
ATOM 2439 C CD2 . PHE C 1 105 ? 30.435  29.584 132.995 1.00 15.38 ? 381 PHE B CD2 1 
ATOM 2440 C CE1 . PHE C 1 105 ? 27.767  29.674 132.247 1.00 15.44 ? 381 PHE B CE1 1 
ATOM 2441 C CE2 . PHE C 1 105 ? 29.442  29.645 133.971 1.00 12.40 ? 381 PHE B CE2 1 
ATOM 2442 C CZ  . PHE C 1 105 ? 28.112  29.691 133.596 1.00 12.40 ? 381 PHE B CZ  1 
ATOM 2443 N N   . TYR C 1 106 ? 31.500  26.350 131.012 1.00 22.29 ? 382 TYR B N   1 
ATOM 2444 C CA  . TYR C 1 106 ? 31.118  25.107 131.683 1.00 19.00 ? 382 TYR B CA  1 
ATOM 2445 C C   . TYR C 1 106 ? 31.181  25.207 133.216 1.00 23.13 ? 382 TYR B C   1 
ATOM 2446 O O   . TYR C 1 106 ? 31.748  26.159 133.760 1.00 26.01 ? 382 TYR B O   1 
ATOM 2447 C CB  . TYR C 1 106 ? 32.022  23.977 131.162 1.00 18.06 ? 382 TYR B CB  1 
ATOM 2448 C CG  . TYR C 1 106 ? 32.120  23.934 129.636 1.00 13.99 ? 382 TYR B CG  1 
ATOM 2449 C CD1 . TYR C 1 106 ? 33.178  23.296 129.004 1.00 12.40 ? 382 TYR B CD1 1 
ATOM 2450 C CD2 . TYR C 1 106 ? 31.163  24.553 128.824 1.00 19.39 ? 382 TYR B CD2 1 
ATOM 2451 C CE1 . TYR C 1 106 ? 33.290  23.279 127.602 1.00 12.40 ? 382 TYR B CE1 1 
ATOM 2452 C CE2 . TYR C 1 106 ? 31.268  24.539 127.425 1.00 20.51 ? 382 TYR B CE2 1 
ATOM 2453 C CZ  . TYR C 1 106 ? 32.334  23.903 126.825 1.00 17.13 ? 382 TYR B CZ  1 
ATOM 2454 O OH  . TYR C 1 106 ? 32.462  23.904 125.457 1.00 23.73 ? 382 TYR B OH  1 
ATOM 2455 N N   . THR C 1 107 ? 30.581  24.237 133.909 1.00 25.82 ? 383 THR B N   1 
ATOM 2456 C CA  . THR C 1 107 ? 30.580  24.228 135.377 1.00 29.03 ? 383 THR B CA  1 
ATOM 2457 C C   . THR C 1 107 ? 31.667  23.316 135.933 1.00 31.46 ? 383 THR B C   1 
ATOM 2458 O O   . THR C 1 107 ? 31.632  22.935 137.104 1.00 31.32 ? 383 THR B O   1 
ATOM 2459 C CB  . THR C 1 107 ? 29.227  23.748 135.965 1.00 27.73 ? 383 THR B CB  1 
ATOM 2460 O OG1 . THR C 1 107 ? 28.964  22.406 135.544 1.00 31.63 ? 383 THR B OG1 1 
ATOM 2461 C CG2 . THR C 1 107 ? 28.101  24.639 135.513 1.00 27.14 ? 383 THR B CG2 1 
ATOM 2462 N N   . GLY C 1 108 ? 32.628  22.968 135.086 1.00 31.52 ? 384 GLY B N   1 
ATOM 2463 C CA  . GLY C 1 108 ? 33.714  22.097 135.504 1.00 32.48 ? 384 GLY B CA  1 
ATOM 2464 C C   . GLY C 1 108 ? 34.326  21.442 134.283 1.00 33.36 ? 384 GLY B C   1 
ATOM 2465 O O   . GLY C 1 108 ? 33.934  21.772 133.157 1.00 34.27 ? 384 GLY B O   1 
ATOM 2466 N N   . TYR C 1 109 ? 35.271  20.523 134.485 1.00 34.80 ? 385 TYR B N   1 
ATOM 2467 C CA  . TYR C 1 109 ? 35.903  19.869 133.350 1.00 34.12 ? 385 TYR B CA  1 
ATOM 2468 C C   . TYR C 1 109 ? 34.940  18.978 132.596 1.00 33.61 ? 385 TYR B C   1 
ATOM 2469 O O   . TYR C 1 109 ? 34.834  19.074 131.373 1.00 37.56 ? 385 TYR B O   1 
ATOM 2470 C CB  . TYR C 1 109 ? 37.130  19.073 133.789 1.00 32.26 ? 385 TYR B CB  1 
ATOM 2471 C CG  . TYR C 1 109 ? 38.386  19.919 133.931 1.00 28.13 ? 385 TYR B CG  1 
ATOM 2472 C CD1 . TYR C 1 109 ? 38.567  20.771 135.032 1.00 28.96 ? 385 TYR B CD1 1 
ATOM 2473 C CD2 . TYR C 1 109 ? 39.386  19.886 132.952 1.00 24.76 ? 385 TYR B CD2 1 
ATOM 2474 C CE1 . TYR C 1 109 ? 39.715  21.568 135.151 1.00 30.24 ? 385 TYR B CE1 1 
ATOM 2475 C CE2 . TYR C 1 109 ? 40.533  20.681 133.061 1.00 26.96 ? 385 TYR B CE2 1 
ATOM 2476 C CZ  . TYR C 1 109 ? 40.690  21.519 134.161 1.00 28.20 ? 385 TYR B CZ  1 
ATOM 2477 O OH  . TYR C 1 109 ? 41.807  22.316 134.261 1.00 32.64 ? 385 TYR B OH  1 
ATOM 2478 N N   . PHE C 1 110 ? 34.237  18.115 133.322 1.00 28.34 ? 386 PHE B N   1 
ATOM 2479 C CA  . PHE C 1 110 ? 33.265  17.212 132.701 1.00 25.77 ? 386 PHE B CA  1 
ATOM 2480 C C   . PHE C 1 110 ? 31.869  17.433 133.303 1.00 26.63 ? 386 PHE B C   1 
ATOM 2481 O O   . PHE C 1 110 ? 31.067  16.494 133.398 1.00 29.30 ? 386 PHE B O   1 
ATOM 2482 C CB  . PHE C 1 110 ? 33.655  15.729 132.892 1.00 23.46 ? 386 PHE B CB  1 
ATOM 2483 C CG  . PHE C 1 110 ? 35.071  15.374 132.455 1.00 16.97 ? 386 PHE B CG  1 
ATOM 2484 C CD1 . PHE C 1 110 ? 36.132  15.437 133.357 1.00 12.43 ? 386 PHE B CD1 1 
ATOM 2485 C CD2 . PHE C 1 110 ? 35.329  14.915 131.162 1.00 16.64 ? 386 PHE B CD2 1 
ATOM 2486 C CE1 . PHE C 1 110 ? 37.416  15.045 132.978 1.00 14.78 ? 386 PHE B CE1 1 
ATOM 2487 C CE2 . PHE C 1 110 ? 36.609  14.522 130.777 1.00 12.40 ? 386 PHE B CE2 1 
ATOM 2488 C CZ  . PHE C 1 110 ? 37.652  14.586 131.688 1.00 12.40 ? 386 PHE B CZ  1 
ATOM 2489 N N   . GLY C 1 111 ? 31.600  18.675 133.706 1.00 27.60 ? 387 GLY B N   1 
ATOM 2490 C CA  . GLY C 1 111 ? 30.318  19.038 134.293 1.00 24.10 ? 387 GLY B CA  1 
ATOM 2491 C C   . GLY C 1 111 ? 29.341  19.683 133.311 1.00 24.19 ? 387 GLY B C   1 
ATOM 2492 O O   . GLY C 1 111 ? 29.307  19.319 132.132 1.00 22.82 ? 387 GLY B O   1 
ATOM 2493 N N   . TYR C 1 112 ? 28.556  20.650 133.793 1.00 22.45 ? 388 TYR B N   1 
ATOM 2494 C CA  . TYR C 1 112 ? 27.546  21.355 132.993 1.00 18.99 ? 388 TYR B CA  1 
ATOM 2495 C C   . TYR C 1 112 ? 28.073  22.244 131.897 1.00 17.39 ? 388 TYR B C   1 
ATOM 2496 O O   . TYR C 1 112 ? 29.140  22.825 132.025 1.00 20.35 ? 388 TYR B O   1 
ATOM 2497 C CB  . TYR C 1 112 ? 26.700  22.240 133.882 1.00 16.33 ? 388 TYR B CB  1 
ATOM 2498 C CG  . TYR C 1 112 ? 25.842  21.514 134.860 1.00 15.39 ? 388 TYR B CG  1 
ATOM 2499 C CD1 . TYR C 1 112 ? 24.671  20.895 134.451 1.00 18.50 ? 388 TYR B CD1 1 
ATOM 2500 C CD2 . TYR C 1 112 ? 26.170  21.488 136.213 1.00 14.84 ? 388 TYR B CD2 1 
ATOM 2501 C CE1 . TYR C 1 112 ? 23.839  20.273 135.361 1.00 17.33 ? 388 TYR B CE1 1 
ATOM 2502 C CE2 . TYR C 1 112 ? 25.347  20.865 137.134 1.00 15.53 ? 388 TYR B CE2 1 
ATOM 2503 C CZ  . TYR C 1 112 ? 24.180  20.263 136.698 1.00 16.27 ? 388 TYR B CZ  1 
ATOM 2504 O OH  . TYR C 1 112 ? 23.340  19.661 137.599 1.00 22.58 ? 388 TYR B OH  1 
ATOM 2505 N N   . LYS C 1 113 ? 27.291  22.378 130.834 1.00 19.07 ? 389 LYS B N   1 
ATOM 2506 C CA  . LYS C 1 113 ? 27.659  23.242 129.717 1.00 17.52 ? 389 LYS B CA  1 
ATOM 2507 C C   . LYS C 1 113 ? 26.510  24.201 129.421 1.00 23.38 ? 389 LYS B C   1 
ATOM 2508 O O   . LYS C 1 113 ? 25.386  23.754 129.204 1.00 26.89 ? 389 LYS B O   1 
ATOM 2509 C CB  . LYS C 1 113 ? 27.956  22.421 128.466 1.00 12.40 ? 389 LYS B CB  1 
ATOM 2510 C CG  . LYS C 1 113 ? 28.184  23.283 127.241 1.00 12.40 ? 389 LYS B CG  1 
ATOM 2511 C CD  . LYS C 1 113 ? 28.413  22.459 126.006 1.00 12.40 ? 389 LYS B CD  1 
ATOM 2512 C CE  . LYS C 1 113 ? 28.531  23.350 124.797 1.00 17.01 ? 389 LYS B CE  1 
ATOM 2513 N NZ  . LYS C 1 113 ? 28.816  22.584 123.561 1.00 20.00 ? 389 LYS B NZ  1 
ATOM 2514 N N   . MET C 1 114 ? 26.787  25.506 129.400 1.00 24.00 ? 390 MET B N   1 
ATOM 2515 C CA  . MET C 1 114 ? 25.748  26.496 129.136 1.00 22.70 ? 390 MET B CA  1 
ATOM 2516 C C   . MET C 1 114 ? 26.019  27.408 127.942 1.00 22.26 ? 390 MET B C   1 
ATOM 2517 O O   . MET C 1 114 ? 26.547  26.974 126.919 1.00 23.62 ? 390 MET B O   1 
ATOM 2518 C CB  . MET C 1 114 ? 25.527  27.364 130.373 1.00 21.62 ? 390 MET B CB  1 
ATOM 2519 C CG  . MET C 1 114 ? 25.314  26.586 131.630 1.00 22.10 ? 390 MET B CG  1 
ATOM 2520 S SD  . MET C 1 114 ? 26.862  26.084 132.296 1.00 26.93 ? 390 MET B SD  1 
ATOM 2521 C CE  . MET C 1 114 ? 26.790  26.863 133.821 1.00 19.91 ? 390 MET B CE  1 
ATOM 2522 N N   . CYS C 1 115 ? 25.621  28.673 128.097 1.00 21.81 ? 391 CYS B N   1 
ATOM 2523 C CA  . CYS C 1 115 ? 25.789  29.731 127.092 1.00 23.31 ? 391 CYS B CA  1 
ATOM 2524 C C   . CYS C 1 115 ? 25.589  31.116 127.728 1.00 24.49 ? 391 CYS B C   1 
ATOM 2525 O O   . CYS C 1 115 ? 26.326  31.496 128.640 1.00 25.56 ? 391 CYS B O   1 
ATOM 2526 C CB  . CYS C 1 115 ? 24.794  29.555 125.940 1.00 23.03 ? 391 CYS B CB  1 
ATOM 2527 S SG  . CYS C 1 115 ? 24.967  30.787 124.613 1.00 27.00 ? 391 CYS B SG  1 
ATOM 2528 N N   . ALA C 1 116 ? 24.595  31.855 127.231 1.00 23.09 ? 392 ALA B N   1 
ATOM 2529 C CA  . ALA C 1 116 ? 24.236  33.197 127.714 1.00 20.86 ? 392 ALA B CA  1 
ATOM 2530 C C   . ALA C 1 116 ? 23.595  34.019 126.590 1.00 22.33 ? 392 ALA B C   1 
ATOM 2531 O O   . ALA C 1 116 ? 24.145  34.120 125.489 1.00 24.93 ? 392 ALA B O   1 
ATOM 2532 C CB  . ALA C 1 116 ? 25.459  33.934 128.265 1.00 19.06 ? 392 ALA B CB  1 
ATOM 2533 N N   . ARG C 1 117 ? 22.431  34.603 126.870 1.00 21.77 ? 393 ARG B N   1 
ATOM 2534 C CA  . ARG C 1 117 ? 21.725  35.399 125.875 1.00 20.53 ? 393 ARG B CA  1 
ATOM 2535 C C   . ARG C 1 117 ? 21.558  36.851 126.320 1.00 21.90 ? 393 ARG B C   1 
ATOM 2536 O O   . ARG C 1 117 ? 21.220  37.117 127.477 1.00 22.44 ? 393 ARG B O   1 
ATOM 2537 C CB  . ARG C 1 117 ? 20.353  34.776 125.577 1.00 22.24 ? 393 ARG B CB  1 
ATOM 2538 C CG  . ARG C 1 117 ? 19.667  35.392 124.365 1.00 22.33 ? 393 ARG B CG  1 
ATOM 2539 C CD  . ARG C 1 117 ? 18.398  34.677 123.917 1.00 24.20 ? 393 ARG B CD  1 
ATOM 2540 N NE  . ARG C 1 117 ? 18.070  35.096 122.555 1.00 28.64 ? 393 ARG B NE  1 
ATOM 2541 C CZ  . ARG C 1 117 ? 17.025  34.674 121.854 1.00 30.59 ? 393 ARG B CZ  1 
ATOM 2542 N NH1 . ARG C 1 117 ? 16.177  33.808 122.381 1.00 29.21 ? 393 ARG B NH1 1 
ATOM 2543 N NH2 . ARG C 1 117 ? 16.844  35.112 120.616 1.00 29.62 ? 393 ARG B NH2 1 
ATOM 2544 N N   . VAL C 1 118 ? 21.808  37.783 125.395 1.00 23.21 ? 394 VAL B N   1 
ATOM 2545 C CA  . VAL C 1 118 ? 21.685  39.216 125.676 1.00 23.60 ? 394 VAL B CA  1 
ATOM 2546 C C   . VAL C 1 118 ? 21.152  40.006 124.479 1.00 24.19 ? 394 VAL B C   1 
ATOM 2547 O O   . VAL C 1 118 ? 21.441  39.680 123.325 1.00 25.42 ? 394 VAL B O   1 
ATOM 2548 C CB  . VAL C 1 118 ? 23.047  39.837 126.097 1.00 24.29 ? 394 VAL B CB  1 
ATOM 2549 C CG1 . VAL C 1 118 ? 23.770  40.424 124.891 1.00 21.11 ? 394 VAL B CG1 1 
ATOM 2550 C CG2 . VAL C 1 118 ? 22.826  40.894 127.147 1.00 26.15 ? 394 VAL B CG2 1 
ATOM 2551 N N   . TYR C 1 119 ? 20.360  41.036 124.780 1.00 25.05 ? 395 TYR B N   1 
ATOM 2552 C CA  . TYR C 1 119 ? 19.776  41.933 123.780 1.00 26.36 ? 395 TYR B CA  1 
ATOM 2553 C C   . TYR C 1 119 ? 20.241  43.318 124.195 1.00 26.56 ? 395 TYR B C   1 
ATOM 2554 O O   . TYR C 1 119 ? 19.837  43.806 125.255 1.00 27.33 ? 395 TYR B O   1 
ATOM 2555 C CB  . TYR C 1 119 ? 18.254  41.895 123.834 1.00 27.67 ? 395 TYR B CB  1 
ATOM 2556 C CG  . TYR C 1 119 ? 17.689  40.506 123.881 1.00 27.62 ? 395 TYR B CG  1 
ATOM 2557 C CD1 . TYR C 1 119 ? 17.834  39.717 125.016 1.00 25.77 ? 395 TYR B CD1 1 
ATOM 2558 C CD2 . TYR C 1 119 ? 17.030  39.967 122.784 1.00 29.43 ? 395 TYR B CD2 1 
ATOM 2559 C CE1 . TYR C 1 119 ? 17.342  38.431 125.055 1.00 27.23 ? 395 TYR B CE1 1 
ATOM 2560 C CE2 . TYR C 1 119 ? 16.532  38.676 122.814 1.00 29.37 ? 395 TYR B CE2 1 
ATOM 2561 C CZ  . TYR C 1 119 ? 16.695  37.915 123.953 1.00 31.78 ? 395 TYR B CZ  1 
ATOM 2562 O OH  . TYR C 1 119 ? 16.219  36.630 123.985 1.00 37.75 ? 395 TYR B OH  1 
ATOM 2563 N N   . LEU C 1 120 ? 21.080  43.949 123.372 1.00 24.46 ? 396 LEU B N   1 
ATOM 2564 C CA  . LEU C 1 120 ? 21.621  45.264 123.708 1.00 25.38 ? 396 LEU B CA  1 
ATOM 2565 C C   . LEU C 1 120 ? 20.580  46.369 123.822 1.00 27.37 ? 396 LEU B C   1 
ATOM 2566 O O   . LEU C 1 120 ? 20.586  47.134 124.788 1.00 30.56 ? 396 LEU B O   1 
ATOM 2567 C CB  . LEU C 1 120 ? 22.732  45.661 122.719 1.00 24.98 ? 396 LEU B CB  1 
ATOM 2568 C CG  . LEU C 1 120 ? 24.119  45.020 122.913 1.00 24.11 ? 396 LEU B CG  1 
ATOM 2569 C CD1 . LEU C 1 120 ? 25.128  45.690 121.996 1.00 22.81 ? 396 LEU B CD1 1 
ATOM 2570 C CD2 . LEU C 1 120 ? 24.574  45.170 124.357 1.00 17.97 ? 396 LEU B CD2 1 
ATOM 2571 N N   . ASN C 1 121 ? 19.687  46.458 122.844 1.00 29.55 ? 397 ASN B N   1 
ATOM 2572 C CA  . ASN C 1 121 ? 18.635  47.469 122.889 1.00 29.38 ? 397 ASN B CA  1 
ATOM 2573 C C   . ASN C 1 121 ? 17.856  47.214 124.166 1.00 28.99 ? 397 ASN B C   1 
ATOM 2574 O O   . ASN C 1 121 ? 17.649  48.093 125.001 1.00 31.36 ? 397 ASN B O   1 
ATOM 2575 C CB  . ASN C 1 121 ? 17.702  47.312 121.688 1.00 32.46 ? 397 ASN B CB  1 
ATOM 2576 C CG  . ASN C 1 121 ? 16.705  48.445 121.574 1.00 33.33 ? 397 ASN B CG  1 
ATOM 2577 O OD1 . ASN C 1 121 ? 15.943  48.516 120.613 1.00 28.35 ? 397 ASN B OD1 1 
ATOM 2578 N ND2 . ASN C 1 121 ? 16.708  49.342 122.552 1.00 37.29 ? 397 ASN B ND2 1 
ATOM 2579 N N   . GLY C 1 122 ? 17.449  45.964 124.292 1.00 27.70 ? 398 GLY B N   1 
ATOM 2580 C CA  . GLY C 1 122 ? 16.694  45.514 125.433 1.00 23.00 ? 398 GLY B CA  1 
ATOM 2581 C C   . GLY C 1 122 ? 15.660  44.572 124.874 1.00 24.32 ? 398 GLY B C   1 
ATOM 2582 O O   . GLY C 1 122 ? 15.476  44.514 123.659 1.00 26.26 ? 398 GLY B O   1 
ATOM 2583 N N   . ASP C 1 123 ? 15.005  43.820 125.749 1.00 23.53 ? 399 ASP B N   1 
ATOM 2584 C CA  . ASP C 1 123 ? 13.959  42.908 125.332 1.00 24.94 ? 399 ASP B CA  1 
ATOM 2585 C C   . ASP C 1 123 ? 13.084  42.623 126.535 1.00 27.05 ? 399 ASP B C   1 
ATOM 2586 O O   . ASP C 1 123 ? 13.578  42.562 127.667 1.00 30.28 ? 399 ASP B O   1 
ATOM 2587 C CB  . ASP C 1 123 ? 14.546  41.610 124.798 1.00 27.62 ? 399 ASP B CB  1 
ATOM 2588 C CG  . ASP C 1 123 ? 13.518  40.767 124.097 1.00 27.84 ? 399 ASP B CG  1 
ATOM 2589 O OD1 . ASP C 1 123 ? 12.992  41.230 123.065 1.00 28.67 ? 399 ASP B OD1 1 
ATOM 2590 O OD2 . ASP C 1 123 ? 13.230  39.651 124.577 1.00 26.55 ? 399 ASP B OD2 1 
ATOM 2591 N N   . GLY C 1 124 ? 11.804  42.435 126.228 1.00 26.73 ? 400 GLY B N   1 
ATOM 2592 C CA  . GLY C 1 124 ? 10.799  42.171 127.228 1.00 23.25 ? 400 GLY B CA  1 
ATOM 2593 C C   . GLY C 1 124 ? 10.196  43.494 127.640 1.00 23.44 ? 400 GLY B C   1 
ATOM 2594 O O   . GLY C 1 124 ? 10.079  44.420 126.834 1.00 23.99 ? 400 GLY B O   1 
ATOM 2595 N N   . MET C 1 125 ? 9.811   43.565 128.908 1.00 23.29 ? 401 MET B N   1 
ATOM 2596 C CA  . MET C 1 125 ? 9.241   44.761 129.500 1.00 21.55 ? 401 MET B CA  1 
ATOM 2597 C C   . MET C 1 125 ? 10.420  45.464 130.170 1.00 22.07 ? 401 MET B C   1 
ATOM 2598 O O   . MET C 1 125 ? 10.553  45.507 131.394 1.00 25.29 ? 401 MET B O   1 
ATOM 2599 C CB  . MET C 1 125 ? 8.156   44.368 130.510 1.00 21.37 ? 401 MET B CB  1 
ATOM 2600 C CG  . MET C 1 125 ? 6.783   44.054 129.876 1.00 20.12 ? 401 MET B CG  1 
ATOM 2601 S SD  . MET C 1 125 ? 6.780   42.844 128.518 1.00 26.75 ? 401 MET B SD  1 
ATOM 2602 C CE  . MET C 1 125 ? 6.869   43.895 127.096 1.00 19.19 ? 401 MET B CE  1 
ATOM 2603 N N   . GLY C 1 126 ? 11.281  45.989 129.306 1.00 19.85 ? 402 GLY B N   1 
ATOM 2604 C CA  . GLY C 1 126 ? 12.497  46.686 129.684 1.00 21.24 ? 402 GLY B CA  1 
ATOM 2605 C C   . GLY C 1 126 ? 13.233  46.807 128.363 1.00 23.74 ? 402 GLY B C   1 
ATOM 2606 O O   . GLY C 1 126 ? 14.446  46.976 128.294 1.00 27.59 ? 402 GLY B O   1 
ATOM 2607 N N   . LYS C 1 127 ? 12.443  46.700 127.301 1.00 22.51 ? 403 LYS B N   1 
ATOM 2608 C CA  . LYS C 1 127 ? 12.909  46.766 125.928 1.00 23.65 ? 403 LYS B CA  1 
ATOM 2609 C C   . LYS C 1 127 ? 13.150  48.206 125.477 1.00 27.46 ? 403 LYS B C   1 
ATOM 2610 O O   . LYS C 1 127 ? 12.460  49.126 125.911 1.00 32.96 ? 403 LYS B O   1 
ATOM 2611 C CB  . LYS C 1 127 ? 11.869  46.104 125.015 1.00 19.57 ? 403 LYS B CB  1 
ATOM 2612 C CG  . LYS C 1 127 ? 12.233  46.128 123.553 1.00 20.85 ? 403 LYS B CG  1 
ATOM 2613 C CD  . LYS C 1 127 ? 11.059  45.803 122.673 1.00 28.25 ? 403 LYS B CD  1 
ATOM 2614 C CE  . LYS C 1 127 ? 11.421  46.054 121.217 1.00 33.90 ? 403 LYS B CE  1 
ATOM 2615 N NZ  . LYS C 1 127 ? 10.235  46.038 120.303 1.00 39.57 ? 403 LYS B NZ  1 
ATOM 2616 N N   . GLY C 1 128 ? 14.133  48.394 124.602 1.00 30.83 ? 404 GLY B N   1 
ATOM 2617 C CA  . GLY C 1 128 ? 14.440  49.721 124.098 1.00 29.21 ? 404 GLY B CA  1 
