data_1FNF
# 
_entry.id   1FNF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FNF         
WWPDB D_1000173350 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FNF 
_pdbx_database_status.recvd_initial_deposition_date   1995-09-30 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Leahy, D.J.'    1 
'Aukhil, I.'     2 
'Erickson, H.P.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary '2.0 A crystal structure of a four-domain segment of human fibronectin encompassing the RGD loop and synergy region.' 
'Cell(Cambridge,Mass.)' 84 155 164 1996 CELLB5 US 0092-8674 0998 ? 8548820 '10.1016/S0092-8674(00)81002-8' 
1       
;Crystallization of a Fragment of Human Fibronectin: Introduction of Methionine by Site-Directed Mutagenesis to Allow Phasing Via Selenomethionine
;
Proteins                19 48  ?   1994 PSFGEY US 0887-3585 0867 ? ?       ?                               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Leahy, D.J.'       1 
primary 'Aukhil, I.'        2 
primary 'Erickson, H.P.'    3 
1       'Leahy, D.J.'       4 
1       'Erickson, H.P.'    5 
1       'Aukhil, I.'        6 
1       'Joshi, P.'         7 
1       'Hendrickson, W.A.' 8 
# 
_cell.entry_id           1FNF 
_cell.length_a           64.050 
_cell.length_b           60.670 
_cell.length_c           58.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         103.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              2 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FNF 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man FIBRONECTIN 39981.160 1   ? ? ? ? 
2 water   nat water       18.015    259 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKD
DKESVPISDTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGT
EYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNS
ITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQ
EFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;PLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKD
DKESVPISDTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGT
EYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNS
ITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQ
EFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   PRO n 
1 2   LEU n 
1 3   SER n 
1 4   PRO n 
1 5   PRO n 
1 6   THR n 
1 7   ASN n 
1 8   LEU n 
1 9   HIS n 
1 10  LEU n 
1 11  GLU n 
1 12  ALA n 
1 13  ASN n 
1 14  PRO n 
1 15  ASP n 
1 16  THR n 
1 17  GLY n 
1 18  VAL n 
1 19  LEU n 
1 20  THR n 
1 21  VAL n 
1 22  SER n 
1 23  TRP n 
1 24  GLU n 
1 25  ARG n 
1 26  SER n 
1 27  THR n 
1 28  THR n 
1 29  PRO n 
1 30  ASP n 
1 31  ILE n 
1 32  THR n 
1 33  GLY n 
1 34  TYR n 
1 35  ARG n 
1 36  ILE n 
1 37  THR n 
1 38  THR n 
1 39  THR n 
1 40  PRO n 
1 41  THR n 
1 42  ASN n 
1 43  GLY n 
1 44  GLN n 
1 45  GLN n 
1 46  GLY n 
1 47  ASN n 
1 48  SER n 
1 49  LEU n 
1 50  GLU n 
1 51  GLU n 
1 52  VAL n 
1 53  VAL n 
1 54  HIS n 
1 55  ALA n 
1 56  ASP n 
1 57  GLN n 
1 58  SER n 
1 59  SER n 
1 60  CYS n 
1 61  THR n 
1 62  PHE n 
1 63  ASP n 
1 64  ASN n 
1 65  LEU n 
1 66  SER n 
1 67  PRO n 
1 68  GLY n 
1 69  LEU n 
1 70  GLU n 
1 71  TYR n 
1 72  ASN n 
1 73  VAL n 
1 74  SER n 
1 75  VAL n 
1 76  TYR n 
1 77  THR n 
1 78  VAL n 
1 79  LYS n 
1 80  ASP n 
1 81  ASP n 
1 82  LYS n 
1 83  GLU n 
1 84  SER n 
1 85  VAL n 
1 86  PRO n 
1 87  ILE n 
1 88  SER n 
1 89  ASP n 
1 90  THR n 
1 91  ILE n 
1 92  ILE n 
1 93  PRO n 
1 94  ALA n 
1 95  VAL n 
1 96  PRO n 
1 97  PRO n 
1 98  PRO n 
1 99  THR n 
1 100 ASP n 
1 101 LEU n 
1 102 ARG n 
1 103 PHE n 
1 104 THR n 
1 105 ASN n 
1 106 ILE n 
1 107 GLY n 
1 108 PRO n 
1 109 ASP n 
1 110 THR n 
1 111 MET n 
1 112 ARG n 
1 113 VAL n 
1 114 THR n 
1 115 TRP n 
1 116 ALA n 
1 117 PRO n 
1 118 PRO n 
1 119 PRO n 
1 120 SER n 
1 121 ILE n 
1 122 ASP n 
1 123 LEU n 
1 124 THR n 
1 125 ASN n 
1 126 PHE n 
1 127 LEU n 
1 128 VAL n 
1 129 ARG n 
1 130 TYR n 
1 131 SER n 
1 132 PRO n 
1 133 VAL n 
1 134 LYS n 
1 135 ASN n 
1 136 GLU n 
1 137 GLU n 
1 138 ASP n 
1 139 VAL n 
1 140 ALA n 
1 141 GLU n 
1 142 LEU n 
1 143 SER n 
1 144 ILE n 
1 145 SER n 
1 146 PRO n 
1 147 SER n 
1 148 ASP n 
1 149 ASN n 
1 150 ALA n 
1 151 VAL n 
1 152 VAL n 
1 153 LEU n 
1 154 THR n 
1 155 ASN n 
1 156 LEU n 
1 157 LEU n 
1 158 PRO n 
1 159 GLY n 
1 160 THR n 
1 161 GLU n 
1 162 TYR n 
1 163 VAL n 
1 164 VAL n 
1 165 SER n 
1 166 VAL n 
1 167 SER n 
1 168 SER n 
1 169 VAL n 
1 170 TYR n 
1 171 GLU n 
1 172 GLN n 
1 173 HIS n 
1 174 GLU n 
1 175 SER n 
1 176 THR n 
1 177 PRO n 
1 178 LEU n 
1 179 ARG n 
1 180 GLY n 
1 181 ARG n 
1 182 GLN n 
1 183 LYS n 
1 184 THR n 
1 185 GLY n 
1 186 LEU n 
1 187 ASP n 
1 188 SER n 
1 189 PRO n 
1 190 THR n 
1 191 GLY n 
1 192 ILE n 
1 193 ASP n 
1 194 PHE n 
1 195 SER n 
1 196 ASP n 
1 197 ILE n 
1 198 THR n 
1 199 ALA n 
1 200 ASN n 
1 201 SER n 
1 202 PHE n 
1 203 THR n 
1 204 VAL n 
1 205 HIS n 
1 206 TRP n 
1 207 ILE n 
1 208 ALA n 
1 209 PRO n 
1 210 ARG n 
1 211 ALA n 
1 212 THR n 
1 213 ILE n 
1 214 THR n 
1 215 GLY n 
1 216 TYR n 
1 217 ARG n 
1 218 ILE n 
1 219 ARG n 
1 220 HIS n 
1 221 HIS n 
1 222 PRO n 
1 223 GLU n 
1 224 HIS n 
1 225 PHE n 
1 226 SER n 
1 227 GLY n 
1 228 ARG n 
1 229 PRO n 
1 230 ARG n 
1 231 GLU n 
1 232 ASP n 
1 233 ARG n 
1 234 VAL n 
1 235 PRO n 
1 236 HIS n 
1 237 SER n 
1 238 ARG n 
1 239 ASN n 
1 240 SER n 
1 241 ILE n 
1 242 THR n 
1 243 LEU n 
1 244 THR n 
1 245 ASN n 
1 246 LEU n 
1 247 THR n 
1 248 PRO n 
1 249 GLY n 
1 250 THR n 
1 251 GLU n 
1 252 TYR n 
1 253 VAL n 
1 254 VAL n 
1 255 SER n 
1 256 ILE n 
1 257 VAL n 
1 258 ALA n 
1 259 LEU n 
1 260 ASN n 
1 261 GLY n 
1 262 ARG n 
1 263 GLU n 
1 264 GLU n 
1 265 SER n 
1 266 PRO n 
1 267 LEU n 
1 268 LEU n 
1 269 ILE n 
1 270 GLY n 
1 271 GLN n 
1 272 GLN n 
1 273 SER n 
1 274 THR n 
1 275 VAL n 
1 276 SER n 
1 277 ASP n 
1 278 VAL n 
1 279 PRO n 
1 280 ARG n 
1 281 ASP n 
1 282 LEU n 
1 283 GLU n 
1 284 VAL n 
1 285 VAL n 
1 286 ALA n 
1 287 ALA n 
1 288 THR n 
1 289 PRO n 
1 290 THR n 
1 291 SER n 
1 292 LEU n 
1 293 LEU n 
1 294 ILE n 
1 295 SER n 
1 296 TRP n 
1 297 ASP n 
1 298 ALA n 
1 299 PRO n 
1 300 ALA n 
1 301 VAL n 
1 302 THR n 
1 303 VAL n 
1 304 ARG n 
1 305 TYR n 
1 306 TYR n 
1 307 ARG n 
1 308 ILE n 
1 309 THR n 
1 310 TYR n 
1 311 GLY n 
1 312 GLU n 
1 313 THR n 
1 314 GLY n 
1 315 GLY n 
1 316 ASN n 
1 317 SER n 
1 318 PRO n 
1 319 VAL n 
1 320 GLN n 
1 321 GLU n 
1 322 PHE n 
1 323 THR n 
1 324 VAL n 
1 325 PRO n 
1 326 GLY n 
1 327 SER n 
1 328 LYS n 
1 329 SER n 
1 330 THR n 
1 331 ALA n 
1 332 THR n 
1 333 ILE n 
1 334 SER n 
1 335 GLY n 
1 336 LEU n 
1 337 LYS n 
1 338 PRO n 
1 339 GLY n 
1 340 VAL n 
1 341 ASP n 
1 342 TYR n 
1 343 THR n 
1 344 ILE n 
1 345 THR n 
1 346 VAL n 
1 347 TYR n 
1 348 ALA n 
1 349 VAL n 
1 350 THR n 
1 351 GLY n 
1 352 ARG n 
1 353 GLY n 
1 354 ASP n 
1 355 SER n 
1 356 PRO n 
1 357 ALA n 
1 358 SER n 
1 359 SER n 
1 360 LYS n 
1 361 PRO n 
1 362 ILE n 
1 363 SER n 
1 364 ILE n 
1 365 ASN n 
1 366 TYR n 
1 367 ARG n 
1 368 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            BL21 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 AND 834(DE4)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET11B 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'T7 EXPRESSION SYSTEM OF W. STUDIER' 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FINC_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P02751 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYG
GSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHET
GGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHPQPPPYGHCVTDSGVVYSVGM
QWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSF
CTDHTVLVQTQGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQ
CQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISK
YILRWRPKNSVGRWKEATIPGHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQS
LILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITI
YAVEENQESTPVVIQQETTGTPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPPRAQITGYRLTVGLTRRGQPR
QYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVR
PSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISDTIIPAVPPPTDLRFTNIGP
DTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDS
PTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYA
VTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIE
GLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKE
KTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTET
ITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLL
VSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTL
PHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNV
GEEIQIGHIPREDVDYHLYPHGPGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGS
GHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCT
CFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1FNF 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 368 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P02751 
_struct_ref_seq.db_align_beg                  1173 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1540 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1142 
_struct_ref_seq.pdbx_auth_seq_align_end       1509 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FNF 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.76 
_exptl_crystal.density_percent_sol   55.51 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 5.8' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   FUJI 
_diffrn_detector.pdbx_collection_date   1994-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9871 1.0 
2 0.9793 1.0 
3 0.9790 1.0 
4 0.9686 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X4A' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X4A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9871, 0.9793, 0.9790, 0.9686' 
# 
_reflns.entry_id                     1FNF 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   28425 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.3 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1FNF 
_refine.ls_number_reflns_obs                     21904 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2. 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             6.0 
_refine.ls_d_res_high                            2.0 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.216 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.216 
_refine.ls_R_factor_R_free                       0.308 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.7 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3443 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             777 
_refine_hist.number_atoms_total               4220 
_refine_hist.d_res_high                       2.0 
_refine_hist.d_res_low                        6.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      25.56 ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.32  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1FNF 
_struct.title                     'FRAGMENT OF HUMAN FIBRONECTIN ENCOMPASSING TYPE-III REPEATS 7 THROUGH 10' 
_struct.pdbx_descriptor           FIBRONECTIN 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FNF 
_struct_keywords.pdbx_keywords   'CELL ADHESION PROTEIN' 
_struct_keywords.text            'RGD, EXTRACELLULAR MATRIX, CELL ADHESION PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 3 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 9   ? ALA A 12  ? HIS A 1150 ALA A 1153 
A 2 LEU A 19  ? SER A 22  ? LEU A 1160 SER A 1163 
A 3 SER A 59  ? THR A 61  ? SER A 1200 THR A 1202 
B 1 LEU A 49  ? VAL A 53  ? LEU A 1190 VAL A 1194 
B 2 GLY A 33  ? PRO A 40  ? GLY A 1174 PRO A 1181 
B 3 GLU A 70  ? VAL A 78  ? GLU A 1211 VAL A 1219 
B 4 ILE A 87  ? ILE A 92  ? ILE A 1228 ILE A 1233 
C 1 ARG A 102 ? THR A 104 ? ARG A 1243 THR A 1245 
C 2 MET A 111 ? THR A 114 ? MET A 1252 THR A 1255 
C 3 ALA A 150 ? LEU A 153 ? ALA A 1291 LEU A 1294 
D 1 LEU A 178 ? LYS A 183 ? LEU A 1319 LYS A 1324 
D 2 GLU A 161 ? VAL A 169 ? GLU A 1302 VAL A 1310 
D 3 ASN A 125 ? PRO A 132 ? ASN A 1266 PRO A 1273 
D 4 ASN A 135 ? ILE A 144 ? ASN A 1276 ILE A 1285 
E 1 ASP A 193 ? SER A 195 ? ASP A 1334 SER A 1336 
E 2 SER A 201 ? HIS A 205 ? SER A 1342 HIS A 1346 
E 3 SER A 240 ? THR A 244 ? SER A 1381 THR A 1385 
F 1 ARG A 230 ? PRO A 235 ? ARG A 1371 PRO A 1376 
F 2 GLY A 215 ? HIS A 221 ? GLY A 1356 HIS A 1362 
F 3 GLU A 251 ? LEU A 259 ? GLU A 1392 LEU A 1400 
F 4 LEU A 268 ? SER A 273 ? LEU A 1409 SER A 1414 
G 1 THR A 330 ? ILE A 333 ? THR A 1471 ILE A 1474 
G 2 SER A 291 ? SER A 295 ? SER A 1432 SER A 1436 
G 3 GLU A 283 ? THR A 288 ? GLU A 1424 THR A 1429 
H 1 GLN A 320 ? PRO A 325 ? GLN A 1461 PRO A 1466 
H 2 TYR A 305 ? GLU A 312 ? TYR A 1446 GLU A 1453 
H 3 TYR A 342 ? VAL A 349 ? TYR A 1483 VAL A 1490 
H 4 ILE A 362 ? TYR A 366 ? ILE A 1503 TYR A 1507 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O HIS A 9   ? O HIS A 1150 N SER A 22  ? N SER A 1163 
A 2 3 O VAL A 21  ? O VAL A 1162 N CYS A 60  ? N CYS A 1201 
B 1 2 O LEU A 49  ? O LEU A 1190 N THR A 38  ? N THR A 1179 
B 2 3 O GLY A 33  ? O GLY A 1174 N VAL A 78  ? N VAL A 1219 
B 3 4 O TYR A 71  ? O TYR A 1212 N ILE A 91  ? N ILE A 1232 
C 1 2 O ARG A 102 ? O ARG A 1243 N THR A 114 ? N THR A 1255 
C 2 3 O MET A 111 ? O MET A 1252 N LEU A 153 ? N LEU A 1294 
D 1 2 O LEU A 178 ? O LEU A 1319 N VAL A 166 ? N VAL A 1307 
D 2 3 O VAL A 163 ? O VAL A 1304 N SER A 131 ? N SER A 1272 
D 3 4 O PHE A 126 ? O PHE A 1267 N ILE A 144 ? N ILE A 1285 
E 1 2 O ASP A 193 ? O ASP A 1334 N HIS A 205 ? N HIS A 1346 
E 2 3 O PHE A 202 ? O PHE A 1343 N LEU A 243 ? N LEU A 1384 
F 1 2 O ARG A 230 ? O ARG A 1371 N HIS A 220 ? N HIS A 1361 
F 2 3 O GLY A 215 ? O GLY A 1356 N LEU A 259 ? N LEU A 1400 
F 3 4 O TYR A 252 ? O TYR A 1393 N GLN A 272 ? N GLN A 1413 
G 1 2 O ALA A 331 ? O ALA A 1472 N ILE A 294 ? N ILE A 1435 
G 2 3 O SER A 291 ? O SER A 1432 N THR A 288 ? N THR A 1429 
H 1 2 O GLN A 320 ? O GLN A 1461 N TYR A 310 ? N TYR A 1451 
H 2 3 O TYR A 305 ? O TYR A 1446 N VAL A 349 ? N VAL A 1490 
H 3 4 O TYR A 342 ? O TYR A 1483 N TYR A 366 ? N TYR A 1507 
# 
_database_PDB_matrix.entry_id          1FNF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FNF 
_atom_sites.fract_transf_matrix[1][1]   0.015613 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003604 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016483 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.017562 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . PRO A 1 1   ? 15.281 -25.529 72.150  1.00 40.10  ? 1142 PRO A N    1 
ATOM   2    C CA   . PRO A 1 1   ? 15.416 -25.663 70.682  1.00 35.13  ? 1142 PRO A CA   1 
ATOM   3    C C    . PRO A 1 1   ? 15.342 -24.290 70.048  1.00 33.87  ? 1142 PRO A C    1 
ATOM   4    O O    . PRO A 1 1   ? 15.130 -23.295 70.744  1.00 33.92  ? 1142 PRO A O    1 
ATOM   5    C CB   . PRO A 1 1   ? 14.294 -26.568 70.181  1.00 30.86  ? 1142 PRO A CB   1 
ATOM   6    C CG   . PRO A 1 1   ? 13.312 -26.564 71.377  1.00 42.72  ? 1142 PRO A CG   1 
ATOM   7    C CD   . PRO A 1 1   ? 14.181 -26.390 72.624  1.00 36.65  ? 1142 PRO A CD   1 
ATOM   8    H H2   . PRO A 1 1   ? 16.210 -25.605 72.603  1.00 0.00   ? 1142 PRO A H2   1 
ATOM   9    H H3   . PRO A 1 1   ? 14.959 -24.528 72.202  1.00 0.00   ? 1142 PRO A H3   1 
ATOM   10   N N    . LEU A 1 2   ? 15.550 -24.239 68.739  1.00 27.78  ? 1143 LEU A N    1 
ATOM   11   C CA   . LEU A 1 2   ? 15.523 -22.979 68.010  1.00 22.06  ? 1143 LEU A CA   1 
ATOM   12   C C    . LEU A 1 2   ? 14.328 -22.965 67.068  1.00 17.29  ? 1143 LEU A C    1 
ATOM   13   O O    . LEU A 1 2   ? 13.970 -23.997 66.492  1.00 19.77  ? 1143 LEU A O    1 
ATOM   14   C CB   . LEU A 1 2   ? 16.815 -22.826 67.202  1.00 21.56  ? 1143 LEU A CB   1 
ATOM   15   C CG   . LEU A 1 2   ? 18.144 -23.183 67.868  1.00 21.04  ? 1143 LEU A CG   1 
ATOM   16   C CD1  . LEU A 1 2   ? 19.272 -23.047 66.866  1.00 30.29  ? 1143 LEU A CD1  1 
ATOM   17   C CD2  . LEU A 1 2   ? 18.396 -22.276 69.048  1.00 31.74  ? 1143 LEU A CD2  1 
ATOM   18   H H    . LEU A 1 2   ? 15.706 -25.051 68.211  1.00 0.00   ? 1143 LEU A H    1 
ATOM   19   N N    . SER A 1 3   ? 13.658 -21.825 66.980  1.00 19.00  ? 1144 SER A N    1 
ATOM   20   C CA   . SER A 1 3   ? 12.524 -21.680 66.084  1.00 17.69  ? 1144 SER A CA   1 
ATOM   21   C C    . SER A 1 3   ? 13.148 -21.230 64.769  1.00 18.58  ? 1144 SER A C    1 
ATOM   22   O O    . SER A 1 3   ? 14.057 -20.395 64.755  1.00 18.87  ? 1144 SER A O    1 
ATOM   23   C CB   . SER A 1 3   ? 11.553 -20.630 66.604  1.00 13.32  ? 1144 SER A CB   1 
ATOM   24   O OG   . SER A 1 3   ? 10.834 -21.108 67.719  1.00 19.79  ? 1144 SER A OG   1 
ATOM   25   H H    . SER A 1 3   ? 13.933 -21.054 67.503  1.00 0.00   ? 1144 SER A H    1 
ATOM   26   H HG   . SER A 1 3   ? 11.216 -20.843 68.576  1.00 0.00   ? 1144 SER A HG   1 
ATOM   27   N N    . PRO A 1 4   ? 12.731 -21.833 63.656  1.00 24.05  ? 1145 PRO A N    1 
ATOM   28   C CA   . PRO A 1 4   ? 13.268 -21.487 62.340  1.00 26.50  ? 1145 PRO A CA   1 
ATOM   29   C C    . PRO A 1 4   ? 12.796 -20.128 61.824  1.00 29.14  ? 1145 PRO A C    1 
ATOM   30   O O    . PRO A 1 4   ? 11.965 -19.462 62.455  1.00 23.88  ? 1145 PRO A O    1 
ATOM   31   C CB   . PRO A 1 4   ? 12.712 -22.604 61.465  1.00 27.90  ? 1145 PRO A CB   1 
ATOM   32   C CG   . PRO A 1 4   ? 11.356 -22.824 62.079  1.00 26.77  ? 1145 PRO A CG   1 
ATOM   33   C CD   . PRO A 1 4   ? 11.715 -22.893 63.542  1.00 21.71  ? 1145 PRO A CD   1 
ATOM   34   N N    . PRO A 1 5   ? 13.391 -19.654 60.712  1.00 28.22  ? 1146 PRO A N    1 
ATOM   35   C CA   . PRO A 1 5   ? 12.940 -18.365 60.187  1.00 17.62  ? 1146 PRO A CA   1 
ATOM   36   C C    . PRO A 1 5   ? 11.567 -18.644 59.571  1.00 22.07  ? 1146 PRO A C    1 
ATOM   37   O O    . PRO A 1 5   ? 11.175 -19.812 59.396  1.00 21.06  ? 1146 PRO A O    1 
ATOM   38   C CB   . PRO A 1 5   ? 13.965 -18.069 59.090  1.00 24.39  ? 1146 PRO A CB   1 
ATOM   39   C CG   . PRO A 1 5   ? 15.186 -18.814 59.540  1.00 23.33  ? 1146 PRO A CG   1 
ATOM   40   C CD   . PRO A 1 5   ? 14.598 -20.116 60.006  1.00 18.84  ? 1146 PRO A CD   1 
ATOM   41   N N    . THR A 1 6   ? 10.807 -17.596 59.299  1.00 17.35  ? 1147 THR A N    1 
ATOM   42   C CA   . THR A 1 6   ? 9.506  -17.764 58.673  1.00 17.62  ? 1147 THR A CA   1 
ATOM   43   C C    . THR A 1 6   ? 9.462  -16.729 57.572  1.00 21.42  ? 1147 THR A C    1 
ATOM   44   O O    . THR A 1 6   ? 10.405 -15.960 57.422  1.00 21.77  ? 1147 THR A O    1 
ATOM   45   C CB   . THR A 1 6   ? 8.371  -17.430 59.620  1.00 13.24  ? 1147 THR A CB   1 
ATOM   46   O OG1  . THR A 1 6   ? 8.573  -16.111 60.147  1.00 19.56  ? 1147 THR A OG1  1 
ATOM   47   C CG2  . THR A 1 6   ? 8.287  -18.457 60.739  1.00 22.98  ? 1147 THR A CG2  1 
ATOM   48   H H    . THR A 1 6   ? 11.124 -16.686 59.500  1.00 0.00   ? 1147 THR A H    1 
ATOM   49   H HG1  . THR A 1 6   ? 9.285  -16.103 60.816  1.00 0.00   ? 1147 THR A HG1  1 
ATOM   50   N N    . ASN A 1 7   ? 8.382  -16.724 56.798  1.00 27.75  ? 1148 ASN A N    1 
ATOM   51   C CA   . ASN A 1 7   ? 8.198  -15.739 55.737  1.00 30.04  ? 1148 ASN A CA   1 
ATOM   52   C C    . ASN A 1 7   ? 9.409  -15.681 54.821  1.00 26.79  ? 1148 ASN A C    1 
ATOM   53   O O    . ASN A 1 7   ? 10.068 -14.645 54.706  1.00 26.06  ? 1148 ASN A O    1 
ATOM   54   C CB   . ASN A 1 7   ? 7.952  -14.365 56.365  1.00 33.11  ? 1148 ASN A CB   1 
ATOM   55   C CG   . ASN A 1 7   ? 7.275  -13.399 55.423  1.00 36.60  ? 1148 ASN A CG   1 
ATOM   56   O OD1  . ASN A 1 7   ? 6.748  -13.788 54.377  1.00 38.56  ? 1148 ASN A OD1  1 
ATOM   57   N ND2  . ASN A 1 7   ? 7.255  -12.133 55.806  1.00 34.21  ? 1148 ASN A ND2  1 
ATOM   58   H H    . ASN A 1 7   ? 7.678  -17.391 56.938  1.00 0.00   ? 1148 ASN A H    1 
ATOM   59   H HD21 . ASN A 1 7   ? 6.864  -11.454 55.221  1.00 0.00   ? 1148 ASN A HD21 1 
ATOM   60   H HD22 . ASN A 1 7   ? 7.649  -11.934 56.680  1.00 0.00   ? 1148 ASN A HD22 1 
ATOM   61   N N    . LEU A 1 8   ? 9.717  -16.816 54.205  1.00 27.13  ? 1149 LEU A N    1 
ATOM   62   C CA   . LEU A 1 8   ? 10.857 -16.917 53.302  1.00 28.34  ? 1149 LEU A CA   1 
ATOM   63   C C    . LEU A 1 8   ? 10.469 -16.341 51.942  1.00 30.73  ? 1149 LEU A C    1 
ATOM   64   O O    . LEU A 1 8   ? 9.374  -16.615 51.434  1.00 27.11  ? 1149 LEU A O    1 
ATOM   65   C CB   . LEU A 1 8   ? 11.265 -18.386 53.157  1.00 26.30  ? 1149 LEU A CB   1 
ATOM   66   C CG   . LEU A 1 8   ? 12.339 -18.782 52.145  1.00 27.20  ? 1149 LEU A CG   1 
ATOM   67   C CD1  . LEU A 1 8   ? 13.681 -18.153 52.497  1.00 21.87  ? 1149 LEU A CD1  1 
ATOM   68   C CD2  . LEU A 1 8   ? 12.438 -20.297 52.096  1.00 16.86  ? 1149 LEU A CD2  1 
ATOM   69   H H    . LEU A 1 8   ? 9.146  -17.596 54.329  1.00 0.00   ? 1149 LEU A H    1 
ATOM   70   N N    . HIS A 1 9   ? 11.336 -15.499 51.390  1.00 33.96  ? 1150 HIS A N    1 
ATOM   71   C CA   . HIS A 1 9   ? 11.099 -14.891 50.081  1.00 40.01  ? 1150 HIS A CA   1 
ATOM   72   C C    . HIS A 1 9   ? 12.296 -15.139 49.176  1.00 35.21  ? 1150 HIS A C    1 
ATOM   73   O O    . HIS A 1 9   ? 13.442 -14.964 49.587  1.00 36.45  ? 1150 HIS A O    1 
ATOM   74   C CB   . HIS A 1 9   ? 10.814 -13.386 50.197  1.00 37.49  ? 1150 HIS A CB   1 
ATOM   75   C CG   . HIS A 1 9   ? 9.504  -13.070 50.852  1.00 46.35  ? 1150 HIS A CG   1 
ATOM   76   N ND1  . HIS A 1 9   ? 9.383  -12.143 51.866  1.00 49.92  ? 1150 HIS A ND1  1 
ATOM   77   C CD2  . HIS A 1 9   ? 8.259  -13.568 50.650  1.00 52.64  ? 1150 HIS A CD2  1 
ATOM   78   C CE1  . HIS A 1 9   ? 8.122  -12.083 52.261  1.00 47.19  ? 1150 HIS A CE1  1 
ATOM   79   N NE2  . HIS A 1 9   ? 7.420  -12.939 51.541  1.00 46.52  ? 1150 HIS A NE2  1 
ATOM   80   H H    . HIS A 1 9   ? 12.180 -15.306 51.833  1.00 0.00   ? 1150 HIS A H    1 
ATOM   81   H HD1  . HIS A 1 9   ? 10.108 -11.616 52.269  1.00 0.00   ? 1150 HIS A HD1  1 
ATOM   82   H HE2  . HIS A 1 9   ? 6.470  -13.127 51.686  1.00 0.00   ? 1150 HIS A HE2  1 
ATOM   83   N N    . LEU A 1 10  ? 12.021 -15.599 47.961  1.00 40.28  ? 1151 LEU A N    1 
ATOM   84   C CA   . LEU A 1 10  ? 13.062 -15.890 46.977  1.00 46.18  ? 1151 LEU A CA   1 
ATOM   85   C C    . LEU A 1 10  ? 12.879 -14.982 45.764  1.00 46.64  ? 1151 LEU A C    1 
ATOM   86   O O    . LEU A 1 10  ? 11.828 -15.015 45.122  1.00 42.90  ? 1151 LEU A O    1 
ATOM   87   C CB   . LEU A 1 10  ? 12.976 -17.356 46.546  1.00 40.54  ? 1151 LEU A CB   1 
ATOM   88   C CG   . LEU A 1 10  ? 12.968 -18.379 47.684  1.00 27.03  ? 1151 LEU A CG   1 
ATOM   89   C CD1  . LEU A 1 10  ? 12.994 -19.763 47.101  1.00 25.65  ? 1151 LEU A CD1  1 
ATOM   90   C CD2  . LEU A 1 10  ? 14.170 -18.159 48.575  1.00 18.61  ? 1151 LEU A CD2  1 
ATOM   91   H H    . LEU A 1 10  ? 11.089 -15.733 47.697  1.00 0.00   ? 1151 LEU A H    1 
ATOM   92   N N    . GLU A 1 11  ? 13.890 -14.167 45.467  1.00 52.25  ? 1152 GLU A N    1 
ATOM   93   C CA   . GLU A 1 11  ? 13.828 -13.238 44.337  1.00 59.56  ? 1152 GLU A CA   1 
ATOM   94   C C    . GLU A 1 11  ? 14.993 -13.444 43.386  1.00 61.69  ? 1152 GLU A C    1 
ATOM   95   O O    . GLU A 1 11  ? 16.125 -13.079 43.696  1.00 55.25  ? 1152 GLU A O    1 
ATOM   96   C CB   . GLU A 1 11  ? 13.829 -11.792 44.835  1.00 64.36  ? 1152 GLU A CB   1 
ATOM   97   C CG   . GLU A 1 11  ? 12.637 -11.438 45.708  1.00 79.85  ? 1152 GLU A CG   1 
ATOM   98   C CD   . GLU A 1 11  ? 12.877 -10.209 46.569  1.00 91.33  ? 1152 GLU A CD   1 
ATOM   99   O OE1  . GLU A 1 11  ? 14.034 -9.982  46.992  1.00 94.64  ? 1152 GLU A OE1  1 
ATOM   100  O OE2  . GLU A 1 11  ? 11.901 -9.479  46.847  1.00 102.21 ? 1152 GLU A OE2  1 
ATOM   101  H H    . GLU A 1 11  ? 14.691 -14.165 46.036  1.00 0.00   ? 1152 GLU A H    1 
ATOM   102  N N    . ALA A 1 12  ? 14.710 -14.038 42.231  1.00 72.11  ? 1153 ALA A N    1 
ATOM   103  C CA   . ALA A 1 12  ? 15.735 -14.298 41.224  1.00 82.29  ? 1153 ALA A CA   1 
ATOM   104  C C    . ALA A 1 12  ? 15.693 -13.244 40.127  1.00 87.88  ? 1153 ALA A C    1 
ATOM   105  O O    . ALA A 1 12  ? 14.641 -12.985 39.536  1.00 90.32  ? 1153 ALA A O    1 
ATOM   106  C CB   . ALA A 1 12  ? 15.552 -15.692 40.620  1.00 80.45  ? 1153 ALA A CB   1 
ATOM   107  H H    . ALA A 1 12  ? 13.784 -14.279 42.035  1.00 0.00   ? 1153 ALA A H    1 
ATOM   108  N N    . ASN A 1 13  ? 16.839 -12.623 39.877  1.00 92.97  ? 1154 ASN A N    1 
ATOM   109  C CA   . ASN A 1 13  ? 16.949 -11.605 38.845  1.00 96.37  ? 1154 ASN A CA   1 
ATOM   110  C C    . ASN A 1 13  ? 16.724 -12.278 37.494  1.00 99.99  ? 1154 ASN A C    1 
ATOM   111  O O    . ASN A 1 13  ? 17.298 -13.335 37.230  1.00 100.66 ? 1154 ASN A O    1 
ATOM   112  C CB   . ASN A 1 13  ? 18.344 -10.985 38.885  1.00 94.91  ? 1154 ASN A CB   1 
ATOM   113  C CG   . ASN A 1 13  ? 18.470 -9.786  37.979  1.00 95.35  ? 1154 ASN A CG   1 
ATOM   114  O OD1  . ASN A 1 13  ? 17.591 -8.920  37.954  1.00 89.23  ? 1154 ASN A OD1  1 
ATOM   115  N ND2  . ASN A 1 13  ? 19.559 -9.726  37.227  1.00 97.26  ? 1154 ASN A ND2  1 
ATOM   116  H H    . ASN A 1 13  ? 17.635 -12.872 40.389  1.00 0.00   ? 1154 ASN A H    1 
ATOM   117  H HD21 . ASN A 1 13  ? 19.638 -8.971  36.596  1.00 0.00   ? 1154 ASN A HD21 1 
ATOM   118  H HD22 . ASN A 1 13  ? 20.256 -10.412 37.237  1.00 0.00   ? 1154 ASN A HD22 1 
ATOM   119  N N    . PRO A 1 14  ? 15.858 -11.697 36.639  1.00 103.81 ? 1155 PRO A N    1 
ATOM   120  C CA   . PRO A 1 14  ? 15.532 -12.218 35.303  1.00 105.80 ? 1155 PRO A CA   1 
ATOM   121  C C    . PRO A 1 14  ? 16.772 -12.708 34.564  1.00 107.58 ? 1155 PRO A C    1 
ATOM   122  O O    . PRO A 1 14  ? 16.816 -13.839 34.077  1.00 107.30 ? 1155 PRO A O    1 
ATOM   123  C CB   . PRO A 1 14  ? 14.903 -11.009 34.629  1.00 107.15 ? 1155 PRO A CB   1 
ATOM   124  C CG   . PRO A 1 14  ? 14.122 -10.410 35.760  1.00 107.43 ? 1155 PRO A CG   1 
ATOM   125  C CD   . PRO A 1 14  ? 15.115 -10.450 36.904  1.00 104.78 ? 1155 PRO A CD   1 
ATOM   126  N N    . ASP A 1 15  ? 17.764 -11.835 34.454  1.00 109.76 ? 1156 ASP A N    1 
ATOM   127  C CA   . ASP A 1 15  ? 19.033 -12.184 33.831  1.00 112.53 ? 1156 ASP A CA   1 
ATOM   128  C C    . ASP A 1 15  ? 19.803 -12.821 34.986  1.00 115.93 ? 1156 ASP A C    1 
ATOM   129  O O    . ASP A 1 15  ? 20.617 -12.176 35.655  1.00 116.68 ? 1156 ASP A O    1 
ATOM   130  C CB   . ASP A 1 15  ? 19.742 -10.934 33.289  1.00 111.34 ? 1156 ASP A CB   1 
ATOM   131  C CG   . ASP A 1 15  ? 19.387 -9.665  34.058  1.00 109.69 ? 1156 ASP A CG   1 
ATOM   132  O OD1  . ASP A 1 15  ? 18.201 -9.254  34.031  1.00 106.31 ? 1156 ASP A OD1  1 
ATOM   133  O OD2  . ASP A 1 15  ? 20.294 -9.070  34.675  1.00 107.51 ? 1156 ASP A OD2  1 
ATOM   134  H H    . ASP A 1 15  ? 17.643 -10.938 34.825  1.00 0.00   ? 1156 ASP A H    1 
ATOM   135  N N    . THR A 1 16  ? 19.465 -14.082 35.251  1.00 119.14 ? 1157 THR A N    1 
ATOM   136  C CA   . THR A 1 16  ? 20.035 -14.853 36.352  1.00 120.70 ? 1157 THR A CA   1 
ATOM   137  C C    . THR A 1 16  ? 21.472 -14.567 36.760  1.00 119.51 ? 1157 THR A C    1 
ATOM   138  O O    . THR A 1 16  ? 22.414 -14.673 35.968  1.00 118.88 ? 1157 THR A O    1 
ATOM   139  C CB   . THR A 1 16  ? 19.838 -16.373 36.168  1.00 120.53 ? 1157 THR A CB   1 
ATOM   140  O OG1  . THR A 1 16  ? 18.440 -16.665 36.066  1.00 119.06 ? 1157 THR A OG1  1 
ATOM   141  C CG2  . THR A 1 16  ? 20.409 -17.140 37.368  1.00 117.76 ? 1157 THR A CG2  1 
ATOM   142  H H    . THR A 1 16  ? 18.789 -14.497 34.679  1.00 0.00   ? 1157 THR A H    1 
ATOM   143  H HG1  . THR A 1 16  ? 18.029 -16.154 35.358  1.00 0.00   ? 1157 THR A HG1  1 
ATOM   144  N N    . GLY A 1 17  ? 21.594 -14.222 38.036  1.00 117.30 ? 1158 GLY A N    1 
ATOM   145  C CA   . GLY A 1 17  ? 22.861 -13.912 38.659  1.00 110.78 ? 1158 GLY A CA   1 
ATOM   146  C C    . GLY A 1 17  ? 22.535 -13.770 40.132  1.00 103.61 ? 1158 GLY A C    1 
ATOM   147  O O    . GLY A 1 17  ? 22.721 -14.705 40.907  1.00 104.04 ? 1158 GLY A O    1 
ATOM   148  H H    . GLY A 1 17  ? 20.789 -14.208 38.589  1.00 0.00   ? 1158 GLY A H    1 
ATOM   149  N N    . VAL A 1 18  ? 21.935 -12.637 40.482  1.00 94.76  ? 1159 VAL A N    1 
ATOM   150  C CA   . VAL A 1 18  ? 21.553 -12.338 41.854  1.00 84.55  ? 1159 VAL A CA   1 
ATOM   151  C C    . VAL A 1 18  ? 20.216 -12.977 42.223  1.00 80.57  ? 1159 VAL A C    1 
ATOM   152  O O    . VAL A 1 18  ? 19.219 -12.822 41.510  1.00 80.95  ? 1159 VAL A O    1 
ATOM   153  C CB   . VAL A 1 18  ? 21.434 -10.814 42.070  1.00 83.82  ? 1159 VAL A CB   1 
ATOM   154  C CG1  . VAL A 1 18  ? 21.087 -10.499 43.518  1.00 84.22  ? 1159 VAL A CG1  1 
ATOM   155  C CG2  . VAL A 1 18  ? 22.718 -10.127 41.666  1.00 86.20  ? 1159 VAL A CG2  1 
ATOM   156  H H    . VAL A 1 18  ? 21.730 -11.980 39.791  1.00 0.00   ? 1159 VAL A H    1 
ATOM   157  N N    . LEU A 1 19  ? 20.219 -13.716 43.327  1.00 73.66  ? 1160 LEU A N    1 
ATOM   158  C CA   . LEU A 1 19  ? 19.027 -14.370 43.857  1.00 58.60  ? 1160 LEU A CA   1 
ATOM   159  C C    . LEU A 1 19  ? 18.990 -13.925 45.309  1.00 55.26  ? 1160 LEU A C    1 
ATOM   160  O O    . LEU A 1 19  ? 19.837 -14.328 46.107  1.00 58.47  ? 1160 LEU A O    1 
ATOM   161  C CB   . LEU A 1 19  ? 19.165 -15.893 43.760  1.00 53.89  ? 1160 LEU A CB   1 
ATOM   162  C CG   . LEU A 1 19  ? 18.141 -16.850 44.385  1.00 48.54  ? 1160 LEU A CG   1 
ATOM   163  C CD1  . LEU A 1 19  ? 18.575 -17.286 45.764  1.00 43.52  ? 1160 LEU A CD1  1 
ATOM   164  C CD2  . LEU A 1 19  ? 16.762 -16.229 44.409  1.00 55.91  ? 1160 LEU A CD2  1 
ATOM   165  H H    . LEU A 1 19  ? 21.071 -13.814 43.806  1.00 0.00   ? 1160 LEU A H    1 
ATOM   166  N N    . THR A 1 20  ? 18.070 -13.024 45.630  1.00 51.90  ? 1161 THR A N    1 
ATOM   167  C CA   . THR A 1 20  ? 17.960 -12.514 46.990  1.00 49.91  ? 1161 THR A CA   1 
ATOM   168  C C    . THR A 1 20  ? 17.040 -13.351 47.885  1.00 48.04  ? 1161 THR A C    1 
ATOM   169  O O    . THR A 1 20  ? 15.865 -13.569 47.565  1.00 42.58  ? 1161 THR A O    1 
ATOM   170  C CB   . THR A 1 20  ? 17.505 -11.043 46.996  1.00 46.83  ? 1161 THR A CB   1 
ATOM   171  O OG1  . THR A 1 20  ? 18.256 -10.309 46.017  1.00 42.31  ? 1161 THR A OG1  1 
ATOM   172  C CG2  . THR A 1 20  ? 17.743 -10.421 48.368  1.00 47.89  ? 1161 THR A CG2  1 
ATOM   173  H H    . THR A 1 20  ? 17.457 -12.678 44.956  1.00 0.00   ? 1161 THR A H    1 
ATOM   174  H HG1  . THR A 1 20  ? 17.883 -10.469 45.137  1.00 0.00   ? 1161 THR A HG1  1 
ATOM   175  N N    . VAL A 1 21  ? 17.617 -13.867 48.969  1.00 47.40  ? 1162 VAL A N    1 
ATOM   176  C CA   . VAL A 1 21  ? 16.900 -14.680 49.952  1.00 43.61  ? 1162 VAL A CA   1 
ATOM   177  C C    . VAL A 1 21  ? 16.594 -13.809 51.175  1.00 40.79  ? 1162 VAL A C    1 
ATOM   178  O O    . VAL A 1 21  ? 17.510 -13.250 51.795  1.00 33.38  ? 1162 VAL A O    1 
ATOM   179  C CB   . VAL A 1 21  ? 17.760 -15.886 50.427  1.00 44.41  ? 1162 VAL A CB   1 
ATOM   180  C CG1  . VAL A 1 21  ? 16.959 -16.775 51.382  1.00 35.66  ? 1162 VAL A CG1  1 
ATOM   181  C CG2  . VAL A 1 21  ? 18.264 -16.685 49.235  1.00 40.70  ? 1162 VAL A CG2  1 
ATOM   182  H H    . VAL A 1 21  ? 18.561 -13.700 49.105  1.00 0.00   ? 1162 VAL A H    1 
ATOM   183  N N    . SER A 1 22  ? 15.314 -13.676 51.505  1.00 36.63  ? 1163 SER A N    1 
ATOM   184  C CA   . SER A 1 22  ? 14.903 -12.883 52.660  1.00 39.64  ? 1163 SER A CA   1 
ATOM   185  C C    . SER A 1 22  ? 13.960 -13.678 53.566  1.00 40.99  ? 1163 SER A C    1 
ATOM   186  O O    . SER A 1 22  ? 13.202 -14.540 53.102  1.00 42.25  ? 1163 SER A O    1 
ATOM   187  C CB   . SER A 1 22  ? 14.232 -11.584 52.211  1.00 37.09  ? 1163 SER A CB   1 
ATOM   188  O OG   . SER A 1 22  ? 13.134 -11.838 51.352  1.00 44.32  ? 1163 SER A OG   1 
ATOM   189  H H    . SER A 1 22  ? 14.617 -14.114 50.973  1.00 0.00   ? 1163 SER A H    1 
ATOM   190  H HG   . SER A 1 22  ? 13.532 -12.084 50.507  1.00 0.00   ? 1163 SER A HG   1 
ATOM   191  N N    . TRP A 1 23  ? 13.992 -13.384 54.858  1.00 36.49  ? 1164 TRP A N    1 
ATOM   192  C CA   . TRP A 1 23  ? 13.144 -14.104 55.793  1.00 30.66  ? 1164 TRP A CA   1 
ATOM   193  C C    . TRP A 1 23  ? 12.839 -13.289 57.038  1.00 25.10  ? 1164 TRP A C    1 
ATOM   194  O O    . TRP A 1 23  ? 13.486 -12.277 57.328  1.00 22.62  ? 1164 TRP A O    1 
ATOM   195  C CB   . TRP A 1 23  ? 13.831 -15.411 56.218  1.00 22.51  ? 1164 TRP A CB   1 
ATOM   196  C CG   . TRP A 1 23  ? 15.167 -15.180 56.892  1.00 27.54  ? 1164 TRP A CG   1 
ATOM   197  C CD1  . TRP A 1 23  ? 15.390 -14.972 58.228  1.00 24.97  ? 1164 TRP A CD1  1 
ATOM   198  C CD2  . TRP A 1 23  ? 16.446 -15.097 56.257  1.00 27.58  ? 1164 TRP A CD2  1 
ATOM   199  N NE1  . TRP A 1 23  ? 16.725 -14.764 58.457  1.00 27.00  ? 1164 TRP A NE1  1 
ATOM   200  C CE2  . TRP A 1 23  ? 17.399 -14.834 57.268  1.00 29.65  ? 1164 TRP A CE2  1 
ATOM   201  C CE3  . TRP A 1 23  ? 16.884 -15.216 54.927  1.00 39.78  ? 1164 TRP A CE3  1 
ATOM   202  C CZ2  . TRP A 1 23  ? 18.770 -14.688 56.992  1.00 34.56  ? 1164 TRP A CZ2  1 
ATOM   203  C CZ3  . TRP A 1 23  ? 18.254 -15.069 54.653  1.00 39.20  ? 1164 TRP A CZ3  1 
ATOM   204  C CH2  . TRP A 1 23  ? 19.177 -14.807 55.684  1.00 34.77  ? 1164 TRP A CH2  1 
ATOM   205  H H    . TRP A 1 23  ? 14.577 -12.675 55.211  1.00 0.00   ? 1164 TRP A H    1 
ATOM   206  H HE1  . TRP A 1 23  ? 17.140 -14.577 59.329  1.00 0.00   ? 1164 TRP A HE1  1 
ATOM   207  N N    . GLU A 1 24  ? 11.804 -13.716 57.739  1.00 26.82  ? 1165 GLU A N    1 
ATOM   208  C CA   . GLU A 1 24  ? 11.413 -13.104 58.990  1.00 24.39  ? 1165 GLU A CA   1 
ATOM   209  C C    . GLU A 1 24  ? 12.358 -13.795 59.975  1.00 27.00  ? 1165 GLU A C    1 
ATOM   210  O O    . GLU A 1 24  ? 12.586 -15.006 59.891  1.00 22.81  ? 1165 GLU A O    1 
ATOM   211  C CB   . GLU A 1 24  ? 9.959  -13.448 59.299  1.00 28.57  ? 1165 GLU A CB   1 
ATOM   212  C CG   . GLU A 1 24  ? 9.458  -12.892 60.618  1.00 35.29  ? 1165 GLU A CG   1 
ATOM   213  C CD   . GLU A 1 24  ? 9.573  -11.396 60.691  1.00 33.05  ? 1165 GLU A CD   1 
ATOM   214  O OE1  . GLU A 1 24  ? 8.817  -10.731 59.961  1.00 37.13  ? 1165 GLU A OE1  1 
ATOM   215  O OE2  . GLU A 1 24  ? 10.418 -10.886 61.467  1.00 28.74  ? 1165 GLU A OE2  1 
ATOM   216  H H    . GLU A 1 24  ? 11.309 -14.461 57.385  1.00 0.00   ? 1165 GLU A H    1 
ATOM   217  N N    . ARG A 1 25  ? 12.946 -13.030 60.879  1.00 27.98  ? 1166 ARG A N    1 
ATOM   218  C CA   . ARG A 1 25  ? 13.888 -13.601 61.830  1.00 23.87  ? 1166 ARG A CA   1 
ATOM   219  C C    . ARG A 1 25  ? 13.242 -14.587 62.807  1.00 26.47  ? 1166 ARG A C    1 
ATOM   220  O O    . ARG A 1 25  ? 12.036 -14.502 63.064  1.00 27.49  ? 1166 ARG A O    1 
ATOM   221  C CB   . ARG A 1 25  ? 14.556 -12.481 62.609  1.00 17.13  ? 1166 ARG A CB   1 
ATOM   222  C CG   . ARG A 1 25  ? 15.779 -11.888 61.969  1.00 24.54  ? 1166 ARG A CG   1 
ATOM   223  C CD   . ARG A 1 25  ? 16.284 -10.781 62.869  1.00 28.36  ? 1166 ARG A CD   1 
ATOM   224  N NE   . ARG A 1 25  ? 15.231 -9.791  63.110  1.00 45.68  ? 1166 ARG A NE   1 
ATOM   225  C CZ   . ARG A 1 25  ? 14.776 -9.424  64.309  1.00 40.46  ? 1166 ARG A CZ   1 
ATOM   226  N NH1  . ARG A 1 25  ? 15.272 -9.964  65.419  1.00 39.31  ? 1166 ARG A NH1  1 
ATOM   227  N NH2  . ARG A 1 25  ? 13.820 -8.504  64.389  1.00 30.58  ? 1166 ARG A NH2  1 
ATOM   228  H H    . ARG A 1 25  ? 12.680 -12.091 60.912  1.00 0.00   ? 1166 ARG A H    1 
ATOM   229  H HE   . ARG A 1 25  ? 14.867 -9.355  62.301  1.00 0.00   ? 1166 ARG A HE   1 
ATOM   230  H HH11 . ARG A 1 25  ? 16.003 -10.653 65.369  1.00 0.00   ? 1166 ARG A HH11 1 
ATOM   231  H HH12 . ARG A 1 25  ? 14.941 -9.670  66.323  1.00 0.00   ? 1166 ARG A HH12 1 
ATOM   232  H HH21 . ARG A 1 25  ? 13.474 -8.088  63.543  1.00 0.00   ? 1166 ARG A HH21 1 
ATOM   233  H HH22 . ARG A 1 25  ? 13.467 -8.162  65.269  1.00 0.00   ? 1166 ARG A HH22 1 
ATOM   234  N N    . SER A 1 26  ? 14.049 -15.509 63.343  1.00 22.59  ? 1167 SER A N    1 
ATOM   235  C CA   . SER A 1 26  ? 13.596 -16.495 64.332  1.00 18.27  ? 1167 SER A CA   1 
ATOM   236  C C    . SER A 1 26  ? 13.075 -15.725 65.545  1.00 19.26  ? 1167 SER A C    1 
ATOM   237  O O    . SER A 1 26  ? 13.437 -14.563 65.754  1.00 15.66  ? 1167 SER A O    1 
ATOM   238  C CB   . SER A 1 26  ? 14.773 -17.368 64.780  1.00 28.06  ? 1167 SER A CB   1 
ATOM   239  O OG   . SER A 1 26  ? 14.481 -18.135 65.944  1.00 17.61  ? 1167 SER A OG   1 
ATOM   240  H H    . SER A 1 26  ? 14.984 -15.540 63.087  1.00 0.00   ? 1167 SER A H    1 
ATOM   241  H HG   . SER A 1 26  ? 14.799 -19.031 65.770  1.00 0.00   ? 1167 SER A HG   1 
ATOM   242  N N    . THR A 1 27  ? 12.190 -16.348 66.315  1.00 26.79  ? 1168 THR A N    1 
ATOM   243  C CA   . THR A 1 27  ? 11.649 -15.709 67.505  1.00 18.30  ? 1168 THR A CA   1 
ATOM   244  C C    . THR A 1 27  ? 12.361 -16.220 68.759  1.00 21.54  ? 1168 THR A C    1 
ATOM   245  O O    . THR A 1 27  ? 11.920 -15.970 69.887  1.00 23.87  ? 1168 THR A O    1 
ATOM   246  C CB   . THR A 1 27  ? 10.140 -15.915 67.609  1.00 18.26  ? 1168 THR A CB   1 
ATOM   247  O OG1  . THR A 1 27  ? 9.819  -17.275 67.297  1.00 22.26  ? 1168 THR A OG1  1 
ATOM   248  C CG2  . THR A 1 27  ? 9.425  -15.000 66.653  1.00 10.77  ? 1168 THR A CG2  1 
ATOM   249  H H    . THR A 1 27  ? 11.860 -17.246 66.076  1.00 0.00   ? 1168 THR A H    1 
ATOM   250  H HG1  . THR A 1 27  ? 10.183 -17.897 67.943  1.00 0.00   ? 1168 THR A HG1  1 
ATOM   251  N N    . THR A 1 28  ? 13.449 -16.956 68.547  1.00 18.99  ? 1169 THR A N    1 
ATOM   252  C CA   . THR A 1 28  ? 14.265 -17.491 69.636  1.00 19.92  ? 1169 THR A CA   1 
ATOM   253  C C    . THR A 1 28  ? 15.360 -16.477 69.889  1.00 22.41  ? 1169 THR A C    1 
ATOM   254  O O    . THR A 1 28  ? 16.047 -16.061 68.946  1.00 24.13  ? 1169 THR A O    1 
ATOM   255  C CB   . THR A 1 28  ? 14.955 -18.810 69.224  1.00 9.68   ? 1169 THR A CB   1 
ATOM   256  O OG1  . THR A 1 28  ? 13.981 -19.723 68.725  1.00 18.88  ? 1169 THR A OG1  1 
ATOM   257  C CG2  . THR A 1 28  ? 15.652 -19.462 70.415  1.00 20.24  ? 1169 THR A CG2  1 
ATOM   258  H H    . THR A 1 28  ? 13.748 -17.171 67.638  1.00 0.00   ? 1169 THR A H    1 
ATOM   259  H HG1  . THR A 1 28  ? 13.275 -19.795 69.400  1.00 0.00   ? 1169 THR A HG1  1 
ATOM   260  N N    . PRO A 1 29  ? 15.507 -16.009 71.141  1.00 21.03  ? 1170 PRO A N    1 
ATOM   261  C CA   . PRO A 1 29  ? 16.571 -15.034 71.401  1.00 24.10  ? 1170 PRO A CA   1 
ATOM   262  C C    . PRO A 1 29  ? 17.922 -15.731 71.645  1.00 23.21  ? 1170 PRO A C    1 
ATOM   263  O O    . PRO A 1 29  ? 17.995 -16.958 71.746  1.00 26.76  ? 1170 PRO A O    1 
ATOM   264  C CB   . PRO A 1 29  ? 16.076 -14.331 72.658  1.00 19.77  ? 1170 PRO A CB   1 
ATOM   265  C CG   . PRO A 1 29  ? 15.443 -15.452 73.403  1.00 20.84  ? 1170 PRO A CG   1 
ATOM   266  C CD   . PRO A 1 29  ? 14.661 -16.196 72.332  1.00 22.42  ? 1170 PRO A CD   1 
ATOM   267  N N    . ASP A 1 30  ? 18.995 -14.951 71.647  1.00 19.14  ? 1171 ASP A N    1 
ATOM   268  C CA   . ASP A 1 30  ? 20.333 -15.461 71.918  1.00 18.80  ? 1171 ASP A CA   1 
ATOM   269  C C    . ASP A 1 30  ? 20.961 -16.420 70.909  1.00 26.73  ? 1171 ASP A C    1 
ATOM   270  O O    . ASP A 1 30  ? 21.809 -17.252 71.269  1.00 28.24  ? 1171 ASP A O    1 
ATOM   271  C CB   . ASP A 1 30  ? 20.368 -16.063 73.328  1.00 29.09  ? 1171 ASP A CB   1 
ATOM   272  C CG   . ASP A 1 30  ? 19.680 -15.171 74.355  1.00 27.55  ? 1171 ASP A CG   1 
ATOM   273  O OD1  . ASP A 1 30  ? 19.988 -13.957 74.406  1.00 28.74  ? 1171 ASP A OD1  1 
ATOM   274  O OD2  . ASP A 1 30  ? 18.805 -15.680 75.087  1.00 31.15  ? 1171 ASP A OD2  1 
ATOM   275  H H    . ASP A 1 30  ? 18.909 -13.991 71.492  1.00 0.00   ? 1171 ASP A H    1 
ATOM   276  N N    . ILE A 1 31  ? 20.570 -16.286 69.645  1.00 28.41  ? 1172 ILE A N    1 
ATOM   277  C CA   . ILE A 1 31  ? 21.123 -17.115 68.586  1.00 19.88  ? 1172 ILE A CA   1 
ATOM   278  C C    . ILE A 1 31  ? 22.340 -16.392 67.965  1.00 26.27  ? 1172 ILE A C    1 
ATOM   279  O O    . ILE A 1 31  ? 22.550 -15.193 68.187  1.00 21.85  ? 1172 ILE A O    1 
ATOM   280  C CB   . ILE A 1 31  ? 20.032 -17.499 67.545  1.00 27.48  ? 1172 ILE A CB   1 
ATOM   281  C CG1  . ILE A 1 31  ? 19.452 -16.261 66.858  1.00 24.31  ? 1172 ILE A CG1  1 
ATOM   282  C CG2  . ILE A 1 31  ? 18.901 -18.289 68.223  1.00 19.17  ? 1172 ILE A CG2  1 
ATOM   283  C CD1  . ILE A 1 31  ? 19.978 -16.069 65.457  1.00 33.98  ? 1172 ILE A CD1  1 
ATOM   284  H H    . ILE A 1 31  ? 19.928 -15.585 69.425  1.00 0.00   ? 1172 ILE A H    1 
ATOM   285  N N    . THR A 1 32  ? 23.150 -17.110 67.198  1.00 31.35  ? 1173 THR A N    1 
ATOM   286  C CA   . THR A 1 32  ? 24.360 -16.528 66.613  1.00 32.00  ? 1173 THR A CA   1 
ATOM   287  C C    . THR A 1 32  ? 24.398 -16.250 65.101  1.00 33.86  ? 1173 THR A C    1 
ATOM   288  O O    . THR A 1 32  ? 25.380 -15.706 64.597  1.00 27.72  ? 1173 THR A O    1 
ATOM   289  C CB   . THR A 1 32  ? 25.549 -17.398 66.958  1.00 24.26  ? 1173 THR A CB   1 
ATOM   290  O OG1  . THR A 1 32  ? 25.295 -18.732 66.498  1.00 24.26  ? 1173 THR A OG1  1 
ATOM   291  C CG2  . THR A 1 32  ? 25.760 -17.407 68.454  1.00 24.41  ? 1173 THR A CG2  1 
ATOM   292  H H    . THR A 1 32  ? 22.961 -18.051 67.007  1.00 0.00   ? 1173 THR A H    1 
ATOM   293  H HG1  . THR A 1 32  ? 25.274 -18.684 65.531  1.00 0.00   ? 1173 THR A HG1  1 
ATOM   294  N N    . GLY A 1 33  ? 23.366 -16.655 64.373  1.00 37.01  ? 1174 GLY A N    1 
ATOM   295  C CA   . GLY A 1 33  ? 23.358 -16.406 62.948  1.00 31.75  ? 1174 GLY A CA   1 
ATOM   296  C C    . GLY A 1 33  ? 22.327 -17.196 62.183  1.00 29.41  ? 1174 GLY A C    1 
ATOM   297  O O    . GLY A 1 33  ? 21.362 -17.713 62.753  1.00 20.66  ? 1174 GLY A O    1 
ATOM   298  H H    . GLY A 1 33  ? 22.613 -17.142 64.772  1.00 0.00   ? 1174 GLY A H    1 
ATOM   299  N N    . TYR A 1 34  ? 22.530 -17.255 60.872  1.00 30.06  ? 1175 TYR A N    1 
ATOM   300  C CA   . TYR A 1 34  ? 21.656 -17.983 59.962  1.00 30.70  ? 1175 TYR A CA   1 
ATOM   301  C C    . TYR A 1 34  ? 22.494 -18.566 58.836  1.00 32.35  ? 1175 TYR A C    1 
ATOM   302  O O    . TYR A 1 34  ? 23.441 -17.937 58.374  1.00 39.28  ? 1175 TYR A O    1 
ATOM   303  C CB   . TYR A 1 34  ? 20.609 -17.061 59.368  1.00 22.53  ? 1175 TYR A CB   1 
ATOM   304  C CG   . TYR A 1 34  ? 19.613 -16.549 60.372  1.00 26.86  ? 1175 TYR A CG   1 
ATOM   305  C CD1  . TYR A 1 34  ? 18.441 -17.255 60.633  1.00 15.70  ? 1175 TYR A CD1  1 
ATOM   306  C CD2  . TYR A 1 34  ? 19.820 -15.341 61.029  1.00 22.41  ? 1175 TYR A CD2  1 
ATOM   307  C CE1  . TYR A 1 34  ? 17.500 -16.772 61.519  1.00 17.42  ? 1175 TYR A CE1  1 
ATOM   308  C CE2  . TYR A 1 34  ? 18.877 -14.845 61.920  1.00 22.32  ? 1175 TYR A CE2  1 
ATOM   309  C CZ   . TYR A 1 34  ? 17.719 -15.566 62.153  1.00 17.17  ? 1175 TYR A CZ   1 
ATOM   310  O OH   . TYR A 1 34  ? 16.755 -15.063 62.989  1.00 22.12  ? 1175 TYR A OH   1 
ATOM   311  H H    . TYR A 1 34  ? 23.305 -16.788 60.495  1.00 0.00   ? 1175 TYR A H    1 
ATOM   312  H HH   . TYR A 1 34  ? 17.056 -14.204 63.299  1.00 0.00   ? 1175 TYR A HH   1 
ATOM   313  N N    . ARG A 1 35  ? 22.181 -19.790 58.438  1.00 32.42  ? 1176 ARG A N    1 
ATOM   314  C CA   . ARG A 1 35  ? 22.906 -20.438 57.365  1.00 27.04  ? 1176 ARG A CA   1 
ATOM   315  C C    . ARG A 1 35  ? 21.911 -20.755 56.262  1.00 34.70  ? 1176 ARG A C    1 
ATOM   316  O O    . ARG A 1 35  ? 20.828 -21.288 56.522  1.00 35.21  ? 1176 ARG A O    1 
ATOM   317  C CB   . ARG A 1 35  ? 23.592 -21.702 57.862  1.00 25.51  ? 1176 ARG A CB   1 
ATOM   318  C CG   . ARG A 1 35  ? 24.562 -22.277 56.851  1.00 31.35  ? 1176 ARG A CG   1 
ATOM   319  C CD   . ARG A 1 35  ? 25.307 -23.451 57.414  1.00 25.69  ? 1176 ARG A CD   1 
ATOM   320  N NE   . ARG A 1 35  ? 24.385 -24.465 57.905  1.00 22.66  ? 1176 ARG A NE   1 
ATOM   321  C CZ   . ARG A 1 35  ? 23.816 -25.396 57.156  1.00 15.17  ? 1176 ARG A CZ   1 
ATOM   322  N NH1  . ARG A 1 35  ? 24.073 -25.464 55.857  1.00 28.95  ? 1176 ARG A NH1  1 
ATOM   323  N NH2  . ARG A 1 35  ? 22.996 -26.263 57.712  1.00 16.99  ? 1176 ARG A NH2  1 
ATOM   324  H H    . ARG A 1 35  ? 21.418 -20.257 58.851  1.00 0.00   ? 1176 ARG A H    1 
ATOM   325  H HE   . ARG A 1 35  ? 24.246 -24.425 58.870  1.00 0.00   ? 1176 ARG A HE   1 
ATOM   326  H HH11 . ARG A 1 35  ? 24.765 -24.840 55.449  1.00 0.00   ? 1176 ARG A HH11 1 
ATOM   327  H HH12 . ARG A 1 35  ? 23.703 -26.146 55.230  1.00 0.00   ? 1176 ARG A HH12 1 
ATOM   328  H HH21 . ARG A 1 35  ? 22.821 -26.189 58.716  1.00 0.00   ? 1176 ARG A HH21 1 
ATOM   329  H HH22 . ARG A 1 35  ? 22.534 -26.997 57.217  1.00 0.00   ? 1176 ARG A HH22 1 
ATOM   330  N N    . ILE A 1 36  ? 22.282 -20.401 55.036  1.00 39.67  ? 1177 ILE A N    1 
ATOM   331  C CA   . ILE A 1 36  ? 21.438 -20.587 53.860  1.00 39.05  ? 1177 ILE A CA   1 
ATOM   332  C C    . ILE A 1 36  ? 22.112 -21.498 52.827  1.00 34.22  ? 1177 ILE A C    1 
ATOM   333  O O    . ILE A 1 36  ? 23.330 -21.483 52.674  1.00 27.33  ? 1177 ILE A O    1 
ATOM   334  C CB   . ILE A 1 36  ? 21.102 -19.219 53.209  1.00 38.29  ? 1177 ILE A CB   1 
ATOM   335  C CG1  . ILE A 1 36  ? 20.731 -18.175 54.281  1.00 27.65  ? 1177 ILE A CG1  1 
ATOM   336  C CG2  . ILE A 1 36  ? 19.947 -19.381 52.234  1.00 46.06  ? 1177 ILE A CG2  1 
ATOM   337  C CD1  . ILE A 1 36  ? 21.924 -17.536 54.999  1.00 17.25  ? 1177 ILE A CD1  1 
ATOM   338  H H    . ILE A 1 36  ? 23.171 -20.034 54.896  1.00 0.00   ? 1177 ILE A H    1 
ATOM   339  N N    . THR A 1 37  ? 21.316 -22.293 52.123  1.00 32.31  ? 1178 THR A N    1 
ATOM   340  C CA   . THR A 1 37  ? 21.848 -23.219 51.132  1.00 33.40  ? 1178 THR A CA   1 
ATOM   341  C C    . THR A 1 37  ? 21.003 -23.254 49.852  1.00 36.81  ? 1178 THR A C    1 
ATOM   342  O O    . THR A 1 37  ? 19.781 -23.095 49.904  1.00 31.90  ? 1178 THR A O    1 
ATOM   343  C CB   . THR A 1 37  ? 21.895 -24.658 51.705  1.00 33.47  ? 1178 THR A CB   1 
ATOM   344  O OG1  . THR A 1 37  ? 20.582 -25.044 52.125  1.00 32.73  ? 1178 THR A OG1  1 
ATOM   345  C CG2  . THR A 1 37  ? 22.849 -24.753 52.905  1.00 24.38  ? 1178 THR A CG2  1 
ATOM   346  H H    . THR A 1 37  ? 20.350 -22.253 52.258  1.00 0.00   ? 1178 THR A H    1 
ATOM   347  H HG1  . THR A 1 37  ? 20.306 -24.403 52.786  1.00 0.00   ? 1178 THR A HG1  1 
ATOM   348  N N    . THR A 1 38  ? 21.657 -23.462 48.710  1.00 42.92  ? 1179 THR A N    1 
ATOM   349  C CA   . THR A 1 38  ? 20.977 -23.550 47.411  1.00 39.81  ? 1179 THR A CA   1 
ATOM   350  C C    . THR A 1 38  ? 21.418 -24.857 46.768  1.00 41.40  ? 1179 THR A C    1 
ATOM   351  O O    . THR A 1 38  ? 22.612 -25.113 46.655  1.00 40.43  ? 1179 THR A O    1 
ATOM   352  C CB   . THR A 1 38  ? 21.366 -22.398 46.465  1.00 33.08  ? 1179 THR A CB   1 
ATOM   353  O OG1  . THR A 1 38  ? 22.787 -22.376 46.303  1.00 41.97  ? 1179 THR A OG1  1 
ATOM   354  C CG2  . THR A 1 38  ? 20.904 -21.065 47.007  1.00 30.17  ? 1179 THR A CG2  1 
ATOM   355  H H    . THR A 1 38  ? 22.633 -23.586 48.715  1.00 0.00   ? 1179 THR A H    1 
ATOM   356  H HG1  . THR A 1 38  ? 23.085 -23.065 45.691  1.00 0.00   ? 1179 THR A HG1  1 
ATOM   357  N N    . THR A 1 39  ? 20.469 -25.693 46.369  1.00 45.09  ? 1180 THR A N    1 
ATOM   358  C CA   . THR A 1 39  ? 20.811 -26.966 45.758  1.00 54.04  ? 1180 THR A CA   1 
ATOM   359  C C    . THR A 1 39  ? 19.819 -27.344 44.658  1.00 60.59  ? 1180 THR A C    1 
ATOM   360  O O    . THR A 1 39  ? 18.616 -27.114 44.793  1.00 59.30  ? 1180 THR A O    1 
ATOM   361  C CB   . THR A 1 39  ? 20.893 -28.081 46.829  1.00 54.11  ? 1180 THR A CB   1 
ATOM   362  O OG1  . THR A 1 39  ? 21.491 -29.252 46.260  1.00 66.42  ? 1180 THR A OG1  1 
ATOM   363  C CG2  . THR A 1 39  ? 19.511 -28.425 47.379  1.00 54.37  ? 1180 THR A CG2  1 
ATOM   364  H H    . THR A 1 39  ? 19.525 -25.474 46.519  1.00 0.00   ? 1180 THR A H    1 
ATOM   365  H HG1  . THR A 1 39  ? 20.892 -29.656 45.624  1.00 0.00   ? 1180 THR A HG1  1 
ATOM   366  N N    . PRO A 1 40  ? 20.320 -27.882 43.532  1.00 66.80  ? 1181 PRO A N    1 
ATOM   367  C CA   . PRO A 1 40  ? 19.468 -28.285 42.407  1.00 70.07  ? 1181 PRO A CA   1 
ATOM   368  C C    . PRO A 1 40  ? 18.416 -29.291 42.863  1.00 72.52  ? 1181 PRO A C    1 
ATOM   369  O O    . PRO A 1 40  ? 18.746 -30.349 43.406  1.00 73.72  ? 1181 PRO A O    1 
ATOM   370  C CB   . PRO A 1 40  ? 20.469 -28.908 41.437  1.00 72.50  ? 1181 PRO A CB   1 
ATOM   371  C CG   . PRO A 1 40  ? 21.722 -28.138 41.716  1.00 70.91  ? 1181 PRO A CG   1 
ATOM   372  C CD   . PRO A 1 40  ? 21.741 -28.110 43.216  1.00 65.04  ? 1181 PRO A CD   1 
ATOM   373  N N    . THR A 1 41  ? 17.152 -28.955 42.643  1.00 80.19  ? 1182 THR A N    1 
ATOM   374  C CA   . THR A 1 41  ? 16.041 -29.800 43.055  1.00 90.35  ? 1182 THR A CA   1 
ATOM   375  C C    . THR A 1 41  ? 16.103 -31.251 42.564  1.00 97.22  ? 1182 THR A C    1 
ATOM   376  O O    . THR A 1 41  ? 16.643 -31.548 41.493  1.00 96.54  ? 1182 THR A O    1 
ATOM   377  C CB   . THR A 1 41  ? 14.692 -29.162 42.657  1.00 90.45  ? 1182 THR A CB   1 
ATOM   378  O OG1  . THR A 1 41  ? 14.649 -27.810 43.132  1.00 92.24  ? 1182 THR A OG1  1 
ATOM   379  C CG2  . THR A 1 41  ? 13.530 -29.926 43.276  1.00 92.75  ? 1182 THR A CG2  1 
ATOM   380  H H    . THR A 1 41  ? 16.935 -28.115 42.183  1.00 0.00   ? 1182 THR A H    1 
ATOM   381  H HG1  . THR A 1 41  ? 13.782 -27.462 42.832  1.00 0.00   ? 1182 THR A HG1  1 
ATOM   382  N N    . ASN A 1 42  ? 15.605 -32.149 43.414  1.00 106.00 ? 1183 ASN A N    1 
ATOM   383  C CA   . ASN A 1 42  ? 15.540 -33.591 43.159  1.00 112.09 ? 1183 ASN A CA   1 
ATOM   384  C C    . ASN A 1 42  ? 16.891 -34.296 43.064  1.00 112.10 ? 1183 ASN A C    1 
ATOM   385  O O    . ASN A 1 42  ? 16.946 -35.517 42.912  1.00 109.88 ? 1183 ASN A O    1 
ATOM   386  C CB   . ASN A 1 42  ? 14.698 -33.889 41.911  1.00 118.30 ? 1183 ASN A CB   1 
ATOM   387  C CG   . ASN A 1 42  ? 14.062 -35.271 41.951  1.00 123.00 ? 1183 ASN A CG   1 
ATOM   388  O OD1  . ASN A 1 42  ? 14.057 -35.997 40.957  1.00 126.93 ? 1183 ASN A OD1  1 
ATOM   389  N ND2  . ASN A 1 42  ? 13.497 -35.631 43.099  1.00 124.76 ? 1183 ASN A ND2  1 
ATOM   390  H H    . ASN A 1 42  ? 15.274 -31.813 44.270  1.00 0.00   ? 1183 ASN A H    1 
ATOM   391  H HD21 . ASN A 1 42  ? 13.104 -36.522 43.127  1.00 0.00   ? 1183 ASN A HD21 1 
ATOM   392  H HD22 . ASN A 1 42  ? 13.493 -35.008 43.852  1.00 0.00   ? 1183 ASN A HD22 1 
ATOM   393  N N    . GLY A 1 43  ? 17.971 -33.534 43.207  1.00 113.59 ? 1184 GLY A N    1 
ATOM   394  C CA   . GLY A 1 43  ? 19.299 -34.111 43.138  1.00 113.68 ? 1184 GLY A CA   1 
ATOM   395  C C    . GLY A 1 43  ? 19.813 -34.183 41.716  1.00 112.89 ? 1184 GLY A C    1 
ATOM   396  O O    . GLY A 1 43  ? 19.641 -35.193 41.032  1.00 115.76 ? 1184 GLY A O    1 
ATOM   397  H H    . GLY A 1 43  ? 17.901 -32.568 43.343  1.00 0.00   ? 1184 GLY A H    1 
ATOM   398  N N    . GLN A 1 44  ? 20.447 -33.107 41.268  1.00 110.23 ? 1185 GLN A N    1 
ATOM   399  C CA   . GLN A 1 44  ? 20.992 -33.037 39.921  1.00 110.73 ? 1185 GLN A CA   1 
ATOM   400  C C    . GLN A 1 44  ? 22.279 -32.224 39.920  1.00 111.06 ? 1185 GLN A C    1 
ATOM   401  O O    . GLN A 1 44  ? 22.641 -31.626 40.937  1.00 112.73 ? 1185 GLN A O    1 
ATOM   402  C CB   . GLN A 1 44  ? 19.970 -32.413 38.969  1.00 112.86 ? 1185 GLN A CB   1 
ATOM   403  C CG   . GLN A 1 44  ? 18.858 -33.361 38.533  1.00 116.39 ? 1185 GLN A CG   1 
ATOM   404  C CD   . GLN A 1 44  ? 19.372 -34.513 37.680  1.00 117.58 ? 1185 GLN A CD   1 
ATOM   405  O OE1  . GLN A 1 44  ? 19.667 -34.343 36.496  1.00 115.86 ? 1185 GLN A OE1  1 
ATOM   406  N NE2  . GLN A 1 44  ? 19.487 -35.689 38.281  1.00 118.76 ? 1185 GLN A NE2  1 
ATOM   407  H H    . GLN A 1 44  ? 20.577 -32.332 41.854  1.00 0.00   ? 1185 GLN A H    1 
ATOM   408  H HE21 . GLN A 1 44  ? 19.786 -36.441 37.735  1.00 0.00   ? 1185 GLN A HE21 1 
ATOM   409  H HE22 . GLN A 1 44  ? 19.258 -35.759 39.235  1.00 0.00   ? 1185 GLN A HE22 1 
ATOM   410  N N    . GLN A 1 45  ? 22.986 -32.227 38.793  1.00 109.14 ? 1186 GLN A N    1 
ATOM   411  C CA   . GLN A 1 45  ? 24.229 -31.479 38.686  1.00 107.51 ? 1186 GLN A CA   1 
ATOM   412  C C    . GLN A 1 45  ? 23.945 -30.006 38.455  1.00 104.94 ? 1186 GLN A C    1 
ATOM   413  O O    . GLN A 1 45  ? 23.285 -29.629 37.486  1.00 101.93 ? 1186 GLN A O    1 
ATOM   414  C CB   . GLN A 1 45  ? 25.104 -32.013 37.551  1.00 109.71 ? 1186 GLN A CB   1 
ATOM   415  C CG   . GLN A 1 45  ? 26.584 -32.172 37.922  1.00 110.80 ? 1186 GLN A CG   1 
ATOM   416  C CD   . GLN A 1 45  ? 27.230 -30.895 38.422  1.00 110.78 ? 1186 GLN A CD   1 
ATOM   417  O OE1  . GLN A 1 45  ? 27.515 -29.984 37.646  1.00 109.35 ? 1186 GLN A OE1  1 
ATOM   418  N NE2  . GLN A 1 45  ? 27.467 -30.825 39.725  1.00 112.45 ? 1186 GLN A NE2  1 
ATOM   419  H H    . GLN A 1 45  ? 22.685 -32.753 38.024  1.00 0.00   ? 1186 GLN A H    1 
ATOM   420  H HE21 . GLN A 1 45  ? 27.877 -30.001 40.056  1.00 0.00   ? 1186 GLN A HE21 1 
ATOM   421  H HE22 . GLN A 1 45  ? 27.219 -31.589 40.284  1.00 0.00   ? 1186 GLN A HE22 1 
ATOM   422  N N    . GLY A 1 46  ? 24.455 -29.184 39.361  1.00 102.15 ? 1187 GLY A N    1 
ATOM   423  C CA   . GLY A 1 46  ? 24.270 -27.754 39.271  1.00 99.97  ? 1187 GLY A CA   1 
