data_1FNS
# 
_entry.id   1FNS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FNS         
RCSB  RCSB011748   
WWPDB D_1000011748 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FNS 
_pdbx_database_status.recvd_initial_deposition_date   2000-08-23 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
_audit_author.name           'Varughese, K.I.' 
_audit_author.pdbx_ordinal   1 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'von Willebrand factor conformation and adhesive function is modulated by an internalized water molecule.' 
Nat.Struct.Biol. 7 881 884 2000 NSBIEW US 1072-8368 2024 ? 11017197 10.1038/79639 
1       
;Crystal Structure of the Von Willebrand Factor A1 D Domain in Complex with the Function Blocking Nmc-4 DOMAIN IN COMPLEX WITH THE FUNCTION BLOCKING NMC-4 FAB
;
Nat.Struct.Biol. 5 189 ?   1998 NSBIEW US 1072-8368 2024 ? ?        ?             
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Celikel, R.'     1 
primary 'Ruggeri, Z.M.'   2 
primary 'Varughese, K.I.' 3 
1       'Celikel, R.'     4 
1       'Varughese, K.I.' 5 
1       Madhusudan        6 
1       'Yoshioka, A.'    7 
1       'Ware, J.'        8 
1       'Ruggeri, Z.M.'   9 
# 
_cell.entry_id           1FNS 
_cell.length_a           209.396 
_cell.length_b           62.673 
_cell.length_c           73.789 
_cell.angle_alpha        90.00 
_cell.angle_beta         108.88 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1FNS 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'IMMUNOGLOBULIN NMC-4 IGG1' 23694.061 1   ? ? 'FAB FRAGMENT, LIGHT CHAIN' ? 
2 polymer nat 'IMMUNOGLOBULIN NMC-4 IGG1' 24105.848 1   ? ? 'FAB FRAGMENT, HEAVY CHAIN' ? 
3 polymer man 'VON WILLEBRAND FACTOR'     22430.107 1   ? ? 
'A1 DOMAIN RESIDUES 507 - 702, OR GLYCOPROTEIN IBA (A\:ALPHA) BINDING DOMAIN' ? 
4 water   nat water                       18.015    636 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DIQMTQSPSSLSASLGDRVTISCSASQDINKYLNWYQQKPDGAVKLLIFYTSSLHSGVPSRFSGSGSGTDYSLTISNLEP
EDIATYYCQQYEKLPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;DIQMTQSPSSLSASLGDRVTISCSASQDINKYLNWYQQKPDGAVKLLIFYTSSLHSGVPSRFSGSGSGTDYSLTISNLEP
EDIATYYCQQYEKLPWTFGGGTKLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
2 'polypeptide(L)' no no 
;QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVDWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSITKDNSKSQVFL
KMNSLQTDDTARYYCVRDPADYGNYDYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
;
;QVQLKESGPGLVAPSQSLSITCTVSGFSLTDYGVDWVRQPPGKGLEWLGMIWGDGSTDYNSALKSRLSITKDNSKSQVFL
KMNSLQTDDTARYYCVRDPADYGNYDYALDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVT
VTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCG
;
H ? 
3 'polypeptide(L)' no no 
;MYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKY
AGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIE
KQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
;
;MYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRVSQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKY
AGSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIE
KQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ILE n 
1 3   GLN n 
1 4   MET n 
1 5   THR n 
1 6   GLN n 
1 7   SER n 
1 8   PRO n 
1 9   SER n 
1 10  SER n 
1 11  LEU n 
1 12  SER n 
1 13  ALA n 
1 14  SER n 
1 15  LEU n 
1 16  GLY n 
1 17  ASP n 
1 18  ARG n 
1 19  VAL n 
1 20  THR n 
1 21  ILE n 
1 22  SER n 
1 23  CYS n 
1 24  SER n 
1 25  ALA n 
1 26  SER n 
1 27  GLN n 
1 28  ASP n 
1 29  ILE n 
1 30  ASN n 
1 31  LYS n 
1 32  TYR n 
1 33  LEU n 
1 34  ASN n 
1 35  TRP n 
1 36  TYR n 
1 37  GLN n 
1 38  GLN n 
1 39  LYS n 
1 40  PRO n 
1 41  ASP n 
1 42  GLY n 
1 43  ALA n 
1 44  VAL n 
1 45  LYS n 
1 46  LEU n 
1 47  LEU n 
1 48  ILE n 
1 49  PHE n 
1 50  TYR n 
1 51  THR n 
1 52  SER n 
1 53  SER n 
1 54  LEU n 
1 55  HIS n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  PRO n 
1 60  SER n 
1 61  ARG n 
1 62  PHE n 
1 63  SER n 
1 64  GLY n 
1 65  SER n 
1 66  GLY n 
1 67  SER n 
1 68  GLY n 
1 69  THR n 
1 70  ASP n 
1 71  TYR n 
1 72  SER n 
1 73  LEU n 
1 74  THR n 
1 75  ILE n 
1 76  SER n 
1 77  ASN n 
1 78  LEU n 
1 79  GLU n 
1 80  PRO n 
1 81  GLU n 
1 82  ASP n 
1 83  ILE n 
1 84  ALA n 
1 85  THR n 
1 86  TYR n 
1 87  TYR n 
1 88  CYS n 
1 89  GLN n 
1 90  GLN n 
1 91  TYR n 
1 92  GLU n 
1 93  LYS n 
1 94  LEU n 
1 95  PRO n 
1 96  TRP n 
1 97  THR n 
1 98  PHE n 
1 99  GLY n 
1 100 GLY n 
1 101 GLY n 
1 102 THR n 
1 103 LYS n 
1 104 LEU n 
1 105 GLU n 
1 106 VAL n 
1 107 LYS n 
1 108 ARG n 
1 109 ALA n 
1 110 ASP n 
1 111 ALA n 
1 112 ALA n 
1 113 PRO n 
1 114 THR n 
1 115 VAL n 
1 116 SER n 
1 117 ILE n 
1 118 PHE n 
1 119 PRO n 
1 120 PRO n 
1 121 SER n 
1 122 SER n 
1 123 GLU n 
1 124 GLN n 
1 125 LEU n 
1 126 THR n 
1 127 SER n 
1 128 GLY n 
1 129 GLY n 
1 130 ALA n 
1 131 SER n 
1 132 VAL n 
1 133 VAL n 
1 134 CYS n 
1 135 PHE n 
1 136 LEU n 
1 137 ASN n 
1 138 ASN n 
1 139 PHE n 
1 140 TYR n 
1 141 PRO n 
1 142 LYS n 
1 143 ASP n 
1 144 ILE n 
1 145 ASN n 
1 146 VAL n 
1 147 LYS n 
1 148 TRP n 
1 149 LYS n 
1 150 ILE n 
1 151 ASP n 
1 152 GLY n 
1 153 SER n 
1 154 GLU n 
1 155 ARG n 
1 156 GLN n 
1 157 ASN n 
1 158 GLY n 
1 159 VAL n 
1 160 LEU n 
1 161 ASN n 
1 162 SER n 
1 163 TRP n 
1 164 THR n 
1 165 ASP n 
1 166 GLN n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 ASP n 
1 171 SER n 
1 172 THR n 
1 173 TYR n 
1 174 SER n 
1 175 MET n 
1 176 SER n 
1 177 SER n 
1 178 THR n 
1 179 LEU n 
1 180 THR n 
1 181 LEU n 
1 182 THR n 
1 183 LYS n 
1 184 ASP n 
1 185 GLU n 
1 186 TYR n 
1 187 GLU n 
1 188 ARG n 
1 189 HIS n 
1 190 ASN n 
1 191 SER n 
1 192 TYR n 
1 193 THR n 
1 194 CYS n 
1 195 GLU n 
1 196 ALA n 
1 197 THR n 
1 198 HIS n 
1 199 LYS n 
1 200 THR n 
1 201 SER n 
1 202 THR n 
1 203 SER n 
1 204 PRO n 
1 205 ILE n 
1 206 VAL n 
1 207 LYS n 
1 208 SER n 
1 209 PHE n 
1 210 ASN n 
1 211 ARG n 
1 212 ASN n 
1 213 GLU n 
1 214 CYS n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   LYS n 
2 6   GLU n 
2 7   SER n 
2 8   GLY n 
2 9   PRO n 
2 10  GLY n 
2 11  LEU n 
2 12  VAL n 
2 13  ALA n 
2 14  PRO n 
2 15  SER n 
2 16  GLN n 
2 17  SER n 
2 18  LEU n 
2 19  SER n 
2 20  ILE n 
2 21  THR n 
2 22  CYS n 
2 23  THR n 
2 24  VAL n 
2 25  SER n 
2 26  GLY n 
2 27  PHE n 
2 28  SER n 
2 29  LEU n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  GLY n 
2 34  VAL n 
2 35  ASP n 
2 36  TRP n 
2 37  VAL n 
2 38  ARG n 
2 39  GLN n 
2 40  PRO n 
2 41  PRO n 
2 42  GLY n 
2 43  LYS n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  LEU n 
2 49  GLY n 
2 50  MET n 
2 51  ILE n 
2 52  TRP n 
2 53  GLY n 
2 54  ASP n 
2 55  GLY n 
2 56  SER n 
2 57  THR n 
2 58  ASP n 
2 59  TYR n 
2 60  ASN n 
2 61  SER n 
2 62  ALA n 
2 63  LEU n 
2 64  LYS n 
2 65  SER n 
2 66  ARG n 
2 67  LEU n 
2 68  SER n 
2 69  ILE n 
2 70  THR n 
2 71  LYS n 
2 72  ASP n 
2 73  ASN n 
2 74  SER n 
2 75  LYS n 
2 76  SER n 
2 77  GLN n 
2 78  VAL n 
2 79  PHE n 
2 80  LEU n 
2 81  LYS n 
2 82  MET n 
2 83  ASN n 
2 84  SER n 
2 85  LEU n 
2 86  GLN n 
2 87  THR n 
2 88  ASP n 
2 89  ASP n 
2 90  THR n 
2 91  ALA n 
2 92  ARG n 
2 93  TYR n 
2 94  TYR n 
2 95  CYS n 
2 96  VAL n 
2 97  ARG n 
2 98  ASP n 
2 99  PRO n 
2 100 ALA n 
2 101 ASP n 
2 102 TYR n 
2 103 GLY n 
2 104 ASN n 
2 105 TYR n 
2 106 ASP n 
2 107 TYR n 
2 108 ALA n 
2 109 LEU n 
2 110 ASP n 
2 111 TYR n 
2 112 TRP n 
2 113 GLY n 
2 114 GLN n 
2 115 GLY n 
2 116 THR n 
2 117 SER n 
2 118 VAL n 
2 119 THR n 
2 120 VAL n 
2 121 SER n 
2 122 SER n 
2 123 ALA n 
2 124 LYS n 
2 125 THR n 
2 126 THR n 
2 127 PRO n 
2 128 PRO n 
2 129 SER n 
2 130 VAL n 
2 131 TYR n 
2 132 PRO n 
2 133 LEU n 
2 134 ALA n 
2 135 PRO n 
2 136 GLY n 
2 137 SER n 
2 138 ALA n 
2 139 ALA n 
2 140 GLN n 
2 141 THR n 
2 142 ASN n 
2 143 SER n 
2 144 MET n 
2 145 VAL n 
2 146 THR n 
2 147 LEU n 
2 148 GLY n 
2 149 CYS n 
2 150 LEU n 
2 151 VAL n 
2 152 LYS n 
2 153 GLY n 
2 154 TYR n 
2 155 PHE n 
2 156 PRO n 
2 157 GLU n 
2 158 PRO n 
2 159 VAL n 
2 160 THR n 
2 161 VAL n 
2 162 THR n 
2 163 TRP n 
2 164 ASN n 
2 165 SER n 
2 166 GLY n 
2 167 SER n 
2 168 LEU n 
2 169 SER n 
2 170 SER n 
2 171 GLY n 
2 172 VAL n 
2 173 HIS n 
2 174 THR n 
2 175 PHE n 
2 176 PRO n 
2 177 ALA n 
2 178 VAL n 
2 179 LEU n 
2 180 GLN n 
2 181 SER n 
2 182 ASP n 
2 183 LEU n 
2 184 TYR n 
2 185 THR n 
2 186 LEU n 
2 187 SER n 
2 188 SER n 
2 189 SER n 
2 190 VAL n 
2 191 THR n 
2 192 VAL n 
2 193 PRO n 
2 194 SER n 
2 195 SER n 
2 196 THR n 
2 197 TRP n 
2 198 PRO n 
2 199 SER n 
2 200 GLU n 
2 201 THR n 
2 202 VAL n 
2 203 THR n 
2 204 CYS n 
2 205 ASN n 
2 206 VAL n 
2 207 ALA n 
2 208 HIS n 
2 209 PRO n 
2 210 ALA n 
2 211 SER n 
2 212 SER n 
2 213 THR n 
2 214 LYS n 
2 215 VAL n 
2 216 ASP n 
2 217 LYS n 
2 218 LYS n 
2 219 ILE n 
2 220 VAL n 
2 221 PRO n 
2 222 ARG n 
2 223 ASP n 
2 224 CYS n 
2 225 GLY n 
3 1   MET n 
3 2   TYR n 
3 3   CYS n 
3 4   SER n 
3 5   ARG n 
3 6   LEU n 
3 7   LEU n 
3 8   ASP n 
3 9   LEU n 
3 10  VAL n 
3 11  PHE n 
3 12  LEU n 
3 13  LEU n 
3 14  ASP n 
3 15  GLY n 
3 16  SER n 
3 17  SER n 
3 18  ARG n 
3 19  LEU n 
3 20  SER n 
3 21  GLU n 
3 22  ALA n 
3 23  GLU n 
3 24  PHE n 
3 25  GLU n 
3 26  VAL n 
3 27  LEU n 
3 28  LYS n 
3 29  ALA n 
3 30  PHE n 
3 31  VAL n 
3 32  VAL n 
3 33  ASP n 
3 34  MET n 
3 35  MET n 
3 36  GLU n 
3 37  ARG n 
3 38  LEU n 
3 39  ARG n 
3 40  VAL n 
3 41  SER n 
3 42  GLN n 
3 43  LYS n 
3 44  TRP n 
3 45  VAL n 
3 46  ARG n 
3 47  VAL n 
3 48  ALA n 
3 49  VAL n 
3 50  VAL n 
3 51  GLU n 
3 52  TYR n 
3 53  HIS n 
3 54  ASP n 
3 55  GLY n 
3 56  SER n 
3 57  HIS n 
3 58  ALA n 
3 59  TYR n 
3 60  ILE n 
3 61  GLY n 
3 62  LEU n 
3 63  LYS n 
3 64  ASP n 
3 65  ARG n 
3 66  LYS n 
3 67  ARG n 
3 68  PRO n 
3 69  SER n 
3 70  GLU n 
3 71  LEU n 
3 72  ARG n 
3 73  ARG n 
3 74  ILE n 
3 75  ALA n 
3 76  SER n 
3 77  GLN n 
3 78  VAL n 
3 79  LYS n 
3 80  TYR n 
3 81  ALA n 
3 82  GLY n 
3 83  SER n 
3 84  GLN n 
3 85  VAL n 
3 86  ALA n 
3 87  SER n 
3 88  THR n 
3 89  SER n 
3 90  GLU n 
3 91  VAL n 
3 92  LEU n 
3 93  LYS n 
3 94  TYR n 
3 95  THR n 
3 96  LEU n 
3 97  PHE n 
3 98  GLN n 
3 99  ILE n 
3 100 PHE n 
3 101 SER n 
3 102 LYS n 
3 103 ILE n 
3 104 ASP n 
3 105 ARG n 
3 106 PRO n 
3 107 GLU n 
3 108 ALA n 
3 109 SER n 
3 110 ARG n 
3 111 ILE n 
3 112 ALA n 
3 113 LEU n 
3 114 LEU n 
3 115 LEU n 
3 116 MET n 
3 117 ALA n 
3 118 SER n 
3 119 GLN n 
3 120 GLU n 
3 121 PRO n 
3 122 GLN n 
3 123 ARG n 
3 124 MET n 
3 125 SER n 
3 126 ARG n 
3 127 ASN n 
3 128 PHE n 
3 129 VAL n 
3 130 ARG n 
3 131 TYR n 
3 132 VAL n 
3 133 GLN n 
3 134 GLY n 
3 135 LEU n 
3 136 LYS n 
3 137 LYS n 
3 138 LYS n 
3 139 LYS n 
3 140 VAL n 
3 141 ILE n 
3 142 VAL n 
3 143 ILE n 
3 144 PRO n 
3 145 VAL n 
3 146 GLY n 
3 147 ILE n 
3 148 GLY n 
3 149 PRO n 
3 150 HIS n 
3 151 ALA n 
3 152 ASN n 
3 153 LEU n 
3 154 LYS n 
3 155 GLN n 
3 156 ILE n 
3 157 ARG n 
3 158 LEU n 
3 159 ILE n 
3 160 GLU n 
3 161 LYS n 
3 162 GLN n 
3 163 ALA n 
3 164 PRO n 
3 165 GLU n 
3 166 ASN n 
3 167 LYS n 
3 168 ALA n 
3 169 PHE n 
3 170 VAL n 
3 171 LEU n 
3 172 SER n 
3 173 SER n 
3 174 VAL n 
3 175 ASP n 
3 176 GLU n 
3 177 LEU n 
3 178 GLU n 
3 179 GLN n 
3 180 GLN n 
3 181 ARG n 
3 182 ASP n 
3 183 GLU n 
3 184 ILE n 
3 185 VAL n 
3 186 SER n 
3 187 TYR n 
3 188 LEU n 
3 189 CYS n 
3 190 ASP n 
3 191 LEU n 
3 192 ALA n 
3 193 PRO n 
3 194 GLU n 
3 195 ALA n 
3 196 PRO n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'T7 PROMOTER' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET8C 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? 'HYBRIDOMA CELLS, MOPC21 CELLS' ? ? ? 
2 1 sample ? ? 'house mouse' 'Mus musculus' 10090 Mus ? ? ? ? ? ? ? ? ? ? ? ? 'HYBRIDOMA CELLS, MOPC21 CELLS' ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 VWF_HUMAN UNP 3 P04275 1271 
;YCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYA
GSQVASTSEVLKYTLFQIFSKIDRPEASRIALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIRLIEK
QAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAP
;
? 
2 1FNS      PDB 1 1FNS   ?    ? ? 
3 1FNS      PDB 2 1FNS   ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1FNS A 2 ? 196 ? P04275 1271 ? 1465 ? 508 702 
2 2 1FNS L 1 ? 214 ? 1FNS   1    ? 214  ? 1   214 
3 3 1FNS H 1 ? 225 ? 1FNS   215  ? 439  ? 215 439 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1FNS MET A 1  ? UNP P04275 ?   ?    'CLONING ARTIFACT' 507 1 
1 1FNS VAL A 40 ? UNP P04275 ILE 1309 CONFLICT           546 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FNS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.27 
_exptl_crystal.density_Matthews      3.26 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL7-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL7-1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FNS 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            ? 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        23.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1FNS 
_refine.ls_number_reflns_obs                     49150 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               666370.39 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             50.00 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    80.0 
_refine.ls_R_factor_obs                          0.172 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.172 
_refine.ls_R_factor_R_free                       0.207 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.3 
_refine.ls_number_reflns_R_free                  1139 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -3.96 
_refine.aniso_B[2][2]                            5.52 
_refine.aniso_B[3][3]                            -1.56 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.09 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.352 
_refine.solvent_model_param_bsol                 52.94 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1FNS 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.19 
_refine_analyze.Luzzati_sigma_a_free            0.11 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4900 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             636 
_refine_hist.number_atoms_total               5536 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        50.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.018 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      26.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.22  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.34  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.02  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.21  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.20  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             5706 
_refine_ls_shell.R_factor_R_work                  0.208 
_refine_ls_shell.percent_reflns_obs               57.7 
_refine_ls_shell.R_factor_R_free                  0.253 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            2.3 
_refine_ls_shell.number_reflns_R_free             136 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP   'X-RAY DIFFRACTION' 
2 ION.PARAM         ION.TOP       'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER_REP.TOP 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1FNS 
_struct.title                     
'CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR (VWF) A1 DOMAIN I546V MUTANT IN COMPLEX WITH THE FUNCTION BLOCKING FAB NMC4' 
_struct.pdbx_descriptor           
'CRYSTAL STRUCTURE OF THE VON WILLEBRAND FACTOR (VWF) A1 DOMAIN I546V MUTANT IN COMPLEX WITH THE FUNCTION BLOCKING FAB NMC4' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FNS 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            
;VON WILLEBRAND FACTOR, GLYCOPROTEIN IBA (A:ALPHA) BINDING, COMPLEX (WILLEBRAND-IMMUNOGLOBULIN), BLOOD COAGULATION TYPE 2B VON WILLEBRAND DISEASE, IMMUNE SYSTEM
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLU A 79  ? ILE A 83  ? GLU L 79  ILE L 83  5 ? 5  
HELX_P HELX_P2  2  SER A 121 ? THR A 126 ? SER L 121 THR L 126 1 ? 6  
HELX_P HELX_P3  3  LYS A 183 ? GLU A 187 ? LYS L 183 GLU L 187 1 ? 5  
HELX_P HELX_P4  4  SER B 61  ? LYS B 64  ? SER H 275 LYS H 278 5 ? 4  
HELX_P HELX_P5  5  ASN B 73  ? LYS B 75  ? ASN H 287 LYS H 289 5 ? 3  
HELX_P HELX_P6  6  GLN B 86  ? THR B 90  ? GLN H 300 THR H 304 5 ? 5  
HELX_P HELX_P7  7  TYR B 102 ? TYR B 105 ? TYR H 316 TYR H 319 5 ? 4  
HELX_P HELX_P8  8  SER B 165 ? SER B 167 ? SER H 379 SER H 381 5 ? 3  
HELX_P HELX_P9  9  SER B 195 ? TRP B 197 ? SER H 409 TRP H 411 5 ? 3  
HELX_P HELX_P10 10 PRO B 209 ? SER B 212 ? PRO H 423 SER H 426 5 ? 4  
HELX_P HELX_P11 11 SER C 20  ? ARG C 37  ? SER A 526 ARG A 543 1 ? 18 
HELX_P HELX_P12 12 ARG C 67  ? GLN C 77  ? ARG A 573 GLN A 583 1 ? 11 
HELX_P HELX_P13 13 SER C 87  ? GLN C 98  ? SER A 593 GLN A 604 1 ? 12 
HELX_P HELX_P14 14 PRO C 121 ? ARG C 126 ? PRO A 627 ARG A 632 5 ? 6  
HELX_P HELX_P15 15 ASN C 127 ? LYS C 138 ? ASN A 633 LYS A 644 1 ? 12 
HELX_P HELX_P16 16 ASN C 152 ? ALA C 163 ? ASN A 658 ALA A 669 1 ? 12 
HELX_P HELX_P17 17 ASP C 175 ? LEU C 191 ? ASP A 681 LEU A 697 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 23  SG ? ? ? 1_555 A CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.098 ? 
disulf2 disulf ? ? A CYS 134 SG ? ? ? 1_555 A CYS 194 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.052 ? 
disulf3 disulf ? ? A CYS 214 SG ? ? ? 1_555 B CYS 224 SG ? ? L CYS 214 H CYS 438 1_555 ? ? ? ? ? ? ? 2.066 ? 
disulf4 disulf ? ? B CYS 22  SG ? ? ? 1_555 B CYS 95  SG ? ? H CYS 236 H CYS 309 1_555 ? ? ? ? ? ? ? 2.068 ? 
disulf5 disulf ? ? B CYS 149 SG ? ? ? 1_555 B CYS 204 SG ? ? H CYS 363 H CYS 418 1_555 ? ? ? ? ? ? ? 2.038 ? 
disulf6 disulf ? ? C CYS 3   SG ? ? ? 1_555 C CYS 189 SG ? ? A CYS 509 A CYS 695 1_555 ? ? ? ? ? ? ? 2.026 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 94  A . ? LEU 94  L PRO 95  A ? PRO 95  L 1 -0.62 
2 TYR 140 A . ? TYR 140 L PRO 141 A ? PRO 141 L 1 0.44  
3 PHE 155 B . ? PHE 369 H PRO 156 B ? PRO 370 H 1 0.09  
4 GLU 157 B . ? GLU 371 H PRO 158 B ? PRO 372 H 1 -0.66 
5 TRP 197 B . ? TRP 411 H PRO 198 B ? PRO 412 H 1 0.48  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 6 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
G ? 5 ? 
H ? 6 ? 
I ? 4 ? 
J ? 4 ? 
K ? 3 ? 
L ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? parallel      
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? parallel      
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? parallel      
L 3 4 ? parallel      
L 4 5 ? parallel      
L 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET A 4   ? THR A 5   ? MET L 4   THR L 5   
A 2 VAL A 19  ? ALA A 25  ? VAL L 19  ALA L 25  
A 3 ASP A 70  ? ILE A 75  ? ASP L 70  ILE L 75  
A 4 PHE A 62  ? SER A 67  ? PHE L 62  SER L 67  
B 1 SER A 53  ? LEU A 54  ? SER L 53  LEU L 54  
B 2 VAL A 44  ? PHE A 49  ? VAL L 44  PHE L 49  
B 3 LEU A 33  ? GLN A 38  ? LEU L 33  GLN L 38  
B 4 THR A 85  ? GLN A 90  ? THR L 85  GLN L 90  
B 5 THR A 97  ? PHE A 98  ? THR L 97  PHE L 98  
C 1 SER A 53  ? LEU A 54  ? SER L 53  LEU L 54  
C 2 VAL A 44  ? PHE A 49  ? VAL L 44  PHE L 49  
C 3 LEU A 33  ? GLN A 38  ? LEU L 33  GLN L 38  
C 4 THR A 85  ? GLN A 90  ? THR L 85  GLN L 90  
C 5 THR A 102 ? VAL A 106 ? THR L 102 VAL L 106 
C 6 SER A 10  ? ALA A 13  ? SER L 10  ALA L 13  
D 1 THR A 114 ? PHE A 118 ? THR L 114 PHE L 118 
D 2 GLY A 129 ? PHE A 139 ? GLY L 129 PHE L 139 
D 3 TYR A 173 ? THR A 182 ? TYR L 173 THR L 182 
D 4 VAL A 159 ? TRP A 163 ? VAL L 159 TRP L 163 
E 1 SER A 153 ? ARG A 155 ? SER L 153 ARG L 155 
E 2 ASN A 145 ? ILE A 150 ? ASN L 145 ILE L 150 
E 3 SER A 191 ? THR A 197 ? SER L 191 THR L 197 
E 4 ILE A 205 ? ASN A 210 ? ILE L 205 ASN L 210 
F 1 GLN B 3   ? SER B 7   ? GLN H 217 SER H 221 
F 2 LEU B 18  ? SER B 25  ? LEU H 232 SER H 239 
F 3 GLN B 77  ? MET B 82  ? GLN H 291 MET H 296 
F 4 LEU B 67  ? ASP B 72  ? LEU H 281 ASP H 286 
G 1 THR B 57  ? TYR B 59  ? THR H 271 TYR H 273 
G 2 GLU B 46  ? ILE B 51  ? GLU H 260 ILE H 265 
G 3 GLY B 33  ? GLN B 39  ? GLY H 247 GLN H 253 
G 4 ALA B 91  ? ASP B 98  ? ALA H 305 ASP H 312 
G 5 TYR B 111 ? TRP B 112 ? TYR H 325 TRP H 326 
H 1 THR B 57  ? TYR B 59  ? THR H 271 TYR H 273 
H 2 GLU B 46  ? ILE B 51  ? GLU H 260 ILE H 265 
H 3 GLY B 33  ? GLN B 39  ? GLY H 247 GLN H 253 
H 4 ALA B 91  ? ASP B 98  ? ALA H 305 ASP H 312 
H 5 THR B 116 ? VAL B 120 ? THR H 330 VAL H 334 
H 6 LEU B 11  ? VAL B 12  ? LEU H 225 VAL H 226 
I 1 SER B 129 ? LEU B 133 ? SER H 343 LEU H 347 
I 2 MET B 144 ? TYR B 154 ? MET H 358 TYR H 368 
I 3 TYR B 184 ? PRO B 193 ? TYR H 398 PRO H 407 
I 4 VAL B 172 ? THR B 174 ? VAL H 386 THR H 388 
J 1 SER B 129 ? LEU B 133 ? SER H 343 LEU H 347 
J 2 MET B 144 ? TYR B 154 ? MET H 358 TYR H 368 
J 3 TYR B 184 ? PRO B 193 ? TYR H 398 PRO H 407 
J 4 VAL B 178 ? LEU B 179 ? VAL H 392 LEU H 393 
K 1 THR B 160 ? TRP B 163 ? THR H 374 TRP H 377 
K 2 THR B 203 ? HIS B 208 ? THR H 417 HIS H 422 
K 3 THR B 213 ? LYS B 218 ? THR H 427 LYS H 432 
L 1 SER C 56  ? ILE C 60  ? SER A 562 ILE A 566 
L 2 VAL C 45  ? TYR C 52  ? VAL A 551 TYR A 558 
L 3 LEU C 7   ? ASP C 14  ? LEU A 513 ASP A 520 
L 4 SER C 109 ? MET C 116 ? SER A 615 MET A 622 
L 5 VAL C 140 ? ILE C 147 ? VAL A 646 ILE A 653 
L 6 PHE C 169 ? LEU C 171 ? PHE A 675 LEU A 677 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 5   ? N THR L 5   O SER A 24  ? O SER L 24  
A 2 3 O CYS A 23  ? O CYS L 23  N TYR A 71  ? N TYR L 71  
A 3 4 N THR A 74  ? N THR L 74  O SER A 63  ? O SER L 63  
B 1 2 N SER A 53  ? N SER L 53  O PHE A 49  ? O PHE L 49  
B 2 3 N LEU A 47  ? N LEU L 47  O TRP A 35  ? O TRP L 35  
B 3 4 N GLN A 38  ? N GLN L 38  O THR A 85  ? O THR L 85  
B 4 5 N GLN A 90  ? N GLN L 90  O THR A 97  ? O THR L 97  
C 1 2 N SER A 53  ? N SER L 53  O PHE A 49  ? O PHE L 49  
C 2 3 N LEU A 47  ? N LEU L 47  O TRP A 35  ? O TRP L 35  
C 3 4 N GLN A 38  ? N GLN L 38  O THR A 85  ? O THR L 85  
C 4 5 N TYR A 86  ? N TYR L 86  O THR A 102 ? O THR L 102 
C 5 6 O LYS A 103 ? O LYS L 103 N LEU A 11  ? N LEU L 11  
D 1 2 N PHE A 118 ? N PHE L 118 O VAL A 133 ? O VAL L 133 
D 2 3 N PHE A 139 ? N PHE L 139 O TYR A 173 ? O TYR L 173 
D 3 4 O THR A 178 ? O THR L 178 N LEU A 160 ? N LEU L 160 
E 1 2 N ARG A 155 ? N ARG L 155 O TRP A 148 ? O TRP L 148 
E 2 3 O LYS A 149 ? O LYS L 149 N THR A 193 ? N THR L 193 
E 3 4 N ALA A 196 ? N ALA L 196 O ILE A 205 ? O ILE L 205 
F 1 2 O SER B 7   ? O SER H 221 N THR B 21  ? N THR H 235 
F 2 3 N CYS B 22  ? N CYS H 236 O VAL B 78  ? O VAL H 292 
F 3 4 O LYS B 81  ? O LYS H 295 N SER B 68  ? N SER H 282 
G 1 2 O ASP B 58  ? O ASP H 272 N MET B 50  ? N MET H 264 
G 2 3 O ILE B 51  ? O ILE H 265 N VAL B 34  ? N VAL H 248 
G 3 4 N GLN B 39  ? N GLN H 253 O ARG B 92  ? O ARG H 306 
G 4 5 N ARG B 97  ? N ARG H 311 O TYR B 111 ? O TYR H 325 
H 1 2 O ASP B 58  ? O ASP H 272 N MET B 50  ? N MET H 264 
H 2 3 O ILE B 51  ? O ILE H 265 N VAL B 34  ? N VAL H 248 
H 3 4 N GLN B 39  ? N GLN H 253 O ARG B 92  ? O ARG H 306 
H 4 5 N TYR B 93  ? N TYR H 307 O THR B 116 ? O THR H 330 
H 5 6 O THR B 119 ? O THR H 333 N VAL B 12  ? N VAL H 226 
I 1 2 N LEU B 133 ? N LEU H 347 O GLY B 148 ? O GLY H 362 
I 2 3 O TYR B 154 ? O TYR H 368 N TYR B 184 ? N TYR H 398 
I 3 4 N SER B 189 ? N SER H 403 O HIS B 173 ? O HIS H 387 
J 1 2 N LEU B 133 ? N LEU H 347 O GLY B 148 ? O GLY H 362 
J 2 3 O TYR B 154 ? O TYR H 368 N TYR B 184 ? N TYR H 398 
J 3 4 O THR B 185 ? O THR H 399 N VAL B 178 ? N VAL H 392 
K 1 2 O THR B 162 ? O THR H 376 N ASN B 205 ? N ASN H 419 
K 2 3 N HIS B 208 ? N HIS H 422 O THR B 213 ? O THR H 427 
L 1 2 N TYR C 59  ? N TYR A 565 O VAL C 49  ? O VAL A 555 
L 2 3 N ARG C 46  ? N ARG A 552 O LEU C 7   ? O LEU A 513 
L 3 4 N ASP C 8   ? N ASP A 514 O SER C 109 ? O SER A 615 
L 4 5 N ALA C 112 ? N ALA A 618 O ILE C 141 ? O ILE A 647 
L 5 6 O PRO C 144 ? O PRO A 650 N PHE C 169 ? N PHE A 675 
# 
_database_PDB_matrix.entry_id          1FNS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FNS 
_atom_sites.fract_transf_matrix[1][1]   0.004776 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001633 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015956 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014323 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 1   ? 107.392 8.057  68.278  1.00 28.62 ? 1    ASP L N   1 
ATOM   2    C CA  . ASP A 1 1   ? 108.097 9.294  67.844  1.00 26.72 ? 1    ASP L CA  1 
ATOM   3    C C   . ASP A 1 1   ? 109.177 8.874  66.854  1.00 25.62 ? 1    ASP L C   1 
ATOM   4    O O   . ASP A 1 1   ? 109.650 7.730  66.893  1.00 25.40 ? 1    ASP L O   1 
ATOM   5    C CB  . ASP A 1 1   ? 108.728 9.986  69.059  1.00 27.82 ? 1    ASP L CB  1 
ATOM   6    C CG  . ASP A 1 1   ? 107.682 10.419 70.100  1.00 30.32 ? 1    ASP L CG  1 
ATOM   7    O OD1 . ASP A 1 1   ? 106.491 10.047 69.937  1.00 31.48 ? 1    ASP L OD1 1 
ATOM   8    O OD2 . ASP A 1 1   ? 108.048 11.120 71.075  1.00 31.06 ? 1    ASP L OD2 1 
ATOM   9    N N   . ILE A 1 2   ? 109.567 9.775  65.955  1.00 21.69 ? 2    ILE L N   1 
ATOM   10   C CA  . ILE A 1 2   ? 110.605 9.439  65.007  1.00 19.39 ? 2    ILE L CA  1 
ATOM   11   C C   . ILE A 1 2   ? 111.896 9.817  65.725  1.00 19.18 ? 2    ILE L C   1 
ATOM   12   O O   . ILE A 1 2   ? 111.954 10.885 66.328  1.00 20.50 ? 2    ILE L O   1 
ATOM   13   C CB  . ILE A 1 2   ? 110.414 10.261 63.673  1.00 17.59 ? 2    ILE L CB  1 
ATOM   14   C CG1 . ILE A 1 2   ? 109.188 9.733  62.924  1.00 16.36 ? 2    ILE L CG1 1 
ATOM   15   C CG2 . ILE A 1 2   ? 111.698 10.243 62.845  1.00 15.10 ? 2    ILE L CG2 1 
ATOM   16   C CD1 . ILE A 1 2   ? 108.875 10.528 61.651  1.00 16.17 ? 2    ILE L CD1 1 
ATOM   17   N N   . GLN A 1 3   ? 112.904 8.944  65.698  1.00 19.69 ? 3    GLN L N   1 
ATOM   18   C CA  . GLN A 1 3   ? 114.186 9.210  66.352  1.00 21.80 ? 3    GLN L CA  1 
ATOM   19   C C   . GLN A 1 3   ? 115.183 9.801  65.374  1.00 20.46 ? 3    GLN L C   1 
ATOM   20   O O   . GLN A 1 3   ? 115.406 9.245  64.287  1.00 18.96 ? 3    GLN L O   1 
ATOM   21   C CB  . GLN A 1 3   ? 114.785 7.931  66.928  1.00 25.89 ? 3    GLN L CB  1 
ATOM   22   C CG  . GLN A 1 3   ? 113.792 7.105  67.755  1.00 34.45 ? 3    GLN L CG  1 
ATOM   23   C CD  . GLN A 1 3   ? 113.373 7.798  69.060  1.00 40.77 ? 3    GLN L CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? 114.217 8.399  69.767  1.00 44.40 ? 3    GLN L OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? 112.071 7.705  69.403  1.00 42.81 ? 3    GLN L NE2 1 
ATOM   26   N N   . MET A 1 4   ? 115.777 10.925 65.775  1.00 17.79 ? 4    MET L N   1 
ATOM   27   C CA  . MET A 1 4   ? 116.767 11.612 64.972  1.00 17.09 ? 4    MET L CA  1 
ATOM   28   C C   . MET A 1 4   ? 118.155 11.418 65.620  1.00 17.47 ? 4    MET L C   1 
ATOM   29   O O   . MET A 1 4   ? 118.362 11.717 66.777  1.00 16.83 ? 4    MET L O   1 
ATOM   30   C CB  . MET A 1 4   ? 116.464 13.114 64.885  1.00 15.67 ? 4    MET L CB  1 
ATOM   31   C CG  . MET A 1 4   ? 115.041 13.471 64.438  1.00 14.83 ? 4    MET L CG  1 
ATOM   32   S SD  . MET A 1 4   ? 114.730 12.795 62.814  1.00 15.51 ? 4    MET L SD  1 
ATOM   33   C CE  . MET A 1 4   ? 115.977 13.559 61.867  1.00 13.62 ? 4    MET L CE  1 
ATOM   34   N N   . THR A 1 5   ? 119.097 10.963 64.814  1.00 18.28 ? 5    THR L N   1 
ATOM   35   C CA  . THR A 1 5   ? 120.440 10.685 65.281  1.00 18.66 ? 5    THR L CA  1 
ATOM   36   C C   . THR A 1 5   ? 121.493 11.543 64.644  1.00 16.69 ? 5    THR L C   1 
ATOM   37   O O   . THR A 1 5   ? 121.577 11.606 63.408  1.00 16.90 ? 5    THR L O   1 
ATOM   38   C CB  . THR A 1 5   ? 120.801 9.224  64.945  1.00 18.68 ? 5    THR L CB  1 
ATOM   39   O OG1 . THR A 1 5   ? 119.819 8.369  65.511  1.00 20.77 ? 5    THR L OG1 1 
ATOM   40   C CG2 . THR A 1 5   ? 122.179 8.867  65.473  1.00 20.48 ? 5    THR L CG2 1 
ATOM   41   N N   . GLN A 1 6   ? 122.301 12.201 65.469  1.00 16.43 ? 6    GLN L N   1 
ATOM   42   C CA  . GLN A 1 6   ? 123.462 12.930 64.947  1.00 17.80 ? 6    GLN L CA  1 
ATOM   43   C C   . GLN A 1 6   ? 124.640 12.108 65.508  1.00 20.77 ? 6    GLN L C   1 
ATOM   44   O O   . GLN A 1 6   ? 124.990 12.196 66.700  1.00 22.90 ? 6    GLN L O   1 
ATOM   45   C CB  . GLN A 1 6   ? 123.484 14.406 65.414  1.00 14.73 ? 6    GLN L CB  1 
ATOM   46   C CG  . GLN A 1 6   ? 122.435 15.224 64.682  1.00 13.57 ? 6    GLN L CG  1 
ATOM   47   C CD  . GLN A 1 6   ? 122.275 16.649 65.180  1.00 14.13 ? 6    GLN L CD  1 
ATOM   48   O OE1 . GLN A 1 6   ? 121.222 17.011 65.757  1.00 12.32 ? 6    GLN L OE1 1 
ATOM   49   N NE2 . GLN A 1 6   ? 123.303 17.500 64.916  1.00 12.92 ? 6    GLN L NE2 1 
ATOM   50   N N   . SER A 1 7   ? 125.212 11.260 64.667  1.00 23.54 ? 7    SER L N   1 
ATOM   51   C CA  . SER A 1 7   ? 126.322 10.392 65.087  1.00 26.87 ? 7    SER L CA  1 
ATOM   52   C C   . SER A 1 7   ? 127.487 11.105 65.789  1.00 27.66 ? 7    SER L C   1 
ATOM   53   O O   . SER A 1 7   ? 127.963 10.593 66.815  1.00 29.65 ? 7    SER L O   1 
ATOM   54   C CB  . SER A 1 7   ? 126.812 9.563  63.890  1.00 28.40 ? 7    SER L CB  1 
ATOM   55   O OG  . SER A 1 7   ? 125.846 8.542  63.642  1.00 32.14 ? 7    SER L OG  1 
ATOM   56   N N   . PRO A 1 8   ? 127.980 12.261 65.258  1.00 24.99 ? 8    PRO L N   1 
ATOM   57   C CA  . PRO A 1 8   ? 129.072 12.904 65.980  1.00 23.63 ? 8    PRO L CA  1 
ATOM   58   C C   . PRO A 1 8   ? 128.526 13.987 66.854  1.00 22.57 ? 8    PRO L C   1 
ATOM   59   O O   . PRO A 1 8   ? 127.900 14.945 66.338  1.00 23.48 ? 8    PRO L O   1 
ATOM   60   C CB  . PRO A 1 8   ? 129.953 13.540 64.881  1.00 24.81 ? 8    PRO L CB  1 
ATOM   61   C CG  . PRO A 1 8   ? 129.660 12.777 63.703  1.00 26.25 ? 8    PRO L CG  1 
ATOM   62   C CD  . PRO A 1 8   ? 128.095 12.628 63.843  1.00 28.28 ? 8    PRO L CD  1 
ATOM   63   N N   . SER A 1 9   ? 128.744 13.861 68.163  1.00 20.06 ? 9    SER L N   1 
ATOM   64   C CA  . SER A 1 9   ? 128.323 14.894 69.075  1.00 19.41 ? 9    SER L CA  1 
ATOM   65   C C   . SER A 1 9   ? 129.396 15.998 69.196  1.00 19.53 ? 9    SER L C   1 
ATOM   66   O O   . SER A 1 9   ? 129.077 17.130 69.565  1.00 18.49 ? 9    SER L O   1 
ATOM   67   C CB  . SER A 1 9   ? 128.013 14.297 70.433  1.00 21.22 ? 9    SER L CB  1 
ATOM   68   O OG  . SER A 1 9   ? 129.085 13.455 70.831  1.00 25.31 ? 9    SER L OG  1 
ATOM   69   N N   . SER A 1 10  ? 130.649 15.684 68.865  1.00 20.02 ? 10   SER L N   1 
ATOM   70   C CA  . SER A 1 10  ? 131.755 16.659 68.958  1.00 22.34 ? 10   SER L CA  1 
ATOM   71   C C   . SER A 1 10  ? 132.540 16.617 67.650  1.00 22.45 ? 10   SER L C   1 
ATOM   72   O O   . SER A 1 10  ? 133.048 15.586 67.257  1.00 23.14 ? 10   SER L O   1 
ATOM   73   C CB  . SER A 1 10  ? 132.682 16.326 70.139  1.00 21.73 ? 10   SER L CB  1 
ATOM   74   O OG  . SER A 1 10  ? 133.807 17.216 70.158  1.00 22.85 ? 10   SER L OG  1 
ATOM   75   N N   . LEU A 1 11  ? 132.635 17.742 66.971  1.00 21.01 ? 11   LEU L N   1 
ATOM   76   C CA  . LEU A 1 11  ? 133.304 17.755 65.687  1.00 21.17 ? 11   LEU L CA  1 
ATOM   77   C C   . LEU A 1 11  ? 134.397 18.817 65.685  1.00 19.97 ? 11   LEU L C   1 
ATOM   78   O O   . LEU A 1 11  ? 134.110 19.975 65.866  1.00 18.38 ? 11   LEU L O   1 
ATOM   79   C CB  . LEU A 1 11  ? 132.253 18.043 64.589  1.00 22.27 ? 11   LEU L CB  1 
ATOM   80   C CG  . LEU A 1 11  ? 132.746 18.168 63.154  1.00 22.79 ? 11   LEU L CG  1 
ATOM   81   C CD1 . LEU A 1 11  ? 133.516 16.867 62.816  1.00 25.21 ? 11   LEU L CD1 1 
ATOM   82   C CD2 . LEU A 1 11  ? 131.541 18.376 62.185  1.00 22.18 ? 11   LEU L CD2 1 
ATOM   83   N N   . SER A 1 12  ? 135.640 18.404 65.459  1.00 19.20 ? 12   SER L N   1 
ATOM   84   C CA  . SER A 1 12  ? 136.764 19.327 65.461  1.00 20.05 ? 12   SER L CA  1 
ATOM   85   C C   . SER A 1 12  ? 137.038 19.862 64.060  1.00 20.33 ? 12   SER L C   1 
ATOM   86   O O   . SER A 1 12  ? 136.946 19.110 63.080  1.00 21.47 ? 12   SER L O   1 
ATOM   87   C CB  . SER A 1 12  ? 138.045 18.625 65.962  1.00 20.77 ? 12   SER L CB  1 
ATOM   88   O OG  . SER A 1 12  ? 137.897 18.126 67.290  1.00 22.11 ? 12   SER L OG  1 
ATOM   89   N N   . ALA A 1 13  ? 137.420 21.134 63.969  1.00 19.48 ? 13   ALA L N   1 
ATOM   90   C CA  . ALA A 1 13  ? 137.744 21.758 62.680  1.00 20.58 ? 13   ALA L CA  1 
ATOM   91   C C   . ALA A 1 13  ? 138.622 22.976 62.888  1.00 21.02 ? 13   ALA L C   1 
ATOM   92   O O   . ALA A 1 13  ? 138.754 23.490 64.009  1.00 20.72 ? 13   ALA L O   1 
ATOM   93   C CB  . ALA A 1 13  ? 136.483 22.218 61.960  1.00 20.10 ? 13   ALA L CB  1 
ATOM   94   N N   . SER A 1 14  ? 139.194 23.442 61.789  1.00 20.94 ? 14   SER L N   1 
ATOM   95   C CA  . SER A 1 14  ? 140.013 24.623 61.782  1.00 20.91 ? 14   SER L CA  1 
ATOM   96   C C   . SER A 1 14  ? 139.214 25.700 61.038  1.00 20.43 ? 14   SER L C   1 
ATOM   97   O O   . SER A 1 14  ? 138.467 25.396 60.108  1.00 17.99 ? 14   SER L O   1 
ATOM   98   C CB  . SER A 1 14  ? 141.292 24.337 61.030  1.00 22.87 ? 14   SER L CB  1 
ATOM   99   O OG  . SER A 1 14  ? 142.114 23.442 61.751  1.00 27.91 ? 14   SER L OG  1 
ATOM   100  N N   . LEU A 1 15  ? 139.382 26.960 61.424  1.00 19.33 ? 15   LEU L N   1 
ATOM   101  C CA  . LEU A 1 15  ? 138.665 28.034 60.736  1.00 19.35 ? 15   LEU L CA  1 
ATOM   102  C C   . LEU A 1 15  ? 139.061 27.974 59.249  1.00 20.23 ? 15   LEU L C   1 
ATOM   103  O O   . LEU A 1 15  ? 140.233 27.672 58.908  1.00 20.14 ? 15   LEU L O   1 
ATOM   104  C CB  . LEU A 1 15  ? 139.064 29.392 61.316  1.00 19.01 ? 15   LEU L CB  1 
ATOM   105  C CG  . LEU A 1 15  ? 138.824 29.610 62.803  1.00 18.99 ? 15   LEU L CG  1 
ATOM   106  C CD1 . LEU A 1 15  ? 139.345 30.978 63.218  1.00 20.19 ? 15   LEU L CD1 1 
ATOM   107  C CD2 . LEU A 1 15  ? 137.334 29.486 63.105  1.00 20.43 ? 15   LEU L CD2 1 
ATOM   108  N N   . GLY A 1 16  ? 138.128 28.280 58.359  1.00 20.45 ? 16   GLY L N   1 
ATOM   109  C CA  . GLY A 1 16  ? 138.441 28.207 56.923  1.00 22.13 ? 16   GLY L CA  1 
ATOM   110  C C   . GLY A 1 16  ? 138.065 26.830 56.345  1.00 23.06 ? 16   GLY L C   1 
ATOM   111  O O   . GLY A 1 16  ? 137.927 26.673 55.112  1.00 22.33 ? 16   GLY L O   1 
ATOM   112  N N   . ASP A 1 17  ? 137.881 25.833 57.210  1.00 20.95 ? 17   ASP L N   1 
ATOM   113  C CA  . ASP A 1 17  ? 137.505 24.504 56.740  1.00 23.38 ? 17   ASP L CA  1 
ATOM   114  C C   . ASP A 1 17  ? 136.067 24.361 56.226  1.00 23.09 ? 17   ASP L C   1 
ATOM   115  O O   . ASP A 1 17  ? 135.166 25.145 56.564  1.00 20.18 ? 17   ASP L O   1 
ATOM   116  C CB  . ASP A 1 17  ? 137.642 23.421 57.844  1.00 24.37 ? 17   ASP L CB  1 
ATOM   117  C CG  . ASP A 1 17  ? 139.088 23.064 58.182  1.00 28.16 ? 17   ASP L CG  1 
ATOM   118  O OD1 . ASP A 1 17  ? 140.028 23.601 57.558  1.00 26.77 ? 17   ASP L OD1 1 
ATOM   119  O OD2 . ASP A 1 17  ? 139.265 22.216 59.099  1.00 26.96 ? 17   ASP L OD2 1 
ATOM   120  N N   . ARG A 1 18  ? 135.885 23.306 55.422  1.00 23.58 ? 18   ARG L N   1 
ATOM   121  C CA  . ARG A 1 18  ? 134.565 22.912 54.935  1.00 24.84 ? 18   ARG L CA  1 
ATOM   122  C C   . ARG A 1 18  ? 134.154 21.938 56.043  1.00 23.60 ? 18   ARG L C   1 
ATOM   123  O O   . ARG A 1 18  ? 134.918 21.034 56.388  1.00 25.00 ? 18   ARG L O   1 
ATOM   124  C CB  . ARG A 1 18  ? 134.655 22.152 53.612  1.00 27.86 ? 18   ARG L CB  1 
ATOM   125  C CG  . ARG A 1 18  ? 133.283 21.837 52.991  1.00 32.43 ? 18   ARG L CG  1 
ATOM   126  C CD  . ARG A 1 18  ? 133.443 20.691 51.991  1.00 37.50 ? 18   ARG L CD  1 
ATOM   127  N NE  . ARG A 1 18  ? 132.237 20.447 51.215  1.00 41.64 ? 18   ARG L NE  1 
ATOM   128  C CZ  . ARG A 1 18  ? 131.731 21.327 50.357  1.00 44.58 ? 18   ARG L CZ  1 
ATOM   129  N NH1 . ARG A 1 18  ? 132.343 22.495 50.181  1.00 45.65 ? 18   ARG L NH1 1 
ATOM   130  N NH2 . ARG A 1 18  ? 130.607 21.049 49.688  1.00 45.16 ? 18   ARG L NH2 1 
ATOM   131  N N   . VAL A 1 19  ? 132.983 22.137 56.632  1.00 20.72 ? 19   VAL L N   1 
ATOM   132  C CA  . VAL A 1 19  ? 132.524 21.279 57.717  1.00 19.45 ? 19   VAL L CA  1 
ATOM   133  C C   . VAL A 1 19  ? 131.159 20.691 57.285  1.00 18.85 ? 19   VAL L C   1 
ATOM   134  O O   . VAL A 1 19  ? 130.344 21.400 56.709  1.00 19.19 ? 19   VAL L O   1 
ATOM   135  C CB  . VAL A 1 19  ? 132.336 22.140 59.019  1.00 18.73 ? 19   VAL L CB  1 
ATOM   136  C CG1 . VAL A 1 19  ? 131.691 21.332 60.105  1.00 18.32 ? 19   VAL L CG1 1 
ATOM   137  C CG2 . VAL A 1 19  ? 133.760 22.689 59.512  1.00 18.32 ? 19   VAL L CG2 1 
ATOM   138  N N   . THR A 1 20  ? 130.921 19.416 57.593  1.00 18.08 ? 20   THR L N   1 
ATOM   139  C CA  . THR A 1 20  ? 129.656 18.767 57.267  1.00 16.89 ? 20   THR L CA  1 
ATOM   140  C C   . THR A 1 20  ? 129.115 18.108 58.524  1.00 16.77 ? 20   THR L C   1 
ATOM   141  O O   . THR A 1 20  ? 129.826 17.364 59.170  1.00 17.56 ? 20   THR L O   1 
ATOM   142  C CB  . THR A 1 20  ? 129.858 17.676 56.207  1.00 16.98 ? 20   THR L CB  1 
ATOM   143  O OG1 . THR A 1 20  ? 130.516 18.241 55.071  1.00 19.32 ? 20   THR L OG1 1 
ATOM   144  C CG2 . THR A 1 20  ? 128.519 17.077 55.803  1.00 18.66 ? 20   THR L CG2 1 
ATOM   145  N N   . ILE A 1 21  ? 127.862 18.386 58.867  1.00 15.46 ? 21   ILE L N   1 
ATOM   146  C CA  . ILE A 1 21  ? 127.235 17.794 60.045  1.00 16.41 ? 21   ILE L CA  1 
ATOM   147  C C   . ILE A 1 21  ? 126.141 16.855 59.510  1.00 17.09 ? 21   ILE L C   1 
ATOM   148  O O   . ILE A 1 21  ? 125.314 17.281 58.716  1.00 15.82 ? 21   ILE L O   1 
ATOM   149  C CB  . ILE A 1 21  ? 126.590 18.880 60.916  1.00 17.05 ? 21   ILE L CB  1 
ATOM   150  C CG1 . ILE A 1 21  ? 127.696 19.817 61.437  1.00 17.15 ? 21   ILE L CG1 1 
ATOM   151  C CG2 . ILE A 1 21  ? 125.813 18.244 62.061  1.00 16.59 ? 21   ILE L CG2 1 
ATOM   152  C CD1 . ILE A 1 21  ? 127.208 21.060 62.025  1.00 18.35 ? 21   ILE L CD1 1 
ATOM   153  N N   . SER A 1 22  ? 126.134 15.598 59.936  1.00 16.21 ? 22   SER L N   1 
ATOM   154  C CA  . SER A 1 22  ? 125.142 14.661 59.447  1.00 16.92 ? 22   SER L CA  1 
ATOM   155  C C   . SER A 1 22  ? 124.004 14.364 60.413  1.00 15.06 ? 22   SER L C   1 
ATOM   156  O O   . SER A 1 22  ? 124.164 14.447 61.625  1.00 13.74 ? 22   SER L O   1 
ATOM   157  C CB  . SER A 1 22  ? 125.836 13.371 59.091  1.00 18.00 ? 22   SER L CB  1 
ATOM   158  O OG  . SER A 1 22  ? 126.230 12.784 60.327  1.00 23.41 ? 22   SER L OG  1 
ATOM   159  N N   . CYS A 1 23  ? 122.840 14.011 59.859  1.00 14.10 ? 23   CYS L N   1 
ATOM   160  C CA  . CYS A 1 23  ? 121.661 13.702 60.632  1.00 14.71 ? 23   CYS L CA  1 
ATOM   161  C C   . CYS A 1 23  ? 120.845 12.620 59.919  1.00 15.79 ? 23   CYS L C   1 
ATOM   162  O O   . CYS A 1 23  ? 120.662 12.679 58.688  1.00 15.09 ? 23   CYS L O   1 
ATOM   163  C CB  . CYS A 1 23  ? 120.797 14.956 60.747  1.00 16.27 ? 23   CYS L CB  1 
ATOM   164  S SG  . CYS A 1 23  ? 119.162 14.731 61.539  1.00 17.72 ? 23   CYS L SG  1 
ATOM   165  N N   . SER A 1 24  ? 120.359 11.644 60.671  1.00 15.40 ? 24   SER L N   1 
ATOM   166  C CA  . SER A 1 24  ? 119.528 10.614 60.058  1.00 17.01 ? 24   SER L CA  1 
ATOM   167  C C   . SER A 1 24  ? 118.317 10.298 60.903  1.00 16.28 ? 24   SER L C   1 
ATOM   168  O O   . SER A 1 24  ? 118.370 10.255 62.128  1.00 17.31 ? 24   SER L O   1 
ATOM   169  C CB  . SER A 1 24  ? 120.337 9.332  59.792  1.00 17.03 ? 24   SER L CB  1 
ATOM   170  O OG  . SER A 1 24  ? 120.708 8.753  61.036  1.00 20.40 ? 24   SER L OG  1 
ATOM   171  N N   . ALA A 1 25  ? 117.202 10.062 60.219  1.00 15.77 ? 25   ALA L N   1 
ATOM   172  C CA  . ALA A 1 25  ? 115.939 9.758  60.848  1.00 14.62 ? 25   ALA L CA  1 
ATOM   173  C C   . ALA A 1 25  ? 115.685 8.235  60.870  1.00 15.80 ? 25   ALA L C   1 
ATOM   174  O O   . ALA A 1 25  ? 116.214 7.504  60.026  1.00 16.38 ? 25   ALA L O   1 
ATOM   175  C CB  . ALA A 1 25  ? 114.848 10.454 60.077  1.00 12.95 ? 25   ALA L CB  1 
ATOM   176  N N   . SER A 1 26  ? 114.871 7.778  61.818  1.00 15.03 ? 26   SER L N   1 
ATOM   177  C CA  . SER A 1 26  ? 114.578 6.363  61.928  1.00 17.49 ? 26   SER L CA  1 
ATOM   178  C C   . SER A 1 26  ? 113.664 5.840  60.811  1.00 18.91 ? 26   SER L C   1 
ATOM   179  O O   . SER A 1 26  ? 113.482 4.647  60.679  1.00 18.22 ? 26   SER L O   1 
ATOM   180  C CB  . SER A 1 26  ? 113.962 6.067  63.272  1.00 16.71 ? 26   SER L CB  1 
ATOM   181  O OG  . SER A 1 26  ? 112.826 6.868  63.541  1.00 20.94 ? 26   SER L OG  1 
ATOM   182  N N   . GLN A 1 27  ? 113.110 6.748  60.003  1.00 17.81 ? 27   GLN L N   1 
ATOM   183  C CA  . GLN A 1 27  ? 112.219 6.364  58.911  1.00 18.46 ? 27   GLN L CA  1 
ATOM   184  C C   . GLN A 1 27  ? 112.226 7.473  57.906  1.00 17.62 ? 27   GLN L C   1 
ATOM   185  O O   . GLN A 1 27  ? 112.668 8.582  58.233  1.00 19.12 ? 27   GLN L O   1 
ATOM   186  C CB  . GLN A 1 27  ? 110.798 6.143  59.421  1.00 18.97 ? 27   GLN L CB  1 
ATOM   187  C CG  . GLN A 1 27  ? 110.050 7.384  59.889  1.00 19.22 ? 27   GLN L CG  1 
ATOM   188  C CD  . GLN A 1 27  ? 108.712 7.030  60.463  1.00 22.30 ? 27   GLN L CD  1 
ATOM   189  O OE1 . GLN A 1 27  ? 107.662 7.245  59.820  1.00 26.21 ? 27   GLN L OE1 1 
ATOM   190  N NE2 . GLN A 1 27  ? 108.714 6.469  61.658  1.00 19.97 ? 27   GLN L NE2 1 
ATOM   191  N N   . ASP A 1 28  ? 111.763 7.195  56.689  1.00 15.14 ? 28   ASP L N   1 
ATOM   192  C CA  . ASP A 1 28  ? 111.705 8.219  55.651  1.00 14.31 ? 28   ASP L CA  1 
ATOM   193  C C   . ASP A 1 28  ? 111.001 9.519  56.210  1.00 13.15 ? 28   ASP L C   1 
ATOM   194  O O   . ASP A 1 28  ? 109.916 9.452  56.762  1.00 12.59 ? 28   ASP L O   1 
ATOM   195  C CB  . ASP A 1 28  ? 110.931 7.630  54.461  1.00 12.86 ? 28   ASP L CB  1 
ATOM   196  C CG  . ASP A 1 28  ? 110.905 8.563  53.212  1.00 16.42 ? 28   ASP L CG  1 
ATOM   197  O OD1 . ASP A 1 28  ? 110.310 8.143  52.186  1.00 14.17 ? 28   ASP L OD1 1 
ATOM   198  O OD2 . ASP A 1 28  ? 111.478 9.692  53.238  1.00 13.99 ? 28   ASP L OD2 1 
ATOM   199  N N   . ILE A 1 29  ? 111.605 10.694 56.104  1.00 12.10 ? 29   ILE L N   1 
ATOM   200  C CA  . ILE A 1 29  ? 110.859 11.869 56.585  1.00 11.94 ? 29   ILE L CA  1 
ATOM   201  C C   . ILE A 1 29  ? 110.529 12.855 55.474  1.00 12.97 ? 29   ILE L C   1 
ATOM   202  O O   . ILE A 1 29  ? 110.175 14.018 55.720  1.00 12.26 ? 29   ILE L O   1 
ATOM   203  C CB  . ILE A 1 29  ? 111.543 12.592 57.797  1.00 12.44 ? 29   ILE L CB  1 
ATOM   204  C CG1 . ILE A 1 29  ? 113.007 12.966 57.486  1.00 10.41 ? 29   ILE L CG1 1 
ATOM   205  C CG2 . ILE A 1 29  ? 111.447 11.707 58.966  1.00 11.93 ? 29   ILE L CG2 1 
ATOM   206  C CD1 . ILE A 1 29  ? 113.671 13.847 58.537  1.00 11.78 ? 29   ILE L CD1 1 
ATOM   207  N N   . ASN A 1 30  ? 110.658 12.376 54.233  1.00 12.02 ? 30   ASN L N   1 
ATOM   208  C CA  . ASN A 1 30  ? 110.201 13.166 53.099  1.00 12.68 ? 30   ASN L CA  1 
ATOM   209  C C   . ASN A 1 30  ? 110.767 14.575 53.011  1.00 12.65 ? 30   ASN L C   1 
ATOM   210  O O   . ASN A 1 30  ? 110.025 15.500 52.638  1.00 12.08 ? 30   ASN L O   1 
ATOM   211  C CB  . ASN A 1 30  ? 108.678 13.238 53.196  1.00 13.40 ? 30   ASN L CB  1 
ATOM   212  C CG  . ASN A 1 30  ? 108.013 11.894 52.900  1.00 16.31 ? 30   ASN L CG  1 
ATOM   213  O OD1 . ASN A 1 30  ? 108.227 11.316 51.821  1.00 15.60 ? 30   ASN L OD1 1 
ATOM   214  N ND2 . ASN A 1 30  ? 107.235 11.389 53.843  1.00 14.58 ? 30   ASN L ND2 1 
ATOM   215  N N   . LYS A 1 31  ? 112.042 14.736 53.371  1.00 11.09 ? 31   LYS L N   1 
ATOM   216  C CA  . LYS A 1 31  ? 112.703 16.058 53.344  1.00 14.26 ? 31   LYS L CA  1 
ATOM   217  C C   . LYS A 1 31  ? 112.130 17.084 54.364  1.00 13.79 ? 31   LYS L C   1 
ATOM   218  O O   . LYS A 1 31  ? 112.491 18.271 54.318  1.00 14.22 ? 31   LYS L O   1 
ATOM   219  C CB  . LYS A 1 31  ? 112.665 16.662 51.909  1.00 15.33 ? 31   LYS L CB  1 
ATOM   220  C CG  . LYS A 1 31  ? 113.461 15.842 50.921  1.00 18.93 ? 31   LYS L CG  1 
ATOM   221  C CD  . LYS A 1 31  ? 113.459 16.376 49.487  1.00 24.50 ? 31   LYS L CD  1 
ATOM   222  C CE  . LYS A 1 31  ? 113.906 15.278 48.514  1.00 27.98 ? 31   LYS L CE  1 
ATOM   223  N NZ  . LYS A 1 31  ? 113.826 15.717 47.064  1.00 31.45 ? 31   LYS L NZ  1 
ATOM   224  N N   . TYR A 1 32  ? 111.260 16.639 55.278  1.00 13.02 ? 32   TYR L N   1 
ATOM   225  C CA  . TYR A 1 32  ? 110.708 17.537 56.310  1.00 14.48 ? 32   TYR L CA  1 
ATOM   226  C C   . TYR A 1 32  ? 111.761 17.611 57.428  1.00 14.57 ? 32   TYR L C   1 
ATOM   227  O O   . TYR A 1 32  ? 111.614 17.081 58.568  1.00 12.90 ? 32   TYR L O   1 
ATOM   228  C CB  . TYR A 1 32  ? 109.371 17.000 56.845  1.00 13.93 ? 32   TYR L CB  1 
ATOM   229  C CG  . TYR A 1 32  ? 108.320 16.935 55.730  1.00 15.66 ? 32   TYR L CG  1 
ATOM   230  C CD1 . TYR A 1 32  ? 107.433 15.851 55.632  1.00 16.08 ? 32   TYR L CD1 1 
ATOM   231  C CD2 . TYR A 1 32  ? 108.189 17.991 54.801  1.00 15.14 ? 32   TYR L CD2 1 
ATOM   232  C CE1 . TYR A 1 32  ? 106.428 15.820 54.644  1.00 15.47 ? 32   TYR L CE1 1 
ATOM   233  C CE2 . TYR A 1 32  ? 107.200 17.959 53.790  1.00 13.15 ? 32   TYR L CE2 1 
ATOM   234  C CZ  . TYR A 1 32  ? 106.329 16.875 53.733  1.00 16.28 ? 32   TYR L CZ  1 
ATOM   235  O OH  . TYR A 1 32  ? 105.328 16.842 52.804  1.00 17.52 ? 32   TYR L OH  1 
ATOM   236  N N   . LEU A 1 33  ? 112.830 18.315 57.097  1.00 14.09 ? 33   LEU L N   1 
ATOM   237  C CA  . LEU A 1 33  ? 113.932 18.411 58.023  1.00 14.19 ? 33   LEU L CA  1 
ATOM   238  C C   . LEU A 1 33  ? 114.450 19.852 58.134  1.00 14.19 ? 33   LEU L C   1 
ATOM   239  O O   . LEU A 1 33  ? 114.712 20.468 57.125  1.00 12.57 ? 33   LEU L O   1 
ATOM   240  C CB  . LEU A 1 33  ? 115.069 17.487 57.546  1.00 13.71 ? 33   LEU L CB  1 
ATOM   241  C CG  . LEU A 1 33  ? 116.069 17.738 58.699  1.00 18.22 ? 33   LEU L CG  1 
ATOM   242  C CD1 . LEU A 1 33  ? 115.948 16.604 59.728  1.00 13.29 ? 33   LEU L CD1 1 
ATOM   243  C CD2 . LEU A 1 33  ? 117.446 18.043 58.225  1.00 13.07 ? 33   LEU L CD2 1 
ATOM   244  N N   . ASN A 1 34  ? 114.627 20.347 59.359  1.00 13.19 ? 34   ASN L N   1 
ATOM   245  C CA  . ASN A 1 34  ? 115.136 21.700 59.619  1.00 12.84 ? 34   ASN L CA  1 
ATOM   246  C C   . ASN A 1 34  ? 116.455 21.629 60.403  1.00 13.60 ? 34   ASN L C   1 
ATOM   247  O O   . ASN A 1 34  ? 116.713 20.626 61.083  1.00 12.03 ? 34   ASN L O   1 
ATOM   248  C CB  . ASN A 1 34  ? 114.120 22.532 60.464  1.00 11.90 ? 34   ASN L CB  1 
ATOM   249  C CG  . ASN A 1 34  ? 112.784 22.636 59.799  1.00 11.03 ? 34   ASN L CG  1 
ATOM   250  O OD1 . ASN A 1 34  ? 112.717 22.836 58.580  1.00 12.14 ? 34   ASN L OD1 1 
ATOM   251  N ND2 . ASN A 1 34  ? 111.702 22.498 60.576  1.00 11.85 ? 34   ASN L ND2 1 
ATOM   252  N N   . TRP A 1 35  ? 117.274 22.689 60.321  1.00 13.45 ? 35   TRP L N   1 
ATOM   253  C CA  . TRP A 1 35  ? 118.544 22.756 61.064  1.00 12.63 ? 35   TRP L CA  1 
ATOM   254  C C   . TRP A 1 35  ? 118.574 24.049 61.888  1.00 14.87 ? 35   TRP L C   1 
ATOM   255  O O   . TRP A 1 35  ? 118.187 25.158 61.368  1.00 10.70 ? 35   TRP L O   1 
ATOM   256  C CB  . TRP A 1 35  ? 119.770 22.788 60.144  1.00 13.20 ? 35   TRP L CB  1 
ATOM   257  C CG  . TRP A 1 35  ? 120.029 21.516 59.453  1.00 13.30 ? 35   TRP L CG  1 
ATOM   258  C CD1 . TRP A 1 35  ? 119.649 21.182 58.195  1.00 13.26 ? 35   TRP L CD1 1 
ATOM   259  C CD2 . TRP A 1 35  ? 120.807 20.438 59.947  1.00 13.17 ? 35   TRP L CD2 1 
ATOM   260  N NE1 . TRP A 1 35  ? 120.153 19.963 57.866  1.00 11.16 ? 35   TRP L NE1 1 
ATOM   261  C CE2 . TRP A 1 35  ? 120.875 19.478 58.929  1.00 14.79 ? 35   TRP L CE2 1 
ATOM   262  C CE3 . TRP A 1 35  ? 121.474 20.196 61.172  1.00 12.94 ? 35   TRP L CE3 1 
ATOM   263  C CZ2 . TRP A 1 35  ? 121.595 18.268 59.081  1.00 11.85 ? 35   TRP L CZ2 1 
ATOM   264  C CZ3 . TRP A 1 35  ? 122.182 19.004 61.323  1.00 14.67 ? 35   TRP L CZ3 1 
ATOM   265  C CH2 . TRP A 1 35  ? 122.236 18.058 60.287  1.00 14.55 ? 35   TRP L CH2 1 
ATOM   266  N N   . TYR A 1 36  ? 119.028 23.901 63.145  1.00 12.56 ? 36   TYR L N   1 
ATOM   267  C CA  . TYR A 1 36  ? 119.160 25.052 64.057  1.00 14.18 ? 36   TYR L CA  1 
ATOM   268  C C   . TYR A 1 36  ? 120.577 25.184 64.587  1.00 13.44 ? 36   TYR L C   1 
ATOM   269  O O   . TYR A 1 36  ? 121.368 24.191 64.683  1.00 12.08 ? 36   TYR L O   1 
ATOM   270  C CB  . TYR A 1 36  ? 118.208 24.957 65.274  1.00 11.83 ? 36   TYR L CB  1 
ATOM   271  C CG  . TYR A 1 36  ? 116.767 24.745 64.896  1.00 12.92 ? 36   TYR L CG  1 
ATOM   272  C CD1 . TYR A 1 36  ? 116.265 23.461 64.624  1.00 10.62 ? 36   TYR L CD1 1 
ATOM   273  C CD2 . TYR A 1 36  ? 115.917 25.837 64.751  1.00 11.60 ? 36   TYR L CD2 1 
ATOM   274  C CE1 . TYR A 1 36  ? 114.944 23.290 64.205  1.00 11.66 ? 36   TYR L CE1 1 
ATOM   275  C CE2 . TYR A 1 36  ? 114.618 25.696 64.342  1.00 12.74 ? 36   TYR L CE2 1 
ATOM   276  C CZ  . TYR A 1 36  ? 114.121 24.417 64.051  1.00 13.67 ? 36   TYR L CZ  1 
ATOM   277  O OH  . TYR A 1 36  ? 112.838 24.350 63.524  1.00 11.58 ? 36   TYR L OH  1 
ATOM   278  N N   . GLN A 1 37  ? 120.901 26.429 64.939  1.00 13.10 ? 37   GLN L N   1 
ATOM   279  C CA  . GLN A 1 37  ? 122.206 26.718 65.524  1.00 13.64 ? 37   GLN L CA  1 
ATOM   280  C C   . GLN A 1 37  ? 122.049 27.258 66.954  1.00 15.29 ? 37   GLN L C   1 
ATOM   281  O O   . GLN A 1 37  ? 121.317 28.232 67.179  1.00 15.59 ? 37   GLN L O   1 
ATOM   282  C CB  . GLN A 1 37  ? 122.927 27.762 64.666  1.00 14.40 ? 37   GLN L CB  1 
ATOM   283  C CG  . GLN A 1 37  ? 124.284 28.146 65.198  1.00 12.91 ? 37   GLN L CG  1 
ATOM   284  C CD  . GLN A 1 37  ? 124.727 29.484 64.622  1.00 16.05 ? 37   GLN L CD  1 
ATOM   285  O OE1 . GLN A 1 37  ? 124.129 30.528 64.906  1.00 14.58 ? 37   GLN L OE1 1 
ATOM   286  N NE2 . GLN A 1 37  ? 125.765 29.460 63.803  1.00 19.25 ? 37   GLN L NE2 1 
ATOM   287  N N   . GLN A 1 38  ? 122.692 26.622 67.933  1.00 14.94 ? 38   GLN L N   1 
ATOM   288  C CA  . GLN A 1 38  ? 122.668 27.190 69.294  1.00 14.45 ? 38   GLN L CA  1 
ATOM   289  C C   . GLN A 1 38  ? 124.101 27.652 69.625  1.00 15.78 ? 38   GLN L C   1 
ATOM   290  O O   . GLN A 1 38  ? 125.044 26.832 69.686  1.00 12.45 ? 38   GLN L O   1 
ATOM   291  C CB  . GLN A 1 38  ? 122.250 26.196 70.349  1.00 14.09 ? 38   GLN L CB  1 
ATOM   292  C CG  . GLN A 1 38  ? 121.934 26.959 71.683  1.00 13.65 ? 38   GLN L CG  1 
ATOM   293  C CD  . GLN A 1 38  ? 121.338 26.058 72.735  1.00 13.77 ? 38   GLN L CD  1 
ATOM   294  O OE1 . GLN A 1 38  ? 121.712 24.882 72.834  1.00 13.11 ? 38   GLN L OE1 1 
ATOM   295  N NE2 . GLN A 1 38  ? 120.422 26.593 73.532  1.00 11.97 ? 38   GLN L NE2 1 
ATOM   296  N N   . LYS A 1 39  ? 124.274 28.955 69.820  1.00 18.72 ? 39   LYS L N   1 
ATOM   297  C CA  . LYS A 1 39  ? 125.612 29.462 70.120  1.00 23.21 ? 39   LYS L CA  1 
ATOM   298  C C   . LYS A 1 39  ? 126.024 29.181 71.555  1.00 25.46 ? 39   LYS L C   1 
ATOM   299  O O   . LYS A 1 39  ? 125.180 28.881 72.391  1.00 25.63 ? 39   LYS L O   1 
ATOM   300  C CB  . LYS A 1 39  ? 125.690 30.937 69.756  1.00 25.39 ? 39   LYS L CB  1 
ATOM   301  C CG  . LYS A 1 39  ? 125.936 31.053 68.244  1.00 26.24 ? 39   LYS L CG  1 
ATOM   302  C CD  . LYS A 1 39  ? 126.307 32.439 67.856  1.00 31.06 ? 39   LYS L CD  1 
ATOM   303  C CE  . LYS A 1 39  ? 126.749 32.484 66.405  1.00 31.53 ? 39   LYS L CE  1 
ATOM   304  N NZ  . LYS A 1 39  ? 126.797 33.876 65.898  1.00 32.94 ? 39   LYS L NZ  1 
ATOM   305  N N   . PRO A 1 40  ? 127.334 29.205 71.851  1.00 28.21 ? 40   PRO L N   1 
ATOM   306  C CA  . PRO A 1 40  ? 127.770 28.923 73.229  1.00 30.08 ? 40   PRO L CA  1 
ATOM   307  C C   . PRO A 1 40  ? 126.996 29.711 74.294  1.00 32.09 ? 40   PRO L C   1 
ATOM   308  O O   . PRO A 1 40  ? 126.781 29.188 75.395  1.00 33.77 ? 40   PRO L O   1 
ATOM   309  C CB  . PRO A 1 40  ? 129.254 29.269 73.206  1.00 29.28 ? 40   PRO L CB  1 
ATOM   310  C CG  . PRO A 1 40  ? 129.666 28.909 71.790  1.00 30.64 ? 40   PRO L CG  1 
ATOM   311  C CD  . PRO A 1 40  ? 128.494 29.465 70.965  1.00 30.02 ? 40   PRO L CD  1 
ATOM   312  N N   . ASP A 1 41  ? 126.556 30.936 73.964  1.00 32.73 ? 41   ASP L N   1 
ATOM   313  C CA  . ASP A 1 41  ? 125.783 31.761 74.910  1.00 33.13 ? 41   ASP L CA  1 
ATOM   314  C C   . ASP A 1 41  ? 124.309 31.342 75.053  1.00 31.84 ? 41   ASP L C   1 
ATOM   315  O O   . ASP A 1 41  ? 123.531 31.994 75.770  1.00 31.67 ? 41   ASP L O   1 
ATOM   316  C CB  . ASP A 1 41  ? 125.860 33.261 74.529  1.00 35.52 ? 41   ASP L CB  1 
ATOM   317  C CG  . ASP A 1 41  ? 124.933 33.657 73.345  1.00 39.38 ? 41   ASP L CG  1 
ATOM   318  O OD1 . ASP A 1 41  ? 124.966 34.849 72.949  1.00 39.86 ? 41   ASP L OD1 1 
ATOM   319  O OD2 . ASP A 1 41  ? 124.171 32.811 72.808  1.00 40.02 ? 41   ASP L OD2 1 
ATOM   320  N N   . GLY A 1 42  ? 123.905 30.270 74.367  1.00 30.15 ? 42   GLY L N   1 
ATOM   321  C CA  . GLY A 1 42  ? 122.510 29.825 74.475  1.00 27.00 ? 42   GLY L CA  1 
ATOM   322  C C   . GLY A 1 42  ? 121.503 30.275 73.395  1.00 24.23 ? 42   GLY L C   1 
ATOM   323  O O   . GLY A 1 42  ? 120.456 29.659 73.261  1.00 23.06 ? 42   GLY L O   1 
ATOM   324  N N   . ALA A 1 43  ? 121.828 31.305 72.609  1.00 21.33 ? 43   ALA L N   1 
ATOM   325  C CA  . ALA A 1 43  ? 120.901 31.829 71.601  1.00 18.68 ? 43   ALA L CA  1 
ATOM   326  C C   . ALA A 1 43  ? 120.654 30.780 70.511  1.00 17.27 ? 43   ALA L C   1 
ATOM   327  O O   . ALA A 1 43  ? 121.617 30.219 69.943  1.00 16.87 ? 43   ALA L O   1 
ATOM   328  C CB  . ALA A 1 43  ? 121.478 33.103 70.958  1.00 19.95 ? 43   ALA L CB  1 
ATOM   329  N N   . VAL A 1 44  ? 119.388 30.507 70.231  1.00 15.94 ? 44   VAL L N   1 
ATOM   330  C CA  . VAL A 1 44  ? 119.034 29.527 69.165  1.00 15.75 ? 44   VAL L CA  1 
ATOM   331  C C   . VAL A 1 44  ? 118.466 30.246 67.928  1.00 16.11 ? 44   VAL L C   1 
ATOM   332  O O   . VAL A 1 44  ? 117.664 31.192 68.076  1.00 14.13 ? 44   VAL L O   1 
ATOM   333  C CB  . VAL A 1 44  ? 117.926 28.559 69.660  1.00 15.11 ? 44   VAL L CB  1 
ATOM   334  C CG1 . VAL A 1 44  ? 117.552 27.544 68.561  1.00 14.75 ? 44   VAL L CG1 1 
ATOM   335  C CG2 . VAL A 1 44  ? 118.416 27.861 70.966  1.00 15.87 ? 44   VAL L CG2 1 
ATOM   336  N N   . LYS A 1 45  ? 118.863 29.826 66.714  1.00 14.66 ? 45   LYS L N   1 
ATOM   337  C CA  . LYS A 1 45  ? 118.253 30.440 65.558  1.00 15.99 ? 45   LYS L CA  1 
ATOM   338  C C   . LYS A 1 45  ? 118.037 29.378 64.491  1.00 14.70 ? 45   LYS L C   1 
ATOM   339  O O   . LYS A 1 45  ? 118.764 28.369 64.452  1.00 12.72 ? 45   LYS L O   1 
ATOM   340  C CB  . LYS A 1 45  ? 119.114 31.594 65.038  1.00 18.97 ? 45   LYS L CB  1 
ATOM   341  C CG  . LYS A 1 45  ? 120.329 31.146 64.288  1.00 25.03 ? 45   LYS L CG  1 
ATOM   342  C CD  . LYS A 1 45  ? 121.123 32.363 63.748  1.00 29.94 ? 45   LYS L CD  1 
ATOM   343  C CE  . LYS A 1 45  ? 122.201 31.969 62.707  1.00 32.06 ? 45   LYS L CE  1 
ATOM   344  N NZ  . LYS A 1 45  ? 122.806 33.171 62.057  1.00 32.12 ? 45   LYS L NZ  1 
ATOM   345  N N   . LEU A 1 46  ? 117.031 29.580 63.652  1.00 13.68 ? 46   LEU L N   1 
ATOM   346  C CA  . LEU A 1 46  ? 116.754 28.636 62.554  1.00 13.13 ? 46   LEU L CA  1 
ATOM   347  C C   . LEU A 1 46  ? 117.748 28.944 61.429  1.00 14.85 ? 46   LEU L C   1 
ATOM   348  O O   . LEU A 1 46  ? 117.966 30.103 61.102  1.00 12.28 ? 46   LEU L O   1 
ATOM   349  C CB  . LEU A 1 46  ? 115.355 28.872 62.028  1.00 12.60 ? 46   LEU L CB  1 
ATOM   350  C CG  . LEU A 1 46  ? 115.057 28.162 60.704  1.00 11.80 ? 46   LEU L CG  1 
ATOM   351  C CD1 . LEU A 1 46  ? 114.898 26.640 60.945  1.00 10.71 ? 46   LEU L CD1 1 
ATOM   352  C CD2 . LEU A 1 46  ? 113.742 28.736 60.155  1.00 12.41 ? 46   LEU L CD2 1 
ATOM   353  N N   . LEU A 1 47  ? 118.349 27.925 60.826  1.00 15.02 ? 47   LEU L N   1 
ATOM   354  C CA  . LEU A 1 47  ? 119.274 28.175 59.728  1.00 16.14 ? 47   LEU L CA  1 
ATOM   355  C C   . LEU A 1 47  ? 118.706 27.691 58.397  1.00 16.71 ? 47   LEU L C   1 
ATOM   356  O O   . LEU A 1 47  ? 118.739 28.418 57.413  1.00 16.84 ? 47   LEU L O   1 
ATOM   357  C CB  . LEU A 1 47  ? 120.616 27.452 59.929  1.00 18.46 ? 47   LEU L CB  1 
ATOM   358  C CG  . LEU A 1 47  ? 121.454 27.832 61.163  1.00 20.54 ? 47   LEU L CG  1 
ATOM   359  C CD1 . LEU A 1 47  ? 122.579 26.797 61.340  1.00 24.87 ? 47   LEU L CD1 1 
ATOM   360  C CD2 . LEU A 1 47  ? 122.027 29.204 61.006  1.00 19.99 ? 47   LEU L CD2 1 
ATOM   361  N N   . ILE A 1 48  ? 118.208 26.459 58.380  1.00 14.82 ? 48   ILE L N   1 
ATOM   362  C CA  . ILE A 1 48  ? 117.747 25.843 57.134  1.00 15.46 ? 48   ILE L CA  1 
ATOM   363  C C   . ILE A 1 48  ? 116.412 25.194 57.413  1.00 15.23 ? 48   ILE L C   1 
ATOM   364  O O   . ILE A 1 48  ? 116.248 24.571 58.484  1.00 14.16 ? 48   ILE L O   1 
ATOM   365  C CB  . ILE A 1 48  ? 118.766 24.745 56.682  1.00 16.37 ? 48   ILE L CB  1 
ATOM   366  C CG1 . ILE A 1 48  ? 120.154 25.368 56.487  1.00 17.13 ? 48   ILE L CG1 1 
ATOM   367  C CG2 . ILE A 1 48  ? 118.284 24.013 55.387  1.00 13.02 ? 48   ILE L CG2 1 
ATOM   368  C CD1 . ILE A 1 48  ? 120.358 26.048 55.198  1.00 20.97 ? 48   ILE L CD1 1 
ATOM   369  N N   . PHE A 1 49  ? 115.470 25.335 56.482  1.00 13.86 ? 49   PHE L N   1 
ATOM   370  C CA  . PHE A 1 49  ? 114.162 24.715 56.650  1.00 14.61 ? 49   PHE L CA  1 
ATOM   371  C C   . PHE A 1 49  ? 113.859 23.921 55.385  1.00 14.55 ? 49   PHE L C   1 
ATOM   372  O O   . PHE A 1 49  ? 114.425 24.214 54.299  1.00 15.26 ? 49   PHE L O   1 
ATOM   373  C CB  . PHE A 1 49  ? 113.056 25.745 56.985  1.00 13.68 ? 49   PHE L CB  1 
ATOM   374  C CG  . PHE A 1 49  ? 112.813 26.802 55.923  1.00 14.62 ? 49   PHE L CG  1 
ATOM   375  C CD1 . PHE A 1 49  ? 111.797 26.626 54.971  1.00 16.53 ? 49   PHE L CD1 1 
ATOM   376  C CD2 . PHE A 1 49  ? 113.565 27.978 55.896  1.00 16.90 ? 49   PHE L CD2 1 
ATOM   377  C CE1 . PHE A 1 49  ? 111.509 27.635 53.964  1.00 16.65 ? 49   PHE L CE1 1 
ATOM   378  C CE2 . PHE A 1 49  ? 113.311 28.986 54.917  1.00 18.52 ? 49   PHE L CE2 1 
ATOM   379  C CZ  . PHE A 1 49  ? 112.273 28.801 53.953  1.00 16.71 ? 49   PHE L CZ  1 
ATOM   380  N N   . TYR A 1 50  ? 113.018 22.898 55.549  1.00 14.40 ? 50   TYR L N   1 
ATOM   381  C CA  . TYR A 1 50  ? 112.624 21.994 54.459  1.00 14.63 ? 50   TYR L CA  1 
ATOM   382  C C   . TYR A 1 50  ? 113.883 21.514 53.700  1.00 14.05 ? 50   TYR L C   1 
ATOM   383  O O   . TYR A 1 50  ? 114.027 21.730 52.495  1.00 11.64 ? 50   TYR L O   1 
ATOM   384  C CB  . TYR A 1 50  ? 111.673 22.728 53.490  1.00 17.13 ? 50   TYR L CB  1 
ATOM   385  C CG  . TYR A 1 50  ? 110.902 21.823 52.546  1.00 16.89 ? 50   TYR L CG  1 
ATOM   386  C CD1 . TYR A 1 50  ? 110.316 22.344 51.383  1.00 21.02 ? 50   TYR L CD1 1 
ATOM   387  C CD2 . TYR A 1 50  ? 110.692 20.479 52.847  1.00 17.67 ? 50   TYR L CD2 1 
ATOM   388  C CE1 . TYR A 1 50  ? 109.516 21.551 50.553  1.00 22.93 ? 50   TYR L CE1 1 
ATOM   389  C CE2 . TYR A 1 50  ? 109.898 19.657 52.025  1.00 19.80 ? 50   TYR L CE2 1 
ATOM   390  C CZ  . TYR A 1 50  ? 109.300 20.193 50.886  1.00 22.54 ? 50   TYR L CZ  1 
ATOM   391  O OH  . TYR A 1 50  ? 108.436 19.415 50.126  1.00 22.87 ? 50   TYR L OH  1 
ATOM   392  N N   . THR A 1 51  ? 114.797 20.901 54.452  1.00 10.46 ? 51   THR L N   1 
ATOM   393  C CA  . THR A 1 51  ? 116.057 20.379 53.966  1.00 11.15 ? 51   THR L CA  1 
ATOM   394  C C   . THR A 1 51  ? 117.101 21.345 53.396  1.00 12.78 ? 51   THR L C   1 
ATOM   395  O O   . THR A 1 51  ? 118.286 21.212 53.724  1.00 11.75 ? 51   THR L O   1 
ATOM   396  C CB  . THR A 1 51  ? 115.852 19.258 52.877  1.00 11.10 ? 51   THR L CB  1 
ATOM   397  O OG1 . THR A 1 51  ? 115.201 18.124 53.489  1.00 12.12 ? 51   THR L OG1 1 
ATOM   398  C CG2 . THR A 1 51  ? 117.218 18.818 52.289  1.00 9.65  ? 51   THR L CG2 1 
ATOM   399  N N   . SER A 1 52  ? 116.686 22.292 52.552  1.00 12.31 ? 52   SER L N   1 
ATOM   400  C CA  . SER A 1 52  ? 117.675 23.162 51.898  1.00 13.25 ? 52   SER L CA  1 
ATOM   401  C C   . SER A 1 52  ? 117.416 24.662 51.781  1.00 14.61 ? 52   SER L C   1 
ATOM   402  O O   . SER A 1 52  ? 118.250 25.363 51.201  1.00 16.76 ? 52   SER L O   1 
ATOM   403  C CB  . SER A 1 52  ? 117.884 22.653 50.469  1.00 15.30 ? 52   SER L CB  1 
ATOM   404  O OG  . SER A 1 52  ? 116.634 22.745 49.769  1.00 19.25 ? 52   SER L OG  1 
ATOM   405  N N   . SER A 1 53  ? 116.278 25.160 52.244  1.00 14.30 ? 53   SER L N   1 
ATOM   406  C CA  . SER A 1 53  ? 115.996 26.610 52.126  1.00 16.11 ? 53   SER L CA  1 
ATOM   407  C C   . SER A 1 53  ? 116.674 27.410 53.259  1.00 15.86 ? 53   SER L C   1 
ATOM   408  O O   . SER A 1 53  ? 116.538 27.064 54.455  1.00 14.21 ? 53   SER L O   1 
ATOM   409  C CB  . SER A 1 53  ? 114.494 26.881 52.184  1.00 15.85 ? 53   SER L CB  1 
ATOM   410  O OG  . SER A 1 53  ? 113.851 26.304 51.072  1.00 20.81 ? 53   SER L OG  1 
ATOM   411  N N   . LEU A 1 54  ? 117.412 28.456 52.887  1.00 15.54 ? 54   LEU L N   1 
ATOM   412  C CA  . LEU A 1 54  ? 118.081 29.276 53.899  1.00 16.92 ? 54   LEU L CA  1 
ATOM   413  C C   . LEU A 1 54  ? 117.135 30.242 54.549  1.00 16.65 ? 54   LEU L C   1 
ATOM   414  O O   . LEU A 1 54  ? 116.369 30.888 53.872  1.00 14.61 ? 54   LEU L O   1 
ATOM   415  C CB  . LEU A 1 54  ? 119.240 30.072 53.316  1.00 16.76 ? 54   LEU L CB  1 
ATOM   416  C CG  . LEU A 1 54  ? 120.596 29.358 53.355  1.00 21.26 ? 54   LEU L CG  1 
ATOM   417  C CD1 . LEU A 1 54  ? 120.624 28.129 52.392  1.00 22.90 ? 54   LEU L CD1 1 
ATOM   418  C CD2 . LEU A 1 54  ? 121.668 30.391 52.892  1.00 22.61 ? 54   LEU L CD2 1 
ATOM   419  N N   . HIS A 1 55  ? 117.179 30.358 55.873  1.00 16.85 ? 55   HIS L N   1 
ATOM   420  C CA  . HIS A 1 55  ? 116.292 31.325 56.542  1.00 17.83 ? 55   HIS L CA  1 
ATOM   421  C C   . HIS A 1 55  ? 116.869 32.763 56.308  1.00 19.13 ? 55   HIS L C   1 
ATOM   422  O O   . HIS A 1 55  ? 118.055 32.923 55.946  1.00 17.19 ? 55   HIS L O   1 
ATOM   423  C CB  . HIS A 1 55  ? 116.237 31.038 58.061  1.00 19.18 ? 55   HIS L CB  1 
ATOM   424  C CG  . HIS A 1 55  ? 115.196 31.831 58.798  1.00 18.90 ? 55   HIS L CG  1 
ATOM   425  N ND1 . HIS A 1 55  ? 115.380 32.270 60.096  1.00 21.60 ? 55   HIS L ND1 1 
ATOM   426  C CD2 . HIS A 1 55  ? 113.936 32.173 58.464  1.00 18.88 ? 55   HIS L CD2 1 
ATOM   427  C CE1 . HIS A 1 55  ? 114.271 32.844 60.527  1.00 18.96 ? 55   HIS L CE1 1 
ATOM   428  N NE2 . HIS A 1 55  ? 113.383 32.800 59.553  1.00 21.57 ? 55   HIS L NE2 1 
ATOM   429  N N   . SER A 1 56  ? 116.030 33.782 56.548  1.00 20.18 ? 56   SER L N   1 
ATOM   430  C CA  . SER A 1 56  ? 116.394 35.204 56.376  1.00 21.88 ? 56   SER L CA  1 
ATOM   431  C C   . SER A 1 56  ? 117.614 35.485 57.157  1.00 22.25 ? 56   SER L C   1 
ATOM   432  O O   . SER A 1 56  ? 117.732 35.031 58.293  1.00 21.06 ? 56   SER L O   1 
ATOM   433  C CB  . SER A 1 56  ? 115.341 36.157 56.964  1.00 24.02 ? 56   SER L CB  1 
ATOM   434  O OG  . SER A 1 56  ? 114.049 35.837 56.520  1.00 28.23 ? 56   SER L OG  1 
ATOM   435  N N   . GLY A 1 57  ? 118.509 36.267 56.569  1.00 22.36 ? 57   GLY L N   1 
ATOM   436  C CA  . GLY A 1 57  ? 119.721 36.639 57.279  1.00 23.66 ? 57   GLY L CA  1 
ATOM   437  C C   . GLY A 1 57  ? 120.871 35.651 57.297  1.00 23.63 ? 57   GLY L C   1 
ATOM   438  O O   . GLY A 1 57  ? 122.008 36.068 57.561  1.00 25.96 ? 57   GLY L O   1 
ATOM   439  N N   . VAL A 1 58  ? 120.614 34.374 57.017  1.00 21.47 ? 58   VAL L N   1 
ATOM   440  C CA  . VAL A 1 58  ? 121.665 33.345 57.060  1.00 21.26 ? 58   VAL L CA  1 
ATOM   441  C C   . VAL A 1 58  ? 122.619 33.425 55.888  1.00 21.59 ? 58   VAL L C   1 
ATOM   442  O O   . VAL A 1 58  ? 122.205 33.448 54.726  1.00 21.11 ? 58   VAL L O   1 
ATOM   443  C CB  . VAL A 1 58  ? 121.047 31.917 57.088  1.00 20.85 ? 58   VAL L CB  1 
ATOM   444  C CG1 . VAL A 1 58  ? 122.157 30.872 57.162  1.00 21.69 ? 58   VAL L CG1 1 
ATOM   445  C CG2 . VAL A 1 58  ? 120.053 31.800 58.277  1.00 20.51 ? 58   VAL L CG2 1 
ATOM   446  N N   . PRO A 1 59  ? 123.920 33.428 56.163  1.00 21.16 ? 59   PRO L N   1 
ATOM   447  C CA  . PRO A 1 59  ? 124.817 33.515 55.006  1.00 21.28 ? 59   PRO L CA  1 
ATOM   448  C C   . PRO A 1 59  ? 124.893 32.250 54.159  1.00 22.27 ? 59   PRO L C   1 
ATOM   449  O O   . PRO A 1 59  ? 124.678 31.117 54.637  1.00 22.41 ? 59   PRO L O   1 
ATOM   450  C CB  . PRO A 1 59  ? 126.166 33.891 55.630  1.00 21.14 ? 59   PRO L CB  1 
ATOM   451  C CG  . PRO A 1 59  ? 126.088 33.270 57.021  1.00 21.31 ? 59   PRO L CG  1 
ATOM   452  C CD  . PRO A 1 59  ? 124.643 33.551 57.437  1.00 20.73 ? 59   PRO L CD  1 
ATOM   453  N N   . SER A 1 60  ? 125.209 32.459 52.887  1.00 21.48 ? 60   SER L N   1 
ATOM   454  C CA  . SER A 1 60  ? 125.333 31.402 51.903  1.00 21.82 ? 60   SER L CA  1 
ATOM   455  C C   . SER A 1 60  ? 126.372 30.336 52.153  1.00 21.27 ? 60   SER L C   1 
ATOM   456  O O   . SER A 1 60  ? 126.378 29.302 51.470  1.00 21.45 ? 60   SER L O   1 
ATOM   457  C CB  . SER A 1 60  ? 125.573 32.028 50.541  1.00 20.59 ? 60   SER L CB  1 
ATOM   458  O OG  . SER A 1 60  ? 124.331 32.595 50.208  1.00 25.20 ? 60   SER L OG  1 
ATOM   459  N N   . ARG A 1 61  ? 127.295 30.574 53.072  1.00 21.32 ? 61   ARG L N   1 
ATOM   460  C CA  . ARG A 1 61  ? 128.250 29.486 53.349  1.00 20.92 ? 61   ARG L CA  1 
ATOM   461  C C   . ARG A 1 61  ? 127.516 28.241 53.975  1.00 19.04 ? 61   ARG L C   1 
ATOM   462  O O   . ARG A 1 61  ? 128.080 27.146 54.009  1.00 18.24 ? 61   ARG L O   1 
ATOM   463  C CB  . ARG A 1 61  ? 129.374 29.945 54.277  1.00 19.46 ? 61   ARG L CB  1 
ATOM   464  C CG  . ARG A 1 61  ? 128.954 30.468 55.646  1.00 19.39 ? 61   ARG L CG  1 
ATOM   465  C CD  . ARG A 1 61  ? 130.268 30.726 56.473  1.00 21.02 ? 61   ARG L CD  1 
ATOM   466  N NE  . ARG A 1 61  ? 129.938 31.195 57.804  1.00 20.13 ? 61   ARG L NE  1 
ATOM   467  C CZ  . ARG A 1 61  ? 129.576 32.434 58.039  1.00 18.99 ? 61   ARG L CZ  1 
ATOM   468  N NH1 . ARG A 1 61  ? 129.546 33.275 57.021  1.00 23.33 ? 61   ARG L NH1 1 
ATOM   469  N NH2 . ARG A 1 61  ? 129.199 32.821 59.247  1.00 20.47 ? 61   ARG L NH2 1 
ATOM   470  N N   . PHE A 1 62  ? 126.283 28.436 54.458  1.00 17.76 ? 62   PHE L N   1 
ATOM   471  C CA  . PHE A 1 62  ? 125.468 27.346 55.025  1.00 18.41 ? 62   PHE L CA  1 
ATOM   472  C C   . PHE A 1 62  ? 124.586 26.770 53.904  1.00 19.63 ? 62   PHE L C   1 
ATOM   473  O O   . PHE A 1 62  ? 123.995 27.540 53.144  1.00 20.39 ? 62   PHE L O   1 
ATOM   474  C CB  . PHE A 1 62  ? 124.526 27.846 56.136  1.00 18.05 ? 62   PHE L CB  1 
ATOM   475  C CG  . PHE A 1 62  ? 125.213 28.215 57.415  1.00 18.63 ? 62   PHE L CG  1 
ATOM   476  C CD1 . PHE A 1 62  ? 125.502 29.552 57.719  1.00 20.51 ? 62   PHE L CD1 1 
ATOM   477  C CD2 . PHE A 1 62  ? 125.578 27.221 58.326  1.00 18.86 ? 62   PHE L CD2 1 
ATOM   478  C CE1 . PHE A 1 62  ? 126.154 29.904 58.937  1.00 20.54 ? 62   PHE L CE1 1 
ATOM   479  C CE2 . PHE A 1 62  ? 126.211 27.543 59.516  1.00 18.56 ? 62   PHE L CE2 1 
ATOM   480  C CZ  . PHE A 1 62  ? 126.507 28.898 59.831  1.00 20.31 ? 62   PHE L CZ  1 
ATOM   481  N N   . SER A 1 63  ? 124.522 25.443 53.777  1.00 17.21 ? 63   SER L N   1 
ATOM   482  C CA  . SER A 1 63  ? 123.632 24.832 52.801  1.00 16.87 ? 63   SER L CA  1 
ATOM   483  C C   . SER A 1 63  ? 123.172 23.480 53.408  1.00 17.27 ? 63   SER L C   1 
ATOM   484  O O   . SER A 1 63  ? 123.869 22.872 54.261  1.00 17.01 ? 63   SER L O   1 
ATOM   485  C CB  . SER A 1 63  ? 124.324 24.610 51.444  1.00 16.95 ? 63   SER L CB  1 
ATOM   486  O OG  . SER A 1 63  ? 125.464 23.758 51.580  1.00 18.72 ? 63   SER L OG  1 
ATOM   487  N N   . GLY A 1 64  ? 122.010 23.014 52.983  1.00 13.87 ? 64   GLY L N   1 
ATOM   488  C CA  . GLY A 1 64  ? 121.537 21.756 53.509  1.00 14.57 ? 64   GLY L CA  1 
ATOM   489  C C   . GLY A 1 64  ? 121.137 20.853 52.372  1.00 15.76 ? 64   GLY L C   1 
ATOM   490  O O   . GLY A 1 64  ? 120.702 21.322 51.311  1.00 14.45 ? 64   GLY L O   1 
ATOM   491  N N   . SER A 1 65  ? 121.313 19.554 52.552  1.00 15.67 ? 65   SER L N   1 
ATOM   492  C CA  . SER A 1 65  ? 120.881 18.674 51.507  1.00 16.68 ? 65   SER L CA  1 
ATOM   493  C C   . SER A 1 65  ? 120.432 17.363 52.121  1.00 16.92 ? 65   SER L C   1 
ATOM   494  O O   . SER A 1 65  ? 120.559 17.181 53.354  1.00 15.37 ? 65   SER L O   1 
ATOM   495  C CB  . SER A 1 65  ? 122.002 18.483 50.491  1.00 19.15 ? 65   SER L CB  1 
ATOM   496  O OG  . SER A 1 65  ? 123.159 18.003 51.137  1.00 21.98 ? 65   SER L OG  1 
ATOM   497  N N   . GLY A 1 66  ? 119.885 16.483 51.269  1.00 14.88 ? 66   GLY L N   1 
ATOM   498  C CA  . GLY A 1 66  ? 119.429 15.181 51.711  1.00 15.60 ? 66   GLY L CA  1 
ATOM   499  C C   . GLY A 1 66  ? 118.019 14.800 51.260  1.00 15.84 ? 66   GLY L C   1 
ATOM   500  O O   . GLY A 1 66  ? 117.304 15.597 50.648  1.00 14.98 ? 66   GLY L O   1 
ATOM   501  N N   . SER A 1 67  ? 117.620 13.569 51.593  1.00 13.76 ? 67   SER L N   1 
ATOM   502  C CA  . SER A 1 67  ? 116.300 13.040 51.267  1.00 15.26 ? 67   SER L CA  1 
ATOM   503  C C   . SER A 1 67  ? 116.194 11.725 52.060  1.00 16.10 ? 67   SER L C   1 
ATOM   504  O O   . SER A 1 67  ? 117.186 11.274 52.669  1.00 16.86 ? 67   SER L O   1 
ATOM   505  C CB  . SER A 1 67  ? 116.184 12.754 49.754  1.00 15.00 ? 67   SER L CB  1 
ATOM   506  O OG  . SER A 1 67  ? 117.013 11.670 49.396  1.00 16.95 ? 67   SER L OG  1 
ATOM   507  N N   . GLY A 1 68  ? 115.003 11.131 52.064  1.00 16.38 ? 68   GLY L N   1 
ATOM   508  C CA  . GLY A 1 68  ? 114.816 9.885  52.769  1.00 15.63 ? 68   GLY L CA  1 
ATOM   509  C C   . GLY A 1 68  ? 115.160 10.001 54.247  1.00 15.89 ? 68   GLY L C   1 
ATOM   510  O O   . GLY A 1 68  ? 114.540 10.787 54.976  1.00 13.09 ? 68   GLY L O   1 
ATOM   511  N N   . THR A 1 69  ? 116.128 9.196  54.698  1.00 15.20 ? 69   THR L N   1 
ATOM   512  C CA  . THR A 1 69  ? 116.517 9.222  56.102  1.00 15.66 ? 69   THR L CA  1 
ATOM   513  C C   . THR A 1 69  ? 117.782 10.059 56.389  1.00 15.70 ? 69   THR L C   1 
ATOM   514  O O   . THR A 1 69  ? 117.970 10.491 57.541  1.00 18.08 ? 69   THR L O   1 
ATOM   515  C CB  . THR A 1 69  ? 116.801 7.793  56.645  1.00 16.42 ? 69   THR L CB  1 
ATOM   516  O OG1 . THR A 1 69  ? 117.945 7.264  55.972  1.00 14.21 ? 69   THR L OG1 1 
ATOM   517  C CG2 . THR A 1 69  ? 115.605 6.870  56.412  1.00 17.54 ? 69   THR L CG2 1 
ATOM   518  N N   . ASP A 1 70  ? 118.621 10.282 55.375  1.00 13.96 ? 70   ASP L N   1 
ATOM   519  C CA  . ASP A 1 70  ? 119.909 10.962 55.558  1.00 15.17 ? 70   ASP L CA  1 
ATOM   520  C C   . ASP A 1 70  ? 119.989 12.430 55.087  1.00 14.43 ? 70   ASP L C   1 