ATOM 2618 C C   . GLY C 1 128 ? 14.979  50.677 125.144 1.00 27.98 ? 404 GLY B C   1 
ATOM 2619 O O   . GLY C 1 128 ? 15.428  51.779 124.816 1.00 32.20 ? 404 GLY B O   1 
ATOM 2620 N N   . THR C 1 129 ? 14.934  50.262 126.407 1.00 26.16 ? 405 THR B N   1 
ATOM 2621 C CA  . THR C 1 129 ? 15.420  51.104 127.492 1.00 29.44 ? 405 THR B CA  1 
ATOM 2622 C C   . THR C 1 129 ? 16.162  50.348 128.592 1.00 31.17 ? 405 THR B C   1 
ATOM 2623 O O   . THR C 1 129 ? 16.362  50.871 129.693 1.00 32.04 ? 405 THR B O   1 
ATOM 2624 C CB  . THR C 1 129 ? 14.268  51.920 128.118 1.00 32.03 ? 405 THR B CB  1 
ATOM 2625 O OG1 . THR C 1 129 ? 13.188  51.045 128.471 1.00 34.40 ? 405 THR B OG1 1 
ATOM 2626 C CG2 . THR C 1 129 ? 13.781  52.978 127.134 1.00 34.23 ? 405 THR B CG2 1 
ATOM 2627 N N   . HIS C 1 130 ? 16.580  49.123 128.287 1.00 30.31 ? 406 HIS B N   1 
ATOM 2628 C CA  . HIS C 1 130 ? 17.325  48.311 129.246 1.00 26.91 ? 406 HIS B CA  1 
ATOM 2629 C C   . HIS C 1 130 ? 18.235  47.302 128.526 1.00 26.74 ? 406 HIS B C   1 
ATOM 2630 O O   . HIS C 1 130 ? 18.202  47.197 127.294 1.00 29.01 ? 406 HIS B O   1 
ATOM 2631 C CB  . HIS C 1 130 ? 16.357  47.591 130.206 1.00 21.22 ? 406 HIS B CB  1 
ATOM 2632 C CG  . HIS C 1 130 ? 15.763  48.480 131.264 1.00 21.79 ? 406 HIS B CG  1 
ATOM 2633 N ND1 . HIS C 1 130 ? 16.504  49.011 132.298 1.00 22.18 ? 406 HIS B ND1 1 
ATOM 2634 C CD2 . HIS C 1 130 ? 14.492  48.905 131.462 1.00 24.72 ? 406 HIS B CD2 1 
ATOM 2635 C CE1 . HIS C 1 130 ? 15.718  49.719 133.088 1.00 24.79 ? 406 HIS B CE1 1 
ATOM 2636 N NE2 . HIS C 1 130 ? 14.491  49.671 132.603 1.00 25.96 ? 406 HIS B NE2 1 
ATOM 2637 N N   . LEU C 1 131 ? 19.061  46.595 129.304 1.00 26.21 ? 407 LEU B N   1 
ATOM 2638 C CA  . LEU C 1 131 ? 19.992  45.578 128.790 1.00 26.22 ? 407 LEU B CA  1 
ATOM 2639 C C   . LEU C 1 131 ? 19.617  44.186 129.326 1.00 26.08 ? 407 LEU B C   1 
ATOM 2640 O O   . LEU C 1 131 ? 20.066  43.778 130.405 1.00 25.17 ? 407 LEU B O   1 
ATOM 2641 C CB  . LEU C 1 131 ? 21.427  45.904 129.213 1.00 28.57 ? 407 LEU B CB  1 
ATOM 2642 C CG  . LEU C 1 131 ? 22.453  44.851 128.784 1.00 26.10 ? 407 LEU B CG  1 
ATOM 2643 C CD1 . LEU C 1 131 ? 22.767  45.023 127.314 1.00 24.78 ? 407 LEU B CD1 1 
ATOM 2644 C CD2 . LEU C 1 131 ? 23.715  44.984 129.607 1.00 21.77 ? 407 LEU B CD2 1 
ATOM 2645 N N   . SER C 1 132 ? 18.800  43.461 128.565 1.00 24.57 ? 408 SER B N   1 
ATOM 2646 C CA  . SER C 1 132 ? 18.342  42.134 128.968 1.00 23.44 ? 408 SER B CA  1 
ATOM 2647 C C   . SER C 1 132 ? 19.437  41.071 128.833 1.00 23.71 ? 408 SER B C   1 
ATOM 2648 O O   . SER C 1 132 ? 19.873  40.745 127.725 1.00 26.72 ? 408 SER B O   1 
ATOM 2649 C CB  . SER C 1 132 ? 17.106  41.756 128.148 1.00 22.47 ? 408 SER B CB  1 
ATOM 2650 O OG  . SER C 1 132 ? 16.107  42.769 128.241 1.00 26.35 ? 408 SER B OG  1 
ATOM 2651 N N   . LEU C 1 133 ? 19.857  40.536 129.981 1.00 21.25 ? 409 LEU B N   1 
ATOM 2652 C CA  . LEU C 1 133 ? 20.932  39.536 130.093 1.00 21.42 ? 409 LEU B CA  1 
ATOM 2653 C C   . LEU C 1 133 ? 20.374  38.262 130.744 1.00 24.20 ? 409 LEU B C   1 
ATOM 2654 O O   . LEU C 1 133 ? 19.732  38.325 131.792 1.00 24.32 ? 409 LEU B O   1 
ATOM 2655 C CB  . LEU C 1 133 ? 22.048  40.140 130.962 1.00 20.39 ? 409 LEU B CB  1 
ATOM 2656 C CG  . LEU C 1 133 ? 23.495  39.656 131.051 1.00 16.09 ? 409 LEU B CG  1 
ATOM 2657 C CD1 . LEU C 1 133 ? 23.521  38.230 131.521 1.00 13.18 ? 409 LEU B CD1 1 
ATOM 2658 C CD2 . LEU C 1 133 ? 24.173  39.810 129.716 1.00 14.79 ? 409 LEU B CD2 1 
ATOM 2659 N N   . PHE C 1 134 ? 20.621  37.105 130.136 1.00 24.86 ? 410 PHE B N   1 
ATOM 2660 C CA  . PHE C 1 134 ? 20.087  35.845 130.677 1.00 23.41 ? 410 PHE B CA  1 
ATOM 2661 C C   . PHE C 1 134 ? 21.088  34.736 131.067 1.00 24.31 ? 410 PHE B C   1 
ATOM 2662 O O   . PHE C 1 134 ? 22.226  35.005 131.463 1.00 27.28 ? 410 PHE B O   1 
ATOM 2663 C CB  . PHE C 1 134 ? 19.071  35.245 129.692 1.00 23.00 ? 410 PHE B CB  1 
ATOM 2664 C CG  . PHE C 1 134 ? 18.030  36.207 129.223 1.00 17.58 ? 410 PHE B CG  1 
ATOM 2665 C CD1 . PHE C 1 134 ? 17.418  36.018 127.994 1.00 16.33 ? 410 PHE B CD1 1 
ATOM 2666 C CD2 . PHE C 1 134 ? 17.679  37.308 129.990 1.00 13.90 ? 410 PHE B CD2 1 
ATOM 2667 C CE1 . PHE C 1 134 ? 16.478  36.907 127.531 1.00 12.40 ? 410 PHE B CE1 1 
ATOM 2668 C CE2 . PHE C 1 134 ? 16.737  38.214 129.540 1.00 12.40 ? 410 PHE B CE2 1 
ATOM 2669 C CZ  . PHE C 1 134 ? 16.132  38.014 128.300 1.00 12.40 ? 410 PHE B CZ  1 
ATOM 2670 N N   . PHE C 1 135 ? 20.639  33.485 130.948 1.00 23.80 ? 411 PHE B N   1 
ATOM 2671 C CA  . PHE C 1 135 ? 21.462  32.332 131.290 1.00 25.27 ? 411 PHE B CA  1 
ATOM 2672 C C   . PHE C 1 135 ? 21.052  31.036 130.579 1.00 28.07 ? 411 PHE B C   1 
ATOM 2673 O O   . PHE C 1 135 ? 20.518  30.112 131.202 1.00 31.76 ? 411 PHE B O   1 
ATOM 2674 C CB  . PHE C 1 135 ? 21.427  32.103 132.803 1.00 24.31 ? 411 PHE B CB  1 
ATOM 2675 C CG  . PHE C 1 135 ? 22.202  30.899 133.243 1.00 26.25 ? 411 PHE B CG  1 
ATOM 2676 C CD1 . PHE C 1 135 ? 23.579  30.857 133.091 1.00 25.17 ? 411 PHE B CD1 1 
ATOM 2677 C CD2 . PHE C 1 135 ? 21.548  29.791 133.758 1.00 28.30 ? 411 PHE B CD2 1 
ATOM 2678 C CE1 . PHE C 1 135 ? 24.286  29.732 133.437 1.00 23.04 ? 411 PHE B CE1 1 
ATOM 2679 C CE2 . PHE C 1 135 ? 22.248  28.660 134.107 1.00 28.39 ? 411 PHE B CE2 1 
ATOM 2680 C CZ  . PHE C 1 135 ? 23.619  28.628 133.948 1.00 26.92 ? 411 PHE B CZ  1 
ATOM 2681 N N   . VAL C 1 136 ? 21.305  30.954 129.278 1.00 29.42 ? 412 VAL B N   1 
ATOM 2682 C CA  . VAL C 1 136 ? 20.948  29.744 128.556 1.00 25.78 ? 412 VAL B CA  1 
ATOM 2683 C C   . VAL C 1 136 ? 21.660  28.583 129.235 1.00 26.54 ? 412 VAL B C   1 
ATOM 2684 O O   . VAL C 1 136 ? 22.617  28.794 129.985 1.00 28.00 ? 412 VAL B O   1 
ATOM 2685 C CB  . VAL C 1 136 ? 21.398  29.802 127.073 1.00 25.87 ? 412 VAL B CB  1 
ATOM 2686 C CG1 . VAL C 1 136 ? 20.998  28.531 126.346 1.00 28.64 ? 412 VAL B CG1 1 
ATOM 2687 C CG2 . VAL C 1 136 ? 20.780  30.995 126.391 1.00 27.82 ? 412 VAL B CG2 1 
ATOM 2688 N N   . ILE C 1 137 ? 21.145  27.374 129.010 1.00 25.72 ? 413 ILE B N   1 
ATOM 2689 C CA  . ILE C 1 137 ? 21.734  26.129 129.510 1.00 21.96 ? 413 ILE B CA  1 
ATOM 2690 C C   . ILE C 1 137 ? 21.649  25.201 128.316 1.00 24.24 ? 413 ILE B C   1 
ATOM 2691 O O   . ILE C 1 137 ? 20.573  24.973 127.776 1.00 26.76 ? 413 ILE B O   1 
ATOM 2692 C CB  . ILE C 1 137 ? 20.976  25.515 130.708 1.00 18.51 ? 413 ILE B CB  1 
ATOM 2693 C CG1 . ILE C 1 137 ? 21.595  26.017 132.021 1.00 18.73 ? 413 ILE B CG1 1 
ATOM 2694 C CG2 . ILE C 1 137 ? 21.052  24.004 130.647 1.00 21.60 ? 413 ILE B CG2 1 
ATOM 2695 C CD1 . ILE C 1 137 ? 21.302  25.161 133.245 1.00 19.26 ? 413 ILE B CD1 1 
ATOM 2696 N N   . MET C 1 138 ? 22.794  24.673 127.904 1.00 25.93 ? 414 MET B N   1 
ATOM 2697 C CA  . MET C 1 138 ? 22.859  23.820 126.725 1.00 25.72 ? 414 MET B CA  1 
ATOM 2698 C C   . MET C 1 138 ? 23.199  22.332 126.898 1.00 28.78 ? 414 MET B C   1 
ATOM 2699 O O   . MET C 1 138 ? 23.892  21.907 127.838 1.00 27.74 ? 414 MET B O   1 
ATOM 2700 C CB  . MET C 1 138 ? 23.839  24.437 125.715 1.00 25.13 ? 414 MET B CB  1 
ATOM 2701 C CG  . MET C 1 138 ? 23.541  25.883 125.334 1.00 23.47 ? 414 MET B CG  1 
ATOM 2702 S SD  . MET C 1 138 ? 24.932  26.636 124.472 1.00 29.15 ? 414 MET B SD  1 
ATOM 2703 C CE  . MET C 1 138 ? 24.563  26.212 122.784 1.00 27.75 ? 414 MET B CE  1 
ATOM 2704 N N   . ARG C 1 139 ? 22.697  21.570 125.931 1.00 31.26 ? 415 ARG B N   1 
ATOM 2705 C CA  . ARG C 1 139 ? 22.863  20.127 125.811 1.00 32.91 ? 415 ARG B CA  1 
ATOM 2706 C C   . ARG C 1 139 ? 24.342  19.771 125.925 1.00 33.06 ? 415 ARG B C   1 
ATOM 2707 O O   . ARG C 1 139 ? 25.094  19.906 124.961 1.00 31.48 ? 415 ARG B O   1 
ATOM 2708 C CB  . ARG C 1 139 ? 22.312  19.716 124.444 1.00 35.03 ? 415 ARG B CB  1 
ATOM 2709 C CG  . ARG C 1 139 ? 22.031  18.260 124.217 1.00 33.99 ? 415 ARG B CG  1 
ATOM 2710 C CD  . ARG C 1 139 ? 21.447  18.090 122.812 1.00 35.44 ? 415 ARG B CD  1 
ATOM 2711 N NE  . ARG C 1 139 ? 22.364  18.546 121.759 1.00 34.76 ? 415 ARG B NE  1 
ATOM 2712 C CZ  . ARG C 1 139 ? 22.047  18.640 120.465 1.00 36.29 ? 415 ARG B CZ  1 
ATOM 2713 N NH1 . ARG C 1 139 ? 20.825  18.315 120.055 1.00 38.21 ? 415 ARG B NH1 1 
ATOM 2714 N NH2 . ARG C 1 139 ? 22.950  19.052 119.577 1.00 36.61 ? 415 ARG B NH2 1 
ATOM 2715 N N   . GLY C 1 140 ? 24.757  19.329 127.107 1.00 34.57 ? 416 GLY B N   1 
ATOM 2716 C CA  . GLY C 1 140 ? 26.149  18.964 127.311 1.00 37.35 ? 416 GLY B CA  1 
ATOM 2717 C C   . GLY C 1 140 ? 26.501  17.612 126.715 1.00 40.56 ? 416 GLY B C   1 
ATOM 2718 O O   . GLY C 1 140 ? 25.638  16.745 126.586 1.00 41.83 ? 416 GLY B O   1 
ATOM 2719 N N   . GLU C 1 141 ? 27.763  17.420 126.351 1.00 40.21 ? 417 GLU B N   1 
ATOM 2720 C CA  . GLU C 1 141 ? 28.181  16.156 125.766 1.00 36.10 ? 417 GLU B CA  1 
ATOM 2721 C C   . GLU C 1 141 ? 28.100  15.065 126.804 1.00 35.76 ? 417 GLU B C   1 
ATOM 2722 O O   . GLU C 1 141 ? 28.050  13.887 126.474 1.00 37.91 ? 417 GLU B O   1 
ATOM 2723 C CB  . GLU C 1 141 ? 29.616  16.244 125.275 1.00 34.88 ? 417 GLU B CB  1 
ATOM 2724 C CG  . GLU C 1 141 ? 29.879  15.452 124.029 1.00 37.36 ? 417 GLU B CG  1 
ATOM 2725 C CD  . GLU C 1 141 ? 28.997  15.907 122.895 1.00 39.88 ? 417 GLU B CD  1 
ATOM 2726 O OE1 . GLU C 1 141 ? 28.549  17.073 122.930 1.00 37.82 ? 417 GLU B OE1 1 
ATOM 2727 O OE2 . GLU C 1 141 ? 28.758  15.110 121.967 1.00 45.57 ? 417 GLU B OE2 1 
ATOM 2728 N N   . TYR C 1 142 ? 28.088  15.468 128.067 1.00 31.07 ? 418 TYR B N   1 
ATOM 2729 C CA  . TYR C 1 142 ? 28.045  14.523 129.178 1.00 31.16 ? 418 TYR B CA  1 
ATOM 2730 C C   . TYR C 1 142 ? 26.692  14.532 129.891 1.00 33.47 ? 418 TYR B C   1 
ATOM 2731 O O   . TYR C 1 142 ? 26.539  13.947 130.970 1.00 33.73 ? 418 TYR B O   1 
ATOM 2732 C CB  . TYR C 1 142 ? 29.158  14.874 130.172 1.00 30.93 ? 418 TYR B CB  1 
ATOM 2733 C CG  . TYR C 1 142 ? 30.526  15.058 129.530 1.00 29.65 ? 418 TYR B CG  1 
ATOM 2734 C CD1 . TYR C 1 142 ? 31.598  15.556 130.266 1.00 28.80 ? 418 TYR B CD1 1 
ATOM 2735 C CD2 . TYR C 1 142 ? 30.757  14.708 128.192 1.00 28.50 ? 418 TYR B CD2 1 
ATOM 2736 C CE1 . TYR C 1 142 ? 32.856  15.696 129.692 1.00 28.40 ? 418 TYR B CE1 1 
ATOM 2737 C CE2 . TYR C 1 142 ? 32.017  14.843 127.612 1.00 29.87 ? 418 TYR B CE2 1 
ATOM 2738 C CZ  . TYR C 1 142 ? 33.061  15.336 128.372 1.00 30.66 ? 418 TYR B CZ  1 
ATOM 2739 O OH  . TYR C 1 142 ? 34.313  15.448 127.819 1.00 35.13 ? 418 TYR B OH  1 
ATOM 2740 N N   . ASP C 1 143 ? 25.715  15.188 129.269 1.00 36.19 ? 419 ASP B N   1 
ATOM 2741 C CA  . ASP C 1 143 ? 24.376  15.325 129.830 1.00 34.69 ? 419 ASP B CA  1 
ATOM 2742 C C   . ASP C 1 143 ? 23.765  14.066 130.418 1.00 34.22 ? 419 ASP B C   1 
ATOM 2743 O O   . ASP C 1 143 ? 23.007  14.142 131.385 1.00 36.22 ? 419 ASP B O   1 
ATOM 2744 C CB  . ASP C 1 143 ? 23.433  15.926 128.788 1.00 35.44 ? 419 ASP B CB  1 
ATOM 2745 C CG  . ASP C 1 143 ? 23.150  17.397 129.043 1.00 36.95 ? 419 ASP B CG  1 
ATOM 2746 O OD1 . ASP C 1 143 ? 24.107  18.152 129.323 1.00 39.72 ? 419 ASP B OD1 1 
ATOM 2747 O OD2 . ASP C 1 143 ? 21.971  17.797 128.960 1.00 41.80 ? 419 ASP B OD2 1 
ATOM 2748 N N   . ALA C 1 144 ? 24.080  12.912 129.849 1.00 33.80 ? 420 ALA B N   1 
ATOM 2749 C CA  . ALA C 1 144 ? 23.531  11.679 130.384 1.00 33.01 ? 420 ALA B CA  1 
ATOM 2750 C C   . ALA C 1 144 ? 23.924  11.554 131.866 1.00 31.93 ? 420 ALA B C   1 
ATOM 2751 O O   . ALA C 1 144 ? 23.111  11.176 132.716 1.00 32.05 ? 420 ALA B O   1 
ATOM 2752 C CB  . ALA C 1 144 ? 24.045  10.493 129.584 1.00 33.84 ? 420 ALA B CB  1 
ATOM 2753 N N   . LEU C 1 145 ? 25.170  11.900 132.173 1.00 32.70 ? 421 LEU B N   1 
ATOM 2754 C CA  . LEU C 1 145 ? 25.678  11.825 133.540 1.00 35.56 ? 421 LEU B CA  1 
ATOM 2755 C C   . LEU C 1 145 ? 25.560  13.183 134.221 1.00 37.82 ? 421 LEU B C   1 
ATOM 2756 O O   . LEU C 1 145 ? 26.417  13.552 135.023 1.00 40.20 ? 421 LEU B O   1 
ATOM 2757 C CB  . LEU C 1 145 ? 27.161  11.395 133.542 1.00 33.38 ? 421 LEU B CB  1 
ATOM 2758 C CG  . LEU C 1 145 ? 27.657  10.006 133.089 1.00 32.24 ? 421 LEU B CG  1 
ATOM 2759 C CD1 . LEU C 1 145 ? 29.148  10.059 132.841 1.00 30.30 ? 421 LEU B CD1 1 
ATOM 2760 C CD2 . LEU C 1 145 ? 27.351  8.959  134.144 1.00 30.87 ? 421 LEU B CD2 1 
ATOM 2761 N N   . LEU C 1 146 ? 24.494  13.920 133.922 1.00 39.00 ? 422 LEU B N   1 
ATOM 2762 C CA  . LEU C 1 146 ? 24.318  15.255 134.504 1.00 37.16 ? 422 LEU B CA  1 
ATOM 2763 C C   . LEU C 1 146 ? 23.001  15.481 135.260 1.00 37.95 ? 422 LEU B C   1 
ATOM 2764 O O   . LEU C 1 146 ? 21.916  15.315 134.700 1.00 38.60 ? 422 LEU B O   1 
ATOM 2765 C CB  . LEU C 1 146 ? 24.463  16.303 133.395 1.00 37.29 ? 422 LEU B CB  1 
ATOM 2766 C CG  . LEU C 1 146 ? 24.980  17.698 133.757 1.00 34.55 ? 422 LEU B CG  1 
ATOM 2767 C CD1 . LEU C 1 146 ? 26.198  17.606 134.685 1.00 35.41 ? 422 LEU B CD1 1 
ATOM 2768 C CD2 . LEU C 1 146 ? 25.332  18.429 132.467 1.00 35.13 ? 422 LEU B CD2 1 
ATOM 2769 N N   . PRO C 1 147 ? 23.087  15.860 136.551 1.00 38.56 ? 423 PRO B N   1 
ATOM 2770 C CA  . PRO C 1 147 ? 21.893  16.105 137.363 1.00 40.68 ? 423 PRO B CA  1 
ATOM 2771 C C   . PRO C 1 147 ? 21.108  17.302 136.850 1.00 42.08 ? 423 PRO B C   1 
ATOM 2772 O O   . PRO C 1 147 ? 21.635  18.130 136.112 1.00 41.39 ? 423 PRO B O   1 
ATOM 2773 C CB  . PRO C 1 147 ? 22.467  16.354 138.756 1.00 40.40 ? 423 PRO B CB  1 
ATOM 2774 C CG  . PRO C 1 147 ? 23.718  15.553 138.755 1.00 40.24 ? 423 PRO B CG  1 
ATOM 2775 C CD  . PRO C 1 147 ? 24.292  15.863 137.398 1.00 38.91 ? 423 PRO B CD  1 
ATOM 2776 N N   . TRP C 1 148 ? 19.844  17.383 137.245 1.00 43.24 ? 424 TRP B N   1 
ATOM 2777 C CA  . TRP C 1 148 ? 18.974  18.488 136.849 1.00 43.36 ? 424 TRP B CA  1 
ATOM 2778 C C   . TRP C 1 148 ? 17.982  18.714 137.995 1.00 44.92 ? 424 TRP B C   1 
ATOM 2779 O O   . TRP C 1 148 ? 18.025  18.012 139.003 1.00 48.24 ? 424 TRP B O   1 
ATOM 2780 C CB  . TRP C 1 148 ? 18.213  18.144 135.559 1.00 42.60 ? 424 TRP B CB  1 
ATOM 2781 C CG  . TRP C 1 148 ? 19.076  17.680 134.415 1.00 42.53 ? 424 TRP B CG  1 
ATOM 2782 C CD1 . TRP C 1 148 ? 19.042  16.454 133.815 1.00 43.22 ? 424 TRP B CD1 1 
ATOM 2783 C CD2 . TRP C 1 148 ? 20.100  18.426 133.741 1.00 44.11 ? 424 TRP B CD2 1 
ATOM 2784 N NE1 . TRP C 1 148 ? 19.978  16.387 132.812 1.00 44.69 ? 424 TRP B NE1 1 
ATOM 2785 C CE2 . TRP C 1 148 ? 20.643  17.584 132.745 1.00 45.10 ? 424 TRP B CE2 1 
ATOM 2786 C CE3 . TRP C 1 148 ? 20.613  19.722 133.882 1.00 46.05 ? 424 TRP B CE3 1 
ATOM 2787 C CZ2 . TRP C 1 148 ? 21.674  17.996 131.896 1.00 46.20 ? 424 TRP B CZ2 1 
ATOM 2788 C CZ3 . TRP C 1 148 ? 21.636  20.128 133.036 1.00 44.89 ? 424 TRP B CZ3 1 
ATOM 2789 C CH2 . TRP C 1 148 ? 22.154  19.267 132.056 1.00 44.53 ? 424 TRP B CH2 1 
ATOM 2790 N N   . PRO C 1 149 ? 17.099  19.714 137.876 1.00 43.93 ? 425 PRO B N   1 
ATOM 2791 C CA  . PRO C 1 149 ? 16.945  20.652 136.765 1.00 42.41 ? 425 PRO B CA  1 
ATOM 2792 C C   . PRO C 1 149 ? 17.842  21.865 137.012 1.00 42.41 ? 425 PRO B C   1 
ATOM 2793 O O   . PRO C 1 149 ? 17.369  22.999 137.009 1.00 43.13 ? 425 PRO B O   1 
ATOM 2794 C CB  . PRO C 1 149 ? 15.475  21.005 136.841 1.00 43.14 ? 425 PRO B CB  1 
ATOM 2795 C CG  . PRO C 1 149 ? 15.277  21.109 138.324 1.00 45.62 ? 425 PRO B CG  1 