ATOM   424  C C    . GLY A 1 46  ? 25.231 -27.117 40.245  1.00 99.50  ? 1187 GLY A C    1 
ATOM   425  O O    . GLY A 1 46  ? 26.290 -27.684 40.526  1.00 99.83  ? 1187 GLY A O    1 
ATOM   426  H H    . GLY A 1 46  ? 24.986 -29.535 40.107  1.00 0.00   ? 1187 GLY A H    1 
ATOM   427  N N    . ASN A 1 47  ? 24.848 -25.973 40.802  1.00 99.11  ? 1188 ASN A N    1 
ATOM   428  C CA   . ASN A 1 47  ? 25.708 -25.276 41.748  1.00 96.51  ? 1188 ASN A CA   1 
ATOM   429  C C    . ASN A 1 47  ? 25.154 -25.186 43.176  1.00 90.36  ? 1188 ASN A C    1 
ATOM   430  O O    . ASN A 1 47  ? 24.536 -24.183 43.555  1.00 88.13  ? 1188 ASN A O    1 
ATOM   431  C CB   . ASN A 1 47  ? 26.046 -23.879 41.219  1.00 99.81  ? 1188 ASN A CB   1 
ATOM   432  C CG   . ASN A 1 47  ? 27.167 -23.218 41.998  1.00 104.37 ? 1188 ASN A CG   1 
ATOM   433  O OD1  . ASN A 1 47  ? 28.010 -23.888 42.599  1.00 103.40 ? 1188 ASN A OD1  1 
ATOM   434  N ND2  . ASN A 1 47  ? 27.187 -21.895 41.986  1.00 110.41 ? 1188 ASN A ND2  1 
ATOM   435  H H    . ASN A 1 47  ? 23.977 -25.575 40.579  1.00 0.00   ? 1188 ASN A H    1 
ATOM   436  H HD21 . ASN A 1 47  ? 27.901 -21.460 42.482  1.00 0.00   ? 1188 ASN A HD21 1 
ATOM   437  H HD22 . ASN A 1 47  ? 26.486 -21.413 41.494  1.00 0.00   ? 1188 ASN A HD22 1 
ATOM   438  N N    . SER A 1 48  ? 25.347 -26.254 43.949  1.00 80.09  ? 1189 SER A N    1 
ATOM   439  C CA   . SER A 1 48  ? 24.902 -26.277 45.335  1.00 72.37  ? 1189 SER A CA   1 
ATOM   440  C C    . SER A 1 48  ? 25.838 -25.370 46.106  1.00 65.84  ? 1189 SER A C    1 
ATOM   441  O O    . SER A 1 48  ? 27.039 -25.620 46.157  1.00 68.11  ? 1189 SER A O    1 
ATOM   442  C CB   . SER A 1 48  ? 24.953 -27.690 45.913  1.00 73.04  ? 1189 SER A CB   1 
ATOM   443  O OG   . SER A 1 48  ? 23.987 -28.524 45.298  1.00 81.46  ? 1189 SER A OG   1 
ATOM   444  H H    . SER A 1 48  ? 25.811 -27.033 43.593  1.00 0.00   ? 1189 SER A H    1 
ATOM   445  H HG   . SER A 1 48  ? 23.491 -29.029 45.962  1.00 0.00   ? 1189 SER A HG   1 
ATOM   446  N N    . LEU A 1 49  ? 25.287 -24.309 46.682  1.00 62.79  ? 1190 LEU A N    1 
ATOM   447  C CA   . LEU A 1 49  ? 26.070 -23.335 47.435  1.00 57.93  ? 1190 LEU A CA   1 
ATOM   448  C C    . LEU A 1 49  ? 25.572 -23.214 48.869  1.00 56.23  ? 1190 LEU A C    1 
ATOM   449  O O    . LEU A 1 49  ? 24.609 -23.879 49.269  1.00 53.71  ? 1190 LEU A O    1 
ATOM   450  C CB   . LEU A 1 49  ? 25.969 -21.965 46.766  1.00 52.72  ? 1190 LEU A CB   1 
ATOM   451  C CG   . LEU A 1 49  ? 26.354 -21.885 45.292  1.00 57.36  ? 1190 LEU A CG   1 
ATOM   452  C CD1  . LEU A 1 49  ? 25.708 -20.663 44.675  1.00 48.46  ? 1190 LEU A CD1  1 
ATOM   453  C CD2  . LEU A 1 49  ? 27.872 -21.861 45.139  1.00 56.98  ? 1190 LEU A CD2  1 
ATOM   454  H H    . LEU A 1 49  ? 24.320 -24.189 46.632  1.00 0.00   ? 1190 LEU A H    1 
ATOM   455  N N    . GLU A 1 50  ? 26.229 -22.346 49.630  1.00 50.19  ? 1191 GLU A N    1 
ATOM   456  C CA   . GLU A 1 50  ? 25.872 -22.092 51.015  1.00 46.51  ? 1191 GLU A CA   1 
ATOM   457  C C    . GLU A 1 50  ? 26.389 -20.718 51.358  1.00 44.39  ? 1191 GLU A C    1 
ATOM   458  O O    . GLU A 1 50  ? 27.343 -20.251 50.748  1.00 47.17  ? 1191 GLU A O    1 
ATOM   459  C CB   . GLU A 1 50  ? 26.504 -23.113 51.950  1.00 44.77  ? 1191 GLU A CB   1 
ATOM   460  C CG   . GLU A 1 50  ? 25.992 -23.016 53.374  1.00 43.79  ? 1191 GLU A CG   1 
ATOM   461  C CD   . GLU A 1 50  ? 26.792 -23.853 54.330  1.00 44.25  ? 1191 GLU A CD   1 
ATOM   462  O OE1  . GLU A 1 50  ? 27.783 -23.330 54.882  1.00 48.47  ? 1191 GLU A OE1  1 
ATOM   463  O OE2  . GLU A 1 50  ? 26.428 -25.030 54.537  1.00 41.98  ? 1191 GLU A OE2  1 
ATOM   464  H H    . GLU A 1 50  ? 26.984 -21.828 49.284  1.00 0.00   ? 1191 GLU A H    1 
ATOM   465  N N    . GLU A 1 51  ? 25.762 -20.086 52.340  1.00 45.73  ? 1192 GLU A N    1 
ATOM   466  C CA   . GLU A 1 51  ? 26.136 -18.749 52.777  1.00 50.24  ? 1192 GLU A CA   1 
ATOM   467  C C    . GLU A 1 51  ? 25.726 -18.600 54.249  1.00 52.95  ? 1192 GLU A C    1 
ATOM   468  O O    . GLU A 1 51  ? 24.790 -19.261 54.698  1.00 60.74  ? 1192 GLU A O    1 
ATOM   469  C CB   . GLU A 1 51  ? 25.422 -17.724 51.884  1.00 52.40  ? 1192 GLU A CB   1 
ATOM   470  C CG   . GLU A 1 51  ? 25.287 -16.315 52.445  1.00 64.31  ? 1192 GLU A CG   1 
ATOM   471  C CD   . GLU A 1 51  ? 26.599 -15.559 52.548  1.00 69.37  ? 1192 GLU A CD   1 
ATOM   472  O OE1  . GLU A 1 51  ? 27.675 -16.144 52.290  1.00 72.02  ? 1192 GLU A OE1  1 
ATOM   473  O OE2  . GLU A 1 51  ? 26.543 -14.363 52.908  1.00 75.03  ? 1192 GLU A OE2  1 
ATOM   474  H H    . GLU A 1 51  ? 25.039 -20.538 52.824  1.00 0.00   ? 1192 GLU A H    1 
ATOM   475  N N    . VAL A 1 52  ? 26.455 -17.796 55.014  1.00 47.40  ? 1193 VAL A N    1 
ATOM   476  C CA   . VAL A 1 52  ? 26.128 -17.585 56.422  1.00 41.20  ? 1193 VAL A CA   1 
ATOM   477  C C    . VAL A 1 52  ? 26.054 -16.099 56.751  1.00 45.01  ? 1193 VAL A C    1 
ATOM   478  O O    . VAL A 1 52  ? 26.887 -15.313 56.305  1.00 47.85  ? 1193 VAL A O    1 
ATOM   479  C CB   . VAL A 1 52  ? 27.144 -18.261 57.369  1.00 34.42  ? 1193 VAL A CB   1 
ATOM   480  C CG1  . VAL A 1 52  ? 26.969 -19.757 57.354  1.00 36.88  ? 1193 VAL A CG1  1 
ATOM   481  C CG2  . VAL A 1 52  ? 28.563 -17.903 56.968  1.00 50.26  ? 1193 VAL A CG2  1 
ATOM   482  H H    . VAL A 1 52  ? 27.192 -17.288 54.596  1.00 0.00   ? 1193 VAL A H    1 
ATOM   483  N N    . VAL A 1 53  ? 25.041 -15.716 57.520  1.00 43.86  ? 1194 VAL A N    1 
ATOM   484  C CA   . VAL A 1 53  ? 24.857 -14.324 57.918  1.00 40.46  ? 1194 VAL A CA   1 
ATOM   485  C C    . VAL A 1 53  ? 24.841 -14.205 59.447  1.00 38.94  ? 1194 VAL A C    1 
ATOM   486  O O    . VAL A 1 53  ? 25.005 -15.207 60.150  1.00 34.56  ? 1194 VAL A O    1 
ATOM   487  C CB   . VAL A 1 53  ? 23.556 -13.722 57.305  1.00 42.36  ? 1194 VAL A CB   1 
ATOM   488  C CG1  . VAL A 1 53  ? 23.715 -13.547 55.794  1.00 46.05  ? 1194 VAL A CG1  1 
ATOM   489  C CG2  . VAL A 1 53  ? 22.364 -14.617 57.589  1.00 42.89  ? 1194 VAL A CG2  1 
ATOM   490  H H    . VAL A 1 53  ? 24.405 -16.385 57.833  1.00 0.00   ? 1194 VAL A H    1 
ATOM   491  N N    . HIS A 1 54  ? 24.735 -12.978 59.953  1.00 36.70  ? 1195 HIS A N    1 
ATOM   492  C CA   . HIS A 1 54  ? 24.697 -12.743 61.393  1.00 34.10  ? 1195 HIS A CA   1 
ATOM   493  C C    . HIS A 1 54  ? 23.258 -12.783 61.859  1.00 34.16  ? 1195 HIS A C    1 
ATOM   494  O O    . HIS A 1 54  ? 22.326 -12.786 61.043  1.00 32.05  ? 1195 HIS A O    1 
ATOM   495  C CB   . HIS A 1 54  ? 25.318 -11.392 61.772  1.00 37.59  ? 1195 HIS A CB   1 
ATOM   496  C CG   . HIS A 1 54  ? 26.778 -11.284 61.462  1.00 45.18  ? 1195 HIS A CG   1 
ATOM   497  N ND1  . HIS A 1 54  ? 27.648 -12.344 61.593  1.00 53.45  ? 1195 HIS A ND1  1 
ATOM   498  C CD2  . HIS A 1 54  ? 27.517 -10.242 61.010  1.00 48.13  ? 1195 HIS A CD2  1 
ATOM   499  C CE1  . HIS A 1 54  ? 28.862 -11.964 61.230  1.00 51.53  ? 1195 HIS A CE1  1 
ATOM   500  N NE2  . HIS A 1 54  ? 28.809 -10.694 60.872  1.00 47.11  ? 1195 HIS A NE2  1 
ATOM   501  H H    . HIS A 1 54  ? 24.653 -12.217 59.342  1.00 0.00   ? 1195 HIS A H    1 
ATOM   502  H HD1  . HIS A 1 54  ? 27.415 -13.229 61.965  1.00 0.00   ? 1195 HIS A HD1  1 
ATOM   503  H HE2  . HIS A 1 54  ? 29.548 -10.162 60.499  1.00 0.00   ? 1195 HIS A HE2  1 
ATOM   504  N N    . ALA A 1 55  ? 23.087 -12.787 63.178  1.00 35.20  ? 1196 ALA A N    1 
ATOM   505  C CA   . ALA A 1 55  ? 21.772 -12.850 63.794  1.00 34.80  ? 1196 ALA A CA   1 
ATOM   506  C C    . ALA A 1 55  ? 20.917 -11.648 63.466  1.00 32.74  ? 1196 ALA A C    1 
ATOM   507  O O    . ALA A 1 55  ? 19.701 -11.765 63.358  1.00 34.12  ? 1196 ALA A O    1 
ATOM   508  C CB   . ALA A 1 55  ? 21.907 -13.000 65.303  1.00 44.77  ? 1196 ALA A CB   1 
ATOM   509  H H    . ALA A 1 55  ? 23.881 -12.744 63.756  1.00 0.00   ? 1196 ALA A H    1 
ATOM   510  N N    . ASP A 1 56  ? 21.547 -10.484 63.374  1.00 38.00  ? 1197 ASP A N    1 
ATOM   511  C CA   . ASP A 1 56  ? 20.840 -9.242  63.064  1.00 44.05  ? 1197 ASP A CA   1 
ATOM   512  C C    . ASP A 1 56  ? 20.482 -9.101  61.580  1.00 42.73  ? 1197 ASP A C    1 
ATOM   513  O O    . ASP A 1 56  ? 19.646 -8.272  61.204  1.00 41.80  ? 1197 ASP A O    1 
ATOM   514  C CB   . ASP A 1 56  ? 21.650 -8.030  63.553  1.00 47.72  ? 1197 ASP A CB   1 
ATOM   515  C CG   . ASP A 1 56  ? 23.123 -8.100  63.169  1.00 45.72  ? 1197 ASP A CG   1 
ATOM   516  O OD1  . ASP A 1 56  ? 23.530 -9.043  62.461  1.00 53.62  ? 1197 ASP A OD1  1 
ATOM   517  O OD2  . ASP A 1 56  ? 23.886 -7.207  63.591  1.00 46.58  ? 1197 ASP A OD2  1 
ATOM   518  H H    . ASP A 1 56  ? 22.517 -10.438 63.493  1.00 0.00   ? 1197 ASP A H    1 
ATOM   519  N N    . GLN A 1 57  ? 21.091 -9.946  60.753  1.00 43.35  ? 1198 GLN A N    1 
ATOM   520  C CA   . GLN A 1 57  ? 20.860 -9.948  59.316  1.00 38.26  ? 1198 GLN A CA   1 
ATOM   521  C C    . GLN A 1 57  ? 19.688 -10.870 58.972  1.00 39.90  ? 1198 GLN A C    1 
ATOM   522  O O    . GLN A 1 57  ? 19.526 -11.938 59.567  1.00 38.70  ? 1198 GLN A O    1 
ATOM   523  C CB   . GLN A 1 57  ? 22.131 -10.407 58.584  1.00 39.07  ? 1198 GLN A CB   1 
ATOM   524  C CG   . GLN A 1 57  ? 23.331 -9.472  58.750  1.00 42.84  ? 1198 GLN A CG   1 
ATOM   525  C CD   . GLN A 1 57  ? 24.560 -9.917  57.956  1.00 52.57  ? 1198 GLN A CD   1 
ATOM   526  O OE1  . GLN A 1 57  ? 25.530 -10.430 58.520  1.00 54.66  ? 1198 GLN A OE1  1 
ATOM   527  N NE2  . GLN A 1 57  ? 24.525 -9.716  56.644  1.00 60.24  ? 1198 GLN A NE2  1 
ATOM   528  H H    . GLN A 1 57  ? 21.702 -10.603 61.136  1.00 0.00   ? 1198 GLN A H    1 
ATOM   529  H HE21 . GLN A 1 57  ? 25.312 -9.989  56.123  1.00 0.00   ? 1198 GLN A HE21 1 
ATOM   530  H HE22 . GLN A 1 57  ? 23.728 -9.307  56.251  1.00 0.00   ? 1198 GLN A HE22 1 
ATOM   531  N N    . SER A 1 58  ? 18.867 -10.451 58.017  1.00 38.60  ? 1199 SER A N    1 
ATOM   532  C CA   . SER A 1 58  ? 17.720 -11.247 57.587  1.00 38.11  ? 1199 SER A CA   1 
ATOM   533  C C    . SER A 1 58  ? 17.622 -11.387 56.059  1.00 33.05  ? 1199 SER A C    1 
ATOM   534  O O    . SER A 1 58  ? 16.539 -11.576 55.505  1.00 27.39  ? 1199 SER A O    1 
ATOM   535  C CB   . SER A 1 58  ? 16.431 -10.660 58.163  1.00 40.92  ? 1199 SER A CB   1 
ATOM   536  O OG   . SER A 1 58  ? 16.479 -9.243  58.177  1.00 57.43  ? 1199 SER A OG   1 
ATOM   537  H H    . SER A 1 58  ? 19.007 -9.569  57.609  1.00 0.00   ? 1199 SER A H    1 
ATOM   538  H HG   . SER A 1 58  ? 15.590 -8.937  58.354  1.00 0.00   ? 1199 SER A HG   1 
ATOM   539  N N    . SER A 1 59  ? 18.768 -11.364 55.391  1.00 34.58  ? 1200 SER A N    1 
ATOM   540  C CA   . SER A 1 59  ? 18.793 -11.480 53.945  1.00 47.57  ? 1200 SER A CA   1 
ATOM   541  C C    . SER A 1 59  ? 20.194 -11.751 53.426  1.00 47.98  ? 1200 SER A C    1 
ATOM   542  O O    . SER A 1 59  ? 21.169 -11.202 53.945  1.00 48.20  ? 1200 SER A O    1 
ATOM   543  C CB   . SER A 1 59  ? 18.274 -10.187 53.312  1.00 57.26  ? 1200 SER A CB   1 
ATOM   544  O OG   . SER A 1 59  ? 19.007 -9.065  53.789  1.00 65.28  ? 1200 SER A OG   1 
ATOM   545  H H    . SER A 1 59  ? 19.620 -11.257 55.855  1.00 0.00   ? 1200 SER A H    1 
ATOM   546  H HG   . SER A 1 59  ? 19.940 -9.205  53.587  1.00 0.00   ? 1200 SER A HG   1 
ATOM   547  N N    . CYS A 1 60  ? 20.279 -12.582 52.391  1.00 49.14  ? 1201 CYS A N    1 
ATOM   548  C CA   . CYS A 1 60  ? 21.546 -12.917 51.757  1.00 52.54  ? 1201 CYS A CA   1 
ATOM   549  C C    . CYS A 1 60  ? 21.296 -13.060 50.249  1.00 60.66  ? 1201 CYS A C    1 
ATOM   550  O O    . CYS A 1 60  ? 20.155 -13.245 49.808  1.00 60.04  ? 1201 CYS A O    1 
ATOM   551  C CB   . CYS A 1 60  ? 22.120 -14.211 52.330  1.00 46.25  ? 1201 CYS A CB   1 
ATOM   552  S SG   . CYS A 1 60  ? 21.339 -15.688 51.710  1.00 42.76  ? 1201 CYS A SG   1 
ATOM   553  H H    . CYS A 1 60  ? 19.462 -12.976 52.005  1.00 0.00   ? 1201 CYS A H    1 
ATOM   554  N N    . THR A 1 61  ? 22.357 -12.956 49.460  1.00 61.81  ? 1202 THR A N    1 
ATOM   555  C CA   . THR A 1 61  ? 22.233 -13.051 48.014  1.00 62.61  ? 1202 THR A CA   1 
ATOM   556  C C    . THR A 1 61  ? 23.090 -14.185 47.480  1.00 63.30  ? 1202 THR A C    1 
ATOM   557  O O    . THR A 1 61  ? 24.137 -14.502 48.054  1.00 64.64  ? 1202 THR A O    1 
ATOM   558  C CB   . THR A 1 61  ? 22.672 -11.726 47.342  1.00 66.13  ? 1202 THR A CB   1 
ATOM   559  O OG1  . THR A 1 61  ? 23.958 -11.331 47.844  1.00 69.71  ? 1202 THR A OG1  1 
ATOM   560  C CG2  . THR A 1 61  ? 21.672 -10.614 47.634  1.00 67.16  ? 1202 THR A CG2  1 
ATOM   561  H H    . THR A 1 61  ? 23.267 -12.840 49.806  1.00 0.00   ? 1202 THR A H    1 
ATOM   562  H HG1  . THR A 1 61  ? 24.322 -10.810 47.110  1.00 0.00   ? 1202 THR A HG1  1 
ATOM   563  N N    . PHE A 1 62  ? 22.620 -14.826 46.416  1.00 63.09  ? 1203 PHE A N    1 
ATOM   564  C CA   . PHE A 1 62  ? 23.354 -15.914 45.783  1.00 64.75  ? 1203 PHE A CA   1 
ATOM   565  C C    . PHE A 1 62  ? 23.595 -15.512 44.346  1.00 67.21  ? 1203 PHE A C    1 
ATOM   566  O O    . PHE A 1 62  ? 22.929 -16.004 43.436  1.00 70.28  ? 1203 PHE A O    1 
ATOM   567  C CB   . PHE A 1 62  ? 22.567 -17.225 45.830  1.00 60.52  ? 1203 PHE A CB   1 
ATOM   568  C CG   . PHE A 1 62  ? 22.548 -17.873 47.183  1.00 60.75  ? 1203 PHE A CG   1 
ATOM   569  C CD1  . PHE A 1 62  ? 23.626 -18.640 47.614  1.00 57.91  ? 1203 PHE A CD1  1 
ATOM   570  C CD2  . PHE A 1 62  ? 21.449 -17.729 48.023  1.00 57.45  ? 1203 PHE A CD2  1 
ATOM   571  C CE1  . PHE A 1 62  ? 23.611 -19.255 48.864  1.00 60.10  ? 1203 PHE A CE1  1 
ATOM   572  C CE2  . PHE A 1 62  ? 21.426 -18.338 49.270  1.00 58.27  ? 1203 PHE A CE2  1 
ATOM   573  C CZ   . PHE A 1 62  ? 22.509 -19.104 49.691  1.00 58.47  ? 1203 PHE A CZ   1 
ATOM   574  H H    . PHE A 1 62  ? 21.760 -14.558 46.038  1.00 0.00   ? 1203 PHE A H    1 
ATOM   575  N N    . ASP A 1 63  ? 24.523 -14.581 44.162  1.00 72.35  ? 1204 ASP A N    1 
ATOM   576  C CA   . ASP A 1 63  ? 24.878 -14.064 42.843  1.00 80.41  ? 1204 ASP A CA   1 
ATOM   577  C C    . ASP A 1 63  ? 25.783 -15.035 42.085  1.00 77.51  ? 1204 ASP A C    1 
ATOM   578  O O    . ASP A 1 63  ? 26.887 -14.680 41.670  1.00 75.43  ? 1204 ASP A O    1 
ATOM   579  C CB   . ASP A 1 63  ? 25.568 -12.701 42.984  1.00 88.09  ? 1204 ASP A CB   1 
ATOM   580  C CG   . ASP A 1 63  ? 24.742 -11.701 43.781  1.00 96.03  ? 1204 ASP A CG   1 
ATOM   581  O OD1  . ASP A 1 63  ? 23.702 -12.090 44.361  1.00 98.41  ? 1204 ASP A OD1  1 
ATOM   582  O OD2  . ASP A 1 63  ? 25.140 -10.517 43.833  1.00 97.06  ? 1204 ASP A OD2  1 
ATOM   583  H H    . ASP A 1 63  ? 24.966 -14.188 44.939  1.00 0.00   ? 1204 ASP A H    1 
ATOM   584  N N    . ASN A 1 64  ? 25.298 -16.256 41.888  1.00 77.15  ? 1205 ASN A N    1 
ATOM   585  C CA   . ASN A 1 64  ? 26.064 -17.289 41.201  1.00 75.11  ? 1205 ASN A CA   1 
ATOM   586  C C    . ASN A 1 64  ? 25.260 -18.563 40.945  1.00 69.87  ? 1205 ASN A C    1 
ATOM   587  O O    . ASN A 1 64  ? 25.758 -19.672 41.137  1.00 69.70  ? 1205 ASN A O    1 
ATOM   588  C CB   . ASN A 1 64  ? 27.351 -17.616 41.986  1.00 80.86  ? 1205 ASN A CB   1 
ATOM   589  C CG   . ASN A 1 64  ? 27.106 -17.817 43.485  1.00 84.37  ? 1205 ASN A CG   1 
ATOM   590  O OD1  . ASN A 1 64  ? 25.969 -17.776 43.960  1.00 85.91  ? 1205 ASN A OD1  1 
ATOM   591  N ND2  . ASN A 1 64  ? 28.183 -18.015 44.235  1.00 84.20  ? 1205 ASN A ND2  1 
ATOM   592  H H    . ASN A 1 64  ? 24.396 -16.462 42.220  1.00 0.00   ? 1205 ASN A H    1 
ATOM   593  H HD21 . ASN A 1 64  ? 28.020 -18.147 45.193  1.00 0.00   ? 1205 ASN A HD21 1 
ATOM   594  H HD22 . ASN A 1 64  ? 29.063 -18.019 43.811  1.00 0.00   ? 1205 ASN A HD22 1 
ATOM   595  N N    . LEU A 1 65  ? 24.022 -18.408 40.493  1.00 65.60  ? 1206 LEU A N    1 
ATOM   596  C CA   . LEU A 1 65  ? 23.186 -19.571 40.205  1.00 65.86  ? 1206 LEU A CA   1 
ATOM   597  C C    . LEU A 1 65  ? 23.085 -19.848 38.705  1.00 62.29  ? 1206 LEU A C    1 
ATOM   598  O O    . LEU A 1 65  ? 23.333 -18.967 37.881  1.00 61.26  ? 1206 LEU A O    1 
ATOM   599  C CB   . LEU A 1 65  ? 21.783 -19.416 40.815  1.00 67.46  ? 1206 LEU A CB   1 
ATOM   600  C CG   . LEU A 1 65  ? 21.655 -19.538 42.339  1.00 63.46  ? 1206 LEU A CG   1 
ATOM   601  C CD1  . LEU A 1 65  ? 20.186 -19.609 42.729  1.00 60.42  ? 1206 LEU A CD1  1 
ATOM   602  C CD2  . LEU A 1 65  ? 22.379 -20.788 42.822  1.00 66.55  ? 1206 LEU A CD2  1 
ATOM   603  H H    . LEU A 1 65  ? 23.683 -17.504 40.330  1.00 0.00   ? 1206 LEU A H    1 
ATOM   604  N N    . SER A 1 66  ? 22.717 -21.078 38.364  1.00 56.43  ? 1207 SER A N    1 
ATOM   605  C CA   . SER A 1 66  ? 22.578 -21.493 36.977  1.00 53.60  ? 1207 SER A CA   1 
ATOM   606  C C    . SER A 1 66  ? 21.153 -21.239 36.487  1.00 54.28  ? 1207 SER A C    1 
ATOM   607  O O    . SER A 1 66  ? 20.211 -21.913 36.915  1.00 55.38  ? 1207 SER A O    1 
ATOM   608  C CB   . SER A 1 66  ? 22.912 -22.975 36.857  1.00 56.64  ? 1207 SER A CB   1 
ATOM   609  O OG   . SER A 1 66  ? 24.057 -23.296 37.632  1.00 69.21  ? 1207 SER A OG   1 
ATOM   610  H H    . SER A 1 66  ? 22.543 -21.730 39.071  1.00 0.00   ? 1207 SER A H    1 
ATOM   611  H HG   . SER A 1 66  ? 24.800 -22.826 37.231  1.00 0.00   ? 1207 SER A HG   1 
ATOM   612  N N    . PRO A 1 67  ? 20.988 -20.298 35.536  1.00 52.70  ? 1208 PRO A N    1 
ATOM   613  C CA   . PRO A 1 67  ? 19.703 -19.900 34.941  1.00 45.83  ? 1208 PRO A CA   1 
ATOM   614  C C    . PRO A 1 67  ? 18.892 -21.054 34.382  1.00 39.49  ? 1208 PRO A C    1 
ATOM   615  O O    . PRO A 1 67  ? 19.453 -22.054 33.929  1.00 46.57  ? 1208 PRO A O    1 
ATOM   616  C CB   . PRO A 1 67  ? 20.120 -18.946 33.819  1.00 49.53  ? 1208 PRO A CB   1 
ATOM   617  C CG   . PRO A 1 67  ? 21.451 -18.400 34.282  1.00 53.10  ? 1208 PRO A CG   1 
ATOM   618  C CD   . PRO A 1 67  ? 22.113 -19.616 34.869  1.00 54.44  ? 1208 PRO A CD   1 
ATOM   619  N N    . GLY A 1 68  ? 17.571 -20.905 34.417  1.00 40.00  ? 1209 GLY A N    1 
ATOM   620  C CA   . GLY A 1 68  ? 16.672 -21.922 33.894  1.00 43.61  ? 1209 GLY A CA   1 
ATOM   621  C C    . GLY A 1 68  ? 16.793 -23.301 34.511  1.00 49.40  ? 1209 GLY A C    1 
ATOM   622  O O    . GLY A 1 68  ? 16.541 -24.306 33.842  1.00 53.33  ? 1209 GLY A O    1 
ATOM   623  H H    . GLY A 1 68  ? 17.171 -20.102 34.813  1.00 0.00   ? 1209 GLY A H    1 
ATOM   624  N N    . LEU A 1 69  ? 17.171 -23.352 35.784  1.00 54.51  ? 1210 LEU A N    1 
ATOM   625  C CA   . LEU A 1 69  ? 17.319 -24.611 36.512  1.00 53.56  ? 1210 LEU A CA   1 
ATOM   626  C C    . LEU A 1 69  ? 16.612 -24.439 37.853  1.00 54.79  ? 1210 LEU A C    1 
ATOM   627  O O    . LEU A 1 69  ? 16.471 -23.317 38.334  1.00 49.35  ? 1210 LEU A O    1 
ATOM   628  C CB   . LEU A 1 69  ? 18.805 -24.928 36.750  1.00 56.22  ? 1210 LEU A CB   1 
ATOM   629  C CG   . LEU A 1 69  ? 19.781 -25.024 35.567  1.00 54.50  ? 1210 LEU A CG   1 
ATOM   630  C CD1  . LEU A 1 69  ? 21.101 -25.560 36.064  1.00 45.93  ? 1210 LEU A CD1  1 
ATOM   631  C CD2  . LEU A 1 69  ? 19.241 -25.944 34.488  1.00 56.53  ? 1210 LEU A CD2  1 
ATOM   632  H H    . LEU A 1 69  ? 17.338 -22.520 36.274  1.00 0.00   ? 1210 LEU A H    1 
ATOM   633  N N    . GLU A 1 70  ? 16.141 -25.529 38.449  1.00 55.87  ? 1211 GLU A N    1 
ATOM   634  C CA   . GLU A 1 70  ? 15.464 -25.418 39.737  1.00 58.89  ? 1211 GLU A CA   1 
ATOM   635  C C    . GLU A 1 70  ? 16.388 -25.650 40.933  1.00 58.99  ? 1211 GLU A C    1 
ATOM   636  O O    . GLU A 1 70  ? 17.229 -26.561 40.931  1.00 47.52  ? 1211 GLU A O    1 
ATOM   637  C CB   . GLU A 1 70  ? 14.253 -26.342 39.824  1.00 59.49  ? 1211 GLU A CB   1 
ATOM   638  C CG   . GLU A 1 70  ? 13.358 -25.978 40.990  1.00 67.24  ? 1211 GLU A CG   1 
ATOM   639  C CD   . GLU A 1 70  ? 12.045 -26.721 41.006  1.00 73.49  ? 1211 GLU A CD   1 
ATOM   640  O OE1  . GLU A 1 70  ? 12.064 -27.960 41.177  1.00 78.39  ? 1211 GLU A OE1  1 
ATOM   641  O OE2  . GLU A 1 70  ? 10.993 -26.057 40.872  1.00 69.71  ? 1211 GLU A OE2  1 
ATOM   642  H H    . GLU A 1 70  ? 16.257 -26.411 38.050  1.00 0.00   ? 1211 GLU A H    1 
ATOM   643  N N    . TYR A 1 71  ? 16.216 -24.811 41.951  1.00 64.43  ? 1212 TYR A N    1 
ATOM   644  C CA   . TYR A 1 71  ? 17.003 -24.866 43.177  1.00 61.87  ? 1212 TYR A CA   1 
ATOM   645  C C    . TYR A 1 71  ? 16.103 -24.829 44.407  1.00 60.30  ? 1212 TYR A C    1 
ATOM   646  O O    . TYR A 1 71  ? 15.047 -24.192 44.398  1.00 55.10  ? 1212 TYR A O    1 
ATOM   647  C CB   . TYR A 1 71  ? 17.956 -23.670 43.242  1.00 61.42  ? 1212 TYR A CB   1 
ATOM   648  C CG   . TYR A 1 71  ? 19.187 -23.801 42.380  1.00 72.51  ? 1212 TYR A CG   1 
ATOM   649  C CD1  . TYR A 1 71  ? 20.294 -24.524 42.825  1.00 75.05  ? 1212 TYR A CD1  1 
ATOM   650  C CD2  . TYR A 1 71  ? 19.258 -23.189 41.126  1.00 73.99  ? 1212 TYR A CD2  1 
ATOM   651  C CE1  . TYR A 1 71  ? 21.441 -24.637 42.050  1.00 74.38  ? 1212 TYR A CE1  1 
ATOM   652  C CE2  . TYR A 1 71  ? 20.407 -23.297 40.337  1.00 72.23  ? 1212 TYR A CE2  1 
ATOM   653  C CZ   . TYR A 1 71  ? 21.492 -24.022 40.810  1.00 74.32  ? 1212 TYR A CZ   1 
ATOM   654  O OH   . TYR A 1 71  ? 22.640 -24.131 40.061  1.00 81.34  ? 1212 TYR A OH   1 
ATOM   655  H H    . TYR A 1 71  ? 15.504 -24.141 41.886  1.00 0.00   ? 1212 TYR A H    1 
ATOM   656  H HH   . TYR A 1 71  ? 22.514 -23.770 39.177  1.00 0.00   ? 1212 TYR A HH   1 
ATOM   657  N N    . ASN A 1 72  ? 16.513 -25.535 45.455  1.00 59.88  ? 1213 ASN A N    1 
ATOM   658  C CA   . ASN A 1 72  ? 15.780 -25.544 46.710  1.00 58.83  ? 1213 ASN A CA   1 
ATOM   659  C C    . ASN A 1 72  ? 16.631 -24.754 47.693  1.00 54.55  ? 1213 ASN A C    1 
ATOM   660  O O    . ASN A 1 72  ? 17.803 -25.069 47.913  1.00 53.60  ? 1213 ASN A O    1 
ATOM   661  C CB   . ASN A 1 72  ? 15.560 -26.965 47.242  1.00 66.40  ? 1213 ASN A CB   1 
ATOM   662  C CG   . ASN A 1 72  ? 14.723 -26.987 48.532  1.00 69.49  ? 1213 ASN A CG   1 
ATOM   663  O OD1  . ASN A 1 72  ? 14.891 -26.141 49.417  1.00 62.82  ? 1213 ASN A OD1  1 
ATOM   664  N ND2  . ASN A 1 72  ? 13.812 -27.951 48.631  1.00 70.44  ? 1213 ASN A ND2  1 
ATOM   665  H H    . ASN A 1 72  ? 17.330 -26.048 45.415  1.00 0.00   ? 1213 ASN A H    1 
ATOM   666  H HD21 . ASN A 1 72  ? 13.295 -27.990 49.461  1.00 0.00   ? 1213 ASN A HD21 1 
ATOM   667  H HD22 . ASN A 1 72  ? 13.716 -28.580 47.890  1.00 0.00   ? 1213 ASN A HD22 1 
ATOM   668  N N    . VAL A 1 73  ? 16.049 -23.693 48.231  1.00 49.64  ? 1214 VAL A N    1 
ATOM   669  C CA   . VAL A 1 73  ? 16.733 -22.836 49.177  1.00 45.57  ? 1214 VAL A CA   1 
ATOM   670  C C    . VAL A 1 73  ? 16.229 -23.121 50.582  1.00 43.06  ? 1214 VAL A C    1 
ATOM   671  O O    . VAL A 1 73  ? 15.019 -23.176 50.815  1.00 37.64  ? 1214 VAL A O    1 
ATOM   672  C CB   . VAL A 1 73  ? 16.489 -21.357 48.851  1.00 41.50  ? 1214 VAL A CB   1 
ATOM   673  C CG1  . VAL A 1 73  ? 17.351 -20.464 49.744  1.00 34.21  ? 1214 VAL A CG1  1 
ATOM   674  C CG2  . VAL A 1 73  ? 16.782 -21.105 47.380  1.00 44.12  ? 1214 VAL A CG2  1 
ATOM   675  H H    . VAL A 1 73  ? 15.126 -23.488 48.008  1.00 0.00   ? 1214 VAL A H    1 
ATOM   676  N N    . SER A 1 74  ? 17.166 -23.305 51.507  1.00 38.17  ? 1215 SER A N    1 
ATOM   677  C CA   . SER A 1 74  ? 16.851 -23.578 52.901  1.00 34.45  ? 1215 SER A CA   1 
ATOM   678  C C    . SER A 1 74  ? 17.612 -22.625 53.812  1.00 34.81  ? 1215 SER A C    1 
ATOM   679  O O    . SER A 1 74  ? 18.804 -22.373 53.617  1.00 35.60  ? 1215 SER A O    1 
ATOM   680  C CB   . SER A 1 74  ? 17.221 -25.018 53.262  1.00 28.33  ? 1215 SER A CB   1 
ATOM   681  O OG   . SER A 1 74  ? 16.471 -25.950 52.502  1.00 36.87  ? 1215 SER A OG   1 
ATOM   682  H H    . SER A 1 74  ? 18.104 -23.257 51.221  1.00 0.00   ? 1215 SER A H    1 
ATOM   683  H HG   . SER A 1 74  ? 16.597 -25.768 51.553  1.00 0.00   ? 1215 SER A HG   1 
ATOM   684  N N    . VAL A 1 75  ? 16.909 -22.068 54.786  1.00 32.87  ? 1216 VAL A N    1 
ATOM   685  C CA   . VAL A 1 75  ? 17.534 -21.168 55.738  1.00 30.40  ? 1216 VAL A CA   1 
ATOM   686  C C    . VAL A 1 75  ? 17.340 -21.783 57.130  1.00 29.01  ? 1216 VAL A C    1 
ATOM   687  O O    . VAL A 1 75  ? 16.246 -22.253 57.474  1.00 16.92  ? 1216 VAL A O    1 
ATOM   688  C CB   . VAL A 1 75  ? 16.922 -19.743 55.685  1.00 30.48  ? 1216 VAL A CB   1 
ATOM   689  C CG1  . VAL A 1 75  ? 17.641 -18.820 56.678  1.00 23.71  ? 1216 VAL A CG1  1 
ATOM   690  C CG2  . VAL A 1 75  ? 17.008 -19.175 54.263  1.00 28.24  ? 1216 VAL A CG2  1 
ATOM   691  H H    . VAL A 1 75  ? 15.949 -22.255 54.875  1.00 0.00   ? 1216 VAL A H    1 
ATOM   692  N N    . TYR A 1 76  ? 18.421 -21.821 57.899  1.00 27.09  ? 1217 TYR A N    1 
ATOM   693  C CA   . TYR A 1 76  ? 18.393 -22.378 59.239  1.00 22.20  ? 1217 TYR A CA   1 
ATOM   694  C C    . TYR A 1 76  ? 18.788 -21.322 60.254  1.00 21.31  ? 1217 TYR A C    1 
ATOM   695  O O    . TYR A 1 76  ? 19.635 -20.478 59.971  1.00 24.66  ? 1217 TYR A O    1 
ATOM   696  C CB   . TYR A 1 76  ? 19.410 -23.511 59.365  1.00 22.51  ? 1217 TYR A CB   1 
ATOM   697  C CG   . TYR A 1 76  ? 19.364 -24.561 58.294  1.00 19.02  ? 1217 TYR A CG   1 
ATOM   698  C CD1  . TYR A 1 76  ? 19.811 -24.284 56.997  1.00 26.77  ? 1217 TYR A CD1  1 
ATOM   699  C CD2  . TYR A 1 76  ? 18.933 -25.850 58.583  1.00 20.70  ? 1217 TYR A CD2  1 
ATOM   700  C CE1  . TYR A 1 76  ? 19.831 -25.273 56.012  1.00 23.12  ? 1217 TYR A CE1  1 
ATOM   701  C CE2  . TYR A 1 76  ? 18.950 -26.841 57.609  1.00 30.04  ? 1217 TYR A CE2  1 
ATOM   702  C CZ   . TYR A 1 76  ? 19.404 -26.547 56.324  1.00 26.99  ? 1217 TYR A CZ   1 
ATOM   703  O OH   . TYR A 1 76  ? 19.448 -27.534 55.364  1.00 25.60  ? 1217 TYR A OH   1 
ATOM   704  H H    . TYR A 1 76  ? 19.260 -21.438 57.571  1.00 0.00   ? 1217 TYR A H    1 
ATOM   705  H HH   . TYR A 1 76  ? 19.063 -28.350 55.704  1.00 0.00   ? 1217 TYR A HH   1 
ATOM   706  N N    . THR A 1 77  ? 18.162 -21.375 61.427  1.00 24.46  ? 1218 THR A N    1 
ATOM   707  C CA   . THR A 1 77  ? 18.476 -20.486 62.543  1.00 19.00  ? 1218 THR A CA   1 
ATOM   708  C C    . THR A 1 77  ? 19.633 -21.214 63.227  1.00 15.36  ? 1218 THR A C    1 
ATOM   709  O O    . THR A 1 77  ? 19.559 -22.426 63.424  1.00 19.35  ? 1218 THR A O    1 
ATOM   710  C CB   . THR A 1 77  ? 17.271 -20.379 63.503  1.00 12.99  ? 1218 THR A CB   1 
ATOM   711  O OG1  . THR A 1 77  ? 16.177 -19.776 62.812  1.00 19.93  ? 1218 THR A OG1  1 
ATOM   712  C CG2  . THR A 1 77  ? 17.597 -19.542 64.712  1.00 10.35  ? 1218 THR A CG2  1 
ATOM   713  H H    . THR A 1 77  ? 17.458 -22.044 61.573  1.00 0.00   ? 1218 THR A H    1 
ATOM   714  H HG1  . THR A 1 77  ? 16.474 -18.916 62.514  1.00 0.00   ? 1218 THR A HG1  1 
ATOM   715  N N    . VAL A 1 78  ? 20.709 -20.499 63.532  1.00 20.02  ? 1219 VAL A N    1 
ATOM   716  C CA   . VAL A 1 78  ? 21.890 -21.106 64.151  1.00 16.32  ? 1219 VAL A CA   1 
ATOM   717  C C    . VAL A 1 78  ? 22.282 -20.468 65.486  1.00 24.59  ? 1219 VAL A C    1 
ATOM   718  O O    . VAL A 1 78  ? 22.250 -19.237 65.631  1.00 26.21  ? 1219 VAL A O    1 
ATOM   719  C CB   . VAL A 1 78  ? 23.150 -20.986 63.224  1.00 19.03  ? 1219 VAL A CB   1 
ATOM   720  C CG1  . VAL A 1 78  ? 24.342 -21.696 63.854  1.00 13.22  ? 1219 VAL A CG1  1 
ATOM   721  C CG2  . VAL A 1 78  ? 22.869 -21.544 61.818  1.00 14.40  ? 1219 VAL A CG2  1 
ATOM   722  H H    . VAL A 1 78  ? 20.729 -19.532 63.355  1.00 0.00   ? 1219 VAL A H    1 
ATOM   723  N N    . LYS A 1 79  ? 22.660 -21.311 66.446  1.00 25.57  ? 1220 LYS A N    1 
ATOM   724  C CA   . LYS A 1 79  ? 23.143 -20.869 67.760  1.00 21.45  ? 1220 LYS A CA   1 
ATOM   725  C C    . LYS A 1 79  ? 24.298 -21.791 68.083  1.00 19.28  ? 1220 LYS A C    1 
ATOM   726  O O    . LYS A 1 79  ? 24.104 -22.939 68.518  1.00 21.08  ? 1220 LYS A O    1 
ATOM   727  C CB   . LYS A 1 79  ? 22.080 -20.964 68.847  1.00 23.05  ? 1220 LYS A CB   1 
ATOM   728  C CG   . LYS A 1 79  ? 22.639 -20.611 70.230  1.00 27.64  ? 1220 LYS A CG   1 
ATOM   729  C CD   . LYS A 1 79  ? 21.545 -20.378 71.262  1.00 37.52  ? 1220 LYS A CD   1 
ATOM   730  C CE   . LYS A 1 79  ? 22.127 -19.993 72.629  1.00 32.79  ? 1220 LYS A CE   1 
ATOM   731  N NZ   . LYS A 1 79  ? 21.122 -19.243 73.438  1.00 45.26  ? 1220 LYS A NZ   1 
ATOM   732  H H    . LYS A 1 79  ? 22.636 -22.276 66.254  1.00 0.00   ? 1220 LYS A H    1 
ATOM   733  H HZ1  . LYS A 1 79  ? 20.175 -19.693 73.490  1.00 0.00   ? 1220 LYS A HZ1  1 
ATOM   734  H HZ2  . LYS A 1 79  ? 21.425 -18.962 74.390  1.00 0.00   ? 1220 LYS A HZ2  1 
ATOM   735  H HZ3  . LYS A 1 79  ? 20.943 -18.355 72.920  1.00 0.00   ? 1220 LYS A HZ3  1 
ATOM   736  N N    . ASP A 1 80  ? 25.500 -21.295 67.814  1.00 23.98  ? 1221 ASP A N    1 
ATOM   737  C CA   . ASP A 1 80  ? 26.730 -22.049 68.021  1.00 27.70  ? 1221 ASP A CA   1 
ATOM   738  C C    . ASP A 1 80  ? 26.638 -23.321 67.194  1.00 26.12  ? 1221 ASP A C    1 
ATOM   739  O O    . ASP A 1 80  ? 26.427 -23.247 65.984  1.00 30.08  ? 1221 ASP A O    1 
ATOM   740  C CB   . ASP A 1 80  ? 26.960 -22.354 69.507  1.00 28.47  ? 1221 ASP A CB   1 
ATOM   741  C CG   . ASP A 1 80  ? 27.122 -21.098 70.343  1.00 34.41  ? 1221 ASP A CG   1 
ATOM   742  O OD1  . ASP A 1 80  ? 27.903 -20.209 69.936  1.00 33.38  ? 1221 ASP A OD1  1 
ATOM   743  O OD2  . ASP A 1 80  ? 26.450 -20.987 71.394  1.00 27.62  ? 1221 ASP A OD2  1 
ATOM   744  H H    . ASP A 1 80  ? 25.553 -20.380 67.469  1.00 0.00   ? 1221 ASP A H    1 
ATOM   745  N N    . ASP A 1 81  ? 26.732 -24.477 67.838  1.00 25.18  ? 1222 ASP A N    1 
ATOM   746  C CA   . ASP A 1 81  ? 26.668 -25.744 67.118  1.00 25.43  ? 1222 ASP A CA   1 
ATOM   747  C C    . ASP A 1 81  ? 25.263 -26.321 66.877  1.00 26.52  ? 1222 ASP A C    1 
ATOM   748  O O    . ASP A 1 81  ? 25.130 -27.419 66.332  1.00 30.79  ? 1222 ASP A O    1 
ATOM   749  C CB   . ASP A 1 81  ? 27.573 -26.784 67.797  1.00 27.35  ? 1222 ASP A CB   1 
ATOM   750  C CG   . ASP A 1 81  ? 27.235 -27.001 69.250  1.00 25.95  ? 1222 ASP A CG   1 
ATOM   751  O OD1  . ASP A 1 81  ? 26.464 -26.208 69.817  1.00 34.01  ? 1222 ASP A OD1  1 
ATOM   752  O OD2  . ASP A 1 81  ? 27.704 -27.992 69.836  1.00 37.70  ? 1222 ASP A OD2  1 
ATOM   753  H H    . ASP A 1 81  ? 26.824 -24.530 68.809  1.00 0.00   ? 1222 ASP A H    1 
ATOM   754  N N    . LYS A 1 82  ? 24.219 -25.592 67.265  1.00 28.16  ? 1223 LYS A N    1 
ATOM   755  C CA   . LYS A 1 82  ? 22.849 -26.062 67.069  1.00 26.27  ? 1223 LYS A CA   1 
ATOM   756  C C    . LYS A 1 82  ? 22.123 -25.290 65.963  1.00 24.97  ? 1223 LYS A C    1 
ATOM   757  O O    . LYS A 1 82  ? 22.419 -24.121 65.716  1.00 27.68  ? 1223 LYS A O    1 
ATOM   758  C CB   . LYS A 1 82  ? 22.060 -25.965 68.374  1.00 24.87  ? 1223 LYS A CB   1 
ATOM   759  C CG   . LYS A 1 82  ? 22.736 -26.661 69.532  1.00 32.33  ? 1223 LYS A CG   1 
ATOM   760  C CD   . LYS A 1 82  ? 22.905 -28.143 69.273  1.00 34.82  ? 1223 LYS A CD   1 
ATOM   761  C CE   . LYS A 1 82  ? 23.686 -28.824 70.399  1.00 36.17  ? 1223 LYS A CE   1 
ATOM   762  N NZ   . LYS A 1 82  ? 25.125 -28.444 70.383  1.00 52.69  ? 1223 LYS A NZ   1 
ATOM   763  H H    . LYS A 1 82  ? 24.376 -24.715 67.672  1.00 0.00   ? 1223 LYS A H    1 
ATOM   764  H HZ1  . LYS A 1 82  ? 25.612 -28.647 69.483  1.00 0.00   ? 1223 LYS A HZ1  1 
ATOM   765  H HZ2  . LYS A 1 82  ? 25.297 -27.418 70.508  1.00 0.00   ? 1223 LYS A HZ2  1 
ATOM   766  H HZ3  . LYS A 1 82  ? 25.724 -28.876 71.107  1.00 0.00   ? 1223 LYS A HZ3  1 
ATOM   767  N N    . GLU A 1 83  ? 21.150 -25.949 65.336  1.00 25.45  ? 1224 GLU A N    1 
ATOM   768  C CA   . GLU A 1 83  ? 20.355 -25.379 64.254  1.00 22.89  ? 1224 GLU A CA   1 
ATOM   769  C C    . GLU A 1 83  ? 18.921 -25.832 64.330  1.00 22.30  ? 1224 GLU A C    1 
ATOM   770  O O    . GLU A 1 83  ? 18.624 -26.923 64.834  1.00 20.85  ? 1224 GLU A O    1 
ATOM   771  C CB   . GLU A 1 83  ? 20.892 -25.805 62.886  1.00 21.38  ? 1224 GLU A CB   1 
ATOM   772  C CG   . GLU A 1 83  ? 21.935 -24.881 62.339  1.00 26.24  ? 1224 GLU A CG   1 
ATOM   773  C CD   . GLU A 1 83  ? 22.529 -25.362 61.037  1.00 33.15  ? 1224 GLU A CD   1 
ATOM   774  O OE1  . GLU A 1 83  ? 22.270 -26.506 60.614  1.00 28.70  ? 1224 GLU A OE1  1 
ATOM   775  O OE2  . GLU A 1 83  ? 23.287 -24.591 60.432  1.00 31.98  ? 1224 GLU A OE2  1 
ATOM   776  H H    . GLU A 1 83  ? 20.944 -26.862 65.627  1.00 0.00   ? 1224 GLU A H    1 
ATOM   777  N N    . SER A 1 84  ? 18.040 -24.986 63.814  1.00 22.74  ? 1225 SER A N    1 
ATOM   778  C CA   . SER A 1 84  ? 16.616 -25.267 63.765  1.00 28.23  ? 1225 SER A CA   1 
ATOM   779  C C    . SER A 1 84  ? 16.354 -26.096 62.510  1.00 24.76  ? 1225 SER A C    1 
ATOM   780  O O    . SER A 1 84  ? 17.272 -26.387 61.744  1.00 26.88  ? 1225 SER A O    1 
ATOM   781  C CB   . SER A 1 84  ? 15.836 -23.951 63.641  1.00 24.29  ? 1225 SER A CB   1 
ATOM   782  O OG   . SER A 1 84  ? 16.026 -23.344 62.362  1.00 22.38  ? 1225 SER A OG   1 
ATOM   783  H H    . SER A 1 84  ? 18.365 -24.147 63.419  1.00 0.00   ? 1225 SER A H    1 
ATOM   784  H HG   . SER A 1 84  ? 15.502 -23.813 61.696  1.00 0.00   ? 1225 SER A HG   1 
ATOM   785  N N    . VAL A 1 85  ? 15.109 -26.518 62.333  1.00 24.49  ? 1226 VAL A N    1 
ATOM   786  C CA   . VAL A 1 85  ? 14.731 -27.222 61.124  1.00 18.24  ? 1226 VAL A CA   1 
ATOM   787  C C    . VAL A 1 85  ? 14.741 -26.052 60.121  1.00 24.67  ? 1226 VAL A C    1 
ATOM   788  O O    . VAL A 1 85  ? 14.603 -24.874 60.516  1.00 20.08  ? 1226 VAL A O    1 
ATOM   789  C CB   . VAL A 1 85  ? 13.305 -27.840 61.227  1.00 23.20  ? 1226 VAL A CB   1 
ATOM   790  C CG1  . VAL A 1 85  ? 13.220 -28.785 62.400  1.00 20.66  ? 1226 VAL A CG1  1 
ATOM   791  C CG2  . VAL A 1 85  ? 12.247 -26.758 61.359  1.00 20.46  ? 1226 VAL A CG2  1 
ATOM   792  H H    . VAL A 1 85  ? 14.443 -26.339 63.035  1.00 0.00   ? 1226 VAL A H    1 
ATOM   793  N N    . PRO A 1 86  ? 14.971 -26.332 58.834  1.00 21.04  ? 1227 PRO A N    1 
ATOM   794  C CA   . PRO A 1 86  ? 14.980 -25.204 57.902  1.00 24.56  ? 1227 PRO A CA   1 
ATOM   795  C C    . PRO A 1 86  ? 13.615 -24.780 57.376  1.00 24.30  ? 1227 PRO A C    1 
ATOM   796  O O    . PRO A 1 86  ? 12.588 -25.407 57.660  1.00 25.03  ? 1227 PRO A O    1 
ATOM   797  C CB   . PRO A 1 86  ? 15.826 -25.737 56.754  1.00 16.51  ? 1227 PRO A CB   1 
ATOM   798  C CG   . PRO A 1 86  ? 15.397 -27.148 56.693  1.00 22.37  ? 1227 PRO A CG   1 
ATOM   799  C CD   . PRO A 1 86  ? 15.410 -27.565 58.161  1.00 21.48  ? 1227 PRO A CD   1 
ATOM   800  N N    . ILE A 1 87  ? 13.609 -23.614 56.744  1.00 27.29  ? 1228 ILE A N    1 
ATOM   801  C CA   . ILE A 1 87  ? 12.430 -23.138 56.050  1.00 25.77  ? 1228 ILE A CA   1 
ATOM   802  C C    . ILE A 1 87  ? 12.986 -23.224 54.630  1.00 32.48  ? 1228 ILE A C    1 
ATOM   803  O O    . ILE A 1 87  ? 14.054 -22.644 54.331  1.00 23.35  ? 1228 ILE A O    1 
ATOM   804  C CB   . ILE A 1 87  ? 11.986 -21.702 56.399  1.00 17.84  ? 1228 ILE A CB   1 
ATOM   805  C CG1  . ILE A 1 87  ? 10.733 -21.391 55.576  1.00 15.15  ? 1228 ILE A CG1  1 
ATOM   806  C CG2  . ILE A 1 87  ? 13.082 -20.668 56.140  1.00 15.09  ? 1228 ILE A CG2  1 
ATOM   807  C CD1  . ILE A 1 87  ? 10.077 -20.101 55.922  1.00 26.99  ? 1228 ILE A CD1  1 
ATOM   808  H H    . ILE A 1 87  ? 14.423 -23.062 56.737  1.00 0.00   ? 1228 ILE A H    1 
ATOM   809  N N    . SER A 1 88  ? 12.377 -24.094 53.830  1.00 30.98  ? 1229 SER A N    1 
ATOM   810  C CA   . SER A 1 88  ? 12.827 -24.324 52.462  1.00 30.52  ? 1229 SER A CA   1 
ATOM   811  C C    . SER A 1 88  ? 11.767 -23.916 51.456  1.00 33.90  ? 1229 SER A C    1 
ATOM   812  O O    . SER A 1 88  ? 10.582 -23.855 51.781  1.00 38.22  ? 1229 SER A O    1 
ATOM   813  C CB   . SER A 1 88  ? 13.150 -25.814 52.248  1.00 25.45  ? 1229 SER A CB   1 
ATOM   814  O OG   . SER A 1 88  ? 13.917 -26.378 53.305  1.00 31.64  ? 1229 SER A OG   1 
ATOM   815  H H    . SER A 1 88  ? 11.614 -24.599 54.150  1.00 0.00   ? 1229 SER A H    1 
ATOM   816  H HG   . SER A 1 88  ? 14.790 -25.982 53.256  1.00 0.00   ? 1229 SER A HG   1 
ATOM   817  N N    . ASP A 1 89  ? 12.205 -23.642 50.235  1.00 36.17  ? 1230 ASP A N    1 
ATOM   818  C CA   . ASP A 1 89  ? 11.308 -23.280 49.151  1.00 35.29  ? 1230 ASP A CA   1 
ATOM   819  C C    . ASP A 1 89  ? 12.116 -23.414 47.882  1.00 35.02  ? 1230 ASP A C    1 
ATOM   820  O O    . ASP A 1 89  ? 13.330 -23.233 47.901  1.00 30.05  ? 1230 ASP A O    1 
ATOM   821  C CB   . ASP A 1 89  ? 10.786 -21.858 49.306  1.00 40.87  ? 1230 ASP A CB   1 
ATOM   822  C CG   . ASP A 1 89  ? 9.495  -21.632 48.548  1.00 50.95  ? 1230 ASP A CG   1 
ATOM   823  O OD1  . ASP A 1 89  ? 9.086  -22.540 47.786  1.00 54.37  ? 1230 ASP A OD1  1 
ATOM   824  O OD2  . ASP A 1 89  ? 8.888  -20.550 48.710  1.00 55.07  ? 1230 ASP A OD2  1 
ATOM   825  H H    . ASP A 1 89  ? 13.170 -23.652 50.041  1.00 0.00   ? 1230 ASP A H    1 
ATOM   826  N N    . THR A 1 90  ? 11.453 -23.725 46.776  1.00 43.12  ? 1231 THR A N    1 
ATOM   827  C CA   . THR A 1 90  ? 12.157 -23.926 45.517  1.00 46.05  ? 1231 THR A CA   1 
ATOM   828  C C    . THR A 1 90  ? 11.867 -22.858 44.455  1.00 47.49  ? 1231 THR A C    1 
ATOM   829  O O    . THR A 1 90  ? 10.752 -22.333 44.376  1.00 43.24  ? 1231 THR A O    1 
ATOM   830  C CB   . THR A 1 90  ? 11.889 -25.347 44.986  1.00 43.77  ? 1231 THR A CB   1 
ATOM   831  O OG1  . THR A 1 90  ? 12.945 -25.736 44.104  1.00 53.40  ? 1231 THR A OG1  1 
ATOM   832  C CG2  . THR A 1 90  ? 10.552 -25.420 44.264  1.00 48.55  ? 1231 THR A CG2  1 
ATOM   833  H H    . THR A 1 90  ? 10.468 -23.740 46.812  1.00 0.00   ? 1231 THR A H    1 
ATOM   834  H HG1  . THR A 1 90  ? 13.821 -25.650 44.483  1.00 0.00   ? 1231 THR A HG1  1 
ATOM   835  N N    . ILE A 1 91  ? 12.882 -22.540 43.649  1.00 49.92  ? 1232 ILE A N    1 
ATOM   836  C CA   . ILE A 1 91  ? 12.767 -21.518 42.603  1.00 47.22  ? 1232 ILE A CA   1 
ATOM   837  C C    . ILE A 1 91  ? 13.560 -21.886 41.350  1.00 44.62  ? 1232 ILE A C    1 
ATOM   838  O O    . ILE A 1 91  ? 14.622 -22.502 41.438  1.00 40.85  ? 1232 ILE A O    1 
ATOM   839  C CB   . ILE A 1 91  ? 13.276 -20.125 43.112  1.00 45.63  ? 1232 ILE A CB   1 
ATOM   840  C CG1  . ILE A 1 91  ? 12.904 -19.015 42.125  1.00 42.35  ? 1232 ILE A CG1  1 
ATOM   841  C CG2  . ILE A 1 91  ? 14.795 -20.134 43.307  1.00 40.34  ? 1232 ILE A CG2  1 
ATOM   842  C CD1  . ILE A 1 91  ? 13.370 -17.631 42.549  1.00 32.14  ? 1232 ILE A CD1  1 
ATOM   843  H H    . ILE A 1 91  ? 13.728 -23.029 43.711  1.00 0.00   ? 1232 ILE A H    1 
ATOM   844  N N    . ILE A 1 92  ? 13.007 -21.544 40.189  1.00 45.18  ? 1233 ILE A N    1 
ATOM   845  C CA   . ILE A 1 92  ? 13.666 -21.779 38.905  1.00 43.36  ? 1233 ILE A CA   1 
ATOM   846  C C    . ILE A 1 92  ? 14.027 -20.386 38.401  1.00 37.80  ? 1233 ILE A C    1 
ATOM   847  O O    . ILE A 1 92  ? 13.146 -19.596 38.051  1.00 39.18  ? 1233 ILE A O    1 
ATOM   848  C CB   . ILE A 1 92  ? 12.726 -22.454 37.871  1.00 44.54  ? 1233 ILE A CB   1 
ATOM   849  C CG1  . ILE A 1 92  ? 12.425 -23.889 38.286  1.00 43.97  ? 1233 ILE A CG1  1 
ATOM   850  C CG2  . ILE A 1 92  ? 13.368 -22.448 36.483  1.00 45.40  ? 1233 ILE A CG2  1 
ATOM   851  C CD1  . ILE A 1 92  ? 11.594 -24.652 37.278  1.00 53.06  ? 1233 ILE A CD1  1 
ATOM   852  H H    . ILE A 1 92  ? 12.134 -21.105 40.180  1.00 0.00   ? 1233 ILE A H    1 
ATOM   853  N N    . PRO A 1 93  ? 15.314 -20.030 38.449  1.00 34.30  ? 1234 PRO A N    1 
ATOM   854  C CA   . PRO A 1 93  ? 15.704 -18.702 37.976  1.00 40.29  ? 1234 PRO A CA   1 
ATOM   855  C C    . PRO A 1 93  ? 15.330 -18.519 36.501  1.00 48.70  ? 1234 PRO A C    1 
ATOM   856  O O    . PRO A 1 93  ? 15.346 -19.479 35.717  1.00 49.72  ? 1234 PRO A O    1 
ATOM   857  C CB   . PRO A 1 93  ? 17.217 -18.710 38.179  1.00 43.12  ? 1234 PRO A CB   1 
ATOM   858  C CG   . PRO A 1 93  ? 17.404 -19.627 39.355  1.00 29.98  ? 1234 PRO A CG   1 
ATOM   859  C CD   . PRO A 1 93  ? 16.470 -20.748 39.012  1.00 34.89  ? 1234 PRO A CD   1 
ATOM   860  N N    . ALA A 1 94  ? 14.986 -17.290 36.128  1.00 52.72  ? 1235 ALA A N    1 
ATOM   861  C CA   . ALA A 1 94  ? 14.601 -16.993 34.753  1.00 47.55  ? 1235 ALA A CA   1 
ATOM   862  C C    . ALA A 1 94  ? 15.763 -17.131 33.772  1.00 44.63  ? 1235 ALA A C    1 
ATOM   863  O O    . ALA A 1 94  ? 16.936 -17.014 34.147  1.00 39.58  ? 1235 ALA A O    1 
ATOM   864  C CB   . ALA A 1 94  ? 13.996 -15.596 34.663  1.00 45.40  ? 1235 ALA A CB   1 
ATOM   865  H H    . ALA A 1 94  ? 15.034 -16.565 36.782  1.00 0.00   ? 1235 ALA A H    1 
ATOM   866  N N    . VAL A 1 95  ? 15.426 -17.450 32.525  1.00 42.82  ? 1236 VAL A N    1 
ATOM   867  C CA   . VAL A 1 95  ? 16.418 -17.585 31.469  1.00 33.50  ? 1236 VAL A CA   1 
ATOM   868  C C    . VAL A 1 95  ? 16.872 -16.183 31.098  1.00 26.83  ? 1236 VAL A C    1 
ATOM   869  O O    . VAL A 1 95  ? 16.060 -15.259 30.995  1.00 23.39  ? 1236 VAL A O    1 
ATOM   870  C CB   . VAL A 1 95  ? 15.829 -18.307 30.238  1.00 39.72  ? 1236 VAL A CB   1 
ATOM   871  C CG1  . VAL A 1 95  ? 16.826 -18.328 29.080  1.00 42.48  ? 1236 VAL A CG1  1 
ATOM   872  C CG2  . VAL A 1 95  ? 15.485 -19.719 30.614  1.00 44.23  ? 1236 VAL A CG2  1 
ATOM   873  H H    . VAL A 1 95  ? 14.488 -17.613 32.331  1.00 0.00   ? 1236 VAL A H    1 
ATOM   874  N N    . PRO A 1 96  ? 18.186 -15.990 30.952  1.00 24.51  ? 1237 PRO A N    1 
ATOM   875  C CA   . PRO A 1 96  ? 18.737 -14.681 30.596  1.00 32.17  ? 1237 PRO A CA   1 
ATOM   876  C C    . PRO A 1 96  ? 18.386 -14.357 29.152  1.00 37.73  ? 1237 PRO A C    1 
ATOM   877  O O    . PRO A 1 96  ? 18.523 -15.201 28.264  1.00 42.03  ? 1237 PRO A O    1 
ATOM   878  C CB   . PRO A 1 96  ? 20.244 -14.897 30.721  1.00 32.84  ? 1237 PRO A CB   1 
ATOM   879  C CG   . PRO A 1 96  ? 20.381 -16.156 31.531  1.00 33.30  ? 1237 PRO A CG   1 
ATOM   880  C CD   . PRO A 1 96  ? 19.254 -16.990 31.065  1.00 26.40  ? 1237 PRO A CD   1 
ATOM   881  N N    . PRO A 1 97  ? 17.855 -13.161 28.903  1.00 40.34  ? 1238 PRO A N    1 
ATOM   882  C CA   . PRO A 1 97  ? 17.524 -12.839 27.517  1.00 36.87  ? 1238 PRO A CA   1 
ATOM   883  C C    . PRO A 1 97  ? 18.789 -12.300 26.846  1.00 35.05  ? 1238 PRO A C    1 
ATOM   884  O O    . PRO A 1 97  ? 19.793 -12.029 27.517  1.00 35.53  ? 1238 PRO A O    1 
ATOM   885  C CB   . PRO A 1 97  ? 16.494 -11.731 27.684  1.00 40.48  ? 1238 PRO A CB   1 
ATOM   886  C CG   . PRO A 1 97  ? 17.060 -10.965 28.864  1.00 42.42  ? 1238 PRO A CG   1 
ATOM   887  C CD   . PRO A 1 97  ? 17.450 -12.080 29.820  1.00 40.97  ? 1238 PRO A CD   1 
ATOM   888  N N    . PRO A 1 98  ? 18.803 -12.246 25.510  1.00 30.64  ? 1239 PRO A N    1 
ATOM   889  C CA   . PRO A 1 98  ? 20.007 -11.713 24.869  1.00 24.14  ? 1239 PRO A CA   1 
ATOM   890  C C    . PRO A 1 98  ? 19.873 -10.196 24.935  1.00 20.71  ? 1239 PRO A C    1 
ATOM   891  O O    . PRO A 1 98  ? 18.827 -9.685  25.352  1.00 30.07  ? 1239 PRO A O    1 
ATOM   892  C CB   . PRO A 1 98  ? 19.878 -12.236 23.443  1.00 31.34  ? 1239 PRO A CB   1 
ATOM   893  C CG   . PRO A 1 98  ? 18.382 -12.253 23.231  1.00 31.57  ? 1239 PRO A CG   1 
ATOM   894  C CD   . PRO A 1 98  ? 17.872 -12.820 24.519  1.00 24.65  ? 1239 PRO A CD   1 
ATOM   895  N N    . THR A 1 99  ? 20.906 -9.462  24.556  1.00 17.94  ? 1240 THR A N    1 
ATOM   896  C CA   . THR A 1 99  ? 20.818 -8.006  24.581  1.00 22.72  ? 1240 THR A CA   1 
ATOM   897  C C    . THR A 1 99  ? 21.475 -7.459  23.334  1.00 23.54  ? 1240 THR A C    1 
ATOM   898  O O    . THR A 1 99  ? 21.736 -8.207  22.405  1.00 27.93  ? 1240 THR A O    1 
ATOM   899  C CB   . THR A 1 99  ? 21.529 -7.414  25.820  1.00 28.16  ? 1240 THR A CB   1 
ATOM   900  O OG1  . THR A 1 99  ? 22.843 -7.969  25.938  1.00 32.89  ? 1240 THR A OG1  1 
ATOM   901  C CG2  . THR A 1 99  ? 20.746 -7.713  27.093  1.00 35.94  ? 1240 THR A CG2  1 
ATOM   902  H H    . THR A 1 99  ? 21.743 -9.861  24.257  1.00 0.00   ? 1240 THR A H    1 
ATOM   903  H HG1  . THR A 1 99  ? 22.808 -8.922  26.124  1.00 0.00   ? 1240 THR A HG1  1 
ATOM   904  N N    . ASP A 1 100 ? 21.660 -6.147  23.280  1.00 31.99  ? 1241 ASP A N    1 
ATOM   905  C CA   . ASP A 1 100 ? 22.340 -5.499  22.158  1.00 40.86  ? 1241 ASP A CA   1 
ATOM   906  C C    . ASP A 1 100 ? 21.749 -5.754  20.752  1.00 36.89  ? 1241 ASP A C    1 
ATOM   907  O O    . ASP A 1 100 ? 22.441 -6.244  19.855  1.00 30.98  ? 1241 ASP A O    1 
ATOM   908  C CB   . ASP A 1 100 ? 23.820 -5.904  22.201  1.00 50.55  ? 1241 ASP A CB   1 
ATOM   909  C CG   . ASP A 1 100 ? 24.702 -4.997  21.387  1.00 61.49  ? 1241 ASP A CG   1 
ATOM   910  O OD1  . ASP A 1 100 ? 24.337 -3.825  21.185  1.00 69.75  ? 1241 ASP A OD1  1 
ATOM   911  O OD2  . ASP A 1 100 ? 25.779 -5.451  20.959  1.00 70.47  ? 1241 ASP A OD2  1 
ATOM   912  H H    . ASP A 1 100 ? 21.347 -5.582  24.019  1.00 0.00   ? 1241 ASP A H    1 
ATOM   913  N N    . LEU A 1 101 ? 20.483 -5.383  20.558  1.00 32.75  ? 1242 LEU A N    1 
ATOM   914  C CA   . LEU A 1 101 ? 19.800 -5.575  19.277  1.00 25.43  ? 1242 LEU A CA   1 
ATOM   915  C C    . LEU A 1 101 ? 20.184 -4.505  18.250  1.00 30.13  ? 1242 LEU A C    1 
ATOM   916  O O    . LEU A 1 101 ? 19.769 -3.341  18.359  1.00 29.76  ? 1242 LEU A O    1 
ATOM   917  C CB   . LEU A 1 101 ? 18.293 -5.558  19.484  1.00 19.90  ? 1242 LEU A CB   1 
ATOM   918  C CG   . LEU A 1 101 ? 17.423 -6.192  18.398  1.00 18.96  ? 1242 LEU A CG   1 
ATOM   919  C CD1  . LEU A 1 101 ? 17.691 -7.690  18.325  1.00 15.48  ? 1242 LEU A CD1  1 
ATOM   920  C CD2  . LEU A 1 101 ? 15.963 -5.937  18.718  1.00 16.42  ? 1242 LEU A CD2  1 
ATOM   921  H H    . LEU A 1 101 ? 20.011 -4.954  21.298  1.00 0.00   ? 1242 LEU A H    1 
ATOM   922  N N    . ARG A 1 102 ? 20.963 -4.906  17.248  1.00 30.42  ? 1243 ARG A N    1 
ATOM   923  C CA   . ARG A 1 102 ? 21.410 -3.993  16.197  1.00 30.82  ? 1243 ARG A CA   1 
ATOM   924  C C    . ARG A 1 102 ? 20.769 -4.360  14.850  1.00 27.05  ? 1243 ARG A C    1 
ATOM   925  O O    . ARG A 1 102 ? 20.671 -5.538  14.499  1.00 26.95  ? 1243 ARG A O    1 
ATOM   926  C CB   . ARG A 1 102 ? 22.936 -4.042  16.031  1.00 30.15  ? 1243 ARG A CB   1 
ATOM   927  C CG   . ARG A 1 102 ? 23.745 -4.587  17.202  1.00 42.16  ? 1243 ARG A CG   1 
ATOM   928  C CD   . ARG A 1 102 ? 25.066 -5.158  16.662  1.00 51.40  ? 1243 ARG A CD   1 
ATOM   929  N NE   . ARG A 1 102 ? 25.921 -5.849  17.636  1.00 54.79  ? 1243 ARG A NE   1 
ATOM   930  C CZ   . ARG A 1 102 ? 25.533 -6.823  18.462  1.00 49.42  ? 1243 ARG A CZ   1 
ATOM   931  N NH1  . ARG A 1 102 ? 24.276 -7.243  18.482  1.00 47.58  ? 1243 ARG A NH1  1 
ATOM   932  N NH2  . ARG A 1 102 ? 26.430 -7.423  19.236  1.00 44.01  ? 1243 ARG A NH2  1 
ATOM   933  H H    . ARG A 1 102 ? 21.209 -5.845  17.211  1.00 0.00   ? 1243 ARG A H    1 
ATOM   934  H HE   . ARG A 1 102 ? 26.842 -5.505  17.701  1.00 0.00   ? 1243 ARG A HE   1 
ATOM   935  H HH11 . ARG A 1 102 ? 23.551 -6.800  17.958  1.00 0.00   ? 1243 ARG A HH11 1 
ATOM   936  H HH12 . ARG A 1 102 ? 23.974 -7.908  19.154  1.00 0.00   ? 1243 ARG A HH12 1 
ATOM   937  H HH21 . ARG A 1 102 ? 27.380 -7.117  19.236  1.00 0.00   ? 1243 ARG A HH21 1 
ATOM   938  H HH22 . ARG A 1 102 ? 26.164 -8.120  19.898  1.00 0.00   ? 1243 ARG A HH22 1 
ATOM   939  N N    . PHE A 1 103 ? 20.318 -3.356  14.108  1.00 23.78  ? 1244 PHE A N    1 
ATOM   940  C CA   . PHE A 1 103 ? 19.722 -3.589  12.802  1.00 24.69  ? 1244 PHE A CA   1 
ATOM   941  C C    . PHE A 1 103 ? 20.686 -3.036  11.758  1.00 27.95  ? 1244 PHE A C    1 
ATOM   942  O O    . PHE A 1 103 ? 21.118 -1.884  11.857  1.00 29.32  ? 1244 PHE A O    1 
ATOM   943  C CB   . PHE A 1 103 ? 18.372 -2.893  12.675  1.00 17.42  ? 1244 PHE A CB   1 
ATOM   944  C CG   . PHE A 1 103 ? 17.270 -3.506  13.508  1.00 29.77  ? 1244 PHE A CG   1 
ATOM   945  C CD1  . PHE A 1 103 ? 16.500 -4.549  13.012  1.00 26.81  ? 1244 PHE A CD1  1 
ATOM   946  C CD2  . PHE A 1 103 ? 16.944 -2.980  14.759  1.00 32.41  ? 1244 PHE A CD2  1 
ATOM   947  C CE1  . PHE A 1 103 ? 15.413 -5.056  13.745  1.00 26.09  ? 1244 PHE A CE1  1 
ATOM   948  C CE2  . PHE A 1 103 ? 15.857 -3.483  15.500  1.00 27.51  ? 1244 PHE A CE2  1 
ATOM   949  C CZ   . PHE A 1 103 ? 15.094 -4.519  14.990  1.00 19.80  ? 1244 PHE A CZ   1 
ATOM   950  H H    . PHE A 1 103 ? 20.392 -2.431  14.435  1.00 0.00   ? 1244 PHE A H    1 
ATOM   951  N N    . THR A 1 104 ? 21.065 -3.873  10.793  1.00 28.48  ? 1245 THR A N    1 
ATOM   952  C CA   . THR A 1 104 ? 21.985 -3.472  9.733   1.00 26.24  ? 1245 THR A CA   1 
ATOM   953  C C    . THR A 1 104 ? 21.495 -4.019  8.401   1.00 21.78  ? 1245 THR A C    1 
ATOM   954  O O    . THR A 1 104 ? 20.526 -4.764  8.370   1.00 20.68  ? 1245 THR A O    1 
ATOM   955  C CB   . THR A 1 104 ? 23.404 -4.016  9.984   1.00 22.20  ? 1245 THR A CB   1 
ATOM   956  O OG1  . THR A 1 104 ? 23.380 -5.444  9.954   1.00 27.93  ? 1245 THR A OG1  1 
ATOM   957  C CG2  . THR A 1 104 ? 23.935 -3.555  11.326  1.00 21.25  ? 1245 THR A CG2  1 
ATOM   958  H H    . THR A 1 104 ? 20.715 -4.789  10.754  1.00 0.00   ? 1245 THR A H    1 
ATOM   959  H HG1  . THR A 1 104 ? 22.899 -5.739  10.746  1.00 0.00   ? 1245 THR A HG1  1 
ATOM   960  N N    . ASN A 1 105 ? 22.146 -3.626  7.305   1.00 24.79  ? 1246 ASN A N    1 
ATOM   961  C CA   . ASN A 1 105 ? 21.786 -4.107  5.964   1.00 22.17  ? 1246 ASN A CA   1 
ATOM   962  C C    . ASN A 1 105 ? 20.298 -3.897  5.640   1.00 22.99  ? 1246 ASN A C    1 
ATOM   963  O O    . ASN A 1 105 ? 19.628 -4.813  5.135   1.00 20.88  ? 1246 ASN A O    1 
ATOM   964  C CB   . ASN A 1 105 ? 22.113 -5.611  5.836   1.00 30.37  ? 1246 ASN A CB   1 
ATOM   965  C CG   . ASN A 1 105 ? 23.617 -5.905  5.705   1.00 36.58  ? 1246 ASN A CG   1 
ATOM   966  O OD1  . ASN A 1 105 ? 24.458 -5.002  5.696   1.00 38.67  ? 1246 ASN A OD1  1 
ATOM   967  N ND2  . ASN A 1 105 ? 23.951 -7.183  5.592   1.00 41.10  ? 1246 ASN A ND2  1 
ATOM   968  H H    . ASN A 1 105 ? 22.894 -3.003  7.407   1.00 0.00   ? 1246 ASN A H    1 
ATOM   969  H HD21 . ASN A 1 105 ? 24.886 -7.432  5.481   1.00 0.00   ? 1246 ASN A HD21 1 
ATOM   970  H HD22 . ASN A 1 105 ? 23.215 -7.836  5.603   1.00 0.00   ? 1246 ASN A HD22 1 
ATOM   971  N N    . ILE A 1 106 ? 19.779 -2.700  5.905   1.00 21.58  ? 1247 ILE A N    1 
ATOM   972  C CA   . ILE A 1 106 ? 18.361 -2.441  5.663   1.00 24.69  ? 1247 ILE A CA   1 
ATOM   973  C C    . ILE A 1 106 ? 18.037 -2.171  4.203   1.00 29.10  ? 1247 ILE A C    1 
ATOM   974  O O    . ILE A 1 106 ? 18.475 -1.173  3.625   1.00 32.30  ? 1247 ILE A O    1 
ATOM   975  C CB   . ILE A 1 106 ? 17.799 -1.285  6.531   1.00 23.95  ? 1247 ILE A CB   1 
ATOM   976  C CG1  . ILE A 1 106 ? 18.212 -1.459  7.998   1.00 22.82  ? 1247 ILE A CG1  1 
ATOM   977  C CG2  . ILE A 1 106 ? 16.277 -1.223  6.413   1.00 21.28  ? 1247 ILE A CG2  1 
ATOM   978  C CD1  . ILE A 1 106 ? 18.098 -2.864  8.530   1.00 27.58  ? 1247 ILE A CD1  1 
ATOM   979  H H    . ILE A 1 106 ? 20.360 -1.989  6.234   1.00 0.00   ? 1247 ILE A H    1 
ATOM   980  N N    . GLY A 1 107 ? 17.261 -3.079  3.620   1.00 29.58  ? 1248 GLY A N    1 
ATOM   981  C CA   . GLY A 1 107 ? 16.855 -2.962  2.235   1.00 22.51  ? 1248 GLY A CA   1 
ATOM   982  C C    . GLY A 1 107 ? 15.362 -2.747  2.158   1.00 25.12  ? 1248 GLY A C    1 
ATOM   983  O O    . GLY A 1 107 ? 14.692 -2.675  3.195   1.00 22.84  ? 1248 GLY A O    1 
ATOM   984  H H    . GLY A 1 107 ? 16.971 -3.836  4.156   1.00 0.00   ? 1248 GLY A H    1 
ATOM   985  N N    . PRO A 1 108 ? 14.803 -2.598  0.951   1.00 23.98  ? 1249 PRO A N    1 
ATOM   986  C CA   . PRO A 1 108 ? 13.357 -2.389  0.859   1.00 16.32  ? 1249 PRO A CA   1 
ATOM   987  C C    . PRO A 1 108 ? 12.544 -3.585  1.322   1.00 14.94  ? 1249 PRO A C    1 
ATOM   988  O O    . PRO A 1 108 ? 11.440 -3.420  1.821   1.00 17.29  ? 1249 PRO A O    1 
ATOM   989  C CB   . PRO A 1 108 ? 13.142 -2.087  -0.624  1.00 19.98  ? 1249 PRO A CB   1 
ATOM   990  C CG   . PRO A 1 108 ? 14.278 -2.783  -1.298  1.00 21.79  ? 1249 PRO A CG   1 
ATOM   991  C CD   . PRO A 1 108 ? 15.439 -2.494  -0.375  1.00 24.08  ? 1249 PRO A CD   1 
ATOM   992  N N    . ASP A 1 109 ? 13.130 -4.774  1.239   1.00 16.39  ? 1250 ASP A N    1 
ATOM   993  C CA   . ASP A 1 109 ? 12.437 -6.000  1.611   1.00 20.58  ? 1250 ASP A CA   1 
ATOM   994  C C    . ASP A 1 109 ? 13.254 -6.919  2.515   1.00 28.04  ? 1250 ASP A C    1 
ATOM   995  O O    . ASP A 1 109 ? 12.935 -8.113  2.647   1.00 25.36  ? 1250 ASP A O    1 
ATOM   996  C CB   . ASP A 1 109 ? 12.113 -6.771  0.339   1.00 21.30  ? 1250 ASP A CB   1 
ATOM   997  C CG   . ASP A 1 109 ? 13.355 -7.328  -0.332  1.00 25.40  ? 1250 ASP A CG   1 
ATOM   998  O OD1  . ASP A 1 109 ? 14.478 -6.835  -0.081  1.00 29.57  ? 1250 ASP A OD1  1 
ATOM   999  O OD2  . ASP A 1 109 ? 13.213 -8.292  -1.100  1.00 40.38  ? 1250 ASP A OD2  1 
ATOM   1000 H H    . ASP A 1 109 ? 14.040 -4.869  0.891   1.00 0.00   ? 1250 ASP A H    1 
ATOM   1001 N N    . THR A 1 110 ? 14.297 -6.378  3.136   1.00 30.19  ? 1251 THR A N    1 
ATOM   1002 C CA   . THR A 1 110 ? 15.159 -7.183  3.981   1.00 28.03  ? 1251 THR A CA   1 
ATOM   1003 C C    . THR A 1 110 ? 15.889 -6.361  5.049   1.00 30.09  ? 1251 THR A C    1 
ATOM   1004 O O    . THR A 1 110 ? 15.956 -5.129  4.968   1.00 28.77  ? 1251 THR A O    1 