ATOM   521  O O   . ASP A 1 70  ? 119.791 12.720 53.910  1.00 12.10 ? 70   ASP L O   1 
ATOM   522  C CB  . ASP A 1 70  ? 121.032 10.164 54.878  1.00 16.03 ? 70   ASP L CB  1 
ATOM   523  C CG  . ASP A 1 70  ? 121.296 8.813  55.550  1.00 18.19 ? 70   ASP L CG  1 
ATOM   524  O OD1 . ASP A 1 70  ? 120.468 8.367  56.374  1.00 17.51 ? 70   ASP L OD1 1 
ATOM   525  O OD2 . ASP A 1 70  ? 122.330 8.191  55.222  1.00 18.22 ? 70   ASP L OD2 1 
ATOM   526  N N   . TYR A 1 71  ? 120.359 13.311 56.019  1.00 13.50 ? 71   TYR L N   1 
ATOM   527  C CA  . TYR A 1 71  ? 120.466 14.753 55.784  1.00 13.90 ? 71   TYR L CA  1 
ATOM   528  C C   . TYR A 1 71  ? 121.803 15.304 56.206  1.00 13.56 ? 71   TYR L C   1 
ATOM   529  O O   . TYR A 1 71  ? 122.459 14.712 57.047  1.00 16.27 ? 71   TYR L O   1 
ATOM   530  C CB  . TYR A 1 71  ? 119.310 15.479 56.522  1.00 12.34 ? 71   TYR L CB  1 
ATOM   531  C CG  . TYR A 1 71  ? 117.984 14.985 55.978  1.00 13.46 ? 71   TYR L CG  1 
ATOM   532  C CD1 . TYR A 1 71  ? 117.423 13.787 56.464  1.00 11.82 ? 71   TYR L CD1 1 
ATOM   533  C CD2 . TYR A 1 71  ? 117.345 15.648 54.924  1.00 8.78  ? 71   TYR L CD2 1 
ATOM   534  C CE1 . TYR A 1 71  ? 116.248 13.266 55.922  1.00 13.78 ? 71   TYR L CE1 1 
ATOM   535  C CE2 . TYR A 1 71  ? 116.177 15.116 54.337  1.00 11.69 ? 71   TYR L CE2 1 
ATOM   536  C CZ  . TYR A 1 71  ? 115.628 13.917 54.859  1.00 13.37 ? 71   TYR L CZ  1 
ATOM   537  O OH  . TYR A 1 71  ? 114.470 13.355 54.343  1.00 13.58 ? 71   TYR L OH  1 
ATOM   538  N N   . SER A 1 72  ? 122.235 16.416 55.604  1.00 13.95 ? 72   SER L N   1 
ATOM   539  C CA  . SER A 1 72  ? 123.552 17.016 55.919  1.00 15.55 ? 72   SER L CA  1 
ATOM   540  C C   . SER A 1 72  ? 123.473 18.523 55.885  1.00 16.03 ? 72   SER L C   1 
ATOM   541  O O   . SER A 1 72  ? 122.784 19.082 55.048  1.00 13.66 ? 72   SER L O   1 
ATOM   542  C CB  . SER A 1 72  ? 124.623 16.679 54.880  1.00 16.28 ? 72   SER L CB  1 
ATOM   543  O OG  . SER A 1 72  ? 125.069 15.379 55.003  1.00 23.18 ? 72   SER L OG  1 
ATOM   544  N N   . LEU A 1 73  ? 124.197 19.156 56.813  1.00 17.13 ? 73   LEU L N   1 
ATOM   545  C CA  . LEU A 1 73  ? 124.298 20.614 56.882  1.00 15.92 ? 73   LEU L CA  1 
ATOM   546  C C   . LEU A 1 73  ? 125.784 20.839 56.571  1.00 16.49 ? 73   LEU L C   1 
ATOM   547  O O   . LEU A 1 73  ? 126.656 20.237 57.223  1.00 15.38 ? 73   LEU L O   1 
ATOM   548  C CB  . LEU A 1 73  ? 123.951 21.100 58.298  1.00 16.41 ? 73   LEU L CB  1 
ATOM   549  C CG  . LEU A 1 73  ? 124.331 22.549 58.599  1.00 17.40 ? 73   LEU L CG  1 
ATOM   550  C CD1 . LEU A 1 73  ? 123.453 23.494 57.748  1.00 18.89 ? 73   LEU L CD1 1 
ATOM   551  C CD2 . LEU A 1 73  ? 124.152 22.821 60.140  1.00 18.13 ? 73   LEU L CD2 1 
ATOM   552  N N   . THR A 1 74  ? 126.081 21.644 55.551  1.00 16.07 ? 74   THR L N   1 
ATOM   553  C CA  . THR A 1 74  ? 127.466 21.929 55.172  1.00 16.13 ? 74   THR L CA  1 
ATOM   554  C C   . THR A 1 74  ? 127.801 23.407 55.386  1.00 18.40 ? 74   THR L C   1 
ATOM   555  O O   . THR A 1 74  ? 127.020 24.291 55.045  1.00 18.21 ? 74   THR L O   1 
ATOM   556  C CB  . THR A 1 74  ? 127.689 21.606 53.645  1.00 17.25 ? 74   THR L CB  1 
ATOM   557  O OG1 . THR A 1 74  ? 127.414 20.226 53.407  1.00 18.04 ? 74   THR L OG1 1 
ATOM   558  C CG2 . THR A 1 74  ? 129.117 21.887 53.195  1.00 18.24 ? 74   THR L CG2 1 
ATOM   559  N N   . ILE A 1 75  ? 128.974 23.672 55.950  1.00 19.46 ? 75   ILE L N   1 
ATOM   560  C CA  . ILE A 1 75  ? 129.455 25.040 56.138  1.00 20.65 ? 75   ILE L CA  1 
ATOM   561  C C   . ILE A 1 75  ? 130.659 25.059 55.170  1.00 21.39 ? 75   ILE L C   1 
ATOM   562  O O   . ILE A 1 75  ? 131.676 24.369 55.370  1.00 21.92 ? 75   ILE L O   1 
ATOM   563  C CB  . ILE A 1 75  ? 129.900 25.279 57.613  1.00 20.57 ? 75   ILE L CB  1 
ATOM   564  C CG1 . ILE A 1 75  ? 128.718 25.022 58.529  1.00 20.18 ? 75   ILE L CG1 1 
ATOM   565  C CG2 . ILE A 1 75  ? 130.404 26.719 57.807  1.00 20.03 ? 75   ILE L CG2 1 
ATOM   566  C CD1 . ILE A 1 75  ? 129.062 25.135 60.001  1.00 22.64 ? 75   ILE L CD1 1 
ATOM   567  N N   . SER A 1 76  ? 130.541 25.830 54.103  1.00 22.85 ? 76   SER L N   1 
ATOM   568  C CA  . SER A 1 76  ? 131.585 25.832 53.078  1.00 22.95 ? 76   SER L CA  1 
ATOM   569  C C   . SER A 1 76  ? 132.963 26.315 53.540  1.00 23.54 ? 76   SER L C   1 
ATOM   570  O O   . SER A 1 76  ? 133.992 25.744 53.098  1.00 21.63 ? 76   SER L O   1 
ATOM   571  C CB  . SER A 1 76  ? 131.116 26.640 51.863  1.00 24.52 ? 76   SER L CB  1 
ATOM   572  O OG  . SER A 1 76  ? 131.112 28.024 52.182  1.00 25.74 ? 76   SER L OG  1 
ATOM   573  N N   . ASN A 1 77  ? 132.988 27.316 54.447  1.00 23.59 ? 77   ASN L N   1 
ATOM   574  C CA  . ASN A 1 77  ? 134.244 27.875 54.978  1.00 24.61 ? 77   ASN L CA  1 
ATOM   575  C C   . ASN A 1 77  ? 133.934 28.327 56.405  1.00 23.38 ? 77   ASN L C   1 
ATOM   576  O O   . ASN A 1 77  ? 133.281 29.359 56.618  1.00 23.95 ? 77   ASN L O   1 
ATOM   577  C CB  . ASN A 1 77  ? 134.733 29.086 54.143  1.00 30.22 ? 77   ASN L CB  1 
ATOM   578  C CG  . ASN A 1 77  ? 134.815 30.403 54.987  1.00 36.65 ? 77   ASN L CG  1 
ATOM   579  O OD1 . ASN A 1 77  ? 133.812 31.186 55.114  1.00 37.89 ? 77   ASN L OD1 1 
ATOM   580  N ND2 . ASN A 1 77  ? 136.006 30.638 55.597  1.00 38.68 ? 77   ASN L ND2 1 
ATOM   581  N N   . LEU A 1 78  ? 134.413 27.566 57.379  1.00 21.56 ? 78   LEU L N   1 
ATOM   582  C CA  . LEU A 1 78  ? 134.096 27.843 58.773  1.00 20.31 ? 78   LEU L CA  1 
ATOM   583  C C   . LEU A 1 78  ? 134.560 29.195 59.291  1.00 20.79 ? 78   LEU L C   1 
ATOM   584  O O   . LEU A 1 78  ? 135.730 29.540 59.143  1.00 19.52 ? 78   LEU L O   1 
ATOM   585  C CB  . LEU A 1 78  ? 134.659 26.716 59.634  1.00 18.30 ? 78   LEU L CB  1 
ATOM   586  C CG  . LEU A 1 78  ? 134.192 26.745 61.072  1.00 19.20 ? 78   LEU L CG  1 
ATOM   587  C CD1 . LEU A 1 78  ? 132.669 26.443 61.102  1.00 17.29 ? 78   LEU L CD1 1 
ATOM   588  C CD2 . LEU A 1 78  ? 135.007 25.742 61.895  1.00 16.91 ? 78   LEU L CD2 1 
ATOM   589  N N   . GLU A 1 79  ? 133.655 29.967 59.895  1.00 21.64 ? 79   GLU L N   1 
ATOM   590  C CA  . GLU A 1 79  ? 134.037 31.286 60.455  1.00 23.24 ? 79   GLU L CA  1 
ATOM   591  C C   . GLU A 1 79  ? 133.955 31.208 61.976  1.00 23.37 ? 79   GLU L C   1 
ATOM   592  O O   . GLU A 1 79  ? 133.238 30.375 62.526  1.00 22.75 ? 79   GLU L O   1 
ATOM   593  C CB  . GLU A 1 79  ? 133.082 32.411 60.001  1.00 26.19 ? 79   GLU L CB  1 
ATOM   594  C CG  . GLU A 1 79  ? 132.984 32.643 58.490  1.00 32.32 ? 79   GLU L CG  1 
ATOM   595  C CD  . GLU A 1 79  ? 134.255 33.290 57.922  1.00 37.97 ? 79   GLU L CD  1 
ATOM   596  O OE1 . GLU A 1 79  ? 134.488 33.195 56.679  1.00 38.70 ? 79   GLU L OE1 1 
ATOM   597  O OE2 . GLU A 1 79  ? 135.012 33.892 58.740  1.00 38.53 ? 79   GLU L OE2 1 
ATOM   598  N N   . PRO A 1 80  ? 134.703 32.065 62.681  1.00 23.60 ? 80   PRO L N   1 
ATOM   599  C CA  . PRO A 1 80  ? 134.654 32.042 64.149  1.00 23.15 ? 80   PRO L CA  1 
ATOM   600  C C   . PRO A 1 80  ? 133.246 32.076 64.757  1.00 22.11 ? 80   PRO L C   1 
ATOM   601  O O   . PRO A 1 80  ? 132.965 31.360 65.718  1.00 20.83 ? 80   PRO L O   1 
ATOM   602  C CB  . PRO A 1 80  ? 135.485 33.285 64.553  1.00 24.13 ? 80   PRO L CB  1 
ATOM   603  C CG  . PRO A 1 80  ? 135.806 34.005 63.187  1.00 26.05 ? 80   PRO L CG  1 
ATOM   604  C CD  . PRO A 1 80  ? 135.819 32.898 62.196  1.00 22.78 ? 80   PRO L CD  1 
ATOM   605  N N   . GLU A 1 81  ? 132.365 32.926 64.233  1.00 22.35 ? 81   GLU L N   1 
ATOM   606  C CA  . GLU A 1 81  ? 131.004 33.015 64.770  1.00 22.73 ? 81   GLU L CA  1 
ATOM   607  C C   . GLU A 1 81  ? 130.186 31.708 64.594  1.00 21.22 ? 81   GLU L C   1 
ATOM   608  O O   . GLU A 1 81  ? 129.126 31.582 65.188  1.00 20.00 ? 81   GLU L O   1 
ATOM   609  C CB  . GLU A 1 81  ? 130.206 34.173 64.124  1.00 23.71 ? 81   GLU L CB  1 
ATOM   610  C CG  . GLU A 1 81  ? 130.070 34.065 62.616  1.00 27.30 ? 81   GLU L CG  1 
ATOM   611  C CD  . GLU A 1 81  ? 131.086 34.935 61.849  1.00 29.91 ? 81   GLU L CD  1 
ATOM   612  O OE1 . GLU A 1 81  ? 132.298 34.952 62.209  1.00 30.13 ? 81   GLU L OE1 1 
ATOM   613  O OE2 . GLU A 1 81  ? 130.661 35.603 60.880  1.00 32.31 ? 81   GLU L OE2 1 
ATOM   614  N N   . ASP A 1 82  ? 130.669 30.782 63.763  1.00 19.26 ? 82   ASP L N   1 
ATOM   615  C CA  . ASP A 1 82  ? 129.952 29.533 63.526  1.00 19.42 ? 82   ASP L CA  1 
ATOM   616  C C   . ASP A 1 82  ? 130.264 28.456 64.564  1.00 19.07 ? 82   ASP L C   1 
ATOM   617  O O   . ASP A 1 82  ? 129.694 27.364 64.499  1.00 17.68 ? 82   ASP L O   1 
ATOM   618  C CB  . ASP A 1 82  ? 130.272 28.946 62.127  1.00 19.40 ? 82   ASP L CB  1 
ATOM   619  C CG  . ASP A 1 82  ? 130.069 29.939 60.989  1.00 19.24 ? 82   ASP L CG  1 
ATOM   620  O OD1 . ASP A 1 82  ? 129.199 30.833 61.098  1.00 15.98 ? 82   ASP L OD1 1 
ATOM   621  O OD2 . ASP A 1 82  ? 130.789 29.794 59.981  1.00 19.44 ? 82   ASP L OD2 1 
ATOM   622  N N   . ILE A 1 83  ? 131.173 28.729 65.510  1.00 19.86 ? 83   ILE L N   1 
ATOM   623  C CA  . ILE A 1 83  ? 131.493 27.713 66.528  1.00 19.87 ? 83   ILE L CA  1 
ATOM   624  C C   . ILE A 1 83  ? 130.240 27.661 67.402  1.00 19.78 ? 83   ILE L C   1 
ATOM   625  O O   . ILE A 1 83  ? 129.910 28.615 68.098  1.00 20.26 ? 83   ILE L O   1 
ATOM   626  C CB  . ILE A 1 83  ? 132.782 28.067 67.328  1.00 20.60 ? 83   ILE L CB  1 
ATOM   627  C CG1 . ILE A 1 83  ? 133.968 28.285 66.358  1.00 19.69 ? 83   ILE L CG1 1 
ATOM   628  C CG2 . ILE A 1 83  ? 133.120 26.938 68.303  1.00 20.72 ? 83   ILE L CG2 1 
ATOM   629  C CD1 . ILE A 1 83  ? 134.192 27.093 65.385  1.00 19.42 ? 83   ILE L CD1 1 
ATOM   630  N N   . ALA A 1 84  ? 129.538 26.525 67.360  1.00 17.85 ? 84   ALA L N   1 
ATOM   631  C CA  . ALA A 1 84  ? 128.260 26.432 68.035  1.00 16.96 ? 84   ALA L CA  1 
ATOM   632  C C   . ALA A 1 84  ? 127.827 25.005 67.956  1.00 16.12 ? 84   ALA L C   1 
ATOM   633  O O   . ALA A 1 84  ? 128.576 24.148 67.457  1.00 17.74 ? 84   ALA L O   1 
ATOM   634  C CB  . ALA A 1 84  ? 127.234 27.313 67.285  1.00 16.49 ? 84   ALA L CB  1 
ATOM   635  N N   . THR A 1 85  ? 126.635 24.744 68.459  1.00 15.89 ? 85   THR L N   1 
ATOM   636  C CA  . THR A 1 85  ? 126.060 23.405 68.435  1.00 16.01 ? 85   THR L CA  1 
ATOM   637  C C   . THR A 1 85  ? 124.917 23.445 67.407  1.00 15.50 ? 85   THR L C   1 
ATOM   638  O O   . THR A 1 85  ? 124.133 24.377 67.382  1.00 16.27 ? 85   THR L O   1 
ATOM   639  C CB  . THR A 1 85  ? 125.521 23.008 69.852  1.00 15.76 ? 85   THR L CB  1 
ATOM   640  O OG1 . THR A 1 85  ? 126.609 23.020 70.765  1.00 17.58 ? 85   THR L OG1 1 
ATOM   641  C CG2 . THR A 1 85  ? 124.984 21.604 69.855  1.00 16.35 ? 85   THR L CG2 1 
ATOM   642  N N   . TYR A 1 86  ? 124.861 22.431 66.558  1.00 15.11 ? 86   TYR L N   1 
ATOM   643  C CA  . TYR A 1 86  ? 123.867 22.352 65.501  1.00 12.80 ? 86   TYR L CA  1 
ATOM   644  C C   . TYR A 1 86  ? 122.935 21.171 65.749  1.00 13.60 ? 86   TYR L C   1 
ATOM   645  O O   . TYR A 1 86  ? 123.387 20.038 66.076  1.00 13.75 ? 86   TYR L O   1 
ATOM   646  C CB  . TYR A 1 86  ? 124.595 22.235 64.143  1.00 10.66 ? 86   TYR L CB  1 
ATOM   647  C CG  . TYR A 1 86  ? 125.426 23.488 63.826  1.00 12.77 ? 86   TYR L CG  1 
ATOM   648  C CD1 . TYR A 1 86  ? 126.756 23.655 64.332  1.00 12.77 ? 86   TYR L CD1 1 
ATOM   649  C CD2 . TYR A 1 86  ? 124.863 24.542 63.096  1.00 11.08 ? 86   TYR L CD2 1 
ATOM   650  C CE1 . TYR A 1 86  ? 127.490 24.851 64.098  1.00 13.22 ? 86   TYR L CE1 1 
ATOM   651  C CE2 . TYR A 1 86  ? 125.575 25.739 62.860  1.00 12.60 ? 86   TYR L CE2 1 
ATOM   652  C CZ  . TYR A 1 86  ? 126.890 25.891 63.363  1.00 13.83 ? 86   TYR L CZ  1 
ATOM   653  O OH  . TYR A 1 86  ? 127.548 27.113 63.175  1.00 15.12 ? 86   TYR L OH  1 
ATOM   654  N N   . TYR A 1 87  ? 121.646 21.431 65.585  1.00 13.09 ? 87   TYR L N   1 
ATOM   655  C CA  . TYR A 1 87  ? 120.620 20.412 65.776  1.00 13.85 ? 87   TYR L CA  1 
ATOM   656  C C   . TYR A 1 87  ? 119.727 20.262 64.536  1.00 14.24 ? 87   TYR L C   1 
ATOM   657  O O   . TYR A 1 87  ? 119.276 21.284 63.983  1.00 12.73 ? 87   TYR L O   1 
ATOM   658  C CB  . TYR A 1 87  ? 119.661 20.806 66.918  1.00 13.05 ? 87   TYR L CB  1 
ATOM   659  C CG  . TYR A 1 87  ? 120.254 20.862 68.302  1.00 14.01 ? 87   TYR L CG  1 
ATOM   660  C CD1 . TYR A 1 87  ? 120.318 19.707 69.110  1.00 15.58 ? 87   TYR L CD1 1 
ATOM   661  C CD2 . TYR A 1 87  ? 120.745 22.053 68.807  1.00 14.40 ? 87   TYR L CD2 1 
ATOM   662  C CE1 . TYR A 1 87  ? 120.878 19.732 70.407  1.00 14.49 ? 87   TYR L CE1 1 
ATOM   663  C CE2 . TYR A 1 87  ? 121.292 22.120 70.112  1.00 16.26 ? 87   TYR L CE2 1 
ATOM   664  C CZ  . TYR A 1 87  ? 121.361 20.952 70.905  1.00 17.05 ? 87   TYR L CZ  1 
ATOM   665  O OH  . TYR A 1 87  ? 121.904 21.033 72.187  1.00 19.13 ? 87   TYR L OH  1 
ATOM   666  N N   . CYS A 1 88  ? 119.434 19.016 64.140  1.00 11.86 ? 88   CYS L N   1 
ATOM   667  C CA  . CYS A 1 88  ? 118.471 18.802 63.059  1.00 11.66 ? 88   CYS L CA  1 
ATOM   668  C C   . CYS A 1 88  ? 117.114 18.524 63.789  1.00 11.96 ? 88   CYS L C   1 
ATOM   669  O O   . CYS A 1 88  ? 117.103 18.198 65.005  1.00 11.57 ? 88   CYS L O   1 
ATOM   670  C CB  . CYS A 1 88  ? 118.870 17.621 62.209  1.00 12.82 ? 88   CYS L CB  1 
ATOM   671  S SG  . CYS A 1 88  ? 119.040 16.067 63.152  1.00 12.07 ? 88   CYS L SG  1 
ATOM   672  N N   . GLN A 1 89  ? 116.010 18.607 63.054  1.00 9.22  ? 89   GLN L N   1 
ATOM   673  C CA  . GLN A 1 89  ? 114.657 18.438 63.623  1.00 11.58 ? 89   GLN L CA  1 
ATOM   674  C C   . GLN A 1 89  ? 113.693 17.979 62.524  1.00 11.15 ? 89   GLN L C   1 
ATOM   675  O O   . GLN A 1 89  ? 113.668 18.571 61.461  1.00 11.24 ? 89   GLN L O   1 
ATOM   676  C CB  . GLN A 1 89  ? 114.130 19.783 64.207  1.00 8.86  ? 89   GLN L CB  1 
ATOM   677  C CG  . GLN A 1 89  ? 112.657 19.707 64.659  1.00 10.24 ? 89   GLN L CG  1 
ATOM   678  C CD  . GLN A 1 89  ? 111.684 20.555 63.773  1.00 11.64 ? 89   GLN L CD  1 
ATOM   679  O OE1 . GLN A 1 89  ? 110.492 20.172 63.509  1.00 13.72 ? 89   GLN L OE1 1 
ATOM   680  N NE2 . GLN A 1 89  ? 112.174 21.700 63.330  1.00 6.56  ? 89   GLN L NE2 1 
ATOM   681  N N   . GLN A 1 90  ? 112.899 16.951 62.774  1.00 10.69 ? 90   GLN L N   1 
ATOM   682  C CA  . GLN A 1 90  ? 111.964 16.477 61.762  1.00 10.96 ? 90   GLN L CA  1 
ATOM   683  C C   . GLN A 1 90  ? 110.553 16.956 61.986  1.00 11.20 ? 90   GLN L C   1 
ATOM   684  O O   . GLN A 1 90  ? 110.143 17.181 63.132  1.00 12.41 ? 90   GLN L O   1 
ATOM   685  C CB  . GLN A 1 90  ? 111.951 14.918 61.712  1.00 10.49 ? 90   GLN L CB  1 
ATOM   686  C CG  . GLN A 1 90  ? 111.396 14.208 62.971  1.00 9.68  ? 90   GLN L CG  1 
ATOM   687  C CD  . GLN A 1 90  ? 109.859 14.179 63.081  1.00 11.97 ? 90   GLN L CD  1 
ATOM   688  O OE1 . GLN A 1 90  ? 109.145 14.183 62.060  1.00 14.48 ? 90   GLN L OE1 1 
ATOM   689  N NE2 . GLN A 1 90  ? 109.335 14.087 64.331  1.00 11.04 ? 90   GLN L NE2 1 
ATOM   690  N N   . TYR A 1 91  ? 109.798 17.108 60.893  1.00 11.33 ? 91   TYR L N   1 
ATOM   691  C CA  . TYR A 1 91  ? 108.389 17.479 61.020  1.00 12.07 ? 91   TYR L CA  1 
ATOM   692  C C   . TYR A 1 91  ? 107.529 16.575 60.099  1.00 13.47 ? 91   TYR L C   1 
ATOM   693  O O   . TYR A 1 91  ? 106.469 16.975 59.557  1.00 12.62 ? 91   TYR L O   1 
ATOM   694  C CB  . TYR A 1 91  ? 108.129 18.995 60.797  1.00 11.52 ? 91   TYR L CB  1 
ATOM   695  C CG  . TYR A 1 91  ? 108.554 19.571 59.477  1.00 12.71 ? 91   TYR L CG  1 
ATOM   696  C CD1 . TYR A 1 91  ? 109.895 19.887 59.233  1.00 12.90 ? 91   TYR L CD1 1 
ATOM   697  C CD2 . TYR A 1 91  ? 107.619 19.845 58.477  1.00 11.62 ? 91   TYR L CD2 1 
ATOM   698  C CE1 . TYR A 1 91  ? 110.309 20.454 58.012  1.00 13.71 ? 91   TYR L CE1 1 
ATOM   699  C CE2 . TYR A 1 91  ? 108.034 20.456 57.247  1.00 13.16 ? 91   TYR L CE2 1 
ATOM   700  C CZ  . TYR A 1 91  ? 109.373 20.741 57.034  1.00 12.08 ? 91   TYR L CZ  1 
ATOM   701  O OH  . TYR A 1 91  ? 109.815 21.285 55.858  1.00 11.13 ? 91   TYR L OH  1 
ATOM   702  N N   . GLU A 1 92  ? 108.020 15.338 59.906  1.00 12.73 ? 92   GLU L N   1 
ATOM   703  C CA  . GLU A 1 92  ? 107.274 14.347 59.144  1.00 11.32 ? 92   GLU L CA  1 
ATOM   704  C C   . GLU A 1 92  ? 106.018 14.016 59.993  1.00 13.42 ? 92   GLU L C   1 
ATOM   705  O O   . GLU A 1 92  ? 104.905 13.844 59.464  1.00 12.26 ? 92   GLU L O   1 
ATOM   706  C CB  . GLU A 1 92  ? 108.123 13.082 58.952  1.00 11.41 ? 92   GLU L CB  1 
ATOM   707  C CG  . GLU A 1 92  ? 107.314 11.822 58.673  1.00 11.96 ? 92   GLU L CG  1 
ATOM   708  C CD  . GLU A 1 92  ? 106.638 11.872 57.297  1.00 12.95 ? 92   GLU L CD  1 
ATOM   709  O OE1 . GLU A 1 92  ? 107.224 12.426 56.365  1.00 13.79 ? 92   GLU L OE1 1 
ATOM   710  O OE2 . GLU A 1 92  ? 105.527 11.374 57.153  1.00 15.50 ? 92   GLU L OE2 1 
ATOM   711  N N   . LYS A 1 93  ? 106.163 13.983 61.318  1.00 13.49 ? 93   LYS L N   1 
ATOM   712  C CA  . LYS A 1 93  ? 105.032 13.605 62.156  1.00 17.12 ? 93   LYS L CA  1 
ATOM   713  C C   . LYS A 1 93  ? 105.182 14.079 63.604  1.00 15.10 ? 93   LYS L C   1 
ATOM   714  O O   . LYS A 1 93  ? 106.277 14.058 64.130  1.00 15.04 ? 93   LYS L O   1 
ATOM   715  C CB  . LYS A 1 93  ? 104.949 12.069 62.138  1.00 20.82 ? 93   LYS L CB  1 
ATOM   716  C CG  . LYS A 1 93  ? 103.955 11.478 63.075  1.00 27.87 ? 93   LYS L CG  1 
ATOM   717  C CD  . LYS A 1 93  ? 103.810 9.950  62.845  1.00 33.56 ? 93   LYS L CD  1 
ATOM   718  C CE  . LYS A 1 93  ? 105.074 9.191  63.219  1.00 37.99 ? 93   LYS L CE  1 
ATOM   719  N NZ  . LYS A 1 93  ? 104.834 7.690  63.280  1.00 41.25 ? 93   LYS L NZ  1 
ATOM   720  N N   . LEU A 1 94  ? 104.085 14.469 64.244  1.00 14.51 ? 94   LEU L N   1 
ATOM   721  C CA  . LEU A 1 94  ? 104.132 14.923 65.645  1.00 15.13 ? 94   LEU L CA  1 
ATOM   722  C C   . LEU A 1 94  ? 104.404 13.726 66.564  1.00 15.80 ? 94   LEU L C   1 
ATOM   723  O O   . LEU A 1 94  ? 104.054 12.607 66.206  1.00 15.10 ? 94   LEU L O   1 
ATOM   724  C CB  . LEU A 1 94  ? 102.804 15.565 66.076  1.00 15.16 ? 94   LEU L CB  1 
ATOM   725  C CG  . LEU A 1 94  ? 102.379 16.918 65.427  1.00 14.90 ? 94   LEU L CG  1 
ATOM   726  C CD1 . LEU A 1 94  ? 100.937 17.202 65.804  1.00 10.81 ? 94   LEU L CD1 1 
ATOM   727  C CD2 . LEU A 1 94  ? 103.352 18.067 65.892  1.00 12.98 ? 94   LEU L CD2 1 
ATOM   728  N N   . PRO A 1 95  ? 105.130 13.941 67.706  1.00 15.10 ? 95   PRO L N   1 
ATOM   729  C CA  . PRO A 1 95  ? 105.677 15.270 68.091  1.00 13.66 ? 95   PRO L CA  1 
ATOM   730  C C   . PRO A 1 95  ? 106.935 15.565 67.325  1.00 12.80 ? 95   PRO L C   1 
ATOM   731  O O   . PRO A 1 95  ? 107.662 14.631 66.906  1.00 11.26 ? 95   PRO L O   1 
ATOM   732  C CB  . PRO A 1 95  ? 105.998 15.120 69.601  1.00 13.26 ? 95   PRO L CB  1 
ATOM   733  C CG  . PRO A 1 95  ? 106.440 13.615 69.696  1.00 14.75 ? 95   PRO L CG  1 
ATOM   734  C CD  . PRO A 1 95  ? 105.386 12.915 68.766  1.00 15.33 ? 95   PRO L CD  1 
ATOM   735  N N   . TRP A 1 96  ? 107.233 16.852 67.105  1.00 11.80 ? 96   TRP L N   1 
ATOM   736  C CA  . TRP A 1 96  ? 108.510 17.154 66.419  1.00 12.25 ? 96   TRP L CA  1 
ATOM   737  C C   . TRP A 1 96  ? 109.646 16.623 67.330  1.00 12.39 ? 96   TRP L C   1 
ATOM   738  O O   . TRP A 1 96  ? 109.518 16.658 68.572  1.00 10.22 ? 96   TRP L O   1 
ATOM   739  C CB  . TRP A 1 96  ? 108.720 18.667 66.284  1.00 13.39 ? 96   TRP L CB  1 
ATOM   740  C CG  . TRP A 1 96  ? 107.633 19.444 65.511  1.00 14.43 ? 96   TRP L CG  1 
ATOM   741  C CD1 . TRP A 1 96  ? 107.363 20.805 65.617  1.00 12.48 ? 96   TRP L CD1 1 
ATOM   742  C CD2 . TRP A 1 96  ? 106.774 18.944 64.477  1.00 12.17 ? 96   TRP L CD2 1 
ATOM   743  N NE1 . TRP A 1 96  ? 106.397 21.161 64.705  1.00 14.03 ? 96   TRP L NE1 1 
ATOM   744  C CE2 . TRP A 1 96  ? 106.014 20.051 63.993  1.00 12.11 ? 96   TRP L CE2 1 
ATOM   745  C CE3 . TRP A 1 96  ? 106.557 17.673 63.915  1.00 10.49 ? 96   TRP L CE3 1 
ATOM   746  C CZ2 . TRP A 1 96  ? 105.050 19.925 62.966  1.00 11.21 ? 96   TRP L CZ2 1 
ATOM   747  C CZ3 . TRP A 1 96  ? 105.592 17.552 62.896  1.00 12.30 ? 96   TRP L CZ3 1 
ATOM   748  C CH2 . TRP A 1 96  ? 104.853 18.684 62.441  1.00 13.28 ? 96   TRP L CH2 1 
ATOM   749  N N   . THR A 1 97  ? 110.758 16.197 66.736  1.00 11.46 ? 97   THR L N   1 
ATOM   750  C CA  . THR A 1 97  ? 111.851 15.665 67.528  1.00 13.63 ? 97   THR L CA  1 
ATOM   751  C C   . THR A 1 97  ? 113.152 16.191 66.938  1.00 15.72 ? 97   THR L C   1 
ATOM   752  O O   . THR A 1 97  ? 113.224 16.460 65.730  1.00 16.19 ? 97   THR L O   1 
ATOM   753  C CB  . THR A 1 97  ? 111.852 14.080 67.554  1.00 13.30 ? 97   THR L CB  1 
ATOM   754  O OG1 . THR A 1 97  ? 111.679 13.556 66.230  1.00 12.59 ? 97   THR L OG1 1 
ATOM   755  C CG2 . THR A 1 97  ? 110.699 13.573 68.491  1.00 12.23 ? 97   THR L CG2 1 
ATOM   756  N N   . PHE A 1 98  ? 114.152 16.358 67.811  1.00 14.17 ? 98   PHE L N   1 
ATOM   757  C CA  . PHE A 1 98  ? 115.467 16.887 67.428  1.00 13.17 ? 98   PHE L CA  1 
ATOM   758  C C   . PHE A 1 98  ? 116.559 15.828 67.544  1.00 12.83 ? 98   PHE L C   1 
ATOM   759  O O   . PHE A 1 98  ? 116.420 14.911 68.345  1.00 12.68 ? 98   PHE L O   1 
ATOM   760  C CB  . PHE A 1 98  ? 115.898 18.010 68.373  1.00 12.46 ? 98   PHE L CB  1 
ATOM   761  C CG  . PHE A 1 98  ? 114.980 19.215 68.386  1.00 11.36 ? 98   PHE L CG  1 
ATOM   762  C CD1 . PHE A 1 98  ? 113.794 19.210 69.136  1.00 13.33 ? 98   PHE L CD1 1 
ATOM   763  C CD2 . PHE A 1 98  ? 115.330 20.368 67.671  1.00 12.20 ? 98   PHE L CD2 1 
ATOM   764  C CE1 . PHE A 1 98  ? 112.965 20.350 69.187  1.00 12.71 ? 98   PHE L CE1 1 
ATOM   765  C CE2 . PHE A 1 98  ? 114.524 21.494 67.708  1.00 13.21 ? 98   PHE L CE2 1 
ATOM   766  C CZ  . PHE A 1 98  ? 113.331 21.496 68.471  1.00 13.74 ? 98   PHE L CZ  1 
ATOM   767  N N   . GLY A 1 99  ? 117.626 16.000 66.762  1.00 10.32 ? 99   GLY L N   1 
ATOM   768  C CA  . GLY A 1 99  ? 118.819 15.167 66.833  1.00 11.92 ? 99   GLY L CA  1 
ATOM   769  C C   . GLY A 1 99  ? 119.501 15.558 68.155  1.00 13.63 ? 99   GLY L C   1 
ATOM   770  O O   . GLY A 1 99  ? 119.137 16.558 68.776  1.00 14.22 ? 99   GLY L O   1 
ATOM   771  N N   . GLY A 1 100 ? 120.493 14.792 68.599  1.00 15.32 ? 100  GLY L N   1 
ATOM   772  C CA  . GLY A 1 100 ? 121.131 15.091 69.879  1.00 14.51 ? 100  GLY L CA  1 
ATOM   773  C C   . GLY A 1 100 ? 122.142 16.222 69.849  1.00 16.76 ? 100  GLY L C   1 
ATOM   774  O O   . GLY A 1 100 ? 122.718 16.524 70.882  1.00 15.75 ? 100  GLY L O   1 
ATOM   775  N N   . GLY A 1 101 ? 122.367 16.841 68.684  1.00 16.03 ? 101  GLY L N   1 
ATOM   776  C CA  . GLY A 1 101 ? 123.325 17.921 68.586  1.00 16.59 ? 101  GLY L CA  1 
ATOM   777  C C   . GLY A 1 101 ? 124.757 17.557 68.207  1.00 17.10 ? 101  GLY L C   1 
ATOM   778  O O   . GLY A 1 101 ? 125.296 16.478 68.535  1.00 17.95 ? 101  GLY L O   1 
ATOM   779  N N   . THR A 1 102 ? 125.382 18.481 67.486  1.00 16.76 ? 102  THR L N   1 
ATOM   780  C CA  . THR A 1 102 ? 126.765 18.358 67.064  1.00 16.06 ? 102  THR L CA  1 
ATOM   781  C C   . THR A 1 102 ? 127.435 19.694 67.406  1.00 17.59 ? 102  THR L C   1 
ATOM   782  O O   . THR A 1 102 ? 127.147 20.731 66.798  1.00 15.75 ? 102  THR L O   1 
ATOM   783  C CB  . THR A 1 102 ? 126.938 18.136 65.544  1.00 16.65 ? 102  THR L CB  1 
ATOM   784  O OG1 . THR A 1 102 ? 126.438 16.832 65.173  1.00 13.91 ? 102  THR L OG1 1 
ATOM   785  C CG2 . THR A 1 102 ? 128.490 18.201 65.181  1.00 13.27 ? 102  THR L CG2 1 
ATOM   786  N N   . LYS A 1 103 ? 128.341 19.655 68.383  1.00 17.35 ? 103  LYS L N   1 
ATOM   787  C CA  . LYS A 1 103 ? 129.053 20.849 68.831  1.00 17.63 ? 103  LYS L CA  1 
ATOM   788  C C   . LYS A 1 103 ? 130.418 20.968 68.174  1.00 16.83 ? 103  LYS L C   1 
ATOM   789  O O   . LYS A 1 103 ? 131.280 20.083 68.298  1.00 17.66 ? 103  LYS L O   1 
ATOM   790  C CB  . LYS A 1 103 ? 129.189 20.826 70.370  1.00 20.12 ? 103  LYS L CB  1 
ATOM   791  C CG  . LYS A 1 103 ? 129.964 22.007 70.963  1.00 22.81 ? 103  LYS L CG  1 
ATOM   792  C CD  . LYS A 1 103 ? 130.024 21.912 72.518  1.00 28.35 ? 103  LYS L CD  1 
ATOM   793  C CE  . LYS A 1 103 ? 128.816 22.576 73.211  1.00 31.45 ? 103  LYS L CE  1 
ATOM   794  N NZ  . LYS A 1 103 ? 127.396 21.903 73.132  1.00 35.99 ? 103  LYS L NZ  1 
ATOM   795  N N   . LEU A 1 104 ? 130.624 22.072 67.482  1.00 15.06 ? 104  LEU L N   1 
ATOM   796  C CA  . LEU A 1 104 ? 131.881 22.285 66.805  1.00 16.25 ? 104  LEU L CA  1 
ATOM   797  C C   . LEU A 1 104 ? 132.909 22.756 67.795  1.00 16.77 ? 104  LEU L C   1 
ATOM   798  O O   . LEU A 1 104 ? 132.598 23.474 68.738  1.00 16.62 ? 104  LEU L O   1 
ATOM   799  C CB  . LEU A 1 104 ? 131.730 23.339 65.709  1.00 15.92 ? 104  LEU L CB  1 
ATOM   800  C CG  . LEU A 1 104 ? 130.708 23.054 64.598  1.00 15.46 ? 104  LEU L CG  1 
ATOM   801  C CD1 . LEU A 1 104 ? 130.852 24.138 63.485  1.00 16.63 ? 104  LEU L CD1 1 
ATOM   802  C CD2 . LEU A 1 104 ? 130.933 21.617 64.002  1.00 15.25 ? 104  LEU L CD2 1 
ATOM   803  N N   . GLU A 1 105 ? 134.149 22.355 67.568  1.00 17.68 ? 105  GLU L N   1 
ATOM   804  C CA  . GLU A 1 105 ? 135.242 22.755 68.426  1.00 19.50 ? 105  GLU L CA  1 
ATOM   805  C C   . GLU A 1 105 ? 136.413 23.103 67.500  1.00 19.43 ? 105  GLU L C   1 
ATOM   806  O O   . GLU A 1 105 ? 136.566 22.458 66.465  1.00 18.24 ? 105  GLU L O   1 
ATOM   807  C CB  . GLU A 1 105 ? 135.646 21.587 69.345  1.00 19.29 ? 105  GLU L CB  1 
ATOM   808  C CG  . GLU A 1 105 ? 137.005 21.851 69.821  1.00 27.96 ? 105  GLU L CG  1 
ATOM   809  C CD  . GLU A 1 105 ? 137.868 20.672 69.983  1.00 27.58 ? 105  GLU L CD  1 
ATOM   810  O OE1 . GLU A 1 105 ? 138.294 20.031 68.966  1.00 26.05 ? 105  GLU L OE1 1 
ATOM   811  O OE2 . GLU A 1 105 ? 138.132 20.429 71.170  1.00 29.25 ? 105  GLU L OE2 1 
ATOM   812  N N   . VAL A 1 106 ? 137.271 24.044 67.920  1.00 18.69 ? 106  VAL L N   1 
ATOM   813  C CA  . VAL A 1 106 ? 138.424 24.518 67.118  1.00 18.59 ? 106  VAL L CA  1 
ATOM   814  C C   . VAL A 1 106 ? 139.721 23.781 67.417  1.00 18.11 ? 106  VAL L C   1 
ATOM   815  O O   . VAL A 1 106 ? 140.122 23.620 68.595  1.00 16.41 ? 106  VAL L O   1 
ATOM   816  C CB  . VAL A 1 106 ? 138.674 26.013 67.357  1.00 19.91 ? 106  VAL L CB  1 
ATOM   817  C CG1 . VAL A 1 106 ? 139.909 26.457 66.581  1.00 19.37 ? 106  VAL L CG1 1 
ATOM   818  C CG2 . VAL A 1 106 ? 137.468 26.796 66.889  1.00 21.00 ? 106  VAL L CG2 1 
ATOM   819  N N   . LYS A 1 107 ? 140.402 23.352 66.360  1.00 18.60 ? 107  LYS L N   1 
ATOM   820  C CA  . LYS A 1 107 ? 141.626 22.603 66.563  1.00 20.36 ? 107  LYS L CA  1 
ATOM   821  C C   . LYS A 1 107 ? 142.793 23.478 66.950  1.00 20.60 ? 107  LYS L C   1 
ATOM   822  O O   . LYS A 1 107 ? 142.876 24.633 66.530  1.00 21.01 ? 107  LYS L O   1 
ATOM   823  C CB  . LYS A 1 107 ? 142.021 21.831 65.310  1.00 21.60 ? 107  LYS L CB  1 
ATOM   824  C CG  . LYS A 1 107 ? 141.075 20.751 64.872  1.00 25.03 ? 107  LYS L CG  1 
ATOM   825  C CD  . LYS A 1 107 ? 141.664 20.109 63.579  1.00 29.83 ? 107  LYS L CD  1 
ATOM   826  C CE  . LYS A 1 107 ? 140.806 18.968 63.073  1.00 31.73 ? 107  LYS L CE  1 
ATOM   827  N NZ  . LYS A 1 107 ? 141.409 18.417 61.823  1.00 35.75 ? 107  LYS L NZ  1 
ATOM   828  N N   . ARG A 1 108 ? 143.686 22.936 67.778  1.00 19.01 ? 108  ARG L N   1 
ATOM   829  C CA  . ARG A 1 108 ? 144.894 23.684 68.141  1.00 19.89 ? 108  ARG L CA  1 
ATOM   830  C C   . ARG A 1 108 ? 145.940 22.653 68.489  1.00 20.55 ? 108  ARG L C   1 
ATOM   831  O O   . ARG A 1 108 ? 145.603 21.454 68.559  1.00 20.42 ? 108  ARG L O   1 
ATOM   832  C CB  . ARG A 1 108 ? 144.656 24.588 69.340  1.00 18.22 ? 108  ARG L CB  1 
ATOM   833  C CG  . ARG A 1 108 ? 144.200 23.859 70.605  1.00 18.17 ? 108  ARG L CG  1 
ATOM   834  C CD  . ARG A 1 108 ? 144.637 24.719 71.835  1.00 17.08 ? 108  ARG L CD  1 
ATOM   835  N NE  . ARG A 1 108 ? 146.088 24.607 71.960  1.00 18.21 ? 108  ARG L NE  1 
ATOM   836  C CZ  . ARG A 1 108 ? 146.897 25.519 72.502  1.00 19.81 ? 108  ARG L CZ  1 
ATOM   837  N NH1 . ARG A 1 108 ? 146.426 26.667 72.978  1.00 18.30 ? 108  ARG L NH1 1 
ATOM   838  N NH2 . ARG A 1 108 ? 148.188 25.250 72.610  1.00 19.72 ? 108  ARG L NH2 1 
ATOM   839  N N   . ALA A 1 109 ? 147.186 23.101 68.701  1.00 20.08 ? 109  ALA L N   1 
ATOM   840  C CA  . ALA A 1 109 ? 148.264 22.178 69.085  1.00 20.50 ? 109  ALA L CA  1 
ATOM   841  C C   . ALA A 1 109 ? 147.924 21.578 70.461  1.00 19.81 ? 109  ALA L C   1 
ATOM   842  O O   . ALA A 1 109 ? 147.342 22.270 71.321  1.00 17.86 ? 109  ALA L O   1 
ATOM   843  C CB  . ALA A 1 109 ? 149.616 22.922 69.158  1.00 21.65 ? 109  ALA L CB  1 
ATOM   844  N N   . ASP A 1 110 ? 148.247 20.289 70.644  1.00 18.18 ? 110  ASP L N   1 
ATOM   845  C CA  . ASP A 1 110 ? 147.990 19.604 71.923  1.00 18.15 ? 110  ASP L CA  1 
ATOM   846  C C   . ASP A 1 110 ? 148.695 20.425 73.030  1.00 15.56 ? 110  ASP L C   1 
ATOM   847  O O   . ASP A 1 110 ? 149.785 20.963 72.778  1.00 13.55 ? 110  ASP L O   1 
ATOM   848  C CB  . ASP A 1 110 ? 148.599 18.170 71.917  1.00 18.90 ? 110  ASP L CB  1 
ATOM   849  C CG  . ASP A 1 110 ? 147.787 17.166 71.078  1.00 21.10 ? 110  ASP L CG  1 
ATOM   850  O OD1 . ASP A 1 110 ? 146.691 17.524 70.599  1.00 19.20 ? 110  ASP L OD1 1 
ATOM   851  O OD2 . ASP A 1 110 ? 148.251 16.002 70.903  1.00 20.00 ? 110  ASP L OD2 1 
ATOM   852  N N   . ALA A 1 111 ? 148.108 20.501 74.227  1.00 13.49 ? 111  ALA L N   1 
ATOM   853  C CA  . ALA A 1 111 ? 148.725 21.232 75.343  1.00 17.18 ? 111  ALA L CA  1 
ATOM   854  C C   . ALA A 1 111 ? 148.420 20.462 76.629  1.00 17.47 ? 111  ALA L C   1 
ATOM   855  O O   . ALA A 1 111 ? 147.254 20.092 76.883  1.00 16.05 ? 111  ALA L O   1 
ATOM   856  C CB  . ALA A 1 111 ? 148.160 22.701 75.450  1.00 16.26 ? 111  ALA L CB  1 
ATOM   857  N N   . ALA A 1 112 ? 149.457 20.198 77.434  1.00 17.14 ? 112  ALA L N   1 
ATOM   858  C CA  . ALA A 1 112 ? 149.247 19.444 78.694  1.00 16.44 ? 112  ALA L CA  1 
ATOM   859  C C   . ALA A 1 112 ? 148.589 20.395 79.690  1.00 16.47 ? 112  ALA L C   1 
ATOM   860  O O   . ALA A 1 112 ? 148.778 21.605 79.641  1.00 15.18 ? 112  ALA L O   1 
ATOM   861  C CB  . ALA A 1 112 ? 150.602 18.933 79.285  1.00 17.43 ? 112  ALA L CB  1 
ATOM   862  N N   . PRO A 1 113 ? 147.801 19.844 80.598  1.00 16.68 ? 113  PRO L N   1 
ATOM   863  C CA  . PRO A 1 113 ? 147.096 20.598 81.634  1.00 16.43 ? 113  PRO L CA  1 
ATOM   864  C C   . PRO A 1 113 ? 148.108 21.054 82.685  1.00 16.88 ? 113  PRO L C   1 
ATOM   865  O O   . PRO A 1 113 ? 149.118 20.362 82.914  1.00 15.55 ? 113  PRO L O   1 
ATOM   866  C CB  . PRO A 1 113 ? 146.192 19.539 82.269  1.00 16.34 ? 113  PRO L CB  1 
ATOM   867  C CG  . PRO A 1 113 ? 147.098 18.311 82.194  1.00 14.75 ? 113  PRO L CG  1 
ATOM   868  C CD  . PRO A 1 113 ? 147.521 18.392 80.734  1.00 15.66 ? 113  PRO L CD  1 
ATOM   869  N N   . THR A 1 114 ? 147.814 22.197 83.310  1.00 15.37 ? 114  THR L N   1 
ATOM   870  C CA  . THR A 1 114 ? 148.595 22.714 84.453  1.00 15.61 ? 114  THR L CA  1 
ATOM   871  C C   . THR A 1 114 ? 147.778 22.214 85.624  1.00 13.52 ? 114  THR L C   1 
ATOM   872  O O   . THR A 1 114 ? 146.621 22.574 85.769  1.00 13.79 ? 114  THR L O   1 
ATOM   873  C CB  . THR A 1 114 ? 148.643 24.236 84.415  1.00 14.70 ? 114  THR L CB  1 
ATOM   874  O OG1 . THR A 1 114 ? 149.393 24.590 83.266  1.00 17.00 ? 114  THR L OG1 1 
ATOM   875  C CG2 . THR A 1 114 ? 149.352 24.807 85.626  1.00 17.84 ? 114  THR L CG2 1 
ATOM   876  N N   . VAL A 1 115 ? 148.356 21.341 86.436  1.00 13.26 ? 115  VAL L N   1 
ATOM   877  C CA  . VAL A 1 115 ? 147.608 20.725 87.540  1.00 14.73 ? 115  VAL L CA  1 
ATOM   878  C C   . VAL A 1 115 ? 148.013 21.333 88.895  1.00 14.54 ? 115  VAL L C   1 
ATOM   879  O O   . VAL A 1 115 ? 149.202 21.492 89.146  1.00 13.83 ? 115  VAL L O   1 
ATOM   880  C CB  . VAL A 1 115 ? 147.919 19.170 87.589  1.00 15.02 ? 115  VAL L CB  1 
ATOM   881  C CG1 . VAL A 1 115 ? 147.078 18.459 88.651  1.00 14.36 ? 115  VAL L CG1 1 
ATOM   882  C CG2 . VAL A 1 115 ? 147.698 18.599 86.232  1.00 17.62 ? 115  VAL L CG2 1 
ATOM   883  N N   . SER A 1 116 ? 147.036 21.639 89.746  1.00 15.18 ? 116  SER L N   1 
ATOM   884  C CA  . SER A 1 116 ? 147.301 22.235 91.055  1.00 15.42 ? 116  SER L CA  1 
ATOM   885  C C   . SER A 1 116 ? 146.372 21.574 92.017  1.00 16.60 ? 116  SER L C   1 
ATOM   886  O O   . SER A 1 116 ? 145.203 21.382 91.694  1.00 16.07 ? 116  SER L O   1 
ATOM   887  C CB  . SER A 1 116 ? 146.920 23.726 91.071  1.00 16.92 ? 116  SER L CB  1 
ATOM   888  O OG  . SER A 1 116 ? 147.589 24.447 90.067  1.00 20.19 ? 116  SER L OG  1 
ATOM   889  N N   . ILE A 1 117 ? 146.861 21.268 93.211  1.00 14.85 ? 117  ILE L N   1 
ATOM   890  C CA  . ILE A 1 117 ? 145.994 20.646 94.200  1.00 15.05 ? 117  ILE L CA  1 
ATOM   891  C C   . ILE A 1 117 ? 145.950 21.578 95.440  1.00 15.95 ? 117  ILE L C   1 
ATOM   892  O O   . ILE A 1 117 ? 146.946 22.236 95.764  1.00 15.13 ? 117  ILE L O   1 
ATOM   893  C CB  . ILE A 1 117 ? 146.555 19.202 94.606  1.00 14.80 ? 117  ILE L CB  1 
ATOM   894  C CG1 . ILE A 1 117 ? 145.565 18.469 95.514  1.00 15.40 ? 117  ILE L CG1 1 
ATOM   895  C CG2 . ILE A 1 117 ? 147.852 19.333 95.294  1.00 12.79 ? 117  ILE L CG2 1 
ATOM   896  C CD1 . ILE A 1 117 ? 146.050 17.041 95.875  1.00 20.18 ? 117  ILE L CD1 1 
ATOM   897  N N   . PHE A 1 118 ? 144.807 21.602 96.112  1.00 16.10 ? 118  PHE L N   1 
ATOM   898  C CA  . PHE A 1 118 ? 144.589 22.426 97.287  1.00 17.92 ? 118  PHE L CA  1 
ATOM   899  C C   . PHE A 1 118 ? 143.965 21.677 98.461  1.00 19.03 ? 118  PHE L C   1 
ATOM   900  O O   . PHE A 1 118 ? 142.901 21.065 98.338  1.00 19.30 ? 118  PHE L O   1 
ATOM   901  C CB  . PHE A 1 118 ? 143.663 23.591 96.960  1.00 17.96 ? 118  PHE L CB  1 
ATOM   902  C CG  . PHE A 1 118 ? 144.170 24.447 95.874  1.00 18.88 ? 118  PHE L CG  1 
ATOM   903  C CD1 . PHE A 1 118 ? 143.944 24.104 94.542  1.00 16.47 ? 118  PHE L CD1 1 
ATOM   904  C CD2 . PHE A 1 118 ? 144.967 25.549 96.162  1.00 18.21 ? 118  PHE L CD2 1 
ATOM   905  C CE1 . PHE A 1 118 ? 144.512 24.832 93.509  1.00 18.85 ? 118  PHE L CE1 1 
ATOM   906  C CE2 . PHE A 1 118 ? 145.548 26.293 95.117  1.00 18.26 ? 118  PHE L CE2 1 
ATOM   907  C CZ  . PHE A 1 118 ? 145.319 25.925 93.779  1.00 17.42 ? 118  PHE L CZ  1 
ATOM   908  N N   . PRO A 1 119 ? 144.620 21.726 99.629  1.00 21.54 ? 119  PRO L N   1 
ATOM   909  C CA  . PRO A 1 119 ? 144.076 21.051 100.816 1.00 20.80 ? 119  PRO L CA  1 
ATOM   910  C C   . PRO A 1 119 ? 142.868 21.866 101.240 1.00 21.07 ? 119  PRO L C   1 
ATOM   911  O O   . PRO A 1 119 ? 142.700 23.002 100.809 1.00 19.49 ? 119  PRO L O   1 
ATOM   912  C CB  . PRO A 1 119 ? 145.193 21.195 101.870 1.00 21.27 ? 119  PRO L CB  1 
ATOM   913  C CG  . PRO A 1 119 ? 146.438 21.573 101.090 1.00 21.45 ? 119  PRO L CG  1 
ATOM   914  C CD  . PRO A 1 119 ? 145.910 22.400 99.932  1.00 21.83 ? 119  PRO L CD  1 
ATOM   915  N N   . PRO A 1 120 ? 142.006 21.300 102.107 1.00 22.24 ? 120  PRO L N   1 
ATOM   916  C CA  . PRO A 1 120 ? 140.812 21.974 102.614 1.00 22.25 ? 120  PRO L CA  1 
ATOM   917  C C   . PRO A 1 120 ? 141.275 23.229 103.381 1.00 23.27 ? 120  PRO L C   1 
ATOM   918  O O   . PRO A 1 120 ? 142.329 23.193 104.059 1.00 21.95 ? 120  PRO L O   1 
ATOM   919  C CB  . PRO A 1 120 ? 140.240 20.966 103.623 1.00 23.27 ? 120  PRO L CB  1 
ATOM   920  C CG  . PRO A 1 120 ? 140.762 19.670 103.185 1.00 22.70 ? 120  PRO L CG  1 
ATOM   921  C CD  . PRO A 1 120 ? 142.186 20.012 102.794 1.00 23.34 ? 120  PRO L CD  1 
ATOM   922  N N   . SER A 1 121 ? 140.505 24.305 103.302 1.00 21.86 ? 121  SER L N   1 
ATOM   923  C CA  . SER A 1 121 ? 140.864 25.502 104.042 1.00 24.89 ? 121  SER L CA  1 
ATOM   924  C C   . SER A 1 121 ? 140.602 25.274 105.548 1.00 26.17 ? 121  SER L C   1 
ATOM   925  O O   . SER A 1 121 ? 139.840 24.391 105.932 1.00 26.17 ? 121  SER L O   1 
ATOM   926  C CB  . SER A 1 121 ? 140.029 26.686 103.554 1.00 25.32 ? 121  SER L CB  1 
ATOM   927  O OG  . SER A 1 121 ? 138.663 26.488 103.889 1.00 23.91 ? 121  SER L OG  1 
ATOM   928  N N   . SER A 1 122 ? 141.251 26.041 106.418 1.00 28.92 ? 122  SER L N   1 
ATOM   929  C CA  . SER A 1 122 ? 140.999 25.850 107.850 1.00 31.31 ? 122  SER L CA  1 
ATOM   930  C C   . SER A 1 122 ? 139.557 26.253 108.144 1.00 31.98 ? 122  SER L C   1 
ATOM   931  O O   . SER A 1 122 ? 138.903 25.645 108.993 1.00 32.76 ? 122  SER L O   1 
ATOM   932  C CB  . SER A 1 122 ? 141.946 26.680 108.700 1.00 31.84 ? 122  SER L CB  1 
ATOM   933  O OG  . SER A 1 122 ? 141.636 28.050 108.561 1.00 35.87 ? 122  SER L OG  1 
ATOM   934  N N   . GLU A 1 123 ? 139.043 27.244 107.420 1.00 32.52 ? 123  GLU L N   1 
ATOM   935  C CA  . GLU A 1 123 ? 137.664 27.671 107.633 1.00 34.38 ? 123  GLU L CA  1 
ATOM   936  C C   . GLU A 1 123 ? 136.705 26.513 107.396 1.00 32.69 ? 123  GLU L C   1 
ATOM   937  O O   . GLU A 1 123 ? 135.852 26.231 108.222 1.00 32.84 ? 123  GLU L O   1 
ATOM   938  C CB  . GLU A 1 123 ? 137.299 28.844 106.706 1.00 37.73 ? 123  GLU L CB  1 
ATOM   939  C CG  . GLU A 1 123 ? 138.016 30.147 107.037 1.00 43.11 ? 123  GLU L CG  1 
ATOM   940  C CD  . GLU A 1 123 ? 137.808 31.263 105.982 1.00 46.47 ? 123  GLU L CD  1 
ATOM   941  O OE1 . GLU A 1 123 ? 136.631 31.669 105.747 1.00 47.93 ? 123  GLU L OE1 1 
ATOM   942  O OE2 . GLU A 1 123 ? 138.839 31.729 105.401 1.00 46.94 ? 123  GLU L OE2 1 
ATOM   943  N N   . GLN A 1 124 ? 136.849 25.826 106.275 1.00 31.13 ? 124  GLN L N   1 
ATOM   944  C CA  . GLN A 1 124 ? 135.954 24.710 105.990 1.00 30.69 ? 124  GLN L CA  1 
ATOM   945  C C   . GLN A 1 124 ? 136.107 23.615 107.060 1.00 30.47 ? 124  GLN L C   1 
ATOM   946  O O   . GLN A 1 124 ? 135.127 23.026 107.480 1.00 31.18 ? 124  GLN L O   1 
ATOM   947  C CB  . GLN A 1 124 ? 136.221 24.134 104.575 1.00 29.78 ? 124  GLN L CB  1 
ATOM   948  C CG  . GLN A 1 124 ? 135.409 22.862 104.303 1.00 29.12 ? 124  GLN L CG  1 
ATOM   949  C CD  . GLN A 1 124 ? 135.646 22.225 102.932 1.00 27.91 ? 124  GLN L CD  1 
ATOM   950  O OE1 . GLN A 1 124 ? 136.767 22.196 102.432 1.00 26.55 ? 124  GLN L OE1 1 
ATOM   951  N NE2 . GLN A 1 124 ? 134.581 21.681 102.338 1.00 27.01 ? 124  GLN L NE2 1 
ATOM   952  N N   . LEU A 1 125 ? 137.326 23.330 107.490 1.00 31.39 ? 125  LEU L N   1 
ATOM   953  C CA  . LEU A 1 125 ? 137.531 22.294 108.502 1.00 34.16 ? 125  LEU L CA  1 
ATOM   954  C C   . LEU A 1 125 ? 136.723 22.628 109.776 1.00 36.90 ? 125  LEU L C   1 
ATOM   955  O O   . LEU A 1 125 ? 136.117 21.761 110.399 1.00 36.85 ? 125  LEU L O   1 
ATOM   956  C CB  . LEU A 1 125 ? 139.016 22.192 108.822 1.00 32.36 ? 125  LEU L CB  1 
ATOM   957  C CG  . LEU A 1 125 ? 139.771 21.375 107.778 1.00 31.76 ? 125  LEU L CG  1 
ATOM   958  C CD1 . LEU A 1 125 ? 141.254 21.521 107.967 1.00 30.71 ? 125  LEU L CD1 1 
ATOM   959  C CD2 . LEU A 1 125 ? 139.362 19.923 107.902 1.00 30.38 ? 125  LEU L CD2 1 
ATOM   960  N N   . THR A 1 126 ? 136.711 23.910 110.127 1.00 39.30 ? 126  THR L N   1 
ATOM   961  C CA  . THR A 1 126 ? 135.961 24.414 111.274 1.00 42.18 ? 126  THR L CA  1 
ATOM   962  C C   . THR A 1 126 ? 134.488 24.009 111.282 1.00 43.74 ? 126  THR L C   1 
ATOM   963  O O   . THR A 1 126 ? 133.853 23.988 112.336 1.00 44.32 ? 126  THR L O   1 
ATOM   964  C CB  . THR A 1 126 ? 136.041 25.951 111.316 1.00 42.02 ? 126  THR L CB  1 
ATOM   965  O OG1 . THR A 1 126 ? 137.365 26.330 111.702 1.00 42.50 ? 126  THR L OG1 1 
ATOM   966  C CG2 . THR A 1 126 ? 135.031 26.531 112.285 1.00 42.41 ? 126  THR L CG2 1 
ATOM   967  N N   . SER A 1 127 ? 133.946 23.700 110.109 1.00 44.65 ? 127  SER L N   1 
ATOM   968  C CA  . SER A 1 127 ? 132.541 23.316 109.988 1.00 45.54 ? 127  SER L CA  1 
ATOM   969  C C   . SER A 1 127 ? 132.400 21.803 109.862 1.00 45.43 ? 127  SER L C   1 
ATOM   970  O O   . SER A 1 127 ? 131.315 21.307 109.532 1.00 45.95 ? 127  SER L O   1 
ATOM   971  C CB  . SER A 1 127 ? 131.928 23.946 108.730 1.00 46.40 ? 127  SER L CB  1 
ATOM   972  O OG  . SER A 1 127 ? 132.395 23.265 107.562 1.00 48.51 ? 127  SER L OG  1 
ATOM   973  N N   . GLY A 1 128 ? 133.491 21.069 110.065 1.00 44.46 ? 128  GLY L N   1 
ATOM   974  C CA  . GLY A 1 128 ? 133.403 19.617 109.958 1.00 43.35 ? 128  GLY L CA  1 
ATOM   975  C C   . GLY A 1 128 ? 133.441 19.068 108.535 1.00 42.54 ? 128  GLY L C   1 
ATOM   976  O O   . GLY A 1 128 ? 133.210 17.864 108.325 1.00 43.12 ? 128  GLY L O   1 
ATOM   977  N N   . GLY A 1 129 ? 133.730 19.940 107.561 1.00 40.87 ? 129  GLY L N   1 
ATOM   978  C CA  . GLY A 1 129 ? 133.811 19.513 106.171 1.00 37.54 ? 129  GLY L CA  1 
ATOM   979  C C   . GLY A 1 129 ? 135.249 19.554 105.664 1.00 35.91 ? 129  GLY L C   1 
ATOM   980  O O   . GLY A 1 129 ? 136.089 20.297 106.221 1.00 36.22 ? 129  GLY L O   1 
ATOM   981  N N   . ALA A 1 130 ? 135.564 18.750 104.639 1.00 32.66 ? 130  ALA L N   1 
ATOM   982  C CA  . ALA A 1 130 ? 136.912 18.769 104.070 1.00 30.36 ? 130  ALA L CA  1 
ATOM   983  C C   . ALA A 1 130 ? 136.936 18.453 102.561 1.00 29.04 ? 130  ALA L C   1 
ATOM   984  O O   . ALA A 1 130 ? 136.882 17.285 102.144 1.00 27.58 ? 130  ALA L O   1 
ATOM   985  C CB  . ALA A 1 130 ? 137.833 17.807 104.835 1.00 29.46 ? 130  ALA L CB  1 
ATOM   986  N N   . SER A 1 131 ? 137.011 19.494 101.738 1.00 25.50 ? 131  SER L N   1 
ATOM   987  C CA  . SER A 1 131 ? 137.088 19.284 100.299 1.00 24.40 ? 131  SER L CA  1 
ATOM   988  C C   . SER A 1 131 ? 138.552 19.476 99.821  1.00 23.77 ? 131  SER L C   1 
ATOM   989  O O   . SER A 1 131 ? 139.257 20.415 100.260 1.00 24.32 ? 131  SER L O   1 
ATOM   990  C CB  . SER A 1 131 ? 136.169 20.263 99.587  1.00 22.66 ? 131  SER L CB  1 
ATOM   991  O OG  . SER A 1 131 ? 134.844 20.144 100.044 1.00 23.38 ? 131  SER L OG  1 
ATOM   992  N N   . VAL A 1 132 ? 139.035 18.556 98.993  1.00 21.19 ? 132  VAL L N   1 
ATOM   993  C CA  . VAL A 1 132 ? 140.380 18.666 98.446  1.00 19.53 ? 132  VAL L CA  1 
ATOM   994  C C   . VAL A 1 132 ? 140.072 19.018 96.984  1.00 20.23 ? 132  VAL L C   1 
ATOM   995  O O   . VAL A 1 132 ? 139.277 18.328 96.316  1.00 20.04 ? 132  VAL L O   1 
ATOM   996  C CB  . VAL A 1 132 ? 141.137 17.341 98.537  1.00 20.03 ? 132  VAL L CB  1 
ATOM   997  C CG1 . VAL A 1 132 ? 142.633 17.560 98.210  1.00 17.62 ? 132  VAL L CG1 1 
ATOM   998  C CG2 . VAL A 1 132 ? 140.960 16.728 99.951  1.00 20.65 ? 132  VAL L CG2 1 
ATOM   999  N N   . VAL A 1 133 ? 140.674 20.093 96.493  1.00 19.89 ? 133  VAL L N   1 
ATOM   1000 C CA  . VAL A 1 133 ? 140.395 20.571 95.140  1.00 18.56 ? 133  VAL L CA  1 
ATOM   1001 C C   . VAL A 1 133 ? 141.588 20.433 94.202  1.00 19.91 ? 133  VAL L C   1 
ATOM   1002 O O   . VAL A 1 133 ? 142.729 20.704 94.574  1.00 20.46 ? 133  VAL L O   1 
ATOM   1003 C CB  . VAL A 1 133 ? 139.946 22.083 95.171  1.00 17.12 ? 133  VAL L CB  1 
ATOM   1004 C CG1 . VAL A 1 133 ? 139.660 22.560 93.750  1.00 17.63 ? 133  VAL L CG1 1 
ATOM   1005 C CG2 . VAL A 1 133 ? 138.688 22.266 96.079  1.00 15.13 ? 133  VAL L CG2 1 
ATOM   1006 N N   . CYS A 1 134 ? 141.313 19.998 92.971  1.00 20.22 ? 134  CYS L N   1 
ATOM   1007 C CA  . CYS A 1 134 ? 142.361 19.852 91.972  1.00 19.66 ? 134  CYS L CA  1 
ATOM   1008 C C   . CYS A 1 134 ? 141.894 20.507 90.671  1.00 18.82 ? 134  CYS L C   1 
ATOM   1009 O O   . CYS A 1 134 ? 140.800 20.217 90.181  1.00 18.21 ? 134  CYS L O   1 
ATOM   1010 C CB  . CYS A 1 134 ? 142.622 18.392 91.698  1.00 21.48 ? 134  CYS L CB  1 
ATOM   1011 S SG  . CYS A 1 134 ? 144.034 18.136 90.593  1.00 25.60 ? 134  CYS L SG  1 
ATOM   1012 N N   . PHE A 1 135 ? 142.712 21.396 90.138  1.00 17.26 ? 135  PHE L N   1 
ATOM   1013 C CA  . PHE A 1 135 ? 142.402 22.077 88.871  1.00 16.94 ? 135  PHE L CA  1 
ATOM   1014 C C   . PHE A 1 135 ? 143.323 21.528 87.791  1.00 16.73 ? 135  PHE L C   1 
ATOM   1015 O O   . PHE A 1 135 ? 144.525 21.369 88.019  1.00 17.72 ? 135  PHE L O   1 
ATOM   1016 C CB  . PHE A 1 135 ? 142.698 23.585 88.985  1.00 17.51 ? 135  PHE L CB  1 
ATOM   1017 C CG  . PHE A 1 135 ? 141.798 24.295 89.924  1.00 19.08 ? 135  PHE L CG  1 
ATOM   1018 C CD1 . PHE A 1 135 ? 140.421 24.226 89.780  1.00 19.58 ? 135  PHE L CD1 1 
ATOM   1019 C CD2 . PHE A 1 135 ? 142.315 25.072 90.953  1.00 21.66 ? 135  PHE L CD2 1 
ATOM   1020 C CE1 . PHE A 1 135 ? 139.557 24.944 90.671  1.00 18.62 ? 135  PHE L CE1 1 
ATOM   1021 C CE2 . PHE A 1 135 ? 141.445 25.781 91.835  1.00 20.83 ? 135  PHE L CE2 1 
ATOM   1022 C CZ  . PHE A 1 135 ? 140.082 25.705 91.676  1.00 18.38 ? 135  PHE L CZ  1 
ATOM   1023 N N   . LEU A 1 136 ? 142.777 21.258 86.615  1.00 15.08 ? 136  LEU L N   1 
ATOM   1024 C CA  . LEU A 1 136 ? 143.588 20.767 85.504  1.00 15.72 ? 136  LEU L CA  1 
ATOM   1025 C C   . LEU A 1 136 ? 143.241 21.830 84.452  1.00 14.80 ? 136  LEU L C   1 
ATOM   1026 O O   . LEU A 1 136 ? 142.175 21.806 83.856  1.00 14.06 ? 136  LEU L O   1 
ATOM   1027 C CB  . LEU A 1 136 ? 143.139 19.359 85.102  1.00 16.42 ? 136  LEU L CB  1 
ATOM   1028 C CG  . LEU A 1 136 ? 143.415 18.314 86.196  1.00 17.11 ? 136  LEU L CG  1 
ATOM   1029 C CD1 . LEU A 1 136 ? 142.388 18.485 87.269  1.00 19.43 ? 136  LEU L CD1 1 
ATOM   1030 C CD2 . LEU A 1 136 ? 143.322 16.901 85.632  1.00 19.13 ? 136  LEU L CD2 1 
ATOM   1031 N N   . ASN A 1 137 ? 144.151 22.755 84.254  1.00 14.12 ? 137  ASN L N   1 
ATOM   1032 C CA  . ASN A 1 137 ? 143.876 23.904 83.396  1.00 16.49 ? 137  ASN L CA  1 
ATOM   1033 C C   . ASN A 1 137 ? 144.597 24.046 82.068  1.00 16.85 ? 137  ASN L C   1 
ATOM   1034 O O   . ASN A 1 137 ? 145.776 23.673 81.949  1.00 14.79 ? 137  ASN L O   1 
ATOM   1035 C CB  . ASN A 1 137 ? 144.131 25.202 84.187  1.00 16.34 ? 137  ASN L CB  1 
ATOM   1036 C CG  . ASN A 1 137 ? 143.119 25.420 85.333  1.00 18.18 ? 137  ASN L CG  1 
ATOM   1037 O OD1 . ASN A 1 137 ? 142.003 24.923 85.268  1.00 18.28 ? 137  ASN L OD1 1 
ATOM   1038 N ND2 . ASN A 1 137 ? 143.507 26.213 86.370  1.00 17.30 ? 137  ASN L ND2 1 
ATOM   1039 N N   . ASN A 1 138 ? 143.850 24.614 81.104  1.00 15.84 ? 138  ASN L N   1 
ATOM   1040 C CA  . ASN A 1 138 ? 144.301 24.951 79.759  1.00 16.72 ? 138  ASN L CA  1 
ATOM   1041 C C   . ASN A 1 138 ? 144.912 23.805 78.961  1.00 17.01 ? 138  ASN L C   1 
ATOM   1042 O O   . ASN A 1 138 ? 146.017 23.941 78.445  1.00 15.29 ? 138  ASN L O   1 
ATOM   1043 C CB  . ASN A 1 138 ? 145.292 26.135 79.818  1.00 17.63 ? 138  ASN L CB  1 
ATOM   1044 C CG  . ASN A 1 138 ? 144.640 27.408 80.398  1.00 19.98 ? 138  ASN L CG  1 
ATOM   1045 O OD1 . ASN A 1 138 ? 144.673 27.616 81.597  1.00 20.60 ? 138  ASN L OD1 1 
ATOM   1046 N ND2 . ASN A 1 138 ? 144.036 28.247 79.530  1.00 19.56 ? 138  ASN L ND2 1 
ATOM   1047 N N   . PHE A 1 139 ? 144.194 22.684 78.848  1.00 16.25 ? 139  PHE L N   1 
ATOM   1048 C CA  . PHE A 1 139 ? 144.736 21.555 78.101  1.00 16.10 ? 139  PHE L CA  1 
ATOM   1049 C C   . PHE A 1 139 ? 144.019 21.360 76.752  1.00 15.96 ? 139  PHE L C   1 
ATOM   1050 O O   . PHE A 1 139 ? 142.945 21.923 76.515  1.00 14.87 ? 139  PHE L O   1 
ATOM   1051 C CB  . PHE A 1 139 ? 144.611 20.250 78.925  1.00 14.65 ? 139  PHE L CB  1 
ATOM   1052 C CG  . PHE A 1 139 ? 143.214 19.968 79.431  1.00 15.69 ? 139  PHE L CG  1 
ATOM   1053 C CD1 . PHE A 1 139 ? 142.804 20.435 80.690  1.00 14.56 ? 139  PHE L CD1 1 
ATOM   1054 C CD2 . PHE A 1 139 ? 142.322 19.210 78.676  1.00 13.84 ? 139  PHE L CD2 1 
ATOM   1055 C CE1 . PHE A 1 139 ? 141.513 20.147 81.195  1.00 15.50 ? 139  PHE L CE1 1 
ATOM   1056 C CE2 . PHE A 1 139 ? 141.037 18.912 79.157  1.00 13.95 ? 139  PHE L CE2 1 
ATOM   1057 C CZ  . PHE A 1 139 ? 140.621 19.378 80.419  1.00 16.38 ? 139  PHE L CZ  1 
ATOM   1058 N N   . TYR A 1 140 ? 144.591 20.518 75.893  1.00 15.38 ? 140  TYR L N   1 
ATOM   1059 C CA  . TYR A 1 140 ? 143.948 20.243 74.619  1.00 15.64 ? 140  TYR L CA  1 
ATOM   1060 C C   . TYR A 1 140 ? 144.621 18.990 74.140  1.00 15.92 ? 140  TYR L C   1 
ATOM   1061 O O   . TYR A 1 140 ? 145.819 18.917 74.152  1.00 15.65 ? 140  TYR L O   1 
ATOM   1062 C CB  . TYR A 1 140 ? 144.177 21.340 73.569  1.00 16.39 ? 140  TYR L CB  1 
ATOM   1063 C CG  . TYR A 1 140 ? 143.365 21.071 72.321  1.00 17.97 ? 140  TYR L CG  1 
ATOM   1064 C CD1 . TYR A 1 140 ? 142.048 21.525 72.215  1.00 18.22 ? 140  TYR L CD1 1 
ATOM   1065 C CD2 . TYR A 1 140 ? 143.886 20.289 71.269  1.00 18.53 ? 140  TYR L CD2 1 
ATOM   1066 C CE1 . TYR A 1 140 ? 141.252 21.210 71.082  1.00 19.56 ? 140  TYR L CE1 1 
ATOM   1067 C CE2 . TYR A 1 140 ? 143.090 19.964 70.130  1.00 17.31 ? 140  TYR L CE2 1 
ATOM   1068 C CZ  . TYR A 1 140 ? 141.780 20.435 70.062  1.00 19.74 ? 140  TYR L CZ  1 
ATOM   1069 O OH  . TYR A 1 140 ? 140.971 20.106 68.986  1.00 21.64 ? 140  TYR L OH  1 
ATOM   1070 N N   . PRO A 1 141 ? 143.852 18.020 73.631  1.00 16.70 ? 141  PRO L N   1 
ATOM   1071 C CA  . PRO A 1 141 ? 142.389 18.035 73.471  1.00 16.85 ? 141  PRO L CA  1 
ATOM   1072 C C   . PRO A 1 141 ? 141.586 17.894 74.741  1.00 17.09 ? 141  PRO L C   1 
ATOM   1073 O O   . PRO A 1 141 ? 142.144 17.650 75.817  1.00 16.32 ? 141  PRO L O   1 
ATOM   1074 C CB  . PRO A 1 141 ? 142.123 16.874 72.515  1.00 17.17 ? 141  PRO L CB  1 
ATOM   1075 C CG  . PRO A 1 141 ? 143.193 15.868 72.924  1.00 17.08 ? 141  PRO L CG  1 
ATOM   1076 C CD  . PRO A 1 141 ? 144.437 16.791 73.044  1.00 17.84 ? 141  PRO L CD  1 
ATOM   1077 N N   . LYS A 1 142 ? 140.261 17.972 74.601  1.00 16.33 ? 142  LYS L N   1 
ATOM   1078 C CA  . LYS A 1 142 ? 139.400 17.913 75.771  1.00 17.93 ? 142  LYS L CA  1 
ATOM   1079 C C   . LYS A 1 142 ? 139.351 16.601 76.574  1.00 18.13 ? 142  LYS L C   1 
ATOM   1080 O O   . LYS A 1 142 ? 138.945 16.602 77.738  1.00 18.66 ? 142  LYS L O   1 
ATOM   1081 C CB  . LYS A 1 142 ? 137.998 18.302 75.368  1.00 19.98 ? 142  LYS L CB  1 
ATOM   1082 C CG  . LYS A 1 142 ? 137.324 17.332 74.355  1.00 23.99 ? 142  LYS L CG  1 
ATOM   1083 C CD  . LYS A 1 142 ? 135.892 17.839 74.090  1.00 28.13 ? 142  LYS L CD  1 
ATOM   1084 C CE  . LYS A 1 142 ? 135.127 16.951 73.085  1.00 31.21 ? 142  LYS L CE  1 
ATOM   1085 N NZ  . LYS A 1 142 ? 134.908 15.567 73.603  1.00 34.05 ? 142  LYS L NZ  1 
ATOM   1086 N N   . ASP A 1 143 ? 139.756 15.484 75.985  1.00 17.48 ? 143  ASP L N   1 
ATOM   1087 C CA  . ASP A 1 143 ? 139.668 14.213 76.715  1.00 18.53 ? 143  ASP L CA  1 
ATOM   1088 C C   . ASP A 1 143 ? 140.684 14.115 77.822  1.00 17.12 ? 143  ASP L C   1 
ATOM   1089 O O   . ASP A 1 143 ? 141.887 14.196 77.568  1.00 16.39 ? 143  ASP L O   1 
ATOM   1090 C CB  . ASP A 1 143 ? 139.871 13.072 75.740  1.00 21.61 ? 143  ASP L CB  1 
ATOM   1091 C CG  . ASP A 1 143 ? 139.122 13.327 74.435  1.00 22.68 ? 143  ASP L CG  1 
ATOM   1092 O OD1 . ASP A 1 143 ? 137.887 13.263 74.517  1.00 23.18 ? 143  ASP L OD1 1 
ATOM   1093 O OD2 . ASP A 1 143 ? 139.773 13.630 73.391  1.00 25.66 ? 143  ASP L OD2 1 
ATOM   1094 N N   . ILE A 1 144 ? 140.213 13.853 79.035  1.00 17.28 ? 144  ILE L N   1 
ATOM   1095 C CA  . ILE A 1 144 ? 141.148 13.817 80.152  1.00 17.41 ? 144  ILE L CA  1 
ATOM   1096 C C   . ILE A 1 144 ? 140.588 12.965 81.268  1.00 18.06 ? 144  ILE L C   1 
ATOM   1097 O O   . ILE A 1 144 ? 139.391 12.793 81.394  1.00 17.31 ? 144  ILE L O   1 
ATOM   1098 C CB  . ILE A 1 144 ? 141.416 15.297 80.641  1.00 19.65 ? 144  ILE L CB  1 
ATOM   1099 C CG1 . ILE A 1 144 ? 142.650 15.405 81.553  1.00 18.31 ? 144  ILE L CG1 1 
ATOM   1100 C CG2 . ILE A 1 144 ? 140.179 15.824 81.409  1.00 18.72 ? 144  ILE L CG2 1 
ATOM   1101 C CD1 . ILE A 1 144 ? 143.150 16.845 81.704  1.00 19.21 ? 144  ILE L CD1 1 
ATOM   1102 N N   . ASN A 1 145 ? 141.457 12.412 82.093  1.00 19.23 ? 145  ASN L N   1 
ATOM   1103 C CA  . ASN A 1 145 ? 140.959 11.609 83.186  1.00 21.38 ? 145  ASN L CA  1 
ATOM   1104 C C   . ASN A 1 145 ? 141.624 12.014 84.489  1.00 19.51 ? 145  ASN L C   1 
ATOM   1105 O O   . ASN A 1 145 ? 142.813 12.231 84.527  1.00 20.88 ? 145  ASN L O   1 
ATOM   1106 C CB  . ASN A 1 145 ? 141.248 10.122 82.930  1.00 25.52 ? 145  ASN L CB  1 
ATOM   1107 C CG  . ASN A 1 145 ? 140.862 9.261  84.120  1.00 31.73 ? 145  ASN L CG  1 
ATOM   1108 O OD1 . ASN A 1 145 ? 139.692 8.901  84.262  1.00 35.73 ? 145  ASN L OD1 1 
ATOM   1109 N ND2 . ASN A 1 145 ? 141.835 8.974  85.027  1.00 33.62 ? 145  ASN L ND2 1 
ATOM   1110 N N   . VAL A 1 146 ? 140.876 12.060 85.573  1.00 19.22 ? 146  VAL L N   1 
ATOM   1111 C CA  . VAL A 1 146 ? 141.477 12.428 86.850  1.00 19.17 ? 146  VAL L CA  1 
ATOM   1112 C C   . VAL A 1 146 ? 141.302 11.282 87.842  1.00 19.45 ? 146  VAL L C   1 
ATOM   1113 O O   . VAL A 1 146 ? 140.214 10.714 87.930  1.00 18.21 ? 146  VAL L O   1 
ATOM   1114 C CB  . VAL A 1 146 ? 140.798 13.702 87.426  1.00 18.73 ? 146  VAL L CB  1 
ATOM   1115 C CG1 . VAL A 1 146 ? 141.394 14.064 88.770  1.00 19.26 ? 146  VAL L CG1 1 
ATOM   1116 C CG2 . VAL A 1 146 ? 141.063 14.866 86.487  1.00 22.10 ? 146  VAL L CG2 1 
ATOM   1117 N N   . LYS A 1 147 ? 142.375 10.939 88.557  1.00 19.58 ? 147  LYS L N   1 
ATOM   1118 C CA  . LYS A 1 147 ? 142.320 9.877  89.570  1.00 20.47 ? 147  LYS L CA  1 
ATOM   1119 C C   . LYS A 1 147 ? 142.817 10.405 90.905  1.00 20.77 ? 147  LYS L C   1 
ATOM   1120 O O   . LYS A 1 147 ? 143.826 11.107 90.958  1.00 21.15 ? 147  LYS L O   1 
ATOM   1121 C CB  . LYS A 1 147 ? 143.208 8.694  89.182  1.00 21.31 ? 147  LYS L CB  1 
ATOM   1122 C CG  . LYS A 1 147 ? 143.221 7.591  90.249  1.00 23.03 ? 147  LYS L CG  1 
ATOM   1123 C CD  . LYS A 1 147 ? 144.401 6.599  90.071  1.00 23.49 ? 147  LYS L CD  1 
ATOM   1124 C CE  . LYS A 1 147 ? 144.158 5.601  88.946  1.00 24.69 ? 147  LYS L CE  1 
ATOM   1125 N NZ  . LYS A 1 147 ? 145.332 4.694  88.809  1.00 24.94 ? 147  LYS L NZ  1 
ATOM   1126 N N   . TRP A 1 148 ? 142.117 10.062 91.977  1.00 20.04 ? 148  TRP L N   1 
ATOM   1127 C CA  . TRP A 1 148 ? 142.502 10.478 93.321  1.00 20.90 ? 148  TRP L CA  1 
ATOM   1128 C C   . TRP A 1 148 ? 143.051 9.289  94.106  1.00 22.22 ? 148  TRP L C   1 
ATOM   1129 O O   . TRP A 1 148 ? 142.561 8.139  93.994  1.00 22.31 ? 148  TRP L O   1 
ATOM   1130 C CB  . TRP A 1 148 ? 141.304 10.981 94.145  1.00 20.17 ? 148  TRP L CB  1 
ATOM   1131 C CG  . TRP A 1 148 ? 140.795 12.337 93.770  1.00 21.73 ? 148  TRP L CG  1 
ATOM   1132 C CD1 . TRP A 1 148 ? 139.840 12.625 92.850  1.00 22.06 ? 148  TRP L CD1 1 
ATOM   1133 C CD2 . TRP A 1 148 ? 141.273 13.599 94.265  1.00 22.80 ? 148  TRP L CD2 1 
ATOM   1134 N NE1 . TRP A 1 148 ? 139.686 13.994 92.733  1.00 22.60 ? 148  TRP L NE1 1 
ATOM   1135 C CE2 . TRP A 1 148 ? 140.562 14.608 93.594  1.00 23.62 ? 148  TRP L CE2 1 
ATOM   1136 C CE3 . TRP A 1 148 ? 142.239 13.965 95.211  1.00 23.57 ? 148  TRP L CE3 1 
ATOM   1137 C CZ2 . TRP A 1 148 ? 140.787 15.986 93.842  1.00 23.56 ? 148  TRP L CZ2 1 
ATOM   1138 C CZ3 . TRP A 1 148 ? 142.462 15.342 95.456  1.00 25.19 ? 148  TRP L CZ3 1 
ATOM   1139 C CH2 . TRP A 1 148 ? 141.737 16.323 94.771  1.00 23.25 ? 148  TRP L CH2 1 
ATOM   1140 N N   . LYS A 1 149 ? 144.024 9.586  94.942  1.00 20.66 ? 149  LYS L N   1 
ATOM   1141 C CA  . LYS A 1 149 ? 144.540 8.586  95.829  1.00 21.40 ? 149  LYS L CA  1 
ATOM   1142 C C   . LYS A 1 149 ? 144.715 9.185  97.233  1.00 23.34 ? 149  LYS L C   1 
ATOM   1143 O O   . LYS A 1 149 ? 145.158 10.340 97.385  1.00 22.42 ? 149  LYS L O   1 
ATOM   1144 C CB  . LYS A 1 149 ? 145.869 8.081  95.339  1.00 21.87 ? 149  LYS L CB  1 
ATOM   1145 C CG  . LYS A 1 149 ? 145.838 7.354  94.020  1.00 22.79 ? 149  LYS L CG  1 
ATOM   1146 C CD  . LYS A 1 149 ? 147.271 6.985  93.635  1.00 23.51 ? 149  LYS L CD  1 
ATOM   1147 C CE  . LYS A 1 149 ? 147.285 6.160  92.351  1.00 26.06 ? 149  LYS L CE  1 
ATOM   1148 N NZ  . LYS A 1 149 ? 148.707 5.832  91.990  1.00 27.55 ? 149  LYS L NZ  1 
ATOM   1149 N N   . ILE A 1 150 ? 144.331 8.415  98.252  1.00 24.12 ? 150  ILE L N   1 
ATOM   1150 C CA  . ILE A 1 150 ? 144.532 8.834  99.635  1.00 25.97 ? 150  ILE L CA  1 
ATOM   1151 C C   . ILE A 1 150 ? 145.534 7.787  100.185 1.00 28.24 ? 150  ILE L C   1 
ATOM   1152 O O   . ILE A 1 150 ? 145.297 6.581  100.084 1.00 29.15 ? 150  ILE L O   1 
ATOM   1153 C CB  . ILE A 1 150 ? 143.226 8.828  100.423 1.00 24.48 ? 150  ILE L CB  1 
ATOM   1154 C CG1 . ILE A 1 150 ? 142.263 9.850  99.815  1.00 22.87 ? 150  ILE L CG1 1 
ATOM   1155 C CG2 . ILE A 1 150 ? 143.483 9.238  101.889 1.00 25.05 ? 150  ILE L CG2 1 
ATOM   1156 C CD1 . ILE A 1 150 ? 140.845 9.701  100.327 1.00 20.38 ? 150  ILE L CD1 1 
ATOM   1157 N N   . ASP A 1 151 ? 146.652 8.252  100.729 1.00 29.80 ? 151  ASP L N   1 
ATOM   1158 C CA  . ASP A 1 151 ? 147.709 7.361  101.240 1.00 31.16 ? 151  ASP L CA  1 
ATOM   1159 C C   . ASP A 1 151 ? 147.979 6.214  100.263 1.00 31.93 ? 151  ASP L C   1 
ATOM   1160 O O   . ASP A 1 151 ? 147.980 5.045  100.650 1.00 32.90 ? 151  ASP L O   1 
ATOM   1161 C CB  . ASP A 1 151 ? 147.328 6.795  102.623 1.00 32.13 ? 151  ASP L CB  1 
ATOM   1162 C CG  . ASP A 1 151 ? 147.437 7.846  103.757 1.00 33.53 ? 151  ASP L CG  1 
ATOM   1163 O OD1 . ASP A 1 151 ? 146.566 7.866  104.655 1.00 34.69 ? 151  ASP L OD1 1 
ATOM   1164 O OD2 . ASP A 1 151 ? 148.394 8.652  103.755 1.00 34.75 ? 151  ASP L OD2 1 
ATOM   1165 N N   . GLY A 1 152 ? 148.187 6.551  98.988  1.00 31.87 ? 152  GLY L N   1 
ATOM   1166 C CA  . GLY A 1 152 ? 148.497 5.550  97.980  1.00 30.07 ? 152  GLY L CA  1 
ATOM   1167 C C   . GLY A 1 152 ? 147.326 4.761  97.417  1.00 30.12 ? 152  GLY L C   1 
ATOM   1168 O O   . GLY A 1 152 ? 147.471 4.082  96.390  1.00 30.84 ? 152  GLY L O   1 
ATOM   1169 N N   . SER A 1 153 ? 146.165 4.840  98.047  1.00 30.23 ? 153  SER L N   1 
ATOM   1170 C CA  . SER A 1 153 ? 145.000 4.081  97.568  1.00 31.58 ? 153  SER L CA  1 
ATOM   1171 C C   . SER A 1 153 ? 143.972 4.891  96.794  1.00 31.91 ? 153  SER L C   1 
ATOM   1172 O O   . SER A 1 153 ? 143.501 5.943  97.265  1.00 32.17 ? 153  SER L O   1 
ATOM   1173 C CB  . SER A 1 153 ? 144.293 3.399  98.754  1.00 33.14 ? 153  SER L CB  1 
ATOM   1174 O OG  . SER A 1 153 ? 145.185 2.474  99.388  1.00 37.89 ? 153  SER L OG  1 
ATOM   1175 N N   . GLU A 1 154 ? 143.599 4.389  95.619  1.00 30.76 ? 154  GLU L N   1 
ATOM   1176 C CA  . GLU A 1 154 ? 142.612 5.074  94.799  1.00 29.89 ? 154  GLU L CA  1 
ATOM   1177 C C   . GLU A 1 154 ? 141.288 5.264  95.542  1.00 30.46 ? 154  GLU L C   1 
ATOM   1178 O O   . GLU A 1 154 ? 140.818 4.379  96.275  1.00 29.01 ? 154  GLU L O   1 
ATOM   1179 C CB  . GLU A 1 154 ? 142.363 4.293  93.514  1.00 29.95 ? 154  GLU L CB  1 
ATOM   1180 C CG  . GLU A 1 154 ? 141.372 4.947  92.558  1.00 29.84 ? 154  GLU L CG  1 
ATOM   1181 C CD  . GLU A 1 154 ? 141.162 4.098  91.316  1.00 30.54 ? 154  GLU L CD  1 
ATOM   1182 O OE1 . GLU A 1 154 ? 140.324 4.454  90.469  1.00 29.14 ? 154  GLU L OE1 1 
ATOM   1183 O OE2 . GLU A 1 154 ? 141.850 3.070  91.199  1.00 29.55 ? 154  GLU L OE2 1 
ATOM   1184 N N   . ARG A 1 155 ? 140.676 6.420  95.327  1.00 30.02 ? 155  ARG L N   1 
ATOM   1185 C CA  . ARG A 1 155 ? 139.420 6.749  95.972  1.00 30.93 ? 155  ARG L CA  1 
ATOM   1186 C C   . ARG A 1 155 ? 138.406 7.170  94.904  1.00 32.64 ? 155  ARG L C   1 
ATOM   1187 O O   . ARG A 1 155 ? 138.690 8.079  94.106  1.00 30.99 ? 155  ARG L O   1 
ATOM   1188 C CB  . ARG A 1 155 ? 139.677 7.892  96.959  1.00 31.62 ? 155  ARG L CB  1 
ATOM   1189 C CG  . ARG A 1 155 ? 138.440 8.564  97.548  1.00 34.06 ? 155  ARG L CG  1 
ATOM   1190 C CD  . ARG A 1 155 ? 137.525 7.558  98.251  1.00 37.09 ? 155  ARG L CD  1 
ATOM   1191 N NE  . ARG A 1 155 ? 136.531 8.196  99.118  1.00 40.51 ? 155  ARG L NE  1 
ATOM   1192 C CZ  . ARG A 1 155 ? 136.629 8.301  100.453 1.00 42.19 ? 155  ARG L CZ  1 
ATOM   1193 N NH1 . ARG A 1 155 ? 137.678 7.810  101.112 1.00 42.76 ? 155  ARG L NH1 1 
ATOM   1194 N NH2 . ARG A 1 155 ? 135.666 8.903  101.148 1.00 43.48 ? 155  ARG L NH2 1 
ATOM   1195 N N   . GLN A 1 156 ? 137.237 6.528  94.868  1.00 34.24 ? 156  GLN L N   1 
ATOM   1196 C CA  . GLN A 1 156 ? 136.214 6.908  93.887  1.00 38.94 ? 156  GLN L CA  1 
ATOM   1197 C C   . GLN A 1 156 ? 134.935 7.627  94.434  1.00 39.70 ? 156  GLN L C   1 
ATOM   1198 O O   . GLN A 1 156 ? 134.350 8.495  93.764  1.00 40.63 ? 156  GLN L O   1 
ATOM   1199 C CB  . GLN A 1 156 ? 135.871 5.686  93.022  1.00 41.11 ? 156  GLN L CB  1 
ATOM   1200 C CG  . GLN A 1 156 ? 137.029 5.354  92.095  1.00 45.38 ? 156  GLN L CG  1 
ATOM   1201 C CD  . GLN A 1 156 ? 137.010 3.926  91.499  1.00 48.26 ? 156  GLN L CD  1 
ATOM   1202 O OE1 . GLN A 1 156 ? 137.226 2.919  92.198  1.00 49.09 ? 156  GLN L OE1 1 
ATOM   1203 N NE2 . GLN A 1 156 ? 136.772 3.852  90.195  1.00 49.30 ? 156  GLN L NE2 1 
ATOM   1204 N N   . ASN A 1 157 ? 134.526 7.324  95.655  1.00 40.78 ? 157  ASN L N   1 
ATOM   1205 C CA  . ASN A 1 157 ? 133.343 7.996  96.259  1.00 40.97 ? 157  ASN L CA  1 
ATOM   1206 C C   . ASN A 1 157 ? 133.629 9.469  96.726  1.00 38.09 ? 157  ASN L C   1 
ATOM   1207 O O   . ASN A 1 157 ? 134.728 9.769  97.157  1.00 37.58 ? 157  ASN L O   1 
ATOM   1208 C CB  . ASN A 1 157 ? 132.878 7.164  97.463  1.00 45.68 ? 157  ASN L CB  1 
ATOM   1209 C CG  . ASN A 1 157 ? 132.639 5.680  97.107  1.00 49.19 ? 157  ASN L CG  1 
ATOM   1210 O OD1 . ASN A 1 157 ? 133.466 5.035  96.434  1.00 51.21 ? 157  ASN L OD1 1 
ATOM   1211 N ND2 . ASN A 1 157 ? 131.506 5.138  97.569  1.00 51.52 ? 157  ASN L ND2 1 
ATOM   1212 N N   . GLY A 1 158 ? 132.645 10.363 96.634  1.00 35.07 ? 158  GLY L N   1 
ATOM   1213 C CA  . GLY A 1 158 ? 132.824 11.745 97.069  1.00 32.26 ? 158  GLY L CA  1 
ATOM   1214 C C   . GLY A 1 158 ? 133.495 12.719 96.090  1.00 30.09 ? 158  GLY L C   1 
ATOM   1215 O O   . GLY A 1 158 ? 133.800 13.866 96.428  1.00 29.31 ? 158  GLY L O   1 
ATOM   1216 N N   . VAL A 1 159 ? 133.713 12.279 94.870  1.00 27.18 ? 159  VAL L N   1 
ATOM   1217 C CA  . VAL A 1 159 ? 134.364 13.109 93.871  1.00 25.26 ? 159  VAL L CA  1 
ATOM   1218 C C   . VAL A 1 159 ? 133.390 13.775 92.901  1.00 27.61 ? 159  VAL L C   1 
ATOM   1219 O O   . VAL A 1 159 ? 132.566 13.084 92.270  1.00 27.62 ? 159  VAL L O   1 
ATOM   1220 C CB  . VAL A 1 159 ? 135.351 12.285 93.019  1.00 23.01 ? 159  VAL L CB  1 
ATOM   1221 C CG1 . VAL A 1 159 ? 135.954 13.162 91.960  1.00 21.54 ? 159  VAL L CG1 1 
ATOM   1222 C CG2 . VAL A 1 159 ? 136.441 11.643 93.911  1.00 21.51 ? 159  VAL L CG2 1 
ATOM   1223 N N   . LEU A 1 160 ? 133.457 15.105 92.774  1.00 26.00 ? 160  LEU L N   1 
ATOM   1224 C CA  . LEU A 1 160 ? 132.602 15.790 91.788  1.00 26.03 ? 160  LEU L CA  1 
ATOM   1225 C C   . LEU A 1 160 ? 133.501 16.533 90.793  1.00 24.75 ? 160  LEU L C   1 
ATOM   1226 O O   . LEU A 1 160 ? 134.441 17.254 91.182  1.00 23.18 ? 160  LEU L O   1 
ATOM   1227 C CB  . LEU A 1 160 ? 131.598 16.731 92.466  1.00 26.83 ? 160  LEU L CB  1 
ATOM   1228 C CG  . LEU A 1 160 ? 130.512 15.916 93.245  1.00 29.46 ? 160  LEU L CG  1 
ATOM   1229 C CD1 . LEU A 1 160 ? 129.543 16.836 93.948  1.00 29.61 ? 160  LEU L CD1 1 
ATOM   1230 C CD2 . LEU A 1 160 ? 129.735 14.995 92.271  1.00 28.91 ? 160  LEU L CD2 1 
ATOM   1231 N N   . ASN A 1 161 ? 133.246 16.309 89.512  1.00 22.77 ? 161  ASN L N   1 
ATOM   1232 C CA  . ASN A 1 161 ? 134.033 16.937 88.452  1.00 21.95 ? 161  ASN L CA  1 
ATOM   1233 C C   . ASN A 1 161 ? 133.226 17.977 87.665  1.00 22.13 ? 161  ASN L C   1 
ATOM   1234 O O   . ASN A 1 161 ? 131.998 17.850 87.524  1.00 21.48 ? 161  ASN L O   1 
ATOM   1235 C CB  . ASN A 1 161 ? 134.531 15.872 87.465  1.00 20.87 ? 161  ASN L CB  1 
ATOM   1236 C CG  . ASN A 1 161 ? 135.477 14.896 88.098  1.00 22.48 ? 161  ASN L CG  1 
ATOM   1237 O OD1 . ASN A 1 161 ? 136.211 15.239 89.029  1.00 22.10 ? 161  ASN L OD1 1 
ATOM   1238 N ND2 . ASN A 1 161 ? 135.517 13.688 87.568  1.00 20.52 ? 161  ASN L ND2 1 
ATOM   1239 N N   . SER A 1 162 ? 133.919 18.990 87.156  1.00 19.93 ? 162  SER L N   1 
ATOM   1240 C CA  . SER A 1 162 ? 133.277 20.022 86.339  1.00 20.84 ? 162  SER L CA  1 
ATOM   1241 C C   . SER A 1 162 ? 134.244 20.475 85.237  1.00 21.25 ? 162  SER L C   1 
ATOM   1242 O O   . SER A 1 162 ? 135.446 20.702 85.479  1.00 20.93 ? 162  SER L O   1 
ATOM   1243 C CB  . SER A 1 162 ? 132.842 21.211 87.190  1.00 20.17 ? 162  SER L CB  1 
ATOM   1244 O OG  . SER A 1 162 ? 132.001 22.091 86.462  1.00 18.14 ? 162  SER L OG  1 
ATOM   1245 N N   . TRP A 1 163 ? 133.699 20.610 84.028  1.00 22.48 ? 163  TRP L N   1 
ATOM   1246 C CA  . TRP A 1 163 ? 134.463 20.971 82.827  1.00 22.61 ? 163  TRP L CA  1 
ATOM   1247 C C   . TRP A 1 163 ? 134.004 22.301 82.213  1.00 21.33 ? 163  TRP L C   1 
ATOM   1248 O O   . TRP A 1 163 ? 132.839 22.577 82.167  1.00 19.66 ? 163  TRP L O   1 
ATOM   1249 C CB  . TRP A 1 163 ? 134.282 19.862 81.784  1.00 24.75 ? 163  TRP L CB  1 
ATOM   1250 C CG  . TRP A 1 163 ? 134.721 18.502 82.261  1.00 29.29 ? 163  TRP L CG  1 
ATOM   1251 C CD1 . TRP A 1 163 ? 135.930 17.911 82.043  1.00 29.88 ? 163  TRP L CD1 1 
ATOM   1252 C CD2 . TRP A 1 163 ? 133.942 17.550 83.007  1.00 30.16 ? 163  TRP L CD2 1 
ATOM   1253 N NE1 . TRP A 1 163 ? 135.952 16.649 82.602  1.00 31.55 ? 163  TRP L NE1 1 
ATOM   1254 C CE2 . TRP A 1 163 ? 134.735 16.409 83.195  1.00 30.74 ? 163  TRP L CE2 1 
ATOM   1255 C CE3 . TRP A 1 163 ? 132.635 17.569 83.532  1.00 31.72 ? 163  TRP L CE3 1 
ATOM   1256 C CZ2 . TRP A 1 163 ? 134.275 15.267 83.886  1.00 33.20 ? 163  TRP L CZ2 1 
ATOM   1257 C CZ3 . TRP A 1 163 ? 132.170 16.441 84.223  1.00 33.46 ? 163  TRP L CZ3 1 
ATOM   1258 C CH2 . TRP A 1 163 ? 132.991 15.300 84.395  1.00 32.87 ? 163  TRP L CH2 1 
ATOM   1259 N N   . THR A 1 164 ? 134.926 23.140 81.789  1.00 20.57 ? 164  THR L N   1 
ATOM   1260 C CA  . THR A 1 164 ? 134.510 24.367 81.165  1.00 20.47 ? 164  THR L CA  1 
ATOM   1261 C C   . THR A 1 164 ? 134.329 24.050 79.678  1.00 21.88 ? 164  THR L C   1 
ATOM   1262 O O   . THR A 1 164 ? 134.849 23.040 79.167  1.00 21.02 ? 164  THR L O   1 
ATOM   1263 C CB  . THR A 1 164 ? 135.596 25.470 81.260  1.00 21.72 ? 164  THR L CB  1 
ATOM   1264 O OG1 . THR A 1 164 ? 136.822 24.984 80.717  1.00 21.51 ? 164  THR L OG1 1 
ATOM   1265 C CG2 . THR A 1 164 ? 135.821 25.928 82.716  1.00 22.71 ? 164  THR L CG2 1 
ATOM   1266 N N   . ASP A 1 165 ? 133.615 24.923 78.982  1.00 20.90 ? 165  ASP L N   1 
ATOM   1267 C CA  . ASP A 1 165 ? 133.461 24.795 77.530  1.00 22.98 ? 165  ASP L CA  1 
ATOM   1268 C C   . ASP A 1 165 ? 134.784 25.324 76.908  1.00 21.89 ? 165  ASP L C   1 
ATOM   1269 O O   . ASP A 1 165 ? 135.516 26.050 77.582  1.00 20.50 ? 165  ASP L O   1 
ATOM   1270 C CB  . ASP A 1 165 ? 132.272 25.649 77.092  1.00 26.56 ? 165  ASP L CB  1 
ATOM   1271 C CG  . ASP A 1 165 ? 132.031 25.602 75.598  1.00 31.66 ? 165  ASP L CG  1 
ATOM   1272 O OD1 . ASP A 1 165 ? 132.494 24.636 74.913  1.00 32.35 ? 165  ASP L OD1 1 
ATOM   1273 O OD2 . ASP A 1 165 ? 131.348 26.558 75.114  1.00 36.23 ? 165  ASP L OD2 1 
ATOM   1274 N N   . GLN A 1 166 ? 135.105 24.972 75.660  1.00 19.95 ? 166  GLN L N   1 
ATOM   1275 C CA  . GLN A 1 166 ? 136.344 25.434 75.044  1.00 20.89 ? 166  GLN L CA  1 
ATOM   1276 C C   . GLN A 1 166 ? 136.554 26.959 75.173  1.00 23.57 ? 166  GLN L C   1 
ATOM   1277 O O   . GLN A 1 166 ? 135.643 27.764 74.944  1.00 22.97 ? 166  GLN L O   1 
ATOM   1278 C CB  . GLN A 1 166 ? 136.400 25.050 73.556  1.00 18.98 ? 166  GLN L CB  1 
ATOM   1279 C CG  . GLN A 1 166 ? 137.734 25.403 72.881  1.00 17.76 ? 166  GLN L CG  1 
ATOM   1280 C CD  . GLN A 1 166 ? 137.811 24.894 71.416  1.00 19.43 ? 166  GLN L CD  1 
ATOM   1281 O OE1 . GLN A 1 166 ? 136.869 25.092 70.645  1.00 14.12 ? 166  GLN L OE1 1 
ATOM   1282 N NE2 . GLN A 1 166 ? 138.960 24.254 71.036  1.00 17.10 ? 166  GLN L NE2 1 
ATOM   1283 N N   . ASP A 1 167 ? 137.769 27.355 75.519  1.00 25.52 ? 167  ASP L N   1 
ATOM   1284 C CA  . ASP A 1 167 ? 138.042 28.772 75.676  1.00 27.87 ? 167  ASP L CA  1 
ATOM   1285 C C   . ASP A 1 167 ? 138.150 29.461 74.321  1.00 29.80 ? 167  ASP L C   1 
ATOM   1286 O O   . ASP A 1 167 ? 138.965 29.094 73.446  1.00 28.72 ? 167  ASP L O   1 
ATOM   1287 C CB  . ASP A 1 167 ? 139.327 28.994 76.461  1.00 28.16 ? 167  ASP L CB  1 
ATOM   1288 C CG  . ASP A 1 167 ? 139.638 30.483 76.642  1.00 31.62 ? 167  ASP L CG  1 
ATOM   1289 O OD1 . ASP A 1 167 ? 140.300 31.119 75.756  1.00 32.18 ? 167  ASP L OD1 1 
ATOM   1290 O OD2 . ASP A 1 167 ? 139.191 31.016 77.672  1.00 30.75 ? 167  ASP L OD2 1 
ATOM   1291 N N   . SER A 1 168 ? 137.309 30.457 74.146  1.00 30.42 ? 168  SER L N   1 
ATOM   1292 C CA  . SER A 1 168 ? 137.290 31.212 72.927  1.00 33.54 ? 168  SER L CA  1 
ATOM   1293 C C   . SER A 1 168 ? 138.666 31.798 72.554  1.00 33.79 ? 168  SER L C   1 
ATOM   1294 O O   . SER A 1 168 ? 139.103 31.728 71.405  1.00 34.72 ? 168  SER L O   1 
ATOM   1295 C CB  . SER A 1 168 ? 136.262 32.325 73.081  1.00 34.85 ? 168  SER L CB  1 
ATOM   1296 O OG  . SER A 1 168 ? 136.670 33.439 72.328  1.00 39.05 ? 168  SER L OG  1 
ATOM   1297 N N   . LYS A 1 169 ? 139.383 32.336 73.522  1.00 33.52 ? 169  LYS L N   1 
ATOM   1298 C CA  . LYS A 1 169 ? 140.664 32.919 73.185  1.00 33.48 ? 169  LYS L CA  1 
ATOM   1299 C C   . LYS A 1 169 ? 141.832 31.969 72.859  1.00 31.20 ? 169  LYS L C   1 
ATOM   1300 O O   . LYS A 1 169 ? 142.486 32.128 71.821  1.00 31.66 ? 169  LYS L O   1 
ATOM   1301 C CB  . LYS A 1 169 ? 141.014 33.915 74.275  1.00 37.61 ? 169  LYS L CB  1 
ATOM   1302 C CG  . LYS A 1 169 ? 139.905 35.007 74.346  1.00 43.75 ? 169  LYS L CG  1 
ATOM   1303 C CD  . LYS A 1 169 ? 140.098 36.046 75.465  1.00 47.92 ? 169  LYS L CD  1 
ATOM   1304 C CE  . LYS A 1 169 ? 138.805 36.843 75.696  1.00 50.25 ? 169  LYS L CE  1 
ATOM   1305 N NZ  . LYS A 1 169 ? 138.821 37.541 77.031  1.00 52.00 ? 169  LYS L NZ  1 
ATOM   1306 N N   . ASP A 1 170 ? 142.095 30.969 73.687  1.00 26.68 ? 170  ASP L N   1 
ATOM   1307 C CA  . ASP A 1 170 ? 143.206 30.086 73.370  1.00 22.96 ? 170  ASP L CA  1 
ATOM   1308 C C   . ASP A 1 170 ? 142.824 28.661 72.955  1.00 20.83 ? 170  ASP L C   1 
ATOM   1309 O O   . ASP A 1 170 ? 143.701 27.818 72.895  1.00 18.31 ? 170  ASP L O   1 
ATOM   1310 C CB  . ASP A 1 170 ? 144.163 29.996 74.569  1.00 23.41 ? 170  ASP L CB  1 
ATOM   1311 C CG  . ASP A 1 170 ? 143.538 29.261 75.767  1.00 24.51 ? 170  ASP L CG  1 
ATOM   1312 O OD1 . ASP A 1 170 ? 142.452 28.640 75.653  1.00 20.92 ? 170  ASP L OD1 1 
ATOM   1313 O OD2 . ASP A 1 170 ? 144.155 29.273 76.844  1.00 25.54 ? 170  ASP L OD2 1 
ATOM   1314 N N   . SER A 1 171 ? 141.534 28.389 72.731  1.00 16.99 ? 171  SER L N   1 
ATOM   1315 C CA  . SER A 1 171 ? 141.020 27.057 72.326  1.00 15.70 ? 171  SER L CA  1 