ATOM 2796 C CD  . PRO C 1 149 ? 16.015  19.894 138.859 1.00 45.27 ? 425 PRO B CD  1 
ATOM 2797 N N   . PHE C 1 150 ? 19.131  21.603 137.235 1.00 41.42 ? 426 PHE B N   1 
ATOM 2798 C CA  . PHE C 1 150 ? 20.128  22.634 137.508 1.00 37.81 ? 426 PHE B CA  1 
ATOM 2799 C C   . PHE C 1 150 ? 19.601  23.515 138.629 1.00 37.59 ? 426 PHE B C   1 
ATOM 2800 O O   . PHE C 1 150 ? 18.519  24.072 138.535 1.00 37.72 ? 426 PHE B O   1 
ATOM 2801 C CB  . PHE C 1 150 ? 20.413  23.447 136.236 1.00 36.25 ? 426 PHE B CB  1 
ATOM 2802 C CG  . PHE C 1 150 ? 21.561  24.415 136.371 1.00 36.56 ? 426 PHE B CG  1 
ATOM 2803 C CD1 . PHE C 1 150 ? 21.325  25.775 136.560 1.00 38.10 ? 426 PHE B CD1 1 
ATOM 2804 C CD2 . PHE C 1 150 ? 22.877  23.969 136.323 1.00 37.53 ? 426 PHE B CD2 1 
ATOM 2805 C CE1 . PHE C 1 150 ? 22.383  26.675 136.701 1.00 35.99 ? 426 PHE B CE1 1 
ATOM 2806 C CE2 . PHE C 1 150 ? 23.942  24.863 136.464 1.00 36.40 ? 426 PHE B CE2 1 
ATOM 2807 C CZ  . PHE C 1 150 ? 23.692  26.216 136.653 1.00 34.11 ? 426 PHE B CZ  1 
ATOM 2808 N N   . LYS C 1 151 ? 20.361  23.627 139.705 1.00 38.45 ? 427 LYS B N   1 
ATOM 2809 C CA  . LYS C 1 151 ? 19.934  24.430 140.840 1.00 40.36 ? 427 LYS B CA  1 
ATOM 2810 C C   . LYS C 1 151 ? 21.122  25.130 141.483 1.00 39.87 ? 427 LYS B C   1 
ATOM 2811 O O   . LYS C 1 151 ? 21.341  25.015 142.694 1.00 41.66 ? 427 LYS B O   1 
ATOM 2812 C CB  . LYS C 1 151 ? 19.236  23.521 141.851 1.00 44.84 ? 427 LYS B CB  1 
ATOM 2813 C CG  . LYS C 1 151 ? 20.003  22.235 142.122 1.00 51.60 ? 427 LYS B CG  1 
ATOM 2814 C CD  . LYS C 1 151 ? 19.067  21.046 142.356 1.00 55.84 ? 427 LYS B CD  1 
ATOM 2815 C CE  . LYS C 1 151 ? 19.837  19.719 142.299 1.00 57.85 ? 427 LYS B CE  1 
ATOM 2816 N NZ  . LYS C 1 151 ? 18.952  18.521 142.400 1.00 59.76 ? 427 LYS B NZ  1 
ATOM 2817 N N   . GLN C 1 152 ? 21.876  25.867 140.665 1.00 39.28 ? 428 GLN B N   1 
ATOM 2818 C CA  . GLN C 1 152 ? 23.074  26.578 141.119 1.00 35.89 ? 428 GLN B CA  1 
ATOM 2819 C C   . GLN C 1 152 ? 22.957  28.097 140.998 1.00 35.23 ? 428 GLN B C   1 
ATOM 2820 O O   . GLN C 1 152 ? 22.951  28.647 139.897 1.00 34.26 ? 428 GLN B O   1 
ATOM 2821 C CB  . GLN C 1 152 ? 24.293  26.086 140.328 1.00 34.47 ? 428 GLN B CB  1 
ATOM 2822 C CG  . GLN C 1 152 ? 24.354  24.570 140.208 1.00 34.92 ? 428 GLN B CG  1 
ATOM 2823 C CD  . GLN C 1 152 ? 24.306  23.880 141.554 1.00 35.29 ? 428 GLN B CD  1 
ATOM 2824 O OE1 . GLN C 1 152 ? 23.758  22.789 141.684 1.00 35.43 ? 428 GLN B OE1 1 
ATOM 2825 N NE2 . GLN C 1 152 ? 24.886  24.513 142.564 1.00 34.29 ? 428 GLN B NE2 1 
ATOM 2826 N N   . LYS C 1 153 ? 22.872  28.749 142.156 1.00 34.65 ? 429 LYS B N   1 
ATOM 2827 C CA  . LYS C 1 153 ? 22.746  30.201 142.286 1.00 31.81 ? 429 LYS B CA  1 
ATOM 2828 C C   . LYS C 1 153 ? 23.522  30.963 141.229 1.00 30.01 ? 429 LYS B C   1 
ATOM 2829 O O   . LYS C 1 153 ? 24.541  31.566 141.534 1.00 32.14 ? 429 LYS B O   1 
ATOM 2830 C CB  . LYS C 1 153 ? 23.236  30.626 143.677 1.00 31.99 ? 429 LYS B CB  1 
ATOM 2831 C CG  . LYS C 1 153 ? 22.674  29.758 144.814 1.00 37.57 ? 429 LYS B CG  1 
ATOM 2832 C CD  . LYS C 1 153 ? 23.371  29.978 146.157 1.00 44.34 ? 429 LYS B CD  1 
ATOM 2833 C CE  . LYS C 1 153 ? 23.187  31.394 146.696 1.00 49.74 ? 429 LYS B CE  1 
ATOM 2834 N NZ  . LYS C 1 153 ? 23.947  32.414 145.914 1.00 48.74 ? 429 LYS B NZ  1 
ATOM 2835 N N   . VAL C 1 154 ? 23.030  30.955 139.994 1.00 29.51 ? 430 VAL B N   1 
ATOM 2836 C CA  . VAL C 1 154 ? 23.709  31.645 138.900 1.00 23.99 ? 430 VAL B CA  1 
ATOM 2837 C C   . VAL C 1 154 ? 23.786  33.159 139.100 1.00 26.49 ? 430 VAL B C   1 
ATOM 2838 O O   . VAL C 1 154 ? 22.921  33.757 139.740 1.00 27.70 ? 430 VAL B O   1 
ATOM 2839 C CB  . VAL C 1 154 ? 23.016  31.380 137.548 1.00 19.43 ? 430 VAL B CB  1 
ATOM 2840 C CG1 . VAL C 1 154 ? 23.817  32.027 136.413 1.00 12.40 ? 430 VAL B CG1 1 
ATOM 2841 C CG2 . VAL C 1 154 ? 22.881  29.888 137.323 1.00 20.12 ? 430 VAL B CG2 1 
ATOM 2842 N N   . THR C 1 155 ? 24.834  33.774 138.558 1.00 28.26 ? 431 THR B N   1 
ATOM 2843 C CA  . THR C 1 155 ? 25.005  35.214 138.661 1.00 29.17 ? 431 THR B CA  1 
ATOM 2844 C C   . THR C 1 155 ? 25.269  35.753 137.267 1.00 29.02 ? 431 THR B C   1 
ATOM 2845 O O   . THR C 1 155 ? 25.868  35.073 136.436 1.00 32.24 ? 431 THR B O   1 
ATOM 2846 C CB  . THR C 1 155 ? 26.184  35.591 139.580 1.00 28.72 ? 431 THR B CB  1 
ATOM 2847 O OG1 . THR C 1 155 ? 25.933  35.107 140.902 1.00 33.99 ? 431 THR B OG1 1 
ATOM 2848 C CG2 . THR C 1 155 ? 26.354  37.105 139.643 1.00 27.88 ? 431 THR B CG2 1 
ATOM 2849 N N   . LEU C 1 156 ? 24.792  36.971 137.018 1.00 31.15 ? 432 LEU B N   1 
ATOM 2850 C CA  . LEU C 1 156 ? 24.954  37.653 135.734 1.00 31.79 ? 432 LEU B CA  1 
ATOM 2851 C C   . LEU C 1 156 ? 25.377  39.056 136.120 1.00 30.14 ? 432 LEU B C   1 
ATOM 2852 O O   . LEU C 1 156 ? 24.832  39.602 137.071 1.00 29.72 ? 432 LEU B O   1 
ATOM 2853 C CB  . LEU C 1 156 ? 23.613  37.724 134.992 1.00 35.03 ? 432 LEU B CB  1 
ATOM 2854 C CG  . LEU C 1 156 ? 22.683  36.505 135.020 1.00 36.59 ? 432 LEU B CG  1 
ATOM 2855 C CD1 . LEU C 1 156 ? 21.378  36.850 134.312 1.00 40.52 ? 432 LEU B CD1 1 
ATOM 2856 C CD2 . LEU C 1 156 ? 23.365  35.311 134.366 1.00 35.47 ? 432 LEU B CD2 1 
ATOM 2857 N N   . MET C 1 157 ? 26.334  39.651 135.414 1.00 27.34 ? 433 MET B N   1 
ATOM 2858 C CA  . MET C 1 157 ? 26.736  41.001 135.793 1.00 26.48 ? 433 MET B CA  1 
ATOM 2859 C C   . MET C 1 157 ? 27.407  41.883 134.745 1.00 24.45 ? 433 MET B C   1 
ATOM 2860 O O   . MET C 1 157 ? 28.116  41.406 133.850 1.00 22.97 ? 433 MET B O   1 
ATOM 2861 C CB  . MET C 1 157 ? 27.615  40.954 137.046 1.00 25.52 ? 433 MET B CB  1 
ATOM 2862 C CG  . MET C 1 157 ? 28.979  40.311 136.867 1.00 28.12 ? 433 MET B CG  1 
ATOM 2863 S SD  . MET C 1 157 ? 29.763  40.119 138.483 1.00 30.61 ? 433 MET B SD  1 
ATOM 2864 C CE  . MET C 1 157 ? 30.306  41.799 138.798 1.00 25.66 ? 433 MET B CE  1 
ATOM 2865 N N   . LEU C 1 158 ? 27.152  43.185 134.893 1.00 26.27 ? 434 LEU B N   1 
ATOM 2866 C CA  . LEU C 1 158 ? 27.686  44.231 134.031 1.00 28.28 ? 434 LEU B CA  1 
ATOM 2867 C C   . LEU C 1 158 ? 29.024  44.689 134.594 1.00 29.83 ? 434 LEU B C   1 
ATOM 2868 O O   . LEU C 1 158 ? 29.067  45.388 135.610 1.00 32.17 ? 434 LEU B O   1 
ATOM 2869 C CB  . LEU C 1 158 ? 26.730  45.423 134.001 1.00 24.59 ? 434 LEU B CB  1 
ATOM 2870 C CG  . LEU C 1 158 ? 27.241  46.627 133.207 1.00 22.32 ? 434 LEU B CG  1 
ATOM 2871 C CD1 . LEU C 1 158 ? 27.291  46.274 131.723 1.00 18.79 ? 434 LEU B CD1 1 
ATOM 2872 C CD2 . LEU C 1 158 ? 26.348  47.831 133.443 1.00 18.37 ? 434 LEU B CD2 1 
ATOM 2873 N N   . MET C 1 159 ? 30.112  44.298 133.939 1.00 30.50 ? 435 MET B N   1 
ATOM 2874 C CA  . MET C 1 159 ? 31.433  44.681 134.409 1.00 28.39 ? 435 MET B CA  1 
ATOM 2875 C C   . MET C 1 159 ? 31.689  46.137 134.064 1.00 29.48 ? 435 MET B C   1 
ATOM 2876 O O   . MET C 1 159 ? 31.467  46.563 132.931 1.00 30.51 ? 435 MET B O   1 
ATOM 2877 C CB  . MET C 1 159 ? 32.517  43.803 133.778 1.00 26.56 ? 435 MET B CB  1 
ATOM 2878 C CG  . MET C 1 159 ? 32.322  42.297 133.970 1.00 22.66 ? 435 MET B CG  1 
ATOM 2879 S SD  . MET C 1 159 ? 31.738  41.764 135.616 1.00 26.15 ? 435 MET B SD  1 
ATOM 2880 C CE  . MET C 1 159 ? 33.307  41.693 136.560 1.00 26.87 ? 435 MET B CE  1 
ATOM 2881 N N   . ASP C 1 160 ? 32.155  46.886 135.060 1.00 30.45 ? 436 ASP B N   1 
ATOM 2882 C CA  . ASP C 1 160 ? 32.462  48.309 134.930 1.00 31.58 ? 436 ASP B CA  1 
ATOM 2883 C C   . ASP C 1 160 ? 33.928  48.581 134.568 1.00 32.94 ? 436 ASP B C   1 
ATOM 2884 O O   . ASP C 1 160 ? 34.840  47.892 135.024 1.00 33.24 ? 436 ASP B O   1 
ATOM 2885 C CB  . ASP C 1 160 ? 32.114  49.026 136.234 1.00 29.79 ? 436 ASP B CB  1 
ATOM 2886 C CG  . ASP C 1 160 ? 32.770  50.379 136.347 1.00 30.03 ? 436 ASP B CG  1 
ATOM 2887 O OD1 . ASP C 1 160 ? 32.504  51.244 135.489 1.00 30.88 ? 436 ASP B OD1 1 
ATOM 2888 O OD2 . ASP C 1 160 ? 33.552  50.574 137.299 1.00 24.06 ? 436 ASP B OD2 1 
ATOM 2889 N N   . GLN C 1 161 ? 34.147  49.611 133.760 1.00 34.45 ? 437 GLN B N   1 
ATOM 2890 C CA  . GLN C 1 161 ? 35.488  49.955 133.318 1.00 36.07 ? 437 GLN B CA  1 
ATOM 2891 C C   . GLN C 1 161 ? 35.855  51.398 133.678 1.00 41.02 ? 437 GLN B C   1 
ATOM 2892 O O   . GLN C 1 161 ? 36.034  52.249 132.803 1.00 41.94 ? 437 GLN B O   1 
ATOM 2893 C CB  . GLN C 1 161 ? 35.579  49.717 131.807 1.00 31.69 ? 437 GLN B CB  1 
ATOM 2894 C CG  . GLN C 1 161 ? 35.216  48.280 131.415 1.00 31.58 ? 437 GLN B CG  1 
ATOM 2895 C CD  . GLN C 1 161 ? 35.007  48.098 129.923 1.00 35.48 ? 437 GLN B CD  1 
ATOM 2896 O OE1 . GLN C 1 161 ? 35.938  48.231 129.133 1.00 38.63 ? 437 GLN B OE1 1 
ATOM 2897 N NE2 . GLN C 1 161 ? 33.778  47.783 129.532 1.00 34.36 ? 437 GLN B NE2 1 
ATOM 2898 N N   . GLY C 1 162 ? 35.966  51.657 134.979 1.00 45.45 ? 438 GLY B N   1 
ATOM 2899 C CA  . GLY C 1 162 ? 36.311  52.985 135.455 1.00 47.08 ? 438 GLY B CA  1 
ATOM 2900 C C   . GLY C 1 162 ? 37.269  52.910 136.626 1.00 50.44 ? 438 GLY B C   1 
ATOM 2901 O O   . GLY C 1 162 ? 36.919  52.386 137.682 1.00 51.11 ? 438 GLY B O   1 
ATOM 2902 N N   . SER C 1 163 ? 38.474  53.442 136.418 1.00 55.11 ? 439 SER B N   1 
ATOM 2903 C CA  . SER C 1 163 ? 39.572  53.470 137.395 1.00 58.63 ? 439 SER B CA  1 
ATOM 2904 C C   . SER C 1 163 ? 39.283  53.153 138.862 1.00 59.50 ? 439 SER B C   1 
ATOM 2905 O O   . SER C 1 163 ? 40.150  52.618 139.556 1.00 61.41 ? 439 SER B O   1 
ATOM 2906 C CB  . SER C 1 163 ? 40.309  54.816 137.314 1.00 58.06 ? 439 SER B CB  1 
ATOM 2907 O OG  . SER C 1 163 ? 41.074  54.917 136.122 1.00 59.91 ? 439 SER B OG  1 
ATOM 2908 N N   . SER C 1 164 ? 38.093  53.487 139.349 1.00 60.25 ? 440 SER B N   1 
ATOM 2909 C CA  . SER C 1 164 ? 37.760  53.196 140.738 1.00 61.75 ? 440 SER B CA  1 
ATOM 2910 C C   . SER C 1 164 ? 36.262  53.221 141.030 1.00 62.43 ? 440 SER B C   1 
ATOM 2911 O O   . SER C 1 164 ? 35.775  54.048 141.805 1.00 62.22 ? 440 SER B O   1 
ATOM 2912 C CB  . SER C 1 164 ? 38.500  54.164 141.665 1.00 63.75 ? 440 SER B CB  1 
ATOM 2913 O OG  . SER C 1 164 ? 39.894  53.886 141.678 1.00 66.74 ? 440 SER B OG  1 
ATOM 2914 N N   . ARG C 1 165 ? 35.544  52.292 140.408 1.00 62.67 ? 441 ARG B N   1 
ATOM 2915 C CA  . ARG C 1 165 ? 34.099  52.169 140.577 1.00 62.21 ? 441 ARG B CA  1 
ATOM 2916 C C   . ARG C 1 165 ? 33.746  50.675 140.521 1.00 62.02 ? 441 ARG B C   1 
ATOM 2917 O O   . ARG C 1 165 ? 34.507  49.872 139.972 1.00 60.85 ? 441 ARG B O   1 
ATOM 2918 C CB  . ARG C 1 165 ? 33.378  52.938 139.460 1.00 62.68 ? 441 ARG B CB  1 
ATOM 2919 C CG  . ARG C 1 165 ? 33.936  54.349 139.203 1.00 60.35 ? 441 ARG B CG  1 
ATOM 2920 C CD  . ARG C 1 165 ? 33.075  55.470 139.789 1.00 56.93 ? 441 ARG B CD  1 
ATOM 2921 N NE  . ARG C 1 165 ? 31.860  55.719 139.011 1.00 54.59 ? 441 ARG B NE  1 
ATOM 2922 C CZ  . ARG C 1 165 ? 30.746  54.995 139.084 1.00 55.29 ? 441 ARG B CZ  1 
ATOM 2923 N NH1 . ARG C 1 165 ? 30.665  53.959 139.910 1.00 52.86 ? 441 ARG B NH1 1 
ATOM 2924 N NH2 . ARG C 1 165 ? 29.711  55.307 138.317 1.00 56.12 ? 441 ARG B NH2 1 
ATOM 2925 N N   . ARG C 1 166 ? 32.596  50.308 141.084 1.00 59.16 ? 442 ARG B N   1 
ATOM 2926 C CA  . ARG C 1 166 ? 32.169  48.906 141.119 1.00 54.67 ? 442 ARG B CA  1 
ATOM 2927 C C   . ARG C 1 166 ? 31.410  48.438 139.873 1.00 50.51 ? 442 ARG B C   1 
ATOM 2928 O O   . ARG C 1 166 ? 31.493  49.064 138.821 1.00 49.55 ? 442 ARG B O   1 
ATOM 2929 C CB  . ARG C 1 166 ? 31.316  48.654 142.372 1.00 58.41 ? 442 ARG B CB  1 
ATOM 2930 C CG  . ARG C 1 166 ? 29.921  49.280 142.354 1.00 59.66 ? 442 ARG B CG  1 
ATOM 2931 C CD  . ARG C 1 166 ? 29.956  50.797 142.213 1.00 57.13 ? 442 ARG B CD  1 
ATOM 2932 N NE  . ARG C 1 166 ? 28.621  51.333 141.966 1.00 57.09 ? 442 ARG B NE  1 
ATOM 2933 C CZ  . ARG C 1 166 ? 27.849  50.975 140.943 1.00 56.62 ? 442 ARG B CZ  1 
ATOM 2934 N NH1 . ARG C 1 166 ? 28.275  50.078 140.062 1.00 56.25 ? 442 ARG B NH1 1 
ATOM 2935 N NH2 . ARG C 1 166 ? 26.643  51.507 140.802 1.00 56.32 ? 442 ARG B NH2 1 
ATOM 2936 N N   . HIS C 1 167 ? 30.676  47.332 140.004 1.00 46.83 ? 443 HIS B N   1 
ATOM 2937 C CA  . HIS C 1 167 ? 29.906  46.760 138.896 1.00 41.70 ? 443 HIS B CA  1 
ATOM 2938 C C   . HIS C 1 167 ? 28.418  46.678 139.219 1.00 40.67 ? 443 HIS B C   1 
ATOM 2939 O O   . HIS C 1 167 ? 27.962  47.154 140.266 1.00 40.89 ? 443 HIS B O   1 
ATOM 2940 C CB  . HIS C 1 167 ? 30.385  45.339 138.584 1.00 39.19 ? 443 HIS B CB  1 
ATOM 2941 C CG  . HIS C 1 167 ? 31.863  45.220 138.396 1.00 35.82 ? 443 HIS B CG  1 
ATOM 2942 N ND1 . HIS C 1 167 ? 32.498  45.596 137.233 1.00 35.55 ? 443 HIS B ND1 1 
ATOM 2943 C CD2 . HIS C 1 167 ? 32.834  44.784 139.232 1.00 33.71 ? 443 HIS B CD2 1 
ATOM 2944 C CE1 . HIS C 1 167 ? 33.798  45.396 137.360 1.00 34.63 ? 443 HIS B CE1 1 
ATOM 2945 N NE2 . HIS C 1 167 ? 34.029  44.904 138.564 1.00 31.04 ? 443 HIS B NE2 1 
ATOM 2946 N N   . LEU C 1 168 ? 27.678  46.049 138.301 1.00 36.99 ? 444 LEU B N   1 
ATOM 2947 C CA  . LEU C 1 168 ? 26.234  45.838 138.436 1.00 33.18 ? 444 LEU B CA  1 
ATOM 2948 C C   . LEU C 1 168 ? 25.911  44.341 138.582 1.00 36.96 ? 444 LEU B C   1 
ATOM 2949 O O   . LEU C 1 168 ? 26.213  43.536 137.699 1.00 39.23 ? 444 LEU B O   1 
ATOM 2950 C CB  . LEU C 1 168 ? 25.483  46.415 137.221 1.00 28.09 ? 444 LEU B CB  1 
ATOM 2951 C CG  . LEU C 1 168 ? 25.297  47.936 137.125 1.00 26.56 ? 444 LEU B CG  1 
ATOM 2952 C CD1 . LEU C 1 168 ? 24.315  48.262 136.015 1.00 25.98 ? 444 LEU B CD1 1 
ATOM 2953 C CD2 . LEU C 1 168 ? 24.774  48.476 138.447 1.00 26.28 ? 444 LEU B CD2 1 
ATOM 2954 N N   . GLY C 1 169 ? 25.295  43.979 139.703 1.00 37.43 ? 445 GLY B N   1 
ATOM 2955 C CA  . GLY C 1 169 ? 24.964  42.588 139.920 1.00 40.48 ? 445 GLY B CA  1 
ATOM 2956 C C   . GLY C 1 169 ? 24.037  42.199 141.062 1.00 40.73 ? 445 GLY B C   1 
ATOM 2957 O O   . GLY C 1 169 ? 24.084  42.742 142.169 1.00 42.58 ? 445 GLY B O   1 
ATOM 2958 N N   . ASP C 1 170 ? 23.177  41.234 140.753 1.00 40.63 ? 446 ASP B N   1 
ATOM 2959 C CA  . ASP C 1 170 ? 22.225  40.646 141.684 1.00 41.07 ? 446 ASP B CA  1 
ATOM 2960 C C   . ASP C 1 170 ? 22.190  39.188 141.241 1.00 39.02 ? 446 ASP B C   1 
ATOM 2961 O O   . ASP C 1 170 ? 22.251  38.903 140.043 1.00 38.52 ? 446 ASP B O   1 
ATOM 2962 C CB  . ASP C 1 170 ? 20.845  41.285 141.535 1.00 46.14 ? 446 ASP B CB  1 
ATOM 2963 C CG  . ASP C 1 170 ? 19.753  40.479 142.222 1.00 47.73 ? 446 ASP B CG  1 
ATOM 2964 O OD1 . ASP C 1 170 ? 19.289  39.481 141.633 1.00 49.21 ? 446 ASP B OD1 1 
ATOM 2965 O OD2 . ASP C 1 170 ? 19.369  40.833 143.357 1.00 48.61 ? 446 ASP B OD2 1 
ATOM 2966 N N   . ALA C 1 171 ? 22.113  38.265 142.193 1.00 38.19 ? 447 ALA B N   1 
ATOM 2967 C CA  . ALA C 1 171 ? 22.107  36.848 141.852 1.00 36.92 ? 447 ALA B CA  1 
ATOM 2968 C C   . ALA C 1 171 ? 20.933  36.088 142.441 1.00 37.00 ? 447 ALA B C   1 
ATOM 2969 O O   . ALA C 1 171 ? 20.536  36.324 143.585 1.00 41.30 ? 447 ALA B O   1 
ATOM 2970 C CB  . ALA C 1 171 ? 23.408  36.202 142.300 1.00 37.02 ? 447 ALA B CB  1 
ATOM 2971 N N   . PHE C 1 172 ? 20.390  35.166 141.648 1.00 34.18 ? 448 PHE B N   1 
ATOM 2972 C CA  . PHE C 1 172 ? 19.261  34.348 142.071 1.00 32.60 ? 448 PHE B CA  1 
ATOM 2973 C C   . PHE C 1 172 ? 19.706  32.941 142.425 1.00 33.64 ? 448 PHE B C   1 
ATOM 2974 O O   . PHE C 1 172 ? 20.830  32.719 142.875 1.00 35.80 ? 448 PHE B O   1 