ATOM   1005 C CB   . THR A 1 110 ? 16.180 -7.922  3.101   1.00 26.45  ? 1251 THR A CB   1 
ATOM   1006 O OG1  . THR A 1 110 ? 17.023 -8.757  3.906   1.00 33.47  ? 1251 THR A OG1  1 
ATOM   1007 C CG2  . THR A 1 110 ? 17.033 -6.922  2.338   1.00 29.78  ? 1251 THR A CG2  1 
ATOM   1008 H H    . THR A 1 110 ? 14.497 -5.424  3.050   1.00 0.00   ? 1251 THR A H    1 
ATOM   1009 H HG1  . THR A 1 110 ? 16.557 -9.581  4.087   1.00 0.00   ? 1251 THR A HG1  1 
ATOM   1010 N N    . MET A 1 111 ? 16.361 -7.051  6.086   1.00 29.07  ? 1252 MET A N    1 
ATOM   1011 C CA   . MET A 1 111 ? 17.117 -6.438  7.175   1.00 25.79  ? 1252 MET A CA   1 
ATOM   1012 C C    . MET A 1 111 ? 17.807 -7.529  7.992   1.00 23.78  ? 1252 MET A C    1 
ATOM   1013 O O    . MET A 1 111 ? 17.272 -8.628  8.159   1.00 25.09  ? 1252 MET A O    1 
ATOM   1014 C CB   . MET A 1 111 ? 16.227 -5.569  8.081   1.00 25.12  ? 1252 MET A CB   1 
ATOM   1015 C CG   . MET A 1 111 ? 15.227 -6.322  8.948   1.00 29.19  ? 1252 MET A CG   1 
ATOM   1016 S SD   . MET A 1 111 ? 14.432 -5.258  10.190  1.00 26.87  ? 1252 MET A SD   1 
ATOM   1017 C CE   . MET A 1 111 ? 12.994 -4.594  9.294   1.00 27.30  ? 1252 MET A CE   1 
ATOM   1018 H H    . MET A 1 111 ? 16.237 -8.025  6.125   1.00 0.00   ? 1252 MET A H    1 
ATOM   1019 N N    . ARG A 1 112 ? 19.025 -7.235  8.436   1.00 25.09  ? 1253 ARG A N    1 
ATOM   1020 C CA   . ARG A 1 112 ? 19.821 -8.151  9.246   1.00 21.39  ? 1253 ARG A CA   1 
ATOM   1021 C C    . ARG A 1 112 ? 19.693 -7.697  10.694  1.00 20.53  ? 1253 ARG A C    1 
ATOM   1022 O O    . ARG A 1 112 ? 19.909 -6.525  11.017  1.00 20.63  ? 1253 ARG A O    1 
ATOM   1023 C CB   . ARG A 1 112 ? 21.277 -8.101  8.800   1.00 21.20  ? 1253 ARG A CB   1 
ATOM   1024 C CG   . ARG A 1 112 ? 22.200 -9.095  9.480   1.00 25.45  ? 1253 ARG A CG   1 
ATOM   1025 C CD   . ARG A 1 112 ? 23.468 -9.253  8.649   1.00 30.84  ? 1253 ARG A CD   1 
ATOM   1026 N NE   . ARG A 1 112 ? 24.293 -10.375 9.097   1.00 35.75  ? 1253 ARG A NE   1 
ATOM   1027 C CZ   . ARG A 1 112 ? 24.626 -11.424 8.350   1.00 28.91  ? 1253 ARG A CZ   1 
ATOM   1028 N NH1  . ARG A 1 112 ? 24.204 -11.520 7.099   1.00 28.96  ? 1253 ARG A NH1  1 
ATOM   1029 N NH2  . ARG A 1 112 ? 25.407 -12.369 8.858   1.00 30.50  ? 1253 ARG A NH2  1 
ATOM   1030 H H    . ARG A 1 112 ? 19.405 -6.359  8.214   1.00 0.00   ? 1253 ARG A H    1 
ATOM   1031 H HE   . ARG A 1 112 ? 24.581 -10.336 10.043  1.00 0.00   ? 1253 ARG A HE   1 
ATOM   1032 H HH11 . ARG A 1 112 ? 23.618 -10.833 6.641   1.00 0.00   ? 1253 ARG A HH11 1 
ATOM   1033 H HH12 . ARG A 1 112 ? 24.418 -12.307 6.507   1.00 0.00   ? 1253 ARG A HH12 1 
ATOM   1034 H HH21 . ARG A 1 112 ? 25.765 -12.341 9.798   1.00 0.00   ? 1253 ARG A HH21 1 
ATOM   1035 H HH22 . ARG A 1 112 ? 25.686 -13.187 8.342   1.00 0.00   ? 1253 ARG A HH22 1 
ATOM   1036 N N    . VAL A 1 113 ? 19.293 -8.617  11.555  1.00 22.72  ? 1254 VAL A N    1 
ATOM   1037 C CA   . VAL A 1 113 ? 19.114 -8.325  12.972  1.00 23.47  ? 1254 VAL A CA   1 
ATOM   1038 C C    . VAL A 1 113 ? 20.185 -9.078  13.755  1.00 20.89  ? 1254 VAL A C    1 
ATOM   1039 O O    . VAL A 1 113 ? 20.327 -10.298 13.596  1.00 23.93  ? 1254 VAL A O    1 
ATOM   1040 C CB   . VAL A 1 113 ? 17.711 -8.775  13.450  1.00 19.97  ? 1254 VAL A CB   1 
ATOM   1041 C CG1  . VAL A 1 113 ? 17.439 -8.254  14.850  1.00 22.77  ? 1254 VAL A CG1  1 
ATOM   1042 C CG2  . VAL A 1 113 ? 16.643 -8.285  12.486  1.00 26.06  ? 1254 VAL A CG2  1 
ATOM   1043 H H    . VAL A 1 113 ? 19.127 -9.521  11.241  1.00 0.00   ? 1254 VAL A H    1 
ATOM   1044 N N    . THR A 1 114 ? 20.946 -8.360  14.580  1.00 16.03  ? 1255 THR A N    1 
ATOM   1045 C CA   . THR A 1 114 ? 22.011 -8.984  15.373  1.00 17.72  ? 1255 THR A CA   1 
ATOM   1046 C C    . THR A 1 114 ? 21.789 -8.745  16.859  1.00 21.55  ? 1255 THR A C    1 
ATOM   1047 O O    . THR A 1 114 ? 21.269 -7.694  17.253  1.00 20.59  ? 1255 THR A O    1 
ATOM   1048 C CB   . THR A 1 114 ? 23.395 -8.413  15.017  1.00 13.74  ? 1255 THR A CB   1 
ATOM   1049 O OG1  . THR A 1 114 ? 23.537 -8.342  13.594  1.00 28.93  ? 1255 THR A OG1  1 
ATOM   1050 C CG2  . THR A 1 114 ? 24.498 -9.295  15.565  1.00 16.67  ? 1255 THR A CG2  1 
ATOM   1051 H H    . THR A 1 114 ? 20.769 -7.407  14.693  1.00 0.00   ? 1255 THR A H    1 
ATOM   1052 H HG1  . THR A 1 114 ? 23.112 -9.135  13.228  1.00 0.00   ? 1255 THR A HG1  1 
ATOM   1053 N N    . TRP A 1 115 ? 22.208 -9.708  17.677  1.00 28.01  ? 1256 TRP A N    1 
ATOM   1054 C CA   . TRP A 1 115 ? 22.079 -9.611  19.131  1.00 27.08  ? 1256 TRP A CA   1 
ATOM   1055 C C    . TRP A 1 115 ? 23.290 -10.197 19.838  1.00 26.69  ? 1256 TRP A C    1 
ATOM   1056 O O    . TRP A 1 115 ? 24.142 -10.837 19.219  1.00 27.23  ? 1256 TRP A O    1 
ATOM   1057 C CB   . TRP A 1 115 ? 20.799 -10.301 19.633  1.00 13.00  ? 1256 TRP A CB   1 
ATOM   1058 C CG   . TRP A 1 115 ? 20.683 -11.742 19.249  1.00 20.96  ? 1256 TRP A CG   1 
ATOM   1059 C CD1  . TRP A 1 115 ? 21.178 -12.820 19.930  1.00 16.16  ? 1256 TRP A CD1  1 
ATOM   1060 C CD2  . TRP A 1 115 ? 20.036 -12.265 18.077  1.00 27.63  ? 1256 TRP A CD2  1 
ATOM   1061 N NE1  . TRP A 1 115 ? 20.884 -13.981 19.252  1.00 20.42  ? 1256 TRP A NE1  1 
ATOM   1062 C CE2  . TRP A 1 115 ? 20.182 -13.673 18.113  1.00 25.44  ? 1256 TRP A CE2  1 
ATOM   1063 C CE3  . TRP A 1 115 ? 19.344 -11.682 17.001  1.00 25.22  ? 1256 TRP A CE3  1 
ATOM   1064 C CZ2  . TRP A 1 115 ? 19.658 -14.511 17.112  1.00 15.38  ? 1256 TRP A CZ2  1 
ATOM   1065 C CZ3  . TRP A 1 115 ? 18.823 -12.510 16.011  1.00 17.91  ? 1256 TRP A CZ3  1 
ATOM   1066 C CH2  . TRP A 1 115 ? 18.987 -13.913 16.078  1.00 15.36  ? 1256 TRP A CH2  1 
ATOM   1067 H H    . TRP A 1 115 ? 22.628 -10.523 17.319  1.00 0.00   ? 1256 TRP A H    1 
ATOM   1068 H HE1  . TRP A 1 115 ? 21.150 -14.890 19.518  1.00 0.00   ? 1256 TRP A HE1  1 
ATOM   1069 N N    . ALA A 1 116 ? 23.396 -9.878  21.121  1.00 30.39  ? 1257 ALA A N    1 
ATOM   1070 C CA   . ALA A 1 116 ? 24.457 -10.367 21.993  1.00 29.20  ? 1257 ALA A CA   1 
ATOM   1071 C C    . ALA A 1 116 ? 23.783 -11.448 22.826  1.00 24.62  ? 1257 ALA A C    1 
ATOM   1072 O O    . ALA A 1 116 ? 22.845 -11.171 23.578  1.00 29.14  ? 1257 ALA A O    1 
ATOM   1073 C CB   . ALA A 1 116 ? 24.958 -9.245  22.897  1.00 29.11  ? 1257 ALA A CB   1 
ATOM   1074 H H    . ALA A 1 116 ? 22.712 -9.316  21.498  1.00 0.00   ? 1257 ALA A H    1 
ATOM   1075 N N    . PRO A 1 117 ? 24.190 -12.707 22.644  1.00 22.59  ? 1258 PRO A N    1 
ATOM   1076 C CA   . PRO A 1 117 ? 23.567 -13.777 23.423  1.00 28.63  ? 1258 PRO A CA   1 
ATOM   1077 C C    . PRO A 1 117 ? 23.971 -13.695 24.904  1.00 37.01  ? 1258 PRO A C    1 
ATOM   1078 O O    . PRO A 1 117 ? 24.960 -13.031 25.259  1.00 38.67  ? 1258 PRO A O    1 
ATOM   1079 C CB   . PRO A 1 117 ? 24.129 -15.035 22.760  1.00 22.42  ? 1258 PRO A CB   1 
ATOM   1080 C CG   . PRO A 1 117 ? 25.496 -14.613 22.389  1.00 20.05  ? 1258 PRO A CG   1 
ATOM   1081 C CD   . PRO A 1 117 ? 25.285 -13.229 21.811  1.00 20.53  ? 1258 PRO A CD   1 
ATOM   1082 N N    . PRO A 1 118 ? 23.180 -14.324 25.792  1.00 33.01  ? 1259 PRO A N    1 
ATOM   1083 C CA   . PRO A 1 118 ? 23.461 -14.333 27.226  1.00 38.53  ? 1259 PRO A CA   1 
ATOM   1084 C C    . PRO A 1 118 ? 24.839 -14.972 27.437  1.00 46.61  ? 1259 PRO A C    1 
ATOM   1085 O O    . PRO A 1 118 ? 25.186 -15.957 26.775  1.00 49.44  ? 1259 PRO A O    1 
ATOM   1086 C CB   . PRO A 1 118 ? 22.372 -15.252 27.771  1.00 36.28  ? 1259 PRO A CB   1 
ATOM   1087 C CG   . PRO A 1 118 ? 21.272 -15.065 26.832  1.00 38.63  ? 1259 PRO A CG   1 
ATOM   1088 C CD   . PRO A 1 118 ? 21.946 -15.067 25.503  1.00 30.58  ? 1259 PRO A CD   1 
ATOM   1089 N N    . PRO A 1 119 ? 25.656 -14.412 28.339  1.00 50.45  ? 1260 PRO A N    1 
ATOM   1090 C CA   . PRO A 1 119 ? 26.972 -15.020 28.549  1.00 48.11  ? 1260 PRO A CA   1 
ATOM   1091 C C    . PRO A 1 119 ? 26.886 -16.343 29.303  1.00 45.53  ? 1260 PRO A C    1 
ATOM   1092 O O    . PRO A 1 119 ? 25.846 -16.688 29.872  1.00 39.60  ? 1260 PRO A O    1 
ATOM   1093 C CB   . PRO A 1 119 ? 27.701 -13.963 29.372  1.00 50.14  ? 1260 PRO A CB   1 
ATOM   1094 C CG   . PRO A 1 119 ? 26.591 -13.366 30.193  1.00 55.38  ? 1260 PRO A CG   1 
ATOM   1095 C CD   . PRO A 1 119 ? 25.491 -13.200 29.162  1.00 52.30  ? 1260 PRO A CD   1 
ATOM   1096 N N    . SER A 1 120 ? 27.975 -17.097 29.246  1.00 47.74  ? 1261 SER A N    1 
ATOM   1097 C CA   . SER A 1 120 ? 28.109 -18.377 29.933  1.00 56.56  ? 1261 SER A CA   1 
ATOM   1098 C C    . SER A 1 120 ? 26.880 -19.296 30.030  1.00 55.26  ? 1261 SER A C    1 
ATOM   1099 O O    . SER A 1 120 ? 26.639 -19.877 31.089  1.00 60.88  ? 1261 SER A O    1 
ATOM   1100 C CB   . SER A 1 120 ? 28.682 -18.143 31.345  1.00 61.03  ? 1261 SER A CB   1 
ATOM   1101 O OG   . SER A 1 120 ? 29.898 -17.406 31.313  1.00 63.95  ? 1261 SER A OG   1 
ATOM   1102 H H    . SER A 1 120 ? 28.749 -16.783 28.742  1.00 0.00   ? 1261 SER A H    1 
ATOM   1103 H HG   . SER A 1 120 ? 30.259 -17.382 32.205  1.00 0.00   ? 1261 SER A HG   1 
ATOM   1104 N N    . ILE A 1 121 ? 26.103 -19.430 28.958  1.00 50.56  ? 1262 ILE A N    1 
ATOM   1105 C CA   . ILE A 1 121 ? 24.943 -20.323 28.993  1.00 43.21  ? 1262 ILE A CA   1 
ATOM   1106 C C    . ILE A 1 121 ? 24.726 -21.029 27.657  1.00 42.32  ? 1262 ILE A C    1 
ATOM   1107 O O    . ILE A 1 121 ? 24.785 -20.411 26.593  1.00 40.55  ? 1262 ILE A O    1 
ATOM   1108 C CB   . ILE A 1 121 ? 23.640 -19.619 29.459  1.00 40.55  ? 1262 ILE A CB   1 
ATOM   1109 C CG1  . ILE A 1 121 ? 22.506 -20.645 29.562  1.00 39.48  ? 1262 ILE A CG1  1 
ATOM   1110 C CG2  . ILE A 1 121 ? 23.260 -18.487 28.518  1.00 47.08  ? 1262 ILE A CG2  1 
ATOM   1111 C CD1  . ILE A 1 121 ? 21.160 -20.058 29.919  1.00 47.09  ? 1262 ILE A CD1  1 
ATOM   1112 H H    . ILE A 1 121 ? 26.279 -18.948 28.124  1.00 0.00   ? 1262 ILE A H    1 
ATOM   1113 N N    . ASP A 1 122 ? 24.513 -22.339 27.735  1.00 42.15  ? 1263 ASP A N    1 
ATOM   1114 C CA   . ASP A 1 122 ? 24.302 -23.175 26.564  1.00 40.63  ? 1263 ASP A CA   1 
ATOM   1115 C C    . ASP A 1 122 ? 22.820 -23.268 26.251  1.00 37.99  ? 1263 ASP A C    1 
ATOM   1116 O O    . ASP A 1 122 ? 22.147 -24.216 26.673  1.00 34.48  ? 1263 ASP A O    1 
ATOM   1117 C CB   . ASP A 1 122 ? 24.870 -24.578 26.807  1.00 44.18  ? 1263 ASP A CB   1 
ATOM   1118 C CG   . ASP A 1 122 ? 26.359 -24.566 27.107  1.00 50.85  ? 1263 ASP A CG   1 
ATOM   1119 O OD1  . ASP A 1 122 ? 26.731 -24.261 28.259  1.00 64.01  ? 1263 ASP A OD1  1 
ATOM   1120 O OD2  . ASP A 1 122 ? 27.160 -24.861 26.196  1.00 57.07  ? 1263 ASP A OD2  1 
ATOM   1121 H H    . ASP A 1 122 ? 24.542 -22.788 28.603  1.00 0.00   ? 1263 ASP A H    1 
ATOM   1122 N N    . LEU A 1 123 ? 22.315 -22.265 25.533  1.00 34.30  ? 1264 LEU A N    1 
ATOM   1123 C CA   . LEU A 1 123 ? 20.908 -22.207 25.147  1.00 27.20  ? 1264 LEU A CA   1 
ATOM   1124 C C    . LEU A 1 123 ? 20.557 -23.347 24.221  1.00 29.08  ? 1264 LEU A C    1 
ATOM   1125 O O    . LEU A 1 123 ? 21.427 -23.979 23.619  1.00 28.78  ? 1264 LEU A O    1 
ATOM   1126 C CB   . LEU A 1 123 ? 20.575 -20.909 24.399  1.00 29.10  ? 1264 LEU A CB   1 
ATOM   1127 C CG   . LEU A 1 123 ? 20.476 -19.519 25.034  1.00 32.83  ? 1264 LEU A CG   1 
ATOM   1128 C CD1  . LEU A 1 123 ? 20.058 -19.642 26.490  1.00 33.50  ? 1264 LEU A CD1  1 
ATOM   1129 C CD2  . LEU A 1 123 ? 21.795 -18.774 24.903  1.00 43.65  ? 1264 LEU A CD2  1 
ATOM   1130 H H    . LEU A 1 123 ? 22.934 -21.563 25.249  1.00 0.00   ? 1264 LEU A H    1 
ATOM   1131 N N    . THR A 1 124 ? 19.266 -23.592 24.099  1.00 31.06  ? 1265 THR A N    1 
ATOM   1132 C CA   . THR A 1 124 ? 18.764 -24.619 23.208  1.00 37.77  ? 1265 THR A CA   1 
ATOM   1133 C C    . THR A 1 124 ? 18.685 -24.005 21.790  1.00 41.25  ? 1265 THR A C    1 
ATOM   1134 O O    . THR A 1 124 ? 18.963 -24.673 20.790  1.00 47.04  ? 1265 THR A O    1 
ATOM   1135 C CB   . THR A 1 124 ? 17.370 -25.094 23.691  1.00 38.02  ? 1265 THR A CB   1 
ATOM   1136 O OG1  . THR A 1 124 ? 17.471 -25.543 25.054  1.00 37.10  ? 1265 THR A OG1  1 
ATOM   1137 C CG2  . THR A 1 124 ? 16.842 -26.229 22.822  1.00 33.29  ? 1265 THR A CG2  1 
ATOM   1138 H H    . THR A 1 124 ? 18.633 -23.091 24.636  1.00 0.00   ? 1265 THR A H    1 
ATOM   1139 H HG1  . THR A 1 124 ? 18.246 -26.123 25.073  1.00 0.00   ? 1265 THR A HG1  1 
ATOM   1140 N N    . ASN A 1 125 ? 18.394 -22.707 21.731  1.00 36.22  ? 1266 ASN A N    1 
ATOM   1141 C CA   . ASN A 1 125 ? 18.265 -21.978 20.473  1.00 34.30  ? 1266 ASN A CA   1 
ATOM   1142 C C    . ASN A 1 125 ? 17.744 -20.580 20.807  1.00 34.16  ? 1266 ASN A C    1 
ATOM   1143 O O    . ASN A 1 125 ? 17.656 -20.210 21.981  1.00 29.33  ? 1266 ASN A O    1 
ATOM   1144 C CB   . ASN A 1 125 ? 17.251 -22.686 19.553  1.00 33.03  ? 1266 ASN A CB   1 
ATOM   1145 C CG   . ASN A 1 125 ? 15.859 -22.799 20.184  1.00 42.34  ? 1266 ASN A CG   1 
ATOM   1146 O OD1  . ASN A 1 125 ? 15.692 -23.370 21.272  1.00 42.46  ? 1266 ASN A OD1  1 
ATOM   1147 N ND2  . ASN A 1 125 ? 14.857 -22.260 19.503  1.00 25.67  ? 1266 ASN A ND2  1 
ATOM   1148 H H    . ASN A 1 125 ? 18.240 -22.195 22.553  1.00 0.00   ? 1266 ASN A H    1 
ATOM   1149 H HD21 . ASN A 1 125 ? 13.965 -22.316 19.894  1.00 0.00   ? 1266 ASN A HD21 1 
ATOM   1150 H HD22 . ASN A 1 125 ? 15.046 -21.837 18.637  1.00 0.00   ? 1266 ASN A HD22 1 
ATOM   1151 N N    . PHE A 1 126 ? 17.481 -19.779 19.776  1.00 30.41  ? 1267 PHE A N    1 
ATOM   1152 C CA   . PHE A 1 126 ? 16.911 -18.449 19.964  1.00 21.14  ? 1267 PHE A CA   1 
ATOM   1153 C C    . PHE A 1 126 ? 15.593 -18.527 19.258  1.00 21.15  ? 1267 PHE A C    1 
ATOM   1154 O O    . PHE A 1 126 ? 15.386 -19.414 18.434  1.00 25.33  ? 1267 PHE A O    1 
ATOM   1155 C CB   . PHE A 1 126 ? 17.768 -17.346 19.357  1.00 16.91  ? 1267 PHE A CB   1 
ATOM   1156 C CG   . PHE A 1 126 ? 19.000 -17.042 20.153  1.00 14.71  ? 1267 PHE A CG   1 
ATOM   1157 C CD1  . PHE A 1 126 ? 18.939 -16.198 21.253  1.00 22.70  ? 1267 PHE A CD1  1 
ATOM   1158 C CD2  . PHE A 1 126 ? 20.215 -17.595 19.807  1.00 14.21  ? 1267 PHE A CD2  1 
ATOM   1159 C CE1  . PHE A 1 126 ? 20.076 -15.911 21.993  1.00 21.55  ? 1267 PHE A CE1  1 
ATOM   1160 C CE2  . PHE A 1 126 ? 21.345 -17.317 20.531  1.00 10.51  ? 1267 PHE A CE2  1 
ATOM   1161 C CZ   . PHE A 1 126 ? 21.276 -16.469 21.631  1.00 21.56  ? 1267 PHE A CZ   1 
ATOM   1162 H H    . PHE A 1 126 ? 17.644 -20.093 18.863  1.00 0.00   ? 1267 PHE A H    1 
ATOM   1163 N N    . LEU A 1 127 ? 14.700 -17.607 19.576  1.00 25.48  ? 1268 LEU A N    1 
ATOM   1164 C CA   . LEU A 1 127 ? 13.377 -17.597 18.976  1.00 29.84  ? 1268 LEU A CA   1 
ATOM   1165 C C    . LEU A 1 127 ? 13.083 -16.182 18.479  1.00 33.37  ? 1268 LEU A C    1 
ATOM   1166 O O    . LEU A 1 127 ? 12.885 -15.257 19.279  1.00 37.86  ? 1268 LEU A O    1 
ATOM   1167 C CB   . LEU A 1 127 ? 12.353 -18.038 20.028  1.00 26.83  ? 1268 LEU A CB   1 
ATOM   1168 C CG   . LEU A 1 127 ? 11.191 -18.920 19.595  1.00 24.29  ? 1268 LEU A CG   1 
ATOM   1169 C CD1  . LEU A 1 127 ? 10.120 -18.055 18.998  1.00 32.71  ? 1268 LEU A CD1  1 
ATOM   1170 C CD2  . LEU A 1 127 ? 11.664 -19.984 18.610  1.00 33.44  ? 1268 LEU A CD2  1 
ATOM   1171 H H    . LEU A 1 127 ? 14.932 -16.910 20.219  1.00 0.00   ? 1268 LEU A H    1 
ATOM   1172 N N    . VAL A 1 128 ? 13.138 -15.996 17.162  1.00 27.11  ? 1269 VAL A N    1 
ATOM   1173 C CA   . VAL A 1 128 ? 12.874 -14.689 16.580  1.00 21.81  ? 1269 VAL A CA   1 
ATOM   1174 C C    . VAL A 1 128 ? 11.431 -14.557 16.110  1.00 21.18  ? 1269 VAL A C    1 
ATOM   1175 O O    . VAL A 1 128 ? 10.913 -15.420 15.400  1.00 20.25  ? 1269 VAL A O    1 
ATOM   1176 C CB   . VAL A 1 128 ? 13.846 -14.385 15.421  1.00 21.83  ? 1269 VAL A CB   1 
ATOM   1177 C CG1  . VAL A 1 128 ? 13.488 -13.057 14.740  1.00 17.20  ? 1269 VAL A CG1  1 
ATOM   1178 C CG2  . VAL A 1 128 ? 15.262 -14.339 15.952  1.00 16.02  ? 1269 VAL A CG2  1 
ATOM   1179 H H    . VAL A 1 128 ? 13.353 -16.739 16.578  1.00 0.00   ? 1269 VAL A H    1 
ATOM   1180 N N    . ARG A 1 129 ? 10.774 -13.504 16.580  1.00 14.51  ? 1270 ARG A N    1 
ATOM   1181 C CA   . ARG A 1 129 ? 9.409  -13.200 16.213  1.00 16.06  ? 1270 ARG A CA   1 
ATOM   1182 C C    . ARG A 1 129 ? 9.449  -11.800 15.639  1.00 13.44  ? 1270 ARG A C    1 
ATOM   1183 O O    . ARG A 1 129 ? 10.193 -10.944 16.114  1.00 22.61  ? 1270 ARG A O    1 
ATOM   1184 C CB   . ARG A 1 129 ? 8.482  -13.245 17.431  1.00 17.11  ? 1270 ARG A CB   1 
ATOM   1185 C CG   . ARG A 1 129 ? 8.082  -14.654 17.807  1.00 24.53  ? 1270 ARG A CG   1 
ATOM   1186 C CD   . ARG A 1 129 ? 7.475  -14.741 19.188  1.00 32.37  ? 1270 ARG A CD   1 
ATOM   1187 N NE   . ARG A 1 129 ? 7.484  -16.119 19.682  1.00 39.83  ? 1270 ARG A NE   1 
ATOM   1188 C CZ   . ARG A 1 129 ? 7.916  -16.483 20.887  1.00 36.75  ? 1270 ARG A CZ   1 
ATOM   1189 N NH1  . ARG A 1 129 ? 8.370  -15.572 21.729  1.00 37.22  ? 1270 ARG A NH1  1 
ATOM   1190 N NH2  . ARG A 1 129 ? 7.962  -17.766 21.218  1.00 39.88  ? 1270 ARG A NH2  1 
ATOM   1191 H H    . ARG A 1 129 ? 11.222 -12.882 17.190  1.00 0.00   ? 1270 ARG A H    1 
ATOM   1192 H HE   . ARG A 1 129 ? 7.165  -16.814 19.046  1.00 0.00   ? 1270 ARG A HE   1 
ATOM   1193 H HH11 . ARG A 1 129 ? 8.469  -14.609 21.471  1.00 0.00   ? 1270 ARG A HH11 1 
ATOM   1194 H HH12 . ARG A 1 129 ? 8.727  -15.833 22.631  1.00 0.00   ? 1270 ARG A HH12 1 
ATOM   1195 H HH21 . ARG A 1 129 ? 7.697  -18.481 20.561  1.00 0.00   ? 1270 ARG A HH21 1 
ATOM   1196 H HH22 . ARG A 1 129 ? 8.320  -18.067 22.123  1.00 0.00   ? 1270 ARG A HH22 1 
ATOM   1197 N N    . TYR A 1 130 ? 8.679  -11.576 14.585  1.00 20.24  ? 1271 TYR A N    1 
ATOM   1198 C CA   . TYR A 1 130 ? 8.637  -10.267 13.954  1.00 22.82  ? 1271 TYR A CA   1 
ATOM   1199 C C    . TYR A 1 130 ? 7.317  -10.095 13.218  1.00 21.45  ? 1271 TYR A C    1 
ATOM   1200 O O    . TYR A 1 130 ? 6.659  -11.085 12.862  1.00 20.61  ? 1271 TYR A O    1 
ATOM   1201 C CB   . TYR A 1 130 ? 9.844  -10.081 13.014  1.00 23.76  ? 1271 TYR A CB   1 
ATOM   1202 C CG   . TYR A 1 130 ? 9.867  -10.998 11.804  1.00 26.37  ? 1271 TYR A CG   1 
ATOM   1203 C CD1  . TYR A 1 130 ? 9.236  -10.624 10.616  1.00 22.85  ? 1271 TYR A CD1  1 
ATOM   1204 C CD2  . TYR A 1 130 ? 10.510 -12.237 11.848  1.00 20.23  ? 1271 TYR A CD2  1 
ATOM   1205 C CE1  . TYR A 1 130 ? 9.243  -11.457 9.506   1.00 28.58  ? 1271 TYR A CE1  1 
ATOM   1206 C CE2  . TYR A 1 130 ? 10.517 -13.084 10.739  1.00 21.77  ? 1271 TYR A CE2  1 
ATOM   1207 C CZ   . TYR A 1 130 ? 9.882  -12.685 9.573   1.00 27.63  ? 1271 TYR A CZ   1 
ATOM   1208 O OH   . TYR A 1 130 ? 9.884  -13.502 8.463   1.00 25.88  ? 1271 TYR A OH   1 
ATOM   1209 H H    . TYR A 1 130 ? 8.132  -12.300 14.210  1.00 0.00   ? 1271 TYR A H    1 
ATOM   1210 H HH   . TYR A 1 130 ? 9.387  -13.065 7.739   1.00 0.00   ? 1271 TYR A HH   1 
ATOM   1211 N N    . SER A 1 131 ? 6.897  -8.844  13.067  1.00 18.98  ? 1272 SER A N    1 
ATOM   1212 C CA   . SER A 1 131 ? 5.656  -8.531  12.375  1.00 24.53  ? 1272 SER A CA   1 
ATOM   1213 C C    . SER A 1 131 ? 5.600  -7.044  12.074  1.00 25.38  ? 1272 SER A C    1 
ATOM   1214 O O    . SER A 1 131 ? 6.390  -6.259  12.621  1.00 23.13  ? 1272 SER A O    1 
ATOM   1215 C CB   . SER A 1 131 ? 4.447  -8.908  13.237  1.00 29.66  ? 1272 SER A CB   1 
ATOM   1216 O OG   . SER A 1 131 ? 4.363  -8.092  14.392  1.00 32.92  ? 1272 SER A OG   1 
ATOM   1217 H H    . SER A 1 131 ? 7.415  -8.093  13.436  1.00 0.00   ? 1272 SER A H    1 
ATOM   1218 H HG   . SER A 1 131 ? 3.522  -8.284  14.822  1.00 0.00   ? 1272 SER A HG   1 
ATOM   1219 N N    . PRO A 1 132 ? 4.715  -6.640  11.146  1.00 29.82  ? 1273 PRO A N    1 
ATOM   1220 C CA   . PRO A 1 132 ? 4.612  -5.213  10.826  1.00 28.19  ? 1273 PRO A CA   1 
ATOM   1221 C C    . PRO A 1 132 ? 3.971  -4.514  12.025  1.00 30.17  ? 1273 PRO A C    1 
ATOM   1222 O O    . PRO A 1 132 ? 3.028  -5.037  12.622  1.00 27.03  ? 1273 PRO A O    1 
ATOM   1223 C CB   . PRO A 1 132 ? 3.674  -5.200  9.615   1.00 25.23  ? 1273 PRO A CB   1 
ATOM   1224 C CG   . PRO A 1 132 ? 3.854  -6.566  9.003   1.00 20.27  ? 1273 PRO A CG   1 
ATOM   1225 C CD   . PRO A 1 132 ? 3.883  -7.442  10.231  1.00 18.93  ? 1273 PRO A CD   1 
ATOM   1226 N N    . VAL A 1 133 ? 4.495  -3.351  12.384  1.00 32.76  ? 1274 VAL A N    1 
ATOM   1227 C CA   . VAL A 1 133 ? 3.972  -2.590  13.510  1.00 39.51  ? 1274 VAL A CA   1 
ATOM   1228 C C    . VAL A 1 133 ? 2.447  -2.404  13.419  1.00 42.92  ? 1274 VAL A C    1 
ATOM   1229 O O    . VAL A 1 133 ? 1.727  -2.562  14.418  1.00 33.92  ? 1274 VAL A O    1 
ATOM   1230 C CB   . VAL A 1 133 ? 4.678  -1.212  13.616  1.00 38.45  ? 1274 VAL A CB   1 
ATOM   1231 C CG1  . VAL A 1 133 ? 3.953  -0.310  14.618  1.00 41.71  ? 1274 VAL A CG1  1 
ATOM   1232 C CG2  . VAL A 1 133 ? 6.118  -1.403  14.053  1.00 29.76  ? 1274 VAL A CG2  1 
ATOM   1233 H H    . VAL A 1 133 ? 5.252  -3.009  11.888  1.00 0.00   ? 1274 VAL A H    1 
ATOM   1234 N N    . LYS A 1 134 ? 1.966  -2.112  12.211  1.00 42.06  ? 1275 LYS A N    1 
ATOM   1235 C CA   . LYS A 1 134 ? 0.543  -1.894  11.966  1.00 46.39  ? 1275 LYS A CA   1 
ATOM   1236 C C    . LYS A 1 134 ? -0.206 -3.164  11.567  1.00 46.23  ? 1275 LYS A C    1 
ATOM   1237 O O    . LYS A 1 134 ? -1.374 -3.102  11.180  1.00 46.16  ? 1275 LYS A O    1 
ATOM   1238 C CB   . LYS A 1 134 ? 0.359  -0.835  10.874  1.00 53.69  ? 1275 LYS A CB   1 
ATOM   1239 C CG   . LYS A 1 134 ? 0.851  0.560   11.239  1.00 65.82  ? 1275 LYS A CG   1 
ATOM   1240 C CD   . LYS A 1 134 ? 0.609  1.554   10.096  1.00 73.30  ? 1275 LYS A CD   1 
ATOM   1241 C CE   . LYS A 1 134 ? -0.859 1.592   9.651   1.00 82.91  ? 1275 LYS A CE   1 
ATOM   1242 N NZ   . LYS A 1 134 ? -1.862 1.838   10.739  1.00 78.19  ? 1275 LYS A NZ   1 
ATOM   1243 H H    . LYS A 1 134 ? 2.583  -2.049  11.446  1.00 0.00   ? 1275 LYS A H    1 
ATOM   1244 H HZ1  . LYS A 1 134 ? -1.647 2.726   11.227  1.00 0.00   ? 1275 LYS A HZ1  1 
ATOM   1245 H HZ2  . LYS A 1 134 ? -2.778 1.879   10.247  1.00 0.00   ? 1275 LYS A HZ2  1 
ATOM   1246 H HZ3  . LYS A 1 134 ? -1.811 1.022   11.372  1.00 0.00   ? 1275 LYS A HZ3  1 
ATOM   1247 N N    . ASN A 1 135 ? 0.458  -4.309  11.690  1.00 49.20  ? 1276 ASN A N    1 
ATOM   1248 C CA   . ASN A 1 135 ? -0.129 -5.596  11.319  1.00 52.80  ? 1276 ASN A CA   1 
ATOM   1249 C C    . ASN A 1 135 ? 0.400  -6.638  12.313  1.00 49.37  ? 1276 ASN A C    1 
ATOM   1250 O O    . ASN A 1 135 ? 1.023  -7.633  11.943  1.00 43.87  ? 1276 ASN A O    1 
ATOM   1251 C CB   . ASN A 1 135 ? 0.287  -5.938  9.879   1.00 55.76  ? 1276 ASN A CB   1 
ATOM   1252 C CG   . ASN A 1 135 ? -0.667 -6.898  9.191   1.00 57.83  ? 1276 ASN A CG   1 
ATOM   1253 O OD1  . ASN A 1 135 ? -1.812 -7.077  9.605   1.00 59.14  ? 1276 ASN A OD1  1 
ATOM   1254 N ND2  . ASN A 1 135 ? -0.200 -7.501  8.105   1.00 56.12  ? 1276 ASN A ND2  1 
ATOM   1255 H H    . ASN A 1 135 ? 1.347  -4.318  12.085  1.00 0.00   ? 1276 ASN A H    1 
ATOM   1256 H HD21 . ASN A 1 135 ? -0.783 -8.164  7.678   1.00 0.00   ? 1276 ASN A HD21 1 
ATOM   1257 H HD22 . ASN A 1 135 ? 0.700  -7.289  7.809   1.00 0.00   ? 1276 ASN A HD22 1 
ATOM   1258 N N    . GLU A 1 136 ? 0.142  -6.365  13.587  1.00 49.44  ? 1277 GLU A N    1 
ATOM   1259 C CA   . GLU A 1 136 ? 0.573  -7.187  14.711  1.00 51.15  ? 1277 GLU A CA   1 
ATOM   1260 C C    . GLU A 1 136 ? 0.299  -8.681  14.596  1.00 48.76  ? 1277 GLU A C    1 
ATOM   1261 O O    . GLU A 1 136 ? 1.178  -9.505  14.876  1.00 48.18  ? 1277 GLU A O    1 
ATOM   1262 C CB   . GLU A 1 136 ? -0.032 -6.638  16.014  1.00 60.68  ? 1277 GLU A CB   1 
ATOM   1263 C CG   . GLU A 1 136 ? -1.550 -6.363  15.945  1.00 73.94  ? 1277 GLU A CG   1 
ATOM   1264 C CD   . GLU A 1 136 ? -2.141 -5.953  17.291  1.00 83.01  ? 1277 GLU A CD   1 
ATOM   1265 O OE1  . GLU A 1 136 ? -1.885 -6.654  18.298  1.00 86.66  ? 1277 GLU A OE1  1 
ATOM   1266 O OE2  . GLU A 1 136 ? -2.866 -4.935  17.345  1.00 85.63  ? 1277 GLU A OE2  1 
ATOM   1267 H H    . GLU A 1 136 ? -0.396 -5.577  13.788  1.00 0.00   ? 1277 GLU A H    1 
ATOM   1268 N N    . GLU A 1 137 ? -0.925 -9.025  14.211  1.00 42.60  ? 1278 GLU A N    1 
ATOM   1269 C CA   . GLU A 1 137 ? -1.344 -10.419 14.068  1.00 38.50  ? 1278 GLU A CA   1 
ATOM   1270 C C    . GLU A 1 137 ? -0.682 -11.157 12.914  1.00 32.70  ? 1278 GLU A C    1 
ATOM   1271 O O    . GLU A 1 137 ? -0.827 -12.375 12.783  1.00 32.28  ? 1278 GLU A O    1 
ATOM   1272 C CB   . GLU A 1 137 ? -2.858 -10.510 13.922  1.00 45.30  ? 1278 GLU A CB   1 
ATOM   1273 C CG   . GLU A 1 137 ? -3.407 -9.721  12.742  1.00 59.06  ? 1278 GLU A CG   1 
ATOM   1274 C CD   . GLU A 1 137 ? -3.340 -8.226  12.963  1.00 64.00  ? 1278 GLU A CD   1 
ATOM   1275 O OE1  . GLU A 1 137 ? -4.009 -7.731  13.894  1.00 72.45  ? 1278 GLU A OE1  1 
ATOM   1276 O OE2  . GLU A 1 137 ? -2.587 -7.554  12.235  1.00 59.82  ? 1278 GLU A OE2  1 
ATOM   1277 H H    . GLU A 1 137 ? -1.536 -8.274  14.063  1.00 0.00   ? 1278 GLU A H    1 
ATOM   1278 N N    . ASP A 1 138 ? 0.009  -10.418 12.057  1.00 33.77  ? 1279 ASP A N    1 
ATOM   1279 C CA   . ASP A 1 138 ? 0.714  -11.004 10.921  1.00 32.25  ? 1279 ASP A CA   1 
ATOM   1280 C C    . ASP A 1 138 ? 2.154  -11.262 11.366  1.00 32.02  ? 1279 ASP A C    1 
ATOM   1281 O O    . ASP A 1 138 ? 3.097  -10.651 10.856  1.00 31.76  ? 1279 ASP A O    1 
ATOM   1282 C CB   . ASP A 1 138 ? 0.699  -10.022 9.754   1.00 36.88  ? 1279 ASP A CB   1 
ATOM   1283 C CG   . ASP A 1 138 ? 1.130  -10.651 8.452   1.00 44.03  ? 1279 ASP A CG   1 
ATOM   1284 O OD1  . ASP A 1 138 ? 1.927  -11.615 8.453   1.00 45.10  ? 1279 ASP A OD1  1 
ATOM   1285 O OD2  . ASP A 1 138 ? 0.663  -10.162 7.405   1.00 56.53  ? 1279 ASP A OD2  1 
ATOM   1286 H H    . ASP A 1 138 ? 0.035  -9.441  12.177  1.00 0.00   ? 1279 ASP A H    1 
ATOM   1287 N N    . VAL A 1 139 ? 2.321  -12.151 12.337  1.00 27.83  ? 1280 VAL A N    1 
ATOM   1288 C CA   . VAL A 1 139 ? 3.643  -12.441 12.856  1.00 25.00  ? 1280 VAL A CA   1 
ATOM   1289 C C    . VAL A 1 139 ? 4.226  -13.729 12.317  1.00 29.70  ? 1280 VAL A C    1 
ATOM   1290 O O    . VAL A 1 139 ? 3.496  -14.660 11.974  1.00 32.00  ? 1280 VAL A O    1 
ATOM   1291 C CB   . VAL A 1 139 ? 3.642  -12.449 14.401  1.00 24.34  ? 1280 VAL A CB   1 
ATOM   1292 C CG1  . VAL A 1 139 ? 2.681  -13.467 14.925  1.00 23.65  ? 1280 VAL A CG1  1 
ATOM   1293 C CG2  . VAL A 1 139 ? 5.040  -12.704 14.936  1.00 27.50  ? 1280 VAL A CG2  1 
ATOM   1294 H H    . VAL A 1 139 ? 1.540  -12.633 12.682  1.00 0.00   ? 1280 VAL A H    1 
ATOM   1295 N N    . ALA A 1 140 ? 5.551  -13.765 12.228  1.00 31.42  ? 1281 ALA A N    1 
ATOM   1296 C CA   . ALA A 1 140 ? 6.273  -14.934 11.744  1.00 26.00  ? 1281 ALA A CA   1 
ATOM   1297 C C    . ALA A 1 140 ? 7.283  -15.317 12.820  1.00 27.59  ? 1281 ALA A C    1 
ATOM   1298 O O    . ALA A 1 140 ? 7.780  -14.458 13.558  1.00 21.62  ? 1281 ALA A O    1 
ATOM   1299 C CB   . ALA A 1 140 ? 6.975  -14.610 10.433  1.00 16.20  ? 1281 ALA A CB   1 
ATOM   1300 H H    . ALA A 1 140 ? 6.080  -12.983 12.503  1.00 0.00   ? 1281 ALA A H    1 
ATOM   1301 N N    . GLU A 1 141 ? 7.571  -16.606 12.922  1.00 31.15  ? 1282 GLU A N    1 
ATOM   1302 C CA   . GLU A 1 141 ? 8.498  -17.096 13.934  1.00 39.65  ? 1282 GLU A CA   1 
ATOM   1303 C C    . GLU A 1 141 ? 9.651  -17.884 13.313  1.00 39.75  ? 1282 GLU A C    1 
ATOM   1304 O O    . GLU A 1 141 ? 9.477  -18.567 12.289  1.00 37.12  ? 1282 GLU A O    1 
ATOM   1305 C CB   . GLU A 1 141 ? 7.733  -17.964 14.942  1.00 46.38  ? 1282 GLU A CB   1 
ATOM   1306 C CG   . GLU A 1 141 ? 8.514  -18.357 16.178  1.00 54.30  ? 1282 GLU A CG   1 
ATOM   1307 C CD   . GLU A 1 141 ? 7.679  -19.149 17.170  1.00 64.07  ? 1282 GLU A CD   1 
ATOM   1308 O OE1  . GLU A 1 141 ? 6.987  -18.533 18.012  1.00 68.89  ? 1282 GLU A OE1  1 
ATOM   1309 O OE2  . GLU A 1 141 ? 7.728  -20.394 17.126  1.00 68.13  ? 1282 GLU A OE2  1 
ATOM   1310 H H    . GLU A 1 141 ? 7.171  -17.265 12.313  1.00 0.00   ? 1282 GLU A H    1 
ATOM   1311 N N    . LEU A 1 142 ? 10.823 -17.783 13.939  1.00 33.23  ? 1283 LEU A N    1 
ATOM   1312 C CA   . LEU A 1 142 ? 12.024 -18.466 13.474  1.00 28.75  ? 1283 LEU A CA   1 
ATOM   1313 C C    . LEU A 1 142 ? 12.856 -18.974 14.643  1.00 25.16  ? 1283 LEU A C    1 
ATOM   1314 O O    . LEU A 1 142 ? 13.123 -18.235 15.592  1.00 22.10  ? 1283 LEU A O    1 
ATOM   1315 C CB   . LEU A 1 142 ? 12.893 -17.506 12.653  1.00 21.97  ? 1283 LEU A CB   1 
ATOM   1316 C CG   . LEU A 1 142 ? 12.316 -16.866 11.391  1.00 25.97  ? 1283 LEU A CG   1 
ATOM   1317 C CD1  . LEU A 1 142 ? 13.288 -15.830 10.862  1.00 19.53  ? 1283 LEU A CD1  1 
ATOM   1318 C CD2  . LEU A 1 142 ? 12.052 -17.941 10.354  1.00 24.36  ? 1283 LEU A CD2  1 
ATOM   1319 H H    . LEU A 1 142 ? 10.871 -17.240 14.755  1.00 0.00   ? 1283 LEU A H    1 
ATOM   1320 N N    . SER A 1 143 ? 13.279 -20.231 14.569  1.00 25.13  ? 1284 SER A N    1 
ATOM   1321 C CA   . SER A 1 143 ? 14.125 -20.803 15.608  1.00 22.18  ? 1284 SER A CA   1 
ATOM   1322 C C    . SER A 1 143 ? 15.545 -20.756 15.067  1.00 18.22  ? 1284 SER A C    1 
ATOM   1323 O O    . SER A 1 143 ? 15.830 -21.329 14.017  1.00 24.47  ? 1284 SER A O    1 
ATOM   1324 C CB   . SER A 1 143 ? 13.725 -22.241 15.919  1.00 18.34  ? 1284 SER A CB   1 
ATOM   1325 O OG   . SER A 1 143 ? 14.691 -22.849 16.764  1.00 30.00  ? 1284 SER A OG   1 
ATOM   1326 H H    . SER A 1 143 ? 13.046 -20.792 13.794  1.00 0.00   ? 1284 SER A H    1 
ATOM   1327 H HG   . SER A 1 143 ? 15.423 -23.160 16.218  1.00 0.00   ? 1284 SER A HG   1 
ATOM   1328 N N    . ILE A 1 144 ? 16.430 -20.099 15.808  1.00 21.92  ? 1285 ILE A N    1 
ATOM   1329 C CA   . ILE A 1 144 ? 17.821 -19.911 15.408  1.00 22.77  ? 1285 ILE A CA   1 
ATOM   1330 C C    . ILE A 1 144 ? 18.816 -20.756 16.207  1.00 28.51  ? 1285 ILE A C    1 
ATOM   1331 O O    . ILE A 1 144 ? 18.676 -20.920 17.417  1.00 17.49  ? 1285 ILE A O    1 
ATOM   1332 C CB   . ILE A 1 144 ? 18.229 -18.422 15.577  1.00 18.37  ? 1285 ILE A CB   1 
ATOM   1333 C CG1  . ILE A 1 144 ? 17.118 -17.496 15.061  1.00 15.52  ? 1285 ILE A CG1  1 
ATOM   1334 C CG2  . ILE A 1 144 ? 19.568 -18.152 14.903  1.00 21.36  ? 1285 ILE A CG2  1 
ATOM   1335 C CD1  . ILE A 1 144 ? 16.772 -17.671 13.584  1.00 12.97  ? 1285 ILE A CD1  1 
ATOM   1336 H H    . ILE A 1 144 ? 16.133 -19.746 16.674  1.00 0.00   ? 1285 ILE A H    1 
ATOM   1337 N N    . SER A 1 145 ? 19.848 -21.238 15.529  1.00 28.45  ? 1286 SER A N    1 
ATOM   1338 C CA   . SER A 1 145 ? 20.880 -22.041 16.164  1.00 31.93  ? 1286 SER A CA   1 
ATOM   1339 C C    . SER A 1 145 ? 21.436 -21.237 17.329  1.00 29.04  ? 1286 SER A C    1 
ATOM   1340 O O    . SER A 1 145 ? 21.628 -20.025 17.220  1.00 26.42  ? 1286 SER A O    1 
ATOM   1341 C CB   . SER A 1 145 ? 21.996 -22.350 15.163  1.00 29.53  ? 1286 SER A CB   1 
ATOM   1342 O OG   . SER A 1 145 ? 23.001 -23.159 15.751  1.00 39.41  ? 1286 SER A OG   1 
ATOM   1343 H H    . SER A 1 145 ? 19.925 -21.039 14.577  1.00 0.00   ? 1286 SER A H    1 
ATOM   1344 H HG   . SER A 1 145 ? 23.797 -22.918 15.232  1.00 0.00   ? 1286 SER A HG   1 
ATOM   1345 N N    . PRO A 1 146 ? 21.693 -21.895 18.468  1.00 30.84  ? 1287 PRO A N    1 
ATOM   1346 C CA   . PRO A 1 146 ? 22.225 -21.161 19.616  1.00 26.67  ? 1287 PRO A CA   1 
ATOM   1347 C C    . PRO A 1 146 ? 23.632 -20.639 19.358  1.00 31.12  ? 1287 PRO A C    1 
ATOM   1348 O O    . PRO A 1 146 ? 24.155 -19.838 20.139  1.00 32.85  ? 1287 PRO A O    1 
ATOM   1349 C CB   . PRO A 1 146 ? 22.172 -22.198 20.735  1.00 26.65  ? 1287 PRO A CB   1 
ATOM   1350 C CG   . PRO A 1 146 ? 22.352 -23.484 20.020  1.00 29.40  ? 1287 PRO A CG   1 
ATOM   1351 C CD   . PRO A 1 146 ? 21.476 -23.312 18.807  1.00 32.92  ? 1287 PRO A CD   1 
ATOM   1352 N N    . SER A 1 147 ? 24.238 -21.089 18.257  1.00 29.66  ? 1288 SER A N    1 
ATOM   1353 C CA   . SER A 1 147 ? 25.582 -20.655 17.875  1.00 30.74  ? 1288 SER A CA   1 
ATOM   1354 C C    . SER A 1 147 ? 25.545 -19.410 16.984  1.00 25.60  ? 1288 SER A C    1 
ATOM   1355 O O    . SER A 1 147 ? 26.593 -18.844 16.643  1.00 25.63  ? 1288 SER A O    1 
ATOM   1356 C CB   . SER A 1 147 ? 26.331 -21.785 17.161  1.00 31.99  ? 1288 SER A CB   1 
ATOM   1357 O OG   . SER A 1 147 ? 25.668 -22.181 15.969  1.00 44.67  ? 1288 SER A OG   1 
ATOM   1358 H H    . SER A 1 147 ? 23.812 -21.734 17.657  1.00 0.00   ? 1288 SER A H    1 
ATOM   1359 H HG   . SER A 1 147 ? 25.670 -21.451 15.313  1.00 0.00   ? 1288 SER A HG   1 
ATOM   1360 N N    . ASP A 1 148 ? 24.345 -18.985 16.607  1.00 22.92  ? 1289 ASP A N    1 
ATOM   1361 C CA   . ASP A 1 148 ? 24.205 -17.806 15.764  1.00 21.87  ? 1289 ASP A CA   1 
ATOM   1362 C C    . ASP A 1 148 ? 23.726 -16.593 16.561  1.00 25.88  ? 1289 ASP A C    1 
ATOM   1363 O O    . ASP A 1 148 ? 23.088 -16.735 17.606  1.00 24.98  ? 1289 ASP A O    1 
ATOM   1364 C CB   . ASP A 1 148 ? 23.267 -18.094 14.595  1.00 18.36  ? 1289 ASP A CB   1 
ATOM   1365 C CG   . ASP A 1 148 ? 23.896 -19.002 13.557  1.00 12.31  ? 1289 ASP A CG   1 
ATOM   1366 O OD1  . ASP A 1 148 ? 24.964 -19.590 13.819  1.00 19.45  ? 1289 ASP A OD1  1 
ATOM   1367 O OD2  . ASP A 1 148 ? 23.328 -19.134 12.465  1.00 19.85  ? 1289 ASP A OD2  1 
ATOM   1368 H H    . ASP A 1 148 ? 23.524 -19.411 16.923  1.00 0.00   ? 1289 ASP A H    1 
ATOM   1369 N N    . ASN A 1 149 ? 24.034 -15.399 16.058  1.00 19.85  ? 1290 ASN A N    1 
ATOM   1370 C CA   . ASN A 1 149 ? 23.648 -14.161 16.734  1.00 22.81  ? 1290 ASN A CA   1 
ATOM   1371 C C    . ASN A 1 149 ? 22.948 -13.208 15.779  1.00 22.03  ? 1290 ASN A C    1 
ATOM   1372 O O    . ASN A 1 149 ? 22.815 -12.012 16.054  1.00 19.98  ? 1290 ASN A O    1 
ATOM   1373 C CB   . ASN A 1 149 ? 24.889 -13.467 17.303  1.00 28.18  ? 1290 ASN A CB   1 
ATOM   1374 C CG   . ASN A 1 149 ? 25.794 -12.890 16.218  1.00 31.74  ? 1290 ASN A CG   1 
ATOM   1375 O OD1  . ASN A 1 149 ? 26.348 -11.807 16.378  1.00 35.55  ? 1290 ASN A OD1  1 
ATOM   1376 N ND2  . ASN A 1 149 ? 25.961 -13.617 15.122  1.00 24.51  ? 1290 ASN A ND2  1 
ATOM   1377 H H    . ASN A 1 149 ? 24.463 -15.412 15.179  1.00 0.00   ? 1290 ASN A H    1 
ATOM   1378 H HD21 . ASN A 1 149 ? 26.496 -13.192 14.414  1.00 0.00   ? 1290 ASN A HD21 1 
ATOM   1379 H HD22 . ASN A 1 149 ? 25.572 -14.498 15.005  1.00 0.00   ? 1290 ASN A HD22 1 
ATOM   1380 N N    . ALA A 1 150 ? 22.475 -13.747 14.665  1.00 24.19  ? 1291 ALA A N    1 
ATOM   1381 C CA   . ALA A 1 150 ? 21.838 -12.922 13.666  1.00 22.16  ? 1291 ALA A CA   1 
ATOM   1382 C C    . ALA A 1 150 ? 20.826 -13.685 12.829  1.00 23.10  ? 1291 ALA A C    1 
ATOM   1383 O O    . ALA A 1 150 ? 20.797 -14.929 12.810  1.00 17.78  ? 1291 ALA A O    1 
ATOM   1384 C CB   . ALA A 1 150 ? 22.916 -12.284 12.762  1.00 15.24  ? 1291 ALA A CB   1 
ATOM   1385 H H    . ALA A 1 150 ? 22.508 -14.713 14.503  1.00 0.00   ? 1291 ALA A H    1 
ATOM   1386 N N    . VAL A 1 151 ? 19.952 -12.912 12.194  1.00 25.52  ? 1292 VAL A N    1 
ATOM   1387 C CA   . VAL A 1 151 ? 18.918 -13.427 11.313  1.00 20.50  ? 1292 VAL A CA   1 
ATOM   1388 C C    . VAL A 1 151 ? 18.729 -12.370 10.232  1.00 22.62  ? 1292 VAL A C    1 
ATOM   1389 O O    . VAL A 1 151 ? 18.733 -11.174 10.525  1.00 20.48  ? 1292 VAL A O    1 
ATOM   1390 C CB   . VAL A 1 151 ? 17.576 -13.661 12.053  1.00 12.23  ? 1292 VAL A CB   1 
ATOM   1391 C CG1  . VAL A 1 151 ? 16.967 -12.348 12.510  1.00 14.71  ? 1292 VAL A CG1  1 
ATOM   1392 C CG2  . VAL A 1 151 ? 16.615 -14.434 11.170  1.00 12.85  ? 1292 VAL A CG2  1 
ATOM   1393 H H    . VAL A 1 151 ? 19.990 -11.937 12.321  1.00 0.00   ? 1292 VAL A H    1 
ATOM   1394 N N    . VAL A 1 152 ? 18.686 -12.805 8.977   1.00 28.47  ? 1293 VAL A N    1 
ATOM   1395 C CA   . VAL A 1 152 ? 18.471 -11.892 7.861   1.00 19.00  ? 1293 VAL A CA   1 
ATOM   1396 C C    . VAL A 1 152 ? 17.027 -12.100 7.465   1.00 14.08  ? 1293 VAL A C    1 
ATOM   1397 O O    . VAL A 1 152 ? 16.668 -13.164 6.967   1.00 20.94  ? 1293 VAL A O    1 
ATOM   1398 C CB   . VAL A 1 152 ? 19.365 -12.225 6.637   1.00 27.56  ? 1293 VAL A CB   1 
ATOM   1399 C CG1  . VAL A 1 152 ? 19.170 -11.166 5.524   1.00 15.87  ? 1293 VAL A CG1  1 
ATOM   1400 C CG2  . VAL A 1 152 ? 20.826 -12.324 7.060   1.00 23.45  ? 1293 VAL A CG2  1 
ATOM   1401 H H    . VAL A 1 152 ? 18.747 -13.770 8.791   1.00 0.00   ? 1293 VAL A H    1 
ATOM   1402 N N    . LEU A 1 153 ? 16.178 -11.138 7.778   1.00 11.62  ? 1294 LEU A N    1 
ATOM   1403 C CA   . LEU A 1 153 ? 14.771 -11.255 7.405   1.00 19.17  ? 1294 LEU A CA   1 
ATOM   1404 C C    . LEU A 1 153 ? 14.679 -10.914 5.923   1.00 20.24  ? 1294 LEU A C    1 
ATOM   1405 O O    . LEU A 1 153 ? 15.450 -10.087 5.425   1.00 17.91  ? 1294 LEU A O    1 
ATOM   1406 C CB   . LEU A 1 153 ? 13.887 -10.331 8.249   1.00 18.01  ? 1294 LEU A CB   1 
ATOM   1407 C CG   . LEU A 1 153 ? 14.011 -10.578 9.761   1.00 21.40  ? 1294 LEU A CG   1 
ATOM   1408 C CD1  . LEU A 1 153 ? 13.167 -9.570  10.562  1.00 13.89  ? 1294 LEU A CD1  1 
ATOM   1409 C CD2  . LEU A 1 153 ? 13.596 -12.027 10.057  1.00 8.07   ? 1294 LEU A CD2  1 
ATOM   1410 H H    . LEU A 1 153 ? 16.507 -10.341 8.238   1.00 0.00   ? 1294 LEU A H    1 
ATOM   1411 N N    . THR A 1 154 ? 13.764 -11.580 5.225   1.00 22.65  ? 1295 THR A N    1 
ATOM   1412 C CA   . THR A 1 154 ? 13.586 -11.395 3.794   1.00 19.16  ? 1295 THR A CA   1 
ATOM   1413 C C    . THR A 1 154 ? 12.118 -11.377 3.431   1.00 22.97  ? 1295 THR A C    1 
ATOM   1414 O O    . THR A 1 154 ? 11.267 -11.719 4.252   1.00 25.23  ? 1295 THR A O    1 
ATOM   1415 C CB   . THR A 1 154 ? 14.235 -12.548 3.022   1.00 21.34  ? 1295 THR A CB   1 
ATOM   1416 O OG1  . THR A 1 154 ? 13.649 -13.782 3.459   1.00 26.12  ? 1295 THR A OG1  1 
ATOM   1417 C CG2  . THR A 1 154 ? 15.751 -12.575 3.259   1.00 11.23  ? 1295 THR A CG2  1 
ATOM   1418 H H    . THR A 1 154 ? 13.162 -12.218 5.674   1.00 0.00   ? 1295 THR A H    1 
ATOM   1419 H HG1  . THR A 1 154 ? 13.715 -13.869 4.421   1.00 0.00   ? 1295 THR A HG1  1 
ATOM   1420 N N    . ASN A 1 155 ? 11.841 -10.986 2.189   1.00 28.00  ? 1296 ASN A N    1 
ATOM   1421 C CA   . ASN A 1 155 ? 10.484 -10.907 1.644   1.00 27.15  ? 1296 ASN A CA   1 
ATOM   1422 C C    . ASN A 1 155 ? 9.623  -10.002 2.509   1.00 17.95  ? 1296 ASN A C    1 
ATOM   1423 O O    . ASN A 1 155 ? 8.475  -10.305 2.803   1.00 24.05  ? 1296 ASN A O    1 
ATOM   1424 C CB   . ASN A 1 155 ? 9.868  -12.314 1.511   1.00 29.58  ? 1296 ASN A CB   1 
ATOM   1425 C CG   . ASN A 1 155 ? 8.617  -12.355 0.612   1.00 47.45  ? 1296 ASN A CG   1 
ATOM   1426 O OD1  . ASN A 1 155 ? 8.029  -13.420 0.421   1.00 61.15  ? 1296 ASN A OD1  1 
ATOM   1427 N ND2  . ASN A 1 155 ? 8.214  -11.214 0.061   1.00 50.41  ? 1296 ASN A ND2  1 
ATOM   1428 H H    . ASN A 1 155 ? 12.590 -10.736 1.617   1.00 0.00   ? 1296 ASN A H    1 
ATOM   1429 H HD21 . ASN A 1 155 ? 7.422  -11.311 -0.502  1.00 0.00   ? 1296 ASN A HD21 1 
ATOM   1430 H HD22 . ASN A 1 155 ? 8.650  -10.351 0.191   1.00 0.00   ? 1296 ASN A HD22 1 
ATOM   1431 N N    . LEU A 1 156 ? 10.182 -8.865  2.894   1.00 18.32  ? 1297 LEU A N    1 
ATOM   1432 C CA   . LEU A 1 156 ? 9.457  -7.917  3.721   1.00 21.20  ? 1297 LEU A CA   1 
ATOM   1433 C C    . LEU A 1 156 ? 8.815  -6.876  2.805   1.00 19.51  ? 1297 LEU A C    1 
ATOM   1434 O O    . LEU A 1 156 ? 9.166  -6.774  1.628   1.00 22.49  ? 1297 LEU A O    1 
ATOM   1435 C CB   . LEU A 1 156 ? 10.420 -7.244  4.718   1.00 22.21  ? 1297 LEU A CB   1 
ATOM   1436 C CG   . LEU A 1 156 ? 11.301 -8.135  5.621   1.00 23.41  ? 1297 LEU A CG   1 
ATOM   1437 C CD1  . LEU A 1 156 ? 12.347 -7.303  6.372   1.00 21.00  ? 1297 LEU A CD1  1 
ATOM   1438 C CD2  . LEU A 1 156 ? 10.433 -8.909  6.604   1.00 13.28  ? 1297 LEU A CD2  1 
ATOM   1439 H H    . LEU A 1 156 ? 11.078 -8.636  2.575   1.00 0.00   ? 1297 LEU A H    1 
ATOM   1440 N N    . LEU A 1 157 ? 7.842  -6.146  3.340   1.00 26.87  ? 1298 LEU A N    1 
ATOM   1441 C CA   . LEU A 1 157 ? 7.144  -5.084  2.609   1.00 26.49  ? 1298 LEU A CA   1 
ATOM   1442 C C    . LEU A 1 157 ? 8.001  -3.822  2.744   1.00 26.17  ? 1298 LEU A C    1 
ATOM   1443 O O    . LEU A 1 157 ? 8.429  -3.496  3.852   1.00 25.48  ? 1298 LEU A O    1 
ATOM   1444 C CB   . LEU A 1 157 ? 5.775  -4.818  3.252   1.00 16.59  ? 1298 LEU A CB   1 
ATOM   1445 C CG   . LEU A 1 157 ? 4.772  -5.970  3.383   1.00 24.05  ? 1298 LEU A CG   1 
ATOM   1446 C CD1  . LEU A 1 157 ? 3.804  -5.695  4.518   1.00 14.85  ? 1298 LEU A CD1  1 
ATOM   1447 C CD2  . LEU A 1 157 ? 4.020  -6.149  2.079   1.00 25.59  ? 1298 LEU A CD2  1 
ATOM   1448 H H    . LEU A 1 157 ? 7.600  -6.301  4.264   1.00 0.00   ? 1298 LEU A H    1 
ATOM   1449 N N    . PRO A 1 158 ? 8.238  -3.087  1.636   1.00 27.91  ? 1299 PRO A N    1 
ATOM   1450 C CA   . PRO A 1 158 ? 9.044  -1.856  1.617   1.00 19.95  ? 1299 PRO A CA   1 
ATOM   1451 C C    . PRO A 1 158 ? 8.406  -0.709  2.393   1.00 22.35  ? 1299 PRO A C    1 
ATOM   1452 O O    . PRO A 1 158 ? 7.176  -0.607  2.473   1.00 24.61  ? 1299 PRO A O    1 
ATOM   1453 C CB   . PRO A 1 158 ? 9.115  -1.517  0.132   1.00 26.95  ? 1299 PRO A CB   1 
ATOM   1454 C CG   . PRO A 1 158 ? 8.942  -2.845  -0.547  1.00 28.87  ? 1299 PRO A CG   1 
ATOM   1455 C CD   . PRO A 1 158 ? 7.832  -3.446  0.269   1.00 26.61  ? 1299 PRO A CD   1 
ATOM   1456 N N    . GLY A 1 159 ? 9.248  0.158   2.952   1.00 20.98  ? 1300 GLY A N    1 
ATOM   1457 C CA   . GLY A 1 159 ? 8.774  1.297   3.717   1.00 25.21  ? 1300 GLY A CA   1 
ATOM   1458 C C    . GLY A 1 159 ? 7.801  0.899   4.801   1.00 26.74  ? 1300 GLY A C    1 
ATOM   1459 O O    . GLY A 1 159 ? 6.856  1.634   5.087   1.00 33.06  ? 1300 GLY A O    1 
ATOM   1460 H H    . GLY A 1 159 ? 10.204 -0.024  2.890   1.00 0.00   ? 1300 GLY A H    1 
ATOM   1461 N N    . THR A 1 160 ? 8.032  -0.257  5.411   1.00 23.61  ? 1301 THR A N    1 
ATOM   1462 C CA   . THR A 1 160 ? 7.148  -0.759  6.453   1.00 26.87  ? 1301 THR A CA   1 
ATOM   1463 C C    . THR A 1 160 ? 7.920  -0.945  7.751   1.00 25.75  ? 1301 THR A C    1 
ATOM   1464 O O    . THR A 1 160 ? 9.028  -1.470  7.738   1.00 30.16  ? 1301 THR A O    1 
ATOM   1465 C CB   . THR A 1 160 ? 6.511  -2.106  6.011   1.00 20.64  ? 1301 THR A CB   1 
ATOM   1466 O OG1  . THR A 1 160 ? 5.712  -1.887  4.847   1.00 19.76  ? 1301 THR A OG1  1 
ATOM   1467 C CG2  . THR A 1 160 ? 5.629  -2.687  7.096   1.00 19.57  ? 1301 THR A CG2  1 
ATOM   1468 H H    . THR A 1 160 ? 8.818  -0.791  5.177   1.00 0.00   ? 1301 THR A H    1 
ATOM   1469 H HG1  . THR A 1 160 ? 6.349  -1.603  4.179   1.00 0.00   ? 1301 THR A HG1  1 
ATOM   1470 N N    . GLU A 1 161 ? 7.365  -0.464  8.859   1.00 23.07  ? 1302 GLU A N    1 
ATOM   1471 C CA   . GLU A 1 161 ? 8.030  -0.619  10.146  1.00 23.48  ? 1302 GLU A CA   1 
ATOM   1472 C C    . GLU A 1 161 ? 7.658  -1.974  10.738  1.00 19.52  ? 1302 GLU A C    1 
ATOM   1473 O O    . GLU A 1 161 ? 6.479  -2.345  10.793  1.00 20.96  ? 1302 GLU A O    1 
ATOM   1474 C CB   . GLU A 1 161 ? 7.653  0.502   11.118  1.00 24.63  ? 1302 GLU A CB   1 
ATOM   1475 C CG   . GLU A 1 161 ? 8.562  0.568   12.354  1.00 28.91  ? 1302 GLU A CG   1 
ATOM   1476 C CD   . GLU A 1 161 ? 8.094  1.561   13.415  1.00 33.74  ? 1302 GLU A CD   1 
ATOM   1477 O OE1  . GLU A 1 161 ? 6.874  1.769   13.577  1.00 36.91  ? 1302 GLU A OE1  1 
ATOM   1478 O OE2  . GLU A 1 161 ? 8.959  2.119   14.119  1.00 35.43  ? 1302 GLU A OE2  1 
ATOM   1479 H H    . GLU A 1 161 ? 6.486  -0.032  8.844   1.00 0.00   ? 1302 GLU A H    1 
ATOM   1480 N N    . TYR A 1 162 ? 8.681  -2.723  11.122  1.00 22.90  ? 1303 TYR A N    1 
ATOM   1481 C CA   . TYR A 1 162 ? 8.514  -4.043  11.709  1.00 27.80  ? 1303 TYR A CA   1 
ATOM   1482 C C    . TYR A 1 162 ? 8.973  -4.054  13.162  1.00 29.35  ? 1303 TYR A C    1 
ATOM   1483 O O    . TYR A 1 162 ? 9.870  -3.298  13.557  1.00 28.26  ? 1303 TYR A O    1 
ATOM   1484 C CB   . TYR A 1 162 ? 9.347  -5.080  10.939  1.00 28.95  ? 1303 TYR A CB   1 
ATOM   1485 C CG   . TYR A 1 162 ? 8.767  -5.491  9.603   1.00 33.67  ? 1303 TYR A CG   1 
ATOM   1486 C CD1  . TYR A 1 162 ? 8.937  -4.693  8.462   1.00 27.08  ? 1303 TYR A CD1  1 
ATOM   1487 C CD2  . TYR A 1 162 ? 8.024  -6.665  9.482   1.00 26.59  ? 1303 TYR A CD2  1 
ATOM   1488 C CE1  . TYR A 1 162 ? 8.374  -5.057  7.246   1.00 24.36  ? 1303 TYR A CE1  1 
ATOM   1489 C CE2  . TYR A 1 162 ? 7.463  -7.036  8.265   1.00 30.75  ? 1303 TYR A CE2  1 
ATOM   1490 C CZ   . TYR A 1 162 ? 7.640  -6.231  7.155   1.00 26.10  ? 1303 TYR A CZ   1 
ATOM   1491 O OH   . TYR A 1 162 ? 7.097  -6.613  5.953   1.00 32.81  ? 1303 TYR A OH   1 
ATOM   1492 H H    . TYR A 1 162 ? 9.591  -2.378  11.028  1.00 0.00   ? 1303 TYR A H    1 
ATOM   1493 H HH   . TYR A 1 162 ? 6.599  -7.440  6.071   1.00 0.00   ? 1303 TYR A HH   1 
ATOM   1494 N N    . VAL A 1 163 ? 8.316  -4.880  13.963  1.00 30.05  ? 1304 VAL A N    1 
ATOM   1495 C CA   . VAL A 1 163 ? 8.692  -5.056  15.358  1.00 30.92  ? 1304 VAL A CA   1 
ATOM   1496 C C    . VAL A 1 163 ? 9.430  -6.392  15.328  1.00 27.37  ? 1304 VAL A C    1 
ATOM   1497 O O    . VAL A 1 163 ? 8.936  -7.369  14.749  1.00 23.92  ? 1304 VAL A O    1 
ATOM   1498 C CB   . VAL A 1 163 ? 7.465  -5.162  16.302  1.00 26.07  ? 1304 VAL A CB   1 
ATOM   1499 C CG1  . VAL A 1 163 ? 7.926  -5.403  17.712  1.00 30.39  ? 1304 VAL A CG1  1 
ATOM   1500 C CG2  . VAL A 1 163 ? 6.639  -3.900  16.258  1.00 30.92  ? 1304 VAL A CG2  1 
ATOM   1501 H H    . VAL A 1 163 ? 7.574  -5.406  13.634  1.00 0.00   ? 1304 VAL A H    1 
ATOM   1502 N N    . VAL A 1 164 ? 10.628 -6.421  15.897  1.00 25.15  ? 1305 VAL A N    1 
ATOM   1503 C CA   . VAL A 1 164 ? 11.433 -7.636  15.922  1.00 31.23  ? 1305 VAL A CA   1 
ATOM   1504 C C    . VAL A 1 164 ? 11.898 -7.945  17.342  1.00 34.71  ? 1305 VAL A C    1 
ATOM   1505 O O    . VAL A 1 164 ? 12.439 -7.077  18.031  1.00 28.91  ? 1305 VAL A O    1 
ATOM   1506 C CB   . VAL A 1 164 ? 12.685 -7.500  15.033  1.00 28.45  ? 1305 VAL A CB   1 
ATOM   1507 C CG1  . VAL A 1 164 ? 13.509 -8.778  15.087  1.00 20.31  ? 1305 VAL A CG1  1 
ATOM   1508 C CG2  . VAL A 1 164 ? 12.281 -7.159  13.596  1.00 21.46  ? 1305 VAL A CG2  1 
ATOM   1509 H H    . VAL A 1 164 ? 10.986 -5.631  16.323  1.00 0.00   ? 1305 VAL A H    1 
ATOM   1510 N N    . SER A 1 165 ? 11.680 -9.184  17.770  1.00 35.59  ? 1306 SER A N    1 
ATOM   1511 C CA   . SER A 1 165 ? 12.086 -9.618  19.096  1.00 33.10  ? 1306 SER A CA   1 
ATOM   1512 C C    . SER A 1 165 ? 12.804 -10.970 19.046  1.00 30.48  ? 1306 SER A C    1 
ATOM   1513 O O    . SER A 1 165 ? 12.425 -11.875 18.294  1.00 32.14  ? 1306 SER A O    1 
ATOM   1514 C CB   . SER A 1 165 ? 10.877 -9.676  20.026  1.00 34.39  ? 1306 SER A CB   1 
ATOM   1515 O OG   . SER A 1 165 ? 9.956  -10.660 19.624  1.00 43.67  ? 1306 SER A OG   1 
ATOM   1516 H H    . SER A 1 165 ? 11.267 -9.867  17.198  1.00 0.00   ? 1306 SER A H    1 
ATOM   1517 H HG   . SER A 1 165 ? 9.058  -10.321 19.570  1.00 0.00   ? 1306 SER A HG   1 
ATOM   1518 N N    . VAL A 1 166 ? 13.891 -11.073 19.799  1.00 29.10  ? 1307 VAL A N    1 
ATOM   1519 C CA   . VAL A 1 166 ? 14.669 -12.303 19.867  1.00 24.34  ? 1307 VAL A CA   1 
ATOM   1520 C C    . VAL A 1 166 ? 14.621 -12.816 21.311  1.00 27.08  ? 1307 VAL A C    1 
ATOM   1521 O O    . VAL A 1 166 ? 14.908 -12.066 22.248  1.00 24.11  ? 1307 VAL A O    1 
ATOM   1522 C CB   . VAL A 1 166 ? 16.150 -12.052 19.494  1.00 26.23  ? 1307 VAL A CB   1 
ATOM   1523 C CG1  . VAL A 1 166 ? 16.870 -13.375 19.288  1.00 15.05  ? 1307 VAL A CG1  1 
ATOM   1524 C CG2  . VAL A 1 166 ? 16.255 -11.159 18.265  1.00 24.97  ? 1307 VAL A CG2  1 
ATOM   1525 H H    . VAL A 1 166 ? 14.190 -10.310 20.335  1.00 0.00   ? 1307 VAL A H    1 
ATOM   1526 N N    . SER A 1 167 ? 14.261 -14.081 21.488  1.00 27.68  ? 1308 SER A N    1 
ATOM   1527 C CA   . SER A 1 167 ? 14.191 -14.669 22.824  1.00 35.86  ? 1308 SER A CA   1 
ATOM   1528 C C    . SER A 1 167 ? 15.122 -15.872 22.961  1.00 33.81  ? 1308 SER A C    1 
ATOM   1529 O O    . SER A 1 167 ? 15.294 -16.640 22.008  1.00 24.80  ? 1308 SER A O    1 
ATOM   1530 C CB   . SER A 1 167 ? 12.755 -15.095 23.153  1.00 33.84  ? 1308 SER A CB   1 
ATOM   1531 O OG   . SER A 1 167 ? 11.865 -13.985 23.126  1.00 36.84  ? 1308 SER A OG   1 
ATOM   1532 H H    . SER A 1 167 ? 14.022 -14.632 20.719  1.00 0.00   ? 1308 SER A H    1 
ATOM   1533 H HG   . SER A 1 167 ? 11.034 -14.293 23.527  1.00 0.00   ? 1308 SER A HG   1 
ATOM   1534 N N    . SER A 1 168 ? 15.771 -15.986 24.119  1.00 29.93  ? 1309 SER A N    1 
ATOM   1535 C CA   . SER A 1 168 ? 16.654 -17.111 24.405  1.00 34.05  ? 1309 SER A CA   1 
ATOM   1536 C C    . SER A 1 168 ? 15.751 -18.264 24.837  1.00 35.99  ? 1309 SER A C    1 
ATOM   1537 O O    . SER A 1 168 ? 14.639 -18.045 25.327  1.00 38.29  ? 1309 SER A O    1 
ATOM   1538 C CB   . SER A 1 168 ? 17.597 -16.782 25.562  1.00 33.93  ? 1309 SER A CB   1 
ATOM   1539 O OG   . SER A 1 168 ? 18.248 -15.539 25.376  1.00 38.13  ? 1309 SER A OG   1 
ATOM   1540 H H    . SER A 1 168 ? 15.671 -15.325 24.835  1.00 0.00   ? 1309 SER A H    1 
ATOM   1541 H HG   . SER A 1 168 ? 18.594 -15.349 26.263  1.00 0.00   ? 1309 SER A HG   1 
ATOM   1542 N N    . VAL A 1 169 ? 16.206 -19.490 24.636  1.00 36.92  ? 1310 VAL A N    1 
ATOM   1543 C CA   . VAL A 1 169 ? 15.417 -20.646 25.027  1.00 34.57  ? 1310 VAL A CA   1 
ATOM   1544 C C    . VAL A 1 169 ? 16.328 -21.707 25.630  1.00 38.18  ? 1310 VAL A C    1 
ATOM   1545 O O    . VAL A 1 169 ? 17.503 -21.816 25.256  1.00 34.34  ? 1310 VAL A O    1 
ATOM   1546 C CB   . VAL A 1 169 ? 14.649 -21.262 23.824  1.00 27.14  ? 1310 VAL A CB   1 
ATOM   1547 C CG1  . VAL A 1 169 ? 13.844 -22.453 24.274  1.00 22.90  ? 1310 VAL A CG1  1 
ATOM   1548 C CG2  . VAL A 1 169 ? 13.727 -20.239 23.186  1.00 21.76  ? 1310 VAL A CG2  1 
ATOM   1549 H H    . VAL A 1 169 ? 17.076 -19.648 24.211  1.00 0.00   ? 1310 VAL A H    1 
ATOM   1550 N N    . TYR A 1 170 ? 15.803 -22.407 26.629  1.00 46.00  ? 1311 TYR A N    1 
ATOM   1551 C CA   . TYR A 1 170 ? 16.496 -23.495 27.301  1.00 53.71  ? 1311 TYR A CA   1 
ATOM   1552 C C    . TYR A 1 170 ? 15.420 -24.494 27.696  1.00 58.15  ? 1311 TYR A C    1 
ATOM   1553 O O    . TYR A 1 170 ? 14.609 -24.231 28.595  1.00 55.90  ? 1311 TYR A O    1 
ATOM   1554 C CB   . TYR A 1 170 ? 17.254 -23.026 28.545  1.00 57.50  ? 1311 TYR A CB   1 
ATOM   1555 C CG   . TYR A 1 170 ? 18.036 -24.157 29.172  1.00 66.51  ? 1311 TYR A CG   1 
ATOM   1556 C CD1  . TYR A 1 170 ? 19.236 -24.593 28.606  1.00 72.36  ? 1311 TYR A CD1  1 
ATOM   1557 C CD2  . TYR A 1 170 ? 17.533 -24.859 30.269  1.00 73.17  ? 1311 TYR A CD2  1 
ATOM   1558 C CE1  . TYR A 1 170 ? 19.914 -25.708 29.110  1.00 76.62  ? 1311 TYR A CE1  1 
ATOM   1559 C CE2  . TYR A 1 170 ? 18.203 -25.978 30.781  1.00 77.76  ? 1311 TYR A CE2  1 
ATOM   1560 C CZ   . TYR A 1 170 ? 19.391 -26.397 30.194  1.00 77.01  ? 1311 TYR A CZ   1 
ATOM   1561 O OH   . TYR A 1 170 ? 20.046 -27.510 30.674  1.00 73.25  ? 1311 TYR A OH   1 
ATOM   1562 H H    . TYR A 1 170 ? 14.896 -22.188 26.926  1.00 0.00   ? 1311 TYR A H    1 
ATOM   1563 H HH   . TYR A 1 170 ? 19.561 -27.865 31.424  1.00 0.00   ? 1311 TYR A HH   1 
ATOM   1564 N N    . GLU A 1 171 ? 15.403 -25.627 27.002  1.00 68.01  ? 1312 GLU A N    1 
ATOM   1565 C CA   . GLU A 1 171 ? 14.415 -26.679 27.232  1.00 78.02  ? 1312 GLU A CA   1 
ATOM   1566 C C    . GLU A 1 171 ? 13.027 -26.120 26.890  1.00 77.73  ? 1312 GLU A C    1 
ATOM   1567 O O    . GLU A 1 171 ? 12.656 -26.035 25.717  1.00 83.50  ? 1312 GLU A O    1 
ATOM   1568 C CB   . GLU A 1 171 ? 14.464 -27.172 28.688  1.00 87.42  ? 1312 GLU A CB   1 
ATOM   1569 C CG   . GLU A 1 171 ? 13.449 -28.275 28.991  1.00 103.50 ? 1312 GLU A CG   1 
ATOM   1570 C CD   . GLU A 1 171 ? 12.882 -28.211 30.401  1.00 109.10 ? 1312 GLU A CD   1 
ATOM   1571 O OE1  . GLU A 1 171 ? 12.916 -27.123 31.032  1.00 113.31 ? 1312 GLU A OE1  1 
ATOM   1572 O OE2  . GLU A 1 171 ? 12.372 -29.254 30.866  1.00 110.37 ? 1312 GLU A OE2  1 
ATOM   1573 H H    . GLU A 1 171 ? 16.055 -25.748 26.287  1.00 0.00   ? 1312 GLU A H    1 
ATOM   1574 N N    . GLN A 1 172 ? 12.286 -25.705 27.911  1.00 73.36  ? 1313 GLN A N    1 
ATOM   1575 C CA   . GLN A 1 172 ? 10.955 -25.139 27.740  1.00 72.57  ? 1313 GLN A CA   1 
ATOM   1576 C C    . GLN A 1 172 ? 11.029 -23.650 28.029  1.00 67.22  ? 1313 GLN A C    1 
ATOM   1577 O O    . GLN A 1 172 ? 10.264 -22.848 27.496  1.00 66.57  ? 1313 GLN A O    1 
ATOM   1578 C CB   . GLN A 1 172 ? 9.984  -25.816 28.725  1.00 84.36  ? 1313 GLN A CB   1 
ATOM   1579 C CG   . GLN A 1 172 ? 8.751  -24.991 29.161  1.00 90.07  ? 1313 GLN A CG   1 
ATOM   1580 C CD   . GLN A 1 172 ? 9.043  -23.999 30.295  1.00 91.16  ? 1313 GLN A CD   1 
ATOM   1581 O OE1  . GLN A 1 172 ? 9.607  -24.362 31.332  1.00 85.81  ? 1313 GLN A OE1  1 
ATOM   1582 N NE2  . GLN A 1 172 ? 8.683  -22.736 30.083  1.00 89.84  ? 1313 GLN A NE2  1 
ATOM   1583 H H    . GLN A 1 172 ? 12.624 -25.797 28.825  1.00 0.00   ? 1313 GLN A H    1 
ATOM   1584 H HE21 . GLN A 1 172 ? 8.788  -22.062 30.780  1.00 0.00   ? 1313 GLN A HE21 1 
ATOM   1585 H HE22 . GLN A 1 172 ? 8.292  -22.523 29.206  1.00 0.00   ? 1313 GLN A HE22 1 
