data_1FPY
# 
_entry.id   1FPY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.385 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1FPY         pdb_00001fpy 10.2210/pdb1fpy/pdb 
RCSB  RCSB011801   ?            ?                   
WWPDB D_1000011801 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2001-04-04 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2024-02-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Data collection'           
4 4 'Structure model' 'Database references'       
5 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' chem_comp_atom         
2 4 'Structure model' chem_comp_bond         
3 4 'Structure model' database_2             
4 4 'Structure model' pdbx_struct_conn_angle 
5 4 'Structure model' struct_conn            
6 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_alt_id'  
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_alt_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
19 4 'Structure model' '_pdbx_struct_conn_angle.value'               
20 4 'Structure model' '_struct_conn.pdbx_dist_value'                
21 4 'Structure model' '_struct_conn.pdbx_ptnr1_label_alt_id'        
22 4 'Structure model' '_struct_conn.pdbx_ptnr2_label_alt_id'        
23 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
24 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
26 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
27 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
28 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
29 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
30 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
31 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
32 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
33 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
34 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
35 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
36 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
37 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FPY 
_pdbx_database_status.recvd_initial_deposition_date   2000-08-31 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1F52 'GS-ADP complex'    unspecified 
PDB 1F1H 'GS-TL-ADP complex' unspecified 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gill, H.S.'    1 
'Eisenberg, D.' 2 
# 
_citation.id                        primary 
_citation.title                     
;The crystal structure of phosphinothricin in the active site of glutamine synthetase illuminates the mechanism of enzymatic inhibition.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            40 
_citation.page_first                1903 
_citation.page_last                 1912 
_citation.year                      2001 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11329256 
_citation.pdbx_database_id_DOI      10.1021/bi002438h 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gill, H.S.'    1 ? 
primary 'Eisenberg, D.' 2 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'GLUTAMINE SYNTHETASE'     51744.418 12   6.3.1.2 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'       54.938    24   ?       ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   12   ?       ? ? ? 
4 non-polymer syn PHOSPHINOTHRICIN           181.127   12   ?       ? ? ? 
5 water       nat water                      18.015    1836 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF
ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS
STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY
VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK
RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP
PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF
ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS
STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY
VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK
RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP
PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'       MN  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 PHOSPHINOTHRICIN           PPQ 
5 water                      HOH 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ALA n 
1 3   GLU n 
1 4   HIS n 
1 5   VAL n 
1 6   LEU n 
1 7   THR n 
1 8   MET n 
1 9   LEU n 
1 10  ASN n 
1 11  GLU n 
1 12  HIS n 
1 13  GLU n 
1 14  VAL n 
1 15  LYS n 
1 16  PHE n 
1 17  VAL n 
1 18  ASP n 
1 19  LEU n 
1 20  ARG n 
1 21  PHE n 
1 22  THR n 
1 23  ASP n 
1 24  THR n 
1 25  LYS n 
1 26  GLY n 
1 27  LYS n 
1 28  GLU n 
1 29  GLN n 
1 30  HIS n 
1 31  VAL n 
1 32  THR n 
1 33  ILE n 
1 34  PRO n 
1 35  ALA n 
1 36  HIS n 
1 37  GLN n 
1 38  VAL n 
1 39  ASN n 
1 40  ALA n 
1 41  GLU n 
1 42  PHE n 
1 43  PHE n 
1 44  GLU n 
1 45  GLU n 
1 46  GLY n 
1 47  LYS n 
1 48  MET n 
1 49  PHE n 
1 50  ASP n 
1 51  GLY n 
1 52  SER n 
1 53  SER n 
1 54  ILE n 
1 55  GLY n 
1 56  GLY n 
1 57  TRP n 
1 58  LYS n 
1 59  GLY n 
1 60  ILE n 
1 61  ASN n 
1 62  GLU n 
1 63  SER n 
1 64  ASP n 
1 65  MET n 
1 66  VAL n 
1 67  LEU n 
1 68  MET n 
1 69  PRO n 
1 70  ASP n 
1 71  ALA n 
1 72  SER n 
1 73  THR n 
1 74  ALA n 
1 75  VAL n 
1 76  ILE n 
1 77  ASP n 
1 78  PRO n 
1 79  PHE n 
1 80  PHE n 
1 81  ALA n 
1 82  ASP n 
1 83  SER n 
1 84  THR n 
1 85  LEU n 
1 86  ILE n 
1 87  ILE n 
1 88  ARG n 
1 89  CYS n 
1 90  ASP n 
1 91  ILE n 
1 92  LEU n 
1 93  GLU n 
1 94  PRO n 
1 95  GLY n 
1 96  THR n 
1 97  LEU n 
1 98  GLN n 
1 99  GLY n 
1 100 TYR n 
1 101 ASP n 
1 102 ARG n 
1 103 ASP n 
1 104 PRO n 
1 105 ARG n 
1 106 SER n 
1 107 ILE n 
1 108 ALA n 
1 109 LYS n 
1 110 ARG n 
1 111 ALA n 
1 112 GLU n 
1 113 ASP n 
1 114 TYR n 
1 115 LEU n 
1 116 ARG n 
1 117 ALA n 
1 118 THR n 
1 119 GLY n 
1 120 ILE n 
1 121 ALA n 
1 122 ASP n 
1 123 THR n 
1 124 VAL n 
1 125 LEU n 
1 126 PHE n 
1 127 GLY n 
1 128 PRO n 
1 129 GLU n 
1 130 PRO n 
1 131 GLU n 
1 132 PHE n 
1 133 PHE n 
1 134 LEU n 
1 135 PHE n 
1 136 ASP n 
1 137 ASP n 
1 138 ILE n 
1 139 ARG n 
1 140 PHE n 
1 141 GLY n 
1 142 ALA n 
1 143 SER n 
1 144 ILE n 
1 145 SER n 
1 146 GLY n 
1 147 SER n 
1 148 HIS n 
1 149 VAL n 
1 150 ALA n 
1 151 ILE n 
1 152 ASP n 
1 153 ASP n 
1 154 ILE n 
1 155 GLU n 
1 156 GLY n 
1 157 ALA n 
1 158 TRP n 
1 159 ASN n 
1 160 SER n 
1 161 SER n 
1 162 THR n 
1 163 LYS n 
1 164 TYR n 
1 165 GLU n 
1 166 GLY n 
1 167 GLY n 
1 168 ASN n 
1 169 LYS n 
1 170 GLY n 
1 171 HIS n 
1 172 ARG n 
1 173 PRO n 
1 174 GLY n 
1 175 VAL n 
1 176 LYS n 
1 177 GLY n 
1 178 GLY n 
1 179 TYR n 
1 180 PHE n 
1 181 PRO n 
1 182 VAL n 
1 183 PRO n 
1 184 PRO n 
1 185 VAL n 
1 186 ASP n 
1 187 SER n 
1 188 ALA n 
1 189 GLN n 
1 190 ASP n 
1 191 ILE n 
1 192 ARG n 
1 193 SER n 
1 194 GLU n 
1 195 MET n 
1 196 CYS n 
1 197 LEU n 
1 198 VAL n 
1 199 MET n 
1 200 GLU n 
1 201 GLN n 
1 202 MET n 
1 203 GLY n 
1 204 LEU n 
1 205 VAL n 
1 206 VAL n 
1 207 GLU n 
1 208 ALA n 
1 209 HIS n 
1 210 HIS n 
1 211 HIS n 
1 212 GLU n 
1 213 VAL n 
1 214 ALA n 
1 215 THR n 
1 216 ALA n 
1 217 GLY n 
1 218 GLN n 
1 219 ASN n 
1 220 GLU n 
1 221 VAL n 
