data_1FPV
# 
_entry.id   1FPV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FPV         
WWPDB D_1000173375 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FPV 
_pdbx_database_status.recvd_initial_deposition_date   1993-03-04 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Agbandje, M.'   1 
'Rossmann, M.G.' 2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure determination of feline panleukopenia virus empty particles.' Proteins                   16  155  171 1993 
PSFGEY US 0887-3585 0867 ? 8392729 10.1002/prot.340160204 
1       'Determination and Refinement of the Canine Parvovirus Empty Capsid Structure' 'To be Published'          ?   ?    ?   ? ? 
?  ?         0353 ? ?       ?                      
2       'The Canine Parvovirus Empty Capsid Structure' J.Mol.Biol.                233 231  ?   1993 JMOBAK UK 0022-2836 0070 ? ? ? 
3       'Structure Determination of Monoclinic Canine Parvovirus' 'Acta Crystallogr.,Sect.B' 48  75   ?   1992 ASBSDK DK 0108-7681 
0622 ? ?       ?                      
4       
;Mapping Specific Functions in the Capsid Structure of Canine Parvovirus and Feline Panleukopenia Virus Using Infectious Plasmid Clones
;
Virology                   183 195  ?   1991 VIRLAX US 0042-6822 0922 ? ?       ?                      
5       'The Three-Dimensional Structure of Canine Parvovirus and its Functional Implications' Science                    251 1456 
?   1991 SCIEAS US 0036-8075 0038 ? ?       ?                      
6       'Preliminary X-Ray Crystallographic Analysis of Canine Parvovirus Crystals' J.Mol.Biol.                200 209  ?   1988 
JMOBAK UK 0022-2836 0070 ? ?       ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Agbandje, M.'     1  
primary 'McKenna, R.'      2  
primary 'Rossmann, M.G.'   3  
primary 'Strassheim, M.L.' 4  
primary 'Parrish, C.R.'    5  
1       'Wu, H.'           6  
1       'Keller, W.'       7  
1       'Rossmann, M.G.'   8  
2       'Wu, H.'           9  
2       'Rossmann, M.G.'   10 
3       'Tsao, J.'         11 
3       'Chapman, M.S.'    12 
3       'Wu, H.'           13 
3       'Agbandje, M.'     14 
3       'Keller, W.'       15 
3       'Rossmann, M.G.'   16 
4       'Parrish, C.R.'    17 
5       'Tsao, J.'         18 
5       'Chapman, M.S.'    19 
5       'Agbandje, M.'     20 
5       'Keller, W.'       21 
5       'Smith, K.'        22 
5       'Wu, H.'           23 
5       'Luo, M.'          24 
5       'Smith, T.J.'      25 
5       'Rossmann, M.G.'   26 
5       'Compans, R.W.'    27 
5       'Parrish, C.R.'    28 
6       'Luo, M.'          29 
6       'Tsao, J.'         30 
6       'Rossmann, M.G.'   31 
6       'Basak, S.'        32 
6       'Compans, R.W.'    33 
# 
_cell.entry_id           1FPV 
_cell.length_a           380.100 
_cell.length_b           379.300 
_cell.length_c           350.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FPV 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'FELINE PANLEUKOPENIA VIRUS (STRAIN B) VIRAL PROTEIN 2' 
_entity.formula_weight             64763.699 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSDGAVQPDGGQPAVRNERATGSGNGSGGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYK
RVVVNNMDKTAVKGNMALDDIHVEIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSESATQP
PTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDD
VQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMG
NTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTY
IAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKP
RLHINAPFVCQNNCPGQLFVKVAPNLTNQYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFN
YVPNNIGAMKIVYEKSQLAPRKLY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSDGAVQPDGGQPAVRNERATGSGNGSGGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYK
RVVVNNMDKTAVKGNMALDDIHVEIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSESATQP
PTKVYNNDLTASLMVALDSNNTMPFTPAAMRSETLGFYPWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDD
VQFYTIENSVPVHLLRTGDEFATGTFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMG
NTDYITEATIMRPAEVGYSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTY
IAHQDTGRYPEGDWIQNINFNLPVTNDNVLLPTDPIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKP
RLHINAPFVCQNNCPGQLFVKVAPNLTNQYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFN
YVPNNIGAMKIVYEKSQLAPRKLY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASP n 
1 4   GLY n 
1 5   ALA n 
1 6   VAL n 
1 7   GLN n 
1 8   PRO n 
1 9   ASP n 
1 10  GLY n 
1 11  GLY n 
1 12  GLN n 
1 13  PRO n 
1 14  ALA n 
1 15  VAL n 
1 16  ARG n 
1 17  ASN n 
1 18  GLU n 
1 19  ARG n 
1 20  ALA n 
1 21  THR n 
1 22  GLY n 
1 23  SER n 
1 24  GLY n 
1 25  ASN n 
1 26  GLY n 
1 27  SER n 
1 28  GLY n 
1 29  GLY n 
1 30  GLY n 
1 31  GLY n 
1 32  GLY n 
1 33  GLY n 
1 34  GLY n 
1 35  SER n 
1 36  GLY n 
1 37  GLY n 
1 38  VAL n 
1 39  GLY n 
1 40  ILE n 
1 41  SER n 
1 42  THR n 
1 43  GLY n 
1 44  THR n 
1 45  PHE n 
1 46  ASN n 
1 47  ASN n 
1 48  GLN n 
1 49  THR n 
1 50  GLU n 
1 51  PHE n 
1 52  LYS n 
1 53  PHE n 
1 54  LEU n 
1 55  GLU n 
1 56  ASN n 
1 57  GLY n 
1 58  TRP n 
1 59  VAL n 
1 60  GLU n 
1 61  ILE n 
1 62  THR n 
1 63  ALA n 
1 64  ASN n 
1 65  SER n 
1 66  SER n 
1 67  ARG n 
1 68  LEU n 
1 69  VAL n 
1 70  HIS n 
1 71  LEU n 
1 72  ASN n 
1 73  MET n 
1 74  PRO n 
1 75  GLU n 
1 76  SER n 
1 77  GLU n 
1 78  ASN n 
1 79  TYR n 
1 80  LYS n 
1 81  ARG n 
1 82  VAL n 
1 83  VAL n 
1 84  VAL n 
1 85  ASN n 
1 86  ASN n 
1 87  MET n 
1 88  ASP n 
1 89  LYS n 
1 90  THR n 
1 91  ALA n 
1 92  VAL n 
1 93  LYS n 
1 94  GLY n 
1 95  ASN n 
1 96  MET n 
1 97  ALA n 
1 98  LEU n 
1 99  ASP n 
1 100 ASP n 
1 101 ILE n 
1 102 HIS n 
1 103 VAL n 
1 104 GLU n 
1 105 ILE n 
1 106 VAL n 
1 107 THR n 
1 108 PRO n 
1 109 TRP n 
1 110 SER n 
1 111 LEU n 
1 112 VAL n 
1 113 ASP n 
1 114 ALA n 
1 115 ASN n 
1 116 ALA n 
1 117 TRP n 
1 118 GLY n 
1 119 VAL n 
1 120 TRP n 
1 121 PHE n 
1 122 ASN n 
1 123 PRO n 
1 124 GLY n 
1 125 ASP n 
1 126 TRP n 
1 127 GLN n 
1 128 LEU n 
1 129 ILE n 
1 130 VAL n 
1 131 ASN n 
1 132 THR n 
1 133 MET n 
1 134 SER n 
1 135 GLU n 
1 136 LEU n 
1 137 HIS n 
1 138 LEU n 
1 139 VAL n 
1 140 SER n 
1 141 PHE n 
1 142 GLU n 
1 143 GLN n 
1 144 GLU n 
1 145 ILE n 
1 146 PHE n 
1 147 ASN n 
1 148 VAL n 
1 149 VAL n 
1 150 LEU n 
1 151 LYS n 
1 152 THR n 
1 153 VAL n 
1 154 SER n 
1 155 GLU n 
1 156 SER n 
1 157 ALA n 
1 158 THR n 
1 159 GLN n 
1 160 PRO n 
1 161 PRO n 
1 162 THR n 
1 163 LYS n 
1 164 VAL n 
1 165 TYR n 
1 166 ASN n 
1 167 ASN n 
1 168 ASP n 
1 169 LEU n 
1 170 THR n 
1 171 ALA n 
1 172 SER n 
1 173 LEU n 
1 174 MET n 
1 175 VAL n 
1 176 ALA n 
1 177 LEU n 
1 178 ASP n 
1 179 SER n 
1 180 ASN n 
1 181 ASN n 
1 182 THR n 
1 183 MET n 
1 184 PRO n 
1 185 PHE n 
1 186 THR n 
1 187 PRO n 
1 188 ALA n 
1 189 ALA n 
1 190 MET n 
1 191 ARG n 
1 192 SER n 
1 193 GLU n 
1 194 THR n 
1 195 LEU n 
1 196 GLY n 
1 197 PHE n 
1 198 TYR n 
1 199 PRO n 
1 200 TRP n 
1 201 LYS n 
1 202 PRO n 
1 203 THR n 
1 204 ILE n 
1 205 PRO n 
1 206 THR n 
1 207 PRO n 
1 208 TRP n 
1 209 ARG n 
1 210 TYR n 
1 211 TYR n 
1 212 PHE n 
1 213 GLN n 
1 214 TRP n 
1 215 ASP n 
1 216 ARG n 
1 217 THR n 
1 218 LEU n 
1 219 ILE n 
1 220 PRO n 
1 221 SER n 
1 222 HIS n 
1 223 THR n 
1 224 GLY n 
1 225 THR n 
1 226 SER n 
1 227 GLY n 
1 228 THR n 
1 229 PRO n 
1 230 THR n 
1 231 ASN n 
1 232 VAL n 
1 233 TYR n 
1 234 HIS n 
1 235 GLY n 
1 236 THR n 
1 237 ASP n 
1 238 PRO n 
1 239 ASP n 
1 240 ASP n 
1 241 VAL n 
1 242 GLN n 
1 243 PHE n 
1 244 TYR n 
1 245 THR n 
1 246 ILE n 
1 247 GLU n 
1 248 ASN n 
1 249 SER n 
1 250 VAL n 
1 251 PRO n 
1 252 VAL n 
1 253 HIS n 
1 254 LEU n 
1 255 LEU n 
1 256 ARG n 
1 257 THR n 
1 258 GLY n 
1 259 ASP n 
1 260 GLU n 
1 261 PHE n 
1 262 ALA n 
1 263 THR n 
1 264 GLY n 
1 265 THR n 
1 266 PHE n 
1 267 PHE n 
1 268 PHE n 
1 269 ASP n 
1 270 CYS n 
1 271 LYS n 
1 272 PRO n 
1 273 CYS n 
1 274 ARG n 
1 275 LEU n 
1 276 THR n 
1 277 HIS n 
1 278 THR n 
1 279 TRP n 
1 280 GLN n 
1 281 THR n 
1 282 ASN n 
1 283 ARG n 
1 284 ALA n 
1 285 LEU n 
1 286 GLY n 
1 287 LEU n 
1 288 PRO n 
1 289 PRO n 
1 290 PHE n 
1 291 LEU n 
1 292 ASN n 
1 293 SER n 
1 294 LEU n 
1 295 PRO n 
1 296 GLN n 
1 297 SER n 
1 298 GLU n 
1 299 GLY n 
1 300 ALA n 
1 301 THR n 
1 302 ASN n 
1 303 PHE n 
1 304 GLY n 
1 305 ASP n 
1 306 ILE n 
1 307 GLY n 
1 308 VAL n 
1 309 GLN n 
1 310 GLN n 
1 311 ASP n 
1 312 LYS n 
1 313 ARG n 
1 314 ARG n 
1 315 GLY n 
1 316 VAL n 
1 317 THR n 
1 318 GLN n 
1 319 MET n 
1 320 GLY n 
1 321 ASN n 
1 322 THR n 
1 323 ASP n 
1 324 TYR n 
1 325 ILE n 
1 326 THR n 
1 327 GLU n 
1 328 ALA n 
1 329 THR n 
1 330 ILE n 
1 331 MET n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 GLU n 
1 336 VAL n 
1 337 GLY n 
1 338 TYR n 
1 339 SER n 
1 340 ALA n 
1 341 PRO n 
1 342 TYR n 
1 343 TYR n 
1 344 SER n 
1 345 PHE n 
1 346 GLU n 
1 347 ALA n 
1 348 SER n 
1 349 THR n 
1 350 GLN n 
1 351 GLY n 
1 352 PRO n 
1 353 PHE n 
1 354 LYS n 
1 355 THR n 
1 356 PRO n 
1 357 ILE n 
1 358 ALA n 
1 359 ALA n 
1 360 GLY n 
1 361 ARG n 
1 362 GLY n 
1 363 GLY n 
1 364 ALA n 
1 365 GLN n 
1 366 THR n 
1 367 ASP n 
1 368 GLU n 
1 369 ASN n 
1 370 GLN n 
1 371 ALA n 
1 372 ALA n 
1 373 ASP n 
1 374 GLY n 
1 375 ASP n 
1 376 PRO n 
1 377 ARG n 
1 378 TYR n 
1 379 ALA n 
1 380 PHE n 
1 381 GLY n 
1 382 ARG n 
1 383 GLN n 
1 384 HIS n 
1 385 GLY n 
1 386 GLN n 
1 387 LYS n 
1 388 THR n 
1 389 THR n 
1 390 THR n 
1 391 THR n 
1 392 GLY n 
1 393 GLU n 
1 394 THR n 
1 395 PRO n 
1 396 GLU n 
1 397 ARG n 
1 398 PHE n 
1 399 THR n 
1 400 TYR n 
1 401 ILE n 
1 402 ALA n 
1 403 HIS n 
1 404 GLN n 
1 405 ASP n 
1 406 THR n 
1 407 GLY n 
1 408 ARG n 
1 409 TYR n 
1 410 PRO n 
1 411 GLU n 
1 412 GLY n 
1 413 ASP n 
1 414 TRP n 
1 415 ILE n 
1 416 GLN n 
1 417 ASN n 
1 418 ILE n 
1 419 ASN n 
1 420 PHE n 
1 421 ASN n 
1 422 LEU n 
1 423 PRO n 
1 424 VAL n 
1 425 THR n 
1 426 ASN n 
1 427 ASP n 
1 428 ASN n 
1 429 VAL n 
1 430 LEU n 
1 431 LEU n 
1 432 PRO n 
1 433 THR n 
1 434 ASP n 
1 435 PRO n 
1 436 ILE n 
1 437 GLY n 
1 438 GLY n 
1 439 LYS n 
1 440 THR n 
1 441 GLY n 
1 442 ILE n 
1 443 ASN n 
1 444 TYR n 
1 445 THR n 
1 446 ASN n 
1 447 ILE n 
1 448 PHE n 
1 449 ASN n 
1 450 THR n 
1 451 TYR n 
1 452 GLY n 
1 453 PRO n 
1 454 LEU n 
1 455 THR n 
1 456 ALA n 
1 457 LEU n 
1 458 ASN n 
1 459 ASN n 
1 460 VAL n 
1 461 PRO n 
1 462 PRO n 
1 463 VAL n 
1 464 TYR n 
1 465 PRO n 
1 466 ASN n 
1 467 GLY n 
1 468 GLN n 
1 469 ILE n 
1 470 TRP n 
1 471 ASP n 
1 472 LYS n 
1 473 GLU n 
1 474 PHE n 
1 475 ASP n 
1 476 THR n 
1 477 ASP n 
1 478 LEU n 
1 479 LYS n 
1 480 PRO n 
1 481 ARG n 
1 482 LEU n 
1 483 HIS n 
1 484 ILE n 
1 485 ASN n 
1 486 ALA n 
1 487 PRO n 
1 488 PHE n 
1 489 VAL n 
1 490 CYS n 
1 491 GLN n 
1 492 ASN n 
1 493 ASN n 
1 494 CYS n 
1 495 PRO n 
1 496 GLY n 
1 497 GLN n 
1 498 LEU n 
1 499 PHE n 
1 500 VAL n 
1 501 LYS n 
1 502 VAL n 
1 503 ALA n 
1 504 PRO n 
1 505 ASN n 
1 506 LEU n 
1 507 THR n 
1 508 ASN n 
1 509 GLN n 
1 510 TYR n 
1 511 ASP n 
1 512 PRO n 
1 513 ASP n 
1 514 ALA n 
1 515 SER n 
1 516 ALA n 
1 517 ASN n 
1 518 MET n 
1 519 SER n 
1 520 ARG n 
1 521 ILE n 
1 522 VAL n 
1 523 THR n 
1 524 TYR n 
1 525 SER n 
1 526 ASP n 
1 527 PHE n 
1 528 TRP n 
1 529 TRP n 
1 530 LYS n 
1 531 GLY n 
1 532 LYS n 
1 533 LEU n 
1 534 VAL n 
1 535 PHE n 
1 536 LYS n 
1 537 ALA n 
1 538 LYS n 
1 539 LEU n 
1 540 ARG n 
1 541 ALA n 
1 542 SER n 
1 543 HIS n 
1 544 THR n 
1 545 TRP n 
1 546 ASN n 
1 547 PRO n 
1 548 ILE n 
1 549 GLN n 
1 550 GLN n 
1 551 MET n 
1 552 SER n 
1 553 ILE n 
1 554 ASN n 
1 555 VAL n 
1 556 ASP n 
1 557 ASN n 
1 558 GLN n 
1 559 PHE n 
1 560 ASN n 
1 561 TYR n 
1 562 VAL n 
1 563 PRO n 
1 564 ASN n 
1 565 ASN n 
1 566 ILE n 
1 567 GLY n 
1 568 ALA n 
1 569 MET n 
1 570 LYS n 
1 571 ILE n 
1 572 VAL n 
1 573 TYR n 
1 574 GLU n 
1 575 LYS n 
1 576 SER n 
1 577 GLN n 
1 578 LEU n 
1 579 ALA n 
1 580 PRO n 
1 581 ARG n 
1 582 LYS n 
1 583 LEU n 
1 584 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Parvovirus 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'STRAIN B' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Feline panleukopenia virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10786 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    COAT_FPV19 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P24840 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAPPAKRARRGLVPPGYKYLGPGNSLDQGEPTNPSDAAAKEHDEAYAAYLRSGKNPYLYFSPADQRFIDQTKDAKDWGGK
IGHYFFRAKKAIAPVLTDTPDHPSTSRPTKPTKRSKPPPHIFINLAKKKKAGAGQVKRDNLAPMSDGAVQPDGGQPAVRN
ERATGSGNGSGGGGGGGSGGVGISTGTFNNQTEFKFLENGWVEITANSSRLVHLNMPESENYKRVVVNNMDKTAVKGNMA
LDDIHVQIVTPWSLVDANAWGVWFNPGDWQLIVNTMSELHLVSFEQEIFNVVLKTVSESATQPPTKVYNNDLTASLMVAL
DSNNTMPFTPAAMRSETLGFYPWKPTIPTPWRYYFQWDRTLIPSHTGTSGTPTNVYHGTDPDDVQFYTIENSVPVHLLRT
GDEFATGTFFFDCKPCRLTHTWQTNRALGLPPFLNSLPQSEGATNFGDIGVQQDKRRGVTQMGNTDYITEATIMRPAEVG
YSAPYYSFEASTQGPFKTPIAAGRGGAQTDENQAADGDPRYAFGRQHGQKTTTTGETPERFTYIAHQDTGRYPEGDWIQN
INFNLPVTNDNVLLPTDPIGGKTGINYTNIFNTYGPLTALNNVPPVYPNGQIWDKEFDTDLKPRLHVNAPFVCQNNCPGQ
LFVKVAPNLTNEYDPDASANMSRIVTYSDFWWKGKLVFKAKLRASHTWNPIQQMSINVDNQFNYVPNNIGAMKIVYEKSQ
LAPRKLY
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1FPV 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 584 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P24840 
_struct_ref_seq.db_align_beg                  144 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  727 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       584 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1FPV GLU A 104 ? UNP P24840 GLN 247 CONFLICT 104 1 
1 1FPV ILE A 484 ? UNP P24840 VAL 627 CONFLICT 484 2 
1 1FPV GLN A 509 ? UNP P24840 GLU 652 CONFLICT 509 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FPV 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.entry_id                                 1FPV 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            3.3 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4350 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4350 
_refine_hist.d_res_high                       3.3 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  1FPV 
_struct.title                     'STRUCTURE DETERMINATION OF FELINE PANLEUKOPENIA VIRUS EMPTY PARTICLES' 
_struct.pdbx_descriptor           'FELINE PANLEUKOPENIA VIRUS (STRAIN B) VIRAL PROTEIN 2' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FPV 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'PANLEUKEMIA VIRUS COAT PROTEIN, Icosahedral virus, Virus' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 A0 TRP A 117 ? PHE A 121 ? TRP A 117 PHE A 121 1 ? 5  
HELX_P HELX_P2 A1 ASN A 122 ? THR A 132 ? ASN A 122 THR A 132 1 ? 11 
HELX_P HELX_P3 B  ILE A 246 ? SER A 249 ? ILE A 246 SER A 249 1 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            disulf1 
_struct_conn.conn_type_id                  disulf 
_struct_conn.pdbx_leaving_atom_flag        ? 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           A 
_struct_conn.ptnr1_label_comp_id           CYS 
_struct_conn.ptnr1_label_seq_id            490 
_struct_conn.ptnr1_label_atom_id           SG 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           A 
_struct_conn.ptnr2_label_comp_id           CYS 
_struct_conn.ptnr2_label_seq_id            494 
_struct_conn.ptnr2_label_atom_id           SG 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            A 
_struct_conn.ptnr1_auth_comp_id            CYS 
_struct_conn.ptnr1_auth_seq_id             490 
_struct_conn.ptnr2_auth_asym_id            A 
_struct_conn.ptnr2_auth_comp_id            CYS 
_struct_conn.ptnr2_auth_seq_id             494 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               2.042 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 160 A . ? PRO 160 A PRO 161 A ? PRO 161 A 1 -4.27 
2 LEU 422 A . ? LEU 422 A PRO 423 A ? PRO 423 A 1 2.54  
3 TYR 464 A . ? TYR 464 A PRO 465 A ? PRO 465 A 1 -7.98 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
BDG ? 5 ? 
CDG ? 5 ? 
CHF ? 4 ? 
CYL ? 2 ? 
LP2 ? 2 ? 
L2  ? 2 ? 
LP4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
BDG 1 2 ? anti-parallel 
BDG 2 3 ? anti-parallel 
BDG 3 4 ? anti-parallel 
BDG 4 5 ? anti-parallel 
CDG 1 2 ? anti-parallel 
CDG 2 3 ? anti-parallel 
CDG 3 4 ? anti-parallel 
CDG 4 5 ? anti-parallel 
CHF 1 2 ? anti-parallel 
CHF 2 3 ? anti-parallel 
CHF 3 4 ? anti-parallel 
CYL 1 2 ? anti-parallel 
LP2 1 2 ? anti-parallel 
L2  1 2 ? anti-parallel 
LP4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
BDG 1 GLN A 48  ? LEU A 54  ? GLN A 48  LEU A 54  
BDG 2 TRP A 58  ? LEU A 71  ? TRP A 58  LEU A 71  
BDG 3 THR A 523 ? LYS A 538 ? THR A 523 LYS A 538 
BDG 4 SER A 134 ? LEU A 150 ? SER A 134 LEU A 150 
BDG 5 PHE A 261 ? PHE A 267 ? PHE A 261 PHE A 267 
CDG 1 GLN A 48  ? LEU A 54  ? GLN A 48  LEU A 54  
CDG 2 TRP A 58  ? LEU A 71  ? TRP A 58  LEU A 71  
CDG 3 THR A 523 ? LYS A 538 ? THR A 523 LYS A 538 
CDG 4 SER A 134 ? LEU A 150 ? SER A 134 LEU A 150 
CDG 5 CYS A 273 ? LEU A 275 ? CYS A 273 LEU A 275 
CHF 1 SER A 110 ? VAL A 112 ? SER A 110 VAL A 112 
CHF 2 LEU A 498 ? LYS A 501 ? LEU A 498 LYS A 501 
CHF 3 LEU A 173 ? LEU A 177 ? LEU A 173 LEU A 177 
CHF 4 VAL A 252 ? LEU A 255 ? VAL A 252 LEU A 255 
CYL 1 LYS A 151 ? SER A 156 ? LYS A 151 SER A 156 
CYL 2 THR A 162 ? ASP A 168 ? THR A 162 ASP A 168 
LP2 1 VAL A 103 ? LEU A 111 ? VAL A 103 LEU A 111 
LP2 2 THR A 206 ? TYR A 211 ? THR A 206 TYR A 211 
L2  1 ASP A 215 ? LEU A 218 ? ASP A 215 LEU A 218 
L2  2 THR A 230 ? GLY A 235 ? THR A 230 GLY A 235 
LP4 1 ILE A 415 ? ASN A 417 ? ILE A 415 ASN A 417 
LP4 2 VAL A 429 ? LEU A 430 ? VAL A 429 LEU A 430 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
BDG 1 2 O LYS A 52  ? O LYS A 52  N GLU A 60  ? N GLU A 60  
BDG 2 3 O LEU A 71  ? O LEU A 71  N SER A 525 ? N SER A 525 
BDG 3 4 N LYS A 538 ? N LYS A 538 O GLU A 135 ? O GLU A 135 
BDG 4 5 O ILE A 145 ? O ILE A 145 N PHE A 261 ? N PHE A 261 
CDG 1 2 O LYS A 52  ? O LYS A 52  N GLU A 60  ? N GLU A 60  
CDG 2 3 O LEU A 71  ? O LEU A 71  N SER A 525 ? N SER A 525 
CDG 3 4 N LYS A 538 ? N LYS A 538 O GLU A 135 ? O GLU A 135 
CDG 4 5 O LEU A 136 ? O LEU A 136 N CYS A 273 ? N CYS A 273 
CHF 1 2 O VAL A 112 ? O VAL A 112 N LEU A 498 ? N LEU A 498 
CHF 2 3 O LYS A 501 ? O LYS A 501 N MET A 174 ? N MET A 174 
CHF 3 4 O VAL A 175 ? O VAL A 175 N HIS A 253 ? N HIS A 253 
CYL 1 2 O SER A 156 ? O SER A 156 N THR A 162 ? N THR A 162 
LP2 1 2 O LEU A 111 ? O LEU A 111 N THR A 206 ? N THR A 206 
L2  1 2 N ASP A 215 ? N ASP A 215 O GLY A 235 ? O GLY A 235 
LP4 1 2 N ILE A 415 ? N ILE A 415 O LEU A 430 ? O LEU A 430 
# 
_database_PDB_matrix.entry_id          1FPV 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FPV 
_atom_sites.fract_transf_matrix[1][1]   0.002631 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002850 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_sites_footnote.id 
_atom_sites_footnote.text 
1 'CIS PROLINE - PRO     161' 
2 'CIS PROLINE - PRO     423' 
3 'CIS PROLINE - PRO     465' 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . GLY A 1 37  ? 45.322  -2.638  79.585  1.00 0.00 ? 37  GLY A N   1 
ATOM 2    C CA  . GLY A 1 37  ? 44.416  -3.100  80.690  1.00 0.00 ? 37  GLY A CA  1 
ATOM 3    C C   . GLY A 1 37  ? 44.175  -2.224  81.980  1.00 0.00 ? 37  GLY A C   1 
ATOM 4    O O   . GLY A 1 37  ? 43.120  -1.602  82.143  1.00 0.00 ? 37  GLY A O   1 
ATOM 5    N N   . VAL A 1 38  ? 45.160  -2.246  82.882  1.00 0.00 ? 38  VAL A N   1 
ATOM 6    C CA  . VAL A 1 38  ? 45.081  -1.756  84.324  1.00 0.00 ? 38  VAL A CA  1 
ATOM 7    C C   . VAL A 1 38  ? 44.689  -0.273  84.689  1.00 0.00 ? 38  VAL A C   1 
ATOM 8    O O   . VAL A 1 38  ? 44.790  0.140   85.865  1.00 0.00 ? 38  VAL A O   1 
ATOM 9    C CB  . VAL A 1 38  ? 46.439  -1.916  85.006  1.00 0.00 ? 38  VAL A CB  1 
ATOM 10   C CG1 . VAL A 1 38  ? 47.614  -1.615  84.075  1.00 0.00 ? 38  VAL A CG1 1 
ATOM 11   C CG2 . VAL A 1 38  ? 46.615  -0.995  86.213  1.00 0.00 ? 38  VAL A CG2 1 
ATOM 12   N N   . GLY A 1 39  ? 44.221  0.550   83.767  1.00 0.00 ? 39  GLY A N   1 
ATOM 13   C CA  . GLY A 1 39  ? 43.863  1.975   84.091  1.00 0.00 ? 39  GLY A CA  1 
ATOM 14   C C   . GLY A 1 39  ? 42.367  2.118   84.428  1.00 0.00 ? 39  GLY A C   1 
ATOM 15   O O   . GLY A 1 39  ? 41.890  3.203   84.826  1.00 0.00 ? 39  GLY A O   1 
ATOM 16   N N   . ILE A 1 40  ? 42.088  1.209   83.540  1.00 0.00 ? 40  ILE A N   1 
ATOM 17   C CA  . ILE A 1 40  ? 40.727  1.671   83.232  1.00 0.00 ? 40  ILE A CA  1 
ATOM 18   C C   . ILE A 1 40  ? 39.650  0.716   83.903  1.00 0.00 ? 40  ILE A C   1 
ATOM 19   O O   . ILE A 1 40  ? 39.889  -0.489  84.083  1.00 0.00 ? 40  ILE A O   1 
ATOM 20   C CB  . ILE A 1 40  ? 40.525  1.710   81.715  1.00 0.00 ? 40  ILE A CB  1 
ATOM 21   C CG1 . ILE A 1 40  ? 41.228  2.894   81.049  1.00 0.00 ? 40  ILE A CG1 1 
ATOM 22   C CG2 . ILE A 1 40  ? 39.054  1.820   81.310  1.00 0.00 ? 40  ILE A CG2 1 
ATOM 23   C CD1 . ILE A 1 40  ? 42.094  2.482   79.856  1.00 0.00 ? 40  ILE A CD1 1 
ATOM 24   N N   . SER A 1 41  ? 38.468  1.350   84.233  1.00 0.00 ? 41  SER A N   1 
ATOM 25   C CA  . SER A 1 41  ? 37.301  0.656   84.949  1.00 0.00 ? 41  SER A CA  1 
ATOM 26   C C   . SER A 1 41  ? 36.578  -0.331  83.999  1.00 0.00 ? 41  SER A C   1 
ATOM 27   O O   . SER A 1 41  ? 36.563  -0.160  82.774  1.00 0.00 ? 41  SER A O   1 
ATOM 28   C CB  . SER A 1 41  ? 36.312  1.689   85.453  1.00 0.00 ? 41  SER A CB  1 
ATOM 29   O OG  . SER A 1 41  ? 36.345  1.736   86.873  1.00 0.00 ? 41  SER A OG  1 
ATOM 30   N N   . THR A 1 42  ? 35.978  -1.312  84.601  1.00 0.00 ? 42  THR A N   1 
ATOM 31   C CA  . THR A 1 42  ? 35.393  -2.403  83.886  1.00 0.00 ? 42  THR A CA  1 
ATOM 32   C C   . THR A 1 42  ? 33.841  -2.434  84.035  1.00 0.00 ? 42  THR A C   1 
ATOM 33   O O   . THR A 1 42  ? 33.123  -2.971  83.173  1.00 0.00 ? 42  THR A O   1 
ATOM 34   C CB  . THR A 1 42  ? 35.971  -3.698  84.396  1.00 0.00 ? 42  THR A CB  1 
ATOM 35   O OG1 . THR A 1 42  ? 36.989  -3.437  85.350  1.00 0.00 ? 42  THR A OG1 1 
ATOM 36   C CG2 . THR A 1 42  ? 36.589  -4.552  83.287  1.00 0.00 ? 42  THR A CG2 1 
ATOM 37   N N   . GLY A 1 43  ? 33.356  -1.866  85.113  1.00 0.00 ? 43  GLY A N   1 
ATOM 38   C CA  . GLY A 1 43  ? 31.912  -1.892  85.410  1.00 0.00 ? 43  GLY A CA  1 
ATOM 39   C C   . GLY A 1 43  ? 31.465  -0.637  86.138  1.00 0.00 ? 43  GLY A C   1 
ATOM 40   O O   . GLY A 1 43  ? 32.238  0.324   86.293  1.00 0.00 ? 43  GLY A O   1 
ATOM 41   N N   . THR A 1 44  ? 30.209  -0.711  86.552  1.00 0.00 ? 44  THR A N   1 
ATOM 42   C CA  . THR A 1 44  ? 29.527  0.342   87.280  1.00 0.00 ? 44  THR A CA  1 
ATOM 43   C C   . THR A 1 44  ? 28.768  -0.275  88.466  1.00 0.00 ? 44  THR A C   1 
ATOM 44   O O   . THR A 1 44  ? 28.481  -1.482  88.483  1.00 0.00 ? 44  THR A O   1 
ATOM 45   C CB  . THR A 1 44  ? 28.519  1.037   86.354  1.00 0.00 ? 44  THR A CB  1 
ATOM 46   O OG1 . THR A 1 44  ? 29.206  1.800   85.373  1.00 0.00 ? 44  THR A OG1 1 
ATOM 47   C CG2 . THR A 1 44  ? 27.575  1.980   87.096  1.00 0.00 ? 44  THR A CG2 1 
ATOM 48   N N   . PHE A 1 45  ? 28.468  0.591   89.419  1.00 0.00 ? 45  PHE A N   1 
ATOM 49   C CA  . PHE A 1 45  ? 27.757  0.233   90.663  1.00 0.00 ? 45  PHE A CA  1 
ATOM 50   C C   . PHE A 1 45  ? 26.285  0.654   90.561  1.00 0.00 ? 45  PHE A C   1 
ATOM 51   O O   . PHE A 1 45  ? 25.969  1.775   90.138  1.00 0.00 ? 45  PHE A O   1 
ATOM 52   C CB  . PHE A 1 45  ? 28.418  0.965   91.837  1.00 0.00 ? 45  PHE A CB  1 
ATOM 53   C CG  . PHE A 1 45  ? 27.903  0.534   93.212  1.00 0.00 ? 45  PHE A CG  1 
ATOM 54   C CD1 . PHE A 1 45  ? 26.527  0.508   93.470  1.00 0.00 ? 45  PHE A CD1 1 
ATOM 55   C CD2 . PHE A 1 45  ? 28.811  0.172   94.214  1.00 0.00 ? 45  PHE A CD2 1 
ATOM 56   C CE1 . PHE A 1 45  ? 26.060  0.122   94.733  1.00 0.00 ? 45  PHE A CE1 1 
ATOM 57   C CE2 . PHE A 1 45  ? 28.344  -0.213  95.477  1.00 0.00 ? 45  PHE A CE2 1 
ATOM 58   C CZ  . PHE A 1 45  ? 26.968  -0.238  95.736  1.00 0.00 ? 45  PHE A CZ  1 
ATOM 59   N N   . ASN A 1 46  ? 25.412  -0.262  90.956  1.00 0.00 ? 46  ASN A N   1 
ATOM 60   C CA  . ASN A 1 46  ? 23.955  -0.032  90.918  1.00 0.00 ? 46  ASN A CA  1 
ATOM 61   C C   . ASN A 1 46  ? 23.229  -0.930  91.926  1.00 0.00 ? 46  ASN A C   1 
ATOM 62   O O   . ASN A 1 46  ? 23.182  -2.159  91.770  1.00 0.00 ? 46  ASN A O   1 
ATOM 63   C CB  . ASN A 1 46  ? 23.409  -0.343  89.521  1.00 0.00 ? 46  ASN A CB  1 
ATOM 64   C CG  . ASN A 1 46  ? 21.938  0.046   89.352  1.00 0.00 ? 46  ASN A CG  1 
ATOM 65   O OD1 . ASN A 1 46  ? 21.060  -0.595  89.929  1.00 0.00 ? 46  ASN A OD1 1 
ATOM 66   N ND2 . ASN A 1 46  ? 21.610  1.070   88.586  1.00 0.00 ? 46  ASN A ND2 1 
ATOM 67   N N   . ASN A 1 47  ? 22.677  -0.275  92.933  1.00 0.00 ? 47  ASN A N   1 
ATOM 68   C CA  . ASN A 1 47  ? 21.910  -0.941  93.998  1.00 0.00 ? 47  ASN A CA  1 
ATOM 69   C C   . ASN A 1 47  ? 20.570  -0.229  94.188  1.00 0.00 ? 47  ASN A C   1 
ATOM 70   O O   . ASN A 1 47  ? 20.166  0.081   95.320  1.00 0.00 ? 47  ASN A O   1 
ATOM 71   C CB  . ASN A 1 47  ? 22.688  -0.918  95.313  1.00 0.00 ? 47  ASN A CB  1 
ATOM 72   C CG  . ASN A 1 47  ? 22.567  -2.233  96.088  1.00 0.00 ? 47  ASN A CG  1 
ATOM 73   O OD1 . ASN A 1 47  ? 21.640  -2.399  96.879  1.00 0.00 ? 47  ASN A OD1 1 
ATOM 74   N ND2 . ASN A 1 47  ? 23.457  -3.191  95.904  1.00 0.00 ? 47  ASN A ND2 1 
ATOM 75   N N   . GLN A 1 48  ? 19.891  -0.151  93.179  1.00 0.00 ? 48  GLN A N   1 
ATOM 76   C CA  . GLN A 1 48  ? 18.651  0.577   92.891  1.00 0.00 ? 48  GLN A CA  1 
ATOM 77   C C   . GLN A 1 48  ? 17.489  -0.415  92.793  1.00 0.00 ? 48  GLN A C   1 
ATOM 78   O O   . GLN A 1 48  ? 17.677  -1.581  92.417  1.00 0.00 ? 48  GLN A O   1 
ATOM 79   C CB  . GLN A 1 48  ? 18.788  1.309   91.551  1.00 0.00 ? 48  GLN A CB  1 
ATOM 80   C CG  . GLN A 1 48  ? 18.259  2.744   91.576  1.00 0.00 ? 48  GLN A CG  1 
ATOM 81   C CD  . GLN A 1 48  ? 18.445  3.467   90.237  1.00 0.00 ? 48  GLN A CD  1 
ATOM 82   O OE1 . GLN A 1 48  ? 17.909  4.557   90.045  1.00 0.00 ? 48  GLN A OE1 1 
ATOM 83   N NE2 . GLN A 1 48  ? 19.182  2.918   89.288  1.00 0.00 ? 48  GLN A NE2 1 
ATOM 84   N N   . THR A 1 49  ? 16.363  -0.080  93.210  1.00 0.00 ? 49  THR A N   1 
ATOM 85   C CA  . THR A 1 49  ? 15.182  -0.947  93.060  1.00 0.00 ? 49  THR A CA  1 
ATOM 86   C C   . THR A 1 49  ? 14.168  -0.252  92.099  1.00 0.00 ? 49  THR A C   1 
ATOM 87   O O   . THR A 1 49  ? 13.528  0.749   92.455  1.00 0.00 ? 49  THR A O   1 
ATOM 88   C CB  . THR A 1 49  ? 14.552  -1.202  94.432  1.00 0.00 ? 49  THR A CB  1 
ATOM 89   O OG1 . THR A 1 49  ? 15.493  -1.833  95.289  1.00 0.00 ? 49  THR A OG1 1 
ATOM 90   C CG2 . THR A 1 49  ? 13.318  -2.104  94.365  1.00 0.00 ? 49  THR A CG2 1 
ATOM 91   N N   . GLU A 1 50  ? 14.043  -0.804  90.880  1.00 0.00 ? 50  GLU A N   1 
ATOM 92   C CA  . GLU A 1 50  ? 13.162  -0.244  89.804  1.00 0.00 ? 50  GLU A CA  1 
ATOM 93   C C   . GLU A 1 50  ? 11.828  -1.021  89.665  1.00 0.00 ? 50  GLU A C   1 
ATOM 94   O O   . GLU A 1 50  ? 11.817  -2.254  89.542  1.00 0.00 ? 50  GLU A O   1 
ATOM 95   C CB  . GLU A 1 50  ? 13.862  -0.330  88.435  1.00 0.00 ? 50  GLU A CB  1 
ATOM 96   C CG  . GLU A 1 50  ? 15.134  0.521   88.338  1.00 0.00 ? 50  GLU A CG  1 
ATOM 97   C CD  . GLU A 1 50  ? 16.053  0.098   87.183  1.00 0.00 ? 50  GLU A CD  1 
ATOM 98   O OE1 . GLU A 1 50  ? 15.566  -0.096  86.003  1.00 0.00 ? 50  GLU A OE1 1 
ATOM 99   O OE2 . GLU A 1 50  ? 17.317  -0.067  87.389  1.00 0.00 ? 50  GLU A OE2 1 
ATOM 100  N N   . PHE A 1 51  ? 10.732  -0.251  89.674  1.00 0.00 ? 51  PHE A N   1 
ATOM 101  C CA  . PHE A 1 51  ? 9.342   -0.774  89.532  1.00 0.00 ? 51  PHE A CA  1 
ATOM 102  C C   . PHE A 1 51  ? 8.711   -0.228  88.230  1.00 0.00 ? 51  PHE A C   1 
ATOM 103  O O   . PHE A 1 51  ? 8.482   1.003   88.171  1.00 0.00 ? 51  PHE A O   1 
ATOM 104  C CB  . PHE A 1 51  ? 8.485   -0.335  90.722  1.00 0.00 ? 51  PHE A CB  1 
ATOM 105  C CG  . PHE A 1 51  ? 8.860   -1.041  92.028  1.00 0.00 ? 51  PHE A CG  1 
ATOM 106  C CD1 . PHE A 1 51  ? 10.053  -0.712  92.682  1.00 0.00 ? 51  PHE A CD1 1 
ATOM 107  C CD2 . PHE A 1 51  ? 8.011   -2.015  92.569  1.00 0.00 ? 51  PHE A CD2 1 
ATOM 108  C CE1 . PHE A 1 51  ? 10.397  -1.354  93.877  1.00 0.00 ? 51  PHE A CE1 1 
ATOM 109  C CE2 . PHE A 1 51  ? 8.355   -2.657  93.765  1.00 0.00 ? 51  PHE A CE2 1 
ATOM 110  C CZ  . PHE A 1 51  ? 9.548   -2.326  94.419  1.00 0.00 ? 51  PHE A CZ  1 
ATOM 111  N N   . LYS A 1 52  ? 8.437   -1.056  87.243  1.00 0.00 ? 52  LYS A N   1 
ATOM 112  C CA  . LYS A 1 52  ? 7.845   -0.547  85.999  1.00 0.00 ? 52  LYS A CA  1 
ATOM 113  C C   . LYS A 1 52  ? 6.491   -1.170  85.687  1.00 0.00 ? 52  LYS A C   1 
ATOM 114  O O   . LYS A 1 52  ? 6.385   -2.269  85.184  1.00 0.00 ? 52  LYS A O   1 
ATOM 115  C CB  . LYS A 1 52  ? 8.786   -0.773  84.851  1.00 0.00 ? 52  LYS A CB  1 
ATOM 116  C CG  . LYS A 1 52  ? 8.135   -0.921  83.480  1.00 0.00 ? 52  LYS A CG  1 
ATOM 117  C CD  . LYS A 1 52  ? 9.229   -1.481  82.571  1.00 0.00 ? 52  LYS A CD  1 
ATOM 118  C CE  . LYS A 1 52  ? 8.736   -1.823  81.178  1.00 0.00 ? 52  LYS A CE  1 
ATOM 119  N NZ  . LYS A 1 52  ? 9.851   -1.599  80.173  1.00 0.00 ? 52  LYS A NZ  1 
ATOM 120  N N   . PHE A 1 53  ? 5.469   -0.403  85.990  1.00 0.00 ? 53  PHE A N   1 
ATOM 121  C CA  . PHE A 1 53  ? 4.062   -0.684  85.797  1.00 0.00 ? 53  PHE A CA  1 
ATOM 122  C C   . PHE A 1 53  ? 3.754   -0.850  84.310  1.00 0.00 ? 53  PHE A C   1 
ATOM 123  O O   . PHE A 1 53  ? 4.051   0.012   83.491  1.00 0.00 ? 53  PHE A O   1 
ATOM 124  C CB  . PHE A 1 53  ? 3.230   0.444   86.443  1.00 0.00 ? 53  PHE A CB  1 
ATOM 125  C CG  . PHE A 1 53  ? 3.637   0.664   87.861  1.00 0.00 ? 53  PHE A CG  1 
ATOM 126  C CD1 . PHE A 1 53  ? 3.162   -0.196  88.819  1.00 0.00 ? 53  PHE A CD1 1 
ATOM 127  C CD2 . PHE A 1 53  ? 4.482   1.675   88.239  1.00 0.00 ? 53  PHE A CD2 1 
ATOM 128  C CE1 . PHE A 1 53  ? 3.483   -0.095  90.181  1.00 0.00 ? 53  PHE A CE1 1 
ATOM 129  C CE2 . PHE A 1 53  ? 4.825   1.820   89.574  1.00 0.00 ? 53  PHE A CE2 1 
ATOM 130  C CZ  . PHE A 1 53  ? 4.337   0.945   90.564  1.00 0.00 ? 53  PHE A CZ  1 
ATOM 131  N N   . LEU A 1 54  ? 3.171   -1.926  83.913  1.00 0.00 ? 54  LEU A N   1 
ATOM 132  C CA  . LEU A 1 54  ? 2.724   -2.396  82.635  1.00 0.00 ? 54  LEU A CA  1 
ATOM 133  C C   . LEU A 1 54  ? 1.222   -2.221  82.473  1.00 0.00 ? 54  LEU A C   1 
ATOM 134  O O   . LEU A 1 54  ? 0.490   -1.389  83.028  1.00 0.00 ? 54  LEU A O   1 
ATOM 135  C CB  . LEU A 1 54  ? 3.082   -3.898  82.535  1.00 0.00 ? 54  LEU A CB  1 
ATOM 136  C CG  . LEU A 1 54  ? 4.523   -4.136  82.174  1.00 0.00 ? 54  LEU A CG  1 
ATOM 137  C CD1 . LEU A 1 54  ? 5.282   -2.876  82.608  1.00 0.00 ? 54  LEU A CD1 1 
ATOM 138  C CD2 . LEU A 1 54  ? 4.994   -5.427  82.844  1.00 0.00 ? 54  LEU A CD2 1 
ATOM 139  N N   . GLU A 1 55  ? 0.605   -3.094  81.673  1.00 0.00 ? 55  GLU A N   1 
ATOM 140  C CA  . GLU A 1 55  ? -0.850  -2.965  81.505  1.00 0.00 ? 55  GLU A CA  1 
ATOM 141  C C   . GLU A 1 55  ? -1.621  -3.985  82.273  1.00 0.00 ? 55  GLU A C   1 
ATOM 142  O O   . GLU A 1 55  ? -1.167  -5.158  82.458  1.00 0.00 ? 55  GLU A O   1 
ATOM 143  C CB  . GLU A 1 55  ? -1.196  -3.183  80.032  1.00 0.00 ? 55  GLU A CB  1 
ATOM 144  C CG  . GLU A 1 55  ? -0.648  -2.112  79.053  1.00 0.00 ? 55  GLU A CG  1 
ATOM 145  C CD  . GLU A 1 55  ? -1.548  -0.885  79.017  1.00 0.00 ? 55  GLU A CD  1 
ATOM 146  O OE1 . GLU A 1 55  ? -2.549  -1.062  79.773  1.00 0.00 ? 55  GLU A OE1 1 
ATOM 147  O OE2 . GLU A 1 55  ? -1.343  0.123   78.350  1.00 0.00 ? 55  GLU A OE2 1 
ATOM 148  N N   . ASN A 1 56  ? -2.777  -3.573  82.692  1.00 0.00 ? 56  ASN A N   1 
ATOM 149  C CA  . ASN A 1 56  ? -3.624  -4.519  83.413  1.00 0.00 ? 56  ASN A CA  1 
ATOM 150  C C   . ASN A 1 56  ? -3.090  -4.977  84.760  1.00 0.00 ? 56  ASN A C   1 
ATOM 151  O O   . ASN A 1 56  ? -3.300  -6.186  85.092  1.00 0.00 ? 56  ASN A O   1 
ATOM 152  C CB  . ASN A 1 56  ? -3.911  -5.810  82.580  1.00 0.00 ? 56  ASN A CB  1 
ATOM 153  C CG  . ASN A 1 56  ? -4.617  -5.491  81.283  1.00 0.00 ? 56  ASN A CG  1 
ATOM 154  O OD1 . ASN A 1 56  ? -4.903  -4.301  80.988  1.00 0.00 ? 56  ASN A OD1 1 
ATOM 155  N ND2 . ASN A 1 56  ? -4.920  -6.500  80.472  1.00 0.00 ? 56  ASN A ND2 1 
ATOM 156  N N   . GLY A 1 57  ? -2.499  -4.049  85.441  1.00 0.00 ? 57  GLY A N   1 
ATOM 157  C CA  . GLY A 1 57  ? -1.955  -4.224  86.765  1.00 0.00 ? 57  GLY A CA  1 
ATOM 158  C C   . GLY A 1 57  ? -0.874  -5.246  86.961  1.00 0.00 ? 57  GLY A C   1 
ATOM 159  O O   . GLY A 1 57  ? -0.959  -6.130  87.842  1.00 0.00 ? 57  GLY A O   1 
ATOM 160  N N   . TRP A 1 58  ? 0.147   -5.139  86.150  1.00 0.00 ? 58  TRP A N   1 
ATOM 161  C CA  . TRP A 1 58  ? 1.291   -6.016  86.210  1.00 0.00 ? 58  TRP A CA  1 
ATOM 162  C C   . TRP A 1 58  ? 2.495   -5.105  86.332  1.00 0.00 ? 58  TRP A C   1 
ATOM 163  O O   . TRP A 1 58  ? 2.625   -4.158  85.572  1.00 0.00 ? 58  TRP A O   1 
ATOM 164  C CB  . TRP A 1 58  ? 1.366   -6.892  84.993  1.00 0.00 ? 58  TRP A CB  1 
ATOM 165  C CG  . TRP A 1 58  ? 0.438   -8.052  85.103  1.00 0.00 ? 58  TRP A CG  1 
ATOM 166  C CD1 . TRP A 1 58  ? -0.791  -8.184  84.538  1.00 0.00 ? 58  TRP A CD1 1 
ATOM 167  C CD2 . TRP A 1 58  ? 0.682   -9.250  85.853  1.00 0.00 ? 58  TRP A CD2 1 
ATOM 168  N NE1 . TRP A 1 58  ? -1.325  -9.402  84.897  1.00 0.00 ? 58  TRP A NE1 1 
ATOM 169  C CE2 . TRP A 1 58  ? -0.434  -10.072 85.692  1.00 0.00 ? 58  TRP A CE2 1 
ATOM 170  C CE3 . TRP A 1 58  ? 1.729   -9.703  86.637  1.00 0.00 ? 58  TRP A CE3 1 
ATOM 171  C CZ2 . TRP A 1 58  ? -0.521  -11.316 86.292  1.00 0.00 ? 58  TRP A CZ2 1 
ATOM 172  C CZ3 . TRP A 1 58  ? 1.645   -10.961 87.236  1.00 0.00 ? 58  TRP A CZ3 1 
ATOM 173  C CH2 . TRP A 1 58  ? 0.532   -11.755 87.078  1.00 0.00 ? 58  TRP A CH2 1 
ATOM 174  N N   . VAL A 1 59  ? 3.341   -5.354  87.268  1.00 0.00 ? 59  VAL A N   1 
ATOM 175  C CA  . VAL A 1 59  ? 4.550   -4.566  87.449  1.00 0.00 ? 59  VAL A CA  1 
ATOM 176  C C   . VAL A 1 59  ? 5.729   -5.514  87.158  1.00 0.00 ? 59  VAL A C   1 
ATOM 177  O O   . VAL A 1 59  ? 5.707   -6.754  87.296  1.00 0.00 ? 59  VAL A O   1 
ATOM 178  C CB  . VAL A 1 59  ? 4.645   -3.952  88.840  1.00 0.00 ? 59  VAL A CB  1 
ATOM 179  C CG1 . VAL A 1 59  ? 3.852   -2.704  88.989  1.00 0.00 ? 59  VAL A CG1 1 
ATOM 180  C CG2 . VAL A 1 59  ? 4.206   -5.003  89.874  1.00 0.00 ? 59  VAL A CG2 1 
ATOM 181  N N   . GLU A 1 60  ? 6.764   -4.821  86.758  1.00 0.00 ? 60  GLU A N   1 
ATOM 182  C CA  . GLU A 1 60  ? 7.989   -5.586  86.459  1.00 0.00 ? 60  GLU A CA  1 
ATOM 183  C C   . GLU A 1 60  ? 9.140   -4.996  87.287  1.00 0.00 ? 60  GLU A C   1 
ATOM 184  O O   . GLU A 1 60  ? 9.751   -3.986  86.906  1.00 0.00 ? 60  GLU A O   1 
ATOM 185  C CB  . GLU A 1 60  ? 8.222   -5.579  84.980  1.00 0.00 ? 60  GLU A CB  1 
ATOM 186  C CG  . GLU A 1 60  ? 9.521   -6.300  84.616  1.00 0.00 ? 60  GLU A CG  1 
ATOM 187  C CD  . GLU A 1 60  ? 10.137  -5.823  83.306  1.00 0.00 ? 60  GLU A CD  1 
ATOM 188  O OE1 . GLU A 1 60  ? 10.710  -4.671  83.243  1.00 0.00 ? 60  GLU A OE1 1 
ATOM 189  O OE2 . GLU A 1 60  ? 10.082  -6.580  82.265  1.00 0.00 ? 60  GLU A OE2 1 
ATOM 190  N N   . ILE A 1 61  ? 9.371   -5.666  88.415  1.00 0.00 ? 61  ILE A N   1 
ATOM 191  C CA  . ILE A 1 61  ? 10.405  -5.292  89.400  1.00 0.00 ? 61  ILE A CA  1 
ATOM 192  C C   . ILE A 1 61  ? 11.757  -5.911  89.030  1.00 0.00 ? 61  ILE A C   1 
ATOM 193  O O   . ILE A 1 61  ? 11.838  -7.082  88.633  1.00 0.00 ? 61  ILE A O   1 
ATOM 194  C CB  . ILE A 1 61  ? 10.018  -5.791  90.799  1.00 0.00 ? 61  ILE A CB  1 
ATOM 195  C CG1 . ILE A 1 61  ? 8.611   -5.365  91.225  1.00 0.00 ? 61  ILE A CG1 1 
ATOM 196  C CG2 . ILE A 1 61  ? 10.953  -5.278  91.898  1.00 0.00 ? 61  ILE A CG2 1 
ATOM 197  C CD1 . ILE A 1 61  ? 7.849   -6.468  91.964  1.00 0.00 ? 61  ILE A CD1 1 
ATOM 198  N N   . THR A 1 62  ? 12.772  -5.086  89.183  1.00 0.00 ? 62  THR A N   1 
ATOM 199  C CA  . THR A 1 62  ? 14.167  -5.444  88.886  1.00 0.00 ? 62  THR A CA  1 
ATOM 200  C C   . THR A 1 62  ? 15.066  -4.889  89.991  1.00 0.00 ? 62  THR A C   1 
ATOM 201  O O   . THR A 1 62  ? 15.363  -3.686  90.029  1.00 0.00 ? 62  THR A O   1 
ATOM 202  C CB  . THR A 1 62  ? 14.570  -4.814  87.550  1.00 0.00 ? 62  THR A CB  1 
ATOM 203  O OG1 . THR A 1 62  ? 13.659  -5.206  86.534  1.00 0.00 ? 62  THR A OG1 1 
ATOM 204  C CG2 . THR A 1 62  ? 15.971  -5.215  87.093  1.00 0.00 ? 62  THR A CG2 1 
ATOM 205  N N   . ALA A 1 63  ? 15.472  -5.785  90.865  1.00 0.00 ? 63  ALA A N   1 
ATOM 206  C CA  . ALA A 1 63  ? 16.344  -5.445  91.997  1.00 0.00 ? 63  ALA A CA  1 
ATOM 207  C C   . ALA A 1 63  ? 17.804  -5.670  91.610  1.00 0.00 ? 63  ALA A C   1 
ATOM 208  O O   . ALA A 1 63  ? 18.168  -6.729  91.077  1.00 0.00 ? 63  ALA A O   1 
ATOM 209  C CB  . ALA A 1 63  ? 16.003  -6.322  93.203  1.00 0.00 ? 63  ALA A CB  1 
ATOM 210  N N   . ASN A 1 64  ? 18.600  -4.659  91.892  1.00 0.00 ? 64  ASN A N   1 
ATOM 211  C CA  . ASN A 1 64  ? 20.039  -4.674  91.601  1.00 0.00 ? 64  ASN A CA  1 
ATOM 212  C C   . ASN A 1 64  ? 20.827  -4.496  92.898  1.00 0.00 ? 64  ASN A C   1 
ATOM 213  O O   . ASN A 1 64  ? 20.579  -3.560  93.672  1.00 0.00 ? 64  ASN A O   1 
ATOM 214  C CB  . ASN A 1 64  ? 20.381  -3.543  90.632  1.00 0.00 ? 64  ASN A CB  1 
ATOM 215  C CG  . ASN A 1 64  ? 19.604  -3.636  89.317  1.00 0.00 ? 64  ASN A CG  1 
ATOM 216  O OD1 . ASN A 1 64  ? 18.876  -2.709  88.966  1.00 0.00 ? 64  ASN A OD1 1 
ATOM 217  N ND2 . ASN A 1 64  ? 19.716  -4.712  88.559  1.00 0.00 ? 64  ASN A ND2 1 
ATOM 218  N N   . SER A 1 65  ? 21.757  -5.411  93.090  1.00 0.00 ? 65  SER A N   1 
ATOM 219  C CA  . SER A 1 65  ? 22.620  -5.430  94.276  1.00 0.00 ? 65  SER A CA  1 
ATOM 220  C C   . SER A 1 65  ? 24.081  -5.604  93.870  1.00 0.00 ? 65  SER A C   1 
ATOM 221  O O   . SER A 1 65  ? 24.545  -6.728  93.621  1.00 0.00 ? 65  SER A O   1 
ATOM 222  C CB  . SER A 1 65  ? 22.225  -6.588  95.192  1.00 0.00 ? 65  SER A CB  1 
ATOM 223  O OG  . SER A 1 65  ? 22.023  -6.112  96.515  1.00 0.00 ? 65  SER A OG  1 
ATOM 224  N N   . SER A 1 66  ? 24.754  -4.475  93.820  1.00 0.00 ? 66  SER A N   1 
ATOM 225  C CA  . SER A 1 66  ? 26.174  -4.406  93.467  1.00 0.00 ? 66  SER A CA  1 
ATOM 226  C C   . SER A 1 66  ? 26.999  -4.220  94.736  1.00 0.00 ? 66  SER A C   1 
ATOM 227  O O   . SER A 1 66  ? 27.189  -3.092  95.214  1.00 0.00 ? 66  SER A O   1 
ATOM 228  C CB  . SER A 1 66  ? 26.424  -3.229  92.524  1.00 0.00 ? 66  SER A CB  1 
ATOM 229  O OG  . SER A 1 66  ? 25.439  -2.228  92.726  1.00 0.00 ? 66  SER A OG  1 
ATOM 230  N N   . ARG A 1 67  ? 27.459  -5.345  95.239  1.00 0.00 ? 67  ARG A N   1 
ATOM 231  C CA  . ARG A 1 67  ? 28.273  -5.398  96.455  1.00 0.00 ? 67  ARG A CA  1 
ATOM 232  C C   . ARG A 1 67  ? 29.732  -5.662  96.095  1.00 0.00 ? 67  ARG A C   1 
ATOM 233  O O   . ARG A 1 67  ? 30.032  -6.348  95.107  1.00 0.00 ? 67  ARG A O   1 
ATOM 234  C CB  . ARG A 1 67  ? 27.777  -6.523  97.366  1.00 0.00 ? 67  ARG A CB  1 
ATOM 235  C CG  . ARG A 1 67  ? 27.390  -6.036  98.763  1.00 0.00 ? 67  ARG A CG  1 
ATOM 236  C CD  . ARG A 1 67  ? 26.215  -6.814  99.360  1.00 0.00 ? 67  ARG A CD  1 
ATOM 237  N NE  . ARG A 1 67  ? 24.946  -6.559  98.664  1.00 0.00 ? 67  ARG A NE  1 
ATOM 238  C CZ  . ARG A 1 67  ? 23.874  -6.000  99.241  1.00 0.00 ? 67  ARG A CZ  1 
ATOM 239  N NH1 . ARG A 1 67  ? 23.899  -5.630  100.529 1.00 0.00 ? 67  ARG A NH1 1 
ATOM 240  N NH2 . ARG A 1 67  ? 22.717  -5.768  98.607  1.00 0.00 ? 67  ARG A NH2 1 
ATOM 241  N N   . LEU A 1 68  ? 30.591  -5.098  96.919  1.00 0.00 ? 68  LEU A N   1 
ATOM 242  C CA  . LEU A 1 68  ? 32.044  -5.235  96.778  1.00 0.00 ? 68  LEU A CA  1 
ATOM 243  C C   . LEU A 1 68  ? 32.520  -6.351  97.705  1.00 0.00 ? 68  LEU A C   1 
ATOM 244  O O   . LEU A 1 68  ? 32.480  -6.218  98.937  1.00 0.00 ? 68  LEU A O   1 
ATOM 245  C CB  . LEU A 1 68  ? 32.725  -3.920  97.155  1.00 0.00 ? 68  LEU A CB  1 
ATOM 246  C CG  . LEU A 1 68  ? 34.141  -4.114  97.702  1.00 0.00 ? 68  LEU A CG  1 
ATOM 247  C CD1 . LEU A 1 68  ? 35.227  -3.679  96.717  1.00 0.00 ? 68  LEU A CD1 1 
ATOM 248  C CD2 . LEU A 1 68  ? 34.401  -3.321  98.984  1.00 0.00 ? 68  LEU A CD2 1 
ATOM 249  N N   . VAL A 1 69  ? 32.958  -7.423  97.079  1.00 0.00 ? 69  VAL A N   1 
ATOM 250  C CA  . VAL A 1 69  ? 33.422  -8.619  97.789  1.00 0.00 ? 69  VAL A CA  1 
ATOM 251  C C   . VAL A 1 69  ? 34.945  -8.652  97.928  1.00 0.00 ? 69  VAL A C   1 
ATOM 252  O O   . VAL A 1 69  ? 35.679  -8.263  97.006  1.00 0.00 ? 69  VAL A O   1 
ATOM 253  C CB  . VAL A 1 69  ? 32.996  -9.876  97.030  1.00 0.00 ? 69  VAL A CB  1 
ATOM 254  C CG1 . VAL A 1 69  ? 33.832  -11.105 97.394  1.00 0.00 ? 69  VAL A CG1 1 
ATOM 255  C CG2 . VAL A 1 69  ? 31.542  -10.270 97.294  1.00 0.00 ? 69  VAL A CG2 1 
ATOM 256  N N   . HIS A 1 70  ? 35.332  -9.126  99.097  1.00 0.00 ? 70  HIS A N   1 
ATOM 257  C CA  . HIS A 1 70  ? 36.732  -9.315  99.497  1.00 0.00 ? 70  HIS A CA  1 
ATOM 258  C C   . HIS A 1 70  ? 36.957  -10.821 99.645  1.00 0.00 ? 70  HIS A C   1 
ATOM 259  O O   . HIS A 1 70  ? 36.043  -11.567 100.023 1.00 0.00 ? 70  HIS A O   1 
ATOM 260  C CB  . HIS A 1 70  ? 36.989  -8.596  100.828 1.00 0.00 ? 70  HIS A CB  1 
ATOM 261  C CG  . HIS A 1 70  ? 38.448  -8.668  101.290 1.00 0.00 ? 70  HIS A CG  1 
ATOM 262  N ND1 . HIS A 1 70  ? 38.887  -9.627  102.199 1.00 0.00 ? 70  HIS A ND1 1 
ATOM 263  C CD2 . HIS A 1 70  ? 39.538  -7.917  100.978 1.00 0.00 ? 70  HIS A CD2 1 
ATOM 264  C CE1 . HIS A 1 70  ? 40.179  -9.440  102.405 1.00 0.00 ? 70  HIS A CE1 1 
ATOM 265  N NE2 . HIS A 1 70  ? 40.582  -8.424  101.684 1.00 0.00 ? 70  HIS A NE2 1 
ATOM 266  N N   . LEU A 1 71  ? 38.161  -11.259 99.345  1.00 0.00 ? 71  LEU A N   1 
ATOM 267  C CA  . LEU A 1 71  ? 38.492  -12.692 99.423  1.00 0.00 ? 71  LEU A CA  1 
ATOM 268  C C   . LEU A 1 71  ? 39.993  -12.894 99.638  1.00 0.00 ? 71  LEU A C   1 
ATOM 269  O O   . LEU A 1 71  ? 40.824  -12.258 98.973  1.00 0.00 ? 71  LEU A O   1 
ATOM 270  C CB  . LEU A 1 71  ? 38.066  -13.376 98.123  1.00 0.00 ? 71  LEU A CB  1 
ATOM 271  C CG  . LEU A 1 71  ? 38.937  -14.573 97.755  1.00 0.00 ? 71  LEU A CG  1 
ATOM 272  C CD1 . LEU A 1 71  ? 38.753  -15.759 98.702  1.00 0.00 ? 71  LEU A CD1 1 
ATOM 273  C CD2 . LEU A 1 71  ? 38.644  -15.111 96.352  1.00 0.00 ? 71  LEU A CD2 1 
ATOM 274  N N   . ASN A 1 72  ? 40.280  -13.791 100.571 1.00 0.00 ? 72  ASN A N   1 
ATOM 275  C CA  . ASN A 1 72  ? 41.656  -14.143 100.956 1.00 0.00 ? 72  ASN A CA  1 
ATOM 276  C C   . ASN A 1 72  ? 42.107  -15.431 100.256 1.00 0.00 ? 72  ASN A C   1 
ATOM 277  O O   . ASN A 1 72  ? 41.302  -16.128 99.620  1.00 0.00 ? 72  ASN A O   1 
ATOM 278  C CB  . ASN A 1 72  ? 41.740  -14.339 102.469 1.00 0.00 ? 72  ASN A CB  1 
ATOM 279  C CG  . ASN A 1 72  ? 41.910  -13.023 103.231 1.00 0.00 ? 72  ASN A CG  1 
ATOM 280  O OD1 . ASN A 1 72  ? 41.125  -12.727 104.131 1.00 0.00 ? 72  ASN A OD1 1 
ATOM 281  N ND2 . ASN A 1 72  ? 42.898  -12.204 102.921 1.00 0.00 ? 72  ASN A ND2 1 
ATOM 282  N N   . MET A 1 73  ? 43.398  -15.689 100.413 1.00 0.00 ? 73  MET A N   1 
ATOM 283  C CA  . MET A 1 73  ? 44.080  -16.856 99.822  1.00 0.00 ? 73  MET A CA  1 
ATOM 284  C C   . MET A 1 73  ? 43.710  -18.143 100.561 1.00 0.00 ? 73  MET A C   1 
ATOM 285  O O   . MET A 1 73  ? 43.804  -18.221 101.797 1.00 0.00 ? 73  MET A O   1 
ATOM 286  C CB  . MET A 1 73  ? 45.595  -16.673 99.907  1.00 0.00 ? 73  MET A CB  1 
ATOM 287  C CG  . MET A 1 73  ? 46.341  -17.331 98.747  1.00 0.00 ? 73  MET A CG  1 
ATOM 288  S SD  . MET A 1 73  ? 48.073  -16.924 98.717  1.00 0.00 ? 73  MET A SD  1 
ATOM 289  C CE  . MET A 1 73  ? 48.907  -17.715 100.077 1.00 0.00 ? 73  MET A CE  1 
ATOM 290  N N   . PRO A 1 74  ? 43.282  -19.191 99.843  1.00 0.00 ? 74  PRO A N   1 
ATOM 291  C CA  . PRO A 1 74  ? 42.914  -20.447 100.468 1.00 0.00 ? 74  PRO A CA  1 
ATOM 292  C C   . PRO A 1 74  ? 44.135  -20.989 101.168 1.00 0.00 ? 74  PRO A C   1 
ATOM 293  O O   . PRO A 1 74  ? 45.248  -20.986 100.558 1.00 0.00 ? 74  PRO A O   1 
ATOM 294  C CB  . PRO A 1 74  ? 42.485  -21.323 99.312  1.00 0.00 ? 74  PRO A CB  1 
ATOM 295  C CG  . PRO A 1 74  ? 42.636  -20.501 98.035  1.00 0.00 ? 74  PRO A CG  1 
ATOM 296  C CD  . PRO A 1 74  ? 43.153  -19.135 98.387  1.00 0.00 ? 74  PRO A CD  1 
ATOM 297  N N   . GLU A 1 75  ? 43.939  -21.433 102.398 1.00 0.00 ? 75  GLU A N   1 
ATOM 298  C CA  . GLU A 1 75  ? 45.042  -21.948 103.235 1.00 0.00 ? 75  GLU A CA  1 
ATOM 299  C C   . GLU A 1 75  ? 45.726  -23.149 102.546 1.00 0.00 ? 75  GLU A C   1 
ATOM 300  O O   . GLU A 1 75  ? 46.959  -23.209 102.441 1.00 0.00 ? 75  GLU A O   1 
ATOM 301  C CB  . GLU A 1 75  ? 44.514  -22.285 104.635 1.00 0.00 ? 75  GLU A CB  1 
ATOM 302  C CG  . GLU A 1 75  ? 44.142  -23.751 104.842 1.00 0.00 ? 75  GLU A CG  1 
ATOM 303  C CD  . GLU A 1 75  ? 43.630  -24.016 106.262 1.00 0.00 ? 75  GLU A CD  1 
ATOM 304  O OE1 . GLU A 1 75  ? 43.459  -23.030 107.081 1.00 0.00 ? 75  GLU A OE1 1 
ATOM 305  O OE2 . GLU A 1 75  ? 43.370  -25.219 106.644 1.00 0.00 ? 75  GLU A OE2 1 
ATOM 306  N N   . SER A 1 76  ? 44.916  -24.090 102.085 1.00 0.00 ? 76  SER A N   1 
ATOM 307  C CA  . SER A 1 76  ? 45.406  -25.280 101.343 1.00 0.00 ? 76  SER A CA  1 
ATOM 308  C C   . SER A 1 76  ? 44.919  -25.168 99.902  1.00 0.00 ? 76  SER A C   1 
ATOM 309  O O   . SER A 1 76  ? 43.787  -24.733 99.641  1.00 0.00 ? 76  SER A O   1 
ATOM 310  C CB  . SER A 1 76  ? 44.863  -26.560 101.981 1.00 0.00 ? 76  SER A CB  1 
ATOM 311  O OG  . SER A 1 76  ? 45.639  -27.675 101.565 1.00 0.00 ? 76  SER A OG  1 
ATOM 312  N N   . GLU A 1 77  ? 45.805  -25.565 99.019  1.00 0.00 ? 77  GLU A N   1 
ATOM 313  C CA  . GLU A 1 77  ? 45.550  -25.578 97.580  1.00 0.00 ? 77  GLU A CA  1 
ATOM 314  C C   . GLU A 1 77  ? 45.239  -27.015 97.173  1.00 0.00 ? 77  GLU A C   1 
ATOM 315  O O   . GLU A 1 77  ? 45.242  -27.356 95.981  1.00 0.00 ? 77  GLU A O   1 
ATOM 316  C CB  . GLU A 1 77  ? 46.782  -25.066 96.832  1.00 0.00 ? 77  GLU A CB  1 
ATOM 317  C CG  . GLU A 1 77  ? 47.193  -23.653 97.254  1.00 0.00 ? 77  GLU A CG  1 
ATOM 318  C CD  . GLU A 1 77  ? 46.411  -22.559 96.522  1.00 0.00 ? 77  GLU A CD  1 
ATOM 319  O OE1 . GLU A 1 77  ? 45.407  -22.873 95.776  1.00 0.00 ? 77  GLU A OE1 1 
ATOM 320  O OE2 . GLU A 1 77  ? 46.757  -21.323 96.652  1.00 0.00 ? 77  GLU A OE2 1 
ATOM 321  N N   . ASN A 1 78  ? 44.984  -27.788 98.215  1.00 0.00 ? 78  ASN A N   1 
ATOM 322  C CA  . ASN A 1 78  ? 44.657  -29.215 98.124  1.00 0.00 ? 78  ASN A CA  1 
ATOM 323  C C   . ASN A 1 78  ? 43.254  -29.469 98.673  1.00 0.00 ? 78  ASN A C   1 
ATOM 324  O O   . ASN A 1 78  ? 42.778  -28.752 99.566  1.00 0.00 ? 78  ASN A O   1 
ATOM 325  C CB  . ASN A 1 78  ? 45.652  -30.029 98.960  1.00 0.00 ? 78  ASN A CB  1 
ATOM 326  C CG  . ASN A 1 78  ? 46.728  -30.721 98.125  1.00 0.00 ? 78  ASN A CG  1 
ATOM 327  O OD1 . ASN A 1 78  ? 47.878  -30.286 98.124  1.00 0.00 ? 78  ASN A OD1 1 
ATOM 328  N ND2 . ASN A 1 78  ? 46.423  -31.785 97.408  1.00 0.00 ? 78  ASN A ND2 1 
ATOM 329  N N   . TYR A 1 79  ? 42.632  -30.491 98.120  1.00 0.00 ? 79  TYR A N   1 
ATOM 330  C CA  . TYR A 1 79  ? 41.286  -30.910 98.527  1.00 0.00 ? 79  TYR A CA  1 
ATOM 331  C C   . TYR A 1 79  ? 41.413  -31.822 99.743  1.00 0.00 ? 79  TYR A C   1 
ATOM 332  O O   . TYR A 1 79  ? 42.349  -32.632 99.838  1.00 0.00 ? 79  TYR A O   1 
ATOM 333  C CB  . TYR A 1 79  ? 40.598  -31.650 97.382  1.00 0.00 ? 79  TYR A CB  1 
ATOM 334  C CG  . TYR A 1 79  ? 40.059  -30.699 96.312  1.00 0.00 ? 79  TYR A CG  1 
ATOM 335  C CD1 . TYR A 1 79  ? 40.946  -30.047 95.447  1.00 0.00 ? 79  TYR A CD1 1 
ATOM 336  C CD2 . TYR A 1 79  ? 38.681  -30.479 96.198  1.00 0.00 ? 79  TYR A CD2 1 
ATOM 337  C CE1 . TYR A 1 79  ? 40.455  -29.175 94.468  1.00 0.00 ? 79  TYR A CE1 1 
ATOM 338  C CE2 . TYR A 1 79  ? 38.190  -29.606 95.219  1.00 0.00 ? 79  TYR A CE2 1 
ATOM 339  C CZ  . TYR A 1 79  ? 39.078  -28.955 94.354  1.00 0.00 ? 79  TYR A CZ  1 
ATOM 340  O OH  . TYR A 1 79  ? 38.602  -28.107 93.403  1.00 0.00 ? 79  TYR A OH  1 
ATOM 341  N N   . LYS A 1 80  ? 40.465  -31.662 100.649 1.00 0.00 ? 80  LYS A N   1 
ATOM 342  C CA  . LYS A 1 80  ? 40.448  -32.431 101.891 1.00 0.00 ? 80  LYS A CA  1 
ATOM 343  C C   . LYS A 1 80  ? 39.157  -33.186 102.006 1.00 0.00 ? 80  LYS A C   1 
ATOM 344  O O   . LYS A 1 80  ? 38.176  -32.876 101.313 1.00 0.00 ? 80  LYS A O   1 
ATOM 345  C CB  . LYS A 1 80  ? 40.631  -31.460 103.105 1.00 0.00 ? 80  LYS A CB  1 
ATOM 346  C CG  . LYS A 1 80  ? 42.056  -31.461 103.662 1.00 0.00 ? 80  LYS A CG  1 
ATOM 347  C CD  . LYS A 1 80  ? 42.534  -30.071 104.086 1.00 0.00 ? 80  LYS A CD  1 
ATOM 348  C CE  . LYS A 1 80  ? 44.048  -29.891 103.951 1.00 0.00 ? 80  LYS A CE  1 
ATOM 349  N NZ  . LYS A 1 80  ? 44.628  -29.075 105.028 1.00 0.00 ? 80  LYS A NZ  1 
ATOM 350  N N   . ARG A 1 81  ? 39.266  -34.129 102.878 1.00 0.00 ? 81  ARG A N   1 
ATOM 351  C CA  . ARG A 1 81  ? 38.220  -35.058 103.211 1.00 0.00 ? 81  ARG A CA  1 
ATOM 352  C C   . ARG A 1 81  ? 38.268  -35.239 104.715 1.00 0.00 ? 81  ARG A C   1 
ATOM 353  O O   . ARG A 1 81  ? 39.088  -36.009 105.233 1.00 0.00 ? 81  ARG A O   1 
ATOM 354  C CB  . ARG A 1 81  ? 38.521  -36.351 102.478 1.00 0.00 ? 81  ARG A CB  1 
ATOM 355  C CG  . ARG A 1 81  ? 37.294  -37.192 102.198 1.00 0.00 ? 81  ARG A CG  1 
ATOM 356  C CD  . ARG A 1 81  ? 37.628  -38.677 102.158 1.00 0.00 ? 81  ARG A CD  1 
ATOM 357  N NE  . ARG A 1 81  ? 37.292  -39.363 103.405 1.00 0.00 ? 81  ARG A NE  1 
ATOM 358  C CZ  . ARG A 1 81  ? 37.563  -40.648 103.638 1.00 0.00 ? 81  ARG A CZ  1 
ATOM 359  N NH1 . ARG A 1 81  ? 38.188  -41.394 102.718 1.00 0.00 ? 81  ARG A NH1 1 
ATOM 360  N NH2 . ARG A 1 81  ? 37.236  -41.286 104.767 1.00 0.00 ? 81  ARG A NH2 1 
ATOM 361  N N   . VAL A 1 82  ? 37.392  -34.511 105.364 1.00 0.00 ? 82  VAL A N   1 
ATOM 362  C CA  . VAL A 1 82  ? 37.338  -34.465 106.823 1.00 0.00 ? 82  VAL A CA  1 
ATOM 363  C C   . VAL A 1 82  ? 36.054  -35.103 107.366 1.00 0.00 ? 82  VAL A C   1 
ATOM 364  O O   . VAL A 1 82  ? 34.962  -34.912 106.810 1.00 0.00 ? 82  VAL A O   1 
ATOM 365  C CB  . VAL A 1 82  ? 37.403  -33.004 107.264 1.00 0.00 ? 82  VAL A CB  1 
ATOM 366  C CG1 . VAL A 1 82  ? 37.532  -32.837 108.776 1.00 0.00 ? 82  VAL A CG1 1 
ATOM 367  C CG2 . VAL A 1 82  ? 38.595  -32.256 106.658 1.00 0.00 ? 82  VAL A CG2 1 
ATOM 368  N N   . VAL A 1 83  ? 36.264  -35.839 108.447 1.00 0.00 ? 83  VAL A N   1 
ATOM 369  C CA  . VAL A 1 83  ? 35.200  -36.528 109.199 1.00 0.00 ? 83  VAL A CA  1 
ATOM 370  C C   . VAL A 1 83  ? 35.007  -35.809 110.529 1.00 0.00 ? 83  VAL A C   1 
ATOM 371  O O   . VAL A 1 83  ? 35.978  -35.514 111.242 1.00 0.00 ? 83  VAL A O   1 
ATOM 372  C CB  . VAL A 1 83  ? 35.598  -37.983 109.455 1.00 0.00 ? 83  VAL A CB  1 
ATOM 373  C CG1 . VAL A 1 83  ? 34.604  -38.726 110.350 1.00 0.00 ? 83  VAL A CG1 1 
ATOM 374  C CG2 . VAL A 1 83  ? 35.699  -38.810 108.172 1.00 0.00 ? 83  VAL A CG2 1 
ATOM 375  N N   . VAL A 1 84  ? 33.743  -35.672 110.918 1.00 0.00 ? 84  VAL A N   1 
ATOM 376  C CA  . VAL A 1 84  ? 33.380  -34.972 112.150 1.00 0.00 ? 84  VAL A CA  1 
ATOM 377  C C   . VAL A 1 84  ? 32.687  -35.878 113.125 1.00 0.00 ? 84  VAL A C   1 
ATOM 378  O O   . VAL A 1 84  ? 31.560  -36.332 112.883 1.00 0.00 ? 84  VAL A O   1 
ATOM 379  C CB  . VAL A 1 84  ? 32.348  -33.885 111.857 1.00 0.00 ? 84  VAL A CB  1 
ATOM 380  C CG1 . VAL A 1 84  ? 31.804  -33.220 113.123 1.00 0.00 ? 84  VAL A CG1 1 
ATOM 381  C CG2 . VAL A 1 84  ? 32.905  -32.748 110.998 1.00 0.00 ? 84  VAL A CG2 1 
ATOM 382  N N   . ASN A 1 85  ? 33.380  -36.098 114.193 1.00 0.00 ? 85  ASN A N   1 
ATOM 383  C CA  . ASN A 1 85  ? 32.850  -36.865 115.290 1.00 0.00 ? 85  ASN A CA  1 
ATOM 384  C C   . ASN A 1 85  ? 32.669  -35.923 116.460 1.00 0.00 ? 85  ASN A C   1 
ATOM 385  O O   . ASN A 1 85  ? 33.505  -35.040 116.700 1.00 0.00 ? 85  ASN A O   1 
ATOM 386  C CB  . ASN A 1 85  ? 33.799  -38.000 115.660 1.00 0.00 ? 85  ASN A CB  1 
ATOM 387  C CG  . ASN A 1 85  ? 33.130  -39.375 115.590 1.00 0.00 ? 85  ASN A CG  1 
ATOM 388  O OD1 . ASN A 1 85  ? 33.663  -40.284 114.956 1.00 0.00 ? 85  ASN A OD1 1 
ATOM 389  N ND2 . ASN A 1 85  ? 31.981  -39.585 116.207 1.00 0.00 ? 85  ASN A ND2 1 
ATOM 390  N N   . ASN A 1 86  ? 31.573  -36.137 117.118 1.00 0.00 ? 86  ASN A N   1 
ATOM 391  C CA  . ASN A 1 86  ? 31.204  -35.401 118.316 1.00 0.00 ? 86  ASN A CA  1 
ATOM 392  C C   . ASN A 1 86  ? 30.529  -36.407 119.225 1.00 0.00 ? 86  ASN A C   1 
ATOM 393  O O   . ASN A 1 86  ? 29.452  -36.140 119.777 1.00 0.00 ? 86  ASN A O   1 
ATOM 394  C CB  . ASN A 1 86  ? 30.315  -34.214 117.943 1.00 0.00 ? 86  ASN A CB  1 
ATOM 395  C CG  . ASN A 1 86  ? 28.879  -34.602 117.606 1.00 0.00 ? 86  ASN A CG  1 
ATOM 396  O OD1 . ASN A 1 86  ? 28.633  -35.718 117.156 1.00 0.00 ? 86  ASN A OD1 1 
ATOM 397  N ND2 . ASN A 1 86  ? 27.905  -33.734 117.801 1.00 0.00 ? 86  ASN A ND2 1 
ATOM 398  N N   . MET A 1 87  ? 31.240  -37.516 119.289 1.00 0.00 ? 87  MET A N   1 
ATOM 399  C CA  . MET A 1 87  ? 30.874  -38.707 120.050 1.00 0.00 ? 87  MET A CA  1 
ATOM 400  C C   . MET A 1 87  ? 31.068  -38.483 121.546 1.00 0.00 ? 87  MET A C   1 
ATOM 401  O O   . MET A 1 87  ? 31.302  -39.431 122.307 1.00 0.00 ? 87  MET A O   1 
ATOM 402  C CB  . MET A 1 87  ? 31.785  -39.868 119.643 1.00 0.00 ? 87  MET A CB  1 
ATOM 403  C CG  . MET A 1 87  ? 31.041  -41.023 118.977 1.00 0.00 ? 87  MET A CG  1 
ATOM 404  S SD  . MET A 1 87  ? 32.055  -42.475 118.801 1.00 0.00 ? 87  MET A SD  1 
ATOM 405  C CE  . MET A 1 87  ? 33.558  -42.281 119.738 1.00 0.00 ? 87  MET A CE  1 
ATOM 406  N N   . ASP A 1 88  ? 30.974  -37.232 121.952 1.00 0.00 ? 88  ASP A N   1 
ATOM 407  C CA  . ASP A 1 88  ? 31.122  -36.882 123.371 1.00 0.00 ? 88  ASP A CA  1 
ATOM 408  C C   . ASP A 1 88  ? 29.902  -36.086 123.848 1.00 0.00 ? 88  ASP A C   1 
ATOM 409  O O   . ASP A 1 88  ? 29.858  -35.606 124.988 1.00 0.00 ? 88  ASP A O   1 
ATOM 410  C CB  . ASP A 1 88  ? 32.427  -36.109 123.607 1.00 0.00 ? 88  ASP A CB  1 
ATOM 411  C CG  . ASP A 1 88  ? 32.462  -34.715 122.982 1.00 0.00 ? 88  ASP A CG  1 
ATOM 412  O OD1 . ASP A 1 88  ? 31.405  -34.223 122.436 1.00 0.00 ? 88  ASP A OD1 1 