ATOM 2975 C CB  . PHE C 1 172 ? 18.200  34.284 140.969 1.00 29.68 ? 448 PHE B CB  1 
ATOM 2976 C CG  . PHE C 1 172 ? 18.683  33.666 139.684 1.00 23.61 ? 448 PHE B CG  1 
ATOM 2977 C CD1 . PHE C 1 172 ? 19.014  32.320 139.614 1.00 24.38 ? 448 PHE B CD1 1 
ATOM 2978 C CD2 . PHE C 1 172 ? 18.779  34.430 138.531 1.00 21.44 ? 448 PHE B CD2 1 
ATOM 2979 C CE1 . PHE C 1 172 ? 19.428  31.744 138.422 1.00 22.07 ? 448 PHE B CE1 1 
ATOM 2980 C CE2 . PHE C 1 172 ? 19.193  33.860 137.329 1.00 16.76 ? 448 PHE B CE2 1 
ATOM 2981 C CZ  . PHE C 1 172 ? 19.518  32.513 137.275 1.00 19.10 ? 448 PHE B CZ  1 
ATOM 2982 N N   . LYS C 1 173 ? 18.808  31.993 142.204 1.00 34.55 ? 449 LYS B N   1 
ATOM 2983 C CA  . LYS C 1 173 ? 19.060  30.594 142.487 1.00 35.73 ? 449 LYS B CA  1 
ATOM 2984 C C   . LYS C 1 173 ? 18.053  29.809 141.666 1.00 38.19 ? 449 LYS B C   1 
ATOM 2985 O O   . LYS C 1 173 ? 16.846  29.955 141.860 1.00 41.50 ? 449 LYS B O   1 
ATOM 2986 C CB  . LYS C 1 173 ? 18.846  30.338 143.976 1.00 33.34 ? 449 LYS B CB  1 
ATOM 2987 C CG  . LYS C 1 173 ? 18.802  28.882 144.389 1.00 38.45 ? 449 LYS B CG  1 
ATOM 2988 C CD  . LYS C 1 173 ? 18.626  28.760 145.900 1.00 41.63 ? 449 LYS B CD  1 
ATOM 2989 C CE  . LYS C 1 173 ? 19.850  29.277 146.677 1.00 40.59 ? 449 LYS B CE  1 
ATOM 2990 N NZ  . LYS C 1 173 ? 20.094  30.750 146.565 1.00 39.52 ? 449 LYS B NZ  1 
ATOM 2991 N N   . PRO C 1 174 ? 18.526  28.971 140.729 1.00 40.19 ? 450 PRO B N   1 
ATOM 2992 C CA  . PRO C 1 174 ? 17.589  28.196 139.915 1.00 40.44 ? 450 PRO B CA  1 
ATOM 2993 C C   . PRO C 1 174 ? 16.409  27.618 140.719 1.00 40.98 ? 450 PRO B C   1 
ATOM 2994 O O   . PRO C 1 174 ? 16.508  27.354 141.924 1.00 41.45 ? 450 PRO B O   1 
ATOM 2995 C CB  . PRO C 1 174 ? 18.485  27.120 139.306 1.00 39.55 ? 450 PRO B CB  1 
ATOM 2996 C CG  . PRO C 1 174 ? 19.754  27.847 139.092 1.00 41.31 ? 450 PRO B CG  1 
ATOM 2997 C CD  . PRO C 1 174 ? 19.916  28.605 140.404 1.00 42.45 ? 450 PRO B CD  1 
ATOM 2998 N N   . ASP C 1 175 ? 15.286  27.444 140.033 1.00 42.49 ? 451 ASP B N   1 
ATOM 2999 C CA  . ASP C 1 175 ? 14.076  26.914 140.641 1.00 44.14 ? 451 ASP B CA  1 
ATOM 3000 C C   . ASP C 1 175 ? 13.880  25.470 140.168 1.00 42.78 ? 451 ASP B C   1 
ATOM 3001 O O   . ASP C 1 175 ? 14.510  25.032 139.199 1.00 44.78 ? 451 ASP B O   1 
ATOM 3002 C CB  . ASP C 1 175 ? 12.884  27.778 140.227 1.00 48.30 ? 451 ASP B CB  1 
ATOM 3003 C CG  . ASP C 1 175 ? 11.695  27.586 141.122 1.00 50.27 ? 451 ASP B CG  1 
ATOM 3004 O OD1 . ASP C 1 175 ? 11.817  27.867 142.332 1.00 53.66 ? 451 ASP B OD1 1 
ATOM 3005 O OD2 . ASP C 1 175 ? 10.642  27.152 140.617 1.00 49.46 ? 451 ASP B OD2 1 
ATOM 3006 N N   . PRO C 1 176 ? 13.020  24.702 140.858 1.00 41.42 ? 452 PRO B N   1 
ATOM 3007 C CA  . PRO C 1 176 ? 12.803  23.314 140.433 1.00 40.43 ? 452 PRO B CA  1 
ATOM 3008 C C   . PRO C 1 176 ? 11.829  23.170 139.256 1.00 40.16 ? 452 PRO B C   1 
ATOM 3009 O O   . PRO C 1 176 ? 12.212  22.726 138.171 1.00 41.63 ? 452 PRO B O   1 
ATOM 3010 C CB  . PRO C 1 176 ? 12.298  22.642 141.710 1.00 41.73 ? 452 PRO B CB  1 
ATOM 3011 C CG  . PRO C 1 176 ? 11.554  23.757 142.401 1.00 42.03 ? 452 PRO B CG  1 
ATOM 3012 C CD  . PRO C 1 176 ? 12.478  24.931 142.213 1.00 41.59 ? 452 PRO B CD  1 
ATOM 3013 N N   . ASN C 1 177 ? 10.574  23.554 139.477 1.00 41.41 ? 453 ASN B N   1 
ATOM 3014 C CA  . ASN C 1 177 ? 9.532   23.476 138.453 1.00 39.98 ? 453 ASN B CA  1 
ATOM 3015 C C   . ASN C 1 177 ? 9.802   24.404 137.268 1.00 40.53 ? 453 ASN B C   1 
ATOM 3016 O O   . ASN C 1 177 ? 9.067   24.394 136.278 1.00 40.77 ? 453 ASN B O   1 
ATOM 3017 C CB  . ASN C 1 177 ? 8.169   23.804 139.077 1.00 40.32 ? 453 ASN B CB  1 
ATOM 3018 C CG  . ASN C 1 177 ? 8.298   24.502 140.425 1.00 43.94 ? 453 ASN B CG  1 
ATOM 3019 O OD1 . ASN C 1 177 ? 8.700   23.892 141.419 1.00 49.29 ? 453 ASN B OD1 1 
ATOM 3020 N ND2 . ASN C 1 177 ? 7.965   25.789 140.462 1.00 43.34 ? 453 ASN B ND2 1 
ATOM 3021 N N   . SER C 1 178 ? 10.857  25.207 137.378 1.00 40.78 ? 454 SER B N   1 
ATOM 3022 C CA  . SER C 1 178 ? 11.231  26.129 136.315 1.00 40.50 ? 454 SER B CA  1 
ATOM 3023 C C   . SER C 1 178 ? 11.534  25.319 135.064 1.00 40.11 ? 454 SER B C   1 
ATOM 3024 O O   . SER C 1 178 ? 12.665  24.876 134.856 1.00 42.64 ? 454 SER B O   1 
ATOM 3025 C CB  . SER C 1 178 ? 12.474  26.932 136.708 1.00 41.12 ? 454 SER B CB  1 
ATOM 3026 O OG  . SER C 1 178 ? 13.647  26.135 136.627 1.00 44.39 ? 454 SER B OG  1 
ATOM 3027 N N   . SER C 1 179 ? 10.512  25.119 134.241 1.00 39.47 ? 455 SER B N   1 
ATOM 3028 C CA  . SER C 1 179 ? 10.647  24.371 132.999 1.00 37.40 ? 455 SER B CA  1 
ATOM 3029 C C   . SER C 1 179 ? 11.888  24.809 132.214 1.00 36.90 ? 455 SER B C   1 
ATOM 3030 O O   . SER C 1 179 ? 12.252  24.199 131.210 1.00 35.87 ? 455 SER B O   1 
ATOM 3031 C CB  . SER C 1 179 ? 9.391   24.587 132.150 1.00 38.24 ? 455 SER B CB  1 
ATOM 3032 O OG  . SER C 1 179 ? 9.554   24.089 130.835 1.00 43.07 ? 455 SER B OG  1 
ATOM 3033 N N   . SER C 1 180 ? 12.543  25.860 132.689 1.00 35.16 ? 456 SER B N   1 
ATOM 3034 C CA  . SER C 1 180 ? 13.712  26.409 132.021 1.00 34.65 ? 456 SER B CA  1 
ATOM 3035 C C   . SER C 1 180 ? 15.046  25.706 132.263 1.00 36.80 ? 456 SER B C   1 
ATOM 3036 O O   . SER C 1 180 ? 15.988  25.898 131.488 1.00 36.20 ? 456 SER B O   1 
ATOM 3037 C CB  . SER C 1 180 ? 13.843  27.897 132.382 1.00 34.39 ? 456 SER B CB  1 
ATOM 3038 O OG  . SER C 1 180 ? 12.690  28.630 131.989 1.00 31.84 ? 456 SER B OG  1 
ATOM 3039 N N   . PHE C 1 181 ? 15.125  24.887 133.313 1.00 36.94 ? 457 PHE B N   1 
ATOM 3040 C CA  . PHE C 1 181 ? 16.376  24.198 133.658 1.00 38.80 ? 457 PHE B CA  1 
ATOM 3041 C C   . PHE C 1 181 ? 16.432  22.656 133.691 1.00 40.90 ? 457 PHE B C   1 
ATOM 3042 O O   . PHE C 1 181 ? 17.500  22.103 133.937 1.00 41.79 ? 457 PHE B O   1 
ATOM 3043 C CB  . PHE C 1 181 ? 16.883  24.703 135.017 1.00 41.57 ? 457 PHE B CB  1 
ATOM 3044 C CG  . PHE C 1 181 ? 17.174  26.181 135.070 1.00 43.51 ? 457 PHE B CG  1 
ATOM 3045 C CD1 . PHE C 1 181 ? 17.485  26.896 133.917 1.00 44.91 ? 457 PHE B CD1 1 
ATOM 3046 C CD2 . PHE C 1 181 ? 17.190  26.847 136.295 1.00 45.12 ? 457 PHE B CD2 1 
ATOM 3047 C CE1 . PHE C 1 181 ? 17.807  28.247 133.984 1.00 45.17 ? 457 PHE B CE1 1 
ATOM 3048 C CE2 . PHE C 1 181 ? 17.512  28.195 136.375 1.00 44.95 ? 457 PHE B CE2 1 
ATOM 3049 C CZ  . PHE C 1 181 ? 17.821  28.896 135.219 1.00 45.68 ? 457 PHE B CZ  1 
ATOM 3050 N N   . LYS C 1 182 ? 15.309  21.971 133.468 1.00 41.40 ? 458 LYS B N   1 
ATOM 3051 C CA  . LYS C 1 182 ? 15.261  20.498 133.498 1.00 43.14 ? 458 LYS B CA  1 
ATOM 3052 C C   . LYS C 1 182 ? 16.411  19.822 132.755 1.00 42.72 ? 458 LYS B C   1 
ATOM 3053 O O   . LYS C 1 182 ? 17.581  20.105 132.998 1.00 43.04 ? 458 LYS B O   1 
ATOM 3054 C CB  . LYS C 1 182 ? 13.944  19.990 132.895 1.00 47.35 ? 458 LYS B CB  1 
ATOM 3055 C CG  . LYS C 1 182 ? 12.695  20.271 133.713 1.00 54.44 ? 458 LYS B CG  1 
ATOM 3056 C CD  . LYS C 1 182 ? 11.457  19.671 133.043 1.00 62.38 ? 458 LYS B CD  1 
ATOM 3057 C CE  . LYS C 1 182 ? 11.548  18.155 132.911 1.00 65.16 ? 458 LYS B CE  1 
ATOM 3058 N NZ  . LYS C 1 182 ? 11.621  17.477 134.238 1.00 67.88 ? 458 LYS B NZ  1 
ATOM 3059 N N   . LYS C 1 183 ? 16.061  18.901 131.862 1.00 40.99 ? 459 LYS B N   1 
ATOM 3060 C CA  . LYS C 1 183 ? 17.045  18.194 131.050 1.00 38.60 ? 459 LYS B CA  1 
ATOM 3061 C C   . LYS C 1 183 ? 16.861  18.680 129.622 1.00 36.71 ? 459 LYS B C   1 
ATOM 3062 O O   . LYS C 1 183 ? 15.747  18.680 129.103 1.00 35.03 ? 459 LYS B O   1 
ATOM 3063 C CB  . LYS C 1 183 ? 16.815  16.681 131.099 1.00 41.76 ? 459 LYS B CB  1 
ATOM 3064 C CG  . LYS C 1 183 ? 17.801  15.869 130.244 1.00 45.27 ? 459 LYS B CG  1 
ATOM 3065 C CD  . LYS C 1 183 ? 17.123  14.651 129.616 1.00 48.50 ? 459 LYS B CD  1 
ATOM 3066 C CE  . LYS C 1 183 ? 15.981  15.079 128.684 1.00 47.77 ? 459 LYS B CE  1 
ATOM 3067 N NZ  . LYS C 1 183 ? 15.286  13.939 128.027 1.00 47.73 ? 459 LYS B NZ  1 
ATOM 3068 N N   . PRO C 1 184 ? 17.952  19.098 128.966 1.00 34.88 ? 460 PRO B N   1 
ATOM 3069 C CA  . PRO C 1 184 ? 17.872  19.586 127.589 1.00 34.75 ? 460 PRO B CA  1 
ATOM 3070 C C   . PRO C 1 184 ? 16.962  18.763 126.676 1.00 34.96 ? 460 PRO B C   1 
ATOM 3071 O O   . PRO C 1 184 ? 16.497  17.686 127.046 1.00 35.41 ? 460 PRO B O   1 
ATOM 3072 C CB  . PRO C 1 184 ? 19.329  19.572 127.149 1.00 32.13 ? 460 PRO B CB  1 
ATOM 3073 C CG  . PRO C 1 184 ? 20.024  19.983 128.396 1.00 33.33 ? 460 PRO B CG  1 
ATOM 3074 C CD  . PRO C 1 184 ? 19.345  19.124 129.443 1.00 35.40 ? 460 PRO B CD  1 
ATOM 3075 N N   . THR C 1 185 ? 16.704  19.299 125.488 1.00 36.53 ? 461 THR B N   1 
ATOM 3076 C CA  . THR C 1 185 ? 15.856  18.658 124.487 1.00 40.12 ? 461 THR B CA  1 
ATOM 3077 C C   . THR C 1 185 ? 16.282  19.219 123.134 1.00 40.97 ? 461 THR B C   1 
ATOM 3078 O O   . THR C 1 185 ? 15.980  18.660 122.078 1.00 43.95 ? 461 THR B O   1 
ATOM 3079 C CB  . THR C 1 185 ? 14.365  18.968 124.746 1.00 40.62 ? 461 THR B CB  1 
ATOM 3080 O OG1 . THR C 1 185 ? 13.980  18.424 126.017 1.00 44.88 ? 461 THR B OG1 1 
ATOM 3081 C CG2 . THR C 1 185 ? 13.491  18.364 123.658 1.00 42.46 ? 461 THR B CG2 1 
ATOM 3082 N N   . GLY C 1 186 ? 16.993  20.342 123.204 1.00 40.57 ? 462 GLY B N   1 
ATOM 3083 C CA  . GLY C 1 186 ? 17.527  21.024 122.036 1.00 39.47 ? 462 GLY B CA  1 
ATOM 3084 C C   . GLY C 1 186 ? 18.902  21.504 122.465 1.00 40.56 ? 462 GLY B C   1 
ATOM 3085 O O   . GLY C 1 186 ? 19.272  21.311 123.624 1.00 42.17 ? 462 GLY B O   1 
ATOM 3086 N N   . GLU C 1 187 ? 19.670  22.125 121.578 1.00 41.14 ? 463 GLU B N   1 
ATOM 3087 C CA  . GLU C 1 187 ? 20.999  22.587 121.979 1.00 40.91 ? 463 GLU B CA  1 
ATOM 3088 C C   . GLU C 1 187 ? 20.929  23.540 123.164 1.00 41.12 ? 463 GLU B C   1 
ATOM 3089 O O   . GLU C 1 187 ? 21.517  23.288 124.213 1.00 42.99 ? 463 GLU B O   1 
ATOM 3090 C CB  . GLU C 1 187 ? 21.712  23.264 120.809 1.00 41.94 ? 463 GLU B CB  1 
ATOM 3091 C CG  . GLU C 1 187 ? 22.248  22.286 119.789 1.00 48.00 ? 463 GLU B CG  1 
ATOM 3092 C CD  . GLU C 1 187 ? 22.709  22.964 118.524 1.00 52.40 ? 463 GLU B CD  1 
ATOM 3093 O OE1 . GLU C 1 187 ? 23.167  22.251 117.604 1.00 55.98 ? 463 GLU B OE1 1 
ATOM 3094 O OE2 . GLU C 1 187 ? 22.608  24.208 118.450 1.00 52.85 ? 463 GLU B OE2 1 
ATOM 3095 N N   . MET C 1 188 ? 20.194  24.630 122.989 1.00 38.83 ? 464 MET B N   1 
ATOM 3096 C CA  . MET C 1 188 ? 20.039  25.625 124.037 1.00 33.84 ? 464 MET B CA  1 
ATOM 3097 C C   . MET C 1 188 ? 18.679  25.442 124.718 1.00 31.84 ? 464 MET B C   1 
ATOM 3098 O O   . MET C 1 188 ? 17.658  25.268 124.044 1.00 33.68 ? 464 MET B O   1 
ATOM 3099 C CB  . MET C 1 188 ? 20.141  27.034 123.439 1.00 35.76 ? 464 MET B CB  1 
ATOM 3100 C CG  . MET C 1 188 ? 21.317  27.249 122.481 1.00 35.39 ? 464 MET B CG  1 
ATOM 3101 S SD  . MET C 1 188 ? 21.126  26.438 120.860 1.00 35.88 ? 464 MET B SD  1 
ATOM 3102 C CE  . MET C 1 188 ? 20.318  27.720 119.916 1.00 34.68 ? 464 MET B CE  1 
ATOM 3103 N N   . ASN C 1 189 ? 18.674  25.485 126.051 1.00 27.98 ? 465 ASN B N   1 
ATOM 3104 C CA  . ASN C 1 189 ? 17.448  25.324 126.833 1.00 27.74 ? 465 ASN B CA  1 
ATOM 3105 C C   . ASN C 1 189 ? 16.667  26.625 127.003 1.00 32.16 ? 465 ASN B C   1 
ATOM 3106 O O   . ASN C 1 189 ? 16.630  27.468 126.099 1.00 31.75 ? 465 ASN B O   1 
ATOM 3107 C CB  . ASN C 1 189 ? 17.766  24.751 128.215 1.00 26.85 ? 465 ASN B CB  1 
ATOM 3108 C CG  . ASN C 1 189 ? 17.034  23.452 128.481 1.00 26.10 ? 465 ASN B CG  1 
ATOM 3109 O OD1 . ASN C 1 189 ? 17.044  22.936 129.602 1.00 30.26 ? 465 ASN B OD1 1 
ATOM 3110 N ND2 . ASN C 1 189 ? 16.395  22.910 127.445 1.00 30.17 ? 465 ASN B ND2 1 
ATOM 3111 N N   . ILE C 1 190 ? 16.034  26.785 128.162 1.00 35.83 ? 466 ILE B N   1 
ATOM 3112 C CA  . ILE C 1 190 ? 15.255  27.990 128.423 1.00 35.98 ? 466 ILE B CA  1 
ATOM 3113 C C   . ILE C 1 190 ? 16.116  28.962 129.226 1.00 37.26 ? 466 ILE B C   1 
ATOM 3114 O O   . ILE C 1 190 ? 16.676  28.589 130.264 1.00 36.65 ? 466 ILE B O   1 
ATOM 3115 C CB  . ILE C 1 190 ? 13.967  27.671 129.210 1.00 36.78 ? 466 ILE B CB  1 
ATOM 3116 C CG1 . ILE C 1 190 ? 13.380  26.325 128.746 1.00 38.64 ? 466 ILE B CG1 1 
ATOM 3117 C CG2 . ILE C 1 190 ? 12.959  28.828 129.051 1.00 37.43 ? 466 ILE B CG2 1 
ATOM 3118 C CD1 . ILE C 1 190 ? 12.944  26.271 127.288 1.00 39.15 ? 466 ILE B CD1 1 
ATOM 3119 N N   . ALA C 1 191 ? 16.210  30.202 128.742 1.00 38.00 ? 467 ALA B N   1 
ATOM 3120 C CA  . ALA C 1 191 ? 17.033  31.234 129.371 1.00 36.00 ? 467 ALA B CA  1 
ATOM 3121 C C   . ALA C 1 191 ? 16.357  32.030 130.474 1.00 35.95 ? 467 ALA B C   1 
ATOM 3122 O O   . ALA C 1 191 ? 15.318  32.657 130.263 1.00 40.68 ? 467 ALA B O   1 
ATOM 3123 C CB  . ALA C 1 191 ? 17.564  32.185 128.307 1.00 34.04 ? 467 ALA B CB  1 
ATOM 3124 N N   . SER C 1 192 ? 16.973  32.004 131.651 1.00 34.58 ? 468 SER B N   1 
ATOM 3125 C CA  . SER C 1 192 ? 16.480  32.725 132.818 1.00 33.57 ? 468 SER B CA  1 
ATOM 3126 C C   . SER C 1 192 ? 17.413  33.879 133.167 1.00 35.08 ? 468 SER B C   1 
ATOM 3127 O O   . SER C 1 192 ? 18.374  33.695 133.918 1.00 38.29 ? 468 SER B O   1 
ATOM 3128 C CB  . SER C 1 192 ? 16.388  31.792 134.020 1.00 32.62 ? 468 SER B CB  1 
ATOM 3129 O OG  . SER C 1 192 ? 16.266  32.549 135.213 1.00 34.23 ? 468 SER B OG  1 
ATOM 3130 N N   . GLY C 1 193 ? 17.126  35.062 132.623 1.00 35.54 ? 469 GLY B N   1 
ATOM 3131 C CA  . GLY C 1 193 ? 17.954  36.226 132.888 1.00 37.62 ? 469 GLY B CA  1 
ATOM 3132 C C   . GLY C 1 193 ? 17.164  37.405 133.411 1.00 36.77 ? 469 GLY B C   1 
ATOM 3133 O O   . GLY C 1 193 ? 16.355  37.247 134.321 1.00 40.44 ? 469 GLY B O   1 
ATOM 3134 N N   . CYS C 1 194 ? 17.394  38.585 132.841 1.00 36.21 ? 470 CYS B N   1 
ATOM 3135 C CA  . CYS C 1 194 ? 16.692  39.797 133.269 1.00 34.84 ? 470 CYS B CA  1 
ATOM 3136 C C   . CYS C 1 194 ? 16.315  40.692 132.085 1.00 33.67 ? 470 CYS B C   1 
ATOM 3137 O O   . CYS C 1 194 ? 17.117  40.893 131.168 1.00 34.24 ? 470 CYS B O   1 
ATOM 3138 C CB  . CYS C 1 194 ? 17.560  40.595 134.244 1.00 36.29 ? 470 CYS B CB  1 
ATOM 3139 S SG  . CYS C 1 194 ? 18.151  39.650 135.665 1.00 47.05 ? 470 CYS B SG  1 
ATOM 3140 N N   . PRO C 1 195 ? 15.082  41.241 132.093 1.00 33.04 ? 471 PRO B N   1 
ATOM 3141 C CA  . PRO C 1 195 ? 14.569  42.123 131.032 1.00 32.38 ? 471 PRO B CA  1 
ATOM 3142 C C   . PRO C 1 195 ? 14.958  43.584 131.289 1.00 33.71 ? 471 PRO B C   1 
ATOM 3143 O O   . PRO C 1 195 ? 15.141  44.384 130.363 1.00 34.38 ? 471 PRO B O   1 
ATOM 3144 C CB  . PRO C 1 195 ? 13.061  41.892 131.105 1.00 31.68 ? 471 PRO B CB  1 
ATOM 3145 C CG  . PRO C 1 195 ? 12.838  41.769 132.585 1.00 32.12 ? 471 PRO B CG  1 
ATOM 3146 C CD  . PRO C 1 195 ? 14.019  40.928 133.072 1.00 33.45 ? 471 PRO B CD  1 
ATOM 3147 N N   . VAL C 1 196 ? 15.081  43.908 132.570 1.00 32.20 ? 472 VAL B N   1 
ATOM 3148 C CA  . VAL C 1 196 ? 15.459  45.233 133.013 1.00 30.47 ? 472 VAL B CA  1 
ATOM 3149 C C   . VAL C 1 196 ? 16.626  45.061 133.978 1.00 30.85 ? 472 VAL B C   1 
ATOM 3150 O O   . VAL C 1 196 ? 16.518  45.361 135.167 1.00 30.55 ? 472 VAL B O   1 
ATOM 3151 C CB  . VAL C 1 196 ? 14.298  45.906 133.728 1.00 33.86 ? 472 VAL B CB  1 
ATOM 3152 C CG1 . VAL C 1 196 ? 13.163  46.149 132.753 1.00 36.63 ? 472 VAL B CG1 1 
ATOM 3153 C CG2 . VAL C 1 196 ? 13.833  45.026 134.869 1.00 31.35 ? 472 VAL B CG2 1 