1 222 ALA n 
1 223 THR n 
1 224 ARG n 
1 225 PHE n 
1 226 ASN n 
1 227 THR n 
1 228 MET n 
1 229 THR n 
1 230 LYS n 
1 231 LYS n 
1 232 ALA n 
1 233 ASP n 
1 234 GLU n 
1 235 ILE n 
1 236 GLN n 
1 237 ILE n 
1 238 TYR n 
1 239 LYS n 
1 240 TYR n 
1 241 VAL n 
1 242 VAL n 
1 243 HIS n 
1 244 ASN n 
1 245 VAL n 
1 246 ALA n 
1 247 HIS n 
1 248 ARG n 
1 249 PHE n 
1 250 GLY n 
1 251 LYS n 
1 252 THR n 
1 253 ALA n 
1 254 THR n 
1 255 PHE n 
1 256 MET n 
1 257 PRO n 
1 258 LYS n 
1 259 PRO n 
1 260 MET n 
1 261 PHE n 
1 262 GLY n 
1 263 ASP n 
1 264 ASN n 
1 265 GLY n 
1 266 SER n 
1 267 GLY n 
1 268 MET n 
1 269 HIS n 
1 270 CYS n 
1 271 HIS n 
1 272 MET n 
1 273 SER n 
1 274 LEU n 
1 275 ALA n 
1 276 LYS n 
1 277 ASN n 
1 278 GLY n 
1 279 THR n 
1 280 ASN n 
1 281 LEU n 
1 282 PHE n 
1 283 SER n 
1 284 GLY n 
1 285 ASP n 
1 286 LYS n 
1 287 TYR n 
1 288 ALA n 
1 289 GLY n 
1 290 LEU n 
1 291 SER n 
1 292 GLU n 
1 293 GLN n 
1 294 ALA n 
1 295 LEU n 
1 296 TYR n 
1 297 TYR n 
1 298 ILE n 
1 299 GLY n 
1 300 GLY n 
1 301 VAL n 
1 302 ILE n 
1 303 LYS n 
1 304 HIS n 
1 305 ALA n 
1 306 LYS n 
1 307 ALA n 
1 308 ILE n 
1 309 ASN n 
1 310 ALA n 
1 311 LEU n 
1 312 ALA n 
1 313 ASN n 
1 314 PRO n 
1 315 THR n 
1 316 THR n 
1 317 ASN n 
1 318 SER n 
1 319 TYR n 
1 320 LYS n 
1 321 ARG n 
1 322 LEU n 
1 323 VAL n 
1 324 PRO n 
1 325 GLY n 
1 326 TYR n 
1 327 GLU n 
1 328 ALA n 
1 329 PRO n 
1 330 VAL n 
1 331 MET n 
1 332 LEU n 
1 333 ALA n 
1 334 TYR n 
1 335 SER n 
1 336 ALA n 
1 337 ARG n 
1 338 ASN n 
1 339 ARG n 
1 340 SER n 
1 341 ALA n 
1 342 SER n 
1 343 ILE n 
1 344 ARG n 
1 345 ILE n 
1 346 PRO n 
1 347 VAL n 
1 348 VAL n 
1 349 ALA n 
1 350 SER n 
1 351 PRO n 
1 352 LYS n 
1 353 ALA n 
1 354 ARG n 
1 355 ARG n 
1 356 ILE n 
1 357 GLU n 
1 358 VAL n 
1 359 ARG n 
1 360 PHE n 
1 361 PRO n 
1 362 ASP n 
1 363 PRO n 
1 364 ALA n 
1 365 ALA n 
1 366 ASN n 
1 367 PRO n 
1 368 TYR n 
1 369 LEU n 
1 370 CYS n 
1 371 PHE n 
1 372 ALA n 
1 373 ALA n 
1 374 LEU n 
1 375 LEU n 
1 376 MET n 
1 377 ALA n 
1 378 GLY n 
1 379 LEU n 
1 380 ASP n 
1 381 GLY n 
1 382 ILE n 
1 383 LYS n 
1 384 ASN n 
1 385 LYS n 
1 386 ILE n 
1 387 HIS n 
1 388 PRO n 
1 389 GLY n 
1 390 GLU n 
1 391 PRO n 
1 392 MET n 
1 393 ASP n 
1 394 LYS n 
1 395 ASN n 
1 396 LEU n 
1 397 TYR n 
1 398 ASP n 
1 399 LEU n 
1 400 PRO n 
1 401 PRO n 
1 402 GLU n 
1 403 GLU n 
1 404 ALA n 
1 405 LYS n 
1 406 GLU n 
1 407 ILE n 
1 408 PRO n 
1 409 GLN n 
1 410 VAL n 
1 411 ALA n 
1 412 GLY n 
1 413 SER n 
1 414 LEU n 
1 415 GLU n 
1 416 GLU n 
1 417 ALA n 
1 418 LEU n 
1 419 ASN n 
1 420 ALA n 
1 421 LEU n 
1 422 ASP n 
1 423 LEU n 
1 424 ASP n 
1 425 ARG n 
1 426 GLU n 
1 427 PHE n 
1 428 LEU n 
1 429 LYS n 
1 430 ALA n 
1 431 GLY n 
1 432 GLY n 
1 433 VAL n 
1 434 PHE n 
1 435 THR n 
1 436 ASP n 
1 437 GLU n 
1 438 ALA n 
1 439 ILE n 
1 440 ASP n 
1 441 ALA n 
1 442 TYR n 
1 443 ILE n 
1 444 ALA n 
1 445 LEU n 
1 446 ARG n 
1 447 ARG n 
1 448 GLU n 
1 449 GLU n 
1 450 ASP n 
1 451 ASP n 
1 452 ARG n 
1 453 VAL n 
1 454 ARG n 
1 455 MET n 
1 456 THR n 
1 457 PRO n 
1 458 HIS n 
1 459 PRO n 
1 460 VAL n 
1 461 GLU n 
1 462 PHE n 
1 463 GLU n 
1 464 LEU n 
1 465 TYR n 
1 466 TYR n 
1 467 SER n 
1 468 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Salmonella 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     602 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ?                                                   'C10 H15 N5 O10 P2' 
427.201 