ATOM 413  O OD2 . ASP A 1 88  ? 33.557  -34.030 123.006 1.00 0.00 ? 88  ASP A OD2 1 
ATOM 414  N N   . LYS A 1 89  ? 28.940  -35.978 122.952 1.00 0.00 ? 89  LYS A N   1 
ATOM 415  C CA  . LYS A 1 89  ? 27.656  -35.314 123.228 1.00 0.00 ? 89  LYS A CA  1 
ATOM 416  C C   . LYS A 1 89  ? 26.538  -36.320 122.987 1.00 0.00 ? 89  LYS A C   1 
ATOM 417  O O   . LYS A 1 89  ? 25.415  -36.161 123.489 1.00 0.00 ? 89  LYS A O   1 
ATOM 418  C CB  . LYS A 1 89  ? 27.456  -34.116 122.297 1.00 0.00 ? 89  LYS A CB  1 
ATOM 419  C CG  . LYS A 1 89  ? 28.311  -32.909 122.680 1.00 0.00 ? 89  LYS A CG  1 
ATOM 420  C CD  . LYS A 1 89  ? 27.646  -32.003 123.719 1.00 0.00 ? 89  LYS A CD  1 
ATOM 421  C CE  . LYS A 1 89  ? 28.142  -30.556 123.654 1.00 0.00 ? 89  LYS A CE  1 
ATOM 422  N NZ  . LYS A 1 89  ? 29.118  -30.235 124.706 1.00 0.00 ? 89  LYS A NZ  1 
ATOM 423  N N   . THR A 1 90  ? 26.924  -37.318 122.221 1.00 0.00 ? 90  THR A N   1 
ATOM 424  C CA  . THR A 1 90  ? 26.052  -38.418 121.814 1.00 0.00 ? 90  THR A CA  1 
ATOM 425  C C   . THR A 1 90  ? 26.354  -39.664 122.654 1.00 0.00 ? 90  THR A C   1 
ATOM 426  O O   . THR A 1 90  ? 26.206  -40.801 122.184 1.00 0.00 ? 90  THR A O   1 
ATOM 427  C CB  . THR A 1 90  ? 26.300  -38.729 120.336 1.00 0.00 ? 90  THR A CB  1 
ATOM 428  O OG1 . THR A 1 90  ? 27.655  -39.114 120.142 1.00 0.00 ? 90  THR A OG1 1 
ATOM 429  C CG2 . THR A 1 90  ? 26.037  -37.530 119.421 1.00 0.00 ? 90  THR A CG2 1 
ATOM 430  N N   . ALA A 1 91  ? 26.769  -39.408 123.885 1.00 0.00 ? 91  ALA A N   1 
ATOM 431  C CA  . ALA A 1 91  ? 27.118  -40.470 124.847 1.00 0.00 ? 91  ALA A CA  1 
ATOM 432  C C   . ALA A 1 91  ? 26.392  -40.254 126.166 1.00 0.00 ? 91  ALA A C   1 
ATOM 433  O O   . ALA A 1 91  ? 26.200  -41.197 126.948 1.00 0.00 ? 91  ALA A O   1 
ATOM 434  C CB  . ALA A 1 91  ? 28.625  -40.464 125.111 1.00 0.00 ? 91  ALA A CB  1 
ATOM 435  N N   . VAL A 1 92  ? 26.019  -39.013 126.343 1.00 0.00 ? 92  VAL A N   1 
ATOM 436  C CA  . VAL A 1 92  ? 25.347  -38.531 127.549 1.00 0.00 ? 92  VAL A CA  1 
ATOM 437  C C   . VAL A 1 92  ? 23.957  -39.192 127.714 1.00 0.00 ? 92  VAL A C   1 
ATOM 438  O O   . VAL A 1 92  ? 23.222  -38.899 128.666 1.00 0.00 ? 92  VAL A O   1 
ATOM 439  C CB  . VAL A 1 92  ? 25.248  -37.009 127.466 1.00 0.00 ? 92  VAL A CB  1 
ATOM 440  C CG1 . VAL A 1 92  ? 24.984  -36.350 128.817 1.00 0.00 ? 92  VAL A CG1 1 
ATOM 441  C CG2 . VAL A 1 92  ? 26.537  -36.361 126.939 1.00 0.00 ? 92  VAL A CG2 1 
ATOM 442  N N   . LYS A 1 93  ? 23.630  -40.073 126.773 1.00 0.00 ? 93  LYS A N   1 
ATOM 443  C CA  . LYS A 1 93  ? 22.374  -40.882 126.786 1.00 0.00 ? 93  LYS A CA  1 
ATOM 444  C C   . LYS A 1 93  ? 21.129  -40.079 126.963 1.00 0.00 ? 93  LYS A C   1 
ATOM 445  O O   . LYS A 1 93  ? 20.140  -40.567 127.527 1.00 0.00 ? 93  LYS A O   1 
ATOM 446  C CB  . LYS A 1 93  ? 22.361  -41.840 127.981 1.00 0.00 ? 93  LYS A CB  1 
ATOM 447  C CG  . LYS A 1 93  ? 23.346  -43.000 127.864 1.00 0.00 ? 93  LYS A CG  1 
ATOM 448  C CD  . LYS A 1 93  ? 23.346  -43.887 129.112 1.00 0.00 ? 93  LYS A CD  1 
ATOM 449  C CE  . LYS A 1 93  ? 23.985  -45.256 128.879 1.00 0.00 ? 93  LYS A CE  1 
ATOM 450  N NZ  . LYS A 1 93  ? 23.977  -46.104 130.080 1.00 0.00 ? 93  LYS A NZ  1 
ATOM 451  N N   . GLY A 1 94  ? 21.197  -38.883 126.507 1.00 0.00 ? 94  GLY A N   1 
ATOM 452  C CA  . GLY A 1 94  ? 20.077  -37.988 126.612 1.00 0.00 ? 94  GLY A CA  1 
ATOM 453  C C   . GLY A 1 94  ? 20.074  -37.114 125.365 1.00 0.00 ? 94  GLY A C   1 
ATOM 454  O O   . GLY A 1 94  ? 19.011  -36.665 124.908 1.00 0.00 ? 94  GLY A O   1 
ATOM 455  N N   . ASN A 1 95  ? 21.295  -36.960 124.889 1.00 0.00 ? 95  ASN A N   1 
ATOM 456  C CA  . ASN A 1 95  ? 21.652  -36.139 123.727 1.00 0.00 ? 95  ASN A CA  1 
ATOM 457  C C   . ASN A 1 95  ? 21.721  -37.006 122.449 1.00 0.00 ? 95  ASN A C   1 
ATOM 458  O O   . ASN A 1 95  ? 22.656  -37.797 122.259 1.00 0.00 ? 95  ASN A O   1 
ATOM 459  C CB  . ASN A 1 95  ? 23.017  -35.492 124.019 1.00 0.00 ? 95  ASN A CB  1 
ATOM 460  C CG  . ASN A 1 95  ? 23.007  -34.675 125.322 1.00 0.00 ? 95  ASN A CG  1 
ATOM 461  O OD1 . ASN A 1 95  ? 21.971  -34.118 125.684 1.00 0.00 ? 95  ASN A OD1 1 
ATOM 462  N ND2 . ASN A 1 95  ? 24.101  -34.561 126.055 1.00 0.00 ? 95  ASN A ND2 1 
ATOM 463  N N   . MET A 1 96  ? 20.714  -36.827 121.579 1.00 0.00 ? 96  MET A N   1 
ATOM 464  C CA  . MET A 1 96  ? 20.606  -37.594 120.304 1.00 0.00 ? 96  MET A CA  1 
ATOM 465  C C   . MET A 1 96  ? 20.321  -36.701 119.092 1.00 0.00 ? 96  MET A C   1 
ATOM 466  O O   . MET A 1 96  ? 20.541  -37.101 117.938 1.00 0.00 ? 96  MET A O   1 
ATOM 467  C CB  . MET A 1 96  ? 19.464  -38.611 120.368 1.00 0.00 ? 96  MET A CB  1 
ATOM 468  C CG  . MET A 1 96  ? 19.180  -39.124 121.779 1.00 0.00 ? 96  MET A CG  1 
ATOM 469  S SD  . MET A 1 96  ? 17.642  -40.015 121.890 1.00 0.00 ? 96  MET A SD  1 
ATOM 470  C CE  . MET A 1 96  ? 17.850  -41.471 122.892 1.00 0.00 ? 96  MET A CE  1 
ATOM 471  N N   . ALA A 1 97  ? 19.835  -35.514 119.390 1.00 0.00 ? 97  ALA A N   1 
ATOM 472  C CA  . ALA A 1 97  ? 19.503  -34.512 118.368 1.00 0.00 ? 97  ALA A CA  1 
ATOM 473  C C   . ALA A 1 97  ? 20.683  -33.564 118.184 1.00 0.00 ? 97  ALA A C   1 
ATOM 474  O O   . ALA A 1 97  ? 20.620  -32.609 117.394 1.00 0.00 ? 97  ALA A O   1 
ATOM 475  C CB  . ALA A 1 97  ? 18.276  -33.709 118.802 1.00 0.00 ? 97  ALA A CB  1 
ATOM 476  N N   . LEU A 1 98  ? 21.723  -33.873 118.931 1.00 0.00 ? 98  LEU A N   1 
ATOM 477  C CA  . LEU A 1 98  ? 22.966  -33.103 118.925 1.00 0.00 ? 98  LEU A CA  1 
ATOM 478  C C   . LEU A 1 98  ? 24.099  -33.855 118.142 1.00 0.00 ? 98  LEU A C   1 
ATOM 479  O O   . LEU A 1 98  ? 25.296  -33.590 118.335 1.00 0.00 ? 98  LEU A O   1 
ATOM 480  C CB  . LEU A 1 98  ? 23.458  -32.899 120.359 1.00 0.00 ? 98  LEU A CB  1 
ATOM 481  C CG  . LEU A 1 98  ? 22.504  -32.050 121.202 1.00 0.00 ? 98  LEU A CG  1 
ATOM 482  C CD1 . LEU A 1 98  ? 22.924  -31.960 122.671 1.00 0.00 ? 98  LEU A CD1 1 
ATOM 483  C CD2 . LEU A 1 98  ? 22.397  -30.605 120.711 1.00 0.00 ? 98  LEU A CD2 1 
ATOM 484  N N   . ASP A 1 99  ? 23.694  -34.786 117.266 1.00 0.00 ? 99  ASP A N   1 
ATOM 485  C CA  . ASP A 1 99  ? 24.620  -35.620 116.423 1.00 0.00 ? 99  ASP A CA  1 
ATOM 486  C C   . ASP A 1 99  ? 25.218  -34.767 115.285 1.00 0.00 ? 99  ASP A C   1 
ATOM 487  O O   . ASP A 1 99  ? 24.583  -34.543 114.247 1.00 0.00 ? 99  ASP A O   1 
ATOM 488  C CB  . ASP A 1 99  ? 23.824  -36.787 115.801 1.00 0.00 ? 99  ASP A CB  1 
ATOM 489  C CG  . ASP A 1 99  ? 24.683  -37.926 115.224 1.00 0.00 ? 99  ASP A CG  1 
ATOM 490  O OD1 . ASP A 1 99  ? 25.968  -37.881 115.305 1.00 0.00 ? 99  ASP A OD1 1 
ATOM 491  O OD2 . ASP A 1 99  ? 24.113  -38.940 114.654 1.00 0.00 ? 99  ASP A OD2 1 
ATOM 492  N N   . ASP A 1 100 ? 26.446  -34.309 115.490 1.00 0.00 ? 100 ASP A N   1 
ATOM 493  C CA  . ASP A 1 100 ? 27.124  -33.419 114.523 1.00 0.00 ? 100 ASP A CA  1 
ATOM 494  C C   . ASP A 1 100 ? 28.156  -34.160 113.688 1.00 0.00 ? 100 ASP A C   1 
ATOM 495  O O   . ASP A 1 100 ? 29.147  -33.571 113.228 1.00 0.00 ? 100 ASP A O   1 
ATOM 496  C CB  . ASP A 1 100 ? 27.874  -32.316 115.256 1.00 0.00 ? 100 ASP A CB  1 
ATOM 497  C CG  . ASP A 1 100 ? 27.161  -30.965 115.176 1.00 0.00 ? 100 ASP A CG  1 
ATOM 498  O OD1 . ASP A 1 100 ? 26.024  -30.872 114.574 1.00 0.00 ? 100 ASP A OD1 1 
ATOM 499  O OD2 . ASP A 1 100 ? 27.697  -29.920 115.709 1.00 0.00 ? 100 ASP A OD2 1 
ATOM 500  N N   . ILE A 1 101 ? 27.902  -35.427 113.505 1.00 0.00 ? 101 ILE A N   1 
ATOM 501  C CA  . ILE A 1 101 ? 28.798  -36.291 112.743 1.00 0.00 ? 101 ILE A CA  1 
ATOM 502  C C   . ILE A 1 101 ? 28.323  -36.398 111.298 1.00 0.00 ? 101 ILE A C   1 
ATOM 503  O O   . ILE A 1 101 ? 27.209  -36.868 111.026 1.00 0.00 ? 101 ILE A O   1 
ATOM 504  C CB  . ILE A 1 101 ? 28.833  -37.671 113.377 1.00 0.00 ? 101 ILE A CB  1 
ATOM 505  C CG1 . ILE A 1 101 ? 29.881  -38.590 112.758 1.00 0.00 ? 101 ILE A CG1 1 
ATOM 506  C CG2 . ILE A 1 101 ? 27.507  -38.415 113.254 1.00 0.00 ? 101 ILE A CG2 1 
ATOM 507  C CD1 . ILE A 1 101 ? 29.917  -39.964 113.425 1.00 0.00 ? 101 ILE A CD1 1 
ATOM 508  N N   . HIS A 1 102 ? 29.209  -35.949 110.445 1.00 0.00 ? 102 HIS A N   1 
ATOM 509  C CA  . HIS A 1 102 ? 29.024  -35.944 108.995 1.00 0.00 ? 102 HIS A CA  1 
ATOM 510  C C   . HIS A 1 102 ? 30.380  -36.019 108.359 1.00 0.00 ? 102 HIS A C   1 
ATOM 511  O O   . HIS A 1 102 ? 31.407  -36.091 109.051 1.00 0.00 ? 102 HIS A O   1 
ATOM 512  C CB  . HIS A 1 102 ? 28.344  -34.648 108.569 1.00 0.00 ? 102 HIS A CB  1 
ATOM 513  C CG  . HIS A 1 102 ? 29.243  -33.434 108.787 1.00 0.00 ? 102 HIS A CG  1 
ATOM 514  N ND1 . HIS A 1 102 ? 29.329  -32.797 110.020 1.00 0.00 ? 102 HIS A ND1 1 
ATOM 515  C CD2 . HIS A 1 102 ? 30.078  -32.764 107.951 1.00 0.00 ? 102 HIS A CD2 1 
ATOM 516  C CE1 . HIS A 1 102 ? 30.181  -31.796 109.905 1.00 0.00 ? 102 HIS A CE1 1 
ATOM 517  N NE2 . HIS A 1 102 ? 30.636  -31.762 108.678 1.00 0.00 ? 102 HIS A NE2 1 
ATOM 518  N N   . VAL A 1 103 ? 30.360  -35.993 107.070 1.00 0.00 ? 103 VAL A N   1 
ATOM 519  C CA  . VAL A 1 103 ? 31.576  -36.062 106.302 1.00 0.00 ? 103 VAL A CA  1 
ATOM 520  C C   . VAL A 1 103 ? 31.567  -35.094 105.162 1.00 0.00 ? 103 VAL A C   1 
ATOM 521  O O   . VAL A 1 103 ? 30.704  -35.168 104.275 1.00 0.00 ? 103 VAL A O   1 
ATOM 522  C CB  . VAL A 1 103 ? 31.773  -37.423 105.730 1.00 0.00 ? 103 VAL A CB  1 
ATOM 523  C CG1 . VAL A 1 103 ? 33.020  -37.522 104.850 1.00 0.00 ? 103 VAL A CG1 1 
ATOM 524  C CG2 . VAL A 1 103 ? 31.930  -38.503 106.802 1.00 0.00 ? 103 VAL A CG2 1 
ATOM 525  N N   . GLU A 1 104 ? 32.549  -34.238 105.232 1.00 0.00 ? 104 GLU A N   1 
ATOM 526  C CA  . GLU A 1 104 ? 32.721  -33.208 104.242 1.00 0.00 ? 104 GLU A CA  1 
ATOM 527  C C   . GLU A 1 104 ? 34.115  -33.191 103.674 1.00 0.00 ? 104 GLU A C   1 
ATOM 528  O O   . GLU A 1 104 ? 35.079  -33.590 104.342 1.00 0.00 ? 104 GLU A O   1 
ATOM 529  C CB  . GLU A 1 104 ? 32.448  -31.835 104.834 1.00 0.00 ? 104 GLU A CB  1 
ATOM 530  C CG  . GLU A 1 104 ? 33.577  -31.280 105.705 1.00 0.00 ? 104 GLU A CG  1 
ATOM 531  C CD  . GLU A 1 104 ? 33.344  -29.807 106.045 1.00 0.00 ? 104 GLU A CD  1 
ATOM 532  O OE1 . GLU A 1 104 ? 32.176  -29.415 106.434 1.00 0.00 ? 104 GLU A OE1 1 
ATOM 533  O OE2 . GLU A 1 104 ? 34.305  -28.958 105.930 1.00 0.00 ? 104 GLU A OE2 1 
ATOM 534  N N   . ILE A 1 105 ? 34.111  -32.721 102.456 1.00 0.00 ? 105 ILE A N   1 
ATOM 535  C CA  . ILE A 1 105 ? 35.308  -32.512 101.676 1.00 0.00 ? 105 ILE A CA  1 
ATOM 536  C C   . ILE A 1 105 ? 35.437  -31.018 101.409 1.00 0.00 ? 105 ILE A C   1 
ATOM 537  O O   . ILE A 1 105 ? 34.530  -30.394 100.840 1.00 0.00 ? 105 ILE A O   1 
ATOM 538  C CB  . ILE A 1 105 ? 35.227  -33.269 100.349 1.00 0.00 ? 105 ILE A CB  1 
ATOM 539  C CG1 . ILE A 1 105 ? 35.501  -34.767 100.495 1.00 0.00 ? 105 ILE A CG1 1 
ATOM 540  C CG2 . ILE A 1 105 ? 36.238  -32.766 99.315  1.00 0.00 ? 105 ILE A CG2 1 
ATOM 541  C CD1 . ILE A 1 105 ? 35.636  -35.483 99.149  1.00 0.00 ? 105 ILE A CD1 1 
ATOM 542  N N   . VAL A 1 106 ? 36.553  -30.479 101.831 1.00 0.00 ? 106 VAL A N   1 
ATOM 543  C CA  . VAL A 1 106 ? 36.843  -29.051 101.671 1.00 0.00 ? 106 VAL A CA  1 
ATOM 544  C C   . VAL A 1 106 ? 37.489  -28.790 100.308 1.00 0.00 ? 106 VAL A C   1 
ATOM 545  O O   . VAL A 1 106 ? 38.307  -29.586 99.825  1.00 0.00 ? 106 VAL A O   1 
ATOM 546  C CB  . VAL A 1 106 ? 37.802  -28.588 102.770 1.00 0.00 ? 106 VAL A CB  1 
ATOM 547  C CG1 . VAL A 1 106 ? 38.265  -27.141 102.590 1.00 0.00 ? 106 VAL A CG1 1 
ATOM 548  C CG2 . VAL A 1 106 ? 37.185  -28.656 104.168 1.00 0.00 ? 106 VAL A CG2 1 
ATOM 549  N N   . THR A 1 107 ? 37.091  -27.669 99.732  1.00 0.00 ? 107 THR A N   1 
ATOM 550  C CA  . THR A 1 107 ? 37.582  -27.221 98.420  1.00 0.00 ? 107 THR A CA  1 
ATOM 551  C C   . THR A 1 107 ? 38.297  -25.879 98.557  1.00 0.00 ? 107 THR A C   1 
ATOM 552  O O   . THR A 1 107 ? 37.800  -24.954 99.219  1.00 0.00 ? 107 THR A O   1 
ATOM 553  C CB  . THR A 1 107 ? 36.413  -27.056 97.449  1.00 0.00 ? 107 THR A CB  1 
ATOM 554  O OG1 . THR A 1 107 ? 35.531  -26.047 97.918  1.00 0.00 ? 107 THR A OG1 1 
ATOM 555  C CG2 . THR A 1 107 ? 35.594  -28.337 97.276  1.00 0.00 ? 107 THR A CG2 1 
ATOM 556  N N   . PRO A 1 108 ? 39.479  -25.707 97.950  1.00 0.00 ? 108 PRO A N   1 
ATOM 557  C CA  . PRO A 1 108 ? 40.202  -24.453 98.044  1.00 0.00 ? 108 PRO A CA  1 
ATOM 558  C C   . PRO A 1 108 ? 39.379  -23.328 97.469  1.00 0.00 ? 108 PRO A C   1 
ATOM 559  O O   . PRO A 1 108 ? 39.729  -22.127 97.699  1.00 0.00 ? 108 PRO A O   1 
ATOM 560  C CB  . PRO A 1 108 ? 41.456  -24.694 97.235  1.00 0.00 ? 108 PRO A CB  1 
ATOM 561  C CG  . PRO A 1 108 ? 41.395  -26.116 96.693  1.00 0.00 ? 108 PRO A CG  1 
ATOM 562  C CD  . PRO A 1 108 ? 40.123  -26.754 97.156  1.00 0.00 ? 108 PRO A CD  1 
ATOM 563  N N   . TRP A 1 109 ? 38.339  -23.729 96.762  1.00 0.00 ? 109 TRP A N   1 
ATOM 564  C CA  . TRP A 1 109 ? 37.415  -22.806 96.079  1.00 0.00 ? 109 TRP A CA  1 
ATOM 565  C C   . TRP A 1 109 ? 36.424  -22.162 97.055  1.00 0.00 ? 109 TRP A C   1 
ATOM 566  O O   . TRP A 1 109 ? 35.773  -22.853 97.854  1.00 0.00 ? 109 TRP A O   1 
ATOM 567  C CB  . TRP A 1 109 ? 36.615  -23.566 95.021  1.00 0.00 ? 109 TRP A CB  1 
ATOM 568  C CG  . TRP A 1 109 ? 37.472  -23.992 93.831  1.00 0.00 ? 109 TRP A CG  1 
ATOM 569  C CD1 . TRP A 1 109 ? 38.007  -25.201 93.611  1.00 0.00 ? 109 TRP A CD1 1 
ATOM 570  C CD2 . TRP A 1 109 ? 37.839  -23.149 92.755  1.00 0.00 ? 109 TRP A CD2 1 
ATOM 571  N NE1 . TRP A 1 109 ? 38.729  -25.122 92.377  1.00 0.00 ? 109 TRP A NE1 1 
ATOM 572  C CE2 . TRP A 1 109 ? 38.618  -23.908 91.893  1.00 0.00 ? 109 TRP A CE2 1 
ATOM 573  C CE3 . TRP A 1 109 ? 37.579  -21.811 92.443  1.00 0.00 ? 109 TRP A CE3 1 
ATOM 574  C CZ2 . TRP A 1 109 ? 39.167  -23.400 90.711  1.00 0.00 ? 109 TRP A CZ2 1 
ATOM 575  C CZ3 . TRP A 1 109 ? 38.135  -21.307 91.250  1.00 0.00 ? 109 TRP A CZ3 1 
ATOM 576  C CH2 . TRP A 1 109 ? 38.892  -22.065 90.426  1.00 0.00 ? 109 TRP A CH2 1 
ATOM 577  N N   . SER A 1 110 ? 36.353  -20.844 96.937  1.00 0.00 ? 110 SER A N   1 
ATOM 578  C CA  . SER A 1 110 ? 35.455  -19.999 97.743  1.00 0.00 ? 110 SER A CA  1 
ATOM 579  C C   . SER A 1 110 ? 34.211  -19.667 96.910  1.00 0.00 ? 110 SER A C   1 
ATOM 580  O O   . SER A 1 110 ? 34.312  -19.117 95.803  1.00 0.00 ? 110 SER A O   1 
ATOM 581  C CB  . SER A 1 110 ? 36.169  -18.702 98.137  1.00 0.00 ? 110 SER A CB  1 
ATOM 582  O OG  . SER A 1 110 ? 37.204  -18.981 99.069  1.00 0.00 ? 110 SER A OG  1 
ATOM 583  N N   . LEU A 1 111 ? 33.066  -20.015 97.470  1.00 0.00 ? 111 LEU A N   1 
ATOM 584  C CA  . LEU A 1 111 ? 31.762  -19.806 96.816  1.00 0.00 ? 111 LEU A CA  1 
ATOM 585  C C   . LEU A 1 111 ? 31.199  -18.414 97.119  1.00 0.00 ? 111 LEU A C   1 
ATOM 586  O O   . LEU A 1 111 ? 31.707  -17.696 97.993  1.00 0.00 ? 111 LEU A O   1 
ATOM 587  C CB  . LEU A 1 111 ? 30.755  -20.845 97.310  1.00 0.00 ? 111 LEU A CB  1 
ATOM 588  C CG  . LEU A 1 111 ? 29.410  -20.763 96.586  1.00 0.00 ? 111 LEU A CG  1 
ATOM 589  C CD1 . LEU A 1 111 ? 28.587  -22.047 96.708  1.00 0.00 ? 111 LEU A CD1 1 
ATOM 590  C CD2 . LEU A 1 111 ? 28.513  -19.642 97.115  1.00 0.00 ? 111 LEU A CD2 1 
ATOM 591  N N   . VAL A 1 112 ? 30.156  -18.102 96.365  1.00 0.00 ? 112 VAL A N   1 
ATOM 592  C CA  . VAL A 1 112 ? 29.426  -16.827 96.460  1.00 0.00 ? 112 VAL A CA  1 
ATOM 593  C C   . VAL A 1 112 ? 27.925  -17.083 96.284  1.00 0.00 ? 112 VAL A C   1 
ATOM 594  O O   . VAL A 1 112 ? 27.472  -17.516 95.214  1.00 0.00 ? 112 VAL A O   1 
ATOM 595  C CB  . VAL A 1 112 ? 29.898  -15.869 95.364  1.00 0.00 ? 112 VAL A CB  1 
ATOM 596  C CG1 . VAL A 1 112 ? 29.074  -14.582 95.299  1.00 0.00 ? 112 VAL A CG1 1 
ATOM 597  C CG2 . VAL A 1 112 ? 31.350  -15.423 95.544  1.00 0.00 ? 112 VAL A CG2 1 
ATOM 598  N N   . ASP A 1 113 ? 27.197  -16.806 97.350  1.00 0.00 ? 113 ASP A N   1 
ATOM 599  C CA  . ASP A 1 113 ? 25.737  -16.992 97.387  1.00 0.00 ? 113 ASP A CA  1 
ATOM 600  C C   . ASP A 1 113 ? 25.032  -15.646 97.574  1.00 0.00 ? 113 ASP A C   1 
ATOM 601  O O   . ASP A 1 113 ? 25.464  -14.806 98.377  1.00 0.00 ? 113 ASP A O   1 
ATOM 602  C CB  . ASP A 1 113 ? 25.356  -17.912 98.548  1.00 0.00 ? 113 ASP A CB  1 
ATOM 603  C CG  . ASP A 1 113 ? 24.185  -18.839 98.218  1.00 0.00 ? 113 ASP A CG  1 
ATOM 604  O OD1 . ASP A 1 113 ? 23.925  -19.137 96.990  1.00 0.00 ? 113 ASP A OD1 1 
ATOM 605  O OD2 . ASP A 1 113 ? 23.457  -19.321 99.167  1.00 0.00 ? 113 ASP A OD2 1 
ATOM 606  N N   . ALA A 1 114 ? 23.962  -15.496 96.816  1.00 0.00 ? 114 ALA A N   1 
ATOM 607  C CA  . ALA A 1 114 ? 23.128  -14.285 96.833  1.00 0.00 ? 114 ALA A CA  1 
ATOM 608  C C   . ALA A 1 114 ? 21.648  -14.674 96.820  1.00 0.00 ? 114 ALA A C   1 
ATOM 609  O O   . ALA A 1 114 ? 20.774  -13.854 96.500  1.00 0.00 ? 114 ALA A O   1 
ATOM 610  C CB  . ALA A 1 114 ? 23.428  -13.425 95.603  1.00 0.00 ? 114 ALA A CB  1 
ATOM 611  N N   . ASN A 1 115 ? 21.421  -15.926 97.173  1.00 0.00 ? 115 ASN A N   1 
ATOM 612  C CA  . ASN A 1 115 ? 20.074  -16.513 97.230  1.00 0.00 ? 115 ASN A CA  1 
ATOM 613  C C   . ASN A 1 115 ? 19.409  -16.171 98.565  1.00 0.00 ? 115 ASN A C   1 
ATOM 614  O O   . ASN A 1 115 ? 19.198  -17.048 99.416  1.00 0.00 ? 115 ASN A O   1 
ATOM 615  C CB  . ASN A 1 115 ? 20.162  -18.035 97.093  1.00 0.00 ? 115 ASN A CB  1 
ATOM 616  C CG  . ASN A 1 115 ? 18.792  -18.705 96.972  1.00 0.00 ? 115 ASN A CG  1 
ATOM 617  O OD1 . ASN A 1 115 ? 17.767  -18.031 97.063  1.00 0.00 ? 115 ASN A OD1 1 
ATOM 618  N ND2 . ASN A 1 115 ? 18.710  -20.007 96.771  1.00 0.00 ? 115 ASN A ND2 1 
ATOM 619  N N   . ALA A 1 116 ? 19.102  -14.893 98.698  1.00 0.00 ? 116 ALA A N   1 
ATOM 620  C CA  . ALA A 1 116 ? 18.454  -14.341 99.898  1.00 0.00 ? 116 ALA A CA  1 
ATOM 621  C C   . ALA A 1 116 ? 17.629  -13.127 99.495  1.00 0.00 ? 116 ALA A C   1 
ATOM 622  O O   . ALA A 1 116 ? 17.790  -12.578 98.398  1.00 0.00 ? 116 ALA A O   1 
ATOM 623  C CB  . ALA A 1 116 ? 19.515  -13.903 100.910 1.00 0.00 ? 116 ALA A CB  1 
ATOM 624  N N   . TRP A 1 117 ? 16.762  -12.729 100.390 1.00 0.00 ? 117 TRP A N   1 
ATOM 625  C CA  . TRP A 1 117 ? 15.891  -11.578 100.157 1.00 0.00 ? 117 TRP A CA  1 
ATOM 626  C C   . TRP A 1 117 ? 16.523  -10.294 100.648 1.00 0.00 ? 117 TRP A C   1 
ATOM 627  O O   . TRP A 1 117 ? 16.447  -9.257  99.979  1.00 0.00 ? 117 TRP A O   1 
ATOM 628  C CB  . TRP A 1 117 ? 14.614  -11.696 100.954 1.00 0.00 ? 117 TRP A CB  1 
ATOM 629  C CG  . TRP A 1 117 ? 13.714  -12.823 100.498 1.00 0.00 ? 117 TRP A CG  1 
ATOM 630  C CD1 . TRP A 1 117 ? 13.589  -14.020 101.070 1.00 0.00 ? 117 TRP A CD1 1 
ATOM 631  C CD2 . TRP A 1 117 ? 12.856  -12.764 99.378  1.00 0.00 ? 117 TRP A CD2 1 
ATOM 632  N NE1 . TRP A 1 117 ? 12.606  -14.732 100.322 1.00 0.00 ? 117 TRP A NE1 1 
ATOM 633  C CE2 . TRP A 1 117 ? 12.180  -13.974 99.340  1.00 0.00 ? 117 TRP A CE2 1 
ATOM 634  C CE3 . TRP A 1 117 ? 12.578  -11.795 98.408  1.00 0.00 ? 117 TRP A CE3 1 
ATOM 635  C CZ2 . TRP A 1 117 ? 11.203  -14.274 98.389  1.00 0.00 ? 117 TRP A CZ2 1 
ATOM 636  C CZ3 . TRP A 1 117 ? 11.599  -12.110 97.443  1.00 0.00 ? 117 TRP A CZ3 1 
ATOM 637  C CH2 . TRP A 1 117 ? 10.943  -13.292 97.438  1.00 0.00 ? 117 TRP A CH2 1 
ATOM 638  N N   . GLY A 1 118 ? 17.105  -10.414 101.819 1.00 0.00 ? 118 GLY A N   1 
ATOM 639  C CA  . GLY A 1 118 ? 17.752  -9.294  102.502 1.00 0.00 ? 118 GLY A CA  1 
ATOM 640  C C   . GLY A 1 118 ? 18.843  -8.672  101.617 1.00 0.00 ? 118 GLY A C   1 
ATOM 641  O O   . GLY A 1 118 ? 19.183  -7.489  101.758 1.00 0.00 ? 118 GLY A O   1 
ATOM 642  N N   . VAL A 1 119 ? 19.375  -9.473  100.723 1.00 0.00 ? 119 VAL A N   1 
ATOM 643  C CA  . VAL A 1 119 ? 20.451  -9.032  99.818  1.00 0.00 ? 119 VAL A CA  1 
ATOM 644  C C   . VAL A 1 119 ? 19.915  -8.258  98.620  1.00 0.00 ? 119 VAL A C   1 
ATOM 645  O O   . VAL A 1 119 ? 20.682  -7.672  97.842  1.00 0.00 ? 119 VAL A O   1 
ATOM 646  C CB  . VAL A 1 119 ? 21.202  -10.235 99.238  1.00 0.00 ? 119 VAL A CB  1 
ATOM 647  C CG1 . VAL A 1 119 ? 22.256  -9.835  98.199  1.00 0.00 ? 119 VAL A CG1 1 
ATOM 648  C CG2 . VAL A 1 119 ? 21.946  -11.049 100.292 1.00 0.00 ? 119 VAL A CG2 1 
ATOM 649  N N   . TRP A 1 120 ? 18.606  -8.247  98.480  1.00 0.00 ? 120 TRP A N   1 
ATOM 650  C CA  . TRP A 1 120 ? 17.998  -7.621  97.309  1.00 0.00 ? 120 TRP A CA  1 
ATOM 651  C C   . TRP A 1 120 ? 17.235  -6.375  97.688  1.00 0.00 ? 120 TRP A C   1 
ATOM 652  O O   . TRP A 1 120 ? 17.565  -5.265  97.244  1.00 0.00 ? 120 TRP A O   1 
ATOM 653  C CB  . TRP A 1 120 ? 17.084  -8.625  96.618  1.00 0.00 ? 120 TRP A CB  1 
ATOM 654  C CG  . TRP A 1 120 ? 17.866  -9.797  96.016  1.00 0.00 ? 120 TRP A CG  1 
ATOM 655  C CD1 . TRP A 1 120 ? 17.887  -11.063 96.453  1.00 0.00 ? 120 TRP A CD1 1 
ATOM 656  C CD2 . TRP A 1 120 ? 18.711  -9.713  94.881  1.00 0.00 ? 120 TRP A CD2 1 
ATOM 657  N NE1 . TRP A 1 120 ? 18.764  -11.793 95.585  1.00 0.00 ? 120 TRP A NE1 1 
ATOM 658  C CE2 . TRP A 1 120 ? 19.238  -10.980 94.671  1.00 0.00 ? 120 TRP A CE2 1 
ATOM 659  C CE3 . TRP A 1 120 ? 19.073  -8.672  94.020  1.00 0.00 ? 120 TRP A CE3 1 
ATOM 660  C CZ2 . TRP A 1 120 ? 20.126  -11.280 93.634  1.00 0.00 ? 120 TRP A CZ2 1 
ATOM 661  C CZ3 . TRP A 1 120 ? 19.967  -8.980  92.972  1.00 0.00 ? 120 TRP A CZ3 1 
ATOM 662  C CH2 . TRP A 1 120 ? 20.470  -10.224 92.789  1.00 0.00 ? 120 TRP A CH2 1 
ATOM 663  N N   . PHE A 1 121 ? 16.246  -6.580  98.488  1.00 0.00 ? 121 PHE A N   1 
ATOM 664  C CA  . PHE A 1 121 ? 15.381  -5.511  98.940  1.00 0.00 ? 121 PHE A CA  1 
ATOM 665  C C   . PHE A 1 121 ? 15.871  -4.959  100.265 1.00 0.00 ? 121 PHE A C   1 
ATOM 666  O O   . PHE A 1 121 ? 16.684  -5.590  100.957 1.00 0.00 ? 121 PHE A O   1 
ATOM 667  C CB  . PHE A 1 121 ? 13.966  -6.042  99.126  1.00 0.00 ? 121 PHE A CB  1 
ATOM 668  C CG  . PHE A 1 121 ? 13.376  -6.603  97.840  1.00 0.00 ? 121 PHE A CG  1 
ATOM 669  C CD1 . PHE A 1 121 ? 13.688  -7.908  97.436  1.00 0.00 ? 121 PHE A CD1 1 
ATOM 670  C CD2 . PHE A 1 121 ? 12.528  -5.812  97.061  1.00 0.00 ? 121 PHE A CD2 1 
ATOM 671  C CE1 . PHE A 1 121 ? 13.148  -8.419  96.250  1.00 0.00 ? 121 PHE A CE1 1 
ATOM 672  C CE2 . PHE A 1 121 ? 11.989  -6.322  95.877  1.00 0.00 ? 121 PHE A CE2 1 
ATOM 673  C CZ  . PHE A 1 121 ? 12.298  -7.626  95.470  1.00 0.00 ? 121 PHE A CZ  1 
ATOM 674  N N   . ASN A 1 122 ? 15.363  -3.789  100.566 1.00 0.00 ? 122 ASN A N   1 
ATOM 675  C CA  . ASN A 1 122 ? 15.615  -3.118  101.834 1.00 0.00 ? 122 ASN A CA  1 
ATOM 676  C C   . ASN A 1 122 ? 14.271  -2.936  102.536 1.00 0.00 ? 122 ASN A C   1 
ATOM 677  O O   . ASN A 1 122 ? 13.205  -3.016  101.906 1.00 0.00 ? 122 ASN A O   1 
ATOM 678  C CB  . ASN A 1 122 ? 16.386  -1.804  101.605 1.00 0.00 ? 122 ASN A CB  1 
ATOM 679  C CG  . ASN A 1 122 ? 15.639  -0.788  100.753 1.00 0.00 ? 122 ASN A CG  1 
ATOM 680  O OD1 . ASN A 1 122 ? 14.928  0.059   101.289 1.00 0.00 ? 122 ASN A OD1 1 
ATOM 681  N ND2 . ASN A 1 122 ? 15.756  -0.816  99.438  1.00 0.00 ? 122 ASN A ND2 1 
ATOM 682  N N   . PRO A 1 123 ? 14.234  -2.679  103.830 1.00 0.00 ? 123 PRO A N   1 
ATOM 683  C CA  . PRO A 1 123 ? 12.973  -2.666  104.564 1.00 0.00 ? 123 PRO A CA  1 
ATOM 684  C C   . PRO A 1 123 ? 11.931  -1.731  103.930 1.00 0.00 ? 123 PRO A C   1 
ATOM 685  O O   . PRO A 1 123 ? 10.700  -1.925  104.173 1.00 0.00 ? 123 PRO A O   1 
ATOM 686  C CB  . PRO A 1 123 ? 13.382  -2.273  105.976 1.00 0.00 ? 123 PRO A CB  1 
ATOM 687  C CG  . PRO A 1 123 ? 14.916  -2.094  105.987 1.00 0.00 ? 123 PRO A CG  1 
ATOM 688  C CD  . PRO A 1 123 ? 15.441  -2.376  104.619 1.00 0.00 ? 123 PRO A CD  1 
ATOM 689  N N   . GLY A 1 124 ? 12.408  -0.780  103.149 1.00 0.00 ? 124 GLY A N   1 
ATOM 690  C CA  . GLY A 1 124 ? 11.537  0.270   102.529 1.00 0.00 ? 124 GLY A CA  1 
ATOM 691  C C   . GLY A 1 124 ? 10.903  -0.243  101.198 1.00 0.00 ? 124 GLY A C   1 
ATOM 692  O O   . GLY A 1 124 ? 9.818   0.203   100.790 1.00 0.00 ? 124 GLY A O   1 
ATOM 693  N N   . ASP A 1 125 ? 11.597  -1.176  100.528 1.00 0.00 ? 125 ASP A N   1 
ATOM 694  C CA  . ASP A 1 125 ? 11.119  -1.780  99.246  1.00 0.00 ? 125 ASP A CA  1 
ATOM 695  C C   . ASP A 1 125 ? 10.120  -2.894  99.515  1.00 0.00 ? 125 ASP A C   1 
ATOM 696  O O   . ASP A 1 125 ? 9.065   -2.986  98.863  1.00 0.00 ? 125 ASP A O   1 
ATOM 697  C CB  . ASP A 1 125 ? 12.251  -2.454  98.467  1.00 0.00 ? 125 ASP A CB  1 
ATOM 698  C CG  . ASP A 1 125 ? 13.326  -1.495  97.977  1.00 0.00 ? 125 ASP A CG  1 
ATOM 699  O OD1 . ASP A 1 125 ? 13.007  -0.309  97.588  1.00 0.00 ? 125 ASP A OD1 1 
ATOM 700  O OD2 . ASP A 1 125 ? 14.556  -1.880  97.955  1.00 0.00 ? 125 ASP A OD2 1 
ATOM 701  N N   . TRP A 1 126 ? 10.505  -3.724  100.464 1.00 0.00 ? 126 TRP A N   1 
ATOM 702  C CA  . TRP A 1 126 ? 9.669   -4.834  100.885 1.00 0.00 ? 126 TRP A CA  1 
ATOM 703  C C   . TRP A 1 126 ? 8.284   -4.270  101.200 1.00 0.00 ? 126 TRP A C   1 
ATOM 704  O O   . TRP A 1 126 ? 7.226   -4.833  100.791 1.00 0.00 ? 126 TRP A O   1 
ATOM 705  C CB  . TRP A 1 126 ? 10.258  -5.536  102.102 1.00 0.00 ? 126 TRP A CB  1 
ATOM 706  C CG  . TRP A 1 126 ? 9.644   -6.920  102.303 1.00 0.00 ? 126 TRP A CG  1 
ATOM 707  C CD1 . TRP A 1 126 ? 8.827   -7.301  103.290 1.00 0.00 ? 126 TRP A CD1 1 
ATOM 708  C CD2 . TRP A 1 126 ? 9.849   -8.034  101.446 1.00 0.00 ? 126 TRP A CD2 1 
ATOM 709  N NE1 . TRP A 1 126 ? 8.496   -8.672  103.055 1.00 0.00 ? 126 TRP A NE1 1 
ATOM 710  C CE2 . TRP A 1 126 ? 9.101   -9.082  101.967 1.00 0.00 ? 126 TRP A CE2 1 
ATOM 711  C CE3 . TRP A 1 126 ? 10.594  -8.244  100.279 1.00 0.00 ? 126 TRP A CE3 1 
ATOM 712  C CZ2 . TRP A 1 126 ? 9.041   -10.349 101.376 1.00 0.00 ? 126 TRP A CZ2 1 
ATOM 713  C CZ3 . TRP A 1 126 ? 10.533  -9.527  99.694  1.00 0.00 ? 126 TRP A CZ3 1 
ATOM 714  C CH2 . TRP A 1 126 ? 9.792   -10.529 100.218 1.00 0.00 ? 126 TRP A CH2 1 
ATOM 715  N N   . GLN A 1 127 ? 8.227   -3.142  101.926 1.00 0.00 ? 127 GLN A N   1 
ATOM 716  C CA  . GLN A 1 127 ? 6.891   -2.578  102.239 1.00 0.00 ? 127 GLN A CA  1 
ATOM 717  C C   . GLN A 1 127 ? 6.061   -2.451  100.964 1.00 0.00 ? 127 GLN A C   1 
ATOM 718  O O   . GLN A 1 127 ? 4.882   -2.858  100.966 1.00 0.00 ? 127 GLN A O   1 
ATOM 719  C CB  . GLN A 1 127 ? 6.973   -1.232  102.927 1.00 0.00 ? 127 GLN A CB  1 
ATOM 720  C CG  . GLN A 1 127 ? 5.714   -0.777  103.641 1.00 0.00 ? 127 GLN A CG  1 
ATOM 721  C CD  . GLN A 1 127 ? 5.820   0.689   104.042 1.00 0.00 ? 127 GLN A CD  1 
ATOM 722  O OE1 . GLN A 1 127 ? 6.562   1.443   103.401 1.00 0.00 ? 127 GLN A OE1 1 
ATOM 723  N NE2 . GLN A 1 127 ? 5.084   1.057   105.070 1.00 0.00 ? 127 GLN A NE2 1 
ATOM 724  N N   . LEU A 1 128 ? 6.607   -1.901  99.884  1.00 0.00 ? 128 LEU A N   1 
ATOM 725  C CA  . LEU A 1 128 ? 5.908   -1.707  98.613  1.00 0.00 ? 128 LEU A CA  1 
ATOM 726  C C   . LEU A 1 128 ? 5.337   -2.986  98.016  1.00 0.00 ? 128 LEU A C   1 
ATOM 727  O O   . LEU A 1 128 ? 4.177   -3.001  97.581  1.00 0.00 ? 128 LEU A O   1 
ATOM 728  C CB  . LEU A 1 128 ? 6.856   -1.018  97.603  1.00 0.00 ? 128 LEU A CB  1 
ATOM 729  C CG  . LEU A 1 128 ? 6.238   -0.446  96.342  1.00 0.00 ? 128 LEU A CG  1 
ATOM 730  C CD1 . LEU A 1 128 ? 4.973   0.338   96.552  1.00 0.00 ? 128 LEU A CD1 1 
ATOM 731  C CD2 . LEU A 1 128 ? 7.183   0.593   95.729  1.00 0.00 ? 128 LEU A CD2 1 
ATOM 732  N N   . ILE A 1 129 ? 6.165   -4.012  97.987  1.00 0.00 ? 129 ILE A N   1 
ATOM 733  C CA  . ILE A 1 129 ? 5.751   -5.300  97.425  1.00 0.00 ? 129 ILE A CA  1 
ATOM 734  C C   . ILE A 1 129 ? 4.582   -5.922  98.162  1.00 0.00 ? 129 ILE A C   1 
ATOM 735  O O   . ILE A 1 129 ? 3.463   -6.211  97.742  1.00 0.00 ? 129 ILE A O   1 
ATOM 736  C CB  . ILE A 1 129 ? 7.002   -6.253  97.416  1.00 0.00 ? 129 ILE A CB  1 
ATOM 737  C CG1 . ILE A 1 129 ? 8.030   -5.568  96.463  1.00 0.00 ? 129 ILE A CG1 1 
ATOM 738  C CG2 . ILE A 1 129 ? 6.594   -7.703  97.093  1.00 0.00 ? 129 ILE A CG2 1 
ATOM 739  C CD1 . ILE A 1 129 ? 9.275   -6.436  96.181  1.00 0.00 ? 129 ILE A CD1 1 
ATOM 740  N N   . VAL A 1 130 ? 4.951   -6.138  99.404  1.00 0.00 ? 130 VAL A N   1 
ATOM 741  C CA  . VAL A 1 130 ? 4.089   -6.739  100.430 1.00 0.00 ? 130 VAL A CA  1 
ATOM 742  C C   . VAL A 1 130 ? 2.852   -5.933  100.639 1.00 0.00 ? 130 VAL A C   1 
ATOM 743  O O   . VAL A 1 130 ? 1.750   -6.563  100.765 1.00 0.00 ? 130 VAL A O   1 
ATOM 744  C CB  . VAL A 1 130 ? 5.128   -6.922  101.584 1.00 0.00 ? 130 VAL A CB  1 
ATOM 745  C CG1 . VAL A 1 130 ? 4.567   -6.571  102.912 1.00 0.00 ? 130 VAL A CG1 1 
ATOM 746  C CG2 . VAL A 1 130 ? 5.691   -8.329  101.410 1.00 0.00 ? 130 VAL A CG2 1 
ATOM 747  N N   . ASN A 1 131 ? 2.793   -4.623  100.692 1.00 0.00 ? 131 ASN A N   1 
ATOM 748  C CA  . ASN A 1 131 ? 1.507   -3.974  100.940 1.00 0.00 ? 131 ASN A CA  1 
ATOM 749  C C   . ASN A 1 131 ? 0.670   -3.809  99.697  1.00 0.00 ? 131 ASN A C   1 
ATOM 750  O O   . ASN A 1 131 ? -0.558  -3.744  99.891  1.00 0.00 ? 131 ASN A O   1 
ATOM 751  C CB  . ASN A 1 131 ? 1.701   -2.579  101.568 1.00 0.00 ? 131 ASN A CB  1 
ATOM 752  C CG  . ASN A 1 131 ? 2.122   -2.613  103.013 1.00 0.00 ? 131 ASN A CG  1 
ATOM 753  O OD1 . ASN A 1 131 ? 2.140   -3.686  103.673 1.00 0.00 ? 131 ASN A OD1 1 
ATOM 754  N ND2 . ASN A 1 131 ? 2.486   -1.395  103.472 1.00 0.00 ? 131 ASN A ND2 1 
ATOM 755  N N   . THR A 1 132 ? 1.333   -3.714  98.551  1.00 0.00 ? 132 THR A N   1 
ATOM 756  C CA  . THR A 1 132 ? 0.494   -3.492  97.362  1.00 0.00 ? 132 THR A CA  1 
ATOM 757  C C   . THR A 1 132 ? 0.423   -4.567  96.315  1.00 0.00 ? 132 THR A C   1 
ATOM 758  O O   . THR A 1 132 ? -0.487  -4.338  95.439  1.00 0.00 ? 132 THR A O   1 
ATOM 759  C CB  . THR A 1 132 ? 0.967   -2.127  96.716  1.00 0.00 ? 132 THR A CB  1 
ATOM 760  O OG1 . THR A 1 132 ? 2.070   -2.445  95.876  1.00 0.00 ? 132 THR A OG1 1 
ATOM 761  C CG2 . THR A 1 132 ? 1.476   -1.065  97.682  1.00 0.00 ? 132 THR A CG2 1 
ATOM 762  N N   . MET A 1 133 ? 1.170   -5.622  96.262  1.00 0.00 ? 133 MET A N   1 
ATOM 763  C CA  . MET A 1 133 ? 1.082   -6.659  95.242  1.00 0.00 ? 133 MET A CA  1 
ATOM 764  C C   . MET A 1 133 ? 0.351   -7.860  95.812  1.00 0.00 ? 133 MET A C   1 
ATOM 765  O O   . MET A 1 133 ? 0.247   -8.056  97.034  1.00 0.00 ? 133 MET A O   1 
ATOM 766  C CB  . MET A 1 133 ? 2.442   -7.123  94.779  1.00 0.00 ? 133 MET A CB  1 
ATOM 767  C CG  . MET A 1 133 ? 3.407   -5.965  94.757  1.00 0.00 ? 133 MET A CG  1 
ATOM 768  S SD  . MET A 1 133 ? 3.019   -4.985  93.241  1.00 0.00 ? 133 MET A SD  1 
ATOM 769  C CE  . MET A 1 133 ? 4.518   -3.940  93.341  1.00 0.00 ? 133 MET A CE  1 
ATOM 770  N N   . SER A 1 134 ? -0.145  -8.664  94.901  1.00 0.00 ? 134 SER A N   1 
ATOM 771  C CA  . SER A 1 134 ? -0.880  -9.845  95.373  1.00 0.00 ? 134 SER A CA  1 
ATOM 772  C C   . SER A 1 134 ? -0.237  -11.146 94.989  1.00 0.00 ? 134 SER A C   1 
ATOM 773  O O   . SER A 1 134 ? -0.672  -12.193 95.512  1.00 0.00 ? 134 SER A O   1 
ATOM 774  C CB  . SER A 1 134 ? -2.264  -9.728  94.787  1.00 0.00 ? 134 SER A CB  1 
ATOM 775  O OG  . SER A 1 134 ? -2.242  -10.191 93.468  1.00 0.00 ? 134 SER A OG  1 
ATOM 776  N N   . GLU A 1 135 ? 0.730   -11.134 94.114  1.00 0.00 ? 135 GLU A N   1 
ATOM 777  C CA  . GLU A 1 135 ? 1.407   -12.387 93.716  1.00 0.00 ? 135 GLU A CA  1 
ATOM 778  C C   . GLU A 1 135 ? 2.782   -11.993 93.169  1.00 0.00 ? 135 GLU A C   1 
ATOM 779  O O   . GLU A 1 135 ? 2.811   -10.850 92.677  1.00 0.00 ? 135 GLU A O   1 
ATOM 780  C CB  . GLU A 1 135 ? 0.625   -13.125 92.737  1.00 0.00 ? 135 GLU A CB  1 
ATOM 781  C CG  . GLU A 1 135 ? 0.884   -13.030 91.258  1.00 0.00 ? 135 GLU A CG  1 
ATOM 782  C CD  . GLU A 1 135 ? -0.223  -13.790 90.532  1.00 0.00 ? 135 GLU A CD  1 
ATOM 783  O OE1 . GLU A 1 135 ? -1.326  -13.856 91.085  1.00 0.00 ? 135 GLU A OE1 1 
ATOM 784  O OE2 . GLU A 1 135 ? 0.124   -14.274 89.443  1.00 0.00 ? 135 GLU A OE2 1 
ATOM 785  N N   . LEU A 1 136 ? 3.785   -12.813 93.261  1.00 0.00 ? 136 LEU A N   1 
ATOM 786  C CA  . LEU A 1 136 ? 5.134   -12.516 92.773  1.00 0.00 ? 136 LEU A CA  1 
ATOM 787  C C   . LEU A 1 136 ? 5.621   -13.625 91.860  1.00 0.00 ? 136 LEU A C   1 
ATOM 788  O O   . LEU A 1 136 ? 5.460   -14.816 92.155  1.00 0.00 ? 136 LEU A O   1 
ATOM 789  C CB  . LEU A 1 136 ? 6.049   -12.397 94.009  1.00 0.00 ? 136 LEU A CB  1 
ATOM 790  C CG  . LEU A 1 136 ? 7.313   -11.563 93.812  1.00 0.00 ? 136 LEU A CG  1 
ATOM 791  C CD1 . LEU A 1 136 ? 7.028   -10.141 93.335  1.00 0.00 ? 136 LEU A CD1 1 
ATOM 792  C CD2 . LEU A 1 136 ? 8.120   -11.410 95.109  1.00 0.00 ? 136 LEU A CD2 1 
ATOM 793  N N   . HIS A 1 137 ? 6.199   -13.193 90.768  1.00 0.00 ? 137 HIS A N   1 
ATOM 794  C CA  . HIS A 1 137 ? 6.772   -14.104 89.790  1.00 0.00 ? 137 HIS A CA  1 
ATOM 795  C C   . HIS A 1 137 ? 8.231   -13.815 89.618  1.00 0.00 ? 137 HIS A C   1 
ATOM 796  O O   . HIS A 1 137 ? 8.617   -12.776 89.063  1.00 0.00 ? 137 HIS A O   1 
ATOM 797  C CB  . HIS A 1 137 ? 6.132   -13.944 88.420  1.00 0.00 ? 137 HIS A CB  1 
ATOM 798  C CG  . HIS A 1 137 ? 4.639   -14.192 88.442  1.00 0.00 ? 137 HIS A CG  1 
ATOM 799  N ND1 . HIS A 1 137 ? 4.036   -15.128 87.611  1.00 0.00 ? 137 HIS A ND1 1 
ATOM 800  C CD2 . HIS A 1 137 ? 3.658   -13.632 89.182  1.00 0.00 ? 137 HIS A CD2 1 
ATOM 801  C CE1 . HIS A 1 137 ? 2.740   -15.109 87.859  1.00 0.00 ? 137 HIS A CE1 1 
ATOM 802  N NE2 . HIS A 1 137 ? 2.498   -14.221 88.794  1.00 0.00 ? 137 HIS A NE2 1 
ATOM 803  N N   . LEU A 1 138 ? 9.000   -14.729 90.113  1.00 0.00 ? 138 LEU A N   1 
ATOM 804  C CA  . LEU A 1 138 ? 10.418  -14.652 89.939  1.00 0.00 ? 138 LEU A CA  1 
ATOM 805  C C   . LEU A 1 138 ? 10.672  -14.805 88.409  1.00 0.00 ? 138 LEU A C   1 
ATOM 806  O O   . LEU A 1 138 ? 10.036  -15.629 87.736  1.00 0.00 ? 138 LEU A O   1 
ATOM 807  C CB  . LEU A 1 138 ? 11.097  -15.777 90.724  1.00 0.00 ? 138 LEU A CB  1 
ATOM 808  C CG  . LEU A 1 138 ? 12.620  -15.638 90.782  1.00 0.00 ? 138 LEU A CG  1 
ATOM 809  C CD1 . LEU A 1 138 ? 13.077  -14.333 91.436  1.00 0.00 ? 138 LEU A CD1 1 
ATOM 810  C CD2 . LEU A 1 138 ? 13.292  -16.759 91.579  1.00 0.00 ? 138 LEU A CD2 1 
ATOM 811  N N   . VAL A 1 139 ? 11.622  -13.991 87.871  1.00 0.00 ? 139 VAL A N   1 
ATOM 812  C CA  . VAL A 1 139 ? 11.911  -13.980 86.383  1.00 0.00 ? 139 VAL A CA  1 
ATOM 813  C C   . VAL A 1 139 ? 13.398  -14.292 86.047  1.00 0.00 ? 139 VAL A C   1 
ATOM 814  O O   . VAL A 1 139 ? 13.785  -15.459 85.883  1.00 0.00 ? 139 VAL A O   1 
ATOM 815  C CB  . VAL A 1 139 ? 11.610  -12.607 85.773  1.00 0.00 ? 139 VAL A CB  1 
ATOM 816  C CG1 . VAL A 1 139 ? 12.152  -12.454 84.349  1.00 0.00 ? 139 VAL A CG1 1 
ATOM 817  C CG2 . VAL A 1 139 ? 10.113  -12.309 85.679  1.00 0.00 ? 139 VAL A CG2 1 
ATOM 818  N N   . SER A 1 140 ? 14.181  -13.206 85.949  1.00 0.00 ? 140 SER A N   1 
ATOM 819  C CA  . SER A 1 140 ? 15.603  -13.268 85.513  1.00 0.00 ? 140 SER A CA  1 
ATOM 820  C C   . SER A 1 140 ? 16.576  -13.139 86.674  1.00 0.00 ? 140 SER A C   1 
ATOM 821  O O   . SER A 1 140 ? 16.211  -12.687 87.768  1.00 0.00 ? 140 SER A O   1 
ATOM 822  C CB  . SER A 1 140 ? 15.918  -12.104 84.569  1.00 0.00 ? 140 SER A CB  1 
ATOM 823  O OG  . SER A 1 140 ? 15.277  -12.304 83.320  1.00 0.00 ? 140 SER A OG  1 
ATOM 824  N N   . PHE A 1 141 ? 17.780  -13.547 86.366  1.00 0.00 ? 141 PHE A N   1 
ATOM 825  C CA  . PHE A 1 141 ? 18.900  -13.483 87.274  1.00 0.00 ? 141 PHE A CA  1 
ATOM 826  C C   . PHE A 1 141 ? 20.199  -13.518 86.486  1.00 0.00 ? 141 PHE A C   1 
ATOM 827  O O   . PHE A 1 141 ? 20.446  -14.447 85.702  1.00 0.00 ? 141 PHE A O   1 
ATOM 828  C CB  . PHE A 1 141 ? 18.887  -14.661 88.229  1.00 0.00 ? 141 PHE A CB  1 
ATOM 829  C CG  . PHE A 1 141 ? 20.070  -14.631 89.178  1.00 0.00 ? 141 PHE A CG  1 
ATOM 830  C CD1 . PHE A 1 141 ? 20.046  -13.788 90.293  1.00 0.00 ? 141 PHE A CD1 1 
ATOM 831  C CD2 . PHE A 1 141 ? 21.186  -15.434 88.927  1.00 0.00 ? 141 PHE A CD2 1 
ATOM 832  C CE1 . PHE A 1 141 ? 21.141  -13.744 91.157  1.00 0.00 ? 141 PHE A CE1 1 
ATOM 833  C CE2 . PHE A 1 141 ? 22.284  -15.390 89.790  1.00 0.00 ? 141 PHE A CE2 1 
ATOM 834  C CZ  . PHE A 1 141 ? 22.262  -14.543 90.906  1.00 0.00 ? 141 PHE A CZ  1 
ATOM 835  N N   . GLU A 1 142 ? 20.995  -12.498 86.712  1.00 0.00 ? 142 GLU A N   1 
ATOM 836  C CA  . GLU A 1 142 ? 22.290  -12.357 86.056  1.00 0.00 ? 142 GLU A CA  1 
ATOM 837  C C   . GLU A 1 142 ? 23.278  -11.663 86.983  1.00 0.00 ? 142 GLU A C   1 
ATOM 838  O O   . GLU A 1 142 ? 22.979  -10.606 87.560  1.00 0.00 ? 142 GLU A O   1 
ATOM 839  C CB  . GLU A 1 142 ? 22.140  -11.571 84.755  1.00 0.00 ? 142 GLU A CB  1 
ATOM 840  C CG  . GLU A 1 142 ? 21.818  -10.096 84.967  1.00 0.00 ? 142 GLU A CG  1 
ATOM 841  C CD  . GLU A 1 142 ? 21.762  -9.313  83.653  1.00 0.00 ? 142 GLU A CD  1 
ATOM 842  O OE1 . GLU A 1 142 ? 20.664  -9.263  82.979  1.00 0.00 ? 142 GLU A OE1 1 
ATOM 843  O OE2 . GLU A 1 142 ? 22.813  -8.704  83.220  1.00 0.00 ? 142 GLU A OE2 1 
ATOM 844  N N   . GLN A 1 143 ? 24.431  -12.302 87.083  1.00 0.00 ? 143 GLN A N   1 
ATOM 845  C CA  . GLN A 1 143 ? 25.535  -11.843 87.920  1.00 0.00 ? 143 GLN A CA  1 
ATOM 846  C C   . GLN A 1 143 ? 26.643  -11.270 87.057  1.00 0.00 ? 143 GLN A C   1 
ATOM 847  O O   . GLN A 1 143 ? 26.865  -11.718 85.921  1.00 0.00 ? 143 GLN A O   1 
ATOM 848  C CB  . GLN A 1 143 ? 26.102  -13.009 88.722  1.00 0.00 ? 143 GLN A CB  1 
ATOM 849  C CG  . GLN A 1 143 ? 25.119  -13.555 89.751  1.00 0.00 ? 143 GLN A CG  1 
ATOM 850  C CD  . GLN A 1 143 ? 25.725  -14.644 90.630  1.00 0.00 ? 143 GLN A CD  1 
ATOM 851  O OE1 . GLN A 1 143 ? 26.260  -14.345 91.696  1.00 0.00 ? 143 GLN A OE1 1 
ATOM 852  N NE2 . GLN A 1 143 ? 25.674  -15.905 90.247  1.00 0.00 ? 143 GLN A NE2 1 
ATOM 853  N N   . GLU A 1 144 ? 27.304  -10.295 87.632  1.00 0.00 ? 144 GLU A N   1 
ATOM 854  C CA  . GLU A 1 144 ? 28.401  -9.602  86.985  1.00 0.00 ? 144 GLU A CA  1 
ATOM 855  C C   . GLU A 1 144 ? 29.473  -9.202  88.025  1.00 0.00 ? 144 GLU A C   1 
ATOM 856  O O   . GLU A 1 144 ? 29.157  -8.646  89.088  1.00 0.00 ? 144 GLU A O   1 
ATOM 857  C CB  . GLU A 1 144 ? 27.891  -8.338  86.300  1.00 0.00 ? 144 GLU A CB  1 
ATOM 858  C CG  . GLU A 1 144 ? 29.001  -7.553  85.601  1.00 0.00 ? 144 GLU A CG  1 
ATOM 859  C CD  . GLU A 1 144 ? 28.472  -6.396  84.758  1.00 0.00 ? 144 GLU A CD  1 
ATOM 860  O OE1 . GLU A 1 144 ? 28.188  -5.268  85.317  1.00 0.00 ? 144 GLU A OE1 1 
ATOM 861  O OE2 . GLU A 1 144 ? 28.309  -6.545  83.488  1.00 0.00 ? 144 GLU A OE2 1 
ATOM 862  N N   . ILE A 1 145 ? 30.726  -9.508  87.653  1.00 0.00 ? 145 ILE A N   1 
ATOM 863  C CA  . ILE A 1 145 ? 31.930  -9.218  88.486  1.00 0.00 ? 145 ILE A CA  1 
ATOM 864  C C   . ILE A 1 145 ? 32.891  -8.282  87.733  1.00 0.00 ? 145 ILE A C   1 
ATOM 865  O O   . ILE A 1 145 ? 33.239  -8.526  86.567  1.00 0.00 ? 145 ILE A O   1 
ATOM 866  C CB  . ILE A 1 145 ? 32.700  -10.499 88.767  1.00 0.00 ? 145 ILE A CB  1 
ATOM 867  C CG1 . ILE A 1 145 ? 31.876  -11.551 89.498  1.00 0.00 ? 145 ILE A CG1 1 
ATOM 868  C CG2 . ILE A 1 145 ? 33.940  -10.270 89.632  1.00 0.00 ? 145 ILE A CG2 1 
ATOM 869  C CD1 . ILE A 1 145 ? 32.637  -12.861 89.714  1.00 0.00 ? 145 ILE A CD1 1 
ATOM 870  N N   . PHE A 1 146 ? 33.317  -7.211  88.434  1.00 0.00 ? 146 PHE A N   1 
ATOM 871  C CA  . PHE A 1 146 ? 34.200  -6.185  87.828  1.00 0.00 ? 146 PHE A CA  1 
ATOM 872  C C   . PHE A 1 146 ? 35.145  -5.509  88.877  1.00 0.00 ? 146 PHE A C   1 
ATOM 873  O O   . PHE A 1 146 ? 34.979  -5.687  90.094  1.00 0.00 ? 146 PHE A O   1 
ATOM 874  C CB  . PHE A 1 146 ? 33.347  -5.098  87.144  1.00 0.00 ? 146 PHE A CB  1 
ATOM 875  C CG  . PHE A 1 146 ? 32.334  -4.410  88.086  1.00 0.00 ? 146 PHE A CG  1 
ATOM 876  C CD1 . PHE A 1 146 ? 31.035  -4.926  88.227  1.00 0.00 ? 146 PHE A CD1 1 
ATOM 877  C CD2 . PHE A 1 146 ? 32.705  -3.260  88.793  1.00 0.00 ? 146 PHE A CD2 1 
ATOM 878  C CE1 . PHE A 1 146 ? 30.112  -4.286  89.070  1.00 0.00 ? 146 PHE A CE1 1 
ATOM 879  C CE2 . PHE A 1 146 ? 31.783  -2.623  89.635  1.00 0.00 ? 146 PHE A CE2 1 
ATOM 880  C CZ  . PHE A 1 146 ? 30.487  -3.135  89.772  1.00 0.00 ? 146 PHE A CZ  1 
ATOM 881  N N   . ASN A 1 147 ? 36.111  -4.751  88.284  1.00 0.00 ? 147 ASN A N   1 
ATOM 882  C CA  . ASN A 1 147 ? 37.174  -3.967  89.008  1.00 0.00 ? 147 ASN A CA  1 
ATOM 883  C C   . ASN A 1 147 ? 37.934  -4.862  89.982  1.00 0.00 ? 147 ASN A C   1 
ATOM 884  O O   . ASN A 1 147 ? 37.960  -4.607  91.197  1.00 0.00 ? 147 ASN A O   1 
ATOM 885  C CB  . ASN A 1 147 ? 36.556  -2.773  89.717  1.00 0.00 ? 147 ASN A CB  1 
ATOM 886  C CG  . ASN A 1 147 ? 36.290  -1.601  88.761  1.00 0.00 ? 147 ASN A CG  1 
ATOM 887  O OD1 . ASN A 1 147 ? 37.198  -0.822  88.474  1.00 0.00 ? 147 ASN A OD1 1 
ATOM 888  N ND2 . ASN A 1 147 ? 35.087  -1.430  88.246  1.00 0.00 ? 147 ASN A ND2 1 
ATOM 889  N N   . VAL A 1 148 ? 38.528  -5.880  89.385  1.00 0.00 ? 148 VAL A N   1 
ATOM 890  C CA  . VAL A 1 148 ? 39.337  -6.876  90.086  1.00 0.00 ? 148 VAL A CA  1 
ATOM 891  C C   . VAL A 1 148 ? 40.658  -6.253  90.523  1.00 0.00 ? 148 VAL A C   1 
ATOM 892  O O   . VAL A 1 148 ? 41.341  -5.583  89.734  1.00 0.00 ? 148 VAL A O   1 
ATOM 893  C CB  . VAL A 1 148 ? 39.643  -8.046  89.142  1.00 0.00 ? 148 VAL A CB  1 
ATOM 894  C CG1 . VAL A 1 148 ? 40.534  -9.113  89.782  1.00 0.00 ? 148 VAL A CG1 1 
ATOM 895  C CG2 . VAL A 1 148 ? 38.387  -8.781  88.673  1.00 0.00 ? 148 VAL A CG2 1 
ATOM 896  N N   . VAL A 1 149 ? 40.979  -6.493  91.772  1.00 0.00 ? 149 VAL A N   1 
ATOM 897  C CA  . VAL A 1 149 ? 42.212  -5.994  92.384  1.00 0.00 ? 149 VAL A CA  1 
ATOM 898  C C   . VAL A 1 149 ? 42.864  -7.096  93.207  1.00 0.00 ? 149 VAL A C   1 
ATOM 899  O O   . VAL A 1 149 ? 42.200  -7.777  94.003  1.00 0.00 ? 149 VAL A O   1 
ATOM 900  C CB  . VAL A 1 149 ? 41.903  -4.805  93.293  1.00 0.00 ? 149 VAL A CB  1 
ATOM 901  C CG1 . VAL A 1 149 ? 43.082  -4.417  94.189  1.00 0.00 ? 149 VAL A CG1 1 
ATOM 902  C CG2 . VAL A 1 149 ? 41.537  -3.539  92.517  1.00 0.00 ? 149 VAL A CG2 1 
ATOM 903  N N   . LEU A 1 150 ? 44.150  -7.234  92.985  1.00 0.00 ? 150 LEU A N   1 
ATOM 904  C CA  . LEU A 1 150 ? 44.971  -8.232  93.667  1.00 0.00 ? 150 LEU A CA  1 
ATOM 905  C C   . LEU A 1 150 ? 46.199  -7.580  94.245  1.00 0.00 ? 150 LEU A C   1 
ATOM 906  O O   . LEU A 1 150 ? 47.032  -7.021  93.512  1.00 0.00 ? 150 LEU A O   1 
ATOM 907  C CB  . LEU A 1 150 ? 45.412  -9.313  92.679  1.00 0.00 ? 150 LEU A CB  1 
ATOM 908  C CG  . LEU A 1 150 ? 44.252  -10.170 92.174  1.00 0.00 ? 150 LEU A CG  1 
ATOM 909  C CD1 . LEU A 1 150 ? 44.637  -11.056 90.987  1.00 0.00 ? 150 LEU A CD1 1 
ATOM 910  C CD2 . LEU A 1 150 ? 43.703  -11.120 93.240  1.00 0.00 ? 150 LEU A CD2 1 
ATOM 911  N N   . LYS A 1 151 ? 46.303  -7.664  95.540  1.00 0.00 ? 151 LYS A N   1 
ATOM 912  C CA  . LYS A 1 151 ? 47.421  -7.072  96.254  1.00 0.00 ? 151 LYS A CA  1 
ATOM 913  C C   . LYS A 1 151 ? 48.171  -8.131  97.084  1.00 0.00 ? 151 LYS A C   1 
ATOM 914  O O   . LYS A 1 151 ? 47.556  -9.048  97.651  1.00 0.00 ? 151 LYS A O   1 
ATOM 915  C CB  . LYS A 1 151 ? 46.920  -5.956  97.164  1.00 0.00 ? 151 LYS A CB  1 
ATOM 916  C CG  . LYS A 1 151 ? 46.304  -4.783  96.389  1.00 0.00 ? 151 LYS A CG  1 
ATOM 917  C CD  . LYS A 1 151 ? 46.176  -3.512  97.232  1.00 0.00 ? 151 LYS A CD  1 
ATOM 918  C CE  . LYS A 1 151 ? 45.577  -2.336  96.458  1.00 0.00 ? 151 LYS A CE  1 
ATOM 919  N NZ  . LYS A 1 151 ? 45.081  -1.265  97.334  1.00 0.00 ? 151 LYS A NZ  1 
ATOM 920  N N   . THR A 1 152 ? 49.509  -7.932  97.103  1.00 0.00 ? 152 THR A N   1 
ATOM 921  C CA  . THR A 1 152 ? 50.474  -8.772  97.866  1.00 0.00 ? 152 THR A CA  1 
ATOM 922  C C   . THR A 1 152 ? 50.888  -8.032  99.138  1.00 0.00 ? 152 THR A C   1 
ATOM 923  O O   . THR A 1 152 ? 51.007  -6.798  99.150  1.00 0.00 ? 152 THR A O   1 
ATOM 924  C CB  . THR A 1 152 ? 51.747  -9.013  97.027  1.00 0.00 ? 152 THR A CB  1 
ATOM 925  O OG1 . THR A 1 152 ? 51.395  -9.360  95.697  1.00 0.00 ? 152 THR A OG1 1 
ATOM 926  C CG2 . THR A 1 152 ? 52.623  -10.142 97.577  1.00 0.00 ? 152 THR A CG2 1 
ATOM 927  N N   . VAL A 1 153 ? 51.097  -8.800  100.178 1.00 0.00 ? 153 VAL A N   1 
ATOM 928  C CA  . VAL A 1 153 ? 51.476  -8.257  101.483 1.00 0.00 ? 153 VAL A CA  1 
ATOM 929  C C   . VAL A 1 153 ? 52.937  -8.558  101.784 1.00 0.00 ? 153 VAL A C   1 
ATOM 930  O O   . VAL A 1 153 ? 53.362  -9.722  101.788 1.00 0.00 ? 153 VAL A O   1 
ATOM 931  C CB  . VAL A 1 153 ? 50.612  -8.871  102.582 1.00 0.00 ? 153 VAL A CB  1 
ATOM 932  C CG1 . VAL A 1 153 ? 51.122  -8.554  103.990 1.00 0.00 ? 153 VAL A CG1 1 
ATOM 933  C CG2 . VAL A 1 153 ? 49.163  -8.381  102.546 1.00 0.00 ? 153 VAL A CG2 1 
ATOM 934  N N   . SER A 1 154 ? 53.652  -7.483  102.022 1.00 0.00 ? 154 SER A N   1 
ATOM 935  C CA  . SER A 1 154 ? 55.064  -7.526  102.389 1.00 0.00 ? 154 SER A CA  1 
ATOM 936  C C   . SER A 1 154 ? 55.201  -7.152  103.861 1.00 0.00 ? 154 SER A C   1 
ATOM 937  O O   . SER A 1 154 ? 54.856  -6.034  104.271 1.00 0.00 ? 154 SER A O   1 
ATOM 938  C CB  . SER A 1 154 ? 55.857  -6.539  101.530 1.00 0.00 ? 154 SER A CB  1 
ATOM 939  O OG  . SER A 1 154 ? 55.913  -7.000  100.188 1.00 0.00 ? 154 SER A OG  1 
ATOM 940  N N   . GLU A 1 155 ? 55.700  -8.106  104.614 1.00 0.00 ? 155 GLU A N   1 
ATOM 941  C CA  . GLU A 1 155 ? 55.875  -7.966  106.065 1.00 0.00 ? 155 GLU A CA  1 
ATOM 942  C C   . GLU A 1 155 ? 57.313  -7.539  106.401 1.00 0.00 ? 155 GLU A C   1 
ATOM 943  O O   . GLU A 1 155 ? 58.221  -8.377  106.501 1.00 0.00 ? 155 GLU A O   1 
ATOM 944  C CB  . GLU A 1 155 ? 55.594  -9.303  106.752 1.00 0.00 ? 155 GLU A CB  1 
ATOM 945  C CG  . GLU A 1 155 ? 55.261  -9.154  108.235 1.00 0.00 ? 155 GLU A CG  1 
ATOM 946  C CD  . GLU A 1 155 ? 54.105  -10.050 108.679 1.00 0.00 ? 155 GLU A CD  1 
ATOM 947  O OE1 . GLU A 1 155 ? 54.334  -11.269 109.034 1.00 0.00 ? 155 GLU A OE1 1 
ATOM 948  O OE2 . GLU A 1 155 ? 52.901  -9.587  108.698 1.00 0.00 ? 155 GLU A OE2 1 
ATOM 949  N N   . SER A 1 156 ? 57.460  -6.229  106.575 1.00 0.00 ? 156 SER A N   1 
ATOM 950  C CA  . SER A 1 156 ? 58.769  -5.579  106.834 1.00 0.00 ? 156 SER A CA  1 
ATOM 951  C C   . SER A 1 156 ? 59.112  -5.587  108.333 1.00 0.00 ? 156 SER A C   1 
ATOM 952  O O   . SER A 1 156 ? 58.963  -4.571  109.028 1.00 0.00 ? 156 SER A O   1 
ATOM 953  C CB  . SER A 1 156 ? 58.727  -4.124  106.360 1.00 0.00 ? 156 SER A CB  1 
ATOM 954  O OG  . SER A 1 156 ? 60.042  -3.595  106.295 1.00 0.00 ? 156 SER A OG  1 
ATOM 955  N N   . ALA A 1 157 ? 59.570  -6.743  108.778 1.00 0.00 ? 157 ALA A N   1 
ATOM 956  C CA  . ALA A 1 157 ? 59.977  -6.957  110.177 1.00 0.00 ? 157 ALA A CA  1 
ATOM 957  C C   . ALA A 1 157 ? 61.041  -5.933  110.563 1.00 0.00 ? 157 ALA A C   1 
ATOM 958  O O   . ALA A 1 157 ? 62.248  -6.184  110.430 1.00 0.00 ? 157 ALA A O   1 
ATOM 959  C CB  . ALA A 1 157 ? 60.551  -8.365  110.345 1.00 0.00 ? 157 ALA A CB  1 
ATOM 960  N N   . THR A 1 158 ? 60.554  -4.804  111.031 1.00 0.00 ? 158 THR A N   1 
ATOM 961  C CA  . THR A 1 158 ? 61.404  -3.687  111.452 1.00 0.00 ? 158 THR A CA  1 
ATOM 962  C C   . THR A 1 158 ? 60.706  -2.885  112.550 1.00 0.00 ? 158 THR A C   1 
ATOM 963  O O   . THR A 1 158 ? 59.870  -2.014  112.270 1.00 0.00 ? 158 THR A O   1 
ATOM 964  C CB  . THR A 1 158 ? 61.692  -2.774  110.259 1.00 0.00 ? 158 THR A CB  1 
ATOM 965  O OG1 . THR A 1 158 ? 63.088  -2.537  110.156 1.00 0.00 ? 158 THR A OG1 1 
ATOM 966  C CG2 . THR A 1 158 ? 61.002  -1.414  110.365 1.00 0.00 ? 158 THR A CG2 1 
ATOM 967  N N   . GLN A 1 159 ? 61.078  -3.214  113.773 1.00 0.00 ? 159 GLN A N   1 
ATOM 968  C CA  . GLN A 1 159 ? 60.550  -2.554  114.977 1.00 0.00 ? 159 GLN A CA  1 
ATOM 969  C C   . GLN A 1 159 ? 59.174  -3.082  115.351 1.00 0.00 ? 159 GLN A C   1 
ATOM 970  O O   . GLN A 1 159 ? 59.043  -3.949  116.233 1.00 0.00 ? 159 GLN A O   1 
ATOM 971  C CB  . GLN A 1 159 ? 60.314  -1.066  114.708 1.00 0.00 ? 159 GLN A CB  1 
ATOM 972  C CG  . GLN A 1 159 ? 61.428  -0.424  113.882 1.00 0.00 ? 159 GLN A CG  1 
ATOM 973  C CD  . GLN A 1 159 ? 62.683  -0.126  114.703 1.00 0.00 ? 159 GLN A CD  1 
ATOM 974  O OE1 . GLN A 1 159 ? 63.665  -0.861  114.613 1.00 0.00 ? 159 GLN A OE1 1 
ATOM 975  N NE2 . GLN A 1 159 ? 62.712  0.919   115.508 1.00 0.00 ? 159 GLN A NE2 1 
ATOM 976  N N   . PRO A 1 160 ? 58.101  -2.579  114.696 1.00 0.00 ? 160 PRO A N   1 
ATOM 977  C CA  . PRO A 1 160 ? 56.736  -2.972  115.033 1.00 0.00 ? 160 PRO A CA  1 
ATOM 978  C C   . PRO A 1 160 ? 56.610  -4.495  115.068 1.00 0.00 ? 160 PRO A C   1 
ATOM 979  O O   . PRO A 1 160 ? 56.179  -5.059  116.116 1.00 0.00 ? 160 PRO A O   1 
ATOM 980  C CB  . PRO A 1 160 ? 55.886  -2.241  114.009 1.00 0.00 ? 160 PRO A CB  1 
ATOM 981  C CG  . PRO A 1 160 ? 56.830  -1.388  113.146 1.00 0.00 ? 160 PRO A CG  1 
ATOM 982  C CD  . PRO A 1 160 ? 58.231  -1.599  113.604 1.00 0.00 ? 160 PRO A CD  1 
ATOM 983  N N   . PRO A 1 161 ? 56.946  -5.284  113.994 1.00 0.00 ? 161 PRO A N   1 
ATOM 984  C CA  . PRO A 1 161 ? 57.370  -4.742  112.682 1.00 0.00 ? 161 PRO A CA  1 
ATOM 985  C C   . PRO A 1 161 ? 56.219  -3.937  112.004 1.00 0.00 ? 161 PRO A C   1 
ATOM 986  O O   . PRO A 1 161 ? 55.286  -3.466  112.724 1.00 0.00 ? 161 PRO A O   1 
ATOM 987  C CB  . PRO A 1 161 ? 57.719  -5.995  111.878 1.00 0.00 ? 161 PRO A CB  1 
ATOM 988  C CG  . PRO A 1 161 ? 57.455  -7.226  112.778 1.00 0.00 ? 161 PRO A CG  1 
ATOM 989  C CD  . PRO A 1 161 ? 56.944  -6.766  114.095 1.00 0.00 ? 161 PRO A CD  1 
ATOM 990  N N   . THR A 1 162 ? 56.331  -3.810  110.638 1.00 0.00 ? 162 THR A N   1 
ATOM 991  C CA  . THR A 1 162 ? 55.337  -3.034  109.777 1.00 0.00 ? 162 THR A CA  1 
ATOM 992  C C   . THR A 1 162 ? 54.905  -3.867  108.528 1.00 0.00 ? 162 THR A C   1 
ATOM 993  O O   . THR A 1 162 ? 55.614  -4.780  108.088 1.00 0.00 ? 162 THR A O   1 
ATOM 994  C CB  . THR A 1 162 ? 55.984  -1.737  109.261 1.00 0.00 ? 162 THR A CB  1 
ATOM 995  O OG1 . THR A 1 162 ? 56.347  -0.906  110.353 1.00 0.00 ? 162 THR A OG1 1 
ATOM 996  C CG2 . THR A 1 162 ? 55.058  -0.921  108.354 1.00 0.00 ? 162 THR A CG2 1 
ATOM 997  N N   . LYS A 1 163 ? 53.728  -3.501  107.979 1.00 0.00 ? 163 LYS A N   1 
ATOM 998  C CA  . LYS A 1 163 ? 53.139  -4.198  106.791 1.00 0.00 ? 163 LYS A CA  1 
ATOM 999  C C   . LYS A 1 163 ? 52.999  -3.233  105.597 1.00 0.00 ? 163 LYS A C   1 
ATOM 1000 O O   . LYS A 1 163 ? 52.403  -2.149  105.718 1.00 0.00 ? 163 LYS A O   1 
ATOM 1001 C CB  . LYS A 1 163 ? 51.756  -4.755  107.133 1.00 0.00 ? 163 LYS A CB  1 
ATOM 1002 C CG  . LYS A 1 163 ? 51.817  -5.932  108.108 1.00 0.00 ? 163 LYS A CG  1 
ATOM 1003 C CD  . LYS A 1 163 ? 50.539  -6.772  108.120 1.00 0.00 ? 163 LYS A CD  1 
ATOM 1004 C CE  . LYS A 1 163 ? 50.657  -8.023  108.995 1.00 0.00 ? 163 LYS A CE  1 
ATOM 1005 N NZ  . LYS A 1 163 ? 49.354  -8.562  109.407 1.00 0.00 ? 163 LYS A NZ  1 
ATOM 1006 N N   . VAL A 1 164 ? 53.553  -3.689  104.479 1.00 0.00 ? 164 VAL A N   1 
ATOM 1007 C CA  . VAL A 1 164 ? 53.548  -2.950  103.207 1.00 0.00 ? 164 VAL A CA  1 
ATOM 1008 C C   . VAL A 1 164 ? 52.726  -3.723  102.158 1.00 0.00 ? 164 VAL A C   1 
ATOM 1009 O O   . VAL A 1 164 ? 53.095  -4.840  101.755 1.00 0.00 ? 164 VAL A O   1 
ATOM 1010 C CB  . VAL A 1 164 ? 54.986  -2.769  102.708 1.00 0.00 ? 164 VAL A CB  1 
ATOM 1011 C CG1 . VAL A 1 164 ? 55.074  -1.977  101.404 1.00 0.00 ? 164 VAL A CG1 1 
ATOM 1012 C CG2 . VAL A 1 164 ? 55.873  -2.020  103.708 1.00 0.00 ? 164 VAL A CG2 1 
ATOM 1013 N N   . TYR A 1 165 ? 51.634  -3.080  101.765 1.00 0.00 ? 165 TYR A N   1 
ATOM 1014 C CA  . TYR A 1 165 ? 50.671  -3.613  100.779 1.00 0.00 ? 165 TYR A CA  1 
ATOM 1015 C C   . TYR A 1 165 ? 51.011  -3.101  99.378  1.00 0.00 ? 165 TYR A C   1 
ATOM 1016 O O   . TYR A 1 165 ? 51.227  -1.904  99.168  1.00 0.00 ? 165 TYR A O   1 
ATOM 1017 C CB  . TYR A 1 165 ? 49.259  -3.117  101.117 1.00 0.00 ? 165 TYR A CB  1 
ATOM 1018 C CG  . TYR A 1 165 ? 48.842  -3.423  102.553 1.00 0.00 ? 165 TYR A CG  1 
ATOM 1019 C CD1 . TYR A 1 165 ? 49.193  -2.547  103.593 1.00 0.00 ? 165 TYR A CD1 1 
ATOM 1020 C CD2 . TYR A 1 165 ? 48.106  -4.576  102.829 1.00 0.00 ? 165 TYR A CD2 1 
ATOM 1021 C CE1 . TYR A 1 165 ? 48.810  -2.838  104.912 1.00 0.00 ? 165 TYR A CE1 1 
ATOM 1022 C CE2 . TYR A 1 165 ? 47.726  -4.869  104.144 1.00 0.00 ? 165 TYR A CE2 1 
ATOM 1023 C CZ  . TYR A 1 165 ? 48.078  -4.002  105.186 1.00 0.00 ? 165 TYR A CZ  1 
ATOM 1024 O OH  . TYR A 1 165 ? 47.710  -4.292  106.462 1.00 0.00 ? 165 TYR A OH  1 
ATOM 1025 N N   . ASN A 1 166 ? 51.046  -4.024  98.437  1.00 0.00 ? 166 ASN A N   1 
ATOM 1026 C CA  . ASN A 1 166 ? 51.358  -3.692  97.033  1.00 0.00 ? 166 ASN A CA  1 
ATOM 1027 C C   . ASN A 1 166 ? 50.385  -4.403  96.089  1.00 0.00 ? 166 ASN A C   1 
ATOM 1028 O O   . ASN A 1 166 ? 49.552  -5.212  96.522  1.00 0.00 ? 166 ASN A O   1 
ATOM 1029 C CB  . ASN A 1 166 ? 52.793  -4.090  96.709  1.00 0.00 ? 166 ASN A CB  1 
ATOM 1030 C CG  . ASN A 1 166 ? 53.826  -3.144  97.333  1.00 0.00 ? 166 ASN A CG  1 
ATOM 1031 O OD1 . ASN A 1 166 ? 54.797  -3.602  97.931  1.00 0.00 ? 166 ASN A OD1 1 
ATOM 1032 N ND2 . ASN A 1 166 ? 53.671  -1.836  97.231  1.00 0.00 ? 166 ASN A ND2 1 
ATOM 1033 N N   . ASN A 1 167 ? 50.530  -4.064  94.812  1.00 0.00 ? 167 ASN A N   1 
ATOM 1034 C CA  . ASN A 1 167 ? 49.679  -4.605  93.736  1.00 0.00 ? 167 ASN A CA  1 
ATOM 1035 C C   . ASN A 1 167 ? 50.495  -5.487  92.776  1.00 0.00 ? 167 ASN A C   1 
ATOM 1036 O O   . ASN A 1 167 ? 51.518  -5.054  92.225  1.00 0.00 ? 167 ASN A O   1 
ATOM 1037 C CB  . ASN A 1 167 ? 49.091  -3.462  92.890  1.00 0.00 ? 167 ASN A CB  1 
ATOM 1038 C CG  . ASN A 1 167 ? 48.209  -2.499  93.689  1.00 0.00 ? 167 ASN A CG  1 
ATOM 1039 O OD1 . ASN A 1 167 ? 47.107  -2.864  94.092  1.00 0.00 ? 167 ASN A OD1 1 
ATOM 1040 N ND2 . ASN A 1 167 ? 48.631  -1.272  93.938  1.00 0.00 ? 167 ASN A ND2 1 
ATOM 1041 N N   . ASP A 1 168 ? 49.995  -6.705  92.612  1.00 0.00 ? 168 ASP A N   1 
ATOM 1042 C CA  . ASP A 1 168 ? 50.561  -7.696  91.669  1.00 0.00 ? 168 ASP A CA  1 
ATOM 1043 C C   . ASP A 1 168 ? 49.667  -7.741  90.430  1.00 0.00 ? 168 ASP A C   1 
ATOM 1044 O O   . ASP A 1 168 ? 48.907  -8.700  90.228  1.00 0.00 ? 168 ASP A O   1 
ATOM 1045 C CB  . ASP A 1 168 ? 50.618  -9.073  92.330  1.00 0.00 ? 168 ASP A CB  1 
ATOM 1046 C CG  . ASP A 1 168 ? 51.459  -10.080 91.539  1.00 0.00 ? 168 ASP A CG  1 
ATOM 1047 O OD1 . ASP A 1 168 ? 52.289  -9.665  90.642  1.00 0.00 ? 168 ASP A OD1 1 