ATOM   1316 C C   . SER A 1 171 ? 141.311 25.886 73.274  1.00 15.15 ? 171  SER L C   1 
ATOM   1317 O O   . SER A 1 171 ? 141.267 24.705 72.863  1.00 14.89 ? 171  SER L O   1 
ATOM   1318 C CB  . SER A 1 171 ? 141.538 26.698 70.932  1.00 14.56 ? 171  SER L CB  1 
ATOM   1319 O OG  . SER A 1 171 ? 141.245 27.761 70.063  1.00 19.06 ? 171  SER L OG  1 
ATOM   1320 N N   . THR A 1 172 ? 141.621 26.181 74.527  1.00 12.46 ? 172  THR L N   1 
ATOM   1321 C CA  . THR A 1 172 ? 141.874 25.111 75.472  1.00 13.00 ? 172  THR L CA  1 
ATOM   1322 C C   . THR A 1 172 ? 140.640 24.843 76.333  1.00 13.66 ? 172  THR L C   1 
ATOM   1323 O O   . THR A 1 172 ? 139.636 25.581 76.271  1.00 13.91 ? 172  THR L O   1 
ATOM   1324 C CB  . THR A 1 172 ? 143.037 25.438 76.428  1.00 12.46 ? 172  THR L CB  1 
ATOM   1325 O OG1 . THR A 1 172 ? 142.635 26.513 77.263  1.00 14.40 ? 172  THR L OG1 1 
ATOM   1326 C CG2 . THR A 1 172 ? 144.366 25.835 75.645  1.00 12.70 ? 172  THR L CG2 1 
ATOM   1327 N N   . TYR A 1 173 ? 140.734 23.775 77.132  1.00 11.46 ? 173  TYR L N   1 
ATOM   1328 C CA  . TYR A 1 173 ? 139.686 23.360 78.059  1.00 14.16 ? 173  TYR L CA  1 
ATOM   1329 C C   . TYR A 1 173 ? 140.285 23.328 79.466  1.00 13.32 ? 173  TYR L C   1 
ATOM   1330 O O   . TYR A 1 173 ? 141.499 23.224 79.609  1.00 14.00 ? 173  TYR L O   1 
ATOM   1331 C CB  . TYR A 1 173 ? 139.223 21.924 77.748  1.00 14.47 ? 173  TYR L CB  1 
ATOM   1332 C CG  . TYR A 1 173 ? 138.548 21.810 76.410  1.00 17.13 ? 173  TYR L CG  1 
ATOM   1333 C CD1 . TYR A 1 173 ? 137.165 21.905 76.317  1.00 18.95 ? 173  TYR L CD1 1 
ATOM   1334 C CD2 . TYR A 1 173 ? 139.304 21.658 75.224  1.00 17.29 ? 173  TYR L CD2 1 
ATOM   1335 C CE1 . TYR A 1 173 ? 136.524 21.851 75.092  1.00 18.43 ? 173  TYR L CE1 1 
ATOM   1336 C CE2 . TYR A 1 173 ? 138.669 21.603 73.952  1.00 17.25 ? 173  TYR L CE2 1 
ATOM   1337 C CZ  . TYR A 1 173 ? 137.261 21.697 73.921  1.00 18.61 ? 173  TYR L CZ  1 
ATOM   1338 O OH  . TYR A 1 173 ? 136.564 21.646 72.725  1.00 20.24 ? 173  TYR L OH  1 
ATOM   1339 N N   . SER A 1 174 ? 139.426 23.404 80.489  1.00 13.14 ? 174  SER L N   1 
ATOM   1340 C CA  . SER A 1 174 ? 139.902 23.282 81.853  1.00 15.51 ? 174  SER L CA  1 
ATOM   1341 C C   . SER A 1 174 ? 138.890 22.413 82.611  1.00 15.77 ? 174  SER L C   1 
ATOM   1342 O O   . SER A 1 174 ? 137.754 22.237 82.175  1.00 12.61 ? 174  SER L O   1 
ATOM   1343 C CB  . SER A 1 174 ? 140.108 24.665 82.509  1.00 15.60 ? 174  SER L CB  1 
ATOM   1344 O OG  . SER A 1 174 ? 141.162 25.375 81.819  1.00 15.14 ? 174  SER L OG  1 
ATOM   1345 N N   . MET A 1 175 ? 139.338 21.835 83.722  1.00 16.51 ? 175  MET L N   1 
ATOM   1346 C CA  . MET A 1 175 ? 138.501 20.948 84.499  1.00 17.95 ? 175  MET L CA  1 
ATOM   1347 C C   . MET A 1 175 ? 138.865 21.101 85.957  1.00 19.12 ? 175  MET L C   1 
ATOM   1348 O O   . MET A 1 175 ? 140.020 21.427 86.285  1.00 18.35 ? 175  MET L O   1 
ATOM   1349 C CB  . MET A 1 175 ? 138.725 19.485 84.041  1.00 19.61 ? 175  MET L CB  1 
ATOM   1350 C CG  . MET A 1 175 ? 138.050 18.426 84.900  1.00 23.36 ? 175  MET L CG  1 
ATOM   1351 S SD  . MET A 1 175 ? 138.745 16.773 84.557  1.00 27.43 ? 175  MET L SD  1 
ATOM   1352 C CE  . MET A 1 175 ? 137.881 15.819 85.828  1.00 23.89 ? 175  MET L CE  1 
ATOM   1353 N N   . SER A 1 176 ? 137.844 20.886 86.796  1.00 19.47 ? 176  SER L N   1 
ATOM   1354 C CA  . SER A 1 176 ? 137.950 20.932 88.228  1.00 20.48 ? 176  SER L CA  1 
ATOM   1355 C C   . SER A 1 176 ? 137.553 19.553 88.796  1.00 18.94 ? 176  SER L C   1 
ATOM   1356 O O   . SER A 1 176 ? 136.634 18.919 88.269  1.00 17.18 ? 176  SER L O   1 
ATOM   1357 C CB  . SER A 1 176 ? 136.981 21.989 88.738  1.00 22.62 ? 176  SER L CB  1 
ATOM   1358 O OG  . SER A 1 176 ? 137.359 22.377 90.021  1.00 31.03 ? 176  SER L OG  1 
ATOM   1359 N N   . SER A 1 177 ? 138.237 19.085 89.849  1.00 17.10 ? 177  SER L N   1 
ATOM   1360 C CA  . SER A 1 177 ? 137.884 17.803 90.480  1.00 16.96 ? 177  SER L CA  1 
ATOM   1361 C C   . SER A 1 177 ? 137.965 18.028 91.965  1.00 17.25 ? 177  SER L C   1 
ATOM   1362 O O   . SER A 1 177 ? 139.012 18.410 92.469  1.00 18.76 ? 177  SER L O   1 
ATOM   1363 C CB  . SER A 1 177 ? 138.849 16.671 90.050  1.00 17.82 ? 177  SER L CB  1 
ATOM   1364 O OG  . SER A 1 177 ? 138.464 15.440 90.672  1.00 19.02 ? 177  SER L OG  1 
ATOM   1365 N N   . THR A 1 178 ? 136.865 17.783 92.674  1.00 18.52 ? 178  THR L N   1 
ATOM   1366 C CA  . THR A 1 178 ? 136.799 18.019 94.090  1.00 19.67 ? 178  THR L CA  1 
ATOM   1367 C C   . THR A 1 178 ? 136.406 16.767 94.867  1.00 19.95 ? 178  THR L C   1 
ATOM   1368 O O   . THR A 1 178 ? 135.359 16.189 94.613  1.00 20.48 ? 178  THR L O   1 
ATOM   1369 C CB  . THR A 1 178 ? 135.748 19.147 94.401  1.00 20.86 ? 178  THR L CB  1 
ATOM   1370 O OG1 . THR A 1 178 ? 136.102 20.350 93.703  1.00 20.19 ? 178  THR L OG1 1 
ATOM   1371 C CG2 . THR A 1 178 ? 135.690 19.428 95.908  1.00 20.62 ? 178  THR L CG2 1 
ATOM   1372 N N   . LEU A 1 179 ? 137.232 16.387 95.831  1.00 22.17 ? 179  LEU L N   1 
ATOM   1373 C CA  . LEU A 1 179 ? 136.993 15.212 96.680  1.00 23.32 ? 179  LEU L CA  1 
ATOM   1374 C C   . LEU A 1 179 ? 136.534 15.743 98.037  1.00 25.24 ? 179  LEU L C   1 
ATOM   1375 O O   . LEU A 1 179 ? 137.282 16.475 98.703  1.00 24.04 ? 179  LEU L O   1 
ATOM   1376 C CB  . LEU A 1 179 ? 138.280 14.402 96.830  1.00 23.00 ? 179  LEU L CB  1 
ATOM   1377 C CG  . LEU A 1 179 ? 138.380 13.310 97.924  1.00 24.68 ? 179  LEU L CG  1 
ATOM   1378 C CD1 . LEU A 1 179 ? 137.275 12.264 97.718  1.00 23.67 ? 179  LEU L CD1 1 
ATOM   1379 C CD2 . LEU A 1 179 ? 139.800 12.629 97.877  1.00 24.48 ? 179  LEU L CD2 1 
ATOM   1380 N N   . THR A 1 180 ? 135.296 15.416 98.422  1.00 25.64 ? 180  THR L N   1 
ATOM   1381 C CA  . THR A 1 180 ? 134.748 15.889 99.694  1.00 29.21 ? 180  THR L CA  1 
ATOM   1382 C C   . THR A 1 180 ? 134.644 14.719 100.677 1.00 30.63 ? 180  THR L C   1 
ATOM   1383 O O   . THR A 1 180 ? 134.141 13.655 100.346 1.00 31.41 ? 180  THR L O   1 
ATOM   1384 C CB  . THR A 1 180 ? 133.363 16.549 99.481  1.00 30.24 ? 180  THR L CB  1 
ATOM   1385 O OG1 . THR A 1 180 ? 133.541 17.749 98.721  1.00 32.00 ? 180  THR L OG1 1 
ATOM   1386 C CG2 . THR A 1 180 ? 132.700 16.917 100.798 1.00 30.95 ? 180  THR L CG2 1 
ATOM   1387 N N   . LEU A 1 181 ? 135.183 14.926 101.865 1.00 32.49 ? 181  LEU L N   1 
ATOM   1388 C CA  . LEU A 1 181 ? 135.227 13.948 102.947 1.00 33.58 ? 181  LEU L CA  1 
ATOM   1389 C C   . LEU A 1 181 ? 134.799 14.671 104.192 1.00 34.58 ? 181  LEU L C   1 
ATOM   1390 O O   . LEU A 1 181 ? 134.714 15.903 104.187 1.00 34.79 ? 181  LEU L O   1 
ATOM   1391 C CB  . LEU A 1 181 ? 136.659 13.501 103.188 1.00 33.86 ? 181  LEU L CB  1 
ATOM   1392 C CG  . LEU A 1 181 ? 137.363 12.755 102.080 1.00 34.60 ? 181  LEU L CG  1 
ATOM   1393 C CD1 . LEU A 1 181 ? 137.383 13.637 100.869 1.00 37.49 ? 181  LEU L CD1 1 
ATOM   1394 C CD2 . LEU A 1 181 ? 138.752 12.425 102.506 1.00 33.03 ? 181  LEU L CD2 1 
ATOM   1395 N N   . THR A 1 182 ? 134.533 13.922 105.268 1.00 35.18 ? 182  THR L N   1 
ATOM   1396 C CA  . THR A 1 182 ? 134.193 14.561 106.547 1.00 35.46 ? 182  THR L CA  1 
ATOM   1397 C C   . THR A 1 182 ? 135.564 14.946 107.117 1.00 34.77 ? 182  THR L C   1 
ATOM   1398 O O   . THR A 1 182 ? 136.581 14.352 106.739 1.00 34.43 ? 182  THR L O   1 
ATOM   1399 C CB  . THR A 1 182 ? 133.587 13.571 107.553 1.00 35.34 ? 182  THR L CB  1 
ATOM   1400 O OG1 . THR A 1 182 ? 134.521 12.504 107.750 1.00 37.23 ? 182  THR L OG1 1 
ATOM   1401 C CG2 . THR A 1 182 ? 132.257 13.007 107.057 1.00 36.71 ? 182  THR L CG2 1 
ATOM   1402 N N   . LYS A 1 183 ? 135.592 15.912 108.030 1.00 35.65 ? 183  LYS L N   1 
ATOM   1403 C CA  . LYS A 1 183 ? 136.838 16.326 108.668 1.00 35.89 ? 183  LYS L CA  1 
ATOM   1404 C C   . LYS A 1 183 ? 137.576 15.148 109.350 1.00 36.57 ? 183  LYS L C   1 
ATOM   1405 O O   . LYS A 1 183 ? 138.798 15.029 109.242 1.00 36.83 ? 183  LYS L O   1 
ATOM   1406 C CB  . LYS A 1 183 ? 136.535 17.415 109.694 1.00 36.59 ? 183  LYS L CB  1 
ATOM   1407 C CG  . LYS A 1 183 ? 137.686 17.790 110.615 1.00 38.88 ? 183  LYS L CG  1 
ATOM   1408 C CD  . LYS A 1 183 ? 137.319 19.007 111.482 1.00 40.26 ? 183  LYS L CD  1 
ATOM   1409 C CE  . LYS A 1 183 ? 138.284 19.152 112.662 1.00 41.17 ? 183  LYS L CE  1 
ATOM   1410 N NZ  . LYS A 1 183 ? 138.110 18.006 113.617 1.00 41.17 ? 183  LYS L NZ  1 
ATOM   1411 N N   . ASP A 1 184 ? 136.847 14.266 110.033 1.00 37.16 ? 184  ASP L N   1 
ATOM   1412 C CA  . ASP A 1 184 ? 137.496 13.144 110.720 1.00 37.93 ? 184  ASP L CA  1 
ATOM   1413 C C   . ASP A 1 184 ? 138.142 12.147 109.795 1.00 36.74 ? 184  ASP L C   1 
ATOM   1414 O O   . ASP A 1 184 ? 139.249 11.673 110.050 1.00 36.11 ? 184  ASP L O   1 
ATOM   1415 C CB  . ASP A 1 184 ? 136.505 12.442 111.633 1.00 40.31 ? 184  ASP L CB  1 
ATOM   1416 C CG  . ASP A 1 184 ? 136.249 13.237 112.903 1.00 43.21 ? 184  ASP L CG  1 
ATOM   1417 O OD1 . ASP A 1 184 ? 135.132 13.099 113.474 1.00 45.03 ? 184  ASP L OD1 1 
ATOM   1418 O OD2 . ASP A 1 184 ? 137.178 13.995 113.320 1.00 43.34 ? 184  ASP L OD2 1 
ATOM   1419 N N   . GLU A 1 185 ? 137.453 11.826 108.708 1.00 36.98 ? 185  GLU L N   1 
ATOM   1420 C CA  . GLU A 1 185 ? 138.002 10.899 107.742 1.00 36.37 ? 185  GLU L CA  1 
ATOM   1421 C C   . GLU A 1 185 ? 139.231 11.548 107.087 1.00 34.78 ? 185  GLU L C   1 
ATOM   1422 O O   . GLU A 1 185 ? 140.285 10.911 106.888 1.00 34.16 ? 185  GLU L O   1 
ATOM   1423 C CB  . GLU A 1 185 ? 136.918 10.578 106.724 1.00 38.96 ? 185  GLU L CB  1 
ATOM   1424 C CG  . GLU A 1 185 ? 137.434 9.868  105.524 1.00 43.28 ? 185  GLU L CG  1 
ATOM   1425 C CD  . GLU A 1 185 ? 136.303 9.420  104.611 1.00 45.63 ? 185  GLU L CD  1 
ATOM   1426 O OE1 . GLU A 1 185 ? 135.298 10.195 104.444 1.00 46.29 ? 185  GLU L OE1 1 
ATOM   1427 O OE2 . GLU A 1 185 ? 136.444 8.296  104.076 1.00 44.82 ? 185  GLU L OE2 1 
ATOM   1428 N N   . TYR A 1 186 ? 139.109 12.831 106.763 1.00 33.95 ? 186  TYR L N   1 
ATOM   1429 C CA  . TYR A 1 186 ? 140.240 13.546 106.158 1.00 32.72 ? 186  TYR L CA  1 
ATOM   1430 C C   . TYR A 1 186 ? 141.422 13.543 107.118 1.00 32.56 ? 186  TYR L C   1 
ATOM   1431 O O   . TYR A 1 186 ? 142.579 13.258 106.733 1.00 30.33 ? 186  TYR L O   1 
ATOM   1432 C CB  . TYR A 1 186 ? 139.836 14.991 105.829 1.00 30.50 ? 186  TYR L CB  1 
ATOM   1433 C CG  . TYR A 1 186 ? 141.004 15.874 105.484 1.00 27.95 ? 186  TYR L CG  1 
ATOM   1434 C CD1 . TYR A 1 186 ? 141.450 16.854 106.379 1.00 26.57 ? 186  TYR L CD1 1 
ATOM   1435 C CD2 . TYR A 1 186 ? 141.687 15.715 104.286 1.00 26.94 ? 186  TYR L CD2 1 
ATOM   1436 C CE1 . TYR A 1 186 ? 142.547 17.654 106.091 1.00 26.39 ? 186  TYR L CE1 1 
ATOM   1437 C CE2 . TYR A 1 186 ? 142.798 16.513 103.974 1.00 26.55 ? 186  TYR L CE2 1 
ATOM   1438 C CZ  . TYR A 1 186 ? 143.221 17.480 104.880 1.00 27.33 ? 186  TYR L CZ  1 
ATOM   1439 O OH  . TYR A 1 186 ? 144.300 18.271 104.580 1.00 26.64 ? 186  TYR L OH  1 
ATOM   1440 N N   . GLU A 1 187 ? 141.126 13.833 108.388 1.00 34.14 ? 187  GLU L N   1 
ATOM   1441 C CA  . GLU A 1 187 ? 142.188 13.888 109.401 1.00 36.81 ? 187  GLU L CA  1 
ATOM   1442 C C   . GLU A 1 187 ? 142.693 12.495 109.761 1.00 37.01 ? 187  GLU L C   1 
ATOM   1443 O O   . GLU A 1 187 ? 143.659 12.343 110.519 1.00 37.64 ? 187  GLU L O   1 
ATOM   1444 C CB  . GLU A 1 187 ? 141.709 14.663 110.649 1.00 38.26 ? 187  GLU L CB  1 
ATOM   1445 C CG  . GLU A 1 187 ? 141.203 16.072 110.256 1.00 41.39 ? 187  GLU L CG  1 
ATOM   1446 C CD  . GLU A 1 187 ? 141.084 17.074 111.405 1.00 43.29 ? 187  GLU L CD  1 
ATOM   1447 O OE1 . GLU A 1 187 ? 140.517 16.737 112.474 1.00 44.18 ? 187  GLU L OE1 1 
ATOM   1448 O OE2 . GLU A 1 187 ? 141.544 18.220 111.214 1.00 43.43 ? 187  GLU L OE2 1 
ATOM   1449 N N   . ARG A 1 188 ? 142.054 11.481 109.187 1.00 37.13 ? 188  ARG L N   1 
ATOM   1450 C CA  . ARG A 1 188 ? 142.458 10.094 109.412 1.00 37.47 ? 188  ARG L CA  1 
ATOM   1451 C C   . ARG A 1 188 ? 143.546 9.638  108.424 1.00 36.74 ? 188  ARG L C   1 
ATOM   1452 O O   . ARG A 1 188 ? 144.037 8.520  108.550 1.00 37.24 ? 188  ARG L O   1 
ATOM   1453 C CB  . ARG A 1 188 ? 141.229 9.169  109.300 1.00 39.44 ? 188  ARG L CB  1 
ATOM   1454 C CG  . ARG A 1 188 ? 141.030 8.245  110.498 1.00 41.46 ? 188  ARG L CG  1 
ATOM   1455 C CD  . ARG A 1 188 ? 139.607 8.302  111.056 1.00 43.93 ? 188  ARG L CD  1 
ATOM   1456 N NE  . ARG A 1 188 ? 138.611 8.035  110.019 1.00 46.26 ? 188  ARG L NE  1 
ATOM   1457 C CZ  . ARG A 1 188 ? 137.296 8.236  110.152 1.00 47.92 ? 188  ARG L CZ  1 
ATOM   1458 N NH1 . ARG A 1 188 ? 136.783 8.713  111.298 1.00 47.90 ? 188  ARG L NH1 1 
ATOM   1459 N NH2 . ARG A 1 188 ? 136.490 7.976  109.117 1.00 48.05 ? 188  ARG L NH2 1 
ATOM   1460 N N   . HIS A 1 189 ? 143.916 10.467 107.432 1.00 35.05 ? 189  HIS L N   1 
ATOM   1461 C CA  . HIS A 1 189 ? 144.956 10.064 106.476 1.00 33.99 ? 189  HIS L CA  1 
ATOM   1462 C C   . HIS A 1 189 ? 145.940 11.168 106.197 1.00 33.56 ? 189  HIS L C   1 
ATOM   1463 O O   . HIS A 1 189 ? 145.691 12.321 106.536 1.00 32.67 ? 189  HIS L O   1 
ATOM   1464 C CB  . HIS A 1 189 ? 144.364 9.624  105.134 1.00 34.41 ? 189  HIS L CB  1 
ATOM   1465 C CG  . HIS A 1 189 ? 143.426 8.467  105.239 1.00 34.11 ? 189  HIS L CG  1 
ATOM   1466 N ND1 . HIS A 1 189 ? 142.079 8.627  105.465 1.00 34.15 ? 189  HIS L ND1 1 
ATOM   1467 C CD2 . HIS A 1 189 ? 143.642 7.136  105.116 1.00 32.91 ? 189  HIS L CD2 1 
ATOM   1468 C CE1 . HIS A 1 189 ? 141.494 7.439  105.470 1.00 33.37 ? 189  HIS L CE1 1 
ATOM   1469 N NE2 . HIS A 1 189 ? 142.420 6.521  105.260 1.00 33.88 ? 189  HIS L NE2 1 
ATOM   1470 N N   . ASN A 1 190 ? 147.035 10.829 105.533 1.00 32.84 ? 190  ASN L N   1 
ATOM   1471 C CA  . ASN A 1 190 ? 148.044 11.838 105.273 1.00 34.39 ? 190  ASN L CA  1 
ATOM   1472 C C   . ASN A 1 190 ? 148.354 12.307 103.842 1.00 32.75 ? 190  ASN L C   1 
ATOM   1473 O O   . ASN A 1 190 ? 148.475 13.501 103.629 1.00 32.65 ? 190  ASN L O   1 
ATOM   1474 C CB  . ASN A 1 190 ? 149.369 11.450 105.937 1.00 34.79 ? 190  ASN L CB  1 
ATOM   1475 C CG  . ASN A 1 190 ? 150.308 12.660 106.083 1.00 38.43 ? 190  ASN L CG  1 
ATOM   1476 O OD1 . ASN A 1 190 ? 149.944 13.671 106.723 1.00 39.44 ? 190  ASN L OD1 1 
ATOM   1477 N ND2 . ASN A 1 190 ? 151.514 12.574 105.481 1.00 38.46 ? 190  ASN L ND2 1 
ATOM   1478 N N   . SER A 1 191 ? 148.527 11.401 102.884 1.00 31.58 ? 191  SER L N   1 
ATOM   1479 C CA  . SER A 1 191 ? 148.836 11.831 101.514 1.00 30.35 ? 191  SER L CA  1 
ATOM   1480 C C   . SER A 1 191 ? 147.607 11.933 100.676 1.00 28.65 ? 191  SER L C   1 
ATOM   1481 O O   . SER A 1 191 ? 146.795 11.027 100.697 1.00 29.29 ? 191  SER L O   1 
ATOM   1482 C CB  . SER A 1 191 ? 149.726 10.839 100.789 1.00 31.35 ? 191  SER L CB  1 
ATOM   1483 O OG  . SER A 1 191 ? 150.870 10.642 101.544 1.00 38.41 ? 191  SER L OG  1 
ATOM   1484 N N   . TYR A 1 192 ? 147.494 13.015 99.910  1.00 26.55 ? 192  TYR L N   1 
ATOM   1485 C CA  . TYR A 1 192 ? 146.364 13.216 99.024  1.00 23.41 ? 192  TYR L CA  1 
ATOM   1486 C C   . TYR A 1 192 ? 146.969 13.575 97.700  1.00 23.20 ? 192  TYR L C   1 
ATOM   1487 O O   . TYR A 1 192 ? 147.753 14.527 97.577  1.00 21.04 ? 192  TYR L O   1 
ATOM   1488 C CB  . TYR A 1 192 ? 145.451 14.313 99.529  1.00 23.64 ? 192  TYR L CB  1 
ATOM   1489 C CG  . TYR A 1 192 ? 144.701 13.881 100.733 1.00 23.07 ? 192  TYR L CG  1 
ATOM   1490 C CD1 . TYR A 1 192 ? 145.282 13.968 102.000 1.00 23.55 ? 192  TYR L CD1 1 
ATOM   1491 C CD2 . TYR A 1 192 ? 143.412 13.370 100.623 1.00 23.87 ? 192  TYR L CD2 1 
ATOM   1492 C CE1 . TYR A 1 192 ? 144.586 13.558 103.148 1.00 25.09 ? 192  TYR L CE1 1 
ATOM   1493 C CE2 . TYR A 1 192 ? 142.704 12.954 101.757 1.00 25.29 ? 192  TYR L CE2 1 
ATOM   1494 C CZ  . TYR A 1 192 ? 143.311 13.057 103.017 1.00 25.63 ? 192  TYR L CZ  1 
ATOM   1495 O OH  . TYR A 1 192 ? 142.624 12.669 104.139 1.00 27.71 ? 192  TYR L OH  1 
ATOM   1496 N N   . THR A 1 193 ? 146.572 12.807 96.698  1.00 22.12 ? 193  THR L N   1 
ATOM   1497 C CA  . THR A 1 193 ? 147.137 12.949 95.392  1.00 22.80 ? 193  THR L CA  1 
ATOM   1498 C C   . THR A 1 193 ? 146.105 13.071 94.281  1.00 22.24 ? 193  THR L C   1 
ATOM   1499 O O   . THR A 1 193 ? 145.088 12.371 94.277  1.00 20.64 ? 193  THR L O   1 
ATOM   1500 C CB  . THR A 1 193 ? 148.008 11.727 95.126  1.00 23.82 ? 193  THR L CB  1 
ATOM   1501 O OG1 . THR A 1 193 ? 148.937 11.580 96.216  1.00 26.09 ? 193  THR L OG1 1 
ATOM   1502 C CG2 . THR A 1 193 ? 148.747 11.862 93.811  1.00 24.20 ? 193  THR L CG2 1 
ATOM   1503 N N   . CYS A 1 194 ? 146.396 13.951 93.331  1.00 21.70 ? 194  CYS L N   1 
ATOM   1504 C CA  . CYS A 1 194 ? 145.506 14.167 92.195  1.00 23.51 ? 194  CYS L CA  1 
ATOM   1505 C C   . CYS A 1 194 ? 146.323 13.706 90.972  1.00 21.68 ? 194  CYS L C   1 
ATOM   1506 O O   . CYS A 1 194 ? 147.414 14.212 90.750  1.00 22.11 ? 194  CYS L O   1 
ATOM   1507 C CB  . CYS A 1 194 ? 145.127 15.679 92.104  1.00 23.94 ? 194  CYS L CB  1 
ATOM   1508 S SG  . CYS A 1 194 ? 144.212 16.092 90.610  1.00 31.86 ? 194  CYS L SG  1 
ATOM   1509 N N   . GLU A 1 195 ? 145.830 12.734 90.193  1.00 21.99 ? 195  GLU L N   1 
ATOM   1510 C CA  . GLU A 1 195 ? 146.598 12.317 89.003  1.00 21.88 ? 195  GLU L CA  1 
ATOM   1511 C C   . GLU A 1 195 ? 145.813 12.579 87.725  1.00 20.96 ? 195  GLU L C   1 
ATOM   1512 O O   . GLU A 1 195 ? 144.672 12.167 87.613  1.00 18.94 ? 195  GLU L O   1 
ATOM   1513 C CB  . GLU A 1 195 ? 146.945 10.840 89.047  1.00 22.83 ? 195  GLU L CB  1 
ATOM   1514 C CG  . GLU A 1 195 ? 147.912 10.464 90.171  1.00 24.74 ? 195  GLU L CG  1 
ATOM   1515 C CD  . GLU A 1 195 ? 148.264 8.978  90.126  1.00 26.23 ? 195  GLU L CD  1 
ATOM   1516 O OE1 . GLU A 1 195 ? 149.141 8.541  90.892  1.00 27.14 ? 195  GLU L OE1 1 
ATOM   1517 O OE2 . GLU A 1 195 ? 147.658 8.242  89.314  1.00 26.48 ? 195  GLU L OE2 1 
ATOM   1518 N N   . ALA A 1 196 ? 146.456 13.214 86.755  1.00 20.97 ? 196  ALA L N   1 
ATOM   1519 C CA  . ALA A 1 196 ? 145.789 13.538 85.501  1.00 22.89 ? 196  ALA L CA  1 
ATOM   1520 C C   . ALA A 1 196 ? 146.329 12.707 84.353  1.00 23.29 ? 196  ALA L C   1 
ATOM   1521 O O   . ALA A 1 196 ? 147.552 12.640 84.161  1.00 25.16 ? 196  ALA L O   1 
ATOM   1522 C CB  . ALA A 1 196 ? 145.962 15.039 85.185  1.00 21.48 ? 196  ALA L CB  1 
ATOM   1523 N N   . THR A 1 197 ? 145.444 12.061 83.591  1.00 22.45 ? 197  THR L N   1 
ATOM   1524 C CA  . THR A 1 197 ? 145.936 11.300 82.437  1.00 21.65 ? 197  THR L CA  1 
ATOM   1525 C C   . THR A 1 197 ? 145.455 12.016 81.175  1.00 19.50 ? 197  THR L C   1 
ATOM   1526 O O   . THR A 1 197 ? 144.286 12.234 80.988  1.00 19.97 ? 197  THR L O   1 
ATOM   1527 C CB  . THR A 1 197 ? 145.395 9.885  82.456  1.00 22.59 ? 197  THR L CB  1 
ATOM   1528 O OG1 . THR A 1 197 ? 145.765 9.275  83.690  1.00 22.87 ? 197  THR L OG1 1 
ATOM   1529 C CG2 . THR A 1 197 ? 145.964 9.066  81.295  1.00 22.36 ? 197  THR L CG2 1 
ATOM   1530 N N   . HIS A 1 198 ? 146.370 12.399 80.320  1.00 18.86 ? 198  HIS L N   1 
ATOM   1531 C CA  . HIS A 1 198 ? 145.995 13.117 79.115  1.00 19.09 ? 198  HIS L CA  1 
ATOM   1532 C C   . HIS A 1 198 ? 146.988 12.686 78.020  1.00 18.73 ? 198  HIS L C   1 
ATOM   1533 O O   . HIS A 1 198 ? 148.109 12.294 78.356  1.00 17.35 ? 198  HIS L O   1 
ATOM   1534 C CB  . HIS A 1 198 ? 146.089 14.617 79.427  1.00 17.15 ? 198  HIS L CB  1 
ATOM   1535 C CG  . HIS A 1 198 ? 145.635 15.480 78.314  1.00 16.60 ? 198  HIS L CG  1 
ATOM   1536 N ND1 . HIS A 1 198 ? 146.512 16.102 77.449  1.00 17.76 ? 198  HIS L ND1 1 
ATOM   1537 C CD2 . HIS A 1 198 ? 144.389 15.854 77.935  1.00 15.42 ? 198  HIS L CD2 1 
ATOM   1538 C CE1 . HIS A 1 198 ? 145.821 16.834 76.591  1.00 16.74 ? 198  HIS L CE1 1 
ATOM   1539 N NE2 . HIS A 1 198 ? 144.534 16.699 76.866  1.00 15.97 ? 198  HIS L NE2 1 
ATOM   1540 N N   . LYS A 1 199 ? 146.606 12.784 76.740  1.00 18.73 ? 199  LYS L N   1 
ATOM   1541 C CA  . LYS A 1 199 ? 147.504 12.302 75.672  1.00 20.02 ? 199  LYS L CA  1 
ATOM   1542 C C   . LYS A 1 199 ? 148.868 12.991 75.571  1.00 19.20 ? 199  LYS L C   1 
ATOM   1543 O O   . LYS A 1 199 ? 149.806 12.411 74.999  1.00 21.03 ? 199  LYS L O   1 
ATOM   1544 C CB  . LYS A 1 199 ? 146.795 12.350 74.312  1.00 20.55 ? 199  LYS L CB  1 
ATOM   1545 C CG  . LYS A 1 199 ? 146.547 13.756 73.793  1.00 21.38 ? 199  LYS L CG  1 
ATOM   1546 C CD  . LYS A 1 199 ? 145.922 13.745 72.398  1.00 21.67 ? 199  LYS L CD  1 
ATOM   1547 C CE  . LYS A 1 199 ? 146.888 13.159 71.403  1.00 23.78 ? 199  LYS L CE  1 
ATOM   1548 N NZ  . LYS A 1 199 ? 146.350 13.163 70.029  1.00 24.42 ? 199  LYS L NZ  1 
ATOM   1549 N N   . THR A 1 200 ? 148.995 14.205 76.119  1.00 16.88 ? 200  THR L N   1 
ATOM   1550 C CA  . THR A 1 200 ? 150.257 14.941 76.093  1.00 17.16 ? 200  THR L CA  1 
ATOM   1551 C C   . THR A 1 200 ? 151.374 14.270 76.935  1.00 18.65 ? 200  THR L C   1 
ATOM   1552 O O   . THR A 1 200 ? 152.552 14.610 76.807  1.00 17.88 ? 200  THR L O   1 
ATOM   1553 C CB  . THR A 1 200 ? 150.074 16.389 76.601  1.00 16.20 ? 200  THR L CB  1 
ATOM   1554 O OG1 . THR A 1 200 ? 149.238 16.398 77.783  1.00 15.57 ? 200  THR L OG1 1 
ATOM   1555 C CG2 . THR A 1 200 ? 149.392 17.207 75.521  1.00 18.25 ? 200  THR L CG2 1 
ATOM   1556 N N   . SER A 1 201 ? 151.006 13.326 77.788  1.00 18.48 ? 201  SER L N   1 
ATOM   1557 C CA  . SER A 1 201 ? 152.016 12.627 78.583  1.00 20.99 ? 201  SER L CA  1 
ATOM   1558 C C   . SER A 1 201 ? 151.668 11.129 78.754  1.00 21.10 ? 201  SER L C   1 
ATOM   1559 O O   . SER A 1 201 ? 150.498 10.762 78.927  1.00 22.47 ? 201  SER L O   1 
ATOM   1560 C CB  . SER A 1 201 ? 152.145 13.311 79.959  1.00 21.02 ? 201  SER L CB  1 
ATOM   1561 O OG  . SER A 1 201 ? 152.959 12.526 80.784  1.00 25.15 ? 201  SER L OG  1 
ATOM   1562 N N   . THR A 1 202 ? 152.662 10.251 78.696  1.00 22.19 ? 202  THR L N   1 
ATOM   1563 C CA  . THR A 1 202 ? 152.340 8.847  78.855  1.00 23.02 ? 202  THR L CA  1 
ATOM   1564 C C   . THR A 1 202 ? 152.456 8.398  80.326  1.00 24.99 ? 202  THR L C   1 
ATOM   1565 O O   . THR A 1 202 ? 152.194 7.225  80.656  1.00 25.94 ? 202  THR L O   1 
ATOM   1566 C CB  . THR A 1 202 ? 153.171 7.976  77.858  1.00 22.28 ? 202  THR L CB  1 
ATOM   1567 O OG1 . THR A 1 202 ? 154.527 8.450  77.801  1.00 19.52 ? 202  THR L OG1 1 
ATOM   1568 C CG2 . THR A 1 202 ? 152.546 8.067  76.457  1.00 18.03 ? 202  THR L CG2 1 
ATOM   1569 N N   . SER A 1 203 ? 152.873 9.325  81.198  1.00 25.24 ? 203  SER L N   1 
ATOM   1570 C CA  . SER A 1 203 ? 152.911 9.069  82.656  1.00 27.20 ? 203  SER L CA  1 
ATOM   1571 C C   . SER A 1 203 ? 151.905 10.041 83.241  1.00 25.44 ? 203  SER L C   1 
ATOM   1572 O O   . SER A 1 203 ? 151.782 11.163 82.752  1.00 23.39 ? 203  SER L O   1 
ATOM   1573 C CB  . SER A 1 203 ? 154.247 9.420  83.271  1.00 28.21 ? 203  SER L CB  1 
ATOM   1574 O OG  . SER A 1 203 ? 155.251 8.649  82.677  1.00 34.54 ? 203  SER L OG  1 
ATOM   1575 N N   . PRO A 1 204 ? 151.206 9.662  84.319  1.00 25.38 ? 204  PRO L N   1 
ATOM   1576 C CA  . PRO A 1 204 ? 150.242 10.650 84.837  1.00 24.98 ? 204  PRO L CA  1 
ATOM   1577 C C   . PRO A 1 204 ? 150.922 11.912 85.343  1.00 25.68 ? 204  PRO L C   1 
ATOM   1578 O O   . PRO A 1 204 ? 152.108 11.855 85.734  1.00 24.69 ? 204  PRO L O   1 
ATOM   1579 C CB  . PRO A 1 204 ? 149.532 9.896  85.953  1.00 25.98 ? 204  PRO L CB  1 
ATOM   1580 C CG  . PRO A 1 204 ? 150.588 8.925  86.434  1.00 26.34 ? 204  PRO L CG  1 
ATOM   1581 C CD  . PRO A 1 204 ? 151.245 8.444  85.142  1.00 24.63 ? 204  PRO L CD  1 
ATOM   1582 N N   . ILE A 1 205 ? 150.232 13.062 85.241  1.00 25.58 ? 205  ILE L N   1 
ATOM   1583 C CA  . ILE A 1 205 ? 150.768 14.300 85.802  1.00 25.56 ? 205  ILE L CA  1 
ATOM   1584 C C   . ILE A 1 205 ? 150.198 14.219 87.223  1.00 25.83 ? 205  ILE L C   1 
ATOM   1585 O O   . ILE A 1 205 ? 148.972 14.192 87.414  1.00 22.79 ? 205  ILE L O   1 
ATOM   1586 C CB  . ILE A 1 205 ? 150.237 15.605 85.124  1.00 28.88 ? 205  ILE L CB  1 
ATOM   1587 C CG1 . ILE A 1 205 ? 150.804 15.757 83.715  1.00 31.42 ? 205  ILE L CG1 1 
ATOM   1588 C CG2 . ILE A 1 205 ? 150.718 16.844 85.937  1.00 29.13 ? 205  ILE L CG2 1 
ATOM   1589 C CD1 . ILE A 1 205 ? 150.465 17.138 83.054  1.00 33.93 ? 205  ILE L CD1 1 
ATOM   1590 N N   . VAL A 1 206 ? 151.103 14.172 88.204  1.00 24.32 ? 206  VAL L N   1 
ATOM   1591 C CA  . VAL A 1 206 ? 150.740 13.988 89.594  1.00 25.71 ? 206  VAL L CA  1 
ATOM   1592 C C   . VAL A 1 206 ? 150.965 15.235 90.470  1.00 26.12 ? 206  VAL L C   1 
ATOM   1593 O O   . VAL A 1 206 ? 151.958 15.931 90.300  1.00 28.03 ? 206  VAL L O   1 
ATOM   1594 C CB  . VAL A 1 206 ? 151.565 12.795 90.139  1.00 24.61 ? 206  VAL L CB  1 
ATOM   1595 C CG1 . VAL A 1 206 ? 151.401 12.653 91.585  1.00 24.97 ? 206  VAL L CG1 1 
ATOM   1596 C CG2 . VAL A 1 206 ? 151.122 11.498 89.452  1.00 26.97 ? 206  VAL L CG2 1 
ATOM   1597 N N   . LYS A 1 207 ? 150.054 15.512 91.395  1.00 24.90 ? 207  LYS L N   1 
ATOM   1598 C CA  . LYS A 1 207 ? 150.215 16.645 92.308  1.00 24.97 ? 207  LYS L CA  1 
ATOM   1599 C C   . LYS A 1 207 ? 149.798 16.066 93.638  1.00 25.41 ? 207  LYS L C   1 
ATOM   1600 O O   . LYS A 1 207 ? 148.790 15.365 93.686  1.00 23.37 ? 207  LYS L O   1 
ATOM   1601 C CB  . LYS A 1 207 ? 149.240 17.751 91.949  1.00 26.17 ? 207  LYS L CB  1 
ATOM   1602 C CG  . LYS A 1 207 ? 149.822 19.023 91.477  1.00 28.92 ? 207  LYS L CG  1 
ATOM   1603 C CD  . LYS A 1 207 ? 150.832 18.816 90.435  1.00 30.62 ? 207  LYS L CD  1 
ATOM   1604 C CE  . LYS A 1 207 ? 151.825 19.934 90.524  1.00 31.70 ? 207  LYS L CE  1 
ATOM   1605 N NZ  . LYS A 1 207 ? 152.681 19.854 89.360  1.00 34.72 ? 207  LYS L NZ  1 
ATOM   1606 N N   . SER A 1 208 ? 150.545 16.347 94.708  1.00 25.54 ? 208  SER L N   1 
ATOM   1607 C CA  . SER A 1 208 ? 150.181 15.835 96.036  1.00 28.23 ? 208  SER L CA  1 
ATOM   1608 C C   . SER A 1 208 ? 150.507 16.772 97.177  1.00 28.43 ? 208  SER L C   1 
ATOM   1609 O O   . SER A 1 208 ? 151.215 17.771 97.014  1.00 28.30 ? 208  SER L O   1 
ATOM   1610 C CB  . SER A 1 208 ? 150.936 14.547 96.353  1.00 28.60 ? 208  SER L CB  1 
ATOM   1611 O OG  . SER A 1 208 ? 150.929 13.707 95.222  1.00 34.53 ? 208  SER L OG  1 
ATOM   1612 N N   . PHE A 1 209 ? 149.976 16.424 98.343  1.00 29.13 ? 209  PHE L N   1 
ATOM   1613 C CA  . PHE A 1 209 ? 150.320 17.131 99.565  1.00 29.47 ? 209  PHE L CA  1 
ATOM   1614 C C   . PHE A 1 209 ? 150.061 16.179 100.732 1.00 30.89 ? 209  PHE L C   1 
ATOM   1615 O O   . PHE A 1 209 ? 149.230 15.245 100.634 1.00 30.48 ? 209  PHE L O   1 
ATOM   1616 C CB  . PHE A 1 209 ? 149.523 18.415 99.740  1.00 27.94 ? 209  PHE L CB  1 
ATOM   1617 C CG  . PHE A 1 209 ? 148.086 18.198 100.144 1.00 27.14 ? 209  PHE L CG  1 
ATOM   1618 C CD1 . PHE A 1 209 ? 147.742 17.996 101.478 1.00 24.81 ? 209  PHE L CD1 1 
ATOM   1619 C CD2 . PHE A 1 209 ? 147.068 18.219 99.179  1.00 25.78 ? 209  PHE L CD2 1 
ATOM   1620 C CE1 . PHE A 1 209 ? 146.394 17.813 101.856 1.00 26.01 ? 209  PHE L CE1 1 
ATOM   1621 C CE2 . PHE A 1 209 ? 145.732 18.045 99.543  1.00 25.80 ? 209  PHE L CE2 1 
ATOM   1622 C CZ  . PHE A 1 209 ? 145.387 17.837 100.890 1.00 25.07 ? 209  PHE L CZ  1 
ATOM   1623 N N   . ASN A 1 210 ? 150.793 16.417 101.820 1.00 31.62 ? 210  ASN L N   1 
ATOM   1624 C CA  . ASN A 1 210 ? 150.639 15.661 103.050 1.00 33.42 ? 210  ASN L CA  1 
ATOM   1625 C C   . ASN A 1 210 ? 149.976 16.569 104.085 1.00 34.71 ? 210  ASN L C   1 
ATOM   1626 O O   . ASN A 1 210 ? 150.463 17.670 104.387 1.00 34.59 ? 210  ASN L O   1 
ATOM   1627 C CB  . ASN A 1 210 ? 151.991 15.216 103.552 1.00 34.05 ? 210  ASN L CB  1 
ATOM   1628 C CG  . ASN A 1 210 ? 152.721 14.411 102.540 1.00 34.64 ? 210  ASN L CG  1 
ATOM   1629 O OD1 . ASN A 1 210 ? 152.235 13.379 102.090 1.00 36.85 ? 210  ASN L OD1 1 
ATOM   1630 N ND2 . ASN A 1 210 ? 153.889 14.877 102.150 1.00 36.46 ? 210  ASN L ND2 1 
ATOM   1631 N N   . ARG A 1 211 ? 148.843 16.119 104.599 1.00 36.40 ? 211  ARG L N   1 
ATOM   1632 C CA  . ARG A 1 211 ? 148.118 16.866 105.606 1.00 39.16 ? 211  ARG L CA  1 
ATOM   1633 C C   . ARG A 1 211 ? 149.051 17.308 106.754 1.00 41.07 ? 211  ARG L C   1 
ATOM   1634 O O   . ARG A 1 211 ? 148.806 18.344 107.401 1.00 41.48 ? 211  ARG L O   1 
ATOM   1635 C CB  . ARG A 1 211 ? 146.984 16.008 106.144 1.00 38.76 ? 211  ARG L CB  1 
ATOM   1636 C CG  . ARG A 1 211 ? 146.075 16.726 107.094 1.00 40.93 ? 211  ARG L CG  1 
ATOM   1637 C CD  . ARG A 1 211 ? 145.039 15.790 107.657 1.00 41.97 ? 211  ARG L CD  1 
ATOM   1638 N NE  . ARG A 1 211 ? 145.475 15.286 108.949 1.00 44.32 ? 211  ARG L NE  1 
ATOM   1639 C CZ  . ARG A 1 211 ? 146.364 14.317 109.114 1.00 45.75 ? 211  ARG L CZ  1 
ATOM   1640 N NH1 . ARG A 1 211 ? 146.906 13.724 108.063 1.00 46.93 ? 211  ARG L NH1 1 
ATOM   1641 N NH2 . ARG A 1 211 ? 146.762 13.982 110.337 1.00 47.16 ? 211  ARG L NH2 1 
ATOM   1642 N N   . ASN A 1 212 ? 150.144 16.563 106.976 1.00 42.25 ? 212  ASN L N   1 
ATOM   1643 C CA  . ASN A 1 212 ? 151.071 16.884 108.070 1.00 44.81 ? 212  ASN L CA  1 
ATOM   1644 C C   . ASN A 1 212 ? 152.377 17.586 107.685 1.00 44.84 ? 212  ASN L C   1 
ATOM   1645 O O   . ASN A 1 212 ? 153.181 17.932 108.568 1.00 45.33 ? 212  ASN L O   1 
ATOM   1646 C CB  . ASN A 1 212 ? 151.443 15.610 108.829 1.00 47.40 ? 212  ASN L CB  1 
ATOM   1647 C CG  . ASN A 1 212 ? 152.834 15.110 108.469 1.00 50.50 ? 212  ASN L CG  1 
ATOM   1648 O OD1 . ASN A 1 212 ? 153.034 14.447 107.444 1.00 53.52 ? 212  ASN L OD1 1 
ATOM   1649 N ND2 . ASN A 1 212 ? 153.825 15.473 109.293 1.00 53.18 ? 212  ASN L ND2 1 
ATOM   1650 N N   . GLU A 1 213 ? 152.633 17.768 106.410 1.00 43.58 ? 213  GLU L N   1 
ATOM   1651 C CA  . GLU A 1 213 ? 153.882 18.422 106.013 1.00 42.85 ? 213  GLU L CA  1 
ATOM   1652 C C   . GLU A 1 213 ? 153.584 19.907 105.941 1.00 44.14 ? 213  GLU L C   1 
ATOM   1653 O O   . GLU A 1 213 ? 154.322 20.704 105.349 1.00 45.03 ? 213  GLU L O   1 
ATOM   1654 C CB  . GLU A 1 213 ? 154.347 17.899 104.688 1.00 41.44 ? 213  GLU L CB  1 
ATOM   1655 C CG  . GLU A 1 213 ? 155.798 18.078 104.534 1.00 39.19 ? 213  GLU L CG  1 
ATOM   1656 C CD  . GLU A 1 213 ? 156.187 17.832 103.136 1.00 38.66 ? 213  GLU L CD  1 
ATOM   1657 O OE1 . GLU A 1 213 ? 155.720 16.807 102.586 1.00 38.90 ? 213  GLU L OE1 1 
ATOM   1658 O OE2 . GLU A 1 213 ? 156.956 18.662 102.582 1.00 39.97 ? 213  GLU L OE2 1 
ATOM   1659 N N   . CYS A 1 214 ? 152.451 20.210 106.558 1.00 45.06 ? 214  CYS L N   1 
ATOM   1660 C CA  . CYS A 1 214 ? 151.883 21.531 106.759 1.00 46.92 ? 214  CYS L CA  1 
ATOM   1661 C C   . CYS A 1 214 ? 151.347 21.181 108.157 1.00 47.14 ? 214  CYS L C   1 
ATOM   1662 O O   . CYS A 1 214 ? 151.361 19.937 108.433 1.00 46.22 ? 214  CYS L O   1 
ATOM   1663 C CB  . CYS A 1 214 ? 150.704 21.755 105.821 1.00 48.63 ? 214  CYS L CB  1 
ATOM   1664 S SG  . CYS A 1 214 ? 150.313 23.539 105.379 1.00 50.20 ? 214  CYS L SG  1 
ATOM   1665 O OXT . CYS A 1 214 ? 150.920 22.077 108.949 1.00 50.38 ? 214  CYS L OXT 1 
ATOM   1666 N N   . GLN B 2 1   ? 110.915 44.035 63.828  1.00 26.94 ? 215  GLN H N   1 
ATOM   1667 C CA  . GLN B 2 1   ? 111.679 42.801 63.991  1.00 28.66 ? 215  GLN H CA  1 
ATOM   1668 C C   . GLN B 2 1   ? 110.837 41.884 64.883  1.00 25.91 ? 215  GLN H C   1 
ATOM   1669 O O   . GLN B 2 1   ? 110.260 42.323 65.898  1.00 23.79 ? 215  GLN H O   1 
ATOM   1670 C CB  . GLN B 2 1   ? 113.026 43.142 64.633  1.00 32.80 ? 215  GLN H CB  1 
ATOM   1671 C CG  . GLN B 2 1   ? 112.870 44.241 65.697  1.00 40.65 ? 215  GLN H CG  1 
ATOM   1672 C CD  . GLN B 2 1   ? 111.993 45.442 65.241  1.00 44.50 ? 215  GLN H CD  1 
ATOM   1673 O OE1 . GLN B 2 1   ? 112.471 46.414 64.657  1.00 49.64 ? 215  GLN H OE1 1 
ATOM   1674 N NE2 . GLN B 2 1   ? 110.712 45.355 65.502  1.00 48.73 ? 215  GLN H NE2 1 
ATOM   1675 N N   . VAL B 2 2   ? 110.721 40.637 64.449  1.00 22.93 ? 216  VAL H N   1 
ATOM   1676 C CA  . VAL B 2 2   ? 110.004 39.602 65.184  1.00 21.80 ? 216  VAL H CA  1 
ATOM   1677 C C   . VAL B 2 2   ? 110.755 39.304 66.495  1.00 20.33 ? 216  VAL H C   1 
ATOM   1678 O O   . VAL B 2 2   ? 111.944 39.007 66.477  1.00 21.80 ? 216  VAL H O   1 
ATOM   1679 C CB  . VAL B 2 2   ? 109.905 38.295 64.318  1.00 21.55 ? 216  VAL H CB  1 
ATOM   1680 C CG1 . VAL B 2 2   ? 109.383 37.125 65.159  1.00 20.76 ? 216  VAL H CG1 1 
ATOM   1681 C CG2 . VAL B 2 2   ? 108.966 38.558 63.100  1.00 21.17 ? 216  VAL H CG2 1 
ATOM   1682 N N   . GLN B 2 3   ? 110.043 39.364 67.614  1.00 19.70 ? 217  GLN H N   1 
ATOM   1683 C CA  . GLN B 2 3   ? 110.600 39.112 68.938  1.00 20.25 ? 217  GLN H CA  1 
ATOM   1684 C C   . GLN B 2 3   ? 109.651 38.356 69.814  1.00 18.76 ? 217  GLN H C   1 
ATOM   1685 O O   . GLN B 2 3   ? 108.433 38.496 69.700  1.00 17.52 ? 217  GLN H O   1 
ATOM   1686 C CB  . GLN B 2 3   ? 110.910 40.427 69.672  1.00 23.53 ? 217  GLN H CB  1 
ATOM   1687 C CG  . GLN B 2 3   ? 112.127 41.117 69.087  1.00 30.91 ? 217  GLN H CG  1 
ATOM   1688 C CD  . GLN B 2 3   ? 112.431 42.455 69.714  1.00 34.79 ? 217  GLN H CD  1 
ATOM   1689 O OE1 . GLN B 2 3   ? 113.422 43.089 69.355  1.00 39.21 ? 217  GLN H OE1 1 
ATOM   1690 N NE2 . GLN B 2 3   ? 111.592 42.899 70.643  1.00 37.55 ? 217  GLN H NE2 1 
ATOM   1691 N N   . LEU B 2 4   ? 110.243 37.586 70.718  1.00 17.59 ? 218  LEU H N   1 
ATOM   1692 C CA  . LEU B 2 4   ? 109.507 36.796 71.699  1.00 17.06 ? 218  LEU H CA  1 
ATOM   1693 C C   . LEU B 2 4   ? 110.358 36.809 72.951  1.00 17.21 ? 218  LEU H C   1 
ATOM   1694 O O   . LEU B 2 4   ? 111.592 36.742 72.878  1.00 17.79 ? 218  LEU H O   1 
ATOM   1695 C CB  . LEU B 2 4   ? 109.317 35.331 71.243  1.00 15.08 ? 218  LEU H CB  1 
ATOM   1696 C CG  . LEU B 2 4   ? 108.531 35.137 69.919  1.00 16.24 ? 218  LEU H CG  1 
ATOM   1697 C CD1 . LEU B 2 4   ? 109.520 35.115 68.726  1.00 15.70 ? 218  LEU H CD1 1 
ATOM   1698 C CD2 . LEU B 2 4   ? 107.708 33.790 69.989  1.00 15.33 ? 218  LEU H CD2 1 
ATOM   1699 N N   . LYS B 2 5   ? 109.702 36.884 74.097  1.00 17.69 ? 219  LYS H N   1 
ATOM   1700 C CA  . LYS B 2 5   ? 110.409 36.869 75.373  1.00 19.50 ? 219  LYS H CA  1 
ATOM   1701 C C   . LYS B 2 5   ? 109.572 36.213 76.477  1.00 19.14 ? 219  LYS H C   1 
ATOM   1702 O O   . LYS B 2 5   ? 108.392 36.525 76.640  1.00 16.51 ? 219  LYS H O   1 
ATOM   1703 C CB  . LYS B 2 5   ? 110.795 38.285 75.810  1.00 20.14 ? 219  LYS H CB  1 
ATOM   1704 C CG  . LYS B 2 5   ? 111.722 38.238 77.061  1.00 22.98 ? 219  LYS H CG  1 
ATOM   1705 C CD  . LYS B 2 5   ? 112.311 39.638 77.420  1.00 26.15 ? 219  LYS H CD  1 
ATOM   1706 C CE  . LYS B 2 5   ? 113.187 40.142 76.239  1.00 29.18 ? 219  LYS H CE  1 
ATOM   1707 N NZ  . LYS B 2 5   ? 114.270 41.030 76.752  1.00 32.24 ? 219  LYS H NZ  1 
ATOM   1708 N N   . GLU B 2 6   ? 110.208 35.318 77.235  1.00 17.88 ? 220  GLU H N   1 
ATOM   1709 C CA  . GLU B 2 6   ? 109.542 34.593 78.315  1.00 18.28 ? 220  GLU H CA  1 
ATOM   1710 C C   . GLU B 2 6   ? 109.689 35.298 79.684  1.00 20.40 ? 220  GLU H C   1 
ATOM   1711 O O   . GLU B 2 6   ? 110.770 35.886 79.962  1.00 19.27 ? 220  GLU H O   1 
ATOM   1712 C CB  . GLU B 2 6   ? 110.163 33.182 78.434  1.00 18.94 ? 220  GLU H CB  1 
ATOM   1713 C CG  . GLU B 2 6   ? 110.259 32.381 77.114  1.00 19.67 ? 220  GLU H CG  1 
ATOM   1714 C CD  . GLU B 2 6   ? 111.517 32.717 76.252  1.00 20.75 ? 220  GLU H CD  1 
ATOM   1715 O OE1 . GLU B 2 6   ? 111.733 32.024 75.214  1.00 18.81 ? 220  GLU H OE1 1 
ATOM   1716 O OE2 . GLU B 2 6   ? 112.278 33.651 76.607  1.00 18.80 ? 220  GLU H OE2 1 
ATOM   1717 N N   . SER B 2 7   ? 108.619 35.283 80.492  1.00 19.39 ? 221  SER H N   1 
ATOM   1718 C CA  . SER B 2 7   ? 108.676 35.800 81.886  1.00 21.86 ? 221  SER H CA  1 
ATOM   1719 C C   . SER B 2 7   ? 108.272 34.567 82.697  1.00 22.17 ? 221  SER H C   1 
ATOM   1720 O O   . SER B 2 7   ? 107.112 34.159 82.651  1.00 20.83 ? 221  SER H O   1 
ATOM   1721 C CB  . SER B 2 7   ? 107.641 36.885 82.195  1.00 22.45 ? 221  SER H CB  1 
ATOM   1722 O OG  . SER B 2 7   ? 107.763 37.990 81.321  1.00 27.12 ? 221  SER H OG  1 
ATOM   1723 N N   . GLY B 2 8   ? 109.222 33.992 83.429  1.00 23.85 ? 222  GLY H N   1 
ATOM   1724 C CA  . GLY B 2 8   ? 108.976 32.779 84.194  1.00 23.62 ? 222  GLY H CA  1 
ATOM   1725 C C   . GLY B 2 8   ? 109.149 33.021 85.665  1.00 24.78 ? 222  GLY H C   1 
ATOM   1726 O O   . GLY B 2 8   ? 109.615 34.105 86.026  1.00 25.38 ? 222  GLY H O   1 
ATOM   1727 N N   . PRO B 2 9   ? 108.849 32.032 86.533  1.00 25.07 ? 223  PRO H N   1 
ATOM   1728 C CA  . PRO B 2 9   ? 108.988 32.229 87.979  1.00 24.54 ? 223  PRO H CA  1 
ATOM   1729 C C   . PRO B 2 9   ? 110.369 31.884 88.555  1.00 24.35 ? 223  PRO H C   1 
ATOM   1730 O O   . PRO B 2 9   ? 110.632 32.117 89.754  1.00 24.40 ? 223  PRO H O   1 
ATOM   1731 C CB  . PRO B 2 9   ? 107.897 31.332 88.533  1.00 24.61 ? 223  PRO H CB  1 
ATOM   1732 C CG  . PRO B 2 9   ? 108.054 30.055 87.628  1.00 25.69 ? 223  PRO H CG  1 
ATOM   1733 C CD  . PRO B 2 9   ? 108.386 30.653 86.231  1.00 24.90 ? 223  PRO H CD  1 
ATOM   1734 N N   . GLY B 2 10  ? 111.245 31.334 87.723  1.00 22.75 ? 224  GLY H N   1 
ATOM   1735 C CA  . GLY B 2 10  ? 112.563 30.958 88.203  1.00 22.12 ? 224  GLY H CA  1 
ATOM   1736 C C   . GLY B 2 10  ? 112.583 29.622 88.944  1.00 21.88 ? 224  GLY H C   1 
ATOM   1737 O O   . GLY B 2 10  ? 113.314 28.688 88.562  1.00 21.85 ? 224  GLY H O   1 
ATOM   1738 N N   . LEU B 2 11  ? 111.774 29.508 89.994  1.00 21.81 ? 225  LEU H N   1 
ATOM   1739 C CA  . LEU B 2 11  ? 111.746 28.287 90.778  1.00 21.38 ? 225  LEU H CA  1 
ATOM   1740 C C   . LEU B 2 11  ? 110.333 27.694 90.908  1.00 21.55 ? 225  LEU H C   1 
ATOM   1741 O O   . LEU B 2 11  ? 109.359 28.429 90.965  1.00 19.62 ? 225  LEU H O   1 
ATOM   1742 C CB  . LEU B 2 11  ? 112.244 28.579 92.188  1.00 24.78 ? 225  LEU H CB  1 
ATOM   1743 C CG  . LEU B 2 11  ? 113.672 29.117 92.394  1.00 28.46 ? 225  LEU H CG  1 
ATOM   1744 C CD1 . LEU B 2 11  ? 113.959 29.061 93.924  1.00 30.93 ? 225  LEU H CD1 1 
ATOM   1745 C CD2 . LEU B 2 11  ? 114.705 28.282 91.629  1.00 28.10 ? 225  LEU H CD2 1 
ATOM   1746 N N   . VAL B 2 12  ? 110.256 26.369 90.999  1.00 20.11 ? 226  VAL H N   1 
ATOM   1747 C CA  . VAL B 2 12  ? 108.977 25.678 91.169  1.00 21.25 ? 226  VAL H CA  1 
ATOM   1748 C C   . VAL B 2 12  ? 109.236 24.525 92.138  1.00 20.68 ? 226  VAL H C   1 
ATOM   1749 O O   . VAL B 2 12  ? 110.178 23.785 91.941  1.00 21.40 ? 226  VAL H O   1 
ATOM   1750 C CB  . VAL B 2 12  ? 108.448 25.069 89.822  1.00 20.19 ? 226  VAL H CB  1 
ATOM   1751 C CG1 . VAL B 2 12  ? 107.200 24.199 90.097  1.00 19.91 ? 226  VAL H CG1 1 
ATOM   1752 C CG2 . VAL B 2 12  ? 108.100 26.186 88.845  1.00 21.07 ? 226  VAL H CG2 1 
ATOM   1753 N N   . ALA B 2 13  ? 108.408 24.388 93.170  1.00 20.65 ? 227  ALA H N   1 
ATOM   1754 C CA  . ALA B 2 13  ? 108.529 23.316 94.169  1.00 19.85 ? 227  ALA H CA  1 
ATOM   1755 C C   . ALA B 2 13  ? 107.935 22.064 93.556  1.00 20.98 ? 227  ALA H C   1 
ATOM   1756 O O   . ALA B 2 13  ? 106.923 22.148 92.856  1.00 20.80 ? 227  ALA H O   1 
ATOM   1757 C CB  . ALA B 2 13  ? 107.720 23.689 95.435  1.00 19.15 ? 227  ALA H CB  1 
ATOM   1758 N N   . PRO B 2 14  ? 108.520 20.888 93.827  1.00 21.74 ? 228  PRO H N   1 
ATOM   1759 C CA  . PRO B 2 14  ? 108.000 19.639 93.265  1.00 21.16 ? 228  PRO H CA  1 
ATOM   1760 C C   . PRO B 2 14  ? 106.492 19.586 93.576  1.00 22.79 ? 228  PRO H C   1 
ATOM   1761 O O   . PRO B 2 14  ? 106.068 19.974 94.671  1.00 19.19 ? 228  PRO H O   1 
ATOM   1762 C CB  . PRO B 2 14  ? 108.755 18.565 94.033  1.00 23.05 ? 228  PRO H CB  1 
ATOM   1763 C CG  . PRO B 2 14  ? 109.976 19.262 94.495  1.00 23.93 ? 228  PRO H CG  1 
ATOM   1764 C CD  . PRO B 2 14  ? 109.546 20.620 94.848  1.00 22.69 ? 228  PRO H CD  1 
ATOM   1765 N N   . SER B 2 15  ? 105.718 19.147 92.580  1.00 22.62 ? 229  SER H N   1 
ATOM   1766 C CA  . SER B 2 15  ? 104.271 19.016 92.614  1.00 23.16 ? 229  SER H CA  1 
ATOM   1767 C C   . SER B 2 15  ? 103.498 20.272 92.364  1.00 21.94 ? 229  SER H C   1 
ATOM   1768 O O   . SER B 2 15  ? 102.286 20.229 92.273  1.00 21.13 ? 229  SER H O   1 
ATOM   1769 C CB  . SER B 2 15  ? 103.790 18.362 93.914  1.00 25.86 ? 229  SER H CB  1 
ATOM   1770 O OG  . SER B 2 15  ? 104.087 16.975 93.806  1.00 30.28 ? 229  SER H OG  1 
ATOM   1771 N N   . GLN B 2 16  ? 104.179 21.395 92.238  1.00 21.04 ? 230  GLN H N   1 
ATOM   1772 C CA  . GLN B 2 16  ? 103.486 22.661 91.971  1.00 20.90 ? 230  GLN H CA  1 
ATOM   1773 C C   . GLN B 2 16  ? 103.472 22.887 90.451  1.00 19.61 ? 230  GLN H C   1 
ATOM   1774 O O   . GLN B 2 16  ? 104.136 22.179 89.703  1.00 18.26 ? 230  GLN H O   1 
ATOM   1775 C CB  . GLN B 2 16  ? 104.234 23.818 92.612  1.00 25.62 ? 230  GLN H CB  1 
ATOM   1776 C CG  . GLN B 2 16  ? 103.564 24.454 93.778  1.00 32.21 ? 230  GLN H CG  1 
ATOM   1777 C CD  . GLN B 2 16  ? 102.772 23.469 94.612  1.00 35.20 ? 230  GLN H CD  1 
ATOM   1778 O OE1 . GLN B 2 16  ? 101.620 23.718 94.931  1.00 34.20 ? 230  GLN H OE1 1 
ATOM   1779 N NE2 . GLN B 2 16  ? 103.389 22.350 94.965  1.00 37.05 ? 230  GLN H NE2 1 
ATOM   1780 N N   . SER B 2 17  ? 102.761 23.916 90.028  1.00 19.29 ? 231  SER H N   1 
ATOM   1781 C CA  . SER B 2 17  ? 102.639 24.214 88.612  1.00 20.32 ? 231  SER H CA  1 
ATOM   1782 C C   . SER B 2 17  ? 103.657 25.270 88.156  1.00 20.05 ? 231  SER H C   1 
ATOM   1783 O O   . SER B 2 17  ? 104.153 26.074 88.957  1.00 19.29 ? 231  SER H O   1 
ATOM   1784 C CB  . SER B 2 17  ? 101.231 24.738 88.356  1.00 21.14 ? 231  SER H CB  1 
ATOM   1785 O OG  . SER B 2 17  ? 101.049 25.964 89.061  1.00 23.25 ? 231  SER H OG  1 
ATOM   1786 N N   . LEU B 2 18  ? 103.935 25.265 86.858  1.00 19.43 ? 232  LEU H N   1 
ATOM   1787 C CA  . LEU B 2 18  ? 104.831 26.221 86.220  1.00 18.47 ? 232  LEU H CA  1 
ATOM   1788 C C   . LEU B 2 18  ? 103.969 27.118 85.325  1.00 18.62 ? 232  LEU H C   1 
ATOM   1789 O O   . LEU B 2 18  ? 103.161 26.620 84.508  1.00 16.59 ? 232  LEU H O   1 
ATOM   1790 C CB  . LEU B 2 18  ? 105.857 25.482 85.360  1.00 15.55 ? 232  LEU H CB  1 
ATOM   1791 C CG  . LEU B 2 18  ? 106.605 26.308 84.298  1.00 16.37 ? 232  LEU H CG  1 
ATOM   1792 C CD1 . LEU B 2 18  ? 107.502 27.423 85.035  1.00 14.80 ? 232  LEU H CD1 1 
ATOM   1793 C CD2 . LEU B 2 18  ? 107.507 25.341 83.410  1.00 12.96 ? 232  LEU H CD2 1 
ATOM   1794 N N   . SER B 2 19  ? 104.097 28.427 85.499  1.00 18.18 ? 233  SER H N   1 
ATOM   1795 C CA  . SER B 2 19  ? 103.382 29.360 84.646  1.00 19.43 ? 233  SER H CA  1 
ATOM   1796 C C   . SER B 2 19  ? 104.416 30.272 83.952  1.00 19.52 ? 233  SER H C   1 
ATOM   1797 O O   . SER B 2 19  ? 105.294 30.806 84.625  1.00 19.51 ? 233  SER H O   1 
ATOM   1798 C CB  . SER B 2 19  ? 102.415 30.236 85.467  1.00 20.92 ? 233  SER H CB  1 
ATOM   1799 O OG  . SER B 2 19  ? 101.201 29.534 85.762  1.00 23.64 ? 233  SER H OG  1 
ATOM   1800 N N   . ILE B 2 20  ? 104.337 30.432 82.635  1.00 17.69 ? 234  ILE H N   1 
ATOM   1801 C CA  . ILE B 2 20  ? 105.255 31.343 81.948  1.00 17.02 ? 234  ILE H CA  1 
ATOM   1802 C C   . ILE B 2 20  ? 104.489 32.145 80.934  1.00 16.81 ? 234  ILE H C   1 
ATOM   1803 O O   . ILE B 2 20  ? 103.636 31.605 80.212  1.00 17.37 ? 234  ILE H O   1 
ATOM   1804 C CB  . ILE B 2 20  ? 106.376 30.619 81.178  1.00 16.44 ? 234  ILE H CB  1 
ATOM   1805 C CG1 . ILE B 2 20  ? 107.146 29.717 82.123  1.00 17.20 ? 234  ILE H CG1 1 
ATOM   1806 C CG2 . ILE B 2 20  ? 107.265 31.659 80.448  1.00 14.46 ? 234  ILE H CG2 1 
ATOM   1807 C CD1 . ILE B 2 20  ? 108.066 28.740 81.370  1.00 16.63 ? 234  ILE H CD1 1 
ATOM   1808 N N   . THR B 2 21  ? 104.784 33.430 80.859  1.00 15.55 ? 235  THR H N   1 
ATOM   1809 C CA  . THR B 2 21  ? 104.122 34.252 79.866  1.00 16.34 ? 235  THR H CA  1 
ATOM   1810 C C   . THR B 2 21  ? 105.122 34.617 78.784  1.00 16.77 ? 235  THR H C   1 
ATOM   1811 O O   . THR B 2 21  ? 106.227 35.069 79.057  1.00 18.87 ? 235  THR H O   1 
ATOM   1812 C CB  . THR B 2 21  ? 103.575 35.551 80.463  1.00 17.32 ? 235  THR H CB  1 
ATOM   1813 O OG1 . THR B 2 21  ? 102.534 35.244 81.396  1.00 17.85 ? 235  THR H OG1 1 
ATOM   1814 C CG2 . THR B 2 21  ? 103.043 36.474 79.348  1.00 16.19 ? 235  THR H CG2 1 
ATOM   1815 N N   . CYS B 2 22  ? 104.743 34.412 77.536  1.00 17.07 ? 236  CYS H N   1 
ATOM   1816 C CA  . CYS B 2 22  ? 105.612 34.774 76.440  1.00 17.80 ? 236  CYS H CA  1 
ATOM   1817 C C   . CYS B 2 22  ? 105.003 36.030 75.831  1.00 18.09 ? 236  CYS H C   1 
ATOM   1818 O O   . CYS B 2 22  ? 103.838 36.014 75.426  1.00 18.43 ? 236  CYS H O   1 
ATOM   1819 C CB  . CYS B 2 22  ? 105.609 33.656 75.427  1.00 18.73 ? 236  CYS H CB  1 
ATOM   1820 S SG  . CYS B 2 22  ? 106.480 33.977 73.863  1.00 24.01 ? 236  CYS H SG  1 
ATOM   1821 N N   . THR B 2 23  ? 105.764 37.119 75.763  1.00 16.84 ? 237  THR H N   1 
ATOM   1822 C CA  . THR B 2 23  ? 105.222 38.349 75.200  1.00 17.40 ? 237  THR H CA  1 
ATOM   1823 C C   . THR B 2 23  ? 105.867 38.486 73.831  1.00 18.22 ? 237  THR H C   1 
ATOM   1824 O O   . THR B 2 23  ? 107.096 38.336 73.719  1.00 17.78 ? 237  THR H O   1 
ATOM   1825 C CB  . THR B 2 23  ? 105.589 39.536 76.100  1.00 19.70 ? 237  THR H CB  1 
ATOM   1826 O OG1 . THR B 2 23  ? 104.990 39.317 77.381  1.00 19.63 ? 237  THR H OG1 1 
ATOM   1827 C CG2 . THR B 2 23  ? 105.077 40.890 75.491  1.00 20.28 ? 237  THR H CG2 1 
ATOM   1828 N N   . VAL B 2 24  ? 105.073 38.717 72.784  1.00 17.36 ? 238  VAL H N   1 
ATOM   1829 C CA  . VAL B 2 24  ? 105.690 38.806 71.461  1.00 17.38 ? 238  VAL H CA  1 
ATOM   1830 C C   . VAL B 2 24  ? 105.482 40.171 70.790  1.00 19.37 ? 238  VAL H C   1 
ATOM   1831 O O   . VAL B 2 24  ? 104.594 40.934 71.213  1.00 20.31 ? 238  VAL H O   1 
ATOM   1832 C CB  . VAL B 2 24  ? 105.155 37.651 70.478  1.00 14.44 ? 238  VAL H CB  1 
ATOM   1833 C CG1 . VAL B 2 24  ? 105.182 36.264 71.174  1.00 12.32 ? 238  VAL H CG1 1 
ATOM   1834 C CG2 . VAL B 2 24  ? 103.757 37.971 69.995  1.00 16.18 ? 238  VAL H CG2 1 
ATOM   1835 N N   . SER B 2 25  ? 106.307 40.484 69.777  1.00 19.13 ? 239  SER H N   1 
ATOM   1836 C CA  . SER B 2 25  ? 106.109 41.700 69.001  1.00 22.31 ? 239  SER H CA  1 
ATOM   1837 C C   . SER B 2 25  ? 106.631 41.517 67.564  1.00 23.34 ? 239  SER H C   1 
ATOM   1838 O O   . SER B 2 25  ? 107.440 40.623 67.283  1.00 23.25 ? 239  SER H O   1 
ATOM   1839 C CB  . SER B 2 25  ? 106.779 42.937 69.652  1.00 22.95 ? 239  SER H CB  1 
ATOM   1840 O OG  . SER B 2 25  ? 108.195 42.852 69.645  1.00 23.59 ? 239  SER H OG  1 
ATOM   1841 N N   . GLY B 2 26  ? 106.124 42.349 66.663  1.00 22.45 ? 240  GLY H N   1 
ATOM   1842 C CA  . GLY B 2 26  ? 106.565 42.287 65.281  1.00 23.25 ? 240  GLY H CA  1 
ATOM   1843 C C   . GLY B 2 26  ? 105.712 41.416 64.378  1.00 21.76 ? 240  GLY H C   1 
ATOM   1844 O O   . GLY B 2 26  ? 106.012 41.274 63.182  1.00 21.69 ? 240  GLY H O   1 
ATOM   1845 N N   . PHE B 2 27  ? 104.654 40.835 64.936  1.00 20.93 ? 241  PHE H N   1 
ATOM   1846 C CA  . PHE B 2 27  ? 103.758 39.984 64.169  1.00 20.92 ? 241  PHE H CA  1 
ATOM   1847 C C   . PHE B 2 27  ? 102.532 39.809 65.041  1.00 21.56 ? 241  PHE H C   1 
ATOM   1848 O O   . PHE B 2 27  ? 102.576 40.077 66.235  1.00 22.94 ? 241  PHE H O   1 
ATOM   1849 C CB  . PHE B 2 27  ? 104.403 38.606 63.863  1.00 19.00 ? 241  PHE H CB  1 
ATOM   1850 C CG  . PHE B 2 27  ? 104.598 37.710 65.098  1.00 18.40 ? 241  PHE H CG  1 
ATOM   1851 C CD1 . PHE B 2 27  ? 105.722 37.857 65.924  1.00 16.99 ? 241  PHE H CD1 1 
ATOM   1852 C CD2 . PHE B 2 27  ? 103.664 36.706 65.405  1.00 16.53 ? 241  PHE H CD2 1 
ATOM   1853 C CE1 . PHE B 2 27  ? 105.947 37.001 67.071  1.00 16.65 ? 241  PHE H CE1 1 
ATOM   1854 C CE2 . PHE B 2 27  ? 103.846 35.848 66.526  1.00 16.13 ? 241  PHE H CE2 1 
ATOM   1855 C CZ  . PHE B 2 27  ? 105.012 35.997 67.375  1.00 15.59 ? 241  PHE H CZ  1 
ATOM   1856 N N   . SER B 2 28  ? 101.440 39.364 64.441  1.00 21.92 ? 242  SER H N   1 
ATOM   1857 C CA  . SER B 2 28  ? 100.204 39.167 65.152  1.00 22.57 ? 242  SER H CA  1 
ATOM   1858 C C   . SER B 2 28  ? 100.012 37.671 65.486  1.00 22.97 ? 242  SER H C   1 
ATOM   1859 O O   . SER B 2 28  ? 100.257 36.812 64.616  1.00 21.71 ? 242  SER H O   1 
ATOM   1860 C CB  . SER B 2 28  ? 99.064  39.680 64.268  1.00 24.18 ? 242  SER H CB  1 
ATOM   1861 O OG  . SER B 2 28  ? 97.806  39.240 64.767  1.00 27.49 ? 242  SER H OG  1 
ATOM   1862 N N   . LEU B 2 29  ? 99.629  37.372 66.733  1.00 21.28 ? 243  LEU H N   1 
ATOM   1863 C CA  . LEU B 2 29  ? 99.394  35.976 67.167  1.00 21.10 ? 243  LEU H CA  1 
ATOM   1864 C C   . LEU B 2 29  ? 98.209  35.380 66.406  1.00 21.31 ? 243  LEU H C   1 
ATOM   1865 O O   . LEU B 2 29  ? 97.970  34.179 66.448  1.00 20.87 ? 243  LEU H O   1 
ATOM   1866 C CB  . LEU B 2 29  ? 99.115  35.891 68.677  1.00 17.69 ? 243  LEU H CB  1 
ATOM   1867 C CG  . LEU B 2 29  ? 100.310 36.146 69.620  1.00 19.21 ? 243  LEU H CG  1 
ATOM   1868 C CD1 . LEU B 2 29  ? 99.854  36.278 71.074  1.00 16.16 ? 243  LEU H CD1 1 
ATOM   1869 C CD2 . LEU B 2 29  ? 101.327 35.004 69.464  1.00 14.60 ? 243  LEU H CD2 1 
ATOM   1870 N N   . THR B 2 30  ? 97.449  36.215 65.708  1.00 21.67 ? 244  THR H N   1 
ATOM   1871 C CA  . THR B 2 30  ? 96.326  35.651 64.956  1.00 23.45 ? 244  THR H CA  1 
ATOM   1872 C C   . THR B 2 30  ? 96.848  34.945 63.679  1.00 21.71 ? 244  THR H C   1 
ATOM   1873 O O   . THR B 2 30  ? 96.213  34.024 63.187  1.00 22.56 ? 244  THR H O   1 
ATOM   1874 C CB  . THR B 2 30  ? 95.249  36.751 64.512  1.00 24.07 ? 244  THR H CB  1 
ATOM   1875 O OG1 . THR B 2 30  ? 95.839  37.644 63.557  1.00 26.54 ? 244  THR H OG1 1 
ATOM   1876 C CG2 . THR B 2 30  ? 94.742  37.570 65.715  1.00 24.49 ? 244  THR H CG2 1 
ATOM   1877 N N   . ASP B 2 31  ? 98.006  35.374 63.173  1.00 21.84 ? 245  ASP H N   1 
ATOM   1878 C CA  . ASP B 2 31  ? 98.573  34.845 61.923  1.00 21.11 ? 245  ASP H CA  1 
ATOM   1879 C C   . ASP B 2 31  ? 99.756  33.885 62.084  1.00 20.64 ? 245  ASP H C   1 
ATOM   1880 O O   . ASP B 2 31  ? 100.321 33.439 61.102  1.00 19.59 ? 245  ASP H O   1 
ATOM   1881 C CB  . ASP B 2 31  ? 99.063  36.003 61.036  1.00 23.89 ? 245  ASP H CB  1 
ATOM   1882 C CG  . ASP B 2 31  ? 97.991  37.078 60.806  1.00 26.83 ? 245  ASP H CG  1 
ATOM   1883 O OD1 . ASP B 2 31  ? 96.827  36.738 60.531  1.00 28.20 ? 245  ASP H OD1 1 
ATOM   1884 O OD2 . ASP B 2 31  ? 98.335  38.277 60.902  1.00 30.54 ? 245  ASP H OD2 1 
ATOM   1885 N N   . TYR B 2 32  ? 100.156 33.596 63.309  1.00 17.77 ? 246  TYR H N   1 
ATOM   1886 C CA  . TYR B 2 32  ? 101.274 32.710 63.480  1.00 16.64 ? 246  TYR H CA  1 
ATOM   1887 C C   . TYR B 2 32  ? 101.031 31.757 64.641  1.00 15.76 ? 246  TYR H C   1 
ATOM   1888 O O   . TYR B 2 32  ? 100.164 31.987 65.470  1.00 16.08 ? 246  TYR H O   1 
ATOM   1889 C CB  . TYR B 2 32  ? 102.549 33.524 63.736  1.00 17.03 ? 246  TYR H CB  1 
ATOM   1890 C CG  . TYR B 2 32  ? 103.081 34.226 62.518  1.00 18.85 ? 246  TYR H CG  1 
ATOM   1891 C CD1 . TYR B 2 32  ? 102.609 35.494 62.133  1.00 19.45 ? 246  TYR H CD1 1 
ATOM   1892 C CD2 . TYR B 2 32  ? 104.010 33.595 61.697  1.00 20.42 ? 246  TYR H CD2 1 
ATOM   1893 C CE1 . TYR B 2 32  ? 103.055 36.097 60.950  1.00 20.43 ? 246  TYR H CE1 1 
ATOM   1894 C CE2 . TYR B 2 32  ? 104.465 34.192 60.514  1.00 20.14 ? 246  TYR H CE2 1 
ATOM   1895 C CZ  . TYR B 2 32  ? 103.986 35.430 60.148  1.00 21.62 ? 246  TYR H CZ  1 
ATOM   1896 O OH  . TYR B 2 32  ? 104.474 36.002 58.979  1.00 21.74 ? 246  TYR H OH  1 
ATOM   1897 N N   . GLY B 2 33  ? 101.796 30.676 64.695  1.00 14.56 ? 247  GLY H N   1 
ATOM   1898 C CA  . GLY B 2 33  ? 101.633 29.791 65.817  1.00 13.38 ? 247  GLY H CA  1 
ATOM   1899 C C   . GLY B 2 33  ? 102.754 30.125 66.788  1.00 14.49 ? 247  GLY H C   1 
ATOM   1900 O O   . GLY B 2 33  ? 103.721 30.855 66.417  1.00 13.36 ? 247  GLY H O   1 
ATOM   1901 N N   . VAL B 2 34  ? 102.621 29.668 68.039  1.00 12.54 ? 248  VAL H N   1 
ATOM   1902 C CA  . VAL B 2 34  ? 103.727 29.848 69.002  1.00 12.65 ? 248  VAL H CA  1 
ATOM   1903 C C   . VAL B 2 34  ? 103.940 28.514 69.698  1.00 11.48 ? 248  VAL H C   1 
ATOM   1904 O O   . VAL B 2 34  ? 103.017 27.912 70.189  1.00 11.36 ? 248  VAL H O   1 
ATOM   1905 C CB  . VAL B 2 34  ? 103.477 30.975 70.056  1.00 13.02 ? 248  VAL H CB  1 
ATOM   1906 C CG1 . VAL B 2 34  ? 104.571 30.901 71.188  1.00 10.18 ? 248  VAL H CG1 1 
ATOM   1907 C CG2 . VAL B 2 34  ? 103.576 32.379 69.330  1.00 9.96  ? 248  VAL H CG2 1 
ATOM   1908 N N   . ASP B 2 35  ? 105.159 28.043 69.675  1.00 10.77 ? 249  ASP H N   1 
ATOM   1909 C CA  . ASP B 2 35  ? 105.547 26.762 70.292  1.00 13.44 ? 249  ASP H CA  1 
ATOM   1910 C C   . ASP B 2 35  ? 106.358 26.964 71.564  1.00 14.12 ? 249  ASP H C   1 
ATOM   1911 O O   . ASP B 2 35  ? 106.897 28.053 71.810  1.00 13.84 ? 249  ASP H O   1 
ATOM   1912 C CB  . ASP B 2 35  ? 106.467 25.991 69.336  1.00 10.42 ? 249  ASP H CB  1 
ATOM   1913 C CG  . ASP B 2 35  ? 105.879 25.864 67.956  1.00 13.07 ? 249  ASP H CG  1 
ATOM   1914 O OD1 . ASP B 2 35  ? 105.499 26.912 67.366  1.00 11.55 ? 249  ASP H OD1 1 
ATOM   1915 O OD2 . ASP B 2 35  ? 105.810 24.719 67.443  1.00 9.77  ? 249  ASP H OD2 1 
ATOM   1916 N N   . TRP B 2 36  ? 106.497 25.885 72.339  1.00 14.18 ? 250  TRP H N   1 
ATOM   1917 C CA  . TRP B 2 36  ? 107.320 25.901 73.533  1.00 13.36 ? 250  TRP H CA  1 
ATOM   1918 C C   . TRP B 2 36  ? 108.227 24.715 73.388  1.00 14.63 ? 250  TRP H C   1 
ATOM   1919 O O   . TRP B 2 36  ? 107.785 23.595 72.991  1.00 12.35 ? 250  TRP H O   1 
ATOM   1920 C CB  . TRP B 2 36  ? 106.497 25.811 74.797  1.00 12.40 ? 250  TRP H CB  1 
ATOM   1921 C CG  . TRP B 2 36  ? 105.694 27.023 75.062  1.00 14.48 ? 250  TRP H CG  1 
ATOM   1922 C CD1 . TRP B 2 36  ? 104.454 27.353 74.543  1.00 14.30 ? 250  TRP H CD1 1 
ATOM   1923 C CD2 . TRP B 2 36  ? 106.086 28.117 75.892  1.00 14.01 ? 250  TRP H CD2 1 
ATOM   1924 N NE1 . TRP B 2 36  ? 104.072 28.595 75.001  1.00 14.05 ? 250  TRP H NE1 1 
ATOM   1925 C CE2 . TRP B 2 36  ? 105.055 29.079 75.835  1.00 15.13 ? 250  TRP H CE2 1 
ATOM   1926 C CE3 . TRP B 2 36  ? 107.218 28.376 76.674  1.00 14.70 ? 250  TRP H CE3 1 
ATOM   1927 C CZ2 . TRP B 2 36  ? 105.118 30.288 76.544  1.00 15.19 ? 250  TRP H CZ2 1 
ATOM   1928 C CZ3 . TRP B 2 36  ? 107.290 29.597 77.386  1.00 18.27 ? 250  TRP H CZ3 1 
ATOM   1929 C CH2 . TRP B 2 36  ? 106.236 30.531 77.311  1.00 15.77 ? 250  TRP H CH2 1 
ATOM   1930 N N   . VAL B 2 37  ? 109.498 24.963 73.717  1.00 12.45 ? 251  VAL H N   1 
ATOM   1931 C CA  . VAL B 2 37  ? 110.574 23.999 73.604  1.00 15.09 ? 251  VAL H CA  1 
ATOM   1932 C C   . VAL B 2 37  ? 111.381 24.096 74.900  1.00 15.32 ? 251  VAL H C   1 
ATOM   1933 O O   . VAL B 2 37  ? 111.522 25.187 75.451  1.00 15.68 ? 251  VAL H O   1 
ATOM   1934 C CB  . VAL B 2 37  ? 111.465 24.390 72.371  1.00 14.29 ? 251  VAL H CB  1 
ATOM   1935 C CG1 . VAL B 2 37  ? 112.751 23.592 72.331  1.00 15.38 ? 251  VAL H CG1 1 
ATOM   1936 C CG2 . VAL B 2 37  ? 110.673 24.160 71.059  1.00 13.62 ? 251  VAL H CG2 1 
ATOM   1937 N N   . ARG B 2 38  ? 111.878 22.985 75.424  1.00 15.86 ? 252  ARG H N   1 
ATOM   1938 C CA  . ARG B 2 38  ? 112.696 23.096 76.643  1.00 16.61 ? 252  ARG H CA  1 
ATOM   1939 C C   . ARG B 2 38  ? 114.010 22.336 76.496  1.00 17.22 ? 252  ARG H C   1 
ATOM   1940 O O   . ARG B 2 38  ? 114.129 21.431 75.639  1.00 16.19 ? 252  ARG H O   1 
ATOM   1941 C CB  . ARG B 2 38  ? 111.956 22.611 77.895  1.00 13.70 ? 252  ARG H CB  1 
ATOM   1942 C CG  . ARG B 2 38  ? 111.750 21.120 77.999  1.00 16.50 ? 252  ARG H CG  1 
ATOM   1943 C CD  . ARG B 2 38  ? 110.967 20.772 79.227  1.00 16.65 ? 252  ARG H CD  1 
ATOM   1944 N NE  . ARG B 2 38  ? 110.709 19.335 79.276  1.00 18.51 ? 252  ARG H NE  1 
ATOM   1945 C CZ  . ARG B 2 38  ? 110.025 18.740 80.257  1.00 19.27 ? 252  ARG H CZ  1 
ATOM   1946 N NH1 . ARG B 2 38  ? 109.531 19.461 81.278  1.00 18.53 ? 252  ARG H NH1 1 
ATOM   1947 N NH2 . ARG B 2 38  ? 109.813 17.423 80.204  1.00 19.97 ? 252  ARG H NH2 1 
ATOM   1948 N N   . GLN B 2 39  ? 114.998 22.733 77.308  1.00 16.30 ? 253  GLN H N   1 
ATOM   1949 C CA  . GLN B 2 39  ? 116.324 22.102 77.300  1.00 15.24 ? 253  GLN H CA  1 
ATOM   1950 C C   . GLN B 2 39  ? 116.826 21.837 78.724  1.00 17.11 ? 253  GLN H C   1 
ATOM   1951 O O   . GLN B 2 39  ? 117.137 22.775 79.472  1.00 15.82 ? 253  GLN H O   1 
ATOM   1952 C CB  . GLN B 2 39  ? 117.310 23.022 76.602  1.00 13.58 ? 253  GLN H CB  1 
ATOM   1953 C CG  . GLN B 2 39  ? 118.720 22.507 76.428  1.00 12.96 ? 253  GLN H CG  1 
ATOM   1954 C CD  . GLN B 2 39  ? 119.509 23.410 75.453  1.00 17.28 ? 253  GLN H CD  1 
ATOM   1955 O OE1 . GLN B 2 39  ? 119.276 24.622 75.414  1.00 16.65 ? 253  GLN H OE1 1 
ATOM   1956 N NE2 . GLN B 2 39  ? 120.414 22.832 74.663  1.00 16.23 ? 253  GLN H NE2 1 
ATOM   1957 N N   . PRO B 2 40  ? 116.846 20.566 79.149  1.00 19.41 ? 254  PRO H N   1 
ATOM   1958 C CA  . PRO B 2 40  ? 117.356 20.291 80.503  1.00 20.38 ? 254  PRO H CA  1 
ATOM   1959 C C   . PRO B 2 40  ? 118.865 20.677 80.496  1.00 22.92 ? 254  PRO H C   1 
ATOM   1960 O O   . PRO B 2 40  ? 119.549 20.583 79.456  1.00 21.45 ? 254  PRO H O   1 
ATOM   1961 C CB  . PRO B 2 40  ? 117.190 18.788 80.643  1.00 22.12 ? 254  PRO H CB  1 
ATOM   1962 C CG  . PRO B 2 40  ? 115.990 18.495 79.670  1.00 21.47 ? 254  PRO H CG  1 
ATOM   1963 C CD  . PRO B 2 40  ? 116.370 19.338 78.491  1.00 21.19 ? 254  PRO H CD  1 
ATOM   1964 N N   . PRO B 2 41  ? 119.390 21.144 81.641  1.00 24.53 ? 255  PRO H N   1 
ATOM   1965 C CA  . PRO B 2 41  ? 120.807 21.535 81.709  1.00 25.76 ? 255  PRO H CA  1 
ATOM   1966 C C   . PRO B 2 41  ? 121.732 20.461 81.103  1.00 27.01 ? 255  PRO H C   1 
ATOM   1967 O O   . PRO B 2 41  ? 121.600 19.261 81.382  1.00 27.97 ? 255  PRO H O   1 
ATOM   1968 C CB  . PRO B 2 41  ? 121.050 21.746 83.220  1.00 26.51 ? 255  PRO H CB  1 
ATOM   1969 C CG  . PRO B 2 41  ? 119.645 22.104 83.758  1.00 26.60 ? 255  PRO H CG  1 
ATOM   1970 C CD  . PRO B 2 41  ? 118.759 21.121 82.985  1.00 24.35 ? 255  PRO H CD  1 
ATOM   1971 N N   . GLY B 2 42  ? 122.651 20.891 80.254  1.00 27.36 ? 256  GLY H N   1 
ATOM   1972 C CA  . GLY B 2 42  ? 123.542 19.944 79.617  1.00 28.36 ? 256  GLY H CA  1 
ATOM   1973 C C   . GLY B 2 42  ? 122.885 18.979 78.624  1.00 29.08 ? 256  GLY H C   1 
ATOM   1974 O O   . GLY B 2 42  ? 123.541 18.036 78.168  1.00 29.73 ? 256  GLY H O   1 
ATOM   1975 N N   . LYS B 2 43  ? 121.614 19.165 78.275  1.00 26.48 ? 257  LYS H N   1 
ATOM   1976 C CA  . LYS B 2 43  ? 121.006 18.234 77.327  1.00 26.75 ? 257  LYS H CA  1 
ATOM   1977 C C   . LYS B 2 43  ? 120.476 18.944 76.087  1.00 24.26 ? 257  LYS H C   1 
ATOM   1978 O O   . LYS B 2 43  ? 120.643 20.161 75.961  1.00 22.53 ? 257  LYS H O   1 
ATOM   1979 C CB  . LYS B 2 43  ? 119.908 17.399 78.013  1.00 28.75 ? 257  LYS H CB  1 
ATOM   1980 C CG  . LYS B 2 43  ? 120.484 16.418 79.071  1.00 34.33 ? 257  LYS H CG  1 
ATOM   1981 C CD  . LYS B 2 43  ? 119.422 15.483 79.708  1.00 39.02 ? 257  LYS H CD  1 
ATOM   1982 C CE  . LYS B 2 43  ? 120.056 14.494 80.757  1.00 41.14 ? 257  LYS H CE  1 
ATOM   1983 N NZ  . LYS B 2 43  ? 119.076 13.583 81.479  1.00 42.44 ? 257  LYS H NZ  1 
ATOM   1984 N N   . GLY B 2 44  ? 119.872 18.174 75.179  1.00 22.10 ? 258  GLY H N   1 
ATOM   1985 C CA  . GLY B 2 44  ? 119.333 18.729 73.947  1.00 20.54 ? 258  GLY H CA  1 
ATOM   1986 C C   . GLY B 2 44  ? 117.947 19.384 74.068  1.00 18.99 ? 258  GLY H C   1 
ATOM   1987 O O   . GLY B 2 44  ? 117.504 19.789 75.154  1.00 19.00 ? 258  GLY H O   1 
ATOM   1988 N N   . LEU B 2 45  ? 117.243 19.456 72.947  1.00 17.43 ? 259  LEU H N   1 
ATOM   1989 C CA  . LEU B 2 45  ? 115.943 20.120 72.874  1.00 16.08 ? 259  LEU H CA  1 
ATOM   1990 C C   . LEU B 2 45  ? 114.791 19.155 72.823  1.00 15.62 ? 259  LEU H C   1 
ATOM   1991 O O   . LEU B 2 45  ? 114.889 18.087 72.191  1.00 15.56 ? 259  LEU H O   1 
ATOM   1992 C CB  . LEU B 2 45  ? 115.904 21.016 71.628  1.00 16.48 ? 259  LEU H CB  1 
ATOM   1993 C CG  . LEU B 2 45  ? 117.083 22.012 71.600  1.00 17.58 ? 259  LEU H CG  1 
ATOM   1994 C CD1 . LEU B 2 45  ? 117.166 22.697 70.258  1.00 17.68 ? 259  LEU H CD1 1 
ATOM   1995 C CD2 . LEU B 2 45  ? 116.923 23.064 72.752  1.00 18.53 ? 259  LEU H CD2 1 
ATOM   1996 N N   . GLU B 2 46  ? 113.697 19.543 73.469  1.00 14.85 ? 260  GLU H N   1 
ATOM   1997 C CA  . GLU B 2 46  ? 112.501 18.732 73.491  1.00 15.16 ? 260  GLU H CA  1 
ATOM   1998 C C   . GLU B 2 46  ? 111.312 19.631 73.063  1.00 14.36 ? 260  GLU H C   1 
ATOM   1999 O O   . GLU B 2 46  ? 111.048 20.636 73.709  1.00 12.48 ? 260  GLU H O   1 
ATOM   2000 C CB  . GLU B 2 46  ? 112.233 18.208 74.914  1.00 17.36 ? 260  GLU H CB  1 
ATOM   2001 C CG  . GLU B 2 46  ? 111.055 17.215 74.973  1.00 21.98 ? 260  GLU H CG  1 
ATOM   2002 C CD  . GLU B 2 46  ? 110.650 16.746 76.418  1.00 24.70 ? 260  GLU H CD  1 
ATOM   2003 O OE1 . GLU B 2 46  ? 109.991 15.680 76.532  1.00 25.63 ? 260  GLU H OE1 1 
ATOM   2004 O OE2 . GLU B 2 46  ? 110.963 17.453 77.415  1.00 25.71 ? 260  GLU H OE2 1 
ATOM   2005 N N   . TRP B 2 47  ? 110.582 19.250 72.007  1.00 12.99 ? 261  TRP H N   1 
ATOM   2006 C CA  . TRP B 2 47  ? 109.434 20.069 71.584  1.00 13.34 ? 261  TRP H CA  1 
ATOM   2007 C C   . TRP B 2 47  ? 108.256 19.718 72.536  1.00 13.65 ? 261  TRP H C   1 
ATOM   2008 O O   . TRP B 2 47  ? 107.904 18.534 72.706  1.00 13.50 ? 261  TRP H O   1 
ATOM   2009 C CB  . TRP B 2 47  ? 109.069 19.759 70.126  1.00 12.30 ? 261  TRP H CB  1 
ATOM   2010 C CG  . TRP B 2 47  ? 107.903 20.575 69.626  1.00 12.66 ? 261  TRP H CG  1 
ATOM   2011 C CD1 . TRP B 2 47  ? 107.933 21.873 69.129  1.00 13.08 ? 261  TRP H CD1 1 
ATOM   2012 C CD2 . TRP B 2 47  ? 106.559 20.145 69.547  1.00 10.58 ? 261  TRP H CD2 1 
ATOM   2013 N NE1 . TRP B 2 47  ? 106.655 22.257 68.734  1.00 13.60 ? 261  TRP H NE1 1 
ATOM   2014 C CE2 . TRP B 2 47  ? 105.798 21.213 68.976  1.00 13.15 ? 261  TRP H CE2 1 
ATOM   2015 C CE3 . TRP B 2 47  ? 105.909 18.961 69.881  1.00 10.95 ? 261  TRP H CE3 1 
ATOM   2016 C CZ2 . TRP B 2 47  ? 104.418 21.107 68.736  1.00 12.19 ? 261  TRP H CZ2 1 
ATOM   2017 C CZ3 . TRP B 2 47  ? 104.513 18.866 69.633  1.00 11.81 ? 261  TRP H CZ3 1 
ATOM   2018 C CH2 . TRP B 2 47  ? 103.797 19.934 69.069  1.00 11.77 ? 261  TRP H CH2 1 
ATOM   2019 N N   . LEU B 2 48  ? 107.627 20.743 73.099  1.00 11.10 ? 262  LEU H N   1 
ATOM   2020 C CA  . LEU B 2 48  ? 106.553 20.533 74.041  1.00 12.78 ? 262  LEU H CA  1 
ATOM   2021 C C   . LEU B 2 48  ? 105.136 20.652 73.480  1.00 11.99 ? 262  LEU H C   1 
ATOM   2022 O O   . LEU B 2 48  ? 104.274 19.878 73.852  1.00 12.07 ? 262  LEU H O   1 
ATOM   2023 C CB  . LEU B 2 48  ? 106.690 21.507 75.210  1.00 12.15 ? 262  LEU H CB  1 
ATOM   2024 C CG  . LEU B 2 48  ? 108.031 21.538 75.968  1.00 14.56 ? 262  LEU H CG  1 
ATOM   2025 C CD1 . LEU B 2 48  ? 107.972 22.595 77.108  1.00 10.97 ? 262  LEU H CD1 1 
ATOM   2026 C CD2 . LEU B 2 48  ? 108.308 20.142 76.548  1.00 13.17 ? 262  LEU H CD2 1 
ATOM   2027 N N   . GLY B 2 49  ? 104.895 21.627 72.608  1.00 11.19 ? 263  GLY H N   1 
ATOM   2028 C CA  . GLY B 2 49  ? 103.550 21.830 72.075  1.00 12.00 ? 263  GLY H CA  1 
ATOM   2029 C C   . GLY B 2 49  ? 103.474 23.180 71.388  1.00 12.24 ? 263  GLY H C   1 
ATOM   2030 O O   . GLY B 2 49  ? 104.500 23.894 71.369  1.00 12.02 ? 263  GLY H O   1 
ATOM   2031 N N   . MET B 2 50  ? 102.319 23.517 70.813  1.00 10.79 ? 264  MET H N   1 
ATOM   2032 C CA  . MET B 2 50  ? 102.155 24.819 70.142  1.00 12.97 ? 264  MET H CA  1 
ATOM   2033 C C   . MET B 2 50  ? 100.679 25.235 70.094  1.00 13.72 ? 264  MET H C   1 
ATOM   2034 O O   . MET B 2 50  ? 99.780  24.403 70.360  1.00 14.34 ? 264  MET H O   1 
ATOM   2035 C CB  . MET B 2 50  ? 102.744 24.821 68.698  1.00 13.29 ? 264  MET H CB  1 
ATOM   2036 C CG  . MET B 2 50  ? 102.111 23.839 67.686  1.00 14.71 ? 264  MET H CG  1 
ATOM   2037 S SD  . MET B 2 50  ? 100.456 24.322 67.097  1.00 11.44 ? 264  MET H SD  1 
ATOM   2038 C CE  . MET B 2 50  ? 100.917 25.743 65.945  1.00 13.37 ? 264  MET H CE  1 
ATOM   2039 N N   . ILE B 2 51  ? 100.446 26.524 69.821  1.00 11.90 ? 265  ILE H N   1 
ATOM   2040 C CA  . ILE B 2 51  ? 99.094  27.043 69.703  1.00 12.08 ? 265  ILE H CA  1 
ATOM   2041 C C   . ILE B 2 51  ? 99.006  27.747 68.345  1.00 13.05 ? 265  ILE H C   1 
ATOM   2042 O O   . ILE B 2 51  ? 99.843  28.610 67.993  1.00 13.71 ? 265  ILE H O   1 
ATOM   2043 C CB  . ILE B 2 51  ? 98.717  28.025 70.881  1.00 12.18 ? 265  ILE H CB  1 
ATOM   2044 C CG1 . ILE B 2 51  ? 97.243  28.405 70.730  1.00 11.91 ? 265  ILE H CG1 1 
ATOM   2045 C CG2 . ILE B 2 51  ? 99.645  29.285 70.906  1.00 10.54 ? 265  ILE H CG2 1 
ATOM   2046 C CD1 . ILE B 2 51  ? 96.570  28.931 72.083  1.00 12.66 ? 265  ILE H CD1 1 
ATOM   2047 N N   . TRP B 2 52  ? 98.013  27.322 67.562  1.00 13.69 ? 266  TRP H N   1 
ATOM   2048 C CA  . TRP B 2 52  ? 97.739  27.846 66.203  1.00 14.47 ? 266  TRP H CA  1 
ATOM   2049 C C   . TRP B 2 52  ? 97.087  29.237 66.270  1.00 14.12 ? 266  TRP H C   1 
ATOM   2050 O O   . TRP B 2 52  ? 96.563  29.647 67.311  1.00 12.47 ? 266  TRP H O   1 
ATOM   2051 C CB  . TRP B 2 52  ? 96.747  26.940 65.466  1.00 13.13 ? 266  TRP H CB  1 
ATOM   2052 C CG  . TRP B 2 52  ? 97.299  25.579 65.112  1.00 13.85 ? 266  TRP H CG  1 
ATOM   2053 C CD1 . TRP B 2 52  ? 97.439  24.515 65.940  1.00 12.74 ? 266  TRP H CD1 1 
ATOM   2054 C CD2 . TRP B 2 52  ? 97.719  25.133 63.788  1.00 13.18 ? 266  TRP H CD2 1 
ATOM   2055 N NE1 . TRP B 2 52  ? 97.924  23.425 65.223  1.00 12.54 ? 266  TRP H NE1 1 
ATOM   2056 C CE2 . TRP B 2 52  ? 98.095  23.786 63.904  1.00 13.20 ? 266  TRP H CE2 1 
ATOM   2057 C CE3 . TRP B 2 52  ? 97.797  25.759 62.527  1.00 14.83 ? 266  TRP H CE3 1 
ATOM   2058 C CZ2 . TRP B 2 52  ? 98.555  23.032 62.799  1.00 12.16 ? 266  TRP H CZ2 1 
ATOM   2059 C CZ3 . TRP B 2 52  ? 98.267  25.003 61.411  1.00 12.82 ? 266  TRP H CZ3 1 
ATOM   2060 C CH2 . TRP B 2 52  ? 98.636  23.652 61.573  1.00 15.19 ? 266  TRP H CH2 1 
ATOM   2061 N N   . GLY B 2 53  ? 97.088  29.917 65.134  1.00 13.79 ? 267  GLY H N   1 
ATOM   2062 C CA  . GLY B 2 53  ? 96.464  31.218 65.083  1.00 15.71 ? 267  GLY H CA  1 
ATOM   2063 C C   . GLY B 2 53  ? 95.068  31.218 65.673  1.00 17.80 ? 267  GLY H C   1 
ATOM   2064 O O   . GLY B 2 53  ? 94.719  32.162 66.375  1.00 18.87 ? 267  GLY H O   1 
ATOM   2065 N N   . ASP B 2 54  ? 94.263  30.176 65.417  1.00 17.86 ? 268  ASP H N   1 
ATOM   2066 C CA  . ASP B 2 54  ? 92.863  30.133 65.905  1.00 16.89 ? 268  ASP H CA  1 
ATOM   2067 C C   . ASP B 2 54  ? 92.704  29.654 67.350  1.00 17.09 ? 268  ASP H C   1 
ATOM   2068 O O   . ASP B 2 54  ? 91.587  29.478 67.831  1.00 16.74 ? 268  ASP H O   1 
ATOM   2069 C CB  . ASP B 2 54  ? 91.993  29.236 65.005  1.00 17.82 ? 268  ASP H CB  1 
ATOM   2070 C CG  . ASP B 2 54  ? 92.292  27.704 65.177  1.00 18.44 ? 268  ASP H CG  1 
ATOM   2071 O OD1 . ASP B 2 54  ? 93.275  27.323 65.851  1.00 15.65 ? 268  ASP H OD1 1 
ATOM   2072 O OD2 . ASP B 2 54  ? 91.522  26.887 64.612  1.00 18.14 ? 268  ASP H OD2 1 
ATOM   2073 N N   . GLY B 2 55  ? 93.814  29.467 68.052  1.00 17.22 ? 269  GLY H N   1 
ATOM   2074 C CA  . GLY B 2 55  ? 93.734  29.028 69.442  1.00 15.67 ? 269  GLY H CA  1 
ATOM   2075 C C   . GLY B 2 55  ? 93.680  27.507 69.653  1.00 17.64 ? 269  GLY H C   1 
ATOM   2076 O O   . GLY B 2 55  ? 93.690  27.051 70.801  1.00 17.38 ? 269  GLY H O   1 
ATOM   2077 N N   . SER B 2 56  ? 93.588  26.718 68.578  1.00 15.85 ? 270  SER H N   1 
ATOM   2078 C CA  . SER B 2 56  ? 93.575  25.269 68.742  1.00 15.25 ? 270  SER H CA  1 
ATOM   2079 C C   . SER B 2 56  ? 95.032  24.898 69.073  1.00 13.28 ? 270  SER H C   1 
ATOM   2080 O O   . SER B 2 56  ? 95.962  25.637 68.734  1.00 13.29 ? 270  SER H O   1 
ATOM   2081 C CB  . SER B 2 56  ? 93.061  24.553 67.463  1.00 13.86 ? 270  SER H CB  1 
ATOM   2082 O OG  . SER B 2 56  ? 93.915  24.792 66.349  1.00 15.01 ? 270  SER H OG  1 
ATOM   2083 N N   . THR B 2 57  ? 95.245  23.747 69.714  1.00 13.65 ? 271  THR H N   1 
ATOM   2084 C CA  . THR B 2 57  ? 96.610  23.371 70.142  1.00 13.06 ? 271  THR H CA  1 
ATOM   2085 C C   . THR B 2 57  ? 97.029  21.954 69.808  1.00 14.03 ? 271  THR H C   1 
ATOM   2086 O O   . THR B 2 57  ? 96.158  21.107 69.543  1.00 13.56 ? 271  THR H O   1 
ATOM   2087 C CB  . THR B 2 57  ? 96.704  23.436 71.668  1.00 13.34 ? 271  THR H CB  1 
ATOM   2088 O OG1 . THR B 2 57  ? 95.668  22.597 72.218  1.00 14.57 ? 271  THR H OG1 1 
ATOM   2089 C CG2 . THR B 2 57  ? 96.471  24.847 72.177  1.00 10.24 ? 271  THR H CG2 1 
ATOM   2090 N N   . ASP B 2 58  ? 98.354  21.727 69.853  1.00 11.57 ? 272  ASP H N   1 
ATOM   2091 C CA  . ASP B 2 58  ? 98.974  20.411 69.679  1.00 13.51 ? 272  ASP H CA  1 
ATOM   2092 C C   . ASP B 2 58  ? 99.952  20.239 70.841  1.00 13.53 ? 272  ASP H C   1 
ATOM   2093 O O   . ASP B 2 58  ? 100.752 21.127 71.091  1.00 14.04 ? 272  ASP H O   1 
ATOM   2094 C CB  . ASP B 2 58  ? 99.726  20.296 68.332  1.00 13.37 ? 272  ASP H CB  1 
ATOM   2095 C CG  . ASP B 2 58  ? 98.760  20.143 67.150  1.00 15.37 ? 272  ASP H CG  1 
ATOM   2096 O OD1 . ASP B 2 58  ? 97.915  19.184 67.222  1.00 15.07 ? 272  ASP H OD1 1 
ATOM   2097 O OD2 . ASP B 2 58  ? 98.848  20.981 66.198  1.00 14.89 ? 272  ASP H OD2 1 
ATOM   2098 N N   . TYR B 2 59  ? 99.879  19.118 71.566  1.00 14.10 ? 273  TYR H N   1 
ATOM   2099 C CA  . TYR B 2 59  ? 100.781 18.884 72.704  1.00 13.46 ? 273  TYR H CA  1 
ATOM   2100 C C   . TYR B 2 59  ? 101.574 17.603 72.507  1.00 15.31 ? 273  TYR H C   1 
ATOM   2101 O O   . TYR B 2 59  ? 101.065 16.628 71.902  1.00 13.80 ? 273  TYR H O   1 
ATOM   2102 C CB  . TYR B 2 59  ? 99.982  18.747 74.022  1.00 12.98 ? 273  TYR H CB  1 
ATOM   2103 C CG  . TYR B 2 59  ? 99.156  19.953 74.390  1.00 13.00 ? 273  TYR H CG  1 
ATOM   2104 C CD1 . TYR B 2 59  ? 99.738  21.238 74.437  1.00 12.20 ? 273  TYR H CD1 1 
ATOM   2105 C CD2 . TYR B 2 59  ? 97.796  19.831 74.691  1.00 14.78 ? 273  TYR H CD2 1 
ATOM   2106 C CE1 . TYR B 2 59  ? 98.988  22.342 74.775  1.00 9.25  ? 273  TYR H CE1 1 
ATOM   2107 C CE2 . TYR B 2 59  ? 97.016  20.960 75.037  1.00 13.06 ? 273  TYR H CE2 1 
ATOM   2108 C CZ  . TYR B 2 59  ? 97.643  22.197 75.071  1.00 11.60 ? 273  TYR H CZ  1 
ATOM   2109 O OH  . TYR B 2 59  ? 96.950  23.269 75.412  1.00 12.35 ? 273  TYR H OH  1 
ATOM   2110 N N   . ASN B 2 60  ? 102.783 17.575 73.074  1.00 14.20 ? 274  ASN H N   1 