ATOM   1586 N N    . HIS A 1 173 ? 11.965 -23.300 28.895  1.00 59.13  ? 1314 HIS A N    1 
ATOM   1587 C CA   . HIS A 1 173 ? 12.141 -21.935 29.327  1.00 53.24  ? 1314 HIS A CA   1 
ATOM   1588 C C    . HIS A 1 173 ? 12.599 -20.915 28.291  1.00 46.43  ? 1314 HIS A C    1 
ATOM   1589 O O    . HIS A 1 173 ? 13.696 -20.998 27.747  1.00 43.76  ? 1314 HIS A O    1 
ATOM   1590 C CB   . HIS A 1 173 ? 13.055 -21.910 30.552  1.00 57.89  ? 1314 HIS A CB   1 
ATOM   1591 C CG   . HIS A 1 173 ? 12.416 -22.462 31.790  1.00 65.73  ? 1314 HIS A CG   1 
ATOM   1592 N ND1  . HIS A 1 173 ? 12.609 -23.758 32.218  1.00 67.44  ? 1314 HIS A ND1  1 
ATOM   1593 C CD2  . HIS A 1 173 ? 11.573 -21.891 32.685  1.00 65.06  ? 1314 HIS A CD2  1 
ATOM   1594 C CE1  . HIS A 1 173 ? 11.911 -23.965 33.322  1.00 67.91  ? 1314 HIS A CE1  1 
ATOM   1595 N NE2  . HIS A 1 173 ? 11.275 -22.847 33.625  1.00 67.91  ? 1314 HIS A NE2  1 
ATOM   1596 H H    . HIS A 1 173 ? 12.597 -23.983 29.199  1.00 0.00   ? 1314 HIS A H    1 
ATOM   1597 H HD1  . HIS A 1 173 ? 13.157 -24.481 31.815  1.00 0.00   ? 1314 HIS A HD1  1 
ATOM   1598 H HE2  . HIS A 1 173 ? 10.678 -22.714 34.392  1.00 0.00   ? 1314 HIS A HE2  1 
ATOM   1599 N N    . GLU A 1 174 ? 11.731 -19.949 28.034  1.00 44.73  ? 1315 GLU A N    1 
ATOM   1600 C CA   . GLU A 1 174 ? 12.013 -18.860 27.117  1.00 41.58  ? 1315 GLU A CA   1 
ATOM   1601 C C    . GLU A 1 174 ? 12.198 -17.598 27.974  1.00 42.10  ? 1315 GLU A C    1 
ATOM   1602 O O    . GLU A 1 174 ? 11.505 -17.416 28.978  1.00 44.60  ? 1315 GLU A O    1 
ATOM   1603 C CB   . GLU A 1 174 ? 10.835 -18.677 26.173  1.00 36.10  ? 1315 GLU A CB   1 
ATOM   1604 C CG   . GLU A 1 174 ? 11.105 -17.758 25.011  1.00 39.95  ? 1315 GLU A CG   1 
ATOM   1605 C CD   . GLU A 1 174 ? 9.872  -17.526 24.178  1.00 42.48  ? 1315 GLU A CD   1 
ATOM   1606 O OE1  . GLU A 1 174 ? 9.336  -18.495 23.593  1.00 40.35  ? 1315 GLU A OE1  1 
ATOM   1607 O OE2  . GLU A 1 174 ? 9.426  -16.364 24.113  1.00 40.92  ? 1315 GLU A OE2  1 
ATOM   1608 H H    . GLU A 1 174 ? 10.849 -19.972 28.464  1.00 0.00   ? 1315 GLU A H    1 
ATOM   1609 N N    . SER A 1 175 ? 13.144 -16.744 27.605  1.00 41.56  ? 1316 SER A N    1 
ATOM   1610 C CA   . SER A 1 175 ? 13.392 -15.517 28.355  1.00 32.13  ? 1316 SER A CA   1 
ATOM   1611 C C    . SER A 1 175 ? 12.463 -14.368 27.931  1.00 27.83  ? 1316 SER A C    1 
ATOM   1612 O O    . SER A 1 175 ? 11.452 -14.579 27.254  1.00 25.29  ? 1316 SER A O    1 
ATOM   1613 C CB   . SER A 1 175 ? 14.865 -15.100 28.199  1.00 29.11  ? 1316 SER A CB   1 
ATOM   1614 O OG   . SER A 1 175 ? 15.189 -14.692 26.876  1.00 34.34  ? 1316 SER A OG   1 
ATOM   1615 H H    . SER A 1 175 ? 13.660 -16.927 26.790  1.00 0.00   ? 1316 SER A H    1 
ATOM   1616 H HG   . SER A 1 175 ? 14.735 -13.859 26.662  1.00 0.00   ? 1316 SER A HG   1 
ATOM   1617 N N    . THR A 1 176 ? 12.748 -13.170 28.428  1.00 30.05  ? 1317 THR A N    1 
ATOM   1618 C CA   . THR A 1 176 ? 11.983 -11.994 28.049  1.00 36.23  ? 1317 THR A CA   1 
ATOM   1619 C C    . THR A 1 176 ? 12.482 -11.714 26.646  1.00 31.24  ? 1317 THR A C    1 
ATOM   1620 O O    . THR A 1 176 ? 13.640 -11.994 26.331  1.00 34.96  ? 1317 THR A O    1 
ATOM   1621 C CB   . THR A 1 176 ? 12.324 -10.769 28.937  1.00 42.13  ? 1317 THR A CB   1 
ATOM   1622 O OG1  . THR A 1 176 ? 13.720 -10.786 29.270  1.00 39.37  ? 1317 THR A OG1  1 
ATOM   1623 C CG2  . THR A 1 176 ? 11.483 -10.764 30.208  1.00 47.93  ? 1317 THR A CG2  1 
ATOM   1624 H H    . THR A 1 176 ? 13.458 -13.047 29.097  1.00 0.00   ? 1317 THR A H    1 
ATOM   1625 H HG1  . THR A 1 176 ? 14.216 -10.620 28.458  1.00 0.00   ? 1317 THR A HG1  1 
ATOM   1626 N N    . PRO A 1 177 ? 11.622 -11.197 25.770  1.00 35.21  ? 1318 PRO A N    1 
ATOM   1627 C CA   . PRO A 1 177 ? 12.113 -10.929 24.417  1.00 34.95  ? 1318 PRO A CA   1 
ATOM   1628 C C    . PRO A 1 177 ? 12.971 -9.683  24.331  1.00 34.73  ? 1318 PRO A C    1 
ATOM   1629 O O    . PRO A 1 177 ? 12.733 -8.701  25.034  1.00 40.87  ? 1318 PRO A O    1 
ATOM   1630 C CB   . PRO A 1 177 ? 10.825 -10.742 23.621  1.00 36.81  ? 1318 PRO A CB   1 
ATOM   1631 C CG   . PRO A 1 177 ? 9.913  -10.107 24.630  1.00 40.58  ? 1318 PRO A CG   1 
ATOM   1632 C CD   . PRO A 1 177 ? 10.178 -10.926 25.877  1.00 35.10  ? 1318 PRO A CD   1 
ATOM   1633 N N    . LEU A 1 178 ? 14.016 -9.757  23.520  1.00 33.29  ? 1319 LEU A N    1 
ATOM   1634 C CA   . LEU A 1 178 ? 14.872 -8.614  23.275  1.00 26.09  ? 1319 LEU A CA   1 
ATOM   1635 C C    . LEU A 1 178 ? 14.144 -7.984  22.095  1.00 26.97  ? 1319 LEU A C    1 
ATOM   1636 O O    . LEU A 1 178 ? 14.136 -8.549  21.007  1.00 25.55  ? 1319 LEU A O    1 
ATOM   1637 C CB   . LEU A 1 178 ? 16.262 -9.072  22.853  1.00 22.05  ? 1319 LEU A CB   1 
ATOM   1638 C CG   . LEU A 1 178 ? 17.138 -7.940  22.341  1.00 20.39  ? 1319 LEU A CG   1 
ATOM   1639 C CD1  . LEU A 1 178 ? 17.197 -6.791  23.357  1.00 17.96  ? 1319 LEU A CD1  1 
ATOM   1640 C CD2  . LEU A 1 178 ? 18.499 -8.492  22.019  1.00 18.24  ? 1319 LEU A CD2  1 
ATOM   1641 H H    . LEU A 1 178 ? 14.210 -10.602 23.080  1.00 0.00   ? 1319 LEU A H    1 
ATOM   1642 N N    . ARG A 1 179 ? 13.484 -6.856  22.329  1.00 32.27  ? 1320 ARG A N    1 
ATOM   1643 C CA   . ARG A 1 179 ? 12.703 -6.203  21.290  1.00 34.24  ? 1320 ARG A CA   1 
ATOM   1644 C C    . ARG A 1 179 ? 13.233 -4.889  20.714  1.00 36.31  ? 1320 ARG A C    1 
ATOM   1645 O O    . ARG A 1 179 ? 13.932 -4.127  21.391  1.00 41.40  ? 1320 ARG A O    1 
ATOM   1646 C CB   . ARG A 1 179 ? 11.271 -6.013  21.781  1.00 28.31  ? 1320 ARG A CB   1 
ATOM   1647 C CG   . ARG A 1 179 ? 10.297 -5.715  20.664  1.00 39.14  ? 1320 ARG A CG   1 
ATOM   1648 C CD   . ARG A 1 179 ? 8.870  -5.594  21.154  1.00 42.24  ? 1320 ARG A CD   1 
ATOM   1649 N NE   . ARG A 1 179 ? 8.268  -6.875  21.515  1.00 46.37  ? 1320 ARG A NE   1 
ATOM   1650 C CZ   . ARG A 1 179 ? 8.314  -7.418  22.732  1.00 48.81  ? 1320 ARG A CZ   1 
ATOM   1651 N NH1  . ARG A 1 179 ? 8.957  -6.800  23.722  1.00 44.75  ? 1320 ARG A NH1  1 
ATOM   1652 N NH2  . ARG A 1 179 ? 7.665  -8.555  22.969  1.00 37.97  ? 1320 ARG A NH2  1 
ATOM   1653 H H    . ARG A 1 179 ? 13.542 -6.443  23.222  1.00 0.00   ? 1320 ARG A H    1 
ATOM   1654 H HE   . ARG A 1 179 ? 7.811  -7.332  20.770  1.00 0.00   ? 1320 ARG A HE   1 
ATOM   1655 H HH11 . ARG A 1 179 ? 9.416  -5.919  23.565  1.00 0.00   ? 1320 ARG A HH11 1 
ATOM   1656 H HH12 . ARG A 1 179 ? 9.027  -7.167  24.656  1.00 0.00   ? 1320 ARG A HH12 1 
ATOM   1657 H HH21 . ARG A 1 179 ? 7.146  -9.017  22.242  1.00 0.00   ? 1320 ARG A HH21 1 
ATOM   1658 H HH22 . ARG A 1 179 ? 7.663  -9.004  23.864  1.00 0.00   ? 1320 ARG A HH22 1 
ATOM   1659 N N    . GLY A 1 180 ? 12.873 -4.636  19.456  1.00 36.76  ? 1321 GLY A N    1 
ATOM   1660 C CA   . GLY A 1 180 ? 13.274 -3.426  18.758  1.00 32.19  ? 1321 GLY A CA   1 
ATOM   1661 C C    . GLY A 1 180 ? 12.443 -3.251  17.498  1.00 28.25  ? 1321 GLY A C    1 
ATOM   1662 O O    . GLY A 1 180 ? 11.811 -4.204  17.054  1.00 30.09  ? 1321 GLY A O    1 
ATOM   1663 H H    . GLY A 1 180 ? 12.343 -5.283  18.941  1.00 0.00   ? 1321 GLY A H    1 
ATOM   1664 N N    . ARG A 1 181 ? 12.400 -2.035  16.957  1.00 25.57  ? 1322 ARG A N    1 
ATOM   1665 C CA   . ARG A 1 181 ? 11.646 -1.728  15.733  1.00 29.42  ? 1322 ARG A CA   1 
ATOM   1666 C C    . ARG A 1 181 ? 12.578 -1.234  14.631  1.00 29.65  ? 1322 ARG A C    1 
ATOM   1667 O O    . ARG A 1 181 ? 13.614 -0.620  14.910  1.00 31.39  ? 1322 ARG A O    1 
ATOM   1668 C CB   . ARG A 1 181 ? 10.596 -0.647  15.980  1.00 27.48  ? 1322 ARG A CB   1 
ATOM   1669 C CG   . ARG A 1 181 ? 9.369  -1.090  16.723  1.00 33.92  ? 1322 ARG A CG   1 
ATOM   1670 C CD   . ARG A 1 181 ? 8.435  0.090   16.851  1.00 38.71  ? 1322 ARG A CD   1 
ATOM   1671 N NE   . ARG A 1 181 ? 7.197  -0.245  17.545  1.00 41.65  ? 1322 ARG A NE   1 
ATOM   1672 C CZ   . ARG A 1 181 ? 6.122  0.539   17.568  1.00 44.85  ? 1322 ARG A CZ   1 
ATOM   1673 N NH1  . ARG A 1 181 ? 6.136  1.710   16.927  1.00 38.45  ? 1322 ARG A NH1  1 
ATOM   1674 N NH2  . ARG A 1 181 ? 5.031  0.145   18.220  1.00 44.84  ? 1322 ARG A NH2  1 
ATOM   1675 H H    . ARG A 1 181 ? 12.894 -1.301  17.380  1.00 0.00   ? 1322 ARG A H    1 
ATOM   1676 H HE   . ARG A 1 181 ? 7.210  -1.118  18.005  1.00 0.00   ? 1322 ARG A HE   1 
ATOM   1677 H HH11 . ARG A 1 181 ? 6.944  1.959   16.361  1.00 0.00   ? 1322 ARG A HH11 1 
ATOM   1678 H HH12 . ARG A 1 181 ? 5.372  2.349   16.863  1.00 0.00   ? 1322 ARG A HH12 1 
ATOM   1679 H HH21 . ARG A 1 181 ? 5.023  -0.744  18.696  1.00 0.00   ? 1322 ARG A HH21 1 
ATOM   1680 H HH22 . ARG A 1 181 ? 4.193  0.694   18.263  1.00 0.00   ? 1322 ARG A HH22 1 
ATOM   1681 N N    . GLN A 1 182 ? 12.190 -1.469  13.382  1.00 27.70  ? 1323 GLN A N    1 
ATOM   1682 C CA   . GLN A 1 182 ? 13.000 -1.053  12.249  1.00 24.55  ? 1323 GLN A CA   1 
ATOM   1683 C C    . GLN A 1 182 ? 12.136 -1.021  11.004  1.00 23.44  ? 1323 GLN A C    1 
ATOM   1684 O O    . GLN A 1 182 ? 11.409 -1.963  10.720  1.00 24.44  ? 1323 GLN A O    1 
ATOM   1685 C CB   . GLN A 1 182 ? 14.172 -2.023  12.057  1.00 24.44  ? 1323 GLN A CB   1 
ATOM   1686 C CG   . GLN A 1 182 ? 15.095 -1.726  10.891  1.00 9.74   ? 1323 GLN A CG   1 
ATOM   1687 C CD   . GLN A 1 182 ? 15.747 -0.373  10.992  1.00 16.92  ? 1323 GLN A CD   1 
ATOM   1688 O OE1  . GLN A 1 182 ? 15.542 0.482   10.143  1.00 24.25  ? 1323 GLN A OE1  1 
ATOM   1689 N NE2  . GLN A 1 182 ? 16.528 -0.164  12.039  1.00 19.60  ? 1323 GLN A NE2  1 
ATOM   1690 H H    . GLN A 1 182 ? 11.342 -1.941  13.215  1.00 0.00   ? 1323 GLN A H    1 
ATOM   1691 H HE21 . GLN A 1 182 ? 16.993 0.700   12.104  1.00 0.00   ? 1323 GLN A HE21 1 
ATOM   1692 H HE22 . GLN A 1 182 ? 16.626 -0.861  12.717  1.00 0.00   ? 1323 GLN A HE22 1 
ATOM   1693 N N    . LYS A 1 183 ? 12.211 0.088   10.282  1.00 23.38  ? 1324 LYS A N    1 
ATOM   1694 C CA   . LYS A 1 183 ? 11.459 0.282   9.056   1.00 23.34  ? 1324 LYS A CA   1 
ATOM   1695 C C    . LYS A 1 183 ? 12.294 -0.142  7.861   1.00 16.00  ? 1324 LYS A C    1 
ATOM   1696 O O    . LYS A 1 183 ? 13.498 0.097   7.820   1.00 19.92  ? 1324 LYS A O    1 
ATOM   1697 C CB   . LYS A 1 183 ? 11.093 1.757   8.914   1.00 25.94  ? 1324 LYS A CB   1 
ATOM   1698 C CG   . LYS A 1 183 ? 9.806  2.011   8.160   1.00 49.62  ? 1324 LYS A CG   1 
ATOM   1699 C CD   . LYS A 1 183 ? 9.371  3.454   8.338   1.00 68.79  ? 1324 LYS A CD   1 
ATOM   1700 C CE   . LYS A 1 183 ? 10.144 4.424   7.436   1.00 86.07  ? 1324 LYS A CE   1 
ATOM   1701 N NZ   . LYS A 1 183 ? 11.622 4.220   7.301   1.00 88.56  ? 1324 LYS A NZ   1 
ATOM   1702 H H    . LYS A 1 183 ? 12.824 0.805   10.565  1.00 0.00   ? 1324 LYS A H    1 
ATOM   1703 H HZ1  . LYS A 1 183 ? 12.227 4.191   8.148   1.00 0.00   ? 1324 LYS A HZ1  1 
ATOM   1704 H HZ2  . LYS A 1 183 ? 11.798 3.353   6.749   1.00 0.00   ? 1324 LYS A HZ2  1 
ATOM   1705 H HZ3  . LYS A 1 183 ? 12.010 4.912   6.627   1.00 0.00   ? 1324 LYS A HZ3  1 
ATOM   1706 N N    . THR A 1 184 ? 11.669 -0.814  6.904   1.00 24.21  ? 1325 THR A N    1 
ATOM   1707 C CA   . THR A 1 184 ? 12.375 -1.228  5.700   1.00 20.67  ? 1325 THR A CA   1 
ATOM   1708 C C    . THR A 1 184 ? 12.519 -0.003  4.799   1.00 18.78  ? 1325 THR A C    1 
ATOM   1709 O O    . THR A 1 184 ? 11.834 1.000   4.984   1.00 16.99  ? 1325 THR A O    1 
ATOM   1710 C CB   . THR A 1 184 ? 11.618 -2.323  4.955   1.00 21.51  ? 1325 THR A CB   1 
ATOM   1711 O OG1  . THR A 1 184 ? 10.250 -1.938  4.830   1.00 25.38  ? 1325 THR A OG1  1 
ATOM   1712 C CG2  . THR A 1 184 ? 11.697 -3.634  5.711   1.00 28.50  ? 1325 THR A CG2  1 
ATOM   1713 H H    . THR A 1 184 ? 10.726 -1.060  6.979   1.00 0.00   ? 1325 THR A H    1 
ATOM   1714 H HG1  . THR A 1 184 ? 9.843  -2.754  4.534   1.00 0.00   ? 1325 THR A HG1  1 
ATOM   1715 N N    . GLY A 1 185 ? 13.426 -0.082  3.841   1.00 19.16  ? 1326 GLY A N    1 
ATOM   1716 C CA   . GLY A 1 185 ? 13.649 1.035   2.952   1.00 18.34  ? 1326 GLY A CA   1 
ATOM   1717 C C    . GLY A 1 185 ? 12.574 1.185   1.894   1.00 20.75  ? 1326 GLY A C    1 
ATOM   1718 O O    . GLY A 1 185 ? 11.624 0.409   1.833   1.00 16.70  ? 1326 GLY A O    1 
ATOM   1719 H H    . GLY A 1 185 ? 13.933 -0.913  3.726   1.00 0.00   ? 1326 GLY A H    1 
ATOM   1720 N N    . LEU A 1 186 ? 12.733 2.197   1.059   1.00 19.66  ? 1327 LEU A N    1 
ATOM   1721 C CA   . LEU A 1 186 ? 11.782 2.459   0.007   1.00 22.09  ? 1327 LEU A CA   1 
ATOM   1722 C C    . LEU A 1 186 ? 12.213 1.709   -1.245  1.00 20.66  ? 1327 LEU A C    1 
ATOM   1723 O O    . LEU A 1 186 ? 13.408 1.612   -1.546  1.00 18.31  ? 1327 LEU A O    1 
ATOM   1724 C CB   . LEU A 1 186 ? 11.735 3.959   -0.280  1.00 26.38  ? 1327 LEU A CB   1 
ATOM   1725 C CG   . LEU A 1 186 ? 11.483 4.982   0.831   1.00 17.32  ? 1327 LEU A CG   1 
ATOM   1726 C CD1  . LEU A 1 186 ? 11.571 6.363   0.207   1.00 22.67  ? 1327 LEU A CD1  1 
ATOM   1727 C CD2  . LEU A 1 186 ? 10.109 4.787   1.463   1.00 20.98  ? 1327 LEU A CD2  1 
ATOM   1728 H H    . LEU A 1 186 ? 13.527 2.771   1.136   1.00 0.00   ? 1327 LEU A H    1 
ATOM   1729 N N    . ASP A 1 187 ? 11.245 1.126   -1.943  1.00 27.76  ? 1328 ASP A N    1 
ATOM   1730 C CA   . ASP A 1 187 ? 11.549 0.417   -3.182  1.00 23.43  ? 1328 ASP A CA   1 
ATOM   1731 C C    . ASP A 1 187 ? 11.599 1.462   -4.276  1.00 22.92  ? 1328 ASP A C    1 
ATOM   1732 O O    . ASP A 1 187 ? 10.983 2.531   -4.153  1.00 22.07  ? 1328 ASP A O    1 
ATOM   1733 C CB   . ASP A 1 187 ? 10.531 -0.690  -3.493  1.00 19.10  ? 1328 ASP A CB   1 
ATOM   1734 C CG   . ASP A 1 187 ? 9.091  -0.226  -3.411  1.00 22.63  ? 1328 ASP A CG   1 
ATOM   1735 O OD1  . ASP A 1 187 ? 8.734  0.525   -2.484  1.00 28.58  ? 1328 ASP A OD1  1 
ATOM   1736 O OD2  . ASP A 1 187 ? 8.289  -0.654  -4.264  1.00 25.65  ? 1328 ASP A OD2  1 
ATOM   1737 H H    . ASP A 1 187 ? 10.324 1.207   -1.644  1.00 0.00   ? 1328 ASP A H    1 
ATOM   1738 N N    . SER A 1 188 ? 12.392 1.184   -5.305  1.00 16.43  ? 1329 SER A N    1 
ATOM   1739 C CA   . SER A 1 188 ? 12.574 2.109   -6.413  1.00 20.39  ? 1329 SER A CA   1 
ATOM   1740 C C    . SER A 1 188 ? 11.390 2.136   -7.347  1.00 23.65  ? 1329 SER A C    1 
ATOM   1741 O O    . SER A 1 188 ? 10.631 1.161   -7.430  1.00 26.12  ? 1329 SER A O    1 
ATOM   1742 C CB   . SER A 1 188 ? 13.784 1.701   -7.244  1.00 13.12  ? 1329 SER A CB   1 
ATOM   1743 O OG   . SER A 1 188 ? 14.890 1.423   -6.417  1.00 32.71  ? 1329 SER A OG   1 
ATOM   1744 H H    . SER A 1 188 ? 12.865 0.329   -5.324  1.00 0.00   ? 1329 SER A H    1 
ATOM   1745 H HG   . SER A 1 188 ? 15.607 1.034   -6.942  1.00 0.00   ? 1329 SER A HG   1 
ATOM   1746 N N    . PRO A 1 189 ? 11.188 3.270   -8.045  1.00 25.85  ? 1330 PRO A N    1 
ATOM   1747 C CA   . PRO A 1 189 ? 10.068 3.347   -8.985  1.00 20.65  ? 1330 PRO A CA   1 
ATOM   1748 C C    . PRO A 1 189 ? 10.549 2.467   -10.141 1.00 20.26  ? 1330 PRO A C    1 
ATOM   1749 O O    . PRO A 1 189 ? 11.743 2.155   -10.233 1.00 18.86  ? 1330 PRO A O    1 
ATOM   1750 C CB   . PRO A 1 189 ? 10.059 4.825   -9.386  1.00 24.56  ? 1330 PRO A CB   1 
ATOM   1751 C CG   . PRO A 1 189 ? 10.748 5.511   -8.236  1.00 28.22  ? 1330 PRO A CG   1 
ATOM   1752 C CD   . PRO A 1 189 ? 11.862 4.575   -7.927  1.00 14.73  ? 1330 PRO A CD   1 
ATOM   1753 N N    . THR A 1 190 ? 9.659  2.037   -11.012 1.00 23.90  ? 1331 THR A N    1 
ATOM   1754 C CA   . THR A 1 190 ? 10.108 1.193   -12.112 1.00 21.71  ? 1331 THR A CA   1 
ATOM   1755 C C    . THR A 1 190 ? 9.569  1.671   -13.452 1.00 16.08  ? 1331 THR A C    1 
ATOM   1756 O O    . THR A 1 190 ? 8.902  2.693   -13.535 1.00 20.41  ? 1331 THR A O    1 
ATOM   1757 C CB   . THR A 1 190 ? 9.661  -0.269  -11.898 1.00 23.23  ? 1331 THR A CB   1 
ATOM   1758 O OG1  . THR A 1 190 ? 8.252  -0.307  -11.643 1.00 21.42  ? 1331 THR A OG1  1 
ATOM   1759 C CG2  . THR A 1 190 ? 10.389 -0.879  -10.726 1.00 28.97  ? 1331 THR A CG2  1 
ATOM   1760 H H    . THR A 1 190 ? 8.711  2.275   -10.929 1.00 0.00   ? 1331 THR A H    1 
ATOM   1761 H HG1  . THR A 1 190 ? 8.070  0.107   -10.781 1.00 0.00   ? 1331 THR A HG1  1 
ATOM   1762 N N    . GLY A 1 191 ? 9.917  0.938   -14.499 1.00 21.51  ? 1332 GLY A N    1 
ATOM   1763 C CA   . GLY A 1 191 ? 9.435  1.229   -15.831 1.00 24.77  ? 1332 GLY A CA   1 
ATOM   1764 C C    . GLY A 1 191 ? 9.591  2.630   -16.371 1.00 23.37  ? 1332 GLY A C    1 
ATOM   1765 O O    . GLY A 1 191 ? 8.622  3.175   -16.910 1.00 25.65  ? 1332 GLY A O    1 
ATOM   1766 H H    . GLY A 1 191 ? 10.520 0.173   -14.378 1.00 0.00   ? 1332 GLY A H    1 
ATOM   1767 N N    . ILE A 1 192 ? 10.801 3.189   -16.283 1.00 27.36  ? 1333 ILE A N    1 
ATOM   1768 C CA   . ILE A 1 192 ? 11.061 4.538   -16.801 1.00 23.51  ? 1333 ILE A CA   1 
ATOM   1769 C C    . ILE A 1 192 ? 10.692 4.450   -18.273 1.00 20.25  ? 1333 ILE A C    1 
ATOM   1770 O O    . ILE A 1 192 ? 11.032 3.477   -18.940 1.00 18.20  ? 1333 ILE A O    1 
ATOM   1771 C CB   . ILE A 1 192 ? 12.553 4.977   -16.630 1.00 26.28  ? 1333 ILE A CB   1 
ATOM   1772 C CG1  . ILE A 1 192 ? 12.687 6.493   -16.823 1.00 19.77  ? 1333 ILE A CG1  1 
ATOM   1773 C CG2  . ILE A 1 192 ? 13.465 4.243   -17.619 1.00 27.22  ? 1333 ILE A CG2  1 
ATOM   1774 C CD1  . ILE A 1 192 ? 14.121 7.026   -16.662 1.00 15.40  ? 1333 ILE A CD1  1 
ATOM   1775 H H    . ILE A 1 192 ? 11.522 2.673   -15.877 1.00 0.00   ? 1333 ILE A H    1 
ATOM   1776 N N    . ASP A 1 193 ? 9.981  5.455   -18.758 1.00 19.93  ? 1334 ASP A N    1 
ATOM   1777 C CA   . ASP A 1 193 ? 9.518  5.473   -20.128 1.00 19.09  ? 1334 ASP A CA   1 
ATOM   1778 C C    . ASP A 1 193 ? 9.422  6.926   -20.598 1.00 21.96  ? 1334 ASP A C    1 
ATOM   1779 O O    . ASP A 1 193 ? 8.971  7.793   -19.850 1.00 25.96  ? 1334 ASP A O    1 
ATOM   1780 C CB   . ASP A 1 193 ? 8.160  4.775   -20.139 1.00 18.32  ? 1334 ASP A CB   1 
ATOM   1781 C CG   . ASP A 1 193 ? 7.481  4.830   -21.467 1.00 27.15  ? 1334 ASP A CG   1 
ATOM   1782 O OD1  . ASP A 1 193 ? 8.115  4.514   -22.491 1.00 25.29  ? 1334 ASP A OD1  1 
ATOM   1783 O OD2  . ASP A 1 193 ? 6.291  5.182   -21.477 1.00 23.93  ? 1334 ASP A OD2  1 
ATOM   1784 H H    . ASP A 1 193 ? 9.748  6.205   -18.171 1.00 0.00   ? 1334 ASP A H    1 
ATOM   1785 N N    . PHE A 1 194 ? 9.836  7.192   -21.835 1.00 30.29  ? 1335 PHE A N    1 
ATOM   1786 C CA   . PHE A 1 194 ? 9.829  8.555   -22.393 1.00 32.62  ? 1335 PHE A CA   1 
ATOM   1787 C C    . PHE A 1 194 ? 8.862  8.776   -23.569 1.00 32.01  ? 1335 PHE A C    1 
ATOM   1788 O O    . PHE A 1 194 ? 8.699  7.889   -24.407 1.00 27.61  ? 1335 PHE A O    1 
ATOM   1789 C CB   . PHE A 1 194 ? 11.240 8.922   -22.868 1.00 25.89  ? 1335 PHE A CB   1 
ATOM   1790 C CG   . PHE A 1 194 ? 12.325 8.616   -21.866 1.00 26.70  ? 1335 PHE A CG   1 
ATOM   1791 C CD1  . PHE A 1 194 ? 12.842 7.324   -21.751 1.00 25.13  ? 1335 PHE A CD1  1 
ATOM   1792 C CD2  . PHE A 1 194 ? 12.866 9.628   -21.073 1.00 23.41  ? 1335 PHE A CD2  1 
ATOM   1793 C CE1  . PHE A 1 194 ? 13.883 7.047   -20.868 1.00 26.53  ? 1335 PHE A CE1  1 
ATOM   1794 C CE2  . PHE A 1 194 ? 13.910 9.363   -20.184 1.00 20.42  ? 1335 PHE A CE2  1 
ATOM   1795 C CZ   . PHE A 1 194 ? 14.419 8.074   -20.082 1.00 27.80  ? 1335 PHE A CZ   1 
ATOM   1796 H H    . PHE A 1 194 ? 10.144 6.461   -22.416 1.00 0.00   ? 1335 PHE A H    1 
ATOM   1797 N N    . SER A 1 195 ? 8.230  9.952   -23.624 1.00 31.37  ? 1336 SER A N    1 
ATOM   1798 C CA   . SER A 1 195 ? 7.317  10.311  -24.722 1.00 32.55  ? 1336 SER A CA   1 
ATOM   1799 C C    . SER A 1 195 ? 7.405  11.822  -25.029 1.00 34.83  ? 1336 SER A C    1 
ATOM   1800 O O    . SER A 1 195 ? 8.218  12.532  -24.424 1.00 28.57  ? 1336 SER A O    1 
ATOM   1801 C CB   . SER A 1 195 ? 5.866  9.885   -24.428 1.00 28.42  ? 1336 SER A CB   1 
ATOM   1802 O OG   . SER A 1 195 ? 5.266  10.645  -23.397 1.00 25.30  ? 1336 SER A OG   1 
ATOM   1803 H H    . SER A 1 195 ? 8.393  10.644  -22.957 1.00 0.00   ? 1336 SER A H    1 
ATOM   1804 H HG   . SER A 1 195 ? 4.435  11.098  -23.701 1.00 0.00   ? 1336 SER A HG   1 
ATOM   1805 N N    . ASP A 1 196 ? 6.637  12.287  -26.019 1.00 31.33  ? 1337 ASP A N    1 
ATOM   1806 C CA   . ASP A 1 196 ? 6.613  13.706  -26.408 1.00 24.53  ? 1337 ASP A CA   1 
ATOM   1807 C C    . ASP A 1 196 ? 8.012  14.249  -26.662 1.00 23.37  ? 1337 ASP A C    1 
ATOM   1808 O O    . ASP A 1 196 ? 8.320  15.379  -26.307 1.00 27.07  ? 1337 ASP A O    1 
ATOM   1809 C CB   . ASP A 1 196 ? 5.953  14.549  -25.309 1.00 31.93  ? 1337 ASP A CB   1 
ATOM   1810 C CG   . ASP A 1 196 ? 4.611  14.002  -24.874 1.00 38.94  ? 1337 ASP A CG   1 
ATOM   1811 O OD1  . ASP A 1 196 ? 3.974  13.283  -25.671 1.00 36.69  ? 1337 ASP A OD1  1 
ATOM   1812 O OD2  . ASP A 1 196 ? 4.200  14.291  -23.729 1.00 45.42  ? 1337 ASP A OD2  1 
ATOM   1813 H H    . ASP A 1 196 ? 5.997  11.700  -26.462 1.00 0.00   ? 1337 ASP A H    1 
ATOM   1814 N N    . ILE A 1 197 ? 8.846  13.449  -27.303 1.00 22.19  ? 1338 ILE A N    1 
ATOM   1815 C CA   . ILE A 1 197 ? 10.224 13.824  -27.574 1.00 25.52  ? 1338 ILE A CA   1 
ATOM   1816 C C    . ILE A 1 197 ? 10.333 14.872  -28.673 1.00 27.80  ? 1338 ILE A C    1 
ATOM   1817 O O    . ILE A 1 197 ? 9.784  14.703  -29.770 1.00 28.65  ? 1338 ILE A O    1 
ATOM   1818 C CB   . ILE A 1 197 ? 11.057 12.554  -27.912 1.00 27.50  ? 1338 ILE A CB   1 
ATOM   1819 C CG1  . ILE A 1 197 ? 10.990 11.586  -26.719 1.00 24.30  ? 1338 ILE A CG1  1 
ATOM   1820 C CG2  . ILE A 1 197 ? 12.520 12.915  -28.226 1.00 14.68  ? 1338 ILE A CG2  1 
ATOM   1821 C CD1  . ILE A 1 197 ? 10.944 10.142  -27.103 1.00 27.37  ? 1338 ILE A CD1  1 
ATOM   1822 H H    . ILE A 1 197 ? 8.517  12.594  -27.632 1.00 0.00   ? 1338 ILE A H    1 
ATOM   1823 N N    . THR A 1 198 ? 10.991 15.980  -28.350 1.00 22.57  ? 1339 THR A N    1 
ATOM   1824 C CA   . THR A 1 198 ? 11.179 17.056  -29.304 1.00 18.63  ? 1339 THR A CA   1 
ATOM   1825 C C    . THR A 1 198 ? 12.661 17.359  -29.409 1.00 18.73  ? 1339 THR A C    1 
ATOM   1826 O O    . THR A 1 198 ? 13.491 16.504  -29.105 1.00 23.25  ? 1339 THR A O    1 
ATOM   1827 C CB   . THR A 1 198 ? 10.384 18.340  -28.931 1.00 12.56  ? 1339 THR A CB   1 
ATOM   1828 O OG1  . THR A 1 198 ? 10.973 18.970  -27.795 1.00 21.20  ? 1339 THR A OG1  1 
ATOM   1829 C CG2  . THR A 1 198 ? 8.927  18.012  -28.643 1.00 17.24  ? 1339 THR A CG2  1 
ATOM   1830 H H    . THR A 1 198 ? 11.365 16.077  -27.457 1.00 0.00   ? 1339 THR A H    1 
ATOM   1831 H HG1  . THR A 1 198 ? 10.514 18.684  -26.983 1.00 0.00   ? 1339 THR A HG1  1 
ATOM   1832 N N    . ALA A 1 199 ? 12.993 18.557  -29.873 1.00 21.17  ? 1340 ALA A N    1 
ATOM   1833 C CA   . ALA A 1 199 ? 14.384 18.969  -30.026 1.00 21.28  ? 1340 ALA A CA   1 
ATOM   1834 C C    . ALA A 1 199 ? 14.905 19.567  -28.736 1.00 21.39  ? 1340 ALA A C    1 
ATOM   1835 O O    . ALA A 1 199 ? 16.101 19.572  -28.484 1.00 27.08  ? 1340 ALA A O    1 
ATOM   1836 C CB   . ALA A 1 199 ? 14.515 19.989  -31.159 1.00 20.57  ? 1340 ALA A CB   1 
ATOM   1837 H H    . ALA A 1 199 ? 12.300 19.204  -30.139 1.00 0.00   ? 1340 ALA A H    1 
ATOM   1838 N N    . ASN A 1 200 ? 14.003 20.054  -27.902 1.00 20.17  ? 1341 ASN A N    1 
ATOM   1839 C CA   . ASN A 1 200 ? 14.418 20.671  -26.660 1.00 30.64  ? 1341 ASN A CA   1 
ATOM   1840 C C    . ASN A 1 200 ? 13.611 20.213  -25.448 1.00 30.01  ? 1341 ASN A C    1 
ATOM   1841 O O    . ASN A 1 200 ? 13.537 20.924  -24.440 1.00 28.97  ? 1341 ASN A O    1 
ATOM   1842 C CB   . ASN A 1 200 ? 14.363 22.200  -26.810 1.00 39.73  ? 1341 ASN A CB   1 
ATOM   1843 C CG   . ASN A 1 200 ? 13.123 22.667  -27.545 1.00 45.04  ? 1341 ASN A CG   1 
ATOM   1844 O OD1  . ASN A 1 200 ? 12.017 22.640  -27.005 1.00 53.13  ? 1341 ASN A OD1  1 
ATOM   1845 N ND2  . ASN A 1 200 ? 13.297 23.081  -28.792 1.00 40.54  ? 1341 ASN A ND2  1 
ATOM   1846 H H    . ASN A 1 200 ? 13.041 19.978  -28.095 1.00 0.00   ? 1341 ASN A H    1 
ATOM   1847 H HD21 . ASN A 1 200 ? 12.506 23.383  -29.279 1.00 0.00   ? 1341 ASN A HD21 1 
ATOM   1848 H HD22 . ASN A 1 200 ? 14.206 23.073  -29.158 1.00 0.00   ? 1341 ASN A HD22 1 
ATOM   1849 N N    . SER A 1 201 ? 13.041 19.015  -25.528 1.00 25.13  ? 1342 SER A N    1 
ATOM   1850 C CA   . SER A 1 201 ? 12.252 18.491  -24.425 1.00 18.61  ? 1342 SER A CA   1 
ATOM   1851 C C    . SER A 1 201 ? 11.765 17.068  -24.667 1.00 16.33  ? 1342 SER A C    1 
ATOM   1852 O O    . SER A 1 201 ? 11.939 16.512  -25.751 1.00 17.65  ? 1342 SER A O    1 
ATOM   1853 C CB   . SER A 1 201 ? 11.038 19.389  -24.172 1.00 19.74  ? 1342 SER A CB   1 
ATOM   1854 O OG   . SER A 1 201 ? 10.055 19.227  -25.183 1.00 29.88  ? 1342 SER A OG   1 
ATOM   1855 H H    . SER A 1 201 ? 13.112 18.463  -26.330 1.00 0.00   ? 1342 SER A H    1 
ATOM   1856 H HG   . SER A 1 201 ? 9.206  19.514  -24.821 1.00 0.00   ? 1342 SER A HG   1 
ATOM   1857 N N    . PHE A 1 202 ? 11.224 16.475  -23.608 1.00 17.05  ? 1343 PHE A N    1 
ATOM   1858 C CA   . PHE A 1 202 ? 10.635 15.142  -23.614 1.00 16.75  ? 1343 PHE A CA   1 
ATOM   1859 C C    . PHE A 1 202 ? 10.010 14.877  -22.248 1.00 21.37  ? 1343 PHE A C    1 
ATOM   1860 O O    . PHE A 1 202 ? 10.378 15.500  -21.250 1.00 21.38  ? 1343 PHE A O    1 
ATOM   1861 C CB   . PHE A 1 202 ? 11.601 14.012  -24.052 1.00 16.42  ? 1343 PHE A CB   1 
ATOM   1862 C CG   . PHE A 1 202 ? 12.801 13.811  -23.162 1.00 23.92  ? 1343 PHE A CG   1 
ATOM   1863 C CD1  . PHE A 1 202 ? 12.661 13.376  -21.844 1.00 19.80  ? 1343 PHE A CD1  1 
ATOM   1864 C CD2  . PHE A 1 202 ? 14.086 14.043  -23.655 1.00 23.08  ? 1343 PHE A CD2  1 
ATOM   1865 C CE1  . PHE A 1 202 ? 13.777 13.182  -21.038 1.00 23.27  ? 1343 PHE A CE1  1 
ATOM   1866 C CE2  . PHE A 1 202 ? 15.207 13.848  -22.854 1.00 22.88  ? 1343 PHE A CE2  1 
ATOM   1867 C CZ   . PHE A 1 202 ? 15.049 13.418  -21.538 1.00 17.89  ? 1343 PHE A CZ   1 
ATOM   1868 H H    . PHE A 1 202 ? 11.199 16.958  -22.750 1.00 0.00   ? 1343 PHE A H    1 
ATOM   1869 N N    . THR A 1 203 ? 8.986  14.039  -22.246 1.00 25.96  ? 1344 THR A N    1 
ATOM   1870 C CA   . THR A 1 203 ? 8.271  13.675  -21.048 1.00 22.81  ? 1344 THR A CA   1 
ATOM   1871 C C    . THR A 1 203 ? 8.749  12.318  -20.536 1.00 29.84  ? 1344 THR A C    1 
ATOM   1872 O O    . THR A 1 203 ? 8.845  11.336  -21.294 1.00 25.52  ? 1344 THR A O    1 
ATOM   1873 C CB   . THR A 1 203 ? 6.772  13.650  -21.323 1.00 18.81  ? 1344 THR A CB   1 
ATOM   1874 O OG1  . THR A 1 203 ? 6.391  14.903  -21.901 1.00 20.89  ? 1344 THR A OG1  1 
ATOM   1875 C CG2  . THR A 1 203 ? 5.992  13.442  -20.035 1.00 12.56  ? 1344 THR A CG2  1 
ATOM   1876 H H    . THR A 1 203 ? 8.675  13.676  -23.091 1.00 0.00   ? 1344 THR A H    1 
ATOM   1877 H HG1  . THR A 1 203 ? 5.592  14.729  -22.444 1.00 0.00   ? 1344 THR A HG1  1 
ATOM   1878 N N    . VAL A 1 204 ? 9.068  12.303  -19.242 1.00 33.47  ? 1345 VAL A N    1 
ATOM   1879 C CA   . VAL A 1 204 ? 9.556  11.139  -18.512 1.00 23.84  ? 1345 VAL A CA   1 
ATOM   1880 C C    . VAL A 1 204 ? 8.406  10.581  -17.688 1.00 20.94  ? 1345 VAL A C    1 
ATOM   1881 O O    . VAL A 1 204 ? 7.677  11.347  -17.054 1.00 17.21  ? 1345 VAL A O    1 
ATOM   1882 C CB   . VAL A 1 204 ? 10.698 11.548  -17.536 1.00 23.81  ? 1345 VAL A CB   1 
ATOM   1883 C CG1  . VAL A 1 204 ? 11.412 10.312  -16.979 1.00 18.14  ? 1345 VAL A CG1  1 
ATOM   1884 C CG2  . VAL A 1 204 ? 11.674 12.472  -18.226 1.00 19.09  ? 1345 VAL A CG2  1 
ATOM   1885 H H    . VAL A 1 204 ? 9.007  13.115  -18.741 1.00 0.00   ? 1345 VAL A H    1 
ATOM   1886 N N    . HIS A 1 205 ? 8.245  9.258   -17.719 1.00 21.81  ? 1346 HIS A N    1 
ATOM   1887 C CA   . HIS A 1 205 ? 7.202  8.555   -16.974 1.00 18.88  ? 1346 HIS A CA   1 
ATOM   1888 C C    . HIS A 1 205 ? 7.858  7.442   -16.164 1.00 17.33  ? 1346 HIS A C    1 
ATOM   1889 O O    . HIS A 1 205 ? 8.892  6.903   -16.558 1.00 17.49  ? 1346 HIS A O    1 
ATOM   1890 C CB   . HIS A 1 205 ? 6.181  7.898   -17.907 1.00 23.65  ? 1346 HIS A CB   1 
ATOM   1891 C CG   . HIS A 1 205 ? 5.715  8.768   -19.027 1.00 20.58  ? 1346 HIS A CG   1 
ATOM   1892 N ND1  . HIS A 1 205 ? 6.474  8.986   -20.156 1.00 23.52  ? 1346 HIS A ND1  1 
ATOM   1893 C CD2  . HIS A 1 205 ? 4.555  9.444   -19.215 1.00 15.47  ? 1346 HIS A CD2  1 
ATOM   1894 C CE1  . HIS A 1 205 ? 5.804  9.756   -20.991 1.00 17.09  ? 1346 HIS A CE1  1 
ATOM   1895 N NE2  . HIS A 1 205 ? 4.637  10.048  -20.446 1.00 17.31  ? 1346 HIS A NE2  1 
ATOM   1896 H H    . HIS A 1 205 ? 8.885  8.700   -18.212 1.00 0.00   ? 1346 HIS A H    1 
ATOM   1897 H HD1  . HIS A 1 205 ? 7.353  8.590   -20.345 1.00 0.00   ? 1346 HIS A HD1  1 
ATOM   1898 H HE2  . HIS A 1 205 ? 3.930  10.553  -20.939 1.00 0.00   ? 1346 HIS A HE2  1 
ATOM   1899 N N    . TRP A 1 206 ? 7.227  7.070   -15.058 1.00 17.81  ? 1347 TRP A N    1 
ATOM   1900 C CA   . TRP A 1 206 ? 7.747  6.016   -14.184 1.00 24.43  ? 1347 TRP A CA   1 
ATOM   1901 C C    . TRP A 1 206 ? 6.580  5.417   -13.406 1.00 26.94  ? 1347 TRP A C    1 
ATOM   1902 O O    . TRP A 1 206 ? 5.506  6.025   -13.317 1.00 23.53  ? 1347 TRP A O    1 
ATOM   1903 C CB   . TRP A 1 206 ? 8.800  6.579   -13.208 1.00 17.94  ? 1347 TRP A CB   1 
ATOM   1904 C CG   . TRP A 1 206 ? 8.278  7.697   -12.321 1.00 16.99  ? 1347 TRP A CG   1 
ATOM   1905 C CD1  . TRP A 1 206 ? 7.618  7.560   -11.136 1.00 13.52  ? 1347 TRP A CD1  1 
ATOM   1906 C CD2  . TRP A 1 206 ? 8.373  9.109   -12.567 1.00 19.01  ? 1347 TRP A CD2  1 
ATOM   1907 N NE1  . TRP A 1 206 ? 7.296  8.789   -10.631 1.00 14.63  ? 1347 TRP A NE1  1 
ATOM   1908 C CE2  . TRP A 1 206 ? 7.749  9.760   -11.483 1.00 16.72  ? 1347 TRP A CE2  1 
ATOM   1909 C CE3  . TRP A 1 206 ? 8.930  9.890   -13.603 1.00 17.64  ? 1347 TRP A CE3  1 
ATOM   1910 C CZ2  . TRP A 1 206 ? 7.660  11.159  -11.393 1.00 20.74  ? 1347 TRP A CZ2  1 
ATOM   1911 C CZ3  . TRP A 1 206 ? 8.844  11.281  -13.516 1.00 9.35   ? 1347 TRP A CZ3  1 
ATOM   1912 C CH2  . TRP A 1 206 ? 8.211  11.899  -12.415 1.00 22.64  ? 1347 TRP A CH2  1 
ATOM   1913 H H    . TRP A 1 206 ? 6.396  7.511   -14.771 1.00 0.00   ? 1347 TRP A H    1 
ATOM   1914 H HE1  . TRP A 1 206 ? 6.795  8.939   -9.800  1.00 0.00   ? 1347 TRP A HE1  1 
ATOM   1915 N N    . ILE A 1 207 ? 6.798  4.238   -12.838 1.00 22.09  ? 1348 ILE A N    1 
ATOM   1916 C CA   . ILE A 1 207 ? 5.764  3.548   -12.082 1.00 19.92  ? 1348 ILE A CA   1 
ATOM   1917 C C    . ILE A 1 207 ? 6.062  3.690   -10.593 1.00 15.43  ? 1348 ILE A C    1 
ATOM   1918 O O    . ILE A 1 207 ? 7.197  3.516   -10.153 1.00 22.30  ? 1348 ILE A O    1 
ATOM   1919 C CB   . ILE A 1 207 ? 5.663  2.044   -12.522 1.00 24.63  ? 1348 ILE A CB   1 
ATOM   1920 C CG1  . ILE A 1 207 ? 5.418  1.959   -14.047 1.00 18.54  ? 1348 ILE A CG1  1 
ATOM   1921 C CG2  . ILE A 1 207 ? 4.514  1.342   -11.790 1.00 14.86  ? 1348 ILE A CG2  1 
ATOM   1922 C CD1  . ILE A 1 207 ? 5.858  0.641   -14.684 1.00 18.96  ? 1348 ILE A CD1  1 
ATOM   1923 H H    . ILE A 1 207 ? 7.683  3.846   -12.891 1.00 0.00   ? 1348 ILE A H    1 
ATOM   1924 N N    . ALA A 1 208 ? 5.050  4.077   -9.836  1.00 17.85  ? 1349 ALA A N    1 
ATOM   1925 C CA   . ALA A 1 208 ? 5.186  4.272   -8.400  1.00 18.90  ? 1349 ALA A CA   1 
ATOM   1926 C C    . ALA A 1 208 ? 5.617  3.005   -7.668  1.00 21.22  ? 1349 ALA A C    1 
ATOM   1927 O O    . ALA A 1 208 ? 5.288  1.889   -8.087  1.00 20.28  ? 1349 ALA A O    1 
ATOM   1928 C CB   . ALA A 1 208 ? 3.865  4.761   -7.830  1.00 22.77  ? 1349 ALA A CB   1 
ATOM   1929 H H    . ALA A 1 208 ? 4.174  4.228   -10.254 1.00 0.00   ? 1349 ALA A H    1 
ATOM   1930 N N    . PRO A 1 209 ? 6.378  3.160   -6.573  1.00 23.95  ? 1350 PRO A N    1 
ATOM   1931 C CA   . PRO A 1 209 ? 6.829  1.998   -5.797  1.00 23.79  ? 1350 PRO A CA   1 
ATOM   1932 C C    . PRO A 1 209 ? 5.713  1.554   -4.837  1.00 27.46  ? 1350 PRO A C    1 
ATOM   1933 O O    . PRO A 1 209 ? 4.707  2.248   -4.695  1.00 29.31  ? 1350 PRO A O    1 
ATOM   1934 C CB   . PRO A 1 209 ? 8.042  2.553   -5.047  1.00 21.71  ? 1350 PRO A CB   1 
ATOM   1935 C CG   . PRO A 1 209 ? 7.653  3.968   -4.782  1.00 21.60  ? 1350 PRO A CG   1 
ATOM   1936 C CD   . PRO A 1 209 ? 7.034  4.398   -6.102  1.00 22.65  ? 1350 PRO A CD   1 
ATOM   1937 N N    . ARG A 1 210 ? 5.859  0.377   -4.238  1.00 27.78  ? 1351 ARG A N    1 
ATOM   1938 C CA   . ARG A 1 210 ? 4.880  -0.135  -3.287  1.00 36.16  ? 1351 ARG A CA   1 
ATOM   1939 C C    . ARG A 1 210 ? 4.834  0.715   -2.002  1.00 37.43  ? 1351 ARG A C    1 
ATOM   1940 O O    . ARG A 1 210 ? 3.759  0.978   -1.445  1.00 39.57  ? 1351 ARG A O    1 
ATOM   1941 C CB   . ARG A 1 210 ? 5.206  -1.591  -2.925  1.00 41.13  ? 1351 ARG A CB   1 
ATOM   1942 C CG   . ARG A 1 210 ? 4.118  -2.287  -2.091  1.00 61.16  ? 1351 ARG A CG   1 
ATOM   1943 C CD   . ARG A 1 210 ? 4.634  -2.859  -0.751  1.00 69.42  ? 1351 ARG A CD   1 
ATOM   1944 N NE   . ARG A 1 210 ? 5.018  -1.834  0.228   1.00 69.01  ? 1351 ARG A NE   1 
ATOM   1945 C CZ   . ARG A 1 210 ? 4.218  -1.364  1.184   1.00 66.53  ? 1351 ARG A CZ   1 
ATOM   1946 N NH1  . ARG A 1 210 ? 2.979  -1.820  1.307   1.00 70.28  ? 1351 ARG A NH1  1 
ATOM   1947 N NH2  . ARG A 1 210 ? 4.660  -0.437  2.020   1.00 68.80  ? 1351 ARG A NH2  1 
ATOM   1948 H H    . ARG A 1 210 ? 6.583  -0.181  -4.503  1.00 0.00   ? 1351 ARG A H    1 
ATOM   1949 H HE   . ARG A 1 210 ? 5.929  -1.470  0.141   1.00 0.00   ? 1351 ARG A HE   1 
ATOM   1950 H HH11 . ARG A 1 210 ? 2.625  -2.526  0.695   1.00 0.00   ? 1351 ARG A HH11 1 
ATOM   1951 H HH12 . ARG A 1 210 ? 2.376  -1.468  2.024   1.00 0.00   ? 1351 ARG A HH12 1 
ATOM   1952 H HH21 . ARG A 1 210 ? 5.598  -0.086  1.963   1.00 0.00   ? 1351 ARG A HH21 1 
ATOM   1953 H HH22 . ARG A 1 210 ? 4.128  0.000   2.755   1.00 0.00   ? 1351 ARG A HH22 1 
ATOM   1954 N N    . ALA A 1 211 ? 6.005  1.099   -1.507  1.00 32.35  ? 1352 ALA A N    1 
ATOM   1955 C CA   . ALA A 1 211 ? 6.103  1.894   -0.288  1.00 21.05  ? 1352 ALA A CA   1 
ATOM   1956 C C    . ALA A 1 211 ? 5.417  3.244   -0.363  1.00 22.35  ? 1352 ALA A C    1 
ATOM   1957 O O    . ALA A 1 211 ? 5.228  3.809   -1.438  1.00 20.97  ? 1352 ALA A O    1 
ATOM   1958 C CB   . ALA A 1 211 ? 7.554  2.094   0.077   1.00 19.04  ? 1352 ALA A CB   1 
ATOM   1959 H H    . ALA A 1 211 ? 6.823  0.869   -2.004  1.00 0.00   ? 1352 ALA A H    1 
ATOM   1960 N N    . THR A 1 212 ? 5.052  3.759   0.803   1.00 28.63  ? 1353 THR A N    1 
ATOM   1961 C CA   . THR A 1 212 ? 4.426  5.068   0.901   1.00 30.12  ? 1353 THR A CA   1 
ATOM   1962 C C    . THR A 1 212 ? 5.541  6.111   0.774   1.00 25.28  ? 1353 THR A C    1 
ATOM   1963 O O    . THR A 1 212 ? 6.584  6.021   1.431   1.00 22.53  ? 1353 THR A O    1 
ATOM   1964 C CB   . THR A 1 212 ? 3.655  5.219   2.236   1.00 31.02  ? 1353 THR A CB   1 
ATOM   1965 O OG1  . THR A 1 212 ? 2.549  4.308   2.246   1.00 35.79  ? 1353 THR A OG1  1 
ATOM   1966 C CG2  . THR A 1 212 ? 3.128  6.631   2.411   1.00 34.76  ? 1353 THR A CG2  1 
ATOM   1967 H H    . THR A 1 212 ? 5.166  3.240   1.624   1.00 0.00   ? 1353 THR A H    1 
ATOM   1968 H HG1  . THR A 1 212 ? 2.045  4.440   3.058   1.00 0.00   ? 1353 THR A HG1  1 
ATOM   1969 N N    . ILE A 1 213 ? 5.341  7.052   -0.140  1.00 26.20  ? 1354 ILE A N    1 
ATOM   1970 C CA   . ILE A 1 213 ? 6.301  8.111   -0.413  1.00 22.86  ? 1354 ILE A CA   1 
ATOM   1971 C C    . ILE A 1 213 ? 5.589  9.461   -0.446  1.00 25.10  ? 1354 ILE A C    1 
ATOM   1972 O O    . ILE A 1 213 ? 4.351  9.538   -0.473  1.00 28.04  ? 1354 ILE A O    1 
ATOM   1973 C CB   . ILE A 1 213 ? 6.983  7.902   -1.792  1.00 28.06  ? 1354 ILE A CB   1 
ATOM   1974 C CG1  . ILE A 1 213 ? 5.924  7.754   -2.891  1.00 23.16  ? 1354 ILE A CG1  1 
ATOM   1975 C CG2  . ILE A 1 213 ? 7.881  6.686   -1.762  1.00 27.66  ? 1354 ILE A CG2  1 
ATOM   1976 C CD1  . ILE A 1 213 ? 6.286  8.417   -4.183  1.00 24.70  ? 1354 ILE A CD1  1 
ATOM   1977 H H    . ILE A 1 213 ? 4.500  7.063   -0.646  1.00 0.00   ? 1354 ILE A H    1 
ATOM   1978 N N    . THR A 1 214 ? 6.373  10.529  -0.451  1.00 26.54  ? 1355 THR A N    1 
ATOM   1979 C CA   . THR A 1 214 ? 5.811  11.867  -0.499  1.00 28.91  ? 1355 THR A CA   1 
ATOM   1980 C C    . THR A 1 214 ? 6.118  12.567  -1.831  1.00 29.30  ? 1355 THR A C    1 
ATOM   1981 O O    . THR A 1 214 ? 5.462  13.536  -2.204  1.00 30.37  ? 1355 THR A O    1 
ATOM   1982 C CB   . THR A 1 214 ? 6.314  12.701  0.676   1.00 29.08  ? 1355 THR A CB   1 
ATOM   1983 O OG1  . THR A 1 214 ? 7.745  12.776  0.639   1.00 29.52  ? 1355 THR A OG1  1 
ATOM   1984 C CG2  . THR A 1 214 ? 5.877  12.057  1.979   1.00 33.59  ? 1355 THR A CG2  1 
ATOM   1985 H H    . THR A 1 214 ? 7.344  10.429  -0.399  1.00 0.00   ? 1355 THR A H    1 
ATOM   1986 H HG1  . THR A 1 214 ? 8.012  13.302  -0.128  1.00 0.00   ? 1355 THR A HG1  1 
ATOM   1987 N N    . GLY A 1 215 ? 7.080  12.035  -2.571  1.00 30.73  ? 1356 GLY A N    1 
ATOM   1988 C CA   . GLY A 1 215 ? 7.431  12.629  -3.838  1.00 23.79  ? 1356 GLY A CA   1 
ATOM   1989 C C    . GLY A 1 215 ? 8.552  11.883  -4.511  1.00 21.38  ? 1356 GLY A C    1 
ATOM   1990 O O    . GLY A 1 215 ? 8.835  10.729  -4.178  1.00 22.61  ? 1356 GLY A O    1 
ATOM   1991 H H    . GLY A 1 215 ? 7.571  11.231  -2.301  1.00 0.00   ? 1356 GLY A H    1 
ATOM   1992 N N    . TYR A 1 216 ? 9.187  12.556  -5.461  1.00 19.17  ? 1357 TYR A N    1 
ATOM   1993 C CA   . TYR A 1 216 ? 10.290 11.999  -6.227  1.00 20.44  ? 1357 TYR A CA   1 
ATOM   1994 C C    . TYR A 1 216 ? 11.257 13.112  -6.555  1.00 23.19  ? 1357 TYR A C    1 
ATOM   1995 O O    . TYR A 1 216 ? 10.885 14.296  -6.588  1.00 25.78  ? 1357 TYR A O    1 
ATOM   1996 C CB   . TYR A 1 216 ? 9.803  11.432  -7.564  1.00 18.02  ? 1357 TYR A CB   1 
ATOM   1997 C CG   . TYR A 1 216 ? 8.715  10.397  -7.471  1.00 24.96  ? 1357 TYR A CG   1 
ATOM   1998 C CD1  . TYR A 1 216 ? 7.376  10.778  -7.398  1.00 16.04  ? 1357 TYR A CD1  1 
ATOM   1999 C CD2  . TYR A 1 216 ? 9.019  9.030   -7.483  1.00 20.11  ? 1357 TYR A CD2  1 
ATOM   2000 C CE1  . TYR A 1 216 ? 6.359  9.823   -7.340  1.00 27.24  ? 1357 TYR A CE1  1 
ATOM   2001 C CE2  . TYR A 1 216 ? 8.008  8.063   -7.425  1.00 22.51  ? 1357 TYR A CE2  1 
ATOM   2002 C CZ   . TYR A 1 216 ? 6.682  8.470   -7.354  1.00 22.49  ? 1357 TYR A CZ   1 
ATOM   2003 O OH   . TYR A 1 216 ? 5.673  7.540   -7.305  1.00 25.52  ? 1357 TYR A OH   1 
ATOM   2004 H H    . TYR A 1 216 ? 8.915  13.485  -5.648  1.00 0.00   ? 1357 TYR A H    1 
ATOM   2005 H HH   . TYR A 1 216 ? 4.835  8.019   -7.335  1.00 0.00   ? 1357 TYR A HH   1 
ATOM   2006 N N    . ARG A 1 217 ? 12.504 12.731  -6.788  1.00 27.76  ? 1358 ARG A N    1 
ATOM   2007 C CA   . ARG A 1 217 ? 13.526 13.679  -7.177  1.00 26.11  ? 1358 ARG A CA   1 
ATOM   2008 C C    . ARG A 1 217 ? 14.075 13.142  -8.488  1.00 26.41  ? 1358 ARG A C    1 
ATOM   2009 O O    . ARG A 1 217 ? 14.648 12.049  -8.533  1.00 28.33  ? 1358 ARG A O    1 
ATOM   2010 C CB   . ARG A 1 217 ? 14.649 13.778  -6.146  1.00 26.57  ? 1358 ARG A CB   1 
ATOM   2011 C CG   . ARG A 1 217 ? 15.770 14.689  -6.608  1.00 30.66  ? 1358 ARG A CG   1 
ATOM   2012 C CD   . ARG A 1 217 ? 17.140 14.076  -6.386  1.00 39.10  ? 1358 ARG A CD   1 
ATOM   2013 N NE   . ARG A 1 217 ? 17.699 14.390  -5.071  1.00 48.14  ? 1358 ARG A NE   1 
ATOM   2014 C CZ   . ARG A 1 217 ? 17.804 13.526  -4.062  1.00 48.97  ? 1358 ARG A CZ   1 
ATOM   2015 N NH1  . ARG A 1 217 ? 17.379 12.277  -4.192  1.00 52.81  ? 1358 ARG A NH1  1 
ATOM   2016 N NH2  . ARG A 1 217 ? 18.410 13.890  -2.940  1.00 61.88  ? 1358 ARG A NH2  1 
ATOM   2017 H H    . ARG A 1 217 ? 12.740 11.780  -6.718  1.00 0.00   ? 1358 ARG A H    1 
ATOM   2018 H HE   . ARG A 1 217 ? 18.048 15.309  -5.018  1.00 0.00   ? 1358 ARG A HE   1 
ATOM   2019 H HH11 . ARG A 1 217 ? 16.982 11.917  -5.036  1.00 0.00   ? 1358 ARG A HH11 1 
ATOM   2020 H HH12 . ARG A 1 217 ? 17.490 11.618  -3.421  1.00 0.00   ? 1358 ARG A HH12 1 
ATOM   2021 H HH21 . ARG A 1 217 ? 18.878 14.755  -2.742  1.00 0.00   ? 1358 ARG A HH21 1 
ATOM   2022 H HH22 . ARG A 1 217 ? 18.467 13.190  -2.201  1.00 0.00   ? 1358 ARG A HH22 1 
ATOM   2023 N N    . ILE A 1 218 ? 13.778 13.859  -9.563  1.00 26.70  ? 1359 ILE A N    1 
ATOM   2024 C CA   . ILE A 1 218 ? 14.230 13.511  -10.899 1.00 15.93  ? 1359 ILE A CA   1 
ATOM   2025 C C    . ILE A 1 218 ? 15.495 14.330  -11.173 1.00 21.88  ? 1359 ILE A C    1 
ATOM   2026 O O    . ILE A 1 218 ? 15.568 15.518  -10.850 1.00 21.62  ? 1359 ILE A O    1 
ATOM   2027 C CB   . ILE A 1 218 ? 13.160 13.866  -11.957 1.00 18.23  ? 1359 ILE A CB   1 
ATOM   2028 C CG1  . ILE A 1 218 ? 11.800 13.288  -11.554 1.00 13.05  ? 1359 ILE A CG1  1 
ATOM   2029 C CG2  . ILE A 1 218 ? 13.580 13.348  -13.323 1.00 18.10  ? 1359 ILE A CG2  1 
ATOM   2030 C CD1  . ILE A 1 218 ? 10.893 14.284  -10.897 1.00 14.38  ? 1359 ILE A CD1  1 
ATOM   2031 H H    . ILE A 1 218 ? 13.262 14.682  -9.441  1.00 0.00   ? 1359 ILE A H    1 
ATOM   2032 N N    . ARG A 1 219 ? 16.470 13.722  -11.820 1.00 20.66  ? 1360 ARG A N    1 
ATOM   2033 C CA   . ARG A 1 219 ? 17.708 14.414  -12.102 1.00 23.40  ? 1360 ARG A CA   1 
ATOM   2034 C C    . ARG A 1 219 ? 18.107 14.036  -13.529 1.00 25.77  ? 1360 ARG A C    1 
ATOM   2035 O O    . ARG A 1 219 ? 17.920 12.897  -13.939 1.00 26.68  ? 1360 ARG A O    1 
ATOM   2036 C CB   . ARG A 1 219 ? 18.741 13.991  -11.051 1.00 24.62  ? 1360 ARG A CB   1 
ATOM   2037 C CG   . ARG A 1 219 ? 20.126 14.545  -11.213 1.00 40.28  ? 1360 ARG A CG   1 
ATOM   2038 C CD   . ARG A 1 219 ? 21.072 13.901  -10.219 1.00 41.31  ? 1360 ARG A CD   1 
ATOM   2039 N NE   . ARG A 1 219 ? 20.967 14.488  -8.883  1.00 58.31  ? 1360 ARG A NE   1 
ATOM   2040 C CZ   . ARG A 1 219 ? 21.687 14.095  -7.833  1.00 58.85  ? 1360 ARG A CZ   1 
ATOM   2041 N NH1  . ARG A 1 219 ? 22.555 13.094  -7.956  1.00 61.35  ? 1360 ARG A NH1  1 
ATOM   2042 N NH2  . ARG A 1 219 ? 21.598 14.752  -6.683  1.00 51.52  ? 1360 ARG A NH2  1 
ATOM   2043 H H    . ARG A 1 219 ? 16.371 12.810  -12.157 1.00 0.00   ? 1360 ARG A H    1 
ATOM   2044 H HE   . ARG A 1 219 ? 20.333 15.240  -8.756  1.00 0.00   ? 1360 ARG A HE   1 
ATOM   2045 H HH11 . ARG A 1 219 ? 22.656 12.585  -8.824  1.00 0.00   ? 1360 ARG A HH11 1 
ATOM   2046 H HH12 . ARG A 1 219 ? 23.156 12.780  -7.213  1.00 0.00   ? 1360 ARG A HH12 1 
ATOM   2047 H HH21 . ARG A 1 219 ? 21.004 15.567  -6.645  1.00 0.00   ? 1360 ARG A HH21 1 
ATOM   2048 H HH22 . ARG A 1 219 ? 22.164 14.500  -5.885  1.00 0.00   ? 1360 ARG A HH22 1 
ATOM   2049 N N    . HIS A 1 220 ? 18.568 15.002  -14.315 1.00 27.29  ? 1361 HIS A N    1 
ATOM   2050 C CA   . HIS A 1 220 ? 18.940 14.706  -15.691 1.00 26.52  ? 1361 HIS A CA   1 
ATOM   2051 C C    . HIS A 1 220 ? 20.186 15.468  -16.119 1.00 29.44  ? 1361 HIS A C    1 
ATOM   2052 O O    . HIS A 1 220 ? 20.464 16.568  -15.622 1.00 30.80  ? 1361 HIS A O    1 
ATOM   2053 C CB   . HIS A 1 220 ? 17.770 14.995  -16.645 1.00 29.42  ? 1361 HIS A CB   1 
ATOM   2054 C CG   . HIS A 1 220 ? 17.469 16.454  -16.816 1.00 25.73  ? 1361 HIS A CG   1 
ATOM   2055 N ND1  . HIS A 1 220 ? 16.782 17.188  -15.875 1.00 23.56  ? 1361 HIS A ND1  1 
ATOM   2056 C CD2  . HIS A 1 220 ? 17.753 17.312  -17.825 1.00 23.86  ? 1361 HIS A CD2  1 
ATOM   2057 C CE1  . HIS A 1 220 ? 16.650 18.433  -16.299 1.00 19.78  ? 1361 HIS A CE1  1 
ATOM   2058 N NE2  . HIS A 1 220 ? 17.232 18.534  -17.478 1.00 22.02  ? 1361 HIS A NE2  1 
ATOM   2059 H H    . HIS A 1 220 ? 18.681 15.908  -13.950 1.00 0.00   ? 1361 HIS A H    1 
ATOM   2060 H HD1  . HIS A 1 220 ? 16.423 16.904  -14.996 1.00 0.00   ? 1361 HIS A HD1  1 
ATOM   2061 H HE2  . HIS A 1 220 ? 17.230 19.371  -18.015 1.00 0.00   ? 1361 HIS A HE2  1 
ATOM   2062 N N    . HIS A 1 221 ? 20.924 14.894  -17.064 1.00 28.02  ? 1362 HIS A N    1 
ATOM   2063 C CA   . HIS A 1 221 ? 22.146 15.508  -17.542 1.00 23.37  ? 1362 HIS A CA   1 
ATOM   2064 C C    . HIS A 1 221 ? 22.635 14.837  -18.805 1.00 26.10  ? 1362 HIS A C    1 
ATOM   2065 O O    . HIS A 1 221 ? 22.289 13.691  -19.062 1.00 25.73  ? 1362 HIS A O    1 
ATOM   2066 C CB   . HIS A 1 221 ? 23.246 15.381  -16.473 1.00 28.35  ? 1362 HIS A CB   1 
ATOM   2067 C CG   . HIS A 1 221 ? 23.765 13.986  -16.292 1.00 26.21  ? 1362 HIS A CG   1 
ATOM   2068 N ND1  . HIS A 1 221 ? 23.344 13.160  -15.272 1.00 28.49  ? 1362 HIS A ND1  1 
ATOM   2069 C CD2  . HIS A 1 221 ? 24.669 13.269  -17.004 1.00 17.70  ? 1362 HIS A CD2  1 
ATOM   2070 C CE1  . HIS A 1 221 ? 23.962 11.997  -15.367 1.00 26.07  ? 1362 HIS A CE1  1 
ATOM   2071 N NE2  . HIS A 1 221 ? 24.768 12.038  -16.411 1.00 23.59  ? 1362 HIS A NE2  1 
ATOM   2072 H H    . HIS A 1 221 ? 20.651 14.023  -17.443 1.00 0.00   ? 1362 HIS A H    1 
ATOM   2073 H HD1  . HIS A 1 221 ? 22.668 13.304  -14.568 1.00 0.00   ? 1362 HIS A HD1  1 
ATOM   2074 H HE2  . HIS A 1 221 ? 25.300 11.275  -16.713 1.00 0.00   ? 1362 HIS A HE2  1 
ATOM   2075 N N    . PRO A 1 222 ? 23.396 15.570  -19.640 1.00 25.39  ? 1363 PRO A N    1 
ATOM   2076 C CA   . PRO A 1 222 ? 23.938 15.004  -20.878 1.00 28.36  ? 1363 PRO A CA   1 
ATOM   2077 C C    . PRO A 1 222 ? 25.307 14.413  -20.489 1.00 32.20  ? 1363 PRO A C    1 
ATOM   2078 O O    . PRO A 1 222 ? 25.694 14.494  -19.318 1.00 31.05  ? 1363 PRO A O    1 
ATOM   2079 C CB   . PRO A 1 222 ? 24.064 16.231  -21.770 1.00 20.91  ? 1363 PRO A CB   1 
ATOM   2080 C CG   . PRO A 1 222 ? 24.492 17.280  -20.804 1.00 24.96  ? 1363 PRO A CG   1 
ATOM   2081 C CD   . PRO A 1 222 ? 23.608 17.028  -19.599 1.00 18.58  ? 1363 PRO A CD   1 
ATOM   2082 N N    . GLU A 1 223 ? 26.045 13.845  -21.439 1.00 33.54  ? 1364 GLU A N    1 
ATOM   2083 C CA   . GLU A 1 223 ? 27.346 13.253  -21.121 1.00 38.06  ? 1364 GLU A CA   1 
ATOM   2084 C C    . GLU A 1 223 ? 28.328 14.213  -20.440 1.00 36.88  ? 1364 GLU A C    1 
ATOM   2085 O O    . GLU A 1 223 ? 29.031 13.824  -19.504 1.00 38.50  ? 1364 GLU A O    1 
ATOM   2086 C CB   . GLU A 1 223 ? 28.003 12.644  -22.366 1.00 41.39  ? 1364 GLU A CB   1 
ATOM   2087 C CG   . GLU A 1 223 ? 28.509 13.661  -23.370 1.00 55.75  ? 1364 GLU A CG   1 
ATOM   2088 C CD   . GLU A 1 223 ? 29.486 13.072  -24.364 1.00 60.78  ? 1364 GLU A CD   1 
ATOM   2089 O OE1  . GLU A 1 223 ? 30.228 12.137  -23.985 1.00 65.05  ? 1364 GLU A OE1  1 
ATOM   2090 O OE2  . GLU A 1 223 ? 29.532 13.571  -25.512 1.00 57.87  ? 1364 GLU A OE2  1 
ATOM   2091 H H    . GLU A 1 223 ? 25.701 13.846  -22.359 1.00 0.00   ? 1364 GLU A H    1 
ATOM   2092 N N    . HIS A 1 224 ? 28.408 15.450  -20.923 1.00 39.41  ? 1365 HIS A N    1 
ATOM   2093 C CA   . HIS A 1 224 ? 29.313 16.423  -20.326 1.00 34.34  ? 1365 HIS A CA   1 
ATOM   2094 C C    . HIS A 1 224 ? 28.582 17.688  -19.950 1.00 36.75  ? 1365 HIS A C    1 
ATOM   2095 O O    . HIS A 1 224 ? 27.824 18.241  -20.750 1.00 39.31  ? 1365 HIS A O    1 
ATOM   2096 C CB   . HIS A 1 224 ? 30.469 16.738  -21.267 1.00 35.59  ? 1365 HIS A CB   1 
ATOM   2097 C CG   . HIS A 1 224 ? 31.260 15.534  -21.656 1.00 30.01  ? 1365 HIS A CG   1 
ATOM   2098 N ND1  . HIS A 1 224 ? 31.372 14.428  -20.843 1.00 38.25  ? 1365 HIS A ND1  1 
ATOM   2099 C CD2  . HIS A 1 224 ? 31.941 15.238  -22.785 1.00 38.09  ? 1365 HIS A CD2  1 
ATOM   2100 C CE1  . HIS A 1 224 ? 32.081 13.502  -21.456 1.00 39.71  ? 1365 HIS A CE1  1 
ATOM   2101 N NE2  . HIS A 1 224 ? 32.439 13.967  -22.639 1.00 45.42  ? 1365 HIS A NE2  1 
ATOM   2102 H H    . HIS A 1 224 ? 27.838 15.751  -21.671 1.00 0.00   ? 1365 HIS A H    1 
ATOM   2103 H HD1  . HIS A 1 224 ? 31.012 14.340  -19.922 1.00 0.00   ? 1365 HIS A HD1  1 
ATOM   2104 H HE2  . HIS A 1 224 ? 32.853 13.429  -23.344 1.00 0.00   ? 1365 HIS A HE2  1 
ATOM   2105 N N    . PHE A 1 225 ? 28.801 18.136  -18.719 1.00 37.74  ? 1366 PHE A N    1 
ATOM   2106 C CA   . PHE A 1 225 ? 28.162 19.336  -18.208 1.00 37.14  ? 1366 PHE A CA   1 
ATOM   2107 C C    . PHE A 1 225 ? 29.032 19.928  -17.105 1.00 44.78  ? 1366 PHE A C    1 
ATOM   2108 O O    . PHE A 1 225 ? 29.613 19.202  -16.298 1.00 50.03  ? 1366 PHE A O    1 
ATOM   2109 C CB   . PHE A 1 225 ? 26.772 19.004  -17.683 1.00 32.44  ? 1366 PHE A CB   1 
ATOM   2110 C CG   . PHE A 1 225 ? 26.773 17.941  -16.640 1.00 25.60  ? 1366 PHE A CG   1 
ATOM   2111 C CD1  . PHE A 1 225 ? 26.993 16.616  -16.989 1.00 21.20  ? 1366 PHE A CD1  1 
ATOM   2112 C CD2  . PHE A 1 225 ? 26.592 18.266  -15.306 1.00 18.00  ? 1366 PHE A CD2  1 
ATOM   2113 C CE1  . PHE A 1 225 ? 27.036 15.626  -16.026 1.00 29.69  ? 1366 PHE A CE1  1 
ATOM   2114 C CE2  . PHE A 1 225 ? 26.635 17.283  -14.337 1.00 26.28  ? 1366 PHE A CE2  1 
ATOM   2115 C CZ   . PHE A 1 225 ? 26.858 15.957  -14.700 1.00 17.82  ? 1366 PHE A CZ   1 
ATOM   2116 H H    . PHE A 1 225 ? 29.422 17.650  -18.119 1.00 0.00   ? 1366 PHE A H    1 
ATOM   2117 N N    . SER A 1 226 ? 29.087 21.252  -17.065 1.00 52.70  ? 1367 SER A N    1 
ATOM   2118 C CA   . SER A 1 226 ? 29.914 21.982  -16.115 1.00 58.20  ? 1367 SER A CA   1 
ATOM   2119 C C    . SER A 1 226 ? 29.673 21.809  -14.620 1.00 58.11  ? 1367 SER A C    1 
ATOM   2120 O O    . SER A 1 226 ? 30.557 21.311  -13.921 1.00 61.83  ? 1367 SER A O    1 
ATOM   2121 C CB   . SER A 1 226 ? 29.912 23.473  -16.467 1.00 61.33  ? 1367 SER A CB   1 
ATOM   2122 O OG   . SER A 1 226 ? 30.131 23.676  -17.857 1.00 68.99  ? 1367 SER A OG   1 
ATOM   2123 H H    . SER A 1 226 ? 28.597 21.797  -17.712 1.00 0.00   ? 1367 SER A H    1 
ATOM   2124 H HG   . SER A 1 226 ? 30.039 24.625  -18.013 1.00 0.00   ? 1367 SER A HG   1 
ATOM   2125 N N    . GLY A 1 227 ? 28.494 22.194  -14.132 1.00 56.54  ? 1368 GLY A N    1 
ATOM   2126 C CA   . GLY A 1 227 ? 28.230 22.121  -12.699 1.00 56.60  ? 1368 GLY A CA   1 
ATOM   2127 C C    . GLY A 1 227 ? 27.319 21.068  -12.088 1.00 54.39  ? 1368 GLY A C    1 
ATOM   2128 O O    . GLY A 1 227 ? 27.586 19.873  -12.160 1.00 57.26  ? 1368 GLY A O    1 
ATOM   2129 H H    . GLY A 1 227 ? 27.817 22.526  -14.750 1.00 0.00   ? 1368 GLY A H    1 
ATOM   2130 N N    . ARG A 1 228 ? 26.283 21.529  -11.394 1.00 53.95  ? 1369 ARG A N    1 
ATOM   2131 C CA   . ARG A 1 228 ? 25.328 20.637  -10.742 1.00 52.12  ? 1369 ARG A CA   1 
ATOM   2132 C C    . ARG A 1 228 ? 24.219 20.264  -11.728 1.00 48.56  ? 1369 ARG A C    1 
ATOM   2133 O O    . ARG A 1 228 ? 23.672 21.134  -12.414 1.00 51.45  ? 1369 ARG A O    1 
ATOM   2134 C CB   . ARG A 1 228 ? 24.715 21.321  -9.506  1.00 51.46  ? 1369 ARG A CB   1 
ATOM   2135 C CG   . ARG A 1 228 ? 24.275 20.360  -8.391  1.00 48.62  ? 1369 ARG A CG   1 
ATOM   2136 C CD   . ARG A 1 228 ? 23.185 20.959  -7.499  1.00 49.16  ? 1369 ARG A CD   1 
ATOM   2137 N NE   . ARG A 1 228 ? 21.931 21.137  -8.232  1.00 66.47  ? 1369 ARG A NE   1 
ATOM   2138 C CZ   . ARG A 1 228 ? 20.709 21.079  -7.701  1.00 65.16  ? 1369 ARG A CZ   1 
ATOM   2139 N NH1  . ARG A 1 228 ? 20.544 20.892  -6.398  1.00 64.25  ? 1369 ARG A NH1  1 
ATOM   2140 N NH2  . ARG A 1 228 ? 19.648 21.255  -8.482  1.00 65.75  ? 1369 ARG A NH2  1 
ATOM   2141 H H    . ARG A 1 228 ? 26.151 22.492  -11.314 1.00 0.00   ? 1369 ARG A H    1 
ATOM   2142 H HE   . ARG A 1 228 ? 22.004 21.323  -9.198  1.00 0.00   ? 1369 ARG A HE   1 
ATOM   2143 H HH11 . ARG A 1 228 ? 21.349 20.814  -5.826  1.00 0.00   ? 1369 ARG A HH11 1 
ATOM   2144 H HH12 . ARG A 1 228 ? 19.621 20.842  -6.006  1.00 0.00   ? 1369 ARG A HH12 1 
ATOM   2145 H HH21 . ARG A 1 228 ? 19.834 21.457  -9.455  1.00 0.00   ? 1369 ARG A HH21 1 
ATOM   2146 H HH22 . ARG A 1 228 ? 18.699 21.202  -8.170  1.00 0.00   ? 1369 ARG A HH22 1 
ATOM   2147 N N    . PRO A 1 229 ? 23.891 18.964  -11.833 1.00 42.44  ? 1370 PRO A N    1 
ATOM   2148 C CA   . PRO A 1 229 ? 22.838 18.511  -12.744 1.00 37.06  ? 1370 PRO A CA   1 
ATOM   2149 C C    . PRO A 1 229 ? 21.527 19.113  -12.274 1.00 35.61  ? 1370 PRO A C    1 
ATOM   2150 O O    . PRO A 1 229 ? 21.305 19.251  -11.066 1.00 33.54  ? 1370 PRO A O    1 
ATOM   2151 C CB   . PRO A 1 229 ? 22.830 16.998  -12.532 1.00 40.86  ? 1370 PRO A CB   1 
ATOM   2152 C CG   . PRO A 1 229 ? 24.200 16.697  -12.046 1.00 42.98  ? 1370 PRO A CG   1 
ATOM   2153 C CD   . PRO A 1 229 ? 24.478 17.824  -11.112 1.00 39.45  ? 1370 PRO A CD   1 
ATOM   2154 N N    . ARG A 1 230 ? 20.671 19.494  -13.219 1.00 37.64  ? 1371 ARG A N    1 
ATOM   2155 C CA   . ARG A 1 230 ? 19.376 20.085  -12.882 1.00 34.86  ? 1371 ARG A CA   1 
ATOM   2156 C C    . ARG A 1 230 ? 18.447 19.010  -12.344 1.00 32.88  ? 1371 ARG A C    1 
ATOM   2157 O O    . ARG A 1 230 ? 18.417 17.890  -12.866 1.00 34.89  ? 1371 ARG A O    1 
ATOM   2158 C CB   . ARG A 1 230 ? 18.748 20.823  -14.073 1.00 41.53  ? 1371 ARG A CB   1 
ATOM   2159 C CG   . ARG A 1 230 ? 19.045 20.241  -15.440 1.00 54.88  ? 1371 ARG A CG   1 
ATOM   2160 C CD   . ARG A 1 230 ? 20.423 20.629  -15.945 1.00 62.85  ? 1371 ARG A CD   1 
ATOM   2161 N NE   . ARG A 1 230 ? 21.247 19.449  -16.211 1.00 73.54  ? 1371 ARG A NE   1 
ATOM   2162 C CZ   . ARG A 1 230 ? 22.541 19.481  -16.526 1.00 74.72  ? 1371 ARG A CZ   1 
ATOM   2163 N NH1  . ARG A 1 230 ? 23.192 20.630  -16.621 1.00 79.81  ? 1371 ARG A NH1  1 
ATOM   2164 N NH2  . ARG A 1 230 ? 23.191 18.349  -16.718 1.00 72.65  ? 1371 ARG A NH2  1 
ATOM   2165 H H    . ARG A 1 230 ? 20.932 19.285  -14.123 1.00 0.00   ? 1371 ARG A H    1 
ATOM   2166 H HE   . ARG A 1 230 ? 20.767 18.588  -16.131 1.00 0.00   ? 1371 ARG A HE   1 