ATOM 1048 O OD2 . ASP A 1 168 ? 51.335  -11.343 91.767  1.00 0.00 ? 168 ASP A OD2 1 
ATOM 1049 N N   . LEU A 1 169 ? 49.809  -6.686  89.668  1.00 0.00 ? 169 LEU A N   1 
ATOM 1050 C CA  . LEU A 1 169 ? 48.992  -6.396  88.480  1.00 0.00 ? 169 LEU A CA  1 
ATOM 1051 C C   . LEU A 1 169 ? 48.949  -7.569  87.464  1.00 0.00 ? 169 LEU A C   1 
ATOM 1052 O O   . LEU A 1 169 ? 48.146  -7.563  86.520  1.00 0.00 ? 169 LEU A O   1 
ATOM 1053 C CB  . LEU A 1 169 ? 49.551  -5.172  87.755  1.00 0.00 ? 169 LEU A CB  1 
ATOM 1054 C CG  . LEU A 1 169 ? 49.670  -3.946  88.664  1.00 0.00 ? 169 LEU A CG  1 
ATOM 1055 C CD1 . LEU A 1 169 ? 50.223  -2.717  87.942  1.00 0.00 ? 169 LEU A CD1 1 
ATOM 1056 C CD2 . LEU A 1 169 ? 48.328  -3.511  89.257  1.00 0.00 ? 169 LEU A CD2 1 
ATOM 1057 N N   . THR A 1 170 ? 49.800  -8.553  87.654  1.00 0.00 ? 170 THR A N   1 
ATOM 1058 C CA  . THR A 1 170 ? 49.848  -9.725  86.728  1.00 0.00 ? 170 THR A CA  1 
ATOM 1059 C C   . THR A 1 170 ? 49.155  -10.941 87.358  1.00 0.00 ? 170 THR A C   1 
ATOM 1060 O O   . THR A 1 170 ? 48.963  -11.977 86.699  1.00 0.00 ? 170 THR A O   1 
ATOM 1061 C CB  . THR A 1 170 ? 51.294  -10.088 86.391  1.00 0.00 ? 170 THR A CB  1 
ATOM 1062 O OG1 . THR A 1 170 ? 52.144  -9.746  87.469  1.00 0.00 ? 170 THR A OG1 1 
ATOM 1063 C CG2 . THR A 1 170 ? 51.816  -9.370  85.144  1.00 0.00 ? 170 THR A CG2 1 
ATOM 1064 N N   . ALA A 1 171 ? 48.803  -10.772 88.626  1.00 0.00 ? 171 ALA A N   1 
ATOM 1065 C CA  . ALA A 1 171 ? 48.114  -11.814 89.417  1.00 0.00 ? 171 ALA A CA  1 
ATOM 1066 C C   . ALA A 1 171 ? 46.787  -12.154 88.762  1.00 0.00 ? 171 ALA A C   1 
ATOM 1067 O O   . ALA A 1 171 ? 46.366  -11.512 87.789  1.00 0.00 ? 171 ALA A O   1 
ATOM 1068 C CB  . ALA A 1 171 ? 47.868  -11.313 90.838  1.00 0.00 ? 171 ALA A CB  1 
ATOM 1069 N N   . SER A 1 172 ? 46.126  -13.154 89.307  1.00 0.00 ? 172 SER A N   1 
ATOM 1070 C CA  . SER A 1 172 ? 44.878  -13.617 88.733  1.00 0.00 ? 172 SER A CA  1 
ATOM 1071 C C   . SER A 1 172 ? 43.886  -14.076 89.765  1.00 0.00 ? 172 SER A C   1 
ATOM 1072 O O   . SER A 1 172 ? 44.242  -14.340 90.927  1.00 0.00 ? 172 SER A O   1 
ATOM 1073 C CB  . SER A 1 172 ? 45.122  -14.812 87.822  1.00 0.00 ? 172 SER A CB  1 
ATOM 1074 O OG  . SER A 1 172 ? 45.579  -14.369 86.560  1.00 0.00 ? 172 SER A OG  1 
ATOM 1075 N N   . LEU A 1 173 ? 42.696  -14.146 89.255  1.00 0.00 ? 173 LEU A N   1 
ATOM 1076 C CA  . LEU A 1 173 ? 41.549  -14.637 89.931  1.00 0.00 ? 173 LEU A CA  1 
ATOM 1077 C C   . LEU A 1 173 ? 40.973  -15.760 89.101  1.00 0.00 ? 173 LEU A C   1 
ATOM 1078 O O   . LEU A 1 173 ? 40.889  -15.663 87.867  1.00 0.00 ? 173 LEU A O   1 
ATOM 1079 C CB  . LEU A 1 173 ? 40.512  -13.524 90.068  1.00 0.00 ? 173 LEU A CB  1 
ATOM 1080 C CG  . LEU A 1 173 ? 39.527  -13.770 91.207  1.00 0.00 ? 173 LEU A CG  1 
ATOM 1081 C CD1 . LEU A 1 173 ? 39.763  -12.849 92.404  1.00 0.00 ? 173 LEU A CD1 1 
ATOM 1082 C CD2 . LEU A 1 173 ? 38.071  -13.556 90.795  1.00 0.00 ? 173 LEU A CD2 1 
ATOM 1083 N N   . MET A 1 174 ? 40.618  -16.799 89.778  1.00 0.00 ? 174 MET A N   1 
ATOM 1084 C CA  . MET A 1 174 ? 40.037  -17.971 89.150  1.00 0.00 ? 174 MET A CA  1 
ATOM 1085 C C   . MET A 1 174 ? 38.485  -18.019 89.344  1.00 0.00 ? 174 MET A C   1 
ATOM 1086 O O   . MET A 1 174 ? 37.982  -18.563 90.341  1.00 0.00 ? 174 MET A O   1 
ATOM 1087 C CB  . MET A 1 174 ? 40.642  -19.245 89.746  1.00 0.00 ? 174 MET A CB  1 
ATOM 1088 C CG  . MET A 1 174 ? 42.171  -19.222 89.779  1.00 0.00 ? 174 MET A CG  1 
ATOM 1089 S SD  . MET A 1 174 ? 42.886  -20.837 90.003  1.00 0.00 ? 174 MET A SD  1 
ATOM 1090 C CE  . MET A 1 174 ? 44.657  -20.707 90.126  1.00 0.00 ? 174 MET A CE  1 
ATOM 1091 N N   . VAL A 1 175 ? 37.737  -17.445 88.369  1.00 0.00 ? 175 VAL A N   1 
ATOM 1092 C CA  . VAL A 1 175 ? 36.240  -17.453 88.382  1.00 0.00 ? 175 VAL A CA  1 
ATOM 1093 C C   . VAL A 1 175 ? 35.739  -18.631 87.612  1.00 0.00 ? 175 VAL A C   1 
ATOM 1094 O O   . VAL A 1 175 ? 36.247  -18.937 86.525  1.00 0.00 ? 175 VAL A O   1 
ATOM 1095 C CB  . VAL A 1 175 ? 35.612  -16.227 87.697  1.00 0.00 ? 175 VAL A CB  1 
ATOM 1096 C CG1 . VAL A 1 175 ? 34.070  -16.279 87.657  1.00 0.00 ? 175 VAL A CG1 1 
ATOM 1097 C CG2 . VAL A 1 175 ? 35.952  -14.916 88.389  1.00 0.00 ? 175 VAL A CG2 1 
ATOM 1098 N N   . ALA A 1 176 ? 34.765  -19.248 88.191  1.00 0.00 ? 176 ALA A N   1 
ATOM 1099 C CA  . ALA A 1 176 ? 34.174  -20.408 87.592  1.00 0.00 ? 176 ALA A CA  1 
ATOM 1100 C C   . ALA A 1 176 ? 32.658  -20.410 87.788  1.00 0.00 ? 176 ALA A C   1 
ATOM 1101 O O   . ALA A 1 176 ? 32.144  -19.880 88.785  1.00 0.00 ? 176 ALA A O   1 
ATOM 1102 C CB  . ALA A 1 176 ? 34.748  -21.677 88.225  1.00 0.00 ? 176 ALA A CB  1 
ATOM 1103 N N   . LEU A 1 177 ? 32.000  -21.026 86.822  1.00 0.00 ? 177 LEU A N   1 
ATOM 1104 C CA  . LEU A 1 177 ? 30.533  -21.106 86.767  1.00 0.00 ? 177 LEU A CA  1 
ATOM 1105 C C   . LEU A 1 177 ? 30.078  -22.530 86.392  1.00 0.00 ? 177 LEU A C   1 
ATOM 1106 O O   . LEU A 1 177 ? 30.447  -23.059 85.333  1.00 0.00 ? 177 LEU A O   1 
ATOM 1107 C CB  . LEU A 1 177 ? 30.041  -20.124 85.696  1.00 0.00 ? 177 LEU A CB  1 
ATOM 1108 C CG  . LEU A 1 177 ? 28.581  -19.707 85.857  1.00 0.00 ? 177 LEU A CG  1 
ATOM 1109 C CD1 . LEU A 1 177 ? 27.690  -20.231 84.728  1.00 0.00 ? 177 LEU A CD1 1 
ATOM 1110 C CD2 . LEU A 1 177 ? 27.954  -20.209 87.155  1.00 0.00 ? 177 LEU A CD2 1 
ATOM 1111 N N   . ASP A 1 178 ? 29.280  -23.117 87.283  1.00 0.00 ? 178 ASP A N   1 
ATOM 1112 C CA  . ASP A 1 178 ? 28.696  -24.469 87.088  1.00 0.00 ? 178 ASP A CA  1 
ATOM 1113 C C   . ASP A 1 178 ? 27.345  -24.322 86.394  1.00 0.00 ? 178 ASP A C   1 
ATOM 1114 O O   . ASP A 1 178 ? 26.294  -24.637 86.974  1.00 0.00 ? 178 ASP A O   1 
ATOM 1115 C CB  . ASP A 1 178 ? 28.508  -25.170 88.433  1.00 0.00 ? 178 ASP A CB  1 
ATOM 1116 C CG  . ASP A 1 178 ? 28.222  -26.666 88.284  1.00 0.00 ? 178 ASP A CG  1 
ATOM 1117 O OD1 . ASP A 1 178 ? 28.646  -27.304 87.245  1.00 0.00 ? 178 ASP A OD1 1 
ATOM 1118 O OD2 . ASP A 1 178 ? 27.558  -27.291 89.196  1.00 0.00 ? 178 ASP A OD2 1 
ATOM 1119 N N   . SER A 1 179 ? 27.456  -23.847 85.174  1.00 0.00 ? 179 SER A N   1 
ATOM 1120 C CA  . SER A 1 179 ? 26.322  -23.548 84.297  1.00 0.00 ? 179 SER A CA  1 
ATOM 1121 C C   . SER A 1 179 ? 25.505  -24.789 83.947  1.00 0.00 ? 179 SER A C   1 
ATOM 1122 O O   . SER A 1 179 ? 24.328  -24.696 83.568  1.00 0.00 ? 179 SER A O   1 
ATOM 1123 C CB  . SER A 1 179 ? 26.828  -22.962 82.977  1.00 0.00 ? 179 SER A CB  1 
ATOM 1124 O OG  . SER A 1 179 ? 26.433  -21.605 82.861  1.00 0.00 ? 179 SER A OG  1 
ATOM 1125 N N   . ASN A 1 180 ? 26.152  -25.921 84.072  1.00 0.00 ? 180 ASN A N   1 
ATOM 1126 C CA  . ASN A 1 180 ? 25.527  -27.207 83.776  1.00 0.00 ? 180 ASN A CA  1 
ATOM 1127 C C   . ASN A 1 180 ? 25.245  -27.947 85.079  1.00 0.00 ? 180 ASN A C   1 
ATOM 1128 O O   . ASN A 1 180 ? 25.246  -29.187 85.121  1.00 0.00 ? 180 ASN A O   1 
ATOM 1129 C CB  . ASN A 1 180 ? 26.448  -28.035 82.880  1.00 0.00 ? 180 ASN A CB  1 
ATOM 1130 C CG  . ASN A 1 180 ? 26.130  -27.859 81.394  1.00 0.00 ? 180 ASN A CG  1 
ATOM 1131 O OD1 . ASN A 1 180 ? 27.039  -27.831 80.566  1.00 0.00 ? 180 ASN A OD1 1 
ATOM 1132 N ND2 . ASN A 1 180 ? 24.875  -27.734 81.000  1.00 0.00 ? 180 ASN A ND2 1 
ATOM 1133 N N   . ASN A 1 181 ? 25.005  -27.152 86.110  1.00 0.00 ? 181 ASN A N   1 
ATOM 1134 C CA  . ASN A 1 181 ? 24.713  -27.677 87.448  1.00 0.00 ? 181 ASN A CA  1 
ATOM 1135 C C   . ASN A 1 181 ? 25.145  -29.144 87.489  1.00 0.00 ? 181 ASN A C   1 
ATOM 1136 O O   . ASN A 1 181 ? 24.328  -30.056 87.296  1.00 0.00 ? 181 ASN A O   1 
ATOM 1137 C CB  . ASN A 1 181 ? 23.210  -27.581 87.726  1.00 0.00 ? 181 ASN A CB  1 
ATOM 1138 C CG  . ASN A 1 181 ? 22.823  -26.329 88.514  1.00 0.00 ? 181 ASN A CG  1 
ATOM 1139 O OD1 . ASN A 1 181 ? 23.120  -26.236 89.703  1.00 0.00 ? 181 ASN A OD1 1 
ATOM 1140 N ND2 . ASN A 1 181 ? 22.168  -25.349 87.918  1.00 0.00 ? 181 ASN A ND2 1 
ATOM 1141 N N   . THR A 1 182 ? 26.432  -29.309 87.738  1.00 0.00 ? 182 THR A N   1 
ATOM 1142 C CA  . THR A 1 182 ? 27.085  -30.626 87.777  1.00 0.00 ? 182 THR A CA  1 
ATOM 1143 C C   . THR A 1 182 ? 27.469  -31.016 89.208  1.00 0.00 ? 182 THR A C   1 
ATOM 1144 O O   . THR A 1 182 ? 27.512  -32.206 89.554  1.00 0.00 ? 182 THR A O   1 
ATOM 1145 C CB  . THR A 1 182 ? 28.367  -30.585 86.941  1.00 0.00 ? 182 THR A CB  1 
ATOM 1146 O OG1 . THR A 1 182 ? 28.208  -29.690 85.851  1.00 0.00 ? 182 THR A OG1 1 
ATOM 1147 C CG2 . THR A 1 182 ? 28.751  -31.948 86.364  1.00 0.00 ? 182 THR A CG2 1 
ATOM 1148 N N   . MET A 1 183 ? 27.740  -29.996 89.996  1.00 0.00 ? 183 MET A N   1 
ATOM 1149 C CA  . MET A 1 183 ? 28.169  -30.154 91.395  1.00 0.00 ? 183 MET A CA  1 
ATOM 1150 C C   . MET A 1 183 ? 26.974  -30.163 92.345  1.00 0.00 ? 183 MET A C   1 
ATOM 1151 O O   . MET A 1 183 ? 25.851  -29.798 91.965  1.00 0.00 ? 183 MET A O   1 
ATOM 1152 C CB  . MET A 1 183 ? 29.057  -28.977 91.800  1.00 0.00 ? 183 MET A CB  1 
ATOM 1153 C CG  . MET A 1 183 ? 30.496  -29.387 92.102  1.00 0.00 ? 183 MET A CG  1 
ATOM 1154 S SD  . MET A 1 183 ? 31.682  -28.556 91.069  1.00 0.00 ? 183 MET A SD  1 
ATOM 1155 C CE  . MET A 1 183 ? 32.587  -29.749 90.108  1.00 0.00 ? 183 MET A CE  1 
ATOM 1156 N N   . PRO A 1 184 ? 27.156  -30.575 93.613  1.00 0.00 ? 184 PRO A N   1 
ATOM 1157 C CA  . PRO A 1 184 ? 26.069  -30.536 94.572  1.00 0.00 ? 184 PRO A CA  1 
ATOM 1158 C C   . PRO A 1 184 ? 25.632  -29.086 94.666  1.00 0.00 ? 184 PRO A C   1 
ATOM 1159 O O   . PRO A 1 184 ? 26.305  -28.204 94.049  1.00 0.00 ? 184 PRO A O   1 
ATOM 1160 C CB  . PRO A 1 184 ? 26.697  -31.062 95.842  1.00 0.00 ? 184 PRO A CB  1 
ATOM 1161 C CG  . PRO A 1 184 ? 28.155  -31.390 95.544  1.00 0.00 ? 184 PRO A CG  1 
ATOM 1162 C CD  . PRO A 1 184 ? 28.437  -31.076 94.109  1.00 0.00 ? 184 PRO A CD  1 
ATOM 1163 N N   . PHE A 1 185 ? 24.579  -28.888 95.394  1.00 0.00 ? 185 PHE A N   1 
ATOM 1164 C CA  . PHE A 1 185 ? 23.954  -27.547 95.580  1.00 0.00 ? 185 PHE A CA  1 
ATOM 1165 C C   . PHE A 1 185 ? 23.983  -27.163 97.077  1.00 0.00 ? 185 PHE A C   1 
ATOM 1166 O O   . PHE A 1 185 ? 23.324  -27.788 97.908  1.00 0.00 ? 185 PHE A O   1 
ATOM 1167 C CB  . PHE A 1 185 ? 22.506  -27.610 95.096  1.00 0.00 ? 185 PHE A CB  1 
ATOM 1168 C CG  . PHE A 1 185 ? 21.870  -26.271 94.923  1.00 0.00 ? 185 PHE A CG  1 
ATOM 1169 C CD1 . PHE A 1 185 ? 22.313  -25.414 93.912  1.00 0.00 ? 185 PHE A CD1 1 
ATOM 1170 C CD2 . PHE A 1 185 ? 20.829  -25.888 95.765  1.00 0.00 ? 185 PHE A CD2 1 
ATOM 1171 C CE1 . PHE A 1 185 ? 21.712  -24.169 93.745  1.00 0.00 ? 185 PHE A CE1 1 
ATOM 1172 C CE2 . PHE A 1 185 ? 20.226  -24.643 95.601  1.00 0.00 ? 185 PHE A CE2 1 
ATOM 1173 C CZ  . PHE A 1 185 ? 20.666  -23.780 94.590  1.00 0.00 ? 185 PHE A CZ  1 
ATOM 1174 N N   . THR A 1 186 ? 24.761  -26.115 97.389  1.00 0.00 ? 186 THR A N   1 
ATOM 1175 C CA  . THR A 1 186 ? 24.948  -25.672 98.817  1.00 0.00 ? 186 THR A CA  1 
ATOM 1176 C C   . THR A 1 186 ? 24.414  -24.269 99.032  1.00 0.00 ? 186 THR A C   1 
ATOM 1177 O O   . THR A 1 186 ? 25.182  -23.292 99.077  1.00 0.00 ? 186 THR A O   1 
ATOM 1178 C CB  . THR A 1 186 ? 26.422  -25.738 99.202  1.00 0.00 ? 186 THR A CB  1 
ATOM 1179 O OG1 . THR A 1 186 ? 27.202  -25.010 98.265  1.00 0.00 ? 186 THR A OG1 1 
ATOM 1180 C CG2 . THR A 1 186 ? 26.966  -27.167 99.239  1.00 0.00 ? 186 THR A CG2 1 
ATOM 1181 N N   . PRO A 1 187 ? 23.082  -24.094 99.181  1.00 0.00 ? 187 PRO A N   1 
ATOM 1182 C CA  . PRO A 1 187 ? 22.513  -22.775 99.462  1.00 0.00 ? 187 PRO A CA  1 
ATOM 1183 C C   . PRO A 1 187 ? 23.090  -22.238 100.800 1.00 0.00 ? 187 PRO A C   1 
ATOM 1184 O O   . PRO A 1 187 ? 22.767  -22.815 101.884 1.00 0.00 ? 187 PRO A O   1 
ATOM 1185 C CB  . PRO A 1 187 ? 20.994  -23.046 99.534  1.00 0.00 ? 187 PRO A CB  1 
ATOM 1186 C CG  . PRO A 1 187 ? 20.782  -24.591 99.278  1.00 0.00 ? 187 PRO A CG  1 
ATOM 1187 C CD  . PRO A 1 187 ? 22.098  -25.232 99.062  1.00 0.00 ? 187 PRO A CD  1 
ATOM 1188 N N   . ALA A 1 188 ? 23.906  -21.169 100.674 1.00 0.00 ? 188 ALA A N   1 
ATOM 1189 C CA  . ALA A 1 188 ? 24.631  -20.543 101.847 1.00 0.00 ? 188 ALA A CA  1 
ATOM 1190 C C   . ALA A 1 188 ? 23.736  -19.481 102.571 1.00 0.00 ? 188 ALA A C   1 
ATOM 1191 O O   . ALA A 1 188 ? 24.220  -18.420 102.994 1.00 0.00 ? 188 ALA A O   1 
ATOM 1192 C CB  . ALA A 1 188 ? 25.907  -19.848 101.370 1.00 0.00 ? 188 ALA A CB  1 
ATOM 1193 N N   . ALA A 1 189 ? 22.473  -19.816 102.684 1.00 0.00 ? 189 ALA A N   1 
ATOM 1194 C CA  . ALA A 1 189 ? 21.465  -18.971 103.407 1.00 0.00 ? 189 ALA A CA  1 
ATOM 1195 C C   . ALA A 1 189 ? 21.065  -19.679 104.674 1.00 0.00 ? 189 ALA A C   1 
ATOM 1196 O O   . ALA A 1 189 ? 20.804  -19.045 105.709 1.00 0.00 ? 189 ALA A O   1 
ATOM 1197 C CB  . ALA A 1 189 ? 20.234  -18.754 102.525 1.00 0.00 ? 189 ALA A CB  1 
ATOM 1198 N N   . MET A 1 190 ? 21.047  -20.946 104.533 1.00 0.00 ? 190 MET A N   1 
ATOM 1199 C CA  . MET A 1 190 ? 20.768  -21.867 105.577 1.00 0.00 ? 190 MET A CA  1 
ATOM 1200 C C   . MET A 1 190 ? 21.571  -21.510 106.842 1.00 0.00 ? 190 MET A C   1 
ATOM 1201 O O   . MET A 1 190 ? 21.030  -21.494 107.957 1.00 0.00 ? 190 MET A O   1 
ATOM 1202 C CB  . MET A 1 190 ? 21.244  -23.261 105.145 1.00 0.00 ? 190 MET A CB  1 
ATOM 1203 C CG  . MET A 1 190 ? 20.336  -24.379 105.587 1.00 0.00 ? 190 MET A CG  1 
ATOM 1204 S SD  . MET A 1 190 ? 20.692  -25.918 104.756 1.00 0.00 ? 190 MET A SD  1 
ATOM 1205 C CE  . MET A 1 190 ? 20.710  -27.257 105.925 1.00 0.00 ? 190 MET A CE  1 
ATOM 1206 N N   . ARG A 1 191 ? 22.868  -21.230 106.608 1.00 0.00 ? 191 ARG A N   1 
ATOM 1207 C CA  . ARG A 1 191 ? 23.855  -20.980 107.699 1.00 0.00 ? 191 ARG A CA  1 
ATOM 1208 C C   . ARG A 1 191 ? 24.356  -19.492 107.683 1.00 0.00 ? 191 ARG A C   1 
ATOM 1209 O O   . ARG A 1 191 ? 25.476  -19.191 108.139 1.00 0.00 ? 191 ARG A O   1 
ATOM 1210 C CB  . ARG A 1 191 ? 25.030  -21.937 107.539 1.00 0.00 ? 191 ARG A CB  1 
ATOM 1211 C CG  . ARG A 1 191 ? 24.593  -23.339 107.050 1.00 0.00 ? 191 ARG A CG  1 
ATOM 1212 C CD  . ARG A 1 191 ? 25.640  -24.424 107.316 1.00 0.00 ? 191 ARG A CD  1 
ATOM 1213 N NE  . ARG A 1 191 ? 25.115  -25.554 108.105 1.00 0.00 ? 191 ARG A NE  1 
ATOM 1214 C CZ  . ARG A 1 191 ? 25.054  -26.822 107.659 1.00 0.00 ? 191 ARG A CZ  1 
ATOM 1215 N NH1 . ARG A 1 191 ? 25.478  -27.143 106.429 1.00 0.00 ? 191 ARG A NH1 1 
ATOM 1216 N NH2 . ARG A 1 191 ? 24.581  -27.849 108.380 1.00 0.00 ? 191 ARG A NH2 1 
ATOM 1217 N N   . SER A 1 192 ? 23.489  -18.645 107.166 1.00 0.00 ? 192 SER A N   1 
ATOM 1218 C CA  . SER A 1 192 ? 23.706  -17.152 107.089 1.00 0.00 ? 192 SER A CA  1 
ATOM 1219 C C   . SER A 1 192 ? 25.115  -16.798 106.522 1.00 0.00 ? 192 SER A C   1 
ATOM 1220 O O   . SER A 1 192 ? 25.723  -15.789 106.906 1.00 0.00 ? 192 SER A O   1 
ATOM 1221 C CB  . SER A 1 192 ? 23.583  -16.524 108.469 1.00 0.00 ? 192 SER A CB  1 
ATOM 1222 O OG  . SER A 1 192 ? 23.463  -15.110 108.348 1.00 0.00 ? 192 SER A OG  1 
ATOM 1223 N N   . GLU A 1 193 ? 25.573  -17.624 105.636 1.00 0.00 ? 193 GLU A N   1 
ATOM 1224 C CA  . GLU A 1 193 ? 26.859  -17.402 104.926 1.00 0.00 ? 193 GLU A CA  1 
ATOM 1225 C C   . GLU A 1 193 ? 26.554  -16.900 103.523 1.00 0.00 ? 193 GLU A C   1 
ATOM 1226 O O   . GLU A 1 193 ? 26.939  -17.525 102.522 1.00 0.00 ? 193 GLU A O   1 
ATOM 1227 C CB  . GLU A 1 193 ? 27.665  -18.707 104.885 1.00 0.00 ? 193 GLU A CB  1 
ATOM 1228 C CG  . GLU A 1 193 ? 27.934  -19.282 106.286 1.00 0.00 ? 193 GLU A CG  1 
ATOM 1229 C CD  . GLU A 1 193 ? 28.809  -20.539 106.268 1.00 0.00 ? 193 GLU A CD  1 
ATOM 1230 O OE1 . GLU A 1 193 ? 29.318  -20.956 105.160 1.00 0.00 ? 193 GLU A OE1 1 
ATOM 1231 O OE2 . GLU A 1 193 ? 29.036  -21.183 107.365 1.00 0.00 ? 193 GLU A OE2 1 
ATOM 1232 N N   . THR A 1 194 ? 25.851  -15.755 103.509 1.00 0.00 ? 194 THR A N   1 
ATOM 1233 C CA  . THR A 1 194 ? 25.331  -15.148 102.287 1.00 0.00 ? 194 THR A CA  1 
ATOM 1234 C C   . THR A 1 194 ? 26.247  -13.998 101.902 1.00 0.00 ? 194 THR A C   1 
ATOM 1235 O O   . THR A 1 194 ? 27.481  -14.142 101.896 1.00 0.00 ? 194 THR A O   1 
ATOM 1236 C CB  . THR A 1 194 ? 23.921  -14.593 102.541 1.00 0.00 ? 194 THR A CB  1 
ATOM 1237 O OG1 . THR A 1 194 ? 23.052  -15.641 102.946 1.00 0.00 ? 194 THR A OG1 1 
ATOM 1238 C CG2 . THR A 1 194 ? 23.304  -13.940 101.303 1.00 0.00 ? 194 THR A CG2 1 
ATOM 1239 N N   . LEU A 1 195 ? 25.631  -12.926 101.614 1.00 0.00 ? 195 LEU A N   1 
ATOM 1240 C CA  . LEU A 1 195 ? 26.300  -11.673 101.332 1.00 0.00 ? 195 LEU A CA  1 
ATOM 1241 C C   . LEU A 1 195 ? 25.667  -10.593 102.202 1.00 0.00 ? 195 LEU A C   1 
ATOM 1242 O O   . LEU A 1 195 ? 24.499  -10.703 102.596 1.00 0.00 ? 195 LEU A O   1 
ATOM 1243 C CB  . LEU A 1 195 ? 26.162  -11.322 99.837  1.00 0.00 ? 195 LEU A CB  1 
ATOM 1244 C CG  . LEU A 1 195 ? 27.163  -12.083 98.943  1.00 0.00 ? 195 LEU A CG  1 
ATOM 1245 C CD1 . LEU A 1 195 ? 26.562  -13.337 98.303  1.00 0.00 ? 195 LEU A CD1 1 
ATOM 1246 C CD2 . LEU A 1 195 ? 27.692  -11.239 97.778  1.00 0.00 ? 195 LEU A CD2 1 
ATOM 1247 N N   . GLY A 1 196 ? 26.453  -9.592  102.496 1.00 0.00 ? 196 GLY A N   1 
ATOM 1248 C CA  . GLY A 1 196 ? 26.011  -8.448  103.353 1.00 0.00 ? 196 GLY A CA  1 
ATOM 1249 C C   . GLY A 1 196 ? 24.687  -7.867  102.819 1.00 0.00 ? 196 GLY A C   1 
ATOM 1250 O O   . GLY A 1 196 ? 24.460  -7.814  101.603 1.00 0.00 ? 196 GLY A O   1 
ATOM 1251 N N   . PHE A 1 197 ? 23.844  -7.434  103.776 1.00 0.00 ? 197 PHE A N   1 
ATOM 1252 C CA  . PHE A 1 197 ? 22.505  -6.848  103.467 1.00 0.00 ? 197 PHE A CA  1 
ATOM 1253 C C   . PHE A 1 197 ? 22.590  -5.303  103.397 1.00 0.00 ? 197 PHE A C   1 
ATOM 1254 O O   . PHE A 1 197 ? 21.624  -4.625  103.032 1.00 0.00 ? 197 PHE A O   1 
ATOM 1255 C CB  . PHE A 1 197 ? 21.490  -7.251  104.536 1.00 0.00 ? 197 PHE A CB  1 
ATOM 1256 C CG  . PHE A 1 197 ? 21.066  -8.719  104.428 1.00 0.00 ? 197 PHE A CG  1 
ATOM 1257 C CD1 . PHE A 1 197 ? 22.004  -9.690  104.067 1.00 0.00 ? 197 PHE A CD1 1 
ATOM 1258 C CD2 . PHE A 1 197 ? 19.739  -9.089  104.691 1.00 0.00 ? 197 PHE A CD2 1 
ATOM 1259 C CE1 . PHE A 1 197 ? 21.622  -11.032 103.976 1.00 0.00 ? 197 PHE A CE1 1 
ATOM 1260 C CE2 . PHE A 1 197 ? 19.358  -10.433 104.602 1.00 0.00 ? 197 PHE A CE2 1 
ATOM 1261 C CZ  . PHE A 1 197 ? 20.300  -11.404 104.245 1.00 0.00 ? 197 PHE A CZ  1 
ATOM 1262 N N   . TYR A 1 198 ? 23.736  -4.804  103.755 1.00 0.00 ? 198 TYR A N   1 
ATOM 1263 C CA  . TYR A 1 198 ? 24.022  -3.352  103.704 1.00 0.00 ? 198 TYR A CA  1 
ATOM 1264 C C   . TYR A 1 198 ? 25.013  -3.091  102.551 1.00 0.00 ? 198 TYR A C   1 
ATOM 1265 O O   . TYR A 1 198 ? 26.199  -3.464  102.634 1.00 0.00 ? 198 TYR A O   1 
ATOM 1266 C CB  . TYR A 1 198 ? 24.518  -2.886  105.065 1.00 0.00 ? 198 TYR A CB  1 
ATOM 1267 C CG  . TYR A 1 198 ? 23.731  -3.548  106.230 1.00 0.00 ? 198 TYR A CG  1 
ATOM 1268 C CD1 . TYR A 1 198 ? 22.451  -3.067  106.590 1.00 0.00 ? 198 TYR A CD1 1 
ATOM 1269 C CD2 . TYR A 1 198 ? 24.281  -4.633  106.917 1.00 0.00 ? 198 TYR A CD2 1 
ATOM 1270 C CE1 . TYR A 1 198 ? 21.732  -3.689  107.635 1.00 0.00 ? 198 TYR A CE1 1 
ATOM 1271 C CE2 . TYR A 1 198 ? 23.562  -5.255  107.956 1.00 0.00 ? 198 TYR A CE2 1 
ATOM 1272 C CZ  . TYR A 1 198 ? 22.290  -4.784  108.313 1.00 0.00 ? 198 TYR A CZ  1 
ATOM 1273 O OH  . TYR A 1 198 ? 21.599  -5.393  109.315 1.00 0.00 ? 198 TYR A OH  1 
ATOM 1274 N N   . PRO A 1 199 ? 24.556  -2.445  101.437 1.00 0.00 ? 199 PRO A N   1 
ATOM 1275 C CA  . PRO A 1 199 ? 25.388  -2.279  100.225 1.00 0.00 ? 199 PRO A CA  1 
ATOM 1276 C C   . PRO A 1 199 ? 26.711  -1.547  100.526 1.00 0.00 ? 199 PRO A C   1 
ATOM 1277 O O   . PRO A 1 199 ? 27.787  -1.973  99.999  1.00 0.00 ? 199 PRO A O   1 
ATOM 1278 C CB  . PRO A 1 199 ? 24.480  -1.495  99.261  1.00 0.00 ? 199 PRO A CB  1 
ATOM 1279 C CG  . PRO A 1 199 ? 23.109  -1.254  99.998  1.00 0.00 ? 199 PRO A CG  1 
ATOM 1280 C CD  . PRO A 1 199 ? 23.169  -1.848  101.355 1.00 0.00 ? 199 PRO A CD  1 
ATOM 1281 N N   . TRP A 1 200 ? 26.612  -0.485  101.328 1.00 0.00 ? 200 TRP A N   1 
ATOM 1282 C CA  . TRP A 1 200 ? 27.811  0.367   101.674 1.00 0.00 ? 200 TRP A CA  1 
ATOM 1283 C C   . TRP A 1 200 ? 28.744  -0.352  102.649 1.00 0.00 ? 200 TRP A C   1 
ATOM 1284 O O   . TRP A 1 200 ? 29.608  0.269   103.282 1.00 0.00 ? 200 TRP A O   1 
ATOM 1285 C CB  . TRP A 1 200 ? 27.386  1.681   102.346 1.00 0.00 ? 200 TRP A CB  1 
ATOM 1286 C CG  . TRP A 1 200 ? 26.642  1.472   103.653 1.00 0.00 ? 200 TRP A CG  1 
ATOM 1287 C CD1 . TRP A 1 200 ? 27.172  1.304   104.873 1.00 0.00 ? 200 TRP A CD1 1 
ATOM 1288 C CD2 . TRP A 1 200 ? 25.241  1.427   103.770 1.00 0.00 ? 200 TRP A CD2 1 
ATOM 1289 N NE1 . TRP A 1 200 ? 26.078  1.144   105.782 1.00 0.00 ? 200 TRP A NE1 1 
ATOM 1290 C CE2 . TRP A 1 200 ? 24.953  1.218   105.111 1.00 0.00 ? 200 TRP A CE2 1 
ATOM 1291 C CE3 . TRP A 1 200 ? 24.196  1.543   102.851 1.00 0.00 ? 200 TRP A CE3 1 
ATOM 1292 C CZ2 . TRP A 1 200 ? 23.648  1.112   105.599 1.00 0.00 ? 200 TRP A CZ2 1 
ATOM 1293 C CZ3 . TRP A 1 200 ? 22.886  1.436   103.352 1.00 0.00 ? 200 TRP A CZ3 1 
ATOM 1294 C CH2 . TRP A 1 200 ? 22.626  1.230   104.662 1.00 0.00 ? 200 TRP A CH2 1 
ATOM 1295 N N   . LYS A 1 201 ? 28.560  -1.653  102.753 1.00 0.00 ? 201 LYS A N   1 
ATOM 1296 C CA  . LYS A 1 201 ? 29.364  -2.477  103.671 1.00 0.00 ? 201 LYS A CA  1 
ATOM 1297 C C   . LYS A 1 201 ? 30.043  -3.634  102.917 1.00 0.00 ? 201 LYS A C   1 
ATOM 1298 O O   . LYS A 1 201 ? 29.373  -4.572  102.455 1.00 0.00 ? 201 LYS A O   1 
ATOM 1299 C CB  . LYS A 1 201 ? 28.468  -3.053  104.768 1.00 0.00 ? 201 LYS A CB  1 
ATOM 1300 C CG  . LYS A 1 201 ? 29.241  -3.887  105.789 1.00 0.00 ? 201 LYS A CG  1 
ATOM 1301 C CD  . LYS A 1 201 ? 28.583  -3.907  107.169 1.00 0.00 ? 201 LYS A CD  1 
ATOM 1302 C CE  . LYS A 1 201 ? 29.454  -4.575  108.234 1.00 0.00 ? 201 LYS A CE  1 
ATOM 1303 N NZ  . LYS A 1 201 ? 28.681  -5.058  109.387 1.00 0.00 ? 201 LYS A NZ  1 
ATOM 1304 N N   . PRO A 1 202 ? 31.384  -3.610  102.772 1.00 0.00 ? 202 PRO A N   1 
ATOM 1305 C CA  . PRO A 1 202 ? 32.122  -4.682  102.077 1.00 0.00 ? 202 PRO A CA  1 
ATOM 1306 C C   . PRO A 1 202 ? 31.869  -6.075  102.800 1.00 0.00 ? 202 PRO A C   1 
ATOM 1307 O O   . PRO A 1 202 ? 31.965  -6.136  104.063 1.00 0.00 ? 202 PRO A O   1 
ATOM 1308 C CB  . PRO A 1 202 ? 33.564  -4.222  102.171 1.00 0.00 ? 202 PRO A CB  1 
ATOM 1309 C CG  . PRO A 1 202 ? 33.593  -2.886  102.917 1.00 0.00 ? 202 PRO A CG  1 
ATOM 1310 C CD  . PRO A 1 202 ? 32.199  -2.507  103.293 1.00 0.00 ? 202 PRO A CD  1 
ATOM 1311 N N   . THR A 1 203 ? 31.559  -7.159  101.925 1.00 0.00 ? 203 THR A N   1 
ATOM 1312 C CA  . THR A 1 203 ? 31.212  -8.607  102.438 1.00 0.00 ? 203 THR A CA  1 
ATOM 1313 C C   . THR A 1 203 ? 32.330  -9.647  102.027 1.00 0.00 ? 203 THR A C   1 
ATOM 1314 O O   . THR A 1 203 ? 33.402  -9.276  101.523 1.00 0.00 ? 203 THR A O   1 
ATOM 1315 C CB  . THR A 1 203 ? 29.875  -9.072  101.854 1.00 0.00 ? 203 THR A CB  1 
ATOM 1316 O OG1 . THR A 1 203 ? 29.749  -10.482 101.990 1.00 0.00 ? 203 THR A OG1 1 
ATOM 1317 C CG2 . THR A 1 203 ? 29.720  -8.739  100.372 1.00 0.00 ? 203 THR A CG2 1 
ATOM 1318 N N   . ILE A 1 204 ? 31.993  -10.992 102.270 1.00 0.00 ? 204 ILE A N   1 
ATOM 1319 C CA  . ILE A 1 204 ? 32.965  -12.124 102.035 1.00 0.00 ? 204 ILE A CA  1 
ATOM 1320 C C   . ILE A 1 204 ? 32.254  -13.436 101.589 1.00 0.00 ? 204 ILE A C   1 
ATOM 1321 O O   . ILE A 1 204 ? 31.269  -13.882 102.216 1.00 0.00 ? 204 ILE A O   1 
ATOM 1322 C CB  . ILE A 1 204 ? 33.700  -12.445 103.317 1.00 0.00 ? 204 ILE A CB  1 
ATOM 1323 C CG1 . ILE A 1 204 ? 32.777  -12.497 104.538 1.00 0.00 ? 204 ILE A CG1 1 
ATOM 1324 C CG2 . ILE A 1 204 ? 34.781  -11.423 103.651 1.00 0.00 ? 204 ILE A CG2 1 
ATOM 1325 C CD1 . ILE A 1 204 ? 33.540  -12.561 105.861 1.00 0.00 ? 204 ILE A CD1 1 
ATOM 1326 N N   . PRO A 1 205 ? 32.749  -14.096 100.490 1.00 0.00 ? 205 PRO A N   1 
ATOM 1327 C CA  . PRO A 1 205 ? 32.208  -15.381 100.047 1.00 0.00 ? 205 PRO A CA  1 
ATOM 1328 C C   . PRO A 1 205 ? 32.427  -16.430 101.123 1.00 0.00 ? 205 PRO A C   1 
ATOM 1329 O O   . PRO A 1 205 ? 33.177  -16.156 102.112 1.00 0.00 ? 205 PRO A O   1 
ATOM 1330 C CB  . PRO A 1 205 ? 33.026  -15.704 98.784  1.00 0.00 ? 205 PRO A CB  1 
ATOM 1331 C CG  . PRO A 1 205 ? 34.049  -14.529 98.579  1.00 0.00 ? 205 PRO A CG  1 
ATOM 1332 C CD  . PRO A 1 205 ? 33.873  -13.537 99.656  1.00 0.00 ? 205 PRO A CD  1 
ATOM 1333 N N   . THR A 1 206 ? 31.815  -17.560 100.912 1.00 0.00 ? 206 THR A N   1 
ATOM 1334 C CA  . THR A 1 206 ? 31.883  -18.677 101.854 1.00 0.00 ? 206 THR A CA  1 
ATOM 1335 C C   . THR A 1 206 ? 32.764  -19.786 101.315 1.00 0.00 ? 206 THR A C   1 
ATOM 1336 O O   . THR A 1 206 ? 32.621  -20.210 100.154 1.00 0.00 ? 206 THR A O   1 
ATOM 1337 C CB  . THR A 1 206 ? 30.498  -19.142 102.189 1.00 0.00 ? 206 THR A CB  1 
ATOM 1338 O OG1 . THR A 1 206 ? 29.738  -19.299 100.999 1.00 0.00 ? 206 THR A OG1 1 
ATOM 1339 C CG2 . THR A 1 206 ? 29.741  -18.163 103.089 1.00 0.00 ? 206 THR A CG2 1 
ATOM 1340 N N   . PRO A 1 207 ? 33.725  -20.315 102.147 1.00 0.00 ? 207 PRO A N   1 
ATOM 1341 C CA  . PRO A 1 207 ? 34.611  -21.389 101.704 1.00 0.00 ? 207 PRO A CA  1 
ATOM 1342 C C   . PRO A 1 207 ? 33.788  -22.555 101.324 1.00 0.00 ? 207 PRO A C   1 
ATOM 1343 O O   . PRO A 1 207 ? 32.929  -22.995 102.138 1.00 0.00 ? 207 PRO A O   1 
ATOM 1344 C CB  . PRO A 1 207 ? 35.490  -21.666 102.947 1.00 0.00 ? 207 PRO A CB  1 
ATOM 1345 C CG  . PRO A 1 207 ? 35.018  -20.678 104.084 1.00 0.00 ? 207 PRO A CG  1 
ATOM 1346 C CD  . PRO A 1 207 ? 33.919  -19.835 103.566 1.00 0.00 ? 207 PRO A CD  1 
ATOM 1347 N N   . TRP A 1 208 ? 34.015  -23.059 100.126 1.00 0.00 ? 208 TRP A N   1 
ATOM 1348 C CA  . TRP A 1 208 ? 33.195  -24.140 99.620  1.00 0.00 ? 208 TRP A CA  1 
ATOM 1349 C C   . TRP A 1 208 ? 33.561  -25.463 100.240 1.00 0.00 ? 208 TRP A C   1 
ATOM 1350 O O   . TRP A 1 208 ? 34.745  -25.735 100.520 1.00 0.00 ? 208 TRP A O   1 
ATOM 1351 C CB  . TRP A 1 208 ? 33.232  -24.242 98.158  1.00 0.00 ? 208 TRP A CB  1 
ATOM 1352 C CG  . TRP A 1 208 ? 31.905  -24.773 97.638  1.00 0.00 ? 208 TRP A CG  1 
ATOM 1353 C CD1 . TRP A 1 208 ? 30.687  -24.327 97.966  1.00 0.00 ? 208 TRP A CD1 1 
ATOM 1354 C CD2 . TRP A 1 208 ? 31.750  -25.844 96.748  1.00 0.00 ? 208 TRP A CD2 1 
ATOM 1355 N NE1 . TRP A 1 208 ? 29.746  -25.143 97.286  1.00 0.00 ? 208 TRP A NE1 1 
ATOM 1356 C CE2 . TRP A 1 208 ? 30.385  -26.033 96.580  1.00 0.00 ? 208 TRP A CE2 1 
ATOM 1357 C CE3 . TRP A 1 208 ? 32.643  -26.673 96.070  1.00 0.00 ? 208 TRP A CE3 1 
ATOM 1358 C CZ2 . TRP A 1 208 ? 29.844  -27.027 95.777  1.00 0.00 ? 208 TRP A CZ2 1 
ATOM 1359 C CZ3 . TRP A 1 208 ? 32.093  -27.673 95.246  1.00 0.00 ? 208 TRP A CZ3 1 
ATOM 1360 C CH2 . TRP A 1 208 ? 30.755  -27.844 95.107  1.00 0.00 ? 208 TRP A CH2 1 
ATOM 1361 N N   . ARG A 1 209 ? 32.487  -26.234 100.410 1.00 0.00 ? 209 ARG A N   1 
ATOM 1362 C CA  . ARG A 1 209 ? 32.493  -27.545 101.013 1.00 0.00 ? 209 ARG A CA  1 
ATOM 1363 C C   . ARG A 1 209 ? 31.178  -28.300 100.597 1.00 0.00 ? 209 ARG A C   1 
ATOM 1364 O O   . ARG A 1 209 ? 30.153  -27.676 100.295 1.00 0.00 ? 209 ARG A O   1 
ATOM 1365 C CB  . ARG A 1 209 ? 32.479  -27.396 102.558 1.00 0.00 ? 209 ARG A CB  1 
ATOM 1366 C CG  . ARG A 1 209 ? 31.124  -26.812 103.099 1.00 0.00 ? 209 ARG A CG  1 
ATOM 1367 C CD  . ARG A 1 209 ? 31.311  -25.655 104.125 1.00 0.00 ? 209 ARG A CD  1 
ATOM 1368 N NE  . ARG A 1 209 ? 30.036  -24.934 104.435 1.00 0.00 ? 209 ARG A NE  1 
ATOM 1369 C CZ  . ARG A 1 209 ? 29.973  -23.700 104.998 1.00 0.00 ? 209 ARG A CZ  1 
ATOM 1370 N NH1 . ARG A 1 209 ? 31.087  -23.032 105.328 1.00 0.00 ? 209 ARG A NH1 1 
ATOM 1371 N NH2 . ARG A 1 209 ? 28.827  -23.052 105.265 1.00 0.00 ? 209 ARG A NH2 1 
ATOM 1372 N N   . TYR A 1 210 ? 31.262  -29.641 100.582 1.00 0.00 ? 210 TYR A N   1 
ATOM 1373 C CA  . TYR A 1 210 ? 30.060  -30.523 100.275 1.00 0.00 ? 210 TYR A CA  1 
ATOM 1374 C C   . TYR A 1 210 ? 30.218  -31.878 100.936 1.00 0.00 ? 210 TYR A C   1 
ATOM 1375 O O   . TYR A 1 210 ? 31.301  -32.228 101.430 1.00 0.00 ? 210 TYR A O   1 
ATOM 1376 C CB  . TYR A 1 210 ? 29.848  -30.663 98.766  1.00 0.00 ? 210 TYR A CB  1 
ATOM 1377 C CG  . TYR A 1 210 ? 30.962  -31.365 98.068  1.00 0.00 ? 210 TYR A CG  1 
ATOM 1378 C CD1 . TYR A 1 210 ? 32.027  -30.632 97.576  1.00 0.00 ? 210 TYR A CD1 1 
ATOM 1379 C CD2 . TYR A 1 210 ? 30.922  -32.760 97.902  1.00 0.00 ? 210 TYR A CD2 1 
ATOM 1380 C CE1 . TYR A 1 210 ? 33.070  -31.276 96.912  1.00 0.00 ? 210 TYR A CE1 1 
ATOM 1381 C CE2 . TYR A 1 210 ? 31.964  -33.409 97.238  1.00 0.00 ? 210 TYR A CE2 1 
ATOM 1382 C CZ  . TYR A 1 210 ? 33.041  -32.666 96.742  1.00 0.00 ? 210 TYR A CZ  1 
ATOM 1383 O OH  . TYR A 1 210 ? 34.058  -33.290 96.095  1.00 0.00 ? 210 TYR A OH  1 
ATOM 1384 N N   . TYR A 1 211 ? 29.139  -32.594 100.908 1.00 0.00 ? 211 TYR A N   1 
ATOM 1385 C CA  . TYR A 1 211 ? 29.007  -33.838 101.606 1.00 0.00 ? 211 TYR A CA  1 
ATOM 1386 C C   . TYR A 1 211 ? 29.602  -35.010 100.851 1.00 0.00 ? 211 TYR A C   1 
ATOM 1387 O O   . TYR A 1 211 ? 29.584  -35.045 99.610  1.00 0.00 ? 211 TYR A O   1 
ATOM 1388 C CB  . TYR A 1 211 ? 27.560  -34.155 101.829 1.00 0.00 ? 211 TYR A CB  1 
ATOM 1389 C CG  . TYR A 1 211 ? 26.970  -33.357 102.986 1.00 0.00 ? 211 TYR A CG  1 
ATOM 1390 C CD1 . TYR A 1 211 ? 27.489  -33.520 104.275 1.00 0.00 ? 211 TYR A CD1 1 
ATOM 1391 C CD2 . TYR A 1 211 ? 25.920  -32.462 102.756 1.00 0.00 ? 211 TYR A CD2 1 
ATOM 1392 C CE1 . TYR A 1 211 ? 26.956  -32.784 105.338 1.00 0.00 ? 211 TYR A CE1 1 
ATOM 1393 C CE2 . TYR A 1 211 ? 25.387  -31.726 103.819 1.00 0.00 ? 211 TYR A CE2 1 
ATOM 1394 C CZ  . TYR A 1 211 ? 25.905  -31.887 105.110 1.00 0.00 ? 211 TYR A CZ  1 
ATOM 1395 O OH  . TYR A 1 211 ? 25.388  -31.171 106.144 1.00 0.00 ? 211 TYR A OH  1 
ATOM 1396 N N   . PHE A 1 212 ? 30.082  -35.899 101.686 1.00 0.00 ? 212 PHE A N   1 
ATOM 1397 C CA  . PHE A 1 212 ? 30.678  -37.170 101.304 1.00 0.00 ? 212 PHE A CA  1 
ATOM 1398 C C   . PHE A 1 212 ? 29.999  -38.253 102.096 1.00 0.00 ? 212 PHE A C   1 
ATOM 1399 O O   . PHE A 1 212 ? 29.859  -38.154 103.322 1.00 0.00 ? 212 PHE A O   1 
ATOM 1400 C CB  . PHE A 1 212 ? 32.150  -37.190 101.660 1.00 0.00 ? 212 PHE A CB  1 
ATOM 1401 C CG  . PHE A 1 212 ? 32.948  -38.202 100.848 1.00 0.00 ? 212 PHE A CG  1 
ATOM 1402 C CD1 . PHE A 1 212 ? 32.920  -39.565 101.183 1.00 0.00 ? 212 PHE A CD1 1 
ATOM 1403 C CD2 . PHE A 1 212 ? 33.707  -37.756 99.769  1.00 0.00 ? 212 PHE A CD2 1 
ATOM 1404 C CE1 . PHE A 1 212 ? 33.680  -40.478 100.439 1.00 0.00 ? 212 PHE A CE1 1 
ATOM 1405 C CE2 . PHE A 1 212 ? 34.471  -38.666 99.031  1.00 0.00 ? 212 PHE A CE2 1 
ATOM 1406 C CZ  . PHE A 1 212 ? 34.460  -40.026 99.366  1.00 0.00 ? 212 PHE A CZ  1 
ATOM 1407 N N   . GLN A 1 213 ? 29.608  -39.251 101.387 1.00 0.00 ? 213 GLN A N   1 
ATOM 1408 C CA  . GLN A 1 213 ? 28.884  -40.346 101.973 1.00 0.00 ? 213 GLN A CA  1 
ATOM 1409 C C   . GLN A 1 213 ? 29.543  -40.883 103.250 1.00 0.00 ? 213 GLN A C   1 
ATOM 1410 O O   . GLN A 1 213 ? 30.595  -41.541 103.201 1.00 0.00 ? 213 GLN A O   1 
ATOM 1411 C CB  . GLN A 1 213 ? 28.781  -41.513 100.990 1.00 0.00 ? 213 GLN A CB  1 
ATOM 1412 C CG  . GLN A 1 213 ? 27.540  -42.380 101.230 1.00 0.00 ? 213 GLN A CG  1 
ATOM 1413 C CD  . GLN A 1 213 ? 27.875  -43.791 101.720 1.00 0.00 ? 213 GLN A CD  1 
ATOM 1414 O OE1 . GLN A 1 213 ? 28.085  -44.689 100.907 1.00 0.00 ? 213 GLN A OE1 1 
ATOM 1415 N NE2 . GLN A 1 213 ? 27.937  -44.045 103.014 1.00 0.00 ? 213 GLN A NE2 1 
ATOM 1416 N N   . TRP A 1 214 ? 28.870  -40.593 104.358 1.00 0.00 ? 214 TRP A N   1 
ATOM 1417 C CA  . TRP A 1 214 ? 29.242  -41.097 105.670 1.00 0.00 ? 214 TRP A CA  1 
ATOM 1418 C C   . TRP A 1 214 ? 28.124  -42.038 106.199 1.00 0.00 ? 214 TRP A C   1 
ATOM 1419 O O   . TRP A 1 214 ? 26.941  -41.674 106.213 1.00 0.00 ? 214 TRP A O   1 
ATOM 1420 C CB  . TRP A 1 214 ? 29.465  -39.929 106.646 1.00 0.00 ? 214 TRP A CB  1 
ATOM 1421 C CG  . TRP A 1 214 ? 28.176  -39.434 107.291 1.00 0.00 ? 214 TRP A CG  1 
ATOM 1422 C CD1 . TRP A 1 214 ? 27.551  -39.960 108.356 1.00 0.00 ? 214 TRP A CD1 1 
ATOM 1423 C CD2 . TRP A 1 214 ? 27.434  -38.321 106.856 1.00 0.00 ? 214 TRP A CD2 1 
ATOM 1424 N NE1 . TRP A 1 214 ? 26.386  -39.161 108.596 1.00 0.00 ? 214 TRP A NE1 1 
ATOM 1425 C CE2 . TRP A 1 214 ? 26.334  -38.205 107.707 1.00 0.00 ? 214 TRP A CE2 1 
ATOM 1426 C CE3 . TRP A 1 214 ? 27.595  -37.402 105.815 1.00 0.00 ? 214 TRP A CE3 1 
ATOM 1427 C CZ2 . TRP A 1 214 ? 25.371  -37.215 107.579 1.00 0.00 ? 214 TRP A CZ2 1 
ATOM 1428 C CZ3 . TRP A 1 214 ? 26.616  -36.395 105.685 1.00 0.00 ? 214 TRP A CZ3 1 
ATOM 1429 C CH2 . TRP A 1 214 ? 25.551  -36.303 106.527 1.00 0.00 ? 214 TRP A CH2 1 
ATOM 1430 N N   . ASP A 1 215 ? 28.558  -43.195 106.584 1.00 0.00 ? 215 ASP A N   1 
ATOM 1431 C CA  . ASP A 1 215 ? 27.672  -44.286 107.114 1.00 0.00 ? 215 ASP A CA  1 
ATOM 1432 C C   . ASP A 1 215 ? 27.754  -44.311 108.665 1.00 0.00 ? 215 ASP A C   1 
ATOM 1433 O O   . ASP A 1 215 ? 28.826  -44.233 109.246 1.00 0.00 ? 215 ASP A O   1 
ATOM 1434 C CB  . ASP A 1 215 ? 28.213  -45.664 106.617 1.00 0.00 ? 215 ASP A CB  1 
ATOM 1435 C CG  . ASP A 1 215 ? 27.161  -46.526 105.945 1.00 0.00 ? 215 ASP A CG  1 
ATOM 1436 O OD1 . ASP A 1 215 ? 26.527  -46.087 104.911 1.00 0.00 ? 215 ASP A OD1 1 
ATOM 1437 O OD2 . ASP A 1 215 ? 26.916  -47.706 106.399 1.00 0.00 ? 215 ASP A OD2 1 
ATOM 1438 N N   . ARG A 1 216 ? 26.574  -44.419 109.322 1.00 0.00 ? 216 ARG A N   1 
ATOM 1439 C CA  . ARG A 1 216 ? 26.527  -44.432 110.829 1.00 0.00 ? 216 ARG A CA  1 
ATOM 1440 C C   . ARG A 1 216 ? 25.302  -45.155 111.366 1.00 0.00 ? 216 ARG A C   1 
ATOM 1441 O O   . ARG A 1 216 ? 24.317  -45.379 110.642 1.00 0.00 ? 216 ARG A O   1 
ATOM 1442 C CB  . ARG A 1 216 ? 26.521  -42.998 111.385 1.00 0.00 ? 216 ARG A CB  1 
ATOM 1443 C CG  . ARG A 1 216 ? 27.044  -42.921 112.863 1.00 0.00 ? 216 ARG A CG  1 
ATOM 1444 C CD  . ARG A 1 216 ? 26.516  -41.693 113.633 1.00 0.00 ? 216 ARG A CD  1 
ATOM 1445 N NE  . ARG A 1 216 ? 26.691  -41.810 115.107 1.00 0.00 ? 216 ARG A NE  1 
ATOM 1446 C CZ  . ARG A 1 216 ? 26.350  -40.844 115.988 1.00 0.00 ? 216 ARG A CZ  1 
ATOM 1447 N NH1 . ARG A 1 216 ? 25.821  -39.685 115.571 1.00 0.00 ? 216 ARG A NH1 1 
ATOM 1448 N NH2 . ARG A 1 216 ? 26.503  -40.950 117.317 1.00 0.00 ? 216 ARG A NH2 1 
ATOM 1449 N N   . THR A 1 217 ? 25.446  -45.492 112.650 1.00 0.00 ? 217 THR A N   1 
ATOM 1450 C CA  . THR A 1 217 ? 24.418  -46.071 113.459 1.00 0.00 ? 217 THR A CA  1 
ATOM 1451 C C   . THR A 1 217 ? 24.414  -45.407 114.845 1.00 0.00 ? 217 THR A C   1 
ATOM 1452 O O   . THR A 1 217 ? 25.474  -45.183 115.448 1.00 0.00 ? 217 THR A O   1 
ATOM 1453 C CB  . THR A 1 217 ? 24.719  -47.586 113.701 1.00 0.00 ? 217 THR A CB  1 
ATOM 1454 O OG1 . THR A 1 217 ? 24.703  -48.288 112.467 1.00 0.00 ? 217 THR A OG1 1 
ATOM 1455 C CG2 . THR A 1 217 ? 23.700  -48.258 114.623 1.00 0.00 ? 217 THR A CG2 1 
ATOM 1456 N N   . LEU A 1 218 ? 23.228  -45.117 115.295 1.00 0.00 ? 218 LEU A N   1 
ATOM 1457 C CA  . LEU A 1 218 ? 23.003  -44.471 116.597 1.00 0.00 ? 218 LEU A CA  1 
ATOM 1458 C C   . LEU A 1 218 ? 21.600  -44.772 117.086 1.00 0.00 ? 218 LEU A C   1 
ATOM 1459 O O   . LEU A 1 218 ? 20.608  -44.348 116.479 1.00 0.00 ? 218 LEU A O   1 
ATOM 1460 C CB  . LEU A 1 218 ? 23.180  -42.954 116.465 1.00 0.00 ? 218 LEU A CB  1 
ATOM 1461 C CG  . LEU A 1 218 ? 22.773  -42.191 117.728 1.00 0.00 ? 218 LEU A CG  1 
ATOM 1462 C CD1 . LEU A 1 218 ? 23.750  -42.391 118.888 1.00 0.00 ? 218 LEU A CD1 1 
ATOM 1463 C CD2 . LEU A 1 218 ? 22.692  -40.678 117.512 1.00 0.00 ? 218 LEU A CD2 1 
ATOM 1464 N N   . ILE A 1 219 ? 21.514  -45.458 118.159 1.00 0.00 ? 219 ILE A N   1 
ATOM 1465 C CA  . ILE A 1 219 ? 20.247  -45.795 118.824 1.00 0.00 ? 219 ILE A CA  1 
ATOM 1466 C C   . ILE A 1 219 ? 19.936  -44.782 119.921 1.00 0.00 ? 219 ILE A C   1 
ATOM 1467 O O   . ILE A 1 219 ? 20.834  -44.346 120.661 1.00 0.00 ? 219 ILE A O   1 
ATOM 1468 C CB  . ILE A 1 219 ? 20.323  -47.212 119.403 1.00 0.00 ? 219 ILE A CB  1 
ATOM 1469 C CG1 . ILE A 1 219 ? 21.312  -48.110 118.657 1.00 0.00 ? 219 ILE A CG1 1 
ATOM 1470 C CG2 . ILE A 1 219 ? 18.982  -47.947 119.362 1.00 0.00 ? 219 ILE A CG2 1 
ATOM 1471 C CD1 . ILE A 1 219 ? 20.977  -49.598 118.778 1.00 0.00 ? 219 ILE A CD1 1 
ATOM 1472 N N   . PRO A 1 220 ? 18.654  -44.364 120.080 1.00 0.00 ? 220 PRO A N   1 
ATOM 1473 C CA  . PRO A 1 220 ? 18.286  -43.388 121.118 1.00 0.00 ? 220 PRO A CA  1 
ATOM 1474 C C   . PRO A 1 220 ? 18.684  -43.924 122.506 1.00 0.00 ? 220 PRO A C   1 
ATOM 1475 O O   . PRO A 1 220 ? 19.182  -45.086 122.597 1.00 0.00 ? 220 PRO A O   1 
ATOM 1476 C CB  . PRO A 1 220 ? 16.762  -43.229 120.938 1.00 0.00 ? 220 PRO A CB  1 
ATOM 1477 C CG  . PRO A 1 220 ? 16.330  -44.166 119.740 1.00 0.00 ? 220 PRO A CG  1 
ATOM 1478 C CD  . PRO A 1 220 ? 17.525  -44.863 119.212 1.00 0.00 ? 220 PRO A CD  1 
ATOM 1479 N N   . SER A 1 221 ? 18.464  -43.069 123.528 1.00 0.00 ? 221 SER A N   1 
ATOM 1480 C CA  . SER A 1 221 ? 18.752  -43.428 124.965 1.00 0.00 ? 221 SER A CA  1 
ATOM 1481 C C   . SER A 1 221 ? 18.498  -42.213 125.891 1.00 0.00 ? 221 SER A C   1 
ATOM 1482 O O   . SER A 1 221 ? 19.152  -41.163 125.768 1.00 0.00 ? 221 SER A O   1 
ATOM 1483 C CB  . SER A 1 221 ? 20.216  -43.894 125.113 1.00 0.00 ? 221 SER A CB  1 
ATOM 1484 O OG  . SER A 1 221 ? 21.103  -42.862 124.706 1.00 0.00 ? 221 SER A OG  1 
ATOM 1485 N N   . HIS A 1 222 ? 17.531  -42.413 126.818 1.00 0.00 ? 222 HIS A N   1 
ATOM 1486 C CA  . HIS A 1 222 ? 17.144  -41.382 127.800 1.00 0.00 ? 222 HIS A CA  1 
ATOM 1487 C C   . HIS A 1 222 ? 18.215  -41.394 128.867 1.00 0.00 ? 222 HIS A C   1 
ATOM 1488 O O   . HIS A 1 222 ? 19.217  -42.116 128.755 1.00 0.00 ? 222 HIS A O   1 
ATOM 1489 C CB  . HIS A 1 222 ? 15.707  -41.650 128.352 1.00 0.00 ? 222 HIS A CB  1 
ATOM 1490 C CG  . HIS A 1 222 ? 15.474  -43.093 128.805 1.00 0.00 ? 222 HIS A CG  1 
ATOM 1491 N ND1 . HIS A 1 222 ? 15.785  -43.521 130.093 1.00 0.00 ? 222 HIS A ND1 1 
ATOM 1492 C CD2 . HIS A 1 222 ? 14.966  -44.177 128.159 1.00 0.00 ? 222 HIS A CD2 1 
ATOM 1493 C CE1 . HIS A 1 222 ? 15.470  -44.801 130.189 1.00 0.00 ? 222 HIS A CE1 1 
ATOM 1494 N NE2 . HIS A 1 222 ? 14.981  -45.206 129.044 1.00 0.00 ? 222 HIS A NE2 1 
ATOM 1495 N N   . THR A 1 223 ? 17.991  -40.602 129.862 1.00 0.00 ? 223 THR A N   1 
ATOM 1496 C CA  . THR A 1 223 ? 18.942  -40.448 130.949 1.00 0.00 ? 223 THR A CA  1 
ATOM 1497 C C   . THR A 1 223 ? 19.075  -41.731 131.767 1.00 0.00 ? 223 THR A C   1 
ATOM 1498 O O   . THR A 1 223 ? 20.031  -41.899 132.538 1.00 0.00 ? 223 THR A O   1 
ATOM 1499 C CB  . THR A 1 223 ? 18.464  -39.344 131.879 1.00 0.00 ? 223 THR A CB  1 
ATOM 1500 O OG1 . THR A 1 223 ? 18.311  -38.136 131.151 1.00 0.00 ? 223 THR A OG1 1 
ATOM 1501 C CG2 . THR A 1 223 ? 19.432  -39.078 133.029 1.00 0.00 ? 223 THR A CG2 1 
ATOM 1502 N N   . GLY A 1 224 ? 18.128  -42.627 131.581 1.00 0.00 ? 224 GLY A N   1 
ATOM 1503 C CA  . GLY A 1 224 ? 18.066  -43.846 132.394 1.00 0.00 ? 224 GLY A CA  1 
ATOM 1504 C C   . GLY A 1 224 ? 18.436  -45.105 131.663 1.00 0.00 ? 224 GLY A C   1 
ATOM 1505 O O   . GLY A 1 224 ? 18.939  -46.045 132.261 1.00 0.00 ? 224 GLY A O   1 
ATOM 1506 N N   . THR A 1 225 ? 18.152  -45.151 130.410 1.00 0.00 ? 225 THR A N   1 
ATOM 1507 C CA  . THR A 1 225 ? 18.474  -46.345 129.667 1.00 0.00 ? 225 THR A CA  1 
ATOM 1508 C C   . THR A 1 225 ? 19.869  -46.815 130.079 1.00 0.00 ? 225 THR A C   1 
ATOM 1509 O O   . THR A 1 225 ? 20.875  -46.129 129.842 1.00 0.00 ? 225 THR A O   1 
ATOM 1510 C CB  . THR A 1 225 ? 18.460  -46.050 128.165 1.00 0.00 ? 225 THR A CB  1 
ATOM 1511 O OG1 . THR A 1 225 ? 17.186  -45.557 127.778 1.00 0.00 ? 225 THR A OG1 1 
ATOM 1512 C CG2 . THR A 1 225 ? 18.751  -47.286 127.311 1.00 0.00 ? 225 THR A CG2 1 
ATOM 1513 N N   . SER A 1 226 ? 19.844  -47.977 130.676 1.00 0.00 ? 226 SER A N   1 
ATOM 1514 C CA  . SER A 1 226 ? 21.018  -48.665 131.202 1.00 0.00 ? 226 SER A CA  1 
ATOM 1515 C C   . SER A 1 226 ? 22.015  -49.058 130.083 1.00 0.00 ? 226 SER A C   1 
ATOM 1516 O O   . SER A 1 226 ? 21.660  -49.168 128.903 1.00 0.00 ? 226 SER A O   1 
ATOM 1517 C CB  . SER A 1 226 ? 20.541  -49.933 131.916 1.00 0.00 ? 226 SER A CB  1 
ATOM 1518 O OG  . SER A 1 226 ? 19.761  -50.732 131.033 1.00 0.00 ? 226 SER A OG  1 
ATOM 1519 N N   . GLY A 1 227 ? 23.263  -49.258 130.499 1.00 0.00 ? 227 GLY A N   1 
ATOM 1520 C CA  . GLY A 1 227 ? 24.358  -49.726 129.612 1.00 0.00 ? 227 GLY A CA  1 
ATOM 1521 C C   . GLY A 1 227 ? 24.830  -48.641 128.634 1.00 0.00 ? 227 GLY A C   1 
ATOM 1522 O O   . GLY A 1 227 ? 24.510  -47.453 128.789 1.00 0.00 ? 227 GLY A O   1 
ATOM 1523 N N   . THR A 1 228 ? 25.583  -49.110 127.639 1.00 0.00 ? 228 THR A N   1 
ATOM 1524 C CA  . THR A 1 228 ? 26.193  -48.239 126.619 1.00 0.00 ? 228 THR A CA  1 
ATOM 1525 C C   . THR A 1 228 ? 25.326  -48.198 125.173 1.00 0.00 ? 228 THR A C   1 
ATOM 1526 O O   . THR A 1 228 ? 25.531  -49.334 124.708 1.00 0.00 ? 228 THR A O   1 
ATOM 1527 C CB  . THR A 1 228 ? 27.617  -48.687 126.282 1.00 0.00 ? 228 THR A CB  1 
ATOM 1528 O OG1 . THR A 1 228 ? 27.732  -50.095 126.399 1.00 0.00 ? 228 THR A OG1 1 
ATOM 1529 C CG2 . THR A 1 228 ? 28.671  -48.059 127.198 1.00 0.00 ? 228 THR A CG2 1 
ATOM 1530 N N   . PRO A 1 229 ? 24.325  -47.436 124.687 1.00 0.00 ? 229 PRO A N   1 
ATOM 1531 C CA  . PRO A 1 229 ? 23.351  -47.965 123.719 1.00 0.00 ? 229 PRO A CA  1 
ATOM 1532 C C   . PRO A 1 229 ? 24.073  -48.585 122.487 1.00 0.00 ? 229 PRO A C   1 
ATOM 1533 O O   . PRO A 1 229 ? 24.303  -49.833 122.465 1.00 0.00 ? 229 PRO A O   1 
ATOM 1534 C CB  . PRO A 1 229 ? 22.453  -46.750 123.408 1.00 0.00 ? 229 PRO A CB  1 
ATOM 1535 C CG  . PRO A 1 229 ? 22.966  -45.549 124.296 1.00 0.00 ? 229 PRO A CG  1 
ATOM 1536 C CD  . PRO A 1 229 ? 24.125  -45.998 125.101 1.00 0.00 ? 229 PRO A CD  1 
ATOM 1537 N N   . THR A 1 230 ? 24.372  -47.720 121.537 1.00 0.00 ? 230 THR A N   1 
ATOM 1538 C CA  . THR A 1 230 ? 24.994  -48.114 120.236 1.00 0.00 ? 230 THR A CA  1 
ATOM 1539 C C   . THR A 1 230 ? 25.118  -46.874 119.346 1.00 0.00 ? 230 THR A C   1 
ATOM 1540 O O   . THR A 1 230 ? 24.140  -46.145 119.128 1.00 0.00 ? 230 THR A O   1 
ATOM 1541 C CB  . THR A 1 230 ? 24.088  -49.141 119.509 1.00 0.00 ? 230 THR A CB  1 
ATOM 1542 O OG1 . THR A 1 230 ? 24.407  -50.457 119.936 1.00 0.00 ? 230 THR A OG1 1 
ATOM 1543 C CG2 . THR A 1 230 ? 24.243  -49.103 117.987 1.00 0.00 ? 230 THR A CG2 1 
ATOM 1544 N N   . ASN A 1 231 ? 26.314  -46.667 118.854 1.00 0.00 ? 231 ASN A N   1 
ATOM 1545 C CA  . ASN A 1 231 ? 26.623  -45.530 117.976 1.00 0.00 ? 231 ASN A CA  1 
ATOM 1546 C C   . ASN A 1 231 ? 28.018  -45.691 117.389 1.00 0.00 ? 231 ASN A C   1 
ATOM 1547 O O   . ASN A 1 231 ? 29.018  -45.723 118.114 1.00 0.00 ? 231 ASN A O   1 
ATOM 1548 C CB  . ASN A 1 231 ? 26.566  -44.225 118.777 1.00 0.00 ? 231 ASN A CB  1 
ATOM 1549 C CG  . ASN A 1 231 ? 27.936  -43.571 118.962 1.00 0.00 ? 231 ASN A CG  1 
ATOM 1550 O OD1 . ASN A 1 231 ? 28.336  -42.740 118.147 1.00 0.00 ? 231 ASN A OD1 1 
ATOM 1551 N ND2 . ASN A 1 231 ? 28.689  -43.895 119.997 1.00 0.00 ? 231 ASN A ND2 1 
ATOM 1552 N N   . VAL A 1 232 ? 28.080  -45.813 116.074 1.00 0.00 ? 232 VAL A N   1 
ATOM 1553 C CA  . VAL A 1 232 ? 29.382  -45.876 115.406 1.00 0.00 ? 232 VAL A CA  1 
ATOM 1554 C C   . VAL A 1 232 ? 29.344  -45.318 113.959 1.00 0.00 ? 232 VAL A C   1 
ATOM 1555 O O   . VAL A 1 232 ? 28.268  -45.179 113.357 1.00 0.00 ? 232 VAL A O   1 
ATOM 1556 C CB  . VAL A 1 232 ? 29.983  -47.296 115.385 1.00 0.00 ? 232 VAL A CB  1 
ATOM 1557 C CG1 . VAL A 1 232 ? 29.038  -48.354 115.959 1.00 0.00 ? 232 VAL A CG1 1 
ATOM 1558 C CG2 . VAL A 1 232 ? 30.336  -47.775 113.976 1.00 0.00 ? 232 VAL A CG2 1 
ATOM 1559 N N   . TYR A 1 233 ? 30.566  -45.010 113.487 1.00 0.00 ? 233 TYR A N   1 
ATOM 1560 C CA  . TYR A 1 233 ? 30.862  -44.468 112.126 1.00 0.00 ? 233 TYR A CA  1 
ATOM 1561 C C   . TYR A 1 233 ? 31.766  -45.466 111.378 1.00 0.00 ? 233 TYR A C   1 
ATOM 1562 O O   . TYR A 1 233 ? 33.001  -45.388 111.450 1.00 0.00 ? 233 TYR A O   1 
ATOM 1563 C CB  . TYR A 1 233 ? 31.590  -43.100 112.252 1.00 0.00 ? 233 TYR A CB  1 
ATOM 1564 C CG  . TYR A 1 233 ? 32.339  -42.623 110.977 1.00 0.00 ? 233 TYR A CG  1 
ATOM 1565 C CD1 . TYR A 1 233 ? 33.463  -43.319 110.497 1.00 0.00 ? 233 TYR A CD1 1 
ATOM 1566 C CD2 . TYR A 1 233 ? 31.914  -41.469 110.289 1.00 0.00 ? 233 TYR A CD2 1 
ATOM 1567 C CE1 . TYR A 1 233 ? 34.138  -42.885 109.344 1.00 0.00 ? 233 TYR A CE1 1 
ATOM 1568 C CE2 . TYR A 1 233 ? 32.595  -41.033 109.135 1.00 0.00 ? 233 TYR A CE2 1 
ATOM 1569 C CZ  . TYR A 1 233 ? 33.704  -41.743 108.662 1.00 0.00 ? 233 TYR A CZ  1 
ATOM 1570 O OH  . TYR A 1 233 ? 34.355  -41.326 107.539 1.00 0.00 ? 233 TYR A OH  1 
ATOM 1571 N N   . HIS A 1 234 ? 31.117  -46.395 110.681 1.00 0.00 ? 234 HIS A N   1 
ATOM 1572 C CA  . HIS A 1 234 ? 31.809  -47.454 109.905 1.00 0.00 ? 234 HIS A CA  1 
ATOM 1573 C C   . HIS A 1 234 ? 32.716  -46.846 108.871 1.00 0.00 ? 234 HIS A C   1 
ATOM 1574 O O   . HIS A 1 234 ? 33.861  -47.275 108.688 1.00 0.00 ? 234 HIS A O   1 
ATOM 1575 C CB  . HIS A 1 234 ? 30.806  -48.326 109.153 1.00 0.00 ? 234 HIS A CB  1 
ATOM 1576 C CG  . HIS A 1 234 ? 29.573  -48.665 109.977 1.00 0.00 ? 234 HIS A CG  1 
ATOM 1577 N ND1 . HIS A 1 234 ? 28.349  -48.053 109.744 1.00 0.00 ? 234 HIS A ND1 1 
ATOM 1578 C CD2 . HIS A 1 234 ? 29.385  -49.531 111.004 1.00 0.00 ? 234 HIS A CD2 1 
ATOM 1579 C CE1 . HIS A 1 234 ? 27.479  -48.544 110.605 1.00 0.00 ? 234 HIS A CE1 1 
ATOM 1580 N NE2 . HIS A 1 234 ? 28.080  -49.427 111.363 1.00 0.00 ? 234 HIS A NE2 1 
ATOM 1581 N N   . GLY A 1 235 ? 32.180  -45.873 108.204 1.00 0.00 ? 235 GLY A N   1 
ATOM 1582 C CA  . GLY A 1 235 ? 32.934  -45.192 107.190 1.00 0.00 ? 235 GLY A CA  1 
ATOM 1583 C C   . GLY A 1 235 ? 32.060  -44.818 106.007 1.00 0.00 ? 235 GLY A C   1 
ATOM 1584 O O   . GLY A 1 235 ? 31.068  -44.085 106.146 1.00 0.00 ? 235 GLY A O   1 
ATOM 1585 N N   . THR A 1 236 ? 32.477  -45.349 104.875 1.00 0.00 ? 236 THR A N   1 
ATOM 1586 C CA  . THR A 1 236 ? 31.854  -45.059 103.595 1.00 0.00 ? 236 THR A CA  1 
ATOM 1587 C C   . THR A 1 236 ? 31.551  -46.299 102.763 1.00 0.00 ? 236 THR A C   1 
ATOM 1588 O O   . THR A 1 236 ? 32.355  -47.244 102.702 1.00 0.00 ? 236 THR A O   1 
ATOM 1589 C CB  . THR A 1 236 ? 32.828  -44.204 102.785 1.00 0.00 ? 236 THR A CB  1 
ATOM 1590 O OG1 . THR A 1 236 ? 33.410  -43.218 103.625 1.00 0.00 ? 236 THR A OG1 1 
ATOM 1591 C CG2 . THR A 1 236 ? 32.174  -43.483 101.612 1.00 0.00 ? 236 THR A CG2 1 
ATOM 1592 N N   . ASP A 1 237 ? 30.382  -46.229 102.149 1.00 0.00 ? 237 ASP A N   1 
ATOM 1593 C CA  . ASP A 1 237 ? 29.907  -47.256 101.231 1.00 0.00 ? 237 ASP A CA  1 
ATOM 1594 C C   . ASP A 1 237 ? 30.659  -47.005 99.935  1.00 0.00 ? 237 ASP A C   1 
ATOM 1595 O O   . ASP A 1 237 ? 30.555  -45.924 99.337  1.00 0.00 ? 237 ASP A O   1 
ATOM 1596 C CB  . ASP A 1 237 ? 28.394  -47.123 101.037 1.00 0.00 ? 237 ASP A CB  1 
ATOM 1597 C CG  . ASP A 1 237 ? 27.786  -48.276 100.233 1.00 0.00 ? 237 ASP A CG  1 
ATOM 1598 O OD1 . ASP A 1 237 ? 28.513  -49.291 99.906  1.00 0.00 ? 237 ASP A OD1 1 
ATOM 1599 O OD2 . ASP A 1 237 ? 26.544  -48.234 99.883  1.00 0.00 ? 237 ASP A OD2 1 
ATOM 1600 N N   . PRO A 1 238 ? 31.437  -47.945 99.431  1.00 0.00 ? 238 PRO A N   1 
ATOM 1601 C CA  . PRO A 1 238 ? 32.221  -47.702 98.238  1.00 0.00 ? 238 PRO A CA  1 
ATOM 1602 C C   . PRO A 1 238 ? 31.343  -47.321 97.006  1.00 0.00 ? 238 PRO A C   1 
ATOM 1603 O O   . PRO A 1 238 ? 31.910  -46.954 95.932  1.00 0.00 ? 238 PRO A O   1 
ATOM 1604 C CB  . PRO A 1 238 ? 32.939  -49.017 98.007  1.00 0.00 ? 238 PRO A CB  1 
ATOM 1605 C CG  . PRO A 1 238 ? 32.520  -49.980 99.115  1.00 0.00 ? 238 PRO A CG  1 
ATOM 1606 C CD  . PRO A 1 238 ? 31.559  -49.280 100.023 1.00 0.00 ? 238 PRO A CD  1 
ATOM 1607 N N   . ASP A 1 239 ? 30.045  -47.400 97.180  1.00 0.00 ? 239 ASP A N   1 
ATOM 1608 C CA  . ASP A 1 239 ? 29.076  -47.168 96.051  1.00 0.00 ? 239 ASP A CA  1 
ATOM 1609 C C   . ASP A 1 239 ? 28.700  -45.753 95.959  1.00 0.00 ? 239 ASP A C   1 
ATOM 1610 O O   . ASP A 1 239 ? 28.428  -45.221 94.886  1.00 0.00 ? 239 ASP A O   1 
ATOM 1611 C CB  . ASP A 1 239 ? 27.832  -47.964 96.253  1.00 0.00 ? 239 ASP A CB  1 
ATOM 1612 C CG  . ASP A 1 239 ? 28.009  -49.404 95.876  1.00 0.00 ? 239 ASP A CG  1 
ATOM 1613 O OD1 . ASP A 1 239 ? 28.293  -49.719 94.659  1.00 0.00 ? 239 ASP A OD1 1 
ATOM 1614 O OD2 . ASP A 1 239 ? 27.889  -50.315 96.772  1.00 0.00 ? 239 ASP A OD2 1 
ATOM 1615 N N   . ASP A 1 240 ? 28.669  -45.186 96.959  1.00 0.00 ? 240 ASP A N   1 
ATOM 1616 C CA  . ASP A 1 240 ? 28.250  -43.882 97.011  1.00 0.00 ? 240 ASP A CA  1 
ATOM 1617 C C   . ASP A 1 240 ? 29.400  -42.979 97.272  1.00 0.00 ? 240 ASP A C   1 
ATOM 1618 O O   . ASP A 1 240 ? 29.366  -42.181 98.207  1.00 0.00 ? 240 ASP A O   1 
ATOM 1619 C CB  . ASP A 1 240 ? 27.192  -43.734 98.057  1.00 0.00 ? 240 ASP A CB  1 
ATOM 1620 C CG  . ASP A 1 240 ? 26.327  -44.984 98.213  1.00 0.00 ? 240 ASP A CG  1 
ATOM 1621 O OD1 . ASP A 1 240 ? 26.687  -45.918 99.026  1.00 0.00 ? 240 ASP A OD1 1 
ATOM 1622 O OD2 . ASP A 1 240 ? 25.237  -45.104 97.534  1.00 0.00 ? 240 ASP A OD2 1 
ATOM 1623 N N   . VAL A 1 241 ? 30.416  -43.104 96.416  1.00 0.00 ? 241 VAL A N   1 
ATOM 1624 C CA  . VAL A 1 241 ? 31.621  -42.249 96.497  1.00 0.00 ? 241 VAL A CA  1 
ATOM 1625 C C   . VAL A 1 241 ? 31.695  -41.299 95.291  1.00 0.00 ? 241 VAL A C   1 
ATOM 1626 O O   . VAL A 1 241 ? 32.101  -41.692 94.190  1.00 0.00 ? 241 VAL A O   1 
ATOM 1627 C CB  . VAL A 1 241 ? 32.887  -43.092 96.524  1.00 0.00 ? 241 VAL A CB  1 
ATOM 1628 C CG1 . VAL A 1 241 ? 34.162  -42.251 96.612  1.00 0.00 ? 241 VAL A CG1 1 
ATOM 1629 C CG2 . VAL A 1 241 ? 32.941  -44.051 97.715  1.00 0.00 ? 241 VAL A CG2 1 
ATOM 1630 N N   . GLN A 1 242 ? 31.284  -40.059 95.531  1.00 0.00 ? 242 GLN A N   1 
ATOM 1631 C CA  . GLN A 1 242 ? 31.357  -38.986 94.514  1.00 0.00 ? 242 GLN A CA  1 
ATOM 1632 C C   . GLN A 1 242 ? 32.356  -37.923 95.011  1.00 0.00 ? 242 GLN A C   1 
ATOM 1633 O O   . GLN A 1 242 ? 32.089  -37.191 95.980  1.00 0.00 ? 242 GLN A O   1 
ATOM 1634 C CB  . GLN A 1 242 ? 29.966  -38.353 94.253  1.00 0.00 ? 242 GLN A CB  1 
ATOM 1635 C CG  . GLN A 1 242 ? 28.842  -39.389 94.061  1.00 0.00 ? 242 GLN A CG  1 
ATOM 1636 C CD  . GLN A 1 242 ? 27.725  -38.952 93.089  1.00 0.00 ? 242 GLN A CD  1 
ATOM 1637 O OE1 . GLN A 1 242 ? 27.910  -38.988 91.872  1.00 0.00 ? 242 GLN A OE1 1 
ATOM 1638 N NE2 . GLN A 1 242 ? 26.554  -38.547 93.555  1.00 0.00 ? 242 GLN A NE2 1 
ATOM 1639 N N   . PHE A 1 243 ? 33.493  -37.896 94.335  1.00 0.00 ? 243 PHE A N   1 
ATOM 1640 C CA  . PHE A 1 243 ? 34.588  -36.951 94.622  1.00 0.00 ? 243 PHE A CA  1 
ATOM 1641 C C   . PHE A 1 243 ? 34.688  -35.936 93.472  1.00 0.00 ? 243 PHE A C   1 
ATOM 1642 O O   . PHE A 1 243 ? 35.320  -36.209 92.437  1.00 0.00 ? 243 PHE A O   1 
ATOM 1643 C CB  . PHE A 1 243 ? 35.915  -37.712 94.758  1.00 0.00 ? 243 PHE A CB  1 
ATOM 1644 C CG  . PHE A 1 243 ? 37.107  -36.779 94.956  1.00 0.00 ? 243 PHE A CG  1 
ATOM 1645 C CD1 . PHE A 1 243 ? 36.885  -35.428 95.239  1.00 0.00 ? 243 PHE A CD1 1 
ATOM 1646 C CD2 . PHE A 1 243 ? 38.416  -37.270 94.851  1.00 0.00 ? 243 PHE A CD2 1 
ATOM 1647 C CE1 . PHE A 1 243 ? 37.970  -34.561 95.412  1.00 0.00 ? 243 PHE A CE1 1 
ATOM 1648 C CE2 . PHE A 1 243 ? 39.503  -36.402 95.026  1.00 0.00 ? 243 PHE A CE2 1 
ATOM 1649 C CZ  . PHE A 1 243 ? 39.279  -35.048 95.305  1.00 0.00 ? 243 PHE A CZ  1 
ATOM 1650 N N   . TYR A 1 244 ? 34.044  -34.787 93.696  1.00 0.00 ? 244 TYR A N   1 
ATOM 1651 C CA  . TYR A 1 244 ? 33.981  -33.680 92.708  1.00 0.00 ? 244 TYR A CA  1 
ATOM 1652 C C   . TYR A 1 244 ? 35.235  -32.841 92.743  1.00 0.00 ? 244 TYR A C   1 
ATOM 1653 O O   . TYR A 1 244 ? 35.933  -32.769 93.768  1.00 0.00 ? 244 TYR A O   1 
ATOM 1654 C CB  . TYR A 1 244 ? 32.838  -32.699 92.995  1.00 0.00 ? 244 TYR A CB  1 
ATOM 1655 C CG  . TYR A 1 244 ? 31.464  -33.245 92.634  1.00 0.00 ? 244 TYR A CG  1 
ATOM 1656 C CD1 . TYR A 1 244 ? 31.147  -33.554 91.302  1.00 0.00 ? 244 TYR A CD1 1 
ATOM 1657 C CD2 . TYR A 1 244 ? 30.523  -33.430 93.644  1.00 0.00 ? 244 TYR A CD2 1 
ATOM 1658 C CE1 . TYR A 1 244 ? 29.883  -34.074 90.993  1.00 0.00 ? 244 TYR A CE1 1 
ATOM 1659 C CE2 . TYR A 1 244 ? 29.265  -33.955 93.338  1.00 0.00 ? 244 TYR A CE2 1 
ATOM 1660 C CZ  . TYR A 1 244 ? 28.945  -34.280 92.013  1.00 0.00 ? 244 TYR A CZ  1 
ATOM 1661 O OH  . TYR A 1 244 ? 27.724  -34.802 91.722  1.00 0.00 ? 244 TYR A OH  1 
ATOM 1662 N N   . THR A 1 245 ? 35.442  -32.235 91.616  1.00 0.00 ? 245 THR A N   1 
ATOM 1663 C CA  . THR A 1 245 ? 36.568  -31.373 91.394  1.00 0.00 ? 245 THR A CA  1 
ATOM 1664 C C   . THR A 1 245 ? 36.190  -30.325 90.339  1.00 0.00 ? 245 THR A C   1 
ATOM 1665 O O   . THR A 1 245 ? 35.818  -30.663 89.208  1.00 0.00 ? 245 THR A O   1 
ATOM 1666 C CB  . THR A 1 245 ? 37.757  -32.210 90.923  1.00 0.00 ? 245 THR A CB  1 
ATOM 1667 O OG1 . THR A 1 245 ? 38.029  -33.235 91.870  1.00 0.00 ? 245 THR A OG1 1 
ATOM 1668 C CG2 . THR A 1 245 ? 39.036  -31.392 90.752  1.00 0.00 ? 245 THR A CG2 1 
ATOM 1669 N N   . ILE A 1 246 ? 36.304  -29.086 90.754  1.00 0.00 ? 246 ILE A N   1 
ATOM 1670 C CA  . ILE A 1 246 ? 35.938  -27.931 89.934  1.00 0.00 ? 246 ILE A CA  1 
ATOM 1671 C C   . ILE A 1 246 ? 36.910  -27.801 88.720  1.00 0.00 ? 246 ILE A C   1 
ATOM 1672 O O   . ILE A 1 246 ? 36.491  -27.561 87.585  1.00 0.00 ? 246 ILE A O   1 
ATOM 1673 C CB  . ILE A 1 246 ? 35.874  -26.682 90.815  1.00 0.00 ? 246 ILE A CB  1 
ATOM 1674 C CG1 . ILE A 1 246 ? 34.764  -26.771 91.881  1.00 0.00 ? 246 ILE A CG1 1 
ATOM 1675 C CG2 . ILE A 1 246 ? 35.597  -25.401 90.027  1.00 0.00 ? 246 ILE A CG2 1 
ATOM 1676 C CD1 . ILE A 1 246 ? 34.691  -25.541 92.778  1.00 0.00 ? 246 ILE A CD1 1 
ATOM 1677 N N   . GLU A 1 247 ? 38.182  -27.979 88.994  1.00 0.00 ? 247 GLU A N   1 
ATOM 1678 C CA  . GLU A 1 247 ? 39.233  -27.884 87.942  1.00 0.00 ? 247 GLU A CA  1 
ATOM 1679 C C   . GLU A 1 247 ? 38.910  -28.854 86.778  1.00 0.00 ? 247 GLU A C   1 
ATOM 1680 O O   . GLU A 1 247 ? 39.066  -28.512 85.598  1.00 0.00 ? 247 GLU A O   1 
ATOM 1681 C CB  . GLU A 1 247 ? 40.611  -28.233 88.521  1.00 0.00 ? 247 GLU A CB  1 
ATOM 1682 C CG  . GLU A 1 247 ? 41.045  -27.284 89.631  1.00 0.00 ? 247 GLU A CG  1 
ATOM 1683 C CD  . GLU A 1 247 ? 40.136  -27.351 90.846  1.00 0.00 ? 247 GLU A CD  1 