ATOM   2111 C CA  . ASN B 2 60  ? 103.644 16.395 73.006  1.00 16.13 ? 274  ASN H CA  1 
ATOM   2112 C C   . ASN B 2 60  ? 103.064 15.420 74.040  1.00 17.18 ? 274  ASN H C   1 
ATOM   2113 O O   . ASN B 2 60  ? 102.958 15.745 75.230  1.00 17.60 ? 274  ASN H O   1 
ATOM   2114 C CB  . ASN B 2 60  ? 105.087 16.778 73.354  1.00 13.56 ? 274  ASN H CB  1 
ATOM   2115 C CG  . ASN B 2 60  ? 106.055 15.630 73.148  1.00 16.49 ? 274  ASN H CG  1 
ATOM   2116 O OD1 . ASN B 2 60  ? 105.709 14.450 73.382  1.00 15.74 ? 274  ASN H OD1 1 
ATOM   2117 N ND2 . ASN B 2 60  ? 107.294 15.957 72.723  1.00 14.94 ? 274  ASN H ND2 1 
ATOM   2118 N N   . SER B 2 61  ? 102.660 14.217 73.631  1.00 19.11 ? 275  SER H N   1 
ATOM   2119 C CA  . SER B 2 61  ? 102.038 13.381 74.658  1.00 20.86 ? 275  SER H CA  1 
ATOM   2120 C C   . SER B 2 61  ? 103.019 12.940 75.738  1.00 20.08 ? 275  SER H C   1 
ATOM   2121 O O   . SER B 2 61  ? 102.599 12.434 76.790  1.00 20.41 ? 275  SER H O   1 
ATOM   2122 C CB  . SER B 2 61  ? 101.324 12.180 74.054  1.00 21.48 ? 275  SER H CB  1 
ATOM   2123 O OG  . SER B 2 61  ? 102.276 11.392 73.384  1.00 26.03 ? 275  SER H OG  1 
ATOM   2124 N N   . ALA B 2 62  ? 104.320 13.139 75.536  1.00 20.41 ? 276  ALA H N   1 
ATOM   2125 C CA  . ALA B 2 62  ? 105.228 12.712 76.611  1.00 20.81 ? 276  ALA H CA  1 
ATOM   2126 C C   . ALA B 2 62  ? 104.977 13.542 77.880  1.00 21.63 ? 276  ALA H C   1 
ATOM   2127 O O   . ALA B 2 62  ? 105.416 13.166 78.968  1.00 22.91 ? 276  ALA H O   1 
ATOM   2128 C CB  . ALA B 2 62  ? 106.710 12.835 76.201  1.00 19.61 ? 276  ALA H CB  1 
ATOM   2129 N N   . LEU B 2 63  ? 104.292 14.672 77.752  1.00 20.89 ? 277  LEU H N   1 
ATOM   2130 C CA  . LEU B 2 63  ? 104.020 15.516 78.910  1.00 20.28 ? 277  LEU H CA  1 
ATOM   2131 C C   . LEU B 2 63  ? 102.825 15.022 79.767  1.00 20.71 ? 277  LEU H C   1 
ATOM   2132 O O   . LEU B 2 63  ? 102.431 15.666 80.780  1.00 18.94 ? 277  LEU H O   1 
ATOM   2133 C CB  . LEU B 2 63  ? 103.806 16.970 78.443  1.00 20.41 ? 277  LEU H CB  1 
ATOM   2134 C CG  . LEU B 2 63  ? 105.113 17.605 77.878  1.00 22.19 ? 277  LEU H CG  1 
ATOM   2135 C CD1 . LEU B 2 63  ? 104.903 19.075 77.608  1.00 21.12 ? 277  LEU H CD1 1 
ATOM   2136 C CD2 . LEU B 2 63  ? 106.282 17.416 78.887  1.00 19.09 ? 277  LEU H CD2 1 
ATOM   2137 N N   . LYS B 2 64  ? 102.231 13.911 79.335  1.00 20.54 ? 278  LYS H N   1 
ATOM   2138 C CA  . LYS B 2 64  ? 101.131 13.277 80.064  1.00 21.53 ? 278  LYS H CA  1 
ATOM   2139 C C   . LYS B 2 64  ? 99.964  14.176 80.401  1.00 21.14 ? 278  LYS H C   1 
ATOM   2140 O O   . LYS B 2 64  ? 99.431  14.160 81.540  1.00 19.96 ? 278  LYS H O   1 
ATOM   2141 C CB  . LYS B 2 64  ? 101.665 12.639 81.354  1.00 24.87 ? 278  LYS H CB  1 
ATOM   2142 C CG  . LYS B 2 64  ? 102.803 11.632 81.110  1.00 30.68 ? 278  LYS H CG  1 
ATOM   2143 C CD  . LYS B 2 64  ? 102.435 10.670 79.964  1.00 36.17 ? 278  LYS H CD  1 
ATOM   2144 C CE  . LYS B 2 64  ? 103.334 9.425  79.933  1.00 41.63 ? 278  LYS H CE  1 
ATOM   2145 N NZ  . LYS B 2 64  ? 103.028 8.535  78.749  1.00 45.89 ? 278  LYS H NZ  1 
ATOM   2146 N N   . SER B 2 65  ? 99.563  14.978 79.414  1.00 18.75 ? 279  SER H N   1 
ATOM   2147 C CA  . SER B 2 65  ? 98.420  15.855 79.561  1.00 19.10 ? 279  SER H CA  1 
ATOM   2148 C C   . SER B 2 65  ? 98.581  16.925 80.626  1.00 18.22 ? 279  SER H C   1 
ATOM   2149 O O   . SER B 2 65  ? 97.592  17.501 81.067  1.00 18.60 ? 279  SER H O   1 
ATOM   2150 C CB  . SER B 2 65  ? 97.164  15.005 79.877  1.00 19.72 ? 279  SER H CB  1 
ATOM   2151 O OG  . SER B 2 65  ? 96.945  14.015 78.873  1.00 21.51 ? 279  SER H OG  1 
ATOM   2152 N N   . ARG B 2 66  ? 99.824  17.220 81.013  1.00 18.14 ? 280  ARG H N   1 
ATOM   2153 C CA  . ARG B 2 66  ? 100.081 18.213 82.072  1.00 17.89 ? 280  ARG H CA  1 
ATOM   2154 C C   . ARG B 2 66  ? 100.143 19.624 81.546  1.00 17.00 ? 280  ARG H C   1 
ATOM   2155 O O   . ARG B 2 66  ? 100.083 20.587 82.330  1.00 16.51 ? 280  ARG H O   1 
ATOM   2156 C CB  . ARG B 2 66  ? 101.426 17.918 82.762  1.00 17.69 ? 280  ARG H CB  1 
ATOM   2157 C CG  . ARG B 2 66  ? 101.352 16.740 83.724  1.00 19.43 ? 280  ARG H CG  1 
ATOM   2158 C CD  . ARG B 2 66  ? 102.686 16.503 84.457  1.00 17.27 ? 280  ARG H CD  1 
ATOM   2159 N NE  . ARG B 2 66  ? 103.846 16.302 83.571  1.00 18.47 ? 280  ARG H NE  1 
ATOM   2160 C CZ  . ARG B 2 66  ? 105.052 16.846 83.784  1.00 18.75 ? 280  ARG H CZ  1 
ATOM   2161 N NH1 . ARG B 2 66  ? 105.269 17.631 84.852  1.00 19.73 ? 280  ARG H NH1 1 
ATOM   2162 N NH2 . ARG B 2 66  ? 106.045 16.632 82.924  1.00 17.52 ? 280  ARG H NH2 1 
ATOM   2163 N N   . LEU B 2 67  ? 100.221 19.742 80.221  1.00 14.25 ? 281  LEU H N   1 
ATOM   2164 C CA  . LEU B 2 67  ? 100.415 21.046 79.608  1.00 15.21 ? 281  LEU H CA  1 
ATOM   2165 C C   . LEU B 2 67  ? 99.232  21.782 78.993  1.00 16.01 ? 281  LEU H C   1 
ATOM   2166 O O   . LEU B 2 67  ? 98.400  21.191 78.309  1.00 16.10 ? 281  LEU H O   1 
ATOM   2167 C CB  . LEU B 2 67  ? 101.543 20.926 78.558  1.00 14.35 ? 281  LEU H CB  1 
ATOM   2168 C CG  . LEU B 2 67  ? 101.895 22.123 77.662  1.00 15.79 ? 281  LEU H CG  1 
ATOM   2169 C CD1 . LEU B 2 67  ? 102.707 23.164 78.467  1.00 15.25 ? 281  LEU H CD1 1 
ATOM   2170 C CD2 . LEU B 2 67  ? 102.747 21.654 76.443  1.00 15.41 ? 281  LEU H CD2 1 
ATOM   2171 N N   . SER B 2 68  ? 99.209  23.098 79.212  1.00 15.95 ? 282  SER H N   1 
ATOM   2172 C CA  . SER B 2 68  ? 98.191  23.965 78.662  1.00 16.44 ? 282  SER H CA  1 
ATOM   2173 C C   . SER B 2 68  ? 98.842  25.168 77.989  1.00 17.70 ? 282  SER H C   1 
ATOM   2174 O O   . SER B 2 68  ? 99.701  25.827 78.590  1.00 17.81 ? 282  SER H O   1 
ATOM   2175 C CB  . SER B 2 68  ? 97.278  24.529 79.763  1.00 17.47 ? 282  SER H CB  1 
ATOM   2176 O OG  . SER B 2 68  ? 96.579  25.679 79.278  1.00 19.73 ? 282  SER H OG  1 
ATOM   2177 N N   . ILE B 2 69  ? 98.449  25.467 76.749  1.00 15.67 ? 283  ILE H N   1 
ATOM   2178 C CA  . ILE B 2 69  ? 98.962  26.673 76.113  1.00 14.91 ? 283  ILE H CA  1 
ATOM   2179 C C   . ILE B 2 69  ? 97.734  27.463 75.714  1.00 15.38 ? 283  ILE H C   1 
ATOM   2180 O O   . ILE B 2 69  ? 96.901  26.939 74.990  1.00 14.31 ? 283  ILE H O   1 
ATOM   2181 C CB  . ILE B 2 69  ? 99.745  26.376 74.859  1.00 14.90 ? 283  ILE H CB  1 
ATOM   2182 C CG1 . ILE B 2 69  ? 100.964 25.509 75.185  1.00 12.93 ? 283  ILE H CG1 1 
ATOM   2183 C CG2 . ILE B 2 69  ? 100.262 27.723 74.215  1.00 14.05 ? 283  ILE H CG2 1 
ATOM   2184 C CD1 . ILE B 2 69  ? 101.624 24.927 73.875  1.00 12.87 ? 283  ILE H CD1 1 
ATOM   2185 N N   . THR B 2 70  ? 97.616  28.711 76.187  1.00 14.69 ? 284  THR H N   1 
ATOM   2186 C CA  . THR B 2 70  ? 96.476  29.592 75.853  1.00 14.01 ? 284  THR H CA  1 
ATOM   2187 C C   . THR B 2 70  ? 97.093  30.939 75.466  1.00 14.34 ? 284  THR H C   1 
ATOM   2188 O O   . THR B 2 70  ? 98.289  31.107 75.557  1.00 13.74 ? 284  THR H O   1 
ATOM   2189 C CB  . THR B 2 70  ? 95.518  29.812 77.069  1.00 13.00 ? 284  THR H CB  1 
ATOM   2190 O OG1 . THR B 2 70  ? 96.311  30.155 78.212  1.00 15.17 ? 284  THR H OG1 1 
ATOM   2191 C CG2 . THR B 2 70  ? 94.680  28.536 77.386  1.00 14.92 ? 284  THR H CG2 1 
ATOM   2192 N N   . LYS B 2 71  ? 96.293  31.908 75.050  1.00 15.02 ? 285  LYS H N   1 
ATOM   2193 C CA  . LYS B 2 71  ? 96.865  33.167 74.637  1.00 16.36 ? 285  LYS H CA  1 
ATOM   2194 C C   . LYS B 2 71  ? 95.839  34.273 74.665  1.00 18.04 ? 285  LYS H C   1 
ATOM   2195 O O   . LYS B 2 71  ? 94.648  34.026 74.834  1.00 15.97 ? 285  LYS H O   1 
ATOM   2196 C CB  . LYS B 2 71  ? 97.388  33.054 73.197  1.00 16.08 ? 285  LYS H CB  1 
ATOM   2197 C CG  . LYS B 2 71  ? 96.295  32.742 72.189  1.00 14.53 ? 285  LYS H CG  1 
ATOM   2198 C CD  . LYS B 2 71  ? 96.895  32.680 70.753  1.00 15.83 ? 285  LYS H CD  1 
ATOM   2199 C CE  . LYS B 2 71  ? 95.826  32.426 69.677  1.00 15.49 ? 285  LYS H CE  1 
ATOM   2200 N NZ  . LYS B 2 71  ? 96.304  32.839 68.319  1.00 13.30 ? 285  LYS H NZ  1 
ATOM   2201 N N   . ASP B 2 72  ? 96.327  35.491 74.498  1.00 17.74 ? 286  ASP H N   1 
ATOM   2202 C CA  . ASP B 2 72  ? 95.466  36.638 74.438  1.00 19.14 ? 286  ASP H CA  1 
ATOM   2203 C C   . ASP B 2 72  ? 95.973  37.404 73.223  1.00 18.82 ? 286  ASP H C   1 
ATOM   2204 O O   . ASP B 2 72  ? 97.007  38.095 73.301  1.00 17.08 ? 286  ASP H O   1 
ATOM   2205 C CB  . ASP B 2 72  ? 95.602  37.499 75.711  1.00 21.17 ? 286  ASP H CB  1 
ATOM   2206 C CG  . ASP B 2 72  ? 94.663  38.743 75.679  1.00 21.88 ? 286  ASP H CG  1 
ATOM   2207 O OD1 . ASP B 2 72  ? 94.471  39.346 74.603  1.00 22.09 ? 286  ASP H OD1 1 
ATOM   2208 O OD2 . ASP B 2 72  ? 94.118  39.091 76.737  1.00 23.99 ? 286  ASP H OD2 1 
ATOM   2209 N N   . ASN B 2 73  ? 95.248  37.291 72.110  1.00 18.60 ? 287  ASN H N   1 
ATOM   2210 C CA  . ASN B 2 73  ? 95.687  37.937 70.902  1.00 20.56 ? 287  ASN H CA  1 
ATOM   2211 C C   . ASN B 2 73  ? 95.887  39.440 71.057  1.00 22.12 ? 287  ASN H C   1 
ATOM   2212 O O   . ASN B 2 73  ? 96.877  39.980 70.570  1.00 22.22 ? 287  ASN H O   1 
ATOM   2213 C CB  . ASN B 2 73  ? 94.715  37.695 69.744  1.00 19.83 ? 287  ASN H CB  1 
ATOM   2214 C CG  . ASN B 2 73  ? 94.687  36.220 69.272  1.00 21.01 ? 287  ASN H CG  1 
ATOM   2215 O OD1 . ASN B 2 73  ? 95.712  35.510 69.245  1.00 19.37 ? 287  ASN H OD1 1 
ATOM   2216 N ND2 . ASN B 2 73  ? 93.516  35.780 68.863  1.00 19.40 ? 287  ASN H ND2 1 
ATOM   2217 N N   . SER B 2 74  ? 94.971  40.120 71.744  1.00 23.28 ? 288  SER H N   1 
ATOM   2218 C CA  . SER B 2 74  ? 95.091  41.571 71.827  1.00 24.30 ? 288  SER H CA  1 
ATOM   2219 C C   . SER B 2 74  ? 96.258  42.039 72.688  1.00 25.50 ? 288  SER H C   1 
ATOM   2220 O O   . SER B 2 74  ? 96.730  43.165 72.522  1.00 26.33 ? 288  SER H O   1 
ATOM   2221 C CB  . SER B 2 74  ? 93.782  42.188 72.305  1.00 23.86 ? 288  SER H CB  1 
ATOM   2222 O OG  . SER B 2 74  ? 93.514  41.790 73.637  1.00 26.40 ? 288  SER H OG  1 
ATOM   2223 N N   . LYS B 2 75  ? 96.737  41.192 73.596  1.00 25.53 ? 289  LYS H N   1 
ATOM   2224 C CA  . LYS B 2 75  ? 97.885  41.585 74.412  1.00 27.06 ? 289  LYS H CA  1 
ATOM   2225 C C   . LYS B 2 75  ? 99.205  40.959 73.936  1.00 25.68 ? 289  LYS H C   1 
ATOM   2226 O O   . LYS B 2 75  ? 100.242 41.085 74.608  1.00 24.63 ? 289  LYS H O   1 
ATOM   2227 C CB  . LYS B 2 75  ? 97.634  41.253 75.891  1.00 29.77 ? 289  LYS H CB  1 
ATOM   2228 C CG  . LYS B 2 75  ? 96.395  41.972 76.415  1.00 33.28 ? 289  LYS H CG  1 
ATOM   2229 C CD  . LYS B 2 75  ? 96.113  41.685 77.898  1.00 39.12 ? 289  LYS H CD  1 
ATOM   2230 C CE  . LYS B 2 75  ? 96.359  40.220 78.231  1.00 42.51 ? 289  LYS H CE  1 
ATOM   2231 N NZ  . LYS B 2 75  ? 95.804  39.855 79.599  1.00 47.29 ? 289  LYS H NZ  1 
ATOM   2232 N N   . SER B 2 76  ? 99.161  40.306 72.769  1.00 23.54 ? 290  SER H N   1 
ATOM   2233 C CA  . SER B 2 76  ? 100.343 39.660 72.202  1.00 21.07 ? 290  SER H CA  1 
ATOM   2234 C C   . SER B 2 76  ? 101.015 38.801 73.241  1.00 19.93 ? 290  SER H C   1 
ATOM   2235 O O   . SER B 2 76  ? 102.231 38.848 73.387  1.00 20.51 ? 290  SER H O   1 
ATOM   2236 C CB  . SER B 2 76  ? 101.334 40.709 71.691  1.00 21.87 ? 290  SER H CB  1 
ATOM   2237 O OG  . SER B 2 76  ? 100.822 41.291 70.503  1.00 22.77 ? 290  SER H OG  1 
ATOM   2238 N N   . GLN B 2 77  ? 100.227 38.025 73.976  1.00 18.02 ? 291  GLN H N   1 
ATOM   2239 C CA  . GLN B 2 77  ? 100.797 37.170 75.000  1.00 19.09 ? 291  GLN H CA  1 
ATOM   2240 C C   . GLN B 2 77  ? 100.324 35.737 74.855  1.00 18.57 ? 291  GLN H C   1 
ATOM   2241 O O   . GLN B 2 77  ? 99.185  35.490 74.467  1.00 16.43 ? 291  GLN H O   1 
ATOM   2242 C CB  . GLN B 2 77  ? 100.423 37.690 76.390  1.00 19.35 ? 291  GLN H CB  1 
ATOM   2243 C CG  . GLN B 2 77  ? 101.041 39.019 76.692  1.00 23.35 ? 291  GLN H CG  1 
ATOM   2244 C CD  . GLN B 2 77  ? 100.631 39.501 78.062  1.00 27.06 ? 291  GLN H CD  1 
ATOM   2245 O OE1 . GLN B 2 77  ? 99.452  39.478 78.402  1.00 28.23 ? 291  GLN H OE1 1 
ATOM   2246 N NE2 . GLN B 2 77  ? 101.614 39.925 78.873  1.00 28.43 ? 291  GLN H NE2 1 
ATOM   2247 N N   . VAL B 2 78  ? 101.232 34.807 75.137  1.00 18.29 ? 292  VAL H N   1 
ATOM   2248 C CA  . VAL B 2 78  ? 100.929 33.381 75.061  1.00 17.93 ? 292  VAL H CA  1 
ATOM   2249 C C   . VAL B 2 78  ? 101.254 32.781 76.434  1.00 17.16 ? 292  VAL H C   1 
ATOM   2250 O O   . VAL B 2 78  ? 102.335 33.004 76.991  1.00 17.21 ? 292  VAL H O   1 
ATOM   2251 C CB  . VAL B 2 78  ? 101.801 32.687 73.972  1.00 18.66 ? 292  VAL H CB  1 
ATOM   2252 C CG1 . VAL B 2 78  ? 101.616 31.182 74.030  1.00 16.80 ? 292  VAL H CG1 1 
ATOM   2253 C CG2 . VAL B 2 78  ? 101.456 33.250 72.608  1.00 18.07 ? 292  VAL H CG2 1 
ATOM   2254 N N   . PHE B 2 79  ? 100.333 32.002 76.973  1.00 17.48 ? 293  PHE H N   1 
ATOM   2255 C CA  . PHE B 2 79  ? 100.556 31.446 78.302  1.00 17.37 ? 293  PHE H CA  1 
ATOM   2256 C C   . PHE B 2 79  ? 100.761 29.953 78.382  1.00 17.21 ? 293  PHE H C   1 
ATOM   2257 O O   . PHE B 2 79  ? 99.909  29.160 77.938  1.00 17.56 ? 293  PHE H O   1 
ATOM   2258 C CB  . PHE B 2 79  ? 99.372  31.834 79.214  1.00 17.19 ? 293  PHE H CB  1 
ATOM   2259 C CG  . PHE B 2 79  ? 98.921  33.264 79.043  1.00 19.00 ? 293  PHE H CG  1 
ATOM   2260 C CD1 . PHE B 2 79  ? 97.784  33.569 78.291  1.00 19.38 ? 293  PHE H CD1 1 
ATOM   2261 C CD2 . PHE B 2 79  ? 99.625  34.308 79.653  1.00 18.37 ? 293  PHE H CD2 1 
ATOM   2262 C CE1 . PHE B 2 79  ? 97.343  34.914 78.151  1.00 21.10 ? 293  PHE H CE1 1 
ATOM   2263 C CE2 . PHE B 2 79  ? 99.201  35.641 79.525  1.00 19.44 ? 293  PHE H CE2 1 
ATOM   2264 C CZ  . PHE B 2 79  ? 98.060  35.954 78.776  1.00 21.21 ? 293  PHE H CZ  1 
ATOM   2265 N N   . LEU B 2 80  ? 101.901 29.571 78.955  1.00 17.61 ? 294  LEU H N   1 
ATOM   2266 C CA  . LEU B 2 80  ? 102.209 28.166 79.188  1.00 15.96 ? 294  LEU H CA  1 
ATOM   2267 C C   . LEU B 2 80  ? 101.858 27.861 80.642  1.00 15.91 ? 294  LEU H C   1 
ATOM   2268 O O   . LEU B 2 80  ? 102.148 28.653 81.527  1.00 15.86 ? 294  LEU H O   1 
ATOM   2269 C CB  . LEU B 2 80  ? 103.715 27.836 78.970  1.00 16.56 ? 294  LEU H CB  1 
ATOM   2270 C CG  . LEU B 2 80  ? 104.119 26.380 79.361  1.00 17.15 ? 294  LEU H CG  1 
ATOM   2271 C CD1 . LEU B 2 80  ? 105.191 25.860 78.409  1.00 14.70 ? 294  LEU H CD1 1 
ATOM   2272 C CD2 . LEU B 2 80  ? 104.646 26.316 80.844  1.00 17.09 ? 294  LEU H CD2 1 
ATOM   2273 N N   . LYS B 2 81  ? 101.185 26.752 80.896  1.00 15.34 ? 295  LYS H N   1 
ATOM   2274 C CA  . LYS B 2 81  ? 100.986 26.373 82.264  1.00 16.65 ? 295  LYS H CA  1 
ATOM   2275 C C   . LYS B 2 81  ? 101.219 24.889 82.303  1.00 17.60 ? 295  LYS H C   1 
ATOM   2276 O O   . LYS B 2 81  ? 100.701 24.163 81.445  1.00 18.68 ? 295  LYS H O   1 
ATOM   2277 C CB  . LYS B 2 81  ? 99.577  26.725 82.818  1.00 17.56 ? 295  LYS H CB  1 
ATOM   2278 C CG  . LYS B 2 81  ? 99.474  26.273 84.296  1.00 16.94 ? 295  LYS H CG  1 
ATOM   2279 C CD  . LYS B 2 81  ? 98.329  26.911 85.042  1.00 20.19 ? 295  LYS H CD  1 
ATOM   2280 C CE  . LYS B 2 81  ? 98.273  26.425 86.515  1.00 19.26 ? 295  LYS H CE  1 
ATOM   2281 N NZ  . LYS B 2 81  ? 97.029  26.975 87.119  1.00 21.28 ? 295  LYS H NZ  1 
ATOM   2282 N N   . MET B 2 82  ? 102.031 24.406 83.246  1.00 17.41 ? 296  MET H N   1 
ATOM   2283 C CA  . MET B 2 82  ? 102.230 22.961 83.331  1.00 19.87 ? 296  MET H CA  1 
ATOM   2284 C C   . MET B 2 82  ? 101.968 22.482 84.770  1.00 20.69 ? 296  MET H C   1 
ATOM   2285 O O   . MET B 2 82  ? 102.528 23.026 85.729  1.00 20.19 ? 296  MET H O   1 
ATOM   2286 C CB  . MET B 2 82  ? 103.642 22.590 82.881  1.00 20.85 ? 296  MET H CB  1 
ATOM   2287 C CG  . MET B 2 82  ? 103.839 21.173 82.346  1.00 25.99 ? 296  MET H CG  1 
ATOM   2288 S SD  . MET B 2 82  ? 105.539 20.995 81.548  1.00 32.76 ? 296  MET H SD  1 
ATOM   2289 C CE  . MET B 2 82  ? 106.321 20.191 82.918  1.00 29.87 ? 296  MET H CE  1 
ATOM   2290 N N   . ASN B 2 83  ? 101.134 21.455 84.909  1.00 20.24 ? 297  ASN H N   1 
ATOM   2291 C CA  . ASN B 2 83  ? 100.802 20.911 86.248  1.00 19.48 ? 297  ASN H CA  1 
ATOM   2292 C C   . ASN B 2 83  ? 101.963 20.057 86.773  1.00 18.65 ? 297  ASN H C   1 
ATOM   2293 O O   . ASN B 2 83  ? 102.720 19.449 85.998  1.00 16.34 ? 297  ASN H O   1 
ATOM   2294 C CB  . ASN B 2 83  ? 99.620  19.903 86.244  1.00 19.56 ? 297  ASN H CB  1 
ATOM   2295 C CG  . ASN B 2 83  ? 98.416  20.343 85.456  1.00 19.31 ? 297  ASN H CG  1 
ATOM   2296 O OD1 . ASN B 2 83  ? 98.064  21.526 85.415  1.00 17.64 ? 297  ASN H OD1 1 
ATOM   2297 N ND2 . ASN B 2 83  ? 97.726  19.342 84.841  1.00 20.18 ? 297  ASN H ND2 1 
ATOM   2298 N N   . SER B 2 84  ? 101.970 19.938 88.103  1.00 19.63 ? 298  SER H N   1 
ATOM   2299 C CA  . SER B 2 84  ? 102.887 19.144 88.902  1.00 21.05 ? 298  SER H CA  1 
ATOM   2300 C C   . SER B 2 84  ? 104.261 18.800 88.369  1.00 20.01 ? 298  SER H C   1 
ATOM   2301 O O   . SER B 2 84  ? 104.540 17.664 87.936  1.00 16.77 ? 298  SER H O   1 
ATOM   2302 C CB  . SER B 2 84  ? 102.197 17.851 89.387  1.00 24.40 ? 298  SER H CB  1 
ATOM   2303 O OG  . SER B 2 84  ? 101.404 17.323 88.368  1.00 27.14 ? 298  SER H OG  1 
ATOM   2304 N N   . LEU B 2 85  ? 105.121 19.810 88.428  1.00 19.95 ? 299  LEU H N   1 
ATOM   2305 C CA  . LEU B 2 85  ? 106.488 19.647 88.012  1.00 20.63 ? 299  LEU H CA  1 
ATOM   2306 C C   . LEU B 2 85  ? 107.235 18.695 88.974  1.00 22.39 ? 299  LEU H C   1 
ATOM   2307 O O   . LEU B 2 85  ? 106.878 18.547 90.162  1.00 22.13 ? 299  LEU H O   1 
ATOM   2308 C CB  . LEU B 2 85  ? 107.178 21.025 87.941  1.00 20.52 ? 299  LEU H CB  1 
ATOM   2309 C CG  . LEU B 2 85  ? 106.980 21.643 86.531  1.00 22.47 ? 299  LEU H CG  1 
ATOM   2310 C CD1 . LEU B 2 85  ? 105.542 22.147 86.460  1.00 22.76 ? 299  LEU H CD1 1 
ATOM   2311 C CD2 . LEU B 2 85  ? 107.988 22.766 86.237  1.00 21.38 ? 299  LEU H CD2 1 
ATOM   2312 N N   . GLN B 2 86  ? 108.209 17.984 88.424  1.00 21.92 ? 300  GLN H N   1 
ATOM   2313 C CA  . GLN B 2 86  ? 109.053 17.147 89.226  1.00 24.31 ? 300  GLN H CA  1 
ATOM   2314 C C   . GLN B 2 86  ? 110.466 17.627 88.834  1.00 24.63 ? 300  GLN H C   1 
ATOM   2315 O O   . GLN B 2 86  ? 110.649 18.474 87.922  1.00 21.00 ? 300  GLN H O   1 
ATOM   2316 C CB  . GLN B 2 86  ? 108.834 15.665 88.940  1.00 23.40 ? 300  GLN H CB  1 
ATOM   2317 C CG  . GLN B 2 86  ? 107.401 15.229 89.198  1.00 26.98 ? 300  GLN H CG  1 
ATOM   2318 C CD  . GLN B 2 86  ? 106.902 15.500 90.623  1.00 28.43 ? 300  GLN H CD  1 
ATOM   2319 O OE1 . GLN B 2 86  ? 105.685 15.665 90.862  1.00 29.85 ? 300  GLN H OE1 1 
ATOM   2320 N NE2 . GLN B 2 86  ? 107.810 15.541 91.558  1.00 27.45 ? 300  GLN H NE2 1 
ATOM   2321 N N   . THR B 2 87  ? 111.458 17.112 89.554  1.00 25.54 ? 301  THR H N   1 
ATOM   2322 C CA  . THR B 2 87  ? 112.832 17.525 89.348  1.00 25.93 ? 301  THR H CA  1 
ATOM   2323 C C   . THR B 2 87  ? 113.248 17.406 87.866  1.00 25.54 ? 301  THR H C   1 
ATOM   2324 O O   . THR B 2 87  ? 113.926 18.294 87.324  1.00 25.15 ? 301  THR H O   1 
ATOM   2325 C CB  . THR B 2 87  ? 113.752 16.726 90.317  1.00 27.25 ? 301  THR H CB  1 
ATOM   2326 O OG1 . THR B 2 87  ? 113.694 15.344 90.003  1.00 30.77 ? 301  THR H OG1 1 
ATOM   2327 C CG2 . THR B 2 87  ? 113.224 16.831 91.755  1.00 28.06 ? 301  THR H CG2 1 
ATOM   2328 N N   . ASP B 2 88  ? 112.796 16.361 87.180  1.00 25.89 ? 302  ASP H N   1 
ATOM   2329 C CA  . ASP B 2 88  ? 113.181 16.229 85.774  1.00 25.73 ? 302  ASP H CA  1 
ATOM   2330 C C   . ASP B 2 88  ? 112.530 17.219 84.786  1.00 23.68 ? 302  ASP H C   1 
ATOM   2331 O O   . ASP B 2 88  ? 112.765 17.129 83.579  1.00 21.24 ? 302  ASP H O   1 
ATOM   2332 C CB  . ASP B 2 88  ? 113.039 14.795 85.288  1.00 29.64 ? 302  ASP H CB  1 
ATOM   2333 C CG  . ASP B 2 88  ? 111.621 14.239 85.438  1.00 35.47 ? 302  ASP H CG  1 
ATOM   2334 O OD1 . ASP B 2 88  ? 111.432 13.077 84.998  1.00 38.65 ? 302  ASP H OD1 1 
ATOM   2335 O OD2 . ASP B 2 88  ? 110.710 14.925 85.981  1.00 37.11 ? 302  ASP H OD2 1 
ATOM   2336 N N   . ASP B 2 89  ? 111.725 18.158 85.294  1.00 20.22 ? 303  ASP H N   1 
ATOM   2337 C CA  . ASP B 2 89  ? 111.149 19.208 84.452  1.00 18.16 ? 303  ASP H CA  1 
ATOM   2338 C C   . ASP B 2 89  ? 112.043 20.455 84.556  1.00 17.77 ? 303  ASP H C   1 
ATOM   2339 O O   . ASP B 2 89  ? 111.756 21.542 84.003  1.00 17.42 ? 303  ASP H O   1 
ATOM   2340 C CB  . ASP B 2 89  ? 109.741 19.525 84.907  1.00 18.30 ? 303  ASP H CB  1 
ATOM   2341 C CG  . ASP B 2 89  ? 108.778 18.366 84.614  1.00 20.83 ? 303  ASP H CG  1 
ATOM   2342 O OD1 . ASP B 2 89  ? 108.689 17.984 83.407  1.00 18.92 ? 303  ASP H OD1 1 
ATOM   2343 O OD2 . ASP B 2 89  ? 108.151 17.856 85.589  1.00 18.26 ? 303  ASP H OD2 1 
ATOM   2344 N N   . THR B 2 90  ? 113.136 20.306 85.290  1.00 18.07 ? 304  THR H N   1 
ATOM   2345 C CA  . THR B 2 90  ? 114.083 21.414 85.427  1.00 17.93 ? 304  THR H CA  1 
ATOM   2346 C C   . THR B 2 90  ? 114.665 21.644 84.026  1.00 17.36 ? 304  THR H C   1 
ATOM   2347 O O   . THR B 2 90  ? 115.164 20.705 83.425  1.00 17.97 ? 304  THR H O   1 
ATOM   2348 C CB  . THR B 2 90  ? 115.216 21.029 86.438  1.00 18.81 ? 304  THR H CB  1 
ATOM   2349 O OG1 . THR B 2 90  ? 114.667 21.037 87.772  1.00 17.18 ? 304  THR H OG1 1 
ATOM   2350 C CG2 . THR B 2 90  ? 116.464 22.015 86.322  1.00 16.54 ? 304  THR H CG2 1 
ATOM   2351 N N   . ALA B 2 91  ? 114.620 22.878 83.506  1.00 15.80 ? 305  ALA H N   1 
ATOM   2352 C CA  . ALA B 2 91  ? 115.129 23.092 82.171  1.00 15.08 ? 305  ALA H CA  1 
ATOM   2353 C C   . ALA B 2 91  ? 115.003 24.548 81.819  1.00 16.16 ? 305  ALA H C   1 
ATOM   2354 O O   . ALA B 2 91  ? 114.411 25.328 82.575  1.00 16.22 ? 305  ALA H O   1 
ATOM   2355 C CB  . ALA B 2 91  ? 114.271 22.238 81.134  1.00 15.63 ? 305  ALA H CB  1 
ATOM   2356 N N   . ARG B 2 92  ? 115.577 24.926 80.684  1.00 15.42 ? 306  ARG H N   1 
ATOM   2357 C CA  . ARG B 2 92  ? 115.383 26.274 80.218  1.00 17.33 ? 306  ARG H CA  1 
ATOM   2358 C C   . ARG B 2 92  ? 114.212 26.079 79.227  1.00 17.46 ? 306  ARG H C   1 
ATOM   2359 O O   . ARG B 2 92  ? 114.229 25.140 78.380  1.00 16.01 ? 306  ARG H O   1 
ATOM   2360 C CB  . ARG B 2 92  ? 116.630 26.836 79.505  1.00 20.93 ? 306  ARG H CB  1 
ATOM   2361 C CG  . ARG B 2 92  ? 116.379 28.234 78.878  1.00 25.24 ? 306  ARG H CG  1 
ATOM   2362 C CD  . ARG B 2 92  ? 117.625 28.975 78.385  1.00 29.76 ? 306  ARG H CD  1 
ATOM   2363 N NE  . ARG B 2 92  ? 118.172 29.699 79.511  1.00 36.22 ? 306  ARG H NE  1 
ATOM   2364 C CZ  . ARG B 2 92  ? 118.132 31.019 79.673  1.00 37.64 ? 306  ARG H CZ  1 
ATOM   2365 N NH1 . ARG B 2 92  ? 117.582 31.820 78.767  1.00 39.29 ? 306  ARG H NH1 1 
ATOM   2366 N NH2 . ARG B 2 92  ? 118.617 31.533 80.783  1.00 37.81 ? 306  ARG H NH2 1 
ATOM   2367 N N   . TYR B 2 93  ? 113.199 26.944 79.361  1.00 15.16 ? 307  TYR H N   1 
ATOM   2368 C CA  . TYR B 2 93  ? 111.976 26.916 78.547  1.00 14.95 ? 307  TYR H CA  1 
ATOM   2369 C C   . TYR B 2 93  ? 111.963 28.083 77.563  1.00 15.07 ? 307  TYR H C   1 
ATOM   2370 O O   . TYR B 2 93  ? 112.110 29.250 77.992  1.00 15.74 ? 307  TYR H O   1 
ATOM   2371 C CB  . TYR B 2 93  ? 110.736 27.037 79.455  1.00 12.65 ? 307  TYR H CB  1 
ATOM   2372 C CG  . TYR B 2 93  ? 110.447 25.777 80.222  1.00 14.78 ? 307  TYR H CG  1 
ATOM   2373 C CD1 . TYR B 2 93  ? 111.324 25.329 81.228  1.00 14.20 ? 307  TYR H CD1 1 
ATOM   2374 C CD2 . TYR B 2 93  ? 109.336 24.963 79.895  1.00 15.04 ? 307  TYR H CD2 1 
ATOM   2375 C CE1 . TYR B 2 93  ? 111.113 24.124 81.892  1.00 12.86 ? 307  TYR H CE1 1 
ATOM   2376 C CE2 . TYR B 2 93  ? 109.132 23.729 80.537  1.00 14.73 ? 307  TYR H CE2 1 
ATOM   2377 C CZ  . TYR B 2 93  ? 110.027 23.315 81.552  1.00 15.49 ? 307  TYR H CZ  1 
ATOM   2378 O OH  . TYR B 2 93  ? 109.812 22.113 82.238  1.00 12.33 ? 307  TYR H OH  1 
ATOM   2379 N N   . TYR B 2 94  ? 111.761 27.785 76.278  1.00 13.55 ? 308  TYR H N   1 
ATOM   2380 C CA  . TYR B 2 94  ? 111.726 28.809 75.228  1.00 13.89 ? 308  TYR H CA  1 
ATOM   2381 C C   . TYR B 2 94  ? 110.341 28.856 74.555  1.00 14.25 ? 308  TYR H C   1 
ATOM   2382 O O   . TYR B 2 94  ? 109.741 27.787 74.348  1.00 12.52 ? 308  TYR H O   1 
ATOM   2383 C CB  . TYR B 2 94  ? 112.667 28.451 74.079  1.00 13.26 ? 308  TYR H CB  1 
ATOM   2384 C CG  . TYR B 2 94  ? 114.115 28.205 74.417  1.00 16.51 ? 308  TYR H CG  1 
ATOM   2385 C CD1 . TYR B 2 94  ? 115.075 29.240 74.315  1.00 16.11 ? 308  TYR H CD1 1 
ATOM   2386 C CD2 . TYR B 2 94  ? 114.526 26.933 74.833  1.00 16.33 ? 308  TYR H CD2 1 
ATOM   2387 C CE1 . TYR B 2 94  ? 116.411 29.009 74.622  1.00 19.00 ? 308  TYR H CE1 1 
ATOM   2388 C CE2 . TYR B 2 94  ? 115.856 26.679 75.145  1.00 18.04 ? 308  TYR H CE2 1 
ATOM   2389 C CZ  . TYR B 2 94  ? 116.785 27.715 75.036  1.00 19.04 ? 308  TYR H CZ  1 
ATOM   2390 O OH  . TYR B 2 94  ? 118.074 27.425 75.326  1.00 22.63 ? 308  TYR H OH  1 
ATOM   2391 N N   . CYS B 2 95  ? 109.881 30.055 74.183  1.00 14.20 ? 309  CYS H N   1 
ATOM   2392 C CA  . CYS B 2 95  ? 108.676 30.169 73.364  1.00 16.62 ? 309  CYS H CA  1 
ATOM   2393 C C   . CYS B 2 95  ? 109.299 30.542 71.980  1.00 16.92 ? 309  CYS H C   1 
ATOM   2394 O O   . CYS B 2 95  ? 110.281 31.297 71.881  1.00 17.37 ? 309  CYS H O   1 
ATOM   2395 C CB  . CYS B 2 95  ? 107.671 31.200 73.844  1.00 19.50 ? 309  CYS H CB  1 
ATOM   2396 S SG  . CYS B 2 95  ? 108.244 32.908 74.017  1.00 22.96 ? 309  CYS H SG  1 
ATOM   2397 N N   . VAL B 2 96  ? 108.751 29.958 70.928  1.00 15.87 ? 310  VAL H N   1 
ATOM   2398 C CA  . VAL B 2 96  ? 109.324 30.084 69.594  1.00 16.00 ? 310  VAL H CA  1 
ATOM   2399 C C   . VAL B 2 96  ? 108.173 30.207 68.655  1.00 15.52 ? 310  VAL H C   1 
ATOM   2400 O O   . VAL B 2 96  ? 107.159 29.513 68.790  1.00 14.54 ? 310  VAL H O   1 
ATOM   2401 C CB  . VAL B 2 96  ? 110.069 28.785 69.232  1.00 16.64 ? 310  VAL H CB  1 
ATOM   2402 C CG1 . VAL B 2 96  ? 110.854 28.930 67.875  1.00 11.55 ? 310  VAL H CG1 1 
ATOM   2403 C CG2 . VAL B 2 96  ? 110.959 28.395 70.405  1.00 17.64 ? 310  VAL H CG2 1 
ATOM   2404 N N   . ARG B 2 97  ? 108.336 31.043 67.654  1.00 13.87 ? 311  ARG H N   1 
ATOM   2405 C CA  . ARG B 2 97  ? 107.230 31.221 66.718  1.00 12.42 ? 311  ARG H CA  1 
ATOM   2406 C C   . ARG B 2 97  ? 107.325 30.169 65.601  1.00 12.22 ? 311  ARG H C   1 
ATOM   2407 O O   . ARG B 2 97  ? 108.420 29.664 65.347  1.00 11.66 ? 311  ARG H O   1 
ATOM   2408 C CB  . ARG B 2 97  ? 107.369 32.580 66.073  1.00 11.11 ? 311  ARG H CB  1 
ATOM   2409 C CG  . ARG B 2 97  ? 106.169 32.963 65.193  1.00 12.84 ? 311  ARG H CG  1 
ATOM   2410 C CD  . ARG B 2 97  ? 106.417 34.270 64.408  1.00 11.73 ? 311  ARG H CD  1 
ATOM   2411 N NE  . ARG B 2 97  ? 107.174 34.049 63.159  1.00 12.12 ? 311  ARG H NE  1 
ATOM   2412 C CZ  . ARG B 2 97  ? 107.218 34.957 62.177  1.00 14.84 ? 311  ARG H CZ  1 
ATOM   2413 N NH1 . ARG B 2 97  ? 106.547 36.124 62.324  1.00 13.32 ? 311  ARG H NH1 1 
ATOM   2414 N NH2 . ARG B 2 97  ? 107.929 34.725 61.075  1.00 14.74 ? 311  ARG H NH2 1 
ATOM   2415 N N   . ASP B 2 98  ? 106.201 29.807 64.970  1.00 10.43 ? 312  ASP H N   1 
ATOM   2416 C CA  . ASP B 2 98  ? 106.270 28.950 63.759  1.00 11.53 ? 312  ASP H CA  1 
ATOM   2417 C C   . ASP B 2 98  ? 105.168 29.507 62.857  1.00 10.93 ? 312  ASP H C   1 
ATOM   2418 O O   . ASP B 2 98  ? 104.166 30.006 63.375  1.00 11.04 ? 312  ASP H O   1 
ATOM   2419 C CB  . ASP B 2 98  ? 106.102 27.431 64.035  1.00 10.96 ? 312  ASP H CB  1 
ATOM   2420 C CG  . ASP B 2 98  ? 104.658 26.993 64.205  1.00 12.18 ? 312  ASP H CG  1 
ATOM   2421 O OD1 . ASP B 2 98  ? 104.191 26.885 65.349  1.00 12.36 ? 312  ASP H OD1 1 
ATOM   2422 O OD2 . ASP B 2 98  ? 103.984 26.730 63.187  1.00 12.56 ? 312  ASP H OD2 1 
ATOM   2423 N N   . PRO B 2 99  ? 105.331 29.437 61.516  1.00 11.73 ? 313  PRO H N   1 
ATOM   2424 C CA  . PRO B 2 99  ? 104.318 29.965 60.574  1.00 12.86 ? 313  PRO H CA  1 
ATOM   2425 C C   . PRO B 2 99  ? 102.936 29.329 60.691  1.00 14.41 ? 313  PRO H C   1 
ATOM   2426 O O   . PRO B 2 99  ? 101.951 29.963 60.278  1.00 15.05 ? 313  PRO H O   1 
ATOM   2427 C CB  . PRO B 2 99  ? 104.914 29.710 59.161  1.00 12.94 ? 313  PRO H CB  1 
ATOM   2428 C CG  . PRO B 2 99  ? 106.354 29.518 59.363  1.00 12.87 ? 313  PRO H CG  1 
ATOM   2429 C CD  . PRO B 2 99  ? 106.479 28.875 60.781  1.00 11.56 ? 313  PRO H CD  1 
ATOM   2430 N N   . ALA B 2 100 ? 102.852 28.090 61.200  1.00 13.16 ? 314  ALA H N   1 
ATOM   2431 C CA  . ALA B 2 100 ? 101.529 27.416 61.373  1.00 13.77 ? 314  ALA H CA  1 
ATOM   2432 C C   . ALA B 2 100 ? 100.743 27.555 60.075  1.00 13.53 ? 314  ALA H C   1 
ATOM   2433 O O   . ALA B 2 100 ? 99.559  27.906 60.096  1.00 15.73 ? 314  ALA H O   1 
ATOM   2434 C CB  . ALA B 2 100 ? 100.719 28.092 62.518  1.00 12.67 ? 314  ALA H CB  1 
ATOM   2435 N N   . ASP B 2 101 ? 101.416 27.310 58.959  1.00 12.99 ? 315  ASP H N   1 
ATOM   2436 C CA  . ASP B 2 101 ? 100.822 27.476 57.618  1.00 13.23 ? 315  ASP H CA  1 
ATOM   2437 C C   . ASP B 2 101 ? 100.574 26.079 57.043  1.00 12.26 ? 315  ASP H C   1 
ATOM   2438 O O   . ASP B 2 101 ? 101.464 25.498 56.440  1.00 13.00 ? 315  ASP H O   1 
ATOM   2439 C CB  . ASP B 2 101 ? 101.851 28.258 56.797  1.00 13.48 ? 315  ASP H CB  1 
ATOM   2440 C CG  . ASP B 2 101 ? 101.493 28.383 55.327  1.00 15.11 ? 315  ASP H CG  1 
ATOM   2441 O OD1 . ASP B 2 101 ? 100.421 27.911 54.915  1.00 15.99 ? 315  ASP H OD1 1 
ATOM   2442 O OD2 . ASP B 2 101 ? 102.315 28.943 54.598  1.00 14.63 ? 315  ASP H OD2 1 
ATOM   2443 N N   . TYR B 2 102 ? 99.400  25.511 57.274  1.00 13.21 ? 316  TYR H N   1 
ATOM   2444 C CA  . TYR B 2 102 ? 99.161  24.162 56.770  1.00 14.60 ? 316  TYR H CA  1 
ATOM   2445 C C   . TYR B 2 102 ? 99.058  24.145 55.226  1.00 15.86 ? 316  TYR H C   1 
ATOM   2446 O O   . TYR B 2 102 ? 99.329  23.119 54.623  1.00 14.93 ? 316  TYR H O   1 
ATOM   2447 C CB  . TYR B 2 102 ? 97.906  23.516 57.440  1.00 14.03 ? 316  TYR H CB  1 
ATOM   2448 C CG  . TYR B 2 102 ? 96.546  24.009 56.989  1.00 15.36 ? 316  TYR H CG  1 
ATOM   2449 C CD1 . TYR B 2 102 ? 95.970  23.531 55.795  1.00 14.43 ? 316  TYR H CD1 1 
ATOM   2450 C CD2 . TYR B 2 102 ? 95.809  24.923 57.772  1.00 14.29 ? 316  TYR H CD2 1 
ATOM   2451 C CE1 . TYR B 2 102 ? 94.700  23.938 55.383  1.00 14.55 ? 316  TYR H CE1 1 
ATOM   2452 C CE2 . TYR B 2 102 ? 94.524  25.337 57.380  1.00 14.79 ? 316  TYR H CE2 1 
ATOM   2453 C CZ  . TYR B 2 102 ? 93.983  24.824 56.170  1.00 15.59 ? 316  TYR H CZ  1 
ATOM   2454 O OH  . TYR B 2 102 ? 92.733  25.183 55.796  1.00 15.08 ? 316  TYR H OH  1 
ATOM   2455 N N   . GLY B 2 103 ? 98.729  25.294 54.607  1.00 15.55 ? 317  GLY H N   1 
ATOM   2456 C CA  . GLY B 2 103 ? 98.612  25.342 53.145  1.00 15.65 ? 317  GLY H CA  1 
ATOM   2457 C C   . GLY B 2 103 ? 99.925  24.970 52.473  1.00 16.16 ? 317  GLY H C   1 
ATOM   2458 O O   . GLY B 2 103 ? 99.944  24.344 51.414  1.00 15.50 ? 317  GLY H O   1 
ATOM   2459 N N   . ASN B 2 104 ? 101.016 25.342 53.130  1.00 15.70 ? 318  ASN H N   1 
ATOM   2460 C CA  . ASN B 2 104 ? 102.365 25.071 52.676  1.00 15.16 ? 318  ASN H CA  1 
ATOM   2461 C C   . ASN B 2 104 ? 103.097 24.053 53.575  1.00 14.92 ? 318  ASN H C   1 
ATOM   2462 O O   . ASN B 2 104 ? 104.320 23.868 53.432  1.00 15.45 ? 318  ASN H O   1 
ATOM   2463 C CB  . ASN B 2 104 ? 103.130 26.408 52.617  1.00 15.19 ? 318  ASN H CB  1 
ATOM   2464 C CG  . ASN B 2 104 ? 102.574 27.301 51.524  1.00 18.52 ? 318  ASN H CG  1 
ATOM   2465 O OD1 . ASN B 2 104 ? 102.516 26.893 50.357  1.00 17.66 ? 318  ASN H OD1 1 
ATOM   2466 N ND2 . ASN B 2 104 ? 102.126 28.486 51.888  1.00 18.03 ? 318  ASN H ND2 1 
ATOM   2467 N N   . TYR B 2 105 ? 102.362 23.399 54.482  1.00 12.25 ? 319  TYR H N   1 
ATOM   2468 C CA  . TYR B 2 105 ? 102.974 22.431 55.415  1.00 13.99 ? 319  TYR H CA  1 
ATOM   2469 C C   . TYR B 2 105 ? 104.292 23.033 55.936  1.00 14.52 ? 319  TYR H C   1 
ATOM   2470 O O   . TYR B 2 105 ? 105.349 22.395 55.872  1.00 16.27 ? 319  TYR H O   1 
ATOM   2471 C CB  . TYR B 2 105 ? 103.287 21.104 54.692  1.00 12.45 ? 319  TYR H CB  1 
ATOM   2472 C CG  . TYR B 2 105 ? 103.496 19.934 55.685  1.00 11.51 ? 319  TYR H CG  1 
ATOM   2473 C CD1 . TYR B 2 105 ? 104.757 19.388 55.887  1.00 10.86 ? 319  TYR H CD1 1 
ATOM   2474 C CD2 . TYR B 2 105 ? 102.423 19.423 56.418  1.00 9.03  ? 319  TYR H CD2 1 
ATOM   2475 C CE1 . TYR B 2 105 ? 104.941 18.348 56.839  1.00 13.09 ? 319  TYR H CE1 1 
ATOM   2476 C CE2 . TYR B 2 105 ? 102.588 18.405 57.351  1.00 12.33 ? 319  TYR H CE2 1 
ATOM   2477 C CZ  . TYR B 2 105 ? 103.840 17.881 57.561  1.00 10.36 ? 319  TYR H CZ  1 
ATOM   2478 O OH  . TYR B 2 105 ? 104.013 16.902 58.528  1.00 14.42 ? 319  TYR H OH  1 
ATOM   2479 N N   . ASP B 2 106 ? 104.226 24.269 56.436  1.00 13.75 ? 320  ASP H N   1 
ATOM   2480 C CA  . ASP B 2 106 ? 105.428 24.990 56.890  1.00 14.08 ? 320  ASP H CA  1 
ATOM   2481 C C   . ASP B 2 106 ? 105.256 25.290 58.368  1.00 12.82 ? 320  ASP H C   1 
ATOM   2482 O O   . ASP B 2 106 ? 104.392 26.081 58.722  1.00 12.63 ? 320  ASP H O   1 
ATOM   2483 C CB  . ASP B 2 106 ? 105.517 26.300 56.077  1.00 16.04 ? 320  ASP H CB  1 
ATOM   2484 C CG  . ASP B 2 106 ? 106.661 27.194 56.524  1.00 17.80 ? 320  ASP H CG  1 
ATOM   2485 O OD1 . ASP B 2 106 ? 106.623 28.389 56.173  1.00 16.26 ? 320  ASP H OD1 1 
ATOM   2486 O OD2 . ASP B 2 106 ? 107.582 26.707 57.209  1.00 17.66 ? 320  ASP H OD2 1 
ATOM   2487 N N   . TYR B 2 107 ? 106.077 24.662 59.221  1.00 11.22 ? 321  TYR H N   1 
ATOM   2488 C CA  . TYR B 2 107 ? 105.955 24.784 60.674  1.00 12.21 ? 321  TYR H CA  1 
ATOM   2489 C C   . TYR B 2 107 ? 107.316 24.986 61.337  1.00 12.26 ? 321  TYR H C   1 
ATOM   2490 O O   . TYR B 2 107 ? 107.493 24.660 62.528  1.00 11.88 ? 321  TYR H O   1 
ATOM   2491 C CB  . TYR B 2 107 ? 105.307 23.487 61.254  1.00 12.76 ? 321  TYR H CB  1 
ATOM   2492 C CG  . TYR B 2 107 ? 104.030 23.086 60.547  1.00 12.43 ? 321  TYR H CG  1 
ATOM   2493 C CD1 . TYR B 2 107 ? 103.899 21.817 59.959  1.00 12.49 ? 321  TYR H CD1 1 
ATOM   2494 C CD2 . TYR B 2 107 ? 102.941 23.965 60.481  1.00 13.74 ? 321  TYR H CD2 1 
ATOM   2495 C CE1 . TYR B 2 107 ? 102.708 21.423 59.323  1.00 11.96 ? 321  TYR H CE1 1 
ATOM   2496 C CE2 . TYR B 2 107 ? 101.731 23.593 59.841  1.00 13.77 ? 321  TYR H CE2 1 
ATOM   2497 C CZ  . TYR B 2 107 ? 101.614 22.316 59.260  1.00 13.40 ? 321  TYR H CZ  1 
ATOM   2498 O OH  . TYR B 2 107 ? 100.419 21.963 58.614  1.00 14.52 ? 321  TYR H OH  1 
ATOM   2499 N N   . ALA B 2 108 ? 108.272 25.514 60.579  1.00 10.65 ? 322  ALA H N   1 
ATOM   2500 C CA  . ALA B 2 108 ? 109.627 25.757 61.106  1.00 11.36 ? 322  ALA H CA  1 
ATOM   2501 C C   . ALA B 2 108 ? 109.618 26.657 62.413  1.00 11.69 ? 322  ALA H C   1 
ATOM   2502 O O   . ALA B 2 108 ? 108.799 27.539 62.507  1.00 11.22 ? 322  ALA H O   1 
ATOM   2503 C CB  . ALA B 2 108 ? 110.461 26.454 60.014  1.00 10.03 ? 322  ALA H CB  1 
ATOM   2504 N N   . LEU B 2 109 ? 110.500 26.397 63.386  1.00 10.37 ? 323  LEU H N   1 
ATOM   2505 C CA  . LEU B 2 109 ? 110.589 27.178 64.633  1.00 12.65 ? 323  LEU H CA  1 
ATOM   2506 C C   . LEU B 2 109 ? 111.504 28.361 64.185  1.00 13.33 ? 323  LEU H C   1 
ATOM   2507 O O   . LEU B 2 109 ? 112.734 28.336 64.377  1.00 13.21 ? 323  LEU H O   1 
ATOM   2508 C CB  . LEU B 2 109 ? 111.246 26.279 65.692  1.00 13.66 ? 323  LEU H CB  1 
ATOM   2509 C CG  . LEU B 2 109 ? 110.411 24.970 65.874  1.00 15.82 ? 323  LEU H CG  1 
ATOM   2510 C CD1 . LEU B 2 109 ? 111.132 23.901 66.732  1.00 15.56 ? 323  LEU H CD1 1 
ATOM   2511 C CD2 . LEU B 2 109 ? 109.078 25.354 66.558  1.00 16.72 ? 323  LEU H CD2 1 
ATOM   2512 N N   . ASP B 2 110 ? 110.884 29.374 63.558  1.00 13.12 ? 324  ASP H N   1 
ATOM   2513 C CA  . ASP B 2 110 ? 111.674 30.440 62.910  1.00 14.12 ? 324  ASP H CA  1 
ATOM   2514 C C   . ASP B 2 110 ? 112.254 31.592 63.737  1.00 14.35 ? 324  ASP H C   1 
ATOM   2515 O O   . ASP B 2 110 ? 113.278 32.174 63.343  1.00 14.69 ? 324  ASP H O   1 
ATOM   2516 C CB  . ASP B 2 110 ? 110.914 30.950 61.635  1.00 15.33 ? 324  ASP H CB  1 
ATOM   2517 C CG  . ASP B 2 110 ? 109.540 31.634 61.948  1.00 15.31 ? 324  ASP H CG  1 
ATOM   2518 O OD1 . ASP B 2 110 ? 109.087 31.764 63.127  1.00 14.44 ? 324  ASP H OD1 1 
ATOM   2519 O OD2 . ASP B 2 110 ? 108.882 32.063 60.967  1.00 17.28 ? 324  ASP H OD2 1 
ATOM   2520 N N   . TYR B 2 111 ? 111.678 31.884 64.900  1.00 13.87 ? 325  TYR H N   1 
ATOM   2521 C CA  . TYR B 2 111 ? 112.223 32.967 65.751  1.00 14.68 ? 325  TYR H CA  1 
ATOM   2522 C C   . TYR B 2 111 ? 112.041 32.501 67.171  1.00 15.07 ? 325  TYR H C   1 
ATOM   2523 O O   . TYR B 2 111 ? 110.934 32.149 67.593  1.00 14.41 ? 325  TYR H O   1 
ATOM   2524 C CB  . TYR B 2 111 ? 111.500 34.315 65.490  1.00 15.13 ? 325  TYR H CB  1 
ATOM   2525 C CG  . TYR B 2 111 ? 111.901 34.842 64.142  1.00 16.01 ? 325  TYR H CG  1 
ATOM   2526 C CD1 . TYR B 2 111 ? 111.047 34.761 63.031  1.00 16.56 ? 325  TYR H CD1 1 
ATOM   2527 C CD2 . TYR B 2 111 ? 113.195 35.299 63.948  1.00 20.30 ? 325  TYR H CD2 1 
ATOM   2528 C CE1 . TYR B 2 111 ? 111.492 35.122 61.738  1.00 17.92 ? 325  TYR H CE1 1 
ATOM   2529 C CE2 . TYR B 2 111 ? 113.663 35.657 62.694  1.00 19.85 ? 325  TYR H CE2 1 
ATOM   2530 C CZ  . TYR B 2 111 ? 112.807 35.566 61.581  1.00 20.80 ? 325  TYR H CZ  1 
ATOM   2531 O OH  . TYR B 2 111 ? 113.337 35.898 60.346  1.00 19.58 ? 325  TYR H OH  1 
ATOM   2532 N N   . TRP B 2 112 ? 113.150 32.460 67.894  1.00 15.65 ? 326  TRP H N   1 
ATOM   2533 C CA  . TRP B 2 112 ? 113.165 31.963 69.257  1.00 14.42 ? 326  TRP H CA  1 
ATOM   2534 C C   . TRP B 2 112 ? 113.334 33.040 70.354  1.00 16.65 ? 326  TRP H C   1 
ATOM   2535 O O   . TRP B 2 112 ? 114.060 34.026 70.170  1.00 13.19 ? 326  TRP H O   1 
ATOM   2536 C CB  . TRP B 2 112 ? 114.321 31.000 69.430  1.00 14.94 ? 326  TRP H CB  1 
ATOM   2537 C CG  . TRP B 2 112 ? 114.253 29.780 68.643  1.00 15.02 ? 326  TRP H CG  1 
ATOM   2538 C CD1 . TRP B 2 112 ? 114.133 29.678 67.276  1.00 14.40 ? 326  TRP H CD1 1 
ATOM   2539 C CD2 . TRP B 2 112 ? 114.273 28.445 69.150  1.00 13.60 ? 326  TRP H CD2 1 
ATOM   2540 N NE1 . TRP B 2 112 ? 114.073 28.356 66.908  1.00 13.99 ? 326  TRP H NE1 1 
ATOM   2541 C CE2 . TRP B 2 112 ? 114.159 27.576 68.043  1.00 15.04 ? 326  TRP H CE2 1 
ATOM   2542 C CE3 . TRP B 2 112 ? 114.376 27.898 70.438  1.00 14.85 ? 326  TRP H CE3 1 
ATOM   2543 C CZ2 . TRP B 2 112 ? 114.139 26.183 68.182  1.00 13.48 ? 326  TRP H CZ2 1 
ATOM   2544 C CZ3 . TRP B 2 112 ? 114.357 26.508 70.583  1.00 13.36 ? 326  TRP H CZ3 1 
ATOM   2545 C CH2 . TRP B 2 112 ? 114.235 25.666 69.451  1.00 12.61 ? 326  TRP H CH2 1 
ATOM   2546 N N   . GLY B 2 113 ? 112.661 32.838 71.487  1.00 15.25 ? 327  GLY H N   1 
ATOM   2547 C CA  . GLY B 2 113 ? 112.893 33.742 72.614  1.00 17.16 ? 327  GLY H CA  1 
ATOM   2548 C C   . GLY B 2 113 ? 114.259 33.346 73.213  1.00 18.48 ? 327  GLY H C   1 
ATOM   2549 O O   . GLY B 2 113 ? 114.832 32.280 72.878  1.00 17.11 ? 327  GLY H O   1 
ATOM   2550 N N   . GLN B 2 114 ? 114.808 34.180 74.097  1.00 18.47 ? 328  GLN H N   1 
ATOM   2551 C CA  . GLN B 2 114 ? 116.087 33.866 74.717  1.00 19.33 ? 328  GLN H CA  1 
ATOM   2552 C C   . GLN B 2 114 ? 115.934 32.708 75.735  1.00 18.97 ? 328  GLN H C   1 
ATOM   2553 O O   . GLN B 2 114 ? 116.924 32.104 76.155  1.00 18.20 ? 328  GLN H O   1 
ATOM   2554 C CB  . GLN B 2 114 ? 116.624 35.087 75.482  1.00 22.10 ? 328  GLN H CB  1 
ATOM   2555 C CG  . GLN B 2 114 ? 115.707 35.402 76.651  1.00 26.47 ? 328  GLN H CG  1 
ATOM   2556 C CD  . GLN B 2 114 ? 116.042 36.690 77.395  1.00 29.77 ? 328  GLN H CD  1 
ATOM   2557 O OE1 . GLN B 2 114 ? 115.260 37.128 78.263  1.00 30.58 ? 328  GLN H OE1 1 
ATOM   2558 N NE2 . GLN B 2 114 ? 117.191 37.296 77.082  1.00 27.57 ? 328  GLN H NE2 1 
ATOM   2559 N N   . GLY B 2 115 ? 114.712 32.438 76.180  1.00 17.88 ? 329  GLY H N   1 
ATOM   2560 C CA  . GLY B 2 115 ? 114.519 31.360 77.131  1.00 19.18 ? 329  GLY H CA  1 
ATOM   2561 C C   . GLY B 2 115 ? 114.502 31.773 78.596  1.00 21.41 ? 329  GLY H C   1 
ATOM   2562 O O   . GLY B 2 115 ? 115.098 32.801 78.926  1.00 21.54 ? 329  GLY H O   1 
ATOM   2563 N N   . THR B 2 116 ? 113.778 31.033 79.454  1.00 20.84 ? 330  THR H N   1 
ATOM   2564 C CA  . THR B 2 116 ? 113.774 31.322 80.900  1.00 20.94 ? 330  THR H CA  1 
ATOM   2565 C C   . THR B 2 116 ? 114.102 30.031 81.644  1.00 20.79 ? 330  THR H C   1 
ATOM   2566 O O   . THR B 2 116 ? 113.513 28.979 81.393  1.00 18.60 ? 330  THR H O   1 
ATOM   2567 C CB  . THR B 2 116 ? 112.435 31.892 81.464  1.00 21.60 ? 330  THR H CB  1 
ATOM   2568 O OG1 . THR B 2 116 ? 112.596 32.169 82.873  1.00 22.32 ? 330  THR H OG1 1 
ATOM   2569 C CG2 . THR B 2 116 ? 111.263 30.870 81.307  1.00 22.44 ? 330  THR H CG2 1 
ATOM   2570 N N   . SER B 2 117 ? 115.055 30.127 82.562  1.00 18.94 ? 331  SER H N   1 
ATOM   2571 C CA  . SER B 2 117 ? 115.495 28.975 83.312  1.00 20.40 ? 331  SER H CA  1 
ATOM   2572 C C   . SER B 2 117 ? 114.551 28.645 84.471  1.00 19.61 ? 331  SER H C   1 
ATOM   2573 O O   . SER B 2 117 ? 114.156 29.521 85.245  1.00 18.72 ? 331  SER H O   1 
ATOM   2574 C CB  . SER B 2 117 ? 116.938 29.208 83.793  1.00 23.14 ? 331  SER H CB  1 
ATOM   2575 O OG  . SER B 2 117 ? 117.204 28.473 84.977  1.00 29.36 ? 331  SER H OG  1 
ATOM   2576 N N   . VAL B 2 118 ? 114.166 27.371 84.538  1.00 18.91 ? 332  VAL H N   1 
ATOM   2577 C CA  . VAL B 2 118 ? 113.257 26.863 85.563  1.00 18.33 ? 332  VAL H CA  1 
ATOM   2578 C C   . VAL B 2 118 ? 113.927 25.742 86.337  1.00 18.67 ? 332  VAL H C   1 
ATOM   2579 O O   . VAL B 2 118 ? 114.409 24.746 85.740  1.00 18.52 ? 332  VAL H O   1 
ATOM   2580 C CB  . VAL B 2 118 ? 111.956 26.275 84.931  1.00 18.68 ? 332  VAL H CB  1 
ATOM   2581 C CG1 . VAL B 2 118 ? 111.036 25.697 86.027  1.00 17.73 ? 332  VAL H CG1 1 
ATOM   2582 C CG2 . VAL B 2 118 ? 111.206 27.376 84.176  1.00 15.51 ? 332  VAL H CG2 1 
ATOM   2583 N N   . THR B 2 119 ? 113.941 25.882 87.664  1.00 18.03 ? 333  THR H N   1 
ATOM   2584 C CA  . THR B 2 119 ? 114.551 24.876 88.529  1.00 19.09 ? 333  THR H CA  1 
ATOM   2585 C C   . THR B 2 119 ? 113.471 24.282 89.403  1.00 17.88 ? 333  THR H C   1 
ATOM   2586 O O   . THR B 2 119 ? 112.737 25.011 90.019  1.00 18.29 ? 333  THR H O   1 
ATOM   2587 C CB  . THR B 2 119 ? 115.622 25.522 89.413  1.00 20.31 ? 333  THR H CB  1 
ATOM   2588 O OG1 . THR B 2 119 ? 116.536 26.194 88.548  1.00 21.17 ? 333  THR H OG1 1 
ATOM   2589 C CG2 . THR B 2 119 ? 116.380 24.465 90.257  1.00 21.21 ? 333  THR H CG2 1 
ATOM   2590 N N   . VAL B 2 120 ? 113.380 22.964 89.469  1.00 17.98 ? 334  VAL H N   1 
ATOM   2591 C CA  . VAL B 2 120 ? 112.332 22.391 90.288  1.00 19.46 ? 334  VAL H CA  1 
ATOM   2592 C C   . VAL B 2 120 ? 113.030 21.768 91.477  1.00 20.00 ? 334  VAL H C   1 
ATOM   2593 O O   . VAL B 2 120 ? 113.813 20.822 91.341  1.00 20.39 ? 334  VAL H O   1 
ATOM   2594 C CB  . VAL B 2 120 ? 111.512 21.336 89.527  1.00 20.32 ? 334  VAL H CB  1 
ATOM   2595 C CG1 . VAL B 2 120 ? 110.387 20.796 90.465  1.00 18.93 ? 334  VAL H CG1 1 
ATOM   2596 C CG2 . VAL B 2 120 ? 110.921 21.996 88.220  1.00 18.87 ? 334  VAL H CG2 1 
ATOM   2597 N N   . SER B 2 121 ? 112.732 22.317 92.645  1.00 19.56 ? 335  SER H N   1 
ATOM   2598 C CA  . SER B 2 121 ? 113.409 21.860 93.843  1.00 20.66 ? 335  SER H CA  1 
ATOM   2599 C C   . SER B 2 121 ? 112.695 22.350 95.087  1.00 21.06 ? 335  SER H C   1 
ATOM   2600 O O   . SER B 2 121 ? 112.008 23.379 95.078  1.00 21.51 ? 335  SER H O   1 
ATOM   2601 C CB  . SER B 2 121 ? 114.884 22.406 93.839  1.00 20.77 ? 335  SER H CB  1 
ATOM   2602 O OG  . SER B 2 121 ? 115.481 22.316 95.122  1.00 18.62 ? 335  SER H OG  1 
ATOM   2603 N N   . SER B 2 122 ? 112.910 21.624 96.173  1.00 23.56 ? 336  SER H N   1 
ATOM   2604 C CA  . SER B 2 122 ? 112.325 21.959 97.460  1.00 26.12 ? 336  SER H CA  1 
ATOM   2605 C C   . SER B 2 122 ? 113.373 22.656 98.334  1.00 25.92 ? 336  SER H C   1 
ATOM   2606 O O   . SER B 2 122 ? 113.088 22.996 99.487  1.00 25.80 ? 336  SER H O   1 
ATOM   2607 C CB  . SER B 2 122 ? 111.859 20.681 98.158  1.00 28.14 ? 336  SER H CB  1 
ATOM   2608 O OG  . SER B 2 122 ? 112.965 19.784 98.226  1.00 33.20 ? 336  SER H OG  1 
ATOM   2609 N N   . ALA B 2 123 ? 114.564 22.882 97.791  1.00 25.61 ? 337  ALA H N   1 
ATOM   2610 C CA  . ALA B 2 123 ? 115.632 23.569 98.542  1.00 27.74 ? 337  ALA H CA  1 
ATOM   2611 C C   . ALA B 2 123 ? 115.267 24.975 98.969  1.00 29.02 ? 337  ALA H C   1 
ATOM   2612 O O   . ALA B 2 123 ? 114.543 25.658 98.291  1.00 28.39 ? 337  ALA H O   1 
ATOM   2613 C CB  . ALA B 2 123 ? 116.956 23.604 97.712  1.00 28.15 ? 337  ALA H CB  1 
ATOM   2614 N N   . LYS B 2 124 ? 115.775 25.408 100.122 1.00 32.04 ? 338  LYS H N   1 
ATOM   2615 C CA  . LYS B 2 124 ? 115.520 26.767 100.604 1.00 33.20 ? 338  LYS H CA  1 
ATOM   2616 C C   . LYS B 2 124 ? 116.648 27.674 100.087 1.00 32.09 ? 338  LYS H C   1 
ATOM   2617 O O   . LYS B 2 124 ? 117.742 27.189 99.856  1.00 31.13 ? 338  LYS H O   1 
ATOM   2618 C CB  . LYS B 2 124 ? 115.555 26.749 102.133 1.00 36.76 ? 338  LYS H CB  1 
ATOM   2619 C CG  . LYS B 2 124 ? 114.385 27.392 102.790 1.00 42.16 ? 338  LYS H CG  1 
ATOM   2620 C CD  . LYS B 2 124 ? 113.701 26.418 103.749 1.00 45.94 ? 338  LYS H CD  1 
ATOM   2621 C CE  . LYS B 2 124 ? 112.878 27.174 104.801 1.00 48.49 ? 338  LYS H CE  1 
ATOM   2622 N NZ  . LYS B 2 124 ? 112.158 26.254 105.733 1.00 51.01 ? 338  LYS H NZ  1 
ATOM   2623 N N   . THR B 2 125 ? 116.395 28.971 99.912  1.00 31.37 ? 339  THR H N   1 
ATOM   2624 C CA  . THR B 2 125 ? 117.445 29.898 99.482  1.00 31.65 ? 339  THR H CA  1 
ATOM   2625 C C   . THR B 2 125 ? 118.583 29.730 100.508 1.00 31.76 ? 339  THR H C   1 
ATOM   2626 O O   . THR B 2 125 ? 118.363 29.815 101.716 1.00 31.46 ? 339  THR H O   1 
ATOM   2627 C CB  . THR B 2 125 ? 116.924 31.356 99.491  1.00 32.49 ? 339  THR H CB  1 
ATOM   2628 O OG1 . THR B 2 125 ? 115.831 31.447 98.581  1.00 34.31 ? 339  THR H OG1 1 
ATOM   2629 C CG2 . THR B 2 125 ? 118.004 32.370 99.051  1.00 32.31 ? 339  THR H CG2 1 
ATOM   2630 N N   . THR B 2 126 ? 119.789 29.457 100.043 1.00 30.35 ? 340  THR H N   1 
ATOM   2631 C CA  . THR B 2 126 ? 120.905 29.229 100.954 1.00 30.41 ? 340  THR H CA  1 
ATOM   2632 C C   . THR B 2 126 ? 122.147 29.912 100.366 1.00 30.80 ? 340  THR H C   1 
ATOM   2633 O O   . THR B 2 126 ? 122.534 29.632 99.217  1.00 29.89 ? 340  THR H O   1 
ATOM   2634 C CB  . THR B 2 126 ? 121.174 27.704 101.111 1.00 30.62 ? 340  THR H CB  1 
ATOM   2635 O OG1 . THR B 2 126 ? 119.960 27.041 101.445 1.00 30.26 ? 340  THR H OG1 1 
ATOM   2636 C CG2 . THR B 2 126 ? 122.202 27.427 102.184 1.00 30.67 ? 340  THR H CG2 1 
ATOM   2637 N N   . PRO B 2 127 ? 122.774 30.837 101.135 1.00 30.70 ? 341  PRO H N   1 
ATOM   2638 C CA  . PRO B 2 127 ? 123.977 31.535 100.632 1.00 29.68 ? 341  PRO H CA  1 
ATOM   2639 C C   . PRO B 2 127 ? 125.149 30.563 100.581 1.00 27.52 ? 341  PRO H C   1 
ATOM   2640 O O   . PRO B 2 127 ? 125.164 29.544 101.284 1.00 26.51 ? 341  PRO H O   1 
ATOM   2641 C CB  . PRO B 2 127 ? 124.210 32.644 101.663 1.00 31.59 ? 341  PRO H CB  1 
ATOM   2642 C CG  . PRO B 2 127 ? 123.691 31.985 102.977 1.00 32.21 ? 341  PRO H CG  1 
ATOM   2643 C CD  . PRO B 2 127 ? 122.401 31.295 102.492 1.00 31.13 ? 341  PRO H CD  1 
ATOM   2644 N N   . PRO B 2 128 ? 126.131 30.841 99.718  1.00 25.51 ? 342  PRO H N   1 
ATOM   2645 C CA  . PRO B 2 128 ? 127.269 29.919 99.664  1.00 24.48 ? 342  PRO H CA  1 
ATOM   2646 C C   . PRO B 2 128 ? 128.271 30.140 100.798 1.00 23.24 ? 342  PRO H C   1 
ATOM   2647 O O   . PRO B 2 128 ? 128.423 31.252 101.288 1.00 20.52 ? 342  PRO H O   1 
ATOM   2648 C CB  . PRO B 2 128 ? 127.926 30.263 98.340  1.00 25.61 ? 342  PRO H CB  1 
ATOM   2649 C CG  . PRO B 2 128 ? 127.668 31.782 98.229  1.00 24.56 ? 342  PRO H CG  1 
ATOM   2650 C CD  . PRO B 2 128 ? 126.206 31.862 98.657  1.00 25.47 ? 342  PRO H CD  1 
ATOM   2651 N N   . SER B 2 129 ? 128.945 29.068 101.190 1.00 22.75 ? 343  SER H N   1 
ATOM   2652 C CA  . SER B 2 129 ? 130.069 29.183 102.118 1.00 23.43 ? 343  SER H CA  1 
ATOM   2653 C C   . SER B 2 129 ? 131.229 29.359 101.110 1.00 23.30 ? 343  SER H C   1 
ATOM   2654 O O   . SER B 2 129 ? 131.365 28.555 100.200 1.00 23.22 ? 343  SER H O   1 
ATOM   2655 C CB  . SER B 2 129 ? 130.269 27.896 102.899 1.00 23.24 ? 343  SER H CB  1 
ATOM   2656 O OG  . SER B 2 129 ? 129.167 27.693 103.760 1.00 23.46 ? 343  SER H OG  1 
ATOM   2657 N N   . VAL B 2 130 ? 132.047 30.405 101.259 1.00 22.90 ? 344  VAL H N   1 
ATOM   2658 C CA  . VAL B 2 130 ? 133.145 30.682 100.351 1.00 20.92 ? 344  VAL H CA  1 
ATOM   2659 C C   . VAL B 2 130 ? 134.483 30.390 101.019 1.00 22.56 ? 344  VAL H C   1 
ATOM   2660 O O   . VAL B 2 130 ? 134.800 30.994 102.033 1.00 22.71 ? 344  VAL H O   1 
ATOM   2661 C CB  . VAL B 2 130 ? 133.098 32.167 99.918  1.00 20.74 ? 344  VAL H CB  1 
ATOM   2662 C CG1 . VAL B 2 130 ? 134.291 32.501 98.998  1.00 19.92 ? 344  VAL H CG1 1 
ATOM   2663 C CG2 . VAL B 2 130 ? 131.752 32.474 99.234  1.00 19.00 ? 344  VAL H CG2 1 
ATOM   2664 N N   . TYR B 2 131 ? 135.285 29.488 100.460 1.00 20.83 ? 345  TYR H N   1 
ATOM   2665 C CA  . TYR B 2 131 ? 136.556 29.158 101.069 1.00 20.48 ? 345  TYR H CA  1 
ATOM   2666 C C   . TYR B 2 131 ? 137.729 29.498 100.148 1.00 21.37 ? 345  TYR H C   1 
ATOM   2667 O O   . TYR B 2 131 ? 137.688 29.228 98.956  1.00 19.74 ? 345  TYR H O   1 
ATOM   2668 C CB  . TYR B 2 131 ? 136.623 27.669 101.406 1.00 21.79 ? 345  TYR H CB  1 
ATOM   2669 C CG  . TYR B 2 131 ? 135.465 27.160 102.223 1.00 24.33 ? 345  TYR H CG  1 
ATOM   2670 C CD1 . TYR B 2 131 ? 134.597 26.202 101.715 1.00 26.10 ? 345  TYR H CD1 1 
ATOM   2671 C CD2 . TYR B 2 131 ? 135.244 27.634 103.517 1.00 25.01 ? 345  TYR H CD2 1 
ATOM   2672 C CE1 . TYR B 2 131 ? 133.522 25.715 102.482 1.00 27.77 ? 345  TYR H CE1 1 
ATOM   2673 C CE2 . TYR B 2 131 ? 134.189 27.158 104.288 1.00 26.41 ? 345  TYR H CE2 1 
ATOM   2674 C CZ  . TYR B 2 131 ? 133.336 26.202 103.778 1.00 26.89 ? 345  TYR H CZ  1 
ATOM   2675 O OH  . TYR B 2 131 ? 132.333 25.705 104.577 1.00 25.43 ? 345  TYR H OH  1 
ATOM   2676 N N   . PRO B 2 132 ? 138.784 30.107 100.703 1.00 21.60 ? 346  PRO H N   1 
ATOM   2677 C CA  . PRO B 2 132 ? 139.996 30.501 99.959  1.00 22.03 ? 346  PRO H CA  1 
ATOM   2678 C C   . PRO B 2 132 ? 140.864 29.268 99.734  1.00 22.94 ? 346  PRO H C   1 
ATOM   2679 O O   . PRO B 2 132 ? 141.017 28.471 100.645 1.00 24.94 ? 346  PRO H O   1 
ATOM   2680 C CB  . PRO B 2 132 ? 140.657 31.539 100.879 1.00 21.40 ? 346  PRO H CB  1 
ATOM   2681 C CG  . PRO B 2 132 ? 140.235 31.081 102.280 1.00 22.83 ? 346  PRO H CG  1 
ATOM   2682 C CD  . PRO B 2 132 ? 138.793 30.609 102.093 1.00 22.07 ? 346  PRO H CD  1 
ATOM   2683 N N   . LEU B 2 133 ? 141.409 29.096 98.532  1.00 21.79 ? 347  LEU H N   1 
ATOM   2684 C CA  . LEU B 2 133 ? 142.258 27.935 98.208  1.00 22.64 ? 347  LEU H CA  1 
ATOM   2685 C C   . LEU B 2 133 ? 143.729 28.380 97.997  1.00 22.86 ? 347  LEU H C   1 
ATOM   2686 O O   . LEU B 2 133 ? 144.096 28.890 96.932  1.00 20.23 ? 347  LEU H O   1 
ATOM   2687 C CB  . LEU B 2 133 ? 141.745 27.235 96.923  1.00 22.95 ? 347  LEU H CB  1 
ATOM   2688 C CG  . LEU B 2 133 ? 140.274 26.775 96.995  1.00 24.51 ? 347  LEU H CG  1 
ATOM   2689 C CD1 . LEU B 2 133 ? 139.888 26.020 95.710  1.00 26.25 ? 347  LEU H CD1 1 
ATOM   2690 C CD2 . LEU B 2 133 ? 140.064 25.888 98.191  1.00 24.14 ? 347  LEU H CD2 1 
ATOM   2691 N N   . ALA B 2 134 ? 144.563 28.245 99.022  1.00 24.81 ? 348  ALA H N   1 
ATOM   2692 C CA  . ALA B 2 134 ? 145.970 28.633 98.856  1.00 26.57 ? 348  ALA H CA  1 
ATOM   2693 C C   . ALA B 2 134 ? 146.769 27.353 98.652  1.00 27.48 ? 348  ALA H C   1 
ATOM   2694 O O   . ALA B 2 134 ? 146.359 26.266 99.088  1.00 28.03 ? 348  ALA H O   1 
ATOM   2695 C CB  . ALA B 2 134 ? 146.475 29.386 100.093 1.00 27.53 ? 348  ALA H CB  1 
ATOM   2696 N N   . PRO B 2 135 ? 147.891 27.445 97.955  1.00 28.88 ? 349  PRO H N   1 
ATOM   2697 C CA  . PRO B 2 135 ? 148.664 26.215 97.771  1.00 31.59 ? 349  PRO H CA  1 
ATOM   2698 C C   . PRO B 2 135 ? 149.078 25.582 99.116  1.00 33.95 ? 349  PRO H C   1 
ATOM   2699 O O   . PRO B 2 135 ? 149.180 26.262 100.141 1.00 33.42 ? 349  PRO H O   1 
ATOM   2700 C CB  . PRO B 2 135 ? 149.861 26.684 96.916  1.00 31.24 ? 349  PRO H CB  1 
ATOM   2701 C CG  . PRO B 2 135 ? 149.904 28.225 97.136  1.00 31.43 ? 349  PRO H CG  1 
ATOM   2702 C CD  . PRO B 2 135 ? 148.453 28.578 97.185  1.00 29.04 ? 349  PRO H CD  1 
ATOM   2703 N N   . GLY B 2 136 ? 149.276 24.272 99.117  1.00 37.48 ? 350  GLY H N   1 
ATOM   2704 C CA  . GLY B 2 136 ? 149.705 23.621 100.342 1.00 41.84 ? 350  GLY H CA  1 
ATOM   2705 C C   . GLY B 2 136 ? 151.140 24.073 100.608 1.00 45.37 ? 350  GLY H C   1 
ATOM   2706 O O   . GLY B 2 136 ? 151.764 24.735 99.763  1.00 47.68 ? 350  GLY H O   1 
ATOM   2707 N N   . SER B 2 137 ? 151.694 23.703 101.765 1.00 46.92 ? 351  SER H N   1 
ATOM   2708 C CA  . SER B 2 137 ? 153.060 24.088 102.120 1.00 49.16 ? 351  SER H CA  1 
ATOM   2709 C C   . SER B 2 137 ? 154.174 23.193 101.529 1.00 49.43 ? 351  SER H C   1 
ATOM   2710 O O   . SER B 2 137 ? 155.176 23.750 101.022 1.00 49.50 ? 351  SER H O   1 
ATOM   2711 C CB  . SER B 2 137 ? 153.160 24.162 103.653 1.00 50.14 ? 351  SER H CB  1 
ATOM   2712 O OG  . SER B 2 137 ? 152.433 23.096 104.258 1.00 53.92 ? 351  SER H OG  1 
ATOM   2713 N N   . SER B 2 143 ? 157.890 32.610 87.466  1.00 31.64 ? 357  SER H N   1 
ATOM   2714 C CA  . SER B 2 143 ? 156.881 31.527 87.410  1.00 29.55 ? 357  SER H CA  1 
ATOM   2715 C C   . SER B 2 143 ? 155.503 32.091 87.814  1.00 27.92 ? 357  SER H C   1 
ATOM   2716 O O   . SER B 2 143 ? 155.350 33.283 88.111  1.00 25.91 ? 357  SER H O   1 
ATOM   2717 C CB  . SER B 2 143 ? 157.293 30.321 88.302  1.00 29.42 ? 357  SER H CB  1 
ATOM   2718 O OG  . SER B 2 143 ? 157.239 30.584 89.720  1.00 31.41 ? 357  SER H OG  1 
ATOM   2719 N N   . MET B 2 144 ? 154.497 31.226 87.744  1.00 26.49 ? 358  MET H N   1 
ATOM   2720 C CA  . MET B 2 144 ? 153.137 31.589 88.064  1.00 26.14 ? 358  MET H CA  1 
ATOM   2721 C C   . MET B 2 144 ? 152.644 30.766 89.251  1.00 25.35 ? 358  MET H C   1 
ATOM   2722 O O   . MET B 2 144 ? 153.172 29.678 89.550  1.00 24.42 ? 358  MET H O   1 
ATOM   2723 C CB  . MET B 2 144 ? 152.221 31.290 86.877  1.00 27.52 ? 358  MET H CB  1 
ATOM   2724 C CG  . MET B 2 144 ? 152.660 31.841 85.560  1.00 30.98 ? 358  MET H CG  1 
ATOM   2725 S SD  . MET B 2 144 ? 152.563 33.652 85.602  1.00 38.77 ? 358  MET H SD  1 
ATOM   2726 C CE  . MET B 2 144 ? 150.824 34.028 85.247  1.00 33.99 ? 358  MET H CE  1 
ATOM   2727 N N   . VAL B 2 145 ? 151.618 31.281 89.915  1.00 22.53 ? 359  VAL H N   1 
ATOM   2728 C CA  . VAL B 2 145 ? 151.022 30.552 90.986  1.00 19.81 ? 359  VAL H CA  1 
ATOM   2729 C C   . VAL B 2 145 ? 149.531 30.554 90.687  1.00 18.74 ? 359  VAL H C   1 
ATOM   2730 O O   . VAL B 2 145 ? 148.972 31.548 90.178  1.00 16.91 ? 359  VAL H O   1 
ATOM   2731 C CB  . VAL B 2 145 ? 151.303 31.198 92.376  1.00 21.91 ? 359  VAL H CB  1 
ATOM   2732 C CG1 . VAL B 2 145 ? 150.857 32.683 92.395  1.00 19.06 ? 359  VAL H CG1 1 
ATOM   2733 C CG2 . VAL B 2 145 ? 150.538 30.409 93.469  1.00 21.30 ? 359  VAL H CG2 1 
ATOM   2734 N N   . THR B 2 146 ? 148.886 29.439 90.980  1.00 15.43 ? 360  THR H N   1 
ATOM   2735 C CA  . THR B 2 146 ? 147.446 29.330 90.768  1.00 15.41 ? 360  THR H CA  1 
ATOM   2736 C C   . THR B 2 146 ? 146.820 29.290 92.164  1.00 15.16 ? 360  THR H C   1 
ATOM   2737 O O   . THR B 2 146 ? 147.344 28.608 93.060  1.00 16.60 ? 360  THR H O   1 
ATOM   2738 C CB  . THR B 2 146 ? 147.143 28.058 89.948  1.00 14.65 ? 360  THR H CB  1 
ATOM   2739 O OG1 . THR B 2 146 ? 147.617 28.277 88.608  1.00 13.15 ? 360  THR H OG1 1 
ATOM   2740 C CG2 . THR B 2 146 ? 145.626 27.730 89.915  1.00 12.17 ? 360  THR H CG2 1 
ATOM   2741 N N   . LEU B 2 147 ? 145.758 30.074 92.354  1.00 13.33 ? 361  LEU H N   1 
ATOM   2742 C CA  . LEU B 2 147 ? 145.020 30.179 93.610  1.00 15.23 ? 361  LEU H CA  1 
ATOM   2743 C C   . LEU B 2 147 ? 143.549 29.858 93.279  1.00 15.04 ? 361  LEU H C   1 
ATOM   2744 O O   . LEU B 2 147 ? 143.185 29.866 92.138  1.00 16.88 ? 361  LEU H O   1 
ATOM   2745 C CB  . LEU B 2 147 ? 145.061 31.609 94.124  1.00 14.86 ? 361  LEU H CB  1 
ATOM   2746 C CG  . LEU B 2 147 ? 146.240 32.192 94.930  1.00 21.04 ? 361  LEU H CG  1 
ATOM   2747 C CD1 . LEU B 2 147 ? 147.412 31.246 95.061  1.00 18.55 ? 361  LEU H CD1 1 
ATOM   2748 C CD2 . LEU B 2 147 ? 146.629 33.521 94.299  1.00 19.26 ? 361  LEU H CD2 1 
ATOM   2749 N N   . GLY B 2 148 ? 142.711 29.596 94.269  1.00 15.44 ? 362  GLY H N   1 
ATOM   2750 C CA  . GLY B 2 148 ? 141.306 29.327 93.957  1.00 18.13 ? 362  GLY H CA  1 
ATOM   2751 C C   . GLY B 2 148 ? 140.351 29.706 95.069  1.00 19.54 ? 362  GLY H C   1 
ATOM   2752 O O   . GLY B 2 148 ? 140.799 30.194 96.106  1.00 17.24 ? 362  GLY H O   1 
ATOM   2753 N N   . CYS B 2 149 ? 139.038 29.558 94.812  1.00 20.37 ? 363  CYS H N   1 
ATOM   2754 C CA  . CYS B 2 149 ? 137.996 29.786 95.806  1.00 21.57 ? 363  CYS H CA  1 
ATOM   2755 C C   . CYS B 2 149 ? 136.967 28.696 95.577  1.00 21.50 ? 363  CYS H C   1 
ATOM   2756 O O   . CYS B 2 149 ? 136.538 28.487 94.429  1.00 20.26 ? 363  CYS H O   1 
ATOM   2757 C CB  . CYS B 2 149 ? 137.270 31.158 95.670  1.00 24.55 ? 363  CYS H CB  1 
ATOM   2758 S SG  . CYS B 2 149 ? 138.027 32.390 96.775  1.00 33.37 ? 363  CYS H SG  1 
ATOM   2759 N N   . LEU B 2 150 ? 136.580 28.014 96.653  1.00 20.32 ? 364  LEU H N   1 
ATOM   2760 C CA  . LEU B 2 150 ? 135.567 26.952 96.607  1.00 19.37 ? 364  LEU H CA  1 
ATOM   2761 C C   . LEU B 2 150 ? 134.297 27.651 97.101  1.00 19.44 ? 364  LEU H C   1 
ATOM   2762 O O   . LEU B 2 150 ? 134.308 28.268 98.184  1.00 18.81 ? 364  LEU H O   1 
ATOM   2763 C CB  . LEU B 2 150 ? 135.964 25.801 97.551  1.00 18.23 ? 364  LEU H CB  1 
ATOM   2764 C CG  . LEU B 2 150 ? 134.961 24.638 97.765  1.00 18.65 ? 364  LEU H CG  1 
ATOM   2765 C CD1 . LEU B 2 150 ? 134.695 23.948 96.425  1.00 15.97 ? 364  LEU H CD1 1 
ATOM   2766 C CD2 . LEU B 2 150 ? 135.568 23.573 98.771  1.00 17.18 ? 364  LEU H CD2 1 
ATOM   2767 N N   . VAL B 2 151 ? 133.226 27.593 96.294  1.00 18.22 ? 365  VAL H N   1 
ATOM   2768 C CA  . VAL B 2 151 ? 131.944 28.230 96.596  1.00 19.32 ? 365  VAL H CA  1 
ATOM   2769 C C   . VAL B 2 151 ? 130.977 27.064 96.744  1.00 20.90 ? 365  VAL H C   1 
ATOM   2770 O O   . VAL B 2 151 ? 130.471 26.512 95.756  1.00 20.26 ? 365  VAL H O   1 
ATOM   2771 C CB  . VAL B 2 151 ? 131.509 29.175 95.426  1.00 19.93 ? 365  VAL H CB  1 
ATOM   2772 C CG1 . VAL B 2 151 ? 130.221 29.899 95.774  1.00 20.82 ? 365  VAL H CG1 1 
ATOM   2773 C CG2 . VAL B 2 151 ? 132.614 30.187 95.135  1.00 18.02 ? 365  VAL H CG2 1 
ATOM   2774 N N   . LYS B 2 152 ? 130.664 26.744 97.994  1.00 21.04 ? 366  LYS H N   1 
ATOM   2775 C CA  . LYS B 2 152 ? 129.909 25.567 98.282  1.00 22.43 ? 366  LYS H CA  1 
ATOM   2776 C C   . LYS B 2 152 ? 128.573 25.670 99.035  1.00 22.52 ? 366  LYS H C   1 
ATOM   2777 O O   . LYS B 2 152 ? 128.368 26.561 99.870  1.00 22.85 ? 366  LYS H O   1 
ATOM   2778 C CB  . LYS B 2 152 ? 130.885 24.631 99.027  1.00 24.09 ? 366  LYS H CB  1 
ATOM   2779 C CG  . LYS B 2 152 ? 130.317 23.321 99.510  1.00 25.87 ? 366  LYS H CG  1 
ATOM   2780 C CD  . LYS B 2 152 ? 131.396 22.416 100.074 1.00 28.78 ? 366  LYS H CD  1 
ATOM   2781 C CE  . LYS B 2 152 ? 130.803 21.113 100.647 1.00 31.18 ? 366  LYS H CE  1 
ATOM   2782 N NZ  . LYS B 2 152 ? 130.701 20.086 99.527  1.00 33.76 ? 366  LYS H NZ  1 
ATOM   2783 N N   . GLY B 2 153 ? 127.680 24.732 98.734  1.00 21.37 ? 367  GLY H N   1 
ATOM   2784 C CA  . GLY B 2 153 ? 126.391 24.669 99.403  1.00 20.58 ? 367  GLY H CA  1 
ATOM   2785 C C   . GLY B 2 153 ? 125.380 25.784 99.186  1.00 21.53 ? 367  GLY H C   1 
ATOM   2786 O O   . GLY B 2 153 ? 124.702 26.165 100.140 1.00 21.36 ? 367  GLY H O   1 
ATOM   2787 N N   . TYR B 2 154 ? 125.243 26.325 97.969  1.00 21.08 ? 368  TYR H N   1 
ATOM   2788 C CA  . TYR B 2 154 ? 124.239 27.365 97.795  1.00 20.68 ? 368  TYR H CA  1 
ATOM   2789 C C   . TYR B 2 154 ? 123.033 26.929 96.983  1.00 20.84 ? 368  TYR H C   1 
ATOM   2790 O O   . TYR B 2 154 ? 123.025 25.871 96.336  1.00 17.28 ? 368  TYR H O   1 
ATOM   2791 C CB  . TYR B 2 154 ? 124.794 28.619 97.142  1.00 19.67 ? 368  TYR H CB  1 
ATOM   2792 C CG  . TYR B 2 154 ? 125.340 28.406 95.750  1.00 19.87 ? 368  TYR H CG  1 
ATOM   2793 C CD1 . TYR B 2 154 ? 126.658 27.995 95.551  1.00 19.61 ? 368  TYR H CD1 1 
ATOM   2794 C CD2 . TYR B 2 154 ? 124.545 28.640 94.626  1.00 20.90 ? 368  TYR H CD2 1 
ATOM   2795 C CE1 . TYR B 2 154 ? 127.168 27.828 94.268  1.00 19.97 ? 368  TYR H CE1 1 
ATOM   2796 C CE2 . TYR B 2 154 ? 125.046 28.469 93.317  1.00 19.12 ? 368  TYR H CE2 1 
ATOM   2797 C CZ  . TYR B 2 154 ? 126.347 28.075 93.151  1.00 19.53 ? 368  TYR H CZ  1 
ATOM   2798 O OH  . TYR B 2 154 ? 126.845 27.955 91.885  1.00 17.61 ? 368  TYR H OH  1 
ATOM   2799 N N   . PHE B 2 155 ? 122.008 27.776 97.043  1.00 20.63 ? 369  PHE H N   1 
ATOM   2800 C CA  . PHE B 2 155 ? 120.781 27.550 96.288  1.00 22.73 ? 369  PHE H CA  1 
ATOM   2801 C C   . PHE B 2 155 ? 119.980 28.819 96.304  1.00 22.40 ? 369  PHE H C   1 
ATOM   2802 O O   . PHE B 2 155 ? 119.845 29.453 97.345  1.00 20.98 ? 369  PHE H O   1 
ATOM   2803 C CB  . PHE B 2 155 ? 119.939 26.418 96.874  1.00 22.42 ? 369  PHE H CB  1 
ATOM   2804 C CG  . PHE B 2 155 ? 118.694 26.147 96.080  1.00 23.43 ? 369  PHE H CG  1 
ATOM   2805 C CD1 . PHE B 2 155 ? 118.693 25.188 95.073  1.00 22.91 ? 369  PHE H CD1 1 
ATOM   2806 C CD2 . PHE B 2 155 ? 117.532 26.915 96.288  1.00 23.08 ? 369  PHE H CD2 1 
ATOM   2807 C CE1 . PHE B 2 155 ? 117.542 24.991 94.258  1.00 22.43 ? 369  PHE H CE1 1 
ATOM   2808 C CE2 . PHE B 2 155 ? 116.387 26.723 95.480  1.00 24.34 ? 369  PHE H CE2 1 
ATOM   2809 C CZ  . PHE B 2 155 ? 116.410 25.751 94.462  1.00 23.20 ? 369  PHE H CZ  1 
ATOM   2810 N N   . PRO B 2 156 ? 119.457 29.232 95.140  1.00 23.53 ? 370  PRO H N   1 
ATOM   2811 C CA  . PRO B 2 156 ? 119.594 28.555 93.847  1.00 23.50 ? 370  PRO H CA  1 
ATOM   2812 C C   . PRO B 2 156 ? 120.723 29.218 93.028  1.00 24.08 ? 370  PRO H C   1 
ATOM   2813 O O   . PRO B 2 156 ? 121.418 30.137 93.517  1.00 24.57 ? 370  PRO H O   1 
ATOM   2814 C CB  . PRO B 2 156 ? 118.241 28.810 93.194  1.00 22.69 ? 370  PRO H CB  1 
ATOM   2815 C CG  . PRO B 2 156 ? 118.033 30.301 93.521  1.00 23.60 ? 370  PRO H CG  1 
ATOM   2816 C CD  . PRO B 2 156 ? 118.507 30.369 95.042  1.00 24.26 ? 370  PRO H CD  1 
ATOM   2817 N N   . GLU B 2 157 ? 120.880 28.740 91.792  1.00 22.94 ? 371  GLU H N   1 
ATOM   2818 C CA  . GLU B 2 157 ? 121.827 29.300 90.858  1.00 22.88 ? 371  GLU H CA  1 
ATOM   2819 C C   . GLU B 2 157 ? 121.241 30.689 90.594  1.00 21.82 ? 371  GLU H C   1 
ATOM   2820 O O   . GLU B 2 157 ? 120.033 30.869 90.695  1.00 22.05 ? 371  GLU H O   1 
ATOM   2821 C CB  . GLU B 2 157 ? 121.841 28.452 89.598  1.00 23.69 ? 371  GLU H CB  1 
ATOM   2822 C CG  . GLU B 2 157 ? 122.825 27.288 89.642  1.00 25.70 ? 371  GLU H CG  1 
ATOM   2823 C CD  . GLU B 2 157 ? 124.222 27.736 89.206  1.00 27.82 ? 371  GLU H CD  1 
ATOM   2824 O OE1 . GLU B 2 157 ? 124.883 28.608 89.855  1.00 29.32 ? 371  GLU H OE1 1 
ATOM   2825 O OE2 . GLU B 2 157 ? 124.665 27.226 88.174  1.00 28.74 ? 371  GLU H OE2 1 
ATOM   2826 N N   . PRO B 2 158 ? 122.067 31.679 90.212  1.00 21.83 ? 372  PRO H N   1 
ATOM   2827 C CA  . PRO B 2 158 ? 123.513 31.603 90.020  1.00 21.34 ? 372  PRO H CA  1 
ATOM   2828 C C   . PRO B 2 158 ? 124.263 32.434 91.033  1.00 21.43 ? 372  PRO H C   1 
ATOM   2829 O O   . PRO B 2 158 ? 123.650 33.146 91.862  1.00 20.92 ? 372  PRO H O   1 
ATOM   2830 C CB  . PRO B 2 158 ? 123.673 32.205 88.626  1.00 21.14 ? 372  PRO H CB  1 
ATOM   2831 C CG  . PRO B 2 158 ? 122.773 33.442 88.741  1.00 21.62 ? 372  PRO H CG  1 
ATOM   2832 C CD  . PRO B 2 158 ? 121.548 32.923 89.579  1.00 21.29 ? 372  PRO H CD  1 
ATOM   2833 N N   . VAL B 2 159 ? 125.599 32.326 90.966  1.00 22.33 ? 373  VAL H N   1 
ATOM   2834 C CA  . VAL B 2 159 ? 126.505 33.145 91.764  1.00 21.86 ? 373  VAL H CA  1 
ATOM   2835 C C   . VAL B 2 159 ? 127.397 33.794 90.737  1.00 22.60 ? 373  VAL H C   1 
ATOM   2836 O O   . VAL B 2 159 ? 127.517 33.325 89.606  1.00 23.55 ? 373  VAL H O   1 
ATOM   2837 C CB  . VAL B 2 159 ? 127.446 32.353 92.731  1.00 22.68 ? 373  VAL H CB  1 
ATOM   2838 C CG1 . VAL B 2 159 ? 126.685 31.925 93.970  1.00 22.42 ? 373  VAL H CG1 1 
ATOM   2839 C CG2 . VAL B 2 159 ? 128.065 31.146 92.020  1.00 23.74 ? 373  VAL H CG2 1 
ATOM   2840 N N   . THR B 2 160 ? 128.010 34.885 91.122  1.00 22.37 ? 374  THR H N   1 
ATOM   2841 C CA  . THR B 2 160 ? 128.955 35.546 90.256  1.00 24.03 ? 374  THR H CA  1 
ATOM   2842 C C   . THR B 2 160 ? 130.275 35.544 91.007  1.00 22.27 ? 374  THR H C   1 
ATOM   2843 O O   . THR B 2 160 ? 130.306 35.885 92.213  1.00 21.46 ? 374  THR H O   1 
ATOM   2844 C CB  . THR B 2 160 ? 128.519 36.973 89.955  1.00 27.02 ? 374  THR H CB  1 
ATOM   2845 O OG1 . THR B 2 160 ? 127.325 36.902 89.173  1.00 29.72 ? 374  THR H OG1 1 
ATOM   2846 C CG2 . THR B 2 160 ? 129.595 37.691 89.123  1.00 30.62 ? 374  THR H CG2 1 
ATOM   2847 N N   . VAL B 2 161 ? 131.345 35.112 90.336  1.00 18.98 ? 375  VAL H N   1 
ATOM   2848 C CA  . VAL B 2 161 ? 132.644 35.102 90.978  1.00 17.37 ? 375  VAL H CA  1 
ATOM   2849 C C   . VAL B 2 161 ? 133.597 36.059 90.268  1.00 17.58 ? 375  VAL H C   1 
ATOM   2850 O O   . VAL B 2 161 ? 133.709 35.993 89.055  1.00 16.17 ? 375  VAL H O   1 
ATOM   2851 C CB  . VAL B 2 161 ? 133.310 33.714 90.909  1.00 16.49 ? 375  VAL H CB  1 
ATOM   2852 C CG1 . VAL B 2 161 ? 134.655 33.759 91.658  1.00 16.99 ? 375  VAL H CG1 1 
ATOM   2853 C CG2 . VAL B 2 161 ? 132.369 32.628 91.502  1.00 16.80 ? 375  VAL H CG2 1 
ATOM   2854 N N   . THR B 2 162 ? 134.269 36.941 91.010  1.00 16.90 ? 376  THR H N   1 
ATOM   2855 C CA  . THR B 2 162 ? 135.279 37.810 90.393  1.00 16.88 ? 376  THR H CA  1 
ATOM   2856 C C   . THR B 2 162 ? 136.517 37.742 91.272  1.00 17.48 ? 376  THR H C   1 
ATOM   2857 O O   . THR B 2 162 ? 136.449 37.296 92.449  1.00 17.17 ? 376  THR H O   1 
ATOM   2858 C CB  . THR B 2 162 ? 134.868 39.313 90.289  1.00 18.17 ? 376  THR H CB  1 
ATOM   2859 O OG1 . THR B 2 162 ? 134.554 39.818 91.599  1.00 19.61 ? 376  THR H OG1 1 
ATOM   2860 C CG2 . THR B 2 162 ? 133.705 39.492 89.336  1.00 15.76 ? 376  THR H CG2 1 
ATOM   2861 N N   . TRP B 2 163 ? 137.644 38.178 90.696  1.00 17.94 ? 377  TRP H N   1 
ATOM   2862 C CA  . TRP B 2 163 ? 138.939 38.201 91.381  1.00 17.39 ? 377  TRP H CA  1 
ATOM   2863 C C   . TRP B 2 163 ? 139.432 39.656 91.441  1.00 17.51 ? 377  TRP H C   1 
ATOM   2864 O O   . TRP B 2 163 ? 139.499 40.341 90.418  1.00 15.21 ? 377  TRP H O   1 
ATOM   2865 C CB  . TRP B 2 163 ? 139.934 37.295 90.652  1.00 14.70 ? 377  TRP H CB  1 
ATOM   2866 C CG  . TRP B 2 163 ? 139.620 35.862 90.852  1.00 15.85 ? 377  TRP H CG  1 
ATOM   2867 C CD1 . TRP B 2 163 ? 138.806 35.078 90.064  1.00 15.79 ? 377  TRP H CD1 1 
ATOM   2868 C CD2 . TRP B 2 163 ? 140.039 35.030 91.956  1.00 16.03 ? 377  TRP H CD2 1 
ATOM   2869 N NE1 . TRP B 2 163 ? 138.708 33.822 90.609  1.00 17.03 ? 377  TRP H NE1 1 
ATOM   2870 C CE2 . TRP B 2 163 ? 139.455 33.763 91.766  1.00 17.02 ? 377  TRP H CE2 1 
ATOM   2871 C CE3 . TRP B 2 163 ? 140.863 35.238 93.086  1.00 16.87 ? 377  TRP H CE3 1 
ATOM   2872 C CZ2 . TRP B 2 163 ? 139.673 32.687 92.665  1.00 17.78 ? 377  TRP H CZ2 1 
ATOM   2873 C CZ3 . TRP B 2 163 ? 141.089 34.168 93.982  1.00 16.95 ? 377  TRP H CZ3 1 
ATOM   2874 C CH2 . TRP B 2 163 ? 140.492 32.899 93.759  1.00 18.01 ? 377  TRP H CH2 1 
ATOM   2875 N N   . ASN B 2 164 ? 139.789 40.108 92.641  1.00 18.29 ? 378  ASN H N   1 
ATOM   2876 C CA  . ASN B 2 164 ? 140.216 41.502 92.817  1.00 18.63 ? 378  ASN H CA  1 
ATOM   2877 C C   . ASN B 2 164 ? 139.182 42.468 92.159  1.00 18.28 ? 378  ASN H C   1 
ATOM   2878 O O   . ASN B 2 164 ? 139.545 43.343 91.376  1.00 18.93 ? 378  ASN H O   1 
ATOM   2879 C CB  . ASN B 2 164 ? 141.626 41.720 92.228  1.00 18.72 ? 378  ASN H CB  1 
ATOM   2880 C CG  . ASN B 2 164 ? 142.748 41.239 93.167  1.00 19.90 ? 378  ASN H CG  1 
ATOM   2881 O OD1 . ASN B 2 164 ? 142.491 40.655 94.224  1.00 18.76 ? 378  ASN H OD1 1 
ATOM   2882 N ND2 . ASN B 2 164 ? 143.990 41.480 92.772  1.00 19.11 ? 378  ASN H ND2 1 
ATOM   2883 N N   . SER B 2 165 ? 137.901 42.235 92.439  1.00 19.05 ? 379  SER H N   1 
ATOM   2884 C CA  . SER B 2 165 ? 136.788 43.068 91.954  1.00 22.13 ? 379  SER H CA  1 
ATOM   2885 C C   . SER B 2 165 ? 136.807 43.207 90.458  1.00 22.72 ? 379  SER H C   1 
ATOM   2886 O O   . SER B 2 165 ? 136.396 44.238 89.903  1.00 23.53 ? 379  SER H O   1 
ATOM   2887 C CB  . SER B 2 165 ? 136.830 44.477 92.579  1.00 22.57 ? 379  SER H CB  1 
ATOM   2888 O OG  . SER B 2 165 ? 136.895 44.370 93.990  1.00 24.03 ? 379  SER H OG  1 
ATOM   2889 N N   . GLY B 2 166 ? 137.307 42.171 89.800  1.00 22.13 ? 380  GLY H N   1 
ATOM   2890 C CA  . GLY B 2 166 ? 137.323 42.209 88.359  1.00 22.54 ? 380  GLY H CA  1 
ATOM   2891 C C   . GLY B 2 166 ? 138.618 42.606 87.736  1.00 21.41 ? 380  GLY H C   1 
ATOM   2892 O O   . GLY B 2 166 ? 138.725 42.454 86.551  1.00 22.84 ? 380  GLY H O   1 
ATOM   2893 N N   . SER B 2 167 ? 139.588 43.087 88.506  1.00 21.44 ? 381  SER H N   1 
ATOM   2894 C CA  . SER B 2 167 ? 140.889 43.509 87.957  1.00 20.23 ? 381  SER H CA  1 
ATOM   2895 C C   . SER B 2 167 ? 141.629 42.323 87.346  1.00 18.58 ? 381  SER H C   1 
ATOM   2896 O O   . SER B 2 167 ? 142.401 42.465 86.392  1.00 17.16 ? 381  SER H O   1 
ATOM   2897 C CB  . SER B 2 167 ? 141.766 44.073 89.065  1.00 22.79 ? 381  SER H CB  1 
ATOM   2898 O OG  . SER B 2 167 ? 141.246 45.293 89.502  1.00 29.41 ? 381  SER H OG  1 
ATOM   2899 N N   . LEU B 2 168 ? 141.416 41.158 87.935  1.00 16.14 ? 382  LEU H N   1 
ATOM   2900 C CA  . LEU B 2 168 ? 142.050 39.950 87.426  1.00 17.44 ? 382  LEU H CA  1 
ATOM   2901 C C   . LEU B 2 168 ? 141.043 39.197 86.595  1.00 16.34 ? 382  LEU H C   1 
ATOM   2902 O O   . LEU B 2 168 ? 139.954 38.839 87.076  1.00 17.94 ? 382  LEU H O   1 
ATOM   2903 C CB  . LEU B 2 168 ? 142.507 39.066 88.566  1.00 14.71 ? 382  LEU H CB  1 
ATOM   2904 C CG  . LEU B 2 168 ? 143.801 39.503 89.259  1.00 14.90 ? 382  LEU H CG  1 
ATOM   2905 C CD1 . LEU B 2 168 ? 143.875 38.729 90.571  1.00 11.58 ? 382  LEU H CD1 1 