ATOM   2167 H HH11 . ARG A 1 230 ? 22.749 21.514  -16.409 1.00 0.00   ? 1371 ARG A HH11 1 
ATOM   2168 H HH12 . ARG A 1 230 ? 24.160 20.703  -16.861 1.00 0.00   ? 1371 ARG A HH12 1 
ATOM   2169 H HH21 . ARG A 1 230 ? 22.650 17.531  -16.587 1.00 0.00   ? 1371 ARG A HH21 1 
ATOM   2170 H HH22 . ARG A 1 230 ? 24.161 18.292  -16.967 1.00 0.00   ? 1371 ARG A HH22 1 
ATOM   2171 N N    . GLU A 1 231 ? 17.718 19.354  -11.285 1.00 31.78  ? 1372 GLU A N    1 
ATOM   2172 C CA   . GLU A 1 231 ? 16.811 18.427  -10.621 1.00 35.11  ? 1372 GLU A CA   1 
ATOM   2173 C C    . GLU A 1 231 ? 15.419 19.008  -10.463 1.00 32.69  ? 1372 GLU A C    1 
ATOM   2174 O O    . GLU A 1 231 ? 15.252 20.229  -10.386 1.00 31.67  ? 1372 GLU A O    1 
ATOM   2175 C CB   . GLU A 1 231 ? 17.308 18.111  -9.208  1.00 37.24  ? 1372 GLU A CB   1 
ATOM   2176 C CG   . GLU A 1 231 ? 18.754 17.682  -9.067  1.00 36.46  ? 1372 GLU A CG   1 
ATOM   2177 C CD   . GLU A 1 231 ? 19.134 17.496  -7.611  1.00 40.43  ? 1372 GLU A CD   1 
ATOM   2178 O OE1  . GLU A 1 231 ? 18.302 17.806  -6.732  1.00 30.40  ? 1372 GLU A OE1  1 
ATOM   2179 O OE2  . GLU A 1 231 ? 20.264 17.044  -7.329  1.00 40.43  ? 1372 GLU A OE2  1 
ATOM   2180 H H    . GLU A 1 231 ? 17.734 20.266  -10.944 1.00 0.00   ? 1372 GLU A H    1 
ATOM   2181 N N    . ASP A 1 232 ? 14.452 18.114  -10.273 1.00 21.34  ? 1373 ASP A N    1 
ATOM   2182 C CA   . ASP A 1 232 ? 13.059 18.483  -10.077 1.00 27.26  ? 1373 ASP A CA   1 
ATOM   2183 C C    . ASP A 1 232 ? 12.526 17.687  -8.883  1.00 33.39  ? 1373 ASP A C    1 
ATOM   2184 O O    . ASP A 1 232 ? 12.857 16.516  -8.721  1.00 38.09  ? 1373 ASP A O    1 
ATOM   2185 C CB   . ASP A 1 232 ? 12.246 18.183  -11.339 1.00 25.31  ? 1373 ASP A CB   1 
ATOM   2186 C CG   . ASP A 1 232 ? 12.617 19.096  -12.509 1.00 29.59  ? 1373 ASP A CG   1 
ATOM   2187 O OD1  . ASP A 1 232 ? 12.089 20.224  -12.582 1.00 33.36  ? 1373 ASP A OD1  1 
ATOM   2188 O OD2  . ASP A 1 232 ? 13.442 18.702  -13.355 1.00 27.71  ? 1373 ASP A OD2  1 
ATOM   2189 H H    . ASP A 1 232 ? 14.679 17.159  -10.240 1.00 0.00   ? 1373 ASP A H    1 
ATOM   2190 N N    . ARG A 1 233 ? 11.750 18.338  -8.021  1.00 32.04  ? 1374 ARG A N    1 
ATOM   2191 C CA   . ARG A 1 233 ? 11.185 17.691  -6.834  1.00 30.33  ? 1374 ARG A CA   1 
ATOM   2192 C C    . ARG A 1 233 ? 9.671  17.775  -6.969  1.00 27.64  ? 1374 ARG A C    1 
ATOM   2193 O O    . ARG A 1 233 ? 9.096  18.861  -6.904  1.00 32.94  ? 1374 ARG A O    1 
ATOM   2194 C CB   . ARG A 1 233 ? 11.636 18.424  -5.560  1.00 33.40  ? 1374 ARG A CB   1 
ATOM   2195 C CG   . ARG A 1 233 ? 13.151 18.545  -5.389  1.00 34.65  ? 1374 ARG A CG   1 
ATOM   2196 C CD   . ARG A 1 233 ? 13.734 17.415  -4.555  1.00 56.96  ? 1374 ARG A CD   1 
ATOM   2197 N NE   . ARG A 1 233 ? 13.634 17.646  -3.108  1.00 64.87  ? 1374 ARG A NE   1 
ATOM   2198 C CZ   . ARG A 1 233 ? 12.620 17.251  -2.335  1.00 67.32  ? 1374 ARG A CZ   1 
ATOM   2199 N NH1  . ARG A 1 233 ? 11.581 16.606  -2.857  1.00 70.48  ? 1374 ARG A NH1  1 
ATOM   2200 N NH2  . ARG A 1 233 ? 12.665 17.461  -1.025  1.00 68.11  ? 1374 ARG A NH2  1 
ATOM   2201 H H    . ARG A 1 233 ? 11.500 19.268  -8.230  1.00 0.00   ? 1374 ARG A H    1 
ATOM   2202 H HE   . ARG A 1 233 ? 14.348 18.211  -2.723  1.00 0.00   ? 1374 ARG A HE   1 
ATOM   2203 H HH11 . ARG A 1 233 ? 11.525 16.415  -3.840  1.00 0.00   ? 1374 ARG A HH11 1 
ATOM   2204 H HH12 . ARG A 1 233 ? 10.792 16.317  -2.301  1.00 0.00   ? 1374 ARG A HH12 1 
ATOM   2205 H HH21 . ARG A 1 233 ? 13.424 17.927  -0.568  1.00 0.00   ? 1374 ARG A HH21 1 
ATOM   2206 H HH22 . ARG A 1 233 ? 11.895 17.186  -0.420  1.00 0.00   ? 1374 ARG A HH22 1 
ATOM   2207 N N    . VAL A 1 234 ? 9.019  16.636  -7.148  1.00 26.94  ? 1375 VAL A N    1 
ATOM   2208 C CA   . VAL A 1 234 ? 7.570  16.625  -7.321  1.00 32.48  ? 1375 VAL A CA   1 
ATOM   2209 C C    . VAL A 1 234 ? 6.848  15.874  -6.210  1.00 30.89  ? 1375 VAL A C    1 
ATOM   2210 O O    . VAL A 1 234 ? 7.482  15.196  -5.413  1.00 35.56  ? 1375 VAL A O    1 
ATOM   2211 C CB   . VAL A 1 234 ? 7.159  16.001  -8.707  1.00 33.77  ? 1375 VAL A CB   1 
ATOM   2212 C CG1  . VAL A 1 234 ? 7.683  16.854  -9.868  1.00 28.43  ? 1375 VAL A CG1  1 
ATOM   2213 C CG2  . VAL A 1 234 ? 7.665  14.568  -8.827  1.00 20.25  ? 1375 VAL A CG2  1 
ATOM   2214 H H    . VAL A 1 234 ? 9.511  15.790  -7.125  1.00 0.00   ? 1375 VAL A H    1 
ATOM   2215 N N    . PRO A 1 235 ? 5.526  16.078  -6.085  1.00 33.18  ? 1376 PRO A N    1 
ATOM   2216 C CA   . PRO A 1 235 ? 4.698  15.413  -5.071  1.00 35.66  ? 1376 PRO A CA   1 
ATOM   2217 C C    . PRO A 1 235 ? 4.444  13.957  -5.474  1.00 33.49  ? 1376 PRO A C    1 
ATOM   2218 O O    . PRO A 1 235 ? 4.579  13.595  -6.649  1.00 35.78  ? 1376 PRO A O    1 
ATOM   2219 C CB   . PRO A 1 235 ? 3.402  16.224  -5.103  1.00 36.36  ? 1376 PRO A CB   1 
ATOM   2220 C CG   . PRO A 1 235 ? 3.855  17.569  -5.530  1.00 42.18  ? 1376 PRO A CG   1 
ATOM   2221 C CD   . PRO A 1 235 ? 4.800  17.225  -6.652  1.00 33.29  ? 1376 PRO A CD   1 
ATOM   2222 N N    . HIS A 1 236 ? 4.040  13.138  -4.508  1.00 31.94  ? 1377 HIS A N    1 
ATOM   2223 C CA   . HIS A 1 236 ? 3.788  11.724  -4.757  1.00 33.68  ? 1377 HIS A CA   1 
ATOM   2224 C C    . HIS A 1 236 ? 2.691  11.494  -5.792  1.00 34.27  ? 1377 HIS A C    1 
ATOM   2225 O O    . HIS A 1 236 ? 2.560  10.400  -6.333  1.00 36.09  ? 1377 HIS A O    1 
ATOM   2226 C CB   . HIS A 1 236 ? 3.435  10.999  -3.452  1.00 36.97  ? 1377 HIS A CB   1 
ATOM   2227 C CG   . HIS A 1 236 ? 2.043  11.260  -2.972  1.00 44.02  ? 1377 HIS A CG   1 
ATOM   2228 N ND1  . HIS A 1 236 ? 1.728  12.309  -2.139  1.00 51.67  ? 1377 HIS A ND1  1 
ATOM   2229 C CD2  . HIS A 1 236 ? 0.877  10.621  -3.234  1.00 43.26  ? 1377 HIS A CD2  1 
ATOM   2230 C CE1  . HIS A 1 236 ? 0.426  12.313  -1.909  1.00 51.79  ? 1377 HIS A CE1  1 
ATOM   2231 N NE2  . HIS A 1 236 ? -0.113 11.300  -2.563  1.00 45.70  ? 1377 HIS A NE2  1 
ATOM   2232 H H    . HIS A 1 236 ? 3.934  13.522  -3.609  1.00 0.00   ? 1377 HIS A H    1 
ATOM   2233 H HD1  . HIS A 1 236 ? 2.348  12.948  -1.712  1.00 0.00   ? 1377 HIS A HD1  1 
ATOM   2234 H HE2  . HIS A 1 236 ? -1.062 11.068  -2.565  1.00 0.00   ? 1377 HIS A HE2  1 
ATOM   2235 N N    . SER A 1 237 ? 1.883  12.514  -6.039  1.00 36.91  ? 1378 SER A N    1 
ATOM   2236 C CA   . SER A 1 237 ? 0.797  12.411  -7.003  1.00 39.38  ? 1378 SER A CA   1 
ATOM   2237 C C    . SER A 1 237 ? 1.271  12.371  -8.462  1.00 37.36  ? 1378 SER A C    1 
ATOM   2238 O O    . SER A 1 237 ? 0.516  11.976  -9.351  1.00 36.39  ? 1378 SER A O    1 
ATOM   2239 C CB   . SER A 1 237 ? -0.181 13.567  -6.787  1.00 42.92  ? 1378 SER A CB   1 
ATOM   2240 O OG   . SER A 1 237 ? 0.500  14.733  -6.338  1.00 48.16  ? 1378 SER A OG   1 
ATOM   2241 H H    . SER A 1 237 ? 1.997  13.393  -5.622  1.00 0.00   ? 1378 SER A H    1 
ATOM   2242 H HG   . SER A 1 237 ? 0.280  15.449  -6.962  1.00 0.00   ? 1378 SER A HG   1 
ATOM   2243 N N    . ARG A 1 238 ? 2.527  12.743  -8.694  1.00 35.97  ? 1379 ARG A N    1 
ATOM   2244 C CA   . ARG A 1 238 ? 3.096  12.770  -10.041 1.00 33.75  ? 1379 ARG A CA   1 
ATOM   2245 C C    . ARG A 1 238 ? 3.848  11.508  -10.479 1.00 30.66  ? 1379 ARG A C    1 
ATOM   2246 O O    . ARG A 1 238 ? 4.652  10.961  -9.731  1.00 28.89  ? 1379 ARG A O    1 
ATOM   2247 C CB   . ARG A 1 238 ? 4.011  13.989  -10.185 1.00 32.40  ? 1379 ARG A CB   1 
ATOM   2248 C CG   . ARG A 1 238 ? 3.262  15.308  -10.180 1.00 33.68  ? 1379 ARG A CG   1 
ATOM   2249 C CD   . ARG A 1 238 ? 3.236  15.961  -11.560 1.00 32.85  ? 1379 ARG A CD   1 
ATOM   2250 N NE   . ARG A 1 238 ? 4.001  17.206  -11.533 1.00 39.98  ? 1379 ARG A NE   1 
ATOM   2251 C CZ   . ARG A 1 238 ? 5.084  17.449  -12.266 1.00 39.31  ? 1379 ARG A CZ   1 
ATOM   2252 N NH1  . ARG A 1 238 ? 5.538  16.536  -13.112 1.00 37.47  ? 1379 ARG A NH1  1 
ATOM   2253 N NH2  . ARG A 1 238 ? 5.739  18.595  -12.116 1.00 48.39  ? 1379 ARG A NH2  1 
ATOM   2254 H H    . ARG A 1 238 ? 3.109  12.988  -7.944  1.00 0.00   ? 1379 ARG A H    1 
ATOM   2255 H HE   . ARG A 1 238 ? 3.642  17.887  -10.909 1.00 0.00   ? 1379 ARG A HE   1 
ATOM   2256 H HH11 . ARG A 1 238 ? 5.071  15.648  -13.210 1.00 0.00   ? 1379 ARG A HH11 1 
ATOM   2257 H HH12 . ARG A 1 238 ? 6.339  16.671  -13.681 1.00 0.00   ? 1379 ARG A HH12 1 
ATOM   2258 H HH21 . ARG A 1 238 ? 5.396  19.283  -11.467 1.00 0.00   ? 1379 ARG A HH21 1 
ATOM   2259 H HH22 . ARG A 1 238 ? 6.578  18.869  -12.608 1.00 0.00   ? 1379 ARG A HH22 1 
ATOM   2260 N N    . ASN A 1 239 ? 3.598  11.065  -11.708 1.00 29.56  ? 1380 ASN A N    1 
ATOM   2261 C CA   . ASN A 1 239 ? 4.275  9.886   -12.245 1.00 34.70  ? 1380 ASN A CA   1 
ATOM   2262 C C    . ASN A 1 239 ? 4.918  10.171  -13.611 1.00 28.51  ? 1380 ASN A C    1 
ATOM   2263 O O    . ASN A 1 239 ? 5.308  9.250   -14.349 1.00 24.31  ? 1380 ASN A O    1 
ATOM   2264 C CB   . ASN A 1 239 ? 3.323  8.683   -12.311 1.00 40.29  ? 1380 ASN A CB   1 
ATOM   2265 C CG   . ASN A 1 239 ? 2.176  8.894   -13.268 1.00 51.32  ? 1380 ASN A CG   1 
ATOM   2266 O OD1  . ASN A 1 239 ? 1.740  10.025  -13.495 1.00 59.77  ? 1380 ASN A OD1  1 
ATOM   2267 N ND2  . ASN A 1 239 ? 1.672  7.803   -13.836 1.00 61.83  ? 1380 ASN A ND2  1 
ATOM   2268 H H    . ASN A 1 239 ? 2.913  11.500  -12.261 1.00 0.00   ? 1380 ASN A H    1 
ATOM   2269 H HD21 . ASN A 1 239 ? 0.921  7.912   -14.457 1.00 0.00   ? 1380 ASN A HD21 1 
ATOM   2270 H HD22 . ASN A 1 239 ? 2.061  6.931   -13.609 1.00 0.00   ? 1380 ASN A HD22 1 
ATOM   2271 N N    . SER A 1 240 ? 5.069  11.458  -13.915 1.00 28.51  ? 1381 SER A N    1 
ATOM   2272 C CA   . SER A 1 240 ? 5.690  11.900  -15.159 1.00 20.94  ? 1381 SER A CA   1 
ATOM   2273 C C    . SER A 1 240 ? 6.148  13.338  -15.006 1.00 21.21  ? 1381 SER A C    1 
ATOM   2274 O O    . SER A 1 240 ? 5.721  14.040  -14.086 1.00 23.14  ? 1381 SER A O    1 
ATOM   2275 C CB   . SER A 1 240 ? 4.688  11.842  -16.305 1.00 20.72  ? 1381 SER A CB   1 
ATOM   2276 O OG   . SER A 1 240 ? 3.666  12.801  -16.113 1.00 25.80  ? 1381 SER A OG   1 
ATOM   2277 H H    . SER A 1 240 ? 4.756  12.161  -13.314 1.00 0.00   ? 1381 SER A H    1 
ATOM   2278 H HG   . SER A 1 240 ? 3.981  13.694  -16.288 1.00 0.00   ? 1381 SER A HG   1 
ATOM   2279 N N    . ILE A 1 241 ? 7.034  13.771  -15.892 1.00 20.82  ? 1382 ILE A N    1 
ATOM   2280 C CA   . ILE A 1 241 ? 7.500  15.148  -15.894 1.00 16.31  ? 1382 ILE A CA   1 
ATOM   2281 C C    . ILE A 1 241 ? 8.028  15.444  -17.295 1.00 23.91  ? 1382 ILE A C    1 
ATOM   2282 O O    . ILE A 1 241 ? 8.574  14.565  -17.953 1.00 20.20  ? 1382 ILE A O    1 
ATOM   2283 C CB   . ILE A 1 241 ? 8.590  15.446  -14.803 1.00 23.43  ? 1382 ILE A CB   1 
ATOM   2284 C CG1  . ILE A 1 241 ? 8.820  16.965  -14.725 1.00 22.55  ? 1382 ILE A CG1  1 
ATOM   2285 C CG2  . ILE A 1 241 ? 9.909  14.702  -15.094 1.00 8.73   ? 1382 ILE A CG2  1 
ATOM   2286 C CD1  . ILE A 1 241 ? 9.761  17.421  -13.637 1.00 21.36  ? 1382 ILE A CD1  1 
ATOM   2287 H H    . ILE A 1 241 ? 7.402  13.166  -16.572 1.00 0.00   ? 1382 ILE A H    1 
ATOM   2288 N N    . THR A 1 242 ? 7.774  16.652  -17.780 1.00 22.51  ? 1383 THR A N    1 
ATOM   2289 C CA   . THR A 1 242 ? 8.244  17.053  -19.094 1.00 20.28  ? 1383 THR A CA   1 
ATOM   2290 C C    . THR A 1 242 ? 9.466  17.921  -18.852 1.00 21.21  ? 1383 THR A C    1 
ATOM   2291 O O    . THR A 1 242 ? 9.363  18.971  -18.221 1.00 22.09  ? 1383 THR A O    1 
ATOM   2292 C CB   . THR A 1 242 ? 7.134  17.832  -19.828 1.00 21.21  ? 1383 THR A CB   1 
ATOM   2293 O OG1  . THR A 1 242 ? 5.989  16.982  -19.948 1.00 24.72  ? 1383 THR A OG1  1 
ATOM   2294 C CG2  . THR A 1 242 ? 7.569  18.255  -21.220 1.00 14.45  ? 1383 THR A CG2  1 
ATOM   2295 H H    . THR A 1 242 ? 7.239  17.301  -17.285 1.00 0.00   ? 1383 THR A H    1 
ATOM   2296 H HG1  . THR A 1 242 ? 6.236  16.312  -20.614 1.00 0.00   ? 1383 THR A HG1  1 
ATOM   2297 N N    . LEU A 1 243 ? 10.636 17.440  -19.254 1.00 21.09  ? 1384 LEU A N    1 
ATOM   2298 C CA   . LEU A 1 243 ? 11.863 18.210  -19.067 1.00 22.55  ? 1384 LEU A CA   1 
ATOM   2299 C C    . LEU A 1 243 ? 11.980 19.145  -20.253 1.00 22.36  ? 1384 LEU A C    1 
ATOM   2300 O O    . LEU A 1 243 ? 11.787 18.728  -21.394 1.00 21.03  ? 1384 LEU A O    1 
ATOM   2301 C CB   . LEU A 1 243 ? 13.077 17.290  -18.966 1.00 17.15  ? 1384 LEU A CB   1 
ATOM   2302 C CG   . LEU A 1 243 ? 13.019 16.285  -17.816 1.00 16.48  ? 1384 LEU A CG   1 
ATOM   2303 C CD1  . LEU A 1 243 ? 14.284 15.469  -17.847 1.00 18.90  ? 1384 LEU A CD1  1 
ATOM   2304 C CD2  . LEU A 1 243 ? 12.861 16.990  -16.475 1.00 12.03  ? 1384 LEU A CD2  1 
ATOM   2305 H H    . LEU A 1 243 ? 10.696 16.573  -19.699 1.00 0.00   ? 1384 LEU A H    1 
ATOM   2306 N N    . THR A 1 244 ? 12.257 20.414  -19.968 1.00 27.61  ? 1385 THR A N    1 
ATOM   2307 C CA   . THR A 1 244 ? 12.347 21.450  -20.993 1.00 22.53  ? 1385 THR A CA   1 
ATOM   2308 C C    . THR A 1 244 ? 13.715 22.127  -21.051 1.00 21.63  ? 1385 THR A C    1 
ATOM   2309 O O    . THR A 1 244 ? 14.547 21.954  -20.159 1.00 22.24  ? 1385 THR A O    1 
ATOM   2310 C CB   . THR A 1 244 ? 11.236 22.528  -20.774 1.00 25.94  ? 1385 THR A CB   1 
ATOM   2311 O OG1  . THR A 1 244 ? 11.399 23.153  -19.488 1.00 36.75  ? 1385 THR A OG1  1 
ATOM   2312 C CG2  . THR A 1 244 ? 9.842  21.887  -20.822 1.00 22.10  ? 1385 THR A CG2  1 
ATOM   2313 H H    . THR A 1 244 ? 12.456 20.677  -19.046 1.00 0.00   ? 1385 THR A H    1 
ATOM   2314 H HG1  . THR A 1 244 ? 10.683 23.791  -19.378 1.00 0.00   ? 1385 THR A HG1  1 
ATOM   2315 N N    . ASN A 1 245 ? 13.925 22.915  -22.101 1.00 23.59  ? 1386 ASN A N    1 
ATOM   2316 C CA   . ASN A 1 245 ? 15.171 23.634  -22.328 1.00 24.17  ? 1386 ASN A CA   1 
ATOM   2317 C C    . ASN A 1 245 ? 16.330 22.693  -22.589 1.00 21.77  ? 1386 ASN A C    1 
ATOM   2318 O O    . ASN A 1 245 ? 17.475 22.989  -22.249 1.00 29.70  ? 1386 ASN A O    1 
ATOM   2319 C CB   . ASN A 1 245 ? 15.495 24.559  -21.157 1.00 29.26  ? 1386 ASN A CB   1 
ATOM   2320 C CG   . ASN A 1 245 ? 14.489 25.667  -21.004 1.00 35.47  ? 1386 ASN A CG   1 
ATOM   2321 O OD1  . ASN A 1 245 ? 13.712 25.941  -21.915 1.00 43.88  ? 1386 ASN A OD1  1 
ATOM   2322 N ND2  . ASN A 1 245 ? 14.481 26.305  -19.844 1.00 48.46  ? 1386 ASN A ND2  1 
ATOM   2323 H H    . ASN A 1 245 ? 13.219 23.020  -22.783 1.00 0.00   ? 1386 ASN A H    1 
ATOM   2324 H HD21 . ASN A 1 245 ? 13.847 27.036  -19.719 1.00 0.00   ? 1386 ASN A HD21 1 
ATOM   2325 H HD22 . ASN A 1 245 ? 15.113 26.025  -19.149 1.00 0.00   ? 1386 ASN A HD22 1 
ATOM   2326 N N    . LEU A 1 246 ? 16.045 21.558  -23.210 1.00 18.45  ? 1387 LEU A N    1 
ATOM   2327 C CA   . LEU A 1 246 ? 17.100 20.602  -23.484 1.00 18.14  ? 1387 LEU A CA   1 
ATOM   2328 C C    . LEU A 1 246 ? 17.739 20.995  -24.813 1.00 23.66  ? 1387 LEU A C    1 
ATOM   2329 O O    . LEU A 1 246 ? 17.112 21.665  -25.628 1.00 26.17  ? 1387 LEU A O    1 
ATOM   2330 C CB   . LEU A 1 246 ? 16.550 19.161  -23.520 1.00 13.37  ? 1387 LEU A CB   1 
ATOM   2331 C CG   . LEU A 1 246 ? 15.727 18.636  -22.338 1.00 13.37  ? 1387 LEU A CG   1 
ATOM   2332 C CD1  . LEU A 1 246 ? 15.320 17.230  -22.599 1.00 9.96   ? 1387 LEU A CD1  1 
ATOM   2333 C CD2  . LEU A 1 246 ? 16.505 18.709  -21.053 1.00 15.74  ? 1387 LEU A CD2  1 
ATOM   2334 H H    . LEU A 1 246 ? 15.131 21.395  -23.511 1.00 0.00   ? 1387 LEU A H    1 
ATOM   2335 N N    . THR A 1 247 ? 18.997 20.625  -25.005 1.00 19.69  ? 1388 THR A N    1 
ATOM   2336 C CA   . THR A 1 247 ? 19.707 20.949  -26.222 1.00 31.84  ? 1388 THR A CA   1 
ATOM   2337 C C    . THR A 1 247 ? 19.359 19.892  -27.268 1.00 33.79  ? 1388 THR A C    1 
ATOM   2338 O O    . THR A 1 247 ? 19.207 18.717  -26.928 1.00 33.14  ? 1388 THR A O    1 
ATOM   2339 C CB   . THR A 1 247 ? 21.212 21.015  -25.940 1.00 35.88  ? 1388 THR A CB   1 
ATOM   2340 O OG1  . THR A 1 247 ? 21.647 19.774  -25.376 1.00 52.57  ? 1388 THR A OG1  1 
ATOM   2341 C CG2  . THR A 1 247 ? 21.491 22.113  -24.931 1.00 35.98  ? 1388 THR A CG2  1 
ATOM   2342 H H    . THR A 1 247 ? 19.468 20.145  -24.304 1.00 0.00   ? 1388 THR A H    1 
ATOM   2343 H HG1  . THR A 1 247 ? 21.853 19.160  -26.102 1.00 0.00   ? 1388 THR A HG1  1 
ATOM   2344 N N    . PRO A 1 248 ? 19.200 20.300  -28.545 1.00 32.49  ? 1389 PRO A N    1 
ATOM   2345 C CA   . PRO A 1 248 ? 18.855 19.393  -29.647 1.00 30.93  ? 1389 PRO A CA   1 
ATOM   2346 C C    . PRO A 1 248 ? 19.839 18.253  -29.839 1.00 30.60  ? 1389 PRO A C    1 
ATOM   2347 O O    . PRO A 1 248 ? 21.022 18.386  -29.511 1.00 29.41  ? 1389 PRO A O    1 
ATOM   2348 C CB   . PRO A 1 248 ? 18.828 20.323  -30.866 1.00 26.74  ? 1389 PRO A CB   1 
ATOM   2349 C CG   . PRO A 1 248 ? 18.441 21.641  -30.276 1.00 31.71  ? 1389 PRO A CG   1 
ATOM   2350 C CD   . PRO A 1 248 ? 19.304 21.685  -29.037 1.00 32.86  ? 1389 PRO A CD   1 
ATOM   2351 N N    . GLY A 1 249 ? 19.318 17.131  -30.331 1.00 31.22  ? 1390 GLY A N    1 
ATOM   2352 C CA   . GLY A 1 249 ? 20.114 15.943  -30.585 1.00 25.55  ? 1390 GLY A CA   1 
ATOM   2353 C C    . GLY A 1 249 ? 21.051 15.572  -29.462 1.00 23.33  ? 1390 GLY A C    1 
ATOM   2354 O O    . GLY A 1 249 ? 22.201 15.208  -29.704 1.00 23.34  ? 1390 GLY A O    1 
ATOM   2355 H H    . GLY A 1 249 ? 18.354 17.106  -30.522 1.00 0.00   ? 1390 GLY A H    1 
ATOM   2356 N N    . THR A 1 250 ? 20.561 15.615  -28.233 1.00 25.48  ? 1391 THR A N    1 
ATOM   2357 C CA   . THR A 1 250 ? 21.413 15.305  -27.094 1.00 26.94  ? 1391 THR A CA   1 
ATOM   2358 C C    . THR A 1 250 ? 20.884 14.170  -26.219 1.00 24.55  ? 1391 THR A C    1 
ATOM   2359 O O    . THR A 1 250 ? 19.697 14.098  -25.911 1.00 25.79  ? 1391 THR A O    1 
ATOM   2360 C CB   . THR A 1 250 ? 21.659 16.571  -26.242 1.00 26.13  ? 1391 THR A CB   1 
ATOM   2361 O OG1  . THR A 1 250 ? 22.193 17.607  -27.076 1.00 23.28  ? 1391 THR A OG1  1 
ATOM   2362 C CG2  . THR A 1 250 ? 22.650 16.291  -25.122 1.00 25.37  ? 1391 THR A CG2  1 
ATOM   2363 H H    . THR A 1 250 ? 19.623 15.834  -28.088 1.00 0.00   ? 1391 THR A H    1 
ATOM   2364 H HG1  . THR A 1 250 ? 21.731 17.606  -27.929 1.00 0.00   ? 1391 THR A HG1  1 
ATOM   2365 N N    . GLU A 1 251 ? 21.789 13.278  -25.846 1.00 24.96  ? 1392 GLU A N    1 
ATOM   2366 C CA   . GLU A 1 251 ? 21.469 12.141  -25.011 1.00 27.34  ? 1392 GLU A CA   1 
ATOM   2367 C C    . GLU A 1 251 ? 21.445 12.585  -23.543 1.00 24.53  ? 1392 GLU A C    1 
ATOM   2368 O O    . GLU A 1 251 ? 22.352 13.269  -23.069 1.00 26.20  ? 1392 GLU A O    1 
ATOM   2369 C CB   . GLU A 1 251 ? 22.513 11.043  -25.241 1.00 30.67  ? 1392 GLU A CB   1 
ATOM   2370 C CG   . GLU A 1 251 ? 22.300 9.752   -24.470 1.00 40.21  ? 1392 GLU A CG   1 
ATOM   2371 C CD   . GLU A 1 251 ? 21.025 9.040   -24.849 1.00 49.45  ? 1392 GLU A CD   1 
ATOM   2372 O OE1  . GLU A 1 251 ? 20.955 8.472   -25.957 1.00 56.81  ? 1392 GLU A OE1  1 
ATOM   2373 O OE2  . GLU A 1 251 ? 20.088 9.031   -24.031 1.00 57.43  ? 1392 GLU A OE2  1 
ATOM   2374 H H    . GLU A 1 251 ? 22.721 13.389  -26.117 1.00 0.00   ? 1392 GLU A H    1 
ATOM   2375 N N    . TYR A 1 252 ? 20.384 12.222  -22.840 1.00 22.31  ? 1393 TYR A N    1 
ATOM   2376 C CA   . TYR A 1 252 ? 20.253 12.572  -21.440 1.00 25.94  ? 1393 TYR A CA   1 
ATOM   2377 C C    . TYR A 1 252 ? 20.089 11.349  -20.542 1.00 26.35  ? 1393 TYR A C    1 
ATOM   2378 O O    . TYR A 1 252 ? 19.407 10.384  -20.889 1.00 26.86  ? 1393 TYR A O    1 
ATOM   2379 C CB   . TYR A 1 252 ? 19.066 13.516  -21.237 1.00 23.83  ? 1393 TYR A CB   1 
ATOM   2380 C CG   . TYR A 1 252 ? 19.315 14.922  -21.717 1.00 21.87  ? 1393 TYR A CG   1 
ATOM   2381 C CD1  . TYR A 1 252 ? 19.897 15.865  -20.880 1.00 20.08  ? 1393 TYR A CD1  1 
ATOM   2382 C CD2  . TYR A 1 252 ? 18.993 15.304  -23.018 1.00 23.99  ? 1393 TYR A CD2  1 
ATOM   2383 C CE1  . TYR A 1 252 ? 20.157 17.162  -21.324 1.00 28.84  ? 1393 TYR A CE1  1 
ATOM   2384 C CE2  . TYR A 1 252 ? 19.253 16.597  -23.476 1.00 26.27  ? 1393 TYR A CE2  1 
ATOM   2385 C CZ   . TYR A 1 252 ? 19.836 17.518  -22.623 1.00 19.86  ? 1393 TYR A CZ   1 
ATOM   2386 O OH   . TYR A 1 252 ? 20.103 18.794  -23.060 1.00 21.50  ? 1393 TYR A OH   1 
ATOM   2387 H H    . TYR A 1 252 ? 19.695 11.674  -23.269 1.00 0.00   ? 1393 TYR A H    1 
ATOM   2388 H HH   . TYR A 1 252 ? 20.132 18.752  -24.029 1.00 0.00   ? 1393 TYR A HH   1 
ATOM   2389 N N    . VAL A 1 253 ? 20.767 11.379  -19.405 1.00 28.00  ? 1394 VAL A N    1 
ATOM   2390 C CA   . VAL A 1 253 ? 20.670 10.320  -18.418 1.00 25.06  ? 1394 VAL A CA   1 
ATOM   2391 C C    . VAL A 1 253 ? 19.676 10.881  -17.399 1.00 26.65  ? 1394 VAL A C    1 
ATOM   2392 O O    . VAL A 1 253 ? 19.868 11.979  -16.880 1.00 31.28  ? 1394 VAL A O    1 
ATOM   2393 C CB   . VAL A 1 253 ? 22.047 10.046  -17.749 1.00 25.02  ? 1394 VAL A CB   1 
ATOM   2394 C CG1  . VAL A 1 253 ? 21.916 9.015   -16.627 1.00 14.98  ? 1394 VAL A CG1  1 
ATOM   2395 C CG2  . VAL A 1 253 ? 23.021 9.534   -18.795 1.00 23.65  ? 1394 VAL A CG2  1 
ATOM   2396 H H    . VAL A 1 253 ? 21.346 12.135  -19.222 1.00 0.00   ? 1394 VAL A H    1 
ATOM   2397 N N    . VAL A 1 254 ? 18.580 10.167  -17.180 1.00 28.54  ? 1395 VAL A N    1 
ATOM   2398 C CA   . VAL A 1 254 ? 17.551 10.597  -16.242 1.00 24.85  ? 1395 VAL A CA   1 
ATOM   2399 C C    . VAL A 1 254 ? 17.495 9.616   -15.068 1.00 25.08  ? 1395 VAL A C    1 
ATOM   2400 O O    . VAL A 1 254 ? 17.425 8.398   -15.267 1.00 25.79  ? 1395 VAL A O    1 
ATOM   2401 C CB   . VAL A 1 254 ? 16.141 10.661  -16.940 1.00 29.43  ? 1395 VAL A CB   1 
ATOM   2402 C CG1  . VAL A 1 254 ? 15.079 11.250  -16.000 1.00 23.95  ? 1395 VAL A CG1  1 
ATOM   2403 C CG2  . VAL A 1 254 ? 16.216 11.470  -18.236 1.00 27.94  ? 1395 VAL A CG2  1 
ATOM   2404 H H    . VAL A 1 254 ? 18.464 9.313   -17.636 1.00 0.00   ? 1395 VAL A H    1 
ATOM   2405 N N    . SER A 1 255 ? 17.562 10.149  -13.851 1.00 28.04  ? 1396 SER A N    1 
ATOM   2406 C CA   . SER A 1 255 ? 17.492 9.336   -12.645 1.00 26.40  ? 1396 SER A CA   1 
ATOM   2407 C C    . SER A 1 255 ? 16.331 9.818   -11.779 1.00 26.47  ? 1396 SER A C    1 
ATOM   2408 O O    . SER A 1 255 ? 16.058 11.019  -11.681 1.00 20.12  ? 1396 SER A O    1 
ATOM   2409 C CB   . SER A 1 255 ? 18.817 9.359   -11.874 1.00 21.39  ? 1396 SER A CB   1 
ATOM   2410 O OG   . SER A 1 255 ? 19.200 10.676  -11.525 1.00 29.85  ? 1396 SER A OG   1 
ATOM   2411 H H    . SER A 1 255 ? 17.642 11.109  -13.745 1.00 0.00   ? 1396 SER A H    1 
ATOM   2412 H HG   . SER A 1 255 ? 19.397 11.159  -12.345 1.00 0.00   ? 1396 SER A HG   1 
ATOM   2413 N N    . ILE A 1 256 ? 15.618 8.864   -11.195 1.00 25.42  ? 1397 ILE A N    1 
ATOM   2414 C CA   . ILE A 1 256 ? 14.468 9.162   -10.365 1.00 21.73  ? 1397 ILE A CA   1 
ATOM   2415 C C    . ILE A 1 256 ? 14.563 8.330   -9.098  1.00 27.44  ? 1397 ILE A C    1 
ATOM   2416 O O    . ILE A 1 256 ? 14.873 7.134   -9.158  1.00 24.84  ? 1397 ILE A O    1 
ATOM   2417 C CB   . ILE A 1 256 ? 13.145 8.748   -11.072 1.00 24.86  ? 1397 ILE A CB   1 
ATOM   2418 C CG1  . ILE A 1 256 ? 13.082 9.340   -12.485 1.00 24.22  ? 1397 ILE A CG1  1 
ATOM   2419 C CG2  . ILE A 1 256 ? 11.939 9.196   -10.255 1.00 21.13  ? 1397 ILE A CG2  1 
ATOM   2420 C CD1  . ILE A 1 256 ? 12.215 8.567   -13.421 1.00 24.15  ? 1397 ILE A CD1  1 
ATOM   2421 H H    . ILE A 1 256 ? 15.863 7.920   -11.313 1.00 0.00   ? 1397 ILE A H    1 
ATOM   2422 N N    . VAL A 1 257 ? 14.369 8.979   -7.954  1.00 25.37  ? 1398 VAL A N    1 
ATOM   2423 C CA   . VAL A 1 257 ? 14.360 8.277   -6.685  1.00 21.80  ? 1398 VAL A CA   1 
ATOM   2424 C C    . VAL A 1 257 ? 13.062 8.681   -6.030  1.00 19.58  ? 1398 VAL A C    1 
ATOM   2425 O O    . VAL A 1 257 ? 12.568 9.786   -6.256  1.00 20.15  ? 1398 VAL A O    1 
ATOM   2426 C CB   . VAL A 1 257 ? 15.543 8.651   -5.736  1.00 23.08  ? 1398 VAL A CB   1 
ATOM   2427 C CG1  . VAL A 1 257 ? 16.843 8.557   -6.457  1.00 19.70  ? 1398 VAL A CG1  1 
ATOM   2428 C CG2  . VAL A 1 257 ? 15.357 10.021  -5.119  1.00 25.00  ? 1398 VAL A CG2  1 
ATOM   2429 H H    . VAL A 1 257 ? 14.222 9.950   -7.961  1.00 0.00   ? 1398 VAL A H    1 
ATOM   2430 N N    . ALA A 1 258 ? 12.455 7.745   -5.315  1.00 22.90  ? 1399 ALA A N    1 
ATOM   2431 C CA   . ALA A 1 258 ? 11.233 8.026   -4.589  1.00 19.91  ? 1399 ALA A CA   1 
ATOM   2432 C C    . ALA A 1 258 ? 11.741 8.538   -3.239  1.00 21.36  ? 1399 ALA A C    1 
ATOM   2433 O O    . ALA A 1 258 ? 12.820 8.138   -2.769  1.00 18.23  ? 1399 ALA A O    1 
ATOM   2434 C CB   . ALA A 1 258 ? 10.413 6.761   -4.424  1.00 15.73  ? 1399 ALA A CB   1 
ATOM   2435 H H    . ALA A 1 258 ? 12.846 6.849   -5.243  1.00 0.00   ? 1399 ALA A H    1 
ATOM   2436 N N    . LEU A 1 259 ? 10.977 9.423   -2.618  1.00 20.64  ? 1400 LEU A N    1 
ATOM   2437 C CA   . LEU A 1 259 ? 11.403 9.986   -1.354  1.00 18.04  ? 1400 LEU A CA   1 
ATOM   2438 C C    . LEU A 1 259 ? 10.280 9.935   -0.327  1.00 18.27  ? 1400 LEU A C    1 
ATOM   2439 O O    . LEU A 1 259 ? 9.101  9.840   -0.670  1.00 19.02  ? 1400 LEU A O    1 
ATOM   2440 C CB   . LEU A 1 259 ? 11.841 11.451  -1.579  1.00 20.70  ? 1400 LEU A CB   1 
ATOM   2441 C CG   . LEU A 1 259 ? 12.853 11.808  -2.697  1.00 24.81  ? 1400 LEU A CG   1 
ATOM   2442 C CD1  . LEU A 1 259 ? 12.608 13.209  -3.249  1.00 21.16  ? 1400 LEU A CD1  1 
ATOM   2443 C CD2  . LEU A 1 259 ? 14.273 11.705  -2.205  1.00 21.08  ? 1400 LEU A CD2  1 
ATOM   2444 H H    . LEU A 1 259 ? 10.112 9.681   -2.999  1.00 0.00   ? 1400 LEU A H    1 
ATOM   2445 N N    . ASN A 1 260 ? 10.652 9.933   0.943   1.00 22.10  ? 1401 ASN A N    1 
ATOM   2446 C CA   . ASN A 1 260 ? 9.677  9.973   2.027   1.00 24.70  ? 1401 ASN A CA   1 
ATOM   2447 C C    . ASN A 1 260 ? 10.429 10.619  3.157   1.00 32.18  ? 1401 ASN A C    1 
ATOM   2448 O O    . ASN A 1 260 ? 11.171 9.955   3.884   1.00 34.60  ? 1401 ASN A O    1 
ATOM   2449 C CB   . ASN A 1 260 ? 9.205  8.597   2.452   1.00 26.21  ? 1401 ASN A CB   1 
ATOM   2450 C CG   . ASN A 1 260 ? 8.096  8.673   3.477   1.00 32.51  ? 1401 ASN A CG   1 
ATOM   2451 O OD1  . ASN A 1 260 ? 7.951  9.682   4.174   1.00 32.95  ? 1401 ASN A OD1  1 
ATOM   2452 N ND2  . ASN A 1 260 ? 7.285  7.626   3.554   1.00 27.68  ? 1401 ASN A ND2  1 
ATOM   2453 H H    . ASN A 1 260 ? 11.608 9.922   1.162   1.00 0.00   ? 1401 ASN A H    1 
ATOM   2454 H HD21 . ASN A 1 260 ? 6.570  7.666   4.217   1.00 0.00   ? 1401 ASN A HD21 1 
ATOM   2455 H HD22 . ASN A 1 260 ? 7.421  6.859   2.957   1.00 0.00   ? 1401 ASN A HD22 1 
ATOM   2456 N N    . GLY A 1 261 ? 10.266 11.930  3.278   1.00 36.45  ? 1402 GLY A N    1 
ATOM   2457 C CA   . GLY A 1 261 ? 10.985 12.656  4.301   1.00 38.20  ? 1402 GLY A CA   1 
ATOM   2458 C C    . GLY A 1 261 ? 12.426 12.593  3.847   1.00 39.58  ? 1402 GLY A C    1 
ATOM   2459 O O    . GLY A 1 261 ? 12.698 12.697  2.650   1.00 45.27  ? 1402 GLY A O    1 
ATOM   2460 H H    . GLY A 1 261 ? 9.678  12.420  2.670   1.00 0.00   ? 1402 GLY A H    1 
ATOM   2461 N N    . ARG A 1 262 ? 13.341 12.352  4.773   1.00 36.60  ? 1403 ARG A N    1 
ATOM   2462 C CA   . ARG A 1 262 ? 14.746 12.256  4.411   1.00 41.94  ? 1403 ARG A CA   1 
ATOM   2463 C C    . ARG A 1 262 ? 15.084 10.885  3.798   1.00 40.44  ? 1403 ARG A C    1 
ATOM   2464 O O    . ARG A 1 262 ? 16.241 10.616  3.467   1.00 41.55  ? 1403 ARG A O    1 
ATOM   2465 C CB   . ARG A 1 262 ? 15.625 12.551  5.637   1.00 50.43  ? 1403 ARG A CB   1 
ATOM   2466 C CG   . ARG A 1 262 ? 15.949 11.351  6.516   1.00 58.04  ? 1403 ARG A CG   1 
ATOM   2467 C CD   . ARG A 1 262 ? 14.710 10.564  6.921   1.00 71.33  ? 1403 ARG A CD   1 
ATOM   2468 N NE   . ARG A 1 262 ? 14.984 9.127   6.925   1.00 78.86  ? 1403 ARG A NE   1 
ATOM   2469 C CZ   . ARG A 1 262 ? 14.739 8.315   7.947   1.00 82.50  ? 1403 ARG A CZ   1 
ATOM   2470 N NH1  . ARG A 1 262 ? 14.206 8.788   9.071   1.00 86.59  ? 1403 ARG A NH1  1 
ATOM   2471 N NH2  . ARG A 1 262 ? 15.033 7.025   7.846   1.00 89.47  ? 1403 ARG A NH2  1 
ATOM   2472 H H    . ARG A 1 262 ? 13.064 12.330  5.707   1.00 0.00   ? 1403 ARG A H    1 
ATOM   2473 H HE   . ARG A 1 262 ? 15.374 8.737   6.094   1.00 0.00   ? 1403 ARG A HE   1 
ATOM   2474 H HH11 . ARG A 1 262 ? 13.990 9.763   9.162   1.00 0.00   ? 1403 ARG A HH11 1 
ATOM   2475 H HH12 . ARG A 1 262 ? 14.026 8.203   9.864   1.00 0.00   ? 1403 ARG A HH12 1 
ATOM   2476 H HH21 . ARG A 1 262 ? 15.457 6.694   6.993   1.00 0.00   ? 1403 ARG A HH21 1 
ATOM   2477 H HH22 . ARG A 1 262 ? 14.890 6.326   8.548   1.00 0.00   ? 1403 ARG A HH22 1 
ATOM   2478 N N    . GLU A 1 263 ? 14.077 10.015  3.684   1.00 38.40  ? 1404 GLU A N    1 
ATOM   2479 C CA   . GLU A 1 263 ? 14.265 8.670   3.128   1.00 34.41  ? 1404 GLU A CA   1 
ATOM   2480 C C    . GLU A 1 263 ? 14.235 8.643   1.609   1.00 24.35  ? 1404 GLU A C    1 
ATOM   2481 O O    . GLU A 1 263 ? 13.306 9.154   0.990   1.00 27.68  ? 1404 GLU A O    1 
ATOM   2482 C CB   . GLU A 1 263 ? 13.203 7.699   3.667   1.00 37.22  ? 1404 GLU A CB   1 
ATOM   2483 C CG   . GLU A 1 263 ? 13.551 7.037   4.982   1.00 50.63  ? 1404 GLU A CG   1 
ATOM   2484 C CD   . GLU A 1 263 ? 14.829 6.225   4.893   1.00 61.14  ? 1404 GLU A CD   1 
ATOM   2485 O OE1  . GLU A 1 263 ? 14.774 5.073   4.414   1.00 66.10  ? 1404 GLU A OE1  1 
ATOM   2486 O OE2  . GLU A 1 263 ? 15.895 6.743   5.301   1.00 63.70  ? 1404 GLU A OE2  1 
ATOM   2487 H H    . GLU A 1 263 ? 13.170 10.269  3.936   1.00 0.00   ? 1404 GLU A H    1 
ATOM   2488 N N    . GLU A 1 264 ? 15.220 7.981   1.020   1.00 21.19  ? 1405 GLU A N    1 
ATOM   2489 C CA   . GLU A 1 264 ? 15.306 7.875   -0.422  1.00 18.62  ? 1405 GLU A CA   1 
ATOM   2490 C C    . GLU A 1 264 ? 15.346 6.429   -0.826  1.00 26.14  ? 1405 GLU A C    1 
ATOM   2491 O O    . GLU A 1 264 ? 15.748 5.575   -0.048  1.00 28.55  ? 1405 GLU A O    1 
ATOM   2492 C CB   . GLU A 1 264 ? 16.558 8.565   -0.931  1.00 23.62  ? 1405 GLU A CB   1 
ATOM   2493 C CG   . GLU A 1 264 ? 16.632 10.009  -0.502  1.00 34.73  ? 1405 GLU A CG   1 
ATOM   2494 C CD   . GLU A 1 264 ? 17.547 10.848  -1.361  1.00 46.41  ? 1405 GLU A CD   1 
ATOM   2495 O OE1  . GLU A 1 264 ? 18.283 10.287  -2.210  1.00 33.83  ? 1405 GLU A OE1  1 
ATOM   2496 O OE2  . GLU A 1 264 ? 17.504 12.092  -1.201  1.00 54.00  ? 1405 GLU A OE2  1 
ATOM   2497 H H    . GLU A 1 264 ? 15.903 7.530   1.563   1.00 0.00   ? 1405 GLU A H    1 
ATOM   2498 N N    . SER A 1 265 ? 14.894 6.149   -2.039  1.00 27.82  ? 1406 SER A N    1 
ATOM   2499 C CA   . SER A 1 265 ? 14.901 4.792   -2.560  1.00 23.78  ? 1406 SER A CA   1 
ATOM   2500 C C    . SER A 1 265 ? 16.094 4.675   -3.485  1.00 14.66  ? 1406 SER A C    1 
ATOM   2501 O O    . SER A 1 265 ? 16.810 5.643   -3.703  1.00 19.46  ? 1406 SER A O    1 
ATOM   2502 C CB   . SER A 1 265 ? 13.636 4.558   -3.391  1.00 26.81  ? 1406 SER A CB   1 
ATOM   2503 O OG   . SER A 1 265 ? 13.747 5.174   -4.669  1.00 29.22  ? 1406 SER A OG   1 
ATOM   2504 H H    . SER A 1 265 ? 14.556 6.869   -2.613  1.00 0.00   ? 1406 SER A H    1 
ATOM   2505 H HG   . SER A 1 265 ? 14.375 4.703   -5.241  1.00 0.00   ? 1406 SER A HG   1 
ATOM   2506 N N    . PRO A 1 266 ? 16.394 3.459   -3.954  1.00 21.68  ? 1407 PRO A N    1 
ATOM   2507 C CA   . PRO A 1 266 ? 17.527 3.358   -4.869  1.00 19.78  ? 1407 PRO A CA   1 
ATOM   2508 C C    . PRO A 1 266 ? 17.075 4.053   -6.173  1.00 23.52  ? 1407 PRO A C    1 
ATOM   2509 O O    . PRO A 1 266 ? 15.884 4.357   -6.359  1.00 21.03  ? 1407 PRO A O    1 
ATOM   2510 C CB   . PRO A 1 266 ? 17.663 1.851   -5.075  1.00 23.09  ? 1407 PRO A CB   1 
ATOM   2511 C CG   . PRO A 1 266 ? 17.139 1.270   -3.784  1.00 16.38  ? 1407 PRO A CG   1 
ATOM   2512 C CD   . PRO A 1 266 ? 15.944 2.123   -3.506  1.00 21.55  ? 1407 PRO A CD   1 
ATOM   2513 N N    . LEU A 1 267 ? 18.007 4.270   -7.086  1.00 23.17  ? 1408 LEU A N    1 
ATOM   2514 C CA   . LEU A 1 267 ? 17.694 4.942   -8.344  1.00 31.79  ? 1408 LEU A CA   1 
ATOM   2515 C C    . LEU A 1 267 ? 17.009 4.096   -9.413  1.00 26.44  ? 1408 LEU A C    1 
ATOM   2516 O O    . LEU A 1 267 ? 17.215 2.889   -9.502  1.00 28.69  ? 1408 LEU A O    1 
ATOM   2517 C CB   . LEU A 1 267 ? 18.974 5.496   -8.993  1.00 32.88  ? 1408 LEU A CB   1 
ATOM   2518 C CG   . LEU A 1 267 ? 19.884 6.539   -8.359  1.00 31.08  ? 1408 LEU A CG   1 
ATOM   2519 C CD1  . LEU A 1 267 ? 21.147 6.572   -9.156  1.00 38.39  ? 1408 LEU A CD1  1 
ATOM   2520 C CD2  . LEU A 1 267 ? 19.259 7.901   -8.346  1.00 37.33  ? 1408 LEU A CD2  1 
ATOM   2521 H H    . LEU A 1 267 ? 18.915 3.955   -6.920  1.00 0.00   ? 1408 LEU A H    1 
ATOM   2522 N N    . LEU A 1 268 ? 16.177 4.761   -10.207 1.00 23.89  ? 1409 LEU A N    1 
ATOM   2523 C CA   . LEU A 1 268 ? 15.534 4.169   -11.364 1.00 20.11  ? 1409 LEU A CA   1 
ATOM   2524 C C    . LEU A 1 268 ? 16.281 5.008   -12.396 1.00 22.76  ? 1409 LEU A C    1 
ATOM   2525 O O    . LEU A 1 268 ? 16.252 6.238   -12.328 1.00 23.82  ? 1409 LEU A O    1 
ATOM   2526 C CB   . LEU A 1 268 ? 14.042 4.490   -11.414 1.00 18.83  ? 1409 LEU A CB   1 
ATOM   2527 C CG   . LEU A 1 268 ? 13.340 4.240   -12.764 1.00 16.06  ? 1409 LEU A CG   1 
ATOM   2528 C CD1  . LEU A 1 268 ? 13.597 2.827   -13.254 1.00 25.43  ? 1409 LEU A CD1  1 
ATOM   2529 C CD2  . LEU A 1 268 ? 11.854 4.478   -12.639 1.00 13.79  ? 1409 LEU A CD2  1 
ATOM   2530 H H    . LEU A 1 268 ? 15.983 5.703   -10.014 1.00 0.00   ? 1409 LEU A H    1 
ATOM   2531 N N    . ILE A 1 269 ? 17.012 4.379   -13.301 1.00 24.91  ? 1410 ILE A N    1 
ATOM   2532 C CA   . ILE A 1 269 ? 17.766 5.163   -14.270 1.00 29.18  ? 1410 ILE A CA   1 
ATOM   2533 C C    . ILE A 1 269 ? 17.399 4.838   -15.710 1.00 26.24  ? 1410 ILE A C    1 
ATOM   2534 O O    . ILE A 1 269 ? 16.899 3.746   -16.003 1.00 25.50  ? 1410 ILE A O    1 
ATOM   2535 C CB   . ILE A 1 269 ? 19.306 5.014   -14.031 1.00 27.53  ? 1410 ILE A CB   1 
ATOM   2536 C CG1  . ILE A 1 269 ? 20.060 6.188   -14.647 1.00 29.76  ? 1410 ILE A CG1  1 
ATOM   2537 C CG2  . ILE A 1 269 ? 19.827 3.717   -14.613 1.00 29.44  ? 1410 ILE A CG2  1 
ATOM   2538 C CD1  . ILE A 1 269 ? 21.547 6.160   -14.362 1.00 36.51  ? 1410 ILE A CD1  1 
ATOM   2539 H H    . ILE A 1 269 ? 17.028 3.395   -13.364 1.00 0.00   ? 1410 ILE A H    1 
ATOM   2540 N N    . GLY A 1 270 ? 17.625 5.812   -16.591 1.00 28.62  ? 1411 GLY A N    1 
ATOM   2541 C CA   . GLY A 1 270 ? 17.332 5.655   -18.004 1.00 25.17  ? 1411 GLY A CA   1 
ATOM   2542 C C    . GLY A 1 270 ? 18.071 6.699   -18.809 1.00 23.85  ? 1411 GLY A C    1 
ATOM   2543 O O    . GLY A 1 270 ? 18.716 7.567   -18.238 1.00 23.02  ? 1411 GLY A O    1 
ATOM   2544 H H    . GLY A 1 270 ? 17.981 6.678   -16.293 1.00 0.00   ? 1411 GLY A H    1 
ATOM   2545 N N    . GLN A 1 271 ? 17.993 6.601   -20.133 1.00 31.79  ? 1412 GLN A N    1 
ATOM   2546 C CA   . GLN A 1 271 ? 18.660 7.538   -21.044 1.00 31.78  ? 1412 GLN A CA   1 
ATOM   2547 C C    . GLN A 1 271 ? 17.713 7.852   -22.185 1.00 32.85  ? 1412 GLN A C    1 
ATOM   2548 O O    . GLN A 1 271 ? 16.997 6.965   -22.656 1.00 32.73  ? 1412 GLN A O    1 
ATOM   2549 C CB   . GLN A 1 271 ? 19.907 6.910   -21.665 1.00 38.75  ? 1412 GLN A CB   1 
ATOM   2550 C CG   . GLN A 1 271 ? 21.195 7.094   -20.923 1.00 41.44  ? 1412 GLN A CG   1 
ATOM   2551 C CD   . GLN A 1 271 ? 22.366 6.513   -21.698 1.00 54.51  ? 1412 GLN A CD   1 
ATOM   2552 O OE1  . GLN A 1 271 ? 23.071 5.629   -21.213 1.00 65.79  ? 1412 GLN A OE1  1 
ATOM   2553 N NE2  . GLN A 1 271 ? 22.567 6.995   -22.918 1.00 55.09  ? 1412 GLN A NE2  1 
ATOM   2554 H H    . GLN A 1 271 ? 17.451 5.895   -20.541 1.00 0.00   ? 1412 GLN A H    1 
ATOM   2555 H HE21 . GLN A 1 271 ? 23.318 6.651   -23.436 1.00 0.00   ? 1412 GLN A HE21 1 
ATOM   2556 H HE22 . GLN A 1 271 ? 21.943 7.678   -23.234 1.00 0.00   ? 1412 GLN A HE22 1 
ATOM   2557 N N    . GLN A 1 272 ? 17.749 9.088   -22.670 1.00 26.28  ? 1413 GLN A N    1 
ATOM   2558 C CA   . GLN A 1 272 ? 16.889 9.494   -23.771 1.00 27.52  ? 1413 GLN A CA   1 
ATOM   2559 C C    . GLN A 1 272 ? 17.501 10.670  -24.485 1.00 27.86  ? 1413 GLN A C    1 
ATOM   2560 O O    . GLN A 1 272 ? 17.906 11.639  -23.848 1.00 28.19  ? 1413 GLN A O    1 
ATOM   2561 C CB   . GLN A 1 272 ? 15.499 9.871   -23.277 1.00 20.71  ? 1413 GLN A CB   1 
ATOM   2562 C CG   . GLN A 1 272 ? 14.577 10.414  -24.360 1.00 22.97  ? 1413 GLN A CG   1 
ATOM   2563 C CD   . GLN A 1 272 ? 14.244 9.399   -25.436 1.00 21.84  ? 1413 GLN A CD   1 
ATOM   2564 O OE1  . GLN A 1 272 ? 13.584 8.396   -25.180 1.00 30.10  ? 1413 GLN A OE1  1 
ATOM   2565 N NE2  . GLN A 1 272 ? 14.674 9.671   -26.651 1.00 30.31  ? 1413 GLN A NE2  1 
ATOM   2566 H H    . GLN A 1 272 ? 18.403 9.739   -22.332 1.00 0.00   ? 1413 GLN A H    1 
ATOM   2567 H HE21 . GLN A 1 272 ? 14.498 9.008   -27.347 1.00 0.00   ? 1413 GLN A HE21 1 
ATOM   2568 H HE22 . GLN A 1 272 ? 15.154 10.506  -26.818 1.00 0.00   ? 1413 GLN A HE22 1 
ATOM   2569 N N    . SER A 1 273 ? 17.578 10.562  -25.807 1.00 27.90  ? 1414 SER A N    1 
ATOM   2570 C CA   . SER A 1 273 ? 18.129 11.609  -26.653 1.00 32.38  ? 1414 SER A CA   1 
ATOM   2571 C C    . SER A 1 273 ? 17.026 12.490  -27.230 1.00 31.54  ? 1414 SER A C    1 
ATOM   2572 O O    . SER A 1 273 ? 15.936 12.007  -27.560 1.00 27.24  ? 1414 SER A O    1 
ATOM   2573 C CB   . SER A 1 273 ? 18.920 10.999  -27.818 1.00 40.98  ? 1414 SER A CB   1 
ATOM   2574 O OG   . SER A 1 273 ? 20.258 10.699  -27.464 1.00 54.86  ? 1414 SER A OG   1 
ATOM   2575 H H    . SER A 1 273 ? 17.238 9.754   -26.236 1.00 0.00   ? 1414 SER A H    1 
ATOM   2576 H HG   . SER A 1 273 ? 20.250 10.023  -26.782 1.00 0.00   ? 1414 SER A HG   1 
ATOM   2577 N N    . THR A 1 274 ? 17.293 13.788  -27.319 1.00 30.33  ? 1415 THR A N    1 
ATOM   2578 C CA   . THR A 1 274 ? 16.325 14.699  -27.907 1.00 29.83  ? 1415 THR A CA   1 
ATOM   2579 C C    . THR A 1 274 ? 16.484 14.574  -29.416 1.00 27.62  ? 1415 THR A C    1 
ATOM   2580 O O    . THR A 1 274 ? 17.514 14.101  -29.913 1.00 24.77  ? 1415 THR A O    1 
ATOM   2581 C CB   . THR A 1 274 ? 16.569 16.160  -27.489 1.00 23.77  ? 1415 THR A CB   1 
ATOM   2582 O OG1  . THR A 1 274 ? 17.957 16.473  -27.636 1.00 28.67  ? 1415 THR A OG1  1 
ATOM   2583 C CG2  . THR A 1 274 ? 16.151 16.377  -26.040 1.00 32.05  ? 1415 THR A CG2  1 
ATOM   2584 H H    . THR A 1 274 ? 18.135 14.161  -26.997 1.00 0.00   ? 1415 THR A H    1 
ATOM   2585 H HG1  . THR A 1 274 ? 18.031 17.399  -27.377 1.00 0.00   ? 1415 THR A HG1  1 
ATOM   2586 N N    . VAL A 1 275 ? 15.426 14.909  -30.136 1.00 29.41  ? 1416 VAL A N    1 
ATOM   2587 C CA   . VAL A 1 275 ? 15.444 14.859  -31.587 1.00 32.48  ? 1416 VAL A CA   1 
ATOM   2588 C C    . VAL A 1 275 ? 16.361 15.980  -32.073 1.00 33.22  ? 1416 VAL A C    1 
ATOM   2589 O O    . VAL A 1 275 ? 16.496 17.023  -31.413 1.00 32.55  ? 1416 VAL A O    1 
ATOM   2590 C CB   . VAL A 1 275 ? 14.005 15.060  -32.155 1.00 31.35  ? 1416 VAL A CB   1 
ATOM   2591 C CG1  . VAL A 1 275 ? 14.038 15.635  -33.557 1.00 31.66  ? 1416 VAL A CG1  1 
ATOM   2592 C CG2  . VAL A 1 275 ? 13.263 13.739  -32.161 1.00 34.25  ? 1416 VAL A CG2  1 
ATOM   2593 H H    . VAL A 1 275 ? 14.623 15.194  -29.666 1.00 0.00   ? 1416 VAL A H    1 
ATOM   2594 N N    . SER A 1 276 ? 17.051 15.731  -33.181 1.00 31.23  ? 1417 SER A N    1 
ATOM   2595 C CA   . SER A 1 276 ? 17.924 16.733  -33.776 1.00 27.13  ? 1417 SER A CA   1 
ATOM   2596 C C    . SER A 1 276 ? 17.076 17.619  -34.689 1.00 25.68  ? 1417 SER A C    1 
ATOM   2597 O O    . SER A 1 276 ? 16.261 17.120  -35.472 1.00 27.72  ? 1417 SER A O    1 
ATOM   2598 C CB   . SER A 1 276 ? 19.023 16.067  -34.588 1.00 29.50  ? 1417 SER A CB   1 
ATOM   2599 O OG   . SER A 1 276 ? 19.681 17.017  -35.403 1.00 36.12  ? 1417 SER A OG   1 
ATOM   2600 H H    . SER A 1 276 ? 16.967 14.857  -33.603 1.00 0.00   ? 1417 SER A H    1 
ATOM   2601 H HG   . SER A 1 276 ? 20.516 16.583  -35.656 1.00 0.00   ? 1417 SER A HG   1 
ATOM   2602 N N    . ASP A 1 277 ? 17.242 18.928  -34.560 1.00 29.23  ? 1418 ASP A N    1 
ATOM   2603 C CA   . ASP A 1 277 ? 16.498 19.878  -35.382 1.00 30.89  ? 1418 ASP A CA   1 
ATOM   2604 C C    . ASP A 1 277 ? 17.311 20.337  -36.592 1.00 33.25  ? 1418 ASP A C    1 
ATOM   2605 O O    . ASP A 1 277 ? 16.892 21.239  -37.323 1.00 34.40  ? 1418 ASP A O    1 
ATOM   2606 C CB   . ASP A 1 277 ? 16.082 21.093  -34.553 1.00 24.70  ? 1418 ASP A CB   1 
ATOM   2607 C CG   . ASP A 1 277 ? 17.255 21.923  -34.080 1.00 19.68  ? 1418 ASP A CG   1 
ATOM   2608 O OD1  . ASP A 1 277 ? 18.416 21.472  -34.133 1.00 23.06  ? 1418 ASP A OD1  1 
ATOM   2609 O OD2  . ASP A 1 277 ? 17.005 23.055  -33.629 1.00 27.20  ? 1418 ASP A OD2  1 
ATOM   2610 H H    . ASP A 1 277 ? 17.887 19.300  -33.919 1.00 0.00   ? 1418 ASP A H    1 
ATOM   2611 N N    . VAL A 1 278 ? 18.449 19.682  -36.817 1.00 28.90  ? 1419 VAL A N    1 
ATOM   2612 C CA   . VAL A 1 278 ? 19.342 20.021  -37.919 1.00 26.62  ? 1419 VAL A CA   1 
ATOM   2613 C C    . VAL A 1 278 ? 19.003 19.279  -39.207 1.00 25.70  ? 1419 VAL A C    1 
ATOM   2614 O O    . VAL A 1 278 ? 18.757 18.075  -39.190 1.00 22.40  ? 1419 VAL A O    1 
ATOM   2615 C CB   . VAL A 1 278 ? 20.815 19.715  -37.545 1.00 25.87  ? 1419 VAL A CB   1 
ATOM   2616 C CG1  . VAL A 1 278 ? 21.760 20.227  -38.624 1.00 21.57  ? 1419 VAL A CG1  1 
ATOM   2617 C CG2  . VAL A 1 278 ? 21.161 20.331  -36.202 1.00 28.23  ? 1419 VAL A CG2  1 
ATOM   2618 H H    . VAL A 1 278 ? 18.692 18.970  -36.195 1.00 0.00   ? 1419 VAL A H    1 
ATOM   2619 N N    . PRO A 1 279 ? 18.953 20.000  -40.343 1.00 29.64  ? 1420 PRO A N    1 
ATOM   2620 C CA   . PRO A 1 279 ? 18.643 19.323  -41.606 1.00 28.42  ? 1420 PRO A CA   1 
ATOM   2621 C C    . PRO A 1 279 ? 19.744 18.304  -41.903 1.00 31.15  ? 1420 PRO A C    1 
ATOM   2622 O O    . PRO A 1 279 ? 20.796 18.314  -41.259 1.00 32.88  ? 1420 PRO A O    1 
ATOM   2623 C CB   . PRO A 1 279 ? 18.676 20.477  -42.623 1.00 27.58  ? 1420 PRO A CB   1 
ATOM   2624 C CG   . PRO A 1 279 ? 18.248 21.653  -41.805 1.00 22.94  ? 1420 PRO A CG   1 
ATOM   2625 C CD   . PRO A 1 279 ? 19.059 21.457  -40.546 1.00 18.91  ? 1420 PRO A CD   1 
ATOM   2626 N N    . ARG A 1 280 ? 19.512 17.423  -42.866 1.00 33.92  ? 1421 ARG A N    1 
ATOM   2627 C CA   . ARG A 1 280 ? 20.522 16.443  -43.208 1.00 35.81  ? 1421 ARG A CA   1 
ATOM   2628 C C    . ARG A 1 280 ? 20.573 16.117  -44.692 1.00 34.64  ? 1421 ARG A C    1 
ATOM   2629 O O    . ARG A 1 280 ? 19.729 16.569  -45.476 1.00 25.00  ? 1421 ARG A O    1 
ATOM   2630 C CB   . ARG A 1 280 ? 20.342 15.174  -42.366 1.00 46.40  ? 1421 ARG A CB   1 
ATOM   2631 C CG   . ARG A 1 280 ? 18.959 14.566  -42.415 1.00 53.91  ? 1421 ARG A CG   1 
ATOM   2632 C CD   . ARG A 1 280 ? 18.585 13.982  -41.057 1.00 61.72  ? 1421 ARG A CD   1 
ATOM   2633 N NE   . ARG A 1 280 ? 18.066 14.992  -40.129 1.00 64.27  ? 1421 ARG A NE   1 
ATOM   2634 C CZ   . ARG A 1 280 ? 18.437 15.114  -38.855 1.00 62.82  ? 1421 ARG A CZ   1 
ATOM   2635 N NH1  . ARG A 1 280 ? 19.343 14.290  -38.340 1.00 72.29  ? 1421 ARG A NH1  1 
ATOM   2636 N NH2  . ARG A 1 280 ? 17.883 16.040  -38.082 1.00 50.83  ? 1421 ARG A NH2  1 
ATOM   2637 H H    . ARG A 1 280 ? 18.663 17.414  -43.364 1.00 0.00   ? 1421 ARG A H    1 
ATOM   2638 H HE   . ARG A 1 280 ? 17.387 15.592  -40.511 1.00 0.00   ? 1421 ARG A HE   1 
ATOM   2639 H HH11 . ARG A 1 280 ? 19.760 13.579  -38.901 1.00 0.00   ? 1421 ARG A HH11 1 
ATOM   2640 H HH12 . ARG A 1 280 ? 19.684 14.415  -37.401 1.00 0.00   ? 1421 ARG A HH12 1 
ATOM   2641 H HH21 . ARG A 1 280 ? 17.205 16.664  -38.460 1.00 0.00   ? 1421 ARG A HH21 1 
ATOM   2642 H HH22 . ARG A 1 280 ? 18.129 16.166  -37.122 1.00 0.00   ? 1421 ARG A HH22 1 
ATOM   2643 N N    . ASP A 1 281 ? 21.643 15.432  -45.070 1.00 34.94  ? 1422 ASP A N    1 
ATOM   2644 C CA   . ASP A 1 281 ? 21.881 14.991  -46.434 1.00 40.48  ? 1422 ASP A CA   1 
ATOM   2645 C C    . ASP A 1 281 ? 21.721 16.093  -47.471 1.00 41.21  ? 1422 ASP A C    1 
ATOM   2646 O O    . ASP A 1 281 ? 21.180 15.875  -48.566 1.00 39.27  ? 1422 ASP A O    1 
ATOM   2647 C CB   . ASP A 1 281 ? 20.999 13.780  -46.759 1.00 43.83  ? 1422 ASP A CB   1 
ATOM   2648 C CG   . ASP A 1 281 ? 21.202 12.632  -45.779 1.00 48.95  ? 1422 ASP A CG   1 
ATOM   2649 O OD1  . ASP A 1 281 ? 22.349 12.434  -45.314 1.00 52.85  ? 1422 ASP A OD1  1 
ATOM   2650 O OD2  . ASP A 1 281 ? 20.217 11.937  -45.456 1.00 56.12  ? 1422 ASP A OD2  1 
ATOM   2651 H H    . ASP A 1 281 ? 22.282 15.200  -44.374 1.00 0.00   ? 1422 ASP A H    1 
ATOM   2652 N N    . LEU A 1 282 ? 22.203 17.282  -47.118 1.00 41.83  ? 1423 LEU A N    1 
ATOM   2653 C CA   . LEU A 1 282 ? 22.155 18.423  -48.024 1.00 38.95  ? 1423 LEU A CA   1 
ATOM   2654 C C    . LEU A 1 282 ? 23.078 18.067  -49.187 1.00 34.54  ? 1423 LEU A C    1 
ATOM   2655 O O    . LEU A 1 282 ? 24.214 17.618  -48.974 1.00 27.42  ? 1423 LEU A O    1 
ATOM   2656 C CB   . LEU A 1 282 ? 22.647 19.701  -47.323 1.00 34.72  ? 1423 LEU A CB   1 
ATOM   2657 C CG   . LEU A 1 282 ? 22.943 20.937  -48.193 1.00 36.22  ? 1423 LEU A CG   1 
ATOM   2658 C CD1  . LEU A 1 282 ? 21.719 21.378  -48.997 1.00 31.63  ? 1423 LEU A CD1  1 
ATOM   2659 C CD2  . LEU A 1 282 ? 23.431 22.061  -47.308 1.00 36.69  ? 1423 LEU A CD2  1 
ATOM   2660 H H    . LEU A 1 282 ? 22.657 17.364  -46.256 1.00 0.00   ? 1423 LEU A H    1 
ATOM   2661 N N    . GLU A 1 283 ? 22.577 18.240  -50.405 1.00 36.46  ? 1424 GLU A N    1 
ATOM   2662 C CA   . GLU A 1 283 ? 23.345 17.935  -51.597 1.00 28.65  ? 1424 GLU A CA   1 
ATOM   2663 C C    . GLU A 1 283 ? 22.842 18.688  -52.795 1.00 29.41  ? 1424 GLU A C    1 
ATOM   2664 O O    . GLU A 1 283 ? 21.756 19.270  -52.760 1.00 27.74  ? 1424 GLU A O    1 
ATOM   2665 C CB   . GLU A 1 283 ? 23.276 16.441  -51.898 1.00 34.09  ? 1424 GLU A CB   1 
ATOM   2666 C CG   . GLU A 1 283 ? 24.351 15.619  -51.205 1.00 44.42  ? 1424 GLU A CG   1 
ATOM   2667 C CD   . GLU A 1 283 ? 25.768 16.000  -51.616 1.00 48.71  ? 1424 GLU A CD   1 
ATOM   2668 O OE1  . GLU A 1 283 ? 25.958 16.777  -52.592 1.00 47.77  ? 1424 GLU A OE1  1 
ATOM   2669 O OE2  . GLU A 1 283 ? 26.700 15.498  -50.952 1.00 59.94  ? 1424 GLU A OE2  1 
ATOM   2670 H H    . GLU A 1 283 ? 21.668 18.565  -50.527 1.00 0.00   ? 1424 GLU A H    1 
ATOM   2671 N N    . VAL A 1 284 ? 23.634 18.641  -53.865 1.00 36.99  ? 1425 VAL A N    1 
ATOM   2672 C CA   . VAL A 1 284 ? 23.305 19.288  -55.135 1.00 36.45  ? 1425 VAL A CA   1 
ATOM   2673 C C    . VAL A 1 284 ? 22.677 18.254  -56.067 1.00 33.84  ? 1425 VAL A C    1 
ATOM   2674 O O    . VAL A 1 284 ? 23.346 17.317  -56.501 1.00 35.12  ? 1425 VAL A O    1 
ATOM   2675 C CB   . VAL A 1 284 ? 24.567 19.892  -55.803 1.00 36.59  ? 1425 VAL A CB   1 
ATOM   2676 C CG1  . VAL A 1 284 ? 24.240 20.377  -57.217 1.00 34.28  ? 1425 VAL A CG1  1 
ATOM   2677 C CG2  . VAL A 1 284 ? 25.099 21.042  -54.960 1.00 34.77  ? 1425 VAL A CG2  1 
ATOM   2678 H H    . VAL A 1 284 ? 24.466 18.118  -53.762 1.00 0.00   ? 1425 VAL A H    1 
ATOM   2679 N N    . VAL A 1 285 ? 21.395 18.443  -56.372 1.00 39.57  ? 1426 VAL A N    1 
ATOM   2680 C CA   . VAL A 1 285 ? 20.625 17.541  -57.230 1.00 37.61  ? 1426 VAL A CA   1 
ATOM   2681 C C    . VAL A 1 285 ? 20.783 17.807  -58.738 1.00 45.02  ? 1426 VAL A C    1 
ATOM   2682 O O    . VAL A 1 285 ? 20.894 16.872  -59.542 1.00 40.68  ? 1426 VAL A O    1 
ATOM   2683 C CB   . VAL A 1 285 ? 19.129 17.565  -56.803 1.00 26.88  ? 1426 VAL A CB   1 
ATOM   2684 C CG1  . VAL A 1 285 ? 18.240 17.030  -57.900 1.00 43.94  ? 1426 VAL A CG1  1 
ATOM   2685 C CG2  . VAL A 1 285 ? 18.953 16.709  -55.575 1.00 27.60  ? 1426 VAL A CG2  1 
ATOM   2686 H H    . VAL A 1 285 ? 20.951 19.221  -55.986 1.00 0.00   ? 1426 VAL A H    1 
ATOM   2687 N N    . ALA A 1 286 ? 20.815 19.086  -59.102 1.00 48.85  ? 1427 ALA A N    1 
ATOM   2688 C CA   . ALA A 1 286 ? 20.965 19.517  -60.484 1.00 50.53  ? 1427 ALA A CA   1 
ATOM   2689 C C    . ALA A 1 286 ? 21.957 20.680  -60.462 1.00 57.42  ? 1427 ALA A C    1 
ATOM   2690 O O    . ALA A 1 286 ? 22.323 21.149  -59.375 1.00 58.11  ? 1427 ALA A O    1 
ATOM   2691 C CB   . ALA A 1 286 ? 19.626 19.962  -61.036 1.00 46.54  ? 1427 ALA A CB   1 
ATOM   2692 H H    . ALA A 1 286 ? 20.782 19.780  -58.408 1.00 0.00   ? 1427 ALA A H    1 
ATOM   2693 N N    . ALA A 1 287 ? 22.407 21.132  -61.636 1.00 59.92  ? 1428 ALA A N    1 
ATOM   2694 C CA   . ALA A 1 287 ? 23.365 22.240  -61.716 1.00 62.73  ? 1428 ALA A CA   1 
ATOM   2695 C C    . ALA A 1 287 ? 23.620 22.765  -63.127 1.00 63.25  ? 1428 ALA A C    1 
ATOM   2696 O O    . ALA A 1 287 ? 23.702 21.996  -64.080 1.00 66.65  ? 1428 ALA A O    1 
ATOM   2697 C CB   . ALA A 1 287 ? 24.697 21.839  -61.073 1.00 61.70  ? 1428 ALA A CB   1 
ATOM   2698 H H    . ALA A 1 287 ? 22.126 20.725  -62.491 1.00 0.00   ? 1428 ALA A H    1 
ATOM   2699 N N    . THR A 1 288 ? 23.772 24.080  -63.239 1.00 64.66  ? 1429 THR A N    1 
ATOM   2700 C CA   . THR A 1 288 ? 24.051 24.733  -64.512 1.00 65.22  ? 1429 THR A CA   1 
ATOM   2701 C C    . THR A 1 288 ? 25.318 25.569  -64.296 1.00 68.92  ? 1429 THR A C    1 
ATOM   2702 O O    . THR A 1 288 ? 25.843 25.622  -63.181 1.00 69.33  ? 1429 THR A O    1 
ATOM   2703 C CB   . THR A 1 288 ? 22.884 25.652  -64.950 1.00 60.81  ? 1429 THR A CB   1 
ATOM   2704 O OG1  . THR A 1 288 ? 22.793 26.769  -64.061 1.00 67.89  ? 1429 THR A OG1  1 
ATOM   2705 C CG2  . THR A 1 288 ? 21.562 24.898  -64.945 1.00 58.61  ? 1429 THR A CG2  1 
ATOM   2706 H H    . THR A 1 288 ? 23.765 24.642  -62.436 1.00 0.00   ? 1429 THR A H    1 
ATOM   2707 H HG1  . THR A 1 288 ? 22.074 27.343  -64.365 1.00 0.00   ? 1429 THR A HG1  1 
ATOM   2708 N N    . PRO A 1 289 ? 25.824 26.242  -65.349 1.00 73.79  ? 1430 PRO A N    1 
ATOM   2709 C CA   . PRO A 1 289 ? 27.039 27.058  -65.198 1.00 73.12  ? 1430 PRO A CA   1 
ATOM   2710 C C    . PRO A 1 289 ? 26.891 28.279  -64.292 1.00 67.72  ? 1430 PRO A C    1 
ATOM   2711 O O    . PRO A 1 289 ? 27.863 28.987  -64.042 1.00 69.52  ? 1430 PRO A O    1 
ATOM   2712 C CB   . PRO A 1 289 ? 27.348 27.482  -66.637 1.00 75.79  ? 1430 PRO A CB   1 
ATOM   2713 C CG   . PRO A 1 289 ? 26.791 26.352  -67.451 1.00 78.00  ? 1430 PRO A CG   1 
ATOM   2714 C CD   . PRO A 1 289 ? 25.466 26.114  -66.774 1.00 76.38  ? 1430 PRO A CD   1 
ATOM   2715 N N    . THR A 1 290 ? 25.678 28.537  -63.820 1.00 65.14  ? 1431 THR A N    1 
ATOM   2716 C CA   . THR A 1 290 ? 25.430 29.683  -62.954 1.00 66.00  ? 1431 THR A CA   1 
ATOM   2717 C C    . THR A 1 290 ? 24.412 29.356  -61.863 1.00 62.02  ? 1431 THR A C    1 
ATOM   2718 O O    . THR A 1 290 ? 23.842 30.263  -61.242 1.00 60.47  ? 1431 THR A O    1 
ATOM   2719 C CB   . THR A 1 290 ? 24.880 30.880  -63.774 1.00 70.21  ? 1431 THR A CB   1 
ATOM   2720 O OG1  . THR A 1 290 ? 23.710 30.473  -64.504 1.00 62.71  ? 1431 THR A OG1  1 
ATOM   2721 C CG2  . THR A 1 290 ? 25.937 31.409  -64.745 1.00 73.95  ? 1431 THR A CG2  1 
ATOM   2722 H H    . THR A 1 290 ? 24.905 27.991  -64.051 1.00 0.00   ? 1431 THR A H    1 
ATOM   2723 H HG1  . THR A 1 290 ? 23.425 31.225  -65.033 1.00 0.00   ? 1431 THR A HG1  1 
ATOM   2724 N N    . SER A 1 291 ? 24.204 28.070  -61.607 1.00 56.54  ? 1432 SER A N    1 
ATOM   2725 C CA   . SER A 1 291 ? 23.219 27.664  -60.619 1.00 49.10  ? 1432 SER A CA   1 
ATOM   2726 C C    . SER A 1 291 ? 23.453 26.273  -60.048 1.00 44.47  ? 1432 SER A C    1 
ATOM   2727 O O    . SER A 1 291 ? 24.264 25.494  -60.558 1.00 38.36  ? 1432 SER A O    1 
ATOM   2728 C CB   . SER A 1 291 ? 21.821 27.734  -61.249 1.00 47.89  ? 1432 SER A CB   1 
ATOM   2729 O OG   . SER A 1 291 ? 20.814 27.218  -60.391 1.00 60.94  ? 1432 SER A OG   1 
ATOM   2730 H H    . SER A 1 291 ? 24.727 27.365  -62.042 1.00 0.00   ? 1432 SER A H    1 
ATOM   2731 H HG   . SER A 1 291 ? 20.001 27.166  -60.900 1.00 0.00   ? 1432 SER A HG   1 
ATOM   2732 N N    . LEU A 1 292 ? 22.719 25.982  -58.981 1.00 44.89  ? 1433 LEU A N    1 
ATOM   2733 C CA   . LEU A 1 292 ? 22.762 24.702  -58.291 1.00 40.55  ? 1433 LEU A CA   1 
ATOM   2734 C C    . LEU A 1 292 ? 21.370 24.470  -57.720 1.00 40.12  ? 1433 LEU A C    1 
ATOM   2735 O O    . LEU A 1 292 ? 20.746 25.398  -57.199 1.00 42.10  ? 1433 LEU A O    1 
ATOM   2736 C CB   . LEU A 1 292 ? 23.767 24.732  -57.134 1.00 40.79  ? 1433 LEU A CB   1 
ATOM   2737 C CG   . LEU A 1 292 ? 25.259 24.886  -57.438 1.00 43.64  ? 1433 LEU A CG   1 
ATOM   2738 C CD1  . LEU A 1 292 ? 26.077 25.059  -56.155 1.00 24.02  ? 1433 LEU A CD1  1 
ATOM   2739 C CD2  . LEU A 1 292 ? 25.732 23.683  -58.231 1.00 48.79  ? 1433 LEU A CD2  1 
ATOM   2740 H H    . LEU A 1 292 ? 22.099 26.671  -58.653 1.00 0.00   ? 1433 LEU A H    1 
ATOM   2741 N N    . LEU A 1 293 ? 20.838 23.270  -57.915 1.00 41.45  ? 1434 LEU A N    1 
ATOM   2742 C CA   . LEU A 1 293 ? 19.541 22.927  -57.351 1.00 40.15  ? 1434 LEU A CA   1 
ATOM   2743 C C    . LEU A 1 293 ? 19.918 22.053  -56.163 1.00 35.66  ? 1434 LEU A C    1 
ATOM   2744 O O    . LEU A 1 293 ? 20.490 20.975  -56.330 1.00 30.31  ? 1434 LEU A O    1 
ATOM   2745 C CB   . LEU A 1 293 ? 18.681 22.142  -58.338 1.00 42.00  ? 1434 LEU A CB   1 
ATOM   2746 C CG   . LEU A 1 293 ? 17.299 21.771  -57.793 1.00 45.63  ? 1434 LEU A CG   1 
ATOM   2747 C CD1  . LEU A 1 293 ? 16.378 22.977  -57.862 1.00 44.79  ? 1434 LEU A CD1  1 