ATOM 1684 O OE1 . GLU A 1 247 ? 39.699  -28.492 91.259  1.00 0.00 ? 247 GLU A OE1 1 
ATOM 1685 O OE2 . GLU A 1 247 ? 39.798  -26.269 91.460  1.00 0.00 ? 247 GLU A OE2 1 
ATOM 1686 N N   . ASN A 1 248 ? 38.454  -30.028 87.158  1.00 0.00 ? 248 ASN A N   1 
ATOM 1687 C CA  . ASN A 1 248 ? 38.199  -31.126 86.210  1.00 0.00 ? 248 ASN A CA  1 
ATOM 1688 C C   . ASN A 1 248 ? 36.860  -30.913 85.448  1.00 0.00 ? 248 ASN A C   1 
ATOM 1689 O O   . ASN A 1 248 ? 36.803  -31.029 84.217  1.00 0.00 ? 248 ASN A O   1 
ATOM 1690 C CB  . ASN A 1 248 ? 38.151  -32.464 86.949  1.00 0.00 ? 248 ASN A CB  1 
ATOM 1691 C CG  . ASN A 1 248 ? 39.543  -32.999 87.299  1.00 0.00 ? 248 ASN A CG  1 
ATOM 1692 O OD1 . ASN A 1 248 ? 40.041  -32.742 88.393  1.00 0.00 ? 248 ASN A OD1 1 
ATOM 1693 N ND2 . ASN A 1 248 ? 40.210  -33.730 86.425  1.00 0.00 ? 248 ASN A ND2 1 
ATOM 1694 N N   . SER A 1 249 ? 35.813  -30.601 86.217  1.00 0.00 ? 249 SER A N   1 
ATOM 1695 C CA  . SER A 1 249 ? 34.407  -30.583 85.686  1.00 0.00 ? 249 SER A CA  1 
ATOM 1696 C C   . SER A 1 249 ? 33.861  -29.199 85.177  1.00 0.00 ? 249 SER A C   1 
ATOM 1697 O O   . SER A 1 249 ? 32.716  -29.096 84.711  1.00 0.00 ? 249 SER A O   1 
ATOM 1698 C CB  . SER A 1 249 ? 33.417  -31.036 86.762  1.00 0.00 ? 249 SER A CB  1 
ATOM 1699 O OG  . SER A 1 249 ? 34.073  -31.126 88.018  1.00 0.00 ? 249 SER A OG  1 
ATOM 1700 N N   . VAL A 1 250 ? 34.622  -28.091 85.223  1.00 0.00 ? 250 VAL A N   1 
ATOM 1701 C CA  . VAL A 1 250 ? 34.050  -26.772 84.757  1.00 0.00 ? 250 VAL A CA  1 
ATOM 1702 C C   . VAL A 1 250 ? 35.088  -25.800 84.129  1.00 0.00 ? 250 VAL A C   1 
ATOM 1703 O O   . VAL A 1 250 ? 36.227  -25.690 84.605  1.00 0.00 ? 250 VAL A O   1 
ATOM 1704 C CB  . VAL A 1 250 ? 33.403  -26.016 85.925  1.00 0.00 ? 250 VAL A CB  1 
ATOM 1705 C CG1 . VAL A 1 250 ? 32.892  -24.627 85.527  1.00 0.00 ? 250 VAL A CG1 1 
ATOM 1706 C CG2 . VAL A 1 250 ? 32.193  -26.743 86.516  1.00 0.00 ? 250 VAL A CG2 1 
ATOM 1707 N N   . PRO A 1 251 ? 34.709  -25.064 83.036  1.00 0.00 ? 251 PRO A N   1 
ATOM 1708 C CA  . PRO A 1 251 ? 35.599  -24.079 82.366  1.00 0.00 ? 251 PRO A CA  1 
ATOM 1709 C C   . PRO A 1 251 ? 35.999  -22.954 83.318  1.00 0.00 ? 251 PRO A C   1 
ATOM 1710 O O   . PRO A 1 251 ? 35.095  -22.285 83.880  1.00 0.00 ? 251 PRO A O   1 
ATOM 1711 C CB  . PRO A 1 251 ? 34.762  -23.559 81.218  1.00 0.00 ? 251 PRO A CB  1 
ATOM 1712 C CG  . PRO A 1 251 ? 33.407  -24.257 81.262  1.00 0.00 ? 251 PRO A CG  1 
ATOM 1713 C CD  . PRO A 1 251 ? 33.381  -25.203 82.423  1.00 0.00 ? 251 PRO A CD  1 
ATOM 1714 N N   . VAL A 1 252 ? 37.288  -22.747 83.514  1.00 0.00 ? 252 VAL A N   1 
ATOM 1715 C CA  . VAL A 1 252 ? 37.750  -21.681 84.430  1.00 0.00 ? 252 VAL A CA  1 
ATOM 1716 C C   . VAL A 1 252 ? 38.315  -20.487 83.663  1.00 0.00 ? 252 VAL A C   1 
ATOM 1717 O O   . VAL A 1 252 ? 39.091  -20.556 82.688  1.00 0.00 ? 252 VAL A O   1 
ATOM 1718 C CB  . VAL A 1 252 ? 38.758  -22.218 85.460  1.00 0.00 ? 252 VAL A CB  1 
ATOM 1719 C CG1 . VAL A 1 252 ? 39.234  -21.063 86.311  1.00 0.00 ? 252 VAL A CG1 1 
ATOM 1720 C CG2 . VAL A 1 252 ? 38.180  -23.366 86.266  1.00 0.00 ? 252 VAL A CG2 1 
ATOM 1721 N N   . HIS A 1 253 ? 37.873  -19.340 84.178  1.00 0.00 ? 253 HIS A N   1 
ATOM 1722 C CA  . HIS A 1 253 ? 38.264  -18.070 83.616  1.00 0.00 ? 253 HIS A CA  1 
ATOM 1723 C C   . HIS A 1 253 ? 39.296  -17.339 84.415  1.00 0.00 ? 253 HIS A C   1 
ATOM 1724 O O   . HIS A 1 253 ? 38.965  -17.162 85.604  1.00 0.00 ? 253 HIS A O   1 
ATOM 1725 C CB  . HIS A 1 253 ? 37.050  -17.084 83.562  1.00 0.00 ? 253 HIS A CB  1 
ATOM 1726 C CG  . HIS A 1 253 ? 36.140  -17.506 82.471  1.00 0.00 ? 253 HIS A CG  1 
ATOM 1727 N ND1 . HIS A 1 253 ? 34.912  -18.097 82.666  1.00 0.00 ? 253 HIS A ND1 1 
ATOM 1728 C CD2 . HIS A 1 253 ? 36.306  -17.429 81.138  1.00 0.00 ? 253 HIS A CD2 1 
ATOM 1729 C CE1 . HIS A 1 253 ? 34.361  -18.364 81.491  1.00 0.00 ? 253 HIS A CE1 1 
ATOM 1730 N NE2 . HIS A 1 253 ? 35.193  -17.966 80.537  1.00 0.00 ? 253 HIS A NE2 1 
ATOM 1731 N N   . LEU A 1 254 ? 40.427  -16.908 83.864  1.00 0.00 ? 254 LEU A N   1 
ATOM 1732 C CA  . LEU A 1 254 ? 41.368  -16.138 84.729  1.00 0.00 ? 254 LEU A CA  1 
ATOM 1733 C C   . LEU A 1 254 ? 41.112  -14.647 84.483  1.00 0.00 ? 254 LEU A C   1 
ATOM 1734 O O   . LEU A 1 254 ? 41.246  -14.156 83.319  1.00 0.00 ? 254 LEU A O   1 
ATOM 1735 C CB  . LEU A 1 254 ? 42.792  -16.577 84.486  1.00 0.00 ? 254 LEU A CB  1 
ATOM 1736 C CG  . LEU A 1 254 ? 43.121  -18.039 84.449  1.00 0.00 ? 254 LEU A CG  1 
ATOM 1737 C CD1 . LEU A 1 254 ? 44.359  -18.201 83.561  1.00 0.00 ? 254 LEU A CD1 1 
ATOM 1738 C CD2 . LEU A 1 254 ? 43.435  -18.524 85.836  1.00 0.00 ? 254 LEU A CD2 1 
ATOM 1739 N N   . LEU A 1 255 ? 40.731  -13.860 85.476  1.00 0.00 ? 255 LEU A N   1 
ATOM 1740 C CA  . LEU A 1 255 ? 40.547  -12.444 85.121  1.00 0.00 ? 255 LEU A CA  1 
ATOM 1741 C C   . LEU A 1 255 ? 41.680  -11.631 85.804  1.00 0.00 ? 255 LEU A C   1 
ATOM 1742 O O   . LEU A 1 255 ? 41.855  -11.913 86.987  1.00 0.00 ? 255 LEU A O   1 
ATOM 1743 C CB  . LEU A 1 255 ? 39.248  -11.823 85.538  1.00 0.00 ? 255 LEU A CB  1 
ATOM 1744 C CG  . LEU A 1 255 ? 38.010  -12.622 85.706  1.00 0.00 ? 255 LEU A CG  1 
ATOM 1745 C CD1 . LEU A 1 255 ? 36.861  -11.674 85.990  1.00 0.00 ? 255 LEU A CD1 1 
ATOM 1746 C CD2 . LEU A 1 255 ? 37.771  -13.341 84.407  1.00 0.00 ? 255 LEU A CD2 1 
ATOM 1747 N N   . ARG A 1 256 ? 42.265  -10.745 85.081  1.00 0.00 ? 256 ARG A N   1 
ATOM 1748 C CA  . ARG A 1 256 ? 43.329  -9.831  85.557  1.00 0.00 ? 256 ARG A CA  1 
ATOM 1749 C C   . ARG A 1 256 ? 42.650  -8.475  85.767  1.00 0.00 ? 256 ARG A C   1 
ATOM 1750 O O   . ARG A 1 256 ? 41.451  -8.445  85.478  1.00 0.00 ? 256 ARG A O   1 
ATOM 1751 C CB  . ARG A 1 256 ? 44.482  -9.797  84.615  1.00 0.00 ? 256 ARG A CB  1 
ATOM 1752 C CG  . ARG A 1 256 ? 45.350  -11.046 84.530  1.00 0.00 ? 256 ARG A CG  1 
ATOM 1753 C CD  . ARG A 1 256 ? 46.345  -10.833 83.460  1.00 0.00 ? 256 ARG A CD  1 
ATOM 1754 N NE  . ARG A 1 256 ? 47.534  -11.609 83.711  1.00 0.00 ? 256 ARG A NE  1 
ATOM 1755 C CZ  . ARG A 1 256 ? 48.585  -11.581 82.884  1.00 0.00 ? 256 ARG A CZ  1 
ATOM 1756 N NH1 . ARG A 1 256 ? 48.575  -10.865 81.752  1.00 0.00 ? 256 ARG A NH1 1 
ATOM 1757 N NH2 . ARG A 1 256 ? 49.689  -12.260 83.163  1.00 0.00 ? 256 ARG A NH2 1 
ATOM 1758 N N   . THR A 1 257 ? 43.235  -7.397  86.224  1.00 0.00 ? 257 THR A N   1 
ATOM 1759 C CA  . THR A 1 257 ? 42.492  -6.134  86.443  1.00 0.00 ? 257 THR A CA  1 
ATOM 1760 C C   . THR A 1 257 ? 41.671  -5.623  85.296  1.00 0.00 ? 257 THR A C   1 
ATOM 1761 O O   . THR A 1 257 ? 40.526  -5.150  85.494  1.00 0.00 ? 257 THR A O   1 
ATOM 1762 C CB  . THR A 1 257 ? 43.428  -4.912  86.816  1.00 0.00 ? 257 THR A CB  1 
ATOM 1763 O OG1 . THR A 1 257 ? 44.183  -5.548  87.823  1.00 0.00 ? 257 THR A OG1 1 
ATOM 1764 C CG2 . THR A 1 257 ? 42.740  -3.691  87.346  1.00 0.00 ? 257 THR A CG2 1 
ATOM 1765 N N   . GLY A 1 258 ? 42.376  -5.737  84.180  1.00 0.00 ? 258 GLY A N   1 
ATOM 1766 C CA  . GLY A 1 258 ? 41.751  -5.286  82.968  1.00 0.00 ? 258 GLY A CA  1 
ATOM 1767 C C   . GLY A 1 258 ? 40.548  -6.114  82.574  1.00 0.00 ? 258 GLY A C   1 
ATOM 1768 O O   . GLY A 1 258 ? 39.767  -5.542  81.799  1.00 0.00 ? 258 GLY A O   1 
ATOM 1769 N N   . ASP A 1 259 ? 40.387  -7.309  83.026  1.00 0.00 ? 259 ASP A N   1 
ATOM 1770 C CA  . ASP A 1 259 ? 39.269  -8.198  82.676  1.00 0.00 ? 259 ASP A CA  1 
ATOM 1771 C C   . ASP A 1 259 ? 38.055  -7.921  83.551  1.00 0.00 ? 259 ASP A C   1 
ATOM 1772 O O   . ASP A 1 259 ? 38.071  -7.172  84.538  1.00 0.00 ? 259 ASP A O   1 
ATOM 1773 C CB  . ASP A 1 259 ? 39.727  -9.648  82.718  1.00 0.00 ? 259 ASP A CB  1 
ATOM 1774 C CG  . ASP A 1 259 ? 40.912  -9.844  81.765  1.00 0.00 ? 259 ASP A CG  1 
ATOM 1775 O OD1 . ASP A 1 259 ? 40.873  -9.449  80.581  1.00 0.00 ? 259 ASP A OD1 1 
ATOM 1776 O OD2 . ASP A 1 259 ? 41.949  -10.400 82.176  1.00 0.00 ? 259 ASP A OD2 1 
ATOM 1777 N N   . GLU A 1 260 ? 37.024  -8.568  83.087  1.00 0.00 ? 260 GLU A N   1 
ATOM 1778 C CA  . GLU A 1 260 ? 35.655  -8.566  83.587  1.00 0.00 ? 260 GLU A CA  1 
ATOM 1779 C C   . GLU A 1 260 ? 34.916  -9.823  83.301  1.00 0.00 ? 260 GLU A C   1 
ATOM 1780 O O   . GLU A 1 260 ? 35.342  -10.623 82.420  1.00 0.00 ? 260 GLU A O   1 
ATOM 1781 C CB  . GLU A 1 260 ? 35.012  -7.361  82.879  1.00 0.00 ? 260 GLU A CB  1 
ATOM 1782 C CG  . GLU A 1 260 ? 33.573  -7.083  83.433  1.00 0.00 ? 260 GLU A CG  1 
ATOM 1783 C CD  . GLU A 1 260 ? 32.584  -7.718  82.426  1.00 0.00 ? 260 GLU A CD  1 
ATOM 1784 O OE1 . GLU A 1 260 ? 33.136  -8.293  81.480  1.00 0.00 ? 260 GLU A OE1 1 
ATOM 1785 O OE2 . GLU A 1 260 ? 31.379  -7.554  82.694  1.00 0.00 ? 260 GLU A OE2 1 
ATOM 1786 N N   . PHE A 1 261 ? 33.838  -10.177 83.938  1.00 0.00 ? 261 PHE A N   1 
ATOM 1787 C CA  . PHE A 1 261 ? 33.112  -11.438 83.660  1.00 0.00 ? 261 PHE A CA  1 
ATOM 1788 C C   . PHE A 1 261 ? 31.620  -11.175 83.872  1.00 0.00 ? 261 PHE A C   1 
ATOM 1789 O O   . PHE A 1 261 ? 31.190  -10.423 84.747  1.00 0.00 ? 261 PHE A O   1 
ATOM 1790 C CB  . PHE A 1 261 ? 33.511  -12.648 84.486  1.00 0.00 ? 261 PHE A CB  1 
ATOM 1791 C CG  . PHE A 1 261 ? 32.665  -13.880 84.445  1.00 0.00 ? 261 PHE A CG  1 
ATOM 1792 C CD1 . PHE A 1 261 ? 31.565  -14.023 85.291  1.00 0.00 ? 261 PHE A CD1 1 
ATOM 1793 C CD2 . PHE A 1 261 ? 32.962  -14.930 83.566  1.00 0.00 ? 261 PHE A CD2 1 
ATOM 1794 C CE1 . PHE A 1 261 ? 30.784  -15.188 85.252  1.00 0.00 ? 261 PHE A CE1 1 
ATOM 1795 C CE2 . PHE A 1 261 ? 32.209  -16.089 83.496  1.00 0.00 ? 261 PHE A CE2 1 
ATOM 1796 C CZ  . PHE A 1 261 ? 31.091  -16.222 84.360  1.00 0.00 ? 261 PHE A CZ  1 
ATOM 1797 N N   . ALA A 1 262 ? 30.893  -11.862 83.025  1.00 0.00 ? 262 ALA A N   1 
ATOM 1798 C CA  . ALA A 1 262 ? 29.421  -11.704 83.137  1.00 0.00 ? 262 ALA A CA  1 
ATOM 1799 C C   . ALA A 1 262 ? 28.740  -12.980 82.721  1.00 0.00 ? 262 ALA A C   1 
ATOM 1800 O O   . ALA A 1 262 ? 28.964  -13.568 81.672  1.00 0.00 ? 262 ALA A O   1 
ATOM 1801 C CB  . ALA A 1 262 ? 29.038  -10.520 82.310  1.00 0.00 ? 262 ALA A CB  1 
ATOM 1802 N N   . THR A 1 263 ? 27.893  -13.492 83.536  1.00 0.00 ? 263 THR A N   1 
ATOM 1803 C CA  . THR A 1 263 ? 27.046  -14.682 83.407  1.00 0.00 ? 263 THR A CA  1 
ATOM 1804 C C   . THR A 1 263 ? 26.053  -14.398 82.418  1.00 0.00 ? 263 THR A C   1 
ATOM 1805 O O   . THR A 1 263 ? 25.744  -13.048 82.427  1.00 0.00 ? 263 THR A O   1 
ATOM 1806 C CB  . THR A 1 263 ? 26.508  -14.669 84.923  1.00 0.00 ? 263 THR A CB  1 
ATOM 1807 O OG1 . THR A 1 263 ? 27.424  -15.654 85.503  1.00 0.00 ? 263 THR A OG1 1 
ATOM 1808 C CG2 . THR A 1 263 ? 25.003  -14.820 85.001  1.00 0.00 ? 263 THR A CG2 1 
ATOM 1809 N N   . GLY A 1 264 ? 25.382  -15.042 81.551  1.00 0.00 ? 264 GLY A N   1 
ATOM 1810 C CA  . GLY A 1 264 ? 24.377  -14.089 80.769  1.00 0.00 ? 264 GLY A CA  1 
ATOM 1811 C C   . GLY A 1 264 ? 23.053  -14.079 81.536  1.00 0.00 ? 264 GLY A C   1 
ATOM 1812 O O   . GLY A 1 264 ? 22.992  -14.222 82.818  1.00 0.00 ? 264 GLY A O   1 
ATOM 1813 N N   . THR A 1 265 ? 21.920  -13.921 80.856  1.00 0.00 ? 265 THR A N   1 
ATOM 1814 C CA  . THR A 1 265 ? 20.662  -13.923 81.592  1.00 0.00 ? 265 THR A CA  1 
ATOM 1815 C C   . THR A 1 265 ? 20.061  -15.297 81.759  1.00 0.00 ? 265 THR A C   1 
ATOM 1816 O O   . THR A 1 265 ? 19.963  -15.902 80.671  1.00 0.00 ? 265 THR A O   1 
ATOM 1817 C CB  . THR A 1 265 ? 19.510  -13.105 80.899  1.00 0.00 ? 265 THR A CB  1 
ATOM 1818 O OG1 . THR A 1 265 ? 19.959  -11.770 81.130  1.00 0.00 ? 265 THR A OG1 1 
ATOM 1819 C CG2 . THR A 1 265 ? 18.160  -13.470 81.490  1.00 0.00 ? 265 THR A CG2 1 
ATOM 1820 N N   . PHE A 1 266 ? 19.677  -15.721 82.924  1.00 0.00 ? 266 PHE A N   1 
ATOM 1821 C CA  . PHE A 1 266 ? 19.078  -17.050 83.111  1.00 0.00 ? 266 PHE A CA  1 
ATOM 1822 C C   . PHE A 1 266 ? 17.610  -16.805 83.439  1.00 0.00 ? 266 PHE A C   1 
ATOM 1823 O O   . PHE A 1 266 ? 17.279  -15.944 84.255  1.00 0.00 ? 266 PHE A O   1 
ATOM 1824 C CB  . PHE A 1 266 ? 19.686  -17.935 84.183  1.00 0.00 ? 266 PHE A CB  1 
ATOM 1825 C CG  . PHE A 1 266 ? 18.884  -19.122 84.625  1.00 0.00 ? 266 PHE A CG  1 
ATOM 1826 C CD1 . PHE A 1 266 ? 17.966  -19.038 85.670  1.00 0.00 ? 266 PHE A CD1 1 
ATOM 1827 C CD2 . PHE A 1 266 ? 19.047  -20.372 83.996  1.00 0.00 ? 266 PHE A CD2 1 
ATOM 1828 C CE1 . PHE A 1 266 ? 17.248  -20.214 86.046  1.00 0.00 ? 266 PHE A CE1 1 
ATOM 1829 C CE2 . PHE A 1 266 ? 18.346  -21.526 84.348  1.00 0.00 ? 266 PHE A CE2 1 
ATOM 1830 C CZ  . PHE A 1 266 ? 17.431  -21.451 85.392  1.00 0.00 ? 266 PHE A CZ  1 
ATOM 1831 N N   . PHE A 1 267 ? 16.817  -17.616 82.748  1.00 0.00 ? 267 PHE A N   1 
ATOM 1832 C CA  . PHE A 1 267 ? 15.336  -17.470 83.000  1.00 0.00 ? 267 PHE A CA  1 
ATOM 1833 C C   . PHE A 1 267 ? 14.895  -18.587 83.925  1.00 0.00 ? 267 PHE A C   1 
ATOM 1834 O O   . PHE A 1 267 ? 15.365  -19.751 83.651  1.00 0.00 ? 267 PHE A O   1 
ATOM 1835 C CB  . PHE A 1 267 ? 14.636  -17.418 81.672  1.00 0.00 ? 267 PHE A CB  1 
ATOM 1836 C CG  . PHE A 1 267 ? 14.955  -16.163 80.941  1.00 0.00 ? 267 PHE A CG  1 
ATOM 1837 C CD1 . PHE A 1 267 ? 14.164  -15.042 81.150  1.00 0.00 ? 267 PHE A CD1 1 
ATOM 1838 C CD2 . PHE A 1 267 ? 16.038  -16.135 80.090  1.00 0.00 ? 267 PHE A CD2 1 
ATOM 1839 C CE1 . PHE A 1 267 ? 14.432  -13.836 80.499  1.00 0.00 ? 267 PHE A CE1 1 
ATOM 1840 C CE2 . PHE A 1 267 ? 16.328  -14.945 79.432  1.00 0.00 ? 267 PHE A CE2 1 
ATOM 1841 C CZ  . PHE A 1 267 ? 15.529  -13.796 79.628  1.00 0.00 ? 267 PHE A CZ  1 
ATOM 1842 N N   . PHE A 1 268 ? 14.071  -18.289 84.936  1.00 0.00 ? 268 PHE A N   1 
ATOM 1843 C CA  . PHE A 1 268 ? 13.671  -19.429 85.807  1.00 0.00 ? 268 PHE A CA  1 
ATOM 1844 C C   . PHE A 1 268 ? 12.326  -19.959 85.270  1.00 0.00 ? 268 PHE A C   1 
ATOM 1845 O O   . PHE A 1 268 ? 11.717  -19.282 84.415  1.00 0.00 ? 268 PHE A O   1 
ATOM 1846 C CB  . PHE A 1 268 ? 13.565  -19.093 87.262  1.00 0.00 ? 268 PHE A CB  1 
ATOM 1847 C CG  . PHE A 1 268 ? 14.623  -18.320 87.968  1.00 0.00 ? 268 PHE A CG  1 
ATOM 1848 C CD1 . PHE A 1 268 ? 14.724  -16.945 87.790  1.00 0.00 ? 268 PHE A CD1 1 
ATOM 1849 C CD2 . PHE A 1 268 ? 15.525  -18.974 88.821  1.00 0.00 ? 268 PHE A CD2 1 
ATOM 1850 C CE1 . PHE A 1 268 ? 15.710  -16.246 88.455  1.00 0.00 ? 268 PHE A CE1 1 
ATOM 1851 C CE2 . PHE A 1 268 ? 16.533  -18.271 89.483  1.00 0.00 ? 268 PHE A CE2 1 
ATOM 1852 C CZ  . PHE A 1 268 ? 16.618  -16.887 89.289  1.00 0.00 ? 268 PHE A CZ  1 
ATOM 1853 N N   . ASP A 1 269 ? 11.961  -21.090 85.803  1.00 0.00 ? 269 ASP A N   1 
ATOM 1854 C CA  . ASP A 1 269 ? 10.697  -21.815 85.491  1.00 0.00 ? 269 ASP A CA  1 
ATOM 1855 C C   . ASP A 1 269 ? 9.938   -21.884 86.792  1.00 0.00 ? 269 ASP A C   1 
ATOM 1856 O O   . ASP A 1 269 ? 10.174  -22.974 87.453  1.00 0.00 ? 269 ASP A O   1 
ATOM 1857 C CB  . ASP A 1 269 ? 11.053  -23.159 84.881  1.00 0.00 ? 269 ASP A CB  1 
ATOM 1858 C CG  . ASP A 1 269 ? 12.043  -24.054 85.653  1.00 0.00 ? 269 ASP A CG  1 
ATOM 1859 O OD1 . ASP A 1 269 ? 12.901  -23.537 86.454  1.00 0.00 ? 269 ASP A OD1 1 
ATOM 1860 O OD2 . ASP A 1 269 ? 11.936  -25.318 85.408  1.00 0.00 ? 269 ASP A OD2 1 
ATOM 1861 N N   . CYS A 1 270 ? 9.130   -20.955 87.298  1.00 0.00 ? 270 CYS A N   1 
ATOM 1862 C CA  . CYS A 1 270 ? 8.560   -21.321 88.672  1.00 0.00 ? 270 CYS A CA  1 
ATOM 1863 C C   . CYS A 1 270 ? 7.153   -20.925 88.914  1.00 0.00 ? 270 CYS A C   1 
ATOM 1864 O O   . CYS A 1 270 ? 6.706   -19.803 88.464  1.00 0.00 ? 270 CYS A O   1 
ATOM 1865 C CB  . CYS A 1 270 ? 9.518   -20.686 89.691  1.00 0.00 ? 270 CYS A CB  1 
ATOM 1866 S SG  . CYS A 1 270 ? 11.314  -21.034 89.620  1.00 0.00 ? 270 CYS A SG  1 
ATOM 1867 N N   . LYS A 1 271 ? 6.313   -21.704 89.625  1.00 0.00 ? 271 LYS A N   1 
ATOM 1868 C CA  . LYS A 1 271 ? 4.896   -21.179 89.827  1.00 0.00 ? 271 LYS A CA  1 
ATOM 1869 C C   . LYS A 1 271 ? 4.980   -19.919 90.638  1.00 0.00 ? 271 LYS A C   1 
ATOM 1870 O O   . LYS A 1 271 ? 5.927   -19.688 91.449  1.00 0.00 ? 271 LYS A O   1 
ATOM 1871 C CB  . LYS A 1 271 ? 4.056   -22.256 90.445  1.00 0.00 ? 271 LYS A CB  1 
ATOM 1872 C CG  . LYS A 1 271 ? 4.789   -23.596 90.429  1.00 0.00 ? 271 LYS A CG  1 
ATOM 1873 C CD  . LYS A 1 271 ? 4.046   -24.773 91.057  1.00 0.00 ? 271 LYS A CD  1 
ATOM 1874 C CE  . LYS A 1 271 ? 4.773   -26.125 90.764  1.00 0.00 ? 271 LYS A CE  1 
ATOM 1875 N NZ  . LYS A 1 271 ? 4.167   -27.175 91.686  1.00 0.00 ? 271 LYS A NZ  1 
ATOM 1876 N N   . PRO A 1 272 ? 4.026   -19.018 90.489  1.00 0.00 ? 272 PRO A N   1 
ATOM 1877 C CA  . PRO A 1 272 ? 4.012   -17.763 91.229  1.00 0.00 ? 272 PRO A CA  1 
ATOM 1878 C C   . PRO A 1 272 ? 3.801   -18.022 92.709  1.00 0.00 ? 272 PRO A C   1 
ATOM 1879 O O   . PRO A 1 272 ? 3.284   -19.042 93.178  1.00 0.00 ? 272 PRO A O   1 
ATOM 1880 C CB  . PRO A 1 272 ? 2.926   -16.880 90.674  1.00 0.00 ? 272 PRO A CB  1 
ATOM 1881 C CG  . PRO A 1 272 ? 2.150   -17.783 89.842  1.00 0.00 ? 272 PRO A CG  1 
ATOM 1882 C CD  . PRO A 1 272 ? 2.891   -19.100 89.638  1.00 0.00 ? 272 PRO A CD  1 
ATOM 1883 N N   . CYS A 1 273 ? 4.251   -17.023 93.430  1.00 0.00 ? 273 CYS A N   1 
ATOM 1884 C CA  . CYS A 1 273 ? 4.232   -16.906 94.866  1.00 0.00 ? 273 CYS A CA  1 
ATOM 1885 C C   . CYS A 1 273 ? 3.091   -15.983 95.218  1.00 0.00 ? 273 CYS A C   1 
ATOM 1886 O O   . CYS A 1 273 ? 3.007   -14.902 94.613  1.00 0.00 ? 273 CYS A O   1 
ATOM 1887 C CB  . CYS A 1 273 ? 5.595   -16.386 95.313  1.00 0.00 ? 273 CYS A CB  1 
ATOM 1888 S SG  . CYS A 1 273 ? 5.759   -16.386 97.084  1.00 0.00 ? 273 CYS A SG  1 
ATOM 1889 N N   . ARG A 1 274 ? 2.259   -16.404 96.122  1.00 0.00 ? 274 ARG A N   1 
ATOM 1890 C CA  . ARG A 1 274 ? 1.111   -15.569 96.561  1.00 0.00 ? 274 ARG A CA  1 
ATOM 1891 C C   . ARG A 1 274 ? 1.538   -14.746 97.779  1.00 0.00 ? 274 ARG A C   1 
ATOM 1892 O O   . ARG A 1 274 ? 2.342   -15.199 98.606  1.00 0.00 ? 274 ARG A O   1 
ATOM 1893 C CB  . ARG A 1 274 ? -0.045  -16.498 96.916  1.00 0.00 ? 274 ARG A CB  1 
ATOM 1894 C CG  . ARG A 1 274 ? -0.244  -17.597 95.872  1.00 0.00 ? 274 ARG A CG  1 
ATOM 1895 C CD  . ARG A 1 274 ? -1.649  -18.193 95.890  1.00 0.00 ? 274 ARG A CD  1 
ATOM 1896 N NE  . ARG A 1 274 ? -2.652  -17.330 95.250  1.00 0.00 ? 274 ARG A NE  1 
ATOM 1897 C CZ  . ARG A 1 274 ? -3.820  -17.779 94.778  1.00 0.00 ? 274 ARG A CZ  1 
ATOM 1898 N NH1 . ARG A 1 274 ? -4.142  -19.077 94.864  1.00 0.00 ? 274 ARG A NH1 1 
ATOM 1899 N NH2 . ARG A 1 274 ? -4.744  -17.001 94.200  1.00 0.00 ? 274 ARG A NH2 1 
ATOM 1900 N N   . LEU A 1 275 ? 0.993   -13.548 97.852  1.00 0.00 ? 275 LEU A N   1 
ATOM 1901 C CA  . LEU A 1 275 ? 1.281   -12.611 98.948  1.00 0.00 ? 275 LEU A CA  1 
ATOM 1902 C C   . LEU A 1 275 ? 0.032   -12.446 99.826  1.00 0.00 ? 275 LEU A C   1 
ATOM 1903 O O   . LEU A 1 275 ? -0.225  -11.362 100.372 1.00 0.00 ? 275 LEU A O   1 
ATOM 1904 C CB  . LEU A 1 275 ? 1.704   -11.253 98.372  1.00 0.00 ? 275 LEU A CB  1 
ATOM 1905 C CG  . LEU A 1 275 ? 3.076   -11.291 97.682  1.00 0.00 ? 275 LEU A CG  1 
ATOM 1906 C CD1 . LEU A 1 275 ? 3.506   -9.933  97.121  1.00 0.00 ? 275 LEU A CD1 1 
ATOM 1907 C CD2 . LEU A 1 275 ? 4.207   -11.725 98.618  1.00 0.00 ? 275 LEU A CD2 1 
ATOM 1908 N N   . THR A 1 276 ? -0.700  -13.549 99.930  1.00 0.00 ? 276 THR A N   1 
ATOM 1909 C CA  . THR A 1 276 ? -1.952  -13.631 100.710 1.00 0.00 ? 276 THR A CA  1 
ATOM 1910 C C   . THR A 1 276 ? -1.943  -14.878 101.598 1.00 0.00 ? 276 THR A C   1 
ATOM 1911 O O   . THR A 1 276 ? -1.268  -15.873 101.300 1.00 0.00 ? 276 THR A O   1 
ATOM 1912 C CB  . THR A 1 276 ? -3.151  -13.728 99.765  1.00 0.00 ? 276 THR A CB  1 
ATOM 1913 O OG1 . THR A 1 276 ? -3.184  -12.599 98.906  1.00 0.00 ? 276 THR A OG1 1 
ATOM 1914 C CG2 . THR A 1 276 ? -4.493  -13.786 100.499 1.00 0.00 ? 276 THR A CG2 1 
ATOM 1915 N N   . HIS A 1 277 ? -2.705  -14.789 102.672 1.00 0.00 ? 277 HIS A N   1 
ATOM 1916 C CA  . HIS A 1 277 ? -2.823  -15.883 103.642 1.00 0.00 ? 277 HIS A CA  1 
ATOM 1917 C C   . HIS A 1 277 ? -4.283  -16.267 103.842 1.00 0.00 ? 277 HIS A C   1 
ATOM 1918 O O   . HIS A 1 277 ? -5.182  -15.414 103.789 1.00 0.00 ? 277 HIS A O   1 
ATOM 1919 C CB  . HIS A 1 277 ? -2.237  -15.466 104.994 1.00 0.00 ? 277 HIS A CB  1 
ATOM 1920 C CG  . HIS A 1 277 ? -3.095  -14.440 105.742 1.00 0.00 ? 277 HIS A CG  1 
ATOM 1921 N ND1 . HIS A 1 277 ? -3.060  -13.086 105.427 1.00 0.00 ? 277 HIS A ND1 1 
ATOM 1922 C CD2 . HIS A 1 277 ? -3.983  -14.568 106.766 1.00 0.00 ? 277 HIS A CD2 1 
ATOM 1923 C CE1 . HIS A 1 277 ? -3.891  -12.453 106.236 1.00 0.00 ? 277 HIS A CE1 1 
ATOM 1924 N NE2 . HIS A 1 277 ? -4.449  -13.322 107.040 1.00 0.00 ? 277 HIS A NE2 1 
ATOM 1925 N N   . THR A 1 278 ? -4.450  -17.552 104.062 1.00 0.00 ? 278 THR A N   1 
ATOM 1926 C CA  . THR A 1 278 ? -5.755  -18.155 104.315 1.00 0.00 ? 278 THR A CA  1 
ATOM 1927 C C   . THR A 1 278 ? -5.956  -18.261 105.821 1.00 0.00 ? 278 THR A C   1 
ATOM 1928 O O   . THR A 1 278 ? -5.081  -18.758 106.547 1.00 0.00 ? 278 THR A O   1 
ATOM 1929 C CB  . THR A 1 278 ? -5.821  -19.535 103.670 1.00 0.00 ? 278 THR A CB  1 
ATOM 1930 O OG1 . THR A 1 278 ? -4.566  -20.187 103.792 1.00 0.00 ? 278 THR A OG1 1 
ATOM 1931 C CG2 . THR A 1 278 ? -6.167  -19.476 102.181 1.00 0.00 ? 278 THR A CG2 1 
ATOM 1932 N N   . TRP A 1 279 ? -7.106  -17.782 106.227 1.00 0.00 ? 279 TRP A N   1 
ATOM 1933 C CA  . TRP A 1 279 ? -7.497  -17.730 107.635 1.00 0.00 ? 279 TRP A CA  1 
ATOM 1934 C C   . TRP A 1 279 ? -8.657  -18.684 107.919 1.00 0.00 ? 279 TRP A C   1 
ATOM 1935 O O   . TRP A 1 279 ? -9.207  -18.699 109.029 1.00 0.00 ? 279 TRP A O   1 
ATOM 1936 C CB  . TRP A 1 279 ? -7.964  -16.314 107.971 1.00 0.00 ? 279 TRP A CB  1 
ATOM 1937 C CG  . TRP A 1 279 ? -9.226  -15.908 107.197 1.00 0.00 ? 279 TRP A CG  1 
ATOM 1938 C CD1 . TRP A 1 279 ? -9.313  -15.024 106.191 1.00 0.00 ? 279 TRP A CD1 1 
ATOM 1939 C CD2 . TRP A 1 279 ? -10.527 -16.424 107.432 1.00 0.00 ? 279 TRP A CD2 1 
ATOM 1940 N NE1 . TRP A 1 279 ? -10.689 -14.971 105.793 1.00 0.00 ? 279 TRP A NE1 1 
ATOM 1941 C CE2 . TRP A 1 279 ? -11.384 -15.796 106.537 1.00 0.00 ? 279 TRP A CE2 1 
ATOM 1942 C CE3 . TRP A 1 279 ? -11.046 -17.361 108.331 1.00 0.00 ? 279 TRP A CE3 1 
ATOM 1943 C CZ2 . TRP A 1 279 ? -12.761 -16.047 106.492 1.00 0.00 ? 279 TRP A CZ2 1 
ATOM 1944 C CZ3 . TRP A 1 279 ? -12.432 -17.611 108.276 1.00 0.00 ? 279 TRP A CZ3 1 
ATOM 1945 C CH2 . TRP A 1 279 ? -13.249 -16.983 107.400 1.00 0.00 ? 279 TRP A CH2 1 
ATOM 1946 N N   . GLN A 1 280 ? -9.000  -19.462 106.910 1.00 0.00 ? 280 GLN A N   1 
ATOM 1947 C CA  . GLN A 1 280 ? -10.126 -20.408 106.990 1.00 0.00 ? 280 GLN A CA  1 
ATOM 1948 C C   . GLN A 1 280 ? -9.653  -21.812 107.381 1.00 0.00 ? 280 GLN A C   1 
ATOM 1949 O O   . GLN A 1 280 ? -8.688  -22.344 106.815 1.00 0.00 ? 280 GLN A O   1 
ATOM 1950 C CB  . GLN A 1 280 ? -10.833 -20.503 105.636 1.00 0.00 ? 280 GLN A CB  1 
ATOM 1951 C CG  . GLN A 1 280 ? -11.667 -19.262 105.308 1.00 0.00 ? 280 GLN A CG  1 
ATOM 1952 C CD  . GLN A 1 280 ? -12.416 -19.372 103.977 1.00 0.00 ? 280 GLN A CD  1 
ATOM 1953 O OE1 . GLN A 1 280 ? -11.875 -19.008 102.934 1.00 0.00 ? 280 GLN A OE1 1 
ATOM 1954 N NE2 . GLN A 1 280 ? -13.644 -19.857 103.948 1.00 0.00 ? 280 GLN A NE2 1 
ATOM 1955 N N   . THR A 1 281 ? -10.368 -22.359 108.346 1.00 0.00 ? 281 THR A N   1 
ATOM 1956 C CA  . THR A 1 281 ? -10.131 -23.716 108.852 1.00 0.00 ? 281 THR A CA  1 
ATOM 1957 C C   . THR A 1 281 ? -11.113 -24.670 108.175 1.00 0.00 ? 281 THR A C   1 
ATOM 1958 O O   . THR A 1 281 ? -11.209 -24.715 106.940 1.00 0.00 ? 281 THR A O   1 
ATOM 1959 C CB  . THR A 1 281 ? -10.355 -23.763 110.367 1.00 0.00 ? 281 THR A CB  1 
ATOM 1960 O OG1 . THR A 1 281 ? -9.902  -22.558 110.964 1.00 0.00 ? 281 THR A OG1 1 
ATOM 1961 C CG2 . THR A 1 281 ? -9.614  -24.917 111.045 1.00 0.00 ? 281 THR A CG2 1 
ATOM 1962 N N   . ASN A 1 282 ? -11.815 -25.398 109.016 1.00 0.00 ? 282 ASN A N   1 
ATOM 1963 C CA  . ASN A 1 282 ? -12.836 -26.356 108.581 1.00 0.00 ? 282 ASN A CA  1 
ATOM 1964 C C   . ASN A 1 282 ? -14.188 -25.949 109.161 1.00 0.00 ? 282 ASN A C   1 
ATOM 1965 O O   . ASN A 1 282 ? -15.233 -26.510 108.800 1.00 0.00 ? 282 ASN A O   1 
ATOM 1966 C CB  . ASN A 1 282 ? -12.488 -27.760 109.080 1.00 0.00 ? 282 ASN A CB  1 
ATOM 1967 C CG  . ASN A 1 282 ? -11.792 -28.617 108.023 1.00 0.00 ? 282 ASN A CG  1 
ATOM 1968 O OD1 . ASN A 1 282 ? -12.459 -29.251 107.206 1.00 0.00 ? 282 ASN A OD1 1 
ATOM 1969 N ND2 . ASN A 1 282 ? -10.474 -28.677 107.988 1.00 0.00 ? 282 ASN A ND2 1 
ATOM 1970 N N   . ARG A 1 283 ? -14.112 -24.973 110.046 1.00 0.00 ? 283 ARG A N   1 
ATOM 1971 C CA  . ARG A 1 283 ? -15.283 -24.436 110.751 1.00 0.00 ? 283 ARG A CA  1 
ATOM 1972 C C   . ARG A 1 283 ? -15.726 -23.112 110.128 1.00 0.00 ? 283 ARG A C   1 
ATOM 1973 O O   . ARG A 1 283 ? -16.735 -22.519 110.534 1.00 0.00 ? 283 ARG A O   1 
ATOM 1974 C CB  . ARG A 1 283 ? -14.939 -24.195 112.221 1.00 0.00 ? 283 ARG A CB  1 
ATOM 1975 C CG  . ARG A 1 283 ? -14.489 -25.467 112.943 1.00 0.00 ? 283 ARG A CG  1 
ATOM 1976 C CD  . ARG A 1 283 ? -15.656 -26.376 113.334 1.00 0.00 ? 283 ARG A CD  1 
ATOM 1977 N NE  . ARG A 1 283 ? -16.653 -25.700 114.176 1.00 0.00 ? 283 ARG A NE  1 
ATOM 1978 C CZ  . ARG A 1 283 ? -16.549 -25.575 115.507 1.00 0.00 ? 283 ARG A CZ  1 
ATOM 1979 N NH1 . ARG A 1 283 ? -15.496 -26.076 116.167 1.00 0.00 ? 283 ARG A NH1 1 
ATOM 1980 N NH2 . ARG A 1 283 ? -17.457 -24.958 116.275 1.00 0.00 ? 283 ARG A NH2 1 
ATOM 1981 N N   . ALA A 1 284 ? -14.954 -22.681 109.156 1.00 0.00 ? 284 ALA A N   1 
ATOM 1982 C CA  . ALA A 1 284 ? -15.218 -21.431 108.435 1.00 0.00 ? 284 ALA A CA  1 
ATOM 1983 C C   . ALA A 1 284 ? -15.348 -21.720 106.944 1.00 0.00 ? 284 ALA A C   1 
ATOM 1984 O O   . ALA A 1 284 ? -14.818 -20.979 106.104 1.00 0.00 ? 284 ALA A O   1 
ATOM 1985 C CB  . ALA A 1 284 ? -14.065 -20.451 108.658 1.00 0.00 ? 284 ALA A CB  1 
ATOM 1986 N N   . LEU A 1 285 ? -16.061 -22.795 106.665 1.00 0.00 ? 285 LEU A N   1 
ATOM 1987 C CA  . LEU A 1 285 ? -16.272 -23.265 105.292 1.00 0.00 ? 285 LEU A CA  1 
ATOM 1988 C C   . LEU A 1 285 ? -17.733 -23.623 105.024 1.00 0.00 ? 285 LEU A C   1 
ATOM 1989 O O   . LEU A 1 285 ? -18.291 -24.535 105.650 1.00 0.00 ? 285 LEU A O   1 
ATOM 1990 C CB  . LEU A 1 285 ? -15.478 -24.551 105.040 1.00 0.00 ? 285 LEU A CB  1 
ATOM 1991 C CG  . LEU A 1 285 ? -13.965 -24.346 105.017 1.00 0.00 ? 285 LEU A CG  1 
ATOM 1992 C CD1 . LEU A 1 285 ? -13.209 -25.568 104.487 1.00 0.00 ? 285 LEU A CD1 1 
ATOM 1993 C CD2 . LEU A 1 285 ? -13.534 -23.176 104.134 1.00 0.00 ? 285 LEU A CD2 1 
ATOM 1994 N N   . GLY A 1 286 ? -18.313 -22.890 104.091 1.00 0.00 ? 286 GLY A N   1 
ATOM 1995 C CA  . GLY A 1 286 ? -19.675 -23.163 103.611 1.00 0.00 ? 286 GLY A CA  1 
ATOM 1996 C C   . GLY A 1 286 ? -20.730 -22.219 104.196 1.00 0.00 ? 286 GLY A C   1 
ATOM 1997 O O   . GLY A 1 286 ? -20.411 -21.124 104.686 1.00 0.00 ? 286 GLY A O   1 
ATOM 1998 N N   . LEU A 1 287 ? -21.943 -22.735 104.088 1.00 0.00 ? 287 LEU A N   1 
ATOM 1999 C CA  . LEU A 1 287 ? -23.184 -22.078 104.510 1.00 0.00 ? 287 LEU A CA  1 
ATOM 2000 C C   . LEU A 1 287 ? -23.422 -22.278 106.006 1.00 0.00 ? 287 LEU A C   1 
ATOM 2001 O O   . LEU A 1 287 ? -23.833 -23.362 106.447 1.00 0.00 ? 287 LEU A O   1 
ATOM 2002 C CB  . LEU A 1 287 ? -24.354 -22.698 103.742 1.00 0.00 ? 287 LEU A CB  1 
ATOM 2003 C CG  . LEU A 1 287 ? -25.698 -22.055 104.062 1.00 0.00 ? 287 LEU A CG  1 
ATOM 2004 C CD1 . LEU A 1 287 ? -25.780 -20.598 103.609 1.00 0.00 ? 287 LEU A CD1 1 
ATOM 2005 C CD2 . LEU A 1 287 ? -26.872 -22.769 103.390 1.00 0.00 ? 287 LEU A CD2 1 
ATOM 2006 N N   . PRO A 1 288 ? -23.180 -21.262 106.842 1.00 0.00 ? 288 PRO A N   1 
ATOM 2007 C CA  . PRO A 1 288 ? -23.399 -21.389 108.275 1.00 0.00 ? 288 PRO A CA  1 
ATOM 2008 C C   . PRO A 1 288 ? -24.852 -21.700 108.562 1.00 0.00 ? 288 PRO A C   1 
ATOM 2009 O O   . PRO A 1 288 ? -25.707 -21.581 107.629 1.00 0.00 ? 288 PRO A O   1 
ATOM 2010 C CB  . PRO A 1 288 ? -22.994 -20.040 108.820 1.00 0.00 ? 288 PRO A CB  1 
ATOM 2011 C CG  . PRO A 1 288 ? -22.554 -19.172 107.648 1.00 0.00 ? 288 PRO A CG  1 
ATOM 2012 C CD  . PRO A 1 288 ? -22.680 -19.964 106.385 1.00 0.00 ? 288 PRO A CD  1 
ATOM 2013 N N   . PRO A 1 289 ? -25.222 -22.109 109.797 1.00 0.00 ? 289 PRO A N   1 
ATOM 2014 C CA  . PRO A 1 289 ? -26.621 -22.379 110.124 1.00 0.00 ? 289 PRO A CA  1 
ATOM 2015 C C   . PRO A 1 289 ? -27.451 -21.120 109.931 1.00 0.00 ? 289 PRO A C   1 
ATOM 2016 O O   . PRO A 1 289 ? -26.860 -20.020 109.706 1.00 0.00 ? 289 PRO A O   1 
ATOM 2017 C CB  . PRO A 1 289 ? -26.573 -22.809 111.579 1.00 0.00 ? 289 PRO A CB  1 
ATOM 2018 C CG  . PRO A 1 289 ? -25.118 -22.765 112.036 1.00 0.00 ? 289 PRO A CG  1 
ATOM 2019 C CD  . PRO A 1 289 ? -24.264 -22.318 110.889 1.00 0.00 ? 289 PRO A CD  1 
ATOM 2020 N N   . PHE A 1 290 ? -28.773 -21.287 110.001 1.00 0.00 ? 290 PHE A N   1 
ATOM 2021 C CA  . PHE A 1 290 ? -29.744 -20.161 109.916 1.00 0.00 ? 290 PHE A CA  1 
ATOM 2022 C C   . PHE A 1 290 ? -30.229 -19.881 111.335 1.00 0.00 ? 290 PHE A C   1 
ATOM 2023 O O   . PHE A 1 290 ? -30.790 -20.753 112.005 1.00 0.00 ? 290 PHE A O   1 
ATOM 2024 C CB  . PHE A 1 290 ? -30.928 -20.531 109.001 1.00 0.00 ? 290 PHE A CB  1 
ATOM 2025 C CG  . PHE A 1 290 ? -32.114 -19.544 109.069 1.00 0.00 ? 290 PHE A CG  1 
ATOM 2026 C CD1 . PHE A 1 290 ? -32.126 -18.382 108.277 1.00 0.00 ? 290 PHE A CD1 1 
ATOM 2027 C CD2 . PHE A 1 290 ? -33.200 -19.805 109.919 1.00 0.00 ? 290 PHE A CD2 1 
ATOM 2028 C CE1 . PHE A 1 290 ? -33.210 -17.495 108.336 1.00 0.00 ? 290 PHE A CE1 1 
ATOM 2029 C CE2 . PHE A 1 290 ? -34.284 -18.915 109.977 1.00 0.00 ? 290 PHE A CE2 1 
ATOM 2030 C CZ  . PHE A 1 290 ? -34.288 -17.761 109.185 1.00 0.00 ? 290 PHE A CZ  1 
ATOM 2031 N N   . LEU A 1 291 ? -29.996 -18.672 111.778 1.00 0.00 ? 291 LEU A N   1 
ATOM 2032 C CA  . LEU A 1 291 ? -30.320 -18.282 113.154 1.00 0.00 ? 291 LEU A CA  1 
ATOM 2033 C C   . LEU A 1 291 ? -31.759 -17.790 113.261 1.00 0.00 ? 291 LEU A C   1 
ATOM 2034 O O   . LEU A 1 291 ? -32.074 -16.649 112.899 1.00 0.00 ? 291 LEU A O   1 
ATOM 2035 C CB  . LEU A 1 291 ? -29.342 -17.210 113.603 1.00 0.00 ? 291 LEU A CB  1 
ATOM 2036 C CG  . LEU A 1 291 ? -27.890 -17.654 113.414 1.00 0.00 ? 291 LEU A CG  1 
ATOM 2037 C CD1 . LEU A 1 291 ? -26.888 -16.729 114.099 1.00 0.00 ? 291 LEU A CD1 1 
ATOM 2038 C CD2 . LEU A 1 291 ? -27.618 -19.054 113.974 1.00 0.00 ? 291 LEU A CD2 1 
ATOM 2039 N N   . ASN A 1 292 ? -32.579 -18.684 113.774 1.00 0.00 ? 292 ASN A N   1 
ATOM 2040 C CA  . ASN A 1 292 ? -34.014 -18.446 113.956 1.00 0.00 ? 292 ASN A CA  1 
ATOM 2041 C C   . ASN A 1 292 ? -34.256 -17.331 114.984 1.00 0.00 ? 292 ASN A C   1 
ATOM 2042 O O   . ASN A 1 292 ? -35.337 -16.727 115.025 1.00 0.00 ? 292 ASN A O   1 
ATOM 2043 C CB  . ASN A 1 292 ? -34.697 -19.727 114.441 1.00 0.00 ? 292 ASN A CB  1 
ATOM 2044 C CG  . ASN A 1 292 ? -34.611 -20.872 113.427 1.00 0.00 ? 292 ASN A CG  1 
ATOM 2045 O OD1 . ASN A 1 292 ? -33.665 -21.658 113.463 1.00 0.00 ? 292 ASN A OD1 1 
ATOM 2046 N ND2 . ASN A 1 292 ? -35.553 -21.018 112.513 1.00 0.00 ? 292 ASN A ND2 1 
ATOM 2047 N N   . SER A 1 293 ? -33.239 -17.080 115.795 1.00 0.00 ? 293 SER A N   1 
ATOM 2048 C CA  . SER A 1 293 ? -33.302 -16.052 116.855 1.00 0.00 ? 293 SER A CA  1 
ATOM 2049 C C   . SER A 1 293 ? -32.045 -15.180 116.836 1.00 0.00 ? 293 SER A C   1 
ATOM 2050 O O   . SER A 1 293 ? -30.915 -15.685 116.804 1.00 0.00 ? 293 SER A O   1 
ATOM 2051 C CB  . SER A 1 293 ? -33.408 -16.720 118.229 1.00 0.00 ? 293 SER A CB  1 
ATOM 2052 O OG  . SER A 1 293 ? -33.440 -15.733 119.250 1.00 0.00 ? 293 SER A OG  1 
ATOM 2053 N N   . LEU A 1 294 ? -32.283 -13.882 116.864 1.00 0.00 ? 294 LEU A N   1 
ATOM 2054 C CA  . LEU A 1 294 ? -31.209 -12.880 116.842 1.00 0.00 ? 294 LEU A CA  1 
ATOM 2055 C C   . LEU A 1 294 ? -31.341 -11.926 118.024 1.00 0.00 ? 294 LEU A C   1 
ATOM 2056 O O   . LEU A 1 294 ? -32.450 -11.674 118.522 1.00 0.00 ? 294 LEU A O   1 
ATOM 2057 C CB  . LEU A 1 294 ? -31.284 -12.061 115.554 1.00 0.00 ? 294 LEU A CB  1 
ATOM 2058 C CG  . LEU A 1 294 ? -31.246 -12.928 114.297 1.00 0.00 ? 294 LEU A CG  1 
ATOM 2059 C CD1 . LEU A 1 294 ? -31.415 -12.121 113.010 1.00 0.00 ? 294 LEU A CD1 1 
ATOM 2060 C CD2 . LEU A 1 294 ? -29.930 -13.693 114.141 1.00 0.00 ? 294 LEU A CD2 1 
ATOM 2061 N N   . PRO A 1 295 ? -30.233 -11.358 118.520 1.00 0.00 ? 295 PRO A N   1 
ATOM 2062 C CA  . PRO A 1 295 ? -30.298 -10.425 119.624 1.00 0.00 ? 295 PRO A CA  1 
ATOM 2063 C C   . PRO A 1 295 ? -31.165 -9.266  119.225 1.00 0.00 ? 295 PRO A C   1 
ATOM 2064 O O   . PRO A 1 295 ? -31.329 -9.016  117.991 1.00 0.00 ? 295 PRO A O   1 
ATOM 2065 C CB  . PRO A 1 295 ? -28.859 -10.033 119.853 1.00 0.00 ? 295 PRO A CB  1 
ATOM 2066 C CG  . PRO A 1 295 ? -28.006 -10.783 118.842 1.00 0.00 ? 295 PRO A CG  1 
ATOM 2067 C CD  . PRO A 1 295 ? -28.897 -11.633 117.994 1.00 0.00 ? 295 PRO A CD  1 
ATOM 2068 N N   . GLN A 1 296 ? -31.697 -8.591  120.227 1.00 0.00 ? 296 GLN A N   1 
ATOM 2069 C CA  . GLN A 1 296 ? -32.582 -7.436  120.008 1.00 0.00 ? 296 GLN A CA  1 
ATOM 2070 C C   . GLN A 1 296 ? -31.944 -6.157  120.573 1.00 0.00 ? 296 GLN A C   1 
ATOM 2071 O O   . GLN A 1 296 ? -32.569 -5.086  120.591 1.00 0.00 ? 296 GLN A O   1 
ATOM 2072 C CB  . GLN A 1 296 ? -33.945 -7.694  120.662 1.00 0.00 ? 296 GLN A CB  1 
ATOM 2073 C CG  . GLN A 1 296 ? -34.757 -8.767  119.923 1.00 0.00 ? 296 GLN A CG  1 
ATOM 2074 C CD  . GLN A 1 296 ? -36.219 -8.851  120.374 1.00 0.00 ? 296 GLN A CD  1 
ATOM 2075 O OE1 . GLN A 1 296 ? -36.533 -9.587  121.308 1.00 0.00 ? 296 GLN A OE1 1 
ATOM 2076 N NE2 . GLN A 1 296 ? -37.144 -8.138  119.758 1.00 0.00 ? 296 GLN A NE2 1 
ATOM 2077 N N   . SER A 1 297 ? -30.702 -6.308  121.020 1.00 0.00 ? 297 SER A N   1 
ATOM 2078 C CA  . SER A 1 297 ? -29.901 -5.192  121.571 1.00 0.00 ? 297 SER A CA  1 
ATOM 2079 C C   . SER A 1 297 ? -28.410 -5.572  121.602 1.00 0.00 ? 297 SER A C   1 
ATOM 2080 O O   . SER A 1 297 ? -28.038 -6.722  121.324 1.00 0.00 ? 297 SER A O   1 
ATOM 2081 C CB  . SER A 1 297 ? -30.369 -4.833  122.983 1.00 0.00 ? 297 SER A CB  1 
ATOM 2082 O OG  . SER A 1 297 ? -30.701 -6.006  123.703 1.00 0.00 ? 297 SER A OG  1 
ATOM 2083 N N   . GLU A 1 298 ? -27.606 -4.576  121.953 1.00 0.00 ? 298 GLU A N   1 
ATOM 2084 C CA  . GLU A 1 298 ? -26.129 -4.681  121.981 1.00 0.00 ? 298 GLU A CA  1 
ATOM 2085 C C   . GLU A 1 298 ? -25.609 -5.347  123.262 1.00 0.00 ? 298 GLU A C   1 
ATOM 2086 O O   . GLU A 1 298 ? -26.268 -5.324  124.312 1.00 0.00 ? 298 GLU A O   1 
ATOM 2087 C CB  . GLU A 1 298 ? -25.511 -3.285  121.896 1.00 0.00 ? 298 GLU A CB  1 
ATOM 2088 C CG  . GLU A 1 298 ? -25.974 -2.509  120.662 1.00 0.00 ? 298 GLU A CG  1 
ATOM 2089 C CD  . GLU A 1 298 ? -25.296 -1.147  120.521 1.00 0.00 ? 298 GLU A CD  1 
ATOM 2090 O OE1 . GLU A 1 298 ? -24.147 -1.056  119.942 1.00 0.00 ? 298 GLU A OE1 1 
ATOM 2091 O OE2 . GLU A 1 298 ? -25.874 -0.089  120.980 1.00 0.00 ? 298 GLU A OE2 1 
ATOM 2092 N N   . GLY A 1 299 ? -24.417 -5.914  123.104 1.00 0.00 ? 299 GLY A N   1 
ATOM 2093 C CA  . GLY A 1 299 ? -23.693 -6.617  124.177 1.00 0.00 ? 299 GLY A CA  1 
ATOM 2094 C C   . GLY A 1 299 ? -22.962 -7.840  123.607 1.00 0.00 ? 299 GLY A C   1 
ATOM 2095 O O   . GLY A 1 299 ? -23.556 -8.669  122.902 1.00 0.00 ? 299 GLY A O   1 
ATOM 2096 N N   . ALA A 1 300 ? -21.684 -7.916  123.934 1.00 0.00 ? 300 ALA A N   1 
ATOM 2097 C CA  . ALA A 1 300 ? -20.810 -9.016  123.494 1.00 0.00 ? 300 ALA A CA  1 
ATOM 2098 C C   . ALA A 1 300 ? -21.246 -10.324 124.155 1.00 0.00 ? 300 ALA A C   1 
ATOM 2099 O O   . ALA A 1 300 ? -20.510 -11.321 124.153 1.00 0.00 ? 300 ALA A O   1 
ATOM 2100 C CB  . ALA A 1 300 ? -19.360 -8.729  123.893 1.00 0.00 ? 300 ALA A CB  1 
ATOM 2101 N N   . THR A 1 301 ? -22.445 -10.285 124.705 1.00 0.00 ? 301 THR A N   1 
ATOM 2102 C CA  . THR A 1 301 ? -23.017 -11.437 125.409 1.00 0.00 ? 301 THR A CA  1 
ATOM 2103 C C   . THR A 1 301 ? -24.418 -11.755 124.896 1.00 0.00 ? 301 THR A C   1 
ATOM 2104 O O   . THR A 1 301 ? -25.146 -12.567 125.487 1.00 0.00 ? 301 THR A O   1 
ATOM 2105 C CB  . THR A 1 301 ? -23.086 -11.150 126.903 1.00 0.00 ? 301 THR A CB  1 
ATOM 2106 O OG1 . THR A 1 301 ? -21.800 -10.787 127.381 1.00 0.00 ? 301 THR A OG1 1 
ATOM 2107 C CG2 . THR A 1 301 ? -23.556 -12.356 127.717 1.00 0.00 ? 301 THR A CG2 1 
ATOM 2108 N N   . ASN A 1 302 ? -24.759 -11.101 123.814 1.00 0.00 ? 302 ASN A N   1 
ATOM 2109 C CA  . ASN A 1 302 ? -26.037 -11.319 123.141 1.00 0.00 ? 302 ASN A CA  1 
ATOM 2110 C C   . ASN A 1 302 ? -25.768 -12.132 121.893 1.00 0.00 ? 302 ASN A C   1 
ATOM 2111 O O   . ASN A 1 302 ? -25.423 -11.584 120.836 1.00 0.00 ? 302 ASN A O   1 
ATOM 2112 C CB  . ASN A 1 302 ? -26.683 -9.987  122.796 1.00 0.00 ? 302 ASN A CB  1 
ATOM 2113 C CG  . ASN A 1 302 ? -27.071 -9.200  124.044 1.00 0.00 ? 302 ASN A CG  1 
ATOM 2114 O OD1 . ASN A 1 302 ? -26.233 -8.498  124.605 1.00 0.00 ? 302 ASN A OD1 1 
ATOM 2115 N ND2 . ASN A 1 302 ? -28.298 -9.280  124.520 1.00 0.00 ? 302 ASN A ND2 1 
ATOM 2116 N N   . PHE A 1 303 ? -25.922 -13.417 122.078 1.00 0.00 ? 303 PHE A N   1 
ATOM 2117 C CA  . PHE A 1 303 ? -25.685 -14.393 121.029 1.00 0.00 ? 303 PHE A CA  1 
ATOM 2118 C C   . PHE A 1 303 ? -26.987 -14.778 120.357 1.00 0.00 ? 303 PHE A C   1 
ATOM 2119 O O   . PHE A 1 303 ? -28.020 -14.956 121.020 1.00 0.00 ? 303 PHE A O   1 
ATOM 2120 C CB  . PHE A 1 303 ? -25.066 -15.654 121.623 1.00 0.00 ? 303 PHE A CB  1 
ATOM 2121 C CG  . PHE A 1 303 ? -23.831 -15.363 122.470 1.00 0.00 ? 303 PHE A CG  1 
ATOM 2122 C CD1 . PHE A 1 303 ? -22.623 -15.032 121.847 1.00 0.00 ? 303 PHE A CD1 1 
ATOM 2123 C CD2 . PHE A 1 303 ? -23.909 -15.428 123.865 1.00 0.00 ? 303 PHE A CD2 1 
ATOM 2124 C CE1 . PHE A 1 303 ? -21.488 -14.769 122.622 1.00 0.00 ? 303 PHE A CE1 1 
ATOM 2125 C CE2 . PHE A 1 303 ? -22.774 -15.164 124.641 1.00 0.00 ? 303 PHE A CE2 1 
ATOM 2126 C CZ  . PHE A 1 303 ? -21.564 -14.835 124.019 1.00 0.00 ? 303 PHE A CZ  1 
ATOM 2127 N N   . GLY A 1 304 ? -26.880 -14.884 119.057 1.00 0.00 ? 304 GLY A N   1 
ATOM 2128 C CA  . GLY A 1 304 ? -27.984 -15.312 118.216 1.00 0.00 ? 304 GLY A CA  1 
ATOM 2129 C C   . GLY A 1 304 ? -28.019 -16.830 118.244 1.00 0.00 ? 304 GLY A C   1 
ATOM 2130 O O   . GLY A 1 304 ? -27.058 -17.501 117.841 1.00 0.00 ? 304 GLY A O   1 
ATOM 2131 N N   . ASP A 1 305 ? -29.117 -17.343 118.738 1.00 0.00 ? 305 ASP A N   1 
ATOM 2132 C CA  . ASP A 1 305 ? -29.302 -18.785 118.840 1.00 0.00 ? 305 ASP A CA  1 
ATOM 2133 C C   . ASP A 1 305 ? -30.079 -19.304 117.640 1.00 0.00 ? 305 ASP A C   1 
ATOM 2134 O O   . ASP A 1 305 ? -31.071 -18.696 117.212 1.00 0.00 ? 305 ASP A O   1 
ATOM 2135 C CB  . ASP A 1 305 ? -30.061 -19.145 120.108 1.00 0.00 ? 305 ASP A CB  1 
ATOM 2136 C CG  . ASP A 1 305 ? -30.180 -20.655 120.289 1.00 0.00 ? 305 ASP A CG  1 
ATOM 2137 O OD1 . ASP A 1 305 ? -31.187 -21.285 119.787 1.00 0.00 ? 305 ASP A OD1 1 
ATOM 2138 O OD2 . ASP A 1 305 ? -29.269 -21.299 120.935 1.00 0.00 ? 305 ASP A OD2 1 
ATOM 2139 N N   . ILE A 1 306 ? -29.584 -20.418 117.151 1.00 0.00 ? 306 ILE A N   1 
ATOM 2140 C CA  . ILE A 1 306 ? -30.159 -21.116 116.001 1.00 0.00 ? 306 ILE A CA  1 
ATOM 2141 C C   . ILE A 1 306 ? -31.643 -21.405 116.290 1.00 0.00 ? 306 ILE A C   1 
ATOM 2142 O O   . ILE A 1 306 ? -32.538 -20.918 115.586 1.00 0.00 ? 306 ILE A O   1 
ATOM 2143 C CB  . ILE A 1 306 ? -29.331 -22.370 115.741 1.00 0.00 ? 306 ILE A CB  1 
ATOM 2144 C CG1 . ILE A 1 306 ? -27.825 -22.069 115.711 1.00 0.00 ? 306 ILE A CG1 1 
ATOM 2145 C CG2 . ILE A 1 306 ? -29.656 -23.036 114.406 1.00 0.00 ? 306 ILE A CG2 1 
ATOM 2146 C CD1 . ILE A 1 306 ? -26.986 -23.233 115.184 1.00 0.00 ? 306 ILE A CD1 1 
ATOM 2147 N N   . GLY A 1 307 ? -31.887 -22.200 117.326 1.00 0.00 ? 307 GLY A N   1 
ATOM 2148 C CA  . GLY A 1 307 ? -33.265 -22.488 117.790 1.00 0.00 ? 307 GLY A CA  1 
ATOM 2149 C C   . GLY A 1 307 ? -33.750 -23.900 117.422 1.00 0.00 ? 307 GLY A C   1 
ATOM 2150 O O   . GLY A 1 307 ? -34.962 -24.171 117.380 1.00 0.00 ? 307 GLY A O   1 
ATOM 2151 N N   . VAL A 1 308 ? -32.812 -24.782 117.163 1.00 0.00 ? 308 VAL A N   1 
ATOM 2152 C CA  . VAL A 1 308 ? -33.134 -26.177 116.834 1.00 0.00 ? 308 VAL A CA  1 
ATOM 2153 C C   . VAL A 1 308 ? -32.158 -27.110 117.518 1.00 0.00 ? 308 VAL A C   1 
ATOM 2154 O O   . VAL A 1 308 ? -31.055 -26.699 117.910 1.00 0.00 ? 308 VAL A O   1 
ATOM 2155 C CB  . VAL A 1 308 ? -33.072 -26.425 115.329 1.00 0.00 ? 308 VAL A CB  1 
ATOM 2156 C CG1 . VAL A 1 308 ? -33.456 -27.860 114.947 1.00 0.00 ? 308 VAL A CG1 1 
ATOM 2157 C CG2 . VAL A 1 308 ? -34.017 -25.522 114.539 1.00 0.00 ? 308 VAL A CG2 1 
ATOM 2158 N N   . GLN A 1 309 ? -32.621 -28.324 117.617 1.00 0.00 ? 309 GLN A N   1 
ATOM 2159 C CA  . GLN A 1 309 ? -31.897 -29.396 118.270 1.00 0.00 ? 309 GLN A CA  1 
ATOM 2160 C C   . GLN A 1 309 ? -30.852 -30.000 117.363 1.00 0.00 ? 309 GLN A C   1 
ATOM 2161 O O   . GLN A 1 309 ? -31.021 -30.044 116.136 1.00 0.00 ? 309 GLN A O   1 
ATOM 2162 C CB  . GLN A 1 309 ? -32.849 -30.498 118.646 1.00 0.00 ? 309 GLN A CB  1 
ATOM 2163 C CG  . GLN A 1 309 ? -32.930 -30.696 120.142 1.00 0.00 ? 309 GLN A CG  1 
ATOM 2164 C CD  . GLN A 1 309 ? -34.086 -31.593 120.517 1.00 0.00 ? 309 GLN A CD  1 
ATOM 2165 O OE1 . GLN A 1 309 ? -35.109 -31.101 120.978 1.00 0.00 ? 309 GLN A OE1 1 
ATOM 2166 N NE2 . GLN A 1 309 ? -33.984 -32.892 120.330 1.00 0.00 ? 309 GLN A NE2 1 
ATOM 2167 N N   . GLN A 1 310 ? -29.826 -30.457 118.033 1.00 0.00 ? 310 GLN A N   1 
ATOM 2168 C CA  . GLN A 1 310 ? -28.671 -31.071 117.400 1.00 0.00 ? 310 GLN A CA  1 
ATOM 2169 C C   . GLN A 1 310 ? -29.067 -32.410 116.740 1.00 0.00 ? 310 GLN A C   1 
ATOM 2170 O O   . GLN A 1 310 ? -28.563 -32.767 115.670 1.00 0.00 ? 310 GLN A O   1 
ATOM 2171 C CB  . GLN A 1 310 ? -27.566 -31.256 118.446 1.00 0.00 ? 310 GLN A CB  1 
ATOM 2172 C CG  . GLN A 1 310 ? -27.116 -29.923 119.069 1.00 0.00 ? 310 GLN A CG  1 
ATOM 2173 C CD  . GLN A 1 310 ? -25.630 -29.891 119.449 1.00 0.00 ? 310 GLN A CD  1 
ATOM 2174 O OE1 . GLN A 1 310 ? -24.800 -29.426 118.668 1.00 0.00 ? 310 GLN A OE1 1 
ATOM 2175 N NE2 . GLN A 1 310 ? -25.238 -30.359 120.621 1.00 0.00 ? 310 GLN A NE2 1 
ATOM 2176 N N   . ASP A 1 311 ? -29.981 -33.153 117.365 1.00 0.00 ? 311 ASP A N   1 
ATOM 2177 C CA  . ASP A 1 311 ? -30.414 -34.466 116.815 1.00 0.00 ? 311 ASP A CA  1 
ATOM 2178 C C   . ASP A 1 311 ? -31.757 -34.353 116.073 1.00 0.00 ? 311 ASP A C   1 
ATOM 2179 O O   . ASP A 1 311 ? -32.590 -35.274 116.106 1.00 0.00 ? 311 ASP A O   1 
ATOM 2180 C CB  . ASP A 1 311 ? -30.550 -35.520 117.926 1.00 0.00 ? 311 ASP A CB  1 
ATOM 2181 C CG  . ASP A 1 311 ? -31.552 -35.147 119.021 1.00 0.00 ? 311 ASP A CG  1 
ATOM 2182 O OD1 . ASP A 1 311 ? -32.800 -35.444 118.888 1.00 0.00 ? 311 ASP A OD1 1 
ATOM 2183 O OD2 . ASP A 1 311 ? -31.143 -34.540 120.083 1.00 0.00 ? 311 ASP A OD2 1 
ATOM 2184 N N   . LYS A 1 312 ? -31.928 -33.222 115.405 1.00 0.00 ? 312 LYS A N   1 
ATOM 2185 C CA  . LYS A 1 312 ? -33.143 -32.939 114.619 1.00 0.00 ? 312 LYS A CA  1 
ATOM 2186 C C   . LYS A 1 312 ? -32.877 -31.806 113.616 1.00 0.00 ? 312 LYS A C   1 
ATOM 2187 O O   . LYS A 1 312 ? -33.812 -31.181 113.093 1.00 0.00 ? 312 LYS A O   1 
ATOM 2188 C CB  . LYS A 1 312 ? -34.293 -32.554 115.552 1.00 0.00 ? 312 LYS A CB  1 
ATOM 2189 C CG  . LYS A 1 312 ? -34.819 -33.746 116.359 1.00 0.00 ? 312 LYS A CG  1 
ATOM 2190 C CD  . LYS A 1 312 ? -36.167 -33.479 117.032 1.00 0.00 ? 312 LYS A CD  1 
ATOM 2191 C CE  . LYS A 1 312 ? -36.659 -34.663 117.869 1.00 0.00 ? 312 LYS A CE  1 
ATOM 2192 N NZ  . LYS A 1 312 ? -37.915 -34.385 118.580 1.00 0.00 ? 312 LYS A NZ  1 
ATOM 2193 N N   . ARG A 1 313 ? -31.595 -31.581 113.381 1.00 0.00 ? 313 ARG A N   1 
ATOM 2194 C CA  . ARG A 1 313 ? -31.117 -30.564 112.427 1.00 0.00 ? 313 ARG A CA  1 
ATOM 2195 C C   . ARG A 1 313 ? -30.937 -31.202 111.044 1.00 0.00 ? 313 ARG A C   1 
ATOM 2196 O O   . ARG A 1 313 ? -30.500 -32.356 110.928 1.00 0.00 ? 313 ARG A O   1 
ATOM 2197 C CB  . ARG A 1 313 ? -29.755 -30.012 112.870 1.00 0.00 ? 313 ARG A CB  1 
ATOM 2198 C CG  . ARG A 1 313 ? -29.787 -29.318 114.233 1.00 0.00 ? 313 ARG A CG  1 
ATOM 2199 C CD  . ARG A 1 313 ? -28.447 -28.673 114.603 1.00 0.00 ? 313 ARG A CD  1 
ATOM 2200 N NE  . ARG A 1 313 ? -28.579 -27.609 115.610 1.00 0.00 ? 313 ARG A NE  1 
ATOM 2201 C CZ  . ARG A 1 313 ? -27.540 -26.992 116.190 1.00 0.00 ? 313 ARG A CZ  1 
ATOM 2202 N NH1 . ARG A 1 313 ? -26.279 -27.317 115.875 1.00 0.00 ? 313 ARG A NH1 1 
ATOM 2203 N NH2 . ARG A 1 313 ? -27.662 -26.024 117.109 1.00 0.00 ? 313 ARG A NH2 1 
ATOM 2204 N N   . ARG A 1 314 ? -31.285 -30.433 110.025 1.00 0.00 ? 314 ARG A N   1 
ATOM 2205 C CA  . ARG A 1 314 ? -31.152 -30.863 108.616 1.00 0.00 ? 314 ARG A CA  1 
ATOM 2206 C C   . ARG A 1 314 ? -29.723 -30.610 108.131 1.00 0.00 ? 314 ARG A C   1 
ATOM 2207 O O   . ARG A 1 314 ? -29.025 -29.723 108.634 1.00 0.00 ? 314 ARG A O   1 
ATOM 2208 C CB  . ARG A 1 314 ? -32.075 -30.044 107.703 1.00 0.00 ? 314 ARG A CB  1 
ATOM 2209 C CG  . ARG A 1 314 ? -33.522 -29.959 108.188 1.00 0.00 ? 314 ARG A CG  1 
ATOM 2210 C CD  . ARG A 1 314 ? -34.437 -29.240 107.188 1.00 0.00 ? 314 ARG A CD  1 
ATOM 2211 N NE  . ARG A 1 314 ? -34.006 -27.862 106.897 1.00 0.00 ? 314 ARG A NE  1 
ATOM 2212 C CZ  . ARG A 1 314 ? -34.848 -26.826 106.769 1.00 0.00 ? 314 ARG A CZ  1 
ATOM 2213 N NH1 . ARG A 1 314 ? -36.171 -26.992 106.900 1.00 0.00 ? 314 ARG A NH1 1 
ATOM 2214 N NH2 . ARG A 1 314 ? -34.459 -25.569 106.510 1.00 0.00 ? 314 ARG A NH2 1 
ATOM 2215 N N   . GLY A 1 315 ? -29.292 -31.390 107.152 1.00 0.00 ? 315 GLY A N   1 
ATOM 2216 C CA  . GLY A 1 315 ? -27.948 -31.209 106.569 1.00 0.00 ? 315 GLY A CA  1 
ATOM 2217 C C   . GLY A 1 315 ? -27.231 -32.544 106.359 1.00 0.00 ? 315 GLY A C   1 
ATOM 2218 O O   . GLY A 1 315 ? -27.830 -33.623 106.458 1.00 0.00 ? 315 GLY A O   1 
ATOM 2219 N N   . VAL A 1 316 ? -25.940 -32.426 106.078 1.00 0.00 ? 316 VAL A N   1 
ATOM 2220 C CA  . VAL A 1 316 ? -25.096 -33.592 105.800 1.00 0.00 ? 316 VAL A CA  1 
ATOM 2221 C C   . VAL A 1 316 ? -23.936 -33.717 106.786 1.00 0.00 ? 316 VAL A C   1 
ATOM 2222 O O   . VAL A 1 316 ? -23.314 -32.715 107.177 1.00 0.00 ? 316 VAL A O   1 
ATOM 2223 C CB  . VAL A 1 316 ? -24.506 -33.504 104.396 1.00 0.00 ? 316 VAL A CB  1 
ATOM 2224 C CG1 . VAL A 1 316 ? -23.726 -34.760 104.001 1.00 0.00 ? 316 VAL A CG1 1 
ATOM 2225 C CG2 . VAL A 1 316 ? -25.574 -33.322 103.317 1.00 0.00 ? 316 VAL A CG2 1 
ATOM 2226 N N   . THR A 1 317 ? -23.720 -34.970 107.120 1.00 0.00 ? 317 THR A N   1 
ATOM 2227 C CA  . THR A 1 317 ? -22.661 -35.417 108.020 1.00 0.00 ? 317 THR A CA  1 
ATOM 2228 C C   . THR A 1 317 ? -21.941 -36.596 107.375 1.00 0.00 ? 317 THR A C   1 
ATOM 2229 O O   . THR A 1 317 ? -22.462 -37.231 106.444 1.00 0.00 ? 317 THR A O   1 
ATOM 2230 C CB  . THR A 1 317 ? -23.266 -35.874 109.349 1.00 0.00 ? 317 THR A CB  1 
ATOM 2231 O OG1 . THR A 1 317 ? -24.042 -34.830 109.915 1.00 0.00 ? 317 THR A OG1 1 
ATOM 2232 C CG2 . THR A 1 317 ? -22.208 -36.272 110.380 1.00 0.00 ? 317 THR A CG2 1 
ATOM 2233 N N   . GLN A 1 318 ? -20.760 -36.856 107.886 1.00 0.00 ? 318 GLN A N   1 
ATOM 2234 C CA  . GLN A 1 318 ? -19.923 -37.960 107.409 1.00 0.00 ? 318 GLN A CA  1 
ATOM 2235 C C   . GLN A 1 318 ? -19.971 -39.107 108.418 1.00 0.00 ? 318 GLN A C   1 
ATOM 2236 O O   . GLN A 1 318 ? -18.992 -39.847 108.589 1.00 0.00 ? 318 GLN A O   1 
ATOM 2237 C CB  . GLN A 1 318 ? -18.480 -37.492 107.238 1.00 0.00 ? 318 GLN A CB  1 
ATOM 2238 C CG  . GLN A 1 318 ? -17.572 -38.575 106.653 1.00 0.00 ? 318 GLN A CG  1 
ATOM 2239 C CD  . GLN A 1 318 ? -16.486 -38.014 105.733 1.00 0.00 ? 318 GLN A CD  1 
ATOM 2240 O OE1 . GLN A 1 318 ? -15.432 -37.597 106.211 1.00 0.00 ? 318 GLN A OE1 1 
ATOM 2241 N NE2 . GLN A 1 318 ? -16.679 -37.980 104.428 1.00 0.00 ? 318 GLN A NE2 1 
ATOM 2242 N N   . MET A 1 319 ? -21.123 -39.204 109.054 1.00 0.00 ? 319 MET A N   1 
ATOM 2243 C CA  . MET A 1 319 ? -21.403 -40.237 110.061 1.00 0.00 ? 319 MET A CA  1 
ATOM 2244 C C   . MET A 1 319 ? -22.722 -40.933 109.721 1.00 0.00 ? 319 MET A C   1 
ATOM 2245 O O   . MET A 1 319 ? -23.656 -40.311 109.194 1.00 0.00 ? 319 MET A O   1 
ATOM 2246 C CB  . MET A 1 319 ? -21.503 -39.598 111.449 1.00 0.00 ? 319 MET A CB  1 
ATOM 2247 C CG  . MET A 1 319 ? -20.201 -38.926 111.892 1.00 0.00 ? 319 MET A CG  1 
ATOM 2248 S SD  . MET A 1 319 ? -20.422 -37.812 113.262 1.00 0.00 ? 319 MET A SD  1 
ATOM 2249 C CE  . MET A 1 319 ? -18.887 -36.987 113.631 1.00 0.00 ? 319 MET A CE  1 
ATOM 2250 N N   . GLY A 1 320 ? -22.761 -42.215 110.033 1.00 0.00 ? 320 GLY A N   1 
ATOM 2251 C CA  . GLY A 1 320 ? -23.937 -43.059 109.772 1.00 0.00 ? 320 GLY A CA  1 
ATOM 2252 C C   . GLY A 1 320 ? -24.524 -43.580 111.085 1.00 0.00 ? 320 GLY A C   1 
ATOM 2253 O O   . GLY A 1 320 ? -25.495 -44.351 111.088 1.00 0.00 ? 320 GLY A O   1 
ATOM 2254 N N   . ASN A 1 321 ? -23.913 -43.134 112.165 1.00 0.00 ? 321 ASN A N   1 
ATOM 2255 C CA  . ASN A 1 321 ? -24.311 -43.526 113.526 1.00 0.00 ? 321 ASN A CA  1 
ATOM 2256 C C   . ASN A 1 321 ? -25.282 -42.519 114.138 1.00 0.00 ? 321 ASN A C   1 
ATOM 2257 O O   . ASN A 1 321 ? -26.411 -42.869 114.514 1.00 0.00 ? 321 ASN A O   1 
ATOM 2258 C CB  . ASN A 1 321 ? -23.098 -43.546 114.464 1.00 0.00 ? 321 ASN A CB  1 
ATOM 2259 C CG  . ASN A 1 321 ? -22.003 -44.522 114.041 1.00 0.00 ? 321 ASN A CG  1 
ATOM 2260 O OD1 . ASN A 1 321 ? -21.915 -45.619 114.590 1.00 0.00 ? 321 ASN A OD1 1 
ATOM 2261 N ND2 . ASN A 1 321 ? -21.149 -44.184 113.093 1.00 0.00 ? 321 ASN A ND2 1 
ATOM 2262 N N   . THR A 1 322 ? -24.782 -41.306 114.207 1.00 0.00 ? 322 THR A N   1 
ATOM 2263 C CA  . THR A 1 322 ? -25.464 -40.175 114.843 1.00 0.00 ? 322 THR A CA  1 
ATOM 2264 C C   . THR A 1 322 ? -26.570 -39.569 113.989 1.00 0.00 ? 322 THR A C   1 
ATOM 2265 O O   . THR A 1 322 ? -26.838 -40.026 112.867 1.00 0.00 ? 322 THR A O   1 
ATOM 2266 C CB  . THR A 1 322 ? -24.471 -39.042 115.094 1.00 0.00 ? 322 THR A CB  1 
ATOM 2267 O OG1 . THR A 1 322 ? -23.721 -38.788 113.913 1.00 0.00 ? 322 THR A OG1 1 
ATOM 2268 C CG2 . THR A 1 322 ? -23.477 -39.356 116.210 1.00 0.00 ? 322 THR A CG2 1 
ATOM 2269 N N   . ASP A 1 323 ? -27.134 -38.559 114.615 1.00 0.00 ? 323 ASP A N   1 
ATOM 2270 C CA  . ASP A 1 323 ? -28.192 -37.714 114.071 1.00 0.00 ? 323 ASP A CA  1 
ATOM 2271 C C   . ASP A 1 323 ? -27.882 -36.280 114.492 1.00 0.00 ? 323 ASP A C   1 
ATOM 2272 O O   . ASP A 1 323 ? -28.649 -35.350 114.205 1.00 0.00 ? 323 ASP A O   1 
ATOM 2273 C CB  . ASP A 1 323 ? -29.548 -38.160 114.616 1.00 0.00 ? 323 ASP A CB  1 
ATOM 2274 C CG  . ASP A 1 323 ? -29.960 -39.544 114.112 1.00 0.00 ? 323 ASP A CG  1 
ATOM 2275 O OD1 . ASP A 1 323 ? -30.345 -39.697 112.890 1.00 0.00 ? 323 ASP A OD1 1 
ATOM 2276 O OD2 . ASP A 1 323 ? -29.920 -40.557 114.907 1.00 0.00 ? 323 ASP A OD2 1 
ATOM 2277 N N   . TYR A 1 324 ? -26.744 -36.186 115.168 1.00 0.00 ? 324 TYR A N   1 
ATOM 2278 C CA  . TYR A 1 324 ? -26.194 -34.922 115.674 1.00 0.00 ? 324 TYR A CA  1 
ATOM 2279 C C   . TYR A 1 324 ? -25.393 -34.217 114.580 1.00 0.00 ? 324 TYR A C   1 
ATOM 2280 O O   . TYR A 1 324 ? -24.360 -34.726 114.118 1.00 0.00 ? 324 TYR A O   1 
ATOM 2281 C CB  . TYR A 1 324 ? -25.210 -35.173 116.828 1.00 0.00 ? 324 TYR A CB  1 
ATOM 2282 C CG  . TYR A 1 324 ? -25.867 -35.619 118.138 1.00 0.00 ? 324 TYR A CG  1 
ATOM 2283 C CD1 . TYR A 1 324 ? -26.537 -34.689 118.945 1.00 0.00 ? 324 TYR A CD1 1 
ATOM 2284 C CD2 . TYR A 1 324 ? -25.786 -36.959 118.535 1.00 0.00 ? 324 TYR A CD2 1 
ATOM 2285 C CE1 . TYR A 1 324 ? -27.129 -35.102 120.147 1.00 0.00 ? 324 TYR A CE1 1 
ATOM 2286 C CE2 . TYR A 1 324 ? -26.378 -37.372 119.735 1.00 0.00 ? 324 TYR A CE2 1 
ATOM 2287 C CZ  . TYR A 1 324 ? -27.049 -36.444 120.541 1.00 0.00 ? 324 TYR A CZ  1 
ATOM 2288 O OH  . TYR A 1 324 ? -27.624 -36.847 121.706 1.00 0.00 ? 324 TYR A OH  1 
ATOM 2289 N N   . ILE A 1 325 ? -25.898 -33.065 114.195 1.00 0.00 ? 325 ILE A N   1 
ATOM 2290 C CA  . ILE A 1 325 ? -25.243 -32.202 113.204 1.00 0.00 ? 325 ILE A CA  1 
ATOM 2291 C C   . ILE A 1 325 ? -24.707 -30.966 113.931 1.00 0.00 ? 325 ILE A C   1 
ATOM 2292 O O   . ILE A 1 325 ? -25.477 -30.094 114.354 1.00 0.00 ? 325 ILE A O   1 
ATOM 2293 C CB  . ILE A 1 325 ? -26.241 -31.779 112.122 1.00 0.00 ? 325 ILE A CB  1 
ATOM 2294 C CG1 . ILE A 1 325 ? -26.986 -32.958 111.492 1.00 0.00 ? 325 ILE A CG1 1 
ATOM 2295 C CG2 . ILE A 1 325 ? -25.577 -31.042 110.956 1.00 0.00 ? 325 ILE A CG2 1 
ATOM 2296 C CD1 . ILE A 1 325 ? -28.102 -32.519 110.542 1.00 0.00 ? 325 ILE A CD1 1 
ATOM 2297 N N   . THR A 1 326 ? -23.391 -30.938 114.060 1.00 0.00 ? 326 THR A N   1 
ATOM 2298 C CA  . THR A 1 326 ? -22.668 -29.858 114.765 1.00 0.00 ? 326 THR A CA  1 
ATOM 2299 C C   . THR A 1 326 ? -21.645 -29.196 113.817 1.00 0.00 ? 326 THR A C   1 
ATOM 2300 O O   . THR A 1 326 ? -21.401 -29.673 112.702 1.00 0.00 ? 326 THR A O   1 
ATOM 2301 C CB  . THR A 1 326 ? -21.939 -30.462 115.970 1.00 0.00 ? 326 THR A CB  1 
ATOM 2302 O OG1 . THR A 1 326 ? -22.862 -31.151 116.806 1.00 0.00 ? 326 THR A OG1 1 
ATOM 2303 C CG2 . THR A 1 326 ? -21.233 -29.419 116.832 1.00 0.00 ? 326 THR A CG2 1 
ATOM 2304 N N   . GLU A 1 327 ? -21.053 -28.090 114.271 1.00 0.00 ? 327 GLU A N   1 
ATOM 2305 C CA  . GLU A 1 327 ? -20.038 -27.354 113.472 1.00 0.00 ? 327 GLU A CA  1 
ATOM 2306 C C   . GLU A 1 327 ? -18.748 -28.179 113.381 1.00 0.00 ? 327 GLU A C   1 
ATOM 2307 O O   . GLU A 1 327 ? -17.868 -27.911 112.548 1.00 0.00 ? 327 GLU A O   1 
ATOM 2308 C CB  . GLU A 1 327 ? -19.695 -26.003 114.115 1.00 0.00 ? 327 GLU A CB  1 
ATOM 2309 C CG  . GLU A 1 327 ? -20.806 -24.956 113.967 1.00 0.00 ? 327 GLU A CG  1 
ATOM 2310 C CD  . GLU A 1 327 ? -21.072 -24.540 112.515 1.00 0.00 ? 327 GLU A CD  1 
ATOM 2311 O OE1 . GLU A 1 327 ? -21.894 -25.221 111.791 1.00 0.00 ? 327 GLU A OE1 1 
ATOM 2312 O OE2 . GLU A 1 327 ? -20.481 -23.506 112.016 1.00 0.00 ? 327 GLU A OE2 1 
ATOM 2313 N N   . ALA A 1 328 ? -18.685 -29.166 114.252 1.00 0.00 ? 328 ALA A N   1 
ATOM 2314 C CA  . ALA A 1 328 ? -17.540 -30.078 114.345 1.00 0.00 ? 328 ALA A CA  1 
ATOM 2315 C C   . ALA A 1 328 ? -17.851 -31.398 113.638 1.00 0.00 ? 328 ALA A C   1 
ATOM 2316 O O   . ALA A 1 328 ? -16.944 -32.117 113.196 1.00 0.00 ? 328 ALA A O   1 
ATOM 2317 C CB  . ALA A 1 328 ? -17.230 -30.381 115.815 1.00 0.00 ? 328 ALA A CB  1 
ATOM 2318 N N   . THR A 1 329 ? -19.136 -31.673 113.543 1.00 0.00 ? 329 THR A N   1 