ATOM   2906 C CD2 . LEU B 2 168 ? 145.039 39.230 88.373  1.00 10.35 ? 382  LEU H CD2 1 
ATOM   2907 N N   . SER B 2 169 ? 141.399 38.941 85.354  1.00 17.76 ? 383  SER H N   1 
ATOM   2908 C CA  . SER B 2 169 ? 140.486 38.208 84.492  1.00 18.21 ? 383  SER H CA  1 
ATOM   2909 C C   . SER B 2 169 ? 141.176 37.325 83.452  1.00 17.80 ? 383  SER H C   1 
ATOM   2910 O O   . SER B 2 169 ? 140.624 36.311 83.107  1.00 18.33 ? 383  SER H O   1 
ATOM   2911 C CB  . SER B 2 169 ? 139.556 39.179 83.741  1.00 18.90 ? 383  SER H CB  1 
ATOM   2912 O OG  . SER B 2 169 ? 140.356 40.067 82.987  1.00 17.84 ? 383  SER H OG  1 
ATOM   2913 N N   . SER B 2 170 ? 142.370 37.674 82.972  1.00 17.47 ? 384  SER H N   1 
ATOM   2914 C CA  . SER B 2 170 ? 142.967 36.859 81.931  1.00 17.57 ? 384  SER H CA  1 
ATOM   2915 C C   . SER B 2 170 ? 143.317 35.437 82.356  1.00 19.25 ? 384  SER H C   1 
ATOM   2916 O O   . SER B 2 170 ? 143.267 34.536 81.525  1.00 18.06 ? 384  SER H O   1 
ATOM   2917 C CB  . SER B 2 170 ? 144.207 37.523 81.349  1.00 18.88 ? 384  SER H CB  1 
ATOM   2918 O OG  . SER B 2 170 ? 145.318 37.429 82.245  1.00 18.94 ? 384  SER H OG  1 
ATOM   2919 N N   . GLY B 2 171 ? 143.684 35.230 83.621  1.00 18.13 ? 385  GLY H N   1 
ATOM   2920 C CA  . GLY B 2 171 ? 144.054 33.889 84.062  1.00 18.53 ? 385  GLY H CA  1 
ATOM   2921 C C   . GLY B 2 171 ? 143.003 33.221 84.931  1.00 17.72 ? 385  GLY H C   1 
ATOM   2922 O O   . GLY B 2 171 ? 143.296 32.292 85.717  1.00 17.73 ? 385  GLY H O   1 
ATOM   2923 N N   . VAL B 2 172 ? 141.763 33.679 84.779  1.00 17.20 ? 386  VAL H N   1 
ATOM   2924 C CA  . VAL B 2 172 ? 140.676 33.164 85.596  1.00 17.50 ? 386  VAL H CA  1 
ATOM   2925 C C   . VAL B 2 172 ? 139.888 32.011 84.927  1.00 18.65 ? 386  VAL H C   1 
ATOM   2926 O O   . VAL B 2 172 ? 139.656 32.053 83.727  1.00 18.94 ? 386  VAL H O   1 
ATOM   2927 C CB  . VAL B 2 172 ? 139.701 34.310 85.946  1.00 16.48 ? 386  VAL H CB  1 
ATOM   2928 C CG1 . VAL B 2 172 ? 138.412 33.735 86.614  1.00 15.72 ? 386  VAL H CG1 1 
ATOM   2929 C CG2 . VAL B 2 172 ? 140.386 35.326 86.918  1.00 15.01 ? 386  VAL H CG2 1 
ATOM   2930 N N   . HIS B 2 173 ? 139.540 30.968 85.680  1.00 18.35 ? 387  HIS H N   1 
ATOM   2931 C CA  . HIS B 2 173 ? 138.693 29.883 85.129  1.00 19.13 ? 387  HIS H CA  1 
ATOM   2932 C C   . HIS B 2 173 ? 137.623 29.697 86.176  1.00 18.05 ? 387  HIS H C   1 
ATOM   2933 O O   . HIS B 2 173 ? 137.971 29.345 87.283  1.00 16.85 ? 387  HIS H O   1 
ATOM   2934 C CB  . HIS B 2 173 ? 139.436 28.513 84.990  1.00 20.19 ? 387  HIS H CB  1 
ATOM   2935 C CG  . HIS B 2 173 ? 140.451 28.490 83.895  1.00 20.18 ? 387  HIS H CG  1 
ATOM   2936 N ND1 . HIS B 2 173 ? 140.117 28.710 82.582  1.00 22.53 ? 387  HIS H ND1 1 
ATOM   2937 C CD2 . HIS B 2 173 ? 141.796 28.351 83.922  1.00 21.65 ? 387  HIS H CD2 1 
ATOM   2938 C CE1 . HIS B 2 173 ? 141.210 28.714 81.840  1.00 21.05 ? 387  HIS H CE1 1 
ATOM   2939 N NE2 . HIS B 2 173 ? 142.246 28.501 82.629  1.00 22.85 ? 387  HIS H NE2 1 
ATOM   2940 N N   . THR B 2 174 ? 136.344 29.926 85.855  1.00 17.52 ? 388  THR H N   1 
ATOM   2941 C CA  . THR B 2 174 ? 135.276 29.689 86.834  1.00 17.40 ? 388  THR H CA  1 
ATOM   2942 C C   . THR B 2 174 ? 134.462 28.516 86.301  1.00 18.20 ? 388  THR H C   1 
ATOM   2943 O O   . THR B 2 174 ? 133.976 28.548 85.181  1.00 16.33 ? 388  THR H O   1 
ATOM   2944 C CB  . THR B 2 174 ? 134.423 30.961 87.058  1.00 16.67 ? 388  THR H CB  1 
ATOM   2945 O OG1 . THR B 2 174 ? 135.260 31.950 87.673  1.00 18.01 ? 388  THR H OG1 1 
ATOM   2946 C CG2 . THR B 2 174 ? 133.238 30.681 87.982  1.00 15.95 ? 388  THR H CG2 1 
ATOM   2947 N N   . PHE B 2 175 ? 134.315 27.478 87.108  1.00 16.16 ? 389  PHE H N   1 
ATOM   2948 C CA  . PHE B 2 175 ? 133.667 26.258 86.618  1.00 17.92 ? 389  PHE H CA  1 
ATOM   2949 C C   . PHE B 2 175 ? 132.135 26.158 86.740  1.00 18.87 ? 389  PHE H C   1 
ATOM   2950 O O   . PHE B 2 175 ? 131.518 26.770 87.645  1.00 18.89 ? 389  PHE H O   1 
ATOM   2951 C CB  . PHE B 2 175 ? 134.359 25.037 87.298  1.00 16.69 ? 389  PHE H CB  1 
ATOM   2952 C CG  . PHE B 2 175 ? 135.831 24.902 86.935  1.00 18.04 ? 389  PHE H CG  1 
ATOM   2953 C CD1 . PHE B 2 175 ? 136.228 24.169 85.820  1.00 18.91 ? 389  PHE H CD1 1 
ATOM   2954 C CD2 . PHE B 2 175 ? 136.802 25.593 87.649  1.00 17.19 ? 389  PHE H CD2 1 
ATOM   2955 C CE1 . PHE B 2 175 ? 137.574 24.129 85.417  1.00 19.11 ? 389  PHE H CE1 1 
ATOM   2956 C CE2 . PHE B 2 175 ? 138.141 25.561 87.251  1.00 18.39 ? 389  PHE H CE2 1 
ATOM   2957 C CZ  . PHE B 2 175 ? 138.523 24.819 86.118  1.00 16.87 ? 389  PHE H CZ  1 
ATOM   2958 N N   . PRO B 2 176 ? 131.480 25.422 85.803  1.00 18.06 ? 390  PRO H N   1 
ATOM   2959 C CA  . PRO B 2 176 ? 130.026 25.329 85.966  1.00 17.94 ? 390  PRO H CA  1 
ATOM   2960 C C   . PRO B 2 176 ? 129.755 24.684 87.316  1.00 17.46 ? 390  PRO H C   1 
ATOM   2961 O O   . PRO B 2 176 ? 130.522 23.845 87.777  1.00 17.84 ? 390  PRO H O   1 
ATOM   2962 C CB  . PRO B 2 176 ? 129.582 24.379 84.844  1.00 18.35 ? 390  PRO H CB  1 
ATOM   2963 C CG  . PRO B 2 176 ? 130.637 24.595 83.761  1.00 17.53 ? 390  PRO H CG  1 
ATOM   2964 C CD  . PRO B 2 176 ? 131.935 24.778 84.558  1.00 18.51 ? 390  PRO H CD  1 
ATOM   2965 N N   . ALA B 2 177 ? 128.634 25.027 87.914  1.00 18.04 ? 391  ALA H N   1 
ATOM   2966 C CA  . ALA B 2 177 ? 128.255 24.481 89.209  1.00 18.75 ? 391  ALA H CA  1 
ATOM   2967 C C   . ALA B 2 177 ? 127.721 23.079 89.027  1.00 19.48 ? 391  ALA H C   1 
ATOM   2968 O O   . ALA B 2 177 ? 127.276 22.754 87.945  1.00 18.58 ? 391  ALA H O   1 
ATOM   2969 C CB  . ALA B 2 177 ? 127.185 25.335 89.811  1.00 18.90 ? 391  ALA H CB  1 
ATOM   2970 N N   . VAL B 2 178 ? 127.789 22.263 90.081  1.00 20.05 ? 392  VAL H N   1 
ATOM   2971 C CA  . VAL B 2 178 ? 127.257 20.909 90.082  1.00 22.96 ? 392  VAL H CA  1 
ATOM   2972 C C   . VAL B 2 178 ? 126.340 20.825 91.288  1.00 25.25 ? 392  VAL H C   1 
ATOM   2973 O O   . VAL B 2 178 ? 126.614 21.403 92.371  1.00 23.37 ? 392  VAL H O   1 
ATOM   2974 C CB  . VAL B 2 178 ? 128.347 19.836 90.204  1.00 23.29 ? 392  VAL H CB  1 
ATOM   2975 C CG1 . VAL B 2 178 ? 129.324 19.978 89.027  1.00 24.94 ? 392  VAL H CG1 1 
ATOM   2976 C CG2 . VAL B 2 178 ? 129.063 19.985 91.508  1.00 25.11 ? 392  VAL H CG2 1 
ATOM   2977 N N   . LEU B 2 179 ? 125.234 20.118 91.092  1.00 28.35 ? 393  LEU H N   1 
ATOM   2978 C CA  . LEU B 2 179 ? 124.225 19.951 92.117  1.00 32.43 ? 393  LEU H CA  1 
ATOM   2979 C C   . LEU B 2 179 ? 124.566 18.734 92.949  1.00 36.97 ? 393  LEU H C   1 
ATOM   2980 O O   . LEU B 2 179 ? 124.505 17.603 92.453  1.00 39.16 ? 393  LEU H O   1 
ATOM   2981 C CB  . LEU B 2 179 ? 122.864 19.797 91.437  1.00 30.81 ? 393  LEU H CB  1 
ATOM   2982 C CG  . LEU B 2 179 ? 121.573 19.819 92.239  1.00 29.10 ? 393  LEU H CG  1 
ATOM   2983 C CD1 . LEU B 2 179 ? 121.434 21.112 93.033  1.00 27.99 ? 393  LEU H CD1 1 
ATOM   2984 C CD2 . LEU B 2 179 ? 120.405 19.661 91.228  1.00 29.90 ? 393  LEU H CD2 1 
ATOM   2985 N N   . GLN B 2 180 ? 124.961 18.975 94.198  1.00 40.54 ? 394  GLN H N   1 
ATOM   2986 C CA  . GLN B 2 180 ? 125.317 17.911 95.127  1.00 44.37 ? 394  GLN H CA  1 
ATOM   2987 C C   . GLN B 2 180 ? 124.096 17.303 95.830  1.00 44.51 ? 394  GLN H C   1 
ATOM   2988 O O   . GLN B 2 180 ? 123.514 16.317 95.384  1.00 45.71 ? 394  GLN H O   1 
ATOM   2989 C CB  . GLN B 2 180 ? 126.266 18.427 96.218  1.00 47.64 ? 394  GLN H CB  1 
ATOM   2990 C CG  . GLN B 2 180 ? 127.664 18.860 95.779  1.00 52.04 ? 394  GLN H CG  1 
ATOM   2991 C CD  . GLN B 2 180 ? 128.655 18.769 96.932  1.00 54.12 ? 394  GLN H CD  1 
ATOM   2992 O OE1 . GLN B 2 180 ? 128.600 17.807 97.714  1.00 56.27 ? 394  GLN H OE1 1 
ATOM   2993 N NE2 . GLN B 2 180 ? 129.568 19.751 97.048  1.00 54.31 ? 394  GLN H NE2 1 
ATOM   2994 N N   . SER B 2 181 ? 123.684 17.896 96.933  1.00 43.51 ? 395  SER H N   1 
ATOM   2995 C CA  . SER B 2 181 ? 122.565 17.306 97.663  1.00 42.25 ? 395  SER H CA  1 
ATOM   2996 C C   . SER B 2 181 ? 121.482 18.365 97.736  1.00 40.17 ? 395  SER H C   1 
ATOM   2997 O O   . SER B 2 181 ? 121.154 18.862 98.812  1.00 39.59 ? 395  SER H O   1 
ATOM   2998 C CB  . SER B 2 181 ? 123.080 16.922 99.056  1.00 43.22 ? 395  SER H CB  1 
ATOM   2999 O OG  . SER B 2 181 ? 122.213 16.024 99.720  1.00 45.89 ? 395  SER H OG  1 
ATOM   3000 N N   . ASP B 2 182 ? 120.928 18.708 96.577  1.00 38.10 ? 396  ASP H N   1 
ATOM   3001 C CA  . ASP B 2 182 ? 119.947 19.784 96.474  1.00 35.56 ? 396  ASP H CA  1 
ATOM   3002 C C   . ASP B 2 182 ? 120.651 21.126 96.574  1.00 31.96 ? 396  ASP H C   1 
ATOM   3003 O O   . ASP B 2 182 ? 120.002 22.171 96.493  1.00 31.25 ? 396  ASP H O   1 
ATOM   3004 C CB  . ASP B 2 182 ? 118.854 19.707 97.550  1.00 38.81 ? 396  ASP H CB  1 
ATOM   3005 C CG  . ASP B 2 182 ? 117.624 18.952 97.067  1.00 42.85 ? 396  ASP H CG  1 
ATOM   3006 O OD1 . ASP B 2 182 ? 116.614 18.889 97.829  1.00 45.81 ? 396  ASP H OD1 1 
ATOM   3007 O OD2 . ASP B 2 182 ? 117.664 18.424 95.922  1.00 44.06 ? 396  ASP H OD2 1 
ATOM   3008 N N   . LEU B 2 183 ? 121.973 21.116 96.756  1.00 28.33 ? 397  LEU H N   1 
ATOM   3009 C CA  . LEU B 2 183 ? 122.692 22.398 96.823  1.00 25.92 ? 397  LEU H CA  1 
ATOM   3010 C C   . LEU B 2 183 ? 123.777 22.454 95.748  1.00 23.15 ? 397  LEU H C   1 
ATOM   3011 O O   . LEU B 2 183 ? 124.307 21.430 95.359  1.00 20.77 ? 397  LEU H O   1 
ATOM   3012 C CB  . LEU B 2 183 ? 123.297 22.635 98.219  1.00 26.26 ? 397  LEU H CB  1 
ATOM   3013 C CG  . LEU B 2 183 ? 122.348 22.765 99.407  1.00 27.41 ? 397  LEU H CG  1 
ATOM   3014 C CD1 . LEU B 2 183 ? 123.175 22.985 100.718 1.00 26.19 ? 397  LEU H CD1 1 
ATOM   3015 C CD2 . LEU B 2 183 ? 121.384 23.926 99.188  1.00 27.94 ? 397  LEU H CD2 1 
ATOM   3016 N N   . TYR B 2 184 ? 124.067 23.651 95.242  1.00 20.76 ? 398  TYR H N   1 
ATOM   3017 C CA  . TYR B 2 184 ? 125.086 23.792 94.204  1.00 19.89 ? 398  TYR H CA  1 
ATOM   3018 C C   . TYR B 2 184 ? 126.464 24.113 94.772  1.00 19.81 ? 398  TYR H C   1 
ATOM   3019 O O   . TYR B 2 184 ? 126.561 24.785 95.830  1.00 19.29 ? 398  TYR H O   1 
ATOM   3020 C CB  . TYR B 2 184 ? 124.734 24.922 93.238  1.00 18.14 ? 398  TYR H CB  1 
ATOM   3021 C CG  . TYR B 2 184 ? 123.469 24.685 92.454  1.00 19.97 ? 398  TYR H CG  1 
ATOM   3022 C CD1 . TYR B 2 184 ? 122.224 25.063 92.968  1.00 21.65 ? 398  TYR H CD1 1 
ATOM   3023 C CD2 . TYR B 2 184 ? 123.509 24.041 91.212  1.00 21.32 ? 398  TYR H CD2 1 
ATOM   3024 C CE1 . TYR B 2 184 ? 121.025 24.802 92.249  1.00 23.93 ? 398  TYR H CE1 1 
ATOM   3025 C CE2 . TYR B 2 184 ? 122.340 23.769 90.481  1.00 22.00 ? 398  TYR H CE2 1 
ATOM   3026 C CZ  . TYR B 2 184 ? 121.100 24.153 91.008  1.00 23.94 ? 398  TYR H CZ  1 
ATOM   3027 O OH  . TYR B 2 184 ? 119.953 23.869 90.323  1.00 24.03 ? 398  TYR H OH  1 
ATOM   3028 N N   . THR B 2 185 ? 127.497 23.682 94.037  1.00 18.73 ? 399  THR H N   1 
ATOM   3029 C CA  . THR B 2 185 ? 128.903 23.954 94.381  1.00 18.21 ? 399  THR H CA  1 
ATOM   3030 C C   . THR B 2 185 ? 129.705 24.237 93.113  1.00 18.69 ? 399  THR H C   1 
ATOM   3031 O O   . THR B 2 185 ? 129.514 23.557 92.073  1.00 19.93 ? 399  THR H O   1 
ATOM   3032 C CB  . THR B 2 185 ? 129.658 22.748 95.074  1.00 17.17 ? 399  THR H CB  1 
ATOM   3033 O OG1 . THR B 2 185 ? 129.045 22.431 96.322  1.00 20.44 ? 399  THR H OG1 1 
ATOM   3034 C CG2 . THR B 2 185 ? 131.159 23.147 95.393  1.00 14.31 ? 399  THR H CG2 1 
ATOM   3035 N N   . LEU B 2 186 ? 130.593 25.231 93.186  1.00 16.45 ? 400  LEU H N   1 
ATOM   3036 C CA  . LEU B 2 186 ? 131.507 25.496 92.076  1.00 16.40 ? 400  LEU H CA  1 
ATOM   3037 C C   . LEU B 2 186 ? 132.837 25.993 92.637  1.00 17.07 ? 400  LEU H C   1 
ATOM   3038 O O   . LEU B 2 186 ? 132.927 26.316 93.816  1.00 17.83 ? 400  LEU H O   1 
ATOM   3039 C CB  . LEU B 2 186 ? 130.917 26.524 91.086  1.00 17.54 ? 400  LEU H CB  1 
ATOM   3040 C CG  . LEU B 2 186 ? 130.661 28.004 91.427  1.00 17.61 ? 400  LEU H CG  1 
ATOM   3041 C CD1 . LEU B 2 186 ? 132.024 28.717 91.619  1.00 15.79 ? 400  LEU H CD1 1 
ATOM   3042 C CD2 . LEU B 2 186 ? 129.849 28.664 90.277  1.00 15.75 ? 400  LEU H CD2 1 
ATOM   3043 N N   . SER B 2 187 ? 133.870 26.034 91.801  1.00 18.23 ? 401  SER H N   1 
ATOM   3044 C CA  . SER B 2 187 ? 135.184 26.531 92.175  1.00 17.28 ? 401  SER H CA  1 
ATOM   3045 C C   . SER B 2 187 ? 135.620 27.496 91.082  1.00 18.24 ? 401  SER H C   1 
ATOM   3046 O O   . SER B 2 187 ? 135.094 27.454 89.946  1.00 18.05 ? 401  SER H O   1 
ATOM   3047 C CB  . SER B 2 187 ? 136.207 25.378 92.236  1.00 19.21 ? 401  SER H CB  1 
ATOM   3048 O OG  . SER B 2 187 ? 136.390 24.979 93.589  1.00 21.37 ? 401  SER H OG  1 
ATOM   3049 N N   . SER B 2 188 ? 136.569 28.367 91.420  1.00 15.96 ? 402  SER H N   1 
ATOM   3050 C CA  . SER B 2 188 ? 137.122 29.332 90.475  1.00 16.32 ? 402  SER H CA  1 
ATOM   3051 C C   . SER B 2 188 ? 138.605 29.377 90.771  1.00 16.06 ? 402  SER H C   1 
ATOM   3052 O O   . SER B 2 188 ? 138.999 29.383 91.953  1.00 16.27 ? 402  SER H O   1 
ATOM   3053 C CB  . SER B 2 188 ? 136.519 30.722 90.679  1.00 15.01 ? 402  SER H CB  1 
ATOM   3054 O OG  . SER B 2 188 ? 137.092 31.636 89.759  1.00 14.57 ? 402  SER H OG  1 
ATOM   3055 N N   . SER B 2 189 ? 139.429 29.340 89.726  1.00 15.51 ? 403  SER H N   1 
ATOM   3056 C CA  . SER B 2 189 ? 140.862 29.421 89.936  1.00 15.92 ? 403  SER H CA  1 
ATOM   3057 C C   . SER B 2 189 ? 141.411 30.666 89.199  1.00 14.54 ? 403  SER H C   1 
ATOM   3058 O O   . SER B 2 189 ? 140.795 31.164 88.257  1.00 13.56 ? 403  SER H O   1 
ATOM   3059 C CB  . SER B 2 189 ? 141.574 28.147 89.403  1.00 17.69 ? 403  SER H CB  1 
ATOM   3060 O OG  . SER B 2 189 ? 141.706 28.171 87.992  1.00 16.79 ? 403  SER H OG  1 
ATOM   3061 N N   . VAL B 2 190 ? 142.554 31.155 89.656  1.00 14.56 ? 404  VAL H N   1 
ATOM   3062 C CA  . VAL B 2 190 ? 143.210 32.289 89.018  1.00 14.97 ? 404  VAL H CA  1 
ATOM   3063 C C   . VAL B 2 190 ? 144.697 32.050 89.030  1.00 15.27 ? 404  VAL H C   1 
ATOM   3064 O O   . VAL B 2 190 ? 145.264 31.597 90.022  1.00 16.49 ? 404  VAL H O   1 
ATOM   3065 C CB  . VAL B 2 190 ? 142.871 33.689 89.701  1.00 14.85 ? 404  VAL H CB  1 
ATOM   3066 C CG1 . VAL B 2 190 ? 143.322 33.732 91.188  1.00 13.86 ? 404  VAL H CG1 1 
ATOM   3067 C CG2 . VAL B 2 190 ? 143.534 34.800 88.885  1.00 13.76 ? 404  VAL H CG2 1 
ATOM   3068 N N   . THR B 2 191 ? 145.338 32.314 87.899  1.00 15.46 ? 405  THR H N   1 
ATOM   3069 C CA  . THR B 2 191 ? 146.768 32.107 87.799  1.00 15.74 ? 405  THR H CA  1 
ATOM   3070 C C   . THR B 2 191 ? 147.422 33.490 87.615  1.00 16.36 ? 405  THR H C   1 
ATOM   3071 O O   . THR B 2 191 ? 147.057 34.258 86.702  1.00 14.93 ? 405  THR H O   1 
ATOM   3072 C CB  . THR B 2 191 ? 147.059 31.143 86.617  1.00 16.51 ? 405  THR H CB  1 
ATOM   3073 O OG1 . THR B 2 191 ? 146.418 29.869 86.904  1.00 16.01 ? 405  THR H OG1 1 
ATOM   3074 C CG2 . THR B 2 191 ? 148.578 30.925 86.419  1.00 16.87 ? 405  THR H CG2 1 
ATOM   3075 N N   . VAL B 2 192 ? 148.379 33.813 88.483  1.00 15.00 ? 406  VAL H N   1 
ATOM   3076 C CA  . VAL B 2 192 ? 148.993 35.139 88.440  1.00 14.81 ? 406  VAL H CA  1 
ATOM   3077 C C   . VAL B 2 192 ? 150.493 35.004 88.602  1.00 15.36 ? 406  VAL H C   1 
ATOM   3078 O O   . VAL B 2 192 ? 150.990 33.985 89.056  1.00 15.78 ? 406  VAL H O   1 
ATOM   3079 C CB  . VAL B 2 192 ? 148.499 36.017 89.617  1.00 13.16 ? 406  VAL H CB  1 
ATOM   3080 C CG1 . VAL B 2 192 ? 146.957 36.180 89.603  1.00 13.72 ? 406  VAL H CG1 1 
ATOM   3081 C CG2 . VAL B 2 192 ? 148.970 35.355 90.966  1.00 12.18 ? 406  VAL H CG2 1 
ATOM   3082 N N   . PRO B 2 193 ? 151.236 36.056 88.258  1.00 16.34 ? 407  PRO H N   1 
ATOM   3083 C CA  . PRO B 2 193 ? 152.695 35.932 88.417  1.00 15.47 ? 407  PRO H CA  1 
ATOM   3084 C C   . PRO B 2 193 ? 153.093 35.833 89.895  1.00 15.40 ? 407  PRO H C   1 
ATOM   3085 O O   . PRO B 2 193 ? 152.483 36.467 90.781  1.00 15.23 ? 407  PRO H O   1 
ATOM   3086 C CB  . PRO B 2 193 ? 153.242 37.199 87.739  1.00 15.02 ? 407  PRO H CB  1 
ATOM   3087 C CG  . PRO B 2 193 ? 152.142 37.489 86.663  1.00 14.23 ? 407  PRO H CG  1 
ATOM   3088 C CD  . PRO B 2 193 ? 150.852 37.192 87.394  1.00 15.98 ? 407  PRO H CD  1 
ATOM   3089 N N   . SER B 2 194 ? 154.111 35.019 90.143  1.00 15.45 ? 408  SER H N   1 
ATOM   3090 C CA  . SER B 2 194 ? 154.654 34.806 91.487  1.00 18.49 ? 408  SER H CA  1 
ATOM   3091 C C   . SER B 2 194 ? 155.037 36.138 92.139  1.00 19.11 ? 408  SER H C   1 
ATOM   3092 O O   . SER B 2 194 ? 154.979 36.261 93.367  1.00 19.41 ? 408  SER H O   1 
ATOM   3093 C CB  . SER B 2 194 ? 155.925 33.938 91.410  1.00 20.78 ? 408  SER H CB  1 
ATOM   3094 O OG  . SER B 2 194 ? 155.585 32.612 91.065  1.00 26.67 ? 408  SER H OG  1 
ATOM   3095 N N   . SER B 2 195 ? 155.450 37.120 91.334  1.00 17.70 ? 409  SER H N   1 
ATOM   3096 C CA  . SER B 2 195 ? 155.844 38.431 91.897  1.00 19.73 ? 409  SER H CA  1 
ATOM   3097 C C   . SER B 2 195 ? 154.678 39.172 92.523  1.00 19.29 ? 409  SER H C   1 
ATOM   3098 O O   . SER B 2 195 ? 154.892 40.076 93.301  1.00 20.17 ? 409  SER H O   1 
ATOM   3099 C CB  . SER B 2 195 ? 156.438 39.346 90.826  1.00 19.17 ? 409  SER H CB  1 
ATOM   3100 O OG  . SER B 2 195 ? 155.423 39.696 89.897  1.00 19.93 ? 409  SER H OG  1 
ATOM   3101 N N   . THR B 2 196 ? 153.443 38.780 92.204  1.00 18.40 ? 410  THR H N   1 
ATOM   3102 C CA  . THR B 2 196 ? 152.280 39.484 92.723  1.00 17.52 ? 410  THR H CA  1 
ATOM   3103 C C   . THR B 2 196 ? 151.571 38.840 93.916  1.00 16.56 ? 410  THR H C   1 
ATOM   3104 O O   . THR B 2 196 ? 150.741 39.512 94.541  1.00 16.56 ? 410  THR H O   1 
ATOM   3105 C CB  . THR B 2 196 ? 151.208 39.709 91.624  1.00 18.20 ? 410  THR H CB  1 
ATOM   3106 O OG1 . THR B 2 196 ? 150.668 38.439 91.249  1.00 18.13 ? 410  THR H OG1 1 
ATOM   3107 C CG2 . THR B 2 196 ? 151.824 40.413 90.398  1.00 17.84 ? 410  THR H CG2 1 
ATOM   3108 N N   . TRP B 2 197 ? 151.845 37.556 94.199  1.00 14.51 ? 411  TRP H N   1 
ATOM   3109 C CA  . TRP B 2 197 ? 151.252 36.874 95.369  1.00 15.41 ? 411  TRP H CA  1 
ATOM   3110 C C   . TRP B 2 197 ? 152.281 35.929 96.007  1.00 15.89 ? 411  TRP H C   1 
ATOM   3111 O O   . TRP B 2 197 ? 152.974 35.202 95.310  1.00 16.41 ? 411  TRP H O   1 
ATOM   3112 C CB  . TRP B 2 197 ? 149.979 36.065 94.995  1.00 16.23 ? 411  TRP H CB  1 
ATOM   3113 C CG  . TRP B 2 197 ? 149.272 35.461 96.212  1.00 16.15 ? 411  TRP H CG  1 
ATOM   3114 C CD1 . TRP B 2 197 ? 148.259 36.021 96.953  1.00 16.32 ? 411  TRP H CD1 1 
ATOM   3115 C CD2 . TRP B 2 197 ? 149.571 34.203 96.842  1.00 16.25 ? 411  TRP H CD2 1 
ATOM   3116 N NE1 . TRP B 2 197 ? 147.911 35.178 98.001  1.00 14.97 ? 411  TRP H NE1 1 
ATOM   3117 C CE2 . TRP B 2 197 ? 148.701 34.065 97.951  1.00 16.59 ? 411  TRP H CE2 1 
ATOM   3118 C CE3 . TRP B 2 197 ? 150.494 33.189 96.574  1.00 16.52 ? 411  TRP H CE3 1 
ATOM   3119 C CZ2 . TRP B 2 197 ? 148.729 32.937 98.797  1.00 18.06 ? 411  TRP H CZ2 1 
ATOM   3120 C CZ3 . TRP B 2 197 ? 150.526 32.071 97.408  1.00 16.78 ? 411  TRP H CZ3 1 
ATOM   3121 C CH2 . TRP B 2 197 ? 149.645 31.958 98.506  1.00 17.78 ? 411  TRP H CH2 1 
ATOM   3122 N N   . PRO B 2 198 ? 152.365 35.889 97.349  1.00 16.76 ? 412  PRO H N   1 
ATOM   3123 C CA  . PRO B 2 198 ? 151.588 36.632 98.344  1.00 17.39 ? 412  PRO H CA  1 
ATOM   3124 C C   . PRO B 2 198 ? 152.007 38.071 98.682  1.00 19.39 ? 412  PRO H C   1 
ATOM   3125 O O   . PRO B 2 198 ? 151.424 38.679 99.593  1.00 18.97 ? 412  PRO H O   1 
ATOM   3126 C CB  . PRO B 2 198 ? 151.676 35.731 99.578  1.00 17.42 ? 412  PRO H CB  1 
ATOM   3127 C CG  . PRO B 2 198 ? 153.166 35.301 99.541  1.00 16.74 ? 412  PRO H CG  1 
ATOM   3128 C CD  . PRO B 2 198 ? 153.318 34.959 97.998  1.00 17.72 ? 412  PRO H CD  1 
ATOM   3129 N N   . SER B 2 199 ? 152.982 38.631 97.980  1.00 19.90 ? 413  SER H N   1 
ATOM   3130 C CA  . SER B 2 199 ? 153.407 40.013 98.305  1.00 21.00 ? 413  SER H CA  1 
ATOM   3131 C C   . SER B 2 199 ? 152.241 41.010 98.214  1.00 23.17 ? 413  SER H C   1 
ATOM   3132 O O   . SER B 2 199 ? 152.182 41.987 98.961  1.00 23.30 ? 413  SER H O   1 
ATOM   3133 C CB  . SER B 2 199 ? 154.506 40.452 97.346  1.00 20.85 ? 413  SER H CB  1 
ATOM   3134 O OG  . SER B 2 199 ? 154.009 40.387 96.013  1.00 22.50 ? 413  SER H OG  1 
ATOM   3135 N N   . GLU B 2 200 ? 151.327 40.799 97.262  1.00 22.91 ? 414  GLU H N   1 
ATOM   3136 C CA  . GLU B 2 200 ? 150.160 41.674 97.144  1.00 23.94 ? 414  GLU H CA  1 
ATOM   3137 C C   . GLU B 2 200 ? 148.919 40.815 97.322  1.00 22.92 ? 414  GLU H C   1 
ATOM   3138 O O   . GLU B 2 200 ? 148.972 39.597 97.248  1.00 21.93 ? 414  GLU H O   1 
ATOM   3139 C CB  . GLU B 2 200 ? 150.139 42.442 95.799  1.00 27.03 ? 414  GLU H CB  1 
ATOM   3140 C CG  . GLU B 2 200 ? 151.313 43.438 95.643  1.00 34.24 ? 414  GLU H CG  1 
ATOM   3141 C CD  . GLU B 2 200 ? 151.006 44.642 94.695  1.00 38.86 ? 414  GLU H CD  1 
ATOM   3142 O OE1 . GLU B 2 200 ? 150.395 45.646 95.156  1.00 43.92 ? 414  GLU H OE1 1 
ATOM   3143 O OE2 . GLU B 2 200 ? 151.356 44.586 93.499  1.00 39.34 ? 414  GLU H OE2 1 
ATOM   3144 N N   . THR B 2 201 ? 147.808 41.475 97.594  1.00 21.87 ? 415  THR H N   1 
ATOM   3145 C CA  . THR B 2 201 ? 146.534 40.836 97.851  1.00 22.69 ? 415  THR H CA  1 
ATOM   3146 C C   . THR B 2 201 ? 145.847 40.273 96.586  1.00 20.67 ? 415  THR H C   1 
ATOM   3147 O O   . THR B 2 201 ? 145.937 40.849 95.470  1.00 20.11 ? 415  THR H O   1 
ATOM   3148 C CB  . THR B 2 201 ? 145.610 41.880 98.529  1.00 25.49 ? 415  THR H CB  1 
ATOM   3149 O OG1 . THR B 2 201 ? 146.303 42.396 99.661  1.00 28.70 ? 415  THR H OG1 1 
ATOM   3150 C CG2 . THR B 2 201 ? 144.311 41.263 99.039  1.00 27.32 ? 415  THR H CG2 1 
ATOM   3151 N N   . VAL B 2 202 ? 145.226 39.110 96.774  1.00 18.27 ? 416  VAL H N   1 
ATOM   3152 C CA  . VAL B 2 202 ? 144.433 38.471 95.759  1.00 16.65 ? 416  VAL H CA  1 
ATOM   3153 C C   . VAL B 2 202 ? 143.208 38.075 96.546  1.00 18.01 ? 416  VAL H C   1 
ATOM   3154 O O   . VAL B 2 202 ? 143.297 37.373 97.596  1.00 18.42 ? 416  VAL H O   1 
ATOM   3155 C CB  . VAL B 2 202 ? 145.083 37.226 95.154  1.00 16.46 ? 416  VAL H CB  1 
ATOM   3156 C CG1 . VAL B 2 202 ? 144.039 36.514 94.270  1.00 15.17 ? 416  VAL H CG1 1 
ATOM   3157 C CG2 . VAL B 2 202 ? 146.329 37.619 94.327  1.00 14.80 ? 416  VAL H CG2 1 
ATOM   3158 N N   . THR B 2 203 ? 142.057 38.528 96.054  1.00 17.45 ? 417  THR H N   1 
ATOM   3159 C CA  . THR B 2 203 ? 140.786 38.281 96.729  1.00 19.59 ? 417  THR H CA  1 
ATOM   3160 C C   . THR B 2 203 ? 139.686 37.765 95.788  1.00 19.66 ? 417  THR H C   1 
ATOM   3161 O O   . THR B 2 203 ? 139.499 38.296 94.688  1.00 18.16 ? 417  THR H O   1 
ATOM   3162 C CB  . THR B 2 203 ? 140.254 39.608 97.338  1.00 20.27 ? 417  THR H CB  1 
ATOM   3163 O OG1 . THR B 2 203 ? 141.255 40.161 98.212  1.00 21.32 ? 417  THR H OG1 1 
ATOM   3164 C CG2 . THR B 2 203 ? 138.943 39.372 98.134  1.00 20.42 ? 417  THR H CG2 1 
ATOM   3165 N N   . CYS B 2 204 ? 138.947 36.735 96.182  1.00 20.23 ? 418  CYS H N   1 
ATOM   3166 C CA  . CYS B 2 204 ? 137.853 36.396 95.276  1.00 21.43 ? 418  CYS H CA  1 
ATOM   3167 C C   . CYS B 2 204 ? 136.555 37.021 95.836  1.00 20.53 ? 418  CYS H C   1 
ATOM   3168 O O   . CYS B 2 204 ? 136.356 37.087 97.042  1.00 19.37 ? 418  CYS H O   1 
ATOM   3169 C CB  . CYS B 2 204 ? 137.704 34.890 95.108  1.00 24.95 ? 418  CYS H CB  1 
ATOM   3170 S SG  . CYS B 2 204 ? 136.952 34.102 96.518  1.00 30.66 ? 418  CYS H SG  1 
ATOM   3171 N N   . ASN B 2 205 ? 135.705 37.522 94.951  1.00 19.80 ? 419  ASN H N   1 
ATOM   3172 C CA  . ASN B 2 205 ? 134.448 38.114 95.378  1.00 20.87 ? 419  ASN H CA  1 
ATOM   3173 C C   . ASN B 2 205 ? 133.280 37.252 94.845  1.00 21.10 ? 419  ASN H C   1 
ATOM   3174 O O   . ASN B 2 205 ? 133.158 37.046 93.640  1.00 22.15 ? 419  ASN H O   1 
ATOM   3175 C CB  . ASN B 2 205 ? 134.338 39.548 94.845  1.00 17.97 ? 419  ASN H CB  1 
ATOM   3176 C CG  . ASN B 2 205 ? 135.700 40.218 94.703  1.00 20.23 ? 419  ASN H CG  1 
ATOM   3177 O OD1 . ASN B 2 205 ? 136.242 40.364 93.591  1.00 19.85 ? 419  ASN H OD1 1 
ATOM   3178 N ND2 . ASN B 2 205 ? 136.281 40.601 95.841  1.00 18.53 ? 419  ASN H ND2 1 
ATOM   3179 N N   . VAL B 2 206 ? 132.430 36.790 95.752  1.00 20.50 ? 420  VAL H N   1 
ATOM   3180 C CA  . VAL B 2 206 ? 131.295 35.953 95.414  1.00 22.80 ? 420  VAL H CA  1 
ATOM   3181 C C   . VAL B 2 206 ? 129.965 36.594 95.796  1.00 24.12 ? 420  VAL H C   1 
ATOM   3182 O O   . VAL B 2 206 ? 129.697 36.833 96.980  1.00 25.22 ? 420  VAL H O   1 
ATOM   3183 C CB  . VAL B 2 206 ? 131.388 34.585 96.136  1.00 22.51 ? 420  VAL H CB  1 
ATOM   3184 C CG1 . VAL B 2 206 ? 130.196 33.726 95.764  1.00 23.86 ? 420  VAL H CG1 1 
ATOM   3185 C CG2 . VAL B 2 206 ? 132.712 33.880 95.764  1.00 22.52 ? 420  VAL H CG2 1 
ATOM   3186 N N   . ALA B 2 207 ? 129.139 36.882 94.799  1.00 25.15 ? 421  ALA H N   1 
ATOM   3187 C CA  . ALA B 2 207 ? 127.829 37.467 95.053  1.00 26.88 ? 421  ALA H CA  1 
ATOM   3188 C C   . ALA B 2 207 ? 126.779 36.406 94.710  1.00 28.40 ? 421  ALA H C   1 
ATOM   3189 O O   . ALA B 2 207 ? 126.906 35.649 93.727  1.00 26.57 ? 421  ALA H O   1 
ATOM   3190 C CB  . ALA B 2 207 ? 127.595 38.704 94.173  1.00 27.25 ? 421  ALA H CB  1 
ATOM   3191 N N   . HIS B 2 208 ? 125.722 36.385 95.508  1.00 28.41 ? 422  HIS H N   1 
ATOM   3192 C CA  . HIS B 2 208 ? 124.651 35.435 95.300  1.00 28.80 ? 422  HIS H CA  1 
ATOM   3193 C C   . HIS B 2 208 ? 123.385 36.270 95.456  1.00 29.81 ? 422  HIS H C   1 
ATOM   3194 O O   . HIS B 2 208 ? 122.859 36.424 96.559  1.00 29.16 ? 422  HIS H O   1 
ATOM   3195 C CB  . HIS B 2 208 ? 124.723 34.340 96.365  1.00 27.37 ? 422  HIS H CB  1 
ATOM   3196 C CG  . HIS B 2 208 ? 123.668 33.301 96.216  1.00 27.99 ? 422  HIS H CG  1 
ATOM   3197 N ND1 . HIS B 2 208 ? 122.822 32.943 97.247  1.00 26.48 ? 422  HIS H ND1 1 
ATOM   3198 C CD2 . HIS B 2 208 ? 123.316 32.534 95.156  1.00 27.62 ? 422  HIS H CD2 1 
ATOM   3199 C CE1 . HIS B 2 208 ? 121.998 32.000 96.826  1.00 27.32 ? 422  HIS H CE1 1 
ATOM   3200 N NE2 . HIS B 2 208 ? 122.276 31.736 95.561  1.00 27.47 ? 422  HIS H NE2 1 
ATOM   3201 N N   . PRO B 2 209 ? 122.919 36.860 94.345  1.00 31.48 ? 423  PRO H N   1 
ATOM   3202 C CA  . PRO B 2 209 ? 121.719 37.715 94.233  1.00 31.95 ? 423  PRO H CA  1 
ATOM   3203 C C   . PRO B 2 209 ? 120.507 37.176 95.014  1.00 31.91 ? 423  PRO H C   1 
ATOM   3204 O O   . PRO B 2 209 ? 119.872 37.922 95.753  1.00 32.96 ? 423  PRO H O   1 
ATOM   3205 C CB  . PRO B 2 209 ? 121.433 37.731 92.735  1.00 31.97 ? 423  PRO H CB  1 
ATOM   3206 C CG  . PRO B 2 209 ? 122.793 37.575 92.130  1.00 33.71 ? 423  PRO H CG  1 
ATOM   3207 C CD  . PRO B 2 209 ? 123.498 36.572 93.015  1.00 31.40 ? 423  PRO H CD  1 
ATOM   3208 N N   . ALA B 2 210 ? 120.193 35.895 94.844  1.00 31.21 ? 424  ALA H N   1 
ATOM   3209 C CA  . ALA B 2 210 ? 119.042 35.318 95.524  1.00 32.19 ? 424  ALA H CA  1 
ATOM   3210 C C   . ALA B 2 210 ? 119.148 35.534 97.031  1.00 32.88 ? 424  ALA H C   1 
ATOM   3211 O O   . ALA B 2 210 ? 118.150 35.709 97.713  1.00 33.00 ? 424  ALA H O   1 
ATOM   3212 C CB  . ALA B 2 210 ? 118.910 33.830 95.204  1.00 30.92 ? 424  ALA H CB  1 
ATOM   3213 N N   . SER B 2 211 ? 120.356 35.558 97.551  1.00 33.42 ? 425  SER H N   1 
ATOM   3214 C CA  . SER B 2 211 ? 120.549 35.745 98.993  1.00 35.19 ? 425  SER H CA  1 
ATOM   3215 C C   . SER B 2 211 ? 120.858 37.201 99.334  1.00 36.01 ? 425  SER H C   1 
ATOM   3216 O O   . SER B 2 211 ? 120.931 37.564 100.501 1.00 35.97 ? 425  SER H O   1 
ATOM   3217 C CB  . SER B 2 211 ? 121.722 34.877 99.472  1.00 35.66 ? 425  SER H CB  1 
ATOM   3218 O OG  . SER B 2 211 ? 121.244 33.687 100.063 1.00 39.42 ? 425  SER H OG  1 
ATOM   3219 N N   . SER B 2 212 ? 121.046 38.022 98.308  1.00 36.90 ? 426  SER H N   1 
ATOM   3220 C CA  . SER B 2 212 ? 121.410 39.419 98.503  1.00 38.83 ? 426  SER H CA  1 
ATOM   3221 C C   . SER B 2 212 ? 122.750 39.448 99.244  1.00 38.60 ? 426  SER H C   1 
ATOM   3222 O O   . SER B 2 212 ? 123.060 40.413 99.960  1.00 40.53 ? 426  SER H O   1 
ATOM   3223 C CB  . SER B 2 212 ? 120.333 40.147 99.316  1.00 40.68 ? 426  SER H CB  1 
ATOM   3224 O OG  . SER B 2 212 ? 119.087 40.093 98.630  1.00 44.24 ? 426  SER H OG  1 
ATOM   3225 N N   . THR B 2 213 ? 123.550 38.393 99.078  1.00 36.76 ? 427  THR H N   1 
ATOM   3226 C CA  . THR B 2 213 ? 124.836 38.327 99.751  1.00 34.67 ? 427  THR H CA  1 
ATOM   3227 C C   . THR B 2 213 ? 126.031 38.585 98.845  1.00 33.14 ? 427  THR H C   1 
ATOM   3228 O O   . THR B 2 213 ? 125.986 38.358 97.630  1.00 30.58 ? 427  THR H O   1 
ATOM   3229 C CB  . THR B 2 213 ? 125.032 36.966 100.479 1.00 34.93 ? 427  THR H CB  1 
ATOM   3230 O OG1 . THR B 2 213 ? 125.133 35.902 99.533  1.00 36.63 ? 427  THR H OG1 1 
ATOM   3231 C CG2 . THR B 2 213 ? 123.851 36.686 101.377 1.00 35.56 ? 427  THR H CG2 1 
ATOM   3232 N N   . LYS B 2 214 ? 127.100 39.096 99.448  1.00 33.71 ? 428  LYS H N   1 
ATOM   3233 C CA  . LYS B 2 214 ? 128.339 39.385 98.727  1.00 34.51 ? 428  LYS H CA  1 
ATOM   3234 C C   . LYS B 2 214 ? 129.462 39.205 99.719  1.00 33.68 ? 428  LYS H C   1 
ATOM   3235 O O   . LYS B 2 214 ? 129.480 39.878 100.749 1.00 34.31 ? 428  LYS H O   1 
ATOM   3236 C CB  . LYS B 2 214 ? 128.356 40.815 98.200  1.00 37.33 ? 428  LYS H CB  1 
ATOM   3237 C CG  . LYS B 2 214 ? 127.405 41.039 97.023  1.00 42.65 ? 428  LYS H CG  1 
ATOM   3238 C CD  . LYS B 2 214 ? 127.353 42.499 96.540  1.00 45.58 ? 428  LYS H CD  1 
ATOM   3239 C CE  . LYS B 2 214 ? 127.030 43.458 97.671  1.00 47.90 ? 428  LYS H CE  1 
ATOM   3240 N NZ  . LYS B 2 214 ? 125.704 43.188 98.316  1.00 50.27 ? 428  LYS H NZ  1 
ATOM   3241 N N   . VAL B 2 215 ? 130.372 38.274 99.453  1.00 30.55 ? 429  VAL H N   1 
ATOM   3242 C CA  . VAL B 2 215 ? 131.477 38.081 100.370 1.00 29.37 ? 429  VAL H CA  1 
ATOM   3243 C C   . VAL B 2 215 ? 132.811 38.114 99.646  1.00 28.14 ? 429  VAL H C   1 
ATOM   3244 O O   . VAL B 2 215 ? 132.909 37.777 98.457  1.00 26.04 ? 429  VAL H O   1 
ATOM   3245 C CB  . VAL B 2 215 ? 131.363 36.756 101.169 1.00 29.67 ? 429  VAL H CB  1 
ATOM   3246 C CG1 . VAL B 2 215 ? 130.056 36.728 101.947 1.00 30.78 ? 429  VAL H CG1 1 
ATOM   3247 C CG2 . VAL B 2 215 ? 131.455 35.584 100.248 1.00 29.80 ? 429  VAL H CG2 1 
ATOM   3248 N N   . ASP B 2 216 ? 133.836 38.550 100.369 1.00 27.39 ? 430  ASP H N   1 
ATOM   3249 C CA  . ASP B 2 216 ? 135.180 38.613 99.805  1.00 28.09 ? 430  ASP H CA  1 
ATOM   3250 C C   . ASP B 2 216 ? 136.005 37.675 100.627 1.00 27.94 ? 430  ASP H C   1 
ATOM   3251 O O   . ASP B 2 216 ? 135.792 37.588 101.832 1.00 29.89 ? 430  ASP H O   1 
ATOM   3252 C CB  . ASP B 2 216 ? 135.744 40.020 99.923  1.00 29.73 ? 430  ASP H CB  1 
ATOM   3253 C CG  . ASP B 2 216 ? 134.930 41.026 99.151  1.00 32.09 ? 430  ASP H CG  1 
ATOM   3254 O OD1 . ASP B 2 216 ? 134.332 41.922 99.772  1.00 35.62 ? 430  ASP H OD1 1 
ATOM   3255 O OD2 . ASP B 2 216 ? 134.859 40.922 97.921  1.00 31.75 ? 430  ASP H OD2 1 
ATOM   3256 N N   . LYS B 2 217 ? 136.907 36.938 99.988  1.00 26.80 ? 431  LYS H N   1 
ATOM   3257 C CA  . LYS B 2 217 ? 137.778 36.057 100.721 1.00 26.58 ? 431  LYS H CA  1 
ATOM   3258 C C   . LYS B 2 217 ? 139.192 36.318 100.205 1.00 26.40 ? 431  LYS H C   1 
ATOM   3259 O O   . LYS B 2 217 ? 139.467 36.115 99.005  1.00 24.35 ? 431  LYS H O   1 
ATOM   3260 C CB  . LYS B 2 217 ? 137.407 34.618 100.489 1.00 27.25 ? 431  LYS H CB  1 
ATOM   3261 C CG  . LYS B 2 217 ? 137.954 33.699 101.543 1.00 32.35 ? 431  LYS H CG  1 
ATOM   3262 C CD  . LYS B 2 217 ? 137.195 33.846 102.894 1.00 35.06 ? 431  LYS H CD  1 
ATOM   3263 C CE  . LYS B 2 217 ? 135.706 34.043 102.658 1.00 34.66 ? 431  LYS H CE  1 
ATOM   3264 N NZ  . LYS B 2 217 ? 134.937 33.939 103.956 1.00 39.02 ? 431  LYS H NZ  1 
ATOM   3265 N N   . LYS B 2 218 ? 140.069 36.789 101.106 1.00 24.76 ? 432  LYS H N   1 
ATOM   3266 C CA  . LYS B 2 218 ? 141.472 37.075 100.785 1.00 25.00 ? 432  LYS H CA  1 
ATOM   3267 C C   . LYS B 2 218 ? 142.202 35.736 100.769 1.00 23.08 ? 432  LYS H C   1 
ATOM   3268 O O   . LYS B 2 218 ? 141.968 34.895 101.647 1.00 23.02 ? 432  LYS H O   1 
ATOM   3269 C CB  . LYS B 2 218 ? 142.100 38.000 101.860 1.00 27.56 ? 432  LYS H CB  1 
ATOM   3270 C CG  . LYS B 2 218 ? 143.586 38.377 101.578 1.00 32.25 ? 432  LYS H CG  1 
ATOM   3271 C CD  . LYS B 2 218 ? 144.263 39.228 102.724 1.00 33.62 ? 432  LYS H CD  1 
ATOM   3272 C CE  . LYS B 2 218 ? 143.625 40.615 102.888 1.00 36.24 ? 432  LYS H CE  1 
ATOM   3273 N NZ  . LYS B 2 218 ? 144.366 41.588 103.823 1.00 39.33 ? 432  LYS H NZ  1 
ATOM   3274 N N   . ILE B 2 219 ? 143.060 35.500 99.769  1.00 23.16 ? 433  ILE H N   1 
ATOM   3275 C CA  . ILE B 2 219 ? 143.792 34.236 99.722  1.00 20.11 ? 433  ILE H CA  1 
ATOM   3276 C C   . ILE B 2 219 ? 145.098 34.478 100.478 1.00 21.64 ? 433  ILE H C   1 
ATOM   3277 O O   . ILE B 2 219 ? 145.906 35.298 100.093 1.00 20.51 ? 433  ILE H O   1 
ATOM   3278 C CB  . ILE B 2 219 ? 144.147 33.762 98.279  1.00 20.22 ? 433  ILE H CB  1 
ATOM   3279 C CG1 . ILE B 2 219 ? 142.928 33.833 97.332  1.00 18.17 ? 433  ILE H CG1 1 
ATOM   3280 C CG2 . ILE B 2 219 ? 144.758 32.342 98.367  1.00 19.11 ? 433  ILE H CG2 1 
ATOM   3281 C CD1 . ILE B 2 219 ? 141.661 33.035 97.712  1.00 13.78 ? 433  ILE H CD1 1 
ATOM   3282 N N   . VAL B 2 220 ? 145.313 33.716 101.534 1.00 23.21 ? 434  VAL H N   1 
ATOM   3283 C CA  . VAL B 2 220 ? 146.493 33.885 102.384 1.00 25.60 ? 434  VAL H CA  1 
ATOM   3284 C C   . VAL B 2 220 ? 147.376 32.624 102.487 1.00 25.33 ? 434  VAL H C   1 
ATOM   3285 O O   . VAL B 2 220 ? 146.867 31.502 102.463 1.00 25.77 ? 434  VAL H O   1 
ATOM   3286 C CB  . VAL B 2 220 ? 145.967 34.308 103.793 1.00 27.37 ? 434  VAL H CB  1 
ATOM   3287 C CG1 . VAL B 2 220 ? 147.071 34.240 104.837 1.00 29.08 ? 434  VAL H CG1 1 
ATOM   3288 C CG2 . VAL B 2 220 ? 145.381 35.719 103.707 1.00 27.62 ? 434  VAL H CG2 1 
ATOM   3289 N N   . PRO B 2 221 ? 148.709 32.777 102.562 1.00 26.40 ? 435  PRO H N   1 
ATOM   3290 C CA  . PRO B 2 221 ? 149.516 31.550 102.682 1.00 28.47 ? 435  PRO H CA  1 
ATOM   3291 C C   . PRO B 2 221 ? 148.944 30.748 103.866 1.00 30.38 ? 435  PRO H C   1 
ATOM   3292 O O   . PRO B 2 221 ? 148.473 31.333 104.829 1.00 30.01 ? 435  PRO H O   1 
ATOM   3293 C CB  . PRO B 2 221 ? 150.914 32.087 102.982 1.00 27.99 ? 435  PRO H CB  1 
ATOM   3294 C CG  . PRO B 2 221 ? 150.957 33.385 102.195 1.00 25.45 ? 435  PRO H CG  1 
ATOM   3295 C CD  . PRO B 2 221 ? 149.564 33.971 102.419 1.00 25.51 ? 435  PRO H CD  1 
ATOM   3296 N N   . ARG B 2 222 ? 148.962 29.426 103.821 1.00 34.07 ? 436  ARG H N   1 
ATOM   3297 C CA  . ARG B 2 222 ? 148.352 28.677 104.953 1.00 38.17 ? 436  ARG H CA  1 
ATOM   3298 C C   . ARG B 2 222 ? 149.031 28.838 106.344 1.00 39.31 ? 436  ARG H C   1 
ATOM   3299 O O   . ARG B 2 222 ? 150.254 28.684 106.475 1.00 39.82 ? 436  ARG H O   1 
ATOM   3300 C CB  . ARG B 2 222 ? 148.261 27.196 104.573 1.00 40.43 ? 436  ARG H CB  1 
ATOM   3301 C CG  . ARG B 2 222 ? 147.700 26.999 103.149 1.00 43.64 ? 436  ARG H CG  1 
ATOM   3302 C CD  . ARG B 2 222 ? 147.441 25.530 102.785 1.00 45.12 ? 436  ARG H CD  1 
ATOM   3303 N NE  . ARG B 2 222 ? 146.193 25.059 103.381 1.00 48.49 ? 436  ARG H NE  1 
ATOM   3304 C CZ  . ARG B 2 222 ? 144.999 25.083 102.782 1.00 48.53 ? 436  ARG H CZ  1 
ATOM   3305 N NH1 . ARG B 2 222 ? 144.835 25.547 101.532 1.00 48.57 ? 436  ARG H NH1 1 
ATOM   3306 N NH2 . ARG B 2 222 ? 143.951 24.654 103.462 1.00 49.06 ? 436  ARG H NH2 1 
ATOM   3307 N N   . ASP B 2 223 ? 148.213 29.164 107.366 1.00 40.08 ? 437  ASP H N   1 
ATOM   3308 C CA  . ASP B 2 223 ? 148.631 29.355 108.784 1.00 41.38 ? 437  ASP H CA  1 
ATOM   3309 C C   . ASP B 2 223 ? 149.164 28.023 109.343 1.00 41.98 ? 437  ASP H C   1 
ATOM   3310 O O   . ASP B 2 223 ? 148.660 27.544 110.354 1.00 42.23 ? 437  ASP H O   1 
ATOM   3311 C CB  . ASP B 2 223 ? 147.392 29.777 109.614 1.00 42.77 ? 437  ASP H CB  1 
ATOM   3312 C CG  . ASP B 2 223 ? 147.700 30.085 111.116 1.00 44.81 ? 437  ASP H CG  1 
ATOM   3313 O OD1 . ASP B 2 223 ? 146.802 29.881 111.965 1.00 46.05 ? 437  ASP H OD1 1 
ATOM   3314 O OD2 . ASP B 2 223 ? 148.796 30.554 111.469 1.00 44.98 ? 437  ASP H OD2 1 
ATOM   3315 N N   . CYS B 2 224 ? 150.161 27.424 108.702 1.00 43.30 ? 438  CYS H N   1 
ATOM   3316 C CA  . CYS B 2 224 ? 150.686 26.134 109.170 1.00 44.57 ? 438  CYS H CA  1 
ATOM   3317 C C   . CYS B 2 224 ? 151.810 26.316 110.225 1.00 43.76 ? 438  CYS H C   1 
ATOM   3318 O O   . CYS B 2 224 ? 152.749 27.101 110.039 1.00 43.49 ? 438  CYS H O   1 
ATOM   3319 C CB  . CYS B 2 224 ? 151.080 25.244 107.941 1.00 48.69 ? 438  CYS H CB  1 
ATOM   3320 S SG  . CYS B 2 224 ? 149.621 24.442 107.104 1.00 49.48 ? 438  CYS H SG  1 
ATOM   3321 N N   . GLY B 2 225 ? 151.675 25.594 111.351 1.00 42.81 ? 439  GLY H N   1 
ATOM   3322 C CA  . GLY B 2 225 ? 152.603 25.674 112.488 1.00 43.02 ? 439  GLY H CA  1 
ATOM   3323 C C   . GLY B 2 225 ? 154.109 25.357 112.457 1.00 44.61 ? 439  GLY H C   1 
ATOM   3324 O O   . GLY B 2 225 ? 154.498 24.216 112.107 1.00 44.83 ? 439  GLY H O   1 
ATOM   3325 O OXT . GLY B 2 225 ? 154.924 26.246 112.828 1.00 48.94 ? 439  GLY H OXT 1 
ATOM   3326 N N   . MET C 3 1   ? 69.748  14.105 32.079  1.00 46.72 ? 507  MET A N   1 
ATOM   3327 C CA  . MET C 3 1   ? 71.051  13.898 32.805  1.00 47.32 ? 507  MET A CA  1 
ATOM   3328 C C   . MET C 3 1   ? 71.222  12.464 33.391  1.00 44.06 ? 507  MET A C   1 
ATOM   3329 O O   . MET C 3 1   ? 70.623  12.148 34.430  1.00 43.63 ? 507  MET A O   1 
ATOM   3330 C CB  . MET C 3 1   ? 71.145  14.918 33.955  1.00 51.13 ? 507  MET A CB  1 
ATOM   3331 C CG  . MET C 3 1   ? 72.548  15.085 34.515  1.00 55.39 ? 507  MET A CG  1 
ATOM   3332 S SD  . MET C 3 1   ? 73.704  15.782 33.294  1.00 60.01 ? 507  MET A SD  1 
ATOM   3333 C CE  . MET C 3 1   ? 74.433  14.300 32.498  1.00 58.89 ? 507  MET A CE  1 
ATOM   3334 N N   . TYR C 3 2   ? 72.045  11.617 32.747  1.00 39.83 ? 508  TYR A N   1 
ATOM   3335 C CA  . TYR C 3 2   ? 72.252  10.227 33.216  1.00 34.86 ? 508  TYR A CA  1 
ATOM   3336 C C   . TYR C 3 2   ? 73.664  9.701  32.857  1.00 32.62 ? 508  TYR A C   1 
ATOM   3337 O O   . TYR C 3 2   ? 74.050  9.625  31.671  1.00 31.64 ? 508  TYR A O   1 
ATOM   3338 C CB  . TYR C 3 2   ? 71.194  9.286  32.625  1.00 33.18 ? 508  TYR A CB  1 
ATOM   3339 C CG  . TYR C 3 2   ? 71.198  7.896  33.232  1.00 33.22 ? 508  TYR A CG  1 
ATOM   3340 C CD1 . TYR C 3 2   ? 70.539  7.623  34.442  1.00 32.97 ? 508  TYR A CD1 1 
ATOM   3341 C CD2 . TYR C 3 2   ? 71.834  6.838  32.582  1.00 34.23 ? 508  TYR A CD2 1 
ATOM   3342 C CE1 . TYR C 3 2   ? 70.509  6.323  34.980  1.00 31.54 ? 508  TYR A CE1 1 
ATOM   3343 C CE2 . TYR C 3 2   ? 71.820  5.537  33.106  1.00 32.20 ? 508  TYR A CE2 1 
ATOM   3344 C CZ  . TYR C 3 2   ? 71.161  5.277  34.295  1.00 33.43 ? 508  TYR A CZ  1 
ATOM   3345 O OH  . TYR C 3 2   ? 71.171  3.965  34.769  1.00 30.07 ? 508  TYR A OH  1 
ATOM   3346 N N   . CYS C 3 3   ? 74.412  9.291  33.870  1.00 27.52 ? 509  CYS A N   1 
ATOM   3347 C CA  . CYS C 3 3   ? 75.793  8.900  33.637  1.00 25.27 ? 509  CYS A CA  1 
ATOM   3348 C C   . CYS C 3 3   ? 76.030  7.420  33.578  1.00 23.43 ? 509  CYS A C   1 
ATOM   3349 O O   . CYS C 3 3   ? 75.885  6.726  34.565  1.00 20.96 ? 509  CYS A O   1 
ATOM   3350 C CB  . CYS C 3 3   ? 76.692  9.515  34.723  1.00 25.16 ? 509  CYS A CB  1 
ATOM   3351 S SG  . CYS C 3 3   ? 78.444  9.263  34.316  1.00 24.17 ? 509  CYS A SG  1 
ATOM   3352 N N   . SER C 3 4   ? 76.383  6.948  32.391  1.00 24.75 ? 510  SER A N   1 
ATOM   3353 C CA  . SER C 3 4   ? 76.648  5.536  32.176  1.00 26.22 ? 510  SER A CA  1 
ATOM   3354 C C   . SER C 3 4   ? 78.118  5.419  31.724  1.00 26.40 ? 510  SER A C   1 
ATOM   3355 O O   . SER C 3 4   ? 78.395  5.343  30.526  1.00 25.40 ? 510  SER A O   1 
ATOM   3356 C CB  . SER C 3 4   ? 75.745  4.998  31.062  1.00 27.54 ? 510  SER A CB  1 
ATOM   3357 O OG  . SER C 3 4   ? 75.825  3.578  31.004  1.00 29.48 ? 510  SER A OG  1 
ATOM   3358 N N   . ARG C 3 5   ? 79.036  5.463  32.689  1.00 25.63 ? 511  ARG A N   1 
ATOM   3359 C CA  . ARG C 3 5   ? 80.459  5.371  32.424  1.00 24.26 ? 511  ARG A CA  1 
ATOM   3360 C C   . ARG C 3 5   ? 81.107  4.632  33.601  1.00 22.61 ? 511  ARG A C   1 
ATOM   3361 O O   . ARG C 3 5   ? 80.439  4.267  34.552  1.00 21.91 ? 511  ARG A O   1 
ATOM   3362 C CB  . ARG C 3 5   ? 81.064  6.778  32.267  1.00 24.59 ? 511  ARG A CB  1 
ATOM   3363 C CG  . ARG C 3 5   ? 80.548  7.553  31.055  1.00 27.89 ? 511  ARG A CG  1 
ATOM   3364 C CD  . ARG C 3 5   ? 81.440  8.733  30.744  1.00 31.60 ? 511  ARG A CD  1 
ATOM   3365 N NE  . ARG C 3 5   ? 80.993  9.487  29.584  1.00 32.77 ? 511  ARG A NE  1 
ATOM   3366 C CZ  . ARG C 3 5   ? 81.674  10.469 28.985  1.00 33.66 ? 511  ARG A CZ  1 
ATOM   3367 N NH1 . ARG C 3 5   ? 82.871  10.862 29.416  1.00 33.57 ? 511  ARG A NH1 1 
ATOM   3368 N NH2 . ARG C 3 5   ? 81.153  11.057 27.917  1.00 34.02 ? 511  ARG A NH2 1 
ATOM   3369 N N   . LEU C 3 6   ? 82.425  4.454  33.536  1.00 22.54 ? 512  LEU A N   1 
ATOM   3370 C CA  . LEU C 3 6   ? 83.181  3.735  34.556  1.00 22.23 ? 512  LEU A CA  1 
ATOM   3371 C C   . LEU C 3 6   ? 83.661  4.749  35.623  1.00 21.14 ? 512  LEU A C   1 
ATOM   3372 O O   . LEU C 3 6   ? 84.596  5.525  35.405  1.00 19.04 ? 512  LEU A O   1 
ATOM   3373 C CB  . LEU C 3 6   ? 84.370  3.020  33.889  1.00 22.08 ? 512  LEU A CB  1 
ATOM   3374 C CG  . LEU C 3 6   ? 83.941  2.108  32.723  1.00 23.45 ? 512  LEU A CG  1 
ATOM   3375 C CD1 . LEU C 3 6   ? 85.170  1.384  32.129  1.00 23.38 ? 512  LEU A CD1 1 
ATOM   3376 C CD2 . LEU C 3 6   ? 82.901  1.103  33.215  1.00 21.18 ? 512  LEU A CD2 1 
ATOM   3377 N N   . LEU C 3 7   ? 82.992  4.729  36.764  1.00 20.55 ? 513  LEU A N   1 
ATOM   3378 C CA  . LEU C 3 7   ? 83.299  5.699  37.793  1.00 21.15 ? 513  LEU A CA  1 
ATOM   3379 C C   . LEU C 3 7   ? 83.031  5.166  39.175  1.00 20.95 ? 513  LEU A C   1 
ATOM   3380 O O   . LEU C 3 7   ? 82.054  4.433  39.369  1.00 21.71 ? 513  LEU A O   1 
ATOM   3381 C CB  . LEU C 3 7   ? 82.433  6.956  37.550  1.00 21.02 ? 513  LEU A CB  1 
ATOM   3382 C CG  . LEU C 3 7   ? 82.307  7.959  38.692  1.00 21.18 ? 513  LEU A CG  1 
ATOM   3383 C CD1 . LEU C 3 7   ? 83.673  8.634  38.886  1.00 21.73 ? 513  LEU A CD1 1 
ATOM   3384 C CD2 . LEU C 3 7   ? 81.219  8.992  38.353  1.00 21.26 ? 513  LEU A CD2 1 
ATOM   3385 N N   . ASP C 3 8   ? 83.932  5.495  40.106  1.00 19.44 ? 514  ASP A N   1 
ATOM   3386 C CA  . ASP C 3 8   ? 83.791  5.164  41.537  1.00 19.11 ? 514  ASP A CA  1 
ATOM   3387 C C   . ASP C 3 8   ? 83.538  6.559  42.175  1.00 19.14 ? 514  ASP A C   1 
ATOM   3388 O O   . ASP C 3 8   ? 84.439  7.398  42.192  1.00 18.40 ? 514  ASP A O   1 
ATOM   3389 C CB  . ASP C 3 8   ? 85.073  4.565  42.132  1.00 17.69 ? 514  ASP A CB  1 
ATOM   3390 C CG  . ASP C 3 8   ? 85.221  3.085  41.810  1.00 18.61 ? 514  ASP A CG  1 
ATOM   3391 O OD1 . ASP C 3 8   ? 84.219  2.468  41.418  1.00 20.18 ? 514  ASP A OD1 1 
ATOM   3392 O OD2 . ASP C 3 8   ? 86.311  2.521  41.939  1.00 18.86 ? 514  ASP A OD2 1 
ATOM   3393 N N   . LEU C 3 9   ? 82.321  6.797  42.654  1.00 17.77 ? 515  LEU A N   1 
ATOM   3394 C CA  . LEU C 3 9   ? 81.975  8.094  43.228  1.00 17.90 ? 515  LEU A CA  1 
ATOM   3395 C C   . LEU C 3 9   ? 81.783  8.024  44.747  1.00 17.89 ? 515  LEU A C   1 
ATOM   3396 O O   . LEU C 3 9   ? 80.938  7.286  45.240  1.00 16.86 ? 515  LEU A O   1 
ATOM   3397 C CB  . LEU C 3 9   ? 80.698  8.589  42.586  1.00 17.99 ? 515  LEU A CB  1 
ATOM   3398 C CG  . LEU C 3 9   ? 80.209  9.948  43.107  1.00 18.14 ? 515  LEU A CG  1 
ATOM   3399 C CD1 . LEU C 3 9   ? 81.350  10.997 42.921  1.00 18.51 ? 515  LEU A CD1 1 
ATOM   3400 C CD2 . LEU C 3 9   ? 78.949  10.358 42.363  1.00 15.63 ? 515  LEU A CD2 1 
ATOM   3401 N N   . VAL C 3 10  ? 82.553  8.812  45.488  1.00 16.51 ? 516  VAL A N   1 
ATOM   3402 C CA  . VAL C 3 10  ? 82.420  8.752  46.931  1.00 15.88 ? 516  VAL A CA  1 
ATOM   3403 C C   . VAL C 3 10  ? 81.747  10.002 47.467  1.00 15.26 ? 516  VAL A C   1 
ATOM   3404 O O   . VAL C 3 10  ? 82.293  11.091 47.348  1.00 15.60 ? 516  VAL A O   1 
ATOM   3405 C CB  . VAL C 3 10  ? 83.813  8.602  47.584  1.00 15.62 ? 516  VAL A CB  1 
ATOM   3406 C CG1 . VAL C 3 10  ? 83.679  8.712  49.117  1.00 16.33 ? 516  VAL A CG1 1 
ATOM   3407 C CG2 . VAL C 3 10  ? 84.464  7.250  47.141  1.00 16.04 ? 516  VAL A CG2 1 
ATOM   3408 N N   . PHE C 3 11  ? 80.575  9.861  48.075  1.00 13.51 ? 517  PHE A N   1 
ATOM   3409 C CA  . PHE C 3 11  ? 79.890  11.050 48.631  1.00 13.89 ? 517  PHE A CA  1 
ATOM   3410 C C   . PHE C 3 11  ? 80.325  11.278 50.088  1.00 13.32 ? 517  PHE A C   1 
ATOM   3411 O O   . PHE C 3 11  ? 80.107  10.400 50.937  1.00 14.57 ? 517  PHE A O   1 
ATOM   3412 C CB  . PHE C 3 11  ? 78.371  10.888 48.620  1.00 10.66 ? 517  PHE A CB  1 
ATOM   3413 C CG  . PHE C 3 11  ? 77.741  10.843 47.226  1.00 16.02 ? 517  PHE A CG  1 
ATOM   3414 C CD1 . PHE C 3 11  ? 77.535  9.608  46.585  1.00 11.99 ? 517  PHE A CD1 1 
ATOM   3415 C CD2 . PHE C 3 11  ? 77.255  12.025 46.612  1.00 12.99 ? 517  PHE A CD2 1 
ATOM   3416 C CE1 . PHE C 3 11  ? 76.842  9.524  45.352  1.00 16.16 ? 517  PHE A CE1 1 
ATOM   3417 C CE2 . PHE C 3 11  ? 76.570  11.953 45.386  1.00 16.60 ? 517  PHE A CE2 1 
ATOM   3418 C CZ  . PHE C 3 11  ? 76.352  10.720 44.750  1.00 16.14 ? 517  PHE A CZ  1 
ATOM   3419 N N   . LEU C 3 12  ? 80.906  12.446 50.386  1.00 12.57 ? 518  LEU A N   1 
ATOM   3420 C CA  . LEU C 3 12  ? 81.355  12.751 51.761  1.00 13.14 ? 518  LEU A CA  1 
ATOM   3421 C C   . LEU C 3 12  ? 80.486  13.874 52.306  1.00 13.38 ? 518  LEU A C   1 
ATOM   3422 O O   . LEU C 3 12  ? 80.597  15.014 51.857  1.00 14.06 ? 518  LEU A O   1 
ATOM   3423 C CB  . LEU C 3 12  ? 82.840  13.178 51.745  1.00 10.84 ? 518  LEU A CB  1 
ATOM   3424 C CG  . LEU C 3 12  ? 83.759  12.118 51.090  1.00 10.47 ? 518  LEU A CG  1 
ATOM   3425 C CD1 . LEU C 3 12  ? 85.170  12.664 50.992  1.00 9.19  ? 518  LEU A CD1 1 
ATOM   3426 C CD2 . LEU C 3 12  ? 83.770  10.761 51.931  1.00 6.96  ? 518  LEU A CD2 1 
ATOM   3427 N N   . LEU C 3 13  ? 79.633  13.546 53.270  1.00 13.51 ? 519  LEU A N   1 
ATOM   3428 C CA  . LEU C 3 13  ? 78.692  14.512 53.840  1.00 15.24 ? 519  LEU A CA  1 
ATOM   3429 C C   . LEU C 3 13  ? 79.085  15.142 55.183  1.00 14.89 ? 519  LEU A C   1 
ATOM   3430 O O   . LEU C 3 13  ? 79.333  14.438 56.144  1.00 14.06 ? 519  LEU A O   1 
ATOM   3431 C CB  . LEU C 3 13  ? 77.326  13.860 54.022  1.00 15.17 ? 519  LEU A CB  1 
ATOM   3432 C CG  . LEU C 3 13  ? 76.788  12.957 52.896  1.00 18.28 ? 519  LEU A CG  1 
ATOM   3433 C CD1 . LEU C 3 13  ? 75.280  12.734 53.121  1.00 18.02 ? 519  LEU A CD1 1 
ATOM   3434 C CD2 . LEU C 3 13  ? 77.035  13.564 51.567  1.00 19.38 ? 519  LEU A CD2 1 
ATOM   3435 N N   . ASP C 3 14  ? 79.128  16.469 55.210  1.00 16.20 ? 520  ASP A N   1 
ATOM   3436 C CA  . ASP C 3 14  ? 79.464  17.252 56.404  1.00 15.45 ? 520  ASP A CA  1 
ATOM   3437 C C   . ASP C 3 14  ? 78.405  16.984 57.460  1.00 15.55 ? 520  ASP A C   1 
ATOM   3438 O O   . ASP C 3 14  ? 77.207  17.293 57.264  1.00 14.35 ? 520  ASP A O   1 
ATOM   3439 C CB  . ASP C 3 14  ? 79.457  18.748 56.037  1.00 16.07 ? 520  ASP A CB  1 
ATOM   3440 C CG  . ASP C 3 14  ? 79.872  19.673 57.223  1.00 17.04 ? 520  ASP A CG  1 
ATOM   3441 O OD1 . ASP C 3 14  ? 79.334  19.483 58.371  1.00 18.14 ? 520  ASP A OD1 1 
ATOM   3442 O OD2 . ASP C 3 14  ? 80.726  20.581 56.977  1.00 14.42 ? 520  ASP A OD2 1 
ATOM   3443 N N   . GLY C 3 15  ? 78.840  16.415 58.584  1.00 16.42 ? 521  GLY A N   1 
ATOM   3444 C CA  . GLY C 3 15  ? 77.935  16.073 59.684  1.00 15.18 ? 521  GLY A CA  1 
ATOM   3445 C C   . GLY C 3 15  ? 77.872  17.128 60.795  1.00 17.45 ? 521  GLY A C   1 
ATOM   3446 O O   . GLY C 3 15  ? 77.293  16.875 61.882  1.00 17.72 ? 521  GLY A O   1 
ATOM   3447 N N   . SER C 3 16  ? 78.431  18.316 60.558  1.00 16.02 ? 522  SER A N   1 
ATOM   3448 C CA  . SER C 3 16  ? 78.392  19.354 61.601  1.00 17.06 ? 522  SER A CA  1 
ATOM   3449 C C   . SER C 3 16  ? 77.025  20.065 61.772  1.00 17.84 ? 522  SER A C   1 
ATOM   3450 O O   . SER C 3 16  ? 76.111  19.892 60.949  1.00 18.02 ? 522  SER A O   1 
ATOM   3451 C CB  . SER C 3 16  ? 79.443  20.420 61.321  1.00 16.12 ? 522  SER A CB  1 
ATOM   3452 O OG  . SER C 3 16  ? 79.002  21.285 60.280  1.00 16.08 ? 522  SER A OG  1 
ATOM   3453 N N   . SER C 3 17  ? 76.907  20.861 62.840  1.00 17.04 ? 523  SER A N   1 
ATOM   3454 C CA  . SER C 3 17  ? 75.691  21.628 63.127  1.00 17.97 ? 523  SER A CA  1 
ATOM   3455 C C   . SER C 3 17  ? 75.651  22.857 62.229  1.00 19.30 ? 523  SER A C   1 
ATOM   3456 O O   . SER C 3 17  ? 74.726  23.698 62.326  1.00 18.73 ? 523  SER A O   1 
ATOM   3457 C CB  . SER C 3 17  ? 75.621  22.042 64.636  1.00 18.30 ? 523  SER A CB  1 
ATOM   3458 O OG  . SER C 3 17  ? 76.841  22.651 65.032  1.00 17.64 ? 523  SER A OG  1 
ATOM   3459 N N   . ARG C 3 18  ? 76.634  23.004 61.346  1.00 18.54 ? 524  ARG A N   1 
ATOM   3460 C CA  . ARG C 3 18  ? 76.531  24.133 60.396  1.00 21.11 ? 524  ARG A CA  1 
ATOM   3461 C C   . ARG C 3 18  ? 75.319  23.897 59.458  1.00 21.16 ? 524  ARG A C   1 
ATOM   3462 O O   . ARG C 3 18  ? 74.811  24.817 58.806  1.00 22.09 ? 524  ARG A O   1 
ATOM   3463 C CB  . ARG C 3 18  ? 77.821  24.311 59.600  1.00 20.14 ? 524  ARG A CB  1 
ATOM   3464 C CG  . ARG C 3 18  ? 78.953  24.838 60.480  1.00 24.29 ? 524  ARG A CG  1 
ATOM   3465 C CD  . ARG C 3 18  ? 78.522  26.113 61.298  1.00 26.29 ? 524  ARG A CD  1 
ATOM   3466 N NE  . ARG C 3 18  ? 79.690  26.816 61.844  1.00 28.32 ? 524  ARG A NE  1 
ATOM   3467 C CZ  . ARG C 3 18  ? 79.660  27.990 62.483  1.00 30.87 ? 524  ARG A CZ  1 
ATOM   3468 N NH1 . ARG C 3 18  ? 78.518  28.647 62.684  1.00 31.53 ? 524  ARG A NH1 1 
ATOM   3469 N NH2 . ARG C 3 18  ? 80.792  28.513 62.939  1.00 29.59 ? 524  ARG A NH2 1 
ATOM   3470 N N   . LEU C 3 19  ? 74.870  22.645 59.391  1.00 19.72 ? 525  LEU A N   1 
ATOM   3471 C CA  . LEU C 3 19  ? 73.659  22.311 58.637  1.00 19.56 ? 525  LEU A CA  1 
ATOM   3472 C C   . LEU C 3 19  ? 72.671  21.888 59.727  1.00 19.46 ? 525  LEU A C   1 
ATOM   3473 O O   . LEU C 3 19  ? 73.033  21.104 60.638  1.00 18.15 ? 525  LEU A O   1 
ATOM   3474 C CB  . LEU C 3 19  ? 73.895  21.124 57.669  1.00 18.29 ? 525  LEU A CB  1 
ATOM   3475 C CG  . LEU C 3 19  ? 74.870  21.422 56.508  1.00 18.24 ? 525  LEU A CG  1 
ATOM   3476 C CD1 . LEU C 3 19  ? 75.035  20.183 55.586  1.00 18.64 ? 525  LEU A CD1 1 
ATOM   3477 C CD2 . LEU C 3 19  ? 74.355  22.625 55.693  1.00 17.42 ? 525  LEU A CD2 1 
ATOM   3478 N N   . SER C 3 20  ? 71.448  22.417 59.663  1.00 18.51 ? 526  SER A N   1 
ATOM   3479 C CA  . SER C 3 20  ? 70.415  22.010 60.618  1.00 18.63 ? 526  SER A CA  1 
ATOM   3480 C C   . SER C 3 20  ? 69.946  20.610 60.219  1.00 18.16 ? 526  SER A C   1 
ATOM   3481 O O   . SER C 3 20  ? 70.284  20.102 59.132  1.00 17.83 ? 526  SER A O   1 
ATOM   3482 C CB  . SER C 3 20  ? 69.192  22.964 60.566  1.00 17.73 ? 526  SER A CB  1 
ATOM   3483 O OG  . SER C 3 20  ? 68.584  22.942 59.278  1.00 18.31 ? 526  SER A OG  1 
ATOM   3484 N N   . GLU C 3 21  ? 69.157  19.996 61.093  1.00 18.32 ? 527  GLU A N   1 
ATOM   3485 C CA  . GLU C 3 21  ? 68.586  18.676 60.837  1.00 17.88 ? 527  GLU A CA  1 
ATOM   3486 C C   . GLU C 3 21  ? 67.818  18.725 59.499  1.00 18.29 ? 527  GLU A C   1 
ATOM   3487 O O   . GLU C 3 21  ? 67.922  17.807 58.681  1.00 17.06 ? 527  GLU A O   1 
ATOM   3488 C CB  . GLU C 3 21  ? 67.608  18.321 61.947  1.00 19.73 ? 527  GLU A CB  1 
ATOM   3489 C CG  . GLU C 3 21  ? 66.966  16.950 61.825  1.00 22.93 ? 527  GLU A CG  1 
ATOM   3490 C CD  . GLU C 3 21  ? 66.054  16.647 62.999  1.00 25.50 ? 527  GLU A CD  1 
ATOM   3491 O OE1 . GLU C 3 21  ? 66.339  17.121 64.123  1.00 25.91 ? 527  GLU A OE1 1 
ATOM   3492 O OE2 . GLU C 3 21  ? 65.047  15.927 62.813  1.00 29.66 ? 527  GLU A OE2 1 
ATOM   3493 N N   . ALA C 3 22  ? 67.051  19.786 59.267  1.00 17.28 ? 528  ALA A N   1 
ATOM   3494 C CA  . ALA C 3 22  ? 66.283  19.848 58.007  1.00 18.57 ? 528  ALA A CA  1 
ATOM   3495 C C   . ALA C 3 22  ? 67.153  20.122 56.770  1.00 17.76 ? 528  ALA A C   1 
ATOM   3496 O O   . ALA C 3 22  ? 66.901  19.562 55.684  1.00 18.56 ? 528  ALA A O   1 
ATOM   3497 C CB  . ALA C 3 22  ? 65.183  20.889 58.098  1.00 18.66 ? 528  ALA A CB  1 
ATOM   3498 N N   . GLU C 3 23  ? 68.140  20.996 56.907  1.00 17.63 ? 529  GLU A N   1 
ATOM   3499 C CA  . GLU C 3 23  ? 69.062  21.241 55.803  1.00 17.49 ? 529  GLU A CA  1 
ATOM   3500 C C   . GLU C 3 23  ? 69.861  19.947 55.527  1.00 18.02 ? 529  GLU A C   1 
ATOM   3501 O O   . GLU C 3 23  ? 70.244  19.664 54.377  1.00 17.26 ? 529  GLU A O   1 
ATOM   3502 C CB  . GLU C 3 23  ? 70.028  22.349 56.154  1.00 17.99 ? 529  GLU A CB  1 
ATOM   3503 C CG  . GLU C 3 23  ? 69.383  23.695 56.226  1.00 20.34 ? 529  GLU A CG  1 
ATOM   3504 C CD  . GLU C 3 23  ? 70.376  24.780 56.663  1.00 22.09 ? 529  GLU A CD  1 
ATOM   3505 O OE1 . GLU C 3 23  ? 70.409  25.872 56.061  1.00 22.48 ? 529  GLU A OE1 1 
ATOM   3506 O OE2 . GLU C 3 23  ? 71.127  24.539 57.621  1.00 22.42 ? 529  GLU A OE2 1 
ATOM   3507 N N   . PHE C 3 24  ? 70.137  19.160 56.561  1.00 15.79 ? 530  PHE A N   1 
ATOM   3508 C CA  . PHE C 3 24  ? 70.858  17.916 56.281  1.00 16.23 ? 530  PHE A CA  1 
ATOM   3509 C C   . PHE C 3 24  ? 69.959  16.991 55.417  1.00 16.32 ? 530  PHE A C   1 
ATOM   3510 O O   . PHE C 3 24  ? 70.477  16.266 54.579  1.00 15.97 ? 530  PHE A O   1 
ATOM   3511 C CB  . PHE C 3 24  ? 71.294  17.172 57.584  1.00 13.71 ? 530  PHE A CB  1 
ATOM   3512 C CG  . PHE C 3 24  ? 72.238  15.985 57.339  1.00 13.73 ? 530  PHE A CG  1 
ATOM   3513 C CD1 . PHE C 3 24  ? 71.848  14.697 57.699  1.00 13.68 ? 530  PHE A CD1 1 
ATOM   3514 C CD2 . PHE C 3 24  ? 73.544  16.186 56.800  1.00 11.14 ? 530  PHE A CD2 1 
ATOM   3515 C CE1 . PHE C 3 24  ? 72.703  13.606 57.548  1.00 11.78 ? 530  PHE A CE1 1 
ATOM   3516 C CE2 . PHE C 3 24  ? 74.424  15.111 56.640  1.00 13.50 ? 530  PHE A CE2 1 
ATOM   3517 C CZ  . PHE C 3 24  ? 74.002  13.804 57.015  1.00 13.43 ? 530  PHE A CZ  1 
ATOM   3518 N N   . GLU C 3 25  ? 68.635  17.008 55.618  1.00 16.25 ? 531  GLU A N   1 
ATOM   3519 C CA  . GLU C 3 25  ? 67.737  16.157 54.797  1.00 16.88 ? 531  GLU A CA  1 
ATOM   3520 C C   . GLU C 3 25  ? 67.817  16.626 53.351  1.00 16.94 ? 531  GLU A C   1 
ATOM   3521 O O   . GLU C 3 25  ? 67.745  15.827 52.413  1.00 17.63 ? 531  GLU A O   1 
ATOM   3522 C CB  . GLU C 3 25  ? 66.272  16.254 55.255  1.00 15.67 ? 531  GLU A CB  1 
ATOM   3523 C CG  . GLU C 3 25  ? 66.026  15.576 56.557  1.00 17.49 ? 531  GLU A CG  1 
ATOM   3524 C CD  . GLU C 3 25  ? 66.292  14.073 56.495  1.00 21.26 ? 531  GLU A CD  1 
ATOM   3525 O OE1 . GLU C 3 25  ? 67.226  13.575 57.182  1.00 22.26 ? 531  GLU A OE1 1 
ATOM   3526 O OE2 . GLU C 3 25  ? 65.559  13.378 55.757  1.00 19.91 ? 531  GLU A OE2 1 
ATOM   3527 N N   . VAL C 3 26  ? 67.953  17.933 53.155  1.00 16.86 ? 532  VAL A N   1 
ATOM   3528 C CA  . VAL C 3 26  ? 68.051  18.425 51.781  1.00 16.38 ? 532  VAL A CA  1 
ATOM   3529 C C   . VAL C 3 26  ? 69.373  17.908 51.158  1.00 16.69 ? 532  VAL A C   1 
ATOM   3530 O O   . VAL C 3 26  ? 69.438  17.549 49.984  1.00 16.44 ? 532  VAL A O   1 
ATOM   3531 C CB  . VAL C 3 26  ? 67.981  19.983 51.767  1.00 15.13 ? 532  VAL A CB  1 
ATOM   3532 C CG1 . VAL C 3 26  ? 68.128  20.514 50.300  1.00 13.16 ? 532  VAL A CG1 1 
ATOM   3533 C CG2 . VAL C 3 26  ? 66.617  20.420 52.420  1.00 14.54 ? 532  VAL A CG2 1 
ATOM   3534 N N   . LEU C 3 27  ? 70.425  17.837 51.962  1.00 16.09 ? 533  LEU A N   1 
ATOM   3535 C CA  . LEU C 3 27  ? 71.688  17.359 51.441  1.00 17.15 ? 533  LEU A CA  1 
ATOM   3536 C C   . LEU C 3 27  ? 71.537  15.872 51.064  1.00 17.91 ? 533  LEU A C   1 
ATOM   3537 O O   . LEU C 3 27  ? 72.000  15.435 50.003  1.00 18.89 ? 533  LEU A O   1 
ATOM   3538 C CB  . LEU C 3 27  ? 72.761  17.535 52.499  1.00 16.55 ? 533  LEU A CB  1 
ATOM   3539 C CG  . LEU C 3 27  ? 74.132  16.960 52.124  1.00 16.60 ? 533  LEU A CG  1 
ATOM   3540 C CD1 . LEU C 3 27  ? 74.639  17.487 50.780  1.00 14.51 ? 533  LEU A CD1 1 
ATOM   3541 C CD2 . LEU C 3 27  ? 75.087  17.322 53.275  1.00 15.58 ? 533  LEU A CD2 1 
ATOM   3542 N N   . LYS C 3 28  ? 70.886  15.105 51.925  1.00 16.28 ? 534  LYS A N   1 
ATOM   3543 C CA  . LYS C 3 28  ? 70.701  13.672 51.659  1.00 16.50 ? 534  LYS A CA  1 
ATOM   3544 C C   . LYS C 3 28  ? 69.844  13.500 50.397  1.00 16.63 ? 534  LYS A C   1 
ATOM   3545 O O   . LYS C 3 28  ? 70.111  12.624 49.582  1.00 13.68 ? 534  LYS A O   1 
ATOM   3546 C CB  . LYS C 3 28  ? 70.050  13.002 52.859  1.00 18.21 ? 534  LYS A CB  1 
ATOM   3547 C CG  . LYS C 3 28  ? 70.924  13.015 54.116  1.00 20.16 ? 534  LYS A CG  1 
ATOM   3548 C CD  . LYS C 3 28  ? 70.092  12.827 55.390  1.00 21.15 ? 534  LYS A CD  1 
ATOM   3549 C CE  . LYS C 3 28  ? 69.273  11.560 55.264  1.00 22.72 ? 534  LYS A CE  1 
ATOM   3550 N NZ  . LYS C 3 28  ? 68.476  11.301 56.495  1.00 19.99 ? 534  LYS A NZ  1 
ATOM   3551 N N   . ALA C 3 29  ? 68.841  14.370 50.229  1.00 16.54 ? 535  ALA A N   1 
ATOM   3552 C CA  . ALA C 3 29  ? 67.961  14.334 49.032  1.00 17.86 ? 535  ALA A CA  1 
ATOM   3553 C C   . ALA C 3 29  ? 68.796  14.568 47.756  1.00 17.36 ? 535  ALA A C   1 
ATOM   3554 O O   . ALA C 3 29  ? 68.588  13.891 46.738  1.00 19.08 ? 535  ALA A O   1 
ATOM   3555 C CB  . ALA C 3 29  ? 66.809  15.408 49.179  1.00 18.99 ? 535  ALA A CB  1 
ATOM   3556 N N   . PHE C 3 30  ? 69.743  15.511 47.808  1.00 17.23 ? 536  PHE A N   1 
ATOM   3557 C CA  . PHE C 3 30  ? 70.662  15.775 46.672  1.00 17.00 ? 536  PHE A CA  1 
ATOM   3558 C C   . PHE C 3 30  ? 71.469  14.489 46.349  1.00 18.00 ? 536  PHE A C   1 
ATOM   3559 O O   . PHE C 3 30  ? 71.668  14.154 45.177  1.00 17.09 ? 536  PHE A O   1 
ATOM   3560 C CB  . PHE C 3 30  ? 71.636  16.916 47.040  1.00 16.74 ? 536  PHE A CB  1 
ATOM   3561 C CG  . PHE C 3 30  ? 72.824  17.061 46.109  1.00 16.74 ? 536  PHE A CG  1 
ATOM   3562 C CD1 . PHE C 3 30  ? 72.685  17.642 44.861  1.00 17.23 ? 536  PHE A CD1 1 
ATOM   3563 C CD2 . PHE C 3 30  ? 74.062  16.599 46.481  1.00 18.69 ? 536  PHE A CD2 1 
ATOM   3564 C CE1 . PHE C 3 30  ? 73.767  17.766 43.989  1.00 18.74 ? 536  PHE A CE1 1 
ATOM   3565 C CE2 . PHE C 3 30  ? 75.148  16.705 45.628  1.00 19.13 ? 536  PHE A CE2 1 
ATOM   3566 C CZ  . PHE C 3 30  ? 75.007  17.294 44.371  1.00 20.27 ? 536  PHE A CZ  1 
ATOM   3567 N N   . VAL C 3 31  ? 71.938  13.780 47.388  1.00 17.87 ? 537  VAL A N   1 
ATOM   3568 C CA  . VAL C 3 31  ? 72.717  12.545 47.199  1.00 18.05 ? 537  VAL A CA  1 
ATOM   3569 C C   . VAL C 3 31  ? 71.819  11.531 46.482  1.00 19.24 ? 537  VAL A C   1 
ATOM   3570 O O   . VAL C 3 31  ? 72.244  10.905 45.502  1.00 18.89 ? 537  VAL A O   1 
ATOM   3571 C CB  . VAL C 3 31  ? 73.207  11.918 48.589  1.00 18.02 ? 537  VAL A CB  1 
ATOM   3572 C CG1 . VAL C 3 31  ? 73.808  10.511 48.363  1.00 17.08 ? 537  VAL A CG1 1 
ATOM   3573 C CG2 . VAL C 3 31  ? 74.255  12.844 49.227  1.00 17.00 ? 537  VAL A CG2 1 
ATOM   3574 N N   . VAL C 3 32  ? 70.581  11.366 46.960  1.00 18.82 ? 538  VAL A N   1 
ATOM   3575 C CA  . VAL C 3 32  ? 69.672  10.412 46.307  1.00 20.17 ? 538  VAL A CA  1 
ATOM   3576 C C   . VAL C 3 32  ? 69.398  10.837 44.863  1.00 19.54 ? 538  VAL A C   1 
ATOM   3577 O O   . VAL C 3 32  ? 69.453  10.032 43.952  1.00 18.89 ? 538  VAL A O   1 
ATOM   3578 C CB  . VAL C 3 32  ? 68.377  10.268 47.103  1.00 20.69 ? 538  VAL A CB  1 
ATOM   3579 C CG1 . VAL C 3 32  ? 67.269  9.555  46.265  1.00 20.93 ? 538  VAL A CG1 1 
ATOM   3580 C CG2 . VAL C 3 32  ? 68.701  9.475  48.376  1.00 21.81 ? 538  VAL A CG2 1 
ATOM   3581 N N   . ASP C 3 33  ? 69.138  12.121 44.657  1.00 20.34 ? 539  ASP A N   1 
ATOM   3582 C CA  . ASP C 3 33  ? 68.924  12.646 43.296  1.00 21.13 ? 539  ASP A CA  1 
ATOM   3583 C C   . ASP C 3 33  ? 70.140  12.373 42.411  1.00 20.63 ? 539  ASP A C   1 
ATOM   3584 O O   . ASP C 3 33  ? 70.007  12.103 41.198  1.00 18.87 ? 539  ASP A O   1 
ATOM   3585 C CB  . ASP C 3 33  ? 68.686  14.168 43.307  1.00 21.38 ? 539  ASP A CB  1 
ATOM   3586 C CG  . ASP C 3 33  ? 67.308  14.557 43.836  1.00 23.55 ? 539  ASP A CG  1 
ATOM   3587 O OD1 . ASP C 3 33  ? 66.499  13.664 44.168  1.00 22.07 ? 539  ASP A OD1 1 
ATOM   3588 O OD2 . ASP C 3 33  ? 67.059  15.784 43.931  1.00 25.61 ? 539  ASP A OD2 1 
ATOM   3589 N N   . MET C 3 34  ? 71.338  12.513 42.968  1.00 19.77 ? 540  MET A N   1 
ATOM   3590 C CA  . MET C 3 34  ? 72.531  12.247 42.153  1.00 19.30 ? 540  MET A CA  1 
ATOM   3591 C C   . MET C 3 34  ? 72.551  10.762 41.762  1.00 19.47 ? 540  MET A C   1 
ATOM   3592 O O   . MET C 3 34  ? 72.775  10.428 40.586  1.00 18.64 ? 540  MET A O   1 
ATOM   3593 C CB  . MET C 3 34  ? 73.821  12.611 42.895  1.00 19.65 ? 540  MET A CB  1 
ATOM   3594 C CG  . MET C 3 34  ? 74.028  14.113 43.097  1.00 23.34 ? 540  MET A CG  1 
ATOM   3595 S SD  . MET C 3 34  ? 74.478  14.936 41.534  1.00 27.89 ? 540  MET A SD  1 
ATOM   3596 C CE  . MET C 3 34  ? 76.321  14.451 41.554  1.00 24.81 ? 540  MET A CE  1 
ATOM   3597 N N   . MET C 3 35  ? 72.271  9.889  42.720  1.00 18.61 ? 541  MET A N   1 
ATOM   3598 C CA  . MET C 3 35  ? 72.282  8.443  42.446  1.00 22.13 ? 541  MET A CA  1 
ATOM   3599 C C   . MET C 3 35  ? 71.308  8.076  41.346  1.00 22.34 ? 541  MET A C   1 
ATOM   3600 O O   . MET C 3 35  ? 71.597  7.197  40.556  1.00 21.60 ? 541  MET A O   1 
ATOM   3601 C CB  . MET C 3 35  ? 71.945  7.611  43.692  1.00 21.25 ? 541  MET A CB  1 
ATOM   3602 C CG  . MET C 3 35  ? 73.048  7.612  44.727  1.00 23.83 ? 541  MET A CG  1 
ATOM   3603 S SD  . MET C 3 35  ? 72.513  6.862  46.271  1.00 29.03 ? 541  MET A SD  1 
ATOM   3604 C CE  . MET C 3 35  ? 74.037  6.864  47.171  1.00 28.07 ? 541  MET A CE  1 
ATOM   3605 N N   . GLU C 3 36  ? 70.175  8.765  41.298  1.00 23.00 ? 542  GLU A N   1 
ATOM   3606 C CA  . GLU C 3 36  ? 69.170  8.499  40.269  1.00 25.20 ? 542  GLU A CA  1 
ATOM   3607 C C   . GLU C 3 36  ? 69.663  8.871  38.874  1.00 24.72 ? 542  GLU A C   1 
ATOM   3608 O O   . GLU C 3 36  ? 69.142  8.405  37.873  1.00 25.68 ? 542  GLU A O   1 
ATOM   3609 C CB  . GLU C 3 36  ? 67.864  9.253  40.597  1.00 26.99 ? 542  GLU A CB  1 
ATOM   3610 C CG  . GLU C 3 36  ? 67.092  8.603  41.745  1.00 30.89 ? 542  GLU A CG  1 
ATOM   3611 C CD  . GLU C 3 36  ? 65.838  9.374  42.128  1.00 35.21 ? 542  GLU A CD  1 
ATOM   3612 O OE1 . GLU C 3 36  ? 65.315  10.149 41.284  1.00 36.78 ? 542  GLU A OE1 1 
ATOM   3613 O OE2 . GLU C 3 36  ? 65.366  9.200  43.272  1.00 38.02 ? 542  GLU A OE2 1 
ATOM   3614 N N   . ARG C 3 37  ? 70.671  9.719  38.803  1.00 22.51 ? 543  ARG A N   1 
ATOM   3615 C CA  . ARG C 3 37  ? 71.226  10.118 37.527  1.00 22.01 ? 543  ARG A CA  1 
ATOM   3616 C C   . ARG C 3 37  ? 72.549  9.403  37.197  1.00 20.97 ? 543  ARG A C   1 
ATOM   3617 O O   . ARG C 3 37  ? 73.337  9.833  36.337  1.00 21.73 ? 543  ARG A O   1 
ATOM   3618 C CB  . ARG C 3 37  ? 71.404  11.621 37.522  1.00 20.46 ? 543  ARG A CB  1 
ATOM   3619 C CG  . ARG C 3 37  ? 70.077  12.335 37.695  1.00 23.27 ? 543  ARG A CG  1 
ATOM   3620 C CD  . ARG C 3 37  ? 70.263  13.797 38.120  1.00 24.96 ? 543  ARG A CD  1 
ATOM   3621 N NE  . ARG C 3 37  ? 69.026  14.558 37.916  1.00 26.71 ? 543  ARG A NE  1 
ATOM   3622 C CZ  . ARG C 3 37  ? 67.910  14.399 38.619  1.00 27.61 ? 543  ARG A CZ  1 
ATOM   3623 N NH1 . ARG C 3 37  ? 67.839  13.515 39.607  1.00 27.42 ? 543  ARG A NH1 1 
ATOM   3624 N NH2 . ARG C 3 37  ? 66.841  15.114 38.308  1.00 28.38 ? 543  ARG A NH2 1 
ATOM   3625 N N   . LEU C 3 38  ? 72.807  8.316  37.890  1.00 20.44 ? 544  LEU A N   1 
ATOM   3626 C CA  . LEU C 3 38  ? 74.037  7.575  37.650  1.00 22.71 ? 544  LEU A CA  1 
ATOM   3627 C C   . LEU C 3 38  ? 73.620  6.138  37.441  1.00 24.28 ? 544  LEU A C   1 
ATOM   3628 O O   . LEU C 3 38  ? 72.648  5.684  38.058  1.00 24.81 ? 544  LEU A O   1 
ATOM   3629 C CB  . LEU C 3 38  ? 74.961  7.638  38.888  1.00 20.14 ? 544  LEU A CB  1 
ATOM   3630 C CG  . LEU C 3 38  ? 75.404  9.022  39.371  1.00 19.23 ? 544  LEU A CG  1 
ATOM   3631 C CD1 . LEU C 3 38  ? 75.961  8.887  40.840  1.00 17.94 ? 544  LEU A CD1 1 
ATOM   3632 C CD2 . LEU C 3 38  ? 76.451  9.643  38.392  1.00 15.30 ? 544  LEU A CD2 1 
ATOM   3633 N N   . ARG C 3 39  ? 74.348  5.433  36.579  1.00 26.15 ? 545  ARG A N   1 
ATOM   3634 C CA  . ARG C 3 39  ? 74.068  4.023  36.321  1.00 26.54 ? 545  ARG A CA  1 
ATOM   3635 C C   . ARG C 3 39  ? 74.777  3.259  37.417  1.00 26.95 ? 545  ARG A C   1 
ATOM   3636 O O   . ARG C 3 39  ? 75.916  2.726  37.226  1.00 26.03 ? 545  ARG A O   1 
ATOM   3637 C CB  . ARG C 3 39  ? 74.602  3.605  34.950  1.00 27.23 ? 545  ARG A CB  1 
ATOM   3638 C CG  . ARG C 3 39  ? 74.069  2.227  34.511  1.00 28.91 ? 545  ARG A CG  1 
ATOM   3639 C CD  . ARG C 3 39  ? 74.301  2.003  33.015  1.00 28.83 ? 545  ARG A CD  1 
ATOM   3640 N NE  . ARG C 3 39  ? 73.820  0.684  32.599  1.00 30.30 ? 545  ARG A NE  1 
ATOM   3641 C CZ  . ARG C 3 39  ? 73.914  0.227  31.355  1.00 27.49 ? 545  ARG A CZ  1 
ATOM   3642 N NH1 . ARG C 3 39  ? 74.460  0.974  30.415  1.00 27.17 ? 545  ARG A NH1 1 
ATOM   3643 N NH2 . ARG C 3 39  ? 73.496  -0.990 31.067  1.00 29.92 ? 545  ARG A NH2 1 
ATOM   3644 N N   . VAL C 3 40  ? 74.095  3.195  38.561  1.00 25.72 ? 546  VAL A N   1 
ATOM   3645 C CA  . VAL C 3 40  ? 74.630  2.548  39.730  1.00 26.97 ? 546  VAL A CA  1 
ATOM   3646 C C   . VAL C 3 40  ? 74.786  1.079  39.516  1.00 28.59 ? 546  VAL A C   1 
ATOM   3647 O O   . VAL C 3 40  ? 73.796  0.372  39.367  1.00 29.89 ? 546  VAL A O   1 
ATOM   3648 C CB  . VAL C 3 40  ? 73.756  2.791  40.971  1.00 25.37 ? 546  VAL A CB  1 
ATOM   3649 C CG1 . VAL C 3 40  ? 74.234  1.918  42.101  1.00 25.63 ? 546  VAL A CG1 1 
ATOM   3650 C CG2 . VAL C 3 40  ? 73.851  4.267  41.374  1.00 24.35 ? 546  VAL A CG2 1 
ATOM   3651 N N   . SER C 3 41  ? 76.036  0.621  39.537  1.00 29.17 ? 547  SER A N   1 
ATOM   3652 C CA  . SER C 3 41  ? 76.350  -0.779 39.311  1.00 29.69 ? 547  SER A CA  1 
ATOM   3653 C C   . SER C 3 41  ? 77.863  -1.029 39.422  1.00 29.92 ? 547  SER A C   1 
ATOM   3654 O O   . SER C 3 41  ? 78.664  -0.147 39.118  1.00 29.29 ? 547  SER A O   1 
ATOM   3655 C CB  . SER C 3 41  ? 75.901  -1.161 37.908  1.00 29.99 ? 547  SER A CB  1 
ATOM   3656 O OG  . SER C 3 41  ? 76.666  -2.255 37.467  1.00 30.49 ? 547  SER A OG  1 
ATOM   3657 N N   . GLN C 3 42  ? 78.248  -2.230 39.843  1.00 29.93 ? 548  GLN A N   1 
ATOM   3658 C CA  . GLN C 3 42  ? 79.664  -2.547 39.965  1.00 31.40 ? 548  GLN A CA  1 
ATOM   3659 C C   . GLN C 3 42  ? 80.371  -2.413 38.613  1.00 32.47 ? 548  GLN A C   1 
ATOM   3660 O O   . GLN C 3 42  ? 81.559  -2.129 38.559  1.00 32.65 ? 548  GLN A O   1 
ATOM   3661 C CB  . GLN C 3 42  ? 79.858  -3.965 40.492  1.00 31.04 ? 548  GLN A CB  1 
ATOM   3662 C CG  . GLN C 3 42  ? 79.441  -4.153 41.930  1.00 32.49 ? 548  GLN A CG  1 
ATOM   3663 C CD  . GLN C 3 42  ? 80.279  -3.326 42.918  1.00 32.15 ? 548  GLN A CD  1 
ATOM   3664 O OE1 . GLN C 3 42  ? 81.527  -3.393 42.926  1.00 32.11 ? 548  GLN A OE1 1 
ATOM   3665 N NE2 . GLN C 3 42  ? 79.593  -2.567 43.769  1.00 30.47 ? 548  GLN A NE2 1 
ATOM   3666 N N   . LYS C 3 43  ? 79.631  -2.582 37.522  1.00 32.27 ? 549  LYS A N   1 
ATOM   3667 C CA  . LYS C 3 43  ? 80.226  -2.496 36.188  1.00 32.44 ? 549  LYS A CA  1 
ATOM   3668 C C   . LYS C 3 43  ? 80.246  -1.097 35.607  1.00 30.86 ? 549  LYS A C   1 
ATOM   3669 O O   . LYS C 3 43  ? 80.893  -0.852 34.599  1.00 29.75 ? 549  LYS A O   1 
ATOM   3670 C CB  . LYS C 3 43  ? 79.446  -3.401 35.220  1.00 35.97 ? 549  LYS A CB  1 
ATOM   3671 C CG  . LYS C 3 43  ? 79.673  -4.906 35.441  1.00 40.95 ? 549  LYS A CG  1 
ATOM   3672 C CD  . LYS C 3 43  ? 78.885  -5.737 34.425  1.00 43.22 ? 549  LYS A CD  1 
ATOM   3673 C CE  . LYS C 3 43  ? 79.251  -7.228 34.478  1.00 45.71 ? 549  LYS A CE  1 
ATOM   3674 N NZ  . LYS C 3 43  ? 78.433  -8.011 33.466  1.00 47.86 ? 549  LYS A NZ  1 
ATOM   3675 N N   . TRP C 3 44  ? 79.497  -0.187 36.219  1.00 30.12 ? 550  TRP A N   1 
ATOM   3676 C CA  . TRP C 3 44  ? 79.409  1.181  35.721  1.00 28.69 ? 550  TRP A CA  1 
ATOM   3677 C C   . TRP C 3 44  ? 79.781  2.172  36.835  1.00 28.05 ? 550  TRP A C   1 
ATOM   3678 O O   . TRP C 3 44  ? 80.974  2.336  37.132  1.00 26.64 ? 550  TRP A O   1 
ATOM   3679 C CB  . TRP C 3 44  ? 77.991  1.426  35.181  1.00 29.17 ? 550  TRP A CB  1 
ATOM   3680 C CG  . TRP C 3 44  ? 77.644  0.510  34.004  1.00 29.60 ? 550  TRP A CG  1 
ATOM   3681 C CD1 . TRP C 3 44  ? 76.968  -0.684 34.052  1.00 28.80 ? 550  TRP A CD1 1 
ATOM   3682 C CD2 . TRP C 3 44  ? 77.969  0.741  32.618  1.00 28.05 ? 550  TRP A CD2 1 
ATOM   3683 N NE1 . TRP C 3 44  ? 76.844  -1.207 32.770  1.00 29.42 ? 550  TRP A NE1 1 
ATOM   3684 C CE2 . TRP C 3 44  ? 77.448  -0.355 31.879  1.00 28.67 ? 550  TRP A CE2 1 
ATOM   3685 C CE3 . TRP C 3 44  ? 78.639  1.765  31.931  1.00 27.71 ? 550  TRP A CE3 1 
ATOM   3686 C CZ2 . TRP C 3 44  ? 77.582  -0.445 30.489  1.00 29.20 ? 550  TRP A CZ2 1 
ATOM   3687 C CZ3 . TRP C 3 44  ? 78.770  1.682  30.546  1.00 29.54 ? 550  TRP A CZ3 1 
ATOM   3688 C CH2 . TRP C 3 44  ? 78.236  0.576  29.835  1.00 28.88 ? 550  TRP A CH2 1 
ATOM   3689 N N   . VAL C 3 45  ? 78.782  2.793  37.467  1.00 24.99 ? 551  VAL A N   1 
ATOM   3690 C CA  . VAL C 3 45  ? 79.084  3.725  38.528  1.00 22.81 ? 551  VAL A CA  1 
ATOM   3691 C C   . VAL C 3 45  ? 78.908  3.086  39.882  1.00 22.60 ? 551  VAL A C   1 
ATOM   3692 O O   . VAL C 3 45  ? 77.806  2.666  40.221  1.00 23.48 ? 551  VAL A O   1 
ATOM   3693 C CB  . VAL C 3 45  ? 78.194  5.001  38.492  1.00 22.83 ? 551  VAL A CB  1 
ATOM   3694 C CG1 . VAL C 3 45  ? 78.716  6.028  39.566  1.00 21.89 ? 551  VAL A CG1 1 
ATOM   3695 C CG2 . VAL C 3 45  ? 78.227  5.646  37.127  1.00 21.53 ? 551  VAL A CG2 1 
ATOM   3696 N N   . ARG C 3 46  ? 79.988  2.971  40.649  1.00 21.09 ? 552  ARG A N   1 
ATOM   3697 C CA  . ARG C 3 46  ? 79.841  2.433  41.979  1.00 21.61 ? 552  ARG A CA  1 
ATOM   3698 C C   . ARG C 3 46  ? 79.771  3.672  42.875  1.00 21.11 ? 552  ARG A C   1 
ATOM   3699 O O   . ARG C 3 46  ? 80.326  4.728  42.517  1.00 20.88 ? 552  ARG A O   1 
ATOM   3700 C CB  . ARG C 3 46  ? 81.041  1.604  42.405  1.00 23.28 ? 552  ARG A CB  1 