ATOM   2748 C CD2  . LEU A 1 293 ? 16.710 20.617  -58.592 1.00 55.70  ? 1434 LEU A CD2  1 
ATOM   2749 H H    . LEU A 1 293 ? 21.341 22.592  -58.414 1.00 0.00   ? 1434 LEU A H    1 
ATOM   2750 N N    . ILE A 1 294 ? 19.698 22.568  -54.965 1.00 34.06  ? 1435 ILE A N    1 
ATOM   2751 C CA   . ILE A 1 294 ? 20.046 21.826  -53.769 1.00 29.90  ? 1435 ILE A CA   1 
ATOM   2752 C C    . ILE A 1 294 ? 18.845 21.150  -53.144 1.00 29.76  ? 1435 ILE A C    1 
ATOM   2753 O O    . ILE A 1 294 ? 17.698 21.572  -53.342 1.00 25.95  ? 1435 ILE A O    1 
ATOM   2754 C CB   . ILE A 1 294 ? 20.777 22.718  -52.740 1.00 28.58  ? 1435 ILE A CB   1 
ATOM   2755 C CG1  . ILE A 1 294 ? 19.861 23.844  -52.252 1.00 23.00  ? 1435 ILE A CG1  1 
ATOM   2756 C CG2  . ILE A 1 294 ? 22.032 23.299  -53.370 1.00 20.00  ? 1435 ILE A CG2  1 
ATOM   2757 C CD1  . ILE A 1 294 ? 20.494 24.737  -51.233 1.00 21.23  ? 1435 ILE A CD1  1 
ATOM   2758 H H    . ILE A 1 294 ? 19.272 23.444  -54.895 1.00 0.00   ? 1435 ILE A H    1 
ATOM   2759 N N    . SER A 1 295 ? 19.128 20.084  -52.401 1.00 33.95  ? 1436 SER A N    1 
ATOM   2760 C CA   . SER A 1 295 ? 18.108 19.289  -51.736 1.00 32.81  ? 1436 SER A CA   1 
ATOM   2761 C C    . SER A 1 295 ? 18.659 18.826  -50.384 1.00 29.73  ? 1436 SER A C    1 
ATOM   2762 O O    . SER A 1 295 ? 19.873 18.708  -50.203 1.00 29.93  ? 1436 SER A O    1 
ATOM   2763 C CB   . SER A 1 295 ? 17.773 18.076  -52.605 1.00 26.56  ? 1436 SER A CB   1 
ATOM   2764 O OG   . SER A 1 295 ? 16.504 17.544  -52.292 1.00 44.16  ? 1436 SER A OG   1 
ATOM   2765 H H    . SER A 1 295 ? 20.054 19.806  -52.261 1.00 0.00   ? 1436 SER A H    1 
ATOM   2766 H HG   . SER A 1 295 ? 15.844 18.248  -52.205 1.00 0.00   ? 1436 SER A HG   1 
ATOM   2767 N N    . TRP A 1 296 ? 17.768 18.608  -49.428 1.00 29.17  ? 1437 TRP A N    1 
ATOM   2768 C CA   . TRP A 1 296 ? 18.169 18.151  -48.106 1.00 29.40  ? 1437 TRP A CA   1 
ATOM   2769 C C    . TRP A 1 296 ? 16.977 17.442  -47.483 1.00 31.41  ? 1437 TRP A C    1 
ATOM   2770 O O    . TRP A 1 296 ? 15.859 17.513  -48.015 1.00 24.70  ? 1437 TRP A O    1 
ATOM   2771 C CB   . TRP A 1 296 ? 18.614 19.334  -47.228 1.00 26.20  ? 1437 TRP A CB   1 
ATOM   2772 C CG   . TRP A 1 296 ? 17.542 20.360  -46.993 1.00 22.56  ? 1437 TRP A CG   1 
ATOM   2773 C CD1  . TRP A 1 296 ? 16.650 20.393  -45.956 1.00 22.77  ? 1437 TRP A CD1  1 
ATOM   2774 C CD2  . TRP A 1 296 ? 17.225 21.479  -47.833 1.00 18.64  ? 1437 TRP A CD2  1 
ATOM   2775 N NE1  . TRP A 1 296 ? 15.791 21.457  -46.106 1.00 21.36  ? 1437 TRP A NE1  1 
ATOM   2776 C CE2  . TRP A 1 296 ? 16.123 22.141  -47.245 1.00 20.67  ? 1437 TRP A CE2  1 
ATOM   2777 C CE3  . TRP A 1 296 ? 17.763 21.983  -49.026 1.00 15.87  ? 1437 TRP A CE3  1 
ATOM   2778 C CZ2  . TRP A 1 296 ? 15.548 23.287  -47.810 1.00 18.55  ? 1437 TRP A CZ2  1 
ATOM   2779 C CZ3  . TRP A 1 296 ? 17.193 23.122  -49.587 1.00 16.07  ? 1437 TRP A CZ3  1 
ATOM   2780 C CH2  . TRP A 1 296 ? 16.096 23.758  -48.978 1.00 22.29  ? 1437 TRP A CH2  1 
ATOM   2781 H H    . TRP A 1 296 ? 16.803 18.714  -49.591 1.00 0.00   ? 1437 TRP A H    1 
ATOM   2782 H HE1  . TRP A 1 296 ? 15.044 21.676  -45.512 1.00 0.00   ? 1437 TRP A HE1  1 
ATOM   2783 N N    . ASP A 1 297 ? 17.213 16.752  -46.371 1.00 26.40  ? 1438 ASP A N    1 
ATOM   2784 C CA   . ASP A 1 297 ? 16.143 16.053  -45.684 1.00 30.21  ? 1438 ASP A CA   1 
ATOM   2785 C C    . ASP A 1 297 ? 15.771 16.784  -44.423 1.00 27.08  ? 1438 ASP A C    1 
ATOM   2786 O O    . ASP A 1 297 ? 16.612 17.030  -43.553 1.00 25.99  ? 1438 ASP A O    1 
ATOM   2787 C CB   . ASP A 1 297 ? 16.526 14.609  -45.369 1.00 39.64  ? 1438 ASP A CB   1 
ATOM   2788 C CG   . ASP A 1 297 ? 16.535 13.733  -46.603 1.00 46.93  ? 1438 ASP A CG   1 
ATOM   2789 O OD1  . ASP A 1 297 ? 15.622 13.869  -47.454 1.00 53.55  ? 1438 ASP A OD1  1 
ATOM   2790 O OD2  . ASP A 1 297 ? 17.465 12.915  -46.729 1.00 53.32  ? 1438 ASP A OD2  1 
ATOM   2791 H H    . ASP A 1 297 ? 18.095 16.688  -46.016 1.00 0.00   ? 1438 ASP A H    1 
ATOM   2792 N N    . ALA A 1 298 ? 14.503 17.170  -44.369 1.00 27.64  ? 1439 ALA A N    1 
ATOM   2793 C CA   . ALA A 1 298 ? 13.928 17.894  -43.245 1.00 33.33  ? 1439 ALA A CA   1 
ATOM   2794 C C    . ALA A 1 298 ? 14.191 17.163  -41.942 1.00 30.78  ? 1439 ALA A C    1 
ATOM   2795 O O    . ALA A 1 298 ? 14.262 15.929  -41.918 1.00 33.22  ? 1439 ALA A O    1 
ATOM   2796 C CB   . ALA A 1 298 ? 12.410 18.067  -43.447 1.00 25.08  ? 1439 ALA A CB   1 
ATOM   2797 H H    . ALA A 1 298 ? 13.940 16.928  -45.134 1.00 0.00   ? 1439 ALA A H    1 
ATOM   2798 N N    . PRO A 1 299 ? 14.470 17.918  -40.868 1.00 29.89  ? 1440 PRO A N    1 
ATOM   2799 C CA   . PRO A 1 299 ? 14.712 17.239  -39.598 1.00 29.48  ? 1440 PRO A CA   1 
ATOM   2800 C C    . PRO A 1 299 ? 13.351 16.816  -39.050 1.00 30.42  ? 1440 PRO A C    1 
ATOM   2801 O O    . PRO A 1 299 ? 12.319 17.312  -39.503 1.00 26.88  ? 1440 PRO A O    1 
ATOM   2802 C CB   . PRO A 1 299 ? 15.388 18.323  -38.760 1.00 27.62  ? 1440 PRO A CB   1 
ATOM   2803 C CG   . PRO A 1 299 ? 14.796 19.602  -39.317 1.00 25.96  ? 1440 PRO A CG   1 
ATOM   2804 C CD   . PRO A 1 299 ? 14.825 19.346  -40.788 1.00 21.32  ? 1440 PRO A CD   1 
ATOM   2805 N N    . ALA A 1 300 ? 13.352 15.871  -38.115 1.00 34.46  ? 1441 ALA A N    1 
ATOM   2806 C CA   . ALA A 1 300 ? 12.126 15.357  -37.511 1.00 35.20  ? 1441 ALA A CA   1 
ATOM   2807 C C    . ALA A 1 300 ? 11.459 16.334  -36.533 1.00 35.78  ? 1441 ALA A C    1 
ATOM   2808 O O    . ALA A 1 300 ? 11.094 15.955  -35.418 1.00 35.21  ? 1441 ALA A O    1 
ATOM   2809 C CB   . ALA A 1 300 ? 12.417 14.034  -36.827 1.00 33.91  ? 1441 ALA A CB   1 
ATOM   2810 H H    . ALA A 1 300 ? 14.200 15.494  -37.853 1.00 0.00   ? 1441 ALA A H    1 
ATOM   2811 N N    . VAL A 1 301 ? 11.328 17.593  -36.951 1.00 34.05  ? 1442 VAL A N    1 
ATOM   2812 C CA   . VAL A 1 301 ? 10.702 18.651  -36.155 1.00 27.19  ? 1442 VAL A CA   1 
ATOM   2813 C C    . VAL A 1 301 ? 9.968  19.566  -37.125 1.00 28.45  ? 1442 VAL A C    1 
ATOM   2814 O O    . VAL A 1 301 ? 10.170 19.478  -38.338 1.00 29.42  ? 1442 VAL A O    1 
ATOM   2815 C CB   . VAL A 1 301 ? 11.737 19.518  -35.375 1.00 23.27  ? 1442 VAL A CB   1 
ATOM   2816 C CG1  . VAL A 1 301 ? 12.394 18.711  -34.259 1.00 25.71  ? 1442 VAL A CG1  1 
ATOM   2817 C CG2  . VAL A 1 301 ? 12.782 20.105  -36.321 1.00 17.99  ? 1442 VAL A CG2  1 
ATOM   2818 H H    . VAL A 1 301 ? 11.599 17.855  -37.852 1.00 0.00   ? 1442 VAL A H    1 
ATOM   2819 N N    . THR A 1 302 ? 9.105  20.428  -36.600 1.00 33.54  ? 1443 THR A N    1 
ATOM   2820 C CA   . THR A 1 302 ? 8.374  21.362  -37.447 1.00 32.09  ? 1443 THR A CA   1 
ATOM   2821 C C    . THR A 1 302 ? 9.244  22.593  -37.699 1.00 31.79  ? 1443 THR A C    1 
ATOM   2822 O O    . THR A 1 302 ? 9.656  23.296  -36.771 1.00 28.93  ? 1443 THR A O    1 
ATOM   2823 C CB   . THR A 1 302 ? 7.042  21.793  -36.819 1.00 36.84  ? 1443 THR A CB   1 
ATOM   2824 O OG1  . THR A 1 302 ? 6.355  20.640  -36.313 1.00 44.00  ? 1443 THR A OG1  1 
ATOM   2825 C CG2  . THR A 1 302 ? 6.164  22.472  -37.868 1.00 39.09  ? 1443 THR A CG2  1 
ATOM   2826 H H    . THR A 1 302 ? 8.942  20.449  -35.637 1.00 0.00   ? 1443 THR A H    1 
ATOM   2827 H HG1  . THR A 1 302 ? 5.527  20.963  -35.937 1.00 0.00   ? 1443 THR A HG1  1 
ATOM   2828 N N    . VAL A 1 303 ? 9.592  22.791  -38.961 1.00 30.40  ? 1444 VAL A N    1 
ATOM   2829 C CA   . VAL A 1 303 ? 10.412 23.912  -39.373 1.00 24.21  ? 1444 VAL A CA   1 
ATOM   2830 C C    . VAL A 1 303 ? 9.500  24.981  -39.963 1.00 30.51  ? 1444 VAL A C    1 
ATOM   2831 O O    . VAL A 1 303 ? 8.678  24.694  -40.843 1.00 31.35  ? 1444 VAL A O    1 
ATOM   2832 C CB   . VAL A 1 303 ? 11.436 23.466  -40.445 1.00 23.11  ? 1444 VAL A CB   1 
ATOM   2833 C CG1  . VAL A 1 303 ? 12.373 24.622  -40.819 1.00 14.70  ? 1444 VAL A CG1  1 
ATOM   2834 C CG2  . VAL A 1 303 ? 12.208 22.229  -39.954 1.00 12.44  ? 1444 VAL A CG2  1 
ATOM   2835 H H    . VAL A 1 303 ? 9.275  22.164  -39.656 1.00 0.00   ? 1444 VAL A H    1 
ATOM   2836 N N    . ARG A 1 304 ? 9.614  26.202  -39.454 1.00 29.22  ? 1445 ARG A N    1 
ATOM   2837 C CA   . ARG A 1 304 ? 8.807  27.298  -39.968 1.00 27.18  ? 1445 ARG A CA   1 
ATOM   2838 C C    . ARG A 1 304 ? 9.274  27.632  -41.381 1.00 21.00  ? 1445 ARG A C    1 
ATOM   2839 O O    . ARG A 1 304 ? 8.458  27.827  -42.280 1.00 27.63  ? 1445 ARG A O    1 
ATOM   2840 C CB   . ARG A 1 304 ? 8.894  28.518  -39.053 1.00 25.25  ? 1445 ARG A CB   1 
ATOM   2841 C CG   . ARG A 1 304 ? 8.112  28.356  -37.752 1.00 36.33  ? 1445 ARG A CG   1 
ATOM   2842 C CD   . ARG A 1 304 ? 7.257  29.585  -37.453 1.00 38.24  ? 1445 ARG A CD   1 
ATOM   2843 N NE   . ARG A 1 304 ? 8.042  30.816  -37.511 1.00 47.53  ? 1445 ARG A NE   1 
ATOM   2844 C CZ   . ARG A 1 304 ? 7.661  31.926  -38.141 1.00 49.51  ? 1445 ARG A CZ   1 
ATOM   2845 N NH1  . ARG A 1 304 ? 6.493  31.972  -38.776 1.00 47.22  ? 1445 ARG A NH1  1 
ATOM   2846 N NH2  . ARG A 1 304 ? 8.453  32.993  -38.138 1.00 50.34  ? 1445 ARG A NH2  1 
ATOM   2847 H H    . ARG A 1 304 ? 10.253 26.365  -38.734 1.00 0.00   ? 1445 ARG A H    1 
ATOM   2848 H HE   . ARG A 1 304 ? 8.906  30.781  -37.027 1.00 0.00   ? 1445 ARG A HE   1 
ATOM   2849 H HH11 . ARG A 1 304 ? 5.862  31.205  -38.810 1.00 0.00   ? 1445 ARG A HH11 1 
ATOM   2850 H HH12 . ARG A 1 304 ? 6.221  32.828  -39.248 1.00 0.00   ? 1445 ARG A HH12 1 
ATOM   2851 H HH21 . ARG A 1 304 ? 9.331  33.025  -37.666 1.00 0.00   ? 1445 ARG A HH21 1 
ATOM   2852 H HH22 . ARG A 1 304 ? 8.158  33.837  -38.614 1.00 0.00   ? 1445 ARG A HH22 1 
ATOM   2853 N N    . TYR A 1 305 ? 10.590 27.705  -41.562 1.00 20.14  ? 1446 TYR A N    1 
ATOM   2854 C CA   . TYR A 1 305 ? 11.208 27.972  -42.856 1.00 18.92  ? 1446 TYR A CA   1 
ATOM   2855 C C    . TYR A 1 305 ? 12.679 27.662  -42.712 1.00 24.41  ? 1446 TYR A C    1 
ATOM   2856 O O    . TYR A 1 305 ? 13.175 27.546  -41.590 1.00 24.43  ? 1446 TYR A O    1 
ATOM   2857 C CB   . TYR A 1 305 ? 11.023 29.432  -43.304 1.00 19.40  ? 1446 TYR A CB   1 
ATOM   2858 C CG   . TYR A 1 305 ? 11.610 30.473  -42.370 1.00 18.01  ? 1446 TYR A CG   1 
ATOM   2859 C CD1  . TYR A 1 305 ? 10.867 30.975  -41.305 1.00 16.19  ? 1446 TYR A CD1  1 
ATOM   2860 C CD2  . TYR A 1 305 ? 12.906 30.947  -42.547 1.00 13.79  ? 1446 TYR A CD2  1 
ATOM   2861 C CE1  . TYR A 1 305 ? 11.403 31.916  -40.434 1.00 16.20  ? 1446 TYR A CE1  1 
ATOM   2862 C CE2  . TYR A 1 305 ? 13.449 31.884  -41.688 1.00 17.04  ? 1446 TYR A CE2  1 
ATOM   2863 C CZ   . TYR A 1 305 ? 12.689 32.363  -40.628 1.00 15.84  ? 1446 TYR A CZ   1 
ATOM   2864 O OH   . TYR A 1 305 ? 13.237 33.261  -39.744 1.00 15.38  ? 1446 TYR A OH   1 
ATOM   2865 H H    . TYR A 1 305 ? 11.198 27.577  -40.796 1.00 0.00   ? 1446 TYR A H    1 
ATOM   2866 H HH   . TYR A 1 305 ? 12.597 33.466  -39.051 1.00 0.00   ? 1446 TYR A HH   1 
ATOM   2867 N N    . TYR A 1 306 ? 13.364 27.488  -43.840 1.00 25.99  ? 1447 TYR A N    1 
ATOM   2868 C CA   . TYR A 1 306 ? 14.794 27.202  -43.846 1.00 25.74  ? 1447 TYR A CA   1 
ATOM   2869 C C    . TYR A 1 306 ? 15.523 28.431  -44.331 1.00 24.95  ? 1447 TYR A C    1 
ATOM   2870 O O    . TYR A 1 306 ? 15.007 29.164  -45.182 1.00 17.72  ? 1447 TYR A O    1 
ATOM   2871 C CB   . TYR A 1 306 ? 15.137 26.046  -44.801 1.00 13.40  ? 1447 TYR A CB   1 
ATOM   2872 C CG   . TYR A 1 306 ? 14.526 24.722  -44.433 1.00 13.61  ? 1447 TYR A CG   1 
ATOM   2873 C CD1  . TYR A 1 306 ? 15.187 23.834  -43.573 1.00 13.40  ? 1447 TYR A CD1  1 
ATOM   2874 C CD2  . TYR A 1 306 ? 13.272 24.363  -44.922 1.00 12.79  ? 1447 TYR A CD2  1 
ATOM   2875 C CE1  . TYR A 1 306 ? 14.599 22.609  -43.204 1.00 10.39  ? 1447 TYR A CE1  1 
ATOM   2876 C CE2  . TYR A 1 306 ? 12.682 23.157  -44.564 1.00 22.85  ? 1447 TYR A CE2  1 
ATOM   2877 C CZ   . TYR A 1 306 ? 13.347 22.284  -43.707 1.00 13.58  ? 1447 TYR A CZ   1 
ATOM   2878 O OH   . TYR A 1 306 ? 12.735 21.096  -43.372 1.00 24.73  ? 1447 TYR A OH   1 
ATOM   2879 H H    . TYR A 1 306 ? 12.913 27.564  -44.698 1.00 0.00   ? 1447 TYR A H    1 
ATOM   2880 H HH   . TYR A 1 306 ? 11.845 21.095  -43.759 1.00 0.00   ? 1447 TYR A HH   1 
ATOM   2881 N N    . ARG A 1 307 ? 16.720 28.647  -43.795 1.00 24.06  ? 1448 ARG A N    1 
ATOM   2882 C CA   . ARG A 1 307 ? 17.566 29.766  -44.198 1.00 21.96  ? 1448 ARG A CA   1 
ATOM   2883 C C    . ARG A 1 307 ? 18.770 29.158  -44.907 1.00 22.96  ? 1448 ARG A C    1 
ATOM   2884 O O    . ARG A 1 307 ? 19.472 28.311  -44.345 1.00 27.14  ? 1448 ARG A O    1 
ATOM   2885 C CB   . ARG A 1 307 ? 18.014 30.583  -42.981 1.00 14.64  ? 1448 ARG A CB   1 
ATOM   2886 C CG   . ARG A 1 307 ? 19.159 31.539  -43.253 1.00 12.92  ? 1448 ARG A CG   1 
ATOM   2887 C CD   . ARG A 1 307 ? 19.526 32.252  -41.992 1.00 26.28  ? 1448 ARG A CD   1 
ATOM   2888 N NE   . ARG A 1 307 ? 20.833 32.885  -42.087 1.00 37.57  ? 1448 ARG A NE   1 
ATOM   2889 C CZ   . ARG A 1 307 ? 21.785 32.786  -41.163 1.00 38.06  ? 1448 ARG A CZ   1 
ATOM   2890 N NH1  . ARG A 1 307 ? 21.582 32.072  -40.061 1.00 33.08  ? 1448 ARG A NH1  1 
ATOM   2891 N NH2  . ARG A 1 307 ? 22.929 33.431  -41.332 1.00 53.45  ? 1448 ARG A NH2  1 
ATOM   2892 H H    . ARG A 1 307 ? 17.049 28.023  -43.117 1.00 0.00   ? 1448 ARG A H    1 
ATOM   2893 H HE   . ARG A 1 307 ? 20.983 33.445  -42.885 1.00 0.00   ? 1448 ARG A HE   1 
ATOM   2894 H HH11 . ARG A 1 307 ? 20.688 31.626  -39.881 1.00 0.00   ? 1448 ARG A HH11 1 
ATOM   2895 H HH12 . ARG A 1 307 ? 22.267 31.983  -39.343 1.00 0.00   ? 1448 ARG A HH12 1 
ATOM   2896 H HH21 . ARG A 1 307 ? 23.017 33.995  -42.173 1.00 0.00   ? 1448 ARG A HH21 1 
ATOM   2897 H HH22 . ARG A 1 307 ? 23.726 33.421  -40.725 1.00 0.00   ? 1448 ARG A HH22 1 
ATOM   2898 N N    . ILE A 1 308 ? 18.956 29.545  -46.163 1.00 25.04  ? 1449 ILE A N    1 
ATOM   2899 C CA   . ILE A 1 308 ? 20.055 29.060  -46.995 1.00 21.39  ? 1449 ILE A CA   1 
ATOM   2900 C C    . ILE A 1 308 ? 21.055 30.205  -47.168 1.00 19.18  ? 1449 ILE A C    1 
ATOM   2901 O O    . ILE A 1 308 ? 20.653 31.347  -47.368 1.00 17.39  ? 1449 ILE A O    1 
ATOM   2902 C CB   . ILE A 1 308 ? 19.540 28.634  -48.439 1.00 27.93  ? 1449 ILE A CB   1 
ATOM   2903 C CG1  . ILE A 1 308 ? 18.585 27.433  -48.368 1.00 30.24  ? 1449 ILE A CG1  1 
ATOM   2904 C CG2  . ILE A 1 308 ? 20.700 28.270  -49.351 1.00 15.25  ? 1449 ILE A CG2  1 
ATOM   2905 C CD1  . ILE A 1 308 ? 17.159 27.767  -47.998 1.00 26.05  ? 1449 ILE A CD1  1 
ATOM   2906 H H    . ILE A 1 308 ? 18.347 30.210  -46.553 1.00 0.00   ? 1449 ILE A H    1 
ATOM   2907 N N    . THR A 1 309 ? 22.345 29.918  -47.030 1.00 20.93  ? 1450 THR A N    1 
ATOM   2908 C CA   . THR A 1 309 ? 23.368 30.929  -47.240 1.00 21.50  ? 1450 THR A CA   1 
ATOM   2909 C C    . THR A 1 309 ? 24.377 30.319  -48.174 1.00 21.38  ? 1450 THR A C    1 
ATOM   2910 O O    . THR A 1 309 ? 24.588 29.101  -48.171 1.00 28.22  ? 1450 THR A O    1 
ATOM   2911 C CB   . THR A 1 309 ? 24.099 31.368  -45.952 1.00 27.37  ? 1450 THR A CB   1 
ATOM   2912 O OG1  . THR A 1 309 ? 24.816 30.260  -45.390 1.00 40.26  ? 1450 THR A OG1  1 
ATOM   2913 C CG2  . THR A 1 309 ? 23.119 31.940  -44.927 1.00 23.43  ? 1450 THR A CG2  1 
ATOM   2914 H H    . THR A 1 309 ? 22.632 29.008  -46.809 1.00 0.00   ? 1450 THR A H    1 
ATOM   2915 H HG1  . THR A 1 309 ? 25.509 29.974  -46.011 1.00 0.00   ? 1450 THR A HG1  1 
ATOM   2916 N N    . TYR A 1 310 ? 24.980 31.157  -49.000 1.00 29.20  ? 1451 TYR A N    1 
ATOM   2917 C CA   . TYR A 1 310 ? 25.984 30.688  -49.944 1.00 29.82  ? 1451 TYR A CA   1 
ATOM   2918 C C    . TYR A 1 310 ? 27.019 31.771  -50.173 1.00 26.11  ? 1451 TYR A C    1 
ATOM   2919 O O    . TYR A 1 310 ? 26.706 32.969  -50.184 1.00 27.92  ? 1451 TYR A O    1 
ATOM   2920 C CB   . TYR A 1 310 ? 25.340 30.273  -51.268 1.00 32.46  ? 1451 TYR A CB   1 
ATOM   2921 C CG   . TYR A 1 310 ? 24.654 31.390  -52.024 1.00 28.65  ? 1451 TYR A CG   1 
ATOM   2922 C CD1  . TYR A 1 310 ? 23.304 31.697  -51.793 1.00 28.23  ? 1451 TYR A CD1  1 
ATOM   2923 C CD2  . TYR A 1 310 ? 25.336 32.095  -53.022 1.00 29.39  ? 1451 TYR A CD2  1 
ATOM   2924 C CE1  . TYR A 1 310 ? 22.649 32.677  -52.547 1.00 22.41  ? 1451 TYR A CE1  1 
ATOM   2925 C CE2  . TYR A 1 310 ? 24.694 33.069  -53.780 1.00 27.66  ? 1451 TYR A CE2  1 
ATOM   2926 C CZ   . TYR A 1 310 ? 23.355 33.357  -53.543 1.00 28.80  ? 1451 TYR A CZ   1 
ATOM   2927 O OH   . TYR A 1 310 ? 22.739 34.322  -54.312 1.00 35.94  ? 1451 TYR A OH   1 
ATOM   2928 H H    . TYR A 1 310 ? 24.772 32.117  -48.990 1.00 0.00   ? 1451 TYR A H    1 
ATOM   2929 H HH   . TYR A 1 310 ? 21.828 34.430  -54.024 1.00 0.00   ? 1451 TYR A HH   1 
ATOM   2930 N N    . GLY A 1 311 ? 28.256 31.338  -50.314 1.00 19.20  ? 1452 GLY A N    1 
ATOM   2931 C CA   . GLY A 1 311 ? 29.344 32.259  -50.530 1.00 26.27  ? 1452 GLY A CA   1 
ATOM   2932 C C    . GLY A 1 311 ? 30.527 31.425  -50.949 1.00 31.76  ? 1452 GLY A C    1 
ATOM   2933 O O    . GLY A 1 311 ? 30.591 30.238  -50.623 1.00 32.13  ? 1452 GLY A O    1 
ATOM   2934 H H    . GLY A 1 311 ? 28.460 30.380  -50.263 1.00 0.00   ? 1452 GLY A H    1 
ATOM   2935 N N    . GLU A 1 312 ? 31.431 32.035  -51.706 1.00 32.84  ? 1453 GLU A N    1 
ATOM   2936 C CA   . GLU A 1 312 ? 32.632 31.380  -52.193 1.00 27.11  ? 1453 GLU A CA   1 
ATOM   2937 C C    . GLU A 1 312 ? 33.388 30.754  -51.040 1.00 27.46  ? 1453 GLU A C    1 
ATOM   2938 O O    . GLU A 1 312 ? 33.653 31.416  -50.040 1.00 35.05  ? 1453 GLU A O    1 
ATOM   2939 C CB   . GLU A 1 312 ? 33.509 32.405  -52.893 1.00 30.61  ? 1453 GLU A CB   1 
ATOM   2940 C CG   . GLU A 1 312 ? 34.753 31.840  -53.525 1.00 40.98  ? 1453 GLU A CG   1 
ATOM   2941 C CD   . GLU A 1 312 ? 35.361 32.808  -54.501 1.00 46.14  ? 1453 GLU A CD   1 
ATOM   2942 O OE1  . GLU A 1 312 ? 35.608 33.970  -54.108 1.00 53.43  ? 1453 GLU A OE1  1 
ATOM   2943 O OE2  . GLU A 1 312 ? 35.560 32.425  -55.669 1.00 47.04  ? 1453 GLU A OE2  1 
ATOM   2944 H H    . GLU A 1 312 ? 31.294 32.973  -51.932 1.00 0.00   ? 1453 GLU A H    1 
ATOM   2945 N N    . THR A 1 313 ? 33.715 29.474  -51.175 1.00 28.77  ? 1454 THR A N    1 
ATOM   2946 C CA   . THR A 1 313 ? 34.425 28.738  -50.144 1.00 26.21  ? 1454 THR A CA   1 
ATOM   2947 C C    . THR A 1 313 ? 35.706 29.469  -49.823 1.00 31.33  ? 1454 THR A C    1 
ATOM   2948 O O    . THR A 1 313 ? 36.439 29.865  -50.729 1.00 34.41  ? 1454 THR A O    1 
ATOM   2949 C CB   . THR A 1 313 ? 34.723 27.307  -50.608 1.00 27.28  ? 1454 THR A CB   1 
ATOM   2950 O OG1  . THR A 1 313 ? 33.486 26.633  -50.865 1.00 31.72  ? 1454 THR A OG1  1 
ATOM   2951 C CG2  . THR A 1 313 ? 35.485 26.550  -49.543 1.00 28.13  ? 1454 THR A CG2  1 
ATOM   2952 H H    . THR A 1 313 ? 33.502 28.989  -51.981 1.00 0.00   ? 1454 THR A H    1 
ATOM   2953 H HG1  . THR A 1 313 ? 33.727 25.857  -51.400 1.00 0.00   ? 1454 THR A HG1  1 
ATOM   2954 N N    . GLY A 1 314 ? 35.937 29.708  -48.533 1.00 31.27  ? 1455 GLY A N    1 
ATOM   2955 C CA   . GLY A 1 314 ? 37.128 30.426  -48.110 1.00 33.80  ? 1455 GLY A CA   1 
ATOM   2956 C C    . GLY A 1 314 ? 37.166 31.876  -48.576 1.00 32.82  ? 1455 GLY A C    1 
ATOM   2957 O O    . GLY A 1 314 ? 38.219 32.520  -48.547 1.00 37.38  ? 1455 GLY A O    1 
ATOM   2958 H H    . GLY A 1 314 ? 35.288 29.404  -47.866 1.00 0.00   ? 1455 GLY A H    1 
ATOM   2959 N N    . GLY A 1 315 ? 36.022 32.386  -49.017 1.00 30.11  ? 1456 GLY A N    1 
ATOM   2960 C CA   . GLY A 1 315 ? 35.949 33.758  -49.473 1.00 32.88  ? 1456 GLY A CA   1 
ATOM   2961 C C    . GLY A 1 315 ? 36.095 34.768  -48.347 1.00 38.06  ? 1456 GLY A C    1 
ATOM   2962 O O    . GLY A 1 315 ? 36.706 35.818  -48.533 1.00 42.25  ? 1456 GLY A O    1 
ATOM   2963 H H    . GLY A 1 315 ? 35.211 31.846  -49.044 1.00 0.00   ? 1456 GLY A H    1 
ATOM   2964 N N    . ASN A 1 316 ? 35.521 34.461  -47.186 1.00 35.23  ? 1457 ASN A N    1 
ATOM   2965 C CA   . ASN A 1 316 ? 35.565 35.336  -46.011 1.00 31.59  ? 1457 ASN A CA   1 
ATOM   2966 C C    . ASN A 1 316 ? 34.640 36.561  -46.094 1.00 34.77  ? 1457 ASN A C    1 
ATOM   2967 O O    . ASN A 1 316 ? 34.342 37.176  -45.073 1.00 43.91  ? 1457 ASN A O    1 
ATOM   2968 C CB   . ASN A 1 316 ? 37.006 35.773  -45.699 1.00 28.30  ? 1457 ASN A CB   1 
ATOM   2969 C CG   . ASN A 1 316 ? 37.146 36.392  -44.316 1.00 28.34  ? 1457 ASN A CG   1 
ATOM   2970 O OD1  . ASN A 1 316 ? 37.671 37.493  -44.161 1.00 30.42  ? 1457 ASN A OD1  1 
ATOM   2971 N ND2  . ASN A 1 316 ? 36.709 35.665  -43.298 1.00 27.17  ? 1457 ASN A ND2  1 
ATOM   2972 H H    . ASN A 1 316 ? 35.069 33.595  -47.108 1.00 0.00   ? 1457 ASN A H    1 
ATOM   2973 H HD21 . ASN A 1 316 ? 36.745 36.055  -42.403 1.00 0.00   ? 1457 ASN A HD21 1 
ATOM   2974 H HD22 . ASN A 1 316 ? 36.343 34.777  -43.477 1.00 0.00   ? 1457 ASN A HD22 1 
ATOM   2975 N N    . SER A 1 317 ? 34.149 36.887  -47.288 1.00 30.49  ? 1458 SER A N    1 
ATOM   2976 C CA   . SER A 1 317 ? 33.252 38.031  -47.482 1.00 27.62  ? 1458 SER A CA   1 
ATOM   2977 C C    . SER A 1 317 ? 31.819 37.658  -47.048 1.00 28.72  ? 1458 SER A C    1 
ATOM   2978 O O    . SER A 1 317 ? 31.525 36.485  -46.810 1.00 32.61  ? 1458 SER A O    1 
ATOM   2979 C CB   . SER A 1 317 ? 33.269 38.453  -48.957 1.00 32.96  ? 1458 SER A CB   1 
ATOM   2980 O OG   . SER A 1 317 ? 34.592 38.682  -49.422 1.00 29.19  ? 1458 SER A OG   1 
ATOM   2981 H H    . SER A 1 317 ? 34.383 36.354  -48.068 1.00 0.00   ? 1458 SER A H    1 
ATOM   2982 H HG   . SER A 1 317 ? 35.055 37.835  -49.452 1.00 0.00   ? 1458 SER A HG   1 
ATOM   2983 N N    . PRO A 1 318 ? 30.902 38.641  -46.964 1.00 24.56  ? 1459 PRO A N    1 
ATOM   2984 C CA   . PRO A 1 318 ? 29.527 38.336  -46.552 1.00 25.75  ? 1459 PRO A CA   1 
ATOM   2985 C C    . PRO A 1 318 ? 28.820 37.306  -47.434 1.00 30.12  ? 1459 PRO A C    1 
ATOM   2986 O O    . PRO A 1 318 ? 28.907 37.365  -48.671 1.00 34.09  ? 1459 PRO A O    1 
ATOM   2987 C CB   . PRO A 1 318 ? 28.830 39.702  -46.635 1.00 26.06  ? 1459 PRO A CB   1 
ATOM   2988 C CG   . PRO A 1 318 ? 29.931 40.668  -46.370 1.00 17.58  ? 1459 PRO A CG   1 
ATOM   2989 C CD   . PRO A 1 318 ? 31.065 40.088  -47.187 1.00 24.36  ? 1459 PRO A CD   1 
ATOM   2990 N N    . VAL A 1 319 ? 28.149 36.351  -46.792 1.00 27.71  ? 1460 VAL A N    1 
ATOM   2991 C CA   . VAL A 1 319 ? 27.405 35.317  -47.509 1.00 26.11  ? 1460 VAL A CA   1 
ATOM   2992 C C    . VAL A 1 319 ? 26.075 35.921  -47.937 1.00 28.02  ? 1460 VAL A C    1 
ATOM   2993 O O    . VAL A 1 319 ? 25.629 36.916  -47.359 1.00 24.13  ? 1460 VAL A O    1 
ATOM   2994 C CB   . VAL A 1 319 ? 27.077 34.047  -46.627 1.00 25.39  ? 1460 VAL A CB   1 
ATOM   2995 C CG1  . VAL A 1 319 ? 28.344 33.312  -46.195 1.00 15.84  ? 1460 VAL A CG1  1 
ATOM   2996 C CG2  . VAL A 1 319 ? 26.220 34.423  -45.426 1.00 27.07  ? 1460 VAL A CG2  1 
ATOM   2997 H H    . VAL A 1 319 ? 28.155 36.353  -45.810 1.00 0.00   ? 1460 VAL A H    1 
ATOM   2998 N N    . GLN A 1 320 ? 25.480 35.367  -48.988 1.00 22.51  ? 1461 GLN A N    1 
ATOM   2999 C CA   . GLN A 1 320 ? 24.185 35.831  -49.440 1.00 25.16  ? 1461 GLN A CA   1 
ATOM   3000 C C    . GLN A 1 320 ? 23.222 34.795  -48.919 1.00 28.05  ? 1461 GLN A C    1 
ATOM   3001 O O    . GLN A 1 320 ? 23.618 33.646  -48.720 1.00 31.37  ? 1461 GLN A O    1 
ATOM   3002 C CB   . GLN A 1 320 ? 24.116 35.880  -50.957 1.00 31.15  ? 1461 GLN A CB   1 
ATOM   3003 C CG   . GLN A 1 320 ? 24.994 36.936  -51.572 1.00 34.14  ? 1461 GLN A CG   1 
ATOM   3004 C CD   . GLN A 1 320 ? 25.058 36.793  -53.064 1.00 33.07  ? 1461 GLN A CD   1 
ATOM   3005 O OE1  . GLN A 1 320 ? 25.967 36.159  -53.597 1.00 41.27  ? 1461 GLN A OE1  1 
ATOM   3006 N NE2  . GLN A 1 320 ? 24.078 37.347  -53.750 1.00 37.21  ? 1461 GLN A NE2  1 
ATOM   3007 H H    . GLN A 1 320 ? 25.922 34.633  -49.475 1.00 0.00   ? 1461 GLN A H    1 
ATOM   3008 H HE21 . GLN A 1 320 ? 24.106 37.210  -54.720 1.00 0.00   ? 1461 GLN A HE21 1 
ATOM   3009 H HE22 . GLN A 1 320 ? 23.372 37.836  -53.286 1.00 0.00   ? 1461 GLN A HE22 1 
ATOM   3010 N N    . GLU A 1 321 ? 21.980 35.197  -48.666 1.00 27.26  ? 1462 GLU A N    1 
ATOM   3011 C CA   . GLU A 1 321 ? 20.989 34.271  -48.155 1.00 29.24  ? 1462 GLU A CA   1 
ATOM   3012 C C    . GLU A 1 321 ? 19.567 34.593  -48.556 1.00 24.90  ? 1462 GLU A C    1 
ATOM   3013 O O    . GLU A 1 321 ? 19.276 35.683  -49.038 1.00 26.84  ? 1462 GLU A O    1 
ATOM   3014 C CB   . GLU A 1 321 ? 21.091 34.141  -46.631 1.00 37.84  ? 1462 GLU A CB   1 
ATOM   3015 C CG   . GLU A 1 321 ? 20.906 35.409  -45.837 1.00 37.04  ? 1462 GLU A CG   1 
ATOM   3016 C CD   . GLU A 1 321 ? 20.811 35.128  -44.346 1.00 49.30  ? 1462 GLU A CD   1 
ATOM   3017 O OE1  . GLU A 1 321 ? 21.863 35.067  -43.667 1.00 50.01  ? 1462 GLU A OE1  1 
ATOM   3018 O OE2  . GLU A 1 321 ? 19.681 34.939  -43.846 1.00 39.47  ? 1462 GLU A OE2  1 
ATOM   3019 H H    . GLU A 1 321 ? 21.695 36.121  -48.805 1.00 0.00   ? 1462 GLU A H    1 
ATOM   3020 N N    . PHE A 1 322 ? 18.699 33.607  -48.379 1.00 24.19  ? 1463 PHE A N    1 
ATOM   3021 C CA   . PHE A 1 322 ? 17.280 33.701  -48.694 1.00 21.45  ? 1463 PHE A CA   1 
ATOM   3022 C C    . PHE A 1 322 ? 16.611 32.570  -47.922 1.00 20.61  ? 1463 PHE A C    1 
ATOM   3023 O O    . PHE A 1 322 ? 17.294 31.718  -47.344 1.00 22.58  ? 1463 PHE A O    1 
ATOM   3024 C CB   . PHE A 1 322 ? 17.039 33.539  -50.201 1.00 23.31  ? 1463 PHE A CB   1 
ATOM   3025 C CG   . PHE A 1 322 ? 17.507 32.215  -50.765 1.00 24.62  ? 1463 PHE A CG   1 
ATOM   3026 C CD1  . PHE A 1 322 ? 18.851 32.005  -51.066 1.00 25.07  ? 1463 PHE A CD1  1 
ATOM   3027 C CD2  . PHE A 1 322 ? 16.600 31.186  -51.007 1.00 29.44  ? 1463 PHE A CD2  1 
ATOM   3028 C CE1  . PHE A 1 322 ? 19.282 30.798  -51.595 1.00 22.69  ? 1463 PHE A CE1  1 
ATOM   3029 C CE2  . PHE A 1 322 ? 17.022 29.966  -51.537 1.00 24.71  ? 1463 PHE A CE2  1 
ATOM   3030 C CZ   . PHE A 1 322 ? 18.363 29.774  -51.831 1.00 17.57  ? 1463 PHE A CZ   1 
ATOM   3031 H H    . PHE A 1 322 ? 19.015 32.757  -47.994 1.00 0.00   ? 1463 PHE A H    1 
ATOM   3032 N N    . THR A 1 323 ? 15.287 32.543  -47.921 1.00 17.40  ? 1464 THR A N    1 
ATOM   3033 C CA   . THR A 1 323 ? 14.572 31.509  -47.197 1.00 23.37  ? 1464 THR A CA   1 
ATOM   3034 C C    . THR A 1 323 ? 13.797 30.575  -48.103 1.00 25.26  ? 1464 THR A C    1 
ATOM   3035 O O    . THR A 1 323 ? 13.618 30.832  -49.294 1.00 25.05  ? 1464 THR A O    1 
ATOM   3036 C CB   . THR A 1 323 ? 13.581 32.114  -46.189 1.00 26.42  ? 1464 THR A CB   1 
ATOM   3037 O OG1  . THR A 1 323 ? 12.548 32.828  -46.891 1.00 30.85  ? 1464 THR A OG1  1 
ATOM   3038 C CG2  . THR A 1 323 ? 14.314 33.061  -45.220 1.00 20.07  ? 1464 THR A CG2  1 
ATOM   3039 H H    . THR A 1 323 ? 14.761 33.207  -48.421 1.00 0.00   ? 1464 THR A H    1 
ATOM   3040 H HG1  . THR A 1 323 ? 11.988 32.234  -47.429 1.00 0.00   ? 1464 THR A HG1  1 
ATOM   3041 N N    . VAL A 1 324 ? 13.300 29.504  -47.501 1.00 31.02  ? 1465 VAL A N    1 
ATOM   3042 C CA   . VAL A 1 324 ? 12.496 28.497  -48.181 1.00 27.05  ? 1465 VAL A CA   1 
ATOM   3043 C C    . VAL A 1 324 ? 11.426 28.125  -47.151 1.00 26.84  ? 1465 VAL A C    1 
ATOM   3044 O O    . VAL A 1 324 ? 11.706 28.126  -45.953 1.00 29.20  ? 1465 VAL A O    1 
ATOM   3045 C CB   . VAL A 1 324 ? 13.359 27.256  -48.541 1.00 26.98  ? 1465 VAL A CB   1 
ATOM   3046 C CG1  . VAL A 1 324 ? 12.502 26.158  -49.115 1.00 30.89  ? 1465 VAL A CG1  1 
ATOM   3047 C CG2  . VAL A 1 324 ? 14.418 27.630  -49.552 1.00 23.28  ? 1465 VAL A CG2  1 
ATOM   3048 H H    . VAL A 1 324 ? 13.482 29.372  -46.544 1.00 0.00   ? 1465 VAL A H    1 
ATOM   3049 N N    . PRO A 1 325 ? 10.169 27.914  -47.583 1.00 25.59  ? 1466 PRO A N    1 
ATOM   3050 C CA   . PRO A 1 325 ? 9.130  27.554  -46.610 1.00 26.92  ? 1466 PRO A CA   1 
ATOM   3051 C C    . PRO A 1 325 ? 9.460  26.221  -45.949 1.00 29.25  ? 1466 PRO A C    1 
ATOM   3052 O O    . PRO A 1 325 ? 10.096 25.355  -46.554 1.00 28.52  ? 1466 PRO A O    1 
ATOM   3053 C CB   . PRO A 1 325 ? 7.871  27.457  -47.468 1.00 21.98  ? 1466 PRO A CB   1 
ATOM   3054 C CG   . PRO A 1 325 ? 8.141  28.431  -48.563 1.00 28.60  ? 1466 PRO A CG   1 
ATOM   3055 C CD   . PRO A 1 325 ? 9.579  28.143  -48.911 1.00 26.46  ? 1466 PRO A CD   1 
ATOM   3056 N N    . GLY A 1 326 ? 9.008  26.056  -44.714 1.00 34.84  ? 1467 GLY A N    1 
ATOM   3057 C CA   . GLY A 1 326 ? 9.281  24.836  -43.979 1.00 34.67  ? 1467 GLY A CA   1 
ATOM   3058 C C    . GLY A 1 326 ? 8.783  23.590  -44.673 1.00 36.59  ? 1467 GLY A C    1 
ATOM   3059 O O    . GLY A 1 326 ? 9.355  22.513  -44.503 1.00 40.83  ? 1467 GLY A O    1 
ATOM   3060 H H    . GLY A 1 326 ? 8.472  26.763  -44.285 1.00 0.00   ? 1467 GLY A H    1 
ATOM   3061 N N    . SER A 1 327 ? 7.732  23.740  -45.473 1.00 33.80  ? 1468 SER A N    1 
ATOM   3062 C CA   . SER A 1 327 ? 7.143  22.620  -46.185 1.00 32.18  ? 1468 SER A CA   1 
ATOM   3063 C C    . SER A 1 327 ? 7.960  22.104  -47.358 1.00 33.88  ? 1468 SER A C    1 
ATOM   3064 O O    . SER A 1 327 ? 7.629  21.054  -47.899 1.00 41.82  ? 1468 SER A O    1 
ATOM   3065 C CB   . SER A 1 327 ? 5.729  22.974  -46.653 1.00 28.19  ? 1468 SER A CB   1 
ATOM   3066 O OG   . SER A 1 327 ? 5.731  24.174  -47.408 1.00 42.16  ? 1468 SER A OG   1 
ATOM   3067 H H    . SER A 1 327 ? 7.323  24.621  -45.602 1.00 0.00   ? 1468 SER A H    1 
ATOM   3068 H HG   . SER A 1 327 ? 4.816  24.364  -47.673 1.00 0.00   ? 1468 SER A HG   1 
ATOM   3069 N N    . LYS A 1 328 ? 9.001  22.828  -47.772 1.00 36.99  ? 1469 LYS A N    1 
ATOM   3070 C CA   . LYS A 1 328 ? 9.815  22.363  -48.892 1.00 37.70  ? 1469 LYS A CA   1 
ATOM   3071 C C    . LYS A 1 328 ? 11.311 22.228  -48.608 1.00 38.41  ? 1469 LYS A C    1 
ATOM   3072 O O    . LYS A 1 328 ? 11.938 23.117  -48.028 1.00 40.60  ? 1469 LYS A O    1 
ATOM   3073 C CB   . LYS A 1 328 ? 9.569  23.197  -50.148 1.00 44.47  ? 1469 LYS A CB   1 
ATOM   3074 C CG   . LYS A 1 328 ? 9.977  24.644  -50.060 1.00 51.61  ? 1469 LYS A CG   1 
ATOM   3075 C CD   . LYS A 1 328 ? 9.720  25.373  -51.393 1.00 62.48  ? 1469 LYS A CD   1 
ATOM   3076 C CE   . LYS A 1 328 ? 10.703 24.994  -52.511 1.00 47.99  ? 1469 LYS A CE   1 
ATOM   3077 N NZ   . LYS A 1 328 ? 11.978 25.750  -52.425 1.00 45.88  ? 1469 LYS A NZ   1 
ATOM   3078 H H    . LYS A 1 328 ? 9.262  23.658  -47.324 1.00 0.00   ? 1469 LYS A H    1 
ATOM   3079 H HZ1  . LYS A 1 328 ? 11.810 26.769  -52.487 1.00 0.00   ? 1469 LYS A HZ1  1 
ATOM   3080 H HZ2  . LYS A 1 328 ? 12.458 25.520  -51.528 1.00 0.00   ? 1469 LYS A HZ2  1 
ATOM   3081 H HZ3  . LYS A 1 328 ? 12.646 25.431  -53.153 1.00 0.00   ? 1469 LYS A HZ3  1 
ATOM   3082 N N    . SER A 1 329 ? 11.877 21.125  -49.089 1.00 34.23  ? 1470 SER A N    1 
ATOM   3083 C CA   . SER A 1 329 ? 13.285 20.800  -48.896 1.00 33.09  ? 1470 SER A CA   1 
ATOM   3084 C C    . SER A 1 329 ? 14.114 20.829  -50.171 1.00 31.34  ? 1470 SER A C    1 
ATOM   3085 O O    . SER A 1 329 ? 15.016 20.009  -50.358 1.00 29.81  ? 1470 SER A O    1 
ATOM   3086 C CB   . SER A 1 329 ? 13.405 19.435  -48.225 1.00 29.13  ? 1470 SER A CB   1 
ATOM   3087 O OG   . SER A 1 329 ? 12.565 18.505  -48.879 1.00 37.01  ? 1470 SER A OG   1 
ATOM   3088 H H    . SER A 1 329 ? 11.344 20.482  -49.607 1.00 0.00   ? 1470 SER A H    1 
ATOM   3089 H HG   . SER A 1 329 ? 13.118 18.070  -49.552 1.00 0.00   ? 1470 SER A HG   1 
ATOM   3090 N N    . THR A 1 330 ? 13.816 21.797  -51.029 1.00 31.18  ? 1471 THR A N    1 
ATOM   3091 C CA   . THR A 1 330 ? 14.534 21.986  -52.283 1.00 38.92  ? 1471 THR A CA   1 
ATOM   3092 C C    . THR A 1 330 ? 14.729 23.478  -52.524 1.00 37.73  ? 1471 THR A C    1 
ATOM   3093 O O    . THR A 1 330 ? 13.935 24.302  -52.047 1.00 34.62  ? 1471 THR A O    1 
ATOM   3094 C CB   . THR A 1 330 ? 13.758 21.396  -53.488 1.00 46.62  ? 1471 THR A CB   1 
ATOM   3095 O OG1  . THR A 1 330 ? 12.343 21.554  -53.287 1.00 54.26  ? 1471 THR A OG1  1 
ATOM   3096 C CG2  . THR A 1 330 ? 14.098 19.927  -53.672 1.00 54.00  ? 1471 THR A CG2  1 
ATOM   3097 H H    . THR A 1 330 ? 13.102 22.424  -50.811 1.00 0.00   ? 1471 THR A H    1 
ATOM   3098 H HG1  . THR A 1 330 ? 11.894 21.260  -54.091 1.00 0.00   ? 1471 THR A HG1  1 
ATOM   3099 N N    . ALA A 1 331 ? 15.778 23.835  -53.254 1.00 31.14  ? 1472 ALA A N    1 
ATOM   3100 C CA   . ALA A 1 331 ? 16.024 25.235  -53.557 1.00 24.15  ? 1472 ALA A CA   1 
ATOM   3101 C C    . ALA A 1 331 ? 16.945 25.350  -54.758 1.00 27.32  ? 1472 ALA A C    1 
ATOM   3102 O O    . ALA A 1 331 ? 17.684 24.422  -55.083 1.00 26.66  ? 1472 ALA A O    1 
ATOM   3103 C CB   . ALA A 1 331 ? 16.634 25.946  -52.350 1.00 25.04  ? 1472 ALA A CB   1 
ATOM   3104 H H    . ALA A 1 331 ? 16.421 23.172  -53.607 1.00 0.00   ? 1472 ALA A H    1 
ATOM   3105 N N    . THR A 1 332 ? 16.894 26.501  -55.406 1.00 31.63  ? 1473 THR A N    1 
ATOM   3106 C CA   . THR A 1 332 ? 17.723 26.765  -56.565 1.00 37.22  ? 1473 THR A CA   1 
ATOM   3107 C C    . THR A 1 332 ? 18.513 28.005  -56.211 1.00 36.20  ? 1473 THR A C    1 
ATOM   3108 O O    . THR A 1 332 ? 17.949 28.962  -55.693 1.00 34.73  ? 1473 THR A O    1 
ATOM   3109 C CB   . THR A 1 332 ? 16.866 27.090  -57.794 1.00 42.37  ? 1473 THR A CB   1 
ATOM   3110 O OG1  . THR A 1 332 ? 15.757 26.182  -57.857 1.00 45.72  ? 1473 THR A OG1  1 
ATOM   3111 C CG2  . THR A 1 332 ? 17.701 26.977  -59.067 1.00 38.46  ? 1473 THR A CG2  1 
ATOM   3112 H H    . THR A 1 332 ? 16.314 27.231  -55.118 1.00 0.00   ? 1473 THR A H    1 
ATOM   3113 H HG1  . THR A 1 332 ? 15.351 26.251  -58.724 1.00 0.00   ? 1473 THR A HG1  1 
ATOM   3114 N N    . ILE A 1 333 ? 19.816 27.969  -56.439 1.00 38.33  ? 1474 ILE A N    1 
ATOM   3115 C CA   . ILE A 1 333 ? 20.668 29.106  -56.145 1.00 36.67  ? 1474 ILE A CA   1 
ATOM   3116 C C    . ILE A 1 333 ? 21.193 29.599  -57.486 1.00 40.21  ? 1474 ILE A C    1 
ATOM   3117 O O    . ILE A 1 333 ? 22.122 29.023  -58.063 1.00 34.89  ? 1474 ILE A O    1 
ATOM   3118 C CB   . ILE A 1 333 ? 21.819 28.710  -55.207 1.00 34.35  ? 1474 ILE A CB   1 
ATOM   3119 C CG1  . ILE A 1 333 ? 21.264 28.068  -53.937 1.00 28.30  ? 1474 ILE A CG1  1 
ATOM   3120 C CG2  . ILE A 1 333 ? 22.605 29.934  -54.823 1.00 39.17  ? 1474 ILE A CG2  1 
ATOM   3121 C CD1  . ILE A 1 333 ? 22.332 27.477  -53.060 1.00 32.23  ? 1474 ILE A CD1  1 
ATOM   3122 H H    . ILE A 1 333 ? 20.219 27.165  -56.826 1.00 0.00   ? 1474 ILE A H    1 
ATOM   3123 N N    . SER A 1 334 ? 20.552 30.646  -57.990 1.00 45.17  ? 1475 SER A N    1 
ATOM   3124 C CA   . SER A 1 334 ? 20.885 31.220  -59.286 1.00 52.31  ? 1475 SER A CA   1 
ATOM   3125 C C    . SER A 1 334 ? 22.037 32.217  -59.295 1.00 57.81  ? 1475 SER A C    1 
ATOM   3126 O O    . SER A 1 334 ? 22.546 32.618  -58.244 1.00 63.86  ? 1475 SER A O    1 
ATOM   3127 C CB   . SER A 1 334 ? 19.644 31.893  -59.865 1.00 43.78  ? 1475 SER A CB   1 
ATOM   3128 O OG   . SER A 1 334 ? 18.488 31.122  -59.590 1.00 51.63  ? 1475 SER A OG   1 
ATOM   3129 H H    . SER A 1 334 ? 19.833 31.060  -57.475 1.00 0.00   ? 1475 SER A H    1 
ATOM   3130 H HG   . SER A 1 334 ? 18.607 30.241  -59.949 1.00 0.00   ? 1475 SER A HG   1 
ATOM   3131 N N    . GLY A 1 335 ? 22.454 32.573  -60.509 1.00 58.24  ? 1476 GLY A N    1 
ATOM   3132 C CA   . GLY A 1 335 ? 23.508 33.549  -60.719 1.00 55.81  ? 1476 GLY A CA   1 
ATOM   3133 C C    . GLY A 1 335 ? 24.893 33.277  -60.175 1.00 52.58  ? 1476 GLY A C    1 
ATOM   3134 O O    . GLY A 1 335 ? 25.716 34.196  -60.108 1.00 53.50  ? 1476 GLY A O    1 
ATOM   3135 H H    . GLY A 1 335 ? 22.076 32.131  -61.291 1.00 0.00   ? 1476 GLY A H    1 
ATOM   3136 N N    . LEU A 1 336 ? 25.180 32.038  -59.810 1.00 48.03  ? 1477 LEU A N    1 
ATOM   3137 C CA   . LEU A 1 336 ? 26.492 31.713  -59.278 1.00 53.92  ? 1477 LEU A CA   1 
ATOM   3138 C C    . LEU A 1 336 ? 27.566 31.994  -60.330 1.00 61.19  ? 1477 LEU A C    1 
ATOM   3139 O O    . LEU A 1 336 ? 27.276 32.553  -61.393 1.00 65.66  ? 1477 LEU A O    1 
ATOM   3140 C CB   . LEU A 1 336 ? 26.528 30.246  -58.843 1.00 55.23  ? 1477 LEU A CB   1 
ATOM   3141 C CG   . LEU A 1 336 ? 25.371 29.792  -57.946 1.00 55.36  ? 1477 LEU A CG   1 
ATOM   3142 C CD1  . LEU A 1 336 ? 25.584 28.353  -57.531 1.00 52.44  ? 1477 LEU A CD1  1 
ATOM   3143 C CD2  . LEU A 1 336 ? 25.272 30.679  -56.722 1.00 53.40  ? 1477 LEU A CD2  1 
ATOM   3144 H H    . LEU A 1 336 ? 24.496 31.348  -59.875 1.00 0.00   ? 1477 LEU A H    1 
ATOM   3145 N N    . LYS A 1 337 ? 28.813 31.669  -60.015 1.00 63.18  ? 1478 LYS A N    1 
ATOM   3146 C CA   . LYS A 1 337 ? 29.908 31.881  -60.951 1.00 65.03  ? 1478 LYS A CA   1 
ATOM   3147 C C    . LYS A 1 337 ? 30.713 30.590  -61.051 1.00 67.79  ? 1478 LYS A C    1 
ATOM   3148 O O    . LYS A 1 337 ? 31.029 29.967  -60.035 1.00 72.63  ? 1478 LYS A O    1 
ATOM   3149 C CB   . LYS A 1 337 ? 30.805 33.031  -60.479 1.00 65.70  ? 1478 LYS A CB   1 
ATOM   3150 C CG   . LYS A 1 337 ? 30.079 34.358  -60.272 1.00 73.24  ? 1478 LYS A CG   1 
ATOM   3151 C CD   . LYS A 1 337 ? 29.546 34.927  -61.580 1.00 79.96  ? 1478 LYS A CD   1 
ATOM   3152 C CE   . LYS A 1 337 ? 28.774 36.229  -61.362 1.00 78.80  ? 1478 LYS A CE   1 
ATOM   3153 N NZ   . LYS A 1 337 ? 27.513 36.018  -60.597 1.00 87.09  ? 1478 LYS A NZ   1 
ATOM   3154 H H    . LYS A 1 337 ? 29.039 31.276  -59.147 1.00 0.00   ? 1478 LYS A H    1 
ATOM   3155 H HZ1  . LYS A 1 337 ? 26.901 35.290  -61.042 1.00 0.00   ? 1478 LYS A HZ1  1 
ATOM   3156 H HZ2  . LYS A 1 337 ? 27.701 35.630  -59.655 1.00 0.00   ? 1478 LYS A HZ2  1 
ATOM   3157 H HZ3  . LYS A 1 337 ? 26.965 36.890  -60.501 1.00 0.00   ? 1478 LYS A HZ3  1 
ATOM   3158 N N    . PRO A 1 338 ? 31.004 30.136  -62.281 1.00 67.10  ? 1479 PRO A N    1 
ATOM   3159 C CA   . PRO A 1 338 ? 31.775 28.905  -62.489 1.00 62.99  ? 1479 PRO A CA   1 
ATOM   3160 C C    . PRO A 1 338 ? 33.218 29.106  -62.058 1.00 59.49  ? 1479 PRO A C    1 
ATOM   3161 O O    . PRO A 1 338 ? 33.710 30.234  -62.038 1.00 60.98  ? 1479 PRO A O    1 
ATOM   3162 C CB   . PRO A 1 338 ? 31.663 28.687  -63.994 1.00 63.40  ? 1479 PRO A CB   1 
ATOM   3163 C CG   . PRO A 1 338 ? 31.583 30.086  -64.523 1.00 66.90  ? 1479 PRO A CG   1 
ATOM   3164 C CD   . PRO A 1 338 ? 30.610 30.730  -63.571 1.00 66.75  ? 1479 PRO A CD   1 
ATOM   3165 N N    . GLY A 1 339 ? 33.896 28.014  -61.725 1.00 57.01  ? 1480 GLY A N    1 
ATOM   3166 C CA   . GLY A 1 339 ? 35.272 28.117  -61.280 1.00 61.36  ? 1480 GLY A CA   1 
ATOM   3167 C C    . GLY A 1 339 ? 35.307 28.804  -59.926 1.00 64.31  ? 1480 GLY A C    1 
ATOM   3168 O O    . GLY A 1 339 ? 36.312 29.410  -59.536 1.00 61.77  ? 1480 GLY A O    1 
ATOM   3169 H H    . GLY A 1 339 ? 33.497 27.110  -61.733 1.00 0.00   ? 1480 GLY A H    1 
ATOM   3170 N N    . VAL A 1 340 ? 34.195 28.709  -59.209 1.00 63.44  ? 1481 VAL A N    1 
ATOM   3171 C CA   . VAL A 1 340 ? 34.064 29.322  -57.901 1.00 61.21  ? 1481 VAL A CA   1 
ATOM   3172 C C    . VAL A 1 340 ? 33.455 28.311  -56.942 1.00 59.58  ? 1481 VAL A C    1 
ATOM   3173 O O    . VAL A 1 340 ? 32.279 27.957  -57.058 1.00 59.49  ? 1481 VAL A O    1 
ATOM   3174 C CB   . VAL A 1 340 ? 33.159 30.591  -57.959 1.00 62.65  ? 1481 VAL A CB   1 
ATOM   3175 C CG1  . VAL A 1 340 ? 32.873 31.119  -56.565 1.00 64.31  ? 1481 VAL A CG1  1 
ATOM   3176 C CG2  . VAL A 1 340 ? 33.818 31.675  -58.795 1.00 65.60  ? 1481 VAL A CG2  1 
ATOM   3177 H H    . VAL A 1 340 ? 33.440 28.170  -59.520 1.00 0.00   ? 1481 VAL A H    1 
ATOM   3178 N N    . ASP A 1 341 ? 34.278 27.807  -56.032 1.00 57.68  ? 1482 ASP A N    1 
ATOM   3179 C CA   . ASP A 1 341 ? 33.820 26.860  -55.023 1.00 55.72  ? 1482 ASP A CA   1 
ATOM   3180 C C    . ASP A 1 341 ? 32.829 27.632  -54.136 1.00 48.95  ? 1482 ASP A C    1 
ATOM   3181 O O    . ASP A 1 341 ? 33.126 28.738  -53.685 1.00 40.52  ? 1482 ASP A O    1 
ATOM   3182 C CB   . ASP A 1 341 ? 35.013 26.389  -54.183 1.00 60.58  ? 1482 ASP A CB   1 
ATOM   3183 C CG   . ASP A 1 341 ? 34.909 24.934  -53.782 1.00 68.39  ? 1482 ASP A CG   1 
ATOM   3184 O OD1  . ASP A 1 341 ? 35.267 24.068  -54.611 1.00 68.85  ? 1482 ASP A OD1  1 
ATOM   3185 O OD2  . ASP A 1 341 ? 34.486 24.650  -52.636 1.00 73.67  ? 1482 ASP A OD2  1 
ATOM   3186 H H    . ASP A 1 341 ? 35.218 28.076  -56.035 1.00 0.00   ? 1482 ASP A H    1 
ATOM   3187 N N    . TYR A 1 342 ? 31.640 27.075  -53.927 1.00 44.96  ? 1483 TYR A N    1 
ATOM   3188 C CA   . TYR A 1 342 ? 30.621 27.723  -53.108 1.00 38.78  ? 1483 TYR A CA   1 
ATOM   3189 C C    . TYR A 1 342 ? 30.235 26.900  -51.895 1.00 38.51  ? 1483 TYR A C    1 
ATOM   3190 O O    . TYR A 1 342 ? 29.908 25.724  -52.034 1.00 45.11  ? 1483 TYR A O    1 
ATOM   3191 C CB   . TYR A 1 342 ? 29.355 27.953  -53.922 1.00 42.17  ? 1483 TYR A CB   1 
ATOM   3192 C CG   . TYR A 1 342 ? 29.390 29.140  -54.843 1.00 54.81  ? 1483 TYR A CG   1 
ATOM   3193 C CD1  . TYR A 1 342 ? 29.376 30.439  -54.336 1.00 59.09  ? 1483 TYR A CD1  1 
ATOM   3194 C CD2  . TYR A 1 342 ? 29.388 28.969  -56.228 1.00 56.71  ? 1483 TYR A CD2  1 
ATOM   3195 C CE1  . TYR A 1 342 ? 29.352 31.543  -55.190 1.00 64.33  ? 1483 TYR A CE1  1 
ATOM   3196 C CE2  . TYR A 1 342 ? 29.364 30.066  -57.089 1.00 60.10  ? 1483 TYR A CE2  1 
ATOM   3197 C CZ   . TYR A 1 342 ? 29.344 31.348  -56.565 1.00 61.90  ? 1483 TYR A CZ   1 
ATOM   3198 O OH   . TYR A 1 342 ? 29.305 32.435  -57.410 1.00 62.16  ? 1483 TYR A OH   1 
ATOM   3199 H H    . TYR A 1 342 ? 31.484 26.194  -54.329 1.00 0.00   ? 1483 TYR A H    1 
ATOM   3200 H HH   . TYR A 1 342 ? 29.380 33.226  -56.864 1.00 0.00   ? 1483 TYR A HH   1 
ATOM   3201 N N    . THR A 1 343 ? 30.290 27.498  -50.708 1.00 32.08  ? 1484 THR A N    1 
ATOM   3202 C CA   . THR A 1 343 ? 29.873 26.793  -49.502 1.00 30.98  ? 1484 THR A CA   1 
ATOM   3203 C C    . THR A 1 343 ? 28.388 27.113  -49.300 1.00 28.36  ? 1484 THR A C    1 
ATOM   3204 O O    . THR A 1 343 ? 28.008 28.283  -49.185 1.00 31.62  ? 1484 THR A O    1 
ATOM   3205 C CB   . THR A 1 343 ? 30.693 27.211  -48.277 1.00 30.32  ? 1484 THR A CB   1 
ATOM   3206 O OG1  . THR A 1 343 ? 32.054 26.823  -48.472 1.00 27.05  ? 1484 THR A OG1  1 
ATOM   3207 C CG2  . THR A 1 343 ? 30.167 26.526  -47.013 1.00 24.84  ? 1484 THR A CG2  1 
ATOM   3208 H H    . THR A 1 343 ? 30.621 28.406  -50.622 1.00 0.00   ? 1484 THR A H    1 
ATOM   3209 H HG1  . THR A 1 343 ? 32.291 26.945  -49.403 1.00 0.00   ? 1484 THR A HG1  1 
ATOM   3210 N N    . ILE A 1 344 ? 27.551 26.079  -49.330 1.00 27.94  ? 1485 ILE A N    1 
ATOM   3211 C CA   . ILE A 1 344 ? 26.105 26.236  -49.179 1.00 25.19  ? 1485 ILE A CA   1 
ATOM   3212 C C    . ILE A 1 344 ? 25.698 25.720  -47.808 1.00 29.70  ? 1485 ILE A C    1 
ATOM   3213 O O    . ILE A 1 344 ? 26.056 24.602  -47.440 1.00 28.55  ? 1485 ILE A O    1 
ATOM   3214 C CB   . ILE A 1 344 ? 25.361 25.456  -50.285 1.00 30.70  ? 1485 ILE A CB   1 
ATOM   3215 C CG1  . ILE A 1 344 ? 25.956 25.813  -51.653 1.00 31.55  ? 1485 ILE A CG1  1 
ATOM   3216 C CG2  . ILE A 1 344 ? 23.878 25.788  -50.267 1.00 25.88  ? 1485 ILE A CG2  1 
ATOM   3217 C CD1  . ILE A 1 344 ? 25.420 25.008  -52.788 1.00 31.47  ? 1485 ILE A CD1  1 
ATOM   3218 H H    . ILE A 1 344 ? 27.926 25.179  -49.427 1.00 0.00   ? 1485 ILE A H    1 
ATOM   3219 N N    . THR A 1 345 ? 24.979 26.546  -47.050 1.00 23.95  ? 1486 THR A N    1 
ATOM   3220 C CA   . THR A 1 345 ? 24.550 26.185  -45.713 1.00 21.95  ? 1486 THR A CA   1 
ATOM   3221 C C    . THR A 1 345 ? 23.039 26.287  -45.639 1.00 28.84  ? 1486 THR A C    1 
ATOM   3222 O O    . THR A 1 345 ? 22.431 27.077  -46.365 1.00 25.72  ? 1486 THR A O    1 
ATOM   3223 C CB   . THR A 1 345 ? 25.192 27.117  -44.661 1.00 24.13  ? 1486 THR A CB   1 
ATOM   3224 O OG1  . THR A 1 345 ? 26.604 27.226  -44.918 1.00 24.86  ? 1486 THR A OG1  1 
ATOM   3225 C CG2  . THR A 1 345 ? 24.988 26.569  -43.246 1.00 18.25  ? 1486 THR A CG2  1 
ATOM   3226 H H    . THR A 1 345 ? 24.688 27.408  -47.396 1.00 0.00   ? 1486 THR A H    1 
ATOM   3227 H HG1  . THR A 1 345 ? 27.005 27.668  -44.162 1.00 0.00   ? 1486 THR A HG1  1 
ATOM   3228 N N    . VAL A 1 346 ? 22.432 25.441  -44.806 1.00 29.18  ? 1487 VAL A N    1 
ATOM   3229 C CA   . VAL A 1 346 ? 20.983 25.421  -44.616 1.00 26.35  ? 1487 VAL A CA   1 
ATOM   3230 C C    . VAL A 1 346 ? 20.699 25.286  -43.116 1.00 26.66  ? 1487 VAL A C    1 
ATOM   3231 O O    . VAL A 1 346 ? 21.356 24.498  -42.431 1.00 28.21  ? 1487 VAL A O    1 
ATOM   3232 C CB   . VAL A 1 346 ? 20.311 24.242  -45.400 1.00 18.79  ? 1487 VAL A CB   1 
ATOM   3233 C CG1  . VAL A 1 346 ? 18.816 24.262  -45.212 1.00 15.32  ? 1487 VAL A CG1  1 
ATOM   3234 C CG2  . VAL A 1 346 ? 20.614 24.341  -46.886 1.00 19.59  ? 1487 VAL A CG2  1 
ATOM   3235 H H    . VAL A 1 346 ? 22.958 24.784  -44.299 1.00 0.00   ? 1487 VAL A H    1 
ATOM   3236 N N    . TYR A 1 347 ? 19.774 26.106  -42.611 1.00 29.55  ? 1488 TYR A N    1 
ATOM   3237 C CA   . TYR A 1 347 ? 19.373 26.105  -41.196 1.00 22.16  ? 1488 TYR A CA   1 
ATOM   3238 C C    . TYR A 1 347 ? 17.872 25.918  -41.134 1.00 18.69  ? 1488 TYR A C    1 
ATOM   3239 O O    . TYR A 1 347 ? 17.144 26.451  -41.969 1.00 21.49  ? 1488 TYR A O    1 
ATOM   3240 C CB   . TYR A 1 347 ? 19.659 27.456  -40.524 1.00 24.38  ? 1488 TYR A CB   1 
ATOM   3241 C CG   . TYR A 1 347 ? 21.063 27.981  -40.660 1.00 23.82  ? 1488 TYR A CG   1 
ATOM   3242 C CD1  . TYR A 1 347 ? 21.472 28.649  -41.815 1.00 18.41  ? 1488 TYR A CD1  1 
ATOM   3243 C CD2  . TYR A 1 347 ? 21.971 27.851  -39.616 1.00 25.88  ? 1488 TYR A CD2  1 
ATOM   3244 C CE1  . TYR A 1 347 ? 22.750 29.168  -41.925 1.00 24.79  ? 1488 TYR A CE1  1 
ATOM   3245 C CE2  . TYR A 1 347 ? 23.250 28.372  -39.709 1.00 28.12  ? 1488 TYR A CE2  1 
ATOM   3246 C CZ   . TYR A 1 347 ? 23.638 29.025  -40.864 1.00 26.27  ? 1488 TYR A CZ   1 
ATOM   3247 O OH   . TYR A 1 347 ? 24.921 29.507  -40.951 1.00 32.80  ? 1488 TYR A OH   1 
ATOM   3248 H H    . TYR A 1 347 ? 19.325 26.731  -43.220 1.00 0.00   ? 1488 TYR A H    1 
ATOM   3249 H HH   . TYR A 1 347 ? 25.059 30.021  -41.761 1.00 0.00   ? 1488 TYR A HH   1 
ATOM   3250 N N    . ALA A 1 348 ? 17.406 25.213  -40.112 1.00 21.54  ? 1489 ALA A N    1 
ATOM   3251 C CA   . ALA A 1 348 ? 15.981 24.983  -39.930 1.00 13.21  ? 1489 ALA A CA   1 
ATOM   3252 C C    . ALA A 1 348 ? 15.477 25.956  -38.895 1.00 12.39  ? 1489 ALA A C    1 
ATOM   3253 O O    . ALA A 1 348 ? 15.756 25.796  -37.716 1.00 23.21  ? 1489 ALA A O    1 
ATOM   3254 C CB   . ALA A 1 348 ? 15.737 23.560  -39.444 1.00 17.86  ? 1489 ALA A CB   1 
ATOM   3255 H H    . ALA A 1 348 ? 18.018 24.830  -39.445 1.00 0.00   ? 1489 ALA A H    1 
ATOM   3256 N N    . VAL A 1 349 ? 14.767 26.989  -39.321 1.00 25.85  ? 1490 VAL A N    1 
ATOM   3257 C CA   . VAL A 1 349 ? 14.231 27.957  -38.370 1.00 24.60  ? 1490 VAL A CA   1 
ATOM   3258 C C    . VAL A 1 349 ? 12.883 27.454  -37.846 1.00 27.11  ? 1490 VAL A C    1 
ATOM   3259 O O    . VAL A 1 349 ? 11.905 27.298  -38.592 1.00 22.82  ? 1490 VAL A O    1 
ATOM   3260 C CB   . VAL A 1 349 ? 14.116 29.359  -38.976 1.00 24.71  ? 1490 VAL A CB   1 
ATOM   3261 C CG1  . VAL A 1 349 ? 13.488 30.306  -37.978 1.00 19.36  ? 1490 VAL A CG1  1 
ATOM   3262 C CG2  . VAL A 1 349 ? 15.496 29.854  -39.390 1.00 19.23  ? 1490 VAL A CG2  1 
ATOM   3263 H H    . VAL A 1 349 ? 14.572 27.104  -40.273 1.00 0.00   ? 1490 VAL A H    1 
ATOM   3264 N N    . THR A 1 350 ? 12.867 27.171  -36.550 1.00 29.41  ? 1491 THR A N    1 
ATOM   3265 C CA   . THR A 1 350 ? 11.708 26.623  -35.864 1.00 24.87  ? 1491 THR A CA   1 
ATOM   3266 C C    . THR A 1 350 ? 10.999 27.646  -34.967 1.00 24.27  ? 1491 THR A C    1 
ATOM   3267 O O    . THR A 1 350 ? 9.804  27.508  -34.664 1.00 20.01  ? 1491 THR A O    1 
ATOM   3268 C CB   . THR A 1 350 ? 12.168 25.417  -35.012 1.00 26.23  ? 1491 THR A CB   1 
ATOM   3269 O OG1  . THR A 1 350 ? 13.254 25.830  -34.168 1.00 23.55  ? 1491 THR A OG1  1 
ATOM   3270 C CG2  . THR A 1 350 ? 12.669 24.271  -35.916 1.00 18.97  ? 1491 THR A CG2  1 
ATOM   3271 H H    . THR A 1 350 ? 13.681 27.309  -36.020 1.00 0.00   ? 1491 THR A H    1 
ATOM   3272 H HG1  . THR A 1 350 ? 13.564 25.031  -33.737 1.00 0.00   ? 1491 THR A HG1  1 
ATOM   3273 N N    . GLY A 1 351 ? 11.746 28.655  -34.529 1.00 24.57  ? 1492 GLY A N    1 
ATOM   3274 C CA   . GLY A 1 351 ? 11.180 29.674  -33.667 1.00 28.83  ? 1492 GLY A CA   1 
ATOM   3275 C C    . GLY A 1 351 ? 10.498 30.794  -34.424 1.00 29.62  ? 1492 GLY A C    1 
ATOM   3276 O O    . GLY A 1 351 ? 10.356 30.751  -35.649 1.00 29.19  ? 1492 GLY A O    1 
ATOM   3277 H H    . GLY A 1 351 ? 12.676 28.707  -34.817 1.00 0.00   ? 1492 GLY A H    1 
ATOM   3278 N N    . ARG A 1 352 ? 10.085 31.816  -33.692 1.00 30.52  ? 1493 ARG A N    1 
ATOM   3279 C CA   . ARG A 1 352 ? 9.422  32.953  -34.296 1.00 35.56  ? 1493 ARG A CA   1 
ATOM   3280 C C    . ARG A 1 352 ? 9.837  34.258  -33.636 1.00 36.98  ? 1493 ARG A C    1 
ATOM   3281 O O    . ARG A 1 352 ? 10.803 34.285  -32.874 1.00 39.69  ? 1493 ARG A O    1 
ATOM   3282 C CB   . ARG A 1 352 ? 7.913  32.755  -34.284 1.00 38.56  ? 1493 ARG A CB   1 
ATOM   3283 C CG   . ARG A 1 352 ? 7.349  32.120  -33.038 1.00 40.93  ? 1493 ARG A CG   1 
ATOM   3284 C CD   . ARG A 1 352 ? 6.134  31.273  -33.402 1.00 48.65  ? 1493 ARG A CD   1 
ATOM   3285 N NE   . ARG A 1 352 ? 5.200  31.996  -34.264 1.00 59.18  ? 1493 ARG A NE   1 
ATOM   3286 C CZ   . ARG A 1 352 ? 4.200  31.437  -34.940 1.00 59.47  ? 1493 ARG A CZ   1 
ATOM   3287 N NH1  . ARG A 1 352 ? 3.993  30.130  -34.861 1.00 66.83  ? 1493 ARG A NH1  1 
ATOM   3288 N NH2  . ARG A 1 352 ? 3.410  32.185  -35.695 1.00 59.35  ? 1493 ARG A NH2  1 
ATOM   3289 H H    . ARG A 1 352 ? 10.246 31.846  -32.724 1.00 0.00   ? 1493 ARG A H    1 
ATOM   3290 H HE   . ARG A 1 352 ? 5.343  32.969  -34.325 1.00 0.00   ? 1493 ARG A HE   1 
ATOM   3291 H HH11 . ARG A 1 352 ? 4.589  29.551  -34.295 1.00 0.00   ? 1493 ARG A HH11 1 
ATOM   3292 H HH12 . ARG A 1 352 ? 3.231  29.695  -35.350 1.00 0.00   ? 1493 ARG A HH12 1 
ATOM   3293 H HH21 . ARG A 1 352 ? 3.553  33.178  -35.779 1.00 0.00   ? 1493 ARG A HH21 1 
ATOM   3294 H HH22 . ARG A 1 352 ? 2.638  31.805  -36.227 1.00 0.00   ? 1493 ARG A HH22 1 
ATOM   3295 N N    . GLY A 1 353 ? 9.151  35.343  -33.967 1.00 33.82  ? 1494 GLY A N    1 
ATOM   3296 C CA   . GLY A 1 353 ? 9.495  36.633  -33.401 1.00 37.75  ? 1494 GLY A CA   1 
ATOM   3297 C C    . GLY A 1 353 ? 10.674 37.219  -34.150 1.00 38.33  ? 1494 GLY A C    1 
ATOM   3298 O O    . GLY A 1 353 ? 11.008 36.762  -35.245 1.00 40.36  ? 1494 GLY A O    1 
ATOM   3299 H H    . GLY A 1 353 ? 8.443  35.280  -34.605 1.00 0.00   ? 1494 GLY A H    1 
ATOM   3300 N N    . ASP A 1 354 ? 11.316 38.219  -33.560 1.00 42.36  ? 1495 ASP A N    1 
ATOM   3301 C CA   . ASP A 1 354 ? 12.459 38.882  -34.188 1.00 42.80  ? 1495 ASP A CA   1 
ATOM   3302 C C    . ASP A 1 354 ? 13.721 38.043  -34.126 1.00 39.89  ? 1495 ASP A C    1 
ATOM   3303 O O    . ASP A 1 354 ? 14.629 38.221  -34.933 1.00 46.47  ? 1495 ASP A O    1 
ATOM   3304 C CB   . ASP A 1 354 ? 12.708 40.258  -33.556 1.00 38.07  ? 1495 ASP A CB   1 
ATOM   3305 C CG   . ASP A 1 354 ? 11.440 41.103  -33.472 1.00 43.36  ? 1495 ASP A CG   1 
ATOM   3306 O OD1  . ASP A 1 354 ? 10.520 40.935  -34.312 1.00 43.73  ? 1495 ASP A OD1  1 
ATOM   3307 O OD2  . ASP A 1 354 ? 11.354 41.917  -32.533 1.00 40.94  ? 1495 ASP A OD2  1 
ATOM   3308 H H    . ASP A 1 354 ? 10.994 38.532  -32.692 1.00 0.00   ? 1495 ASP A H    1 
ATOM   3309 N N    . SER A 1 355 ? 13.788 37.141  -33.155 1.00 43.19  ? 1496 SER A N    1 
ATOM   3310 C CA   . SER A 1 355 ? 14.943 36.263  -33.019 1.00 44.49  ? 1496 SER A CA   1 
ATOM   3311 C C    . SER A 1 355 ? 14.485 34.814  -32.957 1.00 42.69  ? 1496 SER A C    1 
ATOM   3312 O O    . SER A 1 355 ? 14.443 34.181  -31.887 1.00 36.35  ? 1496 SER A O    1 
ATOM   3313 C CB   . SER A 1 355 ? 15.795 36.634  -31.806 1.00 47.25  ? 1496 SER A CB   1 
ATOM   3314 O OG   . SER A 1 355 ? 16.400 37.901  -31.998 1.00 50.73  ? 1496 SER A OG   1 
ATOM   3315 H H    . SER A 1 355 ? 13.049 37.061  -32.523 1.00 0.00   ? 1496 SER A H    1 
ATOM   3316 H HG   . SER A 1 355 ? 15.808 38.585  -31.652 1.00 0.00   ? 1496 SER A HG   1 
ATOM   3317 N N    . PRO A 1 356 ? 14.096 34.284  -34.123 1.00 38.98  ? 1497 PRO A N    1 
ATOM   3318 C CA   . PRO A 1 356 ? 13.619 32.918  -34.297 1.00 39.04  ? 1497 PRO A CA   1 
ATOM   3319 C C    . PRO A 1 356 ? 14.666 31.912  -33.877 1.00 38.86  ? 1497 PRO A C    1 
ATOM   3320 O O    . PRO A 1 356 ? 15.863 32.135  -34.071 1.00 42.33  ? 1497 PRO A O    1 
ATOM   3321 C CB   . PRO A 1 356 ? 13.393 32.841  -35.804 1.00 37.88  ? 1497 PRO A CB   1 
ATOM   3322 C CG   . PRO A 1 356 ? 13.041 34.235  -36.167 1.00 37.02  ? 1497 PRO A CG   1 
ATOM   3323 C CD   . PRO A 1 356 ? 14.063 35.003  -35.406 1.00 28.32  ? 1497 PRO A CD   1 
ATOM   3324 N N    . ALA A 1 357 ? 14.207 30.813  -33.285 1.00 43.16  ? 1498 ALA A N    1 
ATOM   3325 C CA   . ALA A 1 357 ? 15.096 29.735  -32.877 1.00 36.23  ? 1498 ALA A CA   1 
ATOM   3326 C C    . ALA A 1 357 ? 15.455 29.001  -34.156 1.00 32.51  ? 1498 ALA A C    1 
ATOM   3327 O O    . ALA A 1 357 ? 14.580 28.664  -34.959 1.00 30.91  ? 1498 ALA A O    1 
ATOM   3328 C CB   . ALA A 1 357 ? 14.397 28.790  -31.906 1.00 32.82  ? 1498 ALA A CB   1 