ALA 'L-peptide linking' y ALANINE                    ?                                                   'C3 H7 N O2'        
89.093  
ARG 'L-peptide linking' y ARGININE                   ?                                                   'C6 H15 N4 O2 1'    
175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                                                   'C4 H8 N2 O3'       
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                                                   'C4 H7 N O4'        
133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                                                   'C3 H7 N O2 S'      
121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ?                                                   'C5 H10 N2 O3'      
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                                                   'C5 H9 N O4'        
147.129 
GLY 'peptide linking'   y GLYCINE                    ?                                                   'C2 H5 N O2'        
75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                                                   'C6 H10 N3 O2 1'    
156.162 
HOH non-polymer         . WATER                      ?                                                   'H2 O'              
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                                                   'C6 H13 N O2'       
131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                                                   'C6 H13 N O2'       
131.173 
LYS 'L-peptide linking' y LYSINE                     ?                                                   'C6 H15 N2 O2 1'    
147.195 
MET 'L-peptide linking' y METHIONINE                 ?                                                   'C5 H11 N O2 S'     
149.211 
MN  non-polymer         . 'MANGANESE (II) ION'       ?                                                   'Mn 2'              
54.938  
PHE 'L-peptide linking' y PHENYLALANINE              ?                                                   'C9 H11 N O2'       
165.189 
PPQ non-polymer         . PHOSPHINOTHRICIN           '2-AMINO-4-(HYDROXYMETHYL-PHOSPHINYL)BUTANOIC ACID' 'C5 H12 N O4 P'     
181.127 
PRO 'L-peptide linking' y PROLINE                    ?                                                   'C5 H9 N O2'        
115.130 
SER 'L-peptide linking' y SERINE                     ?                                                   'C3 H7 N O3'        
105.093 
THR 'L-peptide linking' y THREONINE                  ?                                                   'C4 H9 N O3'        
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                                                   'C11 H12 N2 O2'     
204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                                                   'C9 H11 N O3'       
181.189 
VAL 'L-peptide linking' y VALINE                     ?                                                   'C5 H11 N O2'       
117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   ALA 2   2   2   ALA ALA A . n 
A 1 3   GLU 3   3   3   GLU GLU A . n 
A 1 4   HIS 4   4   4   HIS HIS A . n 
A 1 5   VAL 5   5   5   VAL VAL A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   MET 8   8   8   MET MET A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  ASN 10  10  10  ASN ASN A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  HIS 12  12  12  HIS HIS A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  LYS 15  15  15  LYS LYS A . n 