ATOM   3701 C CG  . ARG C 3 46  ? 81.382  0.444  41.526  1.00 24.73 ? 552  ARG A CG  1 
ATOM   3702 C CD  . ARG C 3 46  ? 82.889  0.294  41.618  1.00 29.01 ? 552  ARG A CD  1 
ATOM   3703 N NE  . ARG C 3 46  ? 83.283  -0.652 42.634  1.00 29.52 ? 552  ARG A NE  1 
ATOM   3704 C CZ  . ARG C 3 46  ? 84.500  -0.773 43.167  1.00 29.24 ? 552  ARG A CZ  1 
ATOM   3705 N NH1 . ARG C 3 46  ? 85.521  0.005  42.827  1.00 28.81 ? 552  ARG A NH1 1 
ATOM   3706 N NH2 . ARG C 3 46  ? 84.693  -1.739 44.042  1.00 30.88 ? 552  ARG A NH2 1 
ATOM   3707 N N   . VAL C 3 47  ? 79.101  3.544  44.018  1.00 19.68 ? 553  VAL A N   1 
ATOM   3708 C CA  . VAL C 3 47  ? 78.975  4.668  44.931  1.00 19.95 ? 553  VAL A CA  1 
ATOM   3709 C C   . VAL C 3 47  ? 79.311  4.318  46.380  1.00 19.11 ? 553  VAL A C   1 
ATOM   3710 O O   . VAL C 3 47  ? 79.213  3.166  46.807  1.00 18.64 ? 553  VAL A O   1 
ATOM   3711 C CB  . VAL C 3 47  ? 77.539  5.260  44.919  1.00 19.61 ? 553  VAL A CB  1 
ATOM   3712 C CG1 . VAL C 3 47  ? 77.147  5.693  43.498  1.00 19.08 ? 553  VAL A CG1 1 
ATOM   3713 C CG2 . VAL C 3 47  ? 76.538  4.218  45.507  1.00 20.41 ? 553  VAL A CG2 1 
ATOM   3714 N N   . ALA C 3 48  ? 79.686  5.349  47.134  1.00 17.63 ? 554  ALA A N   1 
ATOM   3715 C CA  . ALA C 3 48  ? 80.025  5.224  48.544  1.00 16.61 ? 554  ALA A CA  1 
ATOM   3716 C C   . ALA C 3 48  ? 79.461  6.449  49.250  1.00 16.37 ? 554  ALA A C   1 
ATOM   3717 O O   . ALA C 3 48  ? 79.365  7.546  48.665  1.00 14.51 ? 554  ALA A O   1 
ATOM   3718 C CB  . ALA C 3 48  ? 81.580  5.144  48.707  1.00 16.83 ? 554  ALA A CB  1 
ATOM   3719 N N   . VAL C 3 49  ? 79.070  6.282  50.509  1.00 16.01 ? 555  VAL A N   1 
ATOM   3720 C CA  . VAL C 3 49  ? 78.496  7.393  51.225  1.00 16.48 ? 555  VAL A CA  1 
ATOM   3721 C C   . VAL C 3 49  ? 79.024  7.367  52.637  1.00 17.19 ? 555  VAL A C   1 
ATOM   3722 O O   . VAL C 3 49  ? 78.800  6.376  53.351  1.00 16.97 ? 555  VAL A O   1 
ATOM   3723 C CB  . VAL C 3 49  ? 76.925  7.290  51.313  1.00 15.76 ? 555  VAL A CB  1 
ATOM   3724 C CG1 . VAL C 3 49  ? 76.386  8.398  52.259  1.00 16.75 ? 555  VAL A CG1 1 
ATOM   3725 C CG2 . VAL C 3 49  ? 76.288  7.421  49.921  1.00 15.88 ? 555  VAL A CG2 1 
ATOM   3726 N N   . VAL C 3 50  ? 79.656  8.478  53.025  1.00 16.93 ? 556  VAL A N   1 
ATOM   3727 C CA  . VAL C 3 50  ? 80.228  8.674  54.349  1.00 17.66 ? 556  VAL A CA  1 
ATOM   3728 C C   . VAL C 3 50  ? 79.782  9.999  54.981  1.00 18.22 ? 556  VAL A C   1 
ATOM   3729 O O   . VAL C 3 50  ? 79.790  11.065 54.327  1.00 19.16 ? 556  VAL A O   1 
ATOM   3730 C CB  . VAL C 3 50  ? 81.778  8.692  54.271  1.00 18.41 ? 556  VAL A CB  1 
ATOM   3731 C CG1 . VAL C 3 50  ? 82.393  8.864  55.692  1.00 16.50 ? 556  VAL A CG1 1 
ATOM   3732 C CG2 . VAL C 3 50  ? 82.266  7.387  53.615  1.00 16.39 ? 556  VAL A CG2 1 
ATOM   3733 N N   . GLU C 3 51  ? 79.324  9.928  56.228  1.00 17.71 ? 557  GLU A N   1 
ATOM   3734 C CA  . GLU C 3 51  ? 78.957  11.126 56.978  1.00 18.63 ? 557  GLU A CA  1 
ATOM   3735 C C   . GLU C 3 51  ? 80.150  11.382 57.927  1.00 18.62 ? 557  GLU A C   1 
ATOM   3736 O O   . GLU C 3 51  ? 80.543  10.495 58.691  1.00 19.68 ? 557  GLU A O   1 
ATOM   3737 C CB  . GLU C 3 51  ? 77.663  10.898 57.800  1.00 18.82 ? 557  GLU A CB  1 
ATOM   3738 C CG  . GLU C 3 51  ? 77.359  12.026 58.739  1.00 17.79 ? 557  GLU A CG  1 
ATOM   3739 C CD  . GLU C 3 51  ? 77.992  11.807 60.098  1.00 21.39 ? 557  GLU A CD  1 
ATOM   3740 O OE1 . GLU C 3 51  ? 78.840  12.630 60.556  1.00 24.92 ? 557  GLU A OE1 1 
ATOM   3741 O OE2 . GLU C 3 51  ? 77.655  10.788 60.722  1.00 20.69 ? 557  GLU A OE2 1 
ATOM   3742 N N   . TYR C 3 52  ? 80.706  12.584 57.915  1.00 17.78 ? 558  TYR A N   1 
ATOM   3743 C CA  . TYR C 3 52  ? 81.880  12.848 58.743  1.00 17.64 ? 558  TYR A CA  1 
ATOM   3744 C C   . TYR C 3 52  ? 81.684  13.975 59.751  1.00 18.87 ? 558  TYR A C   1 
ATOM   3745 O O   . TYR C 3 52  ? 81.099  15.008 59.435  1.00 19.32 ? 558  TYR A O   1 
ATOM   3746 C CB  . TYR C 3 52  ? 83.107  13.156 57.831  1.00 15.85 ? 558  TYR A CB  1 
ATOM   3747 C CG  . TYR C 3 52  ? 83.032  14.439 56.973  1.00 13.92 ? 558  TYR A CG  1 
ATOM   3748 C CD1 . TYR C 3 52  ? 83.660  15.610 57.388  1.00 14.61 ? 558  TYR A CD1 1 
ATOM   3749 C CD2 . TYR C 3 52  ? 82.361  14.460 55.744  1.00 13.62 ? 558  TYR A CD2 1 
ATOM   3750 C CE1 . TYR C 3 52  ? 83.635  16.752 56.622  1.00 12.84 ? 558  TYR A CE1 1 
ATOM   3751 C CE2 . TYR C 3 52  ? 82.313  15.609 54.947  1.00 10.82 ? 558  TYR A CE2 1 
ATOM   3752 C CZ  . TYR C 3 52  ? 82.961  16.765 55.404  1.00 14.06 ? 558  TYR A CZ  1 
ATOM   3753 O OH  . TYR C 3 52  ? 82.929  17.945 54.665  1.00 11.85 ? 558  TYR A OH  1 
ATOM   3754 N N   . HIS C 3 53  ? 82.136  13.738 60.976  1.00 19.73 ? 559  HIS A N   1 
ATOM   3755 C CA  . HIS C 3 53  ? 82.098  14.725 62.063  1.00 22.75 ? 559  HIS A CA  1 
ATOM   3756 C C   . HIS C 3 53  ? 83.571  14.705 62.528  1.00 25.43 ? 559  HIS A C   1 
ATOM   3757 O O   . HIS C 3 53  ? 84.496  14.896 61.706  1.00 24.03 ? 559  HIS A O   1 
ATOM   3758 C CB  . HIS C 3 53  ? 81.142  14.255 63.176  1.00 23.56 ? 559  HIS A CB  1 
ATOM   3759 C CG  . HIS C 3 53  ? 81.052  12.769 63.308  1.00 24.85 ? 559  HIS A CG  1 
ATOM   3760 N ND1 . HIS C 3 53  ? 80.173  12.011 62.556  1.00 27.12 ? 559  HIS A ND1 1 
ATOM   3761 C CD2 . HIS C 3 53  ? 81.777  11.888 64.040  1.00 25.45 ? 559  HIS A CD2 1 
ATOM   3762 C CE1 . HIS C 3 53  ? 80.363  10.722 62.820  1.00 25.70 ? 559  HIS A CE1 1 
ATOM   3763 N NE2 . HIS C 3 53  ? 81.331  10.623 63.715  1.00 24.67 ? 559  HIS A NE2 1 
ATOM   3764 N N   . ASP C 3 54  ? 83.811  14.506 63.820  1.00 27.61 ? 560  ASP A N   1 
ATOM   3765 C CA  . ASP C 3 54  ? 85.202  14.377 64.286  1.00 32.02 ? 560  ASP A CA  1 
ATOM   3766 C C   . ASP C 3 54  ? 85.258  12.845 64.251  1.00 33.11 ? 560  ASP A C   1 
ATOM   3767 O O   . ASP C 3 54  ? 84.932  12.166 65.240  1.00 34.71 ? 560  ASP A O   1 
ATOM   3768 C CB  . ASP C 3 54  ? 85.363  14.889 65.725  1.00 36.39 ? 560  ASP A CB  1 
ATOM   3769 C CG  . ASP C 3 54  ? 86.822  14.995 66.146  1.00 40.12 ? 560  ASP A CG  1 
ATOM   3770 O OD1 . ASP C 3 54  ? 87.100  15.657 67.181  1.00 43.79 ? 560  ASP A OD1 1 
ATOM   3771 O OD2 . ASP C 3 54  ? 87.695  14.416 65.444  1.00 41.26 ? 560  ASP A OD2 1 
ATOM   3772 N N   . GLY C 3 55  ? 85.647  12.312 63.104  1.00 31.60 ? 561  GLY A N   1 
ATOM   3773 C CA  . GLY C 3 55  ? 85.620  10.882 62.895  1.00 31.91 ? 561  GLY A CA  1 
ATOM   3774 C C   . GLY C 3 55  ? 84.520  10.763 61.829  1.00 32.12 ? 561  GLY A C   1 
ATOM   3775 O O   . GLY C 3 55  ? 83.938  11.773 61.455  1.00 32.28 ? 561  GLY A O   1 
ATOM   3776 N N   . SER C 3 56  ? 84.200  9.576  61.350  1.00 31.03 ? 562  SER A N   1 
ATOM   3777 C CA  . SER C 3 56  ? 83.168  9.455  60.330  1.00 30.81 ? 562  SER A CA  1 
ATOM   3778 C C   . SER C 3 56  ? 82.461  8.078  60.343  1.00 30.22 ? 562  SER A C   1 
ATOM   3779 O O   . SER C 3 56  ? 82.911  7.128  60.985  1.00 27.47 ? 562  SER A O   1 
ATOM   3780 C CB  . SER C 3 56  ? 83.800  9.708  58.958  1.00 30.07 ? 562  SER A CB  1 
ATOM   3781 O OG  . SER C 3 56  ? 84.850  8.787  58.699  1.00 30.36 ? 562  SER A OG  1 
ATOM   3782 N N   . HIS C 3 57  ? 81.342  7.977  59.637  1.00 28.92 ? 563  HIS A N   1 
ATOM   3783 C CA  . HIS C 3 57  ? 80.636  6.712  59.589  1.00 28.63 ? 563  HIS A CA  1 
ATOM   3784 C C   . HIS C 3 57  ? 80.288  6.392  58.145  1.00 25.70 ? 563  HIS A C   1 
ATOM   3785 O O   . HIS C 3 57  ? 79.577  7.163  57.481  1.00 21.21 ? 563  HIS A O   1 
ATOM   3786 C CB  . HIS C 3 57  ? 79.354  6.747  60.446  1.00 33.76 ? 563  HIS A CB  1 
ATOM   3787 C CG  . HIS C 3 57  ? 78.569  5.470  60.377  1.00 40.46 ? 563  HIS A CG  1 
ATOM   3788 N ND1 . HIS C 3 57  ? 78.885  4.358  61.128  1.00 43.99 ? 563  HIS A ND1 1 
ATOM   3789 C CD2 . HIS C 3 57  ? 77.556  5.091  59.553  1.00 43.15 ? 563  HIS A CD2 1 
ATOM   3790 C CE1 . HIS C 3 57  ? 78.107  3.347  60.769  1.00 44.98 ? 563  HIS A CE1 1 
ATOM   3791 N NE2 . HIS C 3 57  ? 77.291  3.763  59.817  1.00 45.03 ? 563  HIS A NE2 1 
ATOM   3792 N N   . ALA C 3 58  ? 80.774  5.254  57.664  1.00 22.91 ? 564  ALA A N   1 
ATOM   3793 C CA  . ALA C 3 58  ? 80.529  4.849  56.296  1.00 23.61 ? 564  ALA A CA  1 
ATOM   3794 C C   . ALA C 3 58  ? 79.199  4.102  56.218  1.00 25.07 ? 564  ALA A C   1 
ATOM   3795 O O   . ALA C 3 58  ? 79.046  3.083  56.885  1.00 26.69 ? 564  ALA A O   1 
ATOM   3796 C CB  . ALA C 3 58  ? 81.671  3.958  55.815  1.00 23.93 ? 564  ALA A CB  1 
ATOM   3797 N N   . TYR C 3 59  ? 78.238  4.608  55.435  1.00 24.13 ? 565  TYR A N   1 
ATOM   3798 C CA  . TYR C 3 59  ? 76.935  3.941  55.264  1.00 23.21 ? 565  TYR A CA  1 
ATOM   3799 C C   . TYR C 3 59  ? 76.940  3.007  54.026  1.00 23.84 ? 565  TYR A C   1 
ATOM   3800 O O   . TYR C 3 59  ? 76.241  1.986  53.999  1.00 25.02 ? 565  TYR A O   1 
ATOM   3801 C CB  . TYR C 3 59  ? 75.809  4.973  55.102  1.00 22.21 ? 565  TYR A CB  1 
ATOM   3802 C CG  . TYR C 3 59  ? 75.425  5.643  56.385  1.00 21.99 ? 565  TYR A CG  1 
ATOM   3803 C CD1 . TYR C 3 59  ? 74.316  5.202  57.128  1.00 22.22 ? 565  TYR A CD1 1 
ATOM   3804 C CD2 . TYR C 3 59  ? 76.174  6.711  56.881  1.00 23.05 ? 565  TYR A CD2 1 
ATOM   3805 C CE1 . TYR C 3 59  ? 73.955  5.809  58.318  1.00 21.49 ? 565  TYR A CE1 1 
ATOM   3806 C CE2 . TYR C 3 59  ? 75.823  7.337  58.100  1.00 23.51 ? 565  TYR A CE2 1 
ATOM   3807 C CZ  . TYR C 3 59  ? 74.702  6.871  58.811  1.00 22.96 ? 565  TYR A CZ  1 
ATOM   3808 O OH  . TYR C 3 59  ? 74.332  7.497  59.991  1.00 21.76 ? 565  TYR A OH  1 
ATOM   3809 N N   . ILE C 3 60  ? 77.696  3.368  52.990  1.00 21.73 ? 566  ILE A N   1 
ATOM   3810 C CA  . ILE C 3 60  ? 77.754  2.536  51.783  1.00 21.19 ? 566  ILE A CA  1 
ATOM   3811 C C   . ILE C 3 60  ? 79.206  2.487  51.314  1.00 21.33 ? 566  ILE A C   1 
ATOM   3812 O O   . ILE C 3 60  ? 79.875  3.528  51.274  1.00 19.68 ? 566  ILE A O   1 
ATOM   3813 C CB  . ILE C 3 60  ? 76.879  3.133  50.631  1.00 20.51 ? 566  ILE A CB  1 
ATOM   3814 C CG1 . ILE C 3 60  ? 75.407  3.241  51.075  1.00 20.07 ? 566  ILE A CG1 1 
ATOM   3815 C CG2 . ILE C 3 60  ? 77.012  2.281  49.380  1.00 21.20 ? 566  ILE A CG2 1 
ATOM   3816 C CD1 . ILE C 3 60  ? 74.541  4.163  50.140  1.00 19.99 ? 566  ILE A CD1 1 
ATOM   3817 N N   . GLY C 3 61  ? 79.690  1.277  51.010  1.00 21.31 ? 567  GLY A N   1 
ATOM   3818 C CA  . GLY C 3 61  ? 81.041  1.103  50.531  1.00 20.01 ? 567  GLY A CA  1 
ATOM   3819 C C   . GLY C 3 61  ? 80.932  0.794  49.049  1.00 21.73 ? 567  GLY A C   1 
ATOM   3820 O O   . GLY C 3 61  ? 79.919  0.220  48.602  1.00 19.52 ? 567  GLY A O   1 
ATOM   3821 N N   . LEU C 3 62  ? 81.955  1.183  48.286  1.00 20.95 ? 568  LEU A N   1 
ATOM   3822 C CA  . LEU C 3 62  ? 81.976  0.955  46.840  1.00 21.25 ? 568  LEU A CA  1 
ATOM   3823 C C   . LEU C 3 62  ? 81.714  -0.501 46.443  1.00 22.77 ? 568  LEU A C   1 
ATOM   3824 O O   . LEU C 3 62  ? 81.138  -0.772 45.386  1.00 23.17 ? 568  LEU A O   1 
ATOM   3825 C CB  . LEU C 3 62  ? 83.332  1.411  46.240  1.00 18.45 ? 568  LEU A CB  1 
ATOM   3826 C CG  . LEU C 3 62  ? 83.693  2.929  46.281  1.00 17.45 ? 568  LEU A CG  1 
ATOM   3827 C CD1 . LEU C 3 62  ? 85.211  3.117  45.990  1.00 16.47 ? 568  LEU A CD1 1 
ATOM   3828 C CD2 . LEU C 3 62  ? 82.816  3.740  45.295  1.00 14.52 ? 568  LEU A CD2 1 
ATOM   3829 N N   . LYS C 3 63  ? 82.155  -1.427 47.285  1.00 25.82 ? 569  LYS A N   1 
ATOM   3830 C CA  . LYS C 3 63  ? 82.002  -2.843 47.001  1.00 30.08 ? 569  LYS A CA  1 
ATOM   3831 C C   . LYS C 3 63  ? 80.658  -3.438 47.454  1.00 32.21 ? 569  LYS A C   1 
ATOM   3832 O O   . LYS C 3 63  ? 80.365  -4.602 47.159  1.00 32.61 ? 569  LYS A O   1 
ATOM   3833 C CB  . LYS C 3 63  ? 83.146  -3.627 47.652  1.00 31.28 ? 569  LYS A CB  1 
ATOM   3834 C CG  . LYS C 3 63  ? 84.545  -3.301 47.119  1.00 36.24 ? 569  LYS A CG  1 
ATOM   3835 C CD  . LYS C 3 63  ? 85.632  -3.974 47.997  1.00 40.57 ? 569  LYS A CD  1 
ATOM   3836 C CE  . LYS C 3 63  ? 85.295  -3.838 49.490  1.00 43.73 ? 569  LYS A CE  1 
ATOM   3837 N NZ  . LYS C 3 63  ? 86.368  -4.346 50.421  1.00 47.91 ? 569  LYS A NZ  1 
ATOM   3838 N N   . ASP C 3 64  ? 79.829  -2.655 48.140  1.00 33.20 ? 570  ASP A N   1 
ATOM   3839 C CA  . ASP C 3 64  ? 78.538  -3.184 48.596  1.00 34.81 ? 570  ASP A CA  1 
ATOM   3840 C C   . ASP C 3 64  ? 77.696  -3.642 47.402  1.00 35.88 ? 570  ASP A C   1 
ATOM   3841 O O   . ASP C 3 64  ? 77.403  -2.871 46.489  1.00 36.32 ? 570  ASP A O   1 
ATOM   3842 C CB  . ASP C 3 64  ? 77.802  -2.122 49.428  1.00 35.64 ? 570  ASP A CB  1 
ATOM   3843 C CG  . ASP C 3 64  ? 78.539  -1.785 50.753  1.00 35.99 ? 570  ASP A CG  1 
ATOM   3844 O OD1 . ASP C 3 64  ? 79.610  -2.378 51.022  1.00 37.31 ? 570  ASP A OD1 1 
ATOM   3845 O OD2 . ASP C 3 64  ? 78.060  -0.938 51.535  1.00 35.99 ? 570  ASP A OD2 1 
ATOM   3846 N N   . ARG C 3 65  ? 77.333  -4.917 47.378  1.00 37.95 ? 571  ARG A N   1 
ATOM   3847 C CA  . ARG C 3 65  ? 76.518  -5.425 46.276  1.00 39.73 ? 571  ARG A CA  1 
ATOM   3848 C C   . ARG C 3 65  ? 75.058  -5.418 46.686  1.00 39.36 ? 571  ARG A C   1 
ATOM   3849 O O   . ARG C 3 65  ? 74.584  -6.366 47.313  1.00 40.87 ? 571  ARG A O   1 
ATOM   3850 C CB  . ARG C 3 65  ? 76.958  -6.831 45.895  1.00 42.27 ? 571  ARG A CB  1 
ATOM   3851 C CG  . ARG C 3 65  ? 78.218  -6.800 45.063  1.00 45.25 ? 571  ARG A CG  1 
ATOM   3852 C CD  . ARG C 3 65  ? 78.810  -8.157 44.828  1.00 49.50 ? 571  ARG A CD  1 
ATOM   3853 N NE  . ARG C 3 65  ? 79.933  -8.044 43.900  1.00 53.92 ? 571  ARG A NE  1 
ATOM   3854 C CZ  . ARG C 3 65  ? 81.031  -7.312 44.118  1.00 55.88 ? 571  ARG A CZ  1 
ATOM   3855 N NH1 . ARG C 3 65  ? 81.181  -6.611 45.251  1.00 55.75 ? 571  ARG A NH1 1 
ATOM   3856 N NH2 . ARG C 3 65  ? 81.986  -7.265 43.185  1.00 57.92 ? 571  ARG A NH2 1 
ATOM   3857 N N   . LYS C 3 66  ? 74.361  -4.330 46.352  1.00 37.84 ? 572  LYS A N   1 
ATOM   3858 C CA  . LYS C 3 66  ? 72.953  -4.162 46.710  1.00 35.69 ? 572  LYS A CA  1 
ATOM   3859 C C   . LYS C 3 66  ? 72.286  -3.455 45.577  1.00 35.35 ? 572  LYS A C   1 
ATOM   3860 O O   . LYS C 3 66  ? 72.926  -2.759 44.815  1.00 33.49 ? 572  LYS A O   1 
ATOM   3861 C CB  . LYS C 3 66  ? 72.793  -3.308 47.959  1.00 35.29 ? 572  LYS A CB  1 
ATOM   3862 C CG  . LYS C 3 66  ? 73.512  -3.853 49.174  1.00 34.00 ? 572  LYS A CG  1 
ATOM   3863 C CD  . LYS C 3 66  ? 73.286  -2.976 50.379  1.00 34.06 ? 572  LYS A CD  1 
ATOM   3864 C CE  . LYS C 3 66  ? 73.980  -3.592 51.589  1.00 32.21 ? 572  LYS A CE  1 
ATOM   3865 N NZ  . LYS C 3 66  ? 73.867  -2.731 52.777  1.00 32.62 ? 572  LYS A NZ  1 
ATOM   3866 N N   . ARG C 3 67  ? 70.982  -3.617 45.482  1.00 35.57 ? 573  ARG A N   1 
ATOM   3867 C CA  . ARG C 3 67  ? 70.232  -2.989 44.414  1.00 36.57 ? 573  ARG A CA  1 
ATOM   3868 C C   . ARG C 3 67  ? 70.347  -1.440 44.547  1.00 33.37 ? 573  ARG A C   1 
ATOM   3869 O O   . ARG C 3 67  ? 70.416  -0.917 45.655  1.00 32.38 ? 573  ARG A O   1 
ATOM   3870 C CB  . ARG C 3 67  ? 68.793  -3.473 44.563  1.00 40.79 ? 573  ARG A CB  1 
ATOM   3871 C CG  . ARG C 3 67  ? 67.921  -3.239 43.387  1.00 49.01 ? 573  ARG A CG  1 
ATOM   3872 C CD  . ARG C 3 67  ? 66.497  -3.741 43.674  1.00 54.57 ? 573  ARG A CD  1 
ATOM   3873 N NE  . ARG C 3 67  ? 66.415  -5.194 43.833  1.00 58.63 ? 573  ARG A NE  1 
ATOM   3874 C CZ  . ARG C 3 67  ? 66.217  -6.059 42.835  1.00 61.58 ? 573  ARG A CZ  1 
ATOM   3875 N NH1 . ARG C 3 67  ? 66.077  -5.632 41.575  1.00 62.74 ? 573  ARG A NH1 1 
ATOM   3876 N NH2 . ARG C 3 67  ? 66.138  -7.363 43.103  1.00 62.36 ? 573  ARG A NH2 1 
ATOM   3877 N N   . PRO C 3 68  ? 70.422  -0.702 43.423  1.00 31.21 ? 574  PRO A N   1 
ATOM   3878 C CA  . PRO C 3 68  ? 70.516  0.772  43.487  1.00 29.98 ? 574  PRO A CA  1 
ATOM   3879 C C   . PRO C 3 68  ? 69.397  1.420  44.349  1.00 30.38 ? 574  PRO A C   1 
ATOM   3880 O O   . PRO C 3 68  ? 69.612  2.428  45.053  1.00 29.40 ? 574  PRO A O   1 
ATOM   3881 C CB  . PRO C 3 68  ? 70.439  1.179  42.019  1.00 29.90 ? 574  PRO A CB  1 
ATOM   3882 C CG  . PRO C 3 68  ? 71.187  0.026  41.332  1.00 30.59 ? 574  PRO A CG  1 
ATOM   3883 C CD  . PRO C 3 68  ? 70.658  -1.197 42.051  1.00 30.20 ? 574  PRO A CD  1 
ATOM   3884 N N   . SER C 3 69  ? 68.206  0.818  44.297  1.00 29.53 ? 575  SER A N   1 
ATOM   3885 C CA  . SER C 3 69  ? 67.061  1.275  45.064  1.00 29.76 ? 575  SER A CA  1 
ATOM   3886 C C   . SER C 3 69  ? 67.297  1.093  46.578  1.00 28.90 ? 575  SER A C   1 
ATOM   3887 O O   . SER C 3 69  ? 66.851  1.909  47.381  1.00 29.20 ? 575  SER A O   1 
ATOM   3888 C CB  . SER C 3 69  ? 65.794  0.506  44.607  1.00 29.79 ? 575  SER A CB  1 
ATOM   3889 O OG  . SER C 3 69  ? 65.834  -0.852 45.022  1.00 29.84 ? 575  SER A OG  1 
ATOM   3890 N N   . GLU C 3 70  ? 67.997  0.039  46.986  1.00 28.54 ? 576  GLU A N   1 
ATOM   3891 C CA  . GLU C 3 70  ? 68.275  -0.157 48.421  1.00 27.53 ? 576  GLU A CA  1 
ATOM   3892 C C   . GLU C 3 70  ? 69.392  0.815  48.865  1.00 26.90 ? 576  GLU A C   1 
ATOM   3893 O O   . GLU C 3 70  ? 69.455  1.240  50.026  1.00 26.50 ? 576  GLU A O   1 
ATOM   3894 C CB  . GLU C 3 70  ? 68.720  -1.601 48.698  1.00 27.97 ? 576  GLU A CB  1 
ATOM   3895 C CG  . GLU C 3 70  ? 69.343  -1.845 50.083  1.00 29.85 ? 576  GLU A CG  1 
ATOM   3896 C CD  . GLU C 3 70  ? 68.442  -1.488 51.272  1.00 32.73 ? 576  GLU A CD  1 
ATOM   3897 O OE1 . GLU C 3 70  ? 68.905  -1.668 52.418  1.00 34.15 ? 576  GLU A OE1 1 
ATOM   3898 O OE2 . GLU C 3 70  ? 67.282  -1.021 51.096  1.00 34.41 ? 576  GLU A OE2 1 
ATOM   3899 N N   . LEU C 3 71  ? 70.281  1.132  47.930  1.00 26.09 ? 577  LEU A N   1 
ATOM   3900 C CA  . LEU C 3 71  ? 71.369  2.064  48.194  1.00 25.43 ? 577  LEU A CA  1 
ATOM   3901 C C   . LEU C 3 71  ? 70.748  3.473  48.315  1.00 25.20 ? 577  LEU A C   1 
ATOM   3902 O O   . LEU C 3 71  ? 71.133  4.260  49.173  1.00 24.43 ? 577  LEU A O   1 
ATOM   3903 C CB  . LEU C 3 71  ? 72.419  1.983  47.073  1.00 24.66 ? 577  LEU A CB  1 
ATOM   3904 C CG  . LEU C 3 71  ? 73.251  0.678  47.033  1.00 23.32 ? 577  LEU A CG  1 
ATOM   3905 C CD1 . LEU C 3 71  ? 74.307  0.805  45.969  1.00 24.12 ? 577  LEU A CD1 1 
ATOM   3906 C CD2 . LEU C 3 71  ? 73.906  0.384  48.379  1.00 23.00 ? 577  LEU A CD2 1 
ATOM   3907 N N   . ARG C 3 72  ? 69.767  3.781  47.481  1.00 24.68 ? 578  ARG A N   1 
ATOM   3908 C CA  . ARG C 3 72  ? 69.138  5.076  47.601  1.00 25.36 ? 578  ARG A CA  1 
ATOM   3909 C C   . ARG C 3 72  ? 68.413  5.147  48.949  1.00 25.64 ? 578  ARG A C   1 
ATOM   3910 O O   . ARG C 3 72  ? 68.430  6.186  49.619  1.00 23.90 ? 578  ARG A O   1 
ATOM   3911 C CB  . ARG C 3 72  ? 68.174  5.318  46.448  1.00 25.65 ? 578  ARG A CB  1 
ATOM   3912 C CG  . ARG C 3 72  ? 68.891  5.530  45.117  1.00 28.23 ? 578  ARG A CG  1 
ATOM   3913 C CD  . ARG C 3 72  ? 67.949  6.159  44.065  1.00 31.17 ? 578  ARG A CD  1 
ATOM   3914 N NE  . ARG C 3 72  ? 66.704  5.394  43.850  1.00 33.32 ? 578  ARG A NE  1 
ATOM   3915 C CZ  . ARG C 3 72  ? 66.598  4.271  43.117  1.00 35.98 ? 578  ARG A CZ  1 
ATOM   3916 N NH1 . ARG C 3 72  ? 67.675  3.740  42.506  1.00 32.72 ? 578  ARG A NH1 1 
ATOM   3917 N NH2 . ARG C 3 72  ? 65.392  3.686  42.958  1.00 36.06 ? 578  ARG A NH2 1 
ATOM   3918 N N   . ARG C 3 73  ? 67.803  4.027  49.364  1.00 24.96 ? 579  ARG A N   1 
ATOM   3919 C CA  . ARG C 3 73  ? 67.102  4.025  50.646  1.00 24.59 ? 579  ARG A CA  1 
ATOM   3920 C C   . ARG C 3 73  ? 68.058  4.269  51.799  1.00 23.97 ? 579  ARG A C   1 
ATOM   3921 O O   . ARG C 3 73  ? 67.754  5.026  52.736  1.00 23.21 ? 579  ARG A O   1 
ATOM   3922 C CB  . ARG C 3 73  ? 66.381  2.695  50.894  1.00 26.38 ? 579  ARG A CB  1 
ATOM   3923 C CG  . ARG C 3 73  ? 65.576  2.714  52.211  1.00 27.55 ? 579  ARG A CG  1 
ATOM   3924 C CD  . ARG C 3 73  ? 65.181  1.299  52.607  1.00 30.24 ? 579  ARG A CD  1 
ATOM   3925 N NE  . ARG C 3 73  ? 66.345  0.545  53.080  1.00 31.37 ? 579  ARG A NE  1 
ATOM   3926 C CZ  . ARG C 3 73  ? 66.886  0.704  54.285  1.00 30.98 ? 579  ARG A CZ  1 
ATOM   3927 N NH1 . ARG C 3 73  ? 66.362  1.582  55.134  1.00 32.90 ? 579  ARG A NH1 1 
ATOM   3928 N NH2 . ARG C 3 73  ? 67.964  0.013  54.638  1.00 30.93 ? 579  ARG A NH2 1 
ATOM   3929 N N   . ILE C 3 74  ? 69.220  3.624  51.744  1.00 23.24 ? 580  ILE A N   1 
ATOM   3930 C CA  . ILE C 3 74  ? 70.195  3.785  52.833  1.00 22.22 ? 580  ILE A CA  1 
ATOM   3931 C C   . ILE C 3 74  ? 70.617  5.258  52.897  1.00 20.92 ? 580  ILE A C   1 
ATOM   3932 O O   . ILE C 3 74  ? 70.673  5.859  53.983  1.00 18.20 ? 580  ILE A O   1 
ATOM   3933 C CB  . ILE C 3 74  ? 71.450  2.884  52.601  1.00 23.96 ? 580  ILE A CB  1 
ATOM   3934 C CG1 . ILE C 3 74  ? 71.065  1.407  52.824  1.00 24.96 ? 580  ILE A CG1 1 
ATOM   3935 C CG2 . ILE C 3 74  ? 72.607  3.314  53.507  1.00 21.36 ? 580  ILE A CG2 1 
ATOM   3936 C CD1 . ILE C 3 74  ? 72.068  0.409  52.225  1.00 26.46 ? 580  ILE A CD1 1 
ATOM   3937 N N   . ALA C 3 75  ? 70.876  5.844  51.730  1.00 16.90 ? 581  ALA A N   1 
ATOM   3938 C CA  . ALA C 3 75  ? 71.319  7.213  51.735  1.00 18.33 ? 581  ALA A CA  1 
ATOM   3939 C C   . ALA C 3 75  ? 70.271  8.093  52.375  1.00 18.65 ? 581  ALA A C   1 
ATOM   3940 O O   . ALA C 3 75  ? 70.590  8.965  53.170  1.00 19.33 ? 581  ALA A O   1 
ATOM   3941 C CB  . ALA C 3 75  ? 71.618  7.686  50.293  1.00 16.84 ? 581  ALA A CB  1 
ATOM   3942 N N   . SER C 3 76  ? 69.005  7.832  52.050  1.00 20.97 ? 582  SER A N   1 
ATOM   3943 C CA  . SER C 3 76  ? 67.925  8.649  52.554  1.00 21.98 ? 582  SER A CA  1 
ATOM   3944 C C   . SER C 3 76  ? 67.789  8.502  54.057  1.00 23.07 ? 582  SER A C   1 
ATOM   3945 O O   . SER C 3 76  ? 67.148  9.329  54.719  1.00 23.79 ? 582  SER A O   1 
ATOM   3946 C CB  . SER C 3 76  ? 66.607  8.237  51.900  1.00 22.77 ? 582  SER A CB  1 
ATOM   3947 O OG  . SER C 3 76  ? 66.095  7.092  52.559  1.00 24.25 ? 582  SER A OG  1 
ATOM   3948 N N   . GLN C 3 77  ? 68.371  7.449  54.608  1.00 23.10 ? 583  GLN A N   1 
ATOM   3949 C CA  . GLN C 3 77  ? 68.253  7.230  56.050  1.00 24.61 ? 583  GLN A CA  1 
ATOM   3950 C C   . GLN C 3 77  ? 69.480  7.589  56.887  1.00 23.61 ? 583  GLN A C   1 
ATOM   3951 O O   . GLN C 3 77  ? 69.501  7.338  58.087  1.00 22.50 ? 583  GLN A O   1 
ATOM   3952 C CB  . GLN C 3 77  ? 67.847  5.771  56.323  1.00 26.73 ? 583  GLN A CB  1 
ATOM   3953 C CG  . GLN C 3 77  ? 66.398  5.482  55.894  1.00 31.26 ? 583  GLN A CG  1 
ATOM   3954 C CD  . GLN C 3 77  ? 65.401  6.462  56.572  1.00 35.00 ? 583  GLN A CD  1 
ATOM   3955 O OE1 . GLN C 3 77  ? 64.648  7.188  55.893  1.00 36.58 ? 583  GLN A OE1 1 
ATOM   3956 N NE2 . GLN C 3 77  ? 65.416  6.498  57.909  1.00 35.74 ? 583  GLN A NE2 1 
ATOM   3957 N N   . VAL C 3 78  ? 70.488  8.197  56.264  1.00 22.13 ? 584  VAL A N   1 
ATOM   3958 C CA  . VAL C 3 78  ? 71.695  8.569  56.988  1.00 21.03 ? 584  VAL A CA  1 
ATOM   3959 C C   . VAL C 3 78  ? 71.320  9.409  58.205  1.00 22.65 ? 584  VAL A C   1 
ATOM   3960 O O   . VAL C 3 78  ? 70.500  10.341 58.100  1.00 21.81 ? 584  VAL A O   1 
ATOM   3961 C CB  . VAL C 3 78  ? 72.637  9.342  56.064  1.00 19.70 ? 584  VAL A CB  1 
ATOM   3962 C CG1 . VAL C 3 78  ? 73.712  10.082 56.903  1.00 15.79 ? 584  VAL A CG1 1 
ATOM   3963 C CG2 . VAL C 3 78  ? 73.256  8.361  55.069  1.00 17.55 ? 584  VAL A CG2 1 
ATOM   3964 N N   . LYS C 3 79  ? 71.898  9.092  59.361  1.00 21.81 ? 585  LYS A N   1 
ATOM   3965 C CA  . LYS C 3 79  ? 71.525  9.833  60.560  1.00 22.81 ? 585  LYS A CA  1 
ATOM   3966 C C   . LYS C 3 79  ? 72.137  11.224 60.682  1.00 20.38 ? 585  LYS A C   1 
ATOM   3967 O O   . LYS C 3 79  ? 73.285  11.428 60.350  1.00 18.24 ? 585  LYS A O   1 
ATOM   3968 C CB  . LYS C 3 79  ? 71.883  9.018  61.812  1.00 27.07 ? 585  LYS A CB  1 
ATOM   3969 C CG  . LYS C 3 79  ? 71.153  7.679  61.936  1.00 32.88 ? 585  LYS A CG  1 
ATOM   3970 C CD  . LYS C 3 79  ? 71.735  6.762  63.072  1.00 37.40 ? 585  LYS A CD  1 
ATOM   3971 C CE  . LYS C 3 79  ? 71.923  7.512  64.426  1.00 40.36 ? 585  LYS A CE  1 
ATOM   3972 N NZ  . LYS C 3 79  ? 72.619  6.715  65.540  1.00 43.33 ? 585  LYS A NZ  1 
ATOM   3973 N N   . TYR C 3 80  ? 71.348  12.179 61.143  1.00 18.43 ? 586  TYR A N   1 
ATOM   3974 C CA  . TYR C 3 80  ? 71.878  13.518 61.362  1.00 19.83 ? 586  TYR A CA  1 
ATOM   3975 C C   . TYR C 3 80  ? 72.812  13.488 62.596  1.00 19.33 ? 586  TYR A C   1 
ATOM   3976 O O   . TYR C 3 80  ? 72.443  12.983 63.648  1.00 18.19 ? 586  TYR A O   1 
ATOM   3977 C CB  . TYR C 3 80  ? 70.758  14.512 61.655  1.00 18.18 ? 586  TYR A CB  1 
ATOM   3978 C CG  . TYR C 3 80  ? 71.262  15.919 61.982  1.00 18.00 ? 586  TYR A CG  1 
ATOM   3979 C CD1 . TYR C 3 80  ? 71.942  16.673 61.035  1.00 17.21 ? 586  TYR A CD1 1 
ATOM   3980 C CD2 . TYR C 3 80  ? 70.970  16.513 63.199  1.00 18.28 ? 586  TYR A CD2 1 
ATOM   3981 C CE1 . TYR C 3 80  ? 72.306  17.981 61.272  1.00 17.70 ? 586  TYR A CE1 1 
ATOM   3982 C CE2 . TYR C 3 80  ? 71.323  17.827 63.456  1.00 17.02 ? 586  TYR A CE2 1 
ATOM   3983 C CZ  . TYR C 3 80  ? 71.986  18.557 62.506  1.00 18.36 ? 586  TYR A CZ  1 
ATOM   3984 O OH  . TYR C 3 80  ? 72.356  19.862 62.775  1.00 18.50 ? 586  TYR A OH  1 
ATOM   3985 N N   . ALA C 3 81  ? 73.994  14.067 62.462  1.00 20.24 ? 587  ALA A N   1 
ATOM   3986 C CA  . ALA C 3 81  ? 74.963  14.103 63.551  1.00 20.61 ? 587  ALA A CA  1 
ATOM   3987 C C   . ALA C 3 81  ? 74.917  15.446 64.276  1.00 20.15 ? 587  ALA A C   1 
ATOM   3988 O O   . ALA C 3 81  ? 74.798  15.487 65.482  1.00 20.27 ? 587  ALA A O   1 
ATOM   3989 C CB  . ALA C 3 81  ? 76.392  13.814 63.000  1.00 20.06 ? 587  ALA A CB  1 
ATOM   3990 N N   . GLY C 3 82  ? 74.975  16.558 63.555  1.00 20.29 ? 588  GLY A N   1 
ATOM   3991 C CA  . GLY C 3 82  ? 74.953  17.839 64.247  1.00 19.59 ? 588  GLY A CA  1 
ATOM   3992 C C   . GLY C 3 82  ? 76.177  18.063 65.152  1.00 20.54 ? 588  GLY A C   1 
ATOM   3993 O O   . GLY C 3 82  ? 76.072  18.708 66.218  1.00 20.80 ? 588  GLY A O   1 
ATOM   3994 N N   . SER C 3 83  ? 77.329  17.542 64.745  1.00 17.81 ? 589  SER A N   1 
ATOM   3995 C CA  . SER C 3 83  ? 78.580  17.679 65.527  1.00 20.33 ? 589  SER A CA  1 
ATOM   3996 C C   . SER C 3 83  ? 79.124  19.113 65.534  1.00 19.17 ? 589  SER A C   1 
ATOM   3997 O O   . SER C 3 83  ? 78.793  19.934 64.668  1.00 16.48 ? 589  SER A O   1 
ATOM   3998 C CB  . SER C 3 83  ? 79.663  16.777 64.923  1.00 18.83 ? 589  SER A CB  1 
ATOM   3999 O OG  . SER C 3 83  ? 79.915  17.212 63.591  1.00 21.29 ? 589  SER A OG  1 
ATOM   4000 N N   . GLN C 3 84  ? 79.962  19.421 66.516  1.00 20.75 ? 590  GLN A N   1 
ATOM   4001 C CA  . GLN C 3 84  ? 80.565  20.746 66.538  1.00 21.11 ? 590  GLN A CA  1 
ATOM   4002 C C   . GLN C 3 84  ? 81.589  20.850 65.381  1.00 19.85 ? 590  GLN A C   1 
ATOM   4003 O O   . GLN C 3 84  ? 81.751  21.874 64.763  1.00 21.75 ? 590  GLN A O   1 
ATOM   4004 C CB  . GLN C 3 84  ? 81.305  20.969 67.858  1.00 23.59 ? 590  GLN A CB  1 
ATOM   4005 C CG  . GLN C 3 84  ? 81.985  22.347 67.943  1.00 26.09 ? 590  GLN A CG  1 
ATOM   4006 C CD  . GLN C 3 84  ? 82.767  22.519 69.249  1.00 30.37 ? 590  GLN A CD  1 
ATOM   4007 O OE1 . GLN C 3 84  ? 83.291  21.540 69.818  1.00 31.19 ? 590  GLN A OE1 1 
ATOM   4008 N NE2 . GLN C 3 84  ? 82.866  23.757 69.719  1.00 30.83 ? 590  GLN A NE2 1 
ATOM   4009 N N   . VAL C 3 85  ? 82.275  19.758 65.094  1.00 19.26 ? 591  VAL A N   1 
ATOM   4010 C CA  . VAL C 3 85  ? 83.323  19.736 64.065  1.00 18.67 ? 591  VAL A CA  1 
ATOM   4011 C C   . VAL C 3 85  ? 83.058  18.623 63.020  1.00 18.16 ? 591  VAL A C   1 
ATOM   4012 O O   . VAL C 3 85  ? 82.547  17.535 63.348  1.00 17.21 ? 591  VAL A O   1 
ATOM   4013 C CB  . VAL C 3 85  ? 84.744  19.413 64.736  1.00 19.13 ? 591  VAL A CB  1 
ATOM   4014 C CG1 . VAL C 3 85  ? 85.852  19.265 63.647  1.00 19.65 ? 591  VAL A CG1 1 
ATOM   4015 C CG2 . VAL C 3 85  ? 85.112  20.474 65.774  1.00 18.77 ? 591  VAL A CG2 1 
ATOM   4016 N N   . ALA C 3 86  ? 83.424  18.882 61.780  1.00 16.22 ? 592  ALA A N   1 
ATOM   4017 C CA  . ALA C 3 86  ? 83.300  17.864 60.746  1.00 15.95 ? 592  ALA A CA  1 
ATOM   4018 C C   . ALA C 3 86  ? 84.696  18.039 60.156  1.00 15.48 ? 592  ALA A C   1 
ATOM   4019 O O   . ALA C 3 86  ? 84.959  19.054 59.498  1.00 16.79 ? 592  ALA A O   1 
ATOM   4020 C CB  . ALA C 3 86  ? 82.230  18.253 59.721  1.00 16.21 ? 592  ALA A CB  1 
ATOM   4021 N N   . SER C 3 87  ? 85.601  17.097 60.421  1.00 13.37 ? 593  SER A N   1 
ATOM   4022 C CA  . SER C 3 87  ? 86.965  17.251 59.927  1.00 12.16 ? 593  SER A CA  1 
ATOM   4023 C C   . SER C 3 87  ? 87.118  16.807 58.458  1.00 12.93 ? 593  SER A C   1 
ATOM   4024 O O   . SER C 3 87  ? 87.004  15.607 58.139  1.00 12.96 ? 593  SER A O   1 
ATOM   4025 C CB  . SER C 3 87  ? 87.948  16.480 60.840  1.00 10.66 ? 593  SER A CB  1 
ATOM   4026 O OG  . SER C 3 87  ? 89.288  16.608 60.346  1.00 12.93 ? 593  SER A OG  1 
ATOM   4027 N N   . THR C 3 88  ? 87.358  17.766 57.565  1.00 12.01 ? 594  THR A N   1 
ATOM   4028 C CA  . THR C 3 88  ? 87.587  17.448 56.155  1.00 13.18 ? 594  THR A CA  1 
ATOM   4029 C C   . THR C 3 88  ? 88.921  16.675 56.067  1.00 14.55 ? 594  THR A C   1 
ATOM   4030 O O   . THR C 3 88  ? 89.086  15.708 55.285  1.00 12.42 ? 594  THR A O   1 
ATOM   4031 C CB  . THR C 3 88  ? 87.698  18.739 55.338  1.00 14.68 ? 594  THR A CB  1 
ATOM   4032 O OG1 . THR C 3 88  ? 88.593  19.625 56.031  1.00 14.26 ? 594  THR A OG1 1 
ATOM   4033 C CG2 . THR C 3 88  ? 86.266  19.408 55.167  1.00 11.32 ? 594  THR A CG2 1 
ATOM   4034 N N   . SER C 3 89  ? 89.889  17.083 56.874  1.00 12.78 ? 595  SER A N   1 
ATOM   4035 C CA  . SER C 3 89  ? 91.162  16.355 56.848  1.00 14.01 ? 595  SER A CA  1 
ATOM   4036 C C   . SER C 3 89  ? 91.029  14.866 57.179  1.00 14.36 ? 595  SER A C   1 
ATOM   4037 O O   . SER C 3 89  ? 91.584  14.020 56.478  1.00 14.54 ? 595  SER A O   1 
ATOM   4038 C CB  . SER C 3 89  ? 92.141  17.002 57.814  1.00 13.15 ? 595  SER A CB  1 
ATOM   4039 O OG  . SER C 3 89  ? 92.561  18.233 57.276  1.00 10.76 ? 595  SER A OG  1 
ATOM   4040 N N   . GLU C 3 90  ? 90.286  14.552 58.240  1.00 14.21 ? 596  GLU A N   1 
ATOM   4041 C CA  . GLU C 3 90  ? 90.137  13.165 58.674  1.00 15.85 ? 596  GLU A CA  1 
ATOM   4042 C C   . GLU C 3 90  ? 89.360  12.360 57.667  1.00 14.56 ? 596  GLU A C   1 
ATOM   4043 O O   . GLU C 3 90  ? 89.698  11.192 57.399  1.00 15.16 ? 596  GLU A O   1 
ATOM   4044 C CB  . GLU C 3 90  ? 89.443  13.096 60.039  1.00 17.50 ? 596  GLU A CB  1 
ATOM   4045 C CG  . GLU C 3 90  ? 90.329  13.606 61.143  1.00 22.85 ? 596  GLU A CG  1 
ATOM   4046 C CD  . GLU C 3 90  ? 91.651  12.794 61.229  1.00 28.47 ? 596  GLU A CD  1 
ATOM   4047 O OE1 . GLU C 3 90  ? 91.557  11.530 61.297  1.00 29.93 ? 596  GLU A OE1 1 
ATOM   4048 O OE2 . GLU C 3 90  ? 92.767  13.416 61.213  1.00 28.52 ? 596  GLU A OE2 1 
ATOM   4049 N N   . VAL C 3 91  ? 88.347  12.978 57.068  1.00 12.94 ? 597  VAL A N   1 
ATOM   4050 C CA  . VAL C 3 91  ? 87.579  12.221 56.107  1.00 13.44 ? 597  VAL A CA  1 
ATOM   4051 C C   . VAL C 3 91  ? 88.367  12.008 54.817  1.00 13.88 ? 597  VAL A C   1 
ATOM   4052 O O   . VAL C 3 91  ? 88.220  10.974 54.162  1.00 14.34 ? 597  VAL A O   1 
ATOM   4053 C CB  . VAL C 3 91  ? 86.148  12.835 55.858  1.00 12.66 ? 597  VAL A CB  1 
ATOM   4054 C CG1 . VAL C 3 91  ? 86.193  14.054 54.896  1.00 13.67 ? 597  VAL A CG1 1 
ATOM   4055 C CG2 . VAL C 3 91  ? 85.247  11.694 55.287  1.00 9.96  ? 597  VAL A CG2 1 
ATOM   4056 N N   . LEU C 3 92  ? 89.227  12.952 54.444  1.00 12.79 ? 598  LEU A N   1 
ATOM   4057 C CA  . LEU C 3 92  ? 90.073  12.741 53.237  1.00 13.21 ? 598  LEU A CA  1 
ATOM   4058 C C   . LEU C 3 92  ? 91.108  11.640 53.576  1.00 13.80 ? 598  LEU A C   1 
ATOM   4059 O O   . LEU C 3 92  ? 91.435  10.783 52.740  1.00 12.10 ? 598  LEU A O   1 
ATOM   4060 C CB  . LEU C 3 92  ? 90.786  14.030 52.823  1.00 14.55 ? 598  LEU A CB  1 
ATOM   4061 C CG  . LEU C 3 92  ? 89.795  15.068 52.263  1.00 14.10 ? 598  LEU A CG  1 
ATOM   4062 C CD1 . LEU C 3 92  ? 90.458  16.430 52.101  1.00 13.61 ? 598  LEU A CD1 1 
ATOM   4063 C CD2 . LEU C 3 92  ? 89.273  14.521 50.924  1.00 13.36 ? 598  LEU A CD2 1 
ATOM   4064 N N   . LYS C 3 93  ? 91.590  11.649 54.808  1.00 14.16 ? 599  LYS A N   1 
ATOM   4065 C CA  . LYS C 3 93  ? 92.527  10.613 55.281  1.00 17.03 ? 599  LYS A CA  1 
ATOM   4066 C C   . LYS C 3 93  ? 91.839  9.242  55.156  1.00 16.24 ? 599  LYS A C   1 
ATOM   4067 O O   . LYS C 3 93  ? 92.408  8.300  54.589  1.00 17.34 ? 599  LYS A O   1 
ATOM   4068 C CB  . LYS C 3 93  ? 92.881  10.834 56.770  1.00 17.55 ? 599  LYS A CB  1 
ATOM   4069 C CG  . LYS C 3 93  ? 93.884  9.800  57.297  1.00 23.57 ? 599  LYS A CG  1 
ATOM   4070 C CD  . LYS C 3 93  ? 94.111  9.953  58.772  1.00 25.36 ? 599  LYS A CD  1 
ATOM   4071 C CE  . LYS C 3 93  ? 95.068  8.887  59.276  1.00 30.33 ? 599  LYS A CE  1 
ATOM   4072 N NZ  . LYS C 3 93  ? 95.565  9.208  60.677  1.00 33.70 ? 599  LYS A NZ  1 
ATOM   4073 N N   . TYR C 3 94  ? 90.621  9.145  55.701  1.00 15.71 ? 600  TYR A N   1 
ATOM   4074 C CA  . TYR C 3 94  ? 89.804  7.914  55.625  1.00 16.06 ? 600  TYR A CA  1 
ATOM   4075 C C   . TYR C 3 94  ? 89.639  7.505  54.127  1.00 17.14 ? 600  TYR A C   1 
ATOM   4076 O O   . TYR C 3 94  ? 89.777  6.332  53.748  1.00 17.19 ? 600  TYR A O   1 
ATOM   4077 C CB  . TYR C 3 94  ? 88.413  8.164  56.217  1.00 16.88 ? 600  TYR A CB  1 
ATOM   4078 C CG  . TYR C 3 94  ? 87.495  6.936  56.128  1.00 19.35 ? 600  TYR A CG  1 
ATOM   4079 C CD1 . TYR C 3 94  ? 87.564  5.918  57.073  1.00 18.20 ? 600  TYR A CD1 1 
ATOM   4080 C CD2 . TYR C 3 94  ? 86.618  6.778  55.074  1.00 18.28 ? 600  TYR A CD2 1 
ATOM   4081 C CE1 . TYR C 3 94  ? 86.769  4.760  56.957  1.00 20.54 ? 600  TYR A CE1 1 
ATOM   4082 C CE2 . TYR C 3 94  ? 85.807  5.639  54.950  1.00 19.54 ? 600  TYR A CE2 1 
ATOM   4083 C CZ  . TYR C 3 94  ? 85.887  4.640  55.880  1.00 19.92 ? 600  TYR A CZ  1 
ATOM   4084 O OH  . TYR C 3 94  ? 85.097  3.508  55.722  1.00 24.10 ? 600  TYR A OH  1 
ATOM   4085 N N   . THR C 3 95  ? 89.348  8.477  53.275  1.00 14.62 ? 601  THR A N   1 
ATOM   4086 C CA  . THR C 3 95  ? 89.161  8.173  51.870  1.00 14.97 ? 601  THR A CA  1 
ATOM   4087 C C   . THR C 3 95  ? 90.458  7.629  51.232  1.00 16.78 ? 601  THR A C   1 
ATOM   4088 O O   . THR C 3 95  ? 90.438  6.647  50.483  1.00 17.43 ? 601  THR A O   1 
ATOM   4089 C CB  . THR C 3 95  ? 88.692  9.430  51.139  1.00 13.20 ? 601  THR A CB  1 
ATOM   4090 O OG1 . THR C 3 95  ? 87.421  9.828  51.672  1.00 14.17 ? 601  THR A OG1 1 
ATOM   4091 C CG2 . THR C 3 95  ? 88.577  9.190  49.648  1.00 13.34 ? 601  THR A CG2 1 
ATOM   4092 N N   . LEU C 3 96  ? 91.590  8.264  51.538  1.00 16.76 ? 602  LEU A N   1 
ATOM   4093 C CA  . LEU C 3 96  ? 92.883  7.865  50.982  1.00 16.74 ? 602  LEU A CA  1 
ATOM   4094 C C   . LEU C 3 96  ? 93.387  6.499  51.480  1.00 18.58 ? 602  LEU A C   1 
ATOM   4095 O O   . LEU C 3 96  ? 93.774  5.644  50.689  1.00 17.45 ? 602  LEU A O   1 
ATOM   4096 C CB  . LEU C 3 96  ? 93.945  8.933  51.331  1.00 14.83 ? 602  LEU A CB  1 
ATOM   4097 C CG  . LEU C 3 96  ? 95.429  8.667  50.980  1.00 13.17 ? 602  LEU A CG  1 
ATOM   4098 C CD1 . LEU C 3 96  ? 95.570  8.413  49.486  1.00 10.79 ? 602  LEU A CD1 1 
ATOM   4099 C CD2 . LEU C 3 96  ? 96.309  9.844  51.404  1.00 11.52 ? 602  LEU A CD2 1 
ATOM   4100 N N   . PHE C 3 97  ? 93.376  6.324  52.797  1.00 19.11 ? 603  PHE A N   1 
ATOM   4101 C CA  . PHE C 3 97  ? 93.908  5.139  53.436  1.00 21.67 ? 603  PHE A CA  1 
ATOM   4102 C C   . PHE C 3 97  ? 92.967  3.964  53.643  1.00 23.16 ? 603  PHE A C   1 
ATOM   4103 O O   . PHE C 3 97  ? 93.431  2.837  53.819  1.00 23.37 ? 603  PHE A O   1 
ATOM   4104 C CB  . PHE C 3 97  ? 94.558  5.538  54.764  1.00 20.85 ? 603  PHE A CB  1 
ATOM   4105 C CG  . PHE C 3 97  ? 95.789  6.370  54.584  1.00 21.98 ? 603  PHE A CG  1 
ATOM   4106 C CD1 . PHE C 3 97  ? 96.917  5.838  53.949  1.00 23.68 ? 603  PHE A CD1 1 
ATOM   4107 C CD2 . PHE C 3 97  ? 95.836  7.665  55.040  1.00 22.21 ? 603  PHE A CD2 1 
ATOM   4108 C CE1 . PHE C 3 97  ? 98.083  6.596  53.773  1.00 24.62 ? 603  PHE A CE1 1 
ATOM   4109 C CE2 . PHE C 3 97  ? 96.998  8.435  54.873  1.00 25.25 ? 603  PHE A CE2 1 
ATOM   4110 C CZ  . PHE C 3 97  ? 98.131  7.897  54.234  1.00 23.87 ? 603  PHE A CZ  1 
ATOM   4111 N N   . GLN C 3 98  ? 91.666  4.205  53.607  1.00 22.10 ? 604  GLN A N   1 
ATOM   4112 C CA  . GLN C 3 98  ? 90.726  3.108  53.769  1.00 22.40 ? 604  GLN A CA  1 
ATOM   4113 C C   . GLN C 3 98  ? 90.008  2.855  52.441  1.00 22.03 ? 604  GLN A C   1 
ATOM   4114 O O   . GLN C 3 98  ? 90.217  1.831  51.816  1.00 22.53 ? 604  GLN A O   1 
ATOM   4115 C CB  . GLN C 3 98  ? 89.706  3.418  54.862  1.00 24.01 ? 604  GLN A CB  1 
ATOM   4116 C CG  . GLN C 3 98  ? 90.306  3.589  56.229  1.00 31.39 ? 604  GLN A CG  1 
ATOM   4117 C CD  . GLN C 3 98  ? 91.064  2.347  56.677  1.00 35.24 ? 604  GLN A CD  1 
ATOM   4118 O OE1 . GLN C 3 98  ? 90.548  1.214  56.573  1.00 36.67 ? 604  GLN A OE1 1 
ATOM   4119 N NE2 . GLN C 3 98  ? 92.298  2.543  57.177  1.00 36.62 ? 604  GLN A NE2 1 
ATOM   4120 N N   . ILE C 3 99  ? 89.208  3.799  51.964  1.00 20.16 ? 605  ILE A N   1 
ATOM   4121 C CA  . ILE C 3 99  ? 88.461  3.530  50.721  1.00 19.31 ? 605  ILE A CA  1 
ATOM   4122 C C   . ILE C 3 99  ? 89.364  3.161  49.552  1.00 20.32 ? 605  ILE A C   1 
ATOM   4123 O O   . ILE C 3 99  ? 89.101  2.171  48.823  1.00 20.16 ? 605  ILE A O   1 
ATOM   4124 C CB  . ILE C 3 99  ? 87.531  4.738  50.332  1.00 17.60 ? 605  ILE A CB  1 
ATOM   4125 C CG1 . ILE C 3 99  ? 86.501  4.967  51.426  1.00 15.21 ? 605  ILE A CG1 1 
ATOM   4126 C CG2 . ILE C 3 99  ? 86.895  4.496  48.954  1.00 17.70 ? 605  ILE A CG2 1 
ATOM   4127 C CD1 . ILE C 3 99  ? 85.432  6.092  51.140  1.00 16.58 ? 605  ILE A CD1 1 
ATOM   4128 N N   . PHE C 3 100 ? 90.435  3.924  49.363  1.00 18.98 ? 606  PHE A N   1 
ATOM   4129 C CA  . PHE C 3 100 ? 91.327  3.625  48.265  1.00 20.26 ? 606  PHE A CA  1 
ATOM   4130 C C   . PHE C 3 100 ? 92.679  3.038  48.684  1.00 20.04 ? 606  PHE A C   1 
ATOM   4131 O O   . PHE C 3 100 ? 93.692  3.271  48.045  1.00 17.81 ? 606  PHE A O   1 
ATOM   4132 C CB  . PHE C 3 100 ? 91.496  4.867  47.393  1.00 20.97 ? 606  PHE A CB  1 
ATOM   4133 C CG  . PHE C 3 100 ? 90.212  5.303  46.737  1.00 23.19 ? 606  PHE A CG  1 
ATOM   4134 C CD1 . PHE C 3 100 ? 89.577  4.464  45.797  1.00 23.25 ? 606  PHE A CD1 1 
ATOM   4135 C CD2 . PHE C 3 100 ? 89.596  6.527  47.098  1.00 22.67 ? 606  PHE A CD2 1 
ATOM   4136 C CE1 . PHE C 3 100 ? 88.334  4.825  45.233  1.00 24.09 ? 606  PHE A CE1 1 
ATOM   4137 C CE2 . PHE C 3 100 ? 88.363  6.903  46.543  1.00 23.29 ? 606  PHE A CE2 1 
ATOM   4138 C CZ  . PHE C 3 100 ? 87.716  6.057  45.606  1.00 23.43 ? 606  PHE A CZ  1 
ATOM   4139 N N   . SER C 3 101 ? 92.681  2.243  49.750  1.00 22.27 ? 607  SER A N   1 
ATOM   4140 C CA  . SER C 3 101 ? 93.925  1.598  50.202  1.00 25.03 ? 607  SER A CA  1 
ATOM   4141 C C   . SER C 3 101 ? 94.467  0.804  49.022  1.00 26.48 ? 607  SER A C   1 
ATOM   4142 O O   . SER C 3 101 ? 95.672  0.728  48.829  1.00 26.64 ? 607  SER A O   1 
ATOM   4143 C CB  . SER C 3 101 ? 93.656  0.655  51.356  1.00 26.25 ? 607  SER A CB  1 
ATOM   4144 O OG  . SER C 3 101 ? 92.605  -0.232 50.995  1.00 29.83 ? 607  SER A OG  1 
ATOM   4145 N N   . LYS C 3 102 ? 93.572  0.223  48.228  1.00 27.50 ? 608  LYS A N   1 
ATOM   4146 C CA  . LYS C 3 102 ? 93.969  -0.497 47.020  1.00 29.47 ? 608  LYS A CA  1 
ATOM   4147 C C   . LYS C 3 102 ? 93.106  0.051  45.891  1.00 29.57 ? 608  LYS A C   1 
ATOM   4148 O O   . LYS C 3 102 ? 91.978  0.511  46.125  1.00 29.61 ? 608  LYS A O   1 
ATOM   4149 C CB  . LYS C 3 102 ? 93.719  -2.003 47.189  1.00 33.13 ? 608  LYS A CB  1 
ATOM   4150 C CG  . LYS C 3 102 ? 94.456  -2.583 48.394  1.00 37.94 ? 608  LYS A CG  1 
ATOM   4151 C CD  . LYS C 3 102 ? 95.388  -3.719 47.988  1.00 42.58 ? 608  LYS A CD  1 
ATOM   4152 C CE  . LYS C 3 102 ? 96.602  -3.842 48.957  1.00 44.54 ? 608  LYS A CE  1 
ATOM   4153 N NZ  . LYS C 3 102 ? 97.578  -2.690 48.817  1.00 46.40 ? 608  LYS A NZ  1 
ATOM   4154 N N   . ILE C 3 103 ? 93.611  0.019  44.673  1.00 28.52 ? 609  ILE A N   1 
ATOM   4155 C CA  . ILE C 3 103 ? 92.839  0.530  43.558  1.00 28.43 ? 609  ILE A CA  1 
ATOM   4156 C C   . ILE C 3 103 ? 92.313  -0.692 42.803  1.00 29.91 ? 609  ILE A C   1 
ATOM   4157 O O   . ILE C 3 103 ? 92.996  -1.238 41.948  1.00 29.05 ? 609  ILE A O   1 
ATOM   4158 C CB  . ILE C 3 103 ? 93.722  1.414  42.610  1.00 28.28 ? 609  ILE A CB  1 
ATOM   4159 C CG1 . ILE C 3 103 ? 94.301  2.609  43.379  1.00 26.88 ? 609  ILE A CG1 1 
ATOM   4160 C CG2 . ILE C 3 103 ? 92.916  1.901  41.410  1.00 27.46 ? 609  ILE A CG2 1 
ATOM   4161 C CD1 . ILE C 3 103 ? 93.244  3.604  43.863  1.00 26.68 ? 609  ILE A CD1 1 
ATOM   4162 N N   . ASP C 3 104 ? 91.084  -1.085 43.129  1.00 31.50 ? 610  ASP A N   1 
ATOM   4163 C CA  . ASP C 3 104 ? 90.375  -2.217 42.530  1.00 32.99 ? 610  ASP A CA  1 
ATOM   4164 C C   . ASP C 3 104 ? 89.931  -2.082 41.100  1.00 32.28 ? 610  ASP A C   1 
ATOM   4165 O O   . ASP C 3 104 ? 89.859  -3.078 40.399  1.00 33.16 ? 610  ASP A O   1 
ATOM   4166 C CB  . ASP C 3 104 ? 89.121  -2.535 43.323  1.00 36.69 ? 610  ASP A CB  1 
ATOM   4167 C CG  . ASP C 3 104 ? 89.434  -2.982 44.677  1.00 39.49 ? 610  ASP A CG  1 
ATOM   4168 O OD1 . ASP C 3 104 ? 90.487  -3.650 44.797  1.00 41.52 ? 610  ASP A OD1 1 
ATOM   4169 O OD2 . ASP C 3 104 ? 88.642  -2.675 45.599  1.00 42.11 ? 610  ASP A OD2 1 
ATOM   4170 N N   . ARG C 3 105 ? 89.568  -0.886 40.672  1.00 30.78 ? 611  ARG A N   1 
ATOM   4171 C CA  . ARG C 3 105 ? 89.146  -0.730 39.294  1.00 30.52 ? 611  ARG A CA  1 
ATOM   4172 C C   . ARG C 3 105 ? 89.965  0.330  38.666  1.00 29.80 ? 611  ARG A C   1 
ATOM   4173 O O   . ARG C 3 105 ? 89.533  1.485  38.644  1.00 28.46 ? 611  ARG A O   1 
ATOM   4174 C CB  . ARG C 3 105 ? 87.693  -0.244 39.150  1.00 31.90 ? 611  ARG A CB  1 
ATOM   4175 C CG  . ARG C 3 105 ? 86.616  -1.021 39.776  1.00 30.43 ? 611  ARG A CG  1 
ATOM   4176 C CD  . ARG C 3 105 ? 85.322  -0.201 39.663  1.00 29.98 ? 611  ARG A CD  1 
ATOM   4177 N NE  . ARG C 3 105 ? 84.713  -0.217 38.327  1.00 27.75 ? 611  ARG A NE  1 
ATOM   4178 C CZ  . ARG C 3 105 ? 83.697  0.569  37.968  1.00 26.96 ? 611  ARG A CZ  1 
ATOM   4179 N NH1 . ARG C 3 105 ? 83.189  1.451  38.827  1.00 24.65 ? 611  ARG A NH1 1 
ATOM   4180 N NH2 . ARG C 3 105 ? 83.122  0.425  36.781  1.00 27.26 ? 611  ARG A NH2 1 
ATOM   4181 N N   . PRO C 3 106 ? 91.152  -0.023 38.130  1.00 29.80 ? 612  PRO A N   1 
ATOM   4182 C CA  . PRO C 3 106 ? 91.941  1.040  37.504  1.00 29.72 ? 612  PRO A CA  1 
ATOM   4183 C C   . PRO C 3 106 ? 91.283  1.513  36.201  1.00 29.13 ? 612  PRO A C   1 
ATOM   4184 O O   . PRO C 3 106 ? 91.668  2.521  35.640  1.00 29.81 ? 612  PRO A O   1 
ATOM   4185 C CB  . PRO C 3 106 ? 93.314  0.395  37.295  1.00 30.00 ? 612  PRO A CB  1 
ATOM   4186 C CG  . PRO C 3 106 ? 92.979  -1.083 37.161  1.00 29.93 ? 612  PRO A CG  1 
ATOM   4187 C CD  . PRO C 3 106 ? 91.863  -1.318 38.145  1.00 29.41 ? 612  PRO A CD  1 
ATOM   4188 N N   . GLU C 3 107 ? 90.296  0.792  35.712  1.00 29.94 ? 613  GLU A N   1 
ATOM   4189 C CA  . GLU C 3 107 ? 89.645  1.268  34.488  1.00 32.02 ? 613  GLU A CA  1 
ATOM   4190 C C   . GLU C 3 107 ? 88.600  2.377  34.774  1.00 31.02 ? 613  GLU A C   1 
ATOM   4191 O O   . GLU C 3 107 ? 88.133  3.065  33.841  1.00 31.79 ? 613  GLU A O   1 
ATOM   4192 C CB  . GLU C 3 107 ? 88.995  0.119  33.728  1.00 33.14 ? 613  GLU A CB  1 
ATOM   4193 C CG  . GLU C 3 107 ? 87.787  -0.448 34.379  1.00 35.16 ? 613  GLU A CG  1 
ATOM   4194 C CD  . GLU C 3 107 ? 88.102  -1.312 35.574  1.00 36.83 ? 613  GLU A CD  1 
ATOM   4195 O OE1 . GLU C 3 107 ? 87.160  -1.975 36.064  1.00 36.56 ? 613  GLU A OE1 1 
ATOM   4196 O OE2 . GLU C 3 107 ? 89.269  -1.316 36.028  1.00 36.17 ? 613  GLU A OE2 1 
ATOM   4197 N N   . ALA C 3 108 ? 88.238  2.564  36.046  1.00 27.11 ? 614  ALA A N   1 
ATOM   4198 C CA  . ALA C 3 108 ? 87.277  3.619  36.363  1.00 25.99 ? 614  ALA A CA  1 
ATOM   4199 C C   . ALA C 3 108 ? 88.015  4.864  36.823  1.00 24.86 ? 614  ALA A C   1 
ATOM   4200 O O   . ALA C 3 108 ? 89.188  4.803  37.166  1.00 25.09 ? 614  ALA A O   1 
ATOM   4201 C CB  . ALA C 3 108 ? 86.319  3.166  37.466  1.00 26.05 ? 614  ALA A CB  1 
ATOM   4202 N N   . SER C 3 109 ? 87.350  6.005  36.776  1.00 22.08 ? 615  SER A N   1 
ATOM   4203 C CA  . SER C 3 109 ? 87.956  7.206  37.315  1.00 21.02 ? 615  SER A CA  1 
ATOM   4204 C C   . SER C 3 109 ? 87.457  7.150  38.767  1.00 19.49 ? 615  SER A C   1 
ATOM   4205 O O   . SER C 3 109 ? 86.518  6.415  39.076  1.00 16.52 ? 615  SER A O   1 
ATOM   4206 C CB  . SER C 3 109 ? 87.424  8.463  36.630  1.00 21.23 ? 615  SER A CB  1 
ATOM   4207 O OG  . SER C 3 109 ? 88.098  8.640  35.401  1.00 20.66 ? 615  SER A OG  1 
ATOM   4208 N N   . ARG C 3 110 ? 88.079  7.917  39.655  1.00 19.13 ? 616  ARG A N   1 
ATOM   4209 C CA  . ARG C 3 110 ? 87.655  7.931  41.042  1.00 17.11 ? 616  ARG A CA  1 
ATOM   4210 C C   . ARG C 3 110 ? 87.453  9.377  41.438  1.00 16.46 ? 616  ARG A C   1 
ATOM   4211 O O   . ARG C 3 110 ? 88.322  10.225 41.182  1.00 15.40 ? 616  ARG A O   1 
ATOM   4212 C CB  . ARG C 3 110 ? 88.732  7.352  41.939  1.00 19.47 ? 616  ARG A CB  1 
ATOM   4213 C CG  . ARG C 3 110 ? 88.957  5.873  41.850  1.00 24.25 ? 616  ARG A CG  1 
ATOM   4214 C CD  . ARG C 3 110 ? 90.427  5.566  42.199  1.00 27.30 ? 616  ARG A CD  1 
ATOM   4215 N NE  . ARG C 3 110 ? 90.837  4.627  41.199  1.00 36.04 ? 616  ARG A NE  1 
ATOM   4216 C CZ  . ARG C 3 110 ? 91.349  4.928  40.017  1.00 35.36 ? 616  ARG A CZ  1 
ATOM   4217 N NH1 . ARG C 3 110 ? 91.592  6.176  39.648  1.00 39.95 ? 616  ARG A NH1 1 
ATOM   4218 N NH2 . ARG C 3 110 ? 91.487  3.959  39.151  1.00 37.64 ? 616  ARG A NH2 1 
ATOM   4219 N N   . ILE C 3 111 ? 86.345  9.648  42.120  1.00 15.47 ? 617  ILE A N   1 
ATOM   4220 C CA  . ILE C 3 111 ? 86.056  10.997 42.533  1.00 15.76 ? 617  ILE A CA  1 
ATOM   4221 C C   . ILE C 3 111 ? 85.536  11.039 43.959  1.00 17.30 ? 617  ILE A C   1 
ATOM   4222 O O   . ILE C 3 111 ? 84.660  10.223 44.326  1.00 15.94 ? 617  ILE A O   1 
ATOM   4223 C CB  . ILE C 3 111 ? 84.966  11.618 41.643  1.00 15.89 ? 617  ILE A CB  1 
ATOM   4224 C CG1 . ILE C 3 111 ? 85.478  11.770 40.200  1.00 16.04 ? 617  ILE A CG1 1 
ATOM   4225 C CG2 . ILE C 3 111 ? 84.506  12.899 42.247  1.00 16.35 ? 617  ILE A CG2 1 
ATOM   4226 C CD1 . ILE C 3 111 ? 84.366  12.320 39.234  1.00 16.85 ? 617  ILE A CD1 1 
ATOM   4227 N N   . ALA C 3 112 ? 86.083  11.997 44.737  1.00 14.62 ? 618  ALA A N   1 
ATOM   4228 C CA  . ALA C 3 112 ? 85.665  12.237 46.115  1.00 15.34 ? 618  ALA A CA  1 
ATOM   4229 C C   . ALA C 3 112 ? 84.847  13.555 46.048  1.00 15.73 ? 618  ALA A C   1 
ATOM   4230 O O   . ALA C 3 112 ? 85.403  14.630 45.754  1.00 16.04 ? 618  ALA A O   1 
ATOM   4231 C CB  . ALA C 3 112 ? 86.918  12.407 47.021  1.00 14.09 ? 618  ALA A CB  1 
ATOM   4232 N N   . LEU C 3 113 ? 83.537  13.461 46.266  1.00 14.81 ? 619  LEU A N   1 
ATOM   4233 C CA  . LEU C 3 113 ? 82.659  14.650 46.223  1.00 14.99 ? 619  LEU A CA  1 
ATOM   4234 C C   . LEU C 3 113 ? 82.580  15.124 47.664  1.00 14.28 ? 619  LEU A C   1 
ATOM   4235 O O   . LEU C 3 113 ? 81.830  14.566 48.471  1.00 13.87 ? 619  LEU A O   1 
ATOM   4236 C CB  . LEU C 3 113 ? 81.251  14.268 45.733  1.00 14.04 ? 619  LEU A CB  1 
ATOM   4237 C CG  . LEU C 3 113 ? 80.314  15.414 45.305  1.00 14.99 ? 619  LEU A CG  1 
ATOM   4238 C CD1 . LEU C 3 113 ? 81.021  16.221 44.151  1.00 10.69 ? 619  LEU A CD1 1 
ATOM   4239 C CD2 . LEU C 3 113 ? 78.917  14.870 44.790  1.00 14.04 ? 619  LEU A CD2 1 
ATOM   4240 N N   . LEU C 3 114 ? 83.358  16.146 47.987  1.00 13.63 ? 620  LEU A N   1 
ATOM   4241 C CA  . LEU C 3 114 ? 83.434  16.620 49.375  1.00 12.84 ? 620  LEU A CA  1 
ATOM   4242 C C   . LEU C 3 114 ? 82.426  17.746 49.629  1.00 13.91 ? 620  LEU A C   1 
ATOM   4243 O O   . LEU C 3 114 ? 82.658  18.914 49.264  1.00 12.23 ? 620  LEU A O   1 
ATOM   4244 C CB  . LEU C 3 114 ? 84.876  17.033 49.661  1.00 12.74 ? 620  LEU A CB  1 
ATOM   4245 C CG  . LEU C 3 114 ? 85.240  17.589 51.055  1.00 13.97 ? 620  LEU A CG  1 
ATOM   4246 C CD1 . LEU C 3 114 ? 84.935  16.595 52.148  1.00 12.77 ? 620  LEU A CD1 1 
ATOM   4247 C CD2 . LEU C 3 114 ? 86.738  17.882 51.087  1.00 12.02 ? 620  LEU A CD2 1 
ATOM   4248 N N   . LEU C 3 115 ? 81.295  17.373 50.232  1.00 14.00 ? 621  LEU A N   1 
ATOM   4249 C CA  . LEU C 3 115 ? 80.189  18.322 50.509  1.00 15.48 ? 621  LEU A CA  1 
ATOM   4250 C C   . LEU C 3 115 ? 80.467  19.004 51.874  1.00 17.00 ? 621  LEU A C   1 
ATOM   4251 O O   . LEU C 3 115 ? 80.289  18.424 52.918  1.00 18.72 ? 621  LEU A O   1 
ATOM   4252 C CB  . LEU C 3 115 ? 78.903  17.527 50.459  1.00 14.21 ? 621  LEU A CB  1 
ATOM   4253 C CG  . LEU C 3 115 ? 78.649  17.062 49.000  1.00 16.21 ? 621  LEU A CG  1 
ATOM   4254 C CD1 . LEU C 3 115 ? 77.884  15.685 48.865  1.00 14.83 ? 621  LEU A CD1 1 
ATOM   4255 C CD2 . LEU C 3 115 ? 77.802  18.136 48.381  1.00 15.97 ? 621  LEU A CD2 1 
ATOM   4256 N N   . MET C 3 116 ? 80.913  20.248 51.806  1.00 15.94 ? 622  MET A N   1 
ATOM   4257 C CA  . MET C 3 116 ? 81.395  21.001 52.939  1.00 16.73 ? 622  MET A CA  1 
ATOM   4258 C C   . MET C 3 116 ? 80.546  22.181 53.347  1.00 16.39 ? 622  MET A C   1 
ATOM   4259 O O   . MET C 3 116 ? 80.194  22.980 52.503  1.00 18.56 ? 622  MET A O   1 
ATOM   4260 C CB  . MET C 3 116 ? 82.801  21.545 52.589  1.00 19.64 ? 622  MET A CB  1 
ATOM   4261 C CG  . MET C 3 116 ? 83.886  20.549 52.152  1.00 20.29 ? 622  MET A CG  1 
ATOM   4262 S SD  . MET C 3 116 ? 85.262  21.483 51.390  1.00 20.05 ? 622  MET A SD  1 
ATOM   4263 C CE  . MET C 3 116 ? 85.627  22.653 52.745  1.00 17.90 ? 622  MET A CE  1 
ATOM   4264 N N   . ALA C 3 117 ? 80.285  22.328 54.646  1.00 14.68 ? 623  ALA A N   1 
ATOM   4265 C CA  . ALA C 3 117 ? 79.462  23.434 55.153  1.00 14.98 ? 623  ALA A CA  1 
ATOM   4266 C C   . ALA C 3 117 ? 80.093  24.078 56.404  1.00 16.44 ? 623  ALA A C   1 
ATOM   4267 O O   . ALA C 3 117 ? 79.455  24.890 57.061  1.00 13.76 ? 623  ALA A O   1 
ATOM   4268 C CB  . ALA C 3 117 ? 78.083  22.888 55.536  1.00 13.96 ? 623  ALA A CB  1 
ATOM   4269 N N   . SER C 3 118 ? 81.349  23.752 56.703  1.00 15.75 ? 624  SER A N   1 
ATOM   4270 C CA  . SER C 3 118 ? 81.941  24.208 57.959  1.00 17.22 ? 624  SER A CA  1 
ATOM   4271 C C   . SER C 3 118 ? 83.455  24.334 57.857  1.00 18.22 ? 624  SER A C   1 
ATOM   4272 O O   . SER C 3 118 ? 84.045  24.074 56.812  1.00 17.28 ? 624  SER A O   1 
ATOM   4273 C CB  . SER C 3 118 ? 81.587  23.188 59.058  1.00 15.73 ? 624  SER A CB  1 
ATOM   4274 O OG  . SER C 3 118 ? 82.233  21.920 58.785  1.00 15.41 ? 624  SER A OG  1 
ATOM   4275 N N   . GLN C 3 119 ? 84.087  24.723 58.959  1.00 19.35 ? 625  GLN A N   1 
ATOM   4276 C CA  . GLN C 3 119 ? 85.528  24.910 58.960  1.00 21.04 ? 625  GLN A CA  1 
ATOM   4277 C C   . GLN C 3 119 ? 86.179  24.257 60.206  1.00 20.13 ? 625  GLN A C   1 
ATOM   4278 O O   . GLN C 3 119 ? 85.919  24.673 61.335  1.00 19.54 ? 625  GLN A O   1 
ATOM   4279 C CB  . GLN C 3 119 ? 85.775  26.404 58.917  1.00 24.37 ? 625  GLN A CB  1 
ATOM   4280 C CG  . GLN C 3 119 ? 87.217  26.753 59.040  1.00 32.19 ? 625  GLN A CG  1 
ATOM   4281 C CD  . GLN C 3 119 ? 87.455  28.231 58.899  1.00 36.33 ? 625  GLN A CD  1 
ATOM   4282 O OE1 . GLN C 3 119 ? 88.599  28.670 58.965  1.00 41.28 ? 625  GLN A OE1 1 
ATOM   4283 N NE2 . GLN C 3 119 ? 86.384  29.016 58.707  1.00 37.62 ? 625  GLN A NE2 1 
ATOM   4284 N N   . GLU C 3 120 ? 87.017  23.238 60.015  1.00 17.55 ? 626  GLU A N   1 
ATOM   4285 C CA  . GLU C 3 120 ? 87.616  22.531 61.172  1.00 14.27 ? 626  GLU A CA  1 
ATOM   4286 C C   . GLU C 3 120 ? 88.667  23.386 61.898  1.00 14.82 ? 626  GLU A C   1 
ATOM   4287 O O   . GLU C 3 120 ? 89.210  24.320 61.314  1.00 14.39 ? 626  GLU A O   1 
ATOM   4288 C CB  . GLU C 3 120 ? 88.290  21.260 60.684  1.00 13.43 ? 626  GLU A CB  1 
ATOM   4289 C CG  . GLU C 3 120 ? 89.503  21.504 59.706  1.00 11.24 ? 626  GLU A CG  1 
ATOM   4290 C CD  . GLU C 3 120 ? 90.057  20.192 59.089  1.00 13.50 ? 626  GLU A CD  1 
ATOM   4291 O OE1 . GLU C 3 120 ? 89.418  19.144 59.297  1.00 13.12 ? 626  GLU A OE1 1 
ATOM   4292 O OE2 . GLU C 3 120 ? 91.120  20.211 58.408  1.00 12.28 ? 626  GLU A OE2 1 
ATOM   4293 N N   . PRO C 3 121 ? 88.946  23.096 63.187  1.00 14.75 ? 627  PRO A N   1 
ATOM   4294 C CA  . PRO C 3 121 ? 89.959  23.866 63.925  1.00 14.39 ? 627  PRO A CA  1 
ATOM   4295 C C   . PRO C 3 121 ? 91.274  23.697 63.143  1.00 14.28 ? 627  PRO A C   1 
ATOM   4296 O O   . PRO C 3 121 ? 91.500  22.657 62.535  1.00 12.49 ? 627  PRO A O   1 
ATOM   4297 C CB  . PRO C 3 121 ? 90.036  23.136 65.277  1.00 16.09 ? 627  PRO A CB  1 
ATOM   4298 C CG  . PRO C 3 121 ? 88.598  22.643 65.474  1.00 13.33 ? 627  PRO A CG  1 
ATOM   4299 C CD  . PRO C 3 121 ? 88.268  22.122 64.068  1.00 14.60 ? 627  PRO A CD  1 
ATOM   4300 N N   . GLN C 3 122 ? 92.140  24.699 63.152  1.00 14.79 ? 628  GLN A N   1 
ATOM   4301 C CA  . GLN C 3 122 ? 93.390  24.592 62.401  1.00 15.89 ? 628  GLN A CA  1 
ATOM   4302 C C   . GLN C 3 122 ? 94.275  23.373 62.727  1.00 15.90 ? 628  GLN A C   1 
ATOM   4303 O O   . GLN C 3 122 ? 94.870  22.813 61.831  1.00 15.35 ? 628  GLN A O   1 
ATOM   4304 C CB  . GLN C 3 122 ? 94.200  25.875 62.574  1.00 18.21 ? 628  GLN A CB  1 
ATOM   4305 C CG  . GLN C 3 122 ? 93.585  27.012 61.805  1.00 19.55 ? 628  GLN A CG  1 
ATOM   4306 C CD  . GLN C 3 122 ? 94.148  28.380 62.187  1.00 22.37 ? 628  GLN A CD  1 
ATOM   4307 O OE1 . GLN C 3 122 ? 95.037  28.527 63.056  1.00 19.83 ? 628  GLN A OE1 1 
ATOM   4308 N NE2 . GLN C 3 122 ? 93.603  29.412 61.540  1.00 23.52 ? 628  GLN A NE2 1 
ATOM   4309 N N   . ARG C 3 123 ? 94.365  22.980 64.002  1.00 13.63 ? 629  ARG A N   1 
ATOM   4310 C CA  . ARG C 3 123 ? 95.202  21.855 64.356  1.00 15.31 ? 629  ARG A CA  1 
ATOM   4311 C C   . ARG C 3 123 ? 94.770  20.576 63.599  1.00 14.86 ? 629  ARG A C   1 
ATOM   4312 O O   . ARG C 3 123 ? 95.580  19.695 63.348  1.00 15.84 ? 629  ARG A O   1 
ATOM   4313 C CB  . ARG C 3 123 ? 95.129  21.601 65.870  1.00 16.73 ? 629  ARG A CB  1 
ATOM   4314 C CG  . ARG C 3 123 ? 93.704  21.122 66.326  1.00 20.84 ? 629  ARG A CG  1 
ATOM   4315 C CD  . ARG C 3 123 ? 93.713  20.603 67.751  1.00 26.04 ? 629  ARG A CD  1 
ATOM   4316 N NE  . ARG C 3 123 ? 94.606  19.466 67.855  1.00 29.52 ? 629  ARG A NE  1 
ATOM   4317 C CZ  . ARG C 3 123 ? 94.267  18.227 67.520  1.00 32.87 ? 629  ARG A CZ  1 
ATOM   4318 N NH1 . ARG C 3 123 ? 93.037  17.954 67.095  1.00 32.91 ? 629  ARG A NH1 1 
ATOM   4319 N NH2 . ARG C 3 123 ? 95.201  17.276 67.490  1.00 34.24 ? 629  ARG A NH2 1 
ATOM   4320 N N   . MET C 3 124 ? 93.494  20.467 63.252  1.00 14.25 ? 630  MET A N   1 
ATOM   4321 C CA  . MET C 3 124 ? 93.012  19.264 62.549  1.00 14.01 ? 630  MET A CA  1 
ATOM   4322 C C   . MET C 3 124 ? 93.455  19.270 61.076  1.00 13.34 ? 630  MET A C   1 
ATOM   4323 O O   . MET C 3 124 ? 93.496  18.235 60.423  1.00 12.25 ? 630  MET A O   1 
ATOM   4324 C CB  . MET C 3 124 ? 91.475  19.217 62.654  1.00 14.68 ? 630  MET A CB  1 
ATOM   4325 C CG  . MET C 3 124 ? 91.049  18.919 64.067  1.00 17.28 ? 630  MET A CG  1 
ATOM   4326 S SD  . MET C 3 124 ? 89.351  18.496 64.065  1.00 20.80 ? 630  MET A SD  1 
ATOM   4327 C CE  . MET C 3 124 ? 89.544  16.760 63.853  1.00 24.22 ? 630  MET A CE  1 
ATOM   4328 N N   . SER C 3 125 ? 93.836  20.441 60.575  1.00 12.05 ? 631  SER A N   1 
ATOM   4329 C CA  . SER C 3 125 ? 94.271  20.591 59.170  1.00 13.33 ? 631  SER A CA  1 
ATOM   4330 C C   . SER C 3 125 ? 95.772  20.361 58.941  1.00 14.08 ? 631  SER A C   1 
ATOM   4331 O O   . SER C 3 125 ? 96.255  20.531 57.819  1.00 13.54 ? 631  SER A O   1 
ATOM   4332 C CB  . SER C 3 125 ? 93.986  22.040 58.711  1.00 12.35 ? 631  SER A CB  1 
ATOM   4333 O OG  . SER C 3 125 ? 92.624  22.356 58.848  1.00 10.46 ? 631  SER A OG  1 
ATOM   4334 N N   . ARG C 3 126 ? 96.518  20.011 59.983  1.00 13.41 ? 632  ARG A N   1 
ATOM   4335 C CA  . ARG C 3 126 ? 97.986  19.900 59.832  1.00 12.01 ? 632  ARG A CA  1 
ATOM   4336 C C   . ARG C 3 126 ? 98.500  19.115 58.634  1.00 11.45 ? 632  ARG A C   1 
ATOM   4337 O O   . ARG C 3 126 ? 99.433  19.562 57.967  1.00 10.01 ? 632  ARG A O   1 
ATOM   4338 C CB  . ARG C 3 126 ? 98.614  19.346 61.121  1.00 10.83 ? 632  ARG A CB  1 
ATOM   4339 C CG  . ARG C 3 126 ? 100.134 19.444 61.092  1.00 9.93  ? 632  ARG A CG  1 
ATOM   4340 C CD  . ARG C 3 126 ? 100.748 19.045 62.445  1.00 11.67 ? 632  ARG A CD  1 
ATOM   4341 N NE  . ARG C 3 126 ? 100.535 19.980 63.550  1.00 11.68 ? 632  ARG A NE  1 
ATOM   4342 C CZ  . ARG C 3 126 ? 101.161 21.156 63.700  1.00 9.93  ? 632  ARG A CZ  1 
ATOM   4343 N NH1 . ARG C 3 126 ? 102.036 21.603 62.799  1.00 10.18 ? 632  ARG A NH1 1 
ATOM   4344 N NH2 . ARG C 3 126 ? 101.006 21.835 64.843  1.00 9.34  ? 632  ARG A NH2 1 
ATOM   4345 N N   . ASN C 3 127 ? 97.855  17.978 58.354  1.00 11.60 ? 633  ASN A N   1 
ATOM   4346 C CA  . ASN C 3 127 ? 98.221  17.129 57.209  1.00 14.00 ? 633  ASN A CA  1 
ATOM   4347 C C   . ASN C 3 127 ? 97.319  17.313 55.981  1.00 14.14 ? 633  ASN A C   1 
ATOM   4348 O O   . ASN C 3 127 ? 97.485  16.604 54.979  1.00 14.73 ? 633  ASN A O   1 
ATOM   4349 C CB  . ASN C 3 127 ? 98.183  15.635 57.605  1.00 14.58 ? 633  ASN A CB  1 
ATOM   4350 C CG  . ASN C 3 127 ? 99.421  15.228 58.370  1.00 18.48 ? 633  ASN A CG  1 
ATOM   4351 O OD1 . ASN C 3 127 ? 100.432 15.934 58.320  1.00 17.24 ? 633  ASN A OD1 1 
ATOM   4352 N ND2 . ASN C 3 127 ? 99.358  14.091 59.105  1.00 18.87 ? 633  ASN A ND2 1 
ATOM   4353 N N   . PHE C 3 128 ? 96.411  18.279 56.050  1.00 12.41 ? 634  PHE A N   1 
ATOM   4354 C CA  . PHE C 3 128 ? 95.448  18.495 54.984  1.00 13.63 ? 634  PHE A CA  1 
ATOM   4355 C C   . PHE C 3 128 ? 95.984  18.385 53.563  1.00 14.43 ? 634  PHE A C   1 
ATOM   4356 O O   . PHE C 3 128 ? 95.521  17.558 52.789  1.00 13.49 ? 634  PHE A O   1 
ATOM   4357 C CB  . PHE C 3 128 ? 94.741  19.856 55.126  1.00 11.73 ? 634  PHE A CB  1 
ATOM   4358 C CG  . PHE C 3 128 ? 93.696  20.088 54.048  1.00 13.85 ? 634  PHE A CG  1 
ATOM   4359 C CD1 . PHE C 3 128 ? 92.382  19.541 54.177  1.00 11.64 ? 634  PHE A CD1 1 
ATOM   4360 C CD2 . PHE C 3 128 ? 93.993  20.873 52.920  1.00 14.01 ? 634  PHE A CD2 1 
ATOM   4361 C CE1 . PHE C 3 128 ? 91.415  19.799 53.205  1.00 13.90 ? 634  PHE A CE1 1 
ATOM   4362 C CE2 . PHE C 3 128 ? 92.975  21.126 51.937  1.00 12.45 ? 634  PHE A CE2 1 
ATOM   4363 C CZ  . PHE C 3 128 ? 91.734  20.607 52.080  1.00 10.04 ? 634  PHE A CZ  1 
ATOM   4364 N N   . VAL C 3 129 ? 96.966  19.215 53.223  1.00 13.71 ? 635  VAL A N   1 
ATOM   4365 C CA  . VAL C 3 129 ? 97.499  19.187 51.901  1.00 14.91 ? 635  VAL A CA  1 
ATOM   4366 C C   . VAL C 3 129 ? 98.196  17.878 51.549  1.00 15.21 ? 635  VAL A C   1 
ATOM   4367 O O   . VAL C 3 129 ? 98.258  17.500 50.372  1.00 15.52 ? 635  VAL A O   1 
ATOM   4368 C CB  . VAL C 3 129 ? 98.499  20.362 51.672  1.00 17.00 ? 635  VAL A CB  1 
ATOM   4369 C CG1 . VAL C 3 129 ? 99.022  20.317 50.243  1.00 19.18 ? 635  VAL A CG1 1 
ATOM   4370 C CG2 . VAL C 3 129 ? 97.783  21.666 51.864  1.00 18.74 ? 635  VAL A CG2 1 
ATOM   4371 N N   . ARG C 3 130 ? 98.740  17.187 52.543  1.00 14.18 ? 636  ARG A N   1 
ATOM   4372 C CA  . ARG C 3 130 ? 99.410  15.925 52.252  1.00 12.80 ? 636  ARG A CA  1 
ATOM   4373 C C   . ARG C 3 130 ? 98.342  14.905 51.917  1.00 10.56 ? 636  ARG A C   1 
ATOM   4374 O O   . ARG C 3 130 ? 98.575  14.071 51.053  1.00 10.90 ? 636  ARG A O   1 
ATOM   4375 C CB  . ARG C 3 130 ? 100.280 15.446 53.442  1.00 13.20 ? 636  ARG A CB  1 
ATOM   4376 C CG  . ARG C 3 130 ? 101.489 16.334 53.652  1.00 13.84 ? 636  ARG A CG  1 
ATOM   4377 C CD  . ARG C 3 130 ? 102.265 15.936 54.914  1.00 12.87 ? 636  ARG A CD  1 
ATOM   4378 N NE  . ARG C 3 130 ? 102.888 14.651 54.668  1.00 14.10 ? 636  ARG A NE  1 
ATOM   4379 C CZ  . ARG C 3 130 ? 103.516 13.932 55.592  1.00 15.12 ? 636  ARG A CZ  1 
ATOM   4380 N NH1 . ARG C 3 130 ? 103.601 14.368 56.863  1.00 11.48 ? 636  ARG A NH1 1 
ATOM   4381 N NH2 . ARG C 3 130 ? 104.089 12.805 55.219  1.00 14.22 ? 636  ARG A NH2 1 
ATOM   4382 N N   . TYR C 3 131 ? 97.190  14.947 52.598  1.00 9.43  ? 637  TYR A N   1 
ATOM   4383 C CA  . TYR C 3 131 ? 96.124  14.024 52.239  1.00 12.66 ? 637  TYR A CA  1 
ATOM   4384 C C   . TYR C 3 131 ? 95.644  14.326 50.817  1.00 12.71 ? 637  TYR A C   1 
ATOM   4385 O O   . TYR C 3 131 ? 95.478  13.387 50.016  1.00 13.00 ? 637  TYR A O   1 
ATOM   4386 C CB  . TYR C 3 131 ? 94.941  14.092 53.182  1.00 12.06 ? 637  TYR A CB  1 
ATOM   4387 C CG  . TYR C 3 131 ? 95.360  13.725 54.579  1.00 16.22 ? 637  TYR A CG  1 
ATOM   4388 C CD1 . TYR C 3 131 ? 96.268  12.683 54.790  1.00 15.13 ? 637  TYR A CD1 1 
ATOM   4389 C CD2 . TYR C 3 131 ? 94.857  14.417 55.688  1.00 15.10 ? 637  TYR A CD2 1 
ATOM   4390 C CE1 . TYR C 3 131 ? 96.670  12.333 56.056  1.00 16.07 ? 637  TYR A CE1 1 
ATOM   4391 C CE2 . TYR C 3 131 ? 95.251  14.059 56.990  1.00 16.29 ? 637  TYR A CE2 1 
ATOM   4392 C CZ  . TYR C 3 131 ? 96.163  13.014 57.148  1.00 15.68 ? 637  TYR A CZ  1 
ATOM   4393 O OH  . TYR C 3 131 ? 96.592  12.644 58.387  1.00 16.99 ? 637  TYR A OH  1 
ATOM   4394 N N   . VAL C 3 132 ? 95.452  15.609 50.483  1.00 10.48 ? 638  VAL A N   1 
ATOM   4395 C CA  . VAL C 3 132 ? 94.981  15.918 49.129  1.00 11.96 ? 638  VAL A CA  1 
ATOM   4396 C C   . VAL C 3 132 ? 95.985  15.471 48.044  1.00 13.64 ? 638  VAL A C   1 
ATOM   4397 O O   . VAL C 3 132 ? 95.577  14.996 46.951  1.00 11.84 ? 638  VAL A O   1 
ATOM   4398 C CB  . VAL C 3 132 ? 94.667  17.419 48.958  1.00 11.47 ? 638  VAL A CB  1 
ATOM   4399 C CG1 . VAL C 3 132 ? 94.146  17.690 47.515  1.00 12.21 ? 638  VAL A CG1 1 
ATOM   4400 C CG2 . VAL C 3 132 ? 93.647  17.866 50.005  1.00 10.55 ? 638  VAL A CG2 1 
ATOM   4401 N N   . GLN C 3 133 ? 97.282  15.662 48.317  1.00 13.53 ? 639  GLN A N   1 
ATOM   4402 C CA  . GLN C 3 133 ? 98.350  15.212 47.415  1.00 15.61 ? 639  GLN A CA  1 
ATOM   4403 C C   . GLN C 3 133 ? 98.399  13.671 47.344  1.00 14.93 ? 639  GLN A C   1 
ATOM   4404 O O   . GLN C 3 133 ? 98.608  13.105 46.263  1.00 13.60 ? 639  GLN A O   1 
ATOM   4405 C CB  . GLN C 3 133 ? 99.715  15.733 47.851  1.00 16.70 ? 639  GLN A CB  1 
ATOM   4406 C CG  . GLN C 3 133 ? 99.963  17.154 47.372  1.00 24.23 ? 639  GLN A CG  1 
ATOM   4407 C CD  . GLN C 3 133 ? 100.202 17.217 45.852  1.00 29.00 ? 639  GLN A CD  1 
ATOM   4408 O OE1 . GLN C 3 133 ? 100.901 16.351 45.286  1.00 30.91 ? 639  GLN A OE1 1 
ATOM   4409 N NE2 . GLN C 3 133 ? 99.630  18.251 45.185  1.00 30.50 ? 639  GLN A NE2 1 
ATOM   4410 N N   . GLY C 3 134 ? 98.181  12.996 48.465  1.00 13.42 ? 640  GLY A N   1 
ATOM   4411 C CA  . GLY C 3 134 ? 98.162  11.533 48.407  1.00 14.27 ? 640  GLY A CA  1 
ATOM   4412 C C   . GLY C 3 134 ? 97.038  11.031 47.488  1.00 15.55 ? 640  GLY A C   1 
ATOM   4413 O O   . GLY C 3 134 ? 97.252  10.100 46.691  1.00 14.96 ? 640  GLY A O   1 
ATOM   4414 N N   . LEU C 3 135 ? 95.862  11.665 47.562  1.00 14.48 ? 641  LEU A N   1 
ATOM   4415 C CA  . LEU C 3 135 ? 94.715  11.312 46.722  1.00 14.85 ? 641  LEU A CA  1 
ATOM   4416 C C   . LEU C 3 135 ? 95.062  11.565 45.255  1.00 14.90 ? 641  LEU A C   1 
ATOM   4417 O O   . LEU C 3 135 ? 94.790  10.728 44.408  1.00 14.85 ? 641  LEU A O   1 
ATOM   4418 C CB  . LEU C 3 135 ? 93.482  12.141 47.121  1.00 11.94 ? 641  LEU A CB  1 
ATOM   4419 C CG  . LEU C 3 135 ? 92.926  11.646 48.467  1.00 14.12 ? 641  LEU A CG  1 
ATOM   4420 C CD1 . LEU C 3 135 ? 91.962  12.690 49.078  1.00 12.27 ? 641  LEU A CD1 1 
ATOM   4421 C CD2 . LEU C 3 135 ? 92.202  10.301 48.249  1.00 11.30 ? 641  LEU A CD2 1 
ATOM   4422 N N   . LYS C 3 136 ? 95.684  12.717 44.962  1.00 15.04 ? 642  LYS A N   1 
ATOM   4423 C CA  . LYS C 3 136 ? 96.092  13.009 43.601  1.00 16.51 ? 642  LYS A CA  1 
ATOM   4424 C C   . LYS C 3 136 ? 97.011  11.909 43.046  1.00 18.24 ? 642  LYS A C   1 
ATOM   4425 O O   . LYS C 3 136 ? 96.887  11.560 41.859  1.00 17.51 ? 642  LYS A O   1 
ATOM   4426 C CB  . LYS C 3 136 ? 96.839  14.335 43.519  1.00 16.61 ? 642  LYS A CB  1 
ATOM   4427 C CG  . LYS C 3 136 ? 97.202  14.713 42.080  1.00 18.58 ? 642  LYS A CG  1 
ATOM   4428 C CD  . LYS C 3 136 ? 98.203  15.843 42.043  1.00 21.29 ? 642  LYS A CD  1 
ATOM   4429 C CE  . LYS C 3 136 ? 98.471  16.295 40.613  1.00 25.63 ? 642  LYS A CE  1 
ATOM   4430 N NZ  . LYS C 3 136 ? 99.164  17.601 40.704  1.00 28.82 ? 642  LYS A NZ  1 
ATOM   4431 N N   . LYS C 3 137 ? 97.914  11.379 43.891  1.00 16.36 ? 643  LYS A N   1 
ATOM   4432 C CA  . LYS C 3 137 ? 98.876  10.333 43.457  1.00 18.93 ? 643  LYS A CA  1 
ATOM   4433 C C   . LYS C 3 137 ? 98.211  9.044  43.120  1.00 17.06 ? 643  LYS A C   1 
ATOM   4434 O O   . LYS C 3 137 ? 98.748  8.261  42.325  1.00 16.93 ? 643  LYS A O   1 
ATOM   4435 C CB  . LYS C 3 137 ? 99.963  10.053 44.511  1.00 21.20 ? 643  LYS A CB  1 
ATOM   4436 C CG  . LYS C 3 137 ? 101.106 11.002 44.388  1.00 27.34 ? 643  LYS A CG  1 
ATOM   4437 C CD  . LYS C 3 137 ? 101.927 11.072 45.650  1.00 31.43 ? 643  LYS A CD  1 
ATOM   4438 C CE  . LYS C 3 137 ? 102.785 12.348 45.592  1.00 34.37 ? 643  LYS A CE  1 
ATOM   4439 N NZ  . LYS C 3 137 ? 103.400 12.651 46.899  1.00 38.16 ? 643  LYS A NZ  1 
ATOM   4440 N N   . LYS C 3 138 ? 97.078  8.785  43.757  1.00 15.33 ? 644  LYS A N   1 
ATOM   4441 C CA  . LYS C 3 138 ? 96.291  7.575  43.413  1.00 17.12 ? 644  LYS A CA  1 
ATOM   4442 C C   . LYS C 3 138 ? 95.195  7.899  42.328  1.00 16.20 ? 644  LYS A C   1 
ATOM   4443 O O   . LYS C 3 138 ? 94.360  7.074  42.024  1.00 13.71 ? 644  LYS A O   1 
ATOM   4444 C CB  . LYS C 3 138 ? 95.619  6.996  44.661  1.00 18.43 ? 644  LYS A CB  1 
ATOM   4445 C CG  . LYS C 3 138 ? 96.648  6.400  45.638  1.00 23.66 ? 644  LYS A CG  1 
ATOM   4446 C CD  . LYS C 3 138 ? 96.066  5.238  46.457  1.00 25.35 ? 644  LYS A CD  1 
ATOM   4447 C CE  . LYS C 3 138 ? 97.114  4.538  47.282  1.00 24.40 ? 644  LYS A CE  1 
ATOM   4448 N NZ  . LYS C 3 138 ? 96.481  3.321  47.849  1.00 24.92 ? 644  LYS A NZ  1 
ATOM   4449 N N   . LYS C 3 139 ? 95.236  9.096  41.755  1.00 15.41 ? 645  LYS A N   1 
ATOM   4450 C CA  . LYS C 3 139 ? 94.257  9.550  40.761  1.00 17.06 ? 645  LYS A CA  1 
ATOM   4451 C C   . LYS C 3 139 ? 92.835  9.530  41.301  1.00 18.31 ? 645  LYS A C   1 
ATOM   4452 O O   . LYS C 3 139 ? 91.914  8.996  40.657  1.00 16.30 ? 645  LYS A O   1 
ATOM   4453 C CB  . LYS C 3 139 ? 94.314  8.754  39.432  1.00 18.40 ? 645  LYS A CB  1 
ATOM   4454 C CG  . LYS C 3 139 ? 95.705  8.724  38.830  1.00 23.43 ? 645  LYS A CG  1 
ATOM   4455 C CD  . LYS C 3 139 ? 95.745  8.645  37.292  1.00 23.98 ? 645  LYS A CD  1 
ATOM   4456 C CE  . LYS C 3 139 ? 95.129  7.326  36.771  1.00 25.85 ? 645  LYS A CE  1 
ATOM   4457 N NZ  . LYS C 3 139 ? 95.161  7.241  35.252  1.00 19.45 ? 645  LYS A NZ  1 
ATOM   4458 N N   . VAL C 3 140 ? 92.670  10.080 42.505  1.00 15.91 ? 646  VAL A N   1 
ATOM   4459 C CA  . VAL C 3 140 ? 91.345  10.244 43.047  1.00 16.76 ? 646  VAL A CA  1 
ATOM   4460 C C   . VAL C 3 140 ? 91.124  11.771 42.898  1.00 17.46 ? 646  VAL A C   1 
ATOM   4461 O O   . VAL C 3 140 ? 91.875  12.583 43.492  1.00 17.00 ? 646  VAL A O   1 
ATOM   4462 C CB  . VAL C 3 140 ? 91.267  9.831  44.528  1.00 16.31 ? 646  VAL A CB  1 
ATOM   4463 C CG1 . VAL C 3 140 ? 89.857  10.146 45.069  1.00 14.99 ? 646  VAL A CG1 1 
ATOM   4464 C CG2 . VAL C 3 140 ? 91.641  8.325  44.665  1.00 14.06 ? 646  VAL A CG2 1 
ATOM   4465 N N   . ILE C 3 141 ? 90.160  12.163 42.063  1.00 16.93 ? 647  ILE A N   1 
ATOM   4466 C CA  . ILE C 3 141 ? 89.849  13.577 41.846  1.00 17.60 ? 647  ILE A CA  1 
ATOM   4467 C C   . ILE C 3 141 ? 89.026  14.092 43.049  1.00 17.71 ? 647  ILE A C   1 
ATOM   4468 O O   . ILE C 3 141 ? 88.092  13.437 43.504  1.00 17.14 ? 647  ILE A O   1 
ATOM   4469 C CB  . ILE C 3 141 ? 89.036  13.742 40.554  1.00 19.07 ? 647  ILE A CB  1 
ATOM   4470 C CG1 . ILE C 3 141 ? 89.891  13.315 39.348  1.00 21.19 ? 647  ILE A CG1 1 
ATOM   4471 C CG2 . ILE C 3 141 ? 88.601  15.210 40.379  1.00 19.46 ? 647  ILE A CG2 1 
ATOM   4472 C CD1 . ILE C 3 141 ? 89.049  13.072 38.092  1.00 21.65 ? 647  ILE A CD1 1 
ATOM   4473 N N   . VAL C 3 142 ? 89.362  15.266 43.571  1.00 16.91 ? 648  VAL A N   1 
ATOM   4474 C CA  . VAL C 3 142 ? 88.601  15.762 44.698  1.00 14.47 ? 648  VAL A CA  1 
ATOM   4475 C C   . VAL C 3 142 ? 87.738  16.932 44.255  1.00 14.87 ? 648  VAL A C   1 
ATOM   4476 O O   . VAL C 3 142 ? 88.276  17.957 43.823  1.00 14.51 ? 648  VAL A O   1 
ATOM   4477 C CB  . VAL C 3 142 ? 89.533  16.235 45.889  1.00 12.44 ? 648  VAL A CB  1 
ATOM   4478 C CG1 . VAL C 3 142 ? 88.665  16.725 47.029  1.00 9.49  ? 648  VAL A CG1 1 
ATOM   4479 C CG2 . VAL C 3 142 ? 90.424  15.053 46.385  1.00 11.57 ? 648  VAL A CG2 1 
ATOM   4480 N N   . ILE C 3 143 ? 86.419  16.787 44.388  1.00 14.20 ? 649  ILE A N   1 
ATOM   4481 C CA  . ILE C 3 143 ? 85.504  17.865 43.979  1.00 15.35 ? 649  ILE A CA  1 
ATOM   4482 C C   . ILE C 3 143 ? 84.839  18.503 45.192  1.00 15.34 ? 649  ILE A C   1 
ATOM   4483 O O   . ILE C 3 143 ? 83.893  17.985 45.758  1.00 16.49 ? 649  ILE A O   1 
ATOM   4484 C CB  . ILE C 3 143 ? 84.418  17.365 42.987  1.00 14.96 ? 649  ILE A CB  1 
ATOM   4485 C CG1 . ILE C 3 143 ? 85.095  16.762 41.755  1.00 15.86 ? 649  ILE A CG1 1 
ATOM   4486 C CG2 . ILE C 3 143 ? 83.473  18.523 42.631  1.00 13.19 ? 649  ILE A CG2 1 
ATOM   4487 C CD1 . ILE C 3 143 ? 85.959  17.724 40.921  1.00 20.47 ? 649  ILE A CD1 1 
ATOM   4488 N N   . PRO C 3 144 ? 85.359  19.661 45.613  1.00 16.04 ? 650  PRO A N   1 
ATOM   4489 C CA  . PRO C 3 144 ? 84.766  20.303 46.776  1.00 16.59 ? 650  PRO A CA  1 
ATOM   4490 C C   . PRO C 3 144 ? 83.495  21.039 46.375  1.00 17.35 ? 650  PRO A C   1 
ATOM   4491 O O   . PRO C 3 144 ? 83.437  21.726 45.335  1.00 17.70 ? 650  PRO A O   1 
ATOM   4492 C CB  . PRO C 3 144 ? 85.881  21.237 47.274  1.00 16.32 ? 650  PRO A CB  1 
ATOM   4493 C CG  . PRO C 3 144 ? 86.547  21.666 46.005  1.00 17.90 ? 650  PRO A CG  1 
ATOM   4494 C CD  . PRO C 3 144 ? 86.519  20.408 45.102  1.00 15.94 ? 650  PRO A CD  1 
ATOM   4495 N N   . VAL C 3 145 ? 82.467  20.848 47.183  1.00 15.78 ? 651  VAL A N   1 
ATOM   4496 C CA  . VAL C 3 145 ? 81.197  21.525 46.985  1.00 16.78 ? 651  VAL A CA  1 