ATOM   3329 H H    . ALA A 1 357 ? 13.259 30.749  -33.072 1.00 0.00   ? 1498 ALA A H    1 
ATOM   3330 N N    . SER A 1 358 ? 16.747 28.814  -34.370 1.00 30.89  ? 1499 SER A N    1 
ATOM   3331 C CA   . SER A 1 358 ? 17.224 28.125  -35.547 1.00 29.32  ? 1499 SER A CA   1 
ATOM   3332 C C    . SER A 1 358 ? 18.106 26.975  -35.118 1.00 34.42  ? 1499 SER A C    1 
ATOM   3333 O O    . SER A 1 358 ? 18.766 27.037  -34.081 1.00 40.13  ? 1499 SER A O    1 
ATOM   3334 C CB   . SER A 1 358 ? 18.028 29.076  -36.432 1.00 30.03  ? 1499 SER A CB   1 
ATOM   3335 O OG   . SER A 1 358 ? 18.599 28.390  -37.534 1.00 29.50  ? 1499 SER A OG   1 
ATOM   3336 H H    . SER A 1 358 ? 17.408 29.135  -33.724 1.00 0.00   ? 1499 SER A H    1 
ATOM   3337 H HG   . SER A 1 358 ? 19.258 27.758  -37.211 1.00 0.00   ? 1499 SER A HG   1 
ATOM   3338 N N    . SER A 1 359 ? 18.096 25.921  -35.917 1.00 31.13  ? 1500 SER A N    1 
ATOM   3339 C CA   . SER A 1 359 ? 18.903 24.748  -35.664 1.00 29.38  ? 1500 SER A CA   1 
ATOM   3340 C C    . SER A 1 359 ? 20.344 25.118  -35.959 1.00 28.94  ? 1500 SER A C    1 
ATOM   3341 O O    . SER A 1 359 ? 20.630 26.235  -36.419 1.00 27.90  ? 1500 SER A O    1 
ATOM   3342 C CB   . SER A 1 359 ? 18.488 23.627  -36.623 1.00 24.49  ? 1500 SER A CB   1 
ATOM   3343 O OG   . SER A 1 359 ? 18.954 23.870  -37.949 1.00 22.61  ? 1500 SER A OG   1 
ATOM   3344 H H    . SER A 1 359 ? 17.518 25.900  -36.711 1.00 0.00   ? 1500 SER A H    1 
ATOM   3345 H HG   . SER A 1 359 ? 19.880 23.588  -38.016 1.00 0.00   ? 1500 SER A HG   1 
ATOM   3346 N N    . LYS A 1 360 ? 21.252 24.194  -35.664 1.00 31.23  ? 1501 LYS A N    1 
ATOM   3347 C CA   . LYS A 1 360 ? 22.652 24.388  -35.975 1.00 29.62  ? 1501 LYS A CA   1 
ATOM   3348 C C    . LYS A 1 360 ? 22.676 24.140  -37.478 1.00 26.28  ? 1501 LYS A C    1 
ATOM   3349 O O    . LYS A 1 360 ? 21.802 23.459  -38.012 1.00 29.16  ? 1501 LYS A O    1 
ATOM   3350 C CB   . LYS A 1 360 ? 23.522 23.364  -35.257 1.00 31.20  ? 1501 LYS A CB   1 
ATOM   3351 C CG   . LYS A 1 360 ? 23.952 23.777  -33.874 1.00 37.66  ? 1501 LYS A CG   1 
ATOM   3352 C CD   . LYS A 1 360 ? 25.105 22.902  -33.431 1.00 47.92  ? 1501 LYS A CD   1 
ATOM   3353 C CE   . LYS A 1 360 ? 25.711 23.360  -32.114 1.00 51.77  ? 1501 LYS A CE   1 
ATOM   3354 N NZ   . LYS A 1 360 ? 26.898 22.514  -31.787 1.00 54.05  ? 1501 LYS A NZ   1 
ATOM   3355 H H    . LYS A 1 360 ? 20.966 23.358  -35.241 1.00 0.00   ? 1501 LYS A H    1 
ATOM   3356 H HZ1  . LYS A 1 360 ? 26.568 21.526  -31.735 1.00 0.00   ? 1501 LYS A HZ1  1 
ATOM   3357 H HZ2  . LYS A 1 360 ? 27.599 22.592  -32.549 1.00 0.00   ? 1501 LYS A HZ2  1 
ATOM   3358 H HZ3  . LYS A 1 360 ? 27.310 22.787  -30.875 1.00 0.00   ? 1501 LYS A HZ3  1 
ATOM   3359 N N    . PRO A 1 361 ? 23.666 24.693  -38.179 1.00 29.53  ? 1502 PRO A N    1 
ATOM   3360 C CA   . PRO A 1 361 ? 23.798 24.542  -39.630 1.00 29.74  ? 1502 PRO A CA   1 
ATOM   3361 C C    . PRO A 1 361 ? 24.352 23.234  -40.161 1.00 31.76  ? 1502 PRO A C    1 
ATOM   3362 O O    . PRO A 1 361 ? 25.058 22.500  -39.472 1.00 40.33  ? 1502 PRO A O    1 
ATOM   3363 C CB   . PRO A 1 361 ? 24.763 25.657  -39.984 1.00 26.26  ? 1502 PRO A CB   1 
ATOM   3364 C CG   . PRO A 1 361 ? 25.696 25.652  -38.799 1.00 33.06  ? 1502 PRO A CG   1 
ATOM   3365 C CD   . PRO A 1 361 ? 24.727 25.566  -37.639 1.00 29.87  ? 1502 PRO A CD   1 
ATOM   3366 N N    . ILE A 1 362 ? 24.042 22.985  -41.421 1.00 26.31  ? 1503 ILE A N    1 
ATOM   3367 C CA   . ILE A 1 362 ? 24.545 21.845  -42.156 1.00 20.22  ? 1503 ILE A CA   1 
ATOM   3368 C C    . ILE A 1 362 ? 24.935 22.468  -43.503 1.00 22.00  ? 1503 ILE A C    1 
ATOM   3369 O O    . ILE A 1 362 ? 24.187 23.259  -44.072 1.00 23.80  ? 1503 ILE A O    1 
ATOM   3370 C CB   . ILE A 1 362 ? 23.496 20.734  -42.359 1.00 16.12  ? 1503 ILE A CB   1 
ATOM   3371 C CG1  . ILE A 1 362 ? 24.044 19.701  -43.355 1.00 24.10  ? 1503 ILE A CG1  1 
ATOM   3372 C CG2  . ILE A 1 362 ? 22.179 21.322  -42.804 1.00 17.95  ? 1503 ILE A CG2  1 
ATOM   3373 C CD1  . ILE A 1 362 ? 23.129 18.559  -43.667 1.00 24.60  ? 1503 ILE A CD1  1 
ATOM   3374 H H    . ILE A 1 362 ? 23.431 23.582  -41.908 1.00 0.00   ? 1503 ILE A H    1 
ATOM   3375 N N    . SER A 1 363 ? 26.132 22.177  -43.974 1.00 18.84  ? 1504 SER A N    1 
ATOM   3376 C CA   . SER A 1 363 ? 26.576 22.746  -45.223 1.00 30.46  ? 1504 SER A CA   1 
ATOM   3377 C C    . SER A 1 363 ? 27.438 21.784  -46.008 1.00 34.58  ? 1504 SER A C    1 
ATOM   3378 O O    . SER A 1 363 ? 27.779 20.699  -45.524 1.00 37.38  ? 1504 SER A O    1 
ATOM   3379 C CB   . SER A 1 363 ? 27.358 24.035  -44.943 1.00 38.09  ? 1504 SER A CB   1 
ATOM   3380 O OG   . SER A 1 363 ? 28.262 23.868  -43.866 1.00 36.99  ? 1504 SER A OG   1 
ATOM   3381 H H    . SER A 1 363 ? 26.736 21.576  -43.488 1.00 0.00   ? 1504 SER A H    1 
ATOM   3382 H HG   . SER A 1 363 ? 28.909 23.201  -44.108 1.00 0.00   ? 1504 SER A HG   1 
ATOM   3383 N N    . ILE A 1 364 ? 27.788 22.208  -47.216 1.00 35.45  ? 1505 ILE A N    1 
ATOM   3384 C CA   . ILE A 1 364 ? 28.641 21.456  -48.128 1.00 40.36  ? 1505 ILE A CA   1 
ATOM   3385 C C    . ILE A 1 364 ? 29.409 22.499  -48.923 1.00 44.63  ? 1505 ILE A C    1 
ATOM   3386 O O    . ILE A 1 364 ? 29.108 23.692  -48.849 1.00 43.89  ? 1505 ILE A O    1 
ATOM   3387 C CB   . ILE A 1 364 ? 27.821 20.615  -49.163 1.00 40.73  ? 1505 ILE A CB   1 
ATOM   3388 C CG1  . ILE A 1 364 ? 26.880 21.516  -49.969 1.00 34.55  ? 1505 ILE A CG1  1 
ATOM   3389 C CG2  . ILE A 1 364 ? 27.063 19.483  -48.478 1.00 43.80  ? 1505 ILE A CG2  1 
ATOM   3390 C CD1  . ILE A 1 364 ? 26.141 20.798  -51.069 1.00 36.18  ? 1505 ILE A CD1  1 
ATOM   3391 H H    . ILE A 1 364 ? 27.478 23.085  -47.529 1.00 0.00   ? 1505 ILE A H    1 
ATOM   3392 N N    . ASN A 1 365 ? 30.391 22.042  -49.689 1.00 54.54  ? 1506 ASN A N    1 
ATOM   3393 C CA   . ASN A 1 365 ? 31.179 22.914  -50.557 1.00 62.52  ? 1506 ASN A CA   1 
ATOM   3394 C C    . ASN A 1 365 ? 30.974 22.306  -51.934 1.00 62.69  ? 1506 ASN A C    1 
ATOM   3395 O O    . ASN A 1 365 ? 31.073 21.086  -52.084 1.00 61.99  ? 1506 ASN A O    1 
ATOM   3396 C CB   . ASN A 1 365 ? 32.666 22.862  -50.194 1.00 69.44  ? 1506 ASN A CB   1 
ATOM   3397 C CG   . ASN A 1 365 ? 32.950 23.381  -48.796 1.00 77.29  ? 1506 ASN A CG   1 
ATOM   3398 O OD1  . ASN A 1 365 ? 32.090 23.348  -47.912 1.00 82.73  ? 1506 ASN A OD1  1 
ATOM   3399 N ND2  . ASN A 1 365 ? 34.168 23.849  -48.584 1.00 81.56  ? 1506 ASN A ND2  1 
ATOM   3400 H H    . ASN A 1 365 ? 30.591 21.080  -49.685 1.00 0.00   ? 1506 ASN A H    1 
ATOM   3401 H HD21 . ASN A 1 365 ? 34.347 24.192  -47.688 1.00 0.00   ? 1506 ASN A HD21 1 
ATOM   3402 H HD22 . ASN A 1 365 ? 34.799 23.834  -49.333 1.00 0.00   ? 1506 ASN A HD22 1 
ATOM   3403 N N    . TYR A 1 366 ? 30.617 23.115  -52.925 1.00 65.72  ? 1507 TYR A N    1 
ATOM   3404 C CA   . TYR A 1 366 ? 30.415 22.552  -54.247 1.00 70.61  ? 1507 TYR A CA   1 
ATOM   3405 C C    . TYR A 1 366 ? 31.547 22.694  -55.257 1.00 76.40  ? 1507 TYR A C    1 
ATOM   3406 O O    . TYR A 1 366 ? 32.078 23.781  -55.495 1.00 75.55  ? 1507 TYR A O    1 
ATOM   3407 C CB   . TYR A 1 366 ? 29.106 22.999  -54.896 1.00 68.44  ? 1507 TYR A CB   1 
ATOM   3408 C CG   . TYR A 1 366 ? 28.844 22.181  -56.141 1.00 66.97  ? 1507 TYR A CG   1 
ATOM   3409 C CD1  . TYR A 1 366 ? 28.737 20.790  -56.060 1.00 69.66  ? 1507 TYR A CD1  1 
ATOM   3410 C CD2  . TYR A 1 366 ? 28.821 22.769  -57.401 1.00 66.39  ? 1507 TYR A CD2  1 
ATOM   3411 C CE1  . TYR A 1 366 ? 28.626 20.003  -57.195 1.00 71.37  ? 1507 TYR A CE1  1 
ATOM   3412 C CE2  . TYR A 1 366 ? 28.708 21.986  -58.553 1.00 73.93  ? 1507 TYR A CE2  1 
ATOM   3413 C CZ   . TYR A 1 366 ? 28.615 20.602  -58.439 1.00 73.93  ? 1507 TYR A CZ   1 
ATOM   3414 O OH   . TYR A 1 366 ? 28.537 19.807  -59.563 1.00 80.01  ? 1507 TYR A OH   1 
ATOM   3415 H H    . TYR A 1 366 ? 30.530 24.076  -52.777 1.00 0.00   ? 1507 TYR A H    1 
ATOM   3416 H HH   . TYR A 1 366 ? 28.625 20.411  -60.316 1.00 0.00   ? 1507 TYR A HH   1 
ATOM   3417 N N    . ARG A 1 367 ? 31.807 21.568  -55.913 1.00 78.54  ? 1508 ARG A N    1 
ATOM   3418 C CA   . ARG A 1 367 ? 32.819 21.408  -56.943 1.00 78.87  ? 1508 ARG A CA   1 
ATOM   3419 C C    . ARG A 1 367 ? 32.333 21.941  -58.300 1.00 80.08  ? 1508 ARG A C    1 
ATOM   3420 O O    . ARG A 1 367 ? 31.677 21.215  -59.056 1.00 80.39  ? 1508 ARG A O    1 
ATOM   3421 C CB   . ARG A 1 367 ? 33.140 19.912  -57.067 1.00 80.06  ? 1508 ARG A CB   1 
ATOM   3422 C CG   . ARG A 1 367 ? 31.886 19.020  -57.159 1.00 77.25  ? 1508 ARG A CG   1 
ATOM   3423 C CD   . ARG A 1 367 ? 32.207 17.586  -57.554 1.00 76.89  ? 1508 ARG A CD   1 
ATOM   3424 N NE   . ARG A 1 367 ? 31.014 16.818  -57.930 1.00 76.24  ? 1508 ARG A NE   1 
ATOM   3425 C CZ   . ARG A 1 367 ? 30.397 16.898  -59.113 1.00 77.99  ? 1508 ARG A CZ   1 
ATOM   3426 N NH1  . ARG A 1 367 ? 30.849 17.725  -60.053 1.00 78.38  ? 1508 ARG A NH1  1 
ATOM   3427 N NH2  . ARG A 1 367 ? 29.350 16.118  -59.375 1.00 67.70  ? 1508 ARG A NH2  1 
ATOM   3428 H H    . ARG A 1 367 ? 31.267 20.804  -55.642 1.00 0.00   ? 1508 ARG A H    1 
ATOM   3429 H HE   . ARG A 1 367 ? 30.693 16.212  -57.220 1.00 0.00   ? 1508 ARG A HE   1 
ATOM   3430 H HH11 . ARG A 1 367 ? 31.627 18.319  -59.849 1.00 0.00   ? 1508 ARG A HH11 1 
ATOM   3431 H HH12 . ARG A 1 367 ? 30.439 17.845  -60.967 1.00 0.00   ? 1508 ARG A HH12 1 
ATOM   3432 H HH21 . ARG A 1 367 ? 29.031 15.443  -58.697 1.00 0.00   ? 1508 ARG A HH21 1 
ATOM   3433 H HH22 . ARG A 1 367 ? 28.882 16.164  -60.261 1.00 0.00   ? 1508 ARG A HH22 1 
ATOM   3434 N N    . THR A 1 368 ? 32.674 23.183  -58.628 1.00 83.93  ? 1509 THR A N    1 
ATOM   3435 C CA   . THR A 1 368 ? 32.264 23.769  -59.906 1.00 87.04  ? 1509 THR A CA   1 
ATOM   3436 C C    . THR A 1 368 ? 33.316 24.717  -60.492 1.00 86.80  ? 1509 THR A C    1 
ATOM   3437 O O    . THR A 1 368 ? 33.359 24.840  -61.734 1.00 84.79  ? 1509 THR A O    1 
ATOM   3438 C CB   . THR A 1 368 ? 30.902 24.507  -59.793 1.00 88.84  ? 1509 THR A CB   1 
ATOM   3439 O OG1  . THR A 1 368 ? 30.537 25.050  -61.069 1.00 90.73  ? 1509 THR A OG1  1 
ATOM   3440 C CG2  . THR A 1 368 ? 30.966 25.629  -58.762 1.00 92.97  ? 1509 THR A CG2  1 
ATOM   3441 O OXT  . THR A 1 368 ? 34.085 25.327  -59.716 1.00 87.48  ? 1509 THR A OXT  1 
ATOM   3442 H H    . THR A 1 368 ? 33.228 23.748  -58.039 1.00 0.00   ? 1509 THR A H    1 
ATOM   3443 H HG1  . THR A 1 368 ? 31.357 25.427  -61.421 1.00 0.00   ? 1509 THR A HG1  1 
HETATM 3444 O O    . HOH B 2 .   ? 10.217 -24.364 58.852  1.00 15.17  ? 701  HOH A O    1 
HETATM 3445 H H1   . HOH B 2 .   ? 10.877 -25.054 58.676  1.00 0.00   ? 701  HOH A H1   1 
HETATM 3446 H H2   . HOH B 2 .   ? 9.575  -24.902 59.341  1.00 0.00   ? 701  HOH A H2   1 
HETATM 3447 O O    . HOH B 2 .   ? 6.469  -17.079 68.274  1.00 15.17  ? 702  HOH A O    1 
HETATM 3448 H H1   . HOH B 2 .   ? 7.281  -16.599 68.508  1.00 0.00   ? 702  HOH A H1   1 
HETATM 3449 H H2   . HOH B 2 .   ? 5.965  -17.010 69.089  1.00 0.00   ? 702  HOH A H2   1 
HETATM 3450 O O    . HOH B 2 .   ? 13.555 -26.095 64.863  1.00 15.55  ? 703  HOH A O    1 
HETATM 3451 H H1   . HOH B 2 .   ? 13.214 -26.895 65.267  1.00 0.00   ? 703  HOH A H1   1 
HETATM 3452 H H2   . HOH B 2 .   ? 13.183 -25.413 65.437  1.00 0.00   ? 703  HOH A H2   1 
HETATM 3453 O O    . HOH B 2 .   ? 12.902 -17.628 31.473  1.00 42.35  ? 704  HOH A O    1 
HETATM 3454 H H1   . HOH B 2 .   ? 12.838 -16.682 31.638  1.00 0.00   ? 704  HOH A H1   1 
HETATM 3455 H H2   . HOH B 2 .   ? 12.328 -17.714 30.695  1.00 0.00   ? 704  HOH A H2   1 
HETATM 3456 O O    . HOH B 2 .   ? 15.908 -5.980  36.818  0.24 5.23   ? 705  HOH A O    1 
HETATM 3457 H H1   . HOH B 2 .   ? 16.163 -6.362  37.663  1.00 0.00   ? 705  HOH A H1   1 
HETATM 3458 H H2   . HOH B 2 .   ? 16.459 -6.494  36.214  1.00 0.00   ? 705  HOH A H2   1 
HETATM 3459 O O    . HOH B 2 .   ? 4.436  -16.362 57.397  1.00 34.88  ? 706  HOH A O    1 
HETATM 3460 H H1   . HOH B 2 .   ? 4.577  -15.836 58.191  1.00 0.00   ? 706  HOH A H1   1 
HETATM 3461 H H2   . HOH B 2 .   ? 3.698  -15.911 56.983  1.00 0.00   ? 706  HOH A H2   1 
HETATM 3462 O O    . HOH B 2 .   ? 33.889 29.012  -46.752 0.93 36.90  ? 707  HOH A O    1 
HETATM 3463 H H1   . HOH B 2 .   ? 33.216 29.698  -46.939 1.00 0.00   ? 707  HOH A H1   1 
HETATM 3464 H H2   . HOH B 2 .   ? 33.347 28.212  -46.783 1.00 0.00   ? 707  HOH A H2   1 
HETATM 3465 O O    . HOH B 2 .   ? 22.530 -22.795 32.885  1.00 42.70  ? 708  HOH A O    1 
HETATM 3466 H H1   . HOH B 2 .   ? 21.582 -22.882 33.045  1.00 0.00   ? 708  HOH A H1   1 
HETATM 3467 H H2   . HOH B 2 .   ? 22.795 -23.679 32.618  1.00 0.00   ? 708  HOH A H2   1 
HETATM 3468 O O    . HOH B 2 .   ? 30.212 -21.393 55.129  1.00 40.46  ? 709  HOH A O    1 
HETATM 3469 H H1   . HOH B 2 .   ? 30.993 -21.943 55.180  1.00 0.00   ? 709  HOH A H1   1 
HETATM 3470 H H2   . HOH B 2 .   ? 29.497 -22.024 54.939  1.00 0.00   ? 709  HOH A H2   1 
HETATM 3471 O O    . HOH B 2 .   ? 13.633 -4.863  24.677  0.51 11.31  ? 710  HOH A O    1 
HETATM 3472 H H1   . HOH B 2 .   ? 14.047 -4.206  24.107  1.00 0.00   ? 710  HOH A H1   1 
HETATM 3473 H H2   . HOH B 2 .   ? 13.844 -4.581  25.569  1.00 0.00   ? 710  HOH A H2   1 
HETATM 3474 O O    . HOH B 2 .   ? 27.476 16.814  -23.312 1.00 35.50  ? 711  HOH A O    1 
HETATM 3475 H H1   . HOH B 2 .   ? 26.856 17.572  -23.408 1.00 0.00   ? 711  HOH A H1   1 
HETATM 3476 H H2   . HOH B 2 .   ? 27.826 16.738  -24.205 1.00 0.00   ? 711  HOH A H2   1 
HETATM 3477 O O    . HOH B 2 .   ? 6.353  -14.542 60.002  1.00 25.33  ? 712  HOH A O    1 
HETATM 3478 H H1   . HOH B 2 .   ? 6.480  -13.800 59.385  1.00 0.00   ? 712  HOH A H1   1 
HETATM 3479 H H2   . HOH B 2 .   ? 7.271  -14.814 60.161  1.00 0.00   ? 712  HOH A H2   1 
HETATM 3480 O O    . HOH B 2 .   ? 9.009  -9.224  50.006  0.59 27.98  ? 713  HOH A O    1 
HETATM 3481 H H1   . HOH B 2 .   ? 9.828  -9.176  49.484  1.00 0.00   ? 713  HOH A H1   1 
HETATM 3482 H H2   . HOH B 2 .   ? 8.467  -8.556  49.582  1.00 0.00   ? 713  HOH A H2   1 
HETATM 3483 O O    . HOH B 2 .   ? 14.409 -13.252 31.138  1.00 33.56  ? 714  HOH A O    1 
HETATM 3484 H H1   . HOH B 2 .   ? 15.099 -13.789 31.548  1.00 0.00   ? 714  HOH A H1   1 
HETATM 3485 H H2   . HOH B 2 .   ? 14.684 -12.352 31.328  1.00 0.00   ? 714  HOH A H2   1 
HETATM 3486 O O    . HOH B 2 .   ? 9.311  -16.281 47.524  0.32 8.87   ? 715  HOH A O    1 
HETATM 3487 H H1   . HOH B 2 .   ? 9.010  -17.188 47.692  1.00 0.00   ? 715  HOH A H1   1 
HETATM 3488 H H2   . HOH B 2 .   ? 9.293  -16.228 46.562  1.00 0.00   ? 715  HOH A H2   1 
HETATM 3489 O O    . HOH B 2 .   ? 14.512 -30.484 59.675  0.39 35.18  ? 716  HOH A O    1 
HETATM 3490 H H1   . HOH B 2 .   ? 13.573 -30.278 59.621  1.00 0.00   ? 716  HOH A H1   1 
HETATM 3491 H H2   . HOH B 2 .   ? 14.552 -31.159 60.357  1.00 0.00   ? 716  HOH A H2   1 
HETATM 3492 O O    . HOH B 2 .   ? 2.648  6.857   -1.498  0.52 5.86   ? 717  HOH A O    1 
HETATM 3493 H H1   . HOH B 2 .   ? 3.072  6.384   -2.229  1.00 0.00   ? 717  HOH A H1   1 
HETATM 3494 H H2   . HOH B 2 .   ? 1.992  6.213   -1.214  1.00 0.00   ? 717  HOH A H2   1 
HETATM 3495 O O    . HOH B 2 .   ? 16.930 -0.588  -7.852  1.00 52.13  ? 718  HOH A O    1 
HETATM 3496 H H1   . HOH B 2 .   ? 16.932 -0.238  -8.759  1.00 0.00   ? 718  HOH A H1   1 
HETATM 3497 H H2   . HOH B 2 .   ? 16.422 -1.396  -7.942  1.00 0.00   ? 718  HOH A H2   1 
HETATM 3498 O O    . HOH B 2 .   ? 7.346  -21.413 19.665  0.88 25.19  ? 719  HOH A O    1 
HETATM 3499 H H1   . HOH B 2 .   ? 7.044  -20.650 19.137  1.00 0.00   ? 719  HOH A H1   1 
HETATM 3500 H H2   . HOH B 2 .   ? 7.846  -21.830 18.955  1.00 0.00   ? 719  HOH A H2   1 
HETATM 3501 O O    . HOH B 2 .   ? 14.004 -4.104  33.769  0.53 23.27  ? 720  HOH A O    1 
HETATM 3502 H H1   . HOH B 2 .   ? 14.476 -4.923  33.602  1.00 0.00   ? 720  HOH A H1   1 
HETATM 3503 H H2   . HOH B 2 .   ? 14.125 -3.978  34.714  1.00 0.00   ? 720  HOH A H2   1 
HETATM 3504 O O    . HOH B 2 .   ? 9.047  -12.236 5.768   1.00 21.69  ? 721  HOH A O    1 
HETATM 3505 H H1   . HOH B 2 .   ? 8.527  -11.623 5.240   1.00 0.00   ? 721  HOH A H1   1 
HETATM 3506 H H2   . HOH B 2 .   ? 9.802  -12.390 5.190   1.00 0.00   ? 721  HOH A H2   1 
HETATM 3507 O O    . HOH B 2 .   ? 27.257 -4.203  19.107  1.00 30.49  ? 722  HOH A O    1 
HETATM 3508 H H1   . HOH B 2 .   ? 26.301 -4.183  19.316  1.00 0.00   ? 722  HOH A H1   1 
HETATM 3509 H H2   . HOH B 2 .   ? 27.534 -4.375  20.020  1.00 0.00   ? 722  HOH A H2   1 
HETATM 3510 O O    . HOH B 2 .   ? 2.258  12.601  0.919   1.00 48.10  ? 723  HOH A O    1 
HETATM 3511 H H1   . HOH B 2 .   ? 1.817  12.740  1.762   1.00 0.00   ? 723  HOH A H1   1 
HETATM 3512 H H2   . HOH B 2 .   ? 2.134  11.638  0.760   1.00 0.00   ? 723  HOH A H2   1 
HETATM 3513 O O    . HOH B 2 .   ? 13.500 0.072   18.682  0.96 29.96  ? 724  HOH A O    1 
HETATM 3514 H H1   . HOH B 2 .   ? 14.293 0.232   18.159  1.00 0.00   ? 724  HOH A H1   1 
HETATM 3515 H H2   . HOH B 2 .   ? 13.815 0.219   19.577  1.00 0.00   ? 724  HOH A H2   1 
HETATM 3516 O O    . HOH B 2 .   ? 19.630 -21.477 12.821  0.93 17.52  ? 725  HOH A O    1 
HETATM 3517 H H1   . HOH B 2 .   ? 19.961 -20.713 12.290  1.00 0.00   ? 725  HOH A H1   1 
HETATM 3518 H H2   . HOH B 2 .   ? 20.360 -22.087 12.659  1.00 0.00   ? 725  HOH A H2   1 
HETATM 3519 O O    . HOH B 2 .   ? 19.399 -7.513  5.120   0.95 20.14  ? 726  HOH A O    1 
HETATM 3520 H H1   . HOH B 2 .   ? 18.742 -8.002  4.610   1.00 0.00   ? 726  HOH A H1   1 
HETATM 3521 H H2   . HOH B 2 .   ? 19.305 -6.614  4.794   1.00 0.00   ? 726  HOH A H2   1 
HETATM 3522 O O    . HOH B 2 .   ? 11.475 2.606   13.735  1.00 32.49  ? 727  HOH A O    1 
HETATM 3523 H H1   . HOH B 2 .   ? 10.663 3.128   13.585  1.00 0.00   ? 727  HOH A H1   1 
HETATM 3524 H H2   . HOH B 2 .   ? 11.019 1.870   14.172  1.00 0.00   ? 727  HOH A H2   1 
HETATM 3525 O O    . HOH B 2 .   ? 2.176  4.736   -10.843 0.78 17.57  ? 728  HOH A O    1 
HETATM 3526 H H1   . HOH B 2 .   ? 1.620  4.058   -10.434 1.00 0.00   ? 728  HOH A H1   1 
HETATM 3527 H H2   . HOH B 2 .   ? 1.982  4.597   -11.778 1.00 0.00   ? 728  HOH A H2   1 
HETATM 3528 O O    . HOH B 2 .   ? 5.825  -18.488 11.458  0.45 2.00   ? 729  HOH A O    1 
HETATM 3529 H H1   . HOH B 2 .   ? 4.980  -18.482 10.995  1.00 0.00   ? 729  HOH A H1   1 
HETATM 3530 H H2   . HOH B 2 .   ? 6.382  -19.063 10.925  1.00 0.00   ? 729  HOH A H2   1 
HETATM 3531 O O    . HOH B 2 .   ? 26.127 -2.537  14.394  0.34 8.88   ? 730  HOH A O    1 
HETATM 3532 H H1   . HOH B 2 .   ? 25.999 -2.165  13.517  1.00 0.00   ? 730  HOH A H1   1 
HETATM 3533 H H2   . HOH B 2 .   ? 26.935 -2.094  14.701  1.00 0.00   ? 730  HOH A H2   1 
HETATM 3534 O O    . HOH B 2 .   ? 19.087 32.188  -34.282 0.74 37.76  ? 731  HOH A O    1 
HETATM 3535 H H1   . HOH B 2 .   ? 18.130 32.278  -34.399 1.00 0.00   ? 731  HOH A H1   1 
HETATM 3536 H H2   . HOH B 2 .   ? 19.342 33.061  -33.976 1.00 0.00   ? 731  HOH A H2   1 
HETATM 3537 O O    . HOH B 2 .   ? 25.718 18.867  -23.711 0.91 39.19  ? 732  HOH A O    1 
HETATM 3538 H H1   . HOH B 2 .   ? 25.692 19.207  -22.806 1.00 0.00   ? 732  HOH A H1   1 
HETATM 3539 H H2   . HOH B 2 .   ? 24.873 19.164  -24.065 1.00 0.00   ? 732  HOH A H2   1 
HETATM 3540 O O    . HOH B 2 .   ? 22.521 17.048  -39.278 0.37 6.69   ? 733  HOH A O    1 
HETATM 3541 H H1   . HOH B 2 .   ? 23.342 16.914  -39.767 1.00 0.00   ? 733  HOH A H1   1 
HETATM 3542 H H2   . HOH B 2 .   ? 22.028 17.598  -39.911 1.00 0.00   ? 733  HOH A H2   1 
HETATM 3543 O O    . HOH B 2 .   ? 16.236 -11.302 -0.070  1.00 21.51  ? 734  HOH A O    1 
HETATM 3544 H H1   . HOH B 2 .   ? 15.352 -11.058 0.244   1.00 0.00   ? 734  HOH A H1   1 
HETATM 3545 H H2   . HOH B 2 .   ? 16.822 -10.855 0.572   1.00 0.00   ? 734  HOH A H2   1 
HETATM 3546 O O    . HOH B 2 .   ? 7.550  -19.585 68.334  1.00 24.63  ? 735  HOH A O    1 
HETATM 3547 H H1   . HOH B 2 .   ? 7.276  -18.667 68.145  1.00 0.00   ? 735  HOH A H1   1 
HETATM 3548 H H2   . HOH B 2 .   ? 8.504  -19.473 68.503  1.00 0.00   ? 735  HOH A H2   1 
HETATM 3549 O O    . HOH B 2 .   ? 27.687 34.962  -51.854 1.00 48.41  ? 736  HOH A O    1 
HETATM 3550 H H1   . HOH B 2 .   ? 27.862 35.900  -51.779 1.00 0.00   ? 736  HOH A H1   1 
HETATM 3551 H H2   . HOH B 2 .   ? 27.030 34.944  -52.561 1.00 0.00   ? 736  HOH A H2   1 
HETATM 3552 O O    . HOH B 2 .   ? 15.947 33.859  -39.901 1.00 28.82  ? 737  HOH A O    1 
HETATM 3553 H H1   . HOH B 2 .   ? 14.987 33.844  -39.999 1.00 0.00   ? 737  HOH A H1   1 
HETATM 3554 H H2   . HOH B 2 .   ? 16.211 34.561  -40.506 1.00 0.00   ? 737  HOH A H2   1 
HETATM 3555 O O    . HOH B 2 .   ? 18.060 24.790  -31.986 0.80 24.55  ? 738  HOH A O    1 
HETATM 3556 H H1   . HOH B 2 .   ? 18.028 25.153  -32.889 1.00 0.00   ? 738  HOH A H1   1 
HETATM 3557 H H2   . HOH B 2 .   ? 17.920 23.850  -32.184 1.00 0.00   ? 738  HOH A H2   1 
HETATM 3558 O O    . HOH B 2 .   ? 1.806  10.073  0.373   1.00 41.36  ? 739  HOH A O    1 
HETATM 3559 H H1   . HOH B 2 .   ? 2.555  9.606   -0.027  1.00 0.00   ? 739  HOH A H1   1 
HETATM 3560 H H2   . HOH B 2 .   ? 1.579  9.462   1.083   1.00 0.00   ? 739  HOH A H2   1 
HETATM 3561 O O    . HOH B 2 .   ? 11.077 4.632   -23.308 0.94 28.46  ? 740  HOH A O    1 
HETATM 3562 H H1   . HOH B 2 .   ? 11.163 3.988   -22.588 1.00 0.00   ? 740  HOH A H1   1 
HETATM 3563 H H2   . HOH B 2 .   ? 10.127 4.650   -23.495 1.00 0.00   ? 740  HOH A H2   1 
HETATM 3564 O O    . HOH B 2 .   ? 15.576 29.344  -19.470 0.25 33.16  ? 741  HOH A O    1 
HETATM 3565 H H1   . HOH B 2 .   ? 16.294 29.374  -20.109 1.00 0.00   ? 741  HOH A H1   1 
HETATM 3566 H H2   . HOH B 2 .   ? 14.833 29.691  -19.972 1.00 0.00   ? 741  HOH A H2   1 
HETATM 3567 O O    . HOH B 2 .   ? 11.089 21.208  -15.128 1.00 30.64  ? 742  HOH A O    1 
HETATM 3568 H H1   . HOH B 2 .   ? 10.211 20.813  -15.082 1.00 0.00   ? 742  HOH A H1   1 
HETATM 3569 H H2   . HOH B 2 .   ? 11.484 20.876  -14.301 1.00 0.00   ? 742  HOH A H2   1 
HETATM 3570 O O    . HOH B 2 .   ? 5.957  3.987   -16.958 1.00 45.24  ? 743  HOH A O    1 
HETATM 3571 H H1   . HOH B 2 .   ? 6.883  4.258   -16.799 1.00 0.00   ? 743  HOH A H1   1 
HETATM 3572 H H2   . HOH B 2 .   ? 5.469  4.501   -16.289 1.00 0.00   ? 743  HOH A H2   1 
HETATM 3573 O O    . HOH B 2 .   ? 21.023 16.019  -37.330 0.58 15.19  ? 744  HOH A O    1 
HETATM 3574 H H1   . HOH B 2 .   ? 21.801 16.140  -37.927 1.00 0.00   ? 744  HOH A H1   1 
HETATM 3575 H H2   . HOH B 2 .   ? 20.528 16.793  -37.631 1.00 0.00   ? 744  HOH A H2   1 
HETATM 3576 O O    . HOH B 2 .   ? 14.546 23.972  -32.748 1.00 29.24  ? 745  HOH A O    1 
HETATM 3577 H H1   . HOH B 2 .   ? 15.169 23.608  -33.405 1.00 0.00   ? 745  HOH A H1   1 
HETATM 3578 H H2   . HOH B 2 .   ? 15.203 24.303  -32.117 1.00 0.00   ? 745  HOH A H2   1 
HETATM 3579 O O    . HOH B 2 .   ? 7.650  17.152  -24.458 1.00 24.89  ? 746  HOH A O    1 
HETATM 3580 H H1   . HOH B 2 .   ? 6.914  16.542  -24.358 1.00 0.00   ? 746  HOH A H1   1 
HETATM 3581 H H2   . HOH B 2 .   ? 8.196  16.720  -25.115 1.00 0.00   ? 746  HOH A H2   1 
HETATM 3582 O O    . HOH B 2 .   ? 17.486 8.124   -27.082 0.86 27.94  ? 747  HOH A O    1 
HETATM 3583 H H1   . HOH B 2 .   ? 17.333 7.253   -26.685 1.00 0.00   ? 747  HOH A H1   1 
HETATM 3584 H H2   . HOH B 2 .   ? 18.455 8.147   -27.012 1.00 0.00   ? 747  HOH A H2   1 
HETATM 3585 O O    . HOH B 2 .   ? 18.468 14.952  -49.607 1.00 31.18  ? 748  HOH A O    1 
HETATM 3586 H H1   . HOH B 2 .   ? 19.287 14.820  -49.110 1.00 0.00   ? 748  HOH A H1   1 
HETATM 3587 H H2   . HOH B 2 .   ? 17.868 14.412  -49.063 1.00 0.00   ? 748  HOH A H2   1 
HETATM 3588 O O    . HOH B 2 .   ? 27.915 20.309  -42.137 1.00 26.23  ? 749  HOH A O    1 
HETATM 3589 H H1   . HOH B 2 .   ? 28.041 19.801  -42.947 1.00 0.00   ? 749  HOH A H1   1 
HETATM 3590 H H2   . HOH B 2 .   ? 28.824 20.463  -41.855 1.00 0.00   ? 749  HOH A H2   1 
HETATM 3591 O O    . HOH B 2 .   ? 13.074 -8.936  61.484  1.00 39.72  ? 750  HOH A O    1 
HETATM 3592 H H1   . HOH B 2 .   ? 13.163 -8.477  60.639  1.00 0.00   ? 750  HOH A H1   1 
HETATM 3593 H H2   . HOH B 2 .   ? 12.269 -9.463  61.306  1.00 0.00   ? 750  HOH A H2   1 
HETATM 3594 O O    . HOH B 2 .   ? 9.783  -13.913 24.908  1.00 48.06  ? 751  HOH A O    1 
HETATM 3595 H H1   . HOH B 2 .   ? 10.339 -14.305 25.601  1.00 0.00   ? 751  HOH A H1   1 
HETATM 3596 H H2   . HOH B 2 .   ? 9.118  -14.610 24.834  1.00 0.00   ? 751  HOH A H2   1 
HETATM 3597 O O    . HOH B 2 .   ? 10.030 -25.326 54.613  1.00 29.33  ? 752  HOH A O    1 
HETATM 3598 H H1   . HOH B 2 .   ? 9.506  -25.241 53.806  1.00 0.00   ? 752  HOH A H1   1 
HETATM 3599 H H2   . HOH B 2 .   ? 9.990  -26.279 54.796  1.00 0.00   ? 752  HOH A H2   1 
HETATM 3600 O O    . HOH B 2 .   ? 8.675  20.829  -41.194 0.30 2.00   ? 753  HOH A O    1 
HETATM 3601 H H1   . HOH B 2 .   ? 8.956  21.036  -42.091 1.00 0.00   ? 753  HOH A H1   1 
HETATM 3602 H H2   . HOH B 2 .   ? 8.918  19.900  -41.106 1.00 0.00   ? 753  HOH A H2   1 
HETATM 3603 O O    . HOH B 2 .   ? 19.937 35.544  -52.153 0.17 2.16   ? 754  HOH A O    1 
HETATM 3604 H H1   . HOH B 2 .   ? 19.159 35.892  -52.597 1.00 0.00   ? 754  HOH A H1   1 
HETATM 3605 H H2   . HOH B 2 .   ? 19.692 35.608  -51.221 1.00 0.00   ? 754  HOH A H2   1 
HETATM 3606 O O    . HOH B 2 .   ? 6.876  17.627  -35.966 1.00 39.55  ? 755  HOH A O    1 
HETATM 3607 H H1   . HOH B 2 .   ? 6.643  18.541  -36.169 1.00 0.00   ? 755  HOH A H1   1 
HETATM 3608 H H2   . HOH B 2 .   ? 6.924  17.617  -35.007 1.00 0.00   ? 755  HOH A H2   1 
HETATM 3609 O O    . HOH B 2 .   ? 6.992  -11.906 58.703  1.00 27.48  ? 756  HOH A O    1 
HETATM 3610 H H1   . HOH B 2 .   ? 7.249  -11.952 59.638  1.00 0.00   ? 756  HOH A H1   1 
HETATM 3611 H H2   . HOH B 2 .   ? 7.602  -11.190 58.456  1.00 0.00   ? 756  HOH A H2   1 
HETATM 3612 O O    . HOH B 2 .   ? 11.854 23.656  -24.239 0.62 34.90  ? 757  HOH A O    1 
HETATM 3613 H H1   . HOH B 2 .   ? 11.733 24.556  -24.552 1.00 0.00   ? 757  HOH A H1   1 
HETATM 3614 H H2   . HOH B 2 .   ? 11.743 23.133  -25.048 1.00 0.00   ? 757  HOH A H2   1 
HETATM 3615 O O    . HOH B 2 .   ? 7.931  19.883  -12.129 1.00 45.60  ? 758  HOH A O    1 
HETATM 3616 H H1   . HOH B 2 .   ? 7.821  20.806  -11.857 1.00 0.00   ? 758  HOH A H1   1 
HETATM 3617 H H2   . HOH B 2 .   ? 8.838  19.731  -11.803 1.00 0.00   ? 758  HOH A H2   1 
HETATM 3618 O O    . HOH B 2 .   ? 4.887  -10.265 58.735  0.98 19.36  ? 759  HOH A O    1 
HETATM 3619 H H1   . HOH B 2 .   ? 5.652  -10.876 58.652  1.00 0.00   ? 759  HOH A H1   1 
HETATM 3620 H H2   . HOH B 2 .   ? 5.253  -9.547  59.271  1.00 0.00   ? 759  HOH A H2   1 
HETATM 3621 O O    . HOH B 2 .   ? 10.329 -19.579 45.250  1.00 35.73  ? 760  HOH A O    1 
HETATM 3622 H H1   . HOH B 2 .   ? 10.322 -20.471 44.880  1.00 0.00   ? 760  HOH A H1   1 
HETATM 3623 H H2   . HOH B 2 .   ? 9.980  -19.771 46.134  1.00 0.00   ? 760  HOH A H2   1 
HETATM 3624 O O    . HOH B 2 .   ? 9.552  -21.877 59.497  1.00 18.26  ? 761  HOH A O    1 
HETATM 3625 H H1   . HOH B 2 .   ? 9.806  -22.811 59.299  1.00 0.00   ? 761  HOH A H1   1 
HETATM 3626 H H2   . HOH B 2 .   ? 10.345 -21.423 59.182  1.00 0.00   ? 761  HOH A H2   1 
HETATM 3627 O O    . HOH B 2 .   ? 11.885 -28.363 57.485  1.00 29.01  ? 762  HOH A O    1 
HETATM 3628 H H1   . HOH B 2 .   ? 10.949 -28.362 57.257  1.00 0.00   ? 762  HOH A H1   1 
HETATM 3629 H H2   . HOH B 2 .   ? 11.963 -27.454 57.796  1.00 0.00   ? 762  HOH A H2   1 
HETATM 3630 O O    . HOH B 2 .   ? 9.915  -15.849 62.635  1.00 16.86  ? 763  HOH A O    1 
HETATM 3631 H H1   . HOH B 2 .   ? 10.271 -16.593 63.172  1.00 0.00   ? 763  HOH A H1   1 
HETATM 3632 H H2   . HOH B 2 .   ? 10.356 -15.104 63.037  1.00 0.00   ? 763  HOH A H2   1 
HETATM 3633 O O    . HOH B 2 .   ? 10.577 -17.966 64.227  0.71 10.49  ? 764  HOH A O    1 
HETATM 3634 H H1   . HOH B 2 .   ? 9.870  -18.367 64.792  1.00 0.00   ? 764  HOH A H1   1 
HETATM 3635 H H2   . HOH B 2 .   ? 10.877 -18.742 63.738  1.00 0.00   ? 764  HOH A H2   1 
HETATM 3636 O O    . HOH B 2 .   ? 24.336 -10.305 26.215  0.40 2.36   ? 765  HOH A O    1 
HETATM 3637 H H1   . HOH B 2 .   ? 24.941 -9.631  25.905  1.00 0.00   ? 765  HOH A H1   1 
HETATM 3638 H H2   . HOH B 2 .   ? 24.747 -11.139 25.950  1.00 0.00   ? 765  HOH A H2   1 
HETATM 3639 O O    . HOH B 2 .   ? 17.757 -13.354 64.653  1.00 20.21  ? 766  HOH A O    1 
HETATM 3640 H H1   . HOH B 2 .   ? 18.209 -13.854 65.346  1.00 0.00   ? 766  HOH A H1   1 
HETATM 3641 H H2   . HOH B 2 .   ? 18.480 -12.853 64.243  1.00 0.00   ? 766  HOH A H2   1 
HETATM 3642 O O    . HOH B 2 .   ? 18.229 -27.087 67.656  1.00 23.61  ? 767  HOH A O    1 
HETATM 3643 H H1   . HOH B 2 .   ? 18.677 -27.938 67.650  1.00 0.00   ? 767  HOH A H1   1 
HETATM 3644 H H2   . HOH B 2 .   ? 18.099 -26.941 66.710  1.00 0.00   ? 767  HOH A H2   1 
HETATM 3645 O O    . HOH B 2 .   ? 18.561 -19.284 72.728  1.00 33.50  ? 768  HOH A O    1 
HETATM 3646 H H1   . HOH B 2 .   ? 18.346 -18.355 72.916  1.00 0.00   ? 768  HOH A H1   1 
HETATM 3647 H H2   . HOH B 2 .   ? 17.918 -19.457 72.025  1.00 0.00   ? 768  HOH A H2   1 
HETATM 3648 O O    . HOH B 2 .   ? 25.205 -18.467 60.879  1.00 23.68  ? 769  HOH A O    1 
HETATM 3649 H H1   . HOH B 2 .   ? 25.232 -19.431 60.862  1.00 0.00   ? 769  HOH A H1   1 
HETATM 3650 H H2   . HOH B 2 .   ? 24.870 -18.253 59.996  1.00 0.00   ? 769  HOH A H2   1 
HETATM 3651 O O    . HOH B 2 .   ? 2.781  1.279   -8.684  1.00 13.10  ? 770  HOH A O    1 
HETATM 3652 H H1   . HOH B 2 .   ? 2.608  1.170   -7.729  1.00 0.00   ? 770  HOH A H1   1 
HETATM 3653 H H2   . HOH B 2 .   ? 3.737  1.237   -8.706  1.00 0.00   ? 770  HOH A H2   1 
HETATM 3654 O O    . HOH B 2 .   ? 7.445  4.535   3.319   1.00 23.59  ? 771  HOH A O    1 
HETATM 3655 H H1   . HOH B 2 .   ? 6.919  3.761   3.558   1.00 0.00   ? 771  HOH A H1   1 
HETATM 3656 H H2   . HOH B 2 .   ? 7.309  4.602   2.367   1.00 0.00   ? 771  HOH A H2   1 
HETATM 3657 O O    . HOH B 2 .   ? 3.301  -1.579  9.482   1.00 36.17  ? 772  HOH A O    1 
HETATM 3658 H H1   . HOH B 2 .   ? 3.831  -0.754  9.530   1.00 0.00   ? 772  HOH A H1   1 
HETATM 3659 H H2   . HOH B 2 .   ? 3.438  -1.849  8.569   1.00 0.00   ? 772  HOH A H2   1 
HETATM 3660 O O    . HOH B 2 .   ? 17.149 1.436   -12.962 0.77 35.48  ? 773  HOH A O    1 
HETATM 3661 H H1   . HOH B 2 .   ? 16.781 1.113   -12.110 1.00 0.00   ? 773  HOH A H1   1 
HETATM 3662 H H2   . HOH B 2 .   ? 18.063 1.147   -12.891 1.00 0.00   ? 773  HOH A H2   1 
HETATM 3663 O O    . HOH B 2 .   ? 10.695 -13.848 20.717  1.00 31.74  ? 774  HOH A O    1 
HETATM 3664 H H1   . HOH B 2 .   ? 11.206 -13.518 21.465  1.00 0.00   ? 774  HOH A H1   1 
HETATM 3665 H H2   . HOH B 2 .   ? 11.351 -13.847 20.007  1.00 0.00   ? 774  HOH A H2   1 
HETATM 3666 O O    . HOH B 2 .   ? 25.964 33.877  -42.079 0.47 17.70  ? 775  HOH A O    1 
HETATM 3667 H H1   . HOH B 2 .   ? 26.655 34.376  -42.525 1.00 0.00   ? 775  HOH A H1   1 
HETATM 3668 H H2   . HOH B 2 .   ? 26.159 32.952  -42.338 1.00 0.00   ? 775  HOH A H2   1 
HETATM 3669 O O    . HOH B 2 .   ? 18.514 -15.961 8.912   0.96 16.91  ? 776  HOH A O    1 
HETATM 3670 H H1   . HOH B 2 .   ? 19.174 -16.127 8.201   1.00 0.00   ? 776  HOH A H1   1 
HETATM 3671 H H2   . HOH B 2 .   ? 18.863 -16.537 9.625   1.00 0.00   ? 776  HOH A H2   1 
HETATM 3672 O O    . HOH B 2 .   ? 19.002 1.466   12.744  1.00 42.81  ? 777  HOH A O    1 
HETATM 3673 H H1   . HOH B 2 .   ? 19.683 2.138   12.838  1.00 0.00   ? 777  HOH A H1   1 
HETATM 3674 H H2   . HOH B 2 .   ? 19.483 0.743   12.327  1.00 0.00   ? 777  HOH A H2   1 
HETATM 3675 O O    . HOH B 2 .   ? 22.677 -6.277  12.479  1.00 24.37  ? 778  HOH A O    1 
HETATM 3676 H H1   . HOH B 2 .   ? 21.863 -6.247  13.001  1.00 0.00   ? 778  HOH A H1   1 
HETATM 3677 H H2   . HOH B 2 .   ? 23.341 -6.576  13.108  1.00 0.00   ? 778  HOH A H2   1 
HETATM 3678 O O    . HOH B 2 .   ? 6.298  36.296  -32.477 1.00 34.35  ? 779  HOH A O    1 
HETATM 3679 H H1   . HOH B 2 .   ? 5.379  36.567  -32.408 1.00 0.00   ? 779  HOH A H1   1 
HETATM 3680 H H2   . HOH B 2 .   ? 6.323  35.825  -33.321 1.00 0.00   ? 779  HOH A H2   1 
HETATM 3681 O O    . HOH B 2 .   ? 9.605  17.229  -40.388 1.00 26.40  ? 780  HOH A O    1 
HETATM 3682 H H1   . HOH B 2 .   ? 9.305  17.672  -39.585 1.00 0.00   ? 780  HOH A H1   1 
HETATM 3683 H H2   . HOH B 2 .   ? 10.565 17.300  -40.306 1.00 0.00   ? 780  HOH A H2   1 
HETATM 3684 O O    . HOH B 2 .   ? 7.533  28.116  -33.209 1.00 32.11  ? 781  HOH A O    1 
HETATM 3685 H H1   . HOH B 2 .   ? 8.399  28.090  -33.630 1.00 0.00   ? 781  HOH A H1   1 
HETATM 3686 H H2   . HOH B 2 .   ? 7.402  27.185  -33.011 1.00 0.00   ? 781  HOH A H2   1 
HETATM 3687 O O    . HOH B 2 .   ? 10.047 24.089  -32.313 1.00 31.89  ? 782  HOH A O    1 
HETATM 3688 H H1   . HOH B 2 .   ? 10.482 24.949  -32.166 1.00 0.00   ? 782  HOH A H1   1 
HETATM 3689 H H2   . HOH B 2 .   ? 10.701 23.600  -32.819 1.00 0.00   ? 782  HOH A H2   1 
HETATM 3690 O O    . HOH B 2 .   ? 11.144 20.475  -31.350 0.69 24.67  ? 783  HOH A O    1 
HETATM 3691 H H1   . HOH B 2 .   ? 11.631 21.040  -31.991 1.00 0.00   ? 783  HOH A H1   1 
HETATM 3692 H H2   . HOH B 2 .   ? 10.475 21.109  -31.043 1.00 0.00   ? 783  HOH A H2   1 
HETATM 3693 O O    . HOH B 2 .   ? 8.640  -19.424 65.463  1.00 29.67  ? 784  HOH A O    1 
HETATM 3694 H H1   . HOH B 2 .   ? 7.726  -19.407 65.116  1.00 0.00   ? 784  HOH A H1   1 
HETATM 3695 H H2   . HOH B 2 .   ? 8.559  -19.949 66.272  1.00 0.00   ? 784  HOH A H2   1 
HETATM 3696 O O    . HOH B 2 .   ? 12.737 21.078  -17.152 1.00 26.60  ? 785  HOH A O    1 
HETATM 3697 H H1   . HOH B 2 .   ? 11.891 21.477  -17.391 1.00 0.00   ? 785  HOH A H1   1 
HETATM 3698 H H2   . HOH B 2 .   ? 12.461 20.783  -16.259 1.00 0.00   ? 785  HOH A H2   1 
HETATM 3699 O O    . HOH B 2 .   ? 15.019 6.011   -24.240 1.00 18.23  ? 786  HOH A O    1 
HETATM 3700 H H1   . HOH B 2 .   ? 15.793 6.551   -24.045 1.00 0.00   ? 786  HOH A H1   1 
HETATM 3701 H H2   . HOH B 2 .   ? 14.347 6.654   -24.503 1.00 0.00   ? 786  HOH A H2   1 
HETATM 3702 O O    . HOH B 2 .   ? 17.528 13.267  -34.312 0.33 2.00   ? 787  HOH A O    1 
HETATM 3703 H H1   . HOH B 2 .   ? 16.934 12.764  -34.899 1.00 0.00   ? 787  HOH A H1   1 
HETATM 3704 H H2   . HOH B 2 .   ? 18.058 12.583  -33.886 1.00 0.00   ? 787  HOH A H2   1 
HETATM 3705 O O    . HOH B 2 .   ? 16.454 21.001  -18.550 0.36 11.48  ? 788  HOH A O    1 
HETATM 3706 H H1   . HOH B 2 .   ? 16.084 21.480  -19.301 1.00 0.00   ? 788  HOH A H1   1 
HETATM 3707 H H2   . HOH B 2 .   ? 16.333 21.678  -17.844 1.00 0.00   ? 788  HOH A H2   1 
HETATM 3708 O O    . HOH B 2 .   ? 20.915 22.371  -33.632 1.00 40.52  ? 789  HOH A O    1 
HETATM 3709 H H1   . HOH B 2 .   ? 20.044 22.006  -33.448 1.00 0.00   ? 789  HOH A H1   1 
HETATM 3710 H H2   . HOH B 2 .   ? 20.957 23.037  -32.906 1.00 0.00   ? 789  HOH A H2   1 
HETATM 3711 O O    . HOH B 2 .   ? 20.967 17.946  -33.119 0.65 20.66  ? 790  HOH A O    1 
HETATM 3712 H H1   . HOH B 2 .   ? 21.629 18.638  -32.917 1.00 0.00   ? 790  HOH A H1   1 
HETATM 3713 H H2   . HOH B 2 .   ? 20.758 18.142  -34.034 1.00 0.00   ? 790  HOH A H2   1 
HETATM 3714 O O    . HOH B 2 .   ? 20.739 24.282  -31.802 0.75 21.13  ? 791  HOH A O    1 
HETATM 3715 H H1   . HOH B 2 .   ? 19.805 24.555  -31.718 1.00 0.00   ? 791  HOH A H1   1 
HETATM 3716 H H2   . HOH B 2 .   ? 21.153 25.144  -31.987 1.00 0.00   ? 791  HOH A H2   1 
HETATM 3717 O O    . HOH B 2 .   ? 25.039 16.920  -46.225 1.00 29.07  ? 792  HOH A O    1 
HETATM 3718 H H1   . HOH B 2 .   ? 25.947 17.230  -46.207 1.00 0.00   ? 792  HOH A H1   1 
HETATM 3719 H H2   . HOH B 2 .   ? 24.888 16.870  -47.181 1.00 0.00   ? 792  HOH A H2   1 
HETATM 3720 O O    . HOH B 2 .   ? 26.299 31.249  -42.786 1.00 32.18  ? 793  HOH A O    1 
HETATM 3721 H H1   . HOH B 2 .   ? 27.128 30.773  -42.649 1.00 0.00   ? 793  HOH A H1   1 
HETATM 3722 H H2   . HOH B 2 .   ? 26.026 30.952  -43.671 1.00 0.00   ? 793  HOH A H2   1 
HETATM 3723 O O    . HOH B 2 .   ? 16.742 36.763  -49.794 0.63 33.13  ? 794  HOH A O    1 
HETATM 3724 H H1   . HOH B 2 .   ? 16.963 37.598  -49.376 1.00 0.00   ? 794  HOH A H1   1 
HETATM 3725 H H2   . HOH B 2 .   ? 17.528 36.241  -49.594 1.00 0.00   ? 794  HOH A H2   1 
HETATM 3726 O O    . HOH B 2 .   ? 13.229 22.217  -9.317  1.00 44.69  ? 795  HOH A O    1 
HETATM 3727 H H1   . HOH B 2 .   ? 13.237 22.677  -10.179 1.00 0.00   ? 795  HOH A H1   1 
HETATM 3728 H H2   . HOH B 2 .   ? 13.902 21.548  -9.479  1.00 0.00   ? 795  HOH A H2   1 
HETATM 3729 O O    . HOH B 2 .   ? 14.591 15.931  -51.054 1.00 46.03  ? 796  HOH A O    1 
HETATM 3730 H H1   . HOH B 2 .   ? 14.775 15.497  -50.208 1.00 0.00   ? 796  HOH A H1   1 
HETATM 3731 H H2   . HOH B 2 .   ? 15.481 16.167  -51.346 1.00 0.00   ? 796  HOH A H2   1 
HETATM 3732 O O    . HOH B 2 .   ? 18.859 -18.448 75.517  0.66 37.33  ? 797  HOH A O    1 
HETATM 3733 H H1   . HOH B 2 .   ? 18.668 -17.523 75.315  1.00 0.00   ? 797  HOH A H1   1 
HETATM 3734 H H2   . HOH B 2 .   ? 18.023 -18.856 75.276  1.00 0.00   ? 797  HOH A H2   1 
HETATM 3735 O O    . HOH B 2 .   ? 27.235 -16.138 61.525  1.00 38.54  ? 798  HOH A O    1 
HETATM 3736 H H1   . HOH B 2 .   ? 26.847 -16.998 61.291  1.00 0.00   ? 798  HOH A H1   1 
HETATM 3737 H H2   . HOH B 2 .   ? 26.522 -15.579 61.189  1.00 0.00   ? 798  HOH A H2   1 
HETATM 3738 O O    . HOH B 2 .   ? 7.418  0.244   -9.101  1.00 33.83  ? 799  HOH A O    1 
HETATM 3739 H H1   . HOH B 2 .   ? 6.712  0.678   -8.604  1.00 0.00   ? 799  HOH A H1   1 
HETATM 3740 H H2   . HOH B 2 .   ? 7.928  -0.196  -8.385  1.00 0.00   ? 799  HOH A H2   1 
HETATM 3741 O O    . HOH B 2 .   ? 4.432  1.817   3.354   0.73 15.53  ? 800  HOH A O    1 
HETATM 3742 H H1   . HOH B 2 .   ? 4.894  1.884   4.205   1.00 0.00   ? 800  HOH A H1   1 
HETATM 3743 H H2   . HOH B 2 .   ? 3.708  2.448   3.489   1.00 0.00   ? 800  HOH A H2   1 
HETATM 3744 O O    . HOH B 2 .   ? 9.009  -0.758  -7.030  1.00 22.95  ? 801  HOH A O    1 
HETATM 3745 H H1   . HOH B 2 .   ? 9.367  0.066   -6.665  1.00 0.00   ? 801  HOH A H1   1 
HETATM 3746 H H2   . HOH B 2 .   ? 8.750  -1.172  -6.182  1.00 0.00   ? 801  HOH A H2   1 
HETATM 3747 O O    . HOH B 2 .   ? 12.194 -0.935  -14.476 1.00 41.75  ? 802  HOH A O    1 
HETATM 3748 H H1   . HOH B 2 .   ? 12.469 -0.294  -15.162 1.00 0.00   ? 802  HOH A H1   1 
HETATM 3749 H H2   . HOH B 2 .   ? 12.797 -1.676  -14.615 1.00 0.00   ? 802  HOH A H2   1 
HETATM 3750 O O    . HOH B 2 .   ? 12.863 1.097   -16.064 1.00 19.02  ? 803  HOH A O    1 
HETATM 3751 H H1   . HOH B 2 .   ? 13.590 1.326   -15.463 1.00 0.00   ? 803  HOH A H1   1 
HETATM 3752 H H2   . HOH B 2 .   ? 13.242 1.417   -16.897 1.00 0.00   ? 803  HOH A H2   1 
HETATM 3753 O O    . HOH B 2 .   ? 16.839 -6.620  -0.941  1.00 32.20  ? 804  HOH A O    1 
HETATM 3754 H H1   . HOH B 2 .   ? 16.014 -6.262  -1.305  1.00 0.00   ? 804  HOH A H1   1 
HETATM 3755 H H2   . HOH B 2 .   ? 16.415 -7.326  -0.425  1.00 0.00   ? 804  HOH A H2   1 
HETATM 3756 O O    . HOH B 2 .   ? 17.311 6.339   2.834   1.00 26.46  ? 805  HOH A O    1 
HETATM 3757 H H1   . HOH B 2 .   ? 17.459 6.859   3.634   1.00 0.00   ? 805  HOH A H1   1 
HETATM 3758 H H2   . HOH B 2 .   ? 16.602 5.771   3.177   1.00 0.00   ? 805  HOH A H2   1 
HETATM 3759 O O    . HOH B 2 .   ? 26.752 -12.191 12.631  1.00 22.71  ? 806  HOH A O    1 
HETATM 3760 H H1   . HOH B 2 .   ? 27.365 -11.735 13.213  1.00 0.00   ? 806  HOH A H1   1 
HETATM 3761 H H2   . HOH B 2 .   ? 26.049 -11.527 12.522  1.00 0.00   ? 806  HOH A H2   1 
HETATM 3762 O O    . HOH B 2 .   ? 15.577 15.004  -36.883 1.00 37.37  ? 807  HOH A O    1 
HETATM 3763 H H1   . HOH B 2 .   ? 15.446 15.605  -36.136 1.00 0.00   ? 807  HOH A H1   1 
HETATM 3764 H H2   . HOH B 2 .   ? 15.779 14.164  -36.429 1.00 0.00   ? 807  HOH A H2   1 
HETATM 3765 O O    . HOH B 2 .   ? 17.728 32.826  -38.174 1.00 31.14  ? 808  HOH A O    1 
HETATM 3766 H H1   . HOH B 2 .   ? 17.529 33.445  -37.466 1.00 0.00   ? 808  HOH A H1   1 
HETATM 3767 H H2   . HOH B 2 .   ? 17.082 33.128  -38.857 1.00 0.00   ? 808  HOH A H2   1 
HETATM 3768 O O    . HOH B 2 .   ? 13.763 23.729  -17.763 0.86 42.44  ? 809  HOH A O    1 
HETATM 3769 H H1   . HOH B 2 .   ? 13.488 22.796  -17.667 1.00 0.00   ? 809  HOH A H1   1 
HETATM 3770 H H2   . HOH B 2 .   ? 13.182 24.013  -18.480 1.00 0.00   ? 809  HOH A H2   1 
HETATM 3771 O O    . HOH B 2 .   ? 12.013 -9.925  68.921  0.85 20.95  ? 810  HOH A O    1 
HETATM 3772 H H1   . HOH B 2 .   ? 11.812 -9.349  69.674  1.00 0.00   ? 810  HOH A H1   1 
HETATM 3773 H H2   . HOH B 2 .   ? 12.684 -9.380  68.468  1.00 0.00   ? 810  HOH A H2   1 
HETATM 3774 O O    . HOH B 2 .   ? 19.739 -7.885  56.768  0.94 36.92  ? 811  HOH A O    1 
HETATM 3775 H H1   . HOH B 2 .   ? 19.225 -7.152  57.119  1.00 0.00   ? 811  HOH A H1   1 
HETATM 3776 H H2   . HOH B 2 .   ? 19.418 -7.952  55.857  1.00 0.00   ? 811  HOH A H2   1 
HETATM 3777 O O    . HOH B 2 .   ? 20.938 -28.573 60.750  1.00 30.54  ? 812  HOH A O    1 
HETATM 3778 H H1   . HOH B 2 .   ? 21.746 -28.335 61.221  1.00 0.00   ? 812  HOH A H1   1 
HETATM 3779 H H2   . HOH B 2 .   ? 20.733 -27.710 60.371  1.00 0.00   ? 812  HOH A H2   1 
HETATM 3780 O O    . HOH B 2 .   ? 17.859 -12.334 75.639  1.00 39.43  ? 813  HOH A O    1 
HETATM 3781 H H1   . HOH B 2 .   ? 17.775 -11.577 75.029  1.00 0.00   ? 813  HOH A H1   1 
HETATM 3782 H H2   . HOH B 2 .   ? 18.474 -12.922 75.165  1.00 0.00   ? 813  HOH A H2   1 
HETATM 3783 O O    . HOH B 2 .   ? 21.007 -28.820 65.602  1.00 27.94  ? 814  HOH A O    1 
HETATM 3784 H H1   . HOH B 2 .   ? 20.213 -28.775 65.051  1.00 0.00   ? 814  HOH A H1   1 
HETATM 3785 H H2   . HOH B 2 .   ? 21.540 -29.488 65.162  1.00 0.00   ? 814  HOH A H2   1 
HETATM 3786 O O    . HOH B 2 .   ? 25.762 -27.683 61.257  0.45 25.87  ? 815  HOH A O    1 
HETATM 3787 H H1   . HOH B 2 .   ? 25.712 -27.592 62.212  1.00 0.00   ? 815  HOH A H1   1 
HETATM 3788 H H2   . HOH B 2 .   ? 24.909 -27.335 60.972  1.00 0.00   ? 815  HOH A H2   1 
HETATM 3789 O O    . HOH B 2 .   ? 13.208 23.027  -11.971 1.00 35.84  ? 816  HOH A O    1 
HETATM 3790 H H1   . HOH B 2 .   ? 13.668 23.206  -12.795 1.00 0.00   ? 816  HOH A H1   1 
HETATM 3791 H H2   . HOH B 2 .   ? 12.883 22.124  -12.146 1.00 0.00   ? 816  HOH A H2   1 
HETATM 3792 O O    . HOH B 2 .   ? 30.311 -15.463 58.596  1.00 40.47  ? 817  HOH A O    1 
HETATM 3793 H H1   . HOH B 2 .   ? 29.795 -15.156 57.830  1.00 0.00   ? 817  HOH A H1   1 
HETATM 3794 H H2   . HOH B 2 .   ? 30.065 -16.402 58.589  1.00 0.00   ? 817  HOH A H2   1 
HETATM 3795 O O    . HOH B 2 .   ? 28.573 -19.375 67.091  1.00 38.83  ? 818  HOH A O    1 
HETATM 3796 H H1   . HOH B 2 .   ? 28.283 -19.714 67.957  1.00 0.00   ? 818  HOH A H1   1 
HETATM 3797 H H2   . HOH B 2 .   ? 29.202 -20.051 66.813  1.00 0.00   ? 818  HOH A H2   1 
HETATM 3798 O O    . HOH B 2 .   ? -4.445 -14.078 17.536  0.88 38.82  ? 819  HOH A O    1 
HETATM 3799 H H1   . HOH B 2 .   ? -4.859 -13.830 18.380  1.00 0.00   ? 819  HOH A H1   1 
HETATM 3800 H H2   . HOH B 2 .   ? -3.543 -13.769 17.662  1.00 0.00   ? 819  HOH A H2   1 
HETATM 3801 O O    . HOH B 2 .   ? 1.837  0.950   -5.951  1.00 38.12  ? 820  HOH A O    1 
HETATM 3802 H H1   . HOH B 2 .   ? 1.961  1.626   -5.270  1.00 0.00   ? 820  HOH A H1   1 
HETATM 3803 H H2   . HOH B 2 .   ? 0.905  1.050   -6.205  1.00 0.00   ? 820  HOH A H2   1 
HETATM 3804 O O    . HOH B 2 .   ? 23.858 14.539  -43.767 0.75 40.19  ? 821  HOH A O    1 
HETATM 3805 H H1   . HOH B 2 .   ? 24.416 14.606  -44.545 1.00 0.00   ? 821  HOH A H1   1 
HETATM 3806 H H2   . HOH B 2 .   ? 23.371 13.713  -43.972 1.00 0.00   ? 821  HOH A H2   1 
HETATM 3807 O O    . HOH B 2 .   ? 6.995  -2.594  -12.475 0.79 35.26  ? 822  HOH A O    1 
HETATM 3808 H H1   . HOH B 2 .   ? 7.223  -1.698  -12.215 1.00 0.00   ? 822  HOH A H1   1 
HETATM 3809 H H2   . HOH B 2 .   ? 6.647  -2.462  -13.363 1.00 0.00   ? 822  HOH A H2   1 
HETATM 3810 O O    . HOH B 2 .   ? 3.756  9.130   3.902   1.00 35.55  ? 823  HOH A O    1 
HETATM 3811 H H1   . HOH B 2 .   ? 4.006  9.574   4.721   1.00 0.00   ? 823  HOH A H1   1 
HETATM 3812 H H2   . HOH B 2 .   ? 4.354  9.520   3.265   1.00 0.00   ? 823  HOH A H2   1 
HETATM 3813 O O    . HOH B 2 .   ? 5.335  -10.724 9.110   1.00 32.26  ? 824  HOH A O    1 
HETATM 3814 H H1   . HOH B 2 .   ? 4.801  -10.441 9.868   1.00 0.00   ? 824  HOH A H1   1 
HETATM 3815 H H2   . HOH B 2 .   ? 4.672  -11.276 8.675   1.00 0.00   ? 824  HOH A H2   1 
HETATM 3816 O O    . HOH B 2 .   ? 5.622  -8.918  6.397   0.82 31.36  ? 825  HOH A O    1 
HETATM 3817 H H1   . HOH B 2 .   ? 4.638  -8.854  6.354   1.00 0.00   ? 825  HOH A H1   1 
HETATM 3818 H H2   . HOH B 2 .   ? 5.713  -9.560  7.116   1.00 0.00   ? 825  HOH A H2   1 
HETATM 3819 O O    . HOH B 2 .   ? 7.323  -9.135  18.112  1.00 38.67  ? 826  HOH A O    1 
HETATM 3820 H H1   . HOH B 2 .   ? 6.471  -9.220  17.662  1.00 0.00   ? 826  HOH A H1   1 
HETATM 3821 H H2   . HOH B 2 .   ? 7.931  -9.034  17.366  1.00 0.00   ? 826  HOH A H2   1 
HETATM 3822 O O    . HOH B 2 .   ? 11.855 3.691   4.940   1.00 24.80  ? 827  HOH A O    1 
HETATM 3823 H H1   . HOH B 2 .   ? 11.095 4.172   4.551   1.00 0.00   ? 827  HOH A H1   1 
HETATM 3824 H H2   . HOH B 2 .   ? 11.860 2.856   4.453   1.00 0.00   ? 827  HOH A H2   1 
HETATM 3825 O O    . HOH B 2 .   ? 12.686 -13.908 6.789   1.00 22.20  ? 828  HOH A O    1 
HETATM 3826 H H1   . HOH B 2 .   ? 11.795 -13.934 7.174   1.00 0.00   ? 828  HOH A H1   1 
HETATM 3827 H H2   . HOH B 2 .   ? 13.137 -14.618 7.259   1.00 0.00   ? 828  HOH A H2   1 
HETATM 3828 O O    . HOH B 2 .   ? 9.996  -2.051  20.061  1.00 43.16  ? 829  HOH A O    1 
HETATM 3829 H H1   . HOH B 2 .   ? 9.911  -1.158  20.399  1.00 0.00   ? 829  HOH A H1   1 
HETATM 3830 H H2   . HOH B 2 .   ? 10.905 -2.289  20.259  1.00 0.00   ? 829  HOH A H2   1 
HETATM 3831 O O    . HOH B 2 .   ? 15.623 2.597   6.310   1.00 32.77  ? 830  HOH A O    1 
HETATM 3832 H H1   . HOH B 2 .   ? 15.613 2.966   5.412   1.00 0.00   ? 830  HOH A H1   1 
HETATM 3833 H H2   . HOH B 2 .   ? 15.509 1.649   6.183   1.00 0.00   ? 830  HOH A H2   1 
HETATM 3834 O O    . HOH B 2 .   ? 27.623 26.811  -60.566 1.00 42.34  ? 831  HOH A O    1 
HETATM 3835 H H1   . HOH B 2 .   ? 28.460 26.332  -60.642 1.00 0.00   ? 831  HOH A H1   1 
HETATM 3836 H H2   . HOH B 2 .   ? 27.000 26.215  -60.999 1.00 0.00   ? 831  HOH A H2   1 
HETATM 3837 O O    . HOH B 2 .   ? 17.408 -1.583  18.423  1.00 35.19  ? 832  HOH A O    1 
HETATM 3838 H H1   . HOH B 2 .   ? 17.477 -1.393  17.486  1.00 0.00   ? 832  HOH A H1   1 
HETATM 3839 H H2   . HOH B 2 .   ? 18.183 -2.142  18.558  1.00 0.00   ? 832  HOH A H2   1 
HETATM 3840 O O    . HOH B 2 .   ? 12.561 31.198  -30.844 1.00 42.68  ? 833  HOH A O    1 
HETATM 3841 H H1   . HOH B 2 .   ? 12.579 31.119  -29.886 1.00 0.00   ? 833  HOH A H1   1 
HETATM 3842 H H2   . HOH B 2 .   ? 12.846 32.117  -30.963 1.00 0.00   ? 833  HOH A H2   1 
HETATM 3843 O O    . HOH B 2 .   ? -2.499 -12.051 9.360   1.00 43.48  ? 834  HOH A O    1 
HETATM 3844 H H1   . HOH B 2 .   ? -2.028 -11.221 9.203   1.00 0.00   ? 834  HOH A H1   1 
HETATM 3845 H H2   . HOH B 2 .   ? -1.799 -12.690 9.161   1.00 0.00   ? 834  HOH A H2   1 
HETATM 3846 O O    . HOH B 2 .   ? 1.942  4.540   -14.152 1.00 26.63  ? 835  HOH A O    1 
HETATM 3847 H H1   . HOH B 2 .   ? 2.762  4.890   -14.567 1.00 0.00   ? 835  HOH A H1   1 
HETATM 3848 H H2   . HOH B 2 .   ? 1.522  4.152   -14.927 1.00 0.00   ? 835  HOH A H2   1 
HETATM 3849 O O    . HOH B 2 .   ? 9.070  18.529  -32.347 0.67 25.03  ? 836  HOH A O    1 
HETATM 3850 H H1   . HOH B 2 .   ? 9.832  19.053  -32.062 1.00 0.00   ? 836  HOH A H1   1 
HETATM 3851 H H2   . HOH B 2 .   ? 9.434  17.649  -32.490 1.00 0.00   ? 836  HOH A H2   1 
HETATM 3852 O O    . HOH B 2 .   ? 10.326 18.417  -46.870 0.87 55.49  ? 837  HOH A O    1 
HETATM 3853 H H1   . HOH B 2 .   ? 10.064 19.092  -47.497 1.00 0.00   ? 837  HOH A H1   1 
HETATM 3854 H H2   . HOH B 2 .   ? 10.973 17.913  -47.383 1.00 0.00   ? 837  HOH A H2   1 
HETATM 3855 O O    . HOH B 2 .   ? 10.667 20.854  -9.627  1.00 44.92  ? 838  HOH A O    1 
HETATM 3856 H H1   . HOH B 2 .   ? 10.989 21.441  -8.925  1.00 0.00   ? 838  HOH A H1   1 
HETATM 3857 H H2   . HOH B 2 .   ? 11.369 20.933  -10.282 1.00 0.00   ? 838  HOH A H2   1 
HETATM 3858 O O    . HOH B 2 .   ? 11.825 -1.737  -7.810  1.00 46.25  ? 839  HOH A O    1 
HETATM 3859 H H1   . HOH B 2 .   ? 10.997 -1.336  -7.498  1.00 0.00   ? 839  HOH A H1   1 
HETATM 3860 H H2   . HOH B 2 .   ? 12.036 -1.208  -8.579  1.00 0.00   ? 839  HOH A H2   1 
HETATM 3861 O O    . HOH B 2 .   ? 15.372 3.842   -21.505 1.00 37.41  ? 840  HOH A O    1 
HETATM 3862 H H1   . HOH B 2 .   ? 15.401 4.630   -22.080 1.00 0.00   ? 840  HOH A H1   1 
HETATM 3863 H H2   . HOH B 2 .   ? 15.687 3.162   -22.109 1.00 0.00   ? 840  HOH A H2   1 
HETATM 3864 O O    . HOH B 2 .   ? 3.847  5.766   -15.413 1.00 33.34  ? 841  HOH A O    1 
HETATM 3865 H H1   . HOH B 2 .   ? 4.256  6.233   -14.665 1.00 0.00   ? 841  HOH A H1   1 
HETATM 3866 H H2   . HOH B 2 .   ? 3.576  6.488   -15.996 1.00 0.00   ? 841  HOH A H2   1 
HETATM 3867 O O    . HOH B 2 .   ? 32.006 34.274  -48.628 0.75 37.41  ? 842  HOH A O    1 
HETATM 3868 H H1   . HOH B 2 .   ? 31.618 34.936  -48.036 1.00 0.00   ? 842  HOH A H1   1 
HETATM 3869 H H2   . HOH B 2 .   ? 32.102 34.767  -49.450 1.00 0.00   ? 842  HOH A H2   1 
HETATM 3870 O O    . HOH B 2 .   ? 31.250 20.360  -43.245 0.84 27.66  ? 843  HOH A O    1 
HETATM 3871 H H1   . HOH B 2 .   ? 31.776 21.148  -43.386 1.00 0.00   ? 843  HOH A H1   1 
HETATM 3872 H H2   . HOH B 2 .   ? 31.281 19.920  -44.099 1.00 0.00   ? 843  HOH A H2   1 
HETATM 3873 O O    . HOH B 2 .   ? 23.214 20.172  -30.358 1.00 51.89  ? 844  HOH A O    1 
HETATM 3874 H H1   . HOH B 2 .   ? 22.941 20.078  -31.290 1.00 0.00   ? 844  HOH A H1   1 
HETATM 3875 H H2   . HOH B 2 .   ? 22.744 19.428  -29.952 1.00 0.00   ? 844  HOH A H2   1 
HETATM 3876 O O    . HOH B 2 .   ? 21.820 19.883  -21.562 0.57 22.78  ? 845  HOH A O    1 
HETATM 3877 H H1   . HOH B 2 .   ? 20.999 20.384  -21.585 1.00 0.00   ? 845  HOH A H1   1 
HETATM 3878 H H2   . HOH B 2 .   ? 21.746 19.380  -22.379 1.00 0.00   ? 845  HOH A H2   1 
HETATM 3879 O O    . HOH B 2 .   ? 19.144 7.164   -2.986  1.00 38.68  ? 846  HOH A O    1 
HETATM 3880 H H1   . HOH B 2 .   ? 18.979 8.056   -2.641  1.00 0.00   ? 846  HOH A H1   1 
HETATM 3881 H H2   . HOH B 2 .   ? 18.261 6.879   -3.243  1.00 0.00   ? 846  HOH A H2   1 
HETATM 3882 O O    . HOH B 2 .   ? 26.603 22.292  -37.235 1.00 36.26  ? 847  HOH A O    1 
HETATM 3883 H H1   . HOH B 2 .   ? 27.368 22.415  -37.806 1.00 0.00   ? 847  HOH A H1   1 
HETATM 3884 H H2   . HOH B 2 .   ? 25.914 22.128  -37.892 1.00 0.00   ? 847  HOH A H2   1 
HETATM 3885 O O    . HOH B 2 .   ? 24.980 14.169  -24.314 1.00 43.60  ? 848  HOH A O    1 
HETATM 3886 H H1   . HOH B 2 .   ? 25.897 14.452  -24.413 1.00 0.00   ? 848  HOH A H1   1 
HETATM 3887 H H2   . HOH B 2 .   ? 24.754 13.928  -25.232 1.00 0.00   ? 848  HOH A H2   1 
HETATM 3888 O O    . HOH B 2 .   ? 11.756 26.407  -31.926 0.93 30.58  ? 849  HOH A O    1 
HETATM 3889 H H1   . HOH B 2 .   ? 11.913 27.034  -31.213 1.00 0.00   ? 849  HOH A H1   1 
HETATM 3890 H H2   . HOH B 2 .   ? 12.546 26.497  -32.477 1.00 0.00   ? 849  HOH A H2   1 
HETATM 3891 O O    . HOH B 2 .   ? 7.794  -21.741 52.878  1.00 33.46  ? 850  HOH A O    1 
HETATM 3892 H H1   . HOH B 2 .   ? 7.761  -21.226 52.060  1.00 0.00   ? 850  HOH A H1   1 
HETATM 3893 H H2   . HOH B 2 .   ? 8.439  -22.407 52.640  1.00 0.00   ? 850  HOH A H2   1 
HETATM 3894 O O    . HOH B 2 .   ? 4.110  5.658   -19.730 1.00 45.60  ? 851  HOH A O    1 
HETATM 3895 H H1   . HOH B 2 .   ? 4.914  5.630   -20.260 1.00 0.00   ? 851  HOH A H1   1 
HETATM 3896 H H2   . HOH B 2 .   ? 3.444  5.931   -20.379 1.00 0.00   ? 851  HOH A H2   1 
HETATM 3897 O O    . HOH B 2 .   ? 7.181  -16.190 63.826  1.00 33.28  ? 852  HOH A O    1 
HETATM 3898 H H1   . HOH B 2 .   ? 6.586  -15.733 63.192  1.00 0.00   ? 852  HOH A H1   1 
HETATM 3899 H H2   . HOH B 2 .   ? 8.062  -16.074 63.420  1.00 0.00   ? 852  HOH A H2   1 
HETATM 3900 O O    . HOH B 2 .   ? 9.864  -11.976 55.045  0.94 45.91  ? 853  HOH A O    1 
HETATM 3901 H H1   . HOH B 2 .   ? 10.325 -11.584 55.790  1.00 0.00   ? 853  HOH A H1   1 
HETATM 3902 H H2   . HOH B 2 .   ? 10.254 -12.855 54.982  1.00 0.00   ? 853  HOH A H2   1 
HETATM 3903 O O    . HOH B 2 .   ? 10.901 -31.403 60.636  0.36 5.05   ? 854  HOH A O    1 
HETATM 3904 H H1   . HOH B 2 .   ? 10.456 -30.790 61.245  1.00 0.00   ? 854  HOH A H1   1 
HETATM 3905 H H2   . HOH B 2 .   ? 10.297 -31.367 59.854  1.00 0.00   ? 854  HOH A H2   1 
HETATM 3906 O O    . HOH B 2 .   ? 18.321 19.025  7.891   0.87 33.63  ? 855  HOH A O    1 
HETATM 3907 H H1   . HOH B 2 .   ? 19.089 19.097  8.468   1.00 0.00   ? 855  HOH A H1   1 
HETATM 3908 H H2   . HOH B 2 .   ? 18.687 18.750  7.045   1.00 0.00   ? 855  HOH A H2   1 
HETATM 3909 O O    . HOH B 2 .   ? 17.028 -10.567 43.067  0.56 14.66  ? 856  HOH A O    1 