ATOM 2319 C CA  . THR A 1 329 ? -19.636 -32.917 112.948 1.00 0.00 ? 329 THR A CA  1 
ATOM 2320 C C   . THR A 1 329 ? -19.824 -32.799 111.434 1.00 0.00 ? 329 THR A C   1 
ATOM 2321 O O   . THR A 1 329 ? -19.354 -33.650 110.664 1.00 0.00 ? 329 THR A O   1 
ATOM 2322 C CB  . THR A 1 329 ? -20.999 -33.277 113.543 1.00 0.00 ? 329 THR A CB  1 
ATOM 2323 O OG1 . THR A 1 329 ? -20.859 -33.600 114.917 1.00 0.00 ? 329 THR A OG1 1 
ATOM 2324 C CG2 . THR A 1 329 ? -21.653 -34.477 112.854 1.00 0.00 ? 329 THR A CG2 1 
ATOM 2325 N N   . ILE A 1 330 ? -20.508 -31.745 111.044 1.00 0.00 ? 330 ILE A N   1 
ATOM 2326 C CA  . ILE A 1 330 ? -20.871 -31.526 109.640 1.00 0.00 ? 330 ILE A CA  1 
ATOM 2327 C C   . ILE A 1 330 ? -19.713 -31.806 108.702 1.00 0.00 ? 330 ILE A C   1 
ATOM 2328 O O   . ILE A 1 330 ? -18.542 -31.543 109.028 1.00 0.00 ? 330 ILE A O   1 
ATOM 2329 C CB  . ILE A 1 330 ? -21.354 -30.106 109.395 1.00 0.00 ? 330 ILE A CB  1 
ATOM 2330 C CG1 . ILE A 1 330 ? -22.728 -29.853 110.012 1.00 0.00 ? 330 ILE A CG1 1 
ATOM 2331 C CG2 . ILE A 1 330 ? -21.496 -29.782 107.902 1.00 0.00 ? 330 ILE A CG2 1 
ATOM 2332 C CD1 . ILE A 1 330 ? -23.492 -28.721 109.330 1.00 0.00 ? 330 ILE A CD1 1 
ATOM 2333 N N   . MET A 1 331 ? -20.139 -32.327 107.582 1.00 0.00 ? 331 MET A N   1 
ATOM 2334 C CA  . MET A 1 331 ? -19.277 -32.712 106.488 1.00 0.00 ? 331 MET A CA  1 
ATOM 2335 C C   . MET A 1 331 ? -18.834 -31.481 105.722 1.00 0.00 ? 331 MET A C   1 
ATOM 2336 O O   . MET A 1 331 ? -19.662 -30.709 105.216 1.00 0.00 ? 331 MET A O   1 
ATOM 2337 C CB  . MET A 1 331 ? -20.041 -33.636 105.546 1.00 0.00 ? 331 MET A CB  1 
ATOM 2338 C CG  . MET A 1 331 ? -19.284 -33.934 104.256 1.00 0.00 ? 331 MET A CG  1 
ATOM 2339 S SD  . MET A 1 331 ? -20.271 -34.813 103.067 1.00 0.00 ? 331 MET A SD  1 
ATOM 2340 C CE  . MET A 1 331 ? -20.094 -34.068 101.462 1.00 0.00 ? 331 MET A CE  1 
ATOM 2341 N N   . ARG A 1 332 ? -17.537 -31.350 105.683 1.00 0.00 ? 332 ARG A N   1 
ATOM 2342 C CA  . ARG A 1 332 ? -16.878 -30.280 104.957 1.00 0.00 ? 332 ARG A CA  1 
ATOM 2343 C C   . ARG A 1 332 ? -16.285 -30.882 103.693 1.00 0.00 ? 332 ARG A C   1 
ATOM 2344 O O   . ARG A 1 332 ? -15.958 -32.078 103.652 1.00 0.00 ? 332 ARG A O   1 
ATOM 2345 C CB  . ARG A 1 332 ? -15.806 -29.646 105.832 1.00 0.00 ? 332 ARG A CB  1 
ATOM 2346 C CG  . ARG A 1 332 ? -16.287 -29.389 107.262 1.00 0.00 ? 332 ARG A CG  1 
ATOM 2347 C CD  . ARG A 1 332 ? -17.460 -28.407 107.340 1.00 0.00 ? 332 ARG A CD  1 
ATOM 2348 N NE  . ARG A 1 332 ? -17.423 -27.572 108.549 1.00 0.00 ? 332 ARG A NE  1 
ATOM 2349 C CZ  . ARG A 1 332 ? -18.418 -26.764 108.940 1.00 0.00 ? 332 ARG A CZ  1 
ATOM 2350 N NH1 . ARG A 1 332 ? -19.548 -26.666 108.227 1.00 0.00 ? 332 ARG A NH1 1 
ATOM 2351 N NH2 . ARG A 1 332 ? -18.376 -26.004 110.043 1.00 0.00 ? 332 ARG A NH2 1 
ATOM 2352 N N   . PRO A 1 333 ? -16.116 -30.098 102.638 1.00 0.00 ? 333 PRO A N   1 
ATOM 2353 C CA  . PRO A 1 333 ? -15.630 -30.621 101.375 1.00 0.00 ? 333 PRO A CA  1 
ATOM 2354 C C   . PRO A 1 333 ? -14.302 -31.358 101.513 1.00 0.00 ? 333 PRO A C   1 
ATOM 2355 O O   . PRO A 1 333 ? -14.084 -32.381 100.789 1.00 0.00 ? 333 PRO A O   1 
ATOM 2356 C CB  . PRO A 1 333 ? -15.565 -29.402 100.488 1.00 0.00 ? 333 PRO A CB  1 
ATOM 2357 C CG  . PRO A 1 333 ? -16.057 -28.208 101.296 1.00 0.00 ? 333 PRO A CG  1 
ATOM 2358 C CD  . PRO A 1 333 ? -16.410 -28.668 102.672 1.00 0.00 ? 333 PRO A CD  1 
ATOM 2359 N N   . ALA A 1 334 ? -13.423 -30.884 102.397 1.00 0.00 ? 334 ALA A N   1 
ATOM 2360 C CA  . ALA A 1 334 ? -12.091 -31.526 102.599 1.00 0.00 ? 334 ALA A CA  1 
ATOM 2361 C C   . ALA A 1 334 ? -11.486 -31.157 103.967 1.00 0.00 ? 334 ALA A C   1 
ATOM 2362 O O   . ALA A 1 334 ? -12.203 -30.809 104.913 1.00 0.00 ? 334 ALA A O   1 
ATOM 2363 C CB  . ALA A 1 334 ? -11.117 -31.082 101.503 1.00 0.00 ? 334 ALA A CB  1 
ATOM 2364 N N   . GLU A 1 335 ? -10.163 -31.249 104.034 1.00 0.00 ? 335 GLU A N   1 
ATOM 2365 C CA  . GLU A 1 335 ? -9.398  -30.943 105.262 1.00 0.00 ? 335 GLU A CA  1 
ATOM 2366 C C   . GLU A 1 335 ? -8.228  -30.014 104.935 1.00 0.00 ? 335 GLU A C   1 
ATOM 2367 O O   . GLU A 1 335 ? -7.455  -30.261 103.999 1.00 0.00 ? 335 GLU A O   1 
ATOM 2368 C CB  . GLU A 1 335 ? -8.846  -32.236 105.875 1.00 0.00 ? 335 GLU A CB  1 
ATOM 2369 C CG  . GLU A 1 335 ? -8.379  -32.065 107.324 1.00 0.00 ? 335 GLU A CG  1 
ATOM 2370 C CD  . GLU A 1 335 ? -8.107  -33.398 108.027 1.00 0.00 ? 335 GLU A CD  1 
ATOM 2371 O OE1 . GLU A 1 335 ? -9.058  -34.003 108.655 1.00 0.00 ? 335 GLU A OE1 1 
ATOM 2372 O OE2 . GLU A 1 335 ? -6.926  -33.918 107.993 1.00 0.00 ? 335 GLU A OE2 1 
ATOM 2373 N N   . VAL A 1 336 ? -8.128  -28.962 105.723 1.00 0.00 ? 336 VAL A N   1 
ATOM 2374 C CA  . VAL A 1 336 ? -7.071  -27.959 105.557 1.00 0.00 ? 336 VAL A CA  1 
ATOM 2375 C C   . VAL A 1 336 ? -5.877  -28.324 106.427 1.00 0.00 ? 336 VAL A C   1 
ATOM 2376 O O   . VAL A 1 336 ? -6.008  -28.514 107.649 1.00 0.00 ? 336 VAL A O   1 
ATOM 2377 C CB  . VAL A 1 336 ? -7.596  -26.575 105.923 1.00 0.00 ? 336 VAL A CB  1 
ATOM 2378 C CG1 . VAL A 1 336 ? -6.538  -25.480 105.777 1.00 0.00 ? 336 VAL A CG1 1 
ATOM 2379 C CG2 . VAL A 1 336 ? -8.767  -26.140 105.039 1.00 0.00 ? 336 VAL A CG2 1 
ATOM 2380 N N   . GLY A 1 337 ? -4.756  -28.404 105.745 1.00 0.00 ? 337 GLY A N   1 
ATOM 2381 C CA  . GLY A 1 337 ? -3.491  -28.787 106.351 1.00 0.00 ? 337 GLY A CA  1 
ATOM 2382 C C   . GLY A 1 337 ? -3.617  -30.220 106.828 1.00 0.00 ? 337 GLY A C   1 
ATOM 2383 O O   . GLY A 1 337 ? -4.623  -30.897 106.569 1.00 0.00 ? 337 GLY A O   1 
ATOM 2384 N N   . TYR A 1 338 ? -2.600  -30.653 107.511 1.00 0.00 ? 338 TYR A N   1 
ATOM 2385 C CA  . TYR A 1 338 ? -2.576  -31.996 108.055 1.00 0.00 ? 338 TYR A CA  1 
ATOM 2386 C C   . TYR A 1 338 ? -2.056  -31.945 109.482 1.00 0.00 ? 338 TYR A C   1 
ATOM 2387 O O   . TYR A 1 338 ? -1.758  -30.863 110.012 1.00 0.00 ? 338 TYR A O   1 
ATOM 2388 C CB  . TYR A 1 338 ? -1.710  -32.902 107.171 1.00 0.00 ? 338 TYR A CB  1 
ATOM 2389 C CG  . TYR A 1 338 ? -0.235  -32.492 107.099 1.00 0.00 ? 338 TYR A CG  1 
ATOM 2390 C CD1 . TYR A 1 338 ? 0.669   -32.975 108.050 1.00 0.00 ? 338 TYR A CD1 1 
ATOM 2391 C CD2 . TYR A 1 338 ? 0.215   -31.644 106.076 1.00 0.00 ? 338 TYR A CD2 1 
ATOM 2392 C CE1 . TYR A 1 338 ? 2.020   -32.619 107.979 1.00 0.00 ? 338 TYR A CE1 1 
ATOM 2393 C CE2 . TYR A 1 338 ? 1.568   -31.290 106.003 1.00 0.00 ? 338 TYR A CE2 1 
ATOM 2394 C CZ  . TYR A 1 338 ? 2.470   -31.779 106.955 1.00 0.00 ? 338 TYR A CZ  1 
ATOM 2395 O OH  . TYR A 1 338 ? 3.786   -31.441 106.883 1.00 0.00 ? 338 TYR A OH  1 
ATOM 2396 N N   . SER A 1 339 ? -1.989  -33.123 110.044 1.00 0.00 ? 339 SER A N   1 
ATOM 2397 C CA  . SER A 1 339 ? -1.506  -33.340 111.407 1.00 0.00 ? 339 SER A CA  1 
ATOM 2398 C C   . SER A 1 339 ? -0.510  -34.494 111.377 1.00 0.00 ? 339 SER A C   1 
ATOM 2399 O O   . SER A 1 339 ? -0.877  -35.642 111.085 1.00 0.00 ? 339 SER A O   1 
ATOM 2400 C CB  . SER A 1 339 ? -2.688  -33.669 112.320 1.00 0.00 ? 339 SER A CB  1 
ATOM 2401 O OG  . SER A 1 339 ? -3.664  -32.638 112.243 1.00 0.00 ? 339 SER A OG  1 
ATOM 2402 N N   . ALA A 1 340 ? 0.733   -34.152 111.677 1.00 0.00 ? 340 ALA A N   1 
ATOM 2403 C CA  . ALA A 1 340 ? 1.845   -35.116 111.636 1.00 0.00 ? 340 ALA A CA  1 
ATOM 2404 C C   . ALA A 1 340 ? 2.583   -35.212 112.977 1.00 0.00 ? 340 ALA A C   1 
ATOM 2405 O O   . ALA A 1 340 ? 2.367   -34.394 113.885 1.00 0.00 ? 340 ALA A O   1 
ATOM 2406 C CB  . ALA A 1 340 ? 2.859   -34.697 110.574 1.00 0.00 ? 340 ALA A CB  1 
ATOM 2407 N N   . PRO A 1 341 ? 3.467   -36.218 113.114 1.00 0.00 ? 341 PRO A N   1 
ATOM 2408 C CA  . PRO A 1 341 ? 4.224   -36.452 114.347 1.00 0.00 ? 341 PRO A CA  1 
ATOM 2409 C C   . PRO A 1 341 ? 5.131   -35.292 114.712 1.00 0.00 ? 341 PRO A C   1 
ATOM 2410 O O   . PRO A 1 341 ? 5.751   -34.671 113.782 1.00 0.00 ? 341 PRO A O   1 
ATOM 2411 C CB  . PRO A 1 341 ? 5.046   -37.687 114.034 1.00 0.00 ? 341 PRO A CB  1 
ATOM 2412 C CG  . PRO A 1 341 ? 4.725   -38.120 112.607 1.00 0.00 ? 341 PRO A CG  1 
ATOM 2413 C CD  . PRO A 1 341 ? 3.733   -37.166 112.025 1.00 0.00 ? 341 PRO A CD  1 
ATOM 2414 N N   . TYR A 1 342 ? 5.200   -35.019 116.039 1.00 0.00 ? 342 TYR A N   1 
ATOM 2415 C CA  . TYR A 1 342 ? 6.093   -33.967 116.551 1.00 0.00 ? 342 TYR A CA  1 
ATOM 2416 C C   . TYR A 1 342 ? 6.952   -34.406 117.736 1.00 0.00 ? 342 TYR A C   1 
ATOM 2417 O O   . TYR A 1 342 ? 6.359   -34.708 118.843 1.00 0.00 ? 342 TYR A O   1 
ATOM 2418 C CB  . TYR A 1 342 ? 5.432   -32.633 116.794 1.00 0.00 ? 342 TYR A CB  1 
ATOM 2419 C CG  . TYR A 1 342 ? 4.337   -32.646 117.796 1.00 0.00 ? 342 TYR A CG  1 
ATOM 2420 C CD1 . TYR A 1 342 ? 3.359   -33.620 117.706 1.00 0.00 ? 342 TYR A CD1 1 
ATOM 2421 C CD2 . TYR A 1 342 ? 4.323   -31.671 118.788 1.00 0.00 ? 342 TYR A CD2 1 
ATOM 2422 C CE1 . TYR A 1 342 ? 2.323   -33.625 118.625 1.00 0.00 ? 342 TYR A CE1 1 
ATOM 2423 C CE2 . TYR A 1 342 ? 3.281   -31.672 119.712 1.00 0.00 ? 342 TYR A CE2 1 
ATOM 2424 C CZ  . TYR A 1 342 ? 2.280   -32.650 119.629 1.00 0.00 ? 342 TYR A CZ  1 
ATOM 2425 O OH  . TYR A 1 342 ? 1.264   -32.653 120.527 1.00 0.00 ? 342 TYR A OH  1 
ATOM 2426 N N   . TYR A 1 343 ? 8.035   -34.250 117.042 1.00 0.00 ? 343 TYR A N   1 
ATOM 2427 C CA  . TYR A 1 343 ? 9.468   -34.417 117.089 1.00 0.00 ? 343 TYR A CA  1 
ATOM 2428 C C   . TYR A 1 343 ? 9.781   -35.833 116.674 1.00 0.00 ? 343 TYR A C   1 
ATOM 2429 O O   . TYR A 1 343 ? 10.494  -36.551 117.372 1.00 0.00 ? 343 TYR A O   1 
ATOM 2430 C CB  . TYR A 1 343 ? 10.115  -33.890 118.313 1.00 0.00 ? 343 TYR A CB  1 
ATOM 2431 C CG  . TYR A 1 343 ? 10.141  -32.353 118.305 1.00 0.00 ? 343 TYR A CG  1 
ATOM 2432 C CD1 . TYR A 1 343 ? 9.839   -31.604 117.134 1.00 0.00 ? 343 TYR A CD1 1 
ATOM 2433 C CD2 . TYR A 1 343 ? 10.451  -31.696 119.480 1.00 0.00 ? 343 TYR A CD2 1 
ATOM 2434 C CE1 . TYR A 1 343 ? 9.782   -30.192 117.203 1.00 0.00 ? 343 TYR A CE1 1 
ATOM 2435 C CE2 . TYR A 1 343 ? 10.371  -30.301 119.557 1.00 0.00 ? 343 TYR A CE2 1 
ATOM 2436 C CZ  . TYR A 1 343 ? 10.028  -29.548 118.426 1.00 0.00 ? 343 TYR A CZ  1 
ATOM 2437 O OH  . TYR A 1 343 ? 9.921   -28.195 118.529 1.00 0.00 ? 343 TYR A OH  1 
ATOM 2438 N N   . SER A 1 344 ? 9.215   -36.146 115.514 1.00 0.00 ? 344 SER A N   1 
ATOM 2439 C CA  . SER A 1 344 ? 9.405   -37.437 114.853 1.00 0.00 ? 344 SER A CA  1 
ATOM 2440 C C   . SER A 1 344 ? 10.795  -37.462 114.209 1.00 0.00 ? 344 SER A C   1 
ATOM 2441 O O   . SER A 1 344 ? 10.933  -37.350 112.980 1.00 0.00 ? 344 SER A O   1 
ATOM 2442 C CB  . SER A 1 344 ? 8.339   -37.646 113.772 1.00 0.00 ? 344 SER A CB  1 
ATOM 2443 O OG  . SER A 1 344 ? 7.422   -38.650 114.184 1.00 0.00 ? 344 SER A OG  1 
ATOM 2444 N N   . PHE A 1 345 ? 11.779  -37.595 115.081 1.00 0.00 ? 345 PHE A N   1 
ATOM 2445 C CA  . PHE A 1 345 ? 13.195  -37.675 114.695 1.00 0.00 ? 345 PHE A CA  1 
ATOM 2446 C C   . PHE A 1 345 ? 13.481  -39.048 114.089 1.00 0.00 ? 345 PHE A C   1 
ATOM 2447 O O   . PHE A 1 345 ? 13.804  -40.006 114.805 1.00 0.00 ? 345 PHE A O   1 
ATOM 2448 C CB  . PHE A 1 345 ? 14.095  -37.525 115.928 1.00 0.00 ? 345 PHE A CB  1 
ATOM 2449 C CG  . PHE A 1 345 ? 14.518  -36.083 116.226 1.00 0.00 ? 345 PHE A CG  1 
ATOM 2450 C CD1 . PHE A 1 345 ? 13.659  -35.237 116.937 1.00 0.00 ? 345 PHE A CD1 1 
ATOM 2451 C CD2 . PHE A 1 345 ? 15.766  -35.611 115.796 1.00 0.00 ? 345 PHE A CD2 1 
ATOM 2452 C CE1 . PHE A 1 345 ? 14.048  -33.922 117.222 1.00 0.00 ? 345 PHE A CE1 1 
ATOM 2453 C CE2 . PHE A 1 345 ? 16.155  -34.296 116.083 1.00 0.00 ? 345 PHE A CE2 1 
ATOM 2454 C CZ  . PHE A 1 345 ? 15.296  -33.452 116.796 1.00 0.00 ? 345 PHE A CZ  1 
ATOM 2455 N N   . GLU A 1 346 ? 13.348  -39.112 112.781 1.00 0.00 ? 346 GLU A N   1 
ATOM 2456 C CA  . GLU A 1 346 ? 13.591  -40.349 112.031 1.00 0.00 ? 346 GLU A CA  1 
ATOM 2457 C C   . GLU A 1 346 ? 15.094  -40.562 111.885 1.00 0.00 ? 346 GLU A C   1 
ATOM 2458 O O   . GLU A 1 346 ? 15.902  -39.913 112.566 1.00 0.00 ? 346 GLU A O   1 
ATOM 2459 C CB  . GLU A 1 346 ? 12.940  -40.259 110.653 1.00 0.00 ? 346 GLU A CB  1 
ATOM 2460 C CG  . GLU A 1 346 ? 11.413  -40.268 110.725 1.00 0.00 ? 346 GLU A CG  1 
ATOM 2461 C CD  . GLU A 1 346 ? 10.750  -40.473 109.363 1.00 0.00 ? 346 GLU A CD  1 
ATOM 2462 O OE1 . GLU A 1 346 ? 10.696  -39.498 108.521 1.00 0.00 ? 346 GLU A OE1 1 
ATOM 2463 O OE2 . GLU A 1 346 ? 10.245  -41.620 109.059 1.00 0.00 ? 346 GLU A OE2 1 
ATOM 2464 N N   . ALA A 1 347 ? 15.438  -41.470 110.999 1.00 0.00 ? 347 ALA A N   1 
ATOM 2465 C CA  . ALA A 1 347 ? 16.838  -41.800 110.740 1.00 0.00 ? 347 ALA A CA  1 
ATOM 2466 C C   . ALA A 1 347 ? 16.953  -42.831 109.626 1.00 0.00 ? 347 ALA A C   1 
ATOM 2467 O O   . ALA A 1 347 ? 16.026  -43.621 109.388 1.00 0.00 ? 347 ALA A O   1 
ATOM 2468 C CB  . ALA A 1 347 ? 17.480  -42.384 112.000 1.00 0.00 ? 347 ALA A CB  1 
ATOM 2469 N N   . SER A 1 348 ? 18.101  -42.770 108.988 1.00 0.00 ? 348 SER A N   1 
ATOM 2470 C CA  . SER A 1 348 ? 18.461  -43.684 107.907 1.00 0.00 ? 348 SER A CA  1 
ATOM 2471 C C   . SER A 1 348 ? 19.948  -44.024 107.998 1.00 0.00 ? 348 SER A C   1 
ATOM 2472 O O   . SER A 1 348 ? 20.539  -44.024 109.086 1.00 0.00 ? 348 SER A O   1 
ATOM 2473 C CB  . SER A 1 348 ? 18.154  -43.063 106.545 1.00 0.00 ? 348 SER A CB  1 
ATOM 2474 O OG  . SER A 1 348 ? 17.971  -44.094 105.580 1.00 0.00 ? 348 SER A OG  1 
ATOM 2475 N N   . THR A 1 349 ? 20.505  -44.287 106.839 1.00 0.00 ? 349 THR A N   1 
ATOM 2476 C CA  . THR A 1 349 ? 21.897  -44.735 106.695 1.00 0.00 ? 349 THR A CA  1 
ATOM 2477 C C   . THR A 1 349 ? 22.927  -43.649 107.073 1.00 0.00 ? 349 THR A C   1 
ATOM 2478 O O   . THR A 1 349 ? 24.103  -43.947 107.331 1.00 0.00 ? 349 THR A O   1 
ATOM 2479 C CB  . THR A 1 349 ? 22.144  -45.168 105.249 1.00 0.00 ? 349 THR A CB  1 
ATOM 2480 O OG1 . THR A 1 349 ? 21.384  -44.359 104.361 1.00 0.00 ? 349 THR A OG1 1 
ATOM 2481 C CG2 . THR A 1 349 ? 21.744  -46.623 104.988 1.00 0.00 ? 349 THR A CG2 1 
ATOM 2482 N N   . GLN A 1 350 ? 22.496  -42.400 107.114 1.00 0.00 ? 350 GLN A N   1 
ATOM 2483 C CA  . GLN A 1 350 ? 23.413  -41.276 107.416 1.00 0.00 ? 350 GLN A CA  1 
ATOM 2484 C C   . GLN A 1 350 ? 23.325  -40.854 108.897 1.00 0.00 ? 350 GLN A C   1 
ATOM 2485 O O   . GLN A 1 350 ? 24.275  -40.285 109.460 1.00 0.00 ? 350 GLN A O   1 
ATOM 2486 C CB  . GLN A 1 350 ? 23.096  -40.086 106.511 1.00 0.00 ? 350 GLN A CB  1 
ATOM 2487 C CG  . GLN A 1 350 ? 23.294  -40.404 105.022 1.00 0.00 ? 350 GLN A CG  1 
ATOM 2488 C CD  . GLN A 1 350 ? 24.584  -41.182 104.730 1.00 0.00 ? 350 GLN A CD  1 
ATOM 2489 O OE1 . GLN A 1 350 ? 24.633  -42.396 104.930 1.00 0.00 ? 350 GLN A OE1 1 
ATOM 2490 N NE2 . GLN A 1 350 ? 25.646  -40.552 104.260 1.00 0.00 ? 350 GLN A NE2 1 
ATOM 2491 N N   . GLY A 1 351 ? 22.184  -41.137 109.508 1.00 0.00 ? 351 GLY A N   1 
ATOM 2492 C CA  . GLY A 1 351 ? 21.956  -40.825 110.937 1.00 0.00 ? 351 GLY A CA  1 
ATOM 2493 C C   . GLY A 1 351 ? 20.574  -40.196 111.158 1.00 0.00 ? 351 GLY A C   1 
ATOM 2494 O O   . GLY A 1 351 ? 19.873  -39.842 110.198 1.00 0.00 ? 351 GLY A O   1 
ATOM 2495 N N   . PRO A 1 352 ? 20.129  -40.040 112.421 1.00 0.00 ? 352 PRO A N   1 
ATOM 2496 C CA  . PRO A 1 352 ? 18.827  -39.444 112.717 1.00 0.00 ? 352 PRO A CA  1 
ATOM 2497 C C   . PRO A 1 352 ? 18.732  -38.020 112.185 1.00 0.00 ? 352 PRO A C   1 
ATOM 2498 O O   . PRO A 1 352 ? 19.796  -37.329 112.085 1.00 0.00 ? 352 PRO A O   1 
ATOM 2499 C CB  . PRO A 1 352 ? 18.746  -39.485 114.227 1.00 0.00 ? 352 PRO A CB  1 
ATOM 2500 C CG  . PRO A 1 352 ? 20.030  -40.114 114.753 1.00 0.00 ? 352 PRO A CG  1 
ATOM 2501 C CD  . PRO A 1 352 ? 20.909  -40.461 113.591 1.00 0.00 ? 352 PRO A CD  1 
ATOM 2502 N N   . PHE A 1 353 ? 17.485  -37.634 111.870 1.00 0.00 ? 353 PHE A N   1 
ATOM 2503 C CA  . PHE A 1 353 ? 17.119  -36.281 111.350 1.00 0.00 ? 353 PHE A CA  1 
ATOM 2504 C C   . PHE A 1 353 ? 15.595  -36.038 111.543 1.00 0.00 ? 353 PHE A C   1 
ATOM 2505 O O   . PHE A 1 353 ? 14.770  -36.925 111.280 1.00 0.00 ? 353 PHE A O   1 
ATOM 2506 C CB  . PHE A 1 353 ? 17.469  -36.174 109.856 1.00 0.00 ? 353 PHE A CB  1 
ATOM 2507 C CG  . PHE A 1 353 ? 16.711  -37.180 108.986 1.00 0.00 ? 353 PHE A CG  1 
ATOM 2508 C CD1 . PHE A 1 353 ? 15.390  -36.918 108.602 1.00 0.00 ? 353 PHE A CD1 1 
ATOM 2509 C CD2 . PHE A 1 353 ? 17.337  -38.363 108.573 1.00 0.00 ? 353 PHE A CD2 1 
ATOM 2510 C CE1 . PHE A 1 353 ? 14.692  -37.842 107.816 1.00 0.00 ? 353 PHE A CE1 1 
ATOM 2511 C CE2 . PHE A 1 353 ? 16.637  -39.290 107.790 1.00 0.00 ? 353 PHE A CE2 1 
ATOM 2512 C CZ  . PHE A 1 353 ? 15.315  -39.030 107.412 1.00 0.00 ? 353 PHE A CZ  1 
ATOM 2513 N N   . LYS A 1 354 ? 15.256  -34.826 112.006 1.00 0.00 ? 354 LYS A N   1 
ATOM 2514 C CA  . LYS A 1 354 ? 13.847  -34.407 112.292 1.00 0.00 ? 354 LYS A CA  1 
ATOM 2515 C C   . LYS A 1 354 ? 12.969  -34.505 111.031 1.00 0.00 ? 354 LYS A C   1 
ATOM 2516 O O   . LYS A 1 354 ? 13.471  -34.491 109.900 1.00 0.00 ? 354 LYS A O   1 
ATOM 2517 C CB  . LYS A 1 354 ? 13.804  -32.951 112.785 1.00 0.00 ? 354 LYS A CB  1 
ATOM 2518 C CG  . LYS A 1 354 ? 12.513  -32.602 113.541 1.00 0.00 ? 354 LYS A CG  1 
ATOM 2519 C CD  . LYS A 1 354 ? 11.430  -31.996 112.640 1.00 0.00 ? 354 LYS A CD  1 
ATOM 2520 C CE  . LYS A 1 354 ? 11.619  -30.496 112.394 1.00 0.00 ? 354 LYS A CE  1 
ATOM 2521 N NZ  . LYS A 1 354 ? 11.069  -29.660 113.472 1.00 0.00 ? 354 LYS A NZ  1 
ATOM 2522 N N   . THR A 1 355 ? 11.662  -34.598 111.271 1.00 0.00 ? 355 THR A N   1 
ATOM 2523 C CA  . THR A 1 355 ? 10.652  -34.716 110.196 1.00 0.00 ? 355 THR A CA  1 
ATOM 2524 C C   . THR A 1 355 ? 10.062  -33.339 109.867 1.00 0.00 ? 355 THR A C   1 
ATOM 2525 O O   . THR A 1 355 ? 9.406   -32.705 110.711 1.00 0.00 ? 355 THR A O   1 
ATOM 2526 C CB  . THR A 1 355 ? 9.532   -35.668 110.629 1.00 0.00 ? 355 THR A CB  1 
ATOM 2527 O OG1 . THR A 1 355 ? 9.891   -37.008 110.316 1.00 0.00 ? 355 THR A OG1 1 
ATOM 2528 C CG2 . THR A 1 355 ? 8.197   -35.385 109.936 1.00 0.00 ? 355 THR A CG2 1 
ATOM 2529 N N   . PRO A 1 356 ? 10.269  -32.835 108.639 1.00 0.00 ? 356 PRO A N   1 
ATOM 2530 C CA  . PRO A 1 356 ? 9.779   -31.522 108.250 1.00 0.00 ? 356 PRO A CA  1 
ATOM 2531 C C   . PRO A 1 356 ? 8.283   -31.447 108.377 1.00 0.00 ? 356 PRO A C   1 
ATOM 2532 O O   . PRO A 1 356 ? 7.620   -32.522 108.510 1.00 0.00 ? 356 PRO A O   1 
ATOM 2533 C CB  . PRO A 1 356 ? 10.226  -31.373 106.816 1.00 0.00 ? 356 PRO A CB  1 
ATOM 2534 C CG  . PRO A 1 356 ? 10.977  -32.637 106.429 1.00 0.00 ? 356 PRO A CG  1 
ATOM 2535 C CD  . PRO A 1 356 ? 10.998  -33.565 107.602 1.00 0.00 ? 356 PRO A CD  1 
ATOM 2536 N N   . ILE A 1 357 ? 7.802   -30.214 108.334 1.00 0.00 ? 357 ILE A N   1 
ATOM 2537 C CA  . ILE A 1 357 ? 6.366   -29.913 108.430 1.00 0.00 ? 357 ILE A CA  1 
ATOM 2538 C C   . ILE A 1 357 ? 6.037   -28.592 107.735 1.00 0.00 ? 357 ILE A C   1 
ATOM 2539 O O   . ILE A 1 357 ? 6.730   -27.580 107.924 1.00 0.00 ? 357 ILE A O   1 
ATOM 2540 C CB  . ILE A 1 357 ? 5.934   -29.776 109.893 1.00 0.00 ? 357 ILE A CB  1 
ATOM 2541 C CG1 . ILE A 1 357 ? 5.489   -31.101 110.513 1.00 0.00 ? 357 ILE A CG1 1 
ATOM 2542 C CG2 . ILE A 1 357 ? 4.752   -28.818 110.078 1.00 0.00 ? 357 ILE A CG2 1 
ATOM 2543 C CD1 . ILE A 1 357 ? 4.057   -31.487 110.138 1.00 0.00 ? 357 ILE A CD1 1 
ATOM 2544 N N   . ALA A 1 358 ? 4.983   -28.666 106.950 1.00 0.00 ? 358 ALA A N   1 
ATOM 2545 C CA  . ALA A 1 358 ? 4.434   -27.517 106.225 1.00 0.00 ? 358 ALA A CA  1 
ATOM 2546 C C   . ALA A 1 358 ? 3.199   -27.036 106.983 1.00 0.00 ? 358 ALA A C   1 
ATOM 2547 O O   . ALA A 1 358 ? 2.079   -27.511 106.745 1.00 0.00 ? 358 ALA A O   1 
ATOM 2548 C CB  . ALA A 1 358 ? 4.052   -27.935 104.802 1.00 0.00 ? 358 ALA A CB  1 
ATOM 2549 N N   . ALA A 1 359 ? 3.446   -26.107 107.889 1.00 0.00 ? 359 ALA A N   1 
ATOM 2550 C CA  . ALA A 1 359 ? 2.398   -25.560 108.765 1.00 0.00 ? 359 ALA A CA  1 
ATOM 2551 C C   . ALA A 1 359 ? 2.309   -24.031 108.656 1.00 0.00 ? 359 ALA A C   1 
ATOM 2552 O O   . ALA A 1 359 ? 3.221   -23.376 108.126 1.00 0.00 ? 359 ALA A O   1 
ATOM 2553 C CB  . ALA A 1 359 ? 2.711   -25.920 110.222 1.00 0.00 ? 359 ALA A CB  1 
ATOM 2554 N N   . GLY A 1 360 ? 1.177   -23.535 109.160 1.00 0.00 ? 360 GLY A N   1 
ATOM 2555 C CA  . GLY A 1 360 ? 0.868   -22.092 109.244 1.00 0.00 ? 360 GLY A CA  1 
ATOM 2556 C C   . GLY A 1 360 ? 0.894   -21.696 110.726 1.00 0.00 ? 360 GLY A C   1 
ATOM 2557 O O   . GLY A 1 360 ? 1.965   -21.684 111.353 1.00 0.00 ? 360 GLY A O   1 
ATOM 2558 N N   . ARG A 1 361 ? -0.289  -21.383 111.221 1.00 0.00 ? 361 ARG A N   1 
ATOM 2559 C CA  . ARG A 1 361 ? -0.539  -21.095 112.647 1.00 0.00 ? 361 ARG A CA  1 
ATOM 2560 C C   . ARG A 1 361 ? -1.347  -22.274 113.178 1.00 0.00 ? 361 ARG A C   1 
ATOM 2561 O O   . ARG A 1 361 ? -1.166  -23.414 112.721 1.00 0.00 ? 361 ARG A O   1 
ATOM 2562 C CB  . ARG A 1 361 ? -1.359  -19.808 112.803 1.00 0.00 ? 361 ARG A CB  1 
ATOM 2563 C CG  . ARG A 1 361 ? -0.802  -18.853 113.861 1.00 0.00 ? 361 ARG A CG  1 
ATOM 2564 C CD  . ARG A 1 361 ? 0.170   -17.839 113.267 1.00 0.00 ? 361 ARG A CD  1 
ATOM 2565 N NE  . ARG A 1 361 ? 0.093   -16.515 113.896 1.00 0.00 ? 361 ARG A NE  1 
ATOM 2566 C CZ  . ARG A 1 361 ? 1.076   -15.612 113.822 1.00 0.00 ? 361 ARG A CZ  1 
ATOM 2567 N NH1 . ARG A 1 361 ? 2.206   -15.882 113.153 1.00 0.00 ? 361 ARG A NH1 1 
ATOM 2568 N NH2 . ARG A 1 361 ? 1.026   -14.401 114.389 1.00 0.00 ? 361 ARG A NH2 1 
ATOM 2569 N N   . GLY A 1 362 ? -2.230  -21.977 114.113 1.00 0.00 ? 362 GLY A N   1 
ATOM 2570 C CA  . GLY A 1 362 ? -3.129  -22.995 114.678 1.00 0.00 ? 362 GLY A CA  1 
ATOM 2571 C C   . GLY A 1 362 ? -3.396  -22.772 116.174 1.00 0.00 ? 362 GLY A C   1 
ATOM 2572 O O   . GLY A 1 362 ? -3.302  -23.703 116.986 1.00 0.00 ? 362 GLY A O   1 
ATOM 2573 N N   . GLY A 1 363 ? -3.741  -21.539 116.536 1.00 0.00 ? 363 GLY A N   1 
ATOM 2574 C CA  . GLY A 1 363 ? -4.061  -21.219 117.947 1.00 0.00 ? 363 GLY A CA  1 
ATOM 2575 C C   . GLY A 1 363 ? -4.186  -19.707 118.197 1.00 0.00 ? 363 GLY A C   1 
ATOM 2576 O O   . GLY A 1 363 ? -3.867  -18.881 117.328 1.00 0.00 ? 363 GLY A O   1 
ATOM 2577 N N   . ALA A 1 364 ? -4.672  -19.410 119.402 1.00 0.00 ? 364 ALA A N   1 
ATOM 2578 C CA  . ALA A 1 364 ? -4.823  -18.030 119.891 1.00 0.00 ? 364 ALA A CA  1 
ATOM 2579 C C   . ALA A 1 364 ? -3.431  -17.408 119.900 1.00 0.00 ? 364 ALA A C   1 
ATOM 2580 O O   . ALA A 1 364 ? -2.420  -18.113 119.994 1.00 0.00 ? 364 ALA A O   1 
ATOM 2581 C CB  . ALA A 1 364 ? -5.430  -18.037 121.300 1.00 0.00 ? 364 ALA A CB  1 
ATOM 2582 N N   . GLN A 1 365 ? -3.372  -16.100 119.802 1.00 0.00 ? 365 GLN A N   1 
ATOM 2583 C CA  . GLN A 1 365 ? -2.076  -15.410 119.716 1.00 0.00 ? 365 GLN A CA  1 
ATOM 2584 C C   . GLN A 1 365 ? -1.265  -15.601 120.999 1.00 0.00 ? 365 GLN A C   1 
ATOM 2585 O O   . GLN A 1 365 ? -1.765  -15.369 122.111 1.00 0.00 ? 365 GLN A O   1 
ATOM 2586 C CB  . GLN A 1 365 ? -2.283  -13.951 119.365 1.00 0.00 ? 365 GLN A CB  1 
ATOM 2587 C CG  . GLN A 1 365 ? -2.112  -13.755 117.864 1.00 0.00 ? 365 GLN A CG  1 
ATOM 2588 C CD  . GLN A 1 365 ? -1.610  -15.040 117.185 1.00 0.00 ? 365 GLN A CD  1 
ATOM 2589 O OE1 . GLN A 1 365 ? -2.003  -16.142 117.578 1.00 0.00 ? 365 GLN A OE1 1 
ATOM 2590 N NE2 . GLN A 1 365 ? -0.749  -14.971 116.189 1.00 0.00 ? 365 GLN A NE2 1 
ATOM 2591 N N   . THR A 1 366 ? -0.031  -16.016 120.743 1.00 0.00 ? 366 THR A N   1 
ATOM 2592 C CA  . THR A 1 366 ? 0.959   -16.374 121.768 1.00 0.00 ? 366 THR A CA  1 
ATOM 2593 C C   . THR A 1 366 ? 0.451   -17.624 122.471 1.00 0.00 ? 366 THR A C   1 
ATOM 2594 O O   . THR A 1 366 ? 0.834   -17.916 123.613 1.00 0.00 ? 366 THR A O   1 
ATOM 2595 C CB  . THR A 1 366 ? 1.178   -15.224 122.744 1.00 0.00 ? 366 THR A CB  1 
ATOM 2596 O OG1 . THR A 1 366 ? 1.626   -14.074 122.040 1.00 0.00 ? 366 THR A OG1 1 
ATOM 2597 C CG2 . THR A 1 366 ? 2.236   -15.545 123.805 1.00 0.00 ? 366 THR A CG2 1 
ATOM 2598 N N   . ASP A 1 367 ? -0.399  -18.274 121.711 1.00 0.00 ? 367 ASP A N   1 
ATOM 2599 C CA  . ASP A 1 367 ? -1.047  -19.535 122.055 1.00 0.00 ? 367 ASP A CA  1 
ATOM 2600 C C   . ASP A 1 367 ? -0.780  -20.572 120.943 1.00 0.00 ? 367 ASP A C   1 
ATOM 2601 O O   . ASP A 1 367 ? -1.715  -21.129 120.351 1.00 0.00 ? 367 ASP A O   1 
ATOM 2602 C CB  . ASP A 1 367 ? -2.565  -19.303 122.127 1.00 0.00 ? 367 ASP A CB  1 
ATOM 2603 C CG  . ASP A 1 367 ? -3.299  -20.386 122.920 1.00 0.00 ? 367 ASP A CG  1 
ATOM 2604 O OD1 . ASP A 1 367 ? -3.521  -21.539 122.386 1.00 0.00 ? 367 ASP A OD1 1 
ATOM 2605 O OD2 . ASP A 1 367 ? -3.697  -20.146 124.124 1.00 0.00 ? 367 ASP A OD2 1 
ATOM 2606 N N   . GLU A 1 368 ? 0.501   -20.826 120.659 1.00 0.00 ? 368 GLU A N   1 
ATOM 2607 C CA  . GLU A 1 368 ? 0.882   -21.774 119.581 1.00 0.00 ? 368 GLU A CA  1 
ATOM 2608 C C   . GLU A 1 368 ? 1.848   -22.875 120.062 1.00 0.00 ? 368 GLU A C   1 
ATOM 2609 O O   . GLU A 1 368 ? 2.371   -22.819 121.186 1.00 0.00 ? 368 GLU A O   1 
ATOM 2610 C CB  . GLU A 1 368 ? 1.551   -21.050 118.418 1.00 0.00 ? 368 GLU A CB  1 
ATOM 2611 C CG  . GLU A 1 368 ? 1.470   -21.859 117.121 1.00 0.00 ? 368 GLU A CG  1 
ATOM 2612 C CD  . GLU A 1 368 ? 1.862   -21.059 115.882 1.00 0.00 ? 368 GLU A CD  1 
ATOM 2613 O OE1 . GLU A 1 368 ? 3.062   -20.604 115.764 1.00 0.00 ? 368 GLU A OE1 1 
ATOM 2614 O OE2 . GLU A 1 368 ? 0.993   -20.843 114.954 1.00 0.00 ? 368 GLU A OE2 1 
ATOM 2615 N N   . ASN A 1 369 ? 2.038   -23.829 119.141 1.00 0.00 ? 369 ASN A N   1 
ATOM 2616 C CA  . ASN A 1 369 ? 2.845   -25.058 119.348 1.00 0.00 ? 369 ASN A CA  1 
ATOM 2617 C C   . ASN A 1 369 ? 4.196   -25.029 118.597 1.00 0.00 ? 369 ASN A C   1 
ATOM 2618 O O   . ASN A 1 369 ? 4.723   -26.074 118.191 1.00 0.00 ? 369 ASN A O   1 
ATOM 2619 C CB  . ASN A 1 369 ? 2.070   -26.267 118.823 1.00 0.00 ? 369 ASN A CB  1 
ATOM 2620 C CG  . ASN A 1 369 ? 2.276   -27.522 119.664 1.00 0.00 ? 369 ASN A CG  1 
ATOM 2621 O OD1 . ASN A 1 369 ? 1.431   -28.415 119.649 1.00 0.00 ? 369 ASN A OD1 1 
ATOM 2622 N ND2 . ASN A 1 369 ? 3.360   -27.647 120.405 1.00 0.00 ? 369 ASN A ND2 1 
ATOM 2623 N N   . GLN A 1 370 ? 4.704   -23.833 118.444 1.00 0.00 ? 370 GLN A N   1 
ATOM 2624 C CA  . GLN A 1 370 ? 6.006   -23.537 117.804 1.00 0.00 ? 370 GLN A CA  1 
ATOM 2625 C C   . GLN A 1 370 ? 6.657   -24.717 117.038 1.00 0.00 ? 370 GLN A C   1 
ATOM 2626 O O   . GLN A 1 370 ? 7.515   -24.519 116.164 1.00 0.00 ? 370 GLN A O   1 
ATOM 2627 C CB  . GLN A 1 370 ? 7.031   -23.142 118.867 1.00 0.00 ? 370 GLN A CB  1 
ATOM 2628 C CG  . GLN A 1 370 ? 6.600   -21.928 119.683 1.00 0.00 ? 370 GLN A CG  1 
ATOM 2629 C CD  . GLN A 1 370 ? 6.725   -20.623 118.901 1.00 0.00 ? 370 GLN A CD  1 
ATOM 2630 O OE1 . GLN A 1 370 ? 5.723   -19.955 118.658 1.00 0.00 ? 370 GLN A OE1 1 
ATOM 2631 N NE2 . GLN A 1 370 ? 7.910   -20.219 118.485 1.00 0.00 ? 370 GLN A NE2 1 
ATOM 2632 N N   . ALA A 1 371 ? 6.284   -25.951 117.341 1.00 0.00 ? 371 ALA A N   1 
ATOM 2633 C CA  . ALA A 1 371 ? 6.943   -27.115 116.695 1.00 0.00 ? 371 ALA A CA  1 
ATOM 2634 C C   . ALA A 1 371 ? 5.955   -28.051 115.986 1.00 0.00 ? 371 ALA A C   1 
ATOM 2635 O O   . ALA A 1 371 ? 6.349   -28.869 115.137 1.00 0.00 ? 371 ALA A O   1 
ATOM 2636 C CB  . ALA A 1 371 ? 7.687   -27.947 117.741 1.00 0.00 ? 371 ALA A CB  1 
ATOM 2637 N N   . ALA A 1 372 ? 4.699   -27.915 116.346 1.00 0.00 ? 372 ALA A N   1 
ATOM 2638 C CA  . ALA A 1 372 ? 3.624   -28.756 115.795 1.00 0.00 ? 372 ALA A CA  1 
ATOM 2639 C C   . ALA A 1 372 ? 3.373   -28.441 114.312 1.00 0.00 ? 372 ALA A C   1 
ATOM 2640 O O   . ALA A 1 372 ? 3.276   -29.346 113.471 1.00 0.00 ? 372 ALA A O   1 
ATOM 2641 C CB  . ALA A 1 372 ? 2.331   -28.535 116.574 1.00 0.00 ? 372 ALA A CB  1 
ATOM 2642 N N   . ASP A 1 373 ? 3.258   -27.151 113.997 1.00 0.00 ? 373 ASP A N   1 
ATOM 2643 C CA  . ASP A 1 373 ? 3.006   -26.722 112.602 1.00 0.00 ? 373 ASP A CA  1 
ATOM 2644 C C   . ASP A 1 373 ? 4.299   -26.220 111.931 1.00 0.00 ? 373 ASP A C   1 
ATOM 2645 O O   . ASP A 1 373 ? 4.263   -25.635 110.837 1.00 0.00 ? 373 ASP A O   1 
ATOM 2646 C CB  . ASP A 1 373 ? 1.925   -25.628 112.516 1.00 0.00 ? 373 ASP A CB  1 
ATOM 2647 C CG  . ASP A 1 373 ? 2.132   -24.434 113.451 1.00 0.00 ? 373 ASP A CG  1 
ATOM 2648 O OD1 . ASP A 1 373 ? 2.033   -24.587 114.728 1.00 0.00 ? 373 ASP A OD1 1 
ATOM 2649 O OD2 . ASP A 1 373 ? 2.388   -23.269 112.959 1.00 0.00 ? 373 ASP A OD2 1 
ATOM 2650 N N   . GLY A 1 374 ? 5.402   -26.472 112.616 1.00 0.00 ? 374 GLY A N   1 
ATOM 2651 C CA  . GLY A 1 374 ? 6.768   -26.153 112.138 1.00 0.00 ? 374 GLY A CA  1 
ATOM 2652 C C   . GLY A 1 374 ? 6.957   -24.663 111.814 1.00 0.00 ? 374 GLY A C   1 
ATOM 2653 O O   . GLY A 1 374 ? 6.666   -24.207 110.697 1.00 0.00 ? 374 GLY A O   1 
ATOM 2654 N N   . ASP A 1 375 ? 7.460   -23.957 112.813 1.00 0.00 ? 375 ASP A N   1 
ATOM 2655 C CA  . ASP A 1 375 ? 7.778   -22.523 112.714 1.00 0.00 ? 375 ASP A CA  1 
ATOM 2656 C C   . ASP A 1 375 ? 9.292   -22.368 112.541 1.00 0.00 ? 375 ASP A C   1 
ATOM 2657 O O   . ASP A 1 375 ? 10.079  -22.792 113.401 1.00 0.00 ? 375 ASP A O   1 
ATOM 2658 C CB  . ASP A 1 375 ? 7.330   -21.795 113.985 1.00 0.00 ? 375 ASP A CB  1 
ATOM 2659 C CG  . ASP A 1 375 ? 5.809   -21.772 114.158 1.00 0.00 ? 375 ASP A CG  1 
ATOM 2660 O OD1 . ASP A 1 375 ? 5.051   -22.330 113.276 1.00 0.00 ? 375 ASP A OD1 1 
ATOM 2661 O OD2 . ASP A 1 375 ? 5.286   -21.195 115.186 1.00 0.00 ? 375 ASP A OD2 1 
ATOM 2662 N N   . PRO A 1 376 ? 9.776   -21.768 111.444 1.00 0.00 ? 376 PRO A N   1 
ATOM 2663 C CA  . PRO A 1 376 ? 11.211  -21.636 111.217 1.00 0.00 ? 376 PRO A CA  1 
ATOM 2664 C C   . PRO A 1 376 ? 11.865  -20.850 112.312 1.00 0.00 ? 376 PRO A C   1 
ATOM 2665 O O   . PRO A 1 376 ? 11.152  -20.079 113.025 1.00 0.00 ? 376 PRO A O   1 
ATOM 2666 C CB  . PRO A 1 376 ? 11.298  -20.915 109.891 1.00 0.00 ? 376 PRO A CB  1 
ATOM 2667 C CG  . PRO A 1 376 ? 9.879   -20.656 109.401 1.00 0.00 ? 376 PRO A CG  1 
ATOM 2668 C CD  . PRO A 1 376 ? 8.913   -21.206 110.403 1.00 0.00 ? 376 PRO A CD  1 
ATOM 2669 N N   . ARG A 1 377 ? 13.153  -21.072 112.397 1.00 0.00 ? 377 ARG A N   1 
ATOM 2670 C CA  . ARG A 1 377 ? 14.040  -20.414 113.358 1.00 0.00 ? 377 ARG A CA  1 
ATOM 2671 C C   . ARG A 1 377 ? 15.271  -19.938 112.586 1.00 0.00 ? 377 ARG A C   1 
ATOM 2672 O O   . ARG A 1 377 ? 15.884  -20.706 111.833 1.00 0.00 ? 377 ARG A O   1 
ATOM 2673 C CB  . ARG A 1 377 ? 14.433  -21.404 114.445 1.00 0.00 ? 377 ARG A CB  1 
ATOM 2674 C CG  . ARG A 1 377 ? 15.428  -20.825 115.436 1.00 0.00 ? 377 ARG A CG  1 
ATOM 2675 C CD  . ARG A 1 377 ? 14.826  -19.729 116.306 1.00 0.00 ? 377 ARG A CD  1 
ATOM 2676 N NE  . ARG A 1 377 ? 15.577  -19.515 117.543 1.00 0.00 ? 377 ARG A NE  1 
ATOM 2677 C CZ  . ARG A 1 377 ? 15.098  -18.859 118.602 1.00 0.00 ? 377 ARG A CZ  1 
ATOM 2678 N NH1 . ARG A 1 377 ? 13.862  -18.343 118.591 1.00 0.00 ? 377 ARG A NH1 1 
ATOM 2679 N NH2 . ARG A 1 377 ? 15.787  -18.664 119.733 1.00 0.00 ? 377 ARG A NH2 1 
ATOM 2680 N N   . TYR A 1 378 ? 15.618  -18.677 112.783 1.00 0.00 ? 378 TYR A N   1 
ATOM 2681 C CA  . TYR A 1 378 ? 16.741  -18.059 112.047 1.00 0.00 ? 378 TYR A CA  1 
ATOM 2682 C C   . TYR A 1 378 ? 17.790  -17.419 112.977 1.00 0.00 ? 378 TYR A C   1 
ATOM 2683 O O   . TYR A 1 378 ? 17.457  -16.595 113.844 1.00 0.00 ? 378 TYR A O   1 
ATOM 2684 C CB  . TYR A 1 378 ? 16.189  -16.973 111.122 1.00 0.00 ? 378 TYR A CB  1 
ATOM 2685 C CG  . TYR A 1 378 ? 15.519  -17.546 109.870 1.00 0.00 ? 378 TYR A CG  1 
ATOM 2686 C CD1 . TYR A 1 378 ? 16.295  -17.868 108.753 1.00 0.00 ? 378 TYR A CD1 1 
ATOM 2687 C CD2 . TYR A 1 378 ? 14.132  -17.749 109.841 1.00 0.00 ? 378 TYR A CD2 1 
ATOM 2688 C CE1 . TYR A 1 378 ? 15.689  -18.392 107.607 1.00 0.00 ? 378 TYR A CE1 1 
ATOM 2689 C CE2 . TYR A 1 378 ? 13.525  -18.274 108.694 1.00 0.00 ? 378 TYR A CE2 1 
ATOM 2690 C CZ  . TYR A 1 378 ? 14.305  -18.595 107.576 1.00 0.00 ? 378 TYR A CZ  1 
ATOM 2691 O OH  . TYR A 1 378 ? 13.719  -19.104 106.460 1.00 0.00 ? 378 TYR A OH  1 
ATOM 2692 N N   . ALA A 1 379 ? 19.041  -17.837 112.732 1.00 0.00 ? 379 ALA A N   1 
ATOM 2693 C CA  . ALA A 1 379 ? 20.233  -17.363 113.473 1.00 0.00 ? 379 ALA A CA  1 
ATOM 2694 C C   . ALA A 1 379 ? 21.273  -16.773 112.495 1.00 0.00 ? 379 ALA A C   1 
ATOM 2695 O O   . ALA A 1 379 ? 21.860  -17.492 111.671 1.00 0.00 ? 379 ALA A O   1 
ATOM 2696 C CB  . ALA A 1 379 ? 20.888  -18.523 114.231 1.00 0.00 ? 379 ALA A CB  1 
ATOM 2697 N N   . PHE A 1 380 ? 21.459  -15.474 112.630 1.00 0.00 ? 380 PHE A N   1 
ATOM 2698 C CA  . PHE A 1 380 ? 22.415  -14.692 111.818 1.00 0.00 ? 380 PHE A CA  1 
ATOM 2699 C C   . PHE A 1 380 ? 23.279  -13.851 112.741 1.00 0.00 ? 380 PHE A C   1 
ATOM 2700 O O   . PHE A 1 380 ? 23.189  -13.956 113.972 1.00 0.00 ? 380 PHE A O   1 
ATOM 2701 C CB  . PHE A 1 380 ? 21.646  -13.784 110.864 1.00 0.00 ? 380 PHE A CB  1 
ATOM 2702 C CG  . PHE A 1 380 ? 20.395  -13.177 111.502 1.00 0.00 ? 380 PHE A CG  1 
ATOM 2703 C CD1 . PHE A 1 380 ? 19.202  -13.909 111.537 1.00 0.00 ? 380 PHE A CD1 1 
ATOM 2704 C CD2 . PHE A 1 380 ? 20.443  -11.891 112.053 1.00 0.00 ? 380 PHE A CD2 1 
ATOM 2705 C CE1 . PHE A 1 380 ? 18.057  -13.354 112.122 1.00 0.00 ? 380 PHE A CE1 1 
ATOM 2706 C CE2 . PHE A 1 380 ? 19.299  -11.337 112.639 1.00 0.00 ? 380 PHE A CE2 1 
ATOM 2707 C CZ  . PHE A 1 380 ? 18.106  -12.068 112.673 1.00 0.00 ? 380 PHE A CZ  1 
ATOM 2708 N N   . GLY A 1 381 ? 24.109  -13.021 112.143 1.00 0.00 ? 381 GLY A N   1 
ATOM 2709 C CA  . GLY A 1 381 ? 24.995  -12.172 112.935 1.00 0.00 ? 381 GLY A CA  1 
ATOM 2710 C C   . GLY A 1 381 ? 25.767  -11.159 112.091 1.00 0.00 ? 381 GLY A C   1 
ATOM 2711 O O   . GLY A 1 381 ? 26.352  -11.508 111.053 1.00 0.00 ? 381 GLY A O   1 
ATOM 2712 N N   . ARG A 1 382 ? 25.708  -9.955  112.621 1.00 0.00 ? 382 ARG A N   1 
ATOM 2713 C CA  . ARG A 1 382 ? 26.429  -8.774  112.134 1.00 0.00 ? 382 ARG A CA  1 
ATOM 2714 C C   . ARG A 1 382 ? 26.222  -8.473  110.647 1.00 0.00 ? 382 ARG A C   1 
ATOM 2715 O O   . ARG A 1 382 ? 25.955  -7.326  110.258 1.00 0.00 ? 382 ARG A O   1 
ATOM 2716 C CB  . ARG A 1 382 ? 27.934  -8.972  112.326 1.00 0.00 ? 382 ARG A CB  1 
ATOM 2717 C CG  . ARG A 1 382 ? 28.540  -8.018  113.356 1.00 0.00 ? 382 ARG A CG  1 
ATOM 2718 C CD  . ARG A 1 382 ? 27.700  -7.893  114.628 1.00 0.00 ? 382 ARG A CD  1 
ATOM 2719 N NE  . ARG A 1 382 ? 27.933  -8.986  115.585 1.00 0.00 ? 382 ARG A NE  1 
ATOM 2720 C CZ  . ARG A 1 382 ? 29.118  -9.586  115.771 1.00 0.00 ? 382 ARG A CZ  1 
ATOM 2721 N NH1 . ARG A 1 382 ? 30.198  -9.213  115.071 1.00 0.00 ? 382 ARG A NH1 1 
ATOM 2722 N NH2 . ARG A 1 382 ? 29.325  -10.580 116.645 1.00 0.00 ? 382 ARG A NH2 1 
ATOM 2723 N N   . GLN A 1 383 ? 26.348  -9.490  109.819 1.00 0.00 ? 383 GLN A N   1 
ATOM 2724 C CA  . GLN A 1 383 ? 26.321  -9.275  108.365 1.00 0.00 ? 383 GLN A CA  1 
ATOM 2725 C C   . GLN A 1 383 ? 25.006  -9.658  107.662 1.00 0.00 ? 383 GLN A C   1 
ATOM 2726 O O   . GLN A 1 383 ? 24.887  -9.566  106.431 1.00 0.00 ? 383 GLN A O   1 
ATOM 2727 C CB  . GLN A 1 383 ? 27.419  -10.084 107.674 1.00 0.00 ? 383 GLN A CB  1 
ATOM 2728 C CG  . GLN A 1 383 ? 27.719  -9.575  106.260 1.00 0.00 ? 383 GLN A CG  1 
ATOM 2729 C CD  . GLN A 1 383 ? 28.911  -10.273 105.605 1.00 0.00 ? 383 GLN A CD  1 
ATOM 2730 O OE1 . GLN A 1 383 ? 28.739  -11.303 104.955 1.00 0.00 ? 383 GLN A OE1 1 
ATOM 2731 N NE2 . GLN A 1 383 ? 30.124  -9.769  105.735 1.00 0.00 ? 383 GLN A NE2 1 
ATOM 2732 N N   . HIS A 1 384 ? 24.032  -10.073 108.434 1.00 0.00 ? 384 HIS A N   1 
ATOM 2733 C CA  . HIS A 1 384 ? 22.721  -10.459 107.879 1.00 0.00 ? 384 HIS A CA  1 
ATOM 2734 C C   . HIS A 1 384 ? 21.621  -10.183 108.894 1.00 0.00 ? 384 HIS A C   1 
ATOM 2735 O O   . HIS A 1 384 ? 20.758  -11.035 109.149 1.00 0.00 ? 384 HIS A O   1 
ATOM 2736 C CB  . HIS A 1 384 ? 22.723  -11.944 107.520 1.00 0.00 ? 384 HIS A CB  1 
ATOM 2737 C CG  . HIS A 1 384 ? 24.000  -12.370 106.794 1.00 0.00 ? 384 HIS A CG  1 
ATOM 2738 N ND1 . HIS A 1 384 ? 24.018  -12.639 105.427 1.00 0.00 ? 384 HIS A ND1 1 
ATOM 2739 C CD2 . HIS A 1 384 ? 25.270  -12.567 107.235 1.00 0.00 ? 384 HIS A CD2 1 
ATOM 2740 C CE1 . HIS A 1 384 ? 25.251  -12.978 105.091 1.00 0.00 ? 384 HIS A CE1 1 
ATOM 2741 N NE2 . HIS A 1 384 ? 26.009  -12.940 106.159 1.00 0.00 ? 384 HIS A NE2 1 
ATOM 2742 N N   . GLY A 1 385 ? 21.695  -8.989  109.436 1.00 0.00 ? 385 GLY A N   1 
ATOM 2743 C CA  . GLY A 1 385 ? 20.746  -8.510  110.441 1.00 0.00 ? 385 GLY A CA  1 
ATOM 2744 C C   . GLY A 1 385 ? 21.555  -8.167  111.658 1.00 0.00 ? 385 GLY A C   1 
ATOM 2745 O O   . GLY A 1 385 ? 22.749  -7.870  111.575 1.00 0.00 ? 385 GLY A O   1 
ATOM 2746 N N   . GLN A 1 386 ? 20.928  -8.213  112.776 1.00 0.00 ? 386 GLN A N   1 
ATOM 2747 C CA  . GLN A 1 386 ? 21.641  -7.943  114.005 1.00 0.00 ? 386 GLN A CA  1 
ATOM 2748 C C   . GLN A 1 386 ? 22.341  -6.575  113.956 1.00 0.00 ? 386 GLN A C   1 
ATOM 2749 O O   . GLN A 1 386 ? 22.826  -6.135  112.884 1.00 0.00 ? 386 GLN A O   1 
ATOM 2750 C CB  . GLN A 1 386 ? 22.706  -9.014  114.250 1.00 0.00 ? 386 GLN A CB  1 
ATOM 2751 C CG  . GLN A 1 386 ? 23.287  -8.889  115.652 1.00 0.00 ? 386 GLN A CG  1 
ATOM 2752 C CD  . GLN A 1 386 ? 24.332  -9.943  115.997 1.00 0.00 ? 386 GLN A CD  1 
ATOM 2753 O OE1 . GLN A 1 386 ? 25.047  -9.785  116.985 1.00 0.00 ? 386 GLN A OE1 1 
ATOM 2754 N NE2 . GLN A 1 386 ? 24.466  -11.016 115.245 1.00 0.00 ? 386 GLN A NE2 1 
ATOM 2755 N N   . LYS A 1 387 ? 22.329  -5.985  115.160 1.00 0.00 ? 387 LYS A N   1 
ATOM 2756 C CA  . LYS A 1 387 ? 22.923  -4.671  115.441 1.00 0.00 ? 387 LYS A CA  1 
ATOM 2757 C C   . LYS A 1 387 ? 24.429  -4.739  115.120 1.00 0.00 ? 387 LYS A C   1 
ATOM 2758 O O   . LYS A 1 387 ? 25.197  -5.433  115.805 1.00 0.00 ? 387 LYS A O   1 
ATOM 2759 C CB  . LYS A 1 387 ? 22.698  -4.245  116.890 1.00 0.00 ? 387 LYS A CB  1 
ATOM 2760 C CG  . LYS A 1 387 ? 22.261  -2.777  116.997 1.00 0.00 ? 387 LYS A CG  1 
ATOM 2761 C CD  . LYS A 1 387 ? 22.946  -2.022  118.138 1.00 0.00 ? 387 LYS A CD  1 
ATOM 2762 C CE  . LYS A 1 387 ? 22.052  -1.879  119.370 1.00 0.00 ? 387 LYS A CE  1 
ATOM 2763 N NZ  . LYS A 1 387 ? 22.437  -0.755  120.235 1.00 0.00 ? 387 LYS A NZ  1 
ATOM 2764 N N   . THR A 1 388 ? 24.784  -4.001  114.078 1.00 0.00 ? 388 THR A N   1 
ATOM 2765 C CA  . THR A 1 388 ? 26.160  -3.927  113.534 1.00 0.00 ? 388 THR A CA  1 
ATOM 2766 C C   . THR A 1 388 ? 27.206  -3.699  114.630 1.00 0.00 ? 388 THR A C   1 
ATOM 2767 O O   . THR A 1 388 ? 28.291  -4.300  114.614 1.00 0.00 ? 388 THR A O   1 
ATOM 2768 C CB  . THR A 1 388 ? 26.275  -2.767  112.543 1.00 0.00 ? 388 THR A CB  1 
ATOM 2769 O OG1 . THR A 1 388 ? 25.581  -3.080  111.346 1.00 0.00 ? 388 THR A OG1 1 
ATOM 2770 C CG2 . THR A 1 388 ? 27.723  -2.447  112.162 1.00 0.00 ? 388 THR A CG2 1 
ATOM 2771 N N   . THR A 1 389 ? 26.861  -2.827  115.553 1.00 0.00 ? 389 THR A N   1 
ATOM 2772 C CA  . THR A 1 389 ? 27.751  -2.468  116.665 1.00 0.00 ? 389 THR A CA  1 
ATOM 2773 C C   . THR A 1 389 ? 27.436  -3.314  117.899 1.00 0.00 ? 389 THR A C   1 
ATOM 2774 O O   . THR A 1 389 ? 27.076  -2.787  118.961 1.00 0.00 ? 389 THR A O   1 
ATOM 2775 C CB  . THR A 1 389 ? 27.582  -0.989  117.011 1.00 0.00 ? 389 THR A CB  1 
ATOM 2776 O OG1 . THR A 1 389 ? 26.209  -0.692  117.211 1.00 0.00 ? 389 THR A OG1 1 
ATOM 2777 C CG2 . THR A 1 389 ? 28.097  -0.057  115.912 1.00 0.00 ? 389 THR A CG2 1 
ATOM 2778 N N   . THR A 1 390 ? 27.584  -4.612  117.714 1.00 0.00 ? 390 THR A N   1 
ATOM 2779 C CA  . THR A 1 390 ? 27.362  -5.597  118.780 1.00 0.00 ? 390 THR A CA  1 
ATOM 2780 C C   . THR A 1 390 ? 28.713  -6.080  119.298 1.00 0.00 ? 390 THR A C   1 
ATOM 2781 O O   . THR A 1 390 ? 29.772  -5.687  118.789 1.00 0.00 ? 390 THR A O   1 
ATOM 2782 C CB  . THR A 1 390 ? 26.563  -6.787  118.245 1.00 0.00 ? 390 THR A CB  1 
ATOM 2783 O OG1 . THR A 1 390 ? 25.231  -6.387  117.959 1.00 0.00 ? 390 THR A OG1 1 
ATOM 2784 C CG2 . THR A 1 390 ? 26.487  -7.950  119.237 1.00 0.00 ? 390 THR A CG2 1 
ATOM 2785 N N   . THR A 1 391 ? 28.651  -6.924  120.301 1.00 0.00 ? 391 THR A N   1 
ATOM 2786 C CA  . THR A 1 391 ? 29.858  -7.472  120.919 1.00 0.00 ? 391 THR A CA  1 
ATOM 2787 C C   . THR A 1 391 ? 29.639  -8.923  121.300 1.00 0.00 ? 391 THR A C   1 
ATOM 2788 O O   . THR A 1 391 ? 28.503  -9.360  121.538 1.00 0.00 ? 391 THR A O   1 
ATOM 2789 C CB  . THR A 1 391 ? 30.222  -6.664  122.154 1.00 0.00 ? 391 THR A CB  1 
ATOM 2790 O OG1 . THR A 1 391 ? 30.337  -5.292  121.808 1.00 0.00 ? 391 THR A OG1 1 
ATOM 2791 C CG2 . THR A 1 391 ? 31.551  -7.097  122.773 1.00 0.00 ? 391 THR A CG2 1 
ATOM 2792 N N   . GLY A 1 392 ? 30.750  -9.614  121.355 1.00 0.00 ? 392 GLY A N   1 
ATOM 2793 C CA  . GLY A 1 392 ? 30.760  -11.039 121.622 1.00 0.00 ? 392 GLY A CA  1 
ATOM 2794 C C   . GLY A 1 392 ? 30.386  -11.730 120.324 1.00 0.00 ? 392 GLY A C   1 
ATOM 2795 O O   . GLY A 1 392 ? 30.305  -11.095 119.263 1.00 0.00 ? 392 GLY A O   1 
ATOM 2796 N N   . GLU A 1 393 ? 30.154  -13.006 120.420 1.00 0.00 ? 393 GLU A N   1 
ATOM 2797 C CA  . GLU A 1 393 ? 29.806  -13.800 119.250 1.00 0.00 ? 393 GLU A CA  1 
ATOM 2798 C C   . GLU A 1 393 ? 28.649  -14.734 119.602 1.00 0.00 ? 393 GLU A C   1 
ATOM 2799 O O   . GLU A 1 393 ? 28.854  -15.924 119.877 1.00 0.00 ? 393 GLU A O   1 
ATOM 2800 C CB  . GLU A 1 393 ? 31.059  -14.545 118.792 1.00 0.00 ? 393 GLU A CB  1 
ATOM 2801 C CG  . GLU A 1 393 ? 32.319  -13.680 118.940 1.00 0.00 ? 393 GLU A CG  1 
ATOM 2802 C CD  . GLU A 1 393 ? 33.498  -14.153 118.088 1.00 0.00 ? 393 GLU A CD  1 
ATOM 2803 O OE1 . GLU A 1 393 ? 33.454  -14.047 116.803 1.00 0.00 ? 393 GLU A OE1 1 
ATOM 2804 O OE2 . GLU A 1 393 ? 34.541  -14.654 118.658 1.00 0.00 ? 393 GLU A OE2 1 
ATOM 2805 N N   . THR A 1 394 ? 27.468  -14.130 119.577 1.00 0.00 ? 394 THR A N   1 
ATOM 2806 C CA  . THR A 1 394 ? 26.197  -14.810 119.878 1.00 0.00 ? 394 THR A CA  1 
ATOM 2807 C C   . THR A 1 394 ? 25.123  -14.410 118.856 1.00 0.00 ? 394 THR A C   1 
ATOM 2808 O O   . THR A 1 394 ? 24.697  -13.246 118.800 1.00 0.00 ? 394 THR A O   1 
ATOM 2809 C CB  . THR A 1 394 ? 25.709  -14.423 121.275 1.00 0.00 ? 394 THR A CB  1 
ATOM 2810 O OG1 . THR A 1 394 ? 26.713  -14.707 122.237 1.00 0.00 ? 394 THR A OG1 1 
ATOM 2811 C CG2 . THR A 1 394 ? 24.446  -15.177 121.695 1.00 0.00 ? 394 THR A CG2 1 
ATOM 2812 N N   . PRO A 1 395 ? 24.657  -15.347 118.017 1.00 0.00 ? 395 PRO A N   1 
ATOM 2813 C CA  . PRO A 1 395 ? 23.637  -15.055 117.007 1.00 0.00 ? 395 PRO A CA  1 
ATOM 2814 C C   . PRO A 1 395 ? 22.339  -14.590 117.623 1.00 0.00 ? 395 PRO A C   1 
ATOM 2815 O O   . PRO A 1 395 ? 22.064  -14.928 118.815 1.00 0.00 ? 395 PRO A O   1 
ATOM 2816 C CB  . PRO A 1 395 ? 23.450  -16.378 116.297 1.00 0.00 ? 395 PRO A CB  1 
ATOM 2817 C CG  . PRO A 1 395 ? 24.381  -17.397 116.943 1.00 0.00 ? 395 PRO A CG  1 
ATOM 2818 C CD  . PRO A 1 395 ? 25.142  -16.729 118.043 1.00 0.00 ? 395 PRO A CD  1 
ATOM 2819 N N   . GLU A 1 396 ? 21.593  -13.834 116.829 1.00 0.00 ? 396 GLU A N   1 
ATOM 2820 C CA  . GLU A 1 396 ? 20.241  -13.366 117.197 1.00 0.00 ? 396 GLU A CA  1 
ATOM 2821 C C   . GLU A 1 396 ? 19.257  -14.025 116.246 1.00 0.00 ? 396 GLU A C   1 
ATOM 2822 O O   . GLU A 1 396 ? 19.593  -14.346 115.097 1.00 0.00 ? 396 GLU A O   1 
ATOM 2823 C CB  . GLU A 1 396 ? 20.103  -11.848 117.063 1.00 0.00 ? 396 GLU A CB  1 
ATOM 2824 C CG  . GLU A 1 396 ? 18.646  -11.419 116.828 1.00 0.00 ? 396 GLU A CG  1 
ATOM 2825 C CD  . GLU A 1 396 ? 18.260  -10.125 117.550 1.00 0.00 ? 396 GLU A CD  1 
ATOM 2826 O OE1 . GLU A 1 396 ? 18.265  -10.072 118.839 1.00 0.00 ? 396 GLU A OE1 1 
ATOM 2827 O OE2 . GLU A 1 396 ? 17.924  -9.083  116.865 1.00 0.00 ? 396 GLU A OE2 1 
ATOM 2828 N N   . ARG A 1 397 ? 18.045  -14.228 116.708 1.00 0.00 ? 397 ARG A N   1 
ATOM 2829 C CA  . ARG A 1 397 ? 17.069  -14.913 115.873 1.00 0.00 ? 397 ARG A CA  1 
ATOM 2830 C C   . ARG A 1 397 ? 15.655  -14.580 116.205 1.00 0.00 ? 397 ARG A C   1 
ATOM 2831 O O   . ARG A 1 397 ? 15.375  -13.882 117.191 1.00 0.00 ? 397 ARG A O   1 
ATOM 2832 C CB  . ARG A 1 397 ? 17.226  -16.427 116.037 1.00 0.00 ? 397 ARG A CB  1 
ATOM 2833 C CG  . ARG A 1 397 ? 17.412  -16.855 117.497 1.00 0.00 ? 397 ARG A CG  1 
ATOM 2834 C CD  . ARG A 1 397 ? 18.854  -17.246 117.833 1.00 0.00 ? 397 ARG A CD  1 
ATOM 2835 N NE  . ARG A 1 397 ? 18.991  -17.836 119.175 1.00 0.00 ? 397 ARG A NE  1 
ATOM 2836 C CZ  . ARG A 1 397 ? 20.139  -18.322 119.671 1.00 0.00 ? 397 ARG A CZ  1 
ATOM 2837 N NH1 . ARG A 1 397 ? 21.269  -18.298 118.950 1.00 0.00 ? 397 ARG A NH1 1 
ATOM 2838 N NH2 . ARG A 1 397 ? 20.260  -18.860 120.893 1.00 0.00 ? 397 ARG A NH2 1 
ATOM 2839 N N   . PHE A 1 398 ? 14.829  -15.106 115.355 1.00 0.00 ? 398 PHE A N   1 
ATOM 2840 C CA  . PHE A 1 398 ? 13.413  -14.950 115.451 1.00 0.00 ? 398 PHE A CA  1 
ATOM 2841 C C   . PHE A 1 398 ? 12.726  -16.177 114.912 1.00 0.00 ? 398 PHE A C   1 
ATOM 2842 O O   . PHE A 1 398 ? 13.195  -16.800 113.945 1.00 0.00 ? 398 PHE A O   1 
ATOM 2843 C CB  . PHE A 1 398 ? 12.953  -13.731 114.644 1.00 0.00 ? 398 PHE A CB  1 
ATOM 2844 C CG  . PHE A 1 398 ? 13.437  -13.726 113.181 1.00 0.00 ? 398 PHE A CG  1 
ATOM 2845 C CD1 . PHE A 1 398 ? 14.658  -13.124 112.848 1.00 0.00 ? 398 PHE A CD1 1 
ATOM 2846 C CD2 . PHE A 1 398 ? 12.656  -14.317 112.174 1.00 0.00 ? 398 PHE A CD2 1 
ATOM 2847 C CE1 . PHE A 1 398 ? 15.093  -13.106 111.515 1.00 0.00 ? 398 PHE A CE1 1 
ATOM 2848 C CE2 . PHE A 1 398 ? 13.092  -14.296 110.842 1.00 0.00 ? 398 PHE A CE2 1 
ATOM 2849 C CZ  . PHE A 1 398 ? 14.309  -13.690 110.513 1.00 0.00 ? 398 PHE A CZ  1 
ATOM 2850 N N   . THR A 1 399 ? 11.648  -16.469 115.569 1.00 0.00 ? 399 THR A N   1 
ATOM 2851 C CA  . THR A 1 399 ? 10.783  -17.563 115.213 1.00 0.00 ? 399 THR A CA  1 
ATOM 2852 C C   . THR A 1 399 ? 9.605   -17.003 114.430 1.00 0.00 ? 399 THR A C   1 
ATOM 2853 O O   . THR A 1 399 ? 8.573   -16.633 115.007 1.00 0.00 ? 399 THR A O   1 
ATOM 2854 C CB  . THR A 1 399 ? 10.250  -18.250 116.471 1.00 0.00 ? 399 THR A CB  1 
ATOM 2855 O OG1 . THR A 1 399 ? 11.315  -18.840 117.196 1.00 0.00 ? 399 THR A OG1 1 
ATOM 2856 C CG2 . THR A 1 399 ? 9.236   -19.355 116.162 1.00 0.00 ? 399 THR A CG2 1 
ATOM 2857 N N   . TYR A 1 400 ? 9.793   -16.956 113.141 1.00 0.00 ? 400 TYR A N   1 
ATOM 2858 C CA  . TYR A 1 400 ? 8.791   -16.431 112.217 1.00 0.00 ? 400 TYR A CA  1 
ATOM 2859 C C   . TYR A 1 400 ? 7.476   -17.202 112.351 1.00 0.00 ? 400 TYR A C   1 
ATOM 2860 O O   . TYR A 1 400 ? 7.440   -18.433 112.209 1.00 0.00 ? 400 TYR A O   1 
ATOM 2861 C CB  . TYR A 1 400 ? 9.277   -16.556 110.785 1.00 0.00 ? 400 TYR A CB  1 
ATOM 2862 C CG  . TYR A 1 400 ? 8.391   -15.802 109.797 1.00 0.00 ? 400 TYR A CG  1 
ATOM 2863 C CD1 . TYR A 1 400 ? 8.597   -14.436 109.577 1.00 0.00 ? 400 TYR A CD1 1 
ATOM 2864 C CD2 . TYR A 1 400 ? 7.371   -16.475 109.116 1.00 0.00 ? 400 TYR A CD2 1 
ATOM 2865 C CE1 . TYR A 1 400 ? 7.784   -13.743 108.675 1.00 0.00 ? 400 TYR A CE1 1 
ATOM 2866 C CE2 . TYR A 1 400 ? 6.557   -15.782 108.214 1.00 0.00 ? 400 TYR A CE2 1 
ATOM 2867 C CZ  . TYR A 1 400 ? 6.763   -14.415 107.993 1.00 0.00 ? 400 TYR A CZ  1 
ATOM 2868 O OH  . TYR A 1 400 ? 5.972   -13.741 107.117 1.00 0.00 ? 400 TYR A OH  1 
ATOM 2869 N N   . ILE A 1 401 ? 6.438   -16.432 112.622 1.00 0.00 ? 401 ILE A N   1 
ATOM 2870 C CA  . ILE A 1 401 ? 5.072   -16.945 112.769 1.00 0.00 ? 401 ILE A CA  1 
ATOM 2871 C C   . ILE A 1 401 ? 4.164   -16.269 111.722 1.00 0.00 ? 401 ILE A C   1 
ATOM 2872 O O   . ILE A 1 401 ? 3.780   -15.099 111.870 1.00 0.00 ? 401 ILE A O   1 
ATOM 2873 C CB  . ILE A 1 401 ? 4.558   -16.656 114.179 1.00 0.00 ? 401 ILE A CB  1 
ATOM 2874 C CG1 . ILE A 1 401 ? 5.414   -17.315 115.273 1.00 0.00 ? 401 ILE A CG1 1 
ATOM 2875 C CG2 . ILE A 1 401 ? 3.131   -17.158 114.410 1.00 0.00 ? 401 ILE A CG2 1 
ATOM 2876 C CD1 . ILE A 1 401 ? 4.930   -16.995 116.688 1.00 0.00 ? 401 ILE A CD1 1 
ATOM 2877 N N   . ALA A 1 402 ? 3.865   -17.050 110.701 1.00 0.00 ? 402 ALA A N   1 
ATOM 2878 C CA  . ALA A 1 402 ? 3.042   -16.616 109.543 1.00 0.00 ? 402 ALA A CA  1 
ATOM 2879 C C   . ALA A 1 402 ? 1.739   -16.012 110.016 1.00 0.00 ? 402 ALA A C   1 
ATOM 2880 O O   . ALA A 1 402 ? 1.547   -15.775 111.218 1.00 0.00 ? 402 ALA A O   1 
ATOM 2881 C CB  . ALA A 1 402 ? 2.738   -17.812 108.642 1.00 0.00 ? 402 ALA A CB  1 
ATOM 2882 N N   . HIS A 1 403 ? 0.904   -15.789 109.033 1.00 0.00 ? 403 HIS A N   1 
ATOM 2883 C CA  . HIS A 1 403 ? -0.419  -15.223 109.236 1.00 0.00 ? 403 HIS A CA  1 
ATOM 2884 C C   . HIS A 1 403 ? -1.489  -16.286 108.852 1.00 0.00 ? 403 HIS A C   1 
ATOM 2885 O O   . HIS A 1 403 ? -2.596  -16.307 109.410 1.00 0.00 ? 403 HIS A O   1 
ATOM 2886 C CB  . HIS A 1 403 ? -0.562  -13.935 108.396 1.00 0.00 ? 403 HIS A CB  1 
ATOM 2887 C CG  . HIS A 1 403 ? 0.095   -12.664 109.011 1.00 0.00 ? 403 HIS A CG  1 
ATOM 2888 N ND1 . HIS A 1 403 ? 0.641   -12.631 110.301 1.00 0.00 ? 403 HIS A ND1 1 
ATOM 2889 C CD2 . HIS A 1 403 ? 0.281   -11.402 108.511 1.00 0.00 ? 403 HIS A CD2 1 
ATOM 2890 C CE1 . HIS A 1 403 ? 1.113   -11.408 110.528 1.00 0.00 ? 403 HIS A CE1 1 
ATOM 2891 N NE2 . HIS A 1 403 ? 0.905   -10.667 109.471 1.00 0.00 ? 403 HIS A NE2 1 
ATOM 2892 N N   . GLN A 1 404 ? -1.143  -17.182 107.895 1.00 0.00 ? 404 GLN A N   1 
ATOM 2893 C CA  . GLN A 1 404 ? -2.076  -18.271 107.440 1.00 0.00 ? 404 GLN A CA  1 
ATOM 2894 C C   . GLN A 1 404 ? -2.434  -19.144 108.626 1.00 0.00 ? 404 GLN A C   1 
ATOM 2895 O O   . GLN A 1 404 ? -1.659  -19.269 109.587 1.00 0.00 ? 404 GLN A O   1 
ATOM 2896 C CB  . GLN A 1 404 ? -1.473  -19.144 106.334 1.00 0.00 ? 404 GLN A CB  1 
ATOM 2897 C CG  . GLN A 1 404 ? 0.025   -18.963 106.128 1.00 0.00 ? 404 GLN A CG  1 
ATOM 2898 C CD  . GLN A 1 404 ? 0.633   -20.096 105.295 1.00 0.00 ? 404 GLN A CD  1 
ATOM 2899 O OE1 . GLN A 1 404 ? 0.094   -20.449 104.245 1.00 0.00 ? 404 GLN A OE1 1 
ATOM 2900 N NE2 . GLN A 1 404 ? 1.731   -20.700 105.706 1.00 0.00 ? 404 GLN A NE2 1 
ATOM 2901 N N   . ASP A 1 405 ? -3.603  -19.714 108.503 1.00 0.00 ? 405 ASP A N   1 
ATOM 2902 C CA  . ASP A 1 405 ? -4.164  -20.563 109.538 1.00 0.00 ? 405 ASP A CA  1 
ATOM 2903 C C   . ASP A 1 405 ? -4.545  -21.922 108.956 1.00 0.00 ? 405 ASP A C   1 
ATOM 2904 O O   . ASP A 1 405 ? -5.694  -22.137 108.540 1.00 0.00 ? 405 ASP A O   1 
ATOM 2905 C CB  . ASP A 1 405 ? -5.375  -19.861 110.144 1.00 0.00 ? 405 ASP A CB  1 
ATOM 2906 C CG  . ASP A 1 405 ? -5.001  -18.526 110.797 1.00 0.00 ? 405 ASP A CG  1 
ATOM 2907 O OD1 . ASP A 1 405 ? -4.547  -18.506 112.004 1.00 0.00 ? 405 ASP A OD1 1 
ATOM 2908 O OD2 . ASP A 1 405 ? -5.131  -17.422 110.140 1.00 0.00 ? 405 ASP A OD2 1 
ATOM 2909 N N   . THR A 1 406 ? -3.540  -22.777 108.953 1.00 0.00 ? 406 THR A N   1 
ATOM 2910 C CA  . THR A 1 406 ? -3.650  -24.172 108.508 1.00 0.00 ? 406 THR A CA  1 
ATOM 2911 C C   . THR A 1 406 ? -3.073  -25.073 109.602 1.00 0.00 ? 406 THR A C   1 
ATOM 2912 O O   . THR A 1 406 ? -3.321  -26.288 109.624 1.00 0.00 ? 406 THR A O   1 
ATOM 2913 C CB  . THR A 1 406 ? -2.872  -24.392 107.204 1.00 0.00 ? 406 THR A CB  1 
ATOM 2914 O OG1 . THR A 1 406 ? -1.487  -24.169 107.418 1.00 0.00 ? 406 THR A OG1 1 
ATOM 2915 C CG2 . THR A 1 406 ? -3.317  -23.465 106.072 1.00 0.00 ? 406 THR A CG2 1 
ATOM 2916 N N   . GLY A 1 407 ? -2.320  -24.417 110.477 1.00 0.00 ? 407 GLY A N   1 
ATOM 2917 C CA  . GLY A 1 407 ? -1.657  -25.055 111.630 1.00 0.00 ? 407 GLY A CA  1 
ATOM 2918 C C   . GLY A 1 407 ? -2.704  -25.592 112.596 1.00 0.00 ? 407 GLY A C   1 
ATOM 2919 O O   . GLY A 1 407 ? -3.913  -25.437 112.378 1.00 0.00 ? 407 GLY A O   1 
ATOM 2920 N N   . ARG A 1 408 ? -2.208  -26.203 113.682 1.00 0.00 ? 408 ARG A N   1 
ATOM 2921 C CA  . ARG A 1 408 ? -3.082  -26.899 114.643 1.00 0.00 ? 408 ARG A CA  1 
ATOM 2922 C C   . ARG A 1 408 ? -2.647  -26.695 116.114 1.00 0.00 ? 408 ARG A C   1 
ATOM 2923 O O   . ARG A 1 408 ? -1.470  -26.415 116.402 1.00 0.00 ? 408 ARG A O   1 
ATOM 2924 C CB  . ARG A 1 408 ? -3.038  -28.402 114.389 1.00 0.00 ? 408 ARG A CB  1 
ATOM 2925 C CG  . ARG A 1 408 ? -3.346  -28.768 112.942 1.00 0.00 ? 408 ARG A CG  1 
ATOM 2926 C CD  . ARG A 1 408 ? -4.828  -28.664 112.612 1.00 0.00 ? 408 ARG A CD  1 
ATOM 2927 N NE  . ARG A 1 408 ? -5.147  -29.107 111.254 1.00 0.00 ? 408 ARG A NE  1 
ATOM 2928 C CZ  . ARG A 1 408 ? -6.290  -29.712 110.920 1.00 0.00 ? 408 ARG A CZ  1 
ATOM 2929 N NH1 . ARG A 1 408 ? -7.231  -29.963 111.840 1.00 0.00 ? 408 ARG A NH1 1 
ATOM 2930 N NH2 . ARG A 1 408 ? -6.591  -30.107 109.677 1.00 0.00 ? 408 ARG A NH2 1 
ATOM 2931 N N   . TYR A 1 409 ? -3.676  -26.869 116.967 1.00 0.00 ? 409 TYR A N   1 
ATOM 2932 C CA  . TYR A 1 409 ? -3.567  -26.887 118.445 1.00 0.00 ? 409 TYR A CA  1 
ATOM 2933 C C   . TYR A 1 409 ? -3.727  -28.349 118.878 1.00 0.00 ? 409 TYR A C   1 
ATOM 2934 O O   . TYR A 1 409 ? -4.797  -28.759 119.354 1.00 0.00 ? 409 TYR A O   1 
ATOM 2935 C CB  . TYR A 1 409 ? -4.702  -26.020 119.056 1.00 0.00 ? 409 TYR A CB  1 
ATOM 2936 C CG  . TYR A 1 409 ? -4.558  -25.770 120.564 1.00 0.00 ? 409 TYR A CG  1 
ATOM 2937 C CD1 . TYR A 1 409 ? -5.138  -26.654 121.484 1.00 0.00 ? 409 TYR A CD1 1 
ATOM 2938 C CD2 . TYR A 1 409 ? -3.853  -24.650 121.026 1.00 0.00 ? 409 TYR A CD2 1 
ATOM 2939 C CE1 . TYR A 1 409 ? -5.015  -26.419 122.860 1.00 0.00 ? 409 TYR A CE1 1 
ATOM 2940 C CE2 . TYR A 1 409 ? -3.730  -24.415 122.403 1.00 0.00 ? 409 TYR A CE2 1 
ATOM 2941 C CZ  . TYR A 1 409 ? -4.311  -25.299 123.320 1.00 0.00 ? 409 TYR A CZ  1 
ATOM 2942 O OH  . TYR A 1 409 ? -4.193  -25.070 124.656 1.00 0.00 ? 409 TYR A OH  1 
ATOM 2943 N N   . PRO A 1 410 ? -2.684  -29.180 118.732 1.00 0.00 ? 410 PRO A N   1 
ATOM 2944 C CA  . PRO A 1 410 ? -2.782  -30.607 119.019 1.00 0.00 ? 410 PRO A CA  1 
ATOM 2945 C C   . PRO A 1 410 ? -3.183  -30.873 120.444 1.00 0.00 ? 410 PRO A C   1 
ATOM 2946 O O   . PRO A 1 410 ? -3.074  -32.053 120.905 1.00 0.00 ? 410 PRO A O   1 
ATOM 2947 C CB  . PRO A 1 410 ? -1.396  -31.134 118.739 1.00 0.00 ? 410 PRO A CB  1 
ATOM 2948 C CG  . PRO A 1 410 ? -0.534  -29.964 118.287 1.00 0.00 ? 410 PRO A CG  1 
ATOM 2949 C CD  . PRO A 1 410 ? -1.368  -28.722 118.282 1.00 0.00 ? 410 PRO A CD  1 
ATOM 2950 N N   . GLU A 1 411 ? -3.639  -29.828 121.098 1.00 0.00 ? 411 GLU A N   1 
ATOM 2951 C CA  . GLU A 1 411 ? -4.029  -29.894 122.512 1.00 0.00 ? 411 GLU A CA  1 
ATOM 2952 C C   . GLU A 1 411 ? -5.551  -29.782 122.669 1.00 0.00 ? 411 GLU A C   1 
ATOM 2953 O O   . GLU A 1 411 ? -6.061  -29.472 123.758 1.00 0.00 ? 411 GLU A O   1 
ATOM 2954 C CB  . GLU A 1 411 ? -3.340  -28.754 123.268 1.00 0.00 ? 411 GLU A CB  1 