ATOM 3154 N N   . PHE C 1 197 ? 17.740  44.558 133.445 1.00 29.64 ? 473 PHE B N   1 
ATOM 3155 C CA  . PHE C 1 197 ? 18.958  44.315 134.216 1.00 30.41 ? 473 PHE B CA  1 
ATOM 3156 C C   . PHE C 1 197 ? 19.795  45.601 134.282 1.00 32.30 ? 473 PHE B C   1 
ATOM 3157 O O   . PHE C 1 197 ? 20.366  45.936 135.326 1.00 37.35 ? 473 PHE B O   1 
ATOM 3158 C CB  . PHE C 1 197 ? 19.761  43.171 133.558 1.00 27.26 ? 473 PHE B CB  1 
ATOM 3159 C CG  . PHE C 1 197 ? 20.904  42.638 134.409 1.00 26.63 ? 473 PHE B CG  1 
ATOM 3160 C CD1 . PHE C 1 197 ? 20.662  42.067 135.664 1.00 23.67 ? 473 PHE B CD1 1 
ATOM 3161 C CD2 . PHE C 1 197 ? 22.225  42.708 133.953 1.00 25.61 ? 473 PHE B CD2 1 
ATOM 3162 C CE1 . PHE C 1 197 ? 21.716  41.579 136.449 1.00 21.86 ? 473 PHE B CE1 1 
ATOM 3163 C CE2 . PHE C 1 197 ? 23.281  42.225 134.728 1.00 24.08 ? 473 PHE B CE2 1 
ATOM 3164 C CZ  . PHE C 1 197 ? 23.024  41.660 135.977 1.00 24.37 ? 473 PHE B CZ  1 
ATOM 3165 N N   . VAL C 1 198 ? 19.848  46.329 133.172 1.00 31.02 ? 474 VAL B N   1 
ATOM 3166 C CA  . VAL C 1 198 ? 20.617  47.563 133.116 1.00 26.20 ? 474 VAL B CA  1 
ATOM 3167 C C   . VAL C 1 198 ? 19.896  48.636 132.319 1.00 27.81 ? 474 VAL B C   1 
ATOM 3168 O O   . VAL C 1 198 ? 19.710  48.481 131.113 1.00 29.98 ? 474 VAL B O   1 
ATOM 3169 C CB  . VAL C 1 198 ? 21.977  47.320 132.468 1.00 27.22 ? 474 VAL B CB  1 
ATOM 3170 C CG1 . VAL C 1 198 ? 22.668  48.639 132.195 1.00 27.71 ? 474 VAL B CG1 1 
ATOM 3171 C CG2 . VAL C 1 198 ? 22.823  46.458 133.378 1.00 32.31 ? 474 VAL B CG2 1 
ATOM 3172 N N   . ALA C 1 199 ? 19.512  49.723 132.993 1.00 26.96 ? 475 ALA B N   1 
ATOM 3173 C CA  . ALA C 1 199 ? 18.805  50.841 132.361 1.00 23.94 ? 475 ALA B CA  1 
ATOM 3174 C C   . ALA C 1 199 ? 19.594  51.414 131.195 1.00 24.29 ? 475 ALA B C   1 
ATOM 3175 O O   . ALA C 1 199 ? 20.737  51.812 131.363 1.00 26.55 ? 475 ALA B O   1 
ATOM 3176 C CB  . ALA C 1 199 ? 18.546  51.911 133.382 1.00 25.20 ? 475 ALA B CB  1 
ATOM 3177 N N   . GLN C 1 200 ? 18.974  51.470 130.021 1.00 23.55 ? 476 GLN B N   1 
ATOM 3178 C CA  . GLN C 1 200 ? 19.635  51.962 128.814 1.00 23.22 ? 476 GLN B CA  1 
ATOM 3179 C C   . GLN C 1 200 ? 20.633  53.080 129.068 1.00 25.86 ? 476 GLN B C   1 
ATOM 3180 O O   . GLN C 1 200 ? 21.774  53.032 128.594 1.00 30.91 ? 476 GLN B O   1 
ATOM 3181 C CB  . GLN C 1 200 ? 18.602  52.436 127.790 1.00 20.35 ? 476 GLN B CB  1 
ATOM 3182 C CG  . GLN C 1 200 ? 18.720  51.768 126.409 1.00 20.56 ? 476 GLN B CG  1 
ATOM 3183 C CD  . GLN C 1 200 ? 19.890  52.273 125.569 1.00 23.23 ? 476 GLN B CD  1 
ATOM 3184 O OE1 . GLN C 1 200 ? 21.029  52.332 126.036 1.00 27.70 ? 476 GLN B OE1 1 
ATOM 3185 N NE2 . GLN C 1 200 ? 19.612  52.624 124.314 1.00 24.82 ? 476 GLN B NE2 1 
ATOM 3186 N N   . THR C 1 201 ? 20.204  54.096 129.807 1.00 26.97 ? 477 THR B N   1 
ATOM 3187 C CA  . THR C 1 201 ? 21.077  55.222 130.116 1.00 27.47 ? 477 THR B CA  1 
ATOM 3188 C C   . THR C 1 201 ? 22.289  54.737 130.922 1.00 28.19 ? 477 THR B C   1 
ATOM 3189 O O   . THR C 1 201 ? 23.361  54.490 130.355 1.00 30.17 ? 477 THR B O   1 
ATOM 3190 C CB  . THR C 1 201 ? 20.312  56.309 130.905 1.00 30.24 ? 477 THR B CB  1 
ATOM 3191 O OG1 . THR C 1 201 ? 19.981  55.824 132.213 1.00 32.39 ? 477 THR B OG1 1 
ATOM 3192 C CG2 . THR C 1 201 ? 19.028  56.671 130.174 1.00 33.34 ? 477 THR B CG2 1 
ATOM 3193 N N   . VAL C 1 202 ? 22.098  54.581 132.233 1.00 28.32 ? 478 VAL B N   1 
ATOM 3194 C CA  . VAL C 1 202 ? 23.138  54.132 133.165 1.00 28.38 ? 478 VAL B CA  1 
ATOM 3195 C C   . VAL C 1 202 ? 24.282  53.304 132.568 1.00 32.13 ? 478 VAL B C   1 
ATOM 3196 O O   . VAL C 1 202 ? 25.433  53.442 132.987 1.00 32.40 ? 478 VAL B O   1 
ATOM 3197 C CB  . VAL C 1 202 ? 22.505  53.346 134.343 1.00 26.24 ? 478 VAL B CB  1 
ATOM 3198 C CG1 . VAL C 1 202 ? 23.582  52.726 135.208 1.00 22.08 ? 478 VAL B CG1 1 
ATOM 3199 C CG2 . VAL C 1 202 ? 21.648  54.282 135.180 1.00 24.75 ? 478 VAL B CG2 1 
ATOM 3200 N N   . LEU C 1 203 ? 23.977  52.446 131.601 1.00 35.60 ? 479 LEU B N   1 
ATOM 3201 C CA  . LEU C 1 203 ? 25.013  51.630 130.972 1.00 37.19 ? 479 LEU B CA  1 
ATOM 3202 C C   . LEU C 1 203 ? 26.011  52.547 130.276 1.00 40.17 ? 479 LEU B C   1 
ATOM 3203 O O   . LEU C 1 203 ? 27.185  52.598 130.637 1.00 42.41 ? 479 LEU B O   1 
ATOM 3204 C CB  . LEU C 1 203 ? 24.395  50.666 129.948 1.00 36.71 ? 479 LEU B CB  1 
ATOM 3205 C CG  . LEU C 1 203 ? 25.316  49.704 129.192 1.00 34.16 ? 479 LEU B CG  1 
ATOM 3206 C CD1 . LEU C 1 203 ? 25.988  48.777 130.169 1.00 32.09 ? 479 LEU B CD1 1 
ATOM 3207 C CD2 . LEU C 1 203 ? 24.523  48.914 128.194 1.00 34.83 ? 479 LEU B CD2 1 
ATOM 3208 N N   . GLU C 1 204 ? 25.523  53.279 129.282 1.00 42.15 ? 480 GLU B N   1 
ATOM 3209 C CA  . GLU C 1 204 ? 26.347  54.199 128.504 1.00 45.52 ? 480 GLU B CA  1 
ATOM 3210 C C   . GLU C 1 204 ? 26.543  55.529 129.221 1.00 49.14 ? 480 GLU B C   1 
ATOM 3211 O O   . GLU C 1 204 ? 27.521  56.245 128.982 1.00 49.73 ? 480 GLU B O   1 
ATOM 3212 C CB  . GLU C 1 204 ? 25.696  54.424 127.129 1.00 45.07 ? 480 GLU B CB  1 
ATOM 3213 C CG  . GLU C 1 204 ? 24.185  54.137 127.094 1.00 42.69 ? 480 GLU B CG  1 
ATOM 3214 C CD  . GLU C 1 204 ? 23.591  54.259 125.702 1.00 41.10 ? 480 GLU B CD  1 
ATOM 3215 O OE1 . GLU C 1 204 ? 23.403  55.396 125.217 1.00 41.79 ? 480 GLU B OE1 1 
ATOM 3216 O OE2 . GLU C 1 204 ? 23.311  53.212 125.088 1.00 37.49 ? 480 GLU B OE2 1 
ATOM 3217 N N   . ASN C 1 205 ? 25.593  55.834 130.101 1.00 53.47 ? 481 ASN B N   1 
ATOM 3218 C CA  . ASN C 1 205 ? 25.568  57.059 130.896 1.00 54.83 ? 481 ASN B CA  1 
ATOM 3219 C C   . ASN C 1 205 ? 26.615  56.998 132.010 1.00 53.32 ? 481 ASN B C   1 
ATOM 3220 O O   . ASN C 1 205 ? 26.724  57.921 132.825 1.00 54.67 ? 481 ASN B O   1 
ATOM 3221 C CB  . ASN C 1 205 ? 24.154  57.233 131.479 1.00 60.41 ? 481 ASN B CB  1 
ATOM 3222 C CG  . ASN C 1 205 ? 24.051  58.369 132.470 1.00 63.24 ? 481 ASN B CG  1 
ATOM 3223 O OD1 . ASN C 1 205 ? 24.369  59.513 132.158 1.00 67.87 ? 481 ASN B OD1 1 
ATOM 3224 N ND2 . ASN C 1 205 ? 23.585  58.059 133.675 1.00 63.59 ? 481 ASN B ND2 1 
ATOM 3225 N N   . GLY C 1 206 ? 27.397  55.915 132.024 1.00 48.83 ? 482 GLY B N   1 
ATOM 3226 C CA  . GLY C 1 206 ? 28.415  55.749 133.051 1.00 44.02 ? 482 GLY B CA  1 
ATOM 3227 C C   . GLY C 1 206 ? 29.767  55.168 132.652 1.00 38.86 ? 482 GLY B C   1 
ATOM 3228 O O   . GLY C 1 206 ? 30.157  55.163 131.482 1.00 37.71 ? 482 GLY B O   1 
ATOM 3229 N N   . THR C 1 207 ? 30.475  54.673 133.663 1.00 36.30 ? 483 THR B N   1 
ATOM 3230 C CA  . THR C 1 207 ? 31.800  54.090 133.517 1.00 32.25 ? 483 THR B CA  1 
ATOM 3231 C C   . THR C 1 207 ? 31.815  52.722 132.857 1.00 31.25 ? 483 THR B C   1 
ATOM 3232 O O   . THR C 1 207 ? 32.834  52.287 132.324 1.00 33.24 ? 483 THR B O   1 
ATOM 3233 C CB  . THR C 1 207 ? 32.457  53.967 134.881 1.00 32.33 ? 483 THR B CB  1 
ATOM 3234 O OG1 . THR C 1 207 ? 31.515  53.420 135.810 1.00 32.09 ? 483 THR B OG1 1 
ATOM 3235 C CG2 . THR C 1 207 ? 32.902  55.323 135.373 1.00 31.72 ? 483 THR B CG2 1 
ATOM 3236 N N   . TYR C 1 208 ? 30.681  52.042 132.910 1.00 29.26 ? 484 TYR B N   1 
ATOM 3237 C CA  . TYR C 1 208 ? 30.542  50.723 132.322 1.00 24.97 ? 484 TYR B CA  1 
ATOM 3238 C C   . TYR C 1 208 ? 31.061  50.735 130.896 1.00 29.09 ? 484 TYR B C   1 
ATOM 3239 O O   . TYR C 1 208 ? 32.217  50.400 130.653 1.00 31.81 ? 484 TYR B O   1 
ATOM 3240 C CB  . TYR C 1 208 ? 29.075  50.310 132.376 1.00 22.16 ? 484 TYR B CB  1 
ATOM 3241 C CG  . TYR C 1 208 ? 28.565  50.411 133.777 1.00 16.21 ? 484 TYR B CG  1 
ATOM 3242 C CD1 . TYR C 1 208 ? 29.068  49.580 134.770 1.00 15.43 ? 484 TYR B CD1 1 
ATOM 3243 C CD2 . TYR C 1 208 ? 27.682  51.418 134.147 1.00 17.84 ? 484 TYR B CD2 1 
ATOM 3244 C CE1 . TYR C 1 208 ? 28.715  49.752 136.109 1.00 12.40 ? 484 TYR B CE1 1 
ATOM 3245 C CE2 . TYR C 1 208 ? 27.322  51.608 135.487 1.00 15.85 ? 484 TYR B CE2 1 
ATOM 3246 C CZ  . TYR C 1 208 ? 27.846  50.770 136.466 1.00 13.60 ? 484 TYR B CZ  1 
ATOM 3247 O OH  . TYR C 1 208 ? 27.530  50.966 137.797 1.00 20.53 ? 484 TYR B OH  1 
ATOM 3248 N N   . ILE C 1 209 ? 30.217  51.139 129.954 1.00 32.31 ? 485 ILE B N   1 
ATOM 3249 C CA  . ILE C 1 209 ? 30.628  51.180 128.560 1.00 35.08 ? 485 ILE B CA  1 
ATOM 3250 C C   . ILE C 1 209 ? 31.878  52.044 128.393 1.00 36.99 ? 485 ILE B C   1 
ATOM 3251 O O   . ILE C 1 209 ? 31.824  53.276 128.470 1.00 39.31 ? 485 ILE B O   1 
ATOM 3252 C CB  . ILE C 1 209 ? 29.504  51.728 127.664 1.00 36.32 ? 485 ILE B CB  1 
ATOM 3253 C CG1 . ILE C 1 209 ? 28.285  50.816 127.750 1.00 40.92 ? 485 ILE B CG1 1 
ATOM 3254 C CG2 . ILE C 1 209 ? 29.975  51.803 126.218 1.00 33.28 ? 485 ILE B CG2 1 
ATOM 3255 C CD1 . ILE C 1 209 ? 27.101  51.332 127.000 1.00 42.96 ? 485 ILE B CD1 1 
ATOM 3256 N N   . LYS C 1 210 ? 33.006  51.374 128.166 1.00 36.52 ? 486 LYS B N   1 
ATOM 3257 C CA  . LYS C 1 210 ? 34.290  52.037 127.984 1.00 37.39 ? 486 LYS B CA  1 
ATOM 3258 C C   . LYS C 1 210 ? 35.008  51.336 126.838 1.00 37.41 ? 486 LYS B C   1 
ATOM 3259 O O   . LYS C 1 210 ? 34.872  50.126 126.667 1.00 39.40 ? 486 LYS B O   1 
ATOM 3260 C CB  . LYS C 1 210 ? 35.112  51.925 129.270 1.00 35.80 ? 486 LYS B CB  1 
ATOM 3261 C CG  . LYS C 1 210 ? 36.116  53.042 129.480 1.00 38.75 ? 486 LYS B CG  1 
ATOM 3262 C CD  . LYS C 1 210 ? 37.184  53.058 128.406 1.00 39.75 ? 486 LYS B CD  1 
ATOM 3263 C CE  . LYS C 1 210 ? 38.263  54.076 128.717 1.00 40.90 ? 486 LYS B CE  1 
ATOM 3264 N NZ  . LYS C 1 210 ? 39.345  54.020 127.703 1.00 41.50 ? 486 LYS B NZ  1 
ATOM 3265 N N   . ASP C 1 211 ? 35.753  52.102 126.047 1.00 41.66 ? 487 ASP B N   1 
ATOM 3266 C CA  . ASP C 1 211 ? 36.500  51.564 124.908 1.00 44.33 ? 487 ASP B CA  1 
ATOM 3267 C C   . ASP C 1 211 ? 35.597  50.932 123.839 1.00 42.19 ? 487 ASP B C   1 
ATOM 3268 O O   . ASP C 1 211 ? 36.035  50.079 123.066 1.00 43.58 ? 487 ASP B O   1 
ATOM 3269 C CB  . ASP C 1 211 ? 37.545  50.538 125.392 1.00 47.76 ? 487 ASP B CB  1 
ATOM 3270 C CG  . ASP C 1 211 ? 38.507  50.095 124.282 1.00 50.27 ? 487 ASP B CG  1 
ATOM 3271 O OD1 . ASP C 1 211 ? 39.084  50.980 123.609 1.00 50.09 ? 487 ASP B OD1 1 
ATOM 3272 O OD2 . ASP C 1 211 ? 38.693  48.865 124.092 1.00 53.06 ? 487 ASP B OD2 1 
ATOM 3273 N N   . ASP C 1 212 ? 34.337  51.347 123.791 1.00 40.02 ? 488 ASP B N   1 
ATOM 3274 C CA  . ASP C 1 212 ? 33.427  50.816 122.787 1.00 38.47 ? 488 ASP B CA  1 
ATOM 3275 C C   . ASP C 1 212 ? 33.235  49.328 123.027 1.00 36.31 ? 488 ASP B C   1 
ATOM 3276 O O   . ASP C 1 212 ? 32.944  48.586 122.097 1.00 34.90 ? 488 ASP B O   1 
ATOM 3277 C CB  . ASP C 1 212 ? 34.017  51.047 121.388 1.00 39.68 ? 488 ASP B CB  1 
ATOM 3278 C CG  . ASP C 1 212 ? 32.981  50.960 120.284 1.00 43.41 ? 488 ASP B CG  1 
ATOM 3279 O OD1 . ASP C 1 212 ? 31.953  51.662 120.364 1.00 43.79 ? 488 ASP B OD1 1 
ATOM 3280 O OD2 . ASP C 1 212 ? 33.206  50.203 119.320 1.00 44.20 ? 488 ASP B OD2 1 
ATOM 3281 N N   . THR C 1 213 ? 33.410  48.888 124.272 1.00 33.68 ? 489 THR B N   1 
ATOM 3282 C CA  . THR C 1 213 ? 33.236  47.474 124.599 1.00 31.81 ? 489 THR B CA  1 
ATOM 3283 C C   . THR C 1 213 ? 32.654  47.237 125.994 1.00 31.76 ? 489 THR B C   1 
ATOM 3284 O O   . THR C 1 213 ? 32.717  48.113 126.864 1.00 31.14 ? 489 THR B O   1 
ATOM 3285 C CB  . THR C 1 213 ? 34.575  46.671 124.500 1.00 33.60 ? 489 THR B CB  1 
ATOM 3286 O OG1 . THR C 1 213 ? 35.436  47.019 125.590 1.00 33.17 ? 489 THR B OG1 1 
ATOM 3287 C CG2 . THR C 1 213 ? 35.281  46.958 123.195 1.00 32.09 ? 489 THR B CG2 1 
ATOM 3288 N N   . ILE C 1 214 ? 32.091  46.038 126.183 1.00 31.25 ? 490 ILE B N   1 
ATOM 3289 C CA  . ILE C 1 214 ? 31.492  45.612 127.450 1.00 31.38 ? 490 ILE B CA  1 
ATOM 3290 C C   . ILE C 1 214 ? 31.948  44.211 127.817 1.00 31.01 ? 490 ILE B C   1 
ATOM 3291 O O   . ILE C 1 214 ? 32.053  43.333 126.961 1.00 32.44 ? 490 ILE B O   1 
ATOM 3292 C CB  . ILE C 1 214 ? 29.945  45.612 127.388 1.00 33.00 ? 490 ILE B CB  1 
ATOM 3293 C CG1 . ILE C 1 214 ? 29.468  44.919 126.110 1.00 34.40 ? 490 ILE B CG1 1 
ATOM 3294 C CG2 . ILE C 1 214 ? 29.419  47.030 127.446 1.00 31.20 ? 490 ILE B CG2 1 
ATOM 3295 C CD1 . ILE C 1 214 ? 27.976  45.077 125.844 1.00 34.91 ? 490 ILE B CD1 1 
ATOM 3296 N N   . PHE C 1 215 ? 32.226  44.020 129.102 1.00 29.43 ? 491 PHE B N   1 
ATOM 3297 C CA  . PHE C 1 215 ? 32.679  42.734 129.630 1.00 28.40 ? 491 PHE B CA  1 
ATOM 3298 C C   . PHE C 1 215 ? 31.626  42.167 130.562 1.00 27.77 ? 491 PHE B C   1 
ATOM 3299 O O   . PHE C 1 215 ? 31.158  42.888 131.450 1.00 28.90 ? 491 PHE B O   1 
ATOM 3300 C CB  . PHE C 1 215 ? 33.986  42.898 130.417 1.00 33.73 ? 491 PHE B CB  1 
ATOM 3301 C CG  . PHE C 1 215 ? 35.194  43.069 129.554 1.00 37.43 ? 491 PHE B CG  1 
ATOM 3302 C CD1 . PHE C 1 215 ? 35.542  44.319 129.065 1.00 37.26 ? 491 PHE B CD1 1 
ATOM 3303 C CD2 . PHE C 1 215 ? 35.947  41.965 129.181 1.00 37.62 ? 491 PHE B CD2 1 
ATOM 3304 C CE1 . PHE C 1 215 ? 36.618  44.469 128.211 1.00 36.42 ? 491 PHE B CE1 1 
ATOM 3305 C CE2 . PHE C 1 215 ? 37.021  42.101 128.331 1.00 36.97 ? 491 PHE B CE2 1 
ATOM 3306 C CZ  . PHE C 1 215 ? 37.360  43.358 127.841 1.00 37.65 ? 491 PHE B CZ  1 
ATOM 3307 N N   . ILE C 1 216 ? 31.260  40.891 130.369 1.00 27.10 ? 492 ILE B N   1 
ATOM 3308 C CA  . ILE C 1 216 ? 30.246  40.231 131.209 1.00 25.54 ? 492 ILE B CA  1 
ATOM 3309 C C   . ILE C 1 216 ? 30.835  39.036 131.948 1.00 25.59 ? 492 ILE B C   1 
ATOM 3310 O O   . ILE C 1 216 ? 31.780  38.429 131.480 1.00 28.01 ? 492 ILE B O   1 
ATOM 3311 C CB  . ILE C 1 216 ? 29.001  39.770 130.379 1.00 24.25 ? 492 ILE B CB  1 
ATOM 3312 C CG1 . ILE C 1 216 ? 28.348  40.971 129.685 1.00 24.61 ? 492 ILE B CG1 1 
ATOM 3313 C CG2 . ILE C 1 216 ? 27.955  39.168 131.305 1.00 24.84 ? 492 ILE B CG2 1 
ATOM 3314 C CD1 . ILE C 1 216 ? 28.156  40.791 128.206 1.00 21.68 ? 492 ILE B CD1 1 
ATOM 3315 N N   . LYS C 1 217 ? 30.275  38.710 133.108 1.00 24.96 ? 493 LYS B N   1 
ATOM 3316 C CA  . LYS C 1 217 ? 30.788  37.605 133.915 1.00 24.21 ? 493 LYS B CA  1 
ATOM 3317 C C   . LYS C 1 217 ? 29.725  36.769 134.661 1.00 25.11 ? 493 LYS B C   1 
ATOM 3318 O O   . LYS C 1 217 ? 29.320  37.133 135.769 1.00 28.90 ? 493 LYS B O   1 
ATOM 3319 C CB  . LYS C 1 217 ? 31.801  38.164 134.924 1.00 23.36 ? 493 LYS B CB  1 
ATOM 3320 C CG  . LYS C 1 217 ? 32.260  37.179 135.987 1.00 24.81 ? 493 LYS B CG  1 
ATOM 3321 C CD  . LYS C 1 217 ? 33.176  37.849 137.002 1.00 22.27 ? 493 LYS B CD  1 
ATOM 3322 C CE  . LYS C 1 217 ? 33.419  36.947 138.208 1.00 25.14 ? 493 LYS B CE  1 
ATOM 3323 N NZ  . LYS C 1 217 ? 34.224  37.580 139.298 1.00 26.49 ? 493 LYS B NZ  1 
ATOM 3324 N N   . VAL C 1 218 ? 29.288  35.650 134.071 1.00 25.75 ? 494 VAL B N   1 
ATOM 3325 C CA  . VAL C 1 218 ? 28.294  34.778 134.722 1.00 20.97 ? 494 VAL B CA  1 
ATOM 3326 C C   . VAL C 1 218 ? 29.031  33.822 135.687 1.00 19.25 ? 494 VAL B C   1 
ATOM 3327 O O   . VAL C 1 218 ? 29.669  32.846 135.286 1.00 22.19 ? 494 VAL B O   1 
ATOM 3328 C CB  . VAL C 1 218 ? 27.441  33.960 133.675 1.00 22.15 ? 494 VAL B CB  1 
ATOM 3329 C CG1 . VAL C 1 218 ? 26.264  33.257 134.370 1.00 22.76 ? 494 VAL B CG1 1 
ATOM 3330 C CG2 . VAL C 1 218 ? 26.907  34.884 132.583 1.00 19.03 ? 494 VAL B CG2 1 
ATOM 3331 N N   . ILE C 1 219 ? 28.919  34.134 136.970 1.00 19.94 ? 495 ILE B N   1 
ATOM 3332 C CA  . ILE C 1 219 ? 29.578  33.403 138.033 1.00 23.02 ? 495 ILE B CA  1 