A 1 16  PHE 16  16  16  PHE PHE A . n 
A 1 17  VAL 17  17  17  VAL VAL A . n 
A 1 18  ASP 18  18  18  ASP ASP A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  LYS 25  25  25  LYS LYS A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  HIS 30  30  30  HIS HIS A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  HIS 36  36  36  HIS HIS A . n 
A 1 37  GLN 37  37  37  GLN GLN A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  ALA 40  40  40  ALA ALA A . n 
A 1 41  GLU 41  41  41  GLU GLU A . n 
A 1 42  PHE 42  42  42  PHE PHE A . n 
A 1 43  PHE 43  43  43  PHE PHE A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  MET 48  48  48  MET MET A . n 
A 1 49  PHE 49  49  49  PHE PHE A . n 
A 1 50  ASP 50  50  50  ASP ASP A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  SER 52  52  52  SER SER A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ILE 54  54  54  ILE ILE A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  TRP 57  57  57  TRP TRP A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  MET 65  65  65  MET MET A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  MET 68  68  68  MET MET A . n 
A 1 69  PRO 69  69  69  PRO PRO A . n 
A 1 70  ASP 70  70  70  ASP ASP A . n 
A 1 71  ALA 71  71  71  ALA ALA A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  VAL 75  75  75  VAL VAL A . n 
A 1 76  ILE 76  76  76  ILE ILE A . n 
A 1 77  ASP 77  77  77  ASP ASP A . n 
A 1 78  PRO 78  78  78  PRO PRO A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PHE 80  80  80  PHE PHE A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  ILE 86  86  86  ILE ILE A . n 
A 1 87  ILE 87  87  87  ILE ILE A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  CYS 89  89  89  CYS CYS A . n 
A 1 90  ASP 90  90  90  ASP ASP A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  GLY 95  95  95  GLY GLY A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLN 98  98  98  GLN GLN A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 ARG 102 102 102 ARG ARG A . n 
A 1 103 ASP 103 103 103 ASP ASP A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 SER 106 106 106 SER SER A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 ARG 110 110 110 ARG ARG A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 GLU 112 112 112 GLU GLU A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 LEU 115 115 115 LEU LEU A . n 
A 1 116 ARG 116 116 116 ARG ARG A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 THR 118 118 118 THR THR A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 ILE 120 120 120 ILE ILE A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 GLY 127 127 127 GLY GLY A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 GLU 129 129 129 GLU GLU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 PHE 133 133 133 PHE PHE A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 PHE 135 135 135 PHE PHE A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ASP 137 137 137 ASP ASP A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 ARG 139 139 139 ARG ARG A . n 
A 1 140 PHE 140 140 140 PHE PHE A . n 
A 1 141 GLY 141 141 141 GLY GLY A . n 
A 1 142 ALA 142 142 142 ALA ALA A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 HIS 148 148 148 HIS HIS A . n 
A 1 149 VAL 149 149 149 VAL VAL A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 ASP 152 152 152 ASP ASP A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 GLY 156 156 156 GLY GLY A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 TRP 158 158 158 TRP TRP A . n 