ATOM 2955 C CG  . GLU A 1 411 ? -1.895  -29.093 123.654 1.00 0.00 ? 411 GLU A CG  1 
ATOM 2956 C CD  . GLU A 1 411 ? -0.841  -28.182 123.003 1.00 0.00 ? 411 GLU A CD  1 
ATOM 2957 O OE1 . GLU A 1 411 ? -1.165  -27.394 122.034 1.00 0.00 ? 411 GLU A OE1 1 
ATOM 2958 O OE2 . GLU A 1 411 ? 0.378   -28.203 123.430 1.00 0.00 ? 411 GLU A OE2 1 
ATOM 2959 N N   . GLY A 1 412 ? -6.239  -30.049 121.571 1.00 0.00 ? 412 GLY A N   1 
ATOM 2960 C CA  . GLY A 1 412 ? -7.709  -29.981 121.519 1.00 0.00 ? 412 GLY A CA  1 
ATOM 2961 C C   . GLY A 1 412 ? -8.263  -30.894 120.420 1.00 0.00 ? 412 GLY A C   1 
ATOM 2962 O O   . GLY A 1 412 ? -9.042  -30.457 119.561 1.00 0.00 ? 412 GLY A O   1 
ATOM 2963 N N   . ASP A 1 413 ? -7.833  -32.137 120.485 1.00 0.00 ? 413 ASP A N   1 
ATOM 2964 C CA  . ASP A 1 413 ? -8.269  -33.195 119.560 1.00 0.00 ? 413 ASP A CA  1 
ATOM 2965 C C   . ASP A 1 413 ? -8.795  -34.361 120.383 1.00 0.00 ? 413 ASP A C   1 
ATOM 2966 O O   . ASP A 1 413 ? -9.009  -34.243 121.596 1.00 0.00 ? 413 ASP A O   1 
ATOM 2967 C CB  . ASP A 1 413 ? -7.090  -33.691 118.716 1.00 0.00 ? 413 ASP A CB  1 
ATOM 2968 C CG  . ASP A 1 413 ? -6.316  -32.566 118.030 1.00 0.00 ? 413 ASP A CG  1 
ATOM 2969 O OD1 . ASP A 1 413 ? -5.406  -31.922 118.678 1.00 0.00 ? 413 ASP A OD1 1 
ATOM 2970 O OD2 . ASP A 1 413 ? -6.570  -32.266 116.802 1.00 0.00 ? 413 ASP A OD2 1 
ATOM 2971 N N   . TRP A 1 414 ? -9.001  -35.474 119.718 1.00 0.00 ? 414 TRP A N   1 
ATOM 2972 C CA  . TRP A 1 414 ? -9.444  -36.687 120.405 1.00 0.00 ? 414 TRP A CA  1 
ATOM 2973 C C   . TRP A 1 414 ? -9.953  -37.734 119.426 1.00 0.00 ? 414 TRP A C   1 
ATOM 2974 O O   . TRP A 1 414 ? -10.530 -37.403 118.377 1.00 0.00 ? 414 TRP A O   1 
ATOM 2975 C CB  . TRP A 1 414 ? -10.526 -36.356 121.444 1.00 0.00 ? 414 TRP A CB  1 
ATOM 2976 C CG  . TRP A 1 414 ? -11.901 -35.998 120.865 1.00 0.00 ? 414 TRP A CG  1 
ATOM 2977 C CD1 . TRP A 1 414 ? -12.918 -36.835 120.615 1.00 0.00 ? 414 TRP A CD1 1 
ATOM 2978 C CD2 . TRP A 1 414 ? -12.320 -34.689 120.509 1.00 0.00 ? 414 TRP A CD2 1 
ATOM 2979 N NE1 . TRP A 1 414 ? -14.002 -36.045 120.111 1.00 0.00 ? 414 TRP A NE1 1 
ATOM 2980 C CE2 . TRP A 1 414 ? -13.632 -34.789 120.064 1.00 0.00 ? 414 TRP A CE2 1 
ATOM 2981 C CE3 . TRP A 1 414 ? -11.702 -33.435 120.534 1.00 0.00 ? 414 TRP A CE3 1 
ATOM 2982 C CZ2 . TRP A 1 414 ? -14.386 -33.684 119.650 1.00 0.00 ? 414 TRP A CZ2 1 
ATOM 2983 C CZ3 . TRP A 1 414 ? -12.464 -32.329 120.105 1.00 0.00 ? 414 TRP A CZ3 1 
ATOM 2984 C CH2 . TRP A 1 414 ? -13.744 -32.449 119.686 1.00 0.00 ? 414 TRP A CH2 1 
ATOM 2985 N N   . ILE A 1 415 ? -9.689  -38.950 119.852 1.00 0.00 ? 415 ILE A N   1 
ATOM 2986 C CA  . ILE A 1 415 ? -10.055 -40.178 119.150 1.00 0.00 ? 415 ILE A CA  1 
ATOM 2987 C C   . ILE A 1 415 ? -10.977 -41.001 120.057 1.00 0.00 ? 415 ILE A C   1 
ATOM 2988 O O   . ILE A 1 415 ? -10.548 -41.516 121.101 1.00 0.00 ? 415 ILE A O   1 
ATOM 2989 C CB  . ILE A 1 415 ? -8.783  -40.978 118.846 1.00 0.00 ? 415 ILE A CB  1 
ATOM 2990 C CG1 . ILE A 1 415 ? -7.723  -40.161 118.100 1.00 0.00 ? 415 ILE A CG1 1 
ATOM 2991 C CG2 . ILE A 1 415 ? -9.040  -42.211 117.983 1.00 0.00 ? 415 ILE A CG2 1 
ATOM 2992 C CD1 . ILE A 1 415 ? -6.352  -40.841 118.071 1.00 0.00 ? 415 ILE A CD1 1 
ATOM 2993 N N   . GLN A 1 416 ? -12.231 -41.098 119.639 1.00 0.00 ? 416 GLN A N   1 
ATOM 2994 C CA  . GLN A 1 416 ? -13.262 -41.837 120.395 1.00 0.00 ? 416 GLN A CA  1 
ATOM 2995 C C   . GLN A 1 416 ? -13.882 -42.952 119.537 1.00 0.00 ? 416 GLN A C   1 
ATOM 2996 O O   . GLN A 1 416 ? -13.575 -43.083 118.342 1.00 0.00 ? 416 GLN A O   1 
ATOM 2997 C CB  . GLN A 1 416 ? -14.362 -40.888 120.867 1.00 0.00 ? 416 GLN A CB  1 
ATOM 2998 C CG  . GLN A 1 416 ? -14.901 -39.986 119.761 1.00 0.00 ? 416 GLN A CG  1 
ATOM 2999 C CD  . GLN A 1 416 ? -16.018 -39.065 120.251 1.00 0.00 ? 416 GLN A CD  1 
ATOM 3000 O OE1 . GLN A 1 416 ? -17.182 -39.461 120.258 1.00 0.00 ? 416 GLN A OE1 1 
ATOM 3001 N NE2 . GLN A 1 416 ? -15.732 -37.847 120.670 1.00 0.00 ? 416 GLN A NE2 1 
ATOM 3002 N N   . ASN A 1 417 ? -14.750 -43.708 120.199 1.00 0.00 ? 417 ASN A N   1 
ATOM 3003 C CA  . ASN A 1 417 ? -15.412 -44.899 119.626 1.00 0.00 ? 417 ASN A CA  1 
ATOM 3004 C C   . ASN A 1 417 ? -16.368 -44.583 118.482 1.00 0.00 ? 417 ASN A C   1 
ATOM 3005 O O   . ASN A 1 417 ? -16.918 -43.474 118.393 1.00 0.00 ? 417 ASN A O   1 
ATOM 3006 C CB  . ASN A 1 417 ? -16.249 -45.628 120.678 1.00 0.00 ? 417 ASN A CB  1 
ATOM 3007 C CG  . ASN A 1 417 ? -15.983 -47.133 120.683 1.00 0.00 ? 417 ASN A CG  1 
ATOM 3008 O OD1 . ASN A 1 417 ? -16.893 -47.925 120.444 1.00 0.00 ? 417 ASN A OD1 1 
ATOM 3009 N ND2 . ASN A 1 417 ? -14.768 -47.578 120.940 1.00 0.00 ? 417 ASN A ND2 1 
ATOM 3010 N N   . ILE A 1 418 ? -16.507 -45.619 117.670 1.00 0.00 ? 418 ILE A N   1 
ATOM 3011 C CA  . ILE A 1 418 ? -17.394 -45.641 116.510 1.00 0.00 ? 418 ILE A CA  1 
ATOM 3012 C C   . ILE A 1 418 ? -18.836 -45.672 117.004 1.00 0.00 ? 418 ILE A C   1 
ATOM 3013 O O   . ILE A 1 418 ? -19.780 -45.453 116.233 1.00 0.00 ? 418 ILE A O   1 
ATOM 3014 C CB  . ILE A 1 418 ? -17.117 -46.895 115.674 1.00 0.00 ? 418 ILE A CB  1 
ATOM 3015 C CG1 . ILE A 1 418 ? -15.642 -47.057 115.298 1.00 0.00 ? 418 ILE A CG1 1 
ATOM 3016 C CG2 . ILE A 1 418 ? -17.883 -46.915 114.351 1.00 0.00 ? 418 ILE A CG2 1 
ATOM 3017 C CD1 . ILE A 1 418 ? -15.431 -47.973 114.090 1.00 0.00 ? 418 ILE A CD1 1 
ATOM 3018 N N   . ASN A 1 419 ? -18.942 -45.950 118.292 1.00 0.00 ? 419 ASN A N   1 
ATOM 3019 C CA  . ASN A 1 419 ? -20.228 -46.018 118.997 1.00 0.00 ? 419 ASN A CA  1 
ATOM 3020 C C   . ASN A 1 419 ? -20.715 -44.600 119.304 1.00 0.00 ? 419 ASN A C   1 
ATOM 3021 O O   . ASN A 1 419 ? -21.921 -44.364 119.474 1.00 0.00 ? 419 ASN A O   1 
ATOM 3022 C CB  . ASN A 1 419 ? -20.064 -46.783 120.315 1.00 0.00 ? 419 ASN A CB  1 
ATOM 3023 C CG  . ASN A 1 419 ? -19.977 -48.301 120.129 1.00 0.00 ? 419 ASN A CG  1 
ATOM 3024 O OD1 . ASN A 1 419 ? -20.958 -48.931 119.736 1.00 0.00 ? 419 ASN A OD1 1 
ATOM 3025 N ND2 . ASN A 1 419 ? -18.849 -48.936 120.392 1.00 0.00 ? 419 ASN A ND2 1 
ATOM 3026 N N   . PHE A 1 420 ? -19.742 -43.704 119.359 1.00 0.00 ? 420 PHE A N   1 
ATOM 3027 C CA  . PHE A 1 420 ? -19.965 -42.278 119.652 1.00 0.00 ? 420 PHE A CA  1 
ATOM 3028 C C   . PHE A 1 420 ? -20.497 -42.120 121.076 1.00 0.00 ? 420 PHE A C   1 
ATOM 3029 O O   . PHE A 1 420 ? -19.814 -41.577 121.956 1.00 0.00 ? 420 PHE A O   1 
ATOM 3030 C CB  . PHE A 1 420 ? -20.982 -41.687 118.673 1.00 0.00 ? 420 PHE A CB  1 
ATOM 3031 C CG  . PHE A 1 420 ? -20.719 -40.211 118.373 1.00 0.00 ? 420 PHE A CG  1 
ATOM 3032 C CD1 . PHE A 1 420 ? -19.409 -39.720 118.396 1.00 0.00 ? 420 PHE A CD1 1 
ATOM 3033 C CD2 . PHE A 1 420 ? -21.785 -39.351 118.080 1.00 0.00 ? 420 PHE A CD2 1 
ATOM 3034 C CE1 . PHE A 1 420 ? -19.163 -38.369 118.124 1.00 0.00 ? 420 PHE A CE1 1 
ATOM 3035 C CE2 . PHE A 1 420 ? -21.539 -37.999 117.808 1.00 0.00 ? 420 PHE A CE2 1 
ATOM 3036 C CZ  . PHE A 1 420 ? -20.227 -37.508 117.831 1.00 0.00 ? 420 PHE A CZ  1 
ATOM 3037 N N   . ASN A 1 421 ? -21.706 -42.607 121.233 1.00 0.00 ? 421 ASN A N   1 
ATOM 3038 C CA  . ASN A 1 421 ? -22.433 -42.600 122.507 1.00 0.00 ? 421 ASN A CA  1 
ATOM 3039 C C   . ASN A 1 421 ? -21.800 -41.659 123.521 1.00 0.00 ? 421 ASN A C   1 
ATOM 3040 O O   . ASN A 1 421 ? -21.209 -42.098 124.518 1.00 0.00 ? 421 ASN A O   1 
ATOM 3041 C CB  . ASN A 1 421 ? -22.423 -44.001 123.121 1.00 0.00 ? 421 ASN A CB  1 
ATOM 3042 C CG  . ASN A 1 421 ? -23.777 -44.703 123.032 1.00 0.00 ? 421 ASN A CG  1 
ATOM 3043 O OD1 . ASN A 1 421 ? -24.543 -44.685 123.995 1.00 0.00 ? 421 ASN A OD1 1 
ATOM 3044 N ND2 . ASN A 1 421 ? -24.123 -45.329 121.923 1.00 0.00 ? 421 ASN A ND2 1 
ATOM 3045 N N   . LEU A 1 422 ? -21.935 -40.386 123.252 1.00 0.00 ? 422 LEU A N   1 
ATOM 3046 C CA  . LEU A 1 422 ? -21.468 -39.367 124.181 1.00 0.00 ? 422 LEU A CA  1 
ATOM 3047 C C   . LEU A 1 422 ? -22.650 -39.016 125.082 1.00 0.00 ? 422 LEU A C   1 
ATOM 3048 O O   . LEU A 1 422 ? -23.800 -39.373 124.791 1.00 0.00 ? 422 LEU A O   1 
ATOM 3049 C CB  . LEU A 1 422 ? -20.930 -38.155 123.421 1.00 0.00 ? 422 LEU A CB  1 
ATOM 3050 C CG  . LEU A 1 422 ? -22.026 -37.279 122.823 1.00 0.00 ? 422 LEU A CG  1 
ATOM 3051 C CD1 . LEU A 1 422 ? -21.760 -35.785 123.011 1.00 0.00 ? 422 LEU A CD1 1 
ATOM 3052 C CD2 . LEU A 1 422 ? -22.195 -37.487 121.318 1.00 0.00 ? 422 LEU A CD2 1 
ATOM 3053 N N   . PRO A 1 423 ? -22.440 -38.320 126.189 1.00 0.00 ? 423 PRO A N   1 
ATOM 3054 C CA  . PRO A 1 423 ? -21.125 -37.844 126.527 1.00 0.00 ? 423 PRO A CA  1 
ATOM 3055 C C   . PRO A 1 423 ? -20.150 -38.989 126.632 1.00 0.00 ? 423 PRO A C   1 
ATOM 3056 O O   . PRO A 1 423 ? -20.362 -39.899 127.496 1.00 0.00 ? 423 PRO A O   1 
ATOM 3057 C CB  . PRO A 1 423 ? -21.326 -37.149 127.855 1.00 0.00 ? 423 PRO A CB  1 
ATOM 3058 C CG  . PRO A 1 423 ? -22.799 -37.257 128.219 1.00 0.00 ? 423 PRO A CG  1 
ATOM 3059 C CD  . PRO A 1 423 ? -23.507 -38.005 127.136 1.00 0.00 ? 423 PRO A CD  1 
ATOM 3060 N N   . VAL A 1 424 ? -19.139 -38.902 125.772 1.00 0.00 ? 424 VAL A N   1 
ATOM 3061 C CA  . VAL A 1 424 ? -18.069 -39.915 125.651 1.00 0.00 ? 424 VAL A CA  1 
ATOM 3062 C C   . VAL A 1 424 ? -17.488 -40.234 127.026 1.00 0.00 ? 424 VAL A C   1 
ATOM 3063 O O   . VAL A 1 424 ? -17.368 -39.349 127.883 1.00 0.00 ? 424 VAL A O   1 
ATOM 3064 C CB  . VAL A 1 424 ? -16.943 -39.407 124.736 1.00 0.00 ? 424 VAL A CB  1 
ATOM 3065 C CG1 . VAL A 1 424 ? -16.042 -38.368 125.406 1.00 0.00 ? 424 VAL A CG1 1 
ATOM 3066 C CG2 . VAL A 1 424 ? -16.001 -40.522 124.267 1.00 0.00 ? 424 VAL A CG2 1 
ATOM 3067 N N   . THR A 1 425 ? -17.150 -41.504 127.186 1.00 0.00 ? 425 THR A N   1 
ATOM 3068 C CA  . THR A 1 425 ? -16.573 -42.035 128.437 1.00 0.00 ? 425 THR A CA  1 
ATOM 3069 C C   . THR A 1 425 ? -15.085 -42.332 128.235 1.00 0.00 ? 425 THR A C   1 
ATOM 3070 O O   . THR A 1 425 ? -14.648 -42.676 127.129 1.00 0.00 ? 425 THR A O   1 
ATOM 3071 C CB  . THR A 1 425 ? -17.297 -43.322 128.851 1.00 0.00 ? 425 THR A CB  1 
ATOM 3072 O OG1 . THR A 1 425 ? -18.651 -43.038 129.175 1.00 0.00 ? 425 THR A OG1 1 
ATOM 3073 C CG2 . THR A 1 425 ? -16.671 -43.996 130.076 1.00 0.00 ? 425 THR A CG2 1 
ATOM 3074 N N   . ASN A 1 426 ? -14.352 -42.187 129.322 1.00 0.00 ? 426 ASN A N   1 
ATOM 3075 C CA  . ASN A 1 426 ? -12.896 -42.394 129.339 1.00 0.00 ? 426 ASN A CA  1 
ATOM 3076 C C   . ASN A 1 426 ? -12.494 -43.518 128.377 1.00 0.00 ? 426 ASN A C   1 
ATOM 3077 O O   . ASN A 1 426 ? -11.949 -43.273 127.294 1.00 0.00 ? 426 ASN A O   1 
ATOM 3078 C CB  . ASN A 1 426 ? -12.429 -42.762 130.749 1.00 0.00 ? 426 ASN A CB  1 
ATOM 3079 C CG  . ASN A 1 426 ? -10.930 -42.531 130.956 1.00 0.00 ? 426 ASN A CG  1 
ATOM 3080 O OD1 . ASN A 1 426 ? -10.501 -41.393 131.140 1.00 0.00 ? 426 ASN A OD1 1 
ATOM 3081 N ND2 . ASN A 1 426 ? -10.096 -43.554 130.934 1.00 0.00 ? 426 ASN A ND2 1 
ATOM 3082 N N   . ASP A 1 427 ? -12.776 -44.723 128.805 1.00 0.00 ? 427 ASP A N   1 
ATOM 3083 C CA  . ASP A 1 427 ? -12.445 -45.943 128.057 1.00 0.00 ? 427 ASP A CA  1 
ATOM 3084 C C   . ASP A 1 427 ? -12.891 -45.860 126.588 1.00 0.00 ? 427 ASP A C   1 
ATOM 3085 O O   . ASP A 1 427 ? -12.624 -46.770 125.789 1.00 0.00 ? 427 ASP A O   1 
ATOM 3086 C CB  . ASP A 1 427 ? -13.161 -47.140 128.684 1.00 0.00 ? 427 ASP A CB  1 
ATOM 3087 C CG  . ASP A 1 427 ? -12.778 -47.369 130.147 1.00 0.00 ? 427 ASP A CG  1 
ATOM 3088 O OD1 . ASP A 1 427 ? -11.772 -48.122 130.436 1.00 0.00 ? 427 ASP A OD1 1 
ATOM 3089 O OD2 . ASP A 1 427 ? -13.460 -46.812 131.090 1.00 0.00 ? 427 ASP A OD2 1 
ATOM 3090 N N   . ASN A 1 428 ? -13.556 -44.768 126.244 1.00 0.00 ? 428 ASN A N   1 
ATOM 3091 C CA  . ASN A 1 428 ? -14.111 -44.593 124.886 1.00 0.00 ? 428 ASN A CA  1 
ATOM 3092 C C   . ASN A 1 428 ? -13.544 -43.363 124.155 1.00 0.00 ? 428 ASN A C   1 
ATOM 3093 O O   . ASN A 1 428 ? -14.100 -42.902 123.148 1.00 0.00 ? 428 ASN A O   1 
ATOM 3094 C CB  . ASN A 1 428 ? -15.631 -44.406 124.962 1.00 0.00 ? 428 ASN A CB  1 
ATOM 3095 C CG  . ASN A 1 428 ? -16.407 -45.726 124.934 1.00 0.00 ? 428 ASN A CG  1 
ATOM 3096 O OD1 . ASN A 1 428 ? -16.756 -46.258 125.988 1.00 0.00 ? 428 ASN A OD1 1 
ATOM 3097 N ND2 . ASN A 1 428 ? -16.706 -46.293 123.780 1.00 0.00 ? 428 ASN A ND2 1 
ATOM 3098 N N   . VAL A 1 429 ? -12.437 -42.829 124.641 1.00 0.00 ? 429 VAL A N   1 
ATOM 3099 C CA  . VAL A 1 429 ? -11.832 -41.634 124.014 1.00 0.00 ? 429 VAL A CA  1 
ATOM 3100 C C   . VAL A 1 429 ? -10.361 -41.482 124.378 1.00 0.00 ? 429 VAL A C   1 
ATOM 3101 O O   . VAL A 1 429 ? -10.000 -41.483 125.556 1.00 0.00 ? 429 VAL A O   1 
ATOM 3102 C CB  . VAL A 1 429 ? -12.540 -40.369 124.502 1.00 0.00 ? 429 VAL A CB  1 
ATOM 3103 C CG1 . VAL A 1 429 ? -11.911 -39.084 123.957 1.00 0.00 ? 429 VAL A CG1 1 
ATOM 3104 C CG2 . VAL A 1 429 ? -14.014 -40.315 124.104 1.00 0.00 ? 429 VAL A CG2 1 
ATOM 3105 N N   . LEU A 1 430 ? -9.541  -41.345 123.345 1.00 0.00 ? 430 LEU A N   1 
ATOM 3106 C CA  . LEU A 1 430 ? -8.091  -41.137 123.519 1.00 0.00 ? 430 LEU A CA  1 
ATOM 3107 C C   . LEU A 1 430 ? -7.771  -39.659 123.290 1.00 0.00 ? 430 LEU A C   1 
ATOM 3108 O O   . LEU A 1 430 ? -7.817  -39.170 122.146 1.00 0.00 ? 430 LEU A O   1 
ATOM 3109 C CB  . LEU A 1 430 ? -7.293  -41.994 122.539 1.00 0.00 ? 430 LEU A CB  1 
ATOM 3110 C CG  . LEU A 1 430 ? -5.782  -41.904 122.782 1.00 0.00 ? 430 LEU A CG  1 
ATOM 3111 C CD1 . LEU A 1 430 ? -5.380  -42.263 124.215 1.00 0.00 ? 430 LEU A CD1 1 
ATOM 3112 C CD2 . LEU A 1 430 ? -4.972  -42.834 121.880 1.00 0.00 ? 430 LEU A CD2 1 
ATOM 3113 N N   . LEU A 1 431 ? -7.450  -39.010 124.403 1.00 0.00 ? 431 LEU A N   1 
ATOM 3114 C CA  . LEU A 1 431 ? -7.195  -37.563 124.435 1.00 0.00 ? 431 LEU A CA  1 
ATOM 3115 C C   . LEU A 1 431 ? -5.708  -37.208 124.460 1.00 0.00 ? 431 LEU A C   1 
ATOM 3116 O O   . LEU A 1 431 ? -4.841  -38.094 124.564 1.00 0.00 ? 431 LEU A O   1 
ATOM 3117 C CB  . LEU A 1 431 ? -7.840  -36.935 125.668 1.00 0.00 ? 431 LEU A CB  1 
ATOM 3118 C CG  . LEU A 1 431 ? -9.363  -37.059 125.662 1.00 0.00 ? 431 LEU A CG  1 
ATOM 3119 C CD1 . LEU A 1 431 ? -9.837  -38.509 125.760 1.00 0.00 ? 431 LEU A CD1 1 
ATOM 3120 C CD2 . LEU A 1 431 ? -10.027 -36.321 126.825 1.00 0.00 ? 431 LEU A CD2 1 
ATOM 3121 N N   . PRO A 1 432 ? -5.378  -35.897 124.356 1.00 0.00 ? 432 PRO A N   1 
ATOM 3122 C CA  . PRO A 1 432 ? -3.993  -35.435 124.357 1.00 0.00 ? 432 PRO A CA  1 
ATOM 3123 C C   . PRO A 1 432 ? -3.316  -35.718 125.677 1.00 0.00 ? 432 PRO A C   1 
ATOM 3124 O O   . PRO A 1 432 ? -2.101  -36.082 125.686 1.00 0.00 ? 432 PRO A O   1 
ATOM 3125 C CB  . PRO A 1 432 ? -4.107  -33.925 124.171 1.00 0.00 ? 432 PRO A CB  1 
ATOM 3126 C CG  . PRO A 1 432 ? -5.607  -33.580 124.090 1.00 0.00 ? 432 PRO A CG  1 
ATOM 3127 C CD  . PRO A 1 432 ? -6.401  -34.831 124.220 1.00 0.00 ? 432 PRO A CD  1 
ATOM 3128 N N   . THR A 1 433 ? -4.069  -35.517 126.736 1.00 0.00 ? 433 THR A N   1 
ATOM 3129 C CA  . THR A 1 433 ? -3.558  -35.688 128.103 1.00 0.00 ? 433 THR A CA  1 
ATOM 3130 C C   . THR A 1 433 ? -3.154  -37.168 128.377 1.00 0.00 ? 433 THR A C   1 
ATOM 3131 O O   . THR A 1 433 ? -2.190  -37.441 129.105 1.00 0.00 ? 433 THR A O   1 
ATOM 3132 C CB  . THR A 1 433 ? -4.617  -35.319 129.131 1.00 0.00 ? 433 THR A CB  1 
ATOM 3133 O OG1 . THR A 1 433 ? -4.856  -33.919 129.103 1.00 0.00 ? 433 THR A OG1 1 
ATOM 3134 C CG2 . THR A 1 433 ? -4.214  -35.684 130.561 1.00 0.00 ? 433 THR A CG2 1 
ATOM 3135 N N   . ASP A 1 434 ? -3.919  -38.076 127.777 1.00 0.00 ? 434 ASP A N   1 
ATOM 3136 C CA  . ASP A 1 434 ? -3.758  -39.553 127.995 1.00 0.00 ? 434 ASP A CA  1 
ATOM 3137 C C   . ASP A 1 434 ? -2.448  -40.074 127.363 1.00 0.00 ? 434 ASP A C   1 
ATOM 3138 O O   . ASP A 1 434 ? -2.284  -40.052 126.129 1.00 0.00 ? 434 ASP A O   1 
ATOM 3139 C CB  . ASP A 1 434 ? -4.945  -40.297 127.407 1.00 0.00 ? 434 ASP A CB  1 
ATOM 3140 C CG  . ASP A 1 434 ? -6.247  -39.999 128.146 1.00 0.00 ? 434 ASP A CG  1 
ATOM 3141 O OD1 . ASP A 1 434 ? -6.405  -40.401 129.362 1.00 0.00 ? 434 ASP A OD1 1 
ATOM 3142 O OD2 . ASP A 1 434 ? -7.185  -39.341 127.557 1.00 0.00 ? 434 ASP A OD2 1 
ATOM 3143 N N   . PRO A 1 435 ? -1.488  -40.566 128.193 1.00 0.00 ? 435 PRO A N   1 
ATOM 3144 C CA  . PRO A 1 435 ? -0.195  -41.074 127.694 1.00 0.00 ? 435 PRO A CA  1 
ATOM 3145 C C   . PRO A 1 435 ? -0.386  -42.267 126.748 1.00 0.00 ? 435 PRO A C   1 
ATOM 3146 O O   . PRO A 1 435 ? -1.468  -42.932 126.799 1.00 0.00 ? 435 PRO A O   1 
ATOM 3147 C CB  . PRO A 1 435 ? 0.551   -41.479 128.965 1.00 0.00 ? 435 PRO A CB  1 
ATOM 3148 C CG  . PRO A 1 435 ? -0.375  -41.175 130.169 1.00 0.00 ? 435 PRO A CG  1 
ATOM 3149 C CD  . PRO A 1 435 ? -1.662  -40.613 129.667 1.00 0.00 ? 435 PRO A CD  1 
ATOM 3150 N N   . ILE A 1 436 ? 0.661   -42.491 125.944 1.00 0.00 ? 436 ILE A N   1 
ATOM 3151 C CA  . ILE A 1 436 ? 0.709   -43.580 124.943 1.00 0.00 ? 436 ILE A CA  1 
ATOM 3152 C C   . ILE A 1 436 ? 2.090   -44.206 124.929 1.00 0.00 ? 436 ILE A C   1 
ATOM 3153 O O   . ILE A 1 436 ? 3.083   -43.564 124.547 1.00 0.00 ? 436 ILE A O   1 
ATOM 3154 C CB  . ILE A 1 436 ? 0.403   -43.023 123.556 1.00 0.00 ? 436 ILE A CB  1 
ATOM 3155 C CG1 . ILE A 1 436 ? -1.005  -42.443 123.451 1.00 0.00 ? 436 ILE A CG1 1 
ATOM 3156 C CG2 . ILE A 1 436 ? 0.503   -44.075 122.451 1.00 0.00 ? 436 ILE A CG2 1 
ATOM 3157 C CD1 . ILE A 1 436 ? -2.096  -43.464 123.775 1.00 0.00 ? 436 ILE A CD1 1 
ATOM 3158 N N   . GLY A 1 437 ? 2.116   -45.435 125.349 1.00 0.00 ? 437 GLY A N   1 
ATOM 3159 C CA  . GLY A 1 437 ? 3.341   -46.185 125.470 1.00 0.00 ? 437 GLY A CA  1 
ATOM 3160 C C   . GLY A 1 437 ? 3.737   -46.289 126.945 1.00 0.00 ? 437 GLY A C   1 
ATOM 3161 O O   . GLY A 1 437 ? 4.781   -46.848 127.286 1.00 0.00 ? 437 GLY A O   1 
ATOM 3162 N N   . GLY A 1 438 ? 2.889   -45.728 127.786 1.00 0.00 ? 438 GLY A N   1 
ATOM 3163 C CA  . GLY A 1 438 ? 3.063   -45.807 129.254 1.00 0.00 ? 438 GLY A CA  1 
ATOM 3164 C C   . GLY A 1 438 ? 3.801   -44.565 129.802 1.00 0.00 ? 438 GLY A C   1 
ATOM 3165 O O   . GLY A 1 438 ? 3.656   -44.200 130.973 1.00 0.00 ? 438 GLY A O   1 
ATOM 3166 N N   . LYS A 1 439 ? 4.593   -43.955 128.948 1.00 0.00 ? 439 LYS A N   1 
ATOM 3167 C CA  . LYS A 1 439 ? 5.351   -42.739 129.314 1.00 0.00 ? 439 LYS A CA  1 
ATOM 3168 C C   . LYS A 1 439 ? 4.394   -41.545 129.343 1.00 0.00 ? 439 LYS A C   1 
ATOM 3169 O O   . LYS A 1 439 ? 3.396   -41.509 128.608 1.00 0.00 ? 439 LYS A O   1 
ATOM 3170 C CB  . LYS A 1 439 ? 6.460   -42.490 128.303 1.00 0.00 ? 439 LYS A CB  1 
ATOM 3171 C CG  . LYS A 1 439 ? 7.575   -43.535 128.368 1.00 0.00 ? 439 LYS A CG  1 
ATOM 3172 C CD  . LYS A 1 439 ? 8.745   -43.219 127.434 1.00 0.00 ? 439 LYS A CD  1 
ATOM 3173 C CE  . LYS A 1 439 ? 9.845   -44.281 127.472 1.00 0.00 ? 439 LYS A CE  1 
ATOM 3174 N NZ  . LYS A 1 439 ? 10.969  -43.977 126.575 1.00 0.00 ? 439 LYS A NZ  1 
ATOM 3175 N N   . THR A 1 440 ? 4.729   -40.611 130.195 1.00 0.00 ? 440 THR A N   1 
ATOM 3176 C CA  . THR A 1 440 ? 3.923   -39.402 130.418 1.00 0.00 ? 440 THR A CA  1 
ATOM 3177 C C   . THR A 1 440 ? 3.923   -38.507 129.190 1.00 0.00 ? 440 THR A C   1 
ATOM 3178 O O   . THR A 1 440 ? 2.951   -38.489 128.418 1.00 0.00 ? 440 THR A O   1 
ATOM 3179 C CB  . THR A 1 440 ? 4.553   -38.538 131.515 1.00 0.00 ? 440 THR A CB  1 
ATOM 3180 O OG1 . THR A 1 440 ? 4.573   -39.241 132.740 1.00 0.00 ? 440 THR A OG1 1 
ATOM 3181 C CG2 . THR A 1 440 ? 3.804   -37.222 131.739 1.00 0.00 ? 440 THR A CG2 1 
ATOM 3182 N N   . GLY A 1 441 ? 5.019   -37.809 129.091 1.00 0.00 ? 441 GLY A N   1 
ATOM 3183 C CA  . GLY A 1 441 ? 5.257   -36.761 128.096 1.00 0.00 ? 441 GLY A CA  1 
ATOM 3184 C C   . GLY A 1 441 ? 4.656   -37.097 126.716 1.00 0.00 ? 441 GLY A C   1 
ATOM 3185 O O   . GLY A 1 441 ? 4.334   -36.197 125.933 1.00 0.00 ? 441 GLY A O   1 
ATOM 3186 N N   . ILE A 1 442 ? 4.519   -38.373 126.434 1.00 0.00 ? 442 ILE A N   1 
ATOM 3187 C CA  . ILE A 1 442 ? 4.084   -38.829 125.078 1.00 0.00 ? 442 ILE A CA  1 
ATOM 3188 C C   . ILE A 1 442 ? 2.557   -38.732 124.897 1.00 0.00 ? 442 ILE A C   1 
ATOM 3189 O O   . ILE A 1 442 ? 1.793   -38.730 125.876 1.00 0.00 ? 442 ILE A O   1 
ATOM 3190 C CB  . ILE A 1 442 ? 4.528   -40.252 124.822 1.00 0.00 ? 442 ILE A CB  1 
ATOM 3191 C CG1 . ILE A 1 442 ? 6.045   -40.419 124.899 1.00 0.00 ? 442 ILE A CG1 1 
ATOM 3192 C CG2 . ILE A 1 442 ? 4.132   -40.754 123.429 1.00 0.00 ? 442 ILE A CG2 1 
ATOM 3193 C CD1 . ILE A 1 442 ? 6.807   -39.365 124.093 1.00 0.00 ? 442 ILE A CD1 1 
ATOM 3194 N N   . ASN A 1 443 ? 2.199   -38.667 123.612 1.00 0.00 ? 443 ASN A N   1 
ATOM 3195 C CA  . ASN A 1 443 ? 0.811   -38.564 123.139 1.00 0.00 ? 443 ASN A CA  1 
ATOM 3196 C C   . ASN A 1 443 ? 0.600   -39.423 121.929 1.00 0.00 ? 443 ASN A C   1 
ATOM 3197 O O   . ASN A 1 443 ? 1.528   -40.091 121.450 1.00 0.00 ? 443 ASN A O   1 
ATOM 3198 C CB  . ASN A 1 443 ? 0.542   -37.138 122.604 1.00 0.00 ? 443 ASN A CB  1 
ATOM 3199 C CG  . ASN A 1 443 ? 0.045   -36.175 123.684 1.00 0.00 ? 443 ASN A CG  1 
ATOM 3200 O OD1 . ASN A 1 443 ? 0.832   -35.723 124.514 1.00 0.00 ? 443 ASN A OD1 1 
ATOM 3201 N ND2 . ASN A 1 443 ? -1.228  -35.829 123.725 1.00 0.00 ? 443 ASN A ND2 1 
ATOM 3202 N N   . TYR A 1 444 ? -0.619  -39.382 121.477 1.00 0.00 ? 444 TYR A N   1 
ATOM 3203 C CA  . TYR A 1 444 ? -0.999  -39.946 120.212 1.00 0.00 ? 444 TYR A CA  1 
ATOM 3204 C C   . TYR A 1 444 ? -0.918  -38.833 119.190 1.00 0.00 ? 444 TYR A C   1 
ATOM 3205 O O   . TYR A 1 444 ? -0.820  -39.081 117.980 1.00 0.00 ? 444 TYR A O   1 
ATOM 3206 C CB  . TYR A 1 444 ? -2.398  -40.553 120.307 1.00 0.00 ? 444 TYR A CB  1 
ATOM 3207 C CG  . TYR A 1 444 ? -3.502  -39.537 120.073 1.00 0.00 ? 444 TYR A CG  1 
ATOM 3208 C CD1 . TYR A 1 444 ? -3.870  -38.665 121.098 1.00 0.00 ? 444 TYR A CD1 1 
ATOM 3209 C CD2 . TYR A 1 444 ? -4.146  -39.480 118.833 1.00 0.00 ? 444 TYR A CD2 1 
ATOM 3210 C CE1 . TYR A 1 444 ? -4.884  -37.728 120.884 1.00 0.00 ? 444 TYR A CE1 1 
ATOM 3211 C CE2 . TYR A 1 444 ? -5.161  -38.544 118.618 1.00 0.00 ? 444 TYR A CE2 1 
ATOM 3212 C CZ  . TYR A 1 444 ? -5.530  -37.667 119.644 1.00 0.00 ? 444 TYR A CZ  1 
ATOM 3213 O OH  . TYR A 1 444 ? -6.516  -36.754 119.436 1.00 0.00 ? 444 TYR A OH  1 
ATOM 3214 N N   . THR A 1 445 ? -0.952  -37.607 119.753 1.00 0.00 ? 445 THR A N   1 
ATOM 3215 C CA  . THR A 1 445 ? -0.758  -36.370 118.998 1.00 0.00 ? 445 THR A CA  1 
ATOM 3216 C C   . THR A 1 445 ? 0.668   -36.317 118.496 1.00 0.00 ? 445 THR A C   1 
ATOM 3217 O O   . THR A 1 445 ? 0.932   -35.880 117.367 1.00 0.00 ? 445 THR A O   1 
ATOM 3218 C CB  . THR A 1 445 ? -0.980  -35.137 119.908 1.00 0.00 ? 445 THR A CB  1 
ATOM 3219 O OG1 . THR A 1 445 ? -0.109  -35.197 121.028 1.00 0.00 ? 445 THR A OG1 1 
ATOM 3220 C CG2 . THR A 1 445 ? -2.409  -35.041 120.446 1.00 0.00 ? 445 THR A CG2 1 
ATOM 3221 N N   . ASN A 1 446 ? 1.534   -36.781 119.367 1.00 0.00 ? 446 ASN A N   1 
ATOM 3222 C CA  . ASN A 1 446 ? 2.969   -36.827 119.130 1.00 0.00 ? 446 ASN A CA  1 
ATOM 3223 C C   . ASN A 1 446 ? 3.304   -37.839 118.007 1.00 0.00 ? 446 ASN A C   1 
ATOM 3224 O O   . ASN A 1 446 ? 4.296   -37.680 117.285 1.00 0.00 ? 446 ASN A O   1 
ATOM 3225 C CB  . ASN A 1 446 ? 3.696   -37.313 120.402 1.00 0.00 ? 446 ASN A CB  1 
ATOM 3226 C CG  . ASN A 1 446 ? 3.805   -36.239 121.497 1.00 0.00 ? 446 ASN A CG  1 
ATOM 3227 O OD1 . ASN A 1 446 ? 2.838   -35.989 122.216 1.00 0.00 ? 446 ASN A OD1 1 
ATOM 3228 N ND2 . ASN A 1 446 ? 4.942   -35.589 121.674 1.00 0.00 ? 446 ASN A ND2 1 
ATOM 3229 N N   . ILE A 1 447 ? 2.442   -38.856 117.897 1.00 0.00 ? 447 ILE A N   1 
ATOM 3230 C CA  . ILE A 1 447 ? 2.662   -40.021 116.968 1.00 0.00 ? 447 ILE A CA  1 
ATOM 3231 C C   . ILE A 1 447 ? 1.630   -40.026 115.792 1.00 0.00 ? 447 ILE A C   1 
ATOM 3232 O O   . ILE A 1 447 ? 1.670   -40.907 114.918 1.00 0.00 ? 447 ILE A O   1 
ATOM 3233 C CB  . ILE A 1 447 ? 2.450   -41.333 117.739 1.00 0.00 ? 447 ILE A CB  1 
ATOM 3234 C CG1 . ILE A 1 447 ? 3.463   -41.540 118.866 1.00 0.00 ? 447 ILE A CG1 1 
ATOM 3235 C CG2 . ILE A 1 447 ? 2.547   -42.570 116.850 1.00 0.00 ? 447 ILE A CG2 1 
ATOM 3236 C CD1 . ILE A 1 447 ? 4.912   -41.482 118.382 1.00 0.00 ? 447 ILE A CD1 1 
ATOM 3237 N N   . PHE A 1 448 ? 0.790   -39.038 115.828 1.00 0.00 ? 448 PHE A N   1 
ATOM 3238 C CA  . PHE A 1 448 ? -0.393  -38.887 114.919 1.00 0.00 ? 448 PHE A CA  1 
ATOM 3239 C C   . PHE A 1 448 ? 0.027   -38.333 113.503 1.00 0.00 ? 448 PHE A C   1 
ATOM 3240 O O   . PHE A 1 448 ? 0.861   -37.425 113.393 1.00 0.00 ? 448 PHE A O   1 
ATOM 3241 C CB  . PHE A 1 448 ? -1.325  -37.870 115.561 1.00 0.00 ? 448 PHE A CB  1 
ATOM 3242 C CG  . PHE A 1 448 ? -2.765  -37.976 115.147 1.00 0.00 ? 448 PHE A CG  1 
ATOM 3243 C CD1 . PHE A 1 448 ? -3.446  -39.194 115.249 1.00 0.00 ? 448 PHE A CD1 1 
ATOM 3244 C CD2 . PHE A 1 448 ? -3.420  -36.836 114.693 1.00 0.00 ? 448 PHE A CD2 1 
ATOM 3245 C CE1 . PHE A 1 448 ? -4.800  -39.265 114.897 1.00 0.00 ? 448 PHE A CE1 1 
ATOM 3246 C CE2 . PHE A 1 448 ? -4.771  -36.900 114.344 1.00 0.00 ? 448 PHE A CE2 1 
ATOM 3247 C CZ  . PHE A 1 448 ? -5.465  -38.114 114.447 1.00 0.00 ? 448 PHE A CZ  1 
ATOM 3248 N N   . ASN A 1 449 ? -0.612  -38.915 112.452 1.00 0.00 ? 449 ASN A N   1 
ATOM 3249 C CA  . ASN A 1 449 ? -0.418  -38.472 111.027 1.00 0.00 ? 449 ASN A CA  1 
ATOM 3250 C C   . ASN A 1 449 ? -1.744  -38.523 110.254 1.00 0.00 ? 449 ASN A C   1 
ATOM 3251 O O   . ASN A 1 449 ? -2.135  -39.573 109.721 1.00 0.00 ? 449 ASN A O   1 
ATOM 3252 C CB  . ASN A 1 449 ? 0.558   -39.389 110.280 1.00 0.00 ? 449 ASN A CB  1 
ATOM 3253 C CG  . ASN A 1 449 ? 0.755   -38.971 108.797 1.00 0.00 ? 449 ASN A CG  1 
ATOM 3254 O OD1 . ASN A 1 449 ? -0.015  -39.383 107.925 1.00 0.00 ? 449 ASN A OD1 1 
ATOM 3255 N ND2 . ASN A 1 449 ? 1.747   -38.163 108.461 1.00 0.00 ? 449 ASN A ND2 1 
ATOM 3256 N N   . THR A 1 450 ? -2.392  -37.377 110.218 1.00 0.00 ? 450 THR A N   1 
ATOM 3257 C CA  . THR A 1 450 ? -3.643  -37.193 109.471 1.00 0.00 ? 450 THR A CA  1 
ATOM 3258 C C   . THR A 1 450 ? -3.377  -36.413 108.217 1.00 0.00 ? 450 THR A C   1 
ATOM 3259 O O   . THR A 1 450 ? -3.491  -35.178 108.196 1.00 0.00 ? 450 THR A O   1 
ATOM 3260 C CB  . THR A 1 450 ? -4.658  -36.421 110.319 1.00 0.00 ? 450 THR A CB  1 
ATOM 3261 O OG1 . THR A 1 450 ? -4.163  -35.120 110.604 1.00 0.00 ? 450 THR A OG1 1 
ATOM 3262 C CG2 . THR A 1 450 ? -4.958  -37.099 111.658 1.00 0.00 ? 450 THR A CG2 1 
ATOM 3263 N N   . TYR A 1 451 ? -3.010  -37.150 107.228 1.00 0.00 ? 451 TYR A N   1 
ATOM 3264 C CA  . TYR A 1 451 ? -2.766  -36.634 105.911 1.00 0.00 ? 451 TYR A CA  1 
ATOM 3265 C C   . TYR A 1 451 ? -3.446  -37.509 104.913 1.00 0.00 ? 451 TYR A C   1 
ATOM 3266 O O   . TYR A 1 451 ? -3.001  -38.637 104.646 1.00 0.00 ? 451 TYR A O   1 
ATOM 3267 C CB  . TYR A 1 451 ? -1.274  -36.601 105.641 1.00 0.00 ? 451 TYR A CB  1 
ATOM 3268 C CG  . TYR A 1 451 ? -0.937  -36.093 104.245 1.00 0.00 ? 451 TYR A CG  1 
ATOM 3269 C CD1 . TYR A 1 451 ? -1.385  -34.833 103.832 1.00 0.00 ? 451 TYR A CD1 1 
ATOM 3270 C CD2 . TYR A 1 451 ? -0.181  -36.887 103.380 1.00 0.00 ? 451 TYR A CD2 1 
ATOM 3271 C CE1 . TYR A 1 451 ? -1.053  -34.358 102.559 1.00 0.00 ? 451 TYR A CE1 1 
ATOM 3272 C CE2 . TYR A 1 451 ? 0.147   -36.415 102.108 1.00 0.00 ? 451 TYR A CE2 1 
ATOM 3273 C CZ  . TYR A 1 451 ? -0.283  -35.149 101.698 1.00 0.00 ? 451 TYR A CZ  1 
ATOM 3274 O OH  . TYR A 1 451 ? 0.053   -34.684 100.466 1.00 0.00 ? 451 TYR A OH  1 
ATOM 3275 N N   . GLY A 1 452 ? -4.515  -36.987 104.416 1.00 0.00 ? 452 GLY A N   1 
ATOM 3276 C CA  . GLY A 1 452 ? -5.385  -37.701 103.542 1.00 0.00 ? 452 GLY A CA  1 
ATOM 3277 C C   . GLY A 1 452 ? -5.394  -37.069 102.178 1.00 0.00 ? 452 GLY A C   1 
ATOM 3278 O O   . GLY A 1 452 ? -4.954  -35.917 102.003 1.00 0.00 ? 452 GLY A O   1 
ATOM 3279 N N   . PRO A 1 453 ? -5.867  -37.781 101.192 1.00 0.00 ? 453 PRO A N   1 
ATOM 3280 C CA  . PRO A 1 453 ? -5.989  -37.249 99.867  1.00 0.00 ? 453 PRO A CA  1 
ATOM 3281 C C   . PRO A 1 453 ? -6.932  -36.047 99.859  1.00 0.00 ? 453 PRO A C   1 
ATOM 3282 O O   . PRO A 1 453 ? -7.295  -35.554 98.748  1.00 0.00 ? 453 PRO A O   1 
ATOM 3283 C CB  . PRO A 1 453 ? -6.551  -38.420 99.063  1.00 0.00 ? 453 PRO A CB  1 
ATOM 3284 C CG  . PRO A 1 453 ? -6.721  -39.606 100.032 1.00 0.00 ? 453 PRO A CG  1 
ATOM 3285 C CD  . PRO A 1 453 ? -6.286  -39.185 101.377 1.00 0.00 ? 453 PRO A CD  1 
ATOM 3286 N N   . LEU A 1 454 ? -7.289  -35.597 101.067 1.00 0.00 ? 454 LEU A N   1 
ATOM 3287 C CA  . LEU A 1 454 ? -8.260  -34.475 101.250 1.00 0.00 ? 454 LEU A CA  1 
ATOM 3288 C C   . LEU A 1 454 ? -7.574  -33.251 101.892 1.00 0.00 ? 454 LEU A C   1 
ATOM 3289 O O   . LEU A 1 454 ? -8.202  -32.201 102.098 1.00 0.00 ? 454 LEU A O   1 
ATOM 3290 C CB  . LEU A 1 454 ? -9.414  -34.911 102.152 1.00 0.00 ? 454 LEU A CB  1 
ATOM 3291 C CG  . LEU A 1 454 ? -10.308 -35.974 101.509 1.00 0.00 ? 454 LEU A CG  1 
ATOM 3292 C CD1 . LEU A 1 454 ? -11.569 -36.268 102.324 1.00 0.00 ? 454 LEU A CD1 1 
ATOM 3293 C CD2 . LEU A 1 454 ? -10.799 -35.583 100.114 1.00 0.00 ? 454 LEU A CD2 1 
ATOM 3294 N N   . THR A 1 455 ? -6.305  -33.425 102.193 1.00 0.00 ? 455 THR A N   1 
ATOM 3295 C CA  . THR A 1 455 ? -5.481  -32.361 102.795 1.00 0.00 ? 455 THR A CA  1 
ATOM 3296 C C   . THR A 1 455 ? -5.254  -31.208 101.788 1.00 0.00 ? 455 THR A C   1 
ATOM 3297 O O   . THR A 1 455 ? -4.680  -31.406 100.709 1.00 0.00 ? 455 THR A O   1 
ATOM 3298 C CB  . THR A 1 455 ? -4.110  -32.910 103.184 1.00 0.00 ? 455 THR A CB  1 
ATOM 3299 O OG1 . THR A 1 455 ? -4.257  -33.952 104.137 1.00 0.00 ? 455 THR A OG1 1 
ATOM 3300 C CG2 . THR A 1 455 ? -3.195  -31.851 103.801 1.00 0.00 ? 455 THR A CG2 1 
ATOM 3301 N N   . ALA A 1 456 ? -5.721  -30.031 102.198 1.00 0.00 ? 456 ALA A N   1 
ATOM 3302 C CA  . ALA A 1 456 ? -5.453  -28.755 101.484 1.00 0.00 ? 456 ALA A CA  1 
ATOM 3303 C C   . ALA A 1 456 ? -4.250  -28.066 102.136 1.00 0.00 ? 456 ALA A C   1 
ATOM 3304 O O   . ALA A 1 456 ? -4.025  -28.183 103.345 1.00 0.00 ? 456 ALA A O   1 
ATOM 3305 C CB  . ALA A 1 456 ? -6.680  -27.840 101.579 1.00 0.00 ? 456 ALA A CB  1 
ATOM 3306 N N   . LEU A 1 457 ? -3.466  -27.370 101.316 1.00 0.00 ? 457 LEU A N   1 
ATOM 3307 C CA  . LEU A 1 457 ? -2.170  -26.823 101.782 1.00 0.00 ? 457 LEU A CA  1 
ATOM 3308 C C   . LEU A 1 457 ? -1.783  -25.539 101.037 1.00 0.00 ? 457 LEU A C   1 
ATOM 3309 O O   . LEU A 1 457 ? -2.175  -25.328 99.879  1.00 0.00 ? 457 LEU A O   1 
ATOM 3310 C CB  . LEU A 1 457 ? -1.071  -27.856 101.580 1.00 0.00 ? 457 LEU A CB  1 
ATOM 3311 C CG  . LEU A 1 457 ? 0.020   -27.781 102.646 1.00 0.00 ? 457 LEU A CG  1 
ATOM 3312 C CD1 . LEU A 1 457 ? -0.535  -27.679 104.068 1.00 0.00 ? 457 LEU A CD1 1 
ATOM 3313 C CD2 . LEU A 1 457 ? 0.939   -29.004 102.645 1.00 0.00 ? 457 LEU A CD2 1 
ATOM 3314 N N   . ASN A 1 458 ? -0.985  -24.745 101.755 1.00 0.00 ? 458 ASN A N   1 
ATOM 3315 C CA  . ASN A 1 458 ? -0.382  -23.502 101.246 1.00 0.00 ? 458 ASN A CA  1 
ATOM 3316 C C   . ASN A 1 458 ? 1.134   -23.506 101.544 1.00 0.00 ? 458 ASN A C   1 
ATOM 3317 O O   . ASN A 1 458 ? 1.564   -23.815 102.665 1.00 0.00 ? 458 ASN A O   1 
ATOM 3318 C CB  . ASN A 1 458 ? -1.011  -22.290 101.948 1.00 0.00 ? 458 ASN A CB  1 
ATOM 3319 C CG  . ASN A 1 458 ? -2.500  -22.117 101.630 1.00 0.00 ? 458 ASN A CG  1 
ATOM 3320 O OD1 . ASN A 1 458 ? -2.869  -21.214 100.881 1.00 0.00 ? 458 ASN A OD1 1 
ATOM 3321 N ND2 . ASN A 1 458 ? -3.388  -22.940 102.158 1.00 0.00 ? 458 ASN A ND2 1 
ATOM 3322 N N   . ASN A 1 459 ? 1.893   -23.164 100.514 1.00 0.00 ? 459 ASN A N   1 
ATOM 3323 C CA  . ASN A 1 459 ? 3.379   -23.201 100.552 1.00 0.00 ? 459 ASN A CA  1 
ATOM 3324 C C   . ASN A 1 459 ? 3.920   -22.207 101.609 1.00 0.00 ? 459 ASN A C   1 
ATOM 3325 O O   . ASN A 1 459 ? 3.182   -21.348 102.114 1.00 0.00 ? 459 ASN A O   1 
ATOM 3326 C CB  . ASN A 1 459 ? 3.943   -22.864 99.173  1.00 0.00 ? 459 ASN A CB  1 
ATOM 3327 C CG  . ASN A 1 459 ? 5.441   -22.569 99.197  1.00 0.00 ? 459 ASN A CG  1 
ATOM 3328 O OD1 . ASN A 1 459 ? 5.838   -21.409 99.122  1.00 0.00 ? 459 ASN A OD1 1 
ATOM 3329 N ND2 . ASN A 1 459 ? 6.307   -23.560 99.298  1.00 0.00 ? 459 ASN A ND2 1 
ATOM 3330 N N   . VAL A 1 460 ? 5.224   -22.370 101.885 1.00 0.00 ? 460 VAL A N   1 
ATOM 3331 C CA  . VAL A 1 460 ? 5.951   -21.583 102.921 1.00 0.00 ? 460 VAL A CA  1 
ATOM 3332 C C   . VAL A 1 460 ? 6.257   -20.204 102.410 1.00 0.00 ? 460 VAL A C   1 
ATOM 3333 O O   . VAL A 1 460 ? 6.981   -20.044 101.408 1.00 0.00 ? 460 VAL A O   1 
ATOM 3334 C CB  . VAL A 1 460 ? 7.197   -22.345 103.381 1.00 0.00 ? 460 VAL A CB  1 
ATOM 3335 C CG1 . VAL A 1 460 ? 8.123   -21.503 104.260 1.00 0.00 ? 460 VAL A CG1 1 
ATOM 3336 C CG2 . VAL A 1 460 ? 6.865   -23.592 104.203 1.00 0.00 ? 460 VAL A CG2 1 
ATOM 3337 N N   . PRO A 1 461 ? 5.725   -19.185 103.068 1.00 0.00 ? 461 PRO A N   1 
ATOM 3338 C CA  . PRO A 1 461 ? 5.874   -17.808 102.626 1.00 0.00 ? 461 PRO A CA  1 
ATOM 3339 C C   . PRO A 1 461 ? 7.308   -17.345 102.705 1.00 0.00 ? 461 PRO A C   1 
ATOM 3340 O O   . PRO A 1 461 ? 8.140   -18.011 103.398 1.00 0.00 ? 461 PRO A O   1 
ATOM 3341 C CB  . PRO A 1 461 ? 5.048   -17.012 103.641 1.00 0.00 ? 461 PRO A CB  1 
ATOM 3342 C CG  . PRO A 1 461 ? 4.478   -18.025 104.670 1.00 0.00 ? 461 PRO A CG  1 
ATOM 3343 C CD  . PRO A 1 461 ? 4.924   -19.382 104.315 1.00 0.00 ? 461 PRO A CD  1 
ATOM 3344 N N   . PRO A 1 462 ? 7.665   -16.239 102.012 1.00 0.00 ? 462 PRO A N   1 
ATOM 3345 C CA  . PRO A 1 462 ? 8.991   -15.648 102.145 1.00 0.00 ? 462 PRO A CA  1 
ATOM 3346 C C   . PRO A 1 462 ? 9.218   -15.160 103.622 1.00 0.00 ? 462 PRO A C   1 
ATOM 3347 O O   . PRO A 1 462 ? 8.255   -14.603 104.242 1.00 0.00 ? 462 PRO A O   1 
ATOM 3348 C CB  . PRO A 1 462 ? 8.962   -14.466 101.156 1.00 0.00 ? 462 PRO A CB  1 
ATOM 3349 C CG  . PRO A 1 462 ? 7.547   -14.447 100.494 1.00 0.00 ? 462 PRO A CG  1 
ATOM 3350 C CD  . PRO A 1 462 ? 6.738   -15.560 101.051 1.00 0.00 ? 462 PRO A CD  1 
ATOM 3351 N N   . VAL A 1 463 ? 10.465  -15.400 104.101 1.00 0.00 ? 463 VAL A N   1 
ATOM 3352 C CA  . VAL A 1 463 ? 10.947  -14.962 105.478 1.00 0.00 ? 463 VAL A CA  1 
ATOM 3353 C C   . VAL A 1 463 ? 12.128  -13.982 105.311 1.00 0.00 ? 463 VAL A C   1 
ATOM 3354 O O   . VAL A 1 463 ? 13.295  -14.391 105.240 1.00 0.00 ? 463 VAL A O   1 
ATOM 3355 C CB  . VAL A 1 463 ? 11.461  -16.190 106.273 1.00 0.00 ? 463 VAL A CB  1 
ATOM 3356 C CG1 . VAL A 1 463 ? 11.618  -15.921 107.772 1.00 0.00 ? 463 VAL A CG1 1 
ATOM 3357 C CG2 . VAL A 1 463 ? 10.536  -17.405 106.165 1.00 0.00 ? 463 VAL A CG2 1 
ATOM 3358 N N   . TYR A 1 464 ? 11.780  -12.705 105.250 1.00 0.00 ? 464 TYR A N   1 
ATOM 3359 C CA  . TYR A 1 464 ? 12.744  -11.632 104.906 1.00 0.00 ? 464 TYR A CA  1 
ATOM 3360 C C   . TYR A 1 464 ? 13.205  -10.838 106.148 1.00 0.00 ? 464 TYR A C   1 
ATOM 3361 O O   . TYR A 1 464 ? 12.449  -10.652 107.109 1.00 0.00 ? 464 TYR A O   1 
ATOM 3362 C CB  . TYR A 1 464 ? 12.091  -10.617 103.983 1.00 0.00 ? 464 TYR A CB  1 
ATOM 3363 C CG  . TYR A 1 464 ? 12.693  -9.222  104.122 1.00 0.00 ? 464 TYR A CG  1 
ATOM 3364 C CD1 . TYR A 1 464 ? 12.452  -8.463  105.279 1.00 0.00 ? 464 TYR A CD1 1 
ATOM 3365 C CD2 . TYR A 1 464 ? 13.491  -8.705  103.101 1.00 0.00 ? 464 TYR A CD2 1 
ATOM 3366 C CE1 . TYR A 1 464 ? 13.021  -7.189  105.410 1.00 0.00 ? 464 TYR A CE1 1 
ATOM 3367 C CE2 . TYR A 1 464 ? 14.063  -7.435  103.234 1.00 0.00 ? 464 TYR A CE2 1 
ATOM 3368 C CZ  . TYR A 1 464 ? 13.830  -6.677  104.388 1.00 0.00 ? 464 TYR A CZ  1 
ATOM 3369 O OH  . TYR A 1 464 ? 14.392  -5.445  104.515 1.00 0.00 ? 464 TYR A OH  1 
ATOM 3370 N N   . PRO A 1 465 ? 14.477  -10.334 106.154 1.00 0.00 ? 465 PRO A N   1 
ATOM 3371 C CA  . PRO A 1 465 ? 15.441  -10.680 105.100 1.00 0.00 ? 465 PRO A CA  1 
ATOM 3372 C C   . PRO A 1 465 ? 15.792  -12.195 105.175 1.00 0.00 ? 465 PRO A C   1 
ATOM 3373 O O   . PRO A 1 465 ? 15.045  -13.034 104.574 1.00 0.00 ? 465 PRO A O   1 
ATOM 3374 C CB  . PRO A 1 465 ? 16.664  -9.807  105.424 1.00 0.00 ? 465 PRO A CB  1 
ATOM 3375 C CG  . PRO A 1 465 ? 16.330  -9.003  106.720 1.00 0.00 ? 465 PRO A CG  1 
ATOM 3376 C CD  . PRO A 1 465 ? 14.964  -9.374  107.187 1.00 0.00 ? 465 PRO A CD  1 
ATOM 3377 N N   . ASN A 1 466 ? 16.889  -12.454 105.895 1.00 0.00 ? 466 ASN A N   1 
ATOM 3378 C CA  . ASN A 1 466 ? 17.430  -13.838 106.159 1.00 0.00 ? 466 ASN A CA  1 
ATOM 3379 C C   . ASN A 1 466 ? 16.922  -14.843 105.070 1.00 0.00 ? 466 ASN A C   1 
ATOM 3380 O O   . ASN A 1 466 ? 17.573  -15.054 104.038 1.00 0.00 ? 466 ASN A O   1 
ATOM 3381 C CB  . ASN A 1 466 ? 17.068  -14.278 107.578 1.00 0.00 ? 466 ASN A CB  1 
ATOM 3382 C CG  . ASN A 1 466 ? 17.463  -13.251 108.641 1.00 0.00 ? 466 ASN A CG  1 
ATOM 3383 O OD1 . ASN A 1 466 ? 18.440  -13.455 109.360 1.00 0.00 ? 466 ASN A OD1 1 
ATOM 3384 N ND2 . ASN A 1 466 ? 16.756  -12.146 108.786 1.00 0.00 ? 466 ASN A ND2 1 
ATOM 3385 N N   . GLY A 1 467 ? 15.767  -15.439 105.340 1.00 0.00 ? 467 GLY A N   1 
ATOM 3386 C CA  . GLY A 1 467 ? 15.108  -16.453 104.446 1.00 0.00 ? 467 GLY A CA  1 
ATOM 3387 C C   . GLY A 1 467 ? 15.798  -16.571 103.053 1.00 0.00 ? 467 GLY A C   1 
ATOM 3388 O O   . GLY A 1 467 ? 16.504  -15.652 102.609 1.00 0.00 ? 467 GLY A O   1 
ATOM 3389 N N   . GLN A 1 468 ? 15.533  -17.735 102.421 1.00 0.00 ? 468 GLN A N   1 
ATOM 3390 C CA  . GLN A 1 468 ? 16.049  -18.113 101.065 1.00 0.00 ? 468 GLN A CA  1 
ATOM 3391 C C   . GLN A 1 468 ? 15.026  -17.688 99.984  1.00 0.00 ? 468 GLN A C   1 
ATOM 3392 O O   . GLN A 1 468 ? 13.860  -17.404 100.287 1.00 0.00 ? 468 GLN A O   1 
ATOM 3393 C CB  . GLN A 1 468 ? 16.248  -19.644 100.999 1.00 0.00 ? 468 GLN A CB  1 
ATOM 3394 C CG  . GLN A 1 468 ? 17.113  -20.109 99.816  1.00 0.00 ? 468 GLN A CG  1 
ATOM 3395 C CD  . GLN A 1 468 ? 17.384  -21.625 99.824  1.00 0.00 ? 468 GLN A CD  1 
ATOM 3396 O OE1 . GLN A 1 468 ? 16.673  -22.384 99.163  1.00 0.00 ? 468 GLN A OE1 1 
ATOM 3397 N NE2 . GLN A 1 468 ? 18.380  -22.118 100.539 1.00 0.00 ? 468 GLN A NE2 1 
ATOM 3398 N N   . ILE A 1 469 ? 15.486  -17.659 98.732  1.00 0.00 ? 469 ILE A N   1 
ATOM 3399 C CA  . ILE A 1 469 ? 14.644  -17.232 97.579  1.00 0.00 ? 469 ILE A CA  1 
ATOM 3400 C C   . ILE A 1 469 ? 14.124  -18.447 96.785  1.00 0.00 ? 469 ILE A C   1 
ATOM 3401 O O   . ILE A 1 469 ? 12.932  -18.789 96.847  1.00 0.00 ? 469 ILE A O   1 
ATOM 3402 C CB  . ILE A 1 469 ? 15.453  -16.342 96.626  1.00 0.00 ? 469 ILE A CB  1 
ATOM 3403 C CG1 . ILE A 1 469 ? 15.583  -14.897 97.120  1.00 0.00 ? 469 ILE A CG1 1 
ATOM 3404 C CG2 . ILE A 1 469 ? 14.836  -16.243 95.228  1.00 0.00 ? 469 ILE A CG2 1 
ATOM 3405 C CD1 . ILE A 1 469 ? 16.351  -13.998 96.148  1.00 0.00 ? 469 ILE A CD1 1 
ATOM 3406 N N   . TRP A 1 470 ? 15.044  -19.049 96.053  1.00 0.00 ? 470 TRP A N   1 
ATOM 3407 C CA  . TRP A 1 470 ? 14.775  -20.228 95.201  1.00 0.00 ? 470 TRP A CA  1 
ATOM 3408 C C   . TRP A 1 470 ? 15.721  -21.368 95.591  1.00 0.00 ? 470 TRP A C   1 
ATOM 3409 O O   . TRP A 1 470 ? 16.865  -21.136 96.001  1.00 0.00 ? 470 TRP A O   1 
ATOM 3410 C CB  . TRP A 1 470 ? 15.073  -19.883 93.747  1.00 0.00 ? 470 TRP A CB  1 
ATOM 3411 C CG  . TRP A 1 470 ? 16.562  -19.641 93.524  1.00 0.00 ? 470 TRP A CG  1 
ATOM 3412 C CD1 . TRP A 1 470 ? 17.505  -20.569 93.325  1.00 0.00 ? 470 TRP A CD1 1 
ATOM 3413 C CD2 . TRP A 1 470 ? 17.185  -18.370 93.508  1.00 0.00 ? 470 TRP A CD2 1 
ATOM 3414 N NE1 . TRP A 1 470 ? 18.751  -19.878 93.195  1.00 0.00 ? 470 TRP A NE1 1 
ATOM 3415 C CE2 . TRP A 1 470 ? 18.541  -18.590 93.311  1.00 0.00 ? 470 TRP A CE2 1 
ATOM 3416 C CE3 . TRP A 1 470 ? 16.719  -17.059 93.648  1.00 0.00 ? 470 TRP A CE3 1 
ATOM 3417 C CZ2 . TRP A 1 470 ? 19.484  -17.558 93.257  1.00 0.00 ? 470 TRP A CZ2 1 
ATOM 3418 C CZ3 . TRP A 1 470 ? 17.674  -16.023 93.584  1.00 0.00 ? 470 TRP A CZ3 1 
ATOM 3419 C CH2 . TRP A 1 470 ? 18.993  -16.263 93.399  1.00 0.00 ? 470 TRP A CH2 1 
ATOM 3420 N N   . ASP A 1 471 ? 15.233  -22.589 95.449  1.00 0.00 ? 471 ASP A N   1 
ATOM 3421 C CA  . ASP A 1 471 ? 16.029  -23.783 95.792  1.00 0.00 ? 471 ASP A CA  1 
ATOM 3422 C C   . ASP A 1 471 ? 15.831  -24.894 94.772  1.00 0.00 ? 471 ASP A C   1 
ATOM 3423 O O   . ASP A 1 471 ? 14.697  -25.299 94.479  1.00 0.00 ? 471 ASP A O   1 
ATOM 3424 C CB  . ASP A 1 471 ? 15.625  -24.324 97.162  1.00 0.00 ? 471 ASP A CB  1 
ATOM 3425 C CG  . ASP A 1 471 ? 16.544  -25.443 97.655  1.00 0.00 ? 471 ASP A CG  1 
ATOM 3426 O OD1 . ASP A 1 471 ? 17.626  -25.154 98.296  1.00 0.00 ? 471 ASP A OD1 1 
ATOM 3427 O OD2 . ASP A 1 471 ? 16.238  -26.676 97.430  1.00 0.00 ? 471 ASP A OD2 1 
ATOM 3428 N N   . LYS A 1 472 ? 16.955  -25.360 94.255  1.00 0.00 ? 472 LYS A N   1 
ATOM 3429 C CA  . LYS A 1 472 ? 16.972  -26.495 93.335  1.00 0.00 ? 472 LYS A CA  1 
ATOM 3430 C C   . LYS A 1 472 ? 15.863  -27.456 93.764  1.00 0.00 ? 472 LYS A C   1 
ATOM 3431 O O   . LYS A 1 472 ? 15.184  -27.228 94.777  1.00 0.00 ? 472 LYS A O   1 
ATOM 3432 C CB  . LYS A 1 472 ? 18.333  -27.196 93.416  1.00 0.00 ? 472 LYS A CB  1 
ATOM 3433 C CG  . LYS A 1 472 ? 18.552  -28.237 92.316  1.00 0.00 ? 472 LYS A CG  1 
ATOM 3434 C CD  . LYS A 1 472 ? 19.943  -28.877 92.371  1.00 0.00 ? 472 LYS A CD  1 
ATOM 3435 C CE  . LYS A 1 472 ? 20.115  -30.025 91.375  1.00 0.00 ? 472 LYS A CE  1 
ATOM 3436 N NZ  . LYS A 1 472 ? 21.448  -30.645 91.436  1.00 0.00 ? 472 LYS A NZ  1 
ATOM 3437 N N   . GLU A 1 473 ? 15.706  -28.506 92.991  1.00 0.00 ? 473 GLU A N   1 
ATOM 3438 C CA  . GLU A 1 473 ? 14.687  -29.535 93.256  1.00 0.00 ? 473 GLU A CA  1 
ATOM 3439 C C   . GLU A 1 473 ? 15.328  -30.923 93.244  1.00 0.00 ? 473 GLU A C   1 
ATOM 3440 O O   . GLU A 1 473 ? 16.251  -31.193 92.463  1.00 0.00 ? 473 GLU A O   1 
ATOM 3441 C CB  . GLU A 1 473 ? 13.596  -29.481 92.184  1.00 0.00 ? 473 GLU A CB  1 
ATOM 3442 C CG  . GLU A 1 473 ? 12.450  -30.461 92.446  1.00 0.00 ? 473 GLU A CG  1 
ATOM 3443 C CD  . GLU A 1 473 ? 11.799  -30.268 93.818  1.00 0.00 ? 473 GLU A CD  1 
ATOM 3444 O OE1 . GLU A 1 473 ? 12.297  -30.851 94.855  1.00 0.00 ? 473 GLU A OE1 1 
ATOM 3445 O OE2 . GLU A 1 473 ? 10.752  -29.523 93.937  1.00 0.00 ? 473 GLU A OE2 1 
ATOM 3446 N N   . PHE A 1 474 ? 14.815  -31.765 94.122  1.00 0.00 ? 474 PHE A N   1 
ATOM 3447 C CA  . PHE A 1 474 ? 15.288  -33.149 94.264  1.00 0.00 ? 474 PHE A CA  1 
ATOM 3448 C C   . PHE A 1 474 ? 15.182  -33.858 92.901  1.00 0.00 ? 474 PHE A C   1 
ATOM 3449 O O   . PHE A 1 474 ? 14.265  -33.590 92.111  1.00 0.00 ? 474 PHE A O   1 
ATOM 3450 C CB  . PHE A 1 474 ? 14.466  -33.860 95.337  1.00 0.00 ? 474 PHE A CB  1 
ATOM 3451 C CG  . PHE A 1 474 ? 14.779  -33.337 96.734  1.00 0.00 ? 474 PHE A CG  1 
ATOM 3452 C CD1 . PHE A 1 474 ? 15.431  -32.106 96.882  1.00 0.00 ? 474 PHE A CD1 1 
ATOM 3453 C CD2 . PHE A 1 474 ? 14.422  -34.083 97.861  1.00 0.00 ? 474 PHE A CD2 1 
ATOM 3454 C CE1 . PHE A 1 474 ? 15.726  -31.620 98.161  1.00 0.00 ? 474 PHE A CE1 1 
ATOM 3455 C CE2 . PHE A 1 474 ? 14.717  -33.597 99.142  1.00 0.00 ? 474 PHE A CE2 1 
ATOM 3456 C CZ  . PHE A 1 474 ? 15.369  -32.366 99.292  1.00 0.00 ? 474 PHE A CZ  1 
ATOM 3457 N N   . ASP A 1 475 ? 16.138  -34.746 92.674  1.00 0.00 ? 475 ASP A N   1 
ATOM 3458 C CA  . ASP A 1 475 ? 16.259  -35.497 91.405  1.00 0.00 ? 475 ASP A CA  1 
ATOM 3459 C C   . ASP A 1 475 ? 15.552  -36.852 91.492  1.00 0.00 ? 475 ASP A C   1 
ATOM 3460 O O   . ASP A 1 475 ? 15.854  -37.780 90.728  1.00 0.00 ? 475 ASP A O   1 
ATOM 3461 C CB  . ASP A 1 475 ? 17.731  -35.758 91.093  1.00 0.00 ? 475 ASP A CB  1 
ATOM 3462 C CG  . ASP A 1 475 ? 17.993  -35.993 89.608  1.00 0.00 ? 475 ASP A CG  1 
ATOM 3463 O OD1 . ASP A 1 475 ? 18.266  -34.997 88.836  1.00 0.00 ? 475 ASP A OD1 1 
ATOM 3464 O OD2 . ASP A 1 475 ? 17.943  -37.189 89.126  1.00 0.00 ? 475 ASP A OD2 1 
ATOM 3465 N N   . THR A 1 476 ? 14.630  -36.927 92.416  1.00 0.00 ? 476 THR A N   1 
ATOM 3466 C CA  . THR A 1 476 ? 13.852  -38.149 92.659  1.00 0.00 ? 476 THR A CA  1 
ATOM 3467 C C   . THR A 1 476 ? 12.598  -38.162 91.772  1.00 0.00 ? 476 THR A C   1 
ATOM 3468 O O   . THR A 1 476 ? 11.871  -37.161 91.679  1.00 0.00 ? 476 THR A O   1 
ATOM 3469 C CB  . THR A 1 476 ? 13.441  -38.213 94.128  1.00 0.00 ? 476 THR A CB  1 
ATOM 3470 O OG1 . THR A 1 476 ? 12.675  -37.067 94.468  1.00 0.00 ? 476 THR A OG1 1 
ATOM 3471 C CG2 . THR A 1 476 ? 14.637  -38.264 95.081  1.00 0.00 ? 476 THR A CG2 1 
ATOM 3472 N N   . ASP A 1 477 ? 12.392  -39.316 91.143  1.00 0.00 ? 477 ASP A N   1 
ATOM 3473 C CA  . ASP A 1 477 ? 11.239  -39.553 90.248  1.00 0.00 ? 477 ASP A CA  1 
ATOM 3474 C C   . ASP A 1 477 ? 9.994   -38.883 90.834  1.00 0.00 ? 477 ASP A C   1 
ATOM 3475 O O   . ASP A 1 477 ? 9.231   -38.217 90.120  1.00 0.00 ? 477 ASP A O   1 
ATOM 3476 C CB  . ASP A 1 477 ? 11.007  -41.054 90.094  1.00 0.00 ? 477 ASP A CB  1 
ATOM 3477 C CG  . ASP A 1 477 ? 12.276  -41.814 89.693  1.00 0.00 ? 477 ASP A CG  1 
ATOM 3478 O OD1 . ASP A 1 477 ? 12.560  -41.983 88.446  1.00 0.00 ? 477 ASP A OD1 1 
ATOM 3479 O OD2 . ASP A 1 477 ? 13.061  -42.284 90.602  1.00 0.00 ? 477 ASP A OD2 1 
ATOM 3480 N N   . LEU A 1 478 ? 9.838   -39.098 92.124  1.00 0.00 ? 478 LEU A N   1 
ATOM 3481 C CA  . LEU A 1 478 ? 8.765   -38.490 92.924  1.00 0.00 ? 478 LEU A CA  1 
ATOM 3482 C C   . LEU A 1 478 ? 9.367   -37.317 93.674  1.00 0.00 ? 478 LEU A C   1 
ATOM 3483 O O   . LEU A 1 478 ? 10.469  -37.414 94.232  1.00 0.00 ? 478 LEU A O   1 
ATOM 3484 C CB  . LEU A 1 478 ? 8.195   -39.523 93.887  1.00 0.00 ? 478 LEU A CB  1 
ATOM 3485 C CG  . LEU A 1 478 ? 7.673   -40.769 93.172  1.00 0.00 ? 478 LEU A CG  1 
ATOM 3486 C CD1 . LEU A 1 478 ? 6.961   -41.744 94.110  1.00 0.00 ? 478 LEU A CD1 1 
ATOM 3487 C CD2 . LEU A 1 478 ? 6.665   -40.446 92.067  1.00 0.00 ? 478 LEU A CD2 1 
ATOM 3488 N N   . LYS A 1 479 ? 8.656   -36.221 93.690  1.00 0.00 ? 479 LYS A N   1 
ATOM 3489 C CA  . LYS A 1 479 ? 9.199   -34.993 94.261  1.00 0.00 ? 479 LYS A CA  1 
ATOM 3490 C C   . LYS A 1 479 ? 8.284   -34.360 95.290  1.00 0.00 ? 479 LYS A C   1 
ATOM 3491 O O   . LYS A 1 479 ? 7.053   -34.504 95.227  1.00 0.00 ? 479 LYS A O   1 
ATOM 3492 C CB  . LYS A 1 479 ? 9.443   -33.989 93.155  1.00 0.00 ? 479 LYS A CB  1 
ATOM 3493 C CG  . LYS A 1 479 ? 9.912   -34.646 91.859  1.00 0.00 ? 479 LYS A CG  1 
ATOM 3494 C CD  . LYS A 1 479 ? 10.750  -33.715 90.990  1.00 0.00 ? 479 LYS A CD  1 
ATOM 3495 C CE  . LYS A 1 479 ? 11.463  -34.442 89.851  1.00 0.00 ? 479 LYS A CE  1 
ATOM 3496 N NZ  . LYS A 1 479 ? 11.933  -33.534 88.796  1.00 0.00 ? 479 LYS A NZ  1 
ATOM 3497 N N   . PRO A 1 480 ? 8.882   -33.647 96.257  1.00 0.00 ? 480 PRO A N   1 
ATOM 3498 C CA  . PRO A 1 480 ? 8.131   -32.948 97.275  1.00 0.00 ? 480 PRO A CA  1 
ATOM 3499 C C   . PRO A 1 480 ? 7.232   -31.921 96.626  1.00 0.00 ? 480 PRO A C   1 
ATOM 3500 O O   . PRO A 1 480 ? 7.667   -31.261 95.632  1.00 0.00 ? 480 PRO A O   1 
ATOM 3501 C CB  . PRO A 1 480 ? 9.209   -32.303 98.138  1.00 0.00 ? 480 PRO A CB  1 
ATOM 3502 C CG  . PRO A 1 480 ? 10.577  -32.681 97.541  1.00 0.00 ? 480 PRO A CG  1 
ATOM 3503 C CD  . PRO A 1 480 ? 10.352  -33.532 96.346  1.00 0.00 ? 480 PRO A CD  1 
ATOM 3504 N N   . ARG A 1 481 ? 6.038   -31.810 97.183  1.00 0.00 ? 481 ARG A N   1 
ATOM 3505 C CA  . ARG A 1 481 ? 5.005   -30.874 96.690  1.00 0.00 ? 481 ARG A CA  1 
ATOM 3506 C C   . ARG A 1 481 ? 5.493   -29.425 96.823  1.00 0.00 ? 481 ARG A C   1 
ATOM 3507 O O   . ARG A 1 481 ? 5.264   -28.590 95.936  1.00 0.00 ? 481 ARG A O   1 
ATOM 3508 C CB  . ARG A 1 481 ? 3.718   -31.047 97.496  1.00 0.00 ? 481 ARG A CB  1 
ATOM 3509 C CG  . ARG A 1 481 ? 3.238   -32.500 97.545  1.00 0.00 ? 481 ARG A CG  1 
ATOM 3510 C CD  . ARG A 1 481 ? 1.765   -32.631 97.931  1.00 0.00 ? 481 ARG A CD  1 
ATOM 3511 N NE  . ARG A 1 481 ? 0.850   -32.257 96.843  1.00 0.00 ? 481 ARG A NE  1 
ATOM 3512 C CZ  . ARG A 1 481 ? -0.484  -32.338 96.927  1.00 0.00 ? 481 ARG A CZ  1 
ATOM 3513 N NH1 . ARG A 1 481 ? -1.080  -32.779 98.043  1.00 0.00 ? 481 ARG A NH1 1 
ATOM 3514 N NH2 . ARG A 1 481 ? -1.319  -31.996 95.936  1.00 0.00 ? 481 ARG A NH2 1 
ATOM 3515 N N   . LEU A 1 482 ? 6.154   -29.179 97.937  1.00 0.00 ? 482 LEU A N   1 
ATOM 3516 C CA  . LEU A 1 482 ? 6.714   -27.857 98.260  1.00 0.00 ? 482 LEU A CA  1 
ATOM 3517 C C   . LEU A 1 482 ? 7.900   -27.979 99.229  1.00 0.00 ? 482 LEU A C   1 
ATOM 3518 O O   . LEU A 1 482 ? 7.981   -28.928 100.023 1.00 0.00 ? 482 LEU A O   1 
ATOM 3519 C CB  . LEU A 1 482 ? 5.637   -26.971 98.894  1.00 0.00 ? 482 LEU A CB  1 
ATOM 3520 C CG  . LEU A 1 482 ? 5.094   -27.537 100.208 1.00 0.00 ? 482 LEU A CG  1 
ATOM 3521 C CD1 . LEU A 1 482 ? 3.995   -26.669 100.824 1.00 0.00 ? 482 LEU A CD1 1 
ATOM 3522 C CD2 . LEU A 1 482 ? 4.483   -28.931 100.051 1.00 0.00 ? 482 LEU A CD2 1 
ATOM 3523 N N   . HIS A 1 483 ? 8.786   -26.994 99.120  1.00 0.00 ? 483 HIS A N   1 
ATOM 3524 C CA  . HIS A 1 483 ? 9.999   -26.895 99.957  1.00 0.00 ? 483 HIS A CA  1 
ATOM 3525 C C   . HIS A 1 483 ? 9.721   -25.978 101.149 1.00 0.00 ? 483 HIS A C   1 
ATOM 3526 O O   . HIS A 1 483 ? 8.910   -25.047 101.060 1.00 0.00 ? 483 HIS A O   1 
ATOM 3527 C CB  . HIS A 1 483 ? 11.165  -26.360 99.128  1.00 0.00 ? 483 HIS A CB  1 
ATOM 3528 C CG  . HIS A 1 483 ? 11.703  -27.413 98.164  1.00 0.00 ? 483 HIS A CG  1 
ATOM 3529 N ND1 . HIS A 1 483 ? 13.003  -27.372 97.672  1.00 0.00 ? 483 HIS A ND1 1 
ATOM 3530 C CD2 . HIS A 1 483 ? 11.120  -28.511 97.620  1.00 0.00 ? 483 HIS A CD2 1 
ATOM 3531 C CE1 . HIS A 1 483 ? 13.169  -28.410 96.870  1.00 0.00 ? 483 HIS A CE1 1 
ATOM 3532 N NE2 . HIS A 1 483 ? 12.054  -29.099 96.828  1.00 0.00 ? 483 HIS A NE2 1 
ATOM 3533 N N   . ILE A 1 484 ? 10.420  -26.277 102.226 1.00 0.00 ? 484 ILE A N   1 
ATOM 3534 C CA  . ILE A 1 484 ? 10.244  -25.592 103.517 1.00 0.00 ? 484 ILE A CA  1 
ATOM 3535 C C   . ILE A 1 484 ? 11.180  -24.409 103.717 1.00 0.00 ? 484 ILE A C   1 
ATOM 3536 O O   . ILE A 1 484 ? 11.004  -23.604 104.641 1.00 0.00 ? 484 ILE A O   1 
ATOM 3537 C CB  . ILE A 1 484 ? 10.578  -26.539 104.664 1.00 0.00 ? 484 ILE A CB  1 
ATOM 3538 C CG1 . ILE A 1 484 ? 9.339   -27.097 105.352 1.00 0.00 ? 484 ILE A CG1 1 
ATOM 3539 C CG2 . ILE A 1 484 ? 11.408  -25.869 105.762 1.00 0.00 ? 484 ILE A CG2 1 
ATOM 3540 C CD1 . ILE A 1 484 ? 8.883   -28.430 104.760 1.00 0.00 ? 484 ILE A CD1 1 
ATOM 3541 N N   . ASN A 1 485 ? 12.162  -24.306 102.869 1.00 0.00 ? 485 ASN A N   1 
ATOM 3542 C CA  . ASN A 1 485 ? 13.173  -23.270 103.034 1.00 0.00 ? 485 ASN A CA  1 
ATOM 3543 C C   . ASN A 1 485 ? 13.011  -22.098 102.042 1.00 0.00 ? 485 ASN A C   1 
ATOM 3544 O O   . ASN A 1 485 ? 13.530  -20.996 102.265 1.00 0.00 ? 485 ASN A O   1 
ATOM 3545 C CB  . ASN A 1 485 ? 14.564  -23.861 102.802 1.00 0.00 ? 485 ASN A CB  1 
ATOM 3546 C CG  . ASN A 1 485 ? 14.667  -24.631 101.485 1.00 0.00 ? 485 ASN A CG  1 
ATOM 3547 O OD1 . ASN A 1 485 ? 15.139  -24.086 100.489 1.00 0.00 ? 485 ASN A OD1 1 
ATOM 3548 N ND2 . ASN A 1 485 ? 14.246  -25.881 101.417 1.00 0.00 ? 485 ASN A ND2 1 
ATOM 3549 N N   . ALA A 1 486 ? 12.290  -22.344 100.949 1.00 0.00 ? 486 ALA A N   1 
ATOM 3550 C CA  . ALA A 1 486 ? 12.166  -21.323 99.860  1.00 0.00 ? 486 ALA A CA  1 
ATOM 3551 C C   . ALA A 1 486 ? 10.808  -21.366 99.113  1.00 0.00 ? 486 ALA A C   1 
ATOM 3552 O O   . ALA A 1 486 ? 10.300  -22.443 98.768  1.00 0.00 ? 486 ALA A O   1 
ATOM 3553 C CB  . ALA A 1 486 ? 13.143  -21.643 98.730  1.00 0.00 ? 486 ALA A CB  1 
ATOM 3554 N N   . PRO A 1 487 ? 10.150  -20.214 98.832  1.00 0.00 ? 487 PRO A N   1 
ATOM 3555 C CA  . PRO A 1 487 ? 8.895   -20.185 98.064  1.00 0.00 ? 487 PRO A CA  1 
ATOM 3556 C C   . PRO A 1 487 ? 9.018   -20.642 96.589  1.00 0.00 ? 487 PRO A C   1 
ATOM 3557 O O   . PRO A 1 487 ? 8.016   -21.183 96.023  1.00 0.00 ? 487 PRO A O   1 
ATOM 3558 C CB  . PRO A 1 487 ? 8.478   -18.733 98.083  1.00 0.00 ? 487 PRO A CB  1 
ATOM 3559 C CG  . PRO A 1 487 ? 9.537   -17.952 98.845  1.00 0.00 ? 487 PRO A CG  1 
ATOM 3560 C CD  . PRO A 1 487 ? 10.611  -18.900 99.297  1.00 0.00 ? 487 PRO A CD  1 
ATOM 3561 N N   . PHE A 1 488 ? 10.189  -20.438 95.951  1.00 0.00 ? 488 PHE A N   1 
ATOM 3562 C CA  . PHE A 1 488 ? 10.393  -20.763 94.484  1.00 0.00 ? 488 PHE A CA  1 
ATOM 3563 C C   . PHE A 1 488 ? 11.323  -21.942 94.247  1.00 0.00 ? 488 PHE A C   1 
ATOM 3564 O O   . PHE A 1 488 ? 12.538  -21.824 94.554  1.00 0.00 ? 488 PHE A O   1 
ATOM 3565 C CB  . PHE A 1 488 ? 11.048  -19.579 93.756  1.00 0.00 ? 488 PHE A CB  1 
ATOM 3566 C CG  . PHE A 1 488 ? 10.257  -18.267 93.844  1.00 0.00 ? 488 PHE A CG  1 
ATOM 3567 C CD1 . PHE A 1 488 ? 9.093   -18.096 93.083  1.00 0.00 ? 488 PHE A CD1 1 
ATOM 3568 C CD2 . PHE A 1 488 ? 10.703  -17.232 94.678  1.00 0.00 ? 488 PHE A CD2 1 
ATOM 3569 C CE1 . PHE A 1 488 ? 8.377   -16.893 93.157  1.00 0.00 ? 488 PHE A CE1 1 
ATOM 3570 C CE2 . PHE A 1 488 ? 9.987   -16.030 94.750  1.00 0.00 ? 488 PHE A CE2 1 
ATOM 3571 C CZ  . PHE A 1 488 ? 8.825   -15.861 93.990  1.00 0.00 ? 488 PHE A CZ  1 
ATOM 3572 N N   . VAL A 1 489 ? 10.845  -23.036 93.700  1.00 0.00 ? 489 VAL A N   1 
ATOM 3573 C CA  . VAL A 1 489 ? 11.720  -24.164 93.394  1.00 0.00 ? 489 VAL A CA  1 
ATOM 3574 C C   . VAL A 1 489 ? 11.923  -24.209 91.876  1.00 0.00 ? 489 VAL A C   1 
ATOM 3575 O O   . VAL A 1 489 ? 10.885  -24.294 91.211  1.00 0.00 ? 489 VAL A O   1 
ATOM 3576 C CB  . VAL A 1 489 ? 11.201  -25.507 93.887  1.00 0.00 ? 489 VAL A CB  1 
ATOM 3577 C CG1 . VAL A 1 489 ? 11.986  -26.585 93.121  1.00 0.00 ? 489 VAL A CG1 1 
ATOM 3578 C CG2 . VAL A 1 489 ? 11.275  -25.593 95.377  1.00 0.00 ? 489 VAL A CG2 1 
ATOM 3579 N N   . CYS A 1 490 ? 13.085  -24.149 91.309  1.00 0.00 ? 490 CYS A N   1 
ATOM 3580 C CA  . CYS A 1 490 ? 13.100  -24.200 89.817  1.00 0.00 ? 490 CYS A CA  1 
ATOM 3581 C C   . CYS A 1 490 ? 13.288  -25.668 89.494  1.00 0.00 ? 490 CYS A C   1 
ATOM 3582 O O   . CYS A 1 490 ? 14.181  -26.322 89.994  1.00 0.00 ? 490 CYS A O   1 
ATOM 3583 C CB  . CYS A 1 490 ? 14.146  -23.291 89.237  1.00 0.00 ? 490 CYS A CB  1 
ATOM 3584 S SG  . CYS A 1 490 ? 15.580  -23.279 90.378  1.00 0.00 ? 490 CYS A SG  1 
ATOM 3585 N N   . GLN A 1 491 ? 12.386  -26.128 88.648  1.00 0.00 ? 491 GLN A N   1 
ATOM 3586 C CA  . GLN A 1 491 ? 12.403  -27.529 88.250  1.00 0.00 ? 491 GLN A CA  1 
ATOM 3587 C C   . GLN A 1 491 ? 13.429  -27.841 87.184  1.00 0.00 ? 491 GLN A C   1 
ATOM 3588 O O   . GLN A 1 491 ? 14.586  -28.261 87.338  1.00 0.00 ? 491 GLN A O   1 
ATOM 3589 C CB  . GLN A 1 491 ? 11.001  -28.013 87.742  1.00 0.00 ? 491 GLN A CB  1 