HETATM 3910 H H1   . HOH B 2 .   ? 16.153 -10.162 43.035  1.00 0.00   ? 856  HOH A H1   1 
HETATM 3911 H H2   . HOH B 2 .   ? 16.879 -11.490 42.838  1.00 0.00   ? 856  HOH A H2   1 
HETATM 3912 O O    . HOH B 2 .   ? 18.256 -28.706 60.724  0.77 28.30  ? 857  HOH A O    1 
HETATM 3913 H H1   . HOH B 2 .   ? 18.169 -27.878 61.197  1.00 0.00   ? 857  HOH A H1   1 
HETATM 3914 H H2   . HOH B 2 .   ? 19.213 -28.883 60.775  1.00 0.00   ? 857  HOH A H2   1 
HETATM 3915 O O    . HOH B 2 .   ? 17.617 -10.087 73.902  0.31 2.00   ? 858  HOH A O    1 
HETATM 3916 H H1   . HOH B 2 .   ? 17.690 -9.134  73.812  1.00 0.00   ? 858  HOH A H1   1 
HETATM 3917 H H2   . HOH B 2 .   ? 18.255 -10.390 73.242  1.00 0.00   ? 858  HOH A H2   1 
HETATM 3918 O O    . HOH B 2 .   ? 28.748 -10.323 46.912  0.68 28.98  ? 859  HOH A O    1 
HETATM 3919 H H1   . HOH B 2 .   ? 28.324 -9.912  46.150  1.00 0.00   ? 859  HOH A H1   1 
HETATM 3920 H H2   . HOH B 2 .   ? 28.121 -11.019 47.130  1.00 0.00   ? 859  HOH A H2   1 
HETATM 3921 O O    . HOH B 2 .   ? 27.438 -21.037 64.569  0.70 20.50  ? 860  HOH A O    1 
HETATM 3922 H H1   . HOH B 2 .   ? 27.007 -20.864 65.414  1.00 0.00   ? 860  HOH A H1   1 
HETATM 3923 H H2   . HOH B 2 .   ? 27.333 -22.003 64.512  1.00 0.00   ? 860  HOH A H2   1 
HETATM 3924 O O    . HOH B 2 .   ? 27.681 29.451  -46.311 1.00 30.30  ? 861  HOH A O    1 
HETATM 3925 H H1   . HOH B 2 .   ? 28.114 29.459  -47.173 1.00 0.00   ? 861  HOH A H1   1 
HETATM 3926 H H2   . HOH B 2 .   ? 27.459 28.513  -46.219 1.00 0.00   ? 861  HOH A H2   1 
HETATM 3927 O O    . HOH B 2 .   ? 29.942 -18.554 70.525  1.00 29.54  ? 862  HOH A O    1 
HETATM 3928 H H1   . HOH B 2 .   ? 29.381 -18.782 69.766  1.00 0.00   ? 862  HOH A H1   1 
HETATM 3929 H H2   . HOH B 2 .   ? 29.723 -19.315 71.079  1.00 0.00   ? 862  HOH A H2   1 
HETATM 3930 O O    . HOH B 2 .   ? -0.231 16.280  -8.941  0.91 41.77  ? 863  HOH A O    1 
HETATM 3931 H H1   . HOH B 2 .   ? -0.786 17.035  -8.658  1.00 0.00   ? 863  HOH A H1   1 
HETATM 3932 H H2   . HOH B 2 .   ? -0.643 16.048  -9.780  1.00 0.00   ? 863  HOH A H2   1 
HETATM 3933 O O    . HOH B 2 .   ? 2.980  -8.960  6.675   1.00 54.47  ? 864  HOH A O    1 
HETATM 3934 H H1   . HOH B 2 .   ? 2.028  -8.823  6.587   1.00 0.00   ? 864  HOH A H1   1 
HETATM 3935 H H2   . HOH B 2 .   ? 2.916  -9.819  7.128   1.00 0.00   ? 864  HOH A H2   1 
HETATM 3936 O O    . HOH B 2 .   ? 12.541 -22.139 12.137  1.00 32.45  ? 865  HOH A O    1 
HETATM 3937 H H1   . HOH B 2 .   ? 11.581 -22.176 12.186  1.00 0.00   ? 865  HOH A H1   1 
HETATM 3938 H H2   . HOH B 2 .   ? 12.689 -22.644 11.322  1.00 0.00   ? 865  HOH A H2   1 
HETATM 3939 O O    . HOH B 2 .   ? 17.757 11.254  -9.184  0.94 32.00  ? 866  HOH A O    1 
HETATM 3940 H H1   . HOH B 2 .   ? 16.905 11.421  -9.602  1.00 0.00   ? 866  HOH A H1   1 
HETATM 3941 H H2   . HOH B 2 .   ? 18.361 11.215  -9.934  1.00 0.00   ? 866  HOH A H2   1 
HETATM 3942 O O    . HOH B 2 .   ? 16.120 0.724   -10.524 1.00 33.61  ? 867  HOH A O    1 
HETATM 3943 H H1   . HOH B 2 .   ? 16.104 1.537   -10.006 1.00 0.00   ? 867  HOH A H1   1 
HETATM 3944 H H2   . HOH B 2 .   ? 15.163 0.506   -10.603 1.00 0.00   ? 867  HOH A H2   1 
HETATM 3945 O O    . HOH B 2 .   ? 15.949 0.332   14.785  1.00 27.27  ? 868  HOH A O    1 
HETATM 3946 H H1   . HOH B 2 .   ? 15.818 1.152   14.277  1.00 0.00   ? 868  HOH A H1   1 
HETATM 3947 H H2   . HOH B 2 .   ? 15.127 0.283   15.271  1.00 0.00   ? 868  HOH A H2   1 
HETATM 3948 O O    . HOH B 2 .   ? 13.242 2.766   11.661  1.00 31.26  ? 869  HOH A O    1 
HETATM 3949 H H1   . HOH B 2 .   ? 12.587 2.720   12.398  1.00 0.00   ? 869  HOH A H1   1 
HETATM 3950 H H2   . HOH B 2 .   ? 14.054 2.479   12.116  1.00 0.00   ? 869  HOH A H2   1 
HETATM 3951 O O    . HOH B 2 .   ? 12.203 11.535  -34.946 0.73 36.38  ? 870  HOH A O    1 
HETATM 3952 H H1   . HOH B 2 .   ? 11.336 11.763  -34.598 1.00 0.00   ? 870  HOH A H1   1 
HETATM 3953 H H2   . HOH B 2 .   ? 12.732 12.292  -34.690 1.00 0.00   ? 870  HOH A H2   1 
HETATM 3954 O O    . HOH B 2 .   ? 12.572 22.079  -33.057 0.21 2.00   ? 871  HOH A O    1 
HETATM 3955 H H1   . HOH B 2 .   ? 13.217 22.772  -32.793 1.00 0.00   ? 871  HOH A H1   1 
HETATM 3956 H H2   . HOH B 2 .   ? 13.045 21.688  -33.804 1.00 0.00   ? 871  HOH A H2   1 
HETATM 3957 O O    . HOH B 2 .   ? 15.713 13.346  -41.432 1.00 39.16  ? 872  HOH A O    1 
HETATM 3958 H H1   . HOH B 2 .   ? 15.086 14.067  -41.589 1.00 0.00   ? 872  HOH A H1   1 
HETATM 3959 H H2   . HOH B 2 .   ? 15.971 13.108  -42.334 1.00 0.00   ? 872  HOH A H2   1 
HETATM 3960 O O    . HOH B 2 .   ? 17.501 36.433  -35.061 1.00 37.54  ? 873  HOH A O    1 
HETATM 3961 H H1   . HOH B 2 .   ? 16.879 37.137  -34.825 1.00 0.00   ? 873  HOH A H1   1 
HETATM 3962 H H2   . HOH B 2 .   ? 18.162 36.906  -35.572 1.00 0.00   ? 873  HOH A H2   1 
HETATM 3963 O O    . HOH B 2 .   ? 16.921 25.138  -29.538 0.31 4.91   ? 874  HOH A O    1 
HETATM 3964 H H1   . HOH B 2 .   ? 17.599 25.561  -29.010 1.00 0.00   ? 874  HOH A H1   1 
HETATM 3965 H H2   . HOH B 2 .   ? 17.378 25.014  -30.397 1.00 0.00   ? 874  HOH A H2   1 
HETATM 3966 O O    . HOH B 2 .   ? 19.482 36.156  -41.203 0.50 15.30  ? 875  HOH A O    1 
HETATM 3967 H H1   . HOH B 2 .   ? 19.878 37.013  -41.376 1.00 0.00   ? 875  HOH A H1   1 
HETATM 3968 H H2   . HOH B 2 .   ? 19.621 35.703  -42.049 1.00 0.00   ? 875  HOH A H2   1 
HETATM 3969 O O    . HOH B 2 .   ? 20.259 12.280  -31.156 0.23 2.00   ? 876  HOH A O    1 
HETATM 3970 H H1   . HOH B 2 .   ? 19.513 12.725  -30.732 1.00 0.00   ? 876  HOH A H1   1 
HETATM 3971 H H2   . HOH B 2 .   ? 21.026 12.772  -30.849 1.00 0.00   ? 876  HOH A H2   1 
HETATM 3972 O O    . HOH B 2 .   ? 24.734 11.442  -21.093 1.00 37.06  ? 877  HOH A O    1 
HETATM 3973 H H1   . HOH B 2 .   ? 23.916 11.659  -21.554 1.00 0.00   ? 877  HOH A H1   1 
HETATM 3974 H H2   . HOH B 2 .   ? 25.400 11.636  -21.757 1.00 0.00   ? 877  HOH A H2   1 
HETATM 3975 O O    . HOH B 2 .   ? 10.747 20.076  -51.481 0.82 25.86  ? 878  HOH A O    1 
HETATM 3976 H H1   . HOH B 2 .   ? 11.334 20.251  -52.223 1.00 0.00   ? 878  HOH A H1   1 
HETATM 3977 H H2   . HOH B 2 .   ? 10.229 19.316  -51.760 1.00 0.00   ? 878  HOH A H2   1 
HETATM 3978 O O    . HOH B 2 .   ? 17.463 34.834  -45.490 1.00 38.03  ? 879  HOH A O    1 
HETATM 3979 H H1   . HOH B 2 .   ? 18.057 35.473  -45.070 1.00 0.00   ? 879  HOH A H1   1 
HETATM 3980 H H2   . HOH B 2 .   ? 17.977 34.044  -45.287 1.00 0.00   ? 879  HOH A H2   1 
HETATM 3981 O O    . HOH B 2 .   ? 3.857  -21.340 63.547  1.00 43.63  ? 880  HOH A O    1 
HETATM 3982 H H1   . HOH B 2 .   ? 3.451  -20.507 63.800  1.00 0.00   ? 880  HOH A H1   1 
HETATM 3983 H H2   . HOH B 2 .   ? 3.262  -22.016 63.896  1.00 0.00   ? 880  HOH A H2   1 
HETATM 3984 O O    . HOH B 2 .   ? 8.427  13.889  5.858   1.00 45.13  ? 881  HOH A O    1 
HETATM 3985 H H1   . HOH B 2 .   ? 8.422  14.584  6.538   1.00 0.00   ? 881  HOH A H1   1 
HETATM 3986 H H2   . HOH B 2 .   ? 8.615  14.386  5.044   1.00 0.00   ? 881  HOH A H2   1 
HETATM 3987 O O    . HOH B 2 .   ? 15.448 16.778  -13.397 1.00 21.71  ? 882  HOH A O    1 
HETATM 3988 H H1   . HOH B 2 .   ? 15.552 16.703  -12.443 1.00 0.00   ? 882  HOH A H1   1 
HETATM 3989 H H2   . HOH B 2 .   ? 14.587 17.216  -13.445 1.00 0.00   ? 882  HOH A H2   1 
HETATM 3990 O O    . HOH B 2 .   ? 5.252  -10.333 53.746  1.00 39.13  ? 883  HOH A O    1 
HETATM 3991 H H1   . HOH B 2 .   ? 4.720  -10.820 54.396  1.00 0.00   ? 883  HOH A H1   1 
HETATM 3992 H H2   . HOH B 2 .   ? 4.583  -9.849  53.259  1.00 0.00   ? 883  HOH A H2   1 
HETATM 3993 O O    . HOH B 2 .   ? 4.933  -15.107 62.357  0.96 30.08  ? 884  HOH A O    1 
HETATM 3994 H H1   . HOH B 2 .   ? 4.294  -14.415 62.580  1.00 0.00   ? 884  HOH A H1   1 
HETATM 3995 H H2   . HOH B 2 .   ? 5.224  -14.862 61.457  1.00 0.00   ? 884  HOH A H2   1 
HETATM 3996 O O    . HOH B 2 .   ? 10.456 -9.542  -1.886  1.00 35.09  ? 885  HOH A O    1 
HETATM 3997 H H1   . HOH B 2 .   ? 10.801 -8.657  -1.692  1.00 0.00   ? 885  HOH A H1   1 
HETATM 3998 H H2   . HOH B 2 .   ? 11.283 -10.024 -1.954  1.00 0.00   ? 885  HOH A H2   1 
HETATM 3999 O O    . HOH B 2 .   ? 2.904  -16.612 64.842  1.00 37.41  ? 886  HOH A O    1 
HETATM 4000 H H1   . HOH B 2 .   ? 3.713  -16.414 65.358  1.00 0.00   ? 886  HOH A H1   1 
HETATM 4001 H H2   . HOH B 2 .   ? 3.181  -16.304 63.978  1.00 0.00   ? 886  HOH A H2   1 
HETATM 4002 O O    . HOH B 2 .   ? 8.019  14.589  3.181   0.69 24.47  ? 887  HOH A O    1 
HETATM 4003 H H1   . HOH B 2 .   ? 7.177  14.624  3.653   1.00 0.00   ? 887  HOH A H1   1 
HETATM 4004 H H2   . HOH B 2 .   ? 7.855  13.946  2.483   1.00 0.00   ? 887  HOH A H2   1 
HETATM 4005 O O    . HOH B 2 .   ? 15.708 -13.571 76.728  0.80 22.29  ? 888  HOH A O    1 
HETATM 4006 H H1   . HOH B 2 .   ? 16.512 -13.067 76.464  1.00 0.00   ? 888  HOH A H1   1 
HETATM 4007 H H2   . HOH B 2 .   ? 15.268 -13.648 75.885  1.00 0.00   ? 888  HOH A H2   1 
HETATM 4008 O O    . HOH B 2 .   ? 28.717 -12.309 65.783  1.00 35.99  ? 889  HOH A O    1 
HETATM 4009 H H1   . HOH B 2 .   ? 28.840 -11.668 66.483  1.00 0.00   ? 889  HOH A H1   1 
HETATM 4010 H H2   . HOH B 2 .   ? 29.609 -12.665 65.734  1.00 0.00   ? 889  HOH A H2   1 
HETATM 4011 O O    . HOH B 2 .   ? 3.997  -17.328 14.736  1.00 48.69  ? 890  HOH A O    1 
HETATM 4012 H H1   . HOH B 2 .   ? 4.563  -17.572 15.476  1.00 0.00   ? 890  HOH A H1   1 
HETATM 4013 H H2   . HOH B 2 .   ? 4.489  -17.637 13.972  1.00 0.00   ? 890  HOH A H2   1 
HETATM 4014 O O    . HOH B 2 .   ? 18.086 0.369   -0.537  0.54 20.73  ? 891  HOH A O    1 
HETATM 4015 H H1   . HOH B 2 .   ? 18.136 0.046   0.366   1.00 0.00   ? 891  HOH A H1   1 
HETATM 4016 H H2   . HOH B 2 .   ? 17.803 1.279   -0.430  1.00 0.00   ? 891  HOH A H2   1 
HETATM 4017 O O    . HOH B 2 .   ? 15.329 2.897   13.627  0.41 20.72  ? 892  HOH A O    1 
HETATM 4018 H H1   . HOH B 2 .   ? 15.952 3.535   13.269  1.00 0.00   ? 892  HOH A H1   1 
HETATM 4019 H H2   . HOH B 2 .   ? 14.610 3.443   13.968  1.00 0.00   ? 892  HOH A H2   1 
HETATM 4020 O O    . HOH B 2 .   ? 7.876  25.306  -35.672 0.86 39.38  ? 893  HOH A O    1 
HETATM 4021 H H1   . HOH B 2 .   ? 8.315  26.085  -35.308 1.00 0.00   ? 893  HOH A H1   1 
HETATM 4022 H H2   . HOH B 2 .   ? 8.602  24.674  -35.738 1.00 0.00   ? 893  HOH A H2   1 
HETATM 4023 O O    . HOH B 2 .   ? 10.556 38.942  -30.908 0.34 2.00   ? 894  HOH A O    1 
HETATM 4024 H H1   . HOH B 2 .   ? 10.744 39.837  -31.262 1.00 0.00   ? 894  HOH A H1   1 
HETATM 4025 H H2   . HOH B 2 .   ? 9.878  39.128  -30.260 1.00 0.00   ? 894  HOH A H2   1 
HETATM 4026 O O    . HOH B 2 .   ? 15.595 12.458  -36.189 1.00 46.21  ? 895  HOH A O    1 
HETATM 4027 H H1   . HOH B 2 .   ? 15.154 12.607  -37.042 1.00 0.00   ? 895  HOH A H1   1 
HETATM 4028 H H2   . HOH B 2 .   ? 15.301 11.553  -36.017 1.00 0.00   ? 895  HOH A H2   1 
HETATM 4029 O O    . HOH B 2 .   ? 19.588 31.073  -38.682 0.90 28.02  ? 896  HOH A O    1 
HETATM 4030 H H1   . HOH B 2 .   ? 18.918 31.776  -38.459 1.00 0.00   ? 896  HOH A H1   1 
HETATM 4031 H H2   . HOH B 2 .   ? 19.083 30.284  -38.417 1.00 0.00   ? 896  HOH A H2   1 
HETATM 4032 O O    . HOH B 2 .   ? 24.757 20.103  -34.761 1.00 41.75  ? 897  HOH A O    1 
HETATM 4033 H H1   . HOH B 2 .   ? 25.118 20.532  -35.554 1.00 0.00   ? 897  HOH A H1   1 
HETATM 4034 H H2   . HOH B 2 .   ? 24.751 19.172  -35.016 1.00 0.00   ? 897  HOH A H2   1 
HETATM 4035 O O    . HOH B 2 .   ? 24.736 13.601  -27.116 0.69 26.37  ? 898  HOH A O    1 
HETATM 4036 H H1   . HOH B 2 .   ? 25.595 13.920  -27.428 1.00 0.00   ? 898  HOH A H1   1 
HETATM 4037 H H2   . HOH B 2 .   ? 24.401 13.114  -27.876 1.00 0.00   ? 898  HOH A H2   1 
HETATM 4038 O O    . HOH B 2 .   ? 6.337  -18.823 63.945  1.00 25.36  ? 899  HOH A O    1 
HETATM 4039 H H1   . HOH B 2 .   ? 6.580  -17.873 63.899  1.00 0.00   ? 899  HOH A H1   1 
HETATM 4040 H H2   . HOH B 2 .   ? 6.487  -19.114 63.044  1.00 0.00   ? 899  HOH A H2   1 
HETATM 4041 O O    . HOH B 2 .   ? 8.559  -24.389 56.626  0.29 2.00   ? 900  HOH A O    1 
HETATM 4042 H H1   . HOH B 2 .   ? 9.120  -24.459 57.418  1.00 0.00   ? 900  HOH A H1   1 
HETATM 4043 H H2   . HOH B 2 .   ? 9.168  -24.677 55.922  1.00 0.00   ? 900  HOH A H2   1 
HETATM 4044 O O    . HOH B 2 .   ? 7.946  -22.237 61.695  1.00 22.74  ? 901  HOH A O    1 
HETATM 4045 H H1   . HOH B 2 .   ? 8.148  -21.534 62.324  1.00 0.00   ? 901  HOH A H1   1 
HETATM 4046 H H2   . HOH B 2 .   ? 8.449  -21.966 60.898  1.00 0.00   ? 901  HOH A H2   1 
HETATM 4047 O O    . HOH B 2 .   ? 26.237 -18.569 64.001  1.00 33.02  ? 902  HOH A O    1 
HETATM 4048 H H1   . HOH B 2 .   ? 25.817 -18.449 63.132  1.00 0.00   ? 902  HOH A H1   1 
HETATM 4049 H H2   . HOH B 2 .   ? 26.684 -19.442 63.904  1.00 0.00   ? 902  HOH A H2   1 
HETATM 4050 O O    . HOH B 2 .   ? 26.579 -13.238 64.518  0.59 37.54  ? 903  HOH A O    1 
HETATM 4051 H H1   . HOH B 2 .   ? 27.363 -12.926 65.031  1.00 0.00   ? 903  HOH A H1   1 
HETATM 4052 H H2   . HOH B 2 .   ? 26.458 -14.134 64.855  1.00 0.00   ? 903  HOH A H2   1 
HETATM 4053 O O    . HOH B 2 .   ? 7.442  -21.780 57.521  0.33 2.18   ? 904  HOH A O    1 
HETATM 4054 H H1   . HOH B 2 .   ? 8.100  -21.860 58.231  1.00 0.00   ? 904  HOH A H1   1 
HETATM 4055 H H2   . HOH B 2 .   ? 7.589  -22.613 57.038  1.00 0.00   ? 904  HOH A H2   1 
HETATM 4056 O O    . HOH B 2 .   ? 8.149  -24.750 62.684  0.61 20.36  ? 905  HOH A O    1 
HETATM 4057 H H1   . HOH B 2 .   ? 7.962  -23.876 62.269  1.00 0.00   ? 905  HOH A H1   1 
HETATM 4058 H H2   . HOH B 2 .   ? 8.564  -25.222 61.948  1.00 0.00   ? 905  HOH A H2   1 
HETATM 4059 O O    . HOH B 2 .   ? 18.937 -3.396  22.454  1.00 28.35  ? 906  HOH A O    1 
HETATM 4060 H H1   . HOH B 2 .   ? 19.272 -2.742  21.824  1.00 0.00   ? 906  HOH A H1   1 
HETATM 4061 H H2   . HOH B 2 .   ? 17.982 -3.324  22.309  1.00 0.00   ? 906  HOH A H2   1 
HETATM 4062 O O    . HOH B 2 .   ? 20.377 -4.195  25.094  0.57 20.17  ? 907  HOH A O    1 
HETATM 4063 H H1   . HOH B 2 .   ? 20.408 -3.424  25.667  1.00 0.00   ? 907  HOH A H1   1 
HETATM 4064 H H2   . HOH B 2 .   ? 19.935 -3.864  24.295  1.00 0.00   ? 907  HOH A H2   1 
HETATM 4065 O O    . HOH B 2 .   ? 24.113 -15.322 31.179  0.76 33.62  ? 908  HOH A O    1 
HETATM 4066 H H1   . HOH B 2 .   ? 24.643 -15.719 31.875  1.00 0.00   ? 908  HOH A H1   1 
HETATM 4067 H H2   . HOH B 2 .   ? 24.221 -15.974 30.477  1.00 0.00   ? 908  HOH A H2   1 
HETATM 4068 O O    . HOH B 2 .   ? 13.620 -10.721 0.059   1.00 40.64  ? 909  HOH A O    1 
HETATM 4069 H H1   . HOH B 2 .   ? 13.532 -9.756  0.176   1.00 0.00   ? 909  HOH A H1   1 
HETATM 4070 H H2   . HOH B 2 .   ? 13.786 -10.730 -0.895  1.00 0.00   ? 909  HOH A H2   1 
HETATM 4071 O O    . HOH B 2 .   ? 1.087  16.299  -1.364  0.22 2.00   ? 910  HOH A O    1 
HETATM 4072 H H1   . HOH B 2 .   ? 0.742  16.619  -0.522  1.00 0.00   ? 910  HOH A H1   1 
HETATM 4073 H H2   . HOH B 2 .   ? 0.687  16.897  -2.003  1.00 0.00   ? 910  HOH A H2   1 
HETATM 4074 O O    . HOH B 2 .   ? 26.752 -4.452  7.365   0.35 10.69  ? 911  HOH A O    1 
HETATM 4075 H H1   . HOH B 2 .   ? 27.339 -3.767  7.027   1.00 0.00   ? 911  HOH A H1   1 
HETATM 4076 H H2   . HOH B 2 .   ? 26.117 -4.532  6.631   1.00 0.00   ? 911  HOH A H2   1 
HETATM 4077 O O    . HOH B 2 .   ? 25.220 -25.832 34.881  0.28 24.98  ? 912  HOH A O    1 
HETATM 4078 H H1   . HOH B 2 .   ? 25.027 -25.960 35.813  1.00 0.00   ? 912  HOH A H1   1 
HETATM 4079 H H2   . HOH B 2 .   ? 25.373 -26.726 34.566  1.00 0.00   ? 912  HOH A H2   1 
HETATM 4080 O O    . HOH B 2 .   ? 9.607  5.178   4.774   1.00 46.79  ? 913  HOH A O    1 
HETATM 4081 H H1   . HOH B 2 .   ? 9.768  6.081   4.472   1.00 0.00   ? 913  HOH A H1   1 
HETATM 4082 H H2   . HOH B 2 .   ? 8.789  4.946   4.270   1.00 0.00   ? 913  HOH A H2   1 
HETATM 4083 O O    . HOH B 2 .   ? 1.883  31.099  -37.649 0.77 33.01  ? 914  HOH A O    1 
HETATM 4084 H H1   . HOH B 2 .   ? 1.471  31.979  -37.689 1.00 0.00   ? 914  HOH A H1   1 
HETATM 4085 H H2   . HOH B 2 .   ? 1.529  30.677  -38.436 1.00 0.00   ? 914  HOH A H2   1 
HETATM 4086 O O    . HOH B 2 .   ? 15.055 3.701   1.798   0.51 7.16   ? 915  HOH A O    1 
HETATM 4087 H H1   . HOH B 2 .   ? 14.873 4.187   2.620   1.00 0.00   ? 915  HOH A H1   1 
HETATM 4088 H H2   . HOH B 2 .   ? 15.607 4.334   1.325   1.00 0.00   ? 915  HOH A H2   1 
HETATM 4089 O O    . HOH B 2 .   ? 19.824 -0.649  15.957  1.00 32.36  ? 916  HOH A O    1 
HETATM 4090 H H1   . HOH B 2 .   ? 20.059 0.011   16.618  1.00 0.00   ? 916  HOH A H1   1 
HETATM 4091 H H2   . HOH B 2 .   ? 18.980 -0.321  15.621  1.00 0.00   ? 916  HOH A H2   1 
HETATM 4092 O O    . HOH B 2 .   ? 22.938 -0.537  8.402   0.76 35.47  ? 917  HOH A O    1 
HETATM 4093 H H1   . HOH B 2 .   ? 22.535 -0.123  9.174   1.00 0.00   ? 917  HOH A H1   1 
HETATM 4094 H H2   . HOH B 2 .   ? 23.377 0.199   7.970   1.00 0.00   ? 917  HOH A H2   1 
HETATM 4095 O O    . HOH B 2 .   ? 3.735  25.842  -47.549 0.54 10.21  ? 918  HOH A O    1 
HETATM 4096 H H1   . HOH B 2 .   ? 3.216  26.500  -48.029 1.00 0.00   ? 918  HOH A H1   1 
HETATM 4097 H H2   . HOH B 2 .   ? 4.378  26.393  -47.084 1.00 0.00   ? 918  HOH A H2   1 
HETATM 4098 O O    . HOH B 2 .   ? 25.728 -23.930 61.293  0.95 31.14  ? 919  HOH A O    1 
HETATM 4099 H H1   . HOH B 2 .   ? 24.774 -23.856 61.425  1.00 0.00   ? 919  HOH A H1   1 
HETATM 4100 H H2   . HOH B 2 .   ? 25.824 -24.847 61.028  1.00 0.00   ? 919  HOH A H2   1 
HETATM 4101 O O    . HOH B 2 .   ? 4.568  0.732   9.689   0.82 37.63  ? 920  HOH A O    1 
HETATM 4102 H H1   . HOH B 2 .   ? 4.963  0.905   10.562  1.00 0.00   ? 920  HOH A H1   1 
HETATM 4103 H H2   . HOH B 2 .   ? 4.230  1.601   9.445   1.00 0.00   ? 920  HOH A H2   1 
HETATM 4104 O O    . HOH B 2 .   ? 15.617 -24.137 13.166  1.00 45.77  ? 921  HOH A O    1 
HETATM 4105 H H1   . HOH B 2 .   ? 15.615 -23.186 13.357  1.00 0.00   ? 921  HOH A H1   1 
HETATM 4106 H H2   . HOH B 2 .   ? 16.560 -24.318 13.100  1.00 0.00   ? 921  HOH A H2   1 
HETATM 4107 O O    . HOH B 2 .   ? 14.079 34.868  -49.364 1.00 43.42  ? 922  HOH A O    1 
HETATM 4108 H H1   . HOH B 2 .   ? 14.681 35.628  -49.355 1.00 0.00   ? 922  HOH A H1   1 
HETATM 4109 H H2   . HOH B 2 .   ? 13.218 35.259  -49.511 1.00 0.00   ? 922  HOH A H2   1 
HETATM 4110 O O    . HOH B 2 .   ? 12.818 3.144   -21.680 0.54 20.95  ? 923  HOH A O    1 
HETATM 4111 H H1   . HOH B 2 .   ? 13.688 3.278   -21.253 1.00 0.00   ? 923  HOH A H1   1 
HETATM 4112 H H2   . HOH B 2 .   ? 12.938 3.725   -22.448 1.00 0.00   ? 923  HOH A H2   1 
HETATM 4113 O O    . HOH B 2 .   ? 15.230 40.424  -30.739 1.00 48.15  ? 924  HOH A O    1 
HETATM 4114 H H1   . HOH B 2 .   ? 14.385 40.874  -30.875 1.00 0.00   ? 924  HOH A H1   1 
HETATM 4115 H H2   . HOH B 2 .   ? 15.798 40.842  -31.394 1.00 0.00   ? 924  HOH A H2   1 
HETATM 4116 O O    . HOH B 2 .   ? 32.135 31.206  -47.661 0.86 31.72  ? 925  HOH A O    1 
HETATM 4117 H H1   . HOH B 2 .   ? 31.647 32.026  -47.507 1.00 0.00   ? 925  HOH A H1   1 
HETATM 4118 H H2   . HOH B 2 .   ? 32.490 31.377  -48.545 1.00 0.00   ? 925  HOH A H2   1 
HETATM 4119 O O    . HOH B 2 .   ? 27.185 -27.895 56.697  1.00 40.54  ? 926  HOH A O    1 
HETATM 4120 H H1   . HOH B 2 .   ? 27.613 -27.358 57.371  1.00 0.00   ? 926  HOH A H1   1 
HETATM 4121 H H2   . HOH B 2 .   ? 27.240 -27.327 55.916  1.00 0.00   ? 926  HOH A H2   1 
HETATM 4122 O O    . HOH B 2 .   ? 21.677 27.257  -32.848 0.43 19.61  ? 927  HOH A O    1 
HETATM 4123 H H1   . HOH B 2 .   ? 21.515 28.078  -32.380 1.00 0.00   ? 927  HOH A H1   1 
HETATM 4124 H H2   . HOH B 2 .   ? 21.865 27.588  -33.741 1.00 0.00   ? 927  HOH A H2   1 
HETATM 4125 O O    . HOH B 2 .   ? 17.768 -4.270  -0.094  1.00 35.71  ? 928  HOH A O    1 
HETATM 4126 H H1   . HOH B 2 .   ? 18.609 -4.111  -0.523  1.00 0.00   ? 928  HOH A H1   1 
HETATM 4127 H H2   . HOH B 2 .   ? 17.545 -5.177  -0.393  1.00 0.00   ? 928  HOH A H2   1 
HETATM 4128 O O    . HOH B 2 .   ? 6.064  -2.965  20.783  0.31 6.13   ? 929  HOH A O    1 
HETATM 4129 H H1   . HOH B 2 .   ? 6.105  -2.854  21.735  1.00 0.00   ? 929  HOH A H1   1 
HETATM 4130 H H2   . HOH B 2 .   ? 5.983  -3.913  20.667  1.00 0.00   ? 929  HOH A H2   1 
HETATM 4131 O O    . HOH B 2 .   ? 35.802 32.191  -45.489 1.00 47.33  ? 930  HOH A O    1 
HETATM 4132 H H1   . HOH B 2 .   ? 36.296 31.366  -45.485 1.00 0.00   ? 930  HOH A H1   1 
HETATM 4133 H H2   . HOH B 2 .   ? 34.977 31.932  -45.056 1.00 0.00   ? 930  HOH A H2   1 
HETATM 4134 O O    . HOH B 2 .   ? 13.561 0.278   -10.946 1.00 31.53  ? 931  HOH A O    1 
HETATM 4135 H H1   . HOH B 2 .   ? 12.811 0.780   -10.616 1.00 0.00   ? 931  HOH A H1   1 
HETATM 4136 H H2   . HOH B 2 .   ? 13.301 0.076   -11.851 1.00 0.00   ? 931  HOH A H2   1 
HETATM 4137 O O    . HOH B 2 .   ? 14.705 27.928  -16.652 1.00 49.74  ? 932  HOH A O    1 
HETATM 4138 H H1   . HOH B 2 .   ? 15.242 28.317  -15.962 1.00 0.00   ? 932  HOH A H1   1 
HETATM 4139 H H2   . HOH B 2 .   ? 14.969 28.423  -17.441 1.00 0.00   ? 932  HOH A H2   1 
HETATM 4140 O O    . HOH B 2 .   ? 19.115 6.572   -25.186 0.72 34.73  ? 933  HOH A O    1 
HETATM 4141 H H1   . HOH B 2 .   ? 19.144 7.309   -24.560 1.00 0.00   ? 933  HOH A H1   1 
HETATM 4142 H H2   . HOH B 2 .   ? 19.955 6.746   -25.634 1.00 0.00   ? 933  HOH A H2   1 
HETATM 4143 O O    . HOH B 2 .   ? 22.693 20.208  -33.184 0.99 24.29  ? 934  HOH A O    1 
HETATM 4144 H H1   . HOH B 2 .   ? 22.124 20.979  -33.383 1.00 0.00   ? 934  HOH A H1   1 
HETATM 4145 H H2   . HOH B 2 .   ? 23.412 20.303  -33.840 1.00 0.00   ? 934  HOH A H2   1 
HETATM 4146 O O    . HOH B 2 .   ? 6.019  -8.551  56.235  0.88 32.32  ? 935  HOH A O    1 
HETATM 4147 H H1   . HOH B 2 .   ? 5.320  -7.886  56.149  1.00 0.00   ? 935  HOH A H1   1 
HETATM 4148 H H2   . HOH B 2 .   ? 5.910  -9.068  55.429  1.00 0.00   ? 935  HOH A H2   1 
HETATM 4149 O O    . HOH B 2 .   ? 14.384 -12.038 48.963  1.00 39.88  ? 936  HOH A O    1 
HETATM 4150 H H1   . HOH B 2 .   ? 14.189 -11.207 48.488  1.00 0.00   ? 936  HOH A H1   1 
HETATM 4151 H H2   . HOH B 2 .   ? 14.382 -12.658 48.229  1.00 0.00   ? 936  HOH A H2   1 
HETATM 4152 O O    . HOH B 2 .   ? 13.414 -8.449  67.067  1.00 51.50  ? 937  HOH A O    1 
HETATM 4153 H H1   . HOH B 2 .   ? 13.798 -7.533  67.080  1.00 0.00   ? 937  HOH A H1   1 
HETATM 4154 H H2   . HOH B 2 .   ? 12.502 -8.081  67.038  1.00 0.00   ? 937  HOH A H2   1 
HETATM 4155 O O    . HOH B 2 .   ? 28.505 -23.742 57.670  0.82 34.83  ? 938  HOH A O    1 
HETATM 4156 H H1   . HOH B 2 .   ? 29.292 -23.191 57.645  1.00 0.00   ? 938  HOH A H1   1 
HETATM 4157 H H2   . HOH B 2 .   ? 28.184 -23.702 56.753  1.00 0.00   ? 938  HOH A H2   1 
HETATM 4158 O O    . HOH B 2 .   ? 17.280 -7.625  62.154  0.24 2.23   ? 939  HOH A O    1 
HETATM 4159 H H1   . HOH B 2 .   ? 18.055 -7.072  62.299  1.00 0.00   ? 939  HOH A H1   1 
HETATM 4160 H H2   . HOH B 2 .   ? 17.668 -8.223  61.502  1.00 0.00   ? 939  HOH A H2   1 
HETATM 4161 O O    . HOH B 2 .   ? 22.180 28.516  -35.702 1.00 41.74  ? 940  HOH A O    1 
HETATM 4162 H H1   . HOH B 2 .   ? 21.782 29.243  -36.187 1.00 0.00   ? 940  HOH A H1   1 
HETATM 4163 H H2   . HOH B 2 .   ? 21.731 27.740  -36.056 1.00 0.00   ? 940  HOH A H2   1 
HETATM 4164 O O    . HOH B 2 .   ? 9.929  -30.963 58.259  1.00 50.53  ? 941  HOH A O    1 
HETATM 4165 H H1   . HOH B 2 .   ? 9.780  -30.016 58.115  1.00 0.00   ? 941  HOH A H1   1 
HETATM 4166 H H2   . HOH B 2 .   ? 10.871 -31.038 58.038  1.00 0.00   ? 941  HOH A H2   1 
HETATM 4167 O O    . HOH B 2 .   ? 12.276 -32.359 62.815  0.53 37.61  ? 942  HOH A O    1 
HETATM 4168 H H1   . HOH B 2 .   ? 12.011 -31.513 63.169  1.00 0.00   ? 942  HOH A H1   1 
HETATM 4169 H H2   . HOH B 2 .   ? 11.835 -32.298 61.943  1.00 0.00   ? 942  HOH A H2   1 
HETATM 4170 O O    . HOH B 2 .   ? 17.459 -28.249 51.539  0.93 43.82  ? 943  HOH A O    1 
HETATM 4171 H H1   . HOH B 2 .   ? 16.711 -27.892 52.028  1.00 0.00   ? 943  HOH A H1   1 
HETATM 4172 H H2   . HOH B 2 .   ? 18.180 -27.705 51.865  1.00 0.00   ? 943  HOH A H2   1 
HETATM 4173 O O    . HOH B 2 .   ? 19.117 -25.900 70.955  0.72 28.54  ? 944  HOH A O    1 
HETATM 4174 H H1   . HOH B 2 .   ? 19.996 -25.948 71.354  1.00 0.00   ? 944  HOH A H1   1 
HETATM 4175 H H2   . HOH B 2 .   ? 19.282 -26.104 70.022  1.00 0.00   ? 944  HOH A H2   1 
HETATM 4176 O O    . HOH B 2 .   ? 23.111 -23.861 71.210  0.94 45.81  ? 945  HOH A O    1 
HETATM 4177 H H1   . HOH B 2 .   ? 23.774 -23.592 70.553  1.00 0.00   ? 945  HOH A H1   1 
HETATM 4178 H H2   . HOH B 2 .   ? 22.316 -23.408 70.928  1.00 0.00   ? 945  HOH A H2   1 
HETATM 4179 O O    . HOH B 2 .   ? 26.052 -25.112 72.097  0.76 39.26  ? 946  HOH A O    1 
HETATM 4180 H H1   . HOH B 2 .   ? 26.374 -24.890 71.218  1.00 0.00   ? 946  HOH A H1   1 
HETATM 4181 H H2   . HOH B 2 .   ? 25.817 -24.244 72.437  1.00 0.00   ? 946  HOH A H2   1 
HETATM 4182 O O    . HOH B 2 .   ? 8.892  -19.524 28.922  0.57 35.92  ? 947  HOH A O    1 
HETATM 4183 H H1   . HOH B 2 .   ? 9.334  -18.706 28.661  1.00 0.00   ? 947  HOH A H1   1 
HETATM 4184 H H2   . HOH B 2 .   ? 8.018  -19.378 28.557  1.00 0.00   ? 947  HOH A H2   1 
HETATM 4185 O O    . HOH B 2 .   ? 13.919 3.818   8.089   0.76 32.75  ? 948  HOH A O    1 
HETATM 4186 H H1   . HOH B 2 .   ? 14.501 3.561   7.329   1.00 0.00   ? 948  HOH A H1   1 
HETATM 4187 H H2   . HOH B 2 .   ? 14.260 3.144   8.704   1.00 0.00   ? 948  HOH A H2   1 
HETATM 4188 O O    . HOH B 2 .   ? 10.170 -37.992 41.767  1.00 54.83  ? 949  HOH A O    1 
HETATM 4189 H H1   . HOH B 2 .   ? 11.012 -37.522 41.858  1.00 0.00   ? 949  HOH A H1   1 
HETATM 4190 H H2   . HOH B 2 .   ? 9.558  -37.415 42.249  1.00 0.00   ? 949  HOH A H2   1 
HETATM 4191 O O    . HOH B 2 .   ? 25.934 -6.089  9.373   0.48 13.34  ? 950  HOH A O    1 
HETATM 4192 H H1   . HOH B 2 .   ? 26.320 -5.432  8.728   1.00 0.00   ? 950  HOH A H1   1 
HETATM 4193 H H2   . HOH B 2 .   ? 25.084 -5.655  9.519   1.00 0.00   ? 950  HOH A H2   1 
HETATM 4194 O O    . HOH B 2 .   ? 22.334 -12.680 31.403  0.92 41.12  ? 951  HOH A O    1 
HETATM 4195 H H1   . HOH B 2 .   ? 22.855 -13.499 31.403  1.00 0.00   ? 951  HOH A H1   1 
HETATM 4196 H H2   . HOH B 2 .   ? 22.309 -12.409 32.328  1.00 0.00   ? 951  HOH A H2   1 
HETATM 4197 O O    . HOH B 2 .   ? 23.679 -26.498 29.810  0.63 33.06  ? 952  HOH A O    1 
HETATM 4198 H H1   . HOH B 2 .   ? 23.077 -26.282 29.092  1.00 0.00   ? 952  HOH A H1   1 
HETATM 4199 H H2   . HOH B 2 .   ? 24.530 -26.190 29.470  1.00 0.00   ? 952  HOH A H2   1 
HETATM 4200 O O    . HOH B 2 .   ? -0.539 5.632   -14.553 0.78 35.23  ? 953  HOH A O    1 
HETATM 4201 H H1   . HOH B 2 .   ? -1.260 5.327   -13.996 1.00 0.00   ? 953  HOH A H1   1 
HETATM 4202 H H2   . HOH B 2 .   ? 0.259  5.355   -14.068 1.00 0.00   ? 953  HOH A H2   1 
HETATM 4203 O O    . HOH B 2 .   ? 3.040  14.566  -2.299  0.44 39.04  ? 954  HOH A O    1 
HETATM 4204 H H1   . HOH B 2 .   ? 3.903  14.781  -1.909  1.00 0.00   ? 954  HOH A H1   1 
HETATM 4205 H H2   . HOH B 2 .   ? 2.456  15.264  -1.924  1.00 0.00   ? 954  HOH A H2   1 
HETATM 4206 O O    . HOH B 2 .   ? 4.355  3.876   5.690   0.49 44.13  ? 955  HOH A O    1 
HETATM 4207 H H1   . HOH B 2 .   ? 5.265  3.579   5.799   1.00 0.00   ? 955  HOH A H1   1 
HETATM 4208 H H2   . HOH B 2 .   ? 4.334  4.678   6.218   1.00 0.00   ? 955  HOH A H2   1 
HETATM 4209 O O    . HOH B 2 .   ? 6.895  11.674  5.824   0.66 31.66  ? 956  HOH A O    1 
HETATM 4210 H H1   . HOH B 2 .   ? 7.378  12.498  6.032   1.00 0.00   ? 956  HOH A H1   1 
HETATM 4211 H H2   . HOH B 2 .   ? 7.575  11.124  5.424   1.00 0.00   ? 956  HOH A H2   1 
HETATM 4212 O O    . HOH B 2 .   ? 15.021 20.491  -14.954 0.91 25.06  ? 957  HOH A O    1 
HETATM 4213 H H1   . HOH B 2 .   ? 14.476 20.906  -15.629 1.00 0.00   ? 957  HOH A H1   1 
HETATM 4214 H H2   . HOH B 2 .   ? 14.379 20.059  -14.371 1.00 0.00   ? 957  HOH A H2   1 
HETATM 4215 O O    . HOH B 2 .   ? 16.014 22.858  -16.639 0.49 28.44  ? 958  HOH A O    1 
HETATM 4216 H H1   . HOH B 2 .   ? 15.953 23.236  -15.760 1.00 0.00   ? 958  HOH A H1   1 
HETATM 4217 H H2   . HOH B 2 .   ? 15.256 23.299  -17.087 1.00 0.00   ? 958  HOH A H2   1 
HETATM 4218 O O    . HOH B 2 .   ? 20.979 22.635  -10.346 0.80 34.13  ? 959  HOH A O    1 
HETATM 4219 H H1   . HOH B 2 .   ? 20.993 23.591  -10.178 1.00 0.00   ? 959  HOH A H1   1 
HETATM 4220 H H2   . HOH B 2 .   ? 21.494 22.573  -11.167 1.00 0.00   ? 959  HOH A H2   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   PRO 1   1142 1142 PRO PRO A . n 
A 1 2   LEU 2   1143 1143 LEU LEU A . n 
A 1 3   SER 3   1144 1144 SER SER A . n 
A 1 4   PRO 4   1145 1145 PRO PRO A . n 
A 1 5   PRO 5   1146 1146 PRO PRO A . n 
A 1 6   THR 6   1147 1147 THR THR A . n 
A 1 7   ASN 7   1148 1148 ASN ASN A . n 
A 1 8   LEU 8   1149 1149 LEU LEU A . n 
A 1 9   HIS 9   1150 1150 HIS HIS A . n 
A 1 10  LEU 10  1151 1151 LEU LEU A . n 
A 1 11  GLU 11  1152 1152 GLU GLU A . n 
A 1 12  ALA 12  1153 1153 ALA ALA A . n 
A 1 13  ASN 13  1154 1154 ASN ASN A . n 
A 1 14  PRO 14  1155 1155 PRO PRO A . n 
A 1 15  ASP 15  1156 1156 ASP ASP A . n 
A 1 16  THR 16  1157 1157 THR THR A . n 
A 1 17  GLY 17  1158 1158 GLY GLY A . n 
A 1 18  VAL 18  1159 1159 VAL VAL A . n 
A 1 19  LEU 19  1160 1160 LEU LEU A . n 
A 1 20  THR 20  1161 1161 THR THR A . n 
A 1 21  VAL 21  1162 1162 VAL VAL A . n 
A 1 22  SER 22  1163 1163 SER SER A . n 
A 1 23  TRP 23  1164 1164 TRP TRP A . n 
A 1 24  GLU 24  1165 1165 GLU GLU A . n 
A 1 25  ARG 25  1166 1166 ARG ARG A . n 
A 1 26  SER 26  1167 1167 SER SER A . n 
A 1 27  THR 27  1168 1168 THR THR A . n 
A 1 28  THR 28  1169 1169 THR THR A . n 
A 1 29  PRO 29  1170 1170 PRO PRO A . n 
A 1 30  ASP 30  1171 1171 ASP ASP A . n 
A 1 31  ILE 31  1172 1172 ILE ILE A . n 
A 1 32  THR 32  1173 1173 THR THR A . n 
A 1 33  GLY 33  1174 1174 GLY GLY A . n 
A 1 34  TYR 34  1175 1175 TYR TYR A . n 
A 1 35  ARG 35  1176 1176 ARG ARG A . n 
A 1 36  ILE 36  1177 1177 ILE ILE A . n 
A 1 37  THR 37  1178 1178 THR THR A . n 
A 1 38  THR 38  1179 1179 THR THR A . n 
A 1 39  THR 39  1180 1180 THR THR A . n 
A 1 40  PRO 40  1181 1181 PRO PRO A . n 
A 1 41  THR 41  1182 1182 THR THR A . n 
A 1 42  ASN 42  1183 1183 ASN ASN A . n 
A 1 43  GLY 43  1184 1184 GLY GLY A . n 
A 1 44  GLN 44  1185 1185 GLN GLN A . n 
A 1 45  GLN 45  1186 1186 GLN GLN A . n 
A 1 46  GLY 46  1187 1187 GLY GLY A . n 
A 1 47  ASN 47  1188 1188 ASN ASN A . n 
A 1 48  SER 48  1189 1189 SER SER A . n 
A 1 49  LEU 49  1190 1190 LEU LEU A . n 
A 1 50  GLU 50  1191 1191 GLU GLU A . n 
A 1 51  GLU 51  1192 1192 GLU GLU A . n 
A 1 52  VAL 52  1193 1193 VAL VAL A . n 
A 1 53  VAL 53  1194 1194 VAL VAL A . n 
A 1 54  HIS 54  1195 1195 HIS HIS A . n 
A 1 55  ALA 55  1196 1196 ALA ALA A . n 
A 1 56  ASP 56  1197 1197 ASP ASP A . n 
A 1 57  GLN 57  1198 1198 GLN GLN A . n 
A 1 58  SER 58  1199 1199 SER SER A . n 
A 1 59  SER 59  1200 1200 SER SER A . n 
A 1 60  CYS 60  1201 1201 CYS CYS A . n 
A 1 61  THR 61  1202 1202 THR THR A . n 
A 1 62  PHE 62  1203 1203 PHE PHE A . n 
A 1 63  ASP 63  1204 1204 ASP ASP A . n 
A 1 64  ASN 64  1205 1205 ASN ASN A . n 
A 1 65  LEU 65  1206 1206 LEU LEU A . n 
A 1 66  SER 66  1207 1207 SER SER A . n 
A 1 67  PRO 67  1208 1208 PRO PRO A . n 
A 1 68  GLY 68  1209 1209 GLY GLY A . n 
A 1 69  LEU 69  1210 1210 LEU LEU A . n 
A 1 70  GLU 70  1211 1211 GLU GLU A . n 
A 1 71  TYR 71  1212 1212 TYR TYR A . n 
A 1 72  ASN 72  1213 1213 ASN ASN A . n 
A 1 73  VAL 73  1214 1214 VAL VAL A . n 
A 1 74  SER 74  1215 1215 SER SER A . n 
A 1 75  VAL 75  1216 1216 VAL VAL A . n 
A 1 76  TYR 76  1217 1217 TYR TYR A . n 
A 1 77  THR 77  1218 1218 THR THR A . n 
A 1 78  VAL 78  1219 1219 VAL VAL A . n 
A 1 79  LYS 79  1220 1220 LYS LYS A . n 
A 1 80  ASP 80  1221 1221 ASP ASP A . n 
A 1 81  ASP 81  1222 1222 ASP ASP A . n 
A 1 82  LYS 82  1223 1223 LYS LYS A . n 
A 1 83  GLU 83  1224 1224 GLU GLU A . n 
A 1 84  SER 84  1225 1225 SER SER A . n 
A 1 85  VAL 85  1226 1226 VAL VAL A . n 
A 1 86  PRO 86  1227 1227 PRO PRO A . n 
A 1 87  ILE 87  1228 1228 ILE ILE A . n 
A 1 88  SER 88  1229 1229 SER SER A . n 
A 1 89  ASP 89  1230 1230 ASP ASP A . n 
A 1 90  THR 90  1231 1231 THR THR A . n 
A 1 91  ILE 91  1232 1232 ILE ILE A . n 
A 1 92  ILE 92  1233 1233 ILE ILE A . n 
A 1 93  PRO 93  1234 1234 PRO PRO A . n 
A 1 94  ALA 94  1235 1235 ALA ALA A . n 
A 1 95  VAL 95  1236 1236 VAL VAL A . n 
A 1 96  PRO 96  1237 1237 PRO PRO A . n 
A 1 97  PRO 97  1238 1238 PRO PRO A . n 
A 1 98  PRO 98  1239 1239 PRO PRO A . n 
A 1 99  THR 99  1240 1240 THR THR A . n 
A 1 100 ASP 100 1241 1241 ASP ASP A . n 
A 1 101 LEU 101 1242 1242 LEU LEU A . n 
A 1 102 ARG 102 1243 1243 ARG ARG A . n 
A 1 103 PHE 103 1244 1244 PHE PHE A . n 
A 1 104 THR 104 1245 1245 THR THR A . n 
A 1 105 ASN 105 1246 1246 ASN ASN A . n 
A 1 106 ILE 106 1247 1247 ILE ILE A . n 
A 1 107 GLY 107 1248 1248 GLY GLY A . n 
A 1 108 PRO 108 1249 1249 PRO PRO A . n 
A 1 109 ASP 109 1250 1250 ASP ASP A . n 
A 1 110 THR 110 1251 1251 THR THR A . n 
A 1 111 MET 111 1252 1252 MET MET A . n 
A 1 112 ARG 112 1253 1253 ARG ARG A . n 
A 1 113 VAL 113 1254 1254 VAL VAL A . n 
A 1 114 THR 114 1255 1255 THR THR A . n 
A 1 115 TRP 115 1256 1256 TRP TRP A . n 
A 1 116 ALA 116 1257 1257 ALA ALA A . n 
A 1 117 PRO 117 1258 1258 PRO PRO A . n 
A 1 118 PRO 118 1259 1259 PRO PRO A . n 
A 1 119 PRO 119 1260 1260 PRO PRO A . n 
A 1 120 SER 120 1261 1261 SER SER A . n 
A 1 121 ILE 121 1262 1262 ILE ILE A . n 
A 1 122 ASP 122 1263 1263 ASP ASP A . n 
A 1 123 LEU 123 1264 1264 LEU LEU A . n 
A 1 124 THR 124 1265 1265 THR THR A . n 
A 1 125 ASN 125 1266 1266 ASN ASN A . n 
A 1 126 PHE 126 1267 1267 PHE PHE A . n 
A 1 127 LEU 127 1268 1268 LEU LEU A . n 
A 1 128 VAL 128 1269 1269 VAL VAL A . n 
A 1 129 ARG 129 1270 1270 ARG ARG A . n 
A 1 130 TYR 130 1271 1271 TYR TYR A . n 
A 1 131 SER 131 1272 1272 SER SER A . n 
A 1 132 PRO 132 1273 1273 PRO PRO A . n 
A 1 133 VAL 133 1274 1274 VAL VAL A . n 
A 1 134 LYS 134 1275 1275 LYS LYS A . n 
A 1 135 ASN 135 1276 1276 ASN ASN A . n 
A 1 136 GLU 136 1277 1277 GLU GLU A . n 
A 1 137 GLU 137 1278 1278 GLU GLU A . n 
A 1 138 ASP 138 1279 1279 ASP ASP A . n 
A 1 139 VAL 139 1280 1280 VAL VAL A . n 
A 1 140 ALA 140 1281 1281 ALA ALA A . n 
A 1 141 GLU 141 1282 1282 GLU GLU A . n 
A 1 142 LEU 142 1283 1283 LEU LEU A . n 
A 1 143 SER 143 1284 1284 SER SER A . n 
A 1 144 ILE 144 1285 1285 ILE ILE A . n 
A 1 145 SER 145 1286 1286 SER SER A . n 
A 1 146 PRO 146 1287 1287 PRO PRO A . n 
A 1 147 SER 147 1288 1288 SER SER A . n 
A 1 148 ASP 148 1289 1289 ASP ASP A . n 
A 1 149 ASN 149 1290 1290 ASN ASN A . n 
A 1 150 ALA 150 1291 1291 ALA ALA A . n 
A 1 151 VAL 151 1292 1292 VAL VAL A . n 
A 1 152 VAL 152 1293 1293 VAL VAL A . n 
A 1 153 LEU 153 1294 1294 LEU LEU A . n 
A 1 154 THR 154 1295 1295 THR THR A . n 
A 1 155 ASN 155 1296 1296 ASN ASN A . n 
A 1 156 LEU 156 1297 1297 LEU LEU A . n 
A 1 157 LEU 157 1298 1298 LEU LEU A . n 
A 1 158 PRO 158 1299 1299 PRO PRO A . n 
A 1 159 GLY 159 1300 1300 GLY GLY A . n 
A 1 160 THR 160 1301 1301 THR THR A . n 
A 1 161 GLU 161 1302 1302 GLU GLU A . n 
A 1 162 TYR 162 1303 1303 TYR TYR A . n 
A 1 163 VAL 163 1304 1304 VAL VAL A . n 
A 1 164 VAL 164 1305 1305 VAL VAL A . n 
A 1 165 SER 165 1306 1306 SER SER A . n 
A 1 166 VAL 166 1307 1307 VAL VAL A . n 
A 1 167 SER 167 1308 1308 SER SER A . n 
A 1 168 SER 168 1309 1309 SER SER A . n 
A 1 169 VAL 169 1310 1310 VAL VAL A . n 
A 1 170 TYR 170 1311 1311 TYR TYR A . n 
A 1 171 GLU 171 1312 1312 GLU GLU A . n 
A 1 172 GLN 172 1313 1313 GLN GLN A . n 
A 1 173 HIS 173 1314 1314 HIS HIS A . n 
A 1 174 GLU 174 1315 1315 GLU GLU A . n 
A 1 175 SER 175 1316 1316 SER SER A . n 
A 1 176 THR 176 1317 1317 THR THR A . n 
A 1 177 PRO 177 1318 1318 PRO PRO A . n 
A 1 178 LEU 178 1319 1319 LEU LEU A . n 
A 1 179 ARG 179 1320 1320 ARG ARG A . n 
A 1 180 GLY 180 1321 1321 GLY GLY A . n 
A 1 181 ARG 181 1322 1322 ARG ARG A . n 
A 1 182 GLN 182 1323 1323 GLN GLN A . n 
A 1 183 LYS 183 1324 1324 LYS LYS A . n 
A 1 184 THR 184 1325 1325 THR THR A . n 
A 1 185 GLY 185 1326 1326 GLY GLY A . n 
A 1 186 LEU 186 1327 1327 LEU LEU A . n 
A 1 187 ASP 187 1328 1328 ASP ASP A . n 
A 1 188 SER 188 1329 1329 SER SER A . n 
A 1 189 PRO 189 1330 1330 PRO PRO A . n 
A 1 190 THR 190 1331 1331 THR THR A . n 
A 1 191 GLY 191 1332 1332 GLY GLY A . n 
A 1 192 ILE 192 1333 1333 ILE ILE A . n 
A 1 193 ASP 193 1334 1334 ASP ASP A . n 
A 1 194 PHE 194 1335 1335 PHE PHE A . n 
A 1 195 SER 195 1336 1336 SER SER A . n 
A 1 196 ASP 196 1337 1337 ASP ASP A . n 
A 1 197 ILE 197 1338 1338 ILE ILE A . n 
A 1 198 THR 198 1339 1339 THR THR A . n 
A 1 199 ALA 199 1340 1340 ALA ALA A . n 
A 1 200 ASN 200 1341 1341 ASN ASN A . n 
A 1 201 SER 201 1342 1342 SER SER A . n 
A 1 202 PHE 202 1343 1343 PHE PHE A . n 
A 1 203 THR 203 1344 1344 THR THR A . n 
A 1 204 VAL 204 1345 1345 VAL VAL A . n 
A 1 205 HIS 205 1346 1346 HIS HIS A . n 
A 1 206 TRP 206 1347 1347 TRP TRP A . n 
A 1 207 ILE 207 1348 1348 ILE ILE A . n 
A 1 208 ALA 208 1349 1349 ALA ALA A . n 
A 1 209 PRO 209 1350 1350 PRO PRO A . n 
A 1 210 ARG 210 1351 1351 ARG ARG A . n 
A 1 211 ALA 211 1352 1352 ALA ALA A . n 
A 1 212 THR 212 1353 1353 THR THR A . n 
A 1 213 ILE 213 1354 1354 ILE ILE A . n 
A 1 214 THR 214 1355 1355 THR THR A . n 
A 1 215 GLY 215 1356 1356 GLY GLY A . n 
A 1 216 TYR 216 1357 1357 TYR TYR A . n 
A 1 217 ARG 217 1358 1358 ARG ARG A . n 
A 1 218 ILE 218 1359 1359 ILE ILE A . n 
A 1 219 ARG 219 1360 1360 ARG ARG A . n 
A 1 220 HIS 220 1361 1361 HIS HIS A . n 
A 1 221 HIS 221 1362 1362 HIS HIS A . n 
A 1 222 PRO 222 1363 1363 PRO PRO A . n 
A 1 223 GLU 223 1364 1364 GLU GLU A . n 
A 1 224 HIS 224 1365 1365 HIS HIS A . n 
A 1 225 PHE 225 1366 1366 PHE PHE A . n 
A 1 226 SER 226 1367 1367 SER SER A . n 
A 1 227 GLY 227 1368 1368 GLY GLY A . n 
A 1 228 ARG 228 1369 1369 ARG ARG A . n 
A 1 229 PRO 229 1370 1370 PRO PRO A . n 
A 1 230 ARG 230 1371 1371 ARG ARG A . n 
A 1 231 GLU 231 1372 1372 GLU GLU A . n 
A 1 232 ASP 232 1373 1373 ASP ASP A . n 
A 1 233 ARG 233 1374 1374 ARG ARG A . n 
A 1 234 VAL 234 1375 1375 VAL VAL A . n 
A 1 235 PRO 235 1376 1376 PRO PRO A . n 
A 1 236 HIS 236 1377 1377 HIS HIS A . n 
A 1 237 SER 237 1378 1378 SER SER A . n 
A 1 238 ARG 238 1379 1379 ARG ARG A . n 
A 1 239 ASN 239 1380 1380 ASN ASN A . n 
A 1 240 SER 240 1381 1381 SER SER A . n 
A 1 241 ILE 241 1382 1382 ILE ILE A . n 
A 1 242 THR 242 1383 1383 THR THR A . n 
A 1 243 LEU 243 1384 1384 LEU LEU A . n 
A 1 244 THR 244 1385 1385 THR THR A . n 
A 1 245 ASN 245 1386 1386 ASN ASN A . n 
A 1 246 LEU 246 1387 1387 LEU LEU A . n 
A 1 247 THR 247 1388 1388 THR THR A . n 
A 1 248 PRO 248 1389 1389 PRO PRO A . n 
A 1 249 GLY 249 1390 1390 GLY GLY A . n 
A 1 250 THR 250 1391 1391 THR THR A . n 
A 1 251 GLU 251 1392 1392 GLU GLU A . n 
A 1 252 TYR 252 1393 1393 TYR TYR A . n 
A 1 253 VAL 253 1394 1394 VAL VAL A . n 
A 1 254 VAL 254 1395 1395 VAL VAL A . n 
A 1 255 SER 255 1396 1396 SER SER A . n 
A 1 256 ILE 256 1397 1397 ILE ILE A . n 
A 1 257 VAL 257 1398 1398 VAL VAL A . n 
A 1 258 ALA 258 1399 1399 ALA ALA A . n 
A 1 259 LEU 259 1400 1400 LEU LEU A . n 
A 1 260 ASN 260 1401 1401 ASN ASN A . n 
A 1 261 GLY 261 1402 1402 GLY GLY A . n 
A 1 262 ARG 262 1403 1403 ARG ARG A . n 
A 1 263 GLU 263 1404 1404 GLU GLU A . n 
A 1 264 GLU 264 1405 1405 GLU GLU A . n 
A 1 265 SER 265 1406 1406 SER SER A . n 
A 1 266 PRO 266 1407 1407 PRO PRO A . n 
A 1 267 LEU 267 1408 1408 LEU LEU A . n 
A 1 268 LEU 268 1409 1409 LEU LEU A . n 
A 1 269 ILE 269 1410 1410 ILE ILE A . n 
A 1 270 GLY 270 1411 1411 GLY GLY A . n 
A 1 271 GLN 271 1412 1412 GLN GLN A . n 
A 1 272 GLN 272 1413 1413 GLN GLN A . n 
A 1 273 SER 273 1414 1414 SER SER A . n 
A 1 274 THR 274 1415 1415 THR THR A . n 
A 1 275 VAL 275 1416 1416 VAL VAL A . n 
A 1 276 SER 276 1417 1417 SER SER A . n 
A 1 277 ASP 277 1418 1418 ASP ASP A . n 
A 1 278 VAL 278 1419 1419 VAL VAL A . n 
A 1 279 PRO 279 1420 1420 PRO PRO A . n 
A 1 280 ARG 280 1421 1421 ARG ARG A . n 
A 1 281 ASP 281 1422 1422 ASP ASP A . n 
A 1 282 LEU 282 1423 1423 LEU LEU A . n 
A 1 283 GLU 283 1424 1424 GLU GLU A . n 
A 1 284 VAL 284 1425 1425 VAL VAL A . n 
A 1 285 VAL 285 1426 1426 VAL VAL A . n 
A 1 286 ALA 286 1427 1427 ALA ALA A . n 
A 1 287 ALA 287 1428 1428 ALA ALA A . n 
A 1 288 THR 288 1429 1429 THR THR A . n 
A 1 289 PRO 289 1430 1430 PRO PRO A . n 
A 1 290 THR 290 1431 1431 THR THR A . n 
A 1 291 SER 291 1432 1432 SER SER A . n 
A 1 292 LEU 292 1433 1433 LEU LEU A . n 
A 1 293 LEU 293 1434 1434 LEU LEU A . n 
A 1 294 ILE 294 1435 1435 ILE ILE A . n 
A 1 295 SER 295 1436 1436 SER SER A . n 
A 1 296 TRP 296 1437 1437 TRP TRP A . n 
A 1 297 ASP 297 1438 1438 ASP ASP A . n 
A 1 298 ALA 298 1439 1439 ALA ALA A . n 
A 1 299 PRO 299 1440 1440 PRO PRO A . n 
A 1 300 ALA 300 1441 1441 ALA ALA A . n 
A 1 301 VAL 301 1442 1442 VAL VAL A . n 
A 1 302 THR 302 1443 1443 THR THR A . n 
A 1 303 VAL 303 1444 1444 VAL VAL A . n 
A 1 304 ARG 304 1445 1445 ARG ARG A . n 
A 1 305 TYR 305 1446 1446 TYR TYR A . n 
A 1 306 TYR 306 1447 1447 TYR TYR A . n 
A 1 307 ARG 307 1448 1448 ARG ARG A . n 
A 1 308 ILE 308 1449 1449 ILE ILE A . n 
A 1 309 THR 309 1450 1450 THR THR A . n 
A 1 310 TYR 310 1451 1451 TYR TYR A . n 
A 1 311 GLY 311 1452 1452 GLY GLY A . n 
A 1 312 GLU 312 1453 1453 GLU GLU A . n 
A 1 313 THR 313 1454 1454 THR THR A . n 
A 1 314 GLY 314 1455 1455 GLY GLY A . n 
A 1 315 GLY 315 1456 1456 GLY GLY A . n 
A 1 316 ASN 316 1457 1457 ASN ASN A . n 
A 1 317 SER 317 1458 1458 SER SER A . n 
A 1 318 PRO 318 1459 1459 PRO PRO A . n 
A 1 319 VAL 319 1460 1460 VAL VAL A . n 
A 1 320 GLN 320 1461 1461 GLN GLN A . n 
A 1 321 GLU 321 1462 1462 GLU GLU A . n 
A 1 322 PHE 322 1463 1463 PHE PHE A . n 
A 1 323 THR 323 1464 1464 THR THR A . n 
A 1 324 VAL 324 1465 1465 VAL VAL A . n 
A 1 325 PRO 325 1466 1466 PRO PRO A . n 
A 1 326 GLY 326 1467 1467 GLY GLY A . n 
A 1 327 SER 327 1468 1468 SER SER A . n 
A 1 328 LYS 328 1469 1469 LYS LYS A . n 
A 1 329 SER 329 1470 1470 SER SER A . n 
A 1 330 THR 330 1471 1471 THR THR A . n 
A 1 331 ALA 331 1472 1472 ALA ALA A . n 
A 1 332 THR 332 1473 1473 THR THR A . n 
A 1 333 ILE 333 1474 1474 ILE ILE A . n 
A 1 334 SER 334 1475 1475 SER SER A . n 
A 1 335 GLY 335 1476 1476 GLY GLY A . n 
A 1 336 LEU 336 1477 1477 LEU LEU A . n 
A 1 337 LYS 337 1478 1478 LYS LYS A . n 
A 1 338 PRO 338 1479 1479 PRO PRO A . n 
A 1 339 GLY 339 1480 1480 GLY GLY A . n 
A 1 340 VAL 340 1481 1481 VAL VAL A . n 
A 1 341 ASP 341 1482 1482 ASP ASP A . n 
A 1 342 TYR 342 1483 1483 TYR TYR A . n 
A 1 343 THR 343 1484 1484 THR THR A . n 
A 1 344 ILE 344 1485 1485 ILE ILE A . n 
A 1 345 THR 345 1486 1486 THR THR A . n 
A 1 346 VAL 346 1487 1487 VAL VAL A . n 
A 1 347 TYR 347 1488 1488 TYR TYR A . n 
A 1 348 ALA 348 1489 1489 ALA ALA A . n 
A 1 349 VAL 349 1490 1490 VAL VAL A . n 
A 1 350 THR 350 1491 1491 THR THR A . n 
A 1 351 GLY 351 1492 1492 GLY GLY A . n 
A 1 352 ARG 352 1493 1493 ARG ARG A . n 
A 1 353 GLY 353 1494 1494 GLY GLY A . n 
A 1 354 ASP 354 1495 1495 ASP ASP A . n 
A 1 355 SER 355 1496 1496 SER SER A . n 
A 1 356 PRO 356 1497 1497 PRO PRO A . n 
A 1 357 ALA 357 1498 1498 ALA ALA A . n 
A 1 358 SER 358 1499 1499 SER SER A . n 
A 1 359 SER 359 1500 1500 SER SER A . n 
A 1 360 LYS 360 1501 1501 LYS LYS A . n 
A 1 361 PRO 361 1502 1502 PRO PRO A . n 
A 1 362 ILE 362 1503 1503 ILE ILE A . n 
A 1 363 SER 363 1504 1504 SER SER A . n 
A 1 364 ILE 364 1505 1505 ILE ILE A . n 
A 1 365 ASN 365 1506 1506 ASN ASN A . n 
A 1 366 TYR 366 1507 1507 TYR TYR A . n 
A 1 367 ARG 367 1508 1508 ARG ARG A . n 
A 1 368 THR 368 1509 1509 THR THR A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   701 701 HOH HOH A . 
B 2 HOH 2   702 702 HOH HOH A . 
B 2 HOH 3   703 703 HOH HOH A . 
B 2 HOH 4   704 704 HOH HOH A . 
B 2 HOH 5   705 705 HOH HOH A . 
B 2 HOH 6   706 706 HOH HOH A . 
B 2 HOH 7   707 707 HOH HOH A . 
B 2 HOH 8   708 708 HOH HOH A . 
B 2 HOH 9   709 709 HOH HOH A . 
B 2 HOH 10  710 710 HOH HOH A . 
B 2 HOH 11  711 711 HOH HOH A . 
B 2 HOH 12  712 712 HOH HOH A . 
B 2 HOH 13  713 713 HOH HOH A . 
B 2 HOH 14  714 714 HOH HOH A . 
B 2 HOH 15  715 715 HOH HOH A . 
B 2 HOH 16  716 716 HOH HOH A . 
B 2 HOH 17  717 717 HOH HOH A . 
B 2 HOH 18  718 718 HOH HOH A . 
B 2 HOH 19  719 719 HOH HOH A . 
B 2 HOH 20  720 720 HOH HOH A . 
B 2 HOH 21  721 721 HOH HOH A . 
B 2 HOH 22  722 722 HOH HOH A . 
B 2 HOH 23  723 723 HOH HOH A . 
B 2 HOH 24  724 724 HOH HOH A . 
B 2 HOH 25  725 725 HOH HOH A . 
B 2 HOH 26  726 726 HOH HOH A . 
B 2 HOH 27  727 727 HOH HOH A . 
B 2 HOH 28  728 728 HOH HOH A . 
B 2 HOH 29  729 729 HOH HOH A . 
B 2 HOH 30  730 730 HOH HOH A . 
B 2 HOH 31  731 731 HOH HOH A . 
B 2 HOH 32  732 732 HOH HOH A . 
B 2 HOH 33  733 733 HOH HOH A . 
B 2 HOH 34  734 734 HOH HOH A . 
B 2 HOH 35  735 735 HOH HOH A . 
B 2 HOH 36  736 736 HOH HOH A . 
B 2 HOH 37  737 737 HOH HOH A . 
B 2 HOH 38  738 738 HOH HOH A . 
B 2 HOH 39  739 739 HOH HOH A . 
B 2 HOH 40  740 740 HOH HOH A . 
B 2 HOH 41  741 741 HOH HOH A . 
B 2 HOH 42  742 742 HOH HOH A . 
B 2 HOH 43  743 743 HOH HOH A . 
B 2 HOH 44  744 744 HOH HOH A . 
B 2 HOH 45  745 745 HOH HOH A . 
B 2 HOH 46  746 746 HOH HOH A . 
B 2 HOH 47  747 747 HOH HOH A . 
B 2 HOH 48  748 748 HOH HOH A . 
B 2 HOH 49  749 749 HOH HOH A . 
B 2 HOH 50  750 750 HOH HOH A . 
B 2 HOH 51  751 751 HOH HOH A . 
B 2 HOH 52  752 752 HOH HOH A . 
B 2 HOH 53  753 753 HOH HOH A . 
B 2 HOH 54  754 754 HOH HOH A . 
B 2 HOH 55  755 755 HOH HOH A . 
B 2 HOH 56  756 756 HOH HOH A . 
B 2 HOH 57  757 757 HOH HOH A . 
B 2 HOH 58  758 758 HOH HOH A . 
B 2 HOH 59  759 759 HOH HOH A . 
B 2 HOH 60  760 760 HOH HOH A . 
B 2 HOH 61  761 761 HOH HOH A . 
B 2 HOH 62  762 762 HOH HOH A . 
B 2 HOH 63  763 763 HOH HOH A . 
B 2 HOH 64  764 764 HOH HOH A . 
B 2 HOH 65  765 765 HOH HOH A . 
B 2 HOH 66  766 766 HOH HOH A . 
B 2 HOH 67  767 767 HOH HOH A . 
B 2 HOH 68  768 768 HOH HOH A . 
B 2 HOH 69  769 769 HOH HOH A . 
B 2 HOH 70  770 770 HOH HOH A . 
B 2 HOH 71  771 771 HOH HOH A . 
B 2 HOH 72  772 772 HOH HOH A . 
B 2 HOH 73  773 773 HOH HOH A . 
B 2 HOH 74  774 774 HOH HOH A . 
B 2 HOH 75  775 775 HOH HOH A . 
B 2 HOH 76  776 776 HOH HOH A . 
B 2 HOH 77  777 777 HOH HOH A . 
B 2 HOH 78  778 778 HOH HOH A . 
B 2 HOH 79  779 779 HOH HOH A . 
B 2 HOH 80  780 780 HOH HOH A . 
B 2 HOH 81  781 781 HOH HOH A . 
B 2 HOH 82  782 782 HOH HOH A . 
B 2 HOH 83  783 783 HOH HOH A . 
B 2 HOH 84  784 784 HOH HOH A . 
B 2 HOH 85  785 785 HOH HOH A . 
B 2 HOH 86  786 786 HOH HOH A . 
B 2 HOH 87  787 787 HOH HOH A . 
B 2 HOH 88  788 788 HOH HOH A . 
B 2 HOH 89  789 789 HOH HOH A . 
B 2 HOH 90  790 790 HOH HOH A . 
B 2 HOH 91  791 791 HOH HOH A . 
B 2 HOH 92  792 792 HOH HOH A . 
B 2 HOH 93  793 793 HOH HOH A . 
B 2 HOH 94  794 794 HOH HOH A . 
B 2 HOH 95  795 795 HOH HOH A . 
B 2 HOH 96  796 796 HOH HOH A . 
B 2 HOH 97  797 797 HOH HOH A . 
B 2 HOH 98  798 798 HOH HOH A . 
B 2 HOH 99  799 799 HOH HOH A . 
B 2 HOH 100 800 800 HOH HOH A . 
B 2 HOH 101 801 801 HOH HOH A . 
B 2 HOH 102 802 802 HOH HOH A . 
B 2 HOH 103 803 803 HOH HOH A . 
B 2 HOH 104 804 804 HOH HOH A . 
B 2 HOH 105 805 805 HOH HOH A . 
B 2 HOH 106 806 806 HOH HOH A . 
B 2 HOH 107 807 807 HOH HOH A . 
B 2 HOH 108 808 808 HOH HOH A . 
B 2 HOH 109 809 809 HOH HOH A . 
B 2 HOH 110 810 810 HOH HOH A . 
B 2 HOH 111 811 811 HOH HOH A . 
B 2 HOH 112 812 812 HOH HOH A . 
B 2 HOH 113 813 813 HOH HOH A . 
B 2 HOH 114 814 814 HOH HOH A . 
B 2 HOH 115 815 815 HOH HOH A . 
B 2 HOH 116 816 816 HOH HOH A . 
B 2 HOH 117 817 817 HOH HOH A . 
B 2 HOH 118 818 818 HOH HOH A . 
B 2 HOH 119 819 819 HOH HOH A . 
B 2 HOH 120 820 820 HOH HOH A . 
B 2 HOH 121 821 821 HOH HOH A . 
B 2 HOH 122 822 822 HOH HOH A . 
B 2 HOH 123 823 823 HOH HOH A . 
B 2 HOH 124 824 824 HOH HOH A . 
B 2 HOH 125 825 825 HOH HOH A . 
B 2 HOH 126 826 826 HOH HOH A . 
B 2 HOH 127 827 827 HOH HOH A . 
B 2 HOH 128 828 828 HOH HOH A . 
B 2 HOH 129 829 829 HOH HOH A . 
B 2 HOH 130 830 830 HOH HOH A . 
B 2 HOH 131 831 831 HOH HOH A . 
B 2 HOH 132 832 832 HOH HOH A . 
B 2 HOH 133 833 833 HOH HOH A . 
B 2 HOH 134 834 834 HOH HOH A . 
B 2 HOH 135 835 835 HOH HOH A . 
B 2 HOH 136 836 836 HOH HOH A . 
B 2 HOH 137 837 837 HOH HOH A . 
B 2 HOH 138 838 838 HOH HOH A . 
B 2 HOH 139 839 839 HOH HOH A . 
B 2 HOH 140 840 840 HOH HOH A . 
B 2 HOH 141 841 841 HOH HOH A . 
B 2 HOH 142 842 842 HOH HOH A . 
B 2 HOH 143 843 843 HOH HOH A . 
B 2 HOH 144 844 844 HOH HOH A . 
B 2 HOH 145 845 845 HOH HOH A . 
B 2 HOH 146 846 846 HOH HOH A . 
B 2 HOH 147 847 847 HOH HOH A . 
B 2 HOH 148 848 848 HOH HOH A . 
B 2 HOH 149 849 849 HOH HOH A . 
B 2 HOH 150 850 850 HOH HOH A . 
B 2 HOH 151 851 851 HOH HOH A . 
B 2 HOH 152 852 852 HOH HOH A . 
B 2 HOH 153 853 853 HOH HOH A . 
B 2 HOH 154 854 854 HOH HOH A . 
B 2 HOH 155 855 855 HOH HOH A . 
B 2 HOH 156 856 856 HOH HOH A . 
B 2 HOH 157 857 857 HOH HOH A . 
B 2 HOH 158 858 858 HOH HOH A . 
B 2 HOH 159 859 859 HOH HOH A . 
B 2 HOH 160 860 860 HOH HOH A . 
B 2 HOH 161 861 861 HOH HOH A . 
B 2 HOH 162 862 862 HOH HOH A . 
B 2 HOH 163 863 863 HOH HOH A . 
B 2 HOH 164 864 864 HOH HOH A . 
B 2 HOH 165 865 865 HOH HOH A . 
B 2 HOH 166 866 866 HOH HOH A . 
B 2 HOH 167 867 867 HOH HOH A . 
B 2 HOH 168 868 868 HOH HOH A . 
B 2 HOH 169 869 869 HOH HOH A . 
B 2 HOH 170 870 870 HOH HOH A . 
B 2 HOH 171 871 871 HOH HOH A . 
B 2 HOH 172 872 872 HOH HOH A . 
B 2 HOH 173 873 873 HOH HOH A . 
B 2 HOH 174 874 874 HOH HOH A . 
B 2 HOH 175 875 875 HOH HOH A . 
B 2 HOH 176 876 876 HOH HOH A . 
B 2 HOH 177 877 877 HOH HOH A . 
B 2 HOH 178 878 878 HOH HOH A . 
B 2 HOH 179 879 879 HOH HOH A . 
B 2 HOH 180 880 880 HOH HOH A . 
B 2 HOH 181 881 881 HOH HOH A . 
B 2 HOH 182 882 882 HOH HOH A . 
B 2 HOH 183 883 883 HOH HOH A . 
B 2 HOH 184 884 884 HOH HOH A . 
B 2 HOH 185 885 885 HOH HOH A . 
B 2 HOH 186 886 886 HOH HOH A . 
B 2 HOH 187 887 887 HOH HOH A . 
B 2 HOH 188 888 888 HOH HOH A . 
B 2 HOH 189 889 889 HOH HOH A . 
B 2 HOH 190 890 890 HOH HOH A . 
B 2 HOH 191 891 891 HOH HOH A . 
B 2 HOH 192 892 892 HOH HOH A . 
B 2 HOH 193 893 893 HOH HOH A . 
B 2 HOH 194 894 894 HOH HOH A . 
B 2 HOH 195 895 895 HOH HOH A . 
B 2 HOH 196 896 896 HOH HOH A . 
B 2 HOH 197 897 897 HOH HOH A . 
B 2 HOH 198 898 898 HOH HOH A . 
B 2 HOH 199 899 899 HOH HOH A . 
B 2 HOH 200 900 900 HOH HOH A . 
B 2 HOH 201 901 901 HOH HOH A . 
B 2 HOH 202 902 902 HOH HOH A . 
B 2 HOH 203 903 903 HOH HOH A . 
B 2 HOH 204 904 904 HOH HOH A . 
B 2 HOH 205 905 905 HOH HOH A . 
B 2 HOH 206 906 906 HOH HOH A . 
B 2 HOH 207 907 907 HOH HOH A . 
B 2 HOH 208 908 908 HOH HOH A . 
B 2 HOH 209 909 909 HOH HOH A . 
B 2 HOH 210 910 910 HOH HOH A . 
B 2 HOH 211 911 911 HOH HOH A . 
B 2 HOH 212 912 912 HOH HOH A . 
B 2 HOH 213 913 913 HOH HOH A . 
B 2 HOH 214 914 914 HOH HOH A . 
B 2 HOH 215 915 915 HOH HOH A . 
B 2 HOH 216 916 916 HOH HOH A . 
B 2 HOH 217 917 917 HOH HOH A . 
B 2 HOH 218 918 918 HOH HOH A . 
B 2 HOH 219 919 919 HOH HOH A . 
B 2 HOH 220 920 920 HOH HOH A . 
B 2 HOH 221 921 921 HOH HOH A . 
B 2 HOH 222 922 922 HOH HOH A . 
B 2 HOH 223 923 923 HOH HOH A . 
B 2 HOH 224 924 924 HOH HOH A . 
B 2 HOH 225 925 925 HOH HOH A . 
B 2 HOH 226 926 926 HOH HOH A . 
B 2 HOH 227 927 927 HOH HOH A . 
B 2 HOH 228 928 928 HOH HOH A . 
B 2 HOH 229 929 929 HOH HOH A . 
B 2 HOH 230 930 930 HOH HOH A . 
B 2 HOH 231 931 931 HOH HOH A . 
B 2 HOH 232 932 932 HOH HOH A . 
B 2 HOH 233 933 933 HOH HOH A . 
B 2 HOH 234 934 934 HOH HOH A . 
B 2 HOH 235 935 935 HOH HOH A . 
B 2 HOH 236 936 936 HOH HOH A . 
B 2 HOH 237 937 937 HOH HOH A . 
B 2 HOH 238 938 938 HOH HOH A . 
B 2 HOH 239 939 939 HOH HOH A . 
B 2 HOH 240 940 940 HOH HOH A . 
B 2 HOH 241 941 941 HOH HOH A . 
B 2 HOH 242 942 942 HOH HOH A . 
B 2 HOH 243 943 943 HOH HOH A . 
B 2 HOH 244 944 944 HOH HOH A . 
B 2 HOH 245 945 945 HOH HOH A . 
B 2 HOH 246 946 946 HOH HOH A . 
B 2 HOH 247 947 947 HOH HOH A . 
B 2 HOH 248 948 948 HOH HOH A . 
B 2 HOH 249 949 949 HOH HOH A . 
B 2 HOH 250 950 950 HOH HOH A . 
B 2 HOH 251 951 951 HOH HOH A . 
B 2 HOH 252 952 952 HOH HOH A . 
B 2 HOH 253 953 953 HOH HOH A . 
B 2 HOH 254 954 954 HOH HOH A . 
B 2 HOH 255 955 955 HOH HOH A . 
B 2 HOH 256 956 956 HOH HOH A . 
B 2 HOH 257 957 957 HOH HOH A . 
B 2 HOH 258 958 958 HOH HOH A . 
B 2 HOH 259 959 959 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-01-29 
2 'Structure model' 1 1 2008-03-03 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR 'model building' 3.1 ? 1 
X-PLOR refinement       3.1 ? 2 
DENZO  'data reduction' .   ? 3 
X-PLOR phasing          3.1 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR A 1157 ? ? -31.96  122.70  
2  1 ASN A 1183 ? ? 66.13   -0.67   
3  1 ASN A 1205 ? ? -173.49 44.09   
4  1 ASP A 1221 ? ? 58.17   -121.30 
5  1 SER A 1261 ? ? 36.64   41.96   
6  1 ASN A 1266 ? ? 172.46  -176.09 
7  1 ASN A 1276 ? ? -144.75 57.38   
8  1 GLU A 1312 ? ? 63.83   -99.00  
9  1 THR A 1339 ? ? -125.28 -158.67 
10 1 ALA A 1428 ? ? -171.51 142.03  
11 1 THR A 1431 ? ? -142.47 18.69   
12 1 ALA A 1441 ? ? -73.14  46.97   
13 1 ASN A 1457 ? ? 74.86   -15.39  
14 1 LEU A 1477 ? ? -61.86  -176.10 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#