ATOM   4497 C C   . VAL C 3 145 ? 80.960  22.330 48.300  1.00 17.60 ? 651  VAL A C   1 
ATOM   4498 O O   . VAL C 3 145 ? 80.620  21.761 49.357  1.00 16.71 ? 651  VAL A O   1 
ATOM   4499 C CB  . VAL C 3 145 ? 80.040  20.526 46.750  1.00 16.22 ? 651  VAL A CB  1 
ATOM   4500 C CG1 . VAL C 3 145 ? 78.700  21.320 46.569  1.00 16.85 ? 651  VAL A CG1 1 
ATOM   4501 C CG2 . VAL C 3 145 ? 80.298  19.690 45.470  1.00 14.03 ? 651  VAL A CG2 1 
ATOM   4502 N N   . GLY C 3 146 ? 81.188  23.642 48.228  1.00 19.30 ? 652  GLY A N   1 
ATOM   4503 C CA  . GLY C 3 146 ? 80.993  24.522 49.392  1.00 20.33 ? 652  GLY A CA  1 
ATOM   4504 C C   . GLY C 3 146 ? 79.507  24.817 49.585  1.00 22.03 ? 652  GLY A C   1 
ATOM   4505 O O   . GLY C 3 146 ? 78.805  25.131 48.631  1.00 21.94 ? 652  GLY A O   1 
ATOM   4506 N N   . ILE C 3 147 ? 79.002  24.698 50.801  1.00 21.30 ? 653  ILE A N   1 
ATOM   4507 C CA  . ILE C 3 147 ? 77.586  24.955 51.030  1.00 23.56 ? 653  ILE A CA  1 
ATOM   4508 C C   . ILE C 3 147 ? 77.411  25.917 52.191  1.00 23.84 ? 653  ILE A C   1 
ATOM   4509 O O   . ILE C 3 147 ? 77.787  25.630 53.322  1.00 24.91 ? 653  ILE A O   1 
ATOM   4510 C CB  . ILE C 3 147 ? 76.813  23.690 51.429  1.00 23.58 ? 653  ILE A CB  1 
ATOM   4511 C CG1 . ILE C 3 147 ? 76.853  22.647 50.316  1.00 24.81 ? 653  ILE A CG1 1 
ATOM   4512 C CG2 . ILE C 3 147 ? 75.392  24.095 51.807  1.00 23.31 ? 653  ILE A CG2 1 
ATOM   4513 C CD1 . ILE C 3 147 ? 76.365  21.269 50.738  1.00 24.96 ? 653  ILE A CD1 1 
ATOM   4514 N N   . GLY C 3 148 ? 76.817  27.059 51.951  1.00 25.26 ? 654  GLY A N   1 
ATOM   4515 C CA  . GLY C 3 148 ? 76.654  27.946 53.089  1.00 25.72 ? 654  GLY A CA  1 
ATOM   4516 C C   . GLY C 3 148 ? 77.855  28.813 53.372  1.00 24.65 ? 654  GLY A C   1 
ATOM   4517 O O   . GLY C 3 148 ? 78.982  28.587 52.894  1.00 24.23 ? 654  GLY A O   1 
ATOM   4518 N N   . PRO C 3 149 ? 77.632  29.825 54.192  1.00 24.96 ? 655  PRO A N   1 
ATOM   4519 C CA  . PRO C 3 149 ? 78.685  30.767 54.553  1.00 24.59 ? 655  PRO A CA  1 
ATOM   4520 C C   . PRO C 3 149 ? 79.744  30.247 55.488  1.00 23.73 ? 655  PRO A C   1 
ATOM   4521 O O   . PRO C 3 149 ? 80.730  30.926 55.678  1.00 24.79 ? 655  PRO A O   1 
ATOM   4522 C CB  . PRO C 3 149 ? 77.913  31.949 55.141  1.00 26.05 ? 655  PRO A CB  1 
ATOM   4523 C CG  . PRO C 3 149 ? 76.740  31.257 55.843  1.00 25.70 ? 655  PRO A CG  1 
ATOM   4524 C CD  . PRO C 3 149 ? 76.394  30.043 54.979  1.00 25.67 ? 655  PRO A CD  1 
ATOM   4525 N N   . HIS C 3 150 ? 79.569  29.078 56.106  1.00 23.06 ? 656  HIS A N   1 
ATOM   4526 C CA  . HIS C 3 150 ? 80.681  28.617 56.947  1.00 23.31 ? 656  HIS A CA  1 
ATOM   4527 C C   . HIS C 3 150 ? 81.625  27.614 56.272  1.00 22.17 ? 656  HIS A C   1 
ATOM   4528 O O   . HIS C 3 150 ? 82.559  27.090 56.913  1.00 20.89 ? 656  HIS A O   1 
ATOM   4529 C CB  . HIS C 3 150 ? 80.164  28.060 58.263  1.00 25.41 ? 656  HIS A CB  1 
ATOM   4530 C CG  . HIS C 3 150 ? 79.501  29.104 59.091  1.00 28.37 ? 656  HIS A CG  1 
ATOM   4531 N ND1 . HIS C 3 150 ? 78.133  29.227 59.172  1.00 31.27 ? 656  HIS A ND1 1 
ATOM   4532 C CD2 . HIS C 3 150 ? 80.017  30.144 59.780  1.00 30.84 ? 656  HIS A CD2 1 
ATOM   4533 C CE1 . HIS C 3 150 ? 77.830  30.301 59.885  1.00 32.38 ? 656  HIS A CE1 1 
ATOM   4534 N NE2 . HIS C 3 150 ? 78.954  30.874 60.264  1.00 33.85 ? 656  HIS A NE2 1 
ATOM   4535 N N   . ALA C 3 151 ? 81.385  27.361 54.988  1.00 19.71 ? 657  ALA A N   1 
ATOM   4536 C CA  . ALA C 3 151 ? 82.204  26.407 54.239  1.00 20.38 ? 657  ALA A CA  1 
ATOM   4537 C C   . ALA C 3 151 ? 83.639  26.911 54.254  1.00 19.15 ? 657  ALA A C   1 
ATOM   4538 O O   . ALA C 3 151 ? 83.902  28.085 54.055  1.00 20.12 ? 657  ALA A O   1 
ATOM   4539 C CB  . ALA C 3 151 ? 81.692  26.266 52.779  1.00 19.34 ? 657  ALA A CB  1 
ATOM   4540 N N   . ASN C 3 152 ? 84.580  26.018 54.477  1.00 19.33 ? 658  ASN A N   1 
ATOM   4541 C CA  . ASN C 3 152 ? 85.970  26.423 54.533  1.00 18.32 ? 658  ASN A CA  1 
ATOM   4542 C C   . ASN C 3 152 ? 86.508  26.775 53.147  1.00 18.34 ? 658  ASN A C   1 
ATOM   4543 O O   . ASN C 3 152 ? 87.068  25.912 52.459  1.00 15.91 ? 658  ASN A O   1 
ATOM   4544 C CB  . ASN C 3 152 ? 86.786  25.274 55.139  1.00 18.17 ? 658  ASN A CB  1 
ATOM   4545 C CG  . ASN C 3 152 ? 88.209  25.707 55.554  1.00 19.29 ? 658  ASN A CG  1 
ATOM   4546 O OD1 . ASN C 3 152 ? 88.822  26.569 54.917  1.00 17.20 ? 658  ASN A OD1 1 
ATOM   4547 N ND2 . ASN C 3 152 ? 88.742  25.064 56.607  1.00 18.57 ? 658  ASN A ND2 1 
ATOM   4548 N N   . LEU C 3 153 ? 86.359  28.035 52.742  1.00 18.89 ? 659  LEU A N   1 
ATOM   4549 C CA  . LEU C 3 153 ? 86.822  28.500 51.430  1.00 20.44 ? 659  LEU A CA  1 
ATOM   4550 C C   . LEU C 3 153 ? 88.343  28.327 51.218  1.00 19.14 ? 659  LEU A C   1 
ATOM   4551 O O   . LEU C 3 153 ? 88.814  27.978 50.106  1.00 16.59 ? 659  LEU A O   1 
ATOM   4552 C CB  . LEU C 3 153 ? 86.415  29.980 51.248  1.00 25.45 ? 659  LEU A CB  1 
ATOM   4553 C CG  . LEU C 3 153 ? 85.889  30.373 49.877  1.00 30.00 ? 659  LEU A CG  1 
ATOM   4554 C CD1 . LEU C 3 153 ? 84.618  29.557 49.598  1.00 32.48 ? 659  LEU A CD1 1 
ATOM   4555 C CD2 . LEU C 3 153 ? 85.535  31.866 49.859  1.00 31.16 ? 659  LEU A CD2 1 
ATOM   4556 N N   . LYS C 3 154 ? 89.124  28.541 52.281  1.00 17.14 ? 660  LYS A N   1 
ATOM   4557 C CA  . LYS C 3 154 ? 90.588  28.345 52.157  1.00 15.03 ? 660  LYS A CA  1 
ATOM   4558 C C   . LYS C 3 154 ? 90.895  26.925 51.669  1.00 15.08 ? 660  LYS A C   1 
ATOM   4559 O O   . LYS C 3 154 ? 91.744  26.686 50.767  1.00 14.26 ? 660  LYS A O   1 
ATOM   4560 C CB  . LYS C 3 154 ? 91.272  28.544 53.517  1.00 15.00 ? 660  LYS A CB  1 
ATOM   4561 C CG  . LYS C 3 154 ? 92.811  28.295 53.506  1.00 14.79 ? 660  LYS A CG  1 
ATOM   4562 C CD  . LYS C 3 154 ? 93.310  28.522 54.915  1.00 15.89 ? 660  LYS A CD  1 
ATOM   4563 C CE  . LYS C 3 154 ? 94.778  28.224 55.083  1.00 15.59 ? 660  LYS A CE  1 
ATOM   4564 N NZ  . LYS C 3 154 ? 95.662  29.129 54.334  1.00 14.15 ? 660  LYS A NZ  1 
ATOM   4565 N N   . GLN C 3 155 ? 90.222  25.969 52.287  1.00 12.99 ? 661  GLN A N   1 
ATOM   4566 C CA  . GLN C 3 155 ? 90.428  24.578 51.899  1.00 14.17 ? 661  GLN A CA  1 
ATOM   4567 C C   . GLN C 3 155 ? 89.900  24.272 50.485  1.00 13.25 ? 661  GLN A C   1 
ATOM   4568 O O   . GLN C 3 155 ? 90.502  23.485 49.734  1.00 13.57 ? 661  GLN A O   1 
ATOM   4569 C CB  . GLN C 3 155 ? 89.790  23.663 52.939  1.00 14.25 ? 661  GLN A CB  1 
ATOM   4570 C CG  . GLN C 3 155 ? 90.743  23.461 54.139  1.00 14.71 ? 661  GLN A CG  1 
ATOM   4571 C CD  . GLN C 3 155 ? 90.232  22.452 55.132  1.00 17.26 ? 661  GLN A CD  1 
ATOM   4572 O OE1 . GLN C 3 155 ? 89.144  21.862 54.941  1.00 17.49 ? 661  GLN A OE1 1 
ATOM   4573 N NE2 . GLN C 3 155 ? 91.001  22.249 56.219  1.00 15.37 ? 661  GLN A NE2 1 
ATOM   4574 N N   . ILE C 3 156 ? 88.798  24.918 50.116  1.00 14.80 ? 662  ILE A N   1 
ATOM   4575 C CA  . ILE C 3 156 ? 88.238  24.750 48.760  1.00 15.15 ? 662  ILE A CA  1 
ATOM   4576 C C   . ILE C 3 156 ? 89.247  25.245 47.735  1.00 15.43 ? 662  ILE A C   1 
ATOM   4577 O O   . ILE C 3 156 ? 89.538  24.561 46.734  1.00 15.86 ? 662  ILE A O   1 
ATOM   4578 C CB  . ILE C 3 156 ? 86.903  25.490 48.620  1.00 15.52 ? 662  ILE A CB  1 
ATOM   4579 C CG1 . ILE C 3 156 ? 85.869  24.762 49.497  1.00 16.99 ? 662  ILE A CG1 1 
ATOM   4580 C CG2 . ILE C 3 156 ? 86.481  25.563 47.131  1.00 16.35 ? 662  ILE A CG2 1 
ATOM   4581 C CD1 . ILE C 3 156 ? 84.476  25.359 49.498  1.00 18.07 ? 662  ILE A CD1 1 
ATOM   4582 N N   . ARG C 3 157 ? 89.845  26.407 47.973  1.00 14.73 ? 663  ARG A N   1 
ATOM   4583 C CA  . ARG C 3 157 ? 90.825  26.886 46.996  1.00 14.99 ? 663  ARG A CA  1 
ATOM   4584 C C   . ARG C 3 157 ? 92.094  26.043 46.980  1.00 15.71 ? 663  ARG A C   1 
ATOM   4585 O O   . ARG C 3 157 ? 92.684  25.799 45.918  1.00 13.52 ? 663  ARG A O   1 
ATOM   4586 C CB  . ARG C 3 157 ? 91.167  28.342 47.275  1.00 19.21 ? 663  ARG A CB  1 
ATOM   4587 C CG  . ARG C 3 157 ? 89.912  29.216 47.269  1.00 24.80 ? 663  ARG A CG  1 
ATOM   4588 C CD  . ARG C 3 157 ? 89.008  28.886 46.047  1.00 29.50 ? 663  ARG A CD  1 
ATOM   4589 N NE  . ARG C 3 157 ? 87.834  29.757 45.945  1.00 33.01 ? 663  ARG A NE  1 
ATOM   4590 C CZ  . ARG C 3 157 ? 86.792  29.539 45.140  1.00 34.19 ? 663  ARG A CZ  1 
ATOM   4591 N NH1 . ARG C 3 157 ? 86.751  28.475 44.338  1.00 34.73 ? 663  ARG A NH1 1 
ATOM   4592 N NH2 . ARG C 3 157 ? 85.768  30.377 45.170  1.00 36.90 ? 663  ARG A NH2 1 
ATOM   4593 N N   . LEU C 3 158 ? 92.522  25.575 48.156  1.00 14.11 ? 664  LEU A N   1 
ATOM   4594 C CA  . LEU C 3 158 ? 93.732  24.757 48.241  1.00 16.42 ? 664  LEU A CA  1 
ATOM   4595 C C   . LEU C 3 158 ? 93.517  23.465 47.458  1.00 14.87 ? 664  LEU A C   1 
ATOM   4596 O O   . LEU C 3 158 ? 94.415  23.006 46.768  1.00 16.43 ? 664  LEU A O   1 
ATOM   4597 C CB  . LEU C 3 158 ? 93.996  24.459 49.706  1.00 17.02 ? 664  LEU A CB  1 
ATOM   4598 C CG  . LEU C 3 158 ? 95.386  24.346 50.269  1.00 21.25 ? 664  LEU A CG  1 
ATOM   4599 C CD1 . LEU C 3 158 ? 96.395  25.198 49.490  1.00 19.82 ? 664  LEU A CD1 1 
ATOM   4600 C CD2 . LEU C 3 158 ? 95.270  24.740 51.767  1.00 19.40 ? 664  LEU A CD2 1 
ATOM   4601 N N   . ILE C 3 159 ? 92.315  22.875 47.546  1.00 16.84 ? 665  ILE A N   1 
ATOM   4602 C CA  . ILE C 3 159 ? 92.031  21.638 46.783  1.00 15.14 ? 665  ILE A CA  1 
ATOM   4603 C C   . ILE C 3 159 ? 92.119  21.927 45.269  1.00 16.41 ? 665  ILE A C   1 
ATOM   4604 O O   . ILE C 3 159 ? 92.781  21.194 44.529  1.00 13.44 ? 665  ILE A O   1 
ATOM   4605 C CB  . ILE C 3 159 ? 90.625  21.060 47.140  1.00 15.10 ? 665  ILE A CB  1 
ATOM   4606 C CG1 . ILE C 3 159 ? 90.670  20.447 48.563  1.00 13.76 ? 665  ILE A CG1 1 
ATOM   4607 C CG2 . ILE C 3 159 ? 90.179  20.015 46.062  1.00 13.01 ? 665  ILE A CG2 1 
ATOM   4608 C CD1 . ILE C 3 159 ? 89.361  20.120 49.176  1.00 11.73 ? 665  ILE A CD1 1 
ATOM   4609 N N   . GLU C 3 160 ? 91.505  23.020 44.807  1.00 16.97 ? 666  GLU A N   1 
ATOM   4610 C CA  . GLU C 3 160 ? 91.562  23.328 43.380  1.00 18.44 ? 666  GLU A CA  1 
ATOM   4611 C C   . GLU C 3 160 ? 92.956  23.535 42.903  1.00 19.83 ? 666  GLU A C   1 
ATOM   4612 O O   . GLU C 3 160 ? 93.278  23.199 41.771  1.00 18.77 ? 666  GLU A O   1 
ATOM   4613 C CB  . GLU C 3 160 ? 90.801  24.594 43.028  1.00 21.09 ? 666  GLU A CB  1 
ATOM   4614 C CG  . GLU C 3 160 ? 89.359  24.543 43.373  1.00 24.66 ? 666  GLU A CG  1 
ATOM   4615 C CD  . GLU C 3 160 ? 88.641  25.726 42.802  1.00 25.79 ? 666  GLU A CD  1 
ATOM   4616 O OE1 . GLU C 3 160 ? 88.040  25.576 41.709  1.00 26.70 ? 666  GLU A OE1 1 
ATOM   4617 O OE2 . GLU C 3 160 ? 88.702  26.792 43.449  1.00 28.04 ? 666  GLU A OE2 1 
ATOM   4618 N N   . LYS C 3 161 ? 93.807  24.068 43.775  1.00 19.58 ? 667  LYS A N   1 
ATOM   4619 C CA  . LYS C 3 161 ? 95.161  24.333 43.391  1.00 21.21 ? 667  LYS A CA  1 
ATOM   4620 C C   . LYS C 3 161 ? 95.990  23.066 43.248  1.00 21.32 ? 667  LYS A C   1 
ATOM   4621 O O   . LYS C 3 161 ? 96.947  23.030 42.482  1.00 20.72 ? 667  LYS A O   1 
ATOM   4622 C CB  . LYS C 3 161 ? 95.817  25.247 44.431  1.00 24.35 ? 667  LYS A CB  1 
ATOM   4623 C CG  . LYS C 3 161 ? 97.240  25.700 44.099  1.00 29.44 ? 667  LYS A CG  1 
ATOM   4624 C CD  . LYS C 3 161 ? 97.940  26.339 45.361  1.00 33.35 ? 667  LYS A CD  1 
ATOM   4625 C CE  . LYS C 3 161 ? 99.314  26.967 45.023  1.00 35.53 ? 667  LYS A CE  1 
ATOM   4626 N NZ  . LYS C 3 161 ? 99.994  27.536 46.250  1.00 39.95 ? 667  LYS A NZ  1 
ATOM   4627 N N   . GLN C 3 162 ? 95.642  22.022 43.979  1.00 20.06 ? 668  GLN A N   1 
ATOM   4628 C CA  . GLN C 3 162 ? 96.471  20.816 43.929  1.00 20.33 ? 668  GLN A CA  1 
ATOM   4629 C C   . GLN C 3 162 ? 96.437  20.039 42.614  1.00 19.64 ? 668  GLN A C   1 
ATOM   4630 O O   . GLN C 3 162 ? 97.417  19.399 42.280  1.00 20.16 ? 668  GLN A O   1 
ATOM   4631 C CB  . GLN C 3 162 ? 96.113  19.860 45.075  1.00 18.88 ? 668  GLN A CB  1 
ATOM   4632 C CG  . GLN C 3 162 ? 96.190  20.431 46.449  1.00 19.17 ? 668  GLN A CG  1 
ATOM   4633 C CD  . GLN C 3 162 ? 97.482  21.171 46.704  1.00 21.77 ? 668  GLN A CD  1 
ATOM   4634 O OE1 . GLN C 3 162 ? 98.559  20.620 46.527  1.00 21.67 ? 668  GLN A OE1 1 
ATOM   4635 N NE2 . GLN C 3 162 ? 97.376  22.447 47.088  1.00 20.53 ? 668  GLN A NE2 1 
ATOM   4636 N N   . ALA C 3 163 ? 95.327  20.087 41.882  1.00 19.46 ? 669  ALA A N   1 
ATOM   4637 C CA  . ALA C 3 163 ? 95.216  19.352 40.617  1.00 20.11 ? 669  ALA A CA  1 
ATOM   4638 C C   . ALA C 3 163 ? 94.223  20.053 39.703  1.00 19.64 ? 669  ALA A C   1 
ATOM   4639 O O   . ALA C 3 163 ? 93.151  20.500 40.118  1.00 19.36 ? 669  ALA A O   1 
ATOM   4640 C CB  . ALA C 3 163 ? 94.780  17.827 40.869  1.00 18.68 ? 669  ALA A CB  1 
ATOM   4641 N N   . PRO C 3 164 ? 94.560  20.131 38.410  1.00 21.29 ? 670  PRO A N   1 
ATOM   4642 C CA  . PRO C 3 164 ? 93.670  20.806 37.453  1.00 21.39 ? 670  PRO A CA  1 
ATOM   4643 C C   . PRO C 3 164 ? 92.200  20.350 37.427  1.00 21.89 ? 670  PRO A C   1 
ATOM   4644 O O   . PRO C 3 164 ? 91.299  21.163 37.261  1.00 22.01 ? 670  PRO A O   1 
ATOM   4645 C CB  . PRO C 3 164 ? 94.390  20.621 36.089  1.00 21.71 ? 670  PRO A CB  1 
ATOM   4646 C CG  . PRO C 3 164 ? 95.412  19.576 36.331  1.00 23.62 ? 670  PRO A CG  1 
ATOM   4647 C CD  . PRO C 3 164 ? 95.784  19.598 37.784  1.00 20.29 ? 670  PRO A CD  1 
ATOM   4648 N N   . GLU C 3 165 ? 91.939  19.058 37.622  1.00 22.62 ? 671  GLU A N   1 
ATOM   4649 C CA  . GLU C 3 165 ? 90.544  18.619 37.567  1.00 23.85 ? 671  GLU A CA  1 
ATOM   4650 C C   . GLU C 3 165 ? 89.735  18.782 38.865  1.00 22.92 ? 671  GLU A C   1 
ATOM   4651 O O   . GLU C 3 165 ? 88.502  18.544 38.870  1.00 20.39 ? 671  GLU A O   1 
ATOM   4652 C CB  . GLU C 3 165 ? 90.489  17.171 37.084  1.00 28.39 ? 671  GLU A CB  1 
ATOM   4653 C CG  . GLU C 3 165 ? 91.343  16.221 37.924  1.00 34.70 ? 671  GLU A CG  1 
ATOM   4654 C CD  . GLU C 3 165 ? 92.816  16.122 37.479  1.00 37.50 ? 671  GLU A CD  1 
ATOM   4655 O OE1 . GLU C 3 165 ? 93.632  17.045 37.714  1.00 36.97 ? 671  GLU A OE1 1 
ATOM   4656 O OE2 . GLU C 3 165 ? 93.132  15.077 36.879  1.00 41.35 ? 671  GLU A OE2 1 
ATOM   4657 N N   . ASN C 3 166 ? 90.403  19.211 39.952  1.00 21.08 ? 672  ASN A N   1 
ATOM   4658 C CA  . ASN C 3 166 ? 89.709  19.374 41.235  1.00 20.66 ? 672  ASN A CA  1 
ATOM   4659 C C   . ASN C 3 166 ? 88.848  20.653 41.264  1.00 22.02 ? 672  ASN A C   1 
ATOM   4660 O O   . ASN C 3 166 ? 89.052  21.519 42.121  1.00 25.31 ? 672  ASN A O   1 
ATOM   4661 C CB  . ASN C 3 166 ? 90.715  19.467 42.411  1.00 18.80 ? 672  ASN A CB  1 
ATOM   4662 C CG  . ASN C 3 166 ? 91.431  18.146 42.729  1.00 18.77 ? 672  ASN A CG  1 
ATOM   4663 O OD1 . ASN C 3 166 ? 91.100  17.079 42.187  1.00 16.81 ? 672  ASN A OD1 1 
ATOM   4664 N ND2 . ASN C 3 166 ? 92.418  18.222 43.641  1.00 15.42 ? 672  ASN A ND2 1 
ATOM   4665 N N   . LYS C 3 167 ? 87.865  20.759 40.381  1.00 23.42 ? 673  LYS A N   1 
ATOM   4666 C CA  . LYS C 3 167 ? 86.988  21.939 40.284  1.00 21.88 ? 673  LYS A CA  1 
ATOM   4667 C C   . LYS C 3 167 ? 85.981  22.053 41.428  1.00 20.21 ? 673  LYS A C   1 
ATOM   4668 O O   . LYS C 3 167 ? 85.321  21.073 41.823  1.00 19.47 ? 673  LYS A O   1 
ATOM   4669 C CB  . LYS C 3 167 ? 86.247  21.894 38.935  1.00 25.30 ? 673  LYS A CB  1 
ATOM   4670 C CG  . LYS C 3 167 ? 85.155  22.924 38.735  1.00 28.73 ? 673  LYS A CG  1 
ATOM   4671 C CD  . LYS C 3 167 ? 84.344  22.622 37.445  1.00 31.33 ? 673  LYS A CD  1 
ATOM   4672 C CE  . LYS C 3 167 ? 83.721  23.888 36.832  1.00 33.23 ? 673  LYS A CE  1 
ATOM   4673 N NZ  . LYS C 3 167 ? 82.742  24.592 37.692  1.00 34.96 ? 673  LYS A NZ  1 
ATOM   4674 N N   . ALA C 3 168 ? 85.839  23.274 41.927  1.00 17.90 ? 674  ALA A N   1 
ATOM   4675 C CA  . ALA C 3 168 ? 84.962  23.553 43.034  1.00 18.48 ? 674  ALA A CA  1 
ATOM   4676 C C   . ALA C 3 168 ? 83.610  24.147 42.647  1.00 19.44 ? 674  ALA A C   1 
ATOM   4677 O O   . ALA C 3 168 ? 83.492  24.876 41.657  1.00 18.42 ? 674  ALA A O   1 
ATOM   4678 C CB  . ALA C 3 168 ? 85.662  24.480 44.000  1.00 16.92 ? 674  ALA A CB  1 
ATOM   4679 N N   . PHE C 3 169 ? 82.594  23.839 43.444  1.00 19.14 ? 675  PHE A N   1 
ATOM   4680 C CA  . PHE C 3 169 ? 81.269  24.390 43.236  1.00 20.49 ? 675  PHE A CA  1 
ATOM   4681 C C   . PHE C 3 169 ? 80.962  25.075 44.556  1.00 21.79 ? 675  PHE A C   1 
ATOM   4682 O O   . PHE C 3 169 ? 80.837  24.402 45.585  1.00 23.39 ? 675  PHE A O   1 
ATOM   4683 C CB  . PHE C 3 169 ? 80.229  23.288 42.956  1.00 19.08 ? 675  PHE A CB  1 
ATOM   4684 C CG  . PHE C 3 169 ? 80.444  22.566 41.624  1.00 20.21 ? 675  PHE A CG  1 
ATOM   4685 C CD1 . PHE C 3 169 ? 81.313  21.479 41.530  1.00 19.53 ? 675  PHE A CD1 1 
ATOM   4686 C CD2 . PHE C 3 169 ? 79.838  23.042 40.460  1.00 21.42 ? 675  PHE A CD2 1 
ATOM   4687 C CE1 . PHE C 3 169 ? 81.587  20.878 40.291  1.00 22.13 ? 675  PHE A CE1 1 
ATOM   4688 C CE2 . PHE C 3 169 ? 80.097  22.454 39.203  1.00 20.80 ? 675  PHE A CE2 1 
ATOM   4689 C CZ  . PHE C 3 169 ? 80.982  21.363 39.115  1.00 22.85 ? 675  PHE A CZ  1 
ATOM   4690 N N   . VAL C 3 170 ? 80.834  26.400 44.541  1.00 21.47 ? 676  VAL A N   1 
ATOM   4691 C CA  . VAL C 3 170 ? 80.563  27.138 45.789  1.00 22.03 ? 676  VAL A CA  1 
ATOM   4692 C C   . VAL C 3 170 ? 79.107  27.574 45.790  1.00 22.44 ? 676  VAL A C   1 
ATOM   4693 O O   . VAL C 3 170 ? 78.714  28.358 44.920  1.00 22.41 ? 676  VAL A O   1 
ATOM   4694 C CB  . VAL C 3 170 ? 81.484  28.355 45.882  1.00 23.20 ? 676  VAL A CB  1 
ATOM   4695 C CG1 . VAL C 3 170 ? 81.192  29.167 47.183  1.00 21.74 ? 676  VAL A CG1 1 
ATOM   4696 C CG2 . VAL C 3 170 ? 82.946  27.860 45.815  1.00 22.40 ? 676  VAL A CG2 1 
ATOM   4697 N N   . LEU C 3 171 ? 78.319  27.020 46.730  1.00 20.64 ? 677  LEU A N   1 
ATOM   4698 C CA  . LEU C 3 171 ? 76.872  27.271 46.846  1.00 22.22 ? 677  LEU A CA  1 
ATOM   4699 C C   . LEU C 3 171 ? 76.513  28.120 48.058  1.00 22.40 ? 677  LEU A C   1 
ATOM   4700 O O   . LEU C 3 171 ? 77.177  28.046 49.083  1.00 20.86 ? 677  LEU A O   1 
ATOM   4701 C CB  . LEU C 3 171 ? 76.107  25.934 46.928  1.00 23.14 ? 677  LEU A CB  1 
ATOM   4702 C CG  . LEU C 3 171 ? 76.054  25.105 45.618  1.00 26.31 ? 677  LEU A CG  1 
ATOM   4703 C CD1 . LEU C 3 171 ? 77.450  24.918 45.083  1.00 27.76 ? 677  LEU A CD1 1 
ATOM   4704 C CD2 . LEU C 3 171 ? 75.412  23.742 45.838  1.00 25.95 ? 677  LEU A CD2 1 
ATOM   4705 N N   . SER C 3 172 ? 75.443  28.905 47.952  1.00 22.29 ? 678  SER A N   1 
ATOM   4706 C CA  . SER C 3 172 ? 75.039  29.757 49.062  1.00 23.82 ? 678  SER A CA  1 
ATOM   4707 C C   . SER C 3 172 ? 74.311  29.012 50.130  1.00 22.56 ? 678  SER A C   1 
ATOM   4708 O O   . SER C 3 172 ? 74.315  29.459 51.265  1.00 21.95 ? 678  SER A O   1 
ATOM   4709 C CB  . SER C 3 172 ? 74.157  30.911 48.580  1.00 26.16 ? 678  SER A CB  1 
ATOM   4710 O OG  . SER C 3 172 ? 74.976  31.748 47.786  1.00 31.21 ? 678  SER A OG  1 
ATOM   4711 N N   . SER C 3 173 ? 73.669  27.894 49.784  1.00 19.83 ? 679  SER A N   1 
ATOM   4712 C CA  . SER C 3 173 ? 72.972  27.135 50.799  1.00 18.97 ? 679  SER A CA  1 
ATOM   4713 C C   . SER C 3 173 ? 72.596  25.794 50.183  1.00 19.73 ? 679  SER A C   1 
ATOM   4714 O O   . SER C 3 173 ? 72.771  25.623 48.961  1.00 18.62 ? 679  SER A O   1 
ATOM   4715 C CB  . SER C 3 173 ? 71.696  27.862 51.214  1.00 21.60 ? 679  SER A CB  1 
ATOM   4716 O OG  . SER C 3 173 ? 70.659  27.619 50.269  1.00 23.05 ? 679  SER A OG  1 
ATOM   4717 N N   . VAL C 3 174 ? 72.055  24.864 50.981  1.00 17.40 ? 680  VAL A N   1 
ATOM   4718 C CA  . VAL C 3 174 ? 71.669  23.555 50.445  1.00 18.88 ? 680  VAL A CA  1 
ATOM   4719 C C   . VAL C 3 174 ? 70.560  23.689 49.399  1.00 20.34 ? 680  VAL A C   1 
ATOM   4720 O O   . VAL C 3 174 ? 70.314  22.754 48.624  1.00 20.81 ? 680  VAL A O   1 
ATOM   4721 C CB  . VAL C 3 174 ? 71.102  22.562 51.523  1.00 18.59 ? 680  VAL A CB  1 
ATOM   4722 C CG1 . VAL C 3 174 ? 72.215  22.100 52.438  1.00 18.43 ? 680  VAL A CG1 1 
ATOM   4723 C CG2 . VAL C 3 174 ? 69.928  23.209 52.299  1.00 17.54 ? 680  VAL A CG2 1 
ATOM   4724 N N   . ASP C 3 175 ? 69.877  24.832 49.393  1.00 21.32 ? 681  ASP A N   1 
ATOM   4725 C CA  . ASP C 3 175 ? 68.782  25.031 48.439  1.00 22.93 ? 681  ASP A CA  1 
ATOM   4726 C C   . ASP C 3 175 ? 69.264  25.084 47.009  1.00 23.12 ? 681  ASP A C   1 
ATOM   4727 O O   . ASP C 3 175 ? 68.492  24.802 46.076  1.00 24.81 ? 681  ASP A O   1 
ATOM   4728 C CB  . ASP C 3 175 ? 67.998  26.296 48.746  1.00 22.54 ? 681  ASP A CB  1 
ATOM   4729 C CG  . ASP C 3 175 ? 67.259  26.198 50.051  1.00 26.27 ? 681  ASP A CG  1 
ATOM   4730 O OD1 . ASP C 3 175 ? 67.043  25.069 50.572  1.00 26.07 ? 681  ASP A OD1 1 
ATOM   4731 O OD2 . ASP C 3 175 ? 66.874  27.260 50.547  1.00 26.99 ? 681  ASP A OD2 1 
ATOM   4732 N N   . GLU C 3 176 ? 70.533  25.439 46.843  1.00 22.24 ? 682  GLU A N   1 
ATOM   4733 C CA  . GLU C 3 176 ? 71.142  25.524 45.536  1.00 22.57 ? 682  GLU A CA  1 
ATOM   4734 C C   . GLU C 3 176 ? 71.584  24.185 45.001  1.00 21.64 ? 682  GLU A C   1 
ATOM   4735 O O   . GLU C 3 176 ? 71.953  24.100 43.837  1.00 20.26 ? 682  GLU A O   1 
ATOM   4736 C CB  . GLU C 3 176 ? 72.376  26.419 45.570  1.00 24.98 ? 682  GLU A CB  1 
ATOM   4737 C CG  . GLU C 3 176 ? 72.155  27.911 45.459  1.00 30.98 ? 682  GLU A CG  1 
ATOM   4738 C CD  . GLU C 3 176 ? 73.440  28.620 44.946  1.00 36.91 ? 682  GLU A CD  1 
ATOM   4739 O OE1 . GLU C 3 176 ? 74.286  29.023 45.779  1.00 38.91 ? 682  GLU A OE1 1 
ATOM   4740 O OE2 . GLU C 3 176 ? 73.640  28.747 43.687  1.00 41.01 ? 682  GLU A OE2 1 
ATOM   4741 N N   . LEU C 3 177 ? 71.594  23.141 45.822  1.00 20.49 ? 683  LEU A N   1 
ATOM   4742 C CA  . LEU C 3 177 ? 72.064  21.862 45.333  1.00 21.25 ? 683  LEU A CA  1 
ATOM   4743 C C   . LEU C 3 177 ? 71.186  21.355 44.191  1.00 21.70 ? 683  LEU A C   1 
ATOM   4744 O O   . LEU C 3 177 ? 71.676  20.849 43.190  1.00 20.95 ? 683  LEU A O   1 
ATOM   4745 C CB  . LEU C 3 177 ? 72.134  20.811 46.478  1.00 19.19 ? 683  LEU A CB  1 
ATOM   4746 C CG  . LEU C 3 177 ? 73.194  21.054 47.575  1.00 18.93 ? 683  LEU A CG  1 
ATOM   4747 C CD1 . LEU C 3 177 ? 72.803  20.318 48.851  1.00 18.09 ? 683  LEU A CD1 1 
ATOM   4748 C CD2 . LEU C 3 177 ? 74.599  20.643 47.025  1.00 18.91 ? 683  LEU A CD2 1 
ATOM   4749 N N   . GLU C 3 178 ? 69.880  21.480 44.361  1.00 24.41 ? 684  GLU A N   1 
ATOM   4750 C CA  . GLU C 3 178 ? 68.934  21.014 43.357  1.00 26.06 ? 684  GLU A CA  1 
ATOM   4751 C C   . GLU C 3 178 ? 69.146  21.720 42.008  1.00 25.25 ? 684  GLU A C   1 
ATOM   4752 O O   . GLU C 3 178 ? 69.112  21.116 40.967  1.00 23.46 ? 684  GLU A O   1 
ATOM   4753 C CB  . GLU C 3 178 ? 67.542  21.284 43.897  1.00 30.53 ? 684  GLU A CB  1 
ATOM   4754 C CG  . GLU C 3 178 ? 66.418  20.978 42.979  1.00 36.25 ? 684  GLU A CG  1 
ATOM   4755 C CD  . GLU C 3 178 ? 65.094  21.083 43.722  1.00 39.87 ? 684  GLU A CD  1 
ATOM   4756 O OE1 . GLU C 3 178 ? 64.900  22.070 44.487  1.00 41.05 ? 684  GLU A OE1 1 
ATOM   4757 O OE2 . GLU C 3 178 ? 64.263  20.165 43.536  1.00 41.63 ? 684  GLU A OE2 1 
ATOM   4758 N N   . GLN C 3 179 ? 69.404  23.014 42.065  1.00 26.27 ? 685  GLN A N   1 
ATOM   4759 C CA  . GLN C 3 179 ? 69.605  23.816 40.877  1.00 28.47 ? 685  GLN A CA  1 
ATOM   4760 C C   . GLN C 3 179 ? 70.890  23.448 40.169  1.00 27.93 ? 685  GLN A C   1 
ATOM   4761 O O   . GLN C 3 179 ? 70.924  23.420 38.940  1.00 26.45 ? 685  GLN A O   1 
ATOM   4762 C CB  . GLN C 3 179 ? 69.686  25.294 41.240  1.00 32.01 ? 685  GLN A CB  1 
ATOM   4763 C CG  . GLN C 3 179 ? 68.565  25.794 42.129  1.00 37.92 ? 685  GLN A CG  1 
ATOM   4764 C CD  . GLN C 3 179 ? 68.790  27.237 42.535  1.00 41.60 ? 685  GLN A CD  1 
ATOM   4765 O OE1 . GLN C 3 179 ? 69.895  27.625 42.970  1.00 45.20 ? 685  GLN A OE1 1 
ATOM   4766 N NE2 . GLN C 3 179 ? 67.746  28.051 42.403  1.00 45.04 ? 685  GLN A NE2 1 
ATOM   4767 N N   . GLN C 3 180 ? 71.954  23.187 40.930  1.00 26.89 ? 686  GLN A N   1 
ATOM   4768 C CA  . GLN C 3 180 ? 73.222  22.849 40.295  1.00 27.27 ? 686  GLN A CA  1 
ATOM   4769 C C   . GLN C 3 180 ? 73.474  21.366 40.044  1.00 25.01 ? 686  GLN A C   1 
ATOM   4770 O O   . GLN C 3 180 ? 74.471  20.994 39.433  1.00 24.10 ? 686  GLN A O   1 
ATOM   4771 C CB  . GLN C 3 180 ? 74.367  23.462 41.115  1.00 30.79 ? 686  GLN A CB  1 
ATOM   4772 C CG  . GLN C 3 180 ? 74.543  24.933 40.825  1.00 38.39 ? 686  GLN A CG  1 
ATOM   4773 C CD  . GLN C 3 180 ? 75.936  25.396 41.142  1.00 43.40 ? 686  GLN A CD  1 
ATOM   4774 O OE1 . GLN C 3 180 ? 76.226  25.820 42.268  1.00 47.75 ? 686  GLN A OE1 1 
ATOM   4775 N NE2 . GLN C 3 180 ? 76.831  25.297 40.153  1.00 46.12 ? 686  GLN A NE2 1 
ATOM   4776 N N   . ARG C 3 181 ? 72.552  20.521 40.480  1.00 23.26 ? 687  ARG A N   1 
ATOM   4777 C CA  . ARG C 3 181 ? 72.705  19.081 40.357  1.00 23.04 ? 687  ARG A CA  1 
ATOM   4778 C C   . ARG C 3 181 ? 73.088  18.525 38.977  1.00 23.90 ? 687  ARG A C   1 
ATOM   4779 O O   . ARG C 3 181 ? 74.095  17.816 38.855  1.00 20.75 ? 687  ARG A O   1 
ATOM   4780 C CB  . ARG C 3 181 ? 71.417  18.432 40.842  1.00 25.48 ? 687  ARG A CB  1 
ATOM   4781 C CG  . ARG C 3 181 ? 71.306  16.935 40.649  1.00 29.66 ? 687  ARG A CG  1 
ATOM   4782 C CD  . ARG C 3 181 ? 69.921  16.644 40.075  1.00 29.93 ? 687  ARG A CD  1 
ATOM   4783 N NE  . ARG C 3 181 ? 68.951  17.308 40.896  1.00 34.81 ? 687  ARG A NE  1 
ATOM   4784 C CZ  . ARG C 3 181 ? 67.760  17.717 40.489  1.00 34.83 ? 687  ARG A CZ  1 
ATOM   4785 N NH1 . ARG C 3 181 ? 67.374  17.537 39.248  1.00 34.41 ? 687  ARG A NH1 1 
ATOM   4786 N NH2 . ARG C 3 181 ? 66.949  18.288 41.356  1.00 37.55 ? 687  ARG A NH2 1 
ATOM   4787 N N   . ASP C 3 182 ? 72.302  18.830 37.934  1.00 23.66 ? 688  ASP A N   1 
ATOM   4788 C CA  . ASP C 3 182 ? 72.606  18.303 36.603  1.00 25.20 ? 688  ASP A CA  1 
ATOM   4789 C C   . ASP C 3 182 ? 73.977  18.776 36.104  1.00 25.32 ? 688  ASP A C   1 
ATOM   4790 O O   . ASP C 3 182 ? 74.683  18.034 35.459  1.00 24.39 ? 688  ASP A O   1 
ATOM   4791 C CB  . ASP C 3 182 ? 71.512  18.697 35.608  1.00 27.85 ? 688  ASP A CB  1 
ATOM   4792 C CG  . ASP C 3 182 ? 70.160  18.027 35.925  1.00 30.45 ? 688  ASP A CG  1 
ATOM   4793 O OD1 . ASP C 3 182 ? 69.138  18.422 35.327  1.00 33.61 ? 688  ASP A OD1 1 
ATOM   4794 O OD2 . ASP C 3 182 ? 70.114  17.102 36.769  1.00 32.21 ? 688  ASP A OD2 1 
ATOM   4795 N N   . GLU C 3 183 ? 74.342  20.014 36.417  1.00 25.55 ? 689  GLU A N   1 
ATOM   4796 C CA  . GLU C 3 183 ? 75.631  20.579 36.025  1.00 26.59 ? 689  GLU A CA  1 
ATOM   4797 C C   . GLU C 3 183 ? 76.776  19.785 36.707  1.00 24.40 ? 689  GLU A C   1 
ATOM   4798 O O   . GLU C 3 183 ? 77.808  19.457 36.092  1.00 21.19 ? 689  GLU A O   1 
ATOM   4799 C CB  . GLU C 3 183 ? 75.635  22.028 36.484  1.00 32.27 ? 689  GLU A CB  1 
ATOM   4800 C CG  . GLU C 3 183 ? 76.000  23.019 35.447  1.00 42.53 ? 689  GLU A CG  1 
ATOM   4801 C CD  . GLU C 3 183 ? 77.481  22.967 35.139  1.00 47.95 ? 689  GLU A CD  1 
ATOM   4802 O OE1 . GLU C 3 183 ? 77.907  22.020 34.406  1.00 50.78 ? 689  GLU A OE1 1 
ATOM   4803 O OE2 . GLU C 3 183 ? 78.212  23.867 35.650  1.00 51.61 ? 689  GLU A OE2 1 
ATOM   4804 N N   . ILE C 3 184 ? 76.595  19.470 37.988  1.00 21.65 ? 690  ILE A N   1 
ATOM   4805 C CA  . ILE C 3 184 ? 77.623  18.726 38.718  1.00 21.69 ? 690  ILE A CA  1 
ATOM   4806 C C   . ILE C 3 184 ? 77.725  17.283 38.164  1.00 21.74 ? 690  ILE A C   1 
ATOM   4807 O O   . ILE C 3 184 ? 78.819  16.775 37.882  1.00 20.38 ? 690  ILE A O   1 
ATOM   4808 C CB  . ILE C 3 184 ? 77.287  18.693 40.265  1.00 21.44 ? 690  ILE A CB  1 
ATOM   4809 C CG1 . ILE C 3 184 ? 77.461  20.105 40.867  1.00 20.07 ? 690  ILE A CG1 1 
ATOM   4810 C CG2 . ILE C 3 184 ? 78.227  17.724 40.971  1.00 19.83 ? 690  ILE A CG2 1 
ATOM   4811 C CD1 . ILE C 3 184 ? 76.789  20.280 42.266  1.00 20.29 ? 690  ILE A CD1 1 
ATOM   4812 N N   . VAL C 3 185 ? 76.581  16.617 38.027  1.00 21.23 ? 691  VAL A N   1 
ATOM   4813 C CA  . VAL C 3 185 ? 76.564  15.247 37.488  1.00 22.71 ? 691  VAL A CA  1 
ATOM   4814 C C   . VAL C 3 185 ? 77.288  15.209 36.123  1.00 22.62 ? 691  VAL A C   1 
ATOM   4815 O O   . VAL C 3 185 ? 78.084  14.308 35.829  1.00 20.46 ? 691  VAL A O   1 
ATOM   4816 C CB  . VAL C 3 185 ? 75.113  14.771 37.273  1.00 24.99 ? 691  VAL A CB  1 
ATOM   4817 C CG1 . VAL C 3 185 ? 75.092  13.442 36.533  1.00 28.45 ? 691  VAL A CG1 1 
ATOM   4818 C CG2 . VAL C 3 185 ? 74.428  14.662 38.597  1.00 24.77 ? 691  VAL A CG2 1 
ATOM   4819 N N   . SER C 3 186 ? 77.012  16.210 35.299  1.00 22.07 ? 692  SER A N   1 
ATOM   4820 C CA  . SER C 3 186 ? 77.628  16.302 33.971  1.00 23.60 ? 692  SER A CA  1 
ATOM   4821 C C   . SER C 3 186 ? 79.174  16.459 34.007  1.00 22.47 ? 692  SER A C   1 
ATOM   4822 O O   . SER C 3 186 ? 79.919  15.825 33.227  1.00 20.95 ? 692  SER A O   1 
ATOM   4823 C CB  . SER C 3 186 ? 76.968  17.488 33.232  1.00 26.41 ? 692  SER A CB  1 
ATOM   4824 O OG  . SER C 3 186 ? 77.691  17.858 32.069  1.00 31.98 ? 692  SER A OG  1 
ATOM   4825 N N   . TYR C 3 187 ? 79.658  17.318 34.906  1.00 20.80 ? 693  TYR A N   1 
ATOM   4826 C CA  . TYR C 3 187 ? 81.086  17.550 35.048  1.00 21.59 ? 693  TYR A CA  1 
ATOM   4827 C C   . TYR C 3 187 ? 81.737  16.242 35.573  1.00 21.77 ? 693  TYR A C   1 
ATOM   4828 O O   . TYR C 3 187 ? 82.781  15.815 35.063  1.00 20.35 ? 693  TYR A O   1 
ATOM   4829 C CB  . TYR C 3 187 ? 81.349  18.701 36.031  1.00 22.55 ? 693  TYR A CB  1 
ATOM   4830 C CG  . TYR C 3 187 ? 82.815  18.977 36.224  1.00 25.66 ? 693  TYR A CG  1 
ATOM   4831 C CD1 . TYR C 3 187 ? 83.559  19.645 35.235  1.00 25.98 ? 693  TYR A CD1 1 
ATOM   4832 C CD2 . TYR C 3 187 ? 83.496  18.480 37.347  1.00 25.25 ? 693  TYR A CD2 1 
ATOM   4833 C CE1 . TYR C 3 187 ? 84.978  19.800 35.347  1.00 28.20 ? 693  TYR A CE1 1 
ATOM   4834 C CE2 . TYR C 3 187 ? 84.907  18.635 37.473  1.00 27.45 ? 693  TYR A CE2 1 
ATOM   4835 C CZ  . TYR C 3 187 ? 85.645  19.285 36.475  1.00 27.96 ? 693  TYR A CZ  1 
ATOM   4836 O OH  . TYR C 3 187 ? 87.036  19.360 36.560  1.00 29.66 ? 693  TYR A OH  1 
ATOM   4837 N N   . LEU C 3 188 ? 81.122  15.598 36.568  1.00 20.59 ? 694  LEU A N   1 
ATOM   4838 C CA  . LEU C 3 188 ? 81.686  14.353 37.090  1.00 22.31 ? 694  LEU A CA  1 
ATOM   4839 C C   . LEU C 3 188 ? 81.691  13.255 36.013  1.00 22.79 ? 694  LEU A C   1 
ATOM   4840 O O   . LEU C 3 188 ? 82.663  12.502 35.897  1.00 22.78 ? 694  LEU A O   1 
ATOM   4841 C CB  . LEU C 3 188 ? 80.897  13.810 38.297  1.00 21.68 ? 694  LEU A CB  1 
ATOM   4842 C CG  . LEU C 3 188 ? 80.598  14.762 39.492  1.00 22.08 ? 694  LEU A CG  1 
ATOM   4843 C CD1 . LEU C 3 188 ? 79.898  13.987 40.633  1.00 21.33 ? 694  LEU A CD1 1 
ATOM   4844 C CD2 . LEU C 3 188 ? 81.886  15.426 39.951  1.00 22.80 ? 694  LEU A CD2 1 
ATOM   4845 N N   . CYS C 3 189 ? 80.600  13.131 35.267  1.00 22.50 ? 695  CYS A N   1 
ATOM   4846 C CA  . CYS C 3 189 ? 80.521  12.080 34.228  1.00 22.99 ? 695  CYS A CA  1 
ATOM   4847 C C   . CYS C 3 189 ? 81.635  12.244 33.199  1.00 22.37 ? 695  CYS A C   1 
ATOM   4848 O O   . CYS C 3 189 ? 82.258  11.273 32.804  1.00 22.39 ? 695  CYS A O   1 
ATOM   4849 C CB  . CYS C 3 189 ? 79.170  12.102 33.517  1.00 23.01 ? 695  CYS A CB  1 
ATOM   4850 S SG  . CYS C 3 189 ? 78.730  10.498 32.735  1.00 24.35 ? 695  CYS A SG  1 
ATOM   4851 N N   . ASP C 3 190 ? 81.903  13.480 32.788  1.00 24.01 ? 696  ASP A N   1 
ATOM   4852 C CA  . ASP C 3 190 ? 82.964  13.735 31.820  1.00 25.61 ? 696  ASP A CA  1 
ATOM   4853 C C   . ASP C 3 190 ? 84.394  13.419 32.253  1.00 24.90 ? 696  ASP A C   1 
ATOM   4854 O O   . ASP C 3 190 ? 85.280  13.333 31.394  1.00 22.20 ? 696  ASP A O   1 
ATOM   4855 C CB  . ASP C 3 190 ? 82.937  15.176 31.354  1.00 30.03 ? 696  ASP A CB  1 
ATOM   4856 C CG  . ASP C 3 190 ? 81.753  15.463 30.476  1.00 34.32 ? 696  ASP A CG  1 
ATOM   4857 O OD1 . ASP C 3 190 ? 81.100  14.493 30.019  1.00 38.16 ? 696  ASP A OD1 1 
ATOM   4858 O OD2 . ASP C 3 190 ? 81.474  16.657 30.237  1.00 38.78 ? 696  ASP A OD2 1 
ATOM   4859 N N   . LEU C 3 191 ? 84.607  13.243 33.560  1.00 23.19 ? 697  LEU A N   1 
ATOM   4860 C CA  . LEU C 3 191 ? 85.927  12.928 34.109  1.00 23.50 ? 697  LEU A CA  1 
ATOM   4861 C C   . LEU C 3 191 ? 86.129  11.420 34.025  1.00 23.42 ? 697  LEU A C   1 
ATOM   4862 O O   . LEU C 3 191 ? 87.224  10.914 34.259  1.00 23.66 ? 697  LEU A O   1 
ATOM   4863 C CB  . LEU C 3 191 ? 86.006  13.385 35.591  1.00 22.16 ? 697  LEU A CB  1 
ATOM   4864 C CG  . LEU C 3 191 ? 85.841  14.903 35.848  1.00 21.82 ? 697  LEU A CG  1 
ATOM   4865 C CD1 . LEU C 3 191 ? 85.778  15.228 37.350  1.00 19.15 ? 697  LEU A CD1 1 
ATOM   4866 C CD2 . LEU C 3 191 ? 87.017  15.653 35.192  1.00 21.12 ? 697  LEU A CD2 1 
ATOM   4867 N N   . ALA C 3 192 ? 85.055  10.699 33.702  1.00 23.94 ? 698  ALA A N   1 
ATOM   4868 C CA  . ALA C 3 192 ? 85.102  9.236  33.609  1.00 24.97 ? 698  ALA A CA  1 
ATOM   4869 C C   . ALA C 3 192 ? 85.159  8.749  32.161  1.00 27.32 ? 698  ALA A C   1 
ATOM   4870 O O   . ALA C 3 192 ? 84.609  9.398  31.263  1.00 27.03 ? 698  ALA A O   1 
ATOM   4871 C CB  . ALA C 3 192 ? 83.864  8.623  34.300  1.00 24.54 ? 698  ALA A CB  1 
ATOM   4872 N N   . PRO C 3 193 ? 85.842  7.612  31.918  1.00 28.85 ? 699  PRO A N   1 
ATOM   4873 C CA  . PRO C 3 193 ? 85.937  7.064  30.559  1.00 29.99 ? 699  PRO A CA  1 
ATOM   4874 C C   . PRO C 3 193 ? 84.683  6.224  30.239  1.00 31.45 ? 699  PRO A C   1 
ATOM   4875 O O   . PRO C 3 193 ? 84.024  5.708  31.145  1.00 29.52 ? 699  PRO A O   1 
ATOM   4876 C CB  . PRO C 3 193 ? 87.189  6.184  30.640  1.00 29.64 ? 699  PRO A CB  1 
ATOM   4877 C CG  . PRO C 3 193 ? 87.033  5.568  32.004  1.00 29.00 ? 699  PRO A CG  1 
ATOM   4878 C CD  . PRO C 3 193 ? 86.699  6.837  32.835  1.00 27.60 ? 699  PRO A CD  1 
ATOM   4879 N N   . GLU C 3 194 ? 84.348  6.082  28.952  1.00 34.27 ? 700  GLU A N   1 
ATOM   4880 C CA  . GLU C 3 194 ? 83.203  5.251  28.572  1.00 37.33 ? 700  GLU A CA  1 
ATOM   4881 C C   . GLU C 3 194 ? 83.582  3.782  28.635  1.00 37.78 ? 700  GLU A C   1 
ATOM   4882 O O   . GLU C 3 194 ? 84.747  3.441  28.508  1.00 38.49 ? 700  GLU A O   1 
ATOM   4883 C CB  . GLU C 3 194 ? 82.775  5.540  27.148  1.00 41.36 ? 700  GLU A CB  1 
ATOM   4884 C CG  . GLU C 3 194 ? 82.150  6.887  26.927  1.00 47.37 ? 700  GLU A CG  1 
ATOM   4885 C CD  . GLU C 3 194 ? 81.563  6.977  25.548  1.00 50.89 ? 700  GLU A CD  1 
ATOM   4886 O OE1 . GLU C 3 194 ? 80.620  6.183  25.307  1.00 53.58 ? 700  GLU A OE1 1 
ATOM   4887 O OE2 . GLU C 3 194 ? 82.052  7.810  24.724  1.00 51.87 ? 700  GLU A OE2 1 
ATOM   4888 N N   . ALA C 3 195 ? 82.611  2.906  28.823  1.00 38.89 ? 701  ALA A N   1 
ATOM   4889 C CA  . ALA C 3 195 ? 82.915  1.490  28.841  1.00 40.57 ? 701  ALA A CA  1 
ATOM   4890 C C   . ALA C 3 195 ? 83.429  1.144  27.424  1.00 42.97 ? 701  ALA A C   1 
ATOM   4891 O O   . ALA C 3 195 ? 83.303  1.947  26.484  1.00 42.46 ? 701  ALA A O   1 
ATOM   4892 C CB  . ALA C 3 195 ? 81.658  0.682  29.151  1.00 39.91 ? 701  ALA A CB  1 
ATOM   4893 N N   . PRO C 3 196 ? 84.079  -0.017 27.262  1.00 44.60 ? 702  PRO A N   1 
ATOM   4894 C CA  . PRO C 3 196 ? 84.559  -0.374 25.912  1.00 46.47 ? 702  PRO A CA  1 
ATOM   4895 C C   . PRO C 3 196 ? 83.368  -0.828 25.039  1.00 48.18 ? 702  PRO A C   1 
ATOM   4896 O O   . PRO C 3 196 ? 82.898  -1.968 25.263  1.00 49.34 ? 702  PRO A O   1 
ATOM   4897 C CB  . PRO C 3 196 ? 85.534  -1.508 26.182  1.00 45.78 ? 702  PRO A CB  1 
ATOM   4898 C CG  . PRO C 3 196 ? 86.114  -1.133 27.499  1.00 46.23 ? 702  PRO A CG  1 
ATOM   4899 C CD  . PRO C 3 196 ? 84.871  -0.712 28.293  1.00 45.08 ? 702  PRO A CD  1 
ATOM   4900 O OXT . PRO C 3 196 ? 82.903  -0.045 24.167  1.00 48.84 ? 702  PRO A OXT 1 
HETATM 4901 O O   . HOH D 4 .   ? 119.306 19.120 55.184  1.00 11.66 ? 724  HOH L O   1 
HETATM 4902 O O   . HOH D 4 .   ? 140.771 26.435 79.541  1.00 15.01 ? 728  HOH L O   1 
HETATM 4903 O O   . HOH D 4 .   ? 117.919 8.105  52.752  1.00 14.16 ? 742  HOH L O   1 
HETATM 4904 O O   . HOH D 4 .   ? 114.754 13.430 69.045  1.00 77.15 ? 743  HOH L O   1 
HETATM 4905 O O   . HOH D 4 .   ? 124.537 13.927 68.903  1.00 22.56 ? 744  HOH L O   1 
HETATM 4906 O O   . HOH D 4 .   ? 120.824 24.749 50.930  1.00 17.92 ? 745  HOH L O   1 
HETATM 4907 O O   . HOH D 4 .   ? 112.335 11.615 51.379  1.00 14.29 ? 747  HOH L O   1 
HETATM 4908 O O   . HOH D 4 .   ? 133.082 16.898 96.178  1.00 20.58 ? 750  HOH L O   1 
HETATM 4909 O O   . HOH D 4 .   ? 135.004 20.039 91.067  1.00 20.49 ? 754  HOH L O   1 
HETATM 4910 O O   . HOH D 4 .   ? 107.775 22.390 54.463  1.00 15.95 ? 755  HOH L O   1 
HETATM 4911 O O   . HOH D 4 .   ? 110.615 5.676  63.196  1.00 18.92 ? 758  HOH L O   1 
HETATM 4912 O O   . HOH D 4 .   ? 102.213 12.894 60.001  1.00 29.05 ? 761  HOH L O   1 
HETATM 4913 O O   . HOH D 4 .   ? 155.208 11.222 78.975  1.00 26.97 ? 763  HOH L O   1 
HETATM 4914 O O   . HOH D 4 .   ? 118.217 17.273 71.233  1.00 14.32 ? 765  HOH L O   1 
HETATM 4915 O O   . HOH D 4 .   ? 127.786 25.042 52.110  1.00 17.36 ? 766  HOH L O   1 
HETATM 4916 O O   . HOH D 4 .   ? 107.677 11.835 66.160  1.00 14.36 ? 767  HOH L O   1 
HETATM 4917 O O   . HOH D 4 .   ? 138.349 24.129 101.675 1.00 23.10 ? 771  HOH L O   1 
HETATM 4918 O O   . HOH D 4 .   ? 124.775 19.802 52.876  1.00 17.53 ? 773  HOH L O   1 
HETATM 4919 O O   . HOH D 4 .   ? 146.260 7.969  86.928  1.00 24.47 ? 777  HOH L O   1 
HETATM 4920 O O   . HOH D 4 .   ? 123.011 13.825 53.737  1.00 24.71 ? 778  HOH L O   1 
HETATM 4921 O O   . HOH D 4 .   ? 146.230 18.764 68.373  1.00 19.33 ? 781  HOH L O   1 
HETATM 4922 O O   . HOH D 4 .   ? 121.945 5.659  53.968  1.00 20.70 ? 786  HOH L O   1 
HETATM 4923 O O   . HOH D 4 .   ? 120.450 11.136 51.501  1.00 18.92 ? 789  HOH L O   1 
HETATM 4924 O O   . HOH D 4 .   ? 133.880 21.414 72.548  1.00 24.32 ? 791  HOH L O   1 
HETATM 4925 O O   . HOH D 4 .   ? 119.222 6.829  61.951  1.00 24.35 ? 793  HOH L O   1 
HETATM 4926 O O   . HOH D 4 .   ? 101.621 14.841 62.548  1.00 13.27 ? 795  HOH L O   1 
HETATM 4927 O O   . HOH D 4 .   ? 104.709 14.548 51.409  1.00 29.44 ? 797  HOH L O   1 
HETATM 4928 O O   . HOH D 4 .   ? 132.646 26.934 80.508  1.00 24.37 ? 801  HOH L O   1 
HETATM 4929 O O   . HOH D 4 .   ? 147.747 5.508  88.689  1.00 29.87 ? 802  HOH L O   1 
HETATM 4930 O O   . HOH D 4 .   ? 110.826 4.459  56.142  1.00 26.53 ? 803  HOH L O   1 
HETATM 4931 O O   . HOH D 4 .   ? 127.002 31.662 62.324  1.00 24.45 ? 806  HOH L O   1 
HETATM 4932 O O   . HOH D 4 .   ? 117.542 26.363 48.208  1.00 33.49 ? 808  HOH L O   1 
HETATM 4933 O O   . HOH D 4 .   ? 113.512 16.031 70.552  1.00 17.75 ? 809  HOH L O   1 
HETATM 4934 O O   . HOH D 4 .   ? 132.966 19.623 70.812  1.00 21.37 ? 810  HOH L O   1 
HETATM 4935 O O   . HOH D 4 .   ? 144.053 13.499 75.970  1.00 24.26 ? 812  HOH L O   1 
HETATM 4936 O O   . HOH D 4 .   ? 141.670 27.555 63.422  1.00 18.06 ? 818  HOH L O   1 
HETATM 4937 O O   . HOH D 4 .   ? 130.793 25.205 70.455  1.00 31.46 ? 820  HOH L O   1 
HETATM 4938 O O   . HOH D 4 .   ? 152.014 21.515 76.575  1.00 27.37 ? 828  HOH L O   1 
HETATM 4939 O O   . HOH D 4 .   ? 151.048 20.735 85.977  1.00 18.76 ? 830  HOH L O   1 
HETATM 4940 O O   . HOH D 4 .   ? 139.490 6.670  89.898  1.00 21.31 ? 833  HOH L O   1 
HETATM 4941 O O   . HOH D 4 .   ? 149.802 22.053 93.350  1.00 15.20 ? 837  HOH L O   1 
HETATM 4942 O O   . HOH D 4 .   ? 139.615 8.678  91.643  1.00 20.63 ? 838  HOH L O   1 
HETATM 4943 O O   . HOH D 4 .   ? 118.560 33.836 68.833  1.00 20.31 ? 844  HOH L O   1 
HETATM 4944 O O   . HOH D 4 .   ? 129.001 33.216 53.803  1.00 24.70 ? 847  HOH L O   1 
HETATM 4945 O O   . HOH D 4 .   ? 118.450 9.598  50.400  1.00 24.35 ? 848  HOH L O   1 
HETATM 4946 O O   . HOH D 4 .   ? 131.535 21.795 103.880 1.00 24.34 ? 850  HOH L O   1 
HETATM 4947 O O   . HOH D 4 .   ? 134.672 22.654 93.140  1.00 23.93 ? 853  HOH L O   1 
HETATM 4948 O O   . HOH D 4 .   ? 136.720 21.155 79.889  1.00 18.29 ? 854  HOH L O   1 
HETATM 4949 O O   . HOH D 4 .   ? 136.229 16.691 68.627  1.00 27.35 ? 857  HOH L O   1 
HETATM 4950 O O   . HOH D 4 .   ? 113.783 23.530 50.535  1.00 19.06 ? 859  HOH L O   1 
HETATM 4951 O O   . HOH D 4 .   ? 127.715 27.247 50.411  1.00 17.99 ? 861  HOH L O   1 
HETATM 4952 O O   . HOH D 4 .   ? 133.387 17.853 58.411  1.00 27.64 ? 866  HOH L O   1 
HETATM 4953 O O   . HOH D 4 .   ? 142.824 25.350 64.040  1.00 27.22 ? 867  HOH L O   1 
HETATM 4954 O O   . HOH D 4 .   ? 108.695 16.754 50.555  1.00 21.17 ? 869  HOH L O   1 
HETATM 4955 O O   . HOH D 4 .   ? 155.875 7.450  79.946  1.00 20.25 ? 870  HOH L O   1 
HETATM 4956 O O   . HOH D 4 .   ? 109.027 12.276 49.477  1.00 22.29 ? 873  HOH L O   1 
HETATM 4957 O O   . HOH D 4 .   ? 140.183 4.803  99.164  1.00 38.66 ? 875  HOH L O   1 
HETATM 4958 O O   . HOH D 4 .   ? 117.879 37.036 53.866  1.00 26.38 ? 878  HOH L O   1 
HETATM 4959 O O   . HOH D 4 .   ? 140.703 3.724  87.835  1.00 20.20 ? 881  HOH L O   1 
HETATM 4960 O O   . HOH D 4 .   ? 150.323 15.009 72.332  1.00 25.41 ? 884  HOH L O   1 
HETATM 4961 O O   . HOH D 4 .   ? 106.530 11.734 72.833  1.00 31.22 ? 886  HOH L O   1 
HETATM 4962 O O   . HOH D 4 .   ? 117.726 7.594  64.122  1.00 19.78 ? 887  HOH L O   1 
HETATM 4963 O O   . HOH D 4 .   ? 124.173 11.223 61.901  1.00 24.65 ? 892  HOH L O   1 
HETATM 4964 O O   . HOH D 4 .   ? 147.918 26.036 68.368  1.00 23.77 ? 894  HOH L O   1 
HETATM 4965 O O   . HOH D 4 .   ? 138.011 11.592 85.264  1.00 24.33 ? 895  HOH L O   1 
HETATM 4966 O O   . HOH D 4 .   ? 127.906 25.345 71.322  1.00 27.88 ? 896  HOH L O   1 
HETATM 4967 O O   . HOH D 4 .   ? 141.768 29.148 65.760  1.00 32.15 ? 900  HOH L O   1 
HETATM 4968 O O   . HOH D 4 .   ? 145.089 30.145 83.529  1.00 27.06 ? 902  HOH L O   1 
HETATM 4969 O O   . HOH D 4 .   ? 107.261 8.834  51.597  1.00 24.24 ? 903  HOH L O   1 
HETATM 4970 O O   . HOH D 4 .   ? 138.034 26.728 79.161  1.00 22.49 ? 904  HOH L O   1 
HETATM 4971 O O   . HOH D 4 .   ? 149.904 19.245 68.664  1.00 26.99 ? 908  HOH L O   1 
HETATM 4972 O O   . HOH D 4 .   ? 142.318 5.684  85.931  1.00 39.95 ? 911  HOH L O   1 
HETATM 4973 O O   . HOH D 4 .   ? 102.462 15.403 49.791  1.00 24.36 ? 912  HOH L O   1 
HETATM 4974 O O   . HOH D 4 .   ? 136.223 15.782 65.181  1.00 29.16 ? 915  HOH L O   1 
HETATM 4975 O O   . HOH D 4 .   ? 139.912 22.934 99.639  1.00 25.98 ? 922  HOH L O   1 
HETATM 4976 O O   . HOH D 4 .   ? 136.386 27.837 70.342  1.00 31.02 ? 923  HOH L O   1 
HETATM 4977 O O   . HOH D 4 .   ? 150.398 23.586 72.772  1.00 22.91 ? 926  HOH L O   1 
HETATM 4978 O O   . HOH D 4 .   ? 121.862 12.375 68.184  1.00 28.67 ? 928  HOH L O   1 
HETATM 4979 O O   . HOH D 4 .   ? 148.493 9.542  97.904  1.00 26.34 ? 931  HOH L O   1 
HETATM 4980 O O   . HOH D 4 .   ? 113.615 11.883 70.580  1.00 32.92 ? 940  HOH L O   1 
HETATM 4981 O O   . HOH D 4 .   ? 148.671 24.027 94.813  1.00 26.78 ? 941  HOH L O   1 
HETATM 4982 O O   . HOH D 4 .   ? 133.694 24.471 71.173  1.00 36.20 ? 943  HOH L O   1 
HETATM 4983 O O   . HOH D 4 .   ? 148.298 24.410 80.808  1.00 29.79 ? 947  HOH L O   1 
HETATM 4984 O O   . HOH D 4 .   ? 122.530 33.900 52.038  1.00 33.37 ? 949  HOH L O   1 
HETATM 4985 O O   . HOH D 4 .   ? 138.261 21.945 54.178  1.00 26.99 ? 952  HOH L O   1 
HETATM 4986 O O   . HOH D 4 .   ? 117.540 29.042 50.081  1.00 29.32 ? 954  HOH L O   1 
HETATM 4987 O O   . HOH D 4 .   ? 122.546 31.038 67.073  1.00 22.28 ? 955  HOH L O   1 
HETATM 4988 O O   . HOH D 4 .   ? 146.766 27.540 83.440  1.00 39.21 ? 966  HOH L O   1 
HETATM 4989 O O   . HOH D 4 .   ? 144.296 9.805  85.856  1.00 25.72 ? 970  HOH L O   1 
HETATM 4990 O O   . HOH D 4 .   ? 149.702 9.504  74.705  1.00 33.89 ? 973  HOH L O   1 
HETATM 4991 O O   . HOH D 4 .   ? 132.274 26.356 72.221  1.00 32.75 ? 978  HOH L O   1 
HETATM 4992 O O   . HOH D 4 .   ? 117.034 34.311 62.625  1.00 28.03 ? 982  HOH L O   1 
HETATM 4993 O O   . HOH D 4 .   ? 139.706 7.922  87.452  1.00 25.35 ? 984  HOH L O   1 
HETATM 4994 O O   . HOH D 4 .   ? 148.728 9.168  77.563  1.00 29.65 ? 994  HOH L O   1 
HETATM 4995 O O   . HOH D 4 .   ? 150.205 12.411 72.204  1.00 22.12 ? 996  HOH L O   1 
HETATM 4996 O O   . HOH D 4 .   ? 110.436 2.669  58.110  1.00 39.02 ? 1006 HOH L O   1 
HETATM 4997 O O   . HOH D 4 .   ? 143.312 27.809 105.029 1.00 26.08 ? 1012 HOH L O   1 
HETATM 4998 O O   . HOH D 4 .   ? 145.306 15.509 69.364  1.00 31.99 ? 1013 HOH L O   1 
HETATM 4999 O O   . HOH D 4 .   ? 123.822 28.349 50.362  1.00 23.98 ? 1016 HOH L O   1 
HETATM 5000 O O   . HOH D 4 .   ? 135.513 19.451 60.221  1.00 38.90 ? 1027 HOH L O   1 
HETATM 5001 O O   . HOH D 4 .   ? 117.116 4.995  59.520  1.00 31.11 ? 1034 HOH L O   1 
HETATM 5002 O O   . HOH D 4 .   ? 130.213 31.856 71.474  1.00 53.56 ? 1035 HOH L O   1 
HETATM 5003 O O   . HOH D 4 .   ? 133.280 21.125 77.530  1.00 36.10 ? 1036 HOH L O   1 
HETATM 5004 O O   . HOH D 4 .   ? 149.455 8.206  81.623  1.00 47.32 ? 1039 HOH L O   1 
HETATM 5005 O O   . HOH D 4 .   ? 148.963 11.197 80.960  1.00 26.11 ? 1042 HOH L O   1 
HETATM 5006 O O   . HOH D 4 .   ? 124.518 21.447 50.920  1.00 31.34 ? 1047 HOH L O   1 
HETATM 5007 O O   . HOH D 4 .   ? 153.002 17.621 94.146  1.00 32.23 ? 1052 HOH L O   1 
HETATM 5008 O O   . HOH D 4 .   ? 123.573 11.674 56.951  1.00 31.16 ? 1053 HOH L O   1 
HETATM 5009 O O   . HOH D 4 .   ? 138.519 16.324 70.426  1.00 27.35 ? 1054 HOH L O   1 
HETATM 5010 O O   . HOH D 4 .   ? 107.675 8.053  56.801  1.00 35.96 ? 1057 HOH L O   1 
HETATM 5011 O O   . HOH D 4 .   ? 151.324 7.004  89.407  1.00 32.59 ? 1059 HOH L O   1 
HETATM 5012 O O   . HOH D 4 .   ? 153.029 23.503 109.410 1.00 52.20 ? 1060 HOH L O   1 
HETATM 5013 O O   . HOH D 4 .   ? 129.373 18.466 52.628  1.00 39.15 ? 1061 HOH L O   1 
HETATM 5014 O O   . HOH D 4 .   ? 109.104 14.691 48.586  1.00 36.26 ? 1062 HOH L O   1 
HETATM 5015 O O   . HOH D 4 .   ? 103.723 10.328 58.740  1.00 26.97 ? 1068 HOH L O   1 
HETATM 5016 O O   . HOH D 4 .   ? 109.730 23.963 57.769  1.00 26.77 ? 1069 HOH L O   1 
HETATM 5017 O O   . HOH D 4 .   ? 130.935 23.137 80.262  1.00 34.90 ? 1070 HOH L O   1 
HETATM 5018 O O   . HOH D 4 .   ? 152.026 20.263 71.064  1.00 40.17 ? 1071 HOH L O   1 
HETATM 5019 O O   . HOH D 4 .   ? 118.335 39.158 55.710  1.00 39.04 ? 1073 HOH L O   1 
HETATM 5020 O O   . HOH D 4 .   ? 145.159 5.395  85.541  1.00 39.31 ? 1074 HOH L O   1 
HETATM 5021 O O   . HOH D 4 .   ? 133.396 18.492 55.580  1.00 33.63 ? 1075 HOH L O   1 
HETATM 5022 O O   . HOH D 4 .   ? 134.190 15.039 110.746 1.00 37.25 ? 1077 HOH L O   1 
HETATM 5023 O O   . HOH D 4 .   ? 145.087 3.139  91.163  1.00 40.92 ? 1078 HOH L O   1 
HETATM 5024 O O   . HOH D 4 .   ? 150.896 9.066  92.629  1.00 43.50 ? 1079 HOH L O   1 
HETATM 5025 O O   . HOH D 4 .   ? 127.329 17.841 71.892  1.00 45.15 ? 1080 HOH L O   1 
HETATM 5026 O O   . HOH D 4 .   ? 153.675 14.273 87.568  1.00 36.77 ? 1082 HOH L O   1 
HETATM 5027 O O   . HOH D 4 .   ? 121.335 22.847 48.677  1.00 45.12 ? 1086 HOH L O   1 
HETATM 5028 O O   . HOH D 4 .   ? 151.872 20.745 94.724  1.00 28.26 ? 1088 HOH L O   1 
HETATM 5029 O O   . HOH D 4 .   ? 130.885 15.142 96.945  1.00 28.88 ? 1089 HOH L O   1 
HETATM 5030 O O   . HOH D 4 .   ? 130.431 20.690 84.080  1.00 39.48 ? 1091 HOH L O   1 
HETATM 5031 O O   . HOH D 4 .   ? 139.394 35.442 70.645  1.00 51.35 ? 1095 HOH L O   1 
HETATM 5032 O O   . HOH D 4 .   ? 134.331 12.832 66.357  1.00 44.66 ? 1096 HOH L O   1 
HETATM 5033 O O   . HOH D 4 .   ? 131.213 14.443 88.610  1.00 32.91 ? 1102 HOH L O   1 
HETATM 5034 O O   . HOH D 4 .   ? 154.106 10.180 86.909  1.00 37.84 ? 1103 HOH L O   1 
HETATM 5035 O O   . HOH D 4 .   ? 101.475 11.994 65.073  1.00 40.57 ? 1104 HOH L O   1 
HETATM 5036 O O   . HOH D 4 .   ? 117.098 14.854 71.079  1.00 31.94 ? 1105 HOH L O   1 
HETATM 5037 O O   . HOH D 4 .   ? 150.992 26.662 69.389  1.00 50.06 ? 1109 HOH L O   1 
HETATM 5038 O O   . HOH D 4 .   ? 110.758 2.903  61.919  1.00 45.55 ? 1110 HOH L O   1 
HETATM 5039 O O   . HOH D 4 .   ? 147.401 1.805  88.894  1.00 40.60 ? 1116 HOH L O   1 
HETATM 5040 O O   . HOH D 4 .   ? 115.478 19.662 48.952  1.00 36.32 ? 1118 HOH L O   1 
HETATM 5041 O O   . HOH D 4 .   ? 129.016 25.647 73.622  1.00 38.73 ? 1119 HOH L O   1 
HETATM 5042 O O   . HOH D 4 .   ? 125.234 32.777 60.796  1.00 35.23 ? 1120 HOH L O   1 
HETATM 5043 O O   . HOH D 4 .   ? 121.133 33.203 75.230  1.00 38.39 ? 1124 HOH L O   1 
HETATM 5044 O O   . HOH D 4 .   ? 130.186 19.826 107.268 1.00 52.05 ? 1138 HOH L O   1 
HETATM 5045 O O   . HOH D 4 .   ? 119.918 34.504 53.681  1.00 30.61 ? 1141 HOH L O   1 
HETATM 5046 O O   . HOH D 4 .   ? 127.981 33.126 71.859  1.00 43.61 ? 1143 HOH L O   1 
HETATM 5047 O O   . HOH D 4 .   ? 152.025 24.745 70.835  1.00 36.65 ? 1146 HOH L O   1 
HETATM 5048 O O   . HOH D 4 .   ? 117.243 33.587 52.746  1.00 33.05 ? 1148 HOH L O   1 
HETATM 5049 O O   . HOH D 4 .   ? 144.764 1.796  94.892  1.00 41.29 ? 1150 HOH L O   1 
HETATM 5050 O O   . HOH D 4 .   ? 128.997 32.309 50.092  1.00 50.39 ? 1155 HOH L O   1 
HETATM 5051 O O   . HOH D 4 .   ? 132.692 10.445 109.131 1.00 52.37 ? 1157 HOH L O   1 
HETATM 5052 O O   . HOH D 4 .   ? 152.833 18.491 101.668 1.00 27.96 ? 1158 HOH L O   1 
HETATM 5053 O O   . HOH D 4 .   ? 141.937 5.174  102.478 1.00 52.58 ? 1159 HOH L O   1 
HETATM 5054 O O   . HOH D 4 .   ? 118.855 32.736 61.329  1.00 32.63 ? 1166 HOH L O   1 
HETATM 5055 O O   . HOH D 4 .   ? 141.584 20.771 60.271  1.00 47.19 ? 1168 HOH L O   1 
HETATM 5056 O O   . HOH D 4 .   ? 132.493 21.352 93.561  1.00 41.39 ? 1169 HOH L O   1 
HETATM 5057 O O   . HOH D 4 .   ? 146.174 24.436 87.775  1.00 11.91 ? 1171 HOH L O   1 
HETATM 5058 O O   . HOH D 4 .   ? 104.017 10.794 70.940  1.00 33.48 ? 1179 HOH L O   1 
HETATM 5059 O O   . HOH D 4 .   ? 131.847 19.662 91.635  1.00 38.03 ? 1180 HOH L O   1 
HETATM 5060 O O   . HOH D 4 .   ? 131.525 9.013  94.225  1.00 41.95 ? 1182 HOH L O   1 
HETATM 5061 O O   . HOH D 4 .   ? 117.284 5.088  64.951  1.00 31.22 ? 1183 HOH L O   1 
HETATM 5062 O O   . HOH D 4 .   ? 140.239 29.413 105.649 1.00 41.09 ? 1184 HOH L O   1 
HETATM 5063 O O   . HOH D 4 .   ? 112.527 20.028 48.551  1.00 42.32 ? 1185 HOH L O   1 
HETATM 5064 O O   . HOH D 4 .   ? 152.233 16.303 73.037  1.00 32.74 ? 1187 HOH L O   1 
HETATM 5065 O O   . HOH D 4 .   ? 122.528 33.538 67.612  1.00 29.04 ? 1188 HOH L O   1 
HETATM 5066 O O   . HOH D 4 .   ? 120.356 35.077 67.146  1.00 32.87 ? 1189 HOH L O   1 
HETATM 5067 O O   . HOH D 4 .   ? 157.793 5.320  80.328  1.00 35.70 ? 1192 HOH L O   1 
HETATM 5068 O O   . HOH D 4 .   ? 104.967 19.313 51.637  1.00 35.34 ? 1197 HOH L O   1 
HETATM 5069 O O   . HOH D 4 .   ? 128.059 16.009 52.008  1.00 40.04 ? 1203 HOH L O   1 
HETATM 5070 O O   . HOH D 4 .   ? 127.761 20.744 49.208  1.00 40.29 ? 1205 HOH L O   1 
HETATM 5071 O O   . HOH D 4 .   ? 140.577 24.638 111.187 1.00 36.56 ? 1212 HOH L O   1 
HETATM 5072 O O   . HOH D 4 .   ? 143.062 27.217 67.098  1.00 34.05 ? 1213 HOH L O   1 
HETATM 5073 O O   . HOH D 4 .   ? 123.107 15.306 51.407  1.00 40.04 ? 1214 HOH L O   1 
HETATM 5074 O O   . HOH D 4 .   ? 136.435 4.619  96.708  1.00 39.00 ? 1216 HOH L O   1 
HETATM 5075 O O   . HOH D 4 .   ? 141.157 25.898 57.000  1.00 30.68 ? 1221 HOH L O   1 
HETATM 5076 O O   . HOH D 4 .   ? 115.118 26.912 48.499  1.00 43.04 ? 1222 HOH L O   1 
HETATM 5077 O O   . HOH D 4 .   ? 134.981 9.204  91.144  1.00 38.54 ? 1224 HOH L O   1 
HETATM 5078 O O   . HOH D 4 .   ? 111.934 10.163 69.772  1.00 48.61 ? 1228 HOH L O   1 
HETATM 5079 O O   . HOH D 4 .   ? 128.550 14.611 61.554  1.00 35.69 ? 1229 HOH L O   1 
HETATM 5080 O O   . HOH D 4 .   ? 128.528 23.200 49.202  1.00 43.31 ? 1232 HOH L O   1 
HETATM 5081 O O   . HOH D 4 .   ? 131.379 12.978 68.645  1.00 37.34 ? 1234 HOH L O   1 
HETATM 5082 O O   . HOH D 4 .   ? 137.424 29.617 79.188  1.00 38.41 ? 1235 HOH L O   1 
HETATM 5083 O O   . HOH D 4 .   ? 136.934 13.525 83.184  1.00 40.65 ? 1240 HOH L O   1 
HETATM 5084 O O   . HOH D 4 .   ? 143.818 22.462 106.020 1.00 43.82 ? 1243 HOH L O   1 
HETATM 5085 O O   . HOH D 4 .   ? 105.118 9.120  54.399  1.00 34.95 ? 1244 HOH L O   1 
HETATM 5086 O O   . HOH D 4 .   ? 145.304 20.188 106.071 1.00 44.26 ? 1247 HOH L O   1 
HETATM 5087 O O   . HOH D 4 .   ? 142.885 27.792 60.025  1.00 39.06 ? 1248 HOH L O   1 
HETATM 5088 O O   . HOH D 4 .   ? 130.392 11.295 93.767  1.00 38.75 ? 1250 HOH L O   1 
HETATM 5089 O O   . HOH D 4 .   ? 116.856 17.370 48.325  1.00 49.47 ? 1254 HOH L O   1 
HETATM 5090 O O   . HOH D 4 .   ? 152.688 16.531 80.778  1.00 40.91 ? 1256 HOH L O   1 
HETATM 5091 O O   . HOH D 4 .   ? 138.860 9.395  81.837  1.00 46.95 ? 1260 HOH L O   1 
HETATM 5092 O O   . HOH D 4 .   ? 151.148 22.621 90.997  1.00 36.36 ? 1264 HOH L O   1 
HETATM 5093 O O   . HOH D 4 .   ? 133.860 24.203 50.815  1.00 41.72 ? 1267 HOH L O   1 
HETATM 5094 O O   . HOH D 4 .   ? 139.697 6.405  101.760 1.00 45.60 ? 1270 HOH L O   1 
HETATM 5095 O O   . HOH D 4 .   ? 143.335 31.207 80.612  1.00 40.68 ? 1271 HOH L O   1 
HETATM 5096 O O   . HOH D 4 .   ? 142.094 10.860 112.770 1.00 43.86 ? 1273 HOH L O   1 
HETATM 5097 O O   . HOH D 4 .   ? 120.300 17.195 48.631  1.00 55.74 ? 1276 HOH L O   1 
HETATM 5098 O O   . HOH D 4 .   ? 107.946 3.464  59.247  1.00 44.24 ? 1277 HOH L O   1 
HETATM 5099 O O   . HOH D 4 .   ? 123.453 22.955 72.943  1.00 44.39 ? 1281 HOH L O   1 
HETATM 5100 O O   . HOH D 4 .   ? 128.655 35.953 57.249  1.00 36.97 ? 1282 HOH L O   1 
HETATM 5101 O O   . HOH D 4 .   ? 147.974 25.839 77.192  1.00 44.02 ? 1287 HOH L O   1 
HETATM 5102 O O   . HOH D 4 .   ? 143.072 11.768 73.723  1.00 40.69 ? 1289 HOH L O   1 
HETATM 5103 O O   . HOH D 4 .   ? 139.721 14.589 113.504 1.00 44.16 ? 1292 HOH L O   1 
HETATM 5104 O O   . HOH D 4 .   ? 150.420 24.541 89.052  1.00 44.37 ? 1293 HOH L O   1 
HETATM 5105 O O   . HOH D 4 .   ? 151.405 20.307 97.566  1.00 51.40 ? 1294 HOH L O   1 
HETATM 5106 O O   . HOH D 4 .   ? 129.649 16.470 87.467  1.00 49.95 ? 1300 HOH L O   1 
HETATM 5107 O O   . HOH D 4 .   ? 152.488 13.685 99.165  1.00 44.20 ? 1302 HOH L O   1 
HETATM 5108 O O   . HOH D 4 .   ? 104.920 11.731 50.262  1.00 46.70 ? 1304 HOH L O   1 
HETATM 5109 O O   . HOH D 4 .   ? 129.928 29.799 49.434  1.00 46.09 ? 1305 HOH L O   1 
HETATM 5110 O O   . HOH D 4 .   ? 124.231 13.069 71.667  1.00 42.60 ? 1306 HOH L O   1 
HETATM 5111 O O   . HOH D 4 .   ? 153.245 19.182 75.313  1.00 51.26 ? 1307 HOH L O   1 
HETATM 5112 O O   . HOH D 4 .   ? 151.693 23.865 75.311  1.00 46.31 ? 1308 HOH L O   1 
HETATM 5113 O O   . HOH D 4 .   ? 147.455 8.893  72.628  1.00 43.99 ? 1309 HOH L O   1 
HETATM 5114 O O   . HOH D 4 .   ? 148.361 10.366 108.856 1.00 45.77 ? 1310 HOH L O   1 
HETATM 5115 O O   . HOH D 4 .   ? 134.568 28.694 77.407  1.00 44.45 ? 1317 HOH L O   1 
HETATM 5116 O O   . HOH D 4 .   ? 146.405 0.029  90.258  1.00 43.35 ? 1318 HOH L O   1 
HETATM 5117 O O   . HOH D 4 .   ? 127.683 30.641 47.718  1.00 49.38 ? 1319 HOH L O   1 
HETATM 5118 O O   . HOH D 4 .   ? 139.295 18.577 71.920  1.00 17.86 ? 1324 HOH L O   1 
HETATM 5119 O O   . HOH D 4 .   ? 104.658 10.188 66.651  1.00 36.03 ? 1328 HOH L O   1 
HETATM 5120 O O   . HOH D 4 .   ? 150.355 16.000 80.280  1.00 49.97 ? 1342 HOH L O   1 
HETATM 5121 O O   . HOH D 4 .   ? 146.866 28.450 77.000  1.00 45.50 ? 1344 HOH L O   1 
HETATM 5122 O O   . HOH D 4 .   ? 123.629 8.770  60.796  1.00 37.58 ? 1347 HOH L O   1 
HETATM 5123 O O   . HOH D 4 .   ? 99.356  13.751 65.879  1.00 42.63 ? 1353 HOH L O   1 
HETATM 5124 O O   . HOH D 4 .   ? 122.642 35.996 73.381  1.00 43.55 ? 1354 HOH L O   1 
HETATM 5125 O O   . HOH D 4 .   ? 131.239 14.189 99.526  1.00 49.45 ? 1355 HOH L O   1 
HETATM 5126 O O   . HOH D 4 .   ? 138.847 29.058 70.059  1.00 47.43 ? 1357 HOH L O   1 
HETATM 5127 O O   . HOH D 4 .   ? 132.870 15.549 59.190  1.00 45.72 ? 1358 HOH L O   1 
HETATM 5128 O O   . HOH E 4 .   ? 107.576 23.384 66.108  1.00 78.89 ? 721  HOH H O   1 
HETATM 5129 O O   . HOH E 4 .   ? 108.891 22.278 62.109  1.00 10.22 ? 725  HOH H O   1 
HETATM 5130 O O   . HOH E 4 .   ? 98.729  20.483 55.273  1.00 15.57 ? 727  HOH H O   1 
HETATM 5131 O O   . HOH E 4 .   ? 110.915 16.615 71.034  1.00 12.42 ? 729  HOH H O   1 
HETATM 5132 O O   . HOH E 4 .   ? 138.645 42.703 95.661  1.00 16.12 ? 730  HOH H O   1 
HETATM 5133 O O   . HOH E 4 .   ? 110.225 14.046 74.940  1.00 38.28 ? 731  HOH H O   1 
HETATM 5134 O O   . HOH E 4 .   ? 95.703  21.573 78.312  1.00 12.02 ? 732  HOH H O   1 
HETATM 5135 O O   . HOH E 4 .   ? 99.010  31.707 68.053  1.00 15.05 ? 733  HOH H O   1 
HETATM 5136 O O   . HOH E 4 .   ? 102.262 16.445 60.561  1.00 15.79 ? 735  HOH H O   1 
HETATM 5137 O O   . HOH E 4 .   ? 147.177 36.886 85.968  1.00 14.56 ? 737  HOH H O   1 
HETATM 5138 O O   . HOH E 4 .   ? 91.238  26.484 57.639  1.00 14.12 ? 738  HOH H O   1 
HETATM 5139 O O   . HOH E 4 .   ? 146.410 26.871 86.334  1.00 17.41 ? 739  HOH H O   1 
HETATM 5140 O O   . HOH E 4 .   ? 97.708  29.566 62.363  1.00 19.21 ? 740  HOH H O   1 
HETATM 5141 O O   . HOH E 4 .   ? 143.569 29.716 86.687  1.00 13.50 ? 741  HOH H O   1 
HETATM 5142 O O   . HOH E 4 .   ? 108.321 22.824 59.374  1.00 14.04 ? 746  HOH H O   1 
HETATM 5143 O O   . HOH E 4 .   ? 93.602  30.750 74.295  1.00 20.64 ? 751  HOH H O   1 
HETATM 5144 O O   . HOH E 4 .   ? 100.750 15.856 76.929  1.00 18.27 ? 752  HOH H O   1 
HETATM 5145 O O   . HOH E 4 .   ? 113.797 36.872 74.382  1.00 17.17 ? 753  HOH H O   1 
HETATM 5146 O O   . HOH E 4 .   ? 99.122  14.873 72.811  1.00 22.18 ? 759  HOH H O   1 
HETATM 5147 O O   . HOH E 4 .   ? 115.789 32.101 64.060  1.00 12.15 ? 760  HOH H O   1 
HETATM 5148 O O   . HOH E 4 .   ? 117.888 21.596 94.602  1.00 17.72 ? 768  HOH H O   1 
HETATM 5149 O O   . HOH E 4 .   ? 120.004 22.946 87.855  1.00 20.66 ? 770  HOH H O   1 
HETATM 5150 O O   . HOH E 4 .   ? 108.221 15.111 85.211  1.00 25.66 ? 772  HOH H O   1 
HETATM 5151 O O   . HOH E 4 .   ? 108.471 42.271 62.287  1.00 22.55 ? 774  HOH H O   1 
HETATM 5152 O O   . HOH E 4 .   ? 155.084 42.449 90.757  1.00 19.66 ? 776  HOH H O   1 
HETATM 5153 O O   . HOH E 4 .   ? 115.767 18.191 84.067  1.00 25.87 ? 779  HOH H O   1 
HETATM 5154 O O   . HOH E 4 .   ? 111.714 35.226 83.367  1.00 26.39 ? 784  HOH H O   1 
HETATM 5155 O O   . HOH E 4 .   ? 118.319 22.183 91.831  1.00 25.18 ? 785  HOH H O   1 
HETATM 5156 O O   . HOH E 4 .   ? 97.371  17.664 71.297  1.00 22.58 ? 787  HOH H O   1 
HETATM 5157 O O   . HOH E 4 .   ? 99.821  18.329 77.796  1.00 20.02 ? 792  HOH H O   1 
HETATM 5158 O O   . HOH E 4 .   ? 102.882 13.355 71.064  1.00 17.99 ? 794  HOH H O   1 
HETATM 5159 O O   . HOH E 4 .   ? 113.487 35.196 78.958  1.00 27.34 ? 798  HOH H O   1 
HETATM 5160 O O   . HOH E 4 .   ? 97.767  28.057 79.417  1.00 18.82 ? 799  HOH H O   1 
HETATM 5161 O O   . HOH E 4 .   ? 137.538 38.853 88.071  1.00 18.78 ? 804  HOH H O   1 
HETATM 5162 O O   . HOH E 4 .   ? 146.263 37.804 99.392  1.00 20.85 ? 805  HOH H O   1 
HETATM 5163 O O   . HOH E 4 .   ? 113.434 36.676 67.391  1.00 19.60 ? 807  HOH H O   1 
HETATM 5164 O O   . HOH E 4 .   ? 154.866 37.796 95.860  1.00 15.47 ? 811  HOH H O   1 
HETATM 5165 O O   . HOH E 4 .   ? 131.393 22.753 90.202  1.00 23.71 ? 814  HOH H O   1 
HETATM 5166 O O   . HOH E 4 .   ? 98.754  14.146 83.983  1.00 26.42 ? 815  HOH H O   1 
HETATM 5167 O O   . HOH E 4 .   ? 147.913 39.092 91.338  1.00 17.73 ? 816  HOH H O   1 
HETATM 5168 O O   . HOH E 4 .   ? 97.631  27.556 58.256  1.00 15.66 ? 819  HOH H O   1 
HETATM 5169 O O   . HOH E 4 .   ? 98.049  17.087 68.750  1.00 18.56 ? 823  HOH H O   1 
HETATM 5170 O O   . HOH E 4 .   ? 113.186 36.611 70.028  1.00 18.72 ? 824  HOH H O   1 
HETATM 5171 O O   . HOH E 4 .   ? 148.731 38.559 100.186 1.00 25.79 ? 831  HOH H O   1 
HETATM 5172 O O   . HOH E 4 .   ? 157.211 40.790 94.382  1.00 23.38 ? 834  HOH H O   1 
HETATM 5173 O O   . HOH E 4 .   ? 116.158 28.455 87.469  1.00 19.60 ? 835  HOH H O   1 
HETATM 5174 O O   . HOH E 4 .   ? 115.765 32.971 66.641  1.00 16.31 ? 840  HOH H O   1 
HETATM 5175 O O   . HOH E 4 .   ? 143.888 31.144 102.406 1.00 20.99 ? 841  HOH H O   1 
HETATM 5176 O O   . HOH E 4 .   ? 129.885 28.884 86.977  1.00 31.24 ? 843  HOH H O   1 
HETATM 5177 O O   . HOH E 4 .   ? 118.619 24.915 86.811  1.00 28.82 ? 846  HOH H O   1 
HETATM 5178 O O   . HOH E 4 .   ? 121.238 33.830 93.030  1.00 26.12 ? 849  HOH H O   1 
HETATM 5179 O O   . HOH E 4 .   ? 97.976  27.776 55.671  1.00 20.52 ? 851  HOH H O   1 
HETATM 5180 O O   . HOH E 4 .   ? 109.808 28.918 57.354  1.00 25.56 ? 852  HOH H O   1 
HETATM 5181 O O   . HOH E 4 .   ? 95.222  19.968 72.147  1.00 15.65 ? 855  HOH H O   1 
HETATM 5182 O O   . HOH E 4 .   ? 114.718 40.102 66.392  1.00 25.49 ? 856  HOH H O   1 
HETATM 5183 O O   . HOH E 4 .   ? 93.193  28.397 73.265  1.00 35.98 ? 862  HOH H O   1 
HETATM 5184 O O   . HOH E 4 .   ? 100.762 30.810 82.190  1.00 22.04 ? 863  HOH H O   1 
HETATM 5185 O O   . HOH E 4 .   ? 110.470 15.332 91.907  1.00 31.22 ? 865  HOH H O   1 
HETATM 5186 O O   . HOH E 4 .   ? 149.956 28.607 101.240 1.00 34.30 ? 872  HOH H O   1 
HETATM 5187 O O   . HOH E 4 .   ? 131.025 33.771 87.834  1.00 32.84 ? 876  HOH H O   1 
HETATM 5188 O O   . HOH E 4 .   ? 102.107 28.312 88.246  1.00 22.28 ? 877  HOH H O   1 
HETATM 5189 O O   . HOH E 4 .   ? 115.923 35.653 60.343  1.00 27.12 ? 879  HOH H O   1 
HETATM 5190 O O   . HOH E 4 .   ? 149.090 21.979 97.728  1.00 24.81 ? 882  HOH H O   1 
HETATM 5191 O O   . HOH E 4 .   ? 134.574 34.366 87.126  1.00 23.17 ? 885  HOH H O   1 
HETATM 5192 O O   . HOH E 4 .   ? 118.987 26.910 90.511  1.00 26.09 ? 888  HOH H O   1 
HETATM 5193 O O   . HOH E 4 .   ? 94.033  26.351 74.620  1.00 25.04 ? 889  HOH H O   1 
HETATM 5194 O O   . HOH E 4 .   ? 92.637  22.435 70.608  1.00 15.54 ? 891  HOH H O   1 
HETATM 5195 O O   . HOH E 4 .   ? 144.681 42.727 90.333  1.00 34.49 ? 897  HOH H O   1 
HETATM 5196 O O   . HOH E 4 .   ? 99.293  43.488 71.226  1.00 35.71 ? 898  HOH H O   1 
HETATM 5197 O O   . HOH E 4 .   ? 102.094 32.000 58.471  1.00 24.64 ? 899  HOH H O   1 
HETATM 5198 O O   . HOH E 4 .   ? 99.003  30.794 60.358  1.00 25.77 ? 901  HOH H O   1 
HETATM 5199 O O   . HOH E 4 .   ? 131.226 38.725 92.354  1.00 26.12 ? 905  HOH H O   1 
HETATM 5200 O O   . HOH E 4 .   ? 99.071  39.241 68.731  1.00 29.26 ? 906  HOH H O   1 
HETATM 5201 O O   . HOH E 4 .   ? 116.291 32.644 83.102  1.00 23.80 ? 907  HOH H O   1 
HETATM 5202 O O   . HOH E 4 .   ? 94.386  13.625 78.685  1.00 25.02 ? 913  HOH H O   1 
HETATM 5203 O O   . HOH E 4 .   ? 114.805 32.252 85.761  1.00 24.01 ? 917  HOH H O   1 
HETATM 5204 O O   . HOH E 4 .   ? 149.034 26.566 93.588  1.00 26.99 ? 920  HOH H O   1 
HETATM 5205 O O   . HOH E 4 .   ? 142.658 41.725 96.567  1.00 37.94 ? 921  HOH H O   1 
HETATM 5206 O O   . HOH E 4 .   ? 127.023 27.299 86.949  1.00 26.14 ? 924  HOH H O   1 
HETATM 5207 O O   . HOH E 4 .   ? 147.197 35.447 81.936  1.00 25.75 ? 927  HOH H O   1 
HETATM 5208 O O   . HOH E 4 .   ? 147.809 40.760 93.772  1.00 24.19 ? 929  HOH H O   1 
HETATM 5209 O O   . HOH E 4 .   ? 145.954 43.745 94.924  1.00 42.37 ? 930  HOH H O   1 
HETATM 5210 O O   . HOH E 4 .   ? 104.655 29.318 88.339  1.00 25.60 ? 932  HOH H O   1 
HETATM 5211 O O   . HOH E 4 .   ? 140.261 41.760 100.246 1.00 31.37 ? 935  HOH H O   1 
HETATM 5212 O O   . HOH E 4 .   ? 118.112 29.699 89.134  1.00 37.80 ? 936  HOH H O   1 
HETATM 5213 O O   . HOH E 4 .   ? 108.841 24.616 55.115  1.00 28.11 ? 937  HOH H O   1 
HETATM 5214 O O   . HOH E 4 .   ? 92.949  35.791 72.391  1.00 25.87 ? 938  HOH H O   1 
HETATM 5215 O O   . HOH E 4 .   ? 119.162 31.822 74.764  1.00 32.88 ? 942  HOH H O   1 
HETATM 5216 O O   . HOH E 4 .   ? 137.524 29.088 81.556  1.00 37.77 ? 945  HOH H O   1 
HETATM 5217 O O   . HOH E 4 .   ? 137.563 36.222 83.643  1.00 28.25 ? 948  HOH H O   1 
HETATM 5218 O O   . HOH E 4 .   ? 92.851  33.005 68.065  1.00 29.92 ? 950  HOH H O   1 
HETATM 5219 O O   . HOH E 4 .   ? 149.304 42.865 92.916  1.00 27.95 ? 953  HOH H O   1 
HETATM 5220 O O   . HOH E 4 .   ? 116.395 20.299 90.727  1.00 28.83 ? 956  HOH H O   1 
HETATM 5221 O O   . HOH E 4 .   ? 111.567 30.923 84.936  1.00 24.95 ? 957  HOH H O   1 
HETATM 5222 O O   . HOH E 4 .   ? 135.604 30.965 83.197  1.00 39.17 ? 958  HOH H O   1 
HETATM 5223 O O   . HOH E 4 .   ? 106.785 37.919 78.778  1.00 22.54 ? 960  HOH H O   1 
HETATM 5224 O O   . HOH E 4 .   ? 117.040 24.878 84.330  1.00 26.72 ? 961  HOH H O   1 
HETATM 5225 O O   . HOH E 4 .   ? 90.285  22.830 68.868  1.00 28.29 ? 962  HOH H O   1 
HETATM 5226 O O   . HOH E 4 .   ? 102.068 41.825 68.294  1.00 34.67 ? 964  HOH H O   1 
HETATM 5227 O O   . HOH E 4 .   ? 132.872 37.430 86.570  1.00 45.20 ? 967  HOH H O   1 
HETATM 5228 O O   . HOH E 4 .   ? 133.151 42.054 92.139  1.00 32.70 ? 968  HOH H O   1 
HETATM 5229 O O   . HOH E 4 .   ? 117.421 31.812 72.109  1.00 22.77 ? 969  HOH H O   1 
HETATM 5230 O O   . HOH E 4 .   ? 106.454 29.009 90.632  1.00 26.88 ? 971  HOH H O   1 
HETATM 5231 O O   . HOH E 4 .   ? 94.689  31.266 79.912  1.00 39.35 ? 972  HOH H O   1 
HETATM 5232 O O   . HOH E 4 .   ? 115.934 35.823 66.745  1.00 20.13 ? 977  HOH H O   1 
HETATM 5233 O O   . HOH E 4 .   ? 96.396  16.019 73.363  1.00 24.18 ? 979  HOH H O   1 
HETATM 5234 O O   . HOH E 4 .   ? 140.748 42.816 83.721  1.00 25.65 ? 981  HOH H O   1 
HETATM 5235 O O   . HOH E 4 .   ? 108.335 30.450 56.601  1.00 34.39 ? 985  HOH H O   1 
HETATM 5236 O O   . HOH E 4 .   ? 98.409  16.500 85.536  1.00 24.27 ? 986  HOH H O   1 
HETATM 5237 O O   . HOH E 4 .   ? 150.715 27.289 91.764  1.00 23.12 ? 987  HOH H O   1 
HETATM 5238 O O   . HOH E 4 .   ? 109.761 14.489 78.788  1.00 24.16 ? 988  HOH H O   1 
HETATM 5239 O O   . HOH E 4 .   ? 98.272  26.117 89.851  1.00 30.95 ? 989  HOH H O   1 
HETATM 5240 O O   . HOH E 4 .   ? 138.967 37.258 103.609 1.00 24.33 ? 991  HOH H O   1 
HETATM 5241 O O   . HOH E 4 .   ? 111.896 36.552 58.287  1.00 31.45 ? 992  HOH H O   1 
HETATM 5242 O O   . HOH E 4 .   ? 143.537 28.330 102.223 1.00 23.38 ? 993  HOH H O   1 
HETATM 5243 O O   . HOH E 4 .   ? 128.008 33.778 101.297 1.00 26.11 ? 998  HOH H O   1 
HETATM 5244 O O   . HOH E 4 .   ? 92.450  32.866 72.761  1.00 32.35 ? 999  HOH H O   1 
HETATM 5245 O O   . HOH E 4 .   ? 117.149 17.527 86.592  1.00 36.05 ? 1005 HOH H O   1 
HETATM 5246 O O   . HOH E 4 .   ? 105.198 38.874 81.454  1.00 35.39 ? 1009 HOH H O   1 
HETATM 5247 O O   . HOH E 4 .   ? 102.103 33.253 82.920  1.00 19.24 ? 1014 HOH H O   1 
HETATM 5248 O O   . HOH E 4 .   ? 89.364  31.134 67.447  1.00 31.14 ? 1020 HOH H O   1 
HETATM 5249 O O   . HOH E 4 .   ? 156.518 36.821 88.605  1.00 32.86 ? 1021 HOH H O   1 
HETATM 5250 O O   . HOH E 4 .   ? 116.011 30.987 89.541  1.00 46.60 ? 1023 HOH H O   1 
HETATM 5251 O O   . HOH E 4 .   ? 141.415 34.473 104.392 1.00 28.75 ? 1024 HOH H O   1 
HETATM 5252 O O   . HOH E 4 .   ? 109.931 14.455 72.343  1.00 23.85 ? 1025 HOH H O   1 
HETATM 5253 O O   . HOH E 4 .   ? 106.257 22.123 51.851  1.00 44.53 ? 1029 HOH H O   1 
HETATM 5254 O O   . HOH E 4 .   ? 132.005 19.509 95.588  1.00 35.23 ? 1031 HOH H O   1 
HETATM 5255 O O   . HOH E 4 .   ? 127.496 21.341 98.935  1.00 42.33 ? 1032 HOH H O   1 
HETATM 5256 O O   . HOH E 4 .   ? 119.469 24.475 80.192  1.00 37.90 ? 1033 HOH H O   1 
HETATM 5257 O O   . HOH E 4 .   ? 119.567 20.301 87.383  1.00 29.95 ? 1037 HOH H O   1 
HETATM 5258 O O   . HOH E 4 .   ? 116.072 15.641 82.603  1.00 45.79 ? 1038 HOH H O   1 
HETATM 5259 O O   . HOH E 4 .   ? 133.961 23.052 90.638  1.00 23.91 ? 1040 HOH H O   1 
HETATM 5260 O O   . HOH E 4 .   ? 96.569  31.258 59.630  1.00 38.73 ? 1041 HOH H O   1 
HETATM 5261 O O   . HOH E 4 .   ? 106.092 13.815 85.902  1.00 32.59 ? 1044 HOH H O   1 
HETATM 5262 O O   . HOH E 4 .   ? 108.403 26.077 52.449  1.00 40.42 ? 1045 HOH H O   1 
HETATM 5263 O O   . HOH E 4 .   ? 104.101 43.284 72.351  1.00 40.48 ? 1048 HOH H O   1 
HETATM 5264 O O   . HOH E 4 .   ? 99.559  15.276 68.662  1.00 29.85 ? 1049 HOH H O   1 
HETATM 5265 O O   . HOH E 4 .   ? 98.123  23.273 87.517  1.00 32.23 ? 1055 HOH H O   1 
HETATM 5266 O O   . HOH E 4 .   ? 102.008 15.769 69.455  1.00 29.54 ? 1056 HOH H O   1 
HETATM 5267 O O   . HOH E 4 .   ? 96.767  29.078 81.987  1.00 33.66 ? 1065 HOH H O   1 
HETATM 5268 O O   . HOH E 4 .   ? 113.749 16.130 80.928  1.00 48.17 ? 1066 HOH H O   1 
HETATM 5269 O O   . HOH E 4 .   ? 104.257 32.325 56.543  1.00 33.73 ? 1081 HOH H O   1 
HETATM 5270 O O   . HOH E 4 .   ? 134.181 43.044 94.588  1.00 31.09 ? 1084 HOH H O   1 
HETATM 5271 O O   . HOH E 4 .   ? 109.174 42.585 72.267  1.00 37.78 ? 1090 HOH H O   1 
HETATM 5272 O O   . HOH E 4 .   ? 132.681 28.035 83.084  1.00 46.36 ? 1097 HOH H O   1 
HETATM 5273 O O   . HOH E 4 .   ? 108.797 15.238 81.988  1.00 35.61 ? 1098 HOH H O   1 
HETATM 5274 O O   . HOH E 4 .   ? 98.454  23.342 83.113  1.00 27.98 ? 1099 HOH H O   1 
HETATM 5275 O O   . HOH E 4 .   ? 109.100 40.320 73.478  1.00 30.59 ? 1100 HOH H O   1 
HETATM 5276 O O   . HOH E 4 .   ? 97.414  38.846 80.824  1.00 43.29 ? 1101 HOH H O   1 
HETATM 5277 O O   . HOH E 4 .   ? 126.488 30.318 88.668  1.00 30.69 ? 1106 HOH H O   1 
HETATM 5278 O O   . HOH E 4 .   ? 150.338 28.078 88.188  1.00 28.40 ? 1107 HOH H O   1 
HETATM 5279 O O   . HOH E 4 .   ? 117.501 38.375 60.286  1.00 32.65 ? 1108 HOH H O   1 
HETATM 5280 O O   . HOH E 4 .   ? 136.260 36.966 86.085  1.00 47.97 ? 1122 HOH H O   1 
HETATM 5281 O O   . HOH E 4 .   ? 105.186 26.789 95.866  1.00 41.05 ? 1125 HOH H O   1 
HETATM 5282 O O   . HOH E 4 .   ? 111.279 46.480 68.730  1.00 41.03 ? 1127 HOH H O   1 
HETATM 5283 O O   . HOH E 4 .   ? 95.861  40.733 63.475  1.00 40.04 ? 1129 HOH H O   1 
HETATM 5284 O O   . HOH E 4 .   ? 133.147 39.799 102.901 1.00 30.91 ? 1131 HOH H O   1 
HETATM 5285 O O   . HOH E 4 .   ? 104.640 30.001 55.261  1.00 25.01 ? 1133 HOH H O   1 
HETATM 5286 O O   . HOH E 4 .   ? 92.365  38.886 72.417  1.00 36.58 ? 1134 HOH H O   1 
HETATM 5287 O O   . HOH E 4 .   ? 92.306  32.177 70.509  1.00 35.66 ? 1144 HOH H O   1 
HETATM 5288 O O   . HOH E 4 .   ? 122.754 23.300 86.607  1.00 39.73 ? 1145 HOH H O   1 
HETATM 5289 O O   . HOH E 4 .   ? 154.800 28.651 86.264  1.00 38.67 ? 1147 HOH H O   1 
HETATM 5290 O O   . HOH E 4 .   ? 119.621 29.749 76.063  1.00 43.17 ? 1153 HOH H O   1 
HETATM 5291 O O   . HOH E 4 .   ? 104.162 15.164 87.667  1.00 35.27 ? 1161 HOH H O   1 