ATOM 3590 C CG  . GLN A 1 491 ? 10.757  -29.438 88.324  1.00 0.00 ? 491 GLN A CG  1 
ATOM 3591 C CD  . GLN A 1 491 ? 11.437  -30.505 87.498  1.00 0.00 ? 491 GLN A CD  1 
ATOM 3592 O OE1 . GLN A 1 491 ? 10.803  -31.284 86.746  1.00 0.00 ? 491 GLN A OE1 1 
ATOM 3593 N NE2 . GLN A 1 491 ? 12.777  -30.609 87.579  1.00 0.00 ? 491 GLN A NE2 1 
ATOM 3594 N N   . ASN A 1 492 ? 12.890  -27.614 85.973  1.00 0.00 ? 492 ASN A N   1 
ATOM 3595 C CA  . ASN A 1 492 ? 13.813  -27.948 84.851  1.00 0.00 ? 492 ASN A CA  1 
ATOM 3596 C C   . ASN A 1 492 ? 15.035  -27.122 84.897  1.00 0.00 ? 492 ASN A C   1 
ATOM 3597 O O   . ASN A 1 492 ? 16.048  -27.835 84.627  1.00 0.00 ? 492 ASN A O   1 
ATOM 3598 C CB  . ASN A 1 492 ? 13.002  -27.936 83.516  1.00 0.00 ? 492 ASN A CB  1 
ATOM 3599 C CG  . ASN A 1 492 ? 12.257  -29.326 83.753  1.00 0.00 ? 492 ASN A CG  1 
ATOM 3600 O OD1 . ASN A 1 492 ? 12.962  -30.360 83.769  1.00 0.00 ? 492 ASN A OD1 1 
ATOM 3601 N ND2 . ASN A 1 492 ? 10.953  -29.203 83.971  1.00 0.00 ? 492 ASN A ND2 1 
ATOM 3602 N N   . ASN A 1 493 ? 15.021  -25.858 85.216  1.00 0.00 ? 493 ASN A N   1 
ATOM 3603 C CA  . ASN A 1 493 ? 16.379  -25.199 85.185  1.00 0.00 ? 493 ASN A CA  1 
ATOM 3604 C C   . ASN A 1 493 ? 16.650  -24.071 86.142  1.00 0.00 ? 493 ASN A C   1 
ATOM 3605 O O   . ASN A 1 493 ? 15.826  -23.105 86.311  1.00 0.00 ? 493 ASN A O   1 
ATOM 3606 C CB  . ASN A 1 493 ? 16.518  -24.752 83.699  1.00 0.00 ? 493 ASN A CB  1 
ATOM 3607 C CG  . ASN A 1 493 ? 15.289  -23.940 83.251  1.00 0.00 ? 493 ASN A CG  1 
ATOM 3608 O OD1 . ASN A 1 493 ? 15.028  -23.788 82.039  1.00 0.00 ? 493 ASN A OD1 1 
ATOM 3609 N ND2 . ASN A 1 493 ? 14.490  -23.385 84.167  1.00 0.00 ? 493 ASN A ND2 1 
ATOM 3610 N N   . CYS A 1 494 ? 17.860  -24.242 86.744  1.00 0.00 ? 494 CYS A N   1 
ATOM 3611 C CA  . CYS A 1 494 ? 18.265  -23.195 87.701  1.00 0.00 ? 494 CYS A CA  1 
ATOM 3612 C C   . CYS A 1 494 ? 19.558  -22.559 87.309  1.00 0.00 ? 494 CYS A C   1 
ATOM 3613 O O   . CYS A 1 494 ? 20.360  -23.137 86.577  1.00 0.00 ? 494 CYS A O   1 
ATOM 3614 C CB  . CYS A 1 494 ? 18.407  -23.711 89.153  1.00 0.00 ? 494 CYS A CB  1 
ATOM 3615 S SG  . CYS A 1 494 ? 16.889  -24.611 89.553  1.00 0.00 ? 494 CYS A SG  1 
ATOM 3616 N N   . PRO A 1 495 ? 19.755  -21.371 87.808  1.00 0.00 ? 495 PRO A N   1 
ATOM 3617 C CA  . PRO A 1 495 ? 21.021  -20.719 87.487  1.00 0.00 ? 495 PRO A CA  1 
ATOM 3618 C C   . PRO A 1 495 ? 22.121  -21.510 88.219  1.00 0.00 ? 495 PRO A C   1 
ATOM 3619 O O   . PRO A 1 495 ? 21.845  -22.088 89.314  1.00 0.00 ? 495 PRO A O   1 
ATOM 3620 C CB  . PRO A 1 495 ? 20.794  -19.334 87.977  1.00 0.00 ? 495 PRO A CB  1 
ATOM 3621 C CG  . PRO A 1 495 ? 19.445  -19.279 88.674  1.00 0.00 ? 495 PRO A CG  1 
ATOM 3622 C CD  . PRO A 1 495 ? 18.861  -20.649 88.693  1.00 0.00 ? 495 PRO A CD  1 
ATOM 3623 N N   . GLY A 1 496 ? 23.335  -21.562 87.649  1.00 0.00 ? 496 GLY A N   1 
ATOM 3624 C CA  . GLY A 1 496 ? 24.486  -22.343 88.232  1.00 0.00 ? 496 GLY A CA  1 
ATOM 3625 C C   . GLY A 1 496 ? 25.212  -21.559 89.361  1.00 0.00 ? 496 GLY A C   1 
ATOM 3626 O O   . GLY A 1 496 ? 25.025  -20.346 89.506  1.00 0.00 ? 496 GLY A O   1 
ATOM 3627 N N   . GLN A 1 497 ? 26.044  -22.298 90.136  1.00 0.00 ? 497 GLN A N   1 
ATOM 3628 C CA  . GLN A 1 497 ? 26.837  -21.753 91.303  1.00 0.00 ? 497 GLN A CA  1 
ATOM 3629 C C   . GLN A 1 497 ? 28.068  -21.058 90.798  1.00 0.00 ? 497 GLN A C   1 
ATOM 3630 O O   . GLN A 1 497 ? 28.737  -21.536 89.867  1.00 0.00 ? 497 GLN A O   1 
ATOM 3631 C CB  . GLN A 1 497 ? 27.153  -22.889 92.268  1.00 0.00 ? 497 GLN A CB  1 
ATOM 3632 C CG  . GLN A 1 497 ? 25.871  -23.514 92.830  1.00 0.00 ? 497 GLN A CG  1 
ATOM 3633 C CD  . GLN A 1 497 ? 26.107  -24.424 94.032  1.00 0.00 ? 497 GLN A CD  1 
ATOM 3634 O OE1 . GLN A 1 497 ? 25.991  -23.980 95.172  1.00 0.00 ? 497 GLN A OE1 1 
ATOM 3635 N NE2 . GLN A 1 497 ? 26.428  -25.689 93.842  1.00 0.00 ? 497 GLN A NE2 1 
ATOM 3636 N N   . LEU A 1 498 ? 28.311  -19.943 91.425  1.00 0.00 ? 498 LEU A N   1 
ATOM 3637 C CA  . LEU A 1 498 ? 29.461  -19.129 91.169  1.00 0.00 ? 498 LEU A CA  1 
ATOM 3638 C C   . LEU A 1 498 ? 30.515  -19.396 92.227  1.00 0.00 ? 498 LEU A C   1 
ATOM 3639 O O   . LEU A 1 498 ? 30.351  -19.026 93.399  1.00 0.00 ? 498 LEU A O   1 
ATOM 3640 C CB  . LEU A 1 498 ? 29.079  -17.648 91.229  1.00 0.00 ? 498 LEU A CB  1 
ATOM 3641 C CG  . LEU A 1 498 ? 30.271  -16.717 91.006  1.00 0.00 ? 498 LEU A CG  1 
ATOM 3642 C CD1 . LEU A 1 498 ? 30.774  -16.727 89.562  1.00 0.00 ? 498 LEU A CD1 1 
ATOM 3643 C CD2 . LEU A 1 498 ? 29.956  -15.255 91.327  1.00 0.00 ? 498 LEU A CD2 1 
ATOM 3644 N N   . PHE A 1 499 ? 31.562  -20.042 91.785  1.00 0.00 ? 499 PHE A N   1 
ATOM 3645 C CA  . PHE A 1 499 ? 32.709  -20.364 92.629  1.00 0.00 ? 499 PHE A CA  1 
ATOM 3646 C C   . PHE A 1 499 ? 33.862  -19.404 92.321  1.00 0.00 ? 499 PHE A C   1 
ATOM 3647 O O   . PHE A 1 499 ? 34.377  -19.365 91.194  1.00 0.00 ? 499 PHE A O   1 
ATOM 3648 C CB  . PHE A 1 499 ? 33.167  -21.801 92.367  1.00 0.00 ? 499 PHE A CB  1 
ATOM 3649 C CG  . PHE A 1 499 ? 32.078  -22.841 92.653  1.00 0.00 ? 499 PHE A CG  1 
ATOM 3650 C CD1 . PHE A 1 499 ? 31.545  -22.961 93.942  1.00 0.00 ? 499 PHE A CD1 1 
ATOM 3651 C CD2 . PHE A 1 499 ? 31.619  -23.675 91.626  1.00 0.00 ? 499 PHE A CD2 1 
ATOM 3652 C CE1 . PHE A 1 499 ? 30.552  -23.914 94.204  1.00 0.00 ? 499 PHE A CE1 1 
ATOM 3653 C CE2 . PHE A 1 499 ? 30.627  -24.628 91.888  1.00 0.00 ? 499 PHE A CE2 1 
ATOM 3654 C CZ  . PHE A 1 499 ? 30.093  -24.748 93.177  1.00 0.00 ? 499 PHE A CZ  1 
ATOM 3655 N N   . VAL A 1 500 ? 34.228  -18.657 93.344  1.00 0.00 ? 500 VAL A N   1 
ATOM 3656 C CA  . VAL A 1 500 ? 35.296  -17.643 93.261  1.00 0.00 ? 500 VAL A CA  1 
ATOM 3657 C C   . VAL A 1 500 ? 36.510  -18.080 94.103  1.00 0.00 ? 500 VAL A C   1 
ATOM 3658 O O   . VAL A 1 500 ? 36.388  -18.351 95.306  1.00 0.00 ? 500 VAL A O   1 
ATOM 3659 C CB  . VAL A 1 500 ? 34.786  -16.306 93.817  1.00 0.00 ? 500 VAL A CB  1 
ATOM 3660 C CG1 . VAL A 1 500 ? 35.827  -15.189 93.737  1.00 0.00 ? 500 VAL A CG1 1 
ATOM 3661 C CG2 . VAL A 1 500 ? 33.553  -15.781 93.077  1.00 0.00 ? 500 VAL A CG2 1 
ATOM 3662 N N   . LYS A 1 501 ? 37.676  -18.132 93.430  1.00 0.00 ? 501 LYS A N   1 
ATOM 3663 C CA  . LYS A 1 501 ? 38.963  -18.523 94.085  1.00 0.00 ? 501 LYS A CA  1 
ATOM 3664 C C   . LYS A 1 501 ? 40.110  -17.575 93.681  1.00 0.00 ? 501 LYS A C   1 
ATOM 3665 O O   . LYS A 1 501 ? 40.011  -16.837 92.695  1.00 0.00 ? 501 LYS A O   1 
ATOM 3666 C CB  . LYS A 1 501 ? 39.411  -19.920 93.631  1.00 0.00 ? 501 LYS A CB  1 
ATOM 3667 C CG  . LYS A 1 501 ? 40.828  -20.274 94.139  1.00 0.00 ? 501 LYS A CG  1 
ATOM 3668 C CD  . LYS A 1 501 ? 41.321  -21.643 93.668  1.00 0.00 ? 501 LYS A CD  1 
ATOM 3669 C CE  . LYS A 1 501 ? 42.679  -22.031 94.276  1.00 0.00 ? 501 LYS A CE  1 
ATOM 3670 N NZ  . LYS A 1 501 ? 42.981  -23.465 94.143  1.00 0.00 ? 501 LYS A NZ  1 
ATOM 3671 N N   . VAL A 1 502 ? 41.216  -17.607 94.431  1.00 0.00 ? 502 VAL A N   1 
ATOM 3672 C CA  . VAL A 1 502 ? 42.492  -16.917 94.189  1.00 0.00 ? 502 VAL A CA  1 
ATOM 3673 C C   . VAL A 1 502 ? 43.512  -17.899 93.592  1.00 0.00 ? 502 VAL A C   1 
ATOM 3674 O O   . VAL A 1 502 ? 43.656  -19.036 94.066  1.00 0.00 ? 502 VAL A O   1 
ATOM 3675 C CB  . VAL A 1 502 ? 43.030  -16.344 95.501  1.00 0.00 ? 502 VAL A CB  1 
ATOM 3676 C CG1 . VAL A 1 502 ? 44.330  -15.558 95.322  1.00 0.00 ? 502 VAL A CG1 1 
ATOM 3677 C CG2 . VAL A 1 502 ? 42.052  -15.380 96.178  1.00 0.00 ? 502 VAL A CG2 1 
ATOM 3678 N N   . ALA A 1 503 ? 44.189  -17.409 92.559  1.00 0.00 ? 503 ALA A N   1 
ATOM 3679 C CA  . ALA A 1 503 ? 45.201  -18.186 91.810  1.00 0.00 ? 503 ALA A CA  1 
ATOM 3680 C C   . ALA A 1 503 ? 46.507  -18.262 92.600  1.00 0.00 ? 503 ALA A C   1 
ATOM 3681 O O   . ALA A 1 503 ? 46.963  -17.264 93.179  1.00 0.00 ? 503 ALA A O   1 
ATOM 3682 C CB  . ALA A 1 503 ? 45.479  -17.521 90.462  1.00 0.00 ? 503 ALA A CB  1 
ATOM 3683 N N   . PRO A 1 504 ? 47.155  -19.433 92.655  1.00 0.00 ? 504 PRO A N   1 
ATOM 3684 C CA  . PRO A 1 504 ? 48.392  -19.589 93.405  1.00 0.00 ? 504 PRO A CA  1 
ATOM 3685 C C   . PRO A 1 504 ? 49.496  -18.681 92.853  1.00 0.00 ? 504 PRO A C   1 
ATOM 3686 O O   . PRO A 1 504 ? 49.843  -18.803 91.638  1.00 0.00 ? 504 PRO A O   1 
ATOM 3687 C CB  . PRO A 1 504 ? 48.751  -21.061 93.217  1.00 0.00 ? 504 PRO A CB  1 
ATOM 3688 C CG  . PRO A 1 504 ? 47.657  -21.699 92.323  1.00 0.00 ? 504 PRO A CG  1 
ATOM 3689 C CD  . PRO A 1 504 ? 46.661  -20.653 91.971  1.00 0.00 ? 504 PRO A CD  1 
ATOM 3690 N N   . ASN A 1 505 ? 49.991  -17.820 93.748  1.00 0.00 ? 505 ASN A N   1 
ATOM 3691 C CA  . ASN A 1 505 ? 51.155  -16.931 93.471  1.00 0.00 ? 505 ASN A CA  1 
ATOM 3692 C C   . ASN A 1 505 ? 52.398  -17.567 94.106  1.00 0.00 ? 505 ASN A C   1 
ATOM 3693 O O   . ASN A 1 505 ? 52.493  -17.691 95.336  1.00 0.00 ? 505 ASN A O   1 
ATOM 3694 C CB  . ASN A 1 505 ? 50.905  -15.539 94.065  1.00 0.00 ? 505 ASN A CB  1 
ATOM 3695 C CG  . ASN A 1 505 ? 51.835  -14.464 93.487  1.00 0.00 ? 505 ASN A CG  1 
ATOM 3696 O OD1 . ASN A 1 505 ? 52.887  -14.187 94.061  1.00 0.00 ? 505 ASN A OD1 1 
ATOM 3697 N ND2 . ASN A 1 505 ? 51.506  -13.836 92.373  1.00 0.00 ? 505 ASN A ND2 1 
ATOM 3698 N N   . LEU A 1 506 ? 53.326  -17.954 93.245  1.00 0.00 ? 506 LEU A N   1 
ATOM 3699 C CA  . LEU A 1 506 ? 54.500  -18.755 93.657  1.00 0.00 ? 506 LEU A CA  1 
ATOM 3700 C C   . LEU A 1 506 ? 55.787  -17.925 93.737  1.00 0.00 ? 506 LEU A C   1 
ATOM 3701 O O   . LEU A 1 506 ? 55.960  -16.941 93.002  1.00 0.00 ? 506 LEU A O   1 
ATOM 3702 C CB  . LEU A 1 506 ? 54.703  -19.898 92.687  1.00 0.00 ? 506 LEU A CB  1 
ATOM 3703 C CG  . LEU A 1 506 ? 53.615  -20.959 92.805  1.00 0.00 ? 506 LEU A CG  1 
ATOM 3704 C CD1 . LEU A 1 506 ? 53.882  -22.188 91.936  1.00 0.00 ? 506 LEU A CD1 1 
ATOM 3705 C CD2 . LEU A 1 506 ? 53.448  -21.486 94.232  1.00 0.00 ? 506 LEU A CD2 1 
ATOM 3706 N N   . THR A 1 507 ? 56.637  -18.406 94.656  1.00 0.00 ? 507 THR A N   1 
ATOM 3707 C CA  . THR A 1 507 ? 57.952  -17.830 94.953  1.00 0.00 ? 507 THR A CA  1 
ATOM 3708 C C   . THR A 1 507 ? 59.025  -18.506 94.084  1.00 0.00 ? 507 THR A C   1 
ATOM 3709 O O   . THR A 1 507 ? 58.710  -19.263 93.154  1.00 0.00 ? 507 THR A O   1 
ATOM 3710 C CB  . THR A 1 507 ? 58.294  -18.065 96.428  1.00 0.00 ? 507 THR A CB  1 
ATOM 3711 O OG1 . THR A 1 507 ? 58.584  -19.439 96.646  1.00 0.00 ? 507 THR A OG1 1 
ATOM 3712 C CG2 . THR A 1 507 ? 57.153  -17.685 97.375  1.00 0.00 ? 507 THR A CG2 1 
ATOM 3713 N N   . ASN A 1 508 ? 60.274  -18.209 94.427  1.00 0.00 ? 508 ASN A N   1 
ATOM 3714 C CA  . ASN A 1 508 ? 61.449  -18.635 93.633  1.00 0.00 ? 508 ASN A CA  1 
ATOM 3715 C C   . ASN A 1 508 ? 61.840  -20.080 93.980  1.00 0.00 ? 508 ASN A C   1 
ATOM 3716 O O   . ASN A 1 508 ? 62.692  -20.688 93.315  1.00 0.00 ? 508 ASN A O   1 
ATOM 3717 C CB  . ASN A 1 508 ? 62.642  -17.711 93.913  1.00 0.00 ? 508 ASN A CB  1 
ATOM 3718 C CG  . ASN A 1 508 ? 63.080  -17.719 95.380  1.00 0.00 ? 508 ASN A CG  1 
ATOM 3719 O OD1 . ASN A 1 508 ? 62.588  -16.918 96.173  1.00 0.00 ? 508 ASN A OD1 1 
ATOM 3720 N ND2 . ASN A 1 508 ? 63.987  -18.584 95.794  1.00 0.00 ? 508 ASN A ND2 1 
ATOM 3721 N N   . GLN A 1 509 ? 61.201  -20.583 95.014  1.00 0.00 ? 509 GLN A N   1 
ATOM 3722 C CA  . GLN A 1 509 ? 61.425  -21.955 95.500  1.00 0.00 ? 509 GLN A CA  1 
ATOM 3723 C C   . GLN A 1 509 ? 60.112  -22.713 95.507  1.00 0.00 ? 509 GLN A C   1 
ATOM 3724 O O   . GLN A 1 509 ? 59.131  -22.286 96.133  1.00 0.00 ? 509 GLN A O   1 
ATOM 3725 C CB  . GLN A 1 509 ? 61.966  -21.925 96.933  1.00 0.00 ? 509 GLN A CB  1 
ATOM 3726 C CG  . GLN A 1 509 ? 63.329  -21.240 97.046  1.00 0.00 ? 509 GLN A CG  1 
ATOM 3727 C CD  . GLN A 1 509 ? 63.960  -21.392 98.433  1.00 0.00 ? 509 GLN A CD  1 
ATOM 3728 O OE1 . GLN A 1 509 ? 64.749  -22.310 98.652  1.00 0.00 ? 509 GLN A OE1 1 
ATOM 3729 N NE2 . GLN A 1 509 ? 63.658  -20.538 99.393  1.00 0.00 ? 509 GLN A NE2 1 
ATOM 3730 N N   . TYR A 1 510 ? 60.120  -23.811 94.813  1.00 0.00 ? 510 TYR A N   1 
ATOM 3731 C CA  . TYR A 1 510 ? 58.956  -24.673 94.723  1.00 0.00 ? 510 TYR A CA  1 
ATOM 3732 C C   . TYR A 1 510 ? 59.335  -25.994 94.153  1.00 0.00 ? 510 TYR A C   1 
ATOM 3733 O O   . TYR A 1 510 ? 59.691  -26.101 92.964  1.00 0.00 ? 510 TYR A O   1 
ATOM 3734 C CB  . TYR A 1 510 ? 57.901  -24.056 93.817  1.00 0.00 ? 510 TYR A CB  1 
ATOM 3735 C CG  . TYR A 1 510 ? 56.694  -24.975 93.610  1.00 0.00 ? 510 TYR A CG  1 
ATOM 3736 C CD1 . TYR A 1 510 ? 55.671  -25.013 94.565  1.00 0.00 ? 510 TYR A CD1 1 
ATOM 3737 C CD2 . TYR A 1 510 ? 56.619  -25.785 92.470  1.00 0.00 ? 510 TYR A CD2 1 
ATOM 3738 C CE1 . TYR A 1 510 ? 54.570  -25.859 94.378  1.00 0.00 ? 510 TYR A CE1 1 
ATOM 3739 C CE2 . TYR A 1 510 ? 55.518  -26.630 92.284  1.00 0.00 ? 510 TYR A CE2 1 
ATOM 3740 C CZ  . TYR A 1 510 ? 54.493  -26.666 93.237  1.00 0.00 ? 510 TYR A CZ  1 
ATOM 3741 O OH  . TYR A 1 510 ? 53.424  -27.487 93.056  1.00 0.00 ? 510 TYR A OH  1 
ATOM 3742 N N   . ASP A 1 511 ? 59.255  -26.981 95.006  1.00 0.00 ? 511 ASP A N   1 
ATOM 3743 C CA  . ASP A 1 511 ? 59.537  -28.331 94.620  1.00 0.00 ? 511 ASP A CA  1 
ATOM 3744 C C   . ASP A 1 511 ? 58.287  -29.180 94.687  1.00 0.00 ? 511 ASP A C   1 
ATOM 3745 O O   . ASP A 1 511 ? 57.861  -29.606 95.772  1.00 0.00 ? 511 ASP A O   1 
ATOM 3746 C CB  . ASP A 1 511 ? 60.603  -28.930 95.459  1.00 0.00 ? 511 ASP A CB  1 
ATOM 3747 C CG  . ASP A 1 511 ? 61.012  -30.292 94.939  1.00 0.00 ? 511 ASP A CG  1 
ATOM 3748 O OD1 . ASP A 1 511 ? 61.939  -30.390 94.047  1.00 0.00 ? 511 ASP A OD1 1 
ATOM 3749 O OD2 . ASP A 1 511 ? 60.427  -31.352 95.381  1.00 0.00 ? 511 ASP A OD2 1 
ATOM 3750 N N   . PRO A 1 512 ? 57.681  -29.450 93.537  1.00 0.00 ? 512 PRO A N   1 
ATOM 3751 C CA  . PRO A 1 512 ? 56.452  -30.236 93.461  1.00 0.00 ? 512 PRO A CA  1 
ATOM 3752 C C   . PRO A 1 512 ? 56.760  -31.614 93.970  1.00 0.00 ? 512 PRO A C   1 
ATOM 3753 O O   . PRO A 1 512 ? 55.823  -32.468 94.046  1.00 0.00 ? 512 PRO A O   1 
ATOM 3754 C CB  . PRO A 1 512 ? 56.110  -30.231 91.978  1.00 0.00 ? 512 PRO A CB  1 
ATOM 3755 C CG  . PRO A 1 512 ? 57.195  -29.430 91.259  1.00 0.00 ? 512 PRO A CG  1 
ATOM 3756 C CD  . PRO A 1 512 ? 58.202  -28.945 92.265  1.00 0.00 ? 512 PRO A CD  1 
ATOM 3757 N N   . ASP A 1 513 ? 58.040  -31.778 94.288  1.00 0.00 ? 513 ASP A N   1 
ATOM 3758 C CA  . ASP A 1 513 ? 58.595  -33.036 94.815  1.00 0.00 ? 513 ASP A CA  1 
ATOM 3759 C C   . ASP A 1 513 ? 58.970  -32.847 96.267  1.00 0.00 ? 513 ASP A C   1 
ATOM 3760 O O   . ASP A 1 513 ? 59.992  -33.371 96.740  1.00 0.00 ? 513 ASP A O   1 
ATOM 3761 C CB  . ASP A 1 513 ? 59.800  -33.452 93.999  1.00 0.00 ? 513 ASP A CB  1 
ATOM 3762 C CG  . ASP A 1 513 ? 59.377  -34.131 92.707  1.00 0.00 ? 513 ASP A CG  1 
ATOM 3763 O OD1 . ASP A 1 513 ? 59.051  -33.416 91.687  1.00 0.00 ? 513 ASP A OD1 1 
ATOM 3764 O OD2 . ASP A 1 513 ? 59.331  -35.417 92.644  1.00 0.00 ? 513 ASP A OD2 1 
ATOM 3765 N N   . ALA A 1 514 ? 58.101  -32.096 96.860  1.00 0.00 ? 514 ALA A N   1 
ATOM 3766 C CA  . ALA A 1 514 ? 58.125  -31.762 98.257  1.00 0.00 ? 514 ALA A CA  1 
ATOM 3767 C C   . ALA A 1 514 ? 56.686  -31.607 98.684  1.00 0.00 ? 514 ALA A C   1 
ATOM 3768 O O   . ALA A 1 514 ? 55.884  -30.960 97.991  1.00 0.00 ? 514 ALA A O   1 
ATOM 3769 C CB  . ALA A 1 514 ? 58.892  -30.456 98.474  1.00 0.00 ? 514 ALA A CB  1 
ATOM 3770 N N   . SER A 1 515 ? 56.395  -32.232 99.784  1.00 0.00 ? 515 SER A N   1 
ATOM 3771 C CA  . SER A 1 515 ? 55.077  -32.152 100.379 1.00 0.00 ? 515 SER A CA  1 
ATOM 3772 C C   . SER A 1 515 ? 54.837  -30.759 100.889 1.00 0.00 ? 515 SER A C   1 
ATOM 3773 O O   . SER A 1 515 ? 53.920  -30.061 100.432 1.00 0.00 ? 515 SER A O   1 
ATOM 3774 C CB  . SER A 1 515 ? 55.018  -33.079 101.581 1.00 0.00 ? 515 SER A CB  1 
ATOM 3775 O OG  . SER A 1 515 ? 56.256  -33.054 102.276 1.00 0.00 ? 515 SER A OG  1 
ATOM 3776 N N   . ALA A 1 516 ? 55.679  -30.395 101.833 1.00 0.00 ? 516 ALA A N   1 
ATOM 3777 C CA  . ALA A 1 516 ? 55.570  -29.094 102.451 1.00 0.00 ? 516 ALA A CA  1 
ATOM 3778 C C   . ALA A 1 516 ? 54.260  -28.501 102.053 1.00 0.00 ? 516 ALA A C   1 
ATOM 3779 O O   . ALA A 1 516 ? 53.196  -29.081 102.303 1.00 0.00 ? 516 ALA A O   1 
ATOM 3780 C CB  . ALA A 1 516 ? 56.709  -28.192 101.972 1.00 0.00 ? 516 ALA A CB  1 
ATOM 3781 N N   . ASN A 1 517 ? 54.365  -27.373 101.423 1.00 0.00 ? 517 ASN A N   1 
ATOM 3782 C CA  . ASN A 1 517 ? 53.184  -26.677 100.993 1.00 0.00 ? 517 ASN A CA  1 
ATOM 3783 C C   . ASN A 1 517 ? 53.571  -25.442 100.255 1.00 0.00 ? 517 ASN A C   1 
ATOM 3784 O O   . ASN A 1 517 ? 53.932  -24.426 100.873 1.00 0.00 ? 517 ASN A O   1 
ATOM 3785 C CB  . ASN A 1 517 ? 52.367  -26.330 102.220 1.00 0.00 ? 517 ASN A CB  1 
ATOM 3786 C CG  . ASN A 1 517 ? 52.184  -27.528 103.155 1.00 0.00 ? 517 ASN A CG  1 
ATOM 3787 O OD1 . ASN A 1 517 ? 51.055  -27.932 103.424 1.00 0.00 ? 517 ASN A OD1 1 
ATOM 3788 N ND2 . ASN A 1 517 ? 53.241  -28.131 103.668 1.00 0.00 ? 517 ASN A ND2 1 
ATOM 3789 N N   . MET A 1 518 ? 53.463  -25.629 98.982  1.00 0.00 ? 518 MET A N   1 
ATOM 3790 C CA  . MET A 1 518 ? 53.792  -24.634 98.002  1.00 0.00 ? 518 MET A CA  1 
ATOM 3791 C C   . MET A 1 518 ? 53.748  -23.258 98.603  1.00 0.00 ? 518 MET A C   1 
ATOM 3792 O O   . MET A 1 518 ? 52.879  -22.441 98.264  1.00 0.00 ? 518 MET A O   1 
ATOM 3793 C CB  . MET A 1 518 ? 52.822  -24.719 96.840  1.00 0.00 ? 518 MET A CB  1 
ATOM 3794 C CG  . MET A 1 518 ? 51.388  -24.335 97.203  1.00 0.00 ? 518 MET A CG  1 
ATOM 3795 S SD  . MET A 1 518 ? 50.409  -23.931 95.771  1.00 0.00 ? 518 MET A SD  1 
ATOM 3796 C CE  . MET A 1 518 ? 48.723  -24.447 96.012  1.00 0.00 ? 518 MET A CE  1 
ATOM 3797 N N   . SER A 1 519 ? 54.687  -23.040 99.489  1.00 0.00 ? 519 SER A N   1 
ATOM 3798 C CA  . SER A 1 519 ? 54.826  -21.738 100.095 1.00 0.00 ? 519 SER A CA  1 
ATOM 3799 C C   . SER A 1 519 ? 54.626  -20.741 98.971  1.00 0.00 ? 519 SER A C   1 
ATOM 3800 O O   . SER A 1 519 ? 55.385  -20.735 97.992  1.00 0.00 ? 519 SER A O   1 
ATOM 3801 C CB  . SER A 1 519 ? 56.211  -21.596 100.723 1.00 0.00 ? 519 SER A CB  1 
ATOM 3802 O OG  . SER A 1 519 ? 57.216  -21.739 99.730  1.00 0.00 ? 519 SER A OG  1 
ATOM 3803 N N   . ARG A 1 520 ? 53.601  -19.948 99.135  1.00 0.00 ? 520 ARG A N   1 
ATOM 3804 C CA  . ARG A 1 520 ? 53.231  -18.944 98.143  1.00 0.00 ? 520 ARG A CA  1 
ATOM 3805 C C   . ARG A 1 520 ? 53.196  -17.555 98.769  1.00 0.00 ? 520 ARG A C   1 
ATOM 3806 O O   . ARG A 1 520 ? 53.169  -17.420 100.005 1.00 0.00 ? 520 ARG A O   1 
ATOM 3807 C CB  . ARG A 1 520 ? 51.838  -19.252 97.597  1.00 0.00 ? 520 ARG A CB  1 
ATOM 3808 C CG  . ARG A 1 520 ? 50.754  -19.198 98.683  1.00 0.00 ? 520 ARG A CG  1 
ATOM 3809 C CD  . ARG A 1 520 ? 49.936  -20.488 98.799  1.00 0.00 ? 520 ARG A CD  1 
ATOM 3810 N NE  . ARG A 1 520 ? 49.055  -20.533 99.984  1.00 0.00 ? 520 ARG A NE  1 
ATOM 3811 C CZ  . ARG A 1 520 ? 47.878  -21.184 100.010 1.00 0.00 ? 520 ARG A CZ  1 
ATOM 3812 N NH1 . ARG A 1 520 ? 47.429  -21.833 98.926  1.00 0.00 ? 520 ARG A NH1 1 
ATOM 3813 N NH2 . ARG A 1 520 ? 47.073  -21.251 101.079 1.00 0.00 ? 520 ARG A NH2 1 
ATOM 3814 N N   . ILE A 1 521 ? 53.196  -16.600 97.855  1.00 0.00 ? 521 ILE A N   1 
ATOM 3815 C CA  . ILE A 1 521 ? 53.116  -15.165 98.151  1.00 0.00 ? 521 ILE A CA  1 
ATOM 3816 C C   . ILE A 1 521 ? 51.725  -14.846 98.700  1.00 0.00 ? 521 ILE A C   1 
ATOM 3817 O O   . ILE A 1 521 ? 50.706  -15.073 98.029  1.00 0.00 ? 521 ILE A O   1 
ATOM 3818 C CB  . ILE A 1 521 ? 53.326  -14.353 96.863  1.00 0.00 ? 521 ILE A CB  1 
ATOM 3819 C CG1 . ILE A 1 521 ? 54.706  -14.557 96.232  1.00 0.00 ? 521 ILE A CG1 1 
ATOM 3820 C CG2 . ILE A 1 521 ? 53.193  -12.843 97.075  1.00 0.00 ? 521 ILE A CG2 1 
ATOM 3821 C CD1 . ILE A 1 521 ? 54.896  -13.759 94.938  1.00 0.00 ? 521 ILE A CD1 1 
ATOM 3822 N N   . VAL A 1 522 ? 51.727  -14.331 99.911  1.00 0.00 ? 522 VAL A N   1 
ATOM 3823 C CA  . VAL A 1 522 ? 50.495  -13.958 100.620 1.00 0.00 ? 522 VAL A CA  1 
ATOM 3824 C C   . VAL A 1 522 ? 49.693  -12.964 99.785  1.00 0.00 ? 522 VAL A C   1 
ATOM 3825 O O   . VAL A 1 522 ? 49.894  -11.744 99.877  1.00 0.00 ? 522 VAL A O   1 
ATOM 3826 C CB  . VAL A 1 522 ? 50.846  -13.316 101.964 1.00 0.00 ? 522 VAL A CB  1 
ATOM 3827 C CG1 . VAL A 1 522 ? 49.616  -13.011 102.820 1.00 0.00 ? 522 VAL A CG1 1 
ATOM 3828 C CG2 . VAL A 1 522 ? 51.746  -14.200 102.830 1.00 0.00 ? 522 VAL A CG2 1 
ATOM 3829 N N   . THR A 1 523 ? 48.800  -13.525 98.994  1.00 0.00 ? 523 THR A N   1 
ATOM 3830 C CA  . THR A 1 523 ? 47.969  -12.755 98.069  1.00 0.00 ? 523 THR A CA  1 
ATOM 3831 C C   . THR A 1 523 ? 46.487  -12.840 98.440  1.00 0.00 ? 523 THR A C   1 
ATOM 3832 O O   . THR A 1 523 ? 45.996  -13.894 98.868  1.00 0.00 ? 523 THR A O   1 
ATOM 3833 C CB  . THR A 1 523 ? 48.099  -13.321 96.647  1.00 0.00 ? 523 THR A CB  1 
ATOM 3834 O OG1 . THR A 1 523 ? 49.448  -13.239 96.212  1.00 0.00 ? 523 THR A OG1 1 
ATOM 3835 C CG2 . THR A 1 523 ? 47.242  -12.572 95.624  1.00 0.00 ? 523 THR A CG2 1 
ATOM 3836 N N   . TYR A 1 524 ? 45.841  -11.708 98.257  1.00 0.00 ? 524 TYR A N   1 
ATOM 3837 C CA  . TYR A 1 524 ? 44.386  -11.564 98.409  1.00 0.00 ? 524 TYR A CA  1 
ATOM 3838 C C   . TYR A 1 524 ? 43.918  -10.617 97.297  1.00 0.00 ? 524 TYR A C   1 
ATOM 3839 O O   . TYR A 1 524 ? 44.721  -9.909  96.679  1.00 0.00 ? 524 TYR A O   1 
ATOM 3840 C CB  . TYR A 1 524 ? 44.021  -11.041 99.822  1.00 0.00 ? 524 TYR A CB  1 
ATOM 3841 C CG  . TYR A 1 524 ? 44.375  -9.570  100.066 1.00 0.00 ? 524 TYR A CG  1 
ATOM 3842 C CD1 . TYR A 1 524 ? 43.544  -8.554  99.572  1.00 0.00 ? 524 TYR A CD1 1 
ATOM 3843 C CD2 . TYR A 1 524 ? 45.524  -9.238  100.794 1.00 0.00 ? 524 TYR A CD2 1 
ATOM 3844 C CE1 . TYR A 1 524 ? 43.864  -7.209  99.808  1.00 0.00 ? 524 TYR A CE1 1 
ATOM 3845 C CE2 . TYR A 1 524 ? 45.843  -7.895  101.031 1.00 0.00 ? 524 TYR A CE2 1 
ATOM 3846 C CZ  . TYR A 1 524 ? 45.013  -6.881  100.539 1.00 0.00 ? 524 TYR A CZ  1 
ATOM 3847 O OH  . TYR A 1 524 ? 45.323  -5.576  100.771 1.00 0.00 ? 524 TYR A OH  1 
ATOM 3848 N N   . SER A 1 525 ? 42.629  -10.602 97.029  1.00 0.00 ? 525 SER A N   1 
ATOM 3849 C CA  . SER A 1 525 ? 42.097  -9.773  95.926  1.00 0.00 ? 525 SER A CA  1 
ATOM 3850 C C   . SER A 1 525 ? 40.711  -9.242  96.246  1.00 0.00 ? 525 SER A C   1 
ATOM 3851 O O   . SER A 1 525 ? 39.874  -9.951  96.788  1.00 0.00 ? 525 SER A O   1 
ATOM 3852 C CB  . SER A 1 525 ? 41.977  -10.629 94.666  1.00 0.00 ? 525 SER A CB  1 
ATOM 3853 O OG  . SER A 1 525 ? 41.186  -11.782 94.940  1.00 0.00 ? 525 SER A OG  1 
ATOM 3854 N N   . ASP A 1 526 ? 40.464  -7.994  95.894  1.00 0.00 ? 526 ASP A N   1 
ATOM 3855 C CA  . ASP A 1 526 ? 39.149  -7.383  96.161  1.00 0.00 ? 526 ASP A CA  1 
ATOM 3856 C C   . ASP A 1 526 ? 38.421  -7.124  94.859  1.00 0.00 ? 526 ASP A C   1 
ATOM 3857 O O   . ASP A 1 526 ? 38.970  -6.508  93.949  1.00 0.00 ? 526 ASP A O   1 
ATOM 3858 C CB  . ASP A 1 526 ? 39.335  -6.065  96.904  1.00 0.00 ? 526 ASP A CB  1 
ATOM 3859 C CG  . ASP A 1 526 ? 40.050  -6.258  98.235  1.00 0.00 ? 526 ASP A CG  1 
ATOM 3860 O OD1 . ASP A 1 526 ? 39.369  -6.520  99.296  1.00 0.00 ? 526 ASP A OD1 1 
ATOM 3861 O OD2 . ASP A 1 526 ? 41.335  -6.168  98.292  1.00 0.00 ? 526 ASP A OD2 1 
ATOM 3862 N N   . PHE A 1 527 ? 37.184  -7.597  94.770  1.00 0.00 ? 527 PHE A N   1 
ATOM 3863 C CA  . PHE A 1 527 ? 36.405  -7.386  93.540  1.00 0.00 ? 527 PHE A CA  1 
ATOM 3864 C C   . PHE A 1 527 ? 34.948  -7.015  93.823  1.00 0.00 ? 527 PHE A C   1 
ATOM 3865 O O   . PHE A 1 527 ? 34.365  -7.440  94.832  1.00 0.00 ? 527 PHE A O   1 
ATOM 3866 C CB  . PHE A 1 527 ? 36.448  -8.623  92.635  1.00 0.00 ? 527 PHE A CB  1 
ATOM 3867 C CG  . PHE A 1 527 ? 35.818  -9.871  93.247  1.00 0.00 ? 527 PHE A CG  1 
ATOM 3868 C CD1 . PHE A 1 527 ? 36.603  -10.745 94.003  1.00 0.00 ? 527 PHE A CD1 1 
ATOM 3869 C CD2 . PHE A 1 527 ? 34.460  -10.142 93.043  1.00 0.00 ? 527 PHE A CD2 1 
ATOM 3870 C CE1 . PHE A 1 527 ? 36.030  -11.894 94.560  1.00 0.00 ? 527 PHE A CE1 1 
ATOM 3871 C CE2 . PHE A 1 527 ? 33.886  -11.291 93.599  1.00 0.00 ? 527 PHE A CE2 1 
ATOM 3872 C CZ  . PHE A 1 527 ? 34.672  -12.167 94.358  1.00 0.00 ? 527 PHE A CZ  1 
ATOM 3873 N N   . TRP A 1 528 ? 34.418  -6.224  92.906  1.00 0.00 ? 528 TRP A N   1 
ATOM 3874 C CA  . TRP A 1 528 ? 33.035  -5.735  92.964  1.00 0.00 ? 528 TRP A CA  1 
ATOM 3875 C C   . TRP A 1 528 ? 32.096  -6.707  92.230  1.00 0.00 ? 528 TRP A C   1 
ATOM 3876 O O   . TRP A 1 528 ? 32.358  -7.103  91.083  1.00 0.00 ? 528 TRP A O   1 
ATOM 3877 C CB  . TRP A 1 528 ? 32.935  -4.354  92.292  1.00 0.00 ? 528 TRP A CB  1 
ATOM 3878 C CG  . TRP A 1 528 ? 33.692  -3.247  93.043  1.00 0.00 ? 528 TRP A CG  1 
ATOM 3879 C CD1 . TRP A 1 528 ? 34.976  -2.891  92.882  1.00 0.00 ? 528 TRP A CD1 1 
ATOM 3880 C CD2 . TRP A 1 528 ? 33.135  -2.408  94.045  1.00 0.00 ? 528 TRP A CD2 1 
ATOM 3881 N NE1 . TRP A 1 528 ? 35.234  -1.814  93.792  1.00 0.00 ? 528 TRP A NE1 1 
ATOM 3882 C CE2 . TRP A 1 528 ? 34.141  -1.547  94.464  1.00 0.00 ? 528 TRP A CE2 1 
ATOM 3883 C CE3 . TRP A 1 528 ? 31.866  -2.310  94.627  1.00 0.00 ? 528 TRP A CE3 1 
ATOM 3884 C CZ2 . TRP A 1 528 ? 33.954  -0.572  95.451  1.00 0.00 ? 528 TRP A CZ2 1 
ATOM 3885 C CZ3 . TRP A 1 528 ? 31.685  -1.325  95.621  1.00 0.00 ? 528 TRP A CZ3 1 
ATOM 3886 C CH2 . TRP A 1 528 ? 32.681  -0.498  96.013  1.00 0.00 ? 528 TRP A CH2 1 
ATOM 3887 N N   . TRP A 1 529 ? 31.030  -7.055  92.939  1.00 0.00 ? 529 TRP A N   1 
ATOM 3888 C CA  . TRP A 1 529 ? 29.968  -7.957  92.445  1.00 0.00 ? 529 TRP A CA  1 
ATOM 3889 C C   . TRP A 1 529 ? 28.666  -7.160  92.336  1.00 0.00 ? 529 TRP A C   1 
ATOM 3890 O O   . TRP A 1 529 ? 28.341  -6.346  93.199  1.00 0.00 ? 529 TRP A O   1 
ATOM 3891 C CB  . TRP A 1 529 ? 29.771  -9.135  93.414  1.00 0.00 ? 529 TRP A CB  1 
ATOM 3892 C CG  . TRP A 1 529 ? 28.600  -10.065 93.032  1.00 0.00 ? 529 TRP A CG  1 
ATOM 3893 C CD1 . TRP A 1 529 ? 28.650  -11.152 92.247  1.00 0.00 ? 529 TRP A CD1 1 
ATOM 3894 C CD2 . TRP A 1 529 ? 27.252  -9.913  93.467  1.00 0.00 ? 529 TRP A CD2 1 
ATOM 3895 N NE1 . TRP A 1 529 ? 27.323  -11.691 92.179  1.00 0.00 ? 529 TRP A NE1 1 
ATOM 3896 C CE2 . TRP A 1 529 ? 26.519  -10.949 92.899  1.00 0.00 ? 529 TRP A CE2 1 
ATOM 3897 C CE3 . TRP A 1 529 ? 26.598  -8.986  94.287  1.00 0.00 ? 529 TRP A CE3 1 
ATOM 3898 C CZ2 . TRP A 1 529 ? 25.143  -11.116 93.100  1.00 0.00 ? 529 TRP A CZ2 1 
ATOM 3899 C CZ3 . TRP A 1 529 ? 25.211  -9.162  94.487  1.00 0.00 ? 529 TRP A CZ3 1 
ATOM 3900 C CH2 . TRP A 1 529 ? 24.518  -10.177 93.920  1.00 0.00 ? 529 TRP A CH2 1 
ATOM 3901 N N   . LYS A 1 530 ? 27.971  -7.430  91.282  1.00 0.00 ? 530 LYS A N   1 
ATOM 3902 C CA  . LYS A 1 530 ? 26.704  -6.774  90.929  1.00 0.00 ? 530 LYS A CA  1 
ATOM 3903 C C   . LYS A 1 530 ? 25.670  -7.822  90.604  1.00 0.00 ? 530 LYS A C   1 
ATOM 3904 O O   . LYS A 1 530 ? 25.992  -8.896  90.077  1.00 0.00 ? 530 LYS A O   1 
ATOM 3905 C CB  . LYS A 1 530 ? 26.920  -6.137  89.639  1.00 0.00 ? 530 LYS A CB  1 
ATOM 3906 C CG  . LYS A 1 530 ? 25.824  -5.275  89.097  1.00 0.00 ? 530 LYS A CG  1 
ATOM 3907 C CD  . LYS A 1 530 ? 26.428  -4.401  88.009  1.00 0.00 ? 530 LYS A CD  1 
ATOM 3908 C CE  . LYS A 1 530 ? 25.442  -3.522  87.280  1.00 0.00 ? 530 LYS A CE  1 
ATOM 3909 N NZ  . LYS A 1 530 ? 26.094  -2.701  86.249  1.00 0.00 ? 530 LYS A NZ  1 
ATOM 3910 N N   . GLY A 1 531 ? 24.441  -7.504  90.912  1.00 0.00 ? 531 GLY A N   1 
ATOM 3911 C CA  . GLY A 1 531 ? 23.348  -8.434  90.709  1.00 0.00 ? 531 GLY A CA  1 
ATOM 3912 C C   . GLY A 1 531 ? 22.097  -7.740  90.227  1.00 0.00 ? 531 GLY A C   1 
ATOM 3913 O O   . GLY A 1 531 ? 21.769  -6.631  90.674  1.00 0.00 ? 531 GLY A O   1 
ATOM 3914 N N   . LYS A 1 532 ? 21.450  -8.440  89.320  1.00 0.00 ? 532 LYS A N   1 
ATOM 3915 C CA  . LYS A 1 532 ? 20.177  -8.045  88.761  1.00 0.00 ? 532 LYS A CA  1 
ATOM 3916 C C   . LYS A 1 532 ? 19.209  -9.218  88.842  1.00 0.00 ? 532 LYS A C   1 
ATOM 3917 O O   . LYS A 1 532 ? 19.296  -10.173 88.056  1.00 0.00 ? 532 LYS A O   1 
ATOM 3918 C CB  . LYS A 1 532 ? 20.325  -7.629  87.292  1.00 0.00 ? 532 LYS A CB  1 
ATOM 3919 C CG  . LYS A 1 532 ? 18.976  -7.231  86.659  1.00 0.00 ? 532 LYS A CG  1 
ATOM 3920 C CD  . LYS A 1 532 ? 19.090  -6.814  85.190  1.00 0.00 ? 532 LYS A CD  1 
ATOM 3921 C CE  . LYS A 1 532 ? 17.738  -6.417  84.580  1.00 0.00 ? 532 LYS A CE  1 
ATOM 3922 N NZ  . LYS A 1 532 ? 17.839  -6.018  83.168  1.00 0.00 ? 532 LYS A NZ  1 
ATOM 3923 N N   . LEU A 1 533 ? 18.333  -9.105  89.795  1.00 0.00 ? 533 LEU A N   1 
ATOM 3924 C CA  . LEU A 1 533 ? 17.266  -10.081 90.039  1.00 0.00 ? 533 LEU A CA  1 
ATOM 3925 C C   . LEU A 1 533 ? 15.945  -9.451  89.564  1.00 0.00 ? 533 LEU A C   1 
ATOM 3926 O O   . LEU A 1 533 ? 15.624  -8.308  89.906  1.00 0.00 ? 533 LEU A O   1 
ATOM 3927 C CB  . LEU A 1 533 ? 17.233  -10.411 91.542  1.00 0.00 ? 533 LEU A CB  1 
ATOM 3928 C CG  . LEU A 1 533 ? 16.234  -11.503 91.909  1.00 0.00 ? 533 LEU A CG  1 
ATOM 3929 C CD1 . LEU A 1 533 ? 16.516  -12.832 91.206  1.00 0.00 ? 533 LEU A CD1 1 
ATOM 3930 C CD2 . LEU A 1 533 ? 16.220  -11.820 93.406  1.00 0.00 ? 533 LEU A CD2 1 
ATOM 3931 N N   . VAL A 1 534 ? 15.195  -10.197 88.769  1.00 0.00 ? 534 VAL A N   1 
ATOM 3932 C CA  . VAL A 1 534 ? 13.936  -9.670  88.157  1.00 0.00 ? 534 VAL A CA  1 
ATOM 3933 C C   . VAL A 1 534 ? 12.703  -10.423 88.669  1.00 0.00 ? 534 VAL A C   1 
ATOM 3934 O O   . VAL A 1 534 ? 12.656  -11.660 88.648  1.00 0.00 ? 534 VAL A O   1 
ATOM 3935 C CB  . VAL A 1 534 ? 14.001  -9.802  86.636  1.00 0.00 ? 534 VAL A CB  1 
ATOM 3936 C CG1 . VAL A 1 534 ? 12.767  -9.234  85.932  1.00 0.00 ? 534 VAL A CG1 1 
ATOM 3937 C CG2 . VAL A 1 534 ? 15.200  -9.074  86.024  1.00 0.00 ? 534 VAL A CG2 1 
ATOM 3938 N N   . PHE A 1 535 ? 11.737  -9.625  89.113  1.00 0.00 ? 535 PHE A N   1 
ATOM 3939 C CA  . PHE A 1 535 ? 10.455  -10.124 89.641  1.00 0.00 ? 535 PHE A CA  1 
ATOM 3940 C C   . PHE A 1 535 ? 9.314   -9.384  88.934  1.00 0.00 ? 535 PHE A C   1 
ATOM 3941 O O   . PHE A 1 535 ? 9.392   -8.172  88.689  1.00 0.00 ? 535 PHE A O   1 
ATOM 3942 C CB  . PHE A 1 535 ? 10.346  -9.827  91.147  1.00 0.00 ? 535 PHE A CB  1 
ATOM 3943 C CG  . PHE A 1 535 ? 11.470  -10.452 91.977  1.00 0.00 ? 535 PHE A CG  1 
ATOM 3944 C CD1 . PHE A 1 535 ? 11.318  -11.739 92.507  1.00 0.00 ? 535 PHE A CD1 1 
ATOM 3945 C CD2 . PHE A 1 535 ? 12.650  -9.735  92.211  1.00 0.00 ? 535 PHE A CD2 1 
ATOM 3946 C CE1 . PHE A 1 535 ? 12.344  -12.309 93.270  1.00 0.00 ? 535 PHE A CE1 1 
ATOM 3947 C CE2 . PHE A 1 535 ? 13.676  -10.305 92.975  1.00 0.00 ? 535 PHE A CE2 1 
ATOM 3948 C CZ  . PHE A 1 535 ? 13.523  -11.592 93.504  1.00 0.00 ? 535 PHE A CZ  1 
ATOM 3949 N N   . LYS A 1 536 ? 8.277   -10.125 88.611  1.00 0.00 ? 536 LYS A N   1 
ATOM 3950 C CA  . LYS A 1 536 ? 7.087   -9.563  87.952  1.00 0.00 ? 536 LYS A CA  1 
ATOM 3951 C C   . LYS A 1 536 ? 5.851   -9.913  88.764  1.00 0.00 ? 536 LYS A C   1 
ATOM 3952 O O   . LYS A 1 536 ? 5.552   -11.092 88.995  1.00 0.00 ? 536 LYS A O   1 
ATOM 3953 C CB  . LYS A 1 536 ? 6.927   -10.138 86.550  1.00 0.00 ? 536 LYS A CB  1 
ATOM 3954 C CG  . LYS A 1 536 ? 5.588   -9.758  85.917  1.00 0.00 ? 536 LYS A CG  1 
ATOM 3955 C CD  . LYS A 1 536 ? 5.473   -10.191 84.459  1.00 0.00 ? 536 LYS A CD  1 
ATOM 3956 C CE  . LYS A 1 536 ? 6.625   -9.682  83.593  1.00 0.00 ? 536 LYS A CE  1 
ATOM 3957 N NZ  . LYS A 1 536 ? 6.505   -10.089 82.186  1.00 0.00 ? 536 LYS A NZ  1 
ATOM 3958 N N   . ALA A 1 537 ? 5.145   -8.880  89.180  1.00 0.00 ? 537 ALA A N   1 
ATOM 3959 C CA  . ALA A 1 537 ? 3.967   -9.069  90.026  1.00 0.00 ? 537 ALA A CA  1 
ATOM 3960 C C   . ALA A 1 537 ? 2.770   -8.237  89.573  1.00 0.00 ? 537 ALA A C   1 
ATOM 3961 O O   . ALA A 1 537 ? 2.882   -7.387  88.675  1.00 0.00 ? 537 ALA A O   1 
ATOM 3962 C CB  . ALA A 1 537 ? 4.287   -8.676  91.464  1.00 0.00 ? 537 ALA A CB  1 
ATOM 3963 N N   . LYS A 1 538 ? 1.696   -8.554  90.267  1.00 0.00 ? 538 LYS A N   1 
ATOM 3964 C CA  . LYS A 1 538 ? 0.364   -7.986  90.073  1.00 0.00 ? 538 LYS A CA  1 
ATOM 3965 C C   . LYS A 1 538 ? -0.024  -7.127  91.293  1.00 0.00 ? 538 LYS A C   1 
ATOM 3966 O O   . LYS A 1 538 ? 0.515   -7.297  92.391  1.00 0.00 ? 538 LYS A O   1 
ATOM 3967 C CB  . LYS A 1 538 ? -0.606  -9.145  89.936  1.00 0.00 ? 538 LYS A CB  1 
ATOM 3968 C CG  . LYS A 1 538 ? -2.034  -8.689  89.799  1.00 0.00 ? 538 LYS A CG  1 
ATOM 3969 C CD  . LYS A 1 538 ? -2.618  -9.026  88.440  1.00 0.00 ? 538 LYS A CD  1 
ATOM 3970 C CE  . LYS A 1 538 ? -4.115  -9.266  88.509  1.00 0.00 ? 538 LYS A CE  1 
ATOM 3971 N NZ  . LYS A 1 538 ? -4.745  -9.298  87.189  1.00 0.00 ? 538 LYS A NZ  1 
ATOM 3972 N N   . LEU A 1 539 ? -0.973  -6.213  91.085  1.00 0.00 ? 539 LEU A N   1 
ATOM 3973 C CA  . LEU A 1 539 ? -1.430  -5.278  92.151  1.00 0.00 ? 539 LEU A CA  1 
ATOM 3974 C C   . LEU A 1 539 ? -2.753  -5.745  92.799  1.00 0.00 ? 539 LEU A C   1 
ATOM 3975 O O   . LEU A 1 539 ? -3.606  -6.357  92.141  1.00 0.00 ? 539 LEU A O   1 
ATOM 3976 C CB  . LEU A 1 539 ? -1.651  -3.878  91.568  1.00 0.00 ? 539 LEU A CB  1 
ATOM 3977 C CG  . LEU A 1 539 ? -0.378  -3.265  90.977  1.00 0.00 ? 539 LEU A CG  1 
ATOM 3978 C CD1 . LEU A 1 539 ? -0.619  -1.904  90.319  1.00 0.00 ? 539 LEU A CD1 1 
ATOM 3979 C CD2 . LEU A 1 539 ? 0.718   -3.031  92.019  1.00 0.00 ? 539 LEU A CD2 1 
ATOM 3980 N N   . ARG A 1 540 ? -2.875  -5.421  94.090  1.00 0.00 ? 540 ARG A N   1 
ATOM 3981 C CA  . ARG A 1 540 ? -4.054  -5.770  94.928  1.00 0.00 ? 540 ARG A CA  1 
ATOM 3982 C C   . ARG A 1 540 ? -5.138  -4.700  94.807  1.00 0.00 ? 540 ARG A C   1 
ATOM 3983 O O   . ARG A 1 540 ? -4.856  -3.495  94.867  1.00 0.00 ? 540 ARG A O   1 
ATOM 3984 C CB  . ARG A 1 540 ? -3.642  -5.865  96.399  1.00 0.00 ? 540 ARG A CB  1 
ATOM 3985 C CG  . ARG A 1 540 ? -3.474  -4.494  97.058  1.00 0.00 ? 540 ARG A CG  1 
ATOM 3986 C CD  . ARG A 1 540 ? -3.256  -4.574  98.570  1.00 0.00 ? 540 ARG A CD  1 
ATOM 3987 N NE  . ARG A 1 540 ? -3.435  -3.280  99.245  1.00 0.00 ? 540 ARG A NE  1 
ATOM 3988 C CZ  . ARG A 1 540 ? -4.608  -2.839  99.719  1.00 0.00 ? 540 ARG A CZ  1 
ATOM 3989 N NH1 . ARG A 1 540 ? -5.721  -3.576  99.602  1.00 0.00 ? 540 ARG A NH1 1 
ATOM 3990 N NH2 . ARG A 1 540 ? -4.772  -1.659  100.334 1.00 0.00 ? 540 ARG A NH2 1 
ATOM 3991 N N   . ALA A 1 541 ? -6.340  -5.183  94.638  1.00 0.00 ? 541 ALA A N   1 
ATOM 3992 C CA  . ALA A 1 541 ? -7.544  -4.347  94.622  1.00 0.00 ? 541 ALA A CA  1 
ATOM 3993 C C   . ALA A 1 541 ? -8.270  -4.647  95.924  1.00 0.00 ? 541 ALA A C   1 
ATOM 3994 O O   . ALA A 1 541 ? -8.105  -5.727  96.511  1.00 0.00 ? 541 ALA A O   1 
ATOM 3995 C CB  . ALA A 1 541 ? -8.476  -4.793  93.490  1.00 0.00 ? 541 ALA A CB  1 
ATOM 3996 N N   . SER A 1 542 ? -9.051  -3.713  96.379  1.00 0.00 ? 542 SER A N   1 
ATOM 3997 C CA  . SER A 1 542 ? -9.850  -3.934  97.582  1.00 0.00 ? 542 SER A CA  1 
ATOM 3998 C C   . SER A 1 542 ? -11.153 -4.599  97.148  1.00 0.00 ? 542 SER A C   1 
ATOM 3999 O O   . SER A 1 542 ? -11.658 -4.350  96.046  1.00 0.00 ? 542 SER A O   1 
ATOM 4000 C CB  . SER A 1 542 ? -10.127 -2.607  98.279  1.00 0.00 ? 542 SER A CB  1 
ATOM 4001 O OG  . SER A 1 542 ? -11.373 -2.668  98.954  1.00 0.00 ? 542 SER A OG  1 
ATOM 4002 N N   . HIS A 1 543 ? -11.677 -5.441  98.009  1.00 0.00 ? 543 HIS A N   1 
ATOM 4003 C CA  . HIS A 1 543 ? -12.929 -6.153  97.719  1.00 0.00 ? 543 HIS A CA  1 
ATOM 4004 C C   . HIS A 1 543 ? -13.818 -6.180  98.961  1.00 0.00 ? 543 HIS A C   1 
ATOM 4005 O O   . HIS A 1 543 ? -15.016 -6.490  98.882  1.00 0.00 ? 543 HIS A O   1 
ATOM 4006 C CB  . HIS A 1 543 ? -12.626 -7.581  97.261  1.00 0.00 ? 543 HIS A CB  1 
ATOM 4007 C CG  . HIS A 1 543 ? -12.338 -7.678  95.758  1.00 0.00 ? 543 HIS A CG  1 
ATOM 4008 N ND1 . HIS A 1 543 ? -11.100 -8.086  95.269  1.00 0.00 ? 543 HIS A ND1 1 
ATOM 4009 C CD2 . HIS A 1 543 ? -13.109 -7.424  94.664  1.00 0.00 ? 543 HIS A CD2 1 
ATOM 4010 C CE1 . HIS A 1 543 ? -11.151 -8.070  93.948  1.00 0.00 ? 543 HIS A CE1 1 
ATOM 4011 N NE2 . HIS A 1 543 ? -12.341 -7.677  93.572  1.00 0.00 ? 543 HIS A NE2 1 
ATOM 4012 N N   . THR A 1 544 ? -13.201 -5.850  100.079 1.00 0.00 ? 544 THR A N   1 
ATOM 4013 C CA  . THR A 1 544 ? -13.886 -5.808  101.377 1.00 0.00 ? 544 THR A CA  1 
ATOM 4014 C C   . THR A 1 544 ? -14.325 -4.378  101.690 1.00 0.00 ? 544 THR A C   1 
ATOM 4015 O O   . THR A 1 544 ? -14.362 -3.511  100.806 1.00 0.00 ? 544 THR A O   1 
ATOM 4016 C CB  . THR A 1 544 ? -12.955 -6.296  102.488 1.00 0.00 ? 544 THR A CB  1 
ATOM 4017 O OG1 . THR A 1 544 ? -11.948 -5.328  102.740 1.00 0.00 ? 544 THR A OG1 1 
ATOM 4018 C CG2 . THR A 1 544 ? -12.252 -7.611  102.146 1.00 0.00 ? 544 THR A CG2 1 
ATOM 4019 N N   . TRP A 1 545 ? -14.649 -4.178  102.949 1.00 0.00 ? 545 TRP A N   1 
ATOM 4020 C CA  . TRP A 1 545 ? -15.083 -2.874  103.457 1.00 0.00 ? 545 TRP A CA  1 
ATOM 4021 C C   . TRP A 1 545 ? -14.164 -2.436  104.570 1.00 0.00 ? 545 TRP A C   1 
ATOM 4022 O O   . TRP A 1 545 ? -13.920 -1.235  104.763 1.00 0.00 ? 545 TRP A O   1 
ATOM 4023 C CB  . TRP A 1 545 ? -16.501 -2.971  104.008 1.00 0.00 ? 545 TRP A CB  1 
ATOM 4024 C CG  . TRP A 1 545 ? -16.938 -1.693  104.717 1.00 0.00 ? 545 TRP A CG  1 
ATOM 4025 C CD1 . TRP A 1 545 ? -16.472 -1.214  105.878 1.00 0.00 ? 545 TRP A CD1 1 
ATOM 4026 C CD2 . TRP A 1 545 ? -17.923 -0.802  104.236 1.00 0.00 ? 545 TRP A CD2 1 
ATOM 4027 N NE1 . TRP A 1 545 ? -17.175 0.006   106.137 1.00 0.00 ? 545 TRP A NE1 1 
ATOM 4028 C CE2 . TRP A 1 545 ? -18.021 0.228   105.161 1.00 0.00 ? 545 TRP A CE2 1 
ATOM 4029 C CE3 . TRP A 1 545 ? -18.737 -0.782  103.100 1.00 0.00 ? 545 TRP A CE3 1 
ATOM 4030 C CZ2 . TRP A 1 545 ? -18.904 1.303   105.015 1.00 0.00 ? 545 TRP A CZ2 1 
ATOM 4031 C CZ3 . TRP A 1 545 ? -19.624 0.303   102.961 1.00 0.00 ? 545 TRP A CZ3 1 
ATOM 4032 C CH2 . TRP A 1 545 ? -19.702 1.297   103.875 1.00 0.00 ? 545 TRP A CH2 1 
ATOM 4033 N N   . ASN A 1 546 ? -13.714 -3.458  105.249 1.00 0.00 ? 546 ASN A N   1 
ATOM 4034 C CA  . ASN A 1 546 ? -12.754 -3.334  106.326 1.00 0.00 ? 546 ASN A CA  1 
ATOM 4035 C C   . ASN A 1 546 ? -11.359 -3.245  105.734 1.00 0.00 ? 546 ASN A C   1 
ATOM 4036 O O   . ASN A 1 546 ? -10.991 -4.029  104.846 1.00 0.00 ? 546 ASN A O   1 
ATOM 4037 C CB  . ASN A 1 546 ? -12.836 -4.560  107.233 1.00 0.00 ? 546 ASN A CB  1 
ATOM 4038 C CG  . ASN A 1 546 ? -12.506 -5.859  106.500 1.00 0.00 ? 546 ASN A CG  1 
ATOM 4039 O OD1 . ASN A 1 546 ? -11.335 -6.211  106.370 1.00 0.00 ? 546 ASN A OD1 1 
ATOM 4040 N ND2 . ASN A 1 546 ? -13.478 -6.602  106.004 1.00 0.00 ? 546 ASN A ND2 1 
ATOM 4041 N N   . PRO A 1 547 ? -10.553 -2.296  106.189 1.00 0.00 ? 547 PRO A N   1 
ATOM 4042 C CA  . PRO A 1 547 ? -9.198  -2.167  105.706 1.00 0.00 ? 547 PRO A CA  1 
ATOM 4043 C C   . PRO A 1 547 ? -8.448  -3.446  105.967 1.00 0.00 ? 547 PRO A C   1 
ATOM 4044 O O   . PRO A 1 547 ? -8.848  -4.215  106.895 1.00 0.00 ? 547 PRO A O   1 
ATOM 4045 C CB  . PRO A 1 547 ? -8.655  -0.998  106.488 1.00 0.00 ? 547 PRO A CB  1 
ATOM 4046 C CG  . PRO A 1 547 ? -9.758  -0.493  107.404 1.00 0.00 ? 547 PRO A CG  1 
ATOM 4047 C CD  . PRO A 1 547 ? -10.977 -1.332  107.198 1.00 0.00 ? 547 PRO A CD  1 
ATOM 4048 N N   . ILE A 1 548 ? -7.413  -3.654  105.168 1.00 0.00 ? 548 ILE A N   1 
ATOM 4049 C CA  . ILE A 1 548 ? -6.532  -4.833  105.286 1.00 0.00 ? 548 ILE A CA  1 
ATOM 4050 C C   . ILE A 1 548 ? -5.279  -4.462  106.091 1.00 0.00 ? 548 ILE A C   1 
ATOM 4051 O O   . ILE A 1 548 ? -4.858  -3.297  106.116 1.00 0.00 ? 548 ILE A O   1 
ATOM 4052 C CB  . ILE A 1 548 ? -6.102  -5.312  103.894 1.00 0.00 ? 548 ILE A CB  1 
ATOM 4053 C CG1 . ILE A 1 548 ? -7.278  -5.746  103.015 1.00 0.00 ? 548 ILE A CG1 1 
ATOM 4054 C CG2 . ILE A 1 548 ? -5.160  -6.517  103.941 1.00 0.00 ? 548 ILE A CG2 1 
ATOM 4055 C CD1 . ILE A 1 548 ? -6.845  -6.203  101.620 1.00 0.00 ? 548 ILE A CD1 1 
ATOM 4056 N N   . GLN A 1 549 ? -4.713  -5.471  106.735 1.00 0.00 ? 549 GLN A N   1 
ATOM 4057 C CA  . GLN A 1 549 ? -3.503  -5.305  107.563 1.00 0.00 ? 549 GLN A CA  1 
ATOM 4058 C C   . GLN A 1 549 ? -2.294  -4.962  106.673 1.00 0.00 ? 549 GLN A C   1 
ATOM 4059 O O   . GLN A 1 549 ? -1.875  -5.769  105.829 1.00 0.00 ? 549 GLN A O   1 
ATOM 4060 C CB  . GLN A 1 549 ? -3.203  -6.590  108.341 1.00 0.00 ? 549 GLN A CB  1 
ATOM 4061 C CG  . GLN A 1 549 ? -1.998  -6.451  109.275 1.00 0.00 ? 549 GLN A CG  1 
ATOM 4062 C CD  . GLN A 1 549 ? -1.720  -7.716  110.089 1.00 0.00 ? 549 GLN A CD  1 
ATOM 4063 O OE1 . GLN A 1 549 ? -2.241  -7.863  111.194 1.00 0.00 ? 549 GLN A OE1 1 
ATOM 4064 N NE2 . GLN A 1 549 ? -0.921  -8.650  109.607 1.00 0.00 ? 549 GLN A NE2 1 
ATOM 4065 N N   . GLN A 1 550 ? -1.773  -3.761  106.904 1.00 0.00 ? 550 GLN A N   1 
ATOM 4066 C CA  . GLN A 1 550 ? -0.613  -3.215  106.162 1.00 0.00 ? 550 GLN A CA  1 
ATOM 4067 C C   . GLN A 1 550 ? 0.601   -3.059  107.088 1.00 0.00 ? 550 GLN A C   1 
ATOM 4068 O O   . GLN A 1 550 ? 0.494   -3.219  108.308 1.00 0.00 ? 550 GLN A O   1 
ATOM 4069 C CB  . GLN A 1 550 ? -0.943  -1.825  105.609 1.00 0.00 ? 550 GLN A CB  1 
ATOM 4070 C CG  . GLN A 1 550 ? -2.221  -1.797  104.774 1.00 0.00 ? 550 GLN A CG  1 
ATOM 4071 C CD  . GLN A 1 550 ? -2.000  -2.269  103.338 1.00 0.00 ? 550 GLN A CD  1 
ATOM 4072 O OE1 . GLN A 1 550 ? -2.171  -3.452  103.049 1.00 0.00 ? 550 GLN A OE1 1 
ATOM 4073 N NE2 . GLN A 1 550 ? -1.626  -1.409  102.410 1.00 0.00 ? 550 GLN A NE2 1 
ATOM 4074 N N   . MET A 1 551 ? 1.726   -2.744  106.463 1.00 0.00 ? 551 MET A N   1 
ATOM 4075 C CA  . MET A 1 551 ? 3.017   -2.531  107.155 1.00 0.00 ? 551 MET A CA  1 
ATOM 4076 C C   . MET A 1 551 ? 3.206   -1.024  107.398 1.00 0.00 ? 551 MET A C   1 
ATOM 4077 O O   . MET A 1 551 ? 2.925   -0.197  106.520 1.00 0.00 ? 551 MET A O   1 
ATOM 4078 C CB  . MET A 1 551 ? 4.140   -3.079  106.267 1.00 0.00 ? 551 MET A CB  1 
ATOM 4079 C CG  . MET A 1 551 ? 5.533   -2.970  106.885 1.00 0.00 ? 551 MET A CG  1 
ATOM 4080 S SD  . MET A 1 551 ? 6.800   -3.616  105.811 1.00 0.00 ? 551 MET A SD  1 
ATOM 4081 C CE  . MET A 1 551 ? 8.396   -3.452  106.576 1.00 0.00 ? 551 MET A CE  1 
ATOM 4082 N N   . SER A 1 552 ? 3.682   -0.675  108.591 1.00 0.00 ? 552 SER A N   1 
ATOM 4083 C CA  . SER A 1 552 ? 3.864   0.748   108.964 1.00 0.00 ? 552 SER A CA  1 
ATOM 4084 C C   . SER A 1 552 ? 5.019   0.955   109.958 1.00 0.00 ? 552 SER A C   1 
ATOM 4085 O O   . SER A 1 552 ? 5.684   -0.002  110.378 1.00 0.00 ? 552 SER A O   1 
ATOM 4086 C CB  . SER A 1 552 ? 2.590   1.281   109.620 1.00 0.00 ? 552 SER A CB  1 
ATOM 4087 O OG  . SER A 1 552 ? 2.759   2.645   109.977 1.00 0.00 ? 552 SER A OG  1 
ATOM 4088 N N   . ILE A 1 553 ? 5.194   2.230   110.288 1.00 0.00 ? 553 ILE A N   1 
ATOM 4089 C CA  . ILE A 1 553 ? 6.232   2.719   111.219 1.00 0.00 ? 553 ILE A CA  1 
ATOM 4090 C C   . ILE A 1 553 ? 5.582   3.266   112.476 1.00 0.00 ? 553 ILE A C   1 
ATOM 4091 O O   . ILE A 1 553 ? 4.910   4.307   112.447 1.00 0.00 ? 553 ILE A O   1 
ATOM 4092 C CB  . ILE A 1 553 ? 7.009   3.863   110.562 1.00 0.00 ? 553 ILE A CB  1 
ATOM 4093 C CG1 . ILE A 1 553 ? 8.049   3.382   109.550 1.00 0.00 ? 553 ILE A CG1 1 
ATOM 4094 C CG2 . ILE A 1 553 ? 7.773   4.725   111.569 1.00 0.00 ? 553 ILE A CG2 1 
ATOM 4095 C CD1 . ILE A 1 553 ? 9.129   2.503   110.179 1.00 0.00 ? 553 ILE A CD1 1 
ATOM 4096 N N   . ASN A 1 554 ? 5.795   2.552   113.541 1.00 0.00 ? 554 ASN A N   1 
ATOM 4097 C CA  . ASN A 1 554 ? 5.281   2.922   114.852 1.00 0.00 ? 554 ASN A CA  1 
ATOM 4098 C C   . ASN A 1 554 ? 6.310   3.754   115.583 1.00 0.00 ? 554 ASN A C   1 
ATOM 4099 O O   . ASN A 1 554 ? 7.364   4.100   115.028 1.00 0.00 ? 554 ASN A O   1 
ATOM 4100 C CB  . ASN A 1 554 ? 5.008   1.666   115.688 1.00 0.00 ? 554 ASN A CB  1 
ATOM 4101 C CG  . ASN A 1 554 ? 3.909   0.783   115.106 1.00 0.00 ? 554 ASN A CG  1 
ATOM 4102 O OD1 . ASN A 1 554 ? 4.204   -0.200  114.429 1.00 0.00 ? 554 ASN A OD1 1 
ATOM 4103 N ND2 . ASN A 1 554 ? 2.641   1.074   115.330 1.00 0.00 ? 554 ASN A ND2 1 
ATOM 4104 N N   . VAL A 1 555 ? 5.978   4.056   116.803 1.00 0.00 ? 555 VAL A N   1 
ATOM 4105 C CA  . VAL A 1 555 ? 6.858   4.783   117.694 1.00 0.00 ? 555 VAL A CA  1 
ATOM 4106 C C   . VAL A 1 555 ? 7.820   3.785   118.312 1.00 0.00 ? 555 VAL A C   1 
ATOM 4107 O O   . VAL A 1 555 ? 8.689   4.150   119.115 1.00 0.00 ? 555 VAL A O   1 
ATOM 4108 C CB  . VAL A 1 555 ? 6.040   5.455   118.803 1.00 0.00 ? 555 VAL A CB  1 
ATOM 4109 C CG1 . VAL A 1 555 ? 6.897   6.293   119.754 1.00 0.00 ? 555 VAL A CG1 1 
ATOM 4110 C CG2 . VAL A 1 555 ? 4.969   6.405   118.264 1.00 0.00 ? 555 VAL A CG2 1 
ATOM 4111 N N   . ASP A 1 556 ? 7.602   2.565   117.874 1.00 0.00 ? 556 ASP A N   1 
ATOM 4112 C CA  . ASP A 1 556 ? 8.312   1.386   118.359 1.00 0.00 ? 556 ASP A CA  1 
ATOM 4113 C C   . ASP A 1 556 ? 9.190   0.789   117.295 1.00 0.00 ? 556 ASP A C   1 
ATOM 4114 O O   . ASP A 1 556 ? 10.043  -0.063  117.578 1.00 0.00 ? 556 ASP A O   1 
ATOM 4115 C CB  . ASP A 1 556 ? 7.286   0.345   118.745 1.00 0.00 ? 556 ASP A CB  1 
ATOM 4116 C CG  . ASP A 1 556 ? 6.245   0.942   119.666 1.00 0.00 ? 556 ASP A CG  1 
ATOM 4117 O OD1 . ASP A 1 556 ? 6.560   1.176   120.891 1.00 0.00 ? 556 ASP A OD1 1 
ATOM 4118 O OD2 . ASP A 1 556 ? 5.072   1.225   119.221 1.00 0.00 ? 556 ASP A OD2 1 
ATOM 4119 N N   . ASN A 1 557 ? 8.953   1.245   116.112 1.00 0.00 ? 557 ASN A N   1 
ATOM 4120 C CA  . ASN A 1 557 ? 9.687   0.767   114.975 1.00 0.00 ? 557 ASN A CA  1 
ATOM 4121 C C   . ASN A 1 557 ? 10.841  1.724   114.633 1.00 0.00 ? 557 ASN A C   1 
ATOM 4122 O O   . ASN A 1 557 ? 12.018  1.333   114.638 1.00 0.00 ? 557 ASN A O   1 
ATOM 4123 C CB  . ASN A 1 557 ? 8.767   0.686   113.753 1.00 0.00 ? 557 ASN A CB  1 
ATOM 4124 C CG  . ASN A 1 557 ? 7.854   -0.541  113.761 1.00 0.00 ? 557 ASN A CG  1 
ATOM 4125 O OD1 . ASN A 1 557 ? 7.913   -1.357  112.842 1.00 0.00 ? 557 ASN A OD1 1 
ATOM 4126 N ND2 . ASN A 1 557 ? 7.002   -0.724  114.753 1.00 0.00 ? 557 ASN A ND2 1 
ATOM 4127 N N   . GLN A 1 558 ? 10.432  2.924   114.353 1.00 0.00 ? 558 GLN A N   1 
ATOM 4128 C CA  . GLN A 1 558 ? 11.315  4.057   114.001 1.00 0.00 ? 558 GLN A CA  1 
ATOM 4129 C C   . GLN A 1 558 ? 12.806  3.673   113.927 1.00 0.00 ? 558 GLN A C   1 
ATOM 4130 O O   . GLN A 1 558 ? 13.369  3.509   112.834 1.00 0.00 ? 558 GLN A O   1 
ATOM 4131 C CB  . GLN A 1 558 ? 11.174  5.172   115.043 1.00 0.00 ? 558 GLN A CB  1 
ATOM 4132 C CG  . GLN A 1 558 ? 10.184  6.261   114.624 1.00 0.00 ? 558 GLN A CG  1 
ATOM 4133 C CD  . GLN A 1 558 ? 10.401  7.582   115.365 1.00 0.00 ? 558 GLN A CD  1 
ATOM 4134 O OE1 . GLN A 1 558 ? 9.967   7.725   116.507 1.00 0.00 ? 558 GLN A OE1 1 
ATOM 4135 N NE2 . GLN A 1 558 ? 11.054  8.568   114.779 1.00 0.00 ? 558 GLN A NE2 1 
ATOM 4136 N N   . PHE A 1 559 ? 13.400  3.547   115.100 1.00 0.00 ? 559 PHE A N   1 
ATOM 4137 C CA  . PHE A 1 559 ? 14.853  3.318   115.259 1.00 0.00 ? 559 PHE A CA  1 
ATOM 4138 C C   . PHE A 1 559 ? 15.295  1.877   115.060 1.00 0.00 ? 559 PHE A C   1 
ATOM 4139 O O   . PHE A 1 559 ? 16.303  1.434   115.634 1.00 0.00 ? 559 PHE A O   1 
ATOM 4140 C CB  . PHE A 1 559 ? 15.269  3.749   116.650 1.00 0.00 ? 559 PHE A CB  1 
ATOM 4141 C CG  . PHE A 1 559 ? 14.896  5.209   116.898 1.00 0.00 ? 559 PHE A CG  1 
ATOM 4142 C CD1 . PHE A 1 559 ? 15.740  6.230   116.447 1.00 0.00 ? 559 PHE A CD1 1 
ATOM 4143 C CD2 . PHE A 1 559 ? 13.702  5.524   117.558 1.00 0.00 ? 559 PHE A CD2 1 
ATOM 4144 C CE1 . PHE A 1 559 ? 15.391  7.569   116.657 1.00 0.00 ? 559 PHE A CE1 1 
ATOM 4145 C CE2 . PHE A 1 559 ? 13.353  6.863   117.768 1.00 0.00 ? 559 PHE A CE2 1 
ATOM 4146 C CZ  . PHE A 1 559 ? 14.197  7.886   117.317 1.00 0.00 ? 559 PHE A CZ  1 
ATOM 4147 N N   . ASN A 1 560 ? 14.550  1.185   114.253 1.00 0.00 ? 560 ASN A N   1 
ATOM 4148 C CA  . ASN A 1 560 ? 14.880  -0.185  113.877 1.00 0.00 ? 560 ASN A CA  1 
ATOM 4149 C C   . ASN A 1 560 ? 15.254  -0.164  112.408 1.00 0.00 ? 560 ASN A C   1 
ATOM 4150 O O   . ASN A 1 560 ? 15.793  -1.144  111.872 1.00 0.00 ? 560 ASN A O   1 
ATOM 4151 C CB  . ASN A 1 560 ? 13.670  -1.094  114.094 1.00 0.00 ? 560 ASN A CB  1 
ATOM 4152 C CG  . ASN A 1 560 ? 13.842  -2.058  115.269 1.00 0.00 ? 560 ASN A CG  1 
ATOM 4153 O OD1 . ASN A 1 560 ? 13.960  -3.265  115.062 1.00 0.00 ? 560 ASN A OD1 1 
ATOM 4154 N ND2 . ASN A 1 560 ? 13.861  -1.594  116.504 1.00 0.00 ? 560 ASN A ND2 1 
ATOM 4155 N N   . TYR A 1 561 ? 14.948  0.990   111.837 1.00 0.00 ? 561 TYR A N   1 
ATOM 4156 C CA  . TYR A 1 561 ? 15.148  1.252   110.418 1.00 0.00 ? 561 TYR A CA  1 
ATOM 4157 C C   . TYR A 1 561 ? 16.055  2.478   110.148 1.00 0.00 ? 561 TYR A C   1 
ATOM 4158 O O   . TYR A 1 561 ? 16.016  3.075   109.063 1.00 0.00 ? 561 TYR A O   1 
ATOM 4159 C CB  . TYR A 1 561 ? 13.812  1.559   109.734 1.00 0.00 ? 561 TYR A CB  1 
ATOM 4160 C CG  . TYR A 1 561 ? 12.744  0.493   109.972 1.00 0.00 ? 561 TYR A CG  1 
ATOM 4161 C CD1 . TYR A 1 561 ? 12.691  -0.639  109.150 1.00 0.00 ? 561 TYR A CD1 1 
ATOM 4162 C CD2 . TYR A 1 561 ? 11.817  0.651   111.008 1.00 0.00 ? 561 TYR A CD2 1 
ATOM 4163 C CE1 . TYR A 1 561 ? 11.709  -1.613  109.365 1.00 0.00 ? 561 TYR A CE1 1 
ATOM 4164 C CE2 . TYR A 1 561 ? 10.835  -0.322  111.223 1.00 0.00 ? 561 TYR A CE2 1 
ATOM 4165 C CZ  . TYR A 1 561 ? 10.781  -1.454  110.401 1.00 0.00 ? 561 TYR A CZ  1 
ATOM 4166 O OH  . TYR A 1 561 ? 9.827   -2.401  110.609 1.00 0.00 ? 561 TYR A OH  1 
ATOM 4167 N N   . VAL A 1 562 ? 16.864  2.852   111.115 1.00 0.00 ? 562 VAL A N   1 
ATOM 4168 C CA  . VAL A 1 562 ? 17.777  4.022   110.931 1.00 0.00 ? 562 VAL A CA  1 
ATOM 4169 C C   . VAL A 1 562 ? 19.102  3.846   111.653 1.00 0.00 ? 562 VAL A C   1 
ATOM 4170 O O   . VAL A 1 562 ? 19.154  3.309   112.770 1.00 0.00 ? 562 VAL A O   1 
ATOM 4171 C CB  . VAL A 1 562 ? 17.119  5.302   111.406 1.00 0.00 ? 562 VAL A CB  1 
ATOM 4172 C CG1 . VAL A 1 562 ? 18.040  6.520   111.309 1.00 0.00 ? 562 VAL A CG1 1 
ATOM 4173 C CG2 . VAL A 1 562 ? 15.867  5.664   110.605 1.00 0.00 ? 562 VAL A CG2 1 
ATOM 4174 N N   . PRO A 1 563 ? 20.216  4.298   111.029 1.00 0.00 ? 563 PRO A N   1 
ATOM 4175 C CA  . PRO A 1 563 ? 21.528  4.212   111.637 1.00 0.00 ? 563 PRO A CA  1 
ATOM 4176 C C   . PRO A 1 563 ? 21.515  5.012   112.877 1.00 0.00 ? 563 PRO A C   1 
ATOM 4177 O O   . PRO A 1 563 ? 20.514  5.749   113.125 1.00 0.00 ? 563 PRO A O   1 
ATOM 4178 C CB  . PRO A 1 563 ? 22.457  4.807   110.599 1.00 0.00 ? 563 PRO A CB  1 
ATOM 4179 C CG  . PRO A 1 563 ? 21.601  5.224   109.406 1.00 0.00 ? 563 PRO A CG  1 
ATOM 4180 C CD  . PRO A 1 563 ? 20.163  4.898   109.696 1.00 0.00 ? 563 PRO A CD  1 
ATOM 4181 N N   . ASN A 1 564 ? 22.572  4.882   113.621 1.00 0.00 ? 564 ASN A N   1 
ATOM 4182 C CA  . ASN A 1 564 ? 22.682  5.612   114.863 1.00 0.00 ? 564 ASN A CA  1 
ATOM 4183 C C   . ASN A 1 564 ? 24.025  6.291   114.970 1.00 0.00 ? 564 ASN A C   1 
ATOM 4184 O O   . ASN A 1 564 ? 24.985  5.928   114.270 1.00 0.00 ? 564 ASN A O   1 
ATOM 4185 C CB  . ASN A 1 564 ? 22.490  4.687   116.047 1.00 0.00 ? 564 ASN A CB  1 
ATOM 4186 C CG  . ASN A 1 564 ? 23.695  3.800   116.292 1.00 0.00 ? 564 ASN A CG  1 
ATOM 4187 O OD1 . ASN A 1 564 ? 23.650  2.617   115.972 1.00 0.00 ? 564 ASN A OD1 1 
ATOM 4188 N ND2 . ASN A 1 564 ? 24.781  4.306   116.843 1.00 0.00 ? 564 ASN A ND2 1 
ATOM 4189 N N   . ASN A 1 565 ? 23.985  7.226   115.862 1.00 0.00 ? 565 ASN A N   1 
ATOM 4190 C CA  . ASN A 1 565 ? 25.072  8.121   116.154 1.00 0.00 ? 565 ASN A CA  1 
ATOM 4191 C C   . ASN A 1 565 ? 26.461  7.550   115.796 1.00 0.00 ? 565 ASN A C   1 
ATOM 4192 O O   . ASN A 1 565 ? 27.383  8.295   115.430 1.00 0.00 ? 565 ASN A O   1 
ATOM 4193 C CB  . ASN A 1 565 ? 25.059  8.535   117.634 1.00 0.00 ? 565 ASN A CB  1 
ATOM 4194 C CG  . ASN A 1 565 ? 25.245  7.379   118.615 1.00 0.00 ? 565 ASN A CG  1 
ATOM 4195 O OD1 . ASN A 1 565 ? 24.262  6.815   119.092 1.00 0.00 ? 565 ASN A OD1 1 
ATOM 4196 N ND2 . ASN A 1 565 ? 26.460  6.996   118.958 1.00 0.00 ? 565 ASN A ND2 1 
ATOM 4197 N N   . ILE A 1 566 ? 26.600  6.243   115.900 1.00 0.00 ? 566 ILE A N   1 
ATOM 4198 C CA  . ILE A 1 566 ? 27.892  5.573   115.617 1.00 0.00 ? 566 ILE A CA  1 
ATOM 4199 C C   . ILE A 1 566 ? 27.856  4.877   114.254 1.00 0.00 ? 566 ILE A C   1 
ATOM 4200 O O   . ILE A 1 566 ? 28.902  4.620   113.640 1.00 0.00 ? 566 ILE A O   1 
ATOM 4201 C CB  . ILE A 1 566 ? 28.210  4.546   116.700 1.00 0.00 ? 566 ILE A CB  1 
ATOM 4202 C CG1 . ILE A 1 566 ? 28.367  5.173   118.086 1.00 0.00 ? 566 ILE A CG1 1 
ATOM 4203 C CG2 . ILE A 1 566 ? 29.511  3.785   116.438 1.00 0.00 ? 566 ILE A CG2 1 
ATOM 4204 C CD1 . ILE A 1 566 ? 28.822  4.170   119.148 1.00 0.00 ? 566 ILE A CD1 1 
ATOM 4205 N N   . GLY A 1 567 ? 26.646  4.590   113.823 1.00 0.00 ? 567 GLY A N   1 
ATOM 4206 C CA  . GLY A 1 567 ? 26.397  3.926   112.537 1.00 0.00 ? 567 GLY A CA  1 
ATOM 4207 C C   . GLY A 1 567 ? 26.075  2.447   112.761 1.00 0.00 ? 567 GLY A C   1 
ATOM 4208 O O   . GLY A 1 567 ? 26.641  1.564   112.100 1.00 0.00 ? 567 GLY A O   1 
ATOM 4209 N N   . ALA A 1 568 ? 25.171  2.231   113.699 1.00 0.00 ? 568 ALA A N   1 
ATOM 4210 C CA  . ALA A 1 568 ? 24.699  0.887   114.064 1.00 0.00 ? 568 ALA A CA  1 
ATOM 4211 C C   . ALA A 1 568 ? 23.470  0.584   113.207 1.00 0.00 ? 568 ALA A C   1 
ATOM 4212 O O   . ALA A 1 568 ? 22.399  1.179   113.391 1.00 0.00 ? 568 ALA A O   1 
ATOM 4213 C CB  . ALA A 1 568 ? 24.292  0.858   115.538 1.00 0.00 ? 568 ALA A CB  1 
ATOM 4214 N N   . MET A 1 569 ? 23.655  -0.324  112.278 1.00 0.00 ? 569 MET A N   1 
ATOM 4215 C CA  . MET A 1 569 ? 22.599  -0.711  111.337 1.00 0.00 ? 569 MET A CA  1 
ATOM 4216 C C   . MET A 1 569 ? 22.098  -2.106  111.645 1.00 0.00 ? 569 MET A C   1 
ATOM 4217 O O   . MET A 1 569 ? 22.770  -2.897  112.313 1.00 0.00 ? 569 MET A O   1 
ATOM 4218 C CB  . MET A 1 569 ? 23.154  -0.715  109.917 1.00 0.00 ? 569 MET A CB  1 
ATOM 4219 C CG  . MET A 1 569 ? 23.197  0.676   109.298 1.00 0.00 ? 569 MET A CG  1 
ATOM 4220 S SD  . MET A 1 569 ? 21.660  1.551   109.482 1.00 0.00 ? 569 MET A SD  1 
ATOM 4221 C CE  . MET A 1 569 ? 20.393  0.752   108.522 1.00 0.00 ? 569 MET A CE  1 
ATOM 4222 N N   . LYS A 1 570 ? 20.920  -2.400  111.151 1.00 0.00 ? 570 LYS A N   1 
ATOM 4223 C CA  . LYS A 1 570 ? 20.347  -3.724  111.354 1.00 0.00 ? 570 LYS A CA  1 
ATOM 4224 C C   . LYS A 1 570 ? 19.022  -3.861  110.641 1.00 0.00 ? 570 LYS A C   1 
ATOM 4225 O O   . LYS A 1 570 ? 18.281  -2.880  110.462 1.00 0.00 ? 570 LYS A O   1 