ATOM 3333 C C   . ILE C 1 219 ? 28.807  32.206 138.544 1.00 24.74 ? 495 ILE B C   1 
ATOM 3334 O O   . ILE C 1 219 ? 28.323  32.214 139.671 1.00 27.79 ? 495 ILE B O   1 
ATOM 3335 C CB  . ILE C 1 219 ? 29.834  34.346 139.210 1.00 25.70 ? 495 ILE B CB  1 
ATOM 3336 C CG1 . ILE C 1 219 ? 30.482  35.649 138.696 1.00 24.69 ? 495 ILE B CG1 1 
ATOM 3337 C CG2 . ILE C 1 219 ? 30.672  33.638 140.259 1.00 23.28 ? 495 ILE B CG2 1 
ATOM 3338 C CD1 . ILE C 1 219 ? 30.262  36.878 139.587 1.00 22.81 ? 495 ILE B CD1 1 
ATOM 3339 N N   . VAL C 1 220 ? 28.701  31.174 137.715 1.00 27.48 ? 496 VAL B N   1 
ATOM 3340 C CA  . VAL C 1 220 ? 27.997  29.944 138.088 1.00 31.92 ? 496 VAL B CA  1 
ATOM 3341 C C   . VAL C 1 220 ? 28.674  29.293 139.286 1.00 34.61 ? 496 VAL B C   1 
ATOM 3342 O O   . VAL C 1 220 ? 29.893  29.119 139.302 1.00 36.79 ? 496 VAL B O   1 
ATOM 3343 C CB  . VAL C 1 220 ? 27.984  28.936 136.920 1.00 29.19 ? 496 VAL B CB  1 
ATOM 3344 C CG1 . VAL C 1 220 ? 28.487  27.584 137.373 1.00 31.73 ? 496 VAL B CG1 1 
ATOM 3345 C CG2 . VAL C 1 220 ? 26.591  28.803 136.386 1.00 30.06 ? 496 VAL B CG2 1 
ATOM 3346 N N   . ASP C 1 221 ? 27.891  28.916 140.286 1.00 37.07 ? 497 ASP B N   1 
ATOM 3347 C CA  . ASP C 1 221 ? 28.483  28.305 141.459 1.00 39.31 ? 497 ASP B CA  1 
ATOM 3348 C C   . ASP C 1 221 ? 28.705  26.809 141.314 1.00 43.02 ? 497 ASP B C   1 
ATOM 3349 O O   . ASP C 1 221 ? 27.755  26.026 141.334 1.00 46.45 ? 497 ASP B O   1 
ATOM 3350 C CB  . ASP C 1 221 ? 27.627  28.563 142.693 1.00 38.04 ? 497 ASP B CB  1 
ATOM 3351 C CG  . ASP C 1 221 ? 28.283  28.057 143.959 1.00 38.53 ? 497 ASP B CG  1 
ATOM 3352 O OD1 . ASP C 1 221 ? 29.432  28.473 144.225 1.00 43.05 ? 497 ASP B OD1 1 
ATOM 3353 O OD2 . ASP C 1 221 ? 27.662  27.248 144.682 1.00 36.58 ? 497 ASP B OD2 1 
ATOM 3354 N N   . THR C 1 222 ? 29.972  26.426 141.172 1.00 45.93 ? 498 THR B N   1 
ATOM 3355 C CA  . THR C 1 222 ? 30.367  25.027 141.055 1.00 47.27 ? 498 THR B CA  1 
ATOM 3356 C C   . THR C 1 222 ? 31.019  24.589 142.359 1.00 50.90 ? 498 THR B C   1 
ATOM 3357 O O   . THR C 1 222 ? 30.923  23.430 142.747 1.00 50.97 ? 498 THR B O   1 
ATOM 3358 C CB  . THR C 1 222 ? 31.353  24.822 139.902 1.00 43.40 ? 498 THR B CB  1 
ATOM 3359 O OG1 . THR C 1 222 ? 30.644  24.890 138.659 1.00 42.63 ? 498 THR B OG1 1 
ATOM 3360 C CG2 . THR C 1 222 ? 32.053  23.478 140.025 1.00 39.65 ? 498 THR B CG2 1 
ATOM 3361 N N   . SER C 1 223 ? 31.673  25.534 143.032 1.00 54.44 ? 499 SER B N   1 
ATOM 3362 C CA  . SER C 1 223 ? 32.336  25.276 144.312 1.00 57.43 ? 499 SER B CA  1 
ATOM 3363 C C   . SER C 1 223 ? 31.430  24.471 145.247 1.00 58.55 ? 499 SER B C   1 
ATOM 3364 O O   . SER C 1 223 ? 31.846  23.442 145.784 1.00 60.20 ? 499 SER B O   1 
ATOM 3365 C CB  . SER C 1 223 ? 32.734  26.601 144.985 1.00 57.86 ? 499 SER B CB  1 
ATOM 3366 O OG  . SER C 1 223 ? 33.361  26.393 146.241 1.00 61.71 ? 499 SER B OG  1 
ATOM 3367 N N   . ASP C 1 224 ? 30.196  24.927 145.448 1.00 58.82 ? 500 ASP B N   1 
ATOM 3368 C CA  . ASP C 1 224 ? 29.298  24.188 146.320 1.00 58.30 ? 500 ASP B CA  1 
ATOM 3369 C C   . ASP C 1 224 ? 29.092  22.814 145.705 1.00 60.24 ? 500 ASP B C   1 
ATOM 3370 O O   . ASP C 1 224 ? 28.835  22.698 144.505 1.00 58.72 ? 500 ASP B O   1 
ATOM 3371 C CB  . ASP C 1 224 ? 27.955  24.893 146.470 1.00 56.27 ? 500 ASP B CB  1 
ATOM 3372 C CG  . ASP C 1 224 ? 27.089  24.257 147.549 1.00 54.27 ? 500 ASP B CG  1 
ATOM 3373 O OD1 . ASP C 1 224 ? 27.460  24.325 148.744 1.00 53.29 ? 500 ASP B OD1 1 
ATOM 3374 O OD2 . ASP C 1 224 ? 26.042  23.676 147.199 1.00 54.77 ? 500 ASP B OD2 1 
ATOM 3375 N N   . LEU C 1 225 ? 29.209  21.793 146.555 1.00 62.35 ? 501 LEU B N   1 
ATOM 3376 C CA  . LEU C 1 225 ? 29.099  20.375 146.197 1.00 64.89 ? 501 LEU B CA  1 
ATOM 3377 C C   . LEU C 1 225 ? 30.527  19.838 146.200 1.00 64.80 ? 501 LEU B C   1 
ATOM 3378 O O   . LEU C 1 225 ? 31.360  20.274 145.402 1.00 64.35 ? 501 LEU B O   1 
ATOM 3379 C CB  . LEU C 1 225 ? 28.472  20.180 144.807 1.00 66.84 ? 501 LEU B CB  1 
ATOM 3380 C CG  . LEU C 1 225 ? 28.426  18.778 144.181 1.00 68.35 ? 501 LEU B CG  1 
ATOM 3381 C CD1 . LEU C 1 225 ? 29.783  18.402 143.598 1.00 68.60 ? 501 LEU B CD1 1 
ATOM 3382 C CD2 . LEU C 1 225 ? 27.968  17.766 145.224 1.00 68.66 ? 501 LEU B CD2 1 
ATOM 3383 N N   . PRO C 1 226 ? 30.832  18.892 147.107 1.00 66.29 ? 502 PRO B N   1 
ATOM 3384 C CA  . PRO C 1 226 ? 32.178  18.305 147.201 1.00 67.73 ? 502 PRO B CA  1 
ATOM 3385 C C   . PRO C 1 226 ? 32.926  18.315 145.857 1.00 69.41 ? 502 PRO B C   1 
ATOM 3386 O O   . PRO C 1 226 ? 33.568  19.312 145.514 1.00 70.35 ? 502 PRO B O   1 
ATOM 3387 C CB  . PRO C 1 226 ? 31.889  16.901 147.722 1.00 67.92 ? 502 PRO B CB  1 
ATOM 3388 C CG  . PRO C 1 226 ? 30.745  17.158 148.689 1.00 66.92 ? 502 PRO B CG  1 
ATOM 3389 C CD  . PRO C 1 226 ? 29.863  18.147 147.940 1.00 66.23 ? 502 PRO B CD  1 
ATOM 3390 N N   . ASP C 1 227 ? 32.833  17.201 145.123 1.00 70.64 ? 503 ASP B N   1 
ATOM 3391 C CA  . ASP C 1 227 ? 33.436  17.009 143.789 1.00 71.45 ? 503 ASP B CA  1 
ATOM 3392 C C   . ASP C 1 227 ? 33.933  15.584 143.497 1.00 71.79 ? 503 ASP B C   1 
ATOM 3393 O O   . ASP C 1 227 ? 34.333  14.846 144.403 1.00 72.94 ? 503 ASP B O   1 
ATOM 3394 C CB  . ASP C 1 227 ? 34.592  17.996 143.535 1.00 72.43 ? 503 ASP B CB  1 
ATOM 3395 C CG  . ASP C 1 227 ? 35.255  17.787 142.174 1.00 73.51 ? 503 ASP B CG  1 
ATOM 3396 O OD1 . ASP C 1 227 ? 36.208  16.980 142.086 1.00 75.31 ? 503 ASP B OD1 1 
ATOM 3397 O OD2 . ASP C 1 227 ? 34.811  18.420 141.190 1.00 76.52 ? 503 ASP B OD2 1 
ATOM 3398 N N   . PRO C 1 228 ? 33.873  15.175 142.216 1.00 72.86 ? 504 PRO B N   1 
ATOM 3399 C CA  . PRO C 1 228 ? 34.319  13.849 141.779 1.00 71.38 ? 504 PRO B CA  1 
ATOM 3400 C C   . PRO C 1 228 ? 35.834  13.860 141.566 1.00 71.56 ? 504 PRO B C   1 
ATOM 3401 O O   . PRO C 1 228 ? 36.563  13.507 142.518 1.00 71.02 ? 504 PRO B O   1 
ATOM 3402 C CB  . PRO C 1 228 ? 33.568  13.644 140.462 1.00 71.69 ? 504 PRO B CB  1 
ATOM 3403 C CG  . PRO C 1 228 ? 32.363  14.520 140.606 1.00 71.54 ? 504 PRO B CG  1 
ATOM 3404 C CD  . PRO C 1 228 ? 32.959  15.753 141.217 1.00 71.50 ? 504 PRO B CD  1 
ATOM 3405 O OXT . PRO C 1 228 ? 36.271  14.248 140.456 1.00 33.68 ? 504 PRO B OXT 1 
ATOM 3406 N N   . LYS D 2 1   ? 10.973  27.701 150.765 1.00 19.95 ? 246 LYS Y N   1 
ATOM 3407 C CA  . LYS D 2 1   ? 11.150  29.187 150.708 1.00 16.79 ? 246 LYS Y CA  1 
ATOM 3408 C C   . LYS D 2 1   ? 12.022  29.587 149.508 1.00 13.35 ? 246 LYS Y C   1 
ATOM 3409 O O   . LYS D 2 1   ? 13.149  30.080 149.686 1.00 14.33 ? 246 LYS Y O   1 
ATOM 3410 C CB  . LYS D 2 1   ? 11.805  29.700 152.000 1.00 19.39 ? 246 LYS Y CB  1 
ATOM 3411 C CG  . LYS D 2 1   ? 11.071  29.346 153.288 1.00 23.11 ? 246 LYS Y CG  1 
ATOM 3412 C CD  . LYS D 2 1   ? 11.027  27.835 153.521 1.00 26.07 ? 246 LYS Y CD  1 
ATOM 3413 C CE  . LYS D 2 1   ? 10.592  27.479 154.942 1.00 27.80 ? 246 LYS Y CE  1 
ATOM 3414 N NZ  . LYS D 2 1   ? 9.208   27.938 155.259 1.00 33.52 ? 246 LYS Y NZ  1 
ATOM 3415 N N   . THR D 2 2   ? 11.496  29.380 148.294 1.00 11.24 ? 247 THR Y N   1 
ATOM 3416 C CA  . THR D 2 2   ? 12.223  29.706 147.053 1.00 9.59  ? 247 THR Y CA  1 
ATOM 3417 C C   . THR D 2 2   ? 11.790  31.033 146.398 1.00 10.03 ? 247 THR Y C   1 
ATOM 3418 O O   . THR D 2 2   ? 10.698  31.554 146.653 1.00 16.83 ? 247 THR Y O   1 
ATOM 3419 C CB  . THR D 2 2   ? 12.083  28.566 145.989 1.00 13.65 ? 247 THR Y CB  1 
ATOM 3420 O OG1 . THR D 2 2   ? 12.341  27.295 146.603 1.00 14.23 ? 247 THR Y OG1 1 
ATOM 3421 C CG2 . THR D 2 2   ? 13.078  28.773 144.836 1.00 17.91 ? 247 THR Y CG2 1 
ATOM 3422 N N   . ALA D 2 3   ? 12.672  31.571 145.560 1.00 21.61 ? 248 ALA Y N   1 
ATOM 3423 C CA  . ALA D 2 3   ? 12.418  32.818 144.848 1.00 14.83 ? 248 ALA Y CA  1 
ATOM 3424 C C   . ALA D 2 3   ? 12.940  32.717 143.395 1.00 15.77 ? 248 ALA Y C   1 
ATOM 3425 O O   . ALA D 2 3   ? 12.252  32.141 142.535 1.00 13.50 ? 248 ALA Y O   1 
ATOM 3426 C CB  . ALA D 2 3   ? 13.079  33.994 145.595 1.00 14.24 ? 248 ALA Y CB  1 
ATOM 3427 N N   . ALA D 2 4   ? 14.140  33.264 143.139 1.00 25.46 ? 249 ALA Y N   1 
ATOM 3428 C CA  . ALA D 2 4   ? 14.794  33.258 141.810 1.00 15.82 ? 249 ALA Y CA  1 
ATOM 3429 C C   . ALA D 2 4   ? 14.515  34.546 140.981 1.00 13.82 ? 249 ALA Y C   1 
ATOM 3430 O O   . ALA D 2 4   ? 14.216  35.616 141.549 1.00 14.20 ? 249 ALA Y O   1 
ATOM 3431 C CB  . ALA D 2 4   ? 14.379  31.981 141.008 1.00 15.92 ? 249 ALA Y CB  1 
ATOM 3432 N N   . PRO D 2 5   ? 14.647  34.468 139.632 1.00 8.93  ? 250 PRO Y N   1 
ATOM 3433 C CA  . PRO D 2 5   ? 14.383  35.673 138.836 1.00 14.22 ? 250 PRO Y CA  1 
ATOM 3434 C C   . PRO D 2 5   ? 13.099  35.549 138.016 1.00 15.92 ? 250 PRO Y C   1 
ATOM 3435 O O   . PRO D 2 5   ? 11.974  35.539 138.532 1.00 13.81 ? 250 PRO Y O   1 
ATOM 3436 C CB  . PRO D 2 5   ? 15.599  35.730 137.924 1.00 10.05 ? 250 PRO Y CB  1 
ATOM 3437 C CG  . PRO D 2 5   ? 15.740  34.274 137.534 1.00 16.13 ? 250 PRO Y CG  1 
ATOM 3438 C CD  . PRO D 2 5   ? 15.476  33.518 138.849 1.00 18.69 ? 250 PRO Y CD  1 
ATOM 3439 N N   . VAL D 2 6   ? 13.321  35.480 136.711 1.00 10.83 ? 251 VAL Y N   1 
ATOM 3440 C CA  . VAL D 2 6   ? 12.292  35.329 135.711 1.00 12.24 ? 251 VAL Y CA  1 
ATOM 3441 C C   . VAL D 2 6   ? 13.087  34.694 134.595 1.00 14.89 ? 251 VAL Y C   1 
ATOM 3442 O O   . VAL D 2 6   ? 14.318  34.679 134.632 1.00 10.13 ? 251 VAL Y O   1 
ATOM 3443 C CB  . VAL D 2 6   ? 11.748  36.682 135.219 1.00 17.46 ? 251 VAL Y CB  1 
ATOM 3444 C CG1 . VAL D 2 6   ? 11.980  37.750 136.278 1.00 12.81 ? 251 VAL Y CG1 1 
ATOM 3445 C CG2 . VAL D 2 6   ? 12.395  37.065 133.879 1.00 10.65 ? 251 VAL Y CG2 1 
ATOM 3446 N N   . GLN D 2 7   ? 12.389  34.191 133.596 1.00 13.49 ? 252 GLN Y N   1 
ATOM 3447 C CA  . GLN D 2 7   ? 13.042  33.542 132.483 1.00 12.00 ? 252 GLN Y CA  1 
ATOM 3448 C C   . GLN D 2 7   ? 12.679  34.246 131.173 1.00 14.69 ? 252 GLN Y C   1 
ATOM 3449 O O   . GLN D 2 7   ? 13.011  35.414 130.981 1.00 11.05 ? 252 GLN Y O   1 
ATOM 3450 C CB  . GLN D 2 7   ? 12.636  32.054 132.467 1.00 14.50 ? 252 GLN Y CB  1 
ATOM 3451 C CG  . GLN D 2 7   ? 13.247  31.187 133.619 1.00 13.08 ? 252 GLN Y CG  1 
ATOM 3452 C CD  . GLN D 2 7   ? 12.299  30.901 134.794 1.00 10.32 ? 252 GLN Y CD  1 
ATOM 3453 O OE1 . GLN D 2 7   ? 11.215  30.343 134.613 1.00 13.44 ? 252 GLN Y OE1 1 
ATOM 3454 N NE2 . GLN D 2 7   ? 12.723  31.263 136.004 1.00 18.82 ? 252 GLN Y NE2 1 
ATOM 3455 N N   . GLU D 2 8   ? 11.988  33.532 130.287 1.00 14.84 ? 253 GLU Y N   1 
ATOM 3456 C CA  . GLU D 2 8   ? 11.558  34.071 128.990 1.00 9.67  ? 253 GLU Y CA  1 
ATOM 3457 C C   . GLU D 2 8   ? 10.217  33.464 128.457 1.00 11.07 ? 253 GLU Y C   1 
ATOM 3458 O O   . GLU D 2 8   ? 9.426   32.868 129.224 1.00 9.09  ? 253 GLU Y O   1 
ATOM 3459 C CB  . GLU D 2 8   ? 12.685  33.868 127.959 1.00 12.96 ? 253 GLU Y CB  1 
ATOM 3460 C CG  . GLU D 2 8   ? 13.687  34.998 127.908 1.00 16.02 ? 253 GLU Y CG  1 
ATOM 3461 C CD  . GLU D 2 8   ? 13.033  36.338 127.603 1.00 13.85 ? 253 GLU Y CD  1 
ATOM 3462 O OE1 . GLU D 2 8   ? 12.496  36.986 128.533 1.00 14.62 ? 253 GLU Y OE1 1 
ATOM 3463 O OE2 . GLU D 2 8   ? 13.042  36.741 126.423 1.00 12.19 ? 253 GLU Y OE2 1 
ATOM 3464 N N   . THR D 2 9   ? 9.967   33.639 127.151 1.00 15.87 ? 254 THR Y N   1 
ATOM 3465 C CA  . THR D 2 9   ? 8.771   33.100 126.504 1.00 17.04 ? 254 THR Y CA  1 
ATOM 3466 C C   . THR D 2 9   ? 8.957   31.653 125.978 1.00 24.35 ? 254 THR Y C   1 
ATOM 3467 O O   . THR D 2 9   ? 8.661   30.693 126.701 1.00 16.18 ? 254 THR Y O   1 
ATOM 3468 C CB  . THR D 2 9   ? 8.303   34.034 125.356 1.00 12.18 ? 254 THR Y CB  1 
ATOM 3469 O OG1 . THR D 2 9   ? 8.285   35.395 125.814 1.00 13.72 ? 254 THR Y OG1 1 
ATOM 3470 C CG2 . THR D 2 9   ? 6.902   33.630 124.895 1.00 10.36 ? 254 THR Y CG2 1 
ATOM 3471 N N   . LEU D 2 10  ? 9.553   31.550 124.788 1.00 15.68 ? 255 LEU Y N   1 
ATOM 3472 C CA  . LEU D 2 10  ? 9.873   30.277 124.155 1.00 13.31 ? 255 LEU Y CA  1 
ATOM 3473 C C   . LEU D 2 10  ? 10.039  30.469 122.655 1.00 9.18  ? 255 LEU Y C   1 
ATOM 3474 O O   . LEU D 2 10  ? 9.368   31.302 122.028 1.00 9.65  ? 255 LEU Y O   1 
ATOM 3475 C CB  . LEU D 2 10  ? 8.801   29.207 124.449 1.00 10.92 ? 255 LEU Y CB  1 
ATOM 3476 C CG  . LEU D 2 10  ? 9.210   27.714 124.470 1.00 14.35 ? 255 LEU Y CG  1 
ATOM 3477 C CD1 . LEU D 2 10  ? 9.530   27.221 123.062 1.00 14.52 ? 255 LEU Y CD1 1 
ATOM 3478 C CD2 . LEU D 2 10  ? 10.408  27.513 125.399 1.00 15.26 ? 255 LEU Y CD2 1 
ATOM 3479 N N   . HIS D 2 11  ? 10.941  29.667 122.099 1.00 13.13 ? 256 HIS Y N   1 
ATOM 3480 C CA  . HIS D 2 11  ? 11.297  29.685 120.684 1.00 14.13 ? 256 HIS Y CA  1 
ATOM 3481 C C   . HIS D 2 11  ? 10.422  28.839 119.738 1.00 10.13 ? 256 HIS Y C   1 
ATOM 3482 O O   . HIS D 2 11  ? 9.933   27.760 120.094 1.00 13.27 ? 256 HIS Y O   1 
ATOM 3483 C CB  . HIS D 2 11  ? 12.769  29.250 120.552 1.00 20.35 ? 256 HIS Y CB  1 
ATOM 3484 C CG  . HIS D 2 11  ? 13.250  29.142 119.139 1.00 19.31 ? 256 HIS Y CG  1 
ATOM 3485 N ND1 . HIS D 2 11  ? 13.691  30.231 118.417 1.00 20.13 ? 256 HIS Y ND1 1 
ATOM 3486 C CD2 . HIS D 2 11  ? 13.329  28.078 118.305 1.00 9.61  ? 256 HIS Y CD2 1 
ATOM 3487 C CE1 . HIS D 2 11  ? 14.019  29.841 117.198 1.00 12.13 ? 256 HIS Y CE1 1 
ATOM 3488 N NE2 . HIS D 2 11  ? 13.808  28.540 117.104 1.00 15.13 ? 256 HIS Y NE2 1 
ATOM 3489 N N   . GLY D 2 12  ? 10.251  29.344 118.519 1.00 17.09 ? 257 GLY Y N   1 
ATOM 3490 C CA  . GLY D 2 12  ? 9.470   28.636 117.528 1.00 11.16 ? 257 GLY Y CA  1 
ATOM 3491 C C   . GLY D 2 12  ? 10.215  28.435 116.219 1.00 13.33 ? 257 GLY Y C   1 
ATOM 3492 O O   . GLY D 2 12  ? 11.110  27.593 116.117 1.00 12.90 ? 257 GLY Y O   1 
ATOM 3493 N N   . SER D 2 13  ? 9.841   29.226 115.217 1.00 12.82 ? 258 SER Y N   1 
ATOM 3494 C CA  . SER D 2 13  ? 10.423  29.166 113.877 1.00 13.83 ? 258 SER Y CA  1 
ATOM 3495 C C   . SER D 2 13  ? 10.039  30.452 113.139 1.00 13.46 ? 258 SER Y C   1 
ATOM 3496 O O   . SER D 2 13  ? 10.421  30.661 111.982 1.00 11.73 ? 258 SER Y O   1 
ATOM 3497 C CB  . SER D 2 13  ? 9.857   27.951 113.127 1.00 15.56 ? 258 SER Y CB  1 
ATOM 3498 O OG  . SER D 2 13  ? 10.187  27.981 111.748 1.00 19.17 ? 258 SER Y OG  1 
ATOM 3499 N N   . GLN D 2 14  ? 9.287   31.305 113.840 1.00 19.03 ? 259 GLN Y N   1 
ATOM 3500 C CA  . GLN D 2 14  ? 8.769   32.580 113.323 1.00 17.57 ? 259 GLN Y CA  1 
ATOM 3501 C C   . GLN D 2 14  ? 9.657   33.806 113.519 1.00 10.13 ? 259 GLN Y C   1 
ATOM 3502 O O   . GLN D 2 14  ? 10.132  34.070 114.627 1.00 16.00 ? 259 GLN Y O   1 
ATOM 3503 C CB  . GLN D 2 14  ? 7.395   32.888 113.954 1.00 8.65  ? 259 GLN Y CB  1 
ATOM 3504 C CG  . GLN D 2 14  ? 6.184   32.700 113.027 1.00 19.44 ? 259 GLN Y CG  1 
ATOM 3505 C CD  . GLN D 2 14  ? 5.743   31.253 112.862 1.00 14.03 ? 259 GLN Y CD  1 
ATOM 3506 O OE1 . GLN D 2 14  ? 5.227   30.638 113.798 1.00 19.19 ? 259 GLN Y OE1 1 
ATOM 3507 N NE2 . GLN D 2 14  ? 5.951   30.701 111.666 1.00 13.08 ? 259 GLN Y NE2 1 
ATOM 3508 N N   . PRO D 2 15  ? 9.882   34.572 112.431 1.00 16.13 ? 260 PRO Y N   1 
ATOM 3509 C CA  . PRO D 2 15  ? 10.693  35.808 112.374 1.00 20.13 ? 260 PRO Y CA  1 
ATOM 3510 C C   . PRO D 2 15  ? 10.037  37.009 113.119 1.00 15.13 ? 260 PRO Y C   1 