A 1 159 ASN 159 159 159 ASN ASN A . n 
A 1 160 SER 160 160 160 SER SER A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 THR 162 162 162 THR THR A . n 
A 1 163 LYS 163 163 163 LYS LYS A . n 
A 1 164 TYR 164 164 164 TYR TYR A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 ASN 168 168 168 ASN ASN A . n 
A 1 169 LYS 169 169 169 LYS LYS A . n 
A 1 170 GLY 170 170 170 GLY GLY A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 PRO 173 173 173 PRO PRO A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 LYS 176 176 176 LYS LYS A . n 
A 1 177 GLY 177 177 177 GLY GLY A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 TYR 179 179 179 TYR TYR A . n 
A 1 180 PHE 180 180 180 PHE PHE A . n 
A 1 181 PRO 181 181 181 PRO PRO A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 PRO 183 183 183 PRO PRO A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 ASP 186 186 186 ASP ASP A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 ALA 188 188 188 ALA ALA A . n 
A 1 189 GLN 189 189 189 GLN GLN A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ARG 192 192 192 ARG ARG A . n 
A 1 193 SER 193 193 193 SER SER A . n 
A 1 194 GLU 194 194 194 GLU GLU A . n 
A 1 195 MET 195 195 195 MET MET A . n 
A 1 196 CYS 196 196 196 CYS CYS A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 VAL 198 198 198 VAL VAL A . n 
A 1 199 MET 199 199 199 MET MET A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 GLN 201 201 201 GLN GLN A . n 
A 1 202 MET 202 202 202 MET MET A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 ALA 208 208 208 ALA ALA A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 HIS 210 210 210 HIS HIS A . n 
A 1 211 HIS 211 211 211 HIS HIS A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 ALA 214 214 214 ALA ALA A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 GLN 218 218 218 GLN GLN A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 GLU 220 220 220 GLU GLU A . n 
A 1 221 VAL 221 221 221 VAL VAL A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 THR 223 223 223 THR THR A . n 
A 1 224 ARG 224 224 224 ARG ARG A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 MET 228 228 228 MET MET A . n 
A 1 229 THR 229 229 229 THR THR A . n 
A 1 230 LYS 230 230 230 LYS LYS A . n 
A 1 231 LYS 231 231 231 LYS LYS A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 ASP 233 233 233 ASP ASP A . n 
A 1 234 GLU 234 234 234 GLU GLU A . n 
A 1 235 ILE 235 235 235 ILE ILE A . n 
A 1 236 GLN 236 236 236 GLN GLN A . n 
A 1 237 ILE 237 237 237 ILE ILE A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 VAL 241 241 241 VAL VAL A . n 
A 1 242 VAL 242 242 242 VAL VAL A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 ASN 244 244 244 ASN ASN A . n 
A 1 245 VAL 245 245 245 VAL VAL A . n 
A 1 246 ALA 246 246 246 ALA ALA A . n 
A 1 247 HIS 247 247 247 HIS HIS A . n 
A 1 248 ARG 248 248 248 ARG ARG A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 THR 252 252 252 THR THR A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 PHE 255 255 255 PHE PHE A . n 
A 1 256 MET 256 256 256 MET MET A . n 
A 1 257 PRO 257 257 257 PRO PRO A . n 
A 1 258 LYS 258 258 258 LYS LYS A . n 
A 1 259 PRO 259 259 259 PRO PRO A . n 
A 1 260 MET 260 260 260 MET MET A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 ASN 264 264 264 ASN ASN A . n 
A 1 265 GLY 265 265 265 GLY GLY A . n 
A 1 266 SER 266 266 266 SER SER A . n 
A 1 267 GLY 267 267 267 GLY GLY A . n 
A 1 268 MET 268 268 268 MET MET A . n 
A 1 269 HIS 269 269 269 HIS HIS A . n 