ATOM 4226 C CB  . LYS A 1 570 ? 20.160  -3.993  112.840 1.00 0.00 ? 570 LYS A CB  1 
ATOM 4227 C CG  . LYS A 1 570 ? 18.893  -3.373  113.421 1.00 0.00 ? 570 LYS A CG  1 
ATOM 4228 C CD  . LYS A 1 570 ? 18.612  -3.865  114.840 1.00 0.00 ? 570 LYS A CD  1 
ATOM 4229 C CE  . LYS A 1 570 ? 17.510  -3.079  115.545 1.00 0.00 ? 570 LYS A CE  1 
ATOM 4230 N NZ  . LYS A 1 570 ? 17.257  -3.556  116.912 1.00 0.00 ? 570 LYS A NZ  1 
ATOM 4231 N N   . ILE A 1 571 ? 18.780  -5.094  110.270 1.00 0.00 ? 571 ILE A N   1 
ATOM 4232 C CA  . ILE A 1 571 ? 17.586  -5.444  109.543 1.00 0.00 ? 571 ILE A CA  1 
ATOM 4233 C C   . ILE A 1 571 ? 16.752  -6.485  110.269 1.00 0.00 ? 571 ILE A C   1 
ATOM 4234 O O   . ILE A 1 571 ? 17.204  -7.616  110.503 1.00 0.00 ? 571 ILE A O   1 
ATOM 4235 C CB  . ILE A 1 571 ? 17.936  -5.979  108.155 1.00 0.00 ? 571 ILE A CB  1 
ATOM 4236 C CG1 . ILE A 1 571 ? 18.638  -4.938  107.279 1.00 0.00 ? 571 ILE A CG1 1 
ATOM 4237 C CG2 . ILE A 1 571 ? 16.702  -6.423  107.361 1.00 0.00 ? 571 ILE A CG2 1 
ATOM 4238 C CD1 . ILE A 1 571 ? 18.726  -5.351  105.809 1.00 0.00 ? 571 ILE A CD1 1 
ATOM 4239 N N   . VAL A 1 572 ? 15.558  -6.058  110.602 1.00 0.00 ? 572 VAL A N   1 
ATOM 4240 C CA  . VAL A 1 572 ? 14.592  -6.889  111.313 1.00 0.00 ? 572 VAL A CA  1 
ATOM 4241 C C   . VAL A 1 572 ? 13.813  -7.746  110.326 1.00 0.00 ? 572 VAL A C   1 
ATOM 4242 O O   . VAL A 1 572 ? 13.719  -7.421  109.133 1.00 0.00 ? 572 VAL A O   1 
ATOM 4243 C CB  . VAL A 1 572 ? 13.594  -6.007  112.063 1.00 0.00 ? 572 VAL A CB  1 
ATOM 4244 C CG1 . VAL A 1 572 ? 12.510  -6.811  112.782 1.00 0.00 ? 572 VAL A CG1 1 
ATOM 4245 C CG2 . VAL A 1 572 ? 14.253  -5.141  113.139 1.00 0.00 ? 572 VAL A CG2 1 
ATOM 4246 N N   . TYR A 1 573 ? 13.292  -8.822  110.869 1.00 0.00 ? 573 TYR A N   1 
ATOM 4247 C CA  . TYR A 1 573 ? 12.436  -9.742  110.129 1.00 0.00 ? 573 TYR A CA  1 
ATOM 4248 C C   . TYR A 1 573 ? 11.024  -9.199  110.150 1.00 0.00 ? 573 TYR A C   1 
ATOM 4249 O O   . TYR A 1 573 ? 10.587  -8.592  111.138 1.00 0.00 ? 573 TYR A O   1 
ATOM 4250 C CB  . TYR A 1 573 ? 12.451  -11.121 110.789 1.00 0.00 ? 573 TYR A CB  1 
ATOM 4251 C CG  . TYR A 1 573 ? 11.362  -11.296 111.849 1.00 0.00 ? 573 TYR A CG  1 
ATOM 4252 C CD1 . TYR A 1 573 ? 11.593  -10.878 113.165 1.00 0.00 ? 573 TYR A CD1 1 
ATOM 4253 C CD2 . TYR A 1 573 ? 10.134  -11.874 111.503 1.00 0.00 ? 573 TYR A CD2 1 
ATOM 4254 C CE1 . TYR A 1 573 ? 10.598  -11.044 114.137 1.00 0.00 ? 573 TYR A CE1 1 
ATOM 4255 C CE2 . TYR A 1 573 ? 9.139   -12.038 112.475 1.00 0.00 ? 573 TYR A CE2 1 
ATOM 4256 C CZ  . TYR A 1 573 ? 9.372   -11.624 113.792 1.00 0.00 ? 573 TYR A CZ  1 
ATOM 4257 O OH  . TYR A 1 573 ? 8.407   -11.787 114.736 1.00 0.00 ? 573 TYR A OH  1 
ATOM 4258 N N   . GLU A 1 574 ? 10.331  -9.421  109.065 1.00 0.00 ? 574 GLU A N   1 
ATOM 4259 C CA  . GLU A 1 574 ? 8.970   -8.927  108.942 1.00 0.00 ? 574 GLU A CA  1 
ATOM 4260 C C   . GLU A 1 574 ? 8.134   -9.851  108.072 1.00 0.00 ? 574 GLU A C   1 
ATOM 4261 O O   . GLU A 1 574 ? 8.571   -10.280 106.991 1.00 0.00 ? 574 GLU A O   1 
ATOM 4262 C CB  . GLU A 1 574 ? 9.004   -7.515  108.368 1.00 0.00 ? 574 GLU A CB  1 
ATOM 4263 C CG  . GLU A 1 574 ? 9.863   -6.576  109.220 1.00 0.00 ? 574 GLU A CG  1 
ATOM 4264 C CD  . GLU A 1 574 ? 9.708   -5.104  108.849 1.00 0.00 ? 574 GLU A CD  1 
ATOM 4265 O OE1 . GLU A 1 574 ? 10.400  -4.610  107.879 1.00 0.00 ? 574 GLU A OE1 1 
ATOM 4266 O OE2 . GLU A 1 574 ? 8.888   -4.356  109.506 1.00 0.00 ? 574 GLU A OE2 1 
ATOM 4267 N N   . LYS A 1 575 ? 6.963   -10.107 108.617 1.00 0.00 ? 575 LYS A N   1 
ATOM 4268 C CA  . LYS A 1 575 ? 5.941   -10.949 108.003 1.00 0.00 ? 575 LYS A CA  1 
ATOM 4269 C C   . LYS A 1 575 ? 5.699   -10.494 106.571 1.00 0.00 ? 575 LYS A C   1 
ATOM 4270 O O   . LYS A 1 575 ? 5.624   -9.290  106.289 1.00 0.00 ? 575 LYS A O   1 
ATOM 4271 C CB  . LYS A 1 575 ? 4.636   -10.819 108.788 1.00 0.00 ? 575 LYS A CB  1 
ATOM 4272 C CG  . LYS A 1 575 ? 4.843   -10.868 110.301 1.00 0.00 ? 575 LYS A CG  1 
ATOM 4273 C CD  . LYS A 1 575 ? 4.247   -12.124 110.932 1.00 0.00 ? 575 LYS A CD  1 
ATOM 4274 C CE  . LYS A 1 575 ? 4.900   -12.493 112.263 1.00 0.00 ? 575 LYS A CE  1 
ATOM 4275 N NZ  . LYS A 1 575 ? 3.919   -12.802 113.313 1.00 0.00 ? 575 LYS A NZ  1 
ATOM 4276 N N   . SER A 1 576 ? 5.581   -11.476 105.699 1.00 0.00 ? 576 SER A N   1 
ATOM 4277 C CA  . SER A 1 576 ? 5.353   -11.227 104.271 1.00 0.00 ? 576 SER A CA  1 
ATOM 4278 C C   . SER A 1 576 ? 3.846   -11.173 103.965 1.00 0.00 ? 576 SER A C   1 
ATOM 4279 O O   . SER A 1 576 ? 3.285   -10.099 103.712 1.00 0.00 ? 576 SER A O   1 
ATOM 4280 C CB  . SER A 1 576 ? 6.015   -12.318 103.424 1.00 0.00 ? 576 SER A CB  1 
ATOM 4281 O OG  . SER A 1 576 ? 5.772   -13.595 103.989 1.00 0.00 ? 576 SER A OG  1 
ATOM 4282 N N   . GLN A 1 577 ? 3.214   -12.340 103.999 1.00 0.00 ? 577 GLN A N   1 
ATOM 4283 C CA  . GLN A 1 577 ? 1.771   -12.482 103.685 1.00 0.00 ? 577 GLN A CA  1 
ATOM 4284 C C   . GLN A 1 577 ? 0.879   -11.898 104.792 1.00 0.00 ? 577 GLN A C   1 
ATOM 4285 O O   . GLN A 1 577 ? 0.578   -12.568 105.791 1.00 0.00 ? 577 GLN A O   1 
ATOM 4286 C CB  . GLN A 1 577 ? 1.393   -13.960 103.542 1.00 0.00 ? 577 GLN A CB  1 
ATOM 4287 C CG  . GLN A 1 577 ? 2.181   -14.684 102.450 1.00 0.00 ? 577 GLN A CG  1 
ATOM 4288 C CD  . GLN A 1 577 ? 1.781   -16.155 102.304 1.00 0.00 ? 577 GLN A CD  1 
ATOM 4289 O OE1 . GLN A 1 577 ? 2.344   -17.016 102.977 1.00 0.00 ? 577 GLN A OE1 1 
ATOM 4290 N NE2 . GLN A 1 577 ? 0.829   -16.499 101.455 1.00 0.00 ? 577 GLN A NE2 1 
ATOM 4291 N N   . LEU A 1 578 ? 0.473   -10.657 104.570 1.00 0.00 ? 578 LEU A N   1 
ATOM 4292 C CA  . LEU A 1 578 ? -0.430  -9.928  105.483 1.00 0.00 ? 578 LEU A CA  1 
ATOM 4293 C C   . LEU A 1 578 ? -1.518  -9.235  104.658 1.00 0.00 ? 578 LEU A C   1 
ATOM 4294 O O   . LEU A 1 578 ? -1.452  -8.023  104.403 1.00 0.00 ? 578 LEU A O   1 
ATOM 4295 C CB  . LEU A 1 578 ? 0.352   -8.899  106.306 1.00 0.00 ? 578 LEU A CB  1 
ATOM 4296 C CG  . LEU A 1 578 ? 1.105   -7.881  105.451 1.00 0.00 ? 578 LEU A CG  1 
ATOM 4297 C CD1 . LEU A 1 578 ? 1.873   -6.855  106.288 1.00 0.00 ? 578 LEU A CD1 1 
ATOM 4298 C CD2 . LEU A 1 578 ? 2.141   -8.525  104.531 1.00 0.00 ? 578 LEU A CD2 1 
ATOM 4299 N N   . ALA A 1 579 ? -2.482  -10.051 104.267 1.00 0.00 ? 579 ALA A N   1 
ATOM 4300 C CA  . ALA A 1 579 ? -3.636  -9.625  103.458 1.00 0.00 ? 579 ALA A CA  1 
ATOM 4301 C C   . ALA A 1 579 ? -4.562  -10.808 103.249 1.00 0.00 ? 579 ALA A C   1 
ATOM 4302 O O   . ALA A 1 579 ? -4.148  -11.860 102.737 1.00 0.00 ? 579 ALA A O   1 
ATOM 4303 C CB  . ALA A 1 579 ? -3.160  -9.113  102.096 1.00 0.00 ? 579 ALA A CB  1 
ATOM 4304 N N   . PRO A 1 580 ? -5.832  -10.702 103.628 1.00 0.00 ? 580 PRO A N   1 
ATOM 4305 C CA  . PRO A 1 580 ? -6.751  -11.802 103.477 1.00 0.00 ? 580 PRO A CA  1 
ATOM 4306 C C   . PRO A 1 580 ? -6.896  -12.208 102.034 1.00 0.00 ? 580 PRO A C   1 
ATOM 4307 O O   . PRO A 1 580 ? -6.617  -11.365 101.126 1.00 0.00 ? 580 PRO A O   1 
ATOM 4308 C CB  . PRO A 1 580 ? -8.052  -11.274 104.026 1.00 0.00 ? 580 PRO A CB  1 
ATOM 4309 C CG  . PRO A 1 580 ? -7.816  -9.844  104.481 1.00 0.00 ? 580 PRO A CG  1 
ATOM 4310 C CD  . PRO A 1 580 ? -6.387  -9.486  104.219 1.00 0.00 ? 580 PRO A CD  1 
ATOM 4311 N N   . ARG A 1 581 ? -7.309  -13.454 101.916 1.00 0.00 ? 581 ARG A N   1 
ATOM 4312 C CA  . ARG A 1 581 ? -7.626  -14.136 100.653 1.00 0.00 ? 581 ARG A CA  1 
ATOM 4313 C C   . ARG A 1 581 ? -8.606  -15.251 100.976 1.00 0.00 ? 581 ARG A C   1 
ATOM 4314 O O   . ARG A 1 581 ? -8.344  -16.100 101.836 1.00 0.00 ? 581 ARG A O   1 
ATOM 4315 C CB  . ARG A 1 581 ? -6.390  -14.782 100.020 1.00 0.00 ? 581 ARG A CB  1 
ATOM 4316 C CG  . ARG A 1 581 ? -6.697  -16.179 99.453  1.00 0.00 ? 581 ARG A CG  1 
ATOM 4317 C CD  . ARG A 1 581 ? -5.745  -16.614 98.336  1.00 0.00 ? 581 ARG A CD  1 
ATOM 4318 N NE  . ARG A 1 581 ? -4.401  -16.939 98.831  1.00 0.00 ? 581 ARG A NE  1 
ATOM 4319 C CZ  . ARG A 1 581 ? -3.850  -18.162 98.784  1.00 0.00 ? 581 ARG A CZ  1 
ATOM 4320 N NH1 . ARG A 1 581 ? -4.512  -19.203 98.263  1.00 0.00 ? 581 ARG A NH1 1 
ATOM 4321 N NH2 . ARG A 1 581 ? -2.621  -18.445 99.241  1.00 0.00 ? 581 ARG A NH2 1 
ATOM 4322 N N   . LYS A 1 582 ? -9.723  -15.232 100.299 1.00 0.00 ? 582 LYS A N   1 
ATOM 4323 C CA  . LYS A 1 582 ? -10.763 -16.233 100.528 1.00 0.00 ? 582 LYS A CA  1 
ATOM 4324 C C   . LYS A 1 582 ? -10.338 -17.556 99.882  1.00 0.00 ? 582 LYS A C   1 
ATOM 4325 O O   . LYS A 1 582 ? -10.022 -17.610 98.684  1.00 0.00 ? 582 LYS A O   1 
ATOM 4326 C CB  . LYS A 1 582 ? -12.087 -15.705 99.985  1.00 0.00 ? 582 LYS A CB  1 
ATOM 4327 C CG  . LYS A 1 582 ? -12.728 -16.600 98.932  1.00 0.00 ? 582 LYS A CG  1 
ATOM 4328 C CD  . LYS A 1 582 ? -14.152 -16.161 98.585  1.00 0.00 ? 582 LYS A CD  1 
ATOM 4329 C CE  . LYS A 1 582 ? -14.325 -15.799 97.110  1.00 0.00 ? 582 LYS A CE  1 
ATOM 4330 N NZ  . LYS A 1 582 ? -13.817 -16.841 96.207  1.00 0.00 ? 582 LYS A NZ  1 
ATOM 4331 N N   . LEU A 1 583 ? -10.343 -18.572 100.725 1.00 0.00 ? 583 LEU A N   1 
ATOM 4332 C CA  . LEU A 1 583 ? -9.948  -19.938 100.361 1.00 0.00 ? 583 LEU A CA  1 
ATOM 4333 C C   . LEU A 1 583 ? -11.054 -20.633 99.563  1.00 0.00 ? 583 LEU A C   1 
ATOM 4334 O O   . LEU A 1 583 ? -10.783 -21.381 98.613  1.00 0.00 ? 583 LEU A O   1 
ATOM 4335 C CB  . LEU A 1 583 ? -9.691  -20.755 101.636 1.00 0.00 ? 583 LEU A CB  1 
ATOM 4336 C CG  . LEU A 1 583 ? -8.944  -22.068 101.382 1.00 0.00 ? 583 LEU A CG  1 
ATOM 4337 C CD1 . LEU A 1 583 ? -7.817  -22.318 102.388 1.00 0.00 ? 583 LEU A CD1 1 
ATOM 4338 C CD2 . LEU A 1 583 ? -9.850  -23.300 101.468 1.00 0.00 ? 583 LEU A CD2 1 
ATOM 4339 N N   . TYR A 1 584 ? -12.281 -20.359 99.963  1.00 0.00 ? 584 TYR A N   1 
ATOM 4340 C CA  . TYR A 1 584 ? -13.459 -20.999 99.363  1.00 0.00 ? 584 TYR A CA  1 
ATOM 4341 C C   . TYR A 1 584 ? -14.671 -20.155 99.625  1.00 0.00 ? 584 TYR A C   1 
ATOM 4342 O O   . TYR A 1 584 ? -15.191 -19.561 98.634  1.00 0.00 ? 584 TYR A O   1 
ATOM 4343 C CB  . TYR A 1 584 ? -13.539 -22.418 99.983  1.00 0.00 ? 584 TYR A CB  1 
ATOM 4344 C CG  . TYR A 1 584 ? -14.782 -23.268 99.655  1.00 0.00 ? 584 TYR A CG  1 
ATOM 4345 C CD1 . TYR A 1 584 ? -14.860 -24.004 98.458  1.00 0.00 ? 584 TYR A CD1 1 
ATOM 4346 C CD2 . TYR A 1 584 ? -15.836 -23.339 100.573 1.00 0.00 ? 584 TYR A CD2 1 
ATOM 4347 C CE1 . TYR A 1 584 ? -15.981 -24.804 98.193  1.00 0.00 ? 584 TYR A CE1 1 
ATOM 4348 C CE2 . TYR A 1 584 ? -16.956 -24.136 100.306 1.00 0.00 ? 584 TYR A CE2 1 
ATOM 4349 C CZ  . TYR A 1 584 ? -17.029 -24.871 99.118  1.00 0.00 ? 584 TYR A CZ  1 
ATOM 4350 O OH  . TYR A 1 584 ? -18.117 -25.649 98.867  1.00 0.00 ? 584 TYR A OH  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   GLY 4   4   ?   ?   ?   A . n 
A 1 5   ALA 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   ?   ?   ?   A . n 
A 1 7   GLN 7   7   ?   ?   ?   A . n 
A 1 8   PRO 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  GLY 10  10  ?   ?   ?   A . n 
A 1 11  GLY 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  PRO 13  13  ?   ?   ?   A . n 
A 1 14  ALA 14  14  ?   ?   ?   A . n 
A 1 15  VAL 15  15  ?   ?   ?   A . n 
A 1 16  ARG 16  16  ?   ?   ?   A . n 
A 1 17  ASN 17  17  ?   ?   ?   A . n 
A 1 18  GLU 18  18  ?   ?   ?   A . n 
A 1 19  ARG 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  THR 21  21  ?   ?   ?   A . n 
A 1 22  GLY 22  22  ?   ?   ?   A . n 
A 1 23  SER 23  23  ?   ?   ?   A . n 
A 1 24  GLY 24  24  ?   ?   ?   A . n 
A 1 25  ASN 25  25  ?   ?   ?   A . n 
A 1 26  GLY 26  26  ?   ?   ?   A . n 
A 1 27  SER 27  27  ?   ?   ?   A . n 
A 1 28  GLY 28  28  ?   ?   ?   A . n 
A 1 29  GLY 29  29  ?   ?   ?   A . n 
A 1 30  GLY 30  30  ?   ?   ?   A . n 
A 1 31  GLY 31  31  ?   ?   ?   A . n 
A 1 32  GLY 32  32  ?   ?   ?   A . n 
A 1 33  GLY 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  ?   ?   ?   A . n 
A 1 35  SER 35  35  ?   ?   ?   A . n 
A 1 36  GLY 36  36  ?   ?   ?   A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  GLY 39  39  39  GLY GLY A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  SER 41  41  41  SER SER A . n 
A 1 42  THR 42  42  42  THR THR A . n 
A 1 43  GLY 43  43  43  GLY GLY A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  ASN 47  47  47  ASN ASN A . n 
A 1 48  GLN 48  48  48  GLN GLN A . n 
A 1 49  THR 49  49  49  THR THR A . n 
A 1 50  GLU 50  50  50  GLU GLU A . n 
A 1 51  PHE 51  51  51  PHE PHE A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  ASN 56  56  56  ASN ASN A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  ALA 63  63  63  ALA ALA A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  VAL 69  69  69  VAL VAL A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  ASN 72  72  72  ASN ASN A . n 
A 1 73  MET 73  73  73  MET MET A . n 
A 1 74  PRO 74  74  74  PRO PRO A . n 
A 1 75  GLU 75  75  75  GLU GLU A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  ASN 78  78  78  ASN ASN A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  LYS 80  80  80  LYS LYS A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  VAL 83  83  83  VAL VAL A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  MET 87  87  87  MET MET A . n 
A 1 88  ASP 88  88  88  ASP ASP A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  THR 90  90  90  THR THR A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  ALA 97  97  97  ALA ALA A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  ASP 99  99  99  ASP ASP A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 ILE 101 101 101 ILE ILE A . n 
A 1 102 HIS 102 102 102 HIS HIS A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLU 104 104 104 GLU GLU A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 PRO 108 108 108 PRO PRO A . n 
A 1 109 TRP 109 109 109 TRP TRP A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 VAL 112 112 112 VAL VAL A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ALA 114 114 114 ALA ALA A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 TRP 117 117 117 TRP TRP A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 VAL 119 119 119 VAL VAL A . n 
A 1 120 TRP 120 120 120 TRP TRP A . n 
A 1 121 PHE 121 121 121 PHE PHE A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 ASP 125 125 125 ASP ASP A . n 
A 1 126 TRP 126 126 126 TRP TRP A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 LEU 128 128 128 LEU LEU A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 MET 133 133 133 MET MET A . n 
A 1 134 SER 134 134 134 SER SER A . n 
A 1 135 GLU 135 135 135 GLU GLU A . n 
A 1 136 LEU 136 136 136 LEU LEU A . n 
A 1 137 HIS 137 137 137 HIS HIS A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 SER 140 140 140 SER SER A . n 
A 1 141 PHE 141 141 141 PHE PHE A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 GLU 144 144 144 GLU GLU A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 PHE 146 146 146 PHE PHE A . n 
A 1 147 ASN 147 147 147 ASN ASN A . n 
A 1 148 VAL 148 148 148 VAL VAL A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 LEU 150 150 150 LEU LEU A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 GLN 159 159 159 GLN GLN A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 PRO 161 161 161 PRO PRO A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 ASP 168 168 168 ASP ASP A . n 
A 1 169 LEU 169 169 169 LEU LEU A . n 
A 1 170 THR 170 170 170 THR THR A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 SER 172 172 172 SER SER A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 MET 174 174 174 MET MET A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 ASN 180 180 180 ASN ASN A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 THR 182 182 182 THR THR A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 PHE 185 185 185 PHE PHE A . n 
A 1 186 THR 186 186 186 THR THR A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 ALA 189 189 189 ALA ALA A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 GLU 193 193 193 GLU GLU A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 LEU 195 195 195 LEU LEU A . n 
A 1 196 GLY 196 196 196 GLY GLY A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 TYR 198 198 198 TYR TYR A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 TRP 200 200 200 TRP TRP A . n 
A 1 201 LYS 201 201 201 LYS LYS A . n 
A 1 202 PRO 202 202 202 PRO PRO A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 ILE 204 204 204 ILE ILE A . n 
A 1 205 PRO 205 205 205 PRO PRO A . n 
A 1 206 THR 206 206 206 THR THR A . n 
A 1 207 PRO 207 207 207 PRO PRO A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 ARG 209 209 209 ARG ARG A . n 
A 1 210 TYR 210 210 210 TYR TYR A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 GLN 213 213 213 GLN GLN A . n 
A 1 214 TRP 214 214 214 TRP TRP A . n 
A 1 215 ASP 215 215 215 ASP ASP A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 THR 217 217 217 THR THR A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 ILE 219 219 219 ILE ILE A . n 
A 1 220 PRO 220 220 220 PRO PRO A . n 
A 1 221 SER 221 221 221 SER SER A . n 
A 1 222 HIS 222 222 222 HIS HIS A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 GLY 224 224 224 GLY GLY A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 THR 228 228 228 THR THR A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 THR 230 230 230 THR THR A . n 
A 1 231 ASN 231 231 231 ASN ASN A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 HIS 234 234 234 HIS HIS A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 GLN 242 242 242 GLN GLN A . n 
A 1 243 PHE 243 243 243 PHE PHE A . n 
A 1 244 TYR 244 244 244 TYR TYR A . n 
A 1 245 THR 245 245 245 THR THR A . n 
A 1 246 ILE 246 246 246 ILE ILE A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 SER 249 249 249 SER SER A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 PRO 251 251 251 PRO PRO A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 HIS 253 253 253 HIS HIS A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 ARG 256 256 256 ARG ARG A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 GLY 258 258 258 GLY GLY A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 ALA 262 262 262 ALA ALA A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 PHE 268 268 268 PHE PHE A . n 
A 1 269 ASP 269 269 269 ASP ASP A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 LYS 271 271 271 LYS LYS A . n 
A 1 272 PRO 272 272 272 PRO PRO A . n 
A 1 273 CYS 273 273 273 CYS CYS A . n 
A 1 274 ARG 274 274 274 ARG ARG A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 HIS 277 277 277 HIS HIS A . n 
A 1 278 THR 278 278 278 THR THR A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 GLN 280 280 280 GLN GLN A . n 
A 1 281 THR 281 281 281 THR THR A . n 
A 1 282 ASN 282 282 282 ASN ASN A . n 
A 1 283 ARG 283 283 283 ARG ARG A . n 
A 1 284 ALA 284 284 284 ALA ALA A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 GLY 286 286 286 GLY GLY A . n 
A 1 287 LEU 287 287 287 LEU LEU A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 PRO 289 289 289 PRO PRO A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ASN 292 292 292 ASN ASN A . n 
A 1 293 SER 293 293 293 SER SER A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 PRO 295 295 295 PRO PRO A . n 
A 1 296 GLN 296 296 296 GLN GLN A . n 
A 1 297 SER 297 297 297 SER SER A . n 
A 1 298 GLU 298 298 298 GLU GLU A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 THR 301 301 301 THR THR A . n 
A 1 302 ASN 302 302 302 ASN ASN A . n 
A 1 303 PHE 303 303 303 PHE PHE A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 ASP 305 305 305 ASP ASP A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 GLY 307 307 307 GLY GLY A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 GLN 309 309 309 GLN GLN A . n 
A 1 310 GLN 310 310 310 GLN GLN A . n 
A 1 311 ASP 311 311 311 ASP ASP A . n 
A 1 312 LYS 312 312 312 LYS LYS A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 ARG 314 314 314 ARG ARG A . n 
A 1 315 GLY 315 315 315 GLY GLY A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 MET 319 319 319 MET MET A . n 
A 1 320 GLY 320 320 320 GLY GLY A . n 
A 1 321 ASN 321 321 321 ASN ASN A . n 
A 1 322 THR 322 322 322 THR THR A . n 
A 1 323 ASP 323 323 323 ASP ASP A . n 
A 1 324 TYR 324 324 324 TYR TYR A . n 
A 1 325 ILE 325 325 325 ILE ILE A . n 
A 1 326 THR 326 326 326 THR THR A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 THR 329 329 329 THR THR A . n 
A 1 330 ILE 330 330 330 ILE ILE A . n 
A 1 331 MET 331 331 331 MET MET A . n 
A 1 332 ARG 332 332 332 ARG ARG A . n 
A 1 333 PRO 333 333 333 PRO PRO A . n 
A 1 334 ALA 334 334 334 ALA ALA A . n 
A 1 335 GLU 335 335 335 GLU GLU A . n 
A 1 336 VAL 336 336 336 VAL VAL A . n 
A 1 337 GLY 337 337 337 GLY GLY A . n 
A 1 338 TYR 338 338 338 TYR TYR A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 PRO 341 341 341 PRO PRO A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 TYR 343 343 343 TYR TYR A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 PHE 345 345 345 PHE PHE A . n 
A 1 346 GLU 346 346 346 GLU GLU A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 THR 349 349 349 THR THR A . n 
A 1 350 GLN 350 350 350 GLN GLN A . n 
A 1 351 GLY 351 351 351 GLY GLY A . n 
A 1 352 PRO 352 352 352 PRO PRO A . n 
A 1 353 PHE 353 353 353 PHE PHE A . n 
A 1 354 LYS 354 354 354 LYS LYS A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 PRO 356 356 356 PRO PRO A . n 
A 1 357 ILE 357 357 357 ILE ILE A . n 
A 1 358 ALA 358 358 358 ALA ALA A . n 
A 1 359 ALA 359 359 359 ALA ALA A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 ARG 361 361 361 ARG ARG A . n 
A 1 362 GLY 362 362 362 GLY GLY A . n 
A 1 363 GLY 363 363 363 GLY GLY A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 THR 366 366 366 THR THR A . n 
A 1 367 ASP 367 367 367 ASP ASP A . n 
A 1 368 GLU 368 368 368 GLU GLU A . n 
A 1 369 ASN 369 369 369 ASN ASN A . n 
A 1 370 GLN 370 370 370 GLN GLN A . n 
A 1 371 ALA 371 371 371 ALA ALA A . n 
A 1 372 ALA 372 372 372 ALA ALA A . n 
A 1 373 ASP 373 373 373 ASP ASP A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 ASP 375 375 375 ASP ASP A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ARG 377 377 377 ARG ARG A . n 
A 1 378 TYR 378 378 378 TYR TYR A . n 
A 1 379 ALA 379 379 379 ALA ALA A . n 
A 1 380 PHE 380 380 380 PHE PHE A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 ARG 382 382 382 ARG ARG A . n 
A 1 383 GLN 383 383 383 GLN GLN A . n 
A 1 384 HIS 384 384 384 HIS HIS A . n 
A 1 385 GLY 385 385 385 GLY GLY A . n 
A 1 386 GLN 386 386 386 GLN GLN A . n 
A 1 387 LYS 387 387 387 LYS LYS A . n 
A 1 388 THR 388 388 388 THR THR A . n 
A 1 389 THR 389 389 389 THR THR A . n 
A 1 390 THR 390 390 390 THR THR A . n 
A 1 391 THR 391 391 391 THR THR A . n 
A 1 392 GLY 392 392 392 GLY GLY A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 THR 394 394 394 THR THR A . n 
A 1 395 PRO 395 395 395 PRO PRO A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 ARG 397 397 397 ARG ARG A . n 
A 1 398 PHE 398 398 398 PHE PHE A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 TYR 400 400 400 TYR TYR A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 ALA 402 402 402 ALA ALA A . n 
A 1 403 HIS 403 403 403 HIS HIS A . n 
A 1 404 GLN 404 404 404 GLN GLN A . n 
A 1 405 ASP 405 405 405 ASP ASP A . n 
A 1 406 THR 406 406 406 THR THR A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 ARG 408 408 408 ARG ARG A . n 
A 1 409 TYR 409 409 409 TYR TYR A . n 
A 1 410 PRO 410 410 410 PRO PRO A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 ASP 413 413 413 ASP ASP A . n 
A 1 414 TRP 414 414 414 TRP TRP A . n 
A 1 415 ILE 415 415 415 ILE ILE A . n 
A 1 416 GLN 416 416 416 GLN GLN A . n 
A 1 417 ASN 417 417 417 ASN ASN A . n 
A 1 418 ILE 418 418 418 ILE ILE A . n 
A 1 419 ASN 419 419 419 ASN ASN A . n 
A 1 420 PHE 420 420 420 PHE PHE A . n 
A 1 421 ASN 421 421 421 ASN ASN A . n 
A 1 422 LEU 422 422 422 LEU LEU A . n 
A 1 423 PRO 423 423 423 PRO PRO A . n 
A 1 424 VAL 424 424 424 VAL VAL A . n 
A 1 425 THR 425 425 425 THR THR A . n 
A 1 426 ASN 426 426 426 ASN ASN A . n 
A 1 427 ASP 427 427 427 ASP ASP A . n 
A 1 428 ASN 428 428 428 ASN ASN A . n 
A 1 429 VAL 429 429 429 VAL VAL A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 LEU 431 431 431 LEU LEU A . n 
A 1 432 PRO 432 432 432 PRO PRO A . n 
A 1 433 THR 433 433 433 THR THR A . n 
A 1 434 ASP 434 434 434 ASP ASP A . n 
A 1 435 PRO 435 435 435 PRO PRO A . n 
A 1 436 ILE 436 436 436 ILE ILE A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 GLY 438 438 438 GLY GLY A . n 
A 1 439 LYS 439 439 439 LYS LYS A . n 
A 1 440 THR 440 440 440 THR THR A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 ILE 442 442 442 ILE ILE A . n 
A 1 443 ASN 443 443 443 ASN ASN A . n 
A 1 444 TYR 444 444 444 TYR TYR A . n 
A 1 445 THR 445 445 445 THR THR A . n 
A 1 446 ASN 446 446 446 ASN ASN A . n 
A 1 447 ILE 447 447 447 ILE ILE A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 ASN 449 449 449 ASN ASN A . n 
A 1 450 THR 450 450 450 THR THR A . n 
A 1 451 TYR 451 451 451 TYR TYR A . n 
A 1 452 GLY 452 452 452 GLY GLY A . n 
A 1 453 PRO 453 453 453 PRO PRO A . n 
A 1 454 LEU 454 454 454 LEU LEU A . n 
A 1 455 THR 455 455 455 THR THR A . n 
A 1 456 ALA 456 456 456 ALA ALA A . n 
A 1 457 LEU 457 457 457 LEU LEU A . n 
A 1 458 ASN 458 458 458 ASN ASN A . n 
A 1 459 ASN 459 459 459 ASN ASN A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 PRO 461 461 461 PRO PRO A . n 
A 1 462 PRO 462 462 462 PRO PRO A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 TYR 464 464 464 TYR TYR A . n 
A 1 465 PRO 465 465 465 PRO PRO A . n 
A 1 466 ASN 466 466 466 ASN ASN A . n 
A 1 467 GLY 467 467 467 GLY GLY A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 TRP 470 470 470 TRP TRP A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 LYS 472 472 472 LYS LYS A . n 
A 1 473 GLU 473 473 473 GLU GLU A . n 
A 1 474 PHE 474 474 474 PHE PHE A . n 
A 1 475 ASP 475 475 475 ASP ASP A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 ASP 477 477 477 ASP ASP A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 LYS 479 479 479 LYS LYS A . n 
A 1 480 PRO 480 480 480 PRO PRO A . n 
A 1 481 ARG 481 481 481 ARG ARG A . n 
A 1 482 LEU 482 482 482 LEU LEU A . n 
A 1 483 HIS 483 483 483 HIS HIS A . n 
A 1 484 ILE 484 484 484 ILE ILE A . n 
A 1 485 ASN 485 485 485 ASN ASN A . n 
A 1 486 ALA 486 486 486 ALA ALA A . n 
A 1 487 PRO 487 487 487 PRO PRO A . n 
A 1 488 PHE 488 488 488 PHE PHE A . n 
A 1 489 VAL 489 489 489 VAL VAL A . n 
A 1 490 CYS 490 490 490 CYS CYS A . n 
A 1 491 GLN 491 491 491 GLN GLN A . n 
A 1 492 ASN 492 492 492 ASN ASN A . n 
A 1 493 ASN 493 493 493 ASN ASN A . n 
A 1 494 CYS 494 494 494 CYS CYS A . n 
A 1 495 PRO 495 495 495 PRO PRO A . n 
A 1 496 GLY 496 496 496 GLY GLY A . n 
A 1 497 GLN 497 497 497 GLN GLN A . n 
A 1 498 LEU 498 498 498 LEU LEU A . n 
A 1 499 PHE 499 499 499 PHE PHE A . n 
A 1 500 VAL 500 500 500 VAL VAL A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 VAL 502 502 502 VAL VAL A . n 
A 1 503 ALA 503 503 503 ALA ALA A . n 
A 1 504 PRO 504 504 504 PRO PRO A . n 
A 1 505 ASN 505 505 505 ASN ASN A . n 
A 1 506 LEU 506 506 506 LEU LEU A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 ASN 508 508 508 ASN ASN A . n 
A 1 509 GLN 509 509 509 GLN GLN A . n 
A 1 510 TYR 510 510 510 TYR TYR A . n 
A 1 511 ASP 511 511 511 ASP ASP A . n 
A 1 512 PRO 512 512 512 PRO PRO A . n 
A 1 513 ASP 513 513 513 ASP ASP A . n 
A 1 514 ALA 514 514 514 ALA ALA A . n 
A 1 515 SER 515 515 515 SER SER A . n 
A 1 516 ALA 516 516 516 ALA ALA A . n 
A 1 517 ASN 517 517 517 ASN ASN A . n 
A 1 518 MET 518 518 518 MET MET A . n 
A 1 519 SER 519 519 519 SER SER A . n 
A 1 520 ARG 520 520 520 ARG ARG A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 THR 523 523 523 THR THR A . n 
A 1 524 TYR 524 524 524 TYR TYR A . n 
A 1 525 SER 525 525 525 SER SER A . n 
A 1 526 ASP 526 526 526 ASP ASP A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 TRP 528 528 528 TRP TRP A . n 
A 1 529 TRP 529 529 529 TRP TRP A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 GLY 531 531 531 GLY GLY A . n 
A 1 532 LYS 532 532 532 LYS LYS A . n 
A 1 533 LEU 533 533 533 LEU LEU A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 PHE 535 535 535 PHE PHE A . n 
A 1 536 LYS 536 536 536 LYS LYS A . n 
A 1 537 ALA 537 537 537 ALA ALA A . n 
A 1 538 LYS 538 538 538 LYS LYS A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 ARG 540 540 540 ARG ARG A . n 
A 1 541 ALA 541 541 541 ALA ALA A . n 
A 1 542 SER 542 542 542 SER SER A . n 
A 1 543 HIS 543 543 543 HIS HIS A . n 
A 1 544 THR 544 544 544 THR THR A . n 
A 1 545 TRP 545 545 545 TRP TRP A . n 
A 1 546 ASN 546 546 546 ASN ASN A . n 
A 1 547 PRO 547 547 547 PRO PRO A . n 
A 1 548 ILE 548 548 548 ILE ILE A . n 
A 1 549 GLN 549 549 549 GLN GLN A . n 
A 1 550 GLN 550 550 550 GLN GLN A . n 
A 1 551 MET 551 551 551 MET MET A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 ILE 553 553 553 ILE ILE A . n 
A 1 554 ASN 554 554 554 ASN ASN A . n 
A 1 555 VAL 555 555 555 VAL VAL A . n 
A 1 556 ASP 556 556 556 ASP ASP A . n 
A 1 557 ASN 557 557 557 ASN ASN A . n 
A 1 558 GLN 558 558 558 GLN GLN A . n 
A 1 559 PHE 559 559 559 PHE PHE A . n 
A 1 560 ASN 560 560 560 ASN ASN A . n 
A 1 561 TYR 561 561 561 TYR TYR A . n 
A 1 562 VAL 562 562 562 VAL VAL A . n 
A 1 563 PRO 563 563 563 PRO PRO A . n 
A 1 564 ASN 564 564 564 ASN ASN A . n 
A 1 565 ASN 565 565 565 ASN ASN A . n 
A 1 566 ILE 566 566 566 ILE ILE A . n 
A 1 567 GLY 567 567 567 GLY GLY A . n 
A 1 568 ALA 568 568 568 ALA ALA A . n 
A 1 569 MET 569 569 569 MET MET A . n 
A 1 570 LYS 570 570 570 LYS LYS A . n 
A 1 571 ILE 571 571 571 ILE ILE A . n 
A 1 572 VAL 572 572 572 VAL VAL A . n 
A 1 573 TYR 573 573 573 TYR TYR A . n 
A 1 574 GLU 574 574 574 GLU GLU A . n 
A 1 575 LYS 575 575 575 LYS LYS A . n 
A 1 576 SER 576 576 576 SER SER A . n 
A 1 577 GLN 577 577 577 GLN GLN A . n 
A 1 578 LEU 578 578 578 LEU LEU A . n 
A 1 579 ALA 579 579 579 ALA ALA A . n 
A 1 580 PRO 580 580 580 PRO PRO A . n 
A 1 581 ARG 581 581 581 ARG ARG A . n 
A 1 582 LYS 582 582 582 LYS LYS A . n 
A 1 583 LEU 583 583 583 LEU LEU A . n 
A 1 584 TYR 584 584 584 TYR TYR A . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 'complete icosahedral assembly'                ? 'complete icosahedral assembly' 60 
2 'icosahedral asymmetric unit'                  ? monomeric                       1  
3 'icosahedral pentamer'                         ? pentameric                      5  
4 'icosahedral 23 hexamer'                       ? hexameric                       6  
5 'icosahedral asymmetric unit, std point frame' ? monomeric                       1  
6 'crystal asymmetric unit, crystal frame'       ? 60-meric                        60 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 '(1-60)'           A 
2 1                  A 
3 '(1-5)'            A 
4 '(1,2,6,10,23,24)' A 
5 P                  A 
6 '(X0)(1-60)'       A 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
P  'transform to point frame'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000   1.00000000  0.00000000  0.00000000  0.00000   
0.00000000  0.00000000  1.00000000  -0.00000  
X0 'transform to crystal frame' ? ? -0.19726339 0.96769291  -0.15773469 189.16762 -0.96358109 -0.16160849 0.21396053  197.57207 
0.18175438  0.19438598  0.96385968  176.45615 
1  'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000   0.00000000  1.00000000  0.00000000  0.00000   
0.00000000  0.00000000  1.00000000  0.00000   
2  'point symmetry operation'   ? ? 0.50000000  -0.80901699 0.30901699  0.00000   0.80901699  0.30901699  -0.50000000 0.00000   
0.30901699  0.50000000  0.80901699  0.00000   
3  'point symmetry operation'   ? ? -0.30901699 -0.50000000 0.80901699  0.00000   0.50000000  -0.80901699 -0.30901699 0.00000   
0.80901699  0.30901699  0.50000000  0.00000   
4  'point symmetry operation'   ? ? -0.30901699 0.50000000  0.80901699  0.00000   -0.50000000 -0.80901699 0.30901699  0.00000   
0.80901699  -0.30901699 0.50000000  0.00000   
5  'point symmetry operation'   ? ? 0.50000000  0.80901699  0.30901699  0.00000   -0.80901699 0.30901699  0.50000000  0.00000   
0.30901699  -0.50000000 0.80901699  0.00000   
6  'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000   0.00000000  -1.00000000 0.00000000  0.00000   
0.00000000  0.00000000  1.00000000  0.00000   
7  'point symmetry operation'   ? ? -0.50000000 0.80901699  -0.30901699 0.00000   -0.80901699 -0.30901699 0.50000000  0.00000   
0.30901699  0.50000000  0.80901699  0.00000   
8  'point symmetry operation'   ? ? 0.30901699  0.50000000  -0.80901699 0.00000   -0.50000000 0.80901699  0.30901699  0.00000   
0.80901699  0.30901699  0.50000000  0.00000   
9  'point symmetry operation'   ? ? 0.30901699  -0.50000000 -0.80901699 0.00000   0.50000000  0.80901699  -0.30901699 0.00000   
0.80901699  -0.30901699 0.50000000  0.00000   
10 'point symmetry operation'   ? ? -0.50000000 -0.80901699 -0.30901699 0.00000   0.80901699  -0.30901699 -0.50000000 0.00000   
0.30901699  -0.50000000 0.80901699  0.00000   
11 'point symmetry operation'   ? ? 1.00000000  0.00000000  0.00000000  0.00000   0.00000000  -1.00000000 0.00000000  0.00000   
0.00000000  0.00000000  -1.00000000 0.00000   
12 'point symmetry operation'   ? ? 0.50000000  -0.80901699 0.30901699  0.00000   -0.80901699 -0.30901699 0.50000000  0.00000   
-0.30901699 -0.50000000 -0.80901699 0.00000   
13 'point symmetry operation'   ? ? -0.30901699 -0.50000000 0.80901699  0.00000   -0.50000000 0.80901699  0.30901699  0.00000   
-0.80901699 -0.30901699 -0.50000000 0.00000   
14 'point symmetry operation'   ? ? -0.30901699 0.50000000  0.80901699  0.00000   0.50000000  0.80901699  -0.30901699 0.00000   
-0.80901699 0.30901699  -0.50000000 0.00000   
15 'point symmetry operation'   ? ? 0.50000000  0.80901699  0.30901699  0.00000   0.80901699  -0.30901699 -0.50000000 0.00000   
-0.30901699 0.50000000  -0.80901699 0.00000   
16 'point symmetry operation'   ? ? -1.00000000 0.00000000  0.00000000  0.00000   0.00000000  1.00000000  0.00000000  0.00000   
0.00000000  0.00000000  -1.00000000 0.00000   
17 'point symmetry operation'   ? ? -0.50000000 0.80901699  -0.30901699 0.00000   0.80901699  0.30901699  -0.50000000 0.00000   
-0.30901699 -0.50000000 -0.80901699 0.00000   
18 'point symmetry operation'   ? ? 0.30901699  0.50000000  -0.80901699 0.00000   0.50000000  -0.80901699 -0.30901699 0.00000   
-0.80901699 -0.30901699 -0.50000000 0.00000   
19 'point symmetry operation'   ? ? 0.30901699  -0.50000000 -0.80901699 0.00000   -0.50000000 -0.80901699 0.30901699  0.00000   
-0.80901699 0.30901699  -0.50000000 0.00000   
20 'point symmetry operation'   ? ? -0.50000000 -0.80901699 -0.30901699 0.00000   -0.80901699 0.30901699  0.50000000  0.00000   
-0.30901699 0.50000000  -0.80901699 0.00000   
21 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000   0.00000000  0.00000000  -1.00000000 0.00000   
1.00000000  0.00000000  0.00000000  0.00000   
22 'point symmetry operation'   ? ? -0.80901699 -0.30901699 0.50000000  0.00000   -0.30901699 -0.50000000 -0.80901699 0.00000   
0.50000000  -0.80901699 0.30901699  0.00000   
23 'point symmetry operation'   ? ? -0.50000000 0.80901699  0.30901699  0.00000   -0.80901699 -0.30901699 -0.50000000 0.00000   
-0.30901699 -0.50000000 0.80901699  0.00000   
24 'point symmetry operation'   ? ? 0.50000000  0.80901699  -0.30901699 0.00000   -0.80901699 0.30901699  -0.50000000 0.00000   
-0.30901699 0.50000000  0.80901699  0.00000   
25 'point symmetry operation'   ? ? 0.80901699  -0.30901699 -0.50000000 0.00000   -0.30901699 0.50000000  -0.80901699 0.00000   
0.50000000  0.80901699  0.30901699  0.00000   
26 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000   0.00000000  0.00000000  -1.00000000 0.00000   
-1.00000000 0.00000000  0.00000000  0.00000   
27 'point symmetry operation'   ? ? 0.80901699  0.30901699  -0.50000000 0.00000   -0.30901699 -0.50000000 -0.80901699 0.00000   
-0.50000000 0.80901699  -0.30901699 0.00000   
28 'point symmetry operation'   ? ? 0.50000000  -0.80901699 -0.30901699 0.00000   -0.80901699 -0.30901699 -0.50000000 0.00000   
0.30901699  0.50000000  -0.80901699 0.00000   
29 'point symmetry operation'   ? ? -0.50000000 -0.80901699 0.30901699  0.00000   -0.80901699 0.30901699  -0.50000000 0.00000   
0.30901699  -0.50000000 -0.80901699 0.00000   
30 'point symmetry operation'   ? ? -0.80901699 0.30901699  0.50000000  0.00000   -0.30901699 0.50000000  -0.80901699 0.00000   
-0.50000000 -0.80901699 -0.30901699 0.00000   
31 'point symmetry operation'   ? ? 0.00000000  1.00000000  0.00000000  0.00000   0.00000000  0.00000000  1.00000000  0.00000   
1.00000000  0.00000000  0.00000000  0.00000   
32 'point symmetry operation'   ? ? 0.80901699  0.30901699  -0.50000000 0.00000   0.30901699  0.50000000  0.80901699  0.00000   
0.50000000  -0.80901699 0.30901699  0.00000   
33 'point symmetry operation'   ? ? 0.50000000  -0.80901699 -0.30901699 0.00000   0.80901699  0.30901699  0.50000000  0.00000   
-0.30901699 -0.50000000 0.80901699  0.00000   
34 'point symmetry operation'   ? ? -0.50000000 -0.80901699 0.30901699  0.00000   0.80901699  -0.30901699 0.50000000  0.00000   
-0.30901699 0.50000000  0.80901699  0.00000   
35 'point symmetry operation'   ? ? -0.80901699 0.30901699  0.50000000  0.00000   0.30901699  -0.50000000 0.80901699  0.00000   
0.50000000  0.80901699  0.30901699  0.00000   
36 'point symmetry operation'   ? ? 0.00000000  -1.00000000 0.00000000  0.00000   0.00000000  0.00000000  1.00000000  0.00000   
-1.00000000 0.00000000  0.00000000  0.00000   
37 'point symmetry operation'   ? ? -0.80901699 -0.30901699 0.50000000  0.00000   0.30901699  0.50000000  0.80901699  0.00000   
-0.50000000 0.80901699  -0.30901699 0.00000   
38 'point symmetry operation'   ? ? -0.50000000 0.80901699  0.30901699  0.00000   0.80901699  0.30901699  0.50000000  0.00000   
0.30901699  0.50000000  -0.80901699 0.00000   
39 'point symmetry operation'   ? ? 0.50000000  0.80901699  -0.30901699 0.00000   0.80901699  -0.30901699 0.50000000  0.00000   
0.30901699  -0.50000000 -0.80901699 0.00000   
40 'point symmetry operation'   ? ? 0.80901699  -0.30901699 -0.50000000 0.00000   0.30901699  -0.50000000 0.80901699  0.00000   
-0.50000000 -0.80901699 -0.30901699 0.00000   
41 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000   -1.00000000 0.00000000  0.00000000  0.00000   
0.00000000  -1.00000000 0.00000000  0.00000   
42 'point symmetry operation'   ? ? 0.30901699  0.50000000  0.80901699  0.00000   -0.50000000 0.80901699  -0.30901699 0.00000   
-0.80901699 -0.30901699 0.50000000  0.00000   
43 'point symmetry operation'   ? ? 0.80901699  0.30901699  0.50000000  0.00000   0.30901699  0.50000000  -0.80901699 0.00000   
-0.50000000 0.80901699  0.30901699  0.00000   
44 'point symmetry operation'   ? ? 0.80901699  -0.30901699 0.50000000  0.00000   0.30901699  -0.50000000 -0.80901699 0.00000   
0.50000000  0.80901699  -0.30901699 0.00000   
45 'point symmetry operation'   ? ? 0.30901699  -0.50000000 0.80901699  0.00000   -0.50000000 -0.80901699 -0.30901699 0.00000   
0.80901699  -0.30901699 -0.50000000 0.00000   
46 'point symmetry operation'   ? ? 0.00000000  0.00000000  1.00000000  0.00000   1.00000000  0.00000000  0.00000000  0.00000   
0.00000000  1.00000000  0.00000000  0.00000   
47 'point symmetry operation'   ? ? 0.30901699  0.50000000  0.80901699  0.00000   0.50000000  -0.80901699 0.30901699  0.00000   
0.80901699  0.30901699  -0.50000000 0.00000   
48 'point symmetry operation'   ? ? 0.80901699  0.30901699  0.50000000  0.00000   -0.30901699 -0.50000000 0.80901699  0.00000   
0.50000000  -0.80901699 -0.30901699 0.00000   
49 'point symmetry operation'   ? ? 0.80901699  -0.30901699 0.50000000  0.00000   -0.30901699 0.50000000  0.80901699  0.00000   
-0.50000000 -0.80901699 0.30901699  0.00000   
50 'point symmetry operation'   ? ? 0.30901699  -0.50000000 0.80901699  0.00000   0.50000000  0.80901699  0.30901699  0.00000   
-0.80901699 0.30901699  0.50000000  0.00000   
51 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000   -1.00000000 0.00000000  0.00000000  0.00000   
0.00000000  1.00000000  0.00000000  0.00000   
52 'point symmetry operation'   ? ? -0.30901699 -0.50000000 -0.80901699 0.00000   -0.50000000 0.80901699  -0.30901699 0.00000   
0.80901699  0.30901699  -0.50000000 0.00000   
53 'point symmetry operation'   ? ? -0.80901699 -0.30901699 -0.50000000 0.00000   0.30901699  0.50000000  -0.80901699 0.00000   
0.50000000  -0.80901699 -0.30901699 0.00000   
54 'point symmetry operation'   ? ? -0.80901699 0.30901699  -0.50000000 0.00000   0.30901699  -0.50000000 -0.80901699 0.00000   
-0.50000000 -0.80901699 0.30901699  0.00000   
55 'point symmetry operation'   ? ? -0.30901699 0.50000000  -0.80901699 0.00000   -0.50000000 -0.80901699 -0.30901699 0.00000   
-0.80901699 0.30901699  0.50000000  0.00000   
56 'point symmetry operation'   ? ? 0.00000000  0.00000000  -1.00000000 0.00000   1.00000000  0.00000000  0.00000000  0.00000   
0.00000000  -1.00000000 0.00000000  0.00000   
57 'point symmetry operation'   ? ? -0.30901699 -0.50000000 -0.80901699 0.00000   0.50000000  -0.80901699 0.30901699  0.00000   
-0.80901699 -0.30901699 0.50000000  0.00000   
58 'point symmetry operation'   ? ? -0.80901699 -0.30901699 -0.50000000 0.00000   -0.30901699 -0.50000000 0.80901699  0.00000   
-0.50000000 0.80901699  0.30901699  0.00000   
59 'point symmetry operation'   ? ? -0.80901699 0.30901699  -0.50000000 0.00000   -0.30901699 0.50000000  0.80901699  0.00000   
0.50000000  0.80901699  -0.30901699 0.00000   
60 'point symmetry operation'   ? ? -0.30901699 0.50000000  -0.80901699 0.00000   0.50000000  0.80901699  0.30901699  0.00000   
0.80901699  -0.30901699 -0.50000000 0.00000   
# 
_pdbx_point_symmetry.entry_id             1FPV 
_pdbx_point_symmetry.Schoenflies_symbol   I 
_pdbx_point_symmetry.H-M_notation         532 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1994-01-31 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
285 
;THE ENTRY PRESENTED HERE DOES NOT CONTAIN THE COMPLETE
CRYSTAL ASYMMETRIC UNIT. IN ADDITION, THE COORDINATES
ARE NOT PRESENTED IN THE STANDARD CRYSTAL FRAME.

IN ORDER TO GENERATE THE FULL CRYSTAL AU, APPLY THE
FOLLOWING TRANSFORMATION MATRIX OR MATRICES AND SELECTED
BIOMT RECORDS TO THE COORDINATES, AS SHOWN BELOW.
X0  1   -0.197263   0.967693  -0.157735  189.16762
X0  2   -0.963581  -0.161608   0.213961  197.57207
X0  3    0.181754   0.194386   0.963860  176.45615
CRYSTAL AU =
(X0) * (BIOMT 1-60) * CHAINS A 
;
700 
;SHEET
THE STRUCTURE OF FELINE PANLEUKOPENIA VIRUS FOLLOWS THE
CANONICAL PICORNAVIRUS "JELLY ROLL" BARREL.  THE SHEET
IDENTIFIED AS "BDG" IS THAT REFERRED TO AS "BIDG" IN THE
LITERATURE WITH STRANDS 1 TO 5 CORRESPONDING TO STRANDS
A, B, I, D, AND G.  THE SHEET IDENTIFIED AS "CHF" IS THE
SO-CALLED CHEF SHEET WITH STRANDS 1 TO 4 CORRESPONDING TO
STRANDS C, H, E, AND F.  THESE TWO SHEETS ARE LOOSELY
CONNECTED TOGETHER BY HYDROGEN BONDS BETWEEN STRAND 4 OF
"CHF" AND RESIDUE 45 IMMEDIATELY PRECEDING STRAND 1 OF
"BDG" OF A FIVE-FOLD RELATED PROTOMER THAT IS NOT
EXPLICITLY PRESENTED ON THE ATOM RECORDS, BUT WHICH CAN BE
GENERATED USING THE SYMMETRY OPERATORS LISTED BELOW.  FPV
CONTAINS SEVERAL LONG LOOPS BETWEEN STRANDS OF "BDG" AND
"CHF" WITH LITTLE ORGANIZED SECONDARY STRUCTURE.  THERE ARE
STRANDS WITHIN THE LOOPS THAT ARE LOOSELY HYDROGEN-BONDED
TOGETHER.  WITH FEWER HYDROGEN BONDS AND LESS REGULAR
SECONDARY STRUCTURE THEY MUST BE REGARDED MORE TENTATIVELY
UNTIL THE STRUCTURE IS REFINED.  THIS IS WHY THE SHEET
"LP2" HAS BEEN IDENTIFIED SEPARATELY, ALTHOUGH IT COULD BE
CONSIDERED TO BE AN EXTENSION OF SHEET "CHF", EXTENDING
FROM STRAND 1.  STRAND 1 OF "LP2" HAS A BULGE AND A CHANGE
OF DIRECTION AT RESIDUE 107, AFTER WHICH IT BECOMES STRAND
1 OF "CHF".  THE MIDDLE STRAND OF "LP2" CONTAINS TWO
SEGMENTS THAT RUN IN THE SAME GENERAL DIRECTION, BUT ARE
SEPARATED BY NON-BETA STRUCTURE.  THE FIRST SEGMENT (206
TO 211) HYDROGEN BONDS ON ONE SIDE ONLY, TO RESIDUES 103 TO
111, AND THE SECOND SEGMENT (215 TO 218) HYDROGEN BONDS ON
THE OPPOSITE SIDE TO RESIDUES 230 TO 235.
IN ORDER TO REPRESENT THE BIFURCATED SHEET STRUCTURE IN THE
*SHEET* RECORDS BELOW, TWO SHEETS, *BDG* AND *CDG* ARE
DEFINED.  STRANDS 1 - 4 OF THESE SHEETS ARE IDENTICAL.
;
# 
_pdbx_entry_details.entry_id             1FPV 
_pdbx_entry_details.compound_details     
;INTERPRETABLE ELECTRON DENSITY BEGINS AT THE 37TH RESIDUE
OF VP2.  THERE IS DIFFUSE DENSITY, SUGGESTING THAT ONE IN
FIVE OF THE N-TERMINI IS ON THE OUTSIDE OF THE CAPSID, AND
THAT THE POLYPEPTIDE RUNS DOWN THE FIVE-FOLD AXIS TO JOIN
RESIDUE 37 ON THE INSIDE SURFACE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O   A ALA 516 ? ? ND2 A ASN 517 ? ? 1.66 
2  1 CB  A ALA 359 ? ? O   A ASP 373 ? ? 1.69 
3  1 O   A ASN 369 ? ? N   A ALA 371 ? ? 1.78 
4  1 NE1 A TRP 109 ? ? OE2 A GLU 247 ? ? 1.82 
5  1 CE  A MET 96  ? ? N   A SER 221 ? ? 1.83 
6  1 OD1 A ASP 99  ? ? NH1 A ARG 216 ? ? 1.83 
7  1 O   A ASP 113 ? ? CD1 A LEU 195 ? ? 1.84 
8  1 O   A PRO 74  ? ? NH2 A ARG 520 ? ? 1.92 
9  1 OD1 A ASN 564 ? ? CB  A ALA 568 ? ? 1.92 
10 1 NZ  A LYS 93  ? ? O   A GLY 227 ? ? 1.94 
11 1 CG2 A VAL 424 ? ? CG2 A VAL 429 ? ? 2.00 
12 1 NH1 A ARG 361 ? ? CG2 A ILE 401 ? ? 2.02 
13 1 O   A ARG 361 ? ? CA  A GLY 407 ? ? 2.03 
14 1 NH1 A ARG 361 ? ? O   A ALA 402 ? ? 2.05 
15 1 OD2 A ASP 99  ? ? NH1 A ARG 216 ? ? 2.08 
16 1 O   A ASN 517 ? ? N   A SER 519 ? ? 2.10 
17 1 O   A LYS 93  ? ? O   A SER 221 ? ? 2.10 
18 1 O   A SER 576 ? ? CD2 A LEU 578 ? ? 2.11 
19 1 CG  A ASP 99  ? ? NH1 A ARG 216 ? ? 2.12 
20 1 CG  A GLU 77  ? ? CE  A MET 518 ? ? 2.12 
21 1 O   A THR 158 ? ? CD  A PRO 160 ? ? 2.15 
22 1 OE1 A GLU 193 ? ? NH2 A ARG 209 ? ? 2.16 
23 1 O   A PRO 432 ? ? ND2 A ASN 443 ? ? 2.16 
24 1 O   A THR 245 ? ? OG  A SER 249 ? ? 2.16 
25 1 NH1 A ARG 361 ? ? O   A ILE 401 ? ? 2.18 
26 1 O   A ASN 564 ? ? N   A GLY 567 ? ? 2.18 
27 1 O   A LYS 93  ? ? O   A HIS 222 ? ? 2.18 
28 1 ND2 A ASN 122 ? ? OD2 A ASP 125 ? ? 2.18 
29 1 CD2 A HIS 70  ? ? OD1 A ASP 526 ? ? 2.19 
30 1 O   A THR 276 ? ? NE2 A GLN 577 ? ? 2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CA A THR 228 ? ? C  A THR 228 ? ? 1.687 1.525 0.162  0.026 N 
2 1 C  A ASP 239 ? ? N  A ASP 240 ? ? 1.150 1.336 -0.186 0.023 Y 
3 1 C  A THR 263 ? ? O  A THR 263 ? ? 1.385 1.229 0.156  0.019 N 
4 1 N  A GLY 264 ? ? CA A GLY 264 ? ? 1.591 1.456 0.135  0.015 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA  A GLY 39  ? ? C  A GLY 39  ? ? N   A ILE 40  ? ? 89.66  117.20 -27.54 2.20 Y 
2  1 O   A GLY 39  ? ? C  A GLY 39  ? ? N   A ILE 40  ? ? 137.88 122.70 15.18  1.60 Y 
3  1 C   A GLY 39  ? ? N  A ILE 40  ? ? CA  A ILE 40  ? ? 97.01  121.70 -24.69 2.50 Y 
4  1 NE  A ARG 67  ? ? CZ A ARG 67  ? ? NH2 A ARG 67  ? ? 124.03 120.30 3.73   0.50 N 
5  1 CG  A MET 73  ? ? SD A MET 73  ? ? CE  A MET 73  ? ? 109.96 100.20 9.76   1.60 N 
6  1 NE  A ARG 81  ? ? CZ A ARG 81  ? ? NH2 A ARG 81  ? ? 123.88 120.30 3.58   0.50 N 
7  1 CG  A MET 87  ? ? SD A MET 87  ? ? CE  A MET 87  ? ? 109.86 100.20 9.66   1.60 N 
8  1 CG  A MET 96  ? ? SD A MET 96  ? ? CE  A MET 96  ? ? 110.09 100.20 9.89   1.60 N 
9  1 CG  A MET 174 ? ? SD A MET 174 ? ? CE  A MET 174 ? ? 110.00 100.20 9.80   1.60 N 
10 1 CG  A MET 183 ? ? SD A MET 183 ? ? CE  A MET 183 ? ? 109.85 100.20 9.65   1.60 N 
11 1 CG  A MET 190 ? ? SD A MET 190 ? ? CE  A MET 190 ? ? 110.20 100.20 10.00  1.60 N 
12 1 NE  A ARG 191 ? ? CZ A ARG 191 ? ? NH2 A ARG 191 ? ? 124.02 120.30 3.72   0.50 N 
13 1 NE  A ARG 209 ? ? CZ A ARG 209 ? ? NH2 A ARG 209 ? ? 124.08 120.30 3.78   0.50 N 
14 1 NE  A ARG 216 ? ? CZ A ARG 216 ? ? NH2 A ARG 216 ? ? 124.09 120.30 3.79   0.50 N 
15 1 CA  A THR 228 ? ? C  A THR 228 ? ? O   A THR 228 ? ? 102.33 120.10 -17.77 2.10 N 
16 1 CA  A THR 228 ? ? C  A THR 228 ? ? N   A PRO 229 ? ? 134.77 117.10 17.67  2.80 Y 
17 1 OE1 A GLU 260 ? ? CD A GLU 260 ? ? OE2 A GLU 260 ? ? 131.12 123.30 7.82   1.20 N 
18 1 N   A THR 263 ? ? CA A THR 263 ? ? CB  A THR 263 ? ? 95.95  110.30 -14.35 1.90 N 
19 1 CA  A THR 263 ? ? C  A THR 263 ? ? N   A GLY 264 ? ? 137.52 116.20 21.32  2.00 Y 
20 1 O   A THR 263 ? ? C  A THR 263 ? ? N   A GLY 264 ? ? 112.36 123.20 -10.84 1.70 Y 
21 1 NE  A ARG 274 ? ? CZ A ARG 274 ? ? NH2 A ARG 274 ? ? 124.05 120.30 3.75   0.50 N 
22 1 NE  A ARG 283 ? ? CZ A ARG 283 ? ? NH2 A ARG 283 ? ? 124.01 120.30 3.71   0.50 N 
23 1 NE  A ARG 313 ? ? CZ A ARG 313 ? ? NH2 A ARG 313 ? ? 123.96 120.30 3.66   0.50 N 
24 1 NE  A ARG 314 ? ? CZ A ARG 314 ? ? NH2 A ARG 314 ? ? 124.08 120.30 3.78   0.50 N 
25 1 CG  A MET 319 ? ? SD A MET 319 ? ? CE  A MET 319 ? ? 110.02 100.20 9.82   1.60 N 
26 1 CG  A MET 331 ? ? SD A MET 331 ? ? CE  A MET 331 ? ? 109.95 100.20 9.75   1.60 N 
27 1 NE  A ARG 332 ? ? CZ A ARG 332 ? ? NH2 A ARG 332 ? ? 123.97 120.30 3.67   0.50 N 
28 1 CA  A TYR 342 ? ? C  A TYR 342 ? ? N   A TYR 343 ? ? 91.14  117.20 -26.06 2.20 Y 
29 1 O   A TYR 342 ? ? C  A TYR 342 ? ? N   A TYR 343 ? ? 150.57 122.70 27.87  1.60 Y 
30 1 C   A TYR 342 ? ? N  A TYR 343 ? ? CA  A TYR 343 ? ? 142.98 121.70 21.28  2.50 Y 
31 1 NE  A ARG 361 ? ? CZ A ARG 361 ? ? NH2 A ARG 361 ? ? 124.08 120.30 3.78   0.50 N 
32 1 NE  A ARG 377 ? ? CZ A ARG 377 ? ? NH2 A ARG 377 ? ? 123.87 120.30 3.57   0.50 N 
33 1 NE  A ARG 382 ? ? CZ A ARG 382 ? ? NH2 A ARG 382 ? ? 123.98 120.30 3.68   0.50 N 
34 1 NE  A ARG 397 ? ? CZ A ARG 397 ? ? NH2 A ARG 397 ? ? 124.02 120.30 3.72   0.50 N 
35 1 NE  A ARG 408 ? ? CZ A ARG 408 ? ? NH2 A ARG 408 ? ? 123.94 120.30 3.64   0.50 N 
36 1 NE  A ARG 481 ? ? CZ A ARG 481 ? ? NH2 A ARG 481 ? ? 123.97 120.30 3.67   0.50 N 
37 1 CA  A ASN 492 ? ? CB A ASN 492 ? ? CG  A ASN 492 ? ? 96.25  113.40 -17.15 2.20 N 
38 1 CG  A MET 518 ? ? SD A MET 518 ? ? CE  A MET 518 ? ? 110.25 100.20 10.05  1.60 N 
39 1 NE  A ARG 520 ? ? CZ A ARG 520 ? ? NH2 A ARG 520 ? ? 124.42 120.30 4.12   0.50 N 
40 1 NE  A ARG 540 ? ? CZ A ARG 540 ? ? NH2 A ARG 540 ? ? 123.99 120.30 3.69   0.50 N 
41 1 CG  A MET 551 ? ? SD A MET 551 ? ? CE  A MET 551 ? ? 110.21 100.20 10.01  1.60 N 
42 1 NE  A ARG 581 ? ? CZ A ARG 581 ? ? NH2 A ARG 581 ? ? 123.81 120.30 3.51   0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 38  ? ? -57.99  10.15   
2  1 LEU A 54  ? ? -101.30 -151.16 
3  1 ASN A 86  ? ? -142.98 46.88   
4  1 MET A 87  ? ? -73.67  26.80   
5  1 VAL A 92  ? ? -64.46  0.99    
6  1 VAL A 139 ? ? -122.97 -91.87  
7  1 ALA A 157 ? ? -55.99  88.28   
8  1 GLN A 159 ? ? 79.45   -81.69  
9  1 PRO A 161 ? ? -64.29  -157.89 
10 1 ASP A 168 ? ? -102.81 73.61   
11 1 ASN A 181 ? ? 16.49   83.28   
12 1 PRO A 184 ? ? -59.46  173.94  
13 1 THR A 186 ? ? -117.09 79.07   
14 1 ALA A 188 ? ? -86.32  39.62   
15 1 GLU A 193 ? ? -102.96 59.21   
16 1 THR A 194 ? ? -101.68 -132.55 
17 1 GLN A 213 ? ? -48.57  108.87  
18 1 PRO A 220 ? ? -58.10  176.18  
19 1 SER A 221 ? ? 175.82  118.43  
20 1 PRO A 229 ? ? -53.63  -85.98  
21 1 THR A 230 ? ? 176.46  128.01  
22 1 ASN A 231 ? ? -170.61 116.99  
23 1 PRO A 238 ? ? -59.37  -6.34   
24 1 ASP A 240 ? ? -108.36 54.63   
25 1 THR A 281 ? ? -97.78  -126.58 
26 1 ALA A 300 ? ? -67.30  14.91   
27 1 LYS A 312 ? ? -161.59 18.13   
28 1 ALA A 334 ? ? -159.11 -156.08 
29 1 TYR A 343 ? ? 86.37   52.46   
30 1 GLU A 346 ? ? -77.47  -166.16 
31 1 SER A 348 ? ? -142.64 -150.23 
32 1 ARG A 361 ? ? -109.66 -146.39 
33 1 GLN A 370 ? ? 11.98   -21.27  
34 1 ARG A 382 ? ? 53.05   -47.50  
35 1 HIS A 384 ? ? -149.94 47.58   
36 1 GLN A 386 ? ? 55.30   144.78  
37 1 ALA A 402 ? ? -52.15  -170.97 
38 1 TYR A 409 ? ? -106.08 77.61   
39 1 PRO A 410 ? ? -59.18  13.40   
40 1 ASP A 413 ? ? -125.90 -168.38 
41 1 TRP A 414 ? ? 165.55  146.74  
42 1 PHE A 420 ? ? 64.81   -67.64  
43 1 ASN A 421 ? ? 14.95   70.44   
44 1 ASN A 426 ? ? -34.60  -74.55  
45 1 ASP A 427 ? ? -49.16  -3.69   
46 1 THR A 440 ? ? -67.16  -78.75  
47 1 PRO A 453 ? ? -61.03  9.82    
48 1 PRO A 465 ? ? -65.98  -94.05  
49 1 ASN A 466 ? ? 22.36   -88.99  
50 1 ILE A 469 ? ? -101.35 -73.31  
51 1 LYS A 472 ? ? -34.56  176.89  
52 1 GLN A 491 ? ? -79.80  -86.57  
53 1 TYR A 510 ? ? -166.39 111.68  
54 1 ALA A 516 ? ? 12.25   -120.73 
55 1 ASN A 517 ? ? -177.96 101.57  
56 1 MET A 518 ? ? -22.05  67.67   
57 1 VAL A 522 ? ? -56.59  92.08   
58 1 GLN A 558 ? ? 2.73    -77.43  
59 1 ASN A 565 ? ? -24.96  -31.47  
60 1 SER A 576 ? ? -90.45  -72.69  
61 1 ALA A 579 ? ? -177.67 123.50  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 GLY A 39  ? ? 14.15 
2 1 THR A 228 ? ? 13.11 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   C 
_pdbx_validate_polymer_linkage.auth_asym_id_1   A 
_pdbx_validate_polymer_linkage.auth_comp_id_1   ASP 
_pdbx_validate_polymer_linkage.auth_seq_id_1    239 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   N 
_pdbx_validate_polymer_linkage.auth_asym_id_2   A 
_pdbx_validate_polymer_linkage.auth_comp_id_2   ASP 
_pdbx_validate_polymer_linkage.auth_seq_id_2    240 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             1.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1  ? A MET 1  
2  1 Y 1 A SER 2  ? A SER 2  
3  1 Y 1 A ASP 3  ? A ASP 3  
4  1 Y 1 A GLY 4  ? A GLY 4  
5  1 Y 1 A ALA 5  ? A ALA 5  
6  1 Y 1 A VAL 6  ? A VAL 6  
7  1 Y 1 A GLN 7  ? A GLN 7  
8  1 Y 1 A PRO 8  ? A PRO 8  
9  1 Y 1 A ASP 9  ? A ASP 9  
10 1 Y 1 A GLY 10 ? A GLY 10 
11 1 Y 1 A GLY 11 ? A GLY 11 
12 1 Y 1 A GLN 12 ? A GLN 12 
13 1 Y 1 A PRO 13 ? A PRO 13 
14 1 Y 1 A ALA 14 ? A ALA 14 
15 1 Y 1 A VAL 15 ? A VAL 15 
16 1 Y 1 A ARG 16 ? A ARG 16 
17 1 Y 1 A ASN 17 ? A ASN 17 
18 1 Y 1 A GLU 18 ? A GLU 18 
19 1 Y 1 A ARG 19 ? A ARG 19 
20 1 Y 1 A ALA 20 ? A ALA 20 
21 1 Y 1 A THR 21 ? A THR 21 
22 1 Y 1 A GLY 22 ? A GLY 22 
23 1 Y 1 A SER 23 ? A SER 23 
24 1 Y 1 A GLY 24 ? A GLY 24 
25 1 Y 1 A ASN 25 ? A ASN 25 
26 1 Y 1 A GLY 26 ? A GLY 26 
27 1 Y 1 A SER 27 ? A SER 27 
28 1 Y 1 A GLY 28 ? A GLY 28 
29 1 Y 1 A GLY 29 ? A GLY 29 
30 1 Y 1 A GLY 30 ? A GLY 30 
31 1 Y 1 A GLY 31 ? A GLY 31 
32 1 Y 1 A GLY 32 ? A GLY 32 
33 1 Y 1 A GLY 33 ? A GLY 33 
34 1 Y 1 A GLY 34 ? A GLY 34 
35 1 Y 1 A SER 35 ? A SER 35 
36 1 Y 1 A GLY 36 ? A GLY 36 
#