ATOM 3511 O O   . PRO D 2 15  ? 9.583   38.010 112.516 1.00 12.13 ? 260 PRO Y O   1 
ATOM 3512 C CB  . PRO D 2 15  ? 10.869  36.047 110.862 1.00 13.13 ? 260 PRO Y CB  1 
ATOM 3513 C CG  . PRO D 2 15  ? 9.651   35.364 110.249 1.00 10.13 ? 260 PRO Y CG  1 
ATOM 3514 C CD  . PRO D 2 15  ? 9.543   34.101 111.072 1.00 17.13 ? 260 PRO Y CD  1 
ATOM 3515 N N   . VAL D 2 16  ? 10.017  36.875 114.448 1.00 10.13 ? 261 VAL Y N   1 
ATOM 3516 C CA  . VAL D 2 16  ? 9.433   37.855 115.359 1.00 16.13 ? 261 VAL Y CA  1 
ATOM 3517 C C   . VAL D 2 16  ? 10.320  37.958 116.601 1.00 15.13 ? 261 VAL Y C   1 
ATOM 3518 O O   . VAL D 2 16  ? 11.277  37.182 116.769 1.00 19.13 ? 261 VAL Y O   1 
ATOM 3519 C CB  . VAL D 2 16  ? 7.995   37.409 115.807 1.00 20.13 ? 261 VAL Y CB  1 
ATOM 3520 C CG1 . VAL D 2 16  ? 8.087   36.369 116.944 1.00 18.13 ? 261 VAL Y CG1 1 
ATOM 3521 C CG2 . VAL D 2 16  ? 7.169   38.618 116.240 1.00 10.13 ? 261 VAL Y CG2 1 
ATOM 3522 N N   . THR D 2 17  ? 9.983   38.909 117.474 1.00 20.13 ? 262 THR Y N   1 
ATOM 3523 C CA  . THR D 2 17  ? 10.738  39.113 118.716 1.00 19.10 ? 262 THR Y CA  1 
ATOM 3524 C C   . THR D 2 17  ? 10.355  38.091 119.793 1.00 10.89 ? 262 THR Y C   1 
ATOM 3525 O O   . THR D 2 17  ? 9.255   37.499 119.774 1.00 11.46 ? 262 THR Y O   1 
ATOM 3526 C CB  . THR D 2 17  ? 10.556  40.572 119.332 1.00 21.55 ? 262 THR Y CB  1 
ATOM 3527 O OG1 . THR D 2 17  ? 9.223   40.744 119.850 1.00 16.52 ? 262 THR Y OG1 1 
ATOM 3528 C CG2 . THR D 2 17  ? 10.846  41.636 118.278 1.00 20.52 ? 262 THR Y CG2 1 
ATOM 3529 N N   . GLN D 2 18  ? 11.293  37.881 120.717 1.00 20.27 ? 263 GLN Y N   1 
ATOM 3530 C CA  . GLN D 2 18  ? 11.055  36.955 121.840 1.00 19.06 ? 263 GLN Y CA  1 
ATOM 3531 C C   . GLN D 2 18  ? 10.839  37.658 123.197 1.00 19.42 ? 263 GLN Y C   1 
ATOM 3532 O O   . GLN D 2 18  ? 11.666  37.535 124.109 1.00 14.24 ? 263 GLN Y O   1 
ATOM 3533 C CB  . GLN D 2 18  ? 12.225  35.959 121.933 1.00 9.13  ? 263 GLN Y CB  1 
ATOM 3534 C CG  . GLN D 2 18  ? 12.112  34.885 123.043 1.00 16.30 ? 263 GLN Y CG  1 
ATOM 3535 C CD  . GLN D 2 18  ? 13.445  34.202 123.401 1.00 10.96 ? 263 GLN Y CD  1 
ATOM 3536 O OE1 . GLN D 2 18  ? 14.403  34.850 123.854 1.00 13.05 ? 263 GLN Y OE1 1 
ATOM 3537 N NE2 . GLN D 2 18  ? 13.510  32.890 123.179 1.00 11.80 ? 263 GLN Y NE2 1 
ATOM 3538 N N   . GLU D 2 19  ? 9.704   38.363 123.307 1.00 12.26 ? 264 GLU Y N   1 
ATOM 3539 C CA  . GLU D 2 19  ? 9.285   39.122 124.504 1.00 15.30 ? 264 GLU Y CA  1 
ATOM 3540 C C   . GLU D 2 19  ? 8.312   38.391 125.439 1.00 14.68 ? 264 GLU Y C   1 
ATOM 3541 O O   . GLU D 2 19  ? 7.151   38.175 125.074 1.00 16.83 ? 264 GLU Y O   1 
ATOM 3542 C CB  . GLU D 2 19  ? 8.601   40.422 124.067 1.00 10.91 ? 264 GLU Y CB  1 
ATOM 3543 C CG  . GLU D 2 19  ? 9.511   41.624 123.835 1.00 13.93 ? 264 GLU Y CG  1 
ATOM 3544 C CD  . GLU D 2 19  ? 8.754   42.869 123.449 1.00 15.45 ? 264 GLU Y CD  1 
ATOM 3545 O OE1 . GLU D 2 19  ? 8.064   43.416 124.330 1.00 15.45 ? 264 GLU Y OE1 1 
ATOM 3546 O OE2 . GLU D 2 19  ? 8.840   43.299 122.271 1.00 15.38 ? 264 GLU Y OE2 1 
ATOM 3547 N N   . ASP D 2 20  ? 8.780   38.065 126.649 1.00 18.90 ? 265 ASP Y N   1 
ATOM 3548 C CA  . ASP D 2 20  ? 7.988   37.354 127.670 1.00 10.25 ? 265 ASP Y CA  1 
ATOM 3549 C C   . ASP D 2 20  ? 7.316   38.317 128.656 1.00 14.00 ? 265 ASP Y C   1 
ATOM 3550 O O   . ASP D 2 20  ? 7.470   39.536 128.566 1.00 14.92 ? 265 ASP Y O   1 
ATOM 3551 C CB  . ASP D 2 20  ? 8.893   36.383 128.459 1.00 20.13 ? 265 ASP Y CB  1 
ATOM 3552 C CG  . ASP D 2 20  ? 8.110   35.439 129.380 1.00 12.13 ? 265 ASP Y CG  1 
ATOM 3553 O OD1 . ASP D 2 20  ? 7.552   34.452 128.862 1.00 8.18  ? 265 ASP Y OD1 1 
ATOM 3554 O OD2 . ASP D 2 20  ? 8.052   35.673 130.610 1.00 18.18 ? 265 ASP Y OD2 1 
ATOM 3555 N N   . GLY D 2 21  ? 6.537   37.749 129.573 1.00 46.87 ? 266 GLY Y N   1 
ATOM 3556 C CA  . GLY D 2 21  ? 5.868   38.536 130.586 1.00 47.30 ? 266 GLY Y CA  1 
ATOM 3557 C C   . GLY D 2 21  ? 6.593   38.310 131.901 1.00 47.28 ? 266 GLY Y C   1 
ATOM 3558 O O   . GLY D 2 21  ? 7.215   39.262 132.414 1.00 49.18 ? 266 GLY Y O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   277 ?   ?   ?   A . n 
A 1 2   GLN 2   278 ?   ?   ?   A . n 
A 1 3   ASN 3   279 ?   ?   ?   A . n 
A 1 4   TRP 4   280 ?   ?   ?   A . n 
A 1 5   GLU 5   281 ?   ?   ?   A . n 
A 1 6   GLU 6   282 ?   ?   ?   A . n 
A 1 7   ALA 7   283 ?   ?   ?   A . n 
A 1 8   ASP 8   284 ?   ?   ?   A . n 
A 1 9   SER 9   285 ?   ?   ?   A . n 
A 1 10  MET 10  286 ?   ?   ?   A . n 
A 1 11  LYS 11  287 ?   ?   ?   A . n 
A 1 12  SER 12  288 ?   ?   ?   A . n 
A 1 13  SER 13  289 ?   ?   ?   A . n 
A 1 14  VAL 14  290 ?   ?   ?   A . n 
A 1 15  GLU 15  291 ?   ?   ?   A . n 
A 1 16  SER 16  292 ?   ?   ?   A . n 
A 1 17  LEU 17  293 ?   ?   ?   A . n 
A 1 18  GLN 18  294 ?   ?   ?   A . n 
A 1 19  ASN 19  295 ?   ?   ?   A . n 
A 1 20  ARG 20  296 ?   ?   ?   A . n 
A 1 21  VAL 21  297 ?   ?   ?   A . n 
A 1 22  THR 22  298 ?   ?   ?   A . n 
A 1 23  GLU 23  299 ?   ?   ?   A . n 
A 1 24  LEU 24  300 300 LEU LEU A . n 
A 1 25  GLU 25  301 301 GLU GLU A . n 
A 1 26  SER 26  302 302 SER SER A . n 
A 1 27  VAL 27  303 303 VAL VAL A . n 
A 1 28  ASP 28  304 304 ASP ASP A . n 
A 1 29  LYS 29  305 305 LYS LYS A . n 
A 1 30  SER 30  306 306 SER SER A . n 
A 1 31  ALA 31  307 307 ALA ALA A . n 
A 1 32  GLY 32  308 308 GLY GLY A . n 
A 1 33  GLN 33  309 309 GLN GLN A . n 
A 1 34  VAL 34  310 310 VAL VAL A . n 
A 1 35  ALA 35  311 311 ALA ALA A . n 
A 1 36  ARG 36  312 312 ARG ARG A . n 
A 1 37  ASN 37  313 313 ASN ASN A . n 
A 1 38  THR 38  314 314 THR THR A . n 
A 1 39  GLY 39  315 315 GLY GLY A . n 
A 1 40  LEU 40  316 316 LEU LEU A . n 
A 1 41  LEU 41  317 317 LEU LEU A . n 
A 1 42  GLU 42  318 318 GLU GLU A . n 
A 1 43  SER 43  319 319 SER SER A . n 
A 1 44  GLN 44  320 320 GLN GLN A . n 
A 1 45  LEU 45  321 321 LEU LEU A . n 
A 1 46  SER 46  322 322 SER SER A . n 
A 1 47  ARG 47  323 323 ARG ARG A . n 
A 1 48  HIS 48  324 324 HIS HIS A . n 
A 1 49  ASP 49  325 325 ASP ASP A . n 
A 1 50  GLN 50  326 326 GLN GLN A . n 
A 1 51  MET 51  327 327 MET MET A . n 
A 1 52  LEU 52  328 328 LEU LEU A . n 
A 1 53  SER 53  329 329 SER SER A . n 
A 1 54  VAL 54  330 330 VAL VAL A . n 
A 1 55  HIS 55  331 331 HIS HIS A . n 
A 1 56  ASP 56  332 332 ASP ASP A . n 
A 1 57  ILE 57  333 333 ILE ILE A . n 
A 1 58  ARG 58  334 334 ARG ARG A . n 
A 1 59  LEU 59  335 335 LEU LEU A . n 
A 1 60  ALA 60  336 336 ALA ALA A . n 
A 1 61  ASP 61  337 337 ASP ASP A . n 
A 1 62  MET 62  338 338 MET MET A . n 
A 1 63  ASP 63  339 339 ASP ASP A . n 
A 1 64  LEU 64  340 340 LEU LEU A . n 
A 1 65  ARG 65  341 341 ARG ARG A . n 
A 1 66  PHE 66  342 342 PHE PHE A . n 
A 1 67  GLN 67  343 343 GLN GLN A . n 
A 1 68  VAL 68  344 344 VAL VAL A . n 
A 1 69  LEU 69  345 345 LEU LEU A . n 
A 1 70  GLU 70  346 346 GLU GLU A . n 
A 1 71  THR 71  347 347 THR THR A . n 
A 1 72  ALA 72  348 348 ALA ALA A . n 
A 1 73  SER 73  349 349 SER SER A . n 
A 1 74  TYR 74  350 350 TYR TYR A . n 
A 1 75  ASN 75  351 351 ASN ASN A . n 
A 1 76  GLY 76  352 352 GLY GLY A . n 
A 1 77  VAL 77  353 353 VAL VAL A . n 
A 1 78  LEU 78  354 354 LEU LEU A . n 
A 1 79  ILE 79  355 355 ILE ILE A . n 
A 1 80  TRP 80  356 356 TRP TRP A . n 
A 1 81  LYS 81  357 357 LYS LYS A . n 
A 1 82  ILE 82  358 358 ILE ILE A . n 
A 1 83  ARG 83  359 359 ARG ARG A . n 
A 1 84  ASP 84  360 360 ASP ASP A . n 
A 1 85  TYR 85  361 361 TYR TYR A . n 
A 1 86  LYS 86  362 362 LYS LYS A . n 
A 1 87  ARG 87  363 363 ARG ARG A . n 
A 1 88  ARG 88  364 364 ARG ARG A . n 
A 1 89  LYS 89  365 365 LYS LYS A . n 
A 1 90  GLN 90  366 366 GLN GLN A . n 
A 1 91  GLU 91  367 367 GLU GLU A . n 
A 1 92  ALA 92  368 368 ALA ALA A . n 
A 1 93  VAL 93  369 369 VAL VAL A . n 
A 1 94  MET 94  370 370 MET MET A . n 
A 1 95  GLY 95  371 371 GLY GLY A . n 
A 1 96  LYS 96  372 372 LYS LYS A . n 
A 1 97  THR 97  373 373 THR THR A . n 
A 1 98  LEU 98  374 374 LEU LEU A . n 
A 1 99  SER 99  375 375 SER SER A . n 
A 1 100 LEU 100 376 376 LEU LEU A . n 
A 1 101 TYR 101 377 377 TYR TYR A . n 
A 1 102 SER 102 378 378 SER SER A . n 
A 1 103 GLN 103 379 379 GLN GLN A . n 
A 1 104 PRO 104 380 380 PRO PRO A . n 
A 1 105 PHE 105 381 381 PHE PHE A . n 
A 1 106 TYR 106 382 382 TYR TYR A . n 
A 1 107 THR 107 383 383 THR THR A . n 
A 1 108 GLY 108 384 384 GLY GLY A . n 
A 1 109 TYR 109 385 385 TYR TYR A . n 
A 1 110 PHE 110 386 386 PHE PHE A . n 
A 1 111 GLY 111 387 387 GLY GLY A . n 
A 1 112 TYR 112 388 388 TYR TYR A . n 
A 1 113 LYS 113 389 389 LYS LYS A . n 
A 1 114 MET 114 390 390 MET MET A . n 
A 1 115 CYS 115 391 391 CYS CYS A . n 
A 1 116 ALA 116 392 392 ALA ALA A . n 
A 1 117 ARG 117 393 393 ARG ARG A . n 
A 1 118 VAL 118 394 394 VAL VAL A . n 
A 1 119 TYR 119 395 395 TYR TYR A . n 
A 1 120 LEU 120 396 396 LEU LEU A . n 
A 1 121 ASN 121 397 397 ASN ASN A . n 
A 1 122 GLY 122 398 398 GLY GLY A . n 
A 1 123 ASP 123 399 399 ASP ASP A . n 
A 1 124 GLY 124 400 400 GLY GLY A . n 
A 1 125 MET 125 401 401 MET MET A . n 
A 1 126 GLY 126 402 402 GLY GLY A . n 
A 1 127 LYS 127 403 403 LYS LYS A . n 
A 1 128 GLY 128 404 404 GLY GLY A . n 
A 1 129 THR 129 405 405 THR THR A . n 
A 1 130 HIS 130 406 406 HIS HIS A . n 
A 1 131 LEU 131 407 407 LEU LEU A . n 
A 1 132 SER 132 408 408 SER SER A . n 
A 1 133 LEU 133 409 409 LEU LEU A . n 
A 1 134 PHE 134 410 410 PHE PHE A . n 
A 1 135 PHE 135 411 411 PHE PHE A . n 
A 1 136 VAL 136 412 412 VAL VAL A . n 
A 1 137 ILE 137 413 413 ILE ILE A . n 
A 1 138 MET 138 414 414 MET MET A . n 
A 1 139 ARG 139 415 415 ARG ARG A . n 
A 1 140 GLY 140 416 416 GLY GLY A . n 
A 1 141 GLU 141 417 417 GLU GLU A . n 
A 1 142 TYR 142 418 418 TYR TYR A . n 
A 1 143 ASP 143 419 419 ASP ASP A . n 
A 1 144 ALA 144 420 420 ALA ALA A . n 
A 1 145 LEU 145 421 421 LEU LEU A . n 
A 1 146 LEU 146 422 422 LEU LEU A . n 
A 1 147 PRO 147 423 423 PRO PRO A . n 
A 1 148 TRP 148 424 424 TRP TRP A . n 
A 1 149 PRO 149 425 425 PRO PRO A . n 
A 1 150 PHE 150 426 426 PHE PHE A . n 
A 1 151 LYS 151 427 427 LYS LYS A . n 
A 1 152 GLN 152 428 428 GLN GLN A . n 
A 1 153 LYS 153 429 429 LYS LYS A . n 
A 1 154 VAL 154 430 430 VAL VAL A . n 
A 1 155 THR 155 431 431 THR THR A . n 
A 1 156 LEU 156 432 432 LEU LEU A . n 
A 1 157 MET 157 433 433 MET MET A . n 
A 1 158 LEU 158 434 434 LEU LEU A . n 
A 1 159 MET 159 435 435 MET MET A . n 
A 1 160 ASP 160 436 436 ASP ASP A . n 
A 1 161 GLN 161 437 437 GLN GLN A . n 
A 1 162 GLY 162 438 438 GLY GLY A . n 
A 1 163 SER 163 439 439 SER SER A . n 
A 1 164 SER 164 440 440 SER SER A . n 
A 1 165 ARG 165 441 441 ARG ARG A . n 
A 1 166 ARG 166 442 442 ARG ARG A . n 
A 1 167 HIS 167 443 443 HIS HIS A . n 
A 1 168 LEU 168 444 444 LEU LEU A . n 
A 1 169 GLY 169 445 445 GLY GLY A . n 
A 1 170 ASP 170 446 446 ASP ASP A . n 
A 1 171 ALA 171 447 447 ALA ALA A . n 
A 1 172 PHE 172 448 448 PHE PHE A . n 
A 1 173 LYS 173 449 449 LYS LYS A . n 
A 1 174 PRO 174 450 450 PRO PRO A . n 
A 1 175 ASP 175 451 451 ASP ASP A . n 
A 1 176 PRO 176 452 452 PRO PRO A . n 
A 1 177 ASN 177 453 453 ASN ASN A . n 
A 1 178 SER 178 454 454 SER SER A . n 
A 1 179 SER 179 455 455 SER SER A . n 
A 1 180 SER 180 456 456 SER SER A . n 
A 1 181 PHE 181 457 457 PHE PHE A . n 
A 1 182 LYS 182 458 458 LYS LYS A . n 
A 1 183 LYS 183 459 459 LYS LYS A . n 
A 1 184 PRO 184 460 460 PRO PRO A . n 
A 1 185 THR 185 461 461 THR THR A . n 
A 1 186 GLY 186 462 462 GLY GLY A . n 
A 1 187 GLU 187 463 463 GLU GLU A . n 
A 1 188 MET 188 464 464 MET MET A . n 
A 1 189 ASN 189 465 465 ASN ASN A . n 
A 1 190 ILE 190 466 466 ILE ILE A . n 
A 1 191 ALA 191 467 467 ALA ALA A . n 
A 1 192 SER 192 468 468 SER SER A . n 
A 1 193 GLY 193 469 469 GLY GLY A . n 
A 1 194 CYS 194 470 470 CYS CYS A . n 
A 1 195 PRO 195 471 471 PRO PRO A . n 
A 1 196 VAL 196 472 472 VAL VAL A . n 
A 1 197 PHE 197 473 473 PHE PHE A . n 
A 1 198 VAL 198 474 474 VAL VAL A . n 
A 1 199 ALA 199 475 475 ALA ALA A . n 
A 1 200 GLN 200 476 476 GLN GLN A . n 
A 1 201 THR 201 477 477 THR THR A . n 
A 1 202 VAL 202 478 478 VAL VAL A . n 
A 1 203 LEU 203 479 479 LEU LEU A . n 
A 1 204 GLU 204 480 480 GLU GLU A . n 
A 1 205 ASN 205 481 481 ASN ASN A . n 
A 1 206 GLY 206 482 482 GLY GLY A . n 
A 1 207 THR 207 483 483 THR THR A . n 
A 1 208 TYR 208 484 484 TYR TYR A . n 
A 1 209 ILE 209 485 485 ILE ILE A . n 
A 1 210 LYS 210 486 486 LYS LYS A . n 
A 1 211 ASP 211 487 487 ASP ASP A . n 
A 1 212 ASP 212 488 488 ASP ASP A . n 
A 1 213 THR 213 489 489 THR THR A . n 
A 1 214 ILE 214 490 490 ILE ILE A . n 
A 1 215 PHE 215 491 491 PHE PHE A . n 
A 1 216 ILE 216 492 492 ILE ILE A . n 
A 1 217 LYS 217 493 493 LYS LYS A . n 
A 1 218 VAL 218 494 494 VAL VAL A . n 
A 1 219 ILE 219 495 495 ILE ILE A . n 
A 1 220 VAL 220 496 496 VAL VAL A . n 
A 1 221 ASP 221 497 497 ASP ASP A . n 
A 1 222 THR 222 498 498 THR THR A . n 
A 1 223 SER 223 499 499 SER SER A . n 
A 1 224 ASP 224 500 500 ASP ASP A . n 
A 1 225 LEU 225 501 501 LEU LEU A . n 
A 1 226 PRO 226 502 502 PRO PRO A . n 
A 1 227 ASP 227 503 503 ASP ASP A . n 
A 1 228 PRO 228 504 504 PRO PRO A . n 
B 2 1   LYS 1   246 246 LYS LYS X . n 
B 2 2   THR 2   247 247 THR THR X . n 
B 2 3   ALA 3   248 248 ALA ALA X . n 
B 2 4   ALA 4   249 249 ALA ALA X . n 
B 2 5   PRO 5   250 250 PRO PRO X . n 
B 2 6   VAL 6   251 251 VAL VAL X . n 
B 2 7   GLN 7   252 252 GLN GLN X . n 
B 2 8   GLU 8   253 253 GLU GLU X . n 
B 2 9   THR 9   254 254 THR THR X . n 
B 2 10  LEU 10  255 255 LEU LEU X . n 
B 2 11  HIS 11  256 256 HIS HIS X . n 
B 2 12  GLY 12  257 257 GLY GLY X . n 
B 2 13  SER 13  258 258 SER SER X . n 
B 2 14  GLN 14  259 259 GLN GLN X . n 
B 2 15  PRO 15  260 260 PRO PRO X . n 
B 2 16  VAL 16  261 261 VAL VAL X . n 
B 2 17  THR 17  262 262 THR THR X . n 
B 2 18  GLN 18  263 263 GLN GLN X . n 
B 2 19  GLU 19  264 264 GLU GLU X . n 
B 2 20  ASP 20  265 265 ASP ASP X . n 
B 2 21  GLY 21  266 266 GLY GLY X . n 
C 1 1   ARG 1   277 ?   ?   ?   B . n 
C 1 2   GLN 2   278 ?   ?   ?   B . n 
C 1 3   ASN 3   279 ?   ?   ?   B . n 
C 1 4   TRP 4   280 ?   ?   ?   B . n 
C 1 5   GLU 5   281 ?   ?   ?   B . n 
C 1 6   GLU 6   282 ?   ?   ?   B . n 
C 1 7   ALA 7   283 ?   ?   ?   B . n 
C 1 8   ASP 8   284 ?   ?   ?   B . n 
C 1 9   SER 9   285 ?   ?   ?   B . n 
C 1 10  MET 10  286 ?   ?   ?   B . n 
C 1 11  LYS 11  287 ?   ?   ?   B . n 
C 1 12  SER 12  288 ?   ?   ?   B . n 
C 1 13  SER 13  289 ?   ?   ?   B . n 
C 1 14  VAL 14  290 ?   ?   ?   B . n 
C 1 15  GLU 15  291 ?   ?   ?   B . n 
C 1 16  SER 16  292 ?   ?   ?   B . n 
C 1 17  LEU 17  293 ?   ?   ?   B . n 
C 1 18  GLN 18  294 ?   ?   ?   B . n 
C 1 19  ASN 19  295 ?   ?   ?   B . n 
C 1 20  ARG 20  296 ?   ?   ?   B . n 
C 1 21  VAL 21  297 ?   ?   ?   B . n 
C 1 22  THR 22  298 ?   ?   ?   B . n 
C 1 23  GLU 23  299 ?   ?   ?   B . n 
C 1 24  LEU 24  300 300 LEU LEU B . n 
C 1 25  GLU 25  301 301 GLU GLU B . n 
C 1 26  SER 26  302 302 SER SER B . n 
C 1 27  VAL 27  303 303 VAL VAL B . n 
C 1 28  ASP 28  304 304 ASP ASP B . n 
C 1 29  LYS 29  305 305 LYS LYS B . n 
C 1 30  SER 30  306 306 SER SER B . n 
C 1 31  ALA 31  307 307 ALA ALA B . n 
C 1 32  GLY 32  308 308 GLY GLY B . n 
C 1 33  GLN 33  309 309 GLN GLN B . n 
C 1 34  VAL 34  310 310 VAL VAL B . n 
C 1 35  ALA 35  311 311 ALA ALA B . n 
C 1 36  ARG 36  312 312 ARG ARG B . n 