A 1 270 CYS 270 270 270 CYS CYS A . n 
A 1 271 HIS 271 271 271 HIS HIS A . n 
A 1 272 MET 272 272 272 MET MET A . n 
A 1 273 SER 273 273 273 SER SER A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ALA 275 275 275 ALA ALA A . n 
A 1 276 LYS 276 276 276 LYS LYS A . n 
A 1 277 ASN 277 277 277 ASN ASN A . n 
A 1 278 GLY 278 278 278 GLY GLY A . n 
A 1 279 THR 279 279 279 THR THR A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 PHE 282 282 282 PHE PHE A . n 
A 1 283 SER 283 283 283 SER SER A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 LYS 286 286 286 LYS LYS A . n 
A 1 287 TYR 287 287 287 TYR TYR A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 GLY 289 289 289 GLY GLY A . n 
A 1 290 LEU 290 290 290 LEU LEU A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 GLU 292 292 292 GLU GLU A . n 
A 1 293 GLN 293 293 293 GLN GLN A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 TYR 296 296 296 TYR TYR A . n 
A 1 297 TYR 297 297 297 TYR TYR A . n 
A 1 298 ILE 298 298 298 ILE ILE A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ILE 302 302 302 ILE ILE A . n 
A 1 303 LYS 303 303 303 LYS LYS A . n 
A 1 304 HIS 304 304 304 HIS HIS A . n 
A 1 305 ALA 305 305 305 ALA ALA A . n 
A 1 306 LYS 306 306 306 LYS LYS A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 ALA 310 310 310 ALA ALA A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ALA 312 312 312 ALA ALA A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 THR 315 315 315 THR THR A . n 
A 1 316 THR 316 316 316 THR THR A . n 
A 1 317 ASN 317 317 317 ASN ASN A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 LYS 320 320 320 LYS LYS A . n 
A 1 321 ARG 321 321 321 ARG ARG A . n 
A 1 322 LEU 322 322 322 LEU LEU A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 PRO 324 324 324 PRO PRO A . n 
A 1 325 GLY 325 325 325 GLY GLY A . n 
A 1 326 TYR 326 326 326 TYR TYR A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 ALA 328 328 328 ALA ALA A . n 
A 1 329 PRO 329 329 329 PRO PRO A . n 
A 1 330 VAL 330 330 330 VAL VAL A . n 
A 1 331 MET 331 331 331 MET MET A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 SER 335 335 335 SER SER A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 ARG 337 337 337 ARG ARG A . n 
A 1 338 ASN 338 338 338 ASN ASN A . n 
A 1 339 ARG 339 339 339 ARG ARG A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 ALA 341 341 341 ALA ALA A . n 
A 1 342 SER 342 342 342 SER SER A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 ARG 344 344 344 ARG ARG A . n 
A 1 345 ILE 345 345 345 ILE ILE A . n 
A 1 346 PRO 346 346 346 PRO PRO A . n 
A 1 347 VAL 347 347 347 VAL VAL A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 ALA 349 349 349 ALA ALA A . n 
A 1 350 SER 350 350 350 SER SER A . n 
A 1 351 PRO 351 351 351 PRO PRO A . n 
A 1 352 LYS 352 352 352 LYS LYS A . n 
A 1 353 ALA 353 353 353 ALA ALA A . n 
A 1 354 ARG 354 354 354 ARG ARG A . n 
A 1 355 ARG 355 355 355 ARG ARG A . n 
A 1 356 ILE 356 356 356 ILE ILE A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 VAL 358 358 358 VAL VAL A . n 
A 1 359 ARG 359 359 359 ARG ARG A . n 
A 1 360 PHE 360 360 360 PHE PHE A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 ASP 362 362 362 ASP ASP A . n 
A 1 363 PRO 363 363 363 PRO PRO A . n 
A 1 364 ALA 364 364 364 ALA ALA A . n 
A 1 365 ALA 365 365 365 ALA ALA A . n 
A 1 366 ASN 366 366 366 ASN ASN A . n 
A 1 367 PRO 367 367 367 PRO PRO A . n 
A 1 368 TYR 368 368 368 TYR TYR A . n 
A 1 369 LEU 369 369 369 LEU LEU A . n 