HETATM 5292 O O   . HOH E 4 .   ? 109.361 32.118 58.376  1.00 45.95 ? 1163 HOH H O   1 
HETATM 5293 O O   . HOH E 4 .   ? 128.756 42.134 93.644  1.00 56.92 ? 1164 HOH H O   1 
HETATM 5294 O O   . HOH E 4 .   ? 148.957 22.527 103.544 1.00 51.50 ? 1165 HOH H O   1 
HETATM 5295 O O   . HOH E 4 .   ? 105.802 24.105 64.680  1.00 12.49 ? 1172 HOH H O   1 
HETATM 5296 O O   . HOH E 4 .   ? 109.386 44.107 67.512  1.00 27.47 ? 1175 HOH H O   1 
HETATM 5297 O O   . HOH E 4 .   ? 106.343 26.469 93.517  1.00 21.63 ? 1176 HOH H O   1 
HETATM 5298 O O   . HOH E 4 .   ? 106.833 38.086 60.125  1.00 26.73 ? 1177 HOH H O   1 
HETATM 5299 O O   . HOH E 4 .   ? 104.491 26.982 91.358  1.00 32.62 ? 1178 HOH H O   1 
HETATM 5300 O O   . HOH E 4 .   ? 118.606 15.666 75.115  1.00 38.06 ? 1181 HOH H O   1 
HETATM 5301 O O   . HOH E 4 .   ? 117.586 23.456 101.413 1.00 34.24 ? 1186 HOH H O   1 
HETATM 5302 O O   . HOH E 4 .   ? 125.167 19.599 98.138  1.00 51.15 ? 1193 HOH H O   1 
HETATM 5303 O O   . HOH E 4 .   ? 101.296 38.976 61.670  1.00 34.17 ? 1195 HOH H O   1 
HETATM 5304 O O   . HOH E 4 .   ? 148.156 44.310 98.139  1.00 34.48 ? 1196 HOH H O   1 
HETATM 5305 O O   . HOH E 4 .   ? 147.915 33.972 83.903  1.00 35.21 ? 1198 HOH H O   1 
HETATM 5306 O O   . HOH E 4 .   ? 103.855 24.615 49.215  1.00 38.61 ? 1199 HOH H O   1 
HETATM 5307 O O   . HOH E 4 .   ? 116.077 35.319 70.940  1.00 38.60 ? 1200 HOH H O   1 
HETATM 5308 O O   . HOH E 4 .   ? 105.728 14.228 81.547  1.00 29.13 ? 1201 HOH H O   1 
HETATM 5309 O O   . HOH E 4 .   ? 118.186 34.295 71.391  1.00 42.25 ? 1207 HOH H O   1 
HETATM 5310 O O   . HOH E 4 .   ? 129.229 31.846 87.854  1.00 36.83 ? 1208 HOH H O   1 
HETATM 5311 O O   . HOH E 4 .   ? 116.824 36.618 64.244  1.00 38.85 ? 1209 HOH H O   1 
HETATM 5312 O O   . HOH E 4 .   ? 117.050 37.194 68.801  1.00 38.85 ? 1211 HOH H O   1 
HETATM 5313 O O   . HOH E 4 .   ? 104.729 12.683 83.767  1.00 32.89 ? 1215 HOH H O   1 
HETATM 5314 O O   . HOH E 4 .   ? 103.921 44.056 67.781  1.00 36.83 ? 1217 HOH H O   1 
HETATM 5315 O O   . HOH E 4 .   ? 114.020 38.826 71.379  1.00 31.80 ? 1218 HOH H O   1 
HETATM 5316 O O   . HOH E 4 .   ? 115.503 39.820 69.061  1.00 39.58 ? 1230 HOH H O   1 
HETATM 5317 O O   . HOH E 4 .   ? 154.503 32.902 94.939  1.00 31.18 ? 1233 HOH H O   1 
HETATM 5318 O O   . HOH E 4 .   ? 100.817 25.129 92.150  1.00 34.07 ? 1236 HOH H O   1 
HETATM 5319 O O   . HOH E 4 .   ? 99.244  29.238 52.847  1.00 36.65 ? 1237 HOH H O   1 
HETATM 5320 O O   . HOH E 4 .   ? 127.484 30.016 86.523  1.00 49.34 ? 1238 HOH H O   1 
HETATM 5321 O O   . HOH E 4 .   ? 119.930 27.324 86.310  1.00 39.01 ? 1241 HOH H O   1 
HETATM 5322 O O   . HOH E 4 .   ? 127.600 35.507 98.803  1.00 38.64 ? 1245 HOH H O   1 
HETATM 5323 O O   . HOH E 4 .   ? 91.666  31.130 76.517  1.00 36.37 ? 1251 HOH H O   1 
HETATM 5324 O O   . HOH E 4 .   ? 113.175 34.109 86.238  1.00 37.81 ? 1252 HOH H O   1 
HETATM 5325 O O   . HOH E 4 .   ? 139.129 44.919 84.385  1.00 43.28 ? 1253 HOH H O   1 
HETATM 5326 O O   . HOH E 4 .   ? 100.209 21.410 89.787  1.00 40.38 ? 1255 HOH H O   1 
HETATM 5327 O O   . HOH E 4 .   ? 151.744 20.937 100.845 1.00 49.52 ? 1258 HOH H O   1 
HETATM 5328 O O   . HOH E 4 .   ? 108.700 44.912 62.917  1.00 41.84 ? 1278 HOH H O   1 
HETATM 5329 O O   . HOH E 4 .   ? 93.688  43.901 75.640  1.00 50.24 ? 1283 HOH H O   1 
HETATM 5330 O O   . HOH E 4 .   ? 114.376 18.770 92.776  1.00 44.81 ? 1285 HOH H O   1 
HETATM 5331 O O   . HOH E 4 .   ? 106.477 15.736 94.328  1.00 51.16 ? 1286 HOH H O   1 
HETATM 5332 O O   . HOH E 4 .   ? 107.004 20.203 97.282  1.00 44.06 ? 1290 HOH H O   1 
HETATM 5333 O O   . HOH E 4 .   ? 118.746 33.196 91.216  1.00 33.73 ? 1295 HOH H O   1 
HETATM 5334 O O   . HOH E 4 .   ? 116.015 37.946 73.175  1.00 41.17 ? 1297 HOH H O   1 
HETATM 5335 O O   . HOH E 4 .   ? 101.317 36.815 57.595  1.00 43.77 ? 1299 HOH H O   1 
HETATM 5336 O O   . HOH E 4 .   ? 106.145 34.077 57.540  1.00 43.44 ? 1301 HOH H O   1 
HETATM 5337 O O   . HOH E 4 .   ? 87.254  22.199 68.639  1.00 46.89 ? 1312 HOH H O   1 
HETATM 5338 O O   . HOH E 4 .   ? 111.285 15.903 94.339  1.00 43.03 ? 1313 HOH H O   1 
HETATM 5339 O O   . HOH E 4 .   ? 108.731 39.930 78.866  1.00 39.67 ? 1315 HOH H O   1 
HETATM 5340 O O   . HOH E 4 .   ? 127.049 39.231 102.625 1.00 43.66 ? 1316 HOH H O   1 
HETATM 5341 O O   . HOH E 4 .   ? 103.386 39.362 59.664  1.00 43.11 ? 1320 HOH H O   1 
HETATM 5342 O O   . HOH E 4 .   ? 109.557 11.072 75.036  1.00 44.92 ? 1323 HOH H O   1 
HETATM 5343 O O   . HOH E 4 .   ? 141.532 40.065 100.829 1.00 58.19 ? 1327 HOH H O   1 
HETATM 5344 O O   . HOH E 4 .   ? 108.715 22.544 98.741  1.00 40.34 ? 1329 HOH H O   1 
HETATM 5345 O O   . HOH E 4 .   ? 155.932 35.116 86.340  1.00 48.66 ? 1333 HOH H O   1 
HETATM 5346 O O   . HOH E 4 .   ? 141.346 32.181 81.597  1.00 36.59 ? 1334 HOH H O   1 
HETATM 5347 O O   . HOH E 4 .   ? 105.592 40.132 60.774  1.00 36.21 ? 1335 HOH H O   1 
HETATM 5348 O O   . HOH E 4 .   ? 111.626 38.068 81.091  1.00 39.08 ? 1336 HOH H O   1 
HETATM 5349 O O   . HOH E 4 .   ? 115.252 15.579 72.570  1.00 49.23 ? 1337 HOH H O   1 
HETATM 5350 O O   . HOH E 4 .   ? 132.972 42.261 96.998  1.00 49.60 ? 1341 HOH H O   1 
HETATM 5351 O O   . HOH E 4 .   ? 110.489 40.159 80.634  1.00 44.68 ? 1345 HOH H O   1 
HETATM 5352 O O   . HOH E 4 .   ? 140.186 34.215 79.684  1.00 45.73 ? 1346 HOH H O   1 
HETATM 5353 O O   . HOH E 4 .   ? 154.319 23.542 98.757  1.00 43.60 ? 1348 HOH H O   1 
HETATM 5354 O O   . HOH E 4 .   ? 115.140 32.540 95.712  1.00 44.71 ? 1352 HOH H O   1 
HETATM 5355 O O   . HOH E 4 .   ? 116.995 18.898 93.237  1.00 49.18 ? 1356 HOH H O   1 
HETATM 5356 O O   . HOH F 4 .   ? 77.905  26.791 55.969  1.00 13.99 ? 722  HOH A O   1 
HETATM 5357 O O   . HOH F 4 .   ? 87.224  22.421 57.127  1.00 15.88 ? 723  HOH A O   1 
HETATM 5358 O O   . HOH F 4 .   ? 97.973  18.589 64.399  1.00 10.98 ? 726  HOH A O   1 
HETATM 5359 O O   . HOH F 4 .   ? 82.616  17.604 67.032  1.00 22.18 ? 734  HOH A O   1 
HETATM 5360 O O   . HOH F 4 .   ? 75.141  17.847 59.101  1.00 12.43 ? 736  HOH A O   1 
HETATM 5361 O O   . HOH F 4 .   ? 84.325  2.126  49.911  1.00 18.90 ? 749  HOH A O   1 
HETATM 5362 O O   . HOH F 4 .   ? 84.187  21.595 61.302  1.00 19.25 ? 756  HOH A O   1 
HETATM 5363 O O   . HOH F 4 .   ? 67.747  18.948 65.376  1.00 22.02 ? 757  HOH A O   1 
HETATM 5364 O O   . HOH F 4 .   ? 93.659  28.580 49.985  1.00 16.30 ? 762  HOH A O   1 
HETATM 5365 O O   . HOH F 4 .   ? 84.851  21.196 57.932  1.00 19.04 ? 764  HOH A O   1 
HETATM 5366 O O   . HOH F 4 .   ? 93.218  14.753 42.579  1.00 17.12 ? 769  HOH A O   1 
HETATM 5367 O O   . HOH F 4 .   ? 68.533  21.499 46.985  1.00 19.07 ? 775  HOH A O   1 
HETATM 5368 O O   . HOH F 4 .   ? 82.469  25.763 61.126  1.00 21.85 ? 780  HOH A O   1 
HETATM 5369 O O   . HOH F 4 .   ? 94.005  16.187 44.689  1.00 18.77 ? 782  HOH A O   1 
HETATM 5370 O O   . HOH F 4 .   ? 79.761  28.097 50.359  1.00 18.65 ? 783  HOH A O   1 
HETATM 5371 O O   . HOH F 4 .   ? 71.544  21.508 64.687  1.00 20.74 ? 788  HOH A O   1 
HETATM 5372 O O   . HOH F 4 .   ? 67.693  25.374 59.037  1.00 21.84 ? 790  HOH A O   1 
HETATM 5373 O O   . HOH F 4 .   ? 95.631  16.798 59.446  1.00 19.93 ? 796  HOH A O   1 
HETATM 5374 O O   . HOH F 4 .   ? 99.011  8.273  47.843  1.00 15.97 ? 800  HOH A O   1 
HETATM 5375 O O   . HOH F 4 .   ? 91.356  24.544 59.437  1.00 19.37 ? 813  HOH A O   1 
HETATM 5376 O O   . HOH F 4 .   ? 88.770  2.288  41.333  1.00 26.89 ? 817  HOH A O   1 
HETATM 5377 O O   . HOH F 4 .   ? 86.830  0.493  48.384  1.00 29.43 ? 821  HOH A O   1 
HETATM 5378 O O   . HOH F 4 .   ? 92.878  15.931 61.719  1.00 19.61 ? 822  HOH A O   1 
HETATM 5379 O O   . HOH F 4 .   ? 95.639  4.941  41.009  1.00 26.11 ? 825  HOH A O   1 
HETATM 5380 O O   . HOH F 4 .   ? 94.888  28.079 47.675  1.00 27.10 ? 826  HOH A O   1 
HETATM 5381 O O   . HOH F 4 .   ? 90.452  9.184  38.511  1.00 18.37 ? 827  HOH A O   1 
HETATM 5382 O O   . HOH F 4 .   ? 68.878  21.053 63.950  1.00 23.09 ? 829  HOH A O   1 
HETATM 5383 O O   . HOH F 4 .   ? 83.221  23.386 63.062  1.00 20.00 ? 832  HOH A O   1 
HETATM 5384 O O   . HOH F 4 .   ? 79.880  17.675 68.928  1.00 23.26 ? 836  HOH A O   1 
HETATM 5385 O O   . HOH F 4 .   ? 75.517  -0.360 52.221  1.00 21.56 ? 839  HOH A O   1 
HETATM 5386 O O   . HOH F 4 .   ? 83.134  20.436 55.802  1.00 22.82 ? 842  HOH A O   1 
HETATM 5387 O O   . HOH F 4 .   ? 102.888 12.923 52.413  1.00 37.86 ? 845  HOH A O   1 
HETATM 5388 O O   . HOH F 4 .   ? 83.580  27.870 61.892  1.00 30.07 ? 858  HOH A O   1 
HETATM 5389 O O   . HOH F 4 .   ? 88.283  29.925 54.841  1.00 35.98 ? 860  HOH A O   1 
HETATM 5390 O O   . HOH F 4 .   ? 63.030  14.761 64.016  1.00 31.04 ? 864  HOH A O   1 
HETATM 5391 O O   . HOH F 4 .   ? 78.492  0.804  44.578  1.00 27.86 ? 868  HOH A O   1 
HETATM 5392 O O   . HOH F 4 .   ? 75.336  9.703  60.518  1.00 25.97 ? 871  HOH A O   1 
HETATM 5393 O O   . HOH F 4 .   ? 68.449  14.989 59.110  1.00 18.45 ? 874  HOH A O   1 
HETATM 5394 O O   . HOH F 4 .   ? 75.627  26.771 57.170  1.00 25.51 ? 880  HOH A O   1 
HETATM 5395 O O   . HOH F 4 .   ? 83.737  -1.165 49.889  1.00 30.86 ? 883  HOH A O   1 
HETATM 5396 O O   . HOH F 4 .   ? 68.542  18.672 47.406  1.00 23.75 ? 890  HOH A O   1 
HETATM 5397 O O   . HOH F 4 .   ? 72.157  26.407 59.126  1.00 27.32 ? 893  HOH A O   1 
HETATM 5398 O O   . HOH F 4 .   ? 66.279  22.844 54.613  1.00 26.34 ? 909  HOH A O   1 
HETATM 5399 O O   . HOH F 4 .   ? 66.667  24.979 53.097  1.00 30.88 ? 910  HOH A O   1 
HETATM 5400 O O   . HOH F 4 .   ? 74.696  15.554 59.909  1.00 19.66 ? 914  HOH A O   1 
HETATM 5401 O O   . HOH F 4 .   ? 87.435  -0.470 45.990  1.00 21.21 ? 916  HOH A O   1 
HETATM 5402 O O   . HOH F 4 .   ? 81.602  25.922 39.675  1.00 44.53 ? 918  HOH A O   1 
HETATM 5403 O O   . HOH F 4 .   ? 99.611  24.309 47.905  1.00 43.77 ? 919  HOH A O   1 
HETATM 5404 O O   . HOH F 4 .   ? 82.302  30.260 53.044  1.00 34.55 ? 925  HOH A O   1 
HETATM 5405 O O   . HOH F 4 .   ? 84.855  12.958 28.703  1.00 28.38 ? 933  HOH A O   1 
HETATM 5406 O O   . HOH F 4 .   ? 65.172  23.223 50.014  1.00 36.61 ? 934  HOH A O   1 
HETATM 5407 O O   . HOH F 4 .   ? 95.929  28.567 51.629  1.00 33.29 ? 939  HOH A O   1 
HETATM 5408 O O   . HOH F 4 .   ? 81.192  30.441 50.419  1.00 51.17 ? 944  HOH A O   1 
HETATM 5409 O O   . HOH F 4 .   ? 98.471  11.276 39.721  1.00 37.39 ? 946  HOH A O   1 
HETATM 5410 O O   . HOH F 4 .   ? 80.502  -1.737 31.953  1.00 40.23 ? 951  HOH A O   1 
HETATM 5411 O O   . HOH F 4 .   ? 70.256  4.987  41.663  1.00 31.54 ? 959  HOH A O   1 
HETATM 5412 O O   . HOH F 4 .   ? 72.099  25.484 53.890  1.00 27.15 ? 963  HOH A O   1 
HETATM 5413 O O   . HOH F 4 .   ? 71.737  4.242  43.775  1.00 39.86 ? 965  HOH A O   1 
HETATM 5414 O O   . HOH F 4 .   ? 94.048  10.510 33.417  1.00 23.67 ? 974  HOH A O   1 
HETATM 5415 O O   . HOH F 4 .   ? 92.201  28.921 58.413  1.00 20.13 ? 975  HOH A O   1 
HETATM 5416 O O   . HOH F 4 .   ? 100.249 11.089 52.990  1.00 26.62 ? 976  HOH A O   1 
HETATM 5417 O O   . HOH F 4 .   ? 85.976  13.339 59.739  1.00 21.63 ? 980  HOH A O   1 
HETATM 5418 O O   . HOH F 4 .   ? 89.093  2.491  31.471  1.00 44.76 ? 983  HOH A O   1 
HETATM 5419 O O   . HOH F 4 .   ? 75.725  26.050 64.832  1.00 37.18 ? 990  HOH A O   1 
HETATM 5420 O O   . HOH F 4 .   ? 91.146  22.871 39.837  1.00 28.55 ? 995  HOH A O   1 
HETATM 5421 O O   . HOH F 4 .   ? 80.237  4.525  28.430  1.00 34.47 ? 997  HOH A O   1 
HETATM 5422 O O   . HOH F 4 .   ? 86.918  25.834 63.676  1.00 26.94 ? 1000 HOH A O   1 
HETATM 5423 O O   . HOH F 4 .   ? 99.751  26.509 49.036  1.00 33.33 ? 1001 HOH A O   1 
HETATM 5424 O O   . HOH F 4 .   ? 69.030  17.755 44.570  1.00 34.06 ? 1002 HOH A O   1 
HETATM 5425 O O   . HOH F 4 .   ? 89.855  11.909 34.491  1.00 34.12 ? 1003 HOH A O   1 
HETATM 5426 O O   . HOH F 4 .   ? 96.974  13.337 39.045  1.00 36.39 ? 1004 HOH A O   1 
HETATM 5427 O O   . HOH F 4 .   ? 87.898  3.906  27.540  1.00 30.20 ? 1007 HOH A O   1 
HETATM 5428 O O   . HOH F 4 .   ? 76.703  -1.299 42.885  1.00 36.24 ? 1008 HOH A O   1 
HETATM 5429 O O   . HOH F 4 .   ? 98.156  27.955 50.826  1.00 34.05 ? 1010 HOH A O   1 
HETATM 5430 O O   . HOH F 4 .   ? 67.123  22.877 64.492  1.00 36.44 ? 1011 HOH A O   1 
HETATM 5431 O O   . HOH F 4 .   ? 85.081  24.442 64.756  1.00 30.84 ? 1015 HOH A O   1 
HETATM 5432 O O   . HOH F 4 .   ? 95.014  28.872 58.532  1.00 33.33 ? 1017 HOH A O   1 
HETATM 5433 O O   . HOH F 4 .   ? 65.891  21.967 47.526  1.00 30.44 ? 1018 HOH A O   1 
HETATM 5434 O O   . HOH F 4 .   ? 76.625  3.891  27.932  1.00 33.91 ? 1022 HOH A O   1 
HETATM 5435 O O   . HOH F 4 .   ? 98.639  6.559  50.091  1.00 31.13 ? 1026 HOH A O   1 
HETATM 5436 O O   . HOH F 4 .   ? 84.235  19.193 69.647  1.00 38.03 ? 1028 HOH A O   1 
HETATM 5437 O O   . HOH F 4 .   ? 74.778  1.200  56.244  1.00 33.81 ? 1030 HOH A O   1 
HETATM 5438 O O   . HOH F 4 .   ? 75.852  -3.806 41.232  1.00 49.39 ? 1043 HOH A O   1 
HETATM 5439 O O   . HOH F 4 .   ? 72.024  23.852 63.416  1.00 36.08 ? 1046 HOH A O   1 
HETATM 5440 O O   . HOH F 4 .   ? 101.549 12.615 48.793  1.00 41.12 ? 1050 HOH A O   1 
HETATM 5441 O O   . HOH F 4 .   ? 94.224  3.818  38.023  1.00 51.30 ? 1051 HOH A O   1 
HETATM 5442 O O   . HOH F 4 .   ? 73.880  20.300 32.539  1.00 43.73 ? 1058 HOH A O   1 
HETATM 5443 O O   . HOH F 4 .   ? 90.786  4.301  34.348  1.00 32.62 ? 1063 HOH A O   1 
HETATM 5444 O O   . HOH F 4 .   ? 65.861  25.127 45.339  1.00 40.91 ? 1064 HOH A O   1 
HETATM 5445 O O   . HOH F 4 .   ? 90.688  -0.137 49.059  1.00 43.49 ? 1067 HOH A O   1 
HETATM 5446 O O   . HOH F 4 .   ? 65.734  13.033 46.479  1.00 34.75 ? 1072 HOH A O   1 
HETATM 5447 O O   . HOH F 4 .   ? 77.233  30.908 64.421  1.00 54.17 ? 1076 HOH A O   1 
HETATM 5448 O O   . HOH F 4 .   ? 74.125  27.268 54.555  1.00 39.35 ? 1083 HOH A O   1 
HETATM 5449 O O   . HOH F 4 .   ? 78.339  31.450 50.539  1.00 41.98 ? 1085 HOH A O   1 
HETATM 5450 O O   . HOH F 4 .   ? 84.493  21.232 72.160  1.00 38.74 ? 1087 HOH A O   1 
HETATM 5451 O O   . HOH F 4 .   ? 84.592  2.285  57.929  1.00 40.39 ? 1092 HOH A O   1 
HETATM 5452 O O   . HOH F 4 .   ? 97.278  -2.882 44.503  1.00 56.70 ? 1093 HOH A O   1 
HETATM 5453 O O   . HOH F 4 .   ? 62.651  12.359 62.785  1.00 41.56 ? 1094 HOH A O   1 
HETATM 5454 O O   . HOH F 4 .   ? 65.591  11.495 54.076  1.00 33.49 ? 1111 HOH A O   1 
HETATM 5455 O O   . HOH F 4 .   ? 79.129  23.208 63.836  1.00 31.71 ? 1112 HOH A O   1 
HETATM 5456 O O   . HOH F 4 .   ? 71.906  0.716  37.302  1.00 39.98 ? 1113 HOH A O   1 
HETATM 5457 O O   . HOH F 4 .   ? 70.081  20.828 38.224  1.00 30.68 ? 1114 HOH A O   1 
HETATM 5458 O O   . HOH F 4 .   ? 93.777  6.214  32.966  1.00 32.27 ? 1115 HOH A O   1 
HETATM 5459 O O   . HOH F 4 .   ? 96.154  2.026  53.820  1.00 41.96 ? 1117 HOH A O   1 
HETATM 5460 O O   . HOH F 4 .   ? 86.158  3.038  25.499  1.00 45.47 ? 1121 HOH A O   1 
HETATM 5461 O O   . HOH F 4 .   ? 95.459  13.660 60.575  1.00 42.46 ? 1123 HOH A O   1 
HETATM 5462 O O   . HOH F 4 .   ? 89.371  0.803  44.869  1.00 43.88 ? 1126 HOH A O   1 
HETATM 5463 O O   . HOH F 4 .   ? 80.049  20.557 33.683  1.00 54.91 ? 1128 HOH A O   1 
HETATM 5464 O O   . HOH F 4 .   ? 84.796  -5.860 45.143  1.00 51.89 ? 1130 HOH A O   1 
HETATM 5465 O O   . HOH F 4 .   ? 65.282  -1.264 49.325  1.00 33.01 ? 1132 HOH A O   1 
HETATM 5466 O O   . HOH F 4 .   ? 82.352  14.855 66.325  1.00 32.50 ? 1135 HOH A O   1 
HETATM 5467 O O   . HOH F 4 .   ? 67.318  16.846 35.785  1.00 47.95 ? 1136 HOH A O   1 
HETATM 5468 O O   . HOH F 4 .   ? 73.711  18.590 67.819  1.00 34.15 ? 1137 HOH A O   1 
HETATM 5469 O O   . HOH F 4 .   ? 65.486  12.709 41.220  1.00 43.13 ? 1139 HOH A O   1 
HETATM 5470 O O   . HOH F 4 .   ? 80.137  27.403 41.839  1.00 49.44 ? 1140 HOH A O   1 
HETATM 5471 O O   . HOH F 4 .   ? 86.758  17.481 32.408  1.00 37.09 ? 1142 HOH A O   1 
HETATM 5472 O O   . HOH F 4 .   ? 89.291  32.400 53.136  1.00 42.82 ? 1149 HOH A O   1 
HETATM 5473 O O   . HOH F 4 .   ? 70.827  4.390  39.468  1.00 43.57 ? 1151 HOH A O   1 
HETATM 5474 O O   . HOH F 4 .   ? 82.986  3.951  52.021  1.00 33.88 ? 1152 HOH A O   1 
HETATM 5475 O O   . HOH F 4 .   ? 96.428  4.640  50.407  1.00 31.55 ? 1154 HOH A O   1 
HETATM 5476 O O   . HOH F 4 .   ? 93.205  27.676 43.977  1.00 24.72 ? 1156 HOH A O   1 
HETATM 5477 O O   . HOH F 4 .   ? 85.005  6.214  24.066  1.00 49.45 ? 1160 HOH A O   1 
HETATM 5478 O O   . HOH F 4 .   ? 72.228  22.206 36.894  1.00 33.55 ? 1162 HOH A O   1 
HETATM 5479 O O   . HOH F 4 .   ? 64.944  7.096  45.408  1.00 45.78 ? 1167 HOH A O   1 
HETATM 5480 O O   . HOH F 4 .   ? 86.790  10.375 59.234  1.00 32.47 ? 1170 HOH A O   1 
HETATM 5481 O O   . HOH F 4 .   ? 102.993 24.039 63.891  1.00 12.01 ? 1173 HOH A O   1 
HETATM 5482 O O   . HOH F 4 .   ? 72.024  2.223  57.183  1.00 35.27 ? 1190 HOH A O   1 
HETATM 5483 O O   . HOH F 4 .   ? 100.991 9.255  51.499  1.00 41.57 ? 1191 HOH A O   1 
HETATM 5484 O O   . HOH F 4 .   ? 78.017  31.962 47.589  1.00 36.01 ? 1194 HOH A O   1 
HETATM 5485 O O   . HOH F 4 .   ? 84.586  -1.968 35.454  1.00 37.11 ? 1202 HOH A O   1 
HETATM 5486 O O   . HOH F 4 .   ? 68.846  11.651 61.647  1.00 32.00 ? 1204 HOH A O   1 
HETATM 5487 O O   . HOH F 4 .   ? 89.467  -2.306 48.182  1.00 42.22 ? 1206 HOH A O   1 
HETATM 5488 O O   . HOH F 4 .   ? 66.403  26.568 57.007  1.00 37.32 ? 1210 HOH A O   1 
HETATM 5489 O O   . HOH F 4 .   ? 92.429  15.504 40.461  1.00 40.77 ? 1219 HOH A O   1 
HETATM 5490 O O   . HOH F 4 .   ? 96.242  -0.627 44.443  1.00 30.84 ? 1220 HOH A O   1 
HETATM 5491 O O   . HOH F 4 .   ? 94.376  29.450 45.550  1.00 32.39 ? 1223 HOH A O   1 
HETATM 5492 O O   . HOH F 4 .   ? 66.811  24.023 62.450  1.00 43.41 ? 1225 HOH A O   1 
HETATM 5493 O O   . HOH F 4 .   ? 92.761  8.934  34.911  0.5  28.15 ? 1226 HOH A O   1 
HETATM 5494 O O   . HOH F 4 .   ? 90.607  14.652 35.043  1.00 36.29 ? 1227 HOH A O   1 
HETATM 5495 O O   . HOH F 4 .   ? 69.431  11.819 30.915  1.00 41.55 ? 1231 HOH A O   1 
HETATM 5496 O O   . HOH F 4 .   ? 68.245  26.574 54.483  1.00 34.97 ? 1239 HOH A O   1 
HETATM 5497 O O   . HOH F 4 .   ? 66.429  13.357 52.301  1.00 36.30 ? 1242 HOH A O   1 
HETATM 5498 O O   . HOH F 4 .   ? 90.777  28.328 43.032  1.00 42.09 ? 1246 HOH A O   1 
HETATM 5499 O O   . HOH F 4 .   ? 63.429  2.933  55.131  1.00 40.56 ? 1249 HOH A O   1 
HETATM 5500 O O   . HOH F 4 .   ? 80.729  1.555  58.677  1.00 40.54 ? 1257 HOH A O   1 
HETATM 5501 O O   . HOH F 4 .   ? 97.334  28.398 48.093  1.00 46.49 ? 1259 HOH A O   1 
HETATM 5502 O O   . HOH F 4 .   ? 76.468  8.771  29.972  1.00 38.95 ? 1261 HOH A O   1 
HETATM 5503 O O   . HOH F 4 .   ? 100.168 11.289 55.233  1.00 32.83 ? 1262 HOH A O   1 
HETATM 5504 O O   . HOH F 4 .   ? 65.581  24.332 56.594  1.00 37.30 ? 1263 HOH A O   1 
HETATM 5505 O O   . HOH F 4 .   ? 75.832  27.397 62.909  1.00 36.09 ? 1265 HOH A O   1 
HETATM 5506 O O   . HOH F 4 .   ? 86.610  -3.447 44.110  1.00 49.05 ? 1266 HOH A O   1 
HETATM 5507 O O   . HOH F 4 .   ? 85.860  30.316 54.408  1.00 38.26 ? 1268 HOH A O   1 
HETATM 5508 O O   . HOH F 4 .   ? 69.480  -4.901 47.638  1.00 44.54 ? 1269 HOH A O   1 
HETATM 5509 O O   . HOH F 4 .   ? 77.758  -6.379 49.357  1.00 51.27 ? 1272 HOH A O   1 
HETATM 5510 O O   . HOH F 4 .   ? 97.105  30.322 44.535  1.00 39.79 ? 1274 HOH A O   1 
HETATM 5511 O O   . HOH F 4 .   ? 93.746  12.437 39.116  1.00 51.70 ? 1275 HOH A O   1 
HETATM 5512 O O   . HOH F 4 .   ? 81.906  -1.806 52.258  1.00 45.46 ? 1279 HOH A O   1 
HETATM 5513 O O   . HOH F 4 .   ? 89.635  27.001 61.776  1.00 40.98 ? 1280 HOH A O   1 
HETATM 5514 O O   . HOH F 4 .   ? 89.424  25.278 39.282  1.00 44.42 ? 1284 HOH A O   1 
HETATM 5515 O O   . HOH F 4 .   ? 64.934  16.489 45.494  1.00 56.70 ? 1288 HOH A O   1 
HETATM 5516 O O   . HOH F 4 .   ? 70.206  5.053  59.084  1.00 41.12 ? 1291 HOH A O   1 
HETATM 5517 O O   . HOH F 4 .   ? 73.171  -0.977 34.690  1.00 41.92 ? 1296 HOH A O   1 
HETATM 5518 O O   . HOH F 4 .   ? 76.398  6.538  27.709  1.00 41.30 ? 1298 HOH A O   1 
HETATM 5519 O O   . HOH F 4 .   ? 69.979  11.653 64.372  1.00 43.33 ? 1303 HOH A O   1 
HETATM 5520 O O   . HOH F 4 .   ? 81.101  22.473 35.165  1.00 47.77 ? 1311 HOH A O   1 
HETATM 5521 O O   . HOH F 4 .   ? 89.162  15.601 32.412  1.00 46.06 ? 1314 HOH A O   1 
HETATM 5522 O O   . HOH F 4 .   ? 78.845  -0.821 54.601  1.00 50.32 ? 1321 HOH A O   1 
HETATM 5523 O O   . HOH F 4 .   ? 66.573  9.956  58.383  1.00 49.13 ? 1322 HOH A O   1 
HETATM 5524 O O   . HOH F 4 .   ? 99.893  10.471 57.426  1.00 34.64 ? 1325 HOH A O   1 
HETATM 5525 O O   . HOH F 4 .   ? 63.598  11.581 60.589  1.00 43.59 ? 1326 HOH A O   1 
HETATM 5526 O O   . HOH F 4 .   ? 79.390  12.842 29.839  1.00 45.55 ? 1330 HOH A O   1 
HETATM 5527 O O   . HOH F 4 .   ? 92.311  31.057 49.876  1.00 47.85 ? 1331 HOH A O   1 
HETATM 5528 O O   . HOH F 4 .   ? 79.550  -3.944 31.013  1.00 44.65 ? 1332 HOH A O   1 
HETATM 5529 O O   . HOH F 4 .   ? 84.411  29.529 56.849  1.00 49.33 ? 1338 HOH A O   1 
HETATM 5530 O O   . HOH F 4 .   ? 64.171  10.696 57.840  1.00 53.90 ? 1339 HOH A O   1 
HETATM 5531 O O   . HOH F 4 .   ? 65.783  18.700 47.282  1.00 51.02 ? 1340 HOH A O   1 
HETATM 5532 O O   . HOH F 4 .   ? 92.716  31.167 57.420  1.00 44.06 ? 1343 HOH A O   1 
HETATM 5533 O O   . HOH F 4 .   ? 74.912  31.537 59.837  1.00 45.62 ? 1349 HOH A O   1 
HETATM 5534 O O   . HOH F 4 .   ? 70.828  4.492  56.651  1.00 46.55 ? 1350 HOH A O   1 
HETATM 5535 O O   . HOH F 4 .   ? 82.289  3.824  59.609  1.00 43.87 ? 1351 HOH A O   1 
HETATM 5536 O O   . HOH F 4 .   ? 82.539  8.448  65.084  1.00 48.40 ? 1359 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   1   ASP ASP L . n 
A 1 2   ILE 2   2   2   ILE ILE L . n 
A 1 3   GLN 3   3   3   GLN GLN L . n 
A 1 4   MET 4   4   4   MET MET L . n 
A 1 5   THR 5   5   5   THR THR L . n 
A 1 6   GLN 6   6   6   GLN GLN L . n 
A 1 7   SER 7   7   7   SER SER L . n 
A 1 8   PRO 8   8   8   PRO PRO L . n 
A 1 9   SER 9   9   9   SER SER L . n 
A 1 10  SER 10  10  10  SER SER L . n 
A 1 11  LEU 11  11  11  LEU LEU L . n 
A 1 12  SER 12  12  12  SER SER L . n 
A 1 13  ALA 13  13  13  ALA ALA L . n 
A 1 14  SER 14  14  14  SER SER L . n 
A 1 15  LEU 15  15  15  LEU LEU L . n 
A 1 16  GLY 16  16  16  GLY GLY L . n 
A 1 17  ASP 17  17  17  ASP ASP L . n 
A 1 18  ARG 18  18  18  ARG ARG L . n 
A 1 19  VAL 19  19  19  VAL VAL L . n 
A 1 20  THR 20  20  20  THR THR L . n 
A 1 21  ILE 21  21  21  ILE ILE L . n 
A 1 22  SER 22  22  22  SER SER L . n 
A 1 23  CYS 23  23  23  CYS CYS L . n 
A 1 24  SER 24  24  24  SER SER L . n 
A 1 25  ALA 25  25  25  ALA ALA L . n 
A 1 26  SER 26  26  26  SER SER L . n 
A 1 27  GLN 27  27  27  GLN GLN L . n 
A 1 28  ASP 28  28  28  ASP ASP L . n 
A 1 29  ILE 29  29  29  ILE ILE L . n 
A 1 30  ASN 30  30  30  ASN ASN L . n 
A 1 31  LYS 31  31  31  LYS LYS L . n 
A 1 32  TYR 32  32  32  TYR TYR L . n 
A 1 33  LEU 33  33  33  LEU LEU L . n 
A 1 34  ASN 34  34  34  ASN ASN L . n 
A 1 35  TRP 35  35  35  TRP TRP L . n 
A 1 36  TYR 36  36  36  TYR TYR L . n 
A 1 37  GLN 37  37  37  GLN GLN L . n 
A 1 38  GLN 38  38  38  GLN GLN L . n 
A 1 39  LYS 39  39  39  LYS LYS L . n 
A 1 40  PRO 40  40  40  PRO PRO L . n 
A 1 41  ASP 41  41  41  ASP ASP L . n 
A 1 42  GLY 42  42  42  GLY GLY L . n 
A 1 43  ALA 43  43  43  ALA ALA L . n 
A 1 44  VAL 44  44  44  VAL VAL L . n 
A 1 45  LYS 45  45  45  LYS LYS L . n 
A 1 46  LEU 46  46  46  LEU LEU L . n 
A 1 47  LEU 47  47  47  LEU LEU L . n 
A 1 48  ILE 48  48  48  ILE ILE L . n 
A 1 49  PHE 49  49  49  PHE PHE L . n 
A 1 50  TYR 50  50  50  TYR TYR L . n 
A 1 51  THR 51  51  51  THR THR L . n 
A 1 52  SER 52  52  52  SER SER L . n 
A 1 53  SER 53  53  53  SER SER L . n 
A 1 54  LEU 54  54  54  LEU LEU L . n 
A 1 55  HIS 55  55  55  HIS HIS L . n 
A 1 56  SER 56  56  56  SER SER L . n 
A 1 57  GLY 57  57  57  GLY GLY L . n 
A 1 58  VAL 58  58  58  VAL VAL L . n 
A 1 59  PRO 59  59  59  PRO PRO L . n 
A 1 60  SER 60  60  60  SER SER L . n 
A 1 61  ARG 61  61  61  ARG ARG L . n 
A 1 62  PHE 62  62  62  PHE PHE L . n 
A 1 63  SER 63  63  63  SER SER L . n 
A 1 64  GLY 64  64  64  GLY GLY L . n 
A 1 65  SER 65  65  65  SER SER L . n 
A 1 66  GLY 66  66  66  GLY GLY L . n 
A 1 67  SER 67  67  67  SER SER L . n 
A 1 68  GLY 68  68  68  GLY GLY L . n 
A 1 69  THR 69  69  69  THR THR L . n 
A 1 70  ASP 70  70  70  ASP ASP L . n 
A 1 71  TYR 71  71  71  TYR TYR L . n 
A 1 72  SER 72  72  72  SER SER L . n 
A 1 73  LEU 73  73  73  LEU LEU L . n 
A 1 74  THR 74  74  74  THR THR L . n 
A 1 75  ILE 75  75  75  ILE ILE L . n 
A 1 76  SER 76  76  76  SER SER L . n 
A 1 77  ASN 77  77  77  ASN ASN L . n 
A 1 78  LEU 78  78  78  LEU LEU L . n 
A 1 79  GLU 79  79  79  GLU GLU L . n 
A 1 80  PRO 80  80  80  PRO PRO L . n 
A 1 81  GLU 81  81  81  GLU GLU L . n 
A 1 82  ASP 82  82  82  ASP ASP L . n 
A 1 83  ILE 83  83  83  ILE ILE L . n 
A 1 84  ALA 84  84  84  ALA ALA L . n 
A 1 85  THR 85  85  85  THR THR L . n 
A 1 86  TYR 86  86  86  TYR TYR L . n 
A 1 87  TYR 87  87  87  TYR TYR L . n 
A 1 88  CYS 88  88  88  CYS CYS L . n 
A 1 89  GLN 89  89  89  GLN GLN L . n 
A 1 90  GLN 90  90  90  GLN GLN L . n 
A 1 91  TYR 91  91  91  TYR TYR L . n 
A 1 92  GLU 92  92  92  GLU GLU L . n 
A 1 93  LYS 93  93  93  LYS LYS L . n 
A 1 94  LEU 94  94  94  LEU LEU L . n 
A 1 95  PRO 95  95  95  PRO PRO L . n 
A 1 96  TRP 96  96  96  TRP TRP L . n 
A 1 97  THR 97  97  97  THR THR L . n 
A 1 98  PHE 98  98  98  PHE PHE L . n 
A 1 99  GLY 99  99  99  GLY GLY L . n 
A 1 100 GLY 100 100 100 GLY GLY L . n 
A 1 101 GLY 101 101 101 GLY GLY L . n 
A 1 102 THR 102 102 102 THR THR L . n 
A 1 103 LYS 103 103 103 LYS LYS L . n 
A 1 104 LEU 104 104 104 LEU LEU L . n 
A 1 105 GLU 105 105 105 GLU GLU L . n 
A 1 106 VAL 106 106 106 VAL VAL L . n 
A 1 107 LYS 107 107 107 LYS LYS L . n 
A 1 108 ARG 108 108 108 ARG ARG L . n 
A 1 109 ALA 109 109 109 ALA ALA L . n 
A 1 110 ASP 110 110 110 ASP ASP L . n 
A 1 111 ALA 111 111 111 ALA ALA L . n 
A 1 112 ALA 112 112 112 ALA ALA L . n 
A 1 113 PRO 113 113 113 PRO PRO L . n 
A 1 114 THR 114 114 114 THR THR L . n 
A 1 115 VAL 115 115 115 VAL VAL L . n 
A 1 116 SER 116 116 116 SER SER L . n 
A 1 117 ILE 117 117 117 ILE ILE L . n 
A 1 118 PHE 118 118 118 PHE PHE L . n 
A 1 119 PRO 119 119 119 PRO PRO L . n 
A 1 120 PRO 120 120 120 PRO PRO L . n 
A 1 121 SER 121 121 121 SER SER L . n 
A 1 122 SER 122 122 122 SER SER L . n 
A 1 123 GLU 123 123 123 GLU GLU L . n 
A 1 124 GLN 124 124 124 GLN GLN L . n 
A 1 125 LEU 125 125 125 LEU LEU L . n 
A 1 126 THR 126 126 126 THR THR L . n 
A 1 127 SER 127 127 127 SER SER L . n 
A 1 128 GLY 128 128 128 GLY GLY L . n 
A 1 129 GLY 129 129 129 GLY GLY L . n 
A 1 130 ALA 130 130 130 ALA ALA L . n 
A 1 131 SER 131 131 131 SER SER L . n 
A 1 132 VAL 132 132 132 VAL VAL L . n 
A 1 133 VAL 133 133 133 VAL VAL L . n 
A 1 134 CYS 134 134 134 CYS CYS L . n 
A 1 135 PHE 135 135 135 PHE PHE L . n 
A 1 136 LEU 136 136 136 LEU LEU L . n 
A 1 137 ASN 137 137 137 ASN ASN L . n 
A 1 138 ASN 138 138 138 ASN ASN L . n 
A 1 139 PHE 139 139 139 PHE PHE L . n 
A 1 140 TYR 140 140 140 TYR TYR L . n 
A 1 141 PRO 141 141 141 PRO PRO L . n 
A 1 142 LYS 142 142 142 LYS LYS L . n 
A 1 143 ASP 143 143 143 ASP ASP L . n 
A 1 144 ILE 144 144 144 ILE ILE L . n 
A 1 145 ASN 145 145 145 ASN ASN L . n 
A 1 146 VAL 146 146 146 VAL VAL L . n 
A 1 147 LYS 147 147 147 LYS LYS L . n 
A 1 148 TRP 148 148 148 TRP TRP L . n 
A 1 149 LYS 149 149 149 LYS LYS L . n 
A 1 150 ILE 150 150 150 ILE ILE L . n 
A 1 151 ASP 151 151 151 ASP ASP L . n 
A 1 152 GLY 152 152 152 GLY GLY L . n 
A 1 153 SER 153 153 153 SER SER L . n 
A 1 154 GLU 154 154 154 GLU GLU L . n 
A 1 155 ARG 155 155 155 ARG ARG L . n 
A 1 156 GLN 156 156 156 GLN GLN L . n 
A 1 157 ASN 157 157 157 ASN ASN L . n 
A 1 158 GLY 158 158 158 GLY GLY L . n 
A 1 159 VAL 159 159 159 VAL VAL L . n 
A 1 160 LEU 160 160 160 LEU LEU L . n 
A 1 161 ASN 161 161 161 ASN ASN L . n 
A 1 162 SER 162 162 162 SER SER L . n 
A 1 163 TRP 163 163 163 TRP TRP L . n 
A 1 164 THR 164 164 164 THR THR L . n 
A 1 165 ASP 165 165 165 ASP ASP L . n 
A 1 166 GLN 166 166 166 GLN GLN L . n 
A 1 167 ASP 167 167 167 ASP ASP L . n 
A 1 168 SER 168 168 168 SER SER L . n 
A 1 169 LYS 169 169 169 LYS LYS L . n 
A 1 170 ASP 170 170 170 ASP ASP L . n 
A 1 171 SER 171 171 171 SER SER L . n 
A 1 172 THR 172 172 172 THR THR L . n 
A 1 173 TYR 173 173 173 TYR TYR L . n 
A 1 174 SER 174 174 174 SER SER L . n 
A 1 175 MET 175 175 175 MET MET L . n 
A 1 176 SER 176 176 176 SER SER L . n 
A 1 177 SER 177 177 177 SER SER L . n 
A 1 178 THR 178 178 178 THR THR L . n 
A 1 179 LEU 179 179 179 LEU LEU L . n 
A 1 180 THR 180 180 180 THR THR L . n 
A 1 181 LEU 181 181 181 LEU LEU L . n 
A 1 182 THR 182 182 182 THR THR L . n 
A 1 183 LYS 183 183 183 LYS LYS L . n 
A 1 184 ASP 184 184 184 ASP ASP L . n 
A 1 185 GLU 185 185 185 GLU GLU L . n 
A 1 186 TYR 186 186 186 TYR TYR L . n 
A 1 187 GLU 187 187 187 GLU GLU L . n 
A 1 188 ARG 188 188 188 ARG ARG L . n 
A 1 189 HIS 189 189 189 HIS HIS L . n 
A 1 190 ASN 190 190 190 ASN ASN L . n 
A 1 191 SER 191 191 191 SER SER L . n 
A 1 192 TYR 192 192 192 TYR TYR L . n 
A 1 193 THR 193 193 193 THR THR L . n 
A 1 194 CYS 194 194 194 CYS CYS L . n 
A 1 195 GLU 195 195 195 GLU GLU L . n 
A 1 196 ALA 196 196 196 ALA ALA L . n 
A 1 197 THR 197 197 197 THR THR L . n 
A 1 198 HIS 198 198 198 HIS HIS L . n 
A 1 199 LYS 199 199 199 LYS LYS L . n 
A 1 200 THR 200 200 200 THR THR L . n 
A 1 201 SER 201 201 201 SER SER L . n 
A 1 202 THR 202 202 202 THR THR L . n 
A 1 203 SER 203 203 203 SER SER L . n 
A 1 204 PRO 204 204 204 PRO PRO L . n 
A 1 205 ILE 205 205 205 ILE ILE L . n 
A 1 206 VAL 206 206 206 VAL VAL L . n 
A 1 207 LYS 207 207 207 LYS LYS L . n 
A 1 208 SER 208 208 208 SER SER L . n 
A 1 209 PHE 209 209 209 PHE PHE L . n 
A 1 210 ASN 210 210 210 ASN ASN L . n 
A 1 211 ARG 211 211 211 ARG ARG L . n 
A 1 212 ASN 212 212 212 ASN ASN L . n 
A 1 213 GLU 213 213 213 GLU GLU L . n 
A 1 214 CYS 214 214 214 CYS CYS L . n 
B 2 1   GLN 1   215 215 GLN GLN H . n 
B 2 2   VAL 2   216 216 VAL VAL H . n 
B 2 3   GLN 3   217 217 GLN GLN H . n 
B 2 4   LEU 4   218 218 LEU LEU H . n 
B 2 5   LYS 5   219 219 LYS LYS H . n 
B 2 6   GLU 6   220 220 GLU GLU H . n 
B 2 7   SER 7   221 221 SER SER H . n 
B 2 8   GLY 8   222 222 GLY GLY H . n 
B 2 9   PRO 9   223 223 PRO PRO H . n 
B 2 10  GLY 10  224 224 GLY GLY H . n 
B 2 11  LEU 11  225 225 LEU LEU H . n 
B 2 12  VAL 12  226 226 VAL VAL H . n 
B 2 13  ALA 13  227 227 ALA ALA H . n 
B 2 14  PRO 14  228 228 PRO PRO H . n 
B 2 15  SER 15  229 229 SER SER H . n 
B 2 16  GLN 16  230 230 GLN GLN H . n 
B 2 17  SER 17  231 231 SER SER H . n 
B 2 18  LEU 18  232 232 LEU LEU H . n 
B 2 19  SER 19  233 233 SER SER H . n 
B 2 20  ILE 20  234 234 ILE ILE H . n 
B 2 21  THR 21  235 235 THR THR H . n 
B 2 22  CYS 22  236 236 CYS CYS H . n 
B 2 23  THR 23  237 237 THR THR H . n 
B 2 24  VAL 24  238 238 VAL VAL H . n 
B 2 25  SER 25  239 239 SER SER H . n 
B 2 26  GLY 26  240 240 GLY GLY H . n 
B 2 27  PHE 27  241 241 PHE PHE H . n 
B 2 28  SER 28  242 242 SER SER H . n 
B 2 29  LEU 29  243 243 LEU LEU H . n 
B 2 30  THR 30  244 244 THR THR H . n 
B 2 31  ASP 31  245 245 ASP ASP H . n 
B 2 32  TYR 32  246 246 TYR TYR H . n 
B 2 33  GLY 33  247 247 GLY GLY H . n 
B 2 34  VAL 34  248 248 VAL VAL H . n 
B 2 35  ASP 35  249 249 ASP ASP H . n 
B 2 36  TRP 36  250 250 TRP TRP H . n 
B 2 37  VAL 37  251 251 VAL VAL H . n 
B 2 38  ARG 38  252 252 ARG ARG H . n 
B 2 39  GLN 39  253 253 GLN GLN H . n 
B 2 40  PRO 40  254 254 PRO PRO H . n 
B 2 41  PRO 41  255 255 PRO PRO H . n 
B 2 42  GLY 42  256 256 GLY GLY H . n 
B 2 43  LYS 43  257 257 LYS LYS H . n 
B 2 44  GLY 44  258 258 GLY GLY H . n 
B 2 45  LEU 45  259 259 LEU LEU H . n 
B 2 46  GLU 46  260 260 GLU GLU H . n 
B 2 47  TRP 47  261 261 TRP TRP H . n 
B 2 48  LEU 48  262 262 LEU LEU H . n 
B 2 49  GLY 49  263 263 GLY GLY H . n 
B 2 50  MET 50  264 264 MET MET H . n 
B 2 51  ILE 51  265 265 ILE ILE H . n 
B 2 52  TRP 52  266 266 TRP TRP H . n 
B 2 53  GLY 53  267 267 GLY GLY H . n 
B 2 54  ASP 54  268 268 ASP ASP H . n 
B 2 55  GLY 55  269 269 GLY GLY H . n 
B 2 56  SER 56  270 270 SER SER H . n 
B 2 57  THR 57  271 271 THR THR H . n 
B 2 58  ASP 58  272 272 ASP ASP H . n 
B 2 59  TYR 59  273 273 TYR TYR H . n 
B 2 60  ASN 60  274 274 ASN ASN H . n 
B 2 61  SER 61  275 275 SER SER H . n 
B 2 62  ALA 62  276 276 ALA ALA H . n 
B 2 63  LEU 63  277 277 LEU LEU H . n 
B 2 64  LYS 64  278 278 LYS LYS H . n 
B 2 65  SER 65  279 279 SER SER H . n 
B 2 66  ARG 66  280 280 ARG ARG H . n 
B 2 67  LEU 67  281 281 LEU LEU H . n 
B 2 68  SER 68  282 282 SER SER H . n 
B 2 69  ILE 69  283 283 ILE ILE H . n 
B 2 70  THR 70  284 284 THR THR H . n 
B 2 71  LYS 71  285 285 LYS LYS H . n 
B 2 72  ASP 72  286 286 ASP ASP H . n 
B 2 73  ASN 73  287 287 ASN ASN H . n 
B 2 74  SER 74  288 288 SER SER H . n 
B 2 75  LYS 75  289 289 LYS LYS H . n 
B 2 76  SER 76  290 290 SER SER H . n 
B 2 77  GLN 77  291 291 GLN GLN H . n 
B 2 78  VAL 78  292 292 VAL VAL H . n 
B 2 79  PHE 79  293 293 PHE PHE H . n 
B 2 80  LEU 80  294 294 LEU LEU H . n 
B 2 81  LYS 81  295 295 LYS LYS H . n 
B 2 82  MET 82  296 296 MET MET H . n 
B 2 83  ASN 83  297 297 ASN ASN H . n 
B 2 84  SER 84  298 298 SER SER H . n 
B 2 85  LEU 85  299 299 LEU LEU H . n 
B 2 86  GLN 86  300 300 GLN GLN H . n 
B 2 87  THR 87  301 301 THR THR H . n 
B 2 88  ASP 88  302 302 ASP ASP H . n 
B 2 89  ASP 89  303 303 ASP ASP H . n 
B 2 90  THR 90  304 304 THR THR H . n 
B 2 91  ALA 91  305 305 ALA ALA H . n 
B 2 92  ARG 92  306 306 ARG ARG H . n 
B 2 93  TYR 93  307 307 TYR TYR H . n 
B 2 94  TYR 94  308 308 TYR TYR H . n 
B 2 95  CYS 95  309 309 CYS CYS H . n 
B 2 96  VAL 96  310 310 VAL VAL H . n 
B 2 97  ARG 97  311 311 ARG ARG H . n 
B 2 98  ASP 98  312 312 ASP ASP H . n 
B 2 99  PRO 99  313 313 PRO PRO H . n 
B 2 100 ALA 100 314 314 ALA ALA H . n 
B 2 101 ASP 101 315 315 ASP ASP H . n 
B 2 102 TYR 102 316 316 TYR TYR H . n 
B 2 103 GLY 103 317 317 GLY GLY H . n 
B 2 104 ASN 104 318 318 ASN ASN H . n 
B 2 105 TYR 105 319 319 TYR TYR H . n 
B 2 106 ASP 106 320 320 ASP ASP H . n 
B 2 107 TYR 107 321 321 TYR TYR H . n 
B 2 108 ALA 108 322 322 ALA ALA H . n 
B 2 109 LEU 109 323 323 LEU LEU H . n 
B 2 110 ASP 110 324 324 ASP ASP H . n 
B 2 111 TYR 111 325 325 TYR TYR H . n 
B 2 112 TRP 112 326 326 TRP TRP H . n 
B 2 113 GLY 113 327 327 GLY GLY H . n 
B 2 114 GLN 114 328 328 GLN GLN H . n 
B 2 115 GLY 115 329 329 GLY GLY H . n 
B 2 116 THR 116 330 330 THR THR H . n 
B 2 117 SER 117 331 331 SER SER H . n 
B 2 118 VAL 118 332 332 VAL VAL H . n 
B 2 119 THR 119 333 333 THR THR H . n 
B 2 120 VAL 120 334 334 VAL VAL H . n 
B 2 121 SER 121 335 335 SER SER H . n 
B 2 122 SER 122 336 336 SER SER H . n 
B 2 123 ALA 123 337 337 ALA ALA H . n 
B 2 124 LYS 124 338 338 LYS LYS H . n 
B 2 125 THR 125 339 339 THR THR H . n 
B 2 126 THR 126 340 340 THR THR H . n 
B 2 127 PRO 127 341 341 PRO PRO H . n 
B 2 128 PRO 128 342 342 PRO PRO H . n 
B 2 129 SER 129 343 343 SER SER H . n 
B 2 130 VAL 130 344 344 VAL VAL H . n 
B 2 131 TYR 131 345 345 TYR TYR H . n 
B 2 132 PRO 132 346 346 PRO PRO H . n 
B 2 133 LEU 133 347 347 LEU LEU H . n 
B 2 134 ALA 134 348 348 ALA ALA H . n 
B 2 135 PRO 135 349 349 PRO PRO H . n 
B 2 136 GLY 136 350 350 GLY GLY H . n 
B 2 137 SER 137 351 351 SER SER H . n 
B 2 138 ALA 138 352 ?   ?   ?   H . n 
B 2 139 ALA 139 353 ?   ?   ?   H . n 
B 2 140 GLN 140 354 ?   ?   ?   H . n 
B 2 141 THR 141 355 ?   ?   ?   H . n 
B 2 142 ASN 142 356 ?   ?   ?   H . n 
B 2 143 SER 143 357 357 SER SER H . n 
B 2 144 MET 144 358 358 MET MET H . n 
B 2 145 VAL 145 359 359 VAL VAL H . n 
B 2 146 THR 146 360 360 THR THR H . n 
B 2 147 LEU 147 361 361 LEU LEU H . n 
B 2 148 GLY 148 362 362 GLY GLY H . n 
B 2 149 CYS 149 363 363 CYS CYS H . n 
B 2 150 LEU 150 364 364 LEU LEU H . n 
B 2 151 VAL 151 365 365 VAL VAL H . n 
B 2 152 LYS 152 366 366 LYS LYS H . n 
B 2 153 GLY 153 367 367 GLY GLY H . n 
B 2 154 TYR 154 368 368 TYR TYR H . n 
B 2 155 PHE 155 369 369 PHE PHE H . n 
B 2 156 PRO 156 370 370 PRO PRO H . n 
B 2 157 GLU 157 371 371 GLU GLU H . n 
B 2 158 PRO 158 372 372 PRO PRO H . n 
B 2 159 VAL 159 373 373 VAL VAL H . n 
B 2 160 THR 160 374 374 THR THR H . n 
B 2 161 VAL 161 375 375 VAL VAL H . n 
B 2 162 THR 162 376 376 THR THR H . n 
B 2 163 TRP 163 377 377 TRP TRP H . n 
B 2 164 ASN 164 378 378 ASN ASN H . n 
B 2 165 SER 165 379 379 SER SER H . n 
B 2 166 GLY 166 380 380 GLY GLY H . n 
B 2 167 SER 167 381 381 SER SER H . n 
B 2 168 LEU 168 382 382 LEU LEU H . n 
B 2 169 SER 169 383 383 SER SER H . n 
B 2 170 SER 170 384 384 SER SER H . n 
B 2 171 GLY 171 385 385 GLY GLY H . n 
B 2 172 VAL 172 386 386 VAL VAL H . n 
B 2 173 HIS 173 387 387 HIS HIS H . n 
B 2 174 THR 174 388 388 THR THR H . n 
B 2 175 PHE 175 389 389 PHE PHE H . n 
B 2 176 PRO 176 390 390 PRO PRO H . n 
B 2 177 ALA 177 391 391 ALA ALA H . n 
B 2 178 VAL 178 392 392 VAL VAL H . n 
B 2 179 LEU 179 393 393 LEU LEU H . n 
B 2 180 GLN 180 394 394 GLN GLN H . n 
B 2 181 SER 181 395 395 SER SER H . n 
B 2 182 ASP 182 396 396 ASP ASP H . n 
B 2 183 LEU 183 397 397 LEU LEU H . n 
B 2 184 TYR 184 398 398 TYR TYR H . n 
B 2 185 THR 185 399 399 THR THR H . n 
B 2 186 LEU 186 400 400 LEU LEU H . n 
B 2 187 SER 187 401 401 SER SER H . n 
B 2 188 SER 188 402 402 SER SER H . n 
B 2 189 SER 189 403 403 SER SER H . n 
B 2 190 VAL 190 404 404 VAL VAL H . n 
B 2 191 THR 191 405 405 THR THR H . n 
B 2 192 VAL 192 406 406 VAL VAL H . n 
B 2 193 PRO 193 407 407 PRO PRO H . n 
B 2 194 SER 194 408 408 SER SER H . n 
B 2 195 SER 195 409 409 SER SER H . n 
B 2 196 THR 196 410 410 THR THR H . n 
B 2 197 TRP 197 411 411 TRP TRP H . n 
B 2 198 PRO 198 412 412 PRO PRO H . n 
B 2 199 SER 199 413 413 SER SER H . n 
B 2 200 GLU 200 414 414 GLU GLU H . n 
B 2 201 THR 201 415 415 THR THR H . n 
B 2 202 VAL 202 416 416 VAL VAL H . n 
B 2 203 THR 203 417 417 THR THR H . n 
B 2 204 CYS 204 418 418 CYS CYS H . n 
B 2 205 ASN 205 419 419 ASN ASN H . n 
B 2 206 VAL 206 420 420 VAL VAL H . n 
B 2 207 ALA 207 421 421 ALA ALA H . n 
B 2 208 HIS 208 422 422 HIS HIS H . n 
B 2 209 PRO 209 423 423 PRO PRO H . n 
B 2 210 ALA 210 424 424 ALA ALA H . n 
B 2 211 SER 211 425 425 SER SER H . n 
B 2 212 SER 212 426 426 SER SER H . n 
B 2 213 THR 213 427 427 THR THR H . n 
B 2 214 LYS 214 428 428 LYS LYS H . n 
B 2 215 VAL 215 429 429 VAL VAL H . n 
B 2 216 ASP 216 430 430 ASP ASP H . n 
B 2 217 LYS 217 431 431 LYS LYS H . n 
B 2 218 LYS 218 432 432 LYS LYS H . n 
B 2 219 ILE 219 433 433 ILE ILE H . n 
B 2 220 VAL 220 434 434 VAL VAL H . n 
B 2 221 PRO 221 435 435 PRO PRO H . n 
B 2 222 ARG 222 436 436 ARG ARG H . n 
B 2 223 ASP 223 437 437 ASP ASP H . n 
B 2 224 CYS 224 438 438 CYS CYS H . n 
B 2 225 GLY 225 439 439 GLY GLY H . n 
C 3 1   MET 1   507 507 MET MET A . n 
C 3 2   TYR 2   508 508 TYR TYR A . n 
C 3 3   CYS 3   509 509 CYS CYS A . n 
C 3 4   SER 4   510 510 SER SER A . n 
C 3 5   ARG 5   511 511 ARG ARG A . n 
C 3 6   LEU 6   512 512 LEU LEU A . n 
C 3 7   LEU 7   513 513 LEU LEU A . n 
C 3 8   ASP 8   514 514 ASP ASP A . n 
C 3 9   LEU 9   515 515 LEU LEU A . n 
C 3 10  VAL 10  516 516 VAL VAL A . n 
C 3 11  PHE 11  517 517 PHE PHE A . n 
C 3 12  LEU 12  518 518 LEU LEU A . n 
C 3 13  LEU 13  519 519 LEU LEU A . n 
C 3 14  ASP 14  520 520 ASP ASP A . n 
C 3 15  GLY 15  521 521 GLY GLY A . n 
C 3 16  SER 16  522 522 SER SER A . n 
C 3 17  SER 17  523 523 SER SER A . n 
C 3 18  ARG 18  524 524 ARG ARG A . n 
C 3 19  LEU 19  525 525 LEU LEU A . n 
C 3 20  SER 20  526 526 SER SER A . n 
C 3 21  GLU 21  527 527 GLU GLU A . n 
C 3 22  ALA 22  528 528 ALA ALA A . n 
C 3 23  GLU 23  529 529 GLU GLU A . n 
C 3 24  PHE 24  530 530 PHE PHE A . n 
C 3 25  GLU 25  531 531 GLU GLU A . n 
C 3 26  VAL 26  532 532 VAL VAL A . n 
C 3 27  LEU 27  533 533 LEU LEU A . n 
C 3 28  LYS 28  534 534 LYS LYS A . n 
C 3 29  ALA 29  535 535 ALA ALA A . n 
C 3 30  PHE 30  536 536 PHE PHE A . n 
C 3 31  VAL 31  537 537 VAL VAL A . n 
C 3 32  VAL 32  538 538 VAL VAL A . n 
C 3 33  ASP 33  539 539 ASP ASP A . n 
C 3 34  MET 34  540 540 MET MET A . n 
C 3 35  MET 35  541 541 MET MET A . n 
C 3 36  GLU 36  542 542 GLU GLU A . n 
C 3 37  ARG 37  543 543 ARG ARG A . n 
C 3 38  LEU 38  544 544 LEU LEU A . n 
C 3 39  ARG 39  545 545 ARG ARG A . n 
C 3 40  VAL 40  546 546 VAL VAL A . n 
C 3 41  SER 41  547 547 SER SER A . n 
C 3 42  GLN 42  548 548 GLN GLN A . n 
C 3 43  LYS 43  549 549 LYS LYS A . n 
C 3 44  TRP 44  550 550 TRP TRP A . n 
C 3 45  VAL 45  551 551 VAL VAL A . n 
C 3 46  ARG 46  552 552 ARG ARG A . n 
C 3 47  VAL 47  553 553 VAL VAL A . n 
C 3 48  ALA 48  554 554 ALA ALA A . n 
C 3 49  VAL 49  555 555 VAL VAL A . n 
C 3 50  VAL 50  556 556 VAL VAL A . n 
C 3 51  GLU 51  557 557 GLU GLU A . n 
C 3 52  TYR 52  558 558 TYR TYR A . n 
C 3 53  HIS 53  559 559 HIS HIS A . n 
C 3 54  ASP 54  560 560 ASP ASP A . n 
C 3 55  GLY 55  561 561 GLY GLY A . n 
C 3 56  SER 56  562 562 SER SER A . n 
C 3 57  HIS 57  563 563 HIS HIS A . n 
C 3 58  ALA 58  564 564 ALA ALA A . n 
C 3 59  TYR 59  565 565 TYR TYR A . n 
C 3 60  ILE 60  566 566 ILE ILE A . n 
C 3 61  GLY 61  567 567 GLY GLY A . n 
C 3 62  LEU 62  568 568 LEU LEU A . n 
C 3 63  LYS 63  569 569 LYS LYS A . n 
C 3 64  ASP 64  570 570 ASP ASP A . n 
C 3 65  ARG 65  571 571 ARG ARG A . n 
C 3 66  LYS 66  572 572 LYS LYS A . n 
C 3 67  ARG 67  573 573 ARG ARG A . n 
C 3 68  PRO 68  574 574 PRO PRO A . n 
C 3 69  SER 69  575 575 SER SER A . n 
C 3 70  GLU 70  576 576 GLU GLU A . n 
C 3 71  LEU 71  577 577 LEU LEU A . n 
C 3 72  ARG 72  578 578 ARG ARG A . n 
C 3 73  ARG 73  579 579 ARG ARG A . n 
C 3 74  ILE 74  580 580 ILE ILE A . n 
C 3 75  ALA 75  581 581 ALA ALA A . n 
C 3 76  SER 76  582 582 SER SER A . n 
C 3 77  GLN 77  583 583 GLN GLN A . n 
C 3 78  VAL 78  584 584 VAL VAL A . n 
C 3 79  LYS 79  585 585 LYS LYS A . n 
C 3 80  TYR 80  586 586 TYR TYR A . n 
C 3 81  ALA 81  587 587 ALA ALA A . n 
C 3 82  GLY 82  588 588 GLY GLY A . n 
C 3 83  SER 83  589 589 SER SER A . n 
C 3 84  GLN 84  590 590 GLN GLN A . n 
C 3 85  VAL 85  591 591 VAL VAL A . n 
C 3 86  ALA 86  592 592 ALA ALA A . n 
C 3 87  SER 87  593 593 SER SER A . n 
C 3 88  THR 88  594 594 THR THR A . n 
C 3 89  SER 89  595 595 SER SER A . n 
C 3 90  GLU 90  596 596 GLU GLU A . n 
C 3 91  VAL 91  597 597 VAL VAL A . n 
C 3 92  LEU 92  598 598 LEU LEU A . n 
C 3 93  LYS 93  599 599 LYS LYS A . n 
C 3 94  TYR 94  600 600 TYR TYR A . n 
C 3 95  THR 95  601 601 THR THR A . n 
C 3 96  LEU 96  602 602 LEU LEU A . n 
C 3 97  PHE 97  603 603 PHE PHE A . n 
C 3 98  GLN 98  604 604 GLN GLN A . n 
C 3 99  ILE 99  605 605 ILE ILE A . n 
C 3 100 PHE 100 606 606 PHE PHE A . n 
C 3 101 SER 101 607 607 SER SER A . n 
C 3 102 LYS 102 608 608 LYS LYS A . n 
C 3 103 ILE 103 609 609 ILE ILE A . n 
C 3 104 ASP 104 610 610 ASP ASP A . n 
C 3 105 ARG 105 611 611 ARG ARG A . n 
C 3 106 PRO 106 612 612 PRO PRO A . n 
C 3 107 GLU 107 613 613 GLU GLU A . n 
C 3 108 ALA 108 614 614 ALA ALA A . n 
C 3 109 SER 109 615 615 SER SER A . n 
C 3 110 ARG 110 616 616 ARG ARG A . n 
C 3 111 ILE 111 617 617 ILE ILE A . n 
C 3 112 ALA 112 618 618 ALA ALA A . n 
C 3 113 LEU 113 619 619 LEU LEU A . n 
C 3 114 LEU 114 620 620 LEU LEU A . n 
C 3 115 LEU 115 621 621 LEU LEU A . n 
C 3 116 MET 116 622 622 MET MET A . n 
C 3 117 ALA 117 623 623 ALA ALA A . n 
C 3 118 SER 118 624 624 SER SER A . n 
C 3 119 GLN 119 625 625 GLN GLN A . n 
C 3 120 GLU 120 626 626 GLU GLU A . n 
C 3 121 PRO 121 627 627 PRO PRO A . n 
C 3 122 GLN 122 628 628 GLN GLN A . n 
C 3 123 ARG 123 629 629 ARG ARG A . n 
C 3 124 MET 124 630 630 MET MET A . n 
C 3 125 SER 125 631 631 SER SER A . n 
C 3 126 ARG 126 632 632 ARG ARG A . n 
C 3 127 ASN 127 633 633 ASN ASN A . n 
C 3 128 PHE 128 634 634 PHE PHE A . n 
C 3 129 VAL 129 635 635 VAL VAL A . n 
C 3 130 ARG 130 636 636 ARG ARG A . n 
C 3 131 TYR 131 637 637 TYR TYR A . n 
C 3 132 VAL 132 638 638 VAL VAL A . n 
C 3 133 GLN 133 639 639 GLN GLN A . n 
C 3 134 GLY 134 640 640 GLY GLY A . n 
C 3 135 LEU 135 641 641 LEU LEU A . n 
C 3 136 LYS 136 642 642 LYS LYS A . n 
C 3 137 LYS 137 643 643 LYS LYS A . n 
C 3 138 LYS 138 644 644 LYS LYS A . n 
C 3 139 LYS 139 645 645 LYS LYS A . n 
C 3 140 VAL 140 646 646 VAL VAL A . n 
C 3 141 ILE 141 647 647 ILE ILE A . n 
C 3 142 VAL 142 648 648 VAL VAL A . n 
C 3 143 ILE 143 649 649 ILE ILE A . n 
C 3 144 PRO 144 650 650 PRO PRO A . n 
C 3 145 VAL 145 651 651 VAL VAL A . n 
C 3 146 GLY 146 652 652 GLY GLY A . n 
C 3 147 ILE 147 653 653 ILE ILE A . n 
C 3 148 GLY 148 654 654 GLY GLY A . n 
C 3 149 PRO 149 655 655 PRO PRO A . n 
C 3 150 HIS 150 656 656 HIS HIS A . n 
C 3 151 ALA 151 657 657 ALA ALA A . n 
C 3 152 ASN 152 658 658 ASN ASN A . n 
C 3 153 LEU 153 659 659 LEU LEU A . n 
C 3 154 LYS 154 660 660 LYS LYS A . n 
C 3 155 GLN 155 661 661 GLN GLN A . n 
C 3 156 ILE 156 662 662 ILE ILE A . n 
C 3 157 ARG 157 663 663 ARG ARG A . n 
C 3 158 LEU 158 664 664 LEU LEU A . n 
C 3 159 ILE 159 665 665 ILE ILE A . n 
C 3 160 GLU 160 666 666 GLU GLU A . n 
C 3 161 LYS 161 667 667 LYS LYS A . n 
C 3 162 GLN 162 668 668 GLN GLN A . n 
C 3 163 ALA 163 669 669 ALA ALA A . n 
C 3 164 PRO 164 670 670 PRO PRO A . n 
C 3 165 GLU 165 671 671 GLU GLU A . n 
C 3 166 ASN 166 672 672 ASN ASN A . n 
C 3 167 LYS 167 673 673 LYS LYS A . n 
C 3 168 ALA 168 674 674 ALA ALA A . n 
C 3 169 PHE 169 675 675 PHE PHE A . n 
C 3 170 VAL 170 676 676 VAL VAL A . n 
C 3 171 LEU 171 677 677 LEU LEU A . n 
C 3 172 SER 172 678 678 SER SER A . n 
C 3 173 SER 173 679 679 SER SER A . n 
C 3 174 VAL 174 680 680 VAL VAL A . n 
C 3 175 ASP 175 681 681 ASP ASP A . n 
C 3 176 GLU 176 682 682 GLU GLU A . n 
C 3 177 LEU 177 683 683 LEU LEU A . n 
C 3 178 GLU 178 684 684 GLU GLU A . n 
C 3 179 GLN 179 685 685 GLN GLN A . n 
C 3 180 GLN 180 686 686 GLN GLN A . n 
C 3 181 ARG 181 687 687 ARG ARG A . n 
C 3 182 ASP 182 688 688 ASP ASP A . n 
C 3 183 GLU 183 689 689 GLU GLU A . n 
C 3 184 ILE 184 690 690 ILE ILE A . n 
C 3 185 VAL 185 691 691 VAL VAL A . n 
C 3 186 SER 186 692 692 SER SER A . n 
C 3 187 TYR 187 693 693 TYR TYR A . n 
C 3 188 LEU 188 694 694 LEU LEU A . n 
C 3 189 CYS 189 695 695 CYS CYS A . n 
C 3 190 ASP 190 696 696 ASP ASP A . n 
C 3 191 LEU 191 697 697 LEU LEU A . n 
C 3 192 ALA 192 698 698 ALA ALA A . n 
C 3 193 PRO 193 699 699 PRO PRO A . n 
C 3 194 GLU 194 700 700 GLU GLU A . n 
C 3 195 ALA 195 701 701 ALA ALA A . n 
C 3 196 PRO 196 702 702 PRO PRO A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 HOH 1   724  724  HOH HOH L . 
D 4 HOH 2   728  728  HOH HOH L . 
D 4 HOH 3   742  742  HOH HOH L . 
D 4 HOH 4   743  743  HOH HOH L . 
D 4 HOH 5   744  744  HOH HOH L . 
D 4 HOH 6   745  745  HOH HOH L . 
D 4 HOH 7   747  747  HOH HOH L . 
D 4 HOH 8   750  750  HOH HOH L . 
D 4 HOH 9   754  754  HOH HOH L . 
D 4 HOH 10  755  755  HOH HOH L . 
D 4 HOH 11  758  758  HOH HOH L . 
D 4 HOH 12  761  761  HOH HOH L . 
D 4 HOH 13  763  763  HOH HOH L . 
D 4 HOH 14  765  765  HOH HOH L . 
D 4 HOH 15  766  766  HOH HOH L . 
D 4 HOH 16  767  767  HOH HOH L . 
D 4 HOH 17  771  771  HOH HOH L . 
D 4 HOH 18  773  773  HOH HOH L . 
D 4 HOH 19  777  777  HOH HOH L . 
D 4 HOH 20  778  778  HOH HOH L . 
D 4 HOH 21  781  781  HOH HOH L . 
D 4 HOH 22  786  786  HOH HOH L . 
D 4 HOH 23  789  789  HOH HOH L . 
D 4 HOH 24  791  791  HOH HOH L . 
D 4 HOH 25  793  793  HOH HOH L . 
D 4 HOH 26  795  795  HOH HOH L . 
D 4 HOH 27  797  797  HOH HOH L . 
D 4 HOH 28  801  801  HOH HOH L . 
D 4 HOH 29  802  802  HOH HOH L . 
D 4 HOH 30  803  803  HOH HOH L . 
D 4 HOH 31  806  806  HOH HOH L . 
D 4 HOH 32  808  808  HOH HOH L . 
D 4 HOH 33  809  809  HOH HOH L . 
D 4 HOH 34  810  810  HOH HOH L . 
D 4 HOH 35  812  812  HOH HOH L . 
D 4 HOH 36  818  818  HOH HOH L . 
D 4 HOH 37  820  820  HOH HOH L . 
D 4 HOH 38  828  828  HOH HOH L . 
D 4 HOH 39  830  830  HOH HOH L . 
D 4 HOH 40  833  833  HOH HOH L . 
D 4 HOH 41  837  837  HOH HOH L . 
D 4 HOH 42  838  838  HOH HOH L . 
D 4 HOH 43  844  844  HOH HOH L . 
D 4 HOH 44  847  847  HOH HOH L . 
D 4 HOH 45  848  848  HOH HOH L . 
D 4 HOH 46  850  850  HOH HOH L . 
D 4 HOH 47  853  853  HOH HOH L . 
D 4 HOH 48  854  854  HOH HOH L . 
D 4 HOH 49  857  857  HOH HOH L . 
D 4 HOH 50  859  859  HOH HOH L . 
D 4 HOH 51  861  861  HOH HOH L . 
D 4 HOH 52  866  866  HOH HOH L . 
D 4 HOH 53  867  867  HOH HOH L . 
D 4 HOH 54  869  869  HOH HOH L . 
D 4 HOH 55  870  870  HOH HOH L . 
D 4 HOH 56  873  873  HOH HOH L . 
D 4 HOH 57  875  875  HOH HOH L . 
D 4 HOH 58  878  878  HOH HOH L . 
D 4 HOH 59  881  881  HOH HOH L . 
D 4 HOH 60  884  884  HOH HOH L . 
D 4 HOH 61  886  886  HOH HOH L . 
D 4 HOH 62  887  887  HOH HOH L . 
D 4 HOH 63  892  892  HOH HOH L . 
D 4 HOH 64  894  894  HOH HOH L . 
D 4 HOH 65  895  895  HOH HOH L . 
D 4 HOH 66  896  896  HOH HOH L . 
D 4 HOH 67  900  900  HOH HOH L . 
D 4 HOH 68  902  902  HOH HOH L . 
D 4 HOH 69  903  903  HOH HOH L . 
D 4 HOH 70  904  904  HOH HOH L . 
D 4 HOH 71  908  908  HOH HOH L . 
D 4 HOH 72  911  911  HOH HOH L . 
D 4 HOH 73  912  912  HOH HOH L . 
D 4 HOH 74  915  915  HOH HOH L . 
D 4 HOH 75  922  922  HOH HOH L . 
D 4 HOH 76  923  923  HOH HOH L . 
D 4 HOH 77  926  926  HOH HOH L . 
D 4 HOH 78  928  928  HOH HOH L . 
D 4 HOH 79  931  931  HOH HOH L . 
D 4 HOH 80  940  940  HOH HOH L . 
D 4 HOH 81  941  941  HOH HOH L . 
D 4 HOH 82  943  943  HOH HOH L . 
D 4 HOH 83  947  947  HOH HOH L . 
D 4 HOH 84  949  949  HOH HOH L . 
D 4 HOH 85  952  952  HOH HOH L . 
D 4 HOH 86  954  954  HOH HOH L . 
D 4 HOH 87  955  955  HOH HOH L . 
D 4 HOH 88  966  966  HOH HOH L . 
D 4 HOH 89  970  970  HOH HOH L . 
D 4 HOH 90  973  973  HOH HOH L . 
D 4 HOH 91  978  978  HOH HOH L . 
D 4 HOH 92  982  982  HOH HOH L . 
D 4 HOH 93  984  984  HOH HOH L . 
D 4 HOH 94  994  994  HOH HOH L . 
D 4 HOH 95  996  996  HOH HOH L . 
D 4 HOH 96  1006 1006 HOH HOH L . 
D 4 HOH 97  1012 1012 HOH HOH L . 
D 4 HOH 98  1013 1013 HOH HOH L . 
D 4 HOH 99  1016 1016 HOH HOH L . 
D 4 HOH 100 1027 1027 HOH HOH L . 
D 4 HOH 101 1034 1034 HOH HOH L . 
D 4 HOH 102 1035 1035 HOH HOH L . 
D 4 HOH 103 1036 1036 HOH HOH L . 
D 4 HOH 104 1039 1039 HOH HOH L . 
D 4 HOH 105 1042 1042 HOH HOH L . 
D 4 HOH 106 1047 1047 HOH HOH L . 
D 4 HOH 107 1052 1052 HOH HOH L . 
D 4 HOH 108 1053 1053 HOH HOH L . 
D 4 HOH 109 1054 1054 HOH HOH L . 
D 4 HOH 110 1057 1057 HOH HOH L . 
D 4 HOH 111 1059 1059 HOH HOH L . 
D 4 HOH 112 1060 1060 HOH HOH L . 
D 4 HOH 113 1061 1061 HOH HOH L . 
D 4 HOH 114 1062 1062 HOH HOH L . 
D 4 HOH 115 1068 1068 HOH HOH L . 
D 4 HOH 116 1069 1069 HOH HOH L . 
D 4 HOH 117 1070 1070 HOH HOH L . 
D 4 HOH 118 1071 1071 HOH HOH L . 
D 4 HOH 119 1073 1073 HOH HOH L . 
D 4 HOH 120 1074 1074 HOH HOH L . 
D 4 HOH 121 1075 1075 HOH HOH L . 
D 4 HOH 122 1077 1077 HOH HOH L . 
D 4 HOH 123 1078 1078 HOH HOH L . 
D 4 HOH 124 1079 1079 HOH HOH L . 
D 4 HOH 125 1080 1080 HOH HOH L . 
D 4 HOH 126 1082 1082 HOH HOH L . 
D 4 HOH 127 1086 1086 HOH HOH L . 
D 4 HOH 128 1088 1088 HOH HOH L . 
D 4 HOH 129 1089 1089 HOH HOH L . 
D 4 HOH 130 1091 1091 HOH HOH L . 
D 4 HOH 131 1095 1095 HOH HOH L . 
D 4 HOH 132 1096 1096 HOH HOH L . 
D 4 HOH 133 1102 1102 HOH HOH L . 
D 4 HOH 134 1103 1103 HOH HOH L . 
D 4 HOH 135 1104 1104 HOH HOH L . 
D 4 HOH 136 1105 1105 HOH HOH L . 
D 4 HOH 137 1109 1109 HOH HOH L . 
D 4 HOH 138 1110 1110 HOH HOH L . 
D 4 HOH 139 1116 1116 HOH HOH L . 
D 4 HOH 140 1118 1118 HOH HOH L . 
D 4 HOH 141 1119 1119 HOH HOH L . 
D 4 HOH 142 1120 1120 HOH HOH L . 
D 4 HOH 143 1124 1124 HOH HOH L . 
D 4 HOH 144 1138 1138 HOH HOH L . 
D 4 HOH 145 1141 1141 HOH HOH L . 
D 4 HOH 146 1143 1143 HOH HOH L . 
D 4 HOH 147 1146 1146 HOH HOH L . 
D 4 HOH 148 1148 1148 HOH HOH L . 
D 4 HOH 149 1150 1150 HOH HOH L . 
D 4 HOH 150 1155 1155 HOH HOH L . 
D 4 HOH 151 1157 1157 HOH HOH L . 
D 4 HOH 152 1158 1158 HOH HOH L . 
D 4 HOH 153 1159 1159 HOH HOH L . 
D 4 HOH 154 1166 1166 HOH HOH L . 
D 4 HOH 155 1168 1168 HOH HOH L . 
D 4 HOH 156 1169 1169 HOH HOH L . 
D 4 HOH 157 1171 1171 HOH HOH L . 
D 4 HOH 158 1179 1179 HOH HOH L . 
D 4 HOH 159 1180 1180 HOH HOH L . 
D 4 HOH 160 1182 1182 HOH HOH L . 
D 4 HOH 161 1183 1183 HOH HOH L . 
D 4 HOH 162 1184 1184 HOH HOH L . 
D 4 HOH 163 1185 1185 HOH HOH L . 
D 4 HOH 164 1187 1187 HOH HOH L . 
D 4 HOH 165 1188 1188 HOH HOH L . 
D 4 HOH 166 1189 1189 HOH HOH L . 
D 4 HOH 167 1192 1192 HOH HOH L . 
D 4 HOH 168 1197 1197 HOH HOH L . 
D 4 HOH 169 1203 1203 HOH HOH L . 
D 4 HOH 170 1205 1205 HOH HOH L . 
D 4 HOH 171 1212 1212 HOH HOH L . 
D 4 HOH 172 1213 1213 HOH HOH L . 
D 4 HOH 173 1214 1214 HOH HOH L . 
D 4 HOH 174 1216 1216 HOH HOH L . 
D 4 HOH 175 1221 1221 HOH HOH L . 
D 4 HOH 176 1222 1222 HOH HOH L . 
D 4 HOH 177 1224 1224 HOH HOH L . 
D 4 HOH 178 1228 1228 HOH HOH L . 
D 4 HOH 179 1229 1229 HOH HOH L . 
D 4 HOH 180 1232 1232 HOH HOH L . 
D 4 HOH 181 1234 1234 HOH HOH L . 
D 4 HOH 182 1235 1235 HOH HOH L . 
D 4 HOH 183 1240 1240 HOH HOH L . 
D 4 HOH 184 1243 1243 HOH HOH L . 
D 4 HOH 185 1244 1244 HOH HOH L . 
D 4 HOH 186 1247 1247 HOH HOH L . 
D 4 HOH 187 1248 1248 HOH HOH L . 
D 4 HOH 188 1250 1250 HOH HOH L . 
D 4 HOH 189 1254 1254 HOH HOH L . 
D 4 HOH 190 1256 1256 HOH HOH L . 
D 4 HOH 191 1260 1260 HOH HOH L . 
D 4 HOH 192 1264 1264 HOH HOH L . 
D 4 HOH 193 1267 1267 HOH HOH L . 
D 4 HOH 194 1270 1270 HOH HOH L . 
D 4 HOH 195 1271 1271 HOH HOH L . 
D 4 HOH 196 1273 1273 HOH HOH L . 
D 4 HOH 197 1276 1276 HOH HOH L . 
D 4 HOH 198 1277 1277 HOH HOH L . 
D 4 HOH 199 1281 1281 HOH HOH L . 
D 4 HOH 200 1282 1282 HOH HOH L . 
D 4 HOH 201 1287 1287 HOH HOH L . 
D 4 HOH 202 1289 1289 HOH HOH L . 
D 4 HOH 203 1292 1292 HOH HOH L . 
D 4 HOH 204 1293 1293 HOH HOH L . 
D 4 HOH 205 1294 1294 HOH HOH L . 
D 4 HOH 206 1300 1300 HOH HOH L . 
D 4 HOH 207 1302 1302 HOH HOH L . 
D 4 HOH 208 1304 1304 HOH HOH L . 
D 4 HOH 209 1305 1305 HOH HOH L . 
D 4 HOH 210 1306 1306 HOH HOH L . 
D 4 HOH 211 1307 1307 HOH HOH L . 
D 4 HOH 212 1308 1308 HOH HOH L . 
D 4 HOH 213 1309 1309 HOH HOH L . 
D 4 HOH 214 1310 1310 HOH HOH L . 
D 4 HOH 215 1317 1317 HOH HOH L . 
D 4 HOH 216 1318 1318 HOH HOH L . 
D 4 HOH 217 1319 1319 HOH HOH L . 
D 4 HOH 218 1324 1324 HOH HOH L . 
D 4 HOH 219 1328 1328 HOH HOH L . 
D 4 HOH 220 1342 1342 HOH HOH L . 
D 4 HOH 221 1344 1344 HOH HOH L . 
D 4 HOH 222 1347 1347 HOH HOH L . 
D 4 HOH 223 1353 1353 HOH HOH L . 
D 4 HOH 224 1354 1354 HOH HOH L . 
D 4 HOH 225 1355 1355 HOH HOH L . 
D 4 HOH 226 1357 1357 HOH HOH L . 
D 4 HOH 227 1358 1358 HOH HOH L . 
E 4 HOH 1   721  721  HOH HOH H . 
E 4 HOH 2   725  725  HOH HOH H . 
E 4 HOH 3   727  727  HOH HOH H . 
E 4 HOH 4   729  729  HOH HOH H . 
E 4 HOH 5   730  730  HOH HOH H . 
E 4 HOH 6   731  731  HOH HOH H . 
E 4 HOH 7   732  732  HOH HOH H . 
E 4 HOH 8   733  733  HOH HOH H . 
E 4 HOH 9   735  735  HOH HOH H . 
E 4 HOH 10  737  737  HOH HOH H . 
E 4 HOH 11  738  738  HOH HOH H . 
E 4 HOH 12  739  739  HOH HOH H . 
E 4 HOH 13  740  740  HOH HOH H . 
E 4 HOH 14  741  741  HOH HOH H . 
E 4 HOH 15  746  746  HOH HOH H . 
E 4 HOH 16  751  751  HOH HOH H . 
E 4 HOH 17  752  752  HOH HOH H . 
E 4 HOH 18  753  753  HOH HOH H . 
E 4 HOH 19  759  759  HOH HOH H . 
E 4 HOH 20  760  760  HOH HOH H . 
E 4 HOH 21  768  768  HOH HOH H . 
E 4 HOH 22  770  770  HOH HOH H . 
E 4 HOH 23  772  772  HOH HOH H . 
E 4 HOH 24  774  774  HOH HOH H . 
E 4 HOH 25  776  776  HOH HOH H . 
E 4 HOH 26  779  779  HOH HOH H . 
E 4 HOH 27  784  784  HOH HOH H . 
E 4 HOH 28  785  785  HOH HOH H . 
E 4 HOH 29  787  787  HOH HOH H . 
E 4 HOH 30  792  792  HOH HOH H . 
E 4 HOH 31  794  794  HOH HOH H . 
E 4 HOH 32  798  798  HOH HOH H . 
E 4 HOH 33  799  799  HOH HOH H . 
E 4 HOH 34  804  804  HOH HOH H . 
E 4 HOH 35  805  805  HOH HOH H . 
E 4 HOH 36  807  807  HOH HOH H . 
E 4 HOH 37  811  811  HOH HOH H . 
E 4 HOH 38  814  814  HOH HOH H . 
E 4 HOH 39  815  815  HOH HOH H . 
E 4 HOH 40  816  816  HOH HOH H . 
E 4 HOH 41  819  819  HOH HOH H . 
E 4 HOH 42  823  823  HOH HOH H . 
E 4 HOH 43  824  824  HOH HOH H . 
E 4 HOH 44  831  831  HOH HOH H . 
E 4 HOH 45  834  834  HOH HOH H . 
E 4 HOH 46  835  835  HOH HOH H . 
E 4 HOH 47  840  840  HOH HOH H . 
E 4 HOH 48  841  841  HOH HOH H . 
E 4 HOH 49  843  843  HOH HOH H . 
E 4 HOH 50  846  846  HOH HOH H . 
E 4 HOH 51  849  849  HOH HOH H . 
E 4 HOH 52  851  851  HOH HOH H . 
E 4 HOH 53  852  852  HOH HOH H . 
E 4 HOH 54  855  855  HOH HOH H . 
E 4 HOH 55  856  856  HOH HOH H . 
E 4 HOH 56  862  862  HOH HOH H . 
E 4 HOH 57  863  863  HOH HOH H . 
E 4 HOH 58  865  865  HOH HOH H . 
E 4 HOH 59  872  872  HOH HOH H . 
E 4 HOH 60  876  876  HOH HOH H . 
E 4 HOH 61  877  877  HOH HOH H . 
E 4 HOH 62  879  879  HOH HOH H . 
E 4 HOH 63  882  882  HOH HOH H . 
E 4 HOH 64  885  885  HOH HOH H . 
E 4 HOH 65  888  888  HOH HOH H . 
E 4 HOH 66  889  889  HOH HOH H . 
E 4 HOH 67  891  891  HOH HOH H . 
E 4 HOH 68  897  897  HOH HOH H . 
E 4 HOH 69  898  898  HOH HOH H . 
E 4 HOH 70  899  899  HOH HOH H . 
E 4 HOH 71  901  901  HOH HOH H . 
E 4 HOH 72  905  905  HOH HOH H . 
E 4 HOH 73  906  906  HOH HOH H . 
E 4 HOH 74  907  907  HOH HOH H . 
E 4 HOH 75  913  913  HOH HOH H . 
E 4 HOH 76  917  917  HOH HOH H . 
E 4 HOH 77  920  920  HOH HOH H . 
E 4 HOH 78  921  921  HOH HOH H . 
E 4 HOH 79  924  924  HOH HOH H . 
E 4 HOH 80  927  927  HOH HOH H . 
E 4 HOH 81  929  929  HOH HOH H . 
E 4 HOH 82  930  930  HOH HOH H . 
E 4 HOH 83  932  932  HOH HOH H . 
E 4 HOH 84  935  935  HOH HOH H . 
E 4 HOH 85  936  936  HOH HOH H . 
E 4 HOH 86  937  937  HOH HOH H . 
E 4 HOH 87  938  938  HOH HOH H . 
E 4 HOH 88  942  942  HOH HOH H . 
E 4 HOH 89  945  945  HOH HOH H . 
E 4 HOH 90  948  948  HOH HOH H . 
E 4 HOH 91  950  950  HOH HOH H . 
E 4 HOH 92  953  953  HOH HOH H . 
E 4 HOH 93  956  956  HOH HOH H . 
E 4 HOH 94  957  957  HOH HOH H . 
E 4 HOH 95  958  958  HOH HOH H . 
E 4 HOH 96  960  960  HOH HOH H . 
E 4 HOH 97  961  961  HOH HOH H . 
E 4 HOH 98  962  962  HOH HOH H . 
E 4 HOH 99  964  964  HOH HOH H . 
E 4 HOH 100 967  967  HOH HOH H . 
E 4 HOH 101 968  968  HOH HOH H . 
E 4 HOH 102 969  969  HOH HOH H . 
E 4 HOH 103 971  971  HOH HOH H . 
E 4 HOH 104 972  972  HOH HOH H . 
E 4 HOH 105 977  977  HOH HOH H . 
E 4 HOH 106 979  979  HOH HOH H . 
E 4 HOH 107 981  981  HOH HOH H . 
E 4 HOH 108 985  985  HOH HOH H . 
E 4 HOH 109 986  986  HOH HOH H . 
E 4 HOH 110 987  987  HOH HOH H . 
E 4 HOH 111 988  988  HOH HOH H . 
E 4 HOH 112 989  989  HOH HOH H . 
E 4 HOH 113 991  991  HOH HOH H . 
E 4 HOH 114 992  992  HOH HOH H . 
E 4 HOH 115 993  993  HOH HOH H . 
E 4 HOH 116 998  998  HOH HOH H . 
E 4 HOH 117 999  999  HOH HOH H . 
E 4 HOH 118 1005 1005 HOH HOH H . 
E 4 HOH 119 1009 1009 HOH HOH H . 
E 4 HOH 120 1014 1014 HOH HOH H . 
E 4 HOH 121 1020 1020 HOH HOH H . 
E 4 HOH 122 1021 1021 HOH HOH H . 
E 4 HOH 123 1023 1023 HOH HOH H . 
E 4 HOH 124 1024 1024 HOH HOH H . 
E 4 HOH 125 1025 1025 HOH HOH H . 
E 4 HOH 126 1029 1029 HOH HOH H . 
E 4 HOH 127 1031 1031 HOH HOH H . 
E 4 HOH 128 1032 1032 HOH HOH H . 
E 4 HOH 129 1033 1033 HOH HOH H . 
E 4 HOH 130 1037 1037 HOH HOH H . 
E 4 HOH 131 1038 1038 HOH HOH H . 
E 4 HOH 132 1040 1040 HOH HOH H . 
E 4 HOH 133 1041 1041 HOH HOH H . 
E 4 HOH 134 1044 1044 HOH HOH H . 
E 4 HOH 135 1045 1045 HOH HOH H . 
E 4 HOH 136 1048 1048 HOH HOH H . 
E 4 HOH 137 1049 1049 HOH HOH H . 
E 4 HOH 138 1055 1055 HOH HOH H . 
E 4 HOH 139 1056 1056 HOH HOH H . 
E 4 HOH 140 1065 1065 HOH HOH H . 
E 4 HOH 141 1066 1066 HOH HOH H . 
E 4 HOH 142 1081 1081 HOH HOH H . 
E 4 HOH 143 1084 1084 HOH HOH H . 
E 4 HOH 144 1090 1090 HOH HOH H . 
E 4 HOH 145 1097 1097 HOH HOH H . 
E 4 HOH 146 1098 1098 HOH HOH H . 
E 4 HOH 147 1099 1099 HOH HOH H . 
E 4 HOH 148 1100 1100 HOH HOH H . 
E 4 HOH 149 1101 1101 HOH HOH H . 
E 4 HOH 150 1106 1106 HOH HOH H . 
E 4 HOH 151 1107 1107 HOH HOH H . 
E 4 HOH 152 1108 1108 HOH HOH H . 
E 4 HOH 153 1122 1122 HOH HOH H . 
E 4 HOH 154 1125 1125 HOH HOH H . 
E 4 HOH 155 1127 1127 HOH HOH H . 
E 4 HOH 156 1129 1129 HOH HOH H . 
E 4 HOH 157 1131 1131 HOH HOH H . 
E 4 HOH 158 1133 1133 HOH HOH H . 
E 4 HOH 159 1134 1134 HOH HOH H . 
E 4 HOH 160 1144 1144 HOH HOH H . 
E 4 HOH 161 1145 1145 HOH HOH H . 
E 4 HOH 162 1147 1147 HOH HOH H . 
E 4 HOH 163 1153 1153 HOH HOH H . 
E 4 HOH 164 1161 1161 HOH HOH H . 
E 4 HOH 165 1163 1163 HOH HOH H . 
E 4 HOH 166 1164 1164 HOH HOH H . 
E 4 HOH 167 1165 1165 HOH HOH H . 
E 4 HOH 168 1172 1172 HOH HOH H . 
E 4 HOH 169 1175 1175 HOH HOH H . 
E 4 HOH 170 1176 1176 HOH HOH H . 
E 4 HOH 171 1177 1177 HOH HOH H . 
E 4 HOH 172 1178 1178 HOH HOH H . 
E 4 HOH 173 1181 1181 HOH HOH H . 
E 4 HOH 174 1186 1186 HOH HOH H . 
E 4 HOH 175 1193 1193 HOH HOH H . 
E 4 HOH 176 1195 1195 HOH HOH H . 
E 4 HOH 177 1196 1196 HOH HOH H . 
E 4 HOH 178 1198 1198 HOH HOH H . 
E 4 HOH 179 1199 1199 HOH HOH H . 
E 4 HOH 180 1200 1200 HOH HOH H . 
E 4 HOH 181 1201 1201 HOH HOH H . 
E 4 HOH 182 1207 1207 HOH HOH H . 
E 4 HOH 183 1208 1208 HOH HOH H . 
E 4 HOH 184 1209 1209 HOH HOH H . 
E 4 HOH 185 1211 1211 HOH HOH H . 
E 4 HOH 186 1215 1215 HOH HOH H . 
E 4 HOH 187 1217 1217 HOH HOH H . 
E 4 HOH 188 1218 1218 HOH HOH H . 
E 4 HOH 189 1230 1230 HOH HOH H . 
E 4 HOH 190 1233 1233 HOH HOH H . 
E 4 HOH 191 1236 1236 HOH HOH H . 
E 4 HOH 192 1237 1237 HOH HOH H . 
E 4 HOH 193 1238 1238 HOH HOH H . 
E 4 HOH 194 1241 1241 HOH HOH H . 
E 4 HOH 195 1245 1245 HOH HOH H . 
E 4 HOH 196 1251 1251 HOH HOH H . 
E 4 HOH 197 1252 1252 HOH HOH H . 
E 4 HOH 198 1253 1253 HOH HOH H . 
E 4 HOH 199 1255 1255 HOH HOH H . 
E 4 HOH 200 1258 1258 HOH HOH H . 
E 4 HOH 201 1278 1278 HOH HOH H . 
E 4 HOH 202 1283 1283 HOH HOH H . 
E 4 HOH 203 1285 1285 HOH HOH H . 
E 4 HOH 204 1286 1286 HOH HOH H . 
E 4 HOH 205 1290 1290 HOH HOH H . 
E 4 HOH 206 1295 1295 HOH HOH H . 
E 4 HOH 207 1297 1297 HOH HOH H . 
E 4 HOH 208 1299 1299 HOH HOH H . 
E 4 HOH 209 1301 1301 HOH HOH H . 
E 4 HOH 210 1312 1312 HOH HOH H . 
E 4 HOH 211 1313 1313 HOH HOH H . 
E 4 HOH 212 1315 1315 HOH HOH H . 
E 4 HOH 213 1316 1316 HOH HOH H . 
E 4 HOH 214 1320 1320 HOH HOH H . 
E 4 HOH 215 1323 1323 HOH HOH H . 
E 4 HOH 216 1327 1327 HOH HOH H . 
E 4 HOH 217 1329 1329 HOH HOH H . 
E 4 HOH 218 1333 1333 HOH HOH H . 
E 4 HOH 219 1334 1334 HOH HOH H . 
E 4 HOH 220 1335 1335 HOH HOH H . 
E 4 HOH 221 1336 1336 HOH HOH H . 
E 4 HOH 222 1337 1337 HOH HOH H . 
E 4 HOH 223 1341 1341 HOH HOH H . 
E 4 HOH 224 1345 1345 HOH HOH H . 
E 4 HOH 225 1346 1346 HOH HOH H . 
E 4 HOH 226 1348 1348 HOH HOH H . 
E 4 HOH 227 1352 1352 HOH HOH H . 
E 4 HOH 228 1356 1356 HOH HOH H . 
F 4 HOH 1   722  722  HOH HOH A . 
F 4 HOH 2   723  723  HOH HOH A . 
F 4 HOH 3   726  726  HOH HOH A . 
F 4 HOH 4   734  734  HOH HOH A . 
F 4 HOH 5   736  736  HOH HOH A . 
F 4 HOH 6   749  749  HOH HOH A . 
F 4 HOH 7   756  756  HOH HOH A . 
F 4 HOH 8   757  757  HOH HOH A . 
F 4 HOH 9   762  762  HOH HOH A . 
F 4 HOH 10  764  764  HOH HOH A . 
F 4 HOH 11  769  769  HOH HOH A . 
F 4 HOH 12  775  775  HOH HOH A . 
F 4 HOH 13  780  780  HOH HOH A . 
F 4 HOH 14  782  782  HOH HOH A . 
F 4 HOH 15  783  783  HOH HOH A . 
F 4 HOH 16  788  788  HOH HOH A . 
F 4 HOH 17  790  790  HOH HOH A . 
F 4 HOH 18  796  796  HOH HOH A . 
F 4 HOH 19  800  800  HOH HOH A . 
F 4 HOH 20  813  813  HOH HOH A . 
F 4 HOH 21  817  817  HOH HOH A . 
F 4 HOH 22  821  821  HOH HOH A . 
F 4 HOH 23  822  822  HOH HOH A . 
F 4 HOH 24  825  825  HOH HOH A . 
F 4 HOH 25  826  826  HOH HOH A . 
F 4 HOH 26  827  827  HOH HOH A . 
F 4 HOH 27  829  829  HOH HOH A . 
F 4 HOH 28  832  832  HOH HOH A . 
F 4 HOH 29  836  836  HOH HOH A . 
F 4 HOH 30  839  839  HOH HOH A . 
F 4 HOH 31  842  842  HOH HOH A . 
F 4 HOH 32  845  845  HOH HOH A . 
F 4 HOH 33  858  858  HOH HOH A . 
F 4 HOH 34  860  860  HOH HOH A . 
F 4 HOH 35  864  864  HOH HOH A . 
F 4 HOH 36  868  868  HOH HOH A . 
F 4 HOH 37  871  871  HOH HOH A . 
F 4 HOH 38  874  874  HOH HOH A . 
F 4 HOH 39  880  880  HOH HOH A . 
F 4 HOH 40  883  883  HOH HOH A . 
F 4 HOH 41  890  890  HOH HOH A . 
F 4 HOH 42  893  893  HOH HOH A . 
F 4 HOH 43  909  909  HOH HOH A . 
F 4 HOH 44  910  910  HOH HOH A . 
F 4 HOH 45  914  914  HOH HOH A . 
F 4 HOH 46  916  916  HOH HOH A . 
F 4 HOH 47  918  918  HOH HOH A . 
F 4 HOH 48  919  919  HOH HOH A . 
F 4 HOH 49  925  925  HOH HOH A . 
F 4 HOH 50  933  933  HOH HOH A . 
F 4 HOH 51  934  934  HOH HOH A . 
F 4 HOH 52  939  939  HOH HOH A . 
F 4 HOH 53  944  944  HOH HOH A . 
F 4 HOH 54  946  946  HOH HOH A . 
F 4 HOH 55  951  951  HOH HOH A . 
F 4 HOH 56  959  959  HOH HOH A . 
F 4 HOH 57  963  963  HOH HOH A . 
F 4 HOH 58  965  965  HOH HOH A . 
F 4 HOH 59  974  974  HOH HOH A . 
F 4 HOH 60  975  975  HOH HOH A . 
F 4 HOH 61  976  976  HOH HOH A . 
F 4 HOH 62  980  980  HOH HOH A . 
F 4 HOH 63  983  983  HOH HOH A . 
F 4 HOH 64  990  990  HOH HOH A . 
F 4 HOH 65  995  995  HOH HOH A . 
F 4 HOH 66  997  997  HOH HOH A . 
F 4 HOH 67  1000 1000 HOH HOH A . 
F 4 HOH 68  1001 1001 HOH HOH A . 
F 4 HOH 69  1002 1002 HOH HOH A . 
F 4 HOH 70  1003 1003 HOH HOH A . 
F 4 HOH 71  1004 1004 HOH HOH A . 
F 4 HOH 72  1007 1007 HOH HOH A . 
F 4 HOH 73  1008 1008 HOH HOH A . 
F 4 HOH 74  1010 1010 HOH HOH A . 
F 4 HOH 75  1011 1011 HOH HOH A . 
F 4 HOH 76  1015 1015 HOH HOH A . 
F 4 HOH 77  1017 1017 HOH HOH A . 
F 4 HOH 78  1018 1018 HOH HOH A . 
F 4 HOH 79  1022 1022 HOH HOH A . 
F 4 HOH 80  1026 1026 HOH HOH A . 
F 4 HOH 81  1028 1028 HOH HOH A . 
F 4 HOH 82  1030 1030 HOH HOH A . 
F 4 HOH 83  1043 1043 HOH HOH A . 
F 4 HOH 84  1046 1046 HOH HOH A . 
F 4 HOH 85  1050 1050 HOH HOH A . 
F 4 HOH 86  1051 1051 HOH HOH A . 
F 4 HOH 87  1058 1058 HOH HOH A . 
F 4 HOH 88  1063 1063 HOH HOH A . 
F 4 HOH 89  1064 1064 HOH HOH A . 
F 4 HOH 90  1067 1067 HOH HOH A . 
F 4 HOH 91  1072 1072 HOH HOH A . 
F 4 HOH 92  1076 1076 HOH HOH A . 
F 4 HOH 93  1083 1083 HOH HOH A . 
F 4 HOH 94  1085 1085 HOH HOH A . 
F 4 HOH 95  1087 1087 HOH HOH A . 
F 4 HOH 96  1092 1092 HOH HOH A . 
F 4 HOH 97  1093 1093 HOH HOH A . 
F 4 HOH 98  1094 1094 HOH HOH A . 
F 4 HOH 99  1111 1111 HOH HOH A . 
F 4 HOH 100 1112 1112 HOH HOH A . 
F 4 HOH 101 1113 1113 HOH HOH A . 
F 4 HOH 102 1114 1114 HOH HOH A . 
F 4 HOH 103 1115 1115 HOH HOH A . 
F 4 HOH 104 1117 1117 HOH HOH A . 
F 4 HOH 105 1121 1121 HOH HOH A . 
F 4 HOH 106 1123 1123 HOH HOH A . 
F 4 HOH 107 1126 1126 HOH HOH A . 
F 4 HOH 108 1128 1128 HOH HOH A . 
F 4 HOH 109 1130 1130 HOH HOH A . 
F 4 HOH 110 1132 1132 HOH HOH A . 
F 4 HOH 111 1135 1135 HOH HOH A . 
F 4 HOH 112 1136 1136 HOH HOH A . 
F 4 HOH 113 1137 1137 HOH HOH A . 
F 4 HOH 114 1139 1139 HOH HOH A . 
F 4 HOH 115 1140 1140 HOH HOH A . 
F 4 HOH 116 1142 1142 HOH HOH A . 
F 4 HOH 117 1149 1149 HOH HOH A . 
F 4 HOH 118 1151 1151 HOH HOH A . 
F 4 HOH 119 1152 1152 HOH HOH A . 
F 4 HOH 120 1154 1154 HOH HOH A . 
F 4 HOH 121 1156 1156 HOH HOH A . 
F 4 HOH 122 1160 1160 HOH HOH A . 
F 4 HOH 123 1162 1162 HOH HOH A . 
F 4 HOH 124 1167 1167 HOH HOH A . 
F 4 HOH 125 1170 1170 HOH HOH A . 
F 4 HOH 126 1173 1173 HOH HOH A . 
F 4 HOH 127 1190 1190 HOH HOH A . 
F 4 HOH 128 1191 1191 HOH HOH A . 
F 4 HOH 129 1194 1194 HOH HOH A . 
F 4 HOH 130 1202 1202 HOH HOH A . 
F 4 HOH 131 1204 1204 HOH HOH A . 
F 4 HOH 132 1206 1206 HOH HOH A . 
F 4 HOH 133 1210 1210 HOH HOH A . 
F 4 HOH 134 1219 1219 HOH HOH A . 
F 4 HOH 135 1220 1220 HOH HOH A . 
F 4 HOH 136 1223 1223 HOH HOH A . 
F 4 HOH 137 1225 1225 HOH HOH A . 
F 4 HOH 138 1226 1226 HOH HOH A . 
F 4 HOH 139 1227 1227 HOH HOH A . 
F 4 HOH 140 1231 1231 HOH HOH A . 
F 4 HOH 141 1239 1239 HOH HOH A . 
F 4 HOH 142 1242 1242 HOH HOH A . 
F 4 HOH 143 1246 1246 HOH HOH A . 
F 4 HOH 144 1249 1249 HOH HOH A . 
F 4 HOH 145 1257 1257 HOH HOH A . 
F 4 HOH 146 1259 1259 HOH HOH A . 
F 4 HOH 147 1261 1261 HOH HOH A . 
F 4 HOH 148 1262 1262 HOH HOH A . 
F 4 HOH 149 1263 1263 HOH HOH A . 
F 4 HOH 150 1265 1265 HOH HOH A . 
F 4 HOH 151 1266 1266 HOH HOH A . 
F 4 HOH 152 1268 1268 HOH HOH A . 
F 4 HOH 153 1269 1269 HOH HOH A . 
F 4 HOH 154 1272 1272 HOH HOH A . 
F 4 HOH 155 1274 1274 HOH HOH A . 
F 4 HOH 156 1275 1275 HOH HOH A . 
F 4 HOH 157 1279 1279 HOH HOH A . 
F 4 HOH 158 1280 1280 HOH HOH A . 
F 4 HOH 159 1284 1284 HOH HOH A . 
F 4 HOH 160 1288 1288 HOH HOH A . 
F 4 HOH 161 1291 1291 HOH HOH A . 
F 4 HOH 162 1296 1296 HOH HOH A . 
F 4 HOH 163 1298 1298 HOH HOH A . 
F 4 HOH 164 1303 1303 HOH HOH A . 
F 4 HOH 165 1311 1311 HOH HOH A . 
F 4 HOH 166 1314 1314 HOH HOH A . 
F 4 HOH 167 1321 1321 HOH HOH A . 
F 4 HOH 168 1322 1322 HOH HOH A . 
F 4 HOH 169 1325 1325 HOH HOH A . 
F 4 HOH 170 1326 1326 HOH HOH A . 
F 4 HOH 171 1330 1330 HOH HOH A . 
F 4 HOH 172 1331 1331 HOH HOH A . 
F 4 HOH 173 1332 1332 HOH HOH A . 
F 4 HOH 174 1338 1338 HOH HOH A . 
F 4 HOH 175 1339 1339 HOH HOH A . 
F 4 HOH 176 1340 1340 HOH HOH A . 
F 4 HOH 177 1343 1343 HOH HOH A . 
F 4 HOH 178 1349 1349 HOH HOH A . 
F 4 HOH 179 1350 1350 HOH HOH A . 
F 4 HOH 180 1351 1351 HOH HOH A . 
F 4 HOH 181 1359 1359 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1226 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   F 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-10-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
# 
_software.name             CNS 
_software.classification   refinement 
_software.version          0.4 
_software.citation_id      ? 
_software.pdbx_ordinal     1 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CA L LEU 33  ? ? CB L LEU 33  ? ? CG L LEU 33  ? ? 98.57 115.30 -16.73 2.30 N 
2 1 N  L CYS 214 ? ? CA L CYS 214 ? ? C  L CYS 214 ? ? 93.16 111.00 -17.84 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 THR L 51  ? ? 63.94   -44.86  
2  1 ALA L 84  ? ? -172.55 -176.34 
3  1 SER L 171 ? ? 58.59   19.81   
4  1 SER H 229 ? ? 81.45   -5.03   
5  1 SER H 298 ? ? 24.69   76.59   
6  1 SER H 383 ? ? -148.05 -29.88  
7  1 GLN H 394 ? ? -83.61  -86.72  
8  1 ASP H 396 ? ? 75.43   -1.22   
9  1 ASP H 437 ? ? -63.97  56.03   
10 1 TRP A 550 ? ? -125.08 -101.17 
11 1 HIS A 559 ? ? -127.72 -127.26 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 H ALA 352 ? B ALA 138 
2 1 Y 1 H ALA 353 ? B ALA 139 
3 1 Y 1 H GLN 354 ? B GLN 140 
4 1 Y 1 H THR 355 ? B THR 141 
5 1 Y 1 H ASN 356 ? B ASN 142 
# 
_pdbx_entity_nonpoly.entity_id   4 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#