C 1 37  ASN 37  313 313 ASN ASN B . n 
C 1 38  THR 38  314 314 THR THR B . n 
C 1 39  GLY 39  315 315 GLY GLY B . n 
C 1 40  LEU 40  316 316 LEU LEU B . n 
C 1 41  LEU 41  317 317 LEU LEU B . n 
C 1 42  GLU 42  318 318 GLU GLU B . n 
C 1 43  SER 43  319 319 SER SER B . n 
C 1 44  GLN 44  320 320 GLN GLN B . n 
C 1 45  LEU 45  321 321 LEU LEU B . n 
C 1 46  SER 46  322 322 SER SER B . n 
C 1 47  ARG 47  323 323 ARG ARG B . n 
C 1 48  HIS 48  324 324 HIS HIS B . n 
C 1 49  ASP 49  325 325 ASP ASP B . n 
C 1 50  GLN 50  326 326 GLN GLN B . n 
C 1 51  MET 51  327 327 MET MET B . n 
C 1 52  LEU 52  328 328 LEU LEU B . n 
C 1 53  SER 53  329 329 SER SER B . n 
C 1 54  VAL 54  330 330 VAL VAL B . n 
C 1 55  HIS 55  331 331 HIS HIS B . n 
C 1 56  ASP 56  332 332 ASP ASP B . n 
C 1 57  ILE 57  333 333 ILE ILE B . n 
C 1 58  ARG 58  334 334 ARG ARG B . n 
C 1 59  LEU 59  335 335 LEU LEU B . n 
C 1 60  ALA 60  336 336 ALA ALA B . n 
C 1 61  ASP 61  337 337 ASP ASP B . n 
C 1 62  MET 62  338 338 MET MET B . n 
C 1 63  ASP 63  339 339 ASP ASP B . n 
C 1 64  LEU 64  340 340 LEU LEU B . n 
C 1 65  ARG 65  341 341 ARG ARG B . n 
C 1 66  PHE 66  342 342 PHE PHE B . n 
C 1 67  GLN 67  343 343 GLN GLN B . n 
C 1 68  VAL 68  344 344 VAL VAL B . n 
C 1 69  LEU 69  345 345 LEU LEU B . n 
C 1 70  GLU 70  346 346 GLU GLU B . n 
C 1 71  THR 71  347 347 THR THR B . n 
C 1 72  ALA 72  348 348 ALA ALA B . n 
C 1 73  SER 73  349 349 SER SER B . n 
C 1 74  TYR 74  350 350 TYR TYR B . n 
C 1 75  ASN 75  351 351 ASN ASN B . n 
C 1 76  GLY 76  352 352 GLY GLY B . n 
C 1 77  VAL 77  353 353 VAL VAL B . n 
C 1 78  LEU 78  354 354 LEU LEU B . n 
C 1 79  ILE 79  355 355 ILE ILE B . n 
C 1 80  TRP 80  356 356 TRP TRP B . n 
C 1 81  LYS 81  357 357 LYS LYS B . n 
C 1 82  ILE 82  358 358 ILE ILE B . n 
C 1 83  ARG 83  359 359 ARG ARG B . n 
C 1 84  ASP 84  360 360 ASP ASP B . n 
C 1 85  TYR 85  361 361 TYR TYR B . n 
C 1 86  LYS 86  362 362 LYS LYS B . n 
C 1 87  ARG 87  363 363 ARG ARG B . n 
C 1 88  ARG 88  364 364 ARG ARG B . n 
C 1 89  LYS 89  365 365 LYS LYS B . n 
C 1 90  GLN 90  366 366 GLN GLN B . n 
C 1 91  GLU 91  367 367 GLU GLU B . n 
C 1 92  ALA 92  368 368 ALA ALA B . n 
C 1 93  VAL 93  369 369 VAL VAL B . n 
C 1 94  MET 94  370 370 MET MET B . n 
C 1 95  GLY 95  371 371 GLY GLY B . n 
C 1 96  LYS 96  372 372 LYS LYS B . n 
C 1 97  THR 97  373 373 THR THR B . n 
C 1 98  LEU 98  374 374 LEU LEU B . n 
C 1 99  SER 99  375 375 SER SER B . n 
C 1 100 LEU 100 376 376 LEU LEU B . n 
C 1 101 TYR 101 377 377 TYR TYR B . n 
C 1 102 SER 102 378 378 SER SER B . n 
C 1 103 GLN 103 379 379 GLN GLN B . n 
C 1 104 PRO 104 380 380 PRO PRO B . n 
C 1 105 PHE 105 381 381 PHE PHE B . n 
C 1 106 TYR 106 382 382 TYR TYR B . n 
C 1 107 THR 107 383 383 THR THR B . n 
C 1 108 GLY 108 384 384 GLY GLY B . n 
C 1 109 TYR 109 385 385 TYR TYR B . n 
C 1 110 PHE 110 386 386 PHE PHE B . n 
C 1 111 GLY 111 387 387 GLY GLY B . n 
C 1 112 TYR 112 388 388 TYR TYR B . n 
C 1 113 LYS 113 389 389 LYS LYS B . n 
C 1 114 MET 114 390 390 MET MET B . n 
C 1 115 CYS 115 391 391 CYS CYS B . n 
C 1 116 ALA 116 392 392 ALA ALA B . n 
C 1 117 ARG 117 393 393 ARG ARG B . n 
C 1 118 VAL 118 394 394 VAL VAL B . n 
C 1 119 TYR 119 395 395 TYR TYR B . n 
C 1 120 LEU 120 396 396 LEU LEU B . n 
C 1 121 ASN 121 397 397 ASN ASN B . n 
C 1 122 GLY 122 398 398 GLY GLY B . n 
C 1 123 ASP 123 399 399 ASP ASP B . n 
C 1 124 GLY 124 400 400 GLY GLY B . n 
C 1 125 MET 125 401 401 MET MET B . n 
C 1 126 GLY 126 402 402 GLY GLY B . n 
C 1 127 LYS 127 403 403 LYS LYS B . n 
C 1 128 GLY 128 404 404 GLY GLY B . n 
C 1 129 THR 129 405 405 THR THR B . n 
C 1 130 HIS 130 406 406 HIS HIS B . n 
C 1 131 LEU 131 407 407 LEU LEU B . n 
C 1 132 SER 132 408 408 SER SER B . n 
C 1 133 LEU 133 409 409 LEU LEU B . n 
C 1 134 PHE 134 410 410 PHE PHE B . n 
C 1 135 PHE 135 411 411 PHE PHE B . n 
C 1 136 VAL 136 412 412 VAL VAL B . n 
C 1 137 ILE 137 413 413 ILE ILE B . n 
C 1 138 MET 138 414 414 MET MET B . n 
C 1 139 ARG 139 415 415 ARG ARG B . n 
C 1 140 GLY 140 416 416 GLY GLY B . n 
C 1 141 GLU 141 417 417 GLU GLU B . n 
C 1 142 TYR 142 418 418 TYR TYR B . n 
C 1 143 ASP 143 419 419 ASP ASP B . n 
C 1 144 ALA 144 420 420 ALA ALA B . n 
C 1 145 LEU 145 421 421 LEU LEU B . n 
C 1 146 LEU 146 422 422 LEU LEU B . n 
C 1 147 PRO 147 423 423 PRO PRO B . n 
C 1 148 TRP 148 424 424 TRP TRP B . n 
C 1 149 PRO 149 425 425 PRO PRO B . n 
C 1 150 PHE 150 426 426 PHE PHE B . n 
C 1 151 LYS 151 427 427 LYS LYS B . n 
C 1 152 GLN 152 428 428 GLN GLN B . n 
C 1 153 LYS 153 429 429 LYS LYS B . n 
C 1 154 VAL 154 430 430 VAL VAL B . n 
C 1 155 THR 155 431 431 THR THR B . n 
C 1 156 LEU 156 432 432 LEU LEU B . n 
C 1 157 MET 157 433 433 MET MET B . n 
C 1 158 LEU 158 434 434 LEU LEU B . n 
C 1 159 MET 159 435 435 MET MET B . n 
C 1 160 ASP 160 436 436 ASP ASP B . n 
C 1 161 GLN 161 437 437 GLN GLN B . n 
C 1 162 GLY 162 438 438 GLY GLY B . n 
C 1 163 SER 163 439 439 SER SER B . n 
C 1 164 SER 164 440 440 SER SER B . n 
C 1 165 ARG 165 441 441 ARG ARG B . n 
C 1 166 ARG 166 442 442 ARG ARG B . n 
C 1 167 HIS 167 443 443 HIS HIS B . n 
C 1 168 LEU 168 444 444 LEU LEU B . n 
C 1 169 GLY 169 445 445 GLY GLY B . n 
C 1 170 ASP 170 446 446 ASP ASP B . n 
C 1 171 ALA 171 447 447 ALA ALA B . n 
C 1 172 PHE 172 448 448 PHE PHE B . n 
C 1 173 LYS 173 449 449 LYS LYS B . n 
C 1 174 PRO 174 450 450 PRO PRO B . n 
C 1 175 ASP 175 451 451 ASP ASP B . n 
C 1 176 PRO 176 452 452 PRO PRO B . n 
C 1 177 ASN 177 453 453 ASN ASN B . n 
C 1 178 SER 178 454 454 SER SER B . n 
C 1 179 SER 179 455 455 SER SER B . n 
C 1 180 SER 180 456 456 SER SER B . n 
C 1 181 PHE 181 457 457 PHE PHE B . n 
C 1 182 LYS 182 458 458 LYS LYS B . n 
C 1 183 LYS 183 459 459 LYS LYS B . n 
C 1 184 PRO 184 460 460 PRO PRO B . n 
C 1 185 THR 185 461 461 THR THR B . n 
C 1 186 GLY 186 462 462 GLY GLY B . n 
C 1 187 GLU 187 463 463 GLU GLU B . n 
C 1 188 MET 188 464 464 MET MET B . n 
C 1 189 ASN 189 465 465 ASN ASN B . n 
C 1 190 ILE 190 466 466 ILE ILE B . n 
C 1 191 ALA 191 467 467 ALA ALA B . n 
C 1 192 SER 192 468 468 SER SER B . n 
C 1 193 GLY 193 469 469 GLY GLY B . n 
C 1 194 CYS 194 470 470 CYS CYS B . n 
C 1 195 PRO 195 471 471 PRO PRO B . n 
C 1 196 VAL 196 472 472 VAL VAL B . n 
C 1 197 PHE 197 473 473 PHE PHE B . n 
C 1 198 VAL 198 474 474 VAL VAL B . n 
C 1 199 ALA 199 475 475 ALA ALA B . n 
C 1 200 GLN 200 476 476 GLN GLN B . n 
C 1 201 THR 201 477 477 THR THR B . n 
C 1 202 VAL 202 478 478 VAL VAL B . n 
C 1 203 LEU 203 479 479 LEU LEU B . n 
C 1 204 GLU 204 480 480 GLU GLU B . n 
C 1 205 ASN 205 481 481 ASN ASN B . n 
C 1 206 GLY 206 482 482 GLY GLY B . n 
C 1 207 THR 207 483 483 THR THR B . n 
C 1 208 TYR 208 484 484 TYR TYR B . n 
C 1 209 ILE 209 485 485 ILE ILE B . n 
C 1 210 LYS 210 486 486 LYS LYS B . n 
C 1 211 ASP 211 487 487 ASP ASP B . n 
C 1 212 ASP 212 488 488 ASP ASP B . n 
C 1 213 THR 213 489 489 THR THR B . n 
C 1 214 ILE 214 490 490 ILE ILE B . n 
C 1 215 PHE 215 491 491 PHE PHE B . n 
C 1 216 ILE 216 492 492 ILE ILE B . n 
C 1 217 LYS 217 493 493 LYS LYS B . n 
C 1 218 VAL 218 494 494 VAL VAL B . n 
C 1 219 ILE 219 495 495 ILE ILE B . n 
C 1 220 VAL 220 496 496 VAL VAL B . n 
C 1 221 ASP 221 497 497 ASP ASP B . n 
C 1 222 THR 222 498 498 THR THR B . n 
C 1 223 SER 223 499 499 SER SER B . n 
C 1 224 ASP 224 500 500 ASP ASP B . n 
C 1 225 LEU 225 501 501 LEU LEU B . n 
C 1 226 PRO 226 502 502 PRO PRO B . n 
C 1 227 ASP 227 503 503 ASP ASP B . n 
C 1 228 PRO 228 504 504 PRO PRO B . n 
D 2 1   LYS 1   246 246 LYS LYS Y . n 
D 2 2   THR 2   247 247 THR THR Y . n 
D 2 3   ALA 3   248 248 ALA ALA Y . n 
D 2 4   ALA 4   249 249 ALA ALA Y . n 
D 2 5   PRO 5   250 250 PRO PRO Y . n 
D 2 6   VAL 6   251 251 VAL VAL Y . n 
D 2 7   GLN 7   252 252 GLN GLN Y . n 
D 2 8   GLU 8   253 253 GLU GLU Y . n 
D 2 9   THR 9   254 254 THR THR Y . n 
D 2 10  LEU 10  255 255 LEU LEU Y . n 
D 2 11  HIS 11  256 256 HIS HIS Y . n 
D 2 12  GLY 12  257 257 GLY GLY Y . n 
D 2 13  SER 13  258 258 SER SER Y . n 
D 2 14  GLN 14  259 259 GLN GLN Y . n 
D 2 15  PRO 15  260 260 PRO PRO Y . n 
D 2 16  VAL 16  261 261 VAL VAL Y . n 
D 2 17  THR 17  262 262 THR THR Y . n 
D 2 18  GLN 18  263 263 GLN GLN Y . n 
D 2 19  GLU 19  264 264 GLU GLU Y . n 
D 2 20  ASP 20  265 265 ASP ASP Y . n 
D 2 21  GLY 21  266 266 GLY GLY Y . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly              ?    dimeric   2 
2 author_and_software_defined_assembly PISA dimeric   2 
3 software_defined_assembly            PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A,B 
2 1     C,D 
3 1,2,3 C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
2 'ABSA (A^2)' 1230  ? 
2 MORE         -7    ? 
2 'SSA (A^2)'  14590 ? 
3 'ABSA (A^2)' 11180 ? 
3 MORE         -75   ? 
3 'SSA (A^2)'  36290 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -y+1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 83.7600000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038  0.0000000000 41.8800000000 -0.8660254038 
-0.5000000000 0.0000000000 72.5382878210 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-10-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
AMoRE     phasing          . ? 1 
CNS       refinement       . ? 2 
DENZO     'data reduction' . ? 3 
SCALEPACK 'data scaling'   . ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OG1 
_pdbx_validate_close_contact.auth_asym_id_1   X 
_pdbx_validate_close_contact.auth_comp_id_1   THR 
_pdbx_validate_close_contact.auth_seq_id_1    254 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CB 
_pdbx_validate_close_contact.auth_asym_id_2   X 
_pdbx_validate_close_contact.auth_comp_id_2   ASP 
_pdbx_validate_close_contact.auth_seq_id_2    265 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.13 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 301 ? ? -179.24 -13.64  
2  1 GLU A 318 ? ? -34.09  -86.98  
3  1 SER A 319 ? ? -32.74  -25.00  
4  1 LEU A 321 ? ? -37.91  -36.61  
5  1 ASN A 351 ? ? -168.20 35.69   
6  1 ARG A 359 ? ? -125.53 -166.78 
7  1 LYS A 362 ? ? -60.88  0.00    
8  1 GLN A 366 ? ? -71.56  23.88   
9  1 LYS A 372 ? ? -169.97 -36.62  
10 1 LEU A 374 ? ? -36.22  -83.34  
11 1 SER A 378 ? ? -88.57  -125.65 
12 1 LYS A 389 ? ? -93.94  47.56   
13 1 MET A 390 ? ? -48.61  98.50   
14 1 TYR A 395 ? ? -116.39 74.97   
15 1 MET A 401 ? ? -66.42  52.22   
16 1 GLU A 417 ? ? 16.79   -75.87  
17 1 TYR A 418 ? ? -67.01  37.45   
18 1 PRO A 423 ? ? -38.47  124.67  
19 1 LYS A 427 ? ? -150.94 45.55   
20 1 SER A 439 ? ? -55.73  -144.01 
21 1 ARG A 441 ? ? 29.01   105.62  
22 1 ARG A 442 ? ? -35.72  137.04  
23 1 ALA A 447 ? ? -105.22 -146.94 
24 1 PHE A 448 ? ? 155.63  130.84  
25 1 PRO A 452 ? ? -32.50  -16.34  
26 1 PRO A 460 ? ? -20.86  144.40  
27 1 GLU A 463 ? ? -23.61  -41.59  
28 1 ALA A 467 ? ? -49.13  164.70  
29 1 SER A 468 ? ? -157.08 17.49   
30 1 PHE A 473 ? ? -132.12 -80.22  
31 1 TYR A 484 ? ? -51.35  -9.16   
32 1 ASP A 487 ? ? 42.97   15.24   
33 1 ASP A 488 ? ? 68.02   66.49   
34 1 ASP A 497 ? ? -47.82  85.55   
35 1 SER A 499 ? ? -2.92   -90.21  
36 1 THR X 247 ? ? -92.68  -113.63 
37 1 PRO X 250 ? ? -101.75 -166.52 
38 1 GLN X 252 ? ? -108.23 -131.81 
39 1 THR X 254 ? ? -100.00 -108.29 
40 1 LEU X 255 ? ? 170.10  118.72  
41 1 HIS X 256 ? ? -42.57  164.74  
42 1 SER X 258 ? ? -175.11 -31.15  
43 1 VAL X 261 ? ? 161.20  169.39  
44 1 GLN X 263 ? ? -52.33  90.25   
45 1 GLU B 301 ? ? -137.69 -44.63  
46 1 VAL B 303 ? ? -55.37  1.12    
47 1 SER B 319 ? ? -65.30  -71.78  
48 1 SER B 329 ? ? -64.95  41.49   
49 1 VAL B 330 ? ? -140.32 -8.97   
50 1 ALA B 336 ? ? -48.80  -72.31  
51 1 PHE B 342 ? ? -54.55  -70.06  
52 1 ASN B 351 ? ? -156.36 13.34   
53 1 ASP B 360 ? ? 82.05   49.90   
54 1 LYS B 362 ? ? -51.81  -93.57  
55 1 VAL B 369 ? ? -41.55  -72.61  
56 1 MET B 370 ? ? -46.80  -17.13  
57 1 LYS B 372 ? ? -148.70 -8.73   
58 1 THR B 373 ? ? -165.10 90.87   
59 1 PRO B 380 ? ? -21.89  116.55  
60 1 MET B 390 ? ? -122.38 -142.96 
61 1 CYS B 391 ? ? -164.16 -119.48 
62 1 ALA B 392 ? ? 152.16  128.87  
63 1 THR B 405 ? ? -141.31 16.88   
64 1 PHE B 410 ? ? -120.86 -149.92 
65 1 PHE B 411 ? ? -155.95 71.37   
66 1 ARG B 415 ? ? -50.86  99.69   
67 1 LEU B 421 ? ? -95.75  36.08   
68 1 PHE B 426 ? ? 51.16   123.20  
69 1 LYS B 427 ? ? -144.07 54.05   
70 1 LYS B 429 ? ? -35.50  73.30   
71 1 SER B 439 ? ? -13.98  -31.99  
72 1 SER B 440 ? ? -161.63 64.47   
73 1 PHE B 448 ? ? -104.03 -149.25 
74 1 LYS B 449 ? ? -160.09 117.89  
75 1 PRO B 450 ? ? -41.62  151.44  
76 1 SER B 454 ? ? -60.58  91.48   
77 1 SER B 455 ? ? -46.21  -6.94   
78 1 LYS B 458 ? ? -45.02  -128.30 
79 1 PRO B 460 ? ? -42.16  169.75  
80 1 THR B 461 ? ? -155.82 -17.20  
81 1 ASN B 465 ? ? -84.84  -145.20 
82 1 THR B 477 ? ? -61.85  -82.00  
83 1 VAL B 478 ? ? -24.34  -37.04  
84 1 TYR B 484 ? ? -49.51  -84.38  
85 1 ILE B 485 ? ? -56.09  106.37  
86 1 LEU B 501 ? ? 104.52  115.95  
87 1 PRO B 502 ? ? -28.26  -94.40  
88 1 ASP B 503 ? ? 145.44  148.61  
89 1 ALA Y 248 ? ? -139.72 -98.91  
90 1 ALA Y 249 ? ? 94.19   -157.41 
91 1 PRO Y 250 ? ? -109.92 -111.60 
92 1 GLN Y 252 ? ? -121.52 -115.76 
93 1 THR Y 254 ? ? -88.11  -82.27  
94 1 LEU Y 255 ? ? 158.56  146.87  
95 1 SER Y 258 ? ? -164.24 -0.34   
96 1 PRO Y 260 ? ? -69.87  69.80   
97 1 GLN Y 263 ? ? -107.11 68.25   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   X 
_pdbx_validate_peptide_omega.auth_seq_id_1    264 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASP 
_pdbx_validate_peptide_omega.auth_asym_id_2   X 
_pdbx_validate_peptide_omega.auth_seq_id_2    265 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            149.80 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     388 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.067 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ARG 277 ? A ARG 1  
2  1 Y 1 A GLN 278 ? A GLN 2  
3  1 Y 1 A ASN 279 ? A ASN 3  
4  1 Y 1 A TRP 280 ? A TRP 4  
5  1 Y 1 A GLU 281 ? A GLU 5  
6  1 Y 1 A GLU 282 ? A GLU 6  
7  1 Y 1 A ALA 283 ? A ALA 7  
8  1 Y 1 A ASP 284 ? A ASP 8  
9  1 Y 1 A SER 285 ? A SER 9  
10 1 Y 1 A MET 286 ? A MET 10 
11 1 Y 1 A LYS 287 ? A LYS 11 
12 1 Y 1 A SER 288 ? A SER 12 
13 1 Y 1 A SER 289 ? A SER 13 
14 1 Y 1 A VAL 290 ? A VAL 14 
15 1 Y 1 A GLU 291 ? A GLU 15 
16 1 Y 1 A SER 292 ? A SER 16 
17 1 Y 1 A LEU 293 ? A LEU 17 
18 1 Y 1 A GLN 294 ? A GLN 18 
19 1 Y 1 A ASN 295 ? A ASN 19 
20 1 Y 1 A ARG 296 ? A ARG 20 
21 1 Y 1 A VAL 297 ? A VAL 21 
22 1 Y 1 A THR 298 ? A THR 22 
23 1 Y 1 A GLU 299 ? A GLU 23 
24 1 Y 1 B ARG 277 ? C ARG 1  
25 1 Y 1 B GLN 278 ? C GLN 2  
26 1 Y 1 B ASN 279 ? C ASN 3  
27 1 Y 1 B TRP 280 ? C TRP 4  
28 1 Y 1 B GLU 281 ? C GLU 5  
29 1 Y 1 B GLU 282 ? C GLU 6  
30 1 Y 1 B ALA 283 ? C ALA 7  
31 1 Y 1 B ASP 284 ? C ASP 8  
32 1 Y 1 B SER 285 ? C SER 9  
33 1 Y 1 B MET 286 ? C MET 10 
34 1 Y 1 B LYS 287 ? C LYS 11 
35 1 Y 1 B SER 288 ? C SER 12 
36 1 Y 1 B SER 289 ? C SER 13 
37 1 Y 1 B VAL 290 ? C VAL 14 
38 1 Y 1 B GLU 291 ? C GLU 15 
39 1 Y 1 B SER 292 ? C SER 16 
40 1 Y 1 B LEU 293 ? C LEU 17 
41 1 Y 1 B GLN 294 ? C GLN 18 
42 1 Y 1 B ASN 295 ? C ASN 19 
43 1 Y 1 B ARG 296 ? C ARG 20 
44 1 Y 1 B VAL 297 ? C VAL 21 
45 1 Y 1 B THR 298 ? C THR 22 
46 1 Y 1 B GLU 299 ? C GLU 23 
#