A 1 370 CYS 370 370 370 CYS CYS A . n 
A 1 371 PHE 371 371 371 PHE PHE A . n 
A 1 372 ALA 372 372 372 ALA ALA A . n 
A 1 373 ALA 373 373 373 ALA ALA A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 LEU 375 375 375 LEU LEU A . n 
A 1 376 MET 376 376 376 MET MET A . n 
A 1 377 ALA 377 377 377 ALA ALA A . n 
A 1 378 GLY 378 378 378 GLY GLY A . n 
A 1 379 LEU 379 379 379 LEU LEU A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 ILE 382 382 382 ILE ILE A . n 
A 1 383 LYS 383 383 383 LYS LYS A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 LYS 385 385 385 LYS LYS A . n 
A 1 386 ILE 386 386 386 ILE ILE A . n 
A 1 387 HIS 387 387 387 HIS HIS A . n 
A 1 388 PRO 388 388 388 PRO PRO A . n 
A 1 389 GLY 389 389 389 GLY GLY A . n 
A 1 390 GLU 390 390 390 GLU GLU A . n 
A 1 391 PRO 391 391 391 PRO PRO A . n 
A 1 392 MET 392 392 392 MET MET A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 LYS 394 394 394 LYS LYS A . n 
A 1 395 ASN 395 395 395 ASN ASN A . n 
A 1 396 LEU 396 396 396 LEU LEU A . n 
A 1 397 TYR 397 397 397 TYR TYR A . n 
A 1 398 ASP 398 398 398 ASP ASP A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 PRO 400 400 400 PRO PRO A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 GLU 403 403 403 GLU GLU A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 GLU 406 406 406 GLU GLU A . n 
A 1 407 ILE 407 407 407 ILE ILE A . n 
A 1 408 PRO 408 408 408 PRO PRO A . n 
A 1 409 GLN 409 409 409 GLN GLN A . n 
A 1 410 VAL 410 410 410 VAL VAL A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 GLY 412 412 412 GLY GLY A . n 
A 1 413 SER 413 413 413 SER SER A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 GLU 415 415 415 GLU GLU A . n 
A 1 416 GLU 416 416 416 GLU GLU A . n 
A 1 417 ALA 417 417 417 ALA ALA A . n 
A 1 418 LEU 418 418 418 LEU LEU A . n 
A 1 419 ASN 419 419 419 ASN ASN A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 LEU 421 421 421 LEU LEU A . n 
A 1 422 ASP 422 422 422 ASP ASP A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 ASP 424 424 424 ASP ASP A . n 
A 1 425 ARG 425 425 425 ARG ARG A . n 
A 1 426 GLU 426 426 426 GLU GLU A . n 
A 1 427 PHE 427 427 427 PHE PHE A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 ALA 430 430 430 ALA ALA A . n 
A 1 431 GLY 431 431 431 GLY GLY A . n 
A 1 432 GLY 432 432 432 GLY GLY A . n 
A 1 433 VAL 433 433 433 VAL VAL A . n 
A 1 434 PHE 434 434 434 PHE PHE A . n 
A 1 435 THR 435 435 435 THR THR A . n 
A 1 436 ASP 436 436 436 ASP ASP A . n 
A 1 437 GLU 437 437 437 GLU GLU A . n 
A 1 438 ALA 438 438 438 ALA ALA A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 ASP 440 440 440 ASP ASP A . n 
A 1 441 ALA 441 441 441 ALA ALA A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 ILE 443 443 443 ILE ILE A . n 
A 1 444 ALA 444 444 444 ALA ALA A . n 
A 1 445 LEU 445 445 445 LEU LEU A . n 
A 1 446 ARG 446 446 446 ARG ARG A . n 
A 1 447 ARG 447 447 447 ARG ARG A . n 
A 1 448 GLU 448 448 448 GLU GLU A . n 
A 1 449 GLU 449 449 449 GLU GLU A . n 
A 1 450 ASP 450 450 450 ASP ASP A . n 
A 1 451 ASP 451 451 451 ASP ASP A . n 
A 1 452 ARG 452 452 452 ARG ARG A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 ARG 454 454 454 ARG ARG A . n 
A 1 455 MET 455 455 455 MET MET A . n 
A 1 456 THR 456 456 456 THR THR A . n 
A 1 457 PRO 457 457 457 PRO PRO A . n 
A 1 458 HIS 458 458 458 HIS HIS A . n 
A 1 459 PRO 459 459 459 PRO PRO A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 PHE 462 462 462 PHE PHE A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 LEU 464 464 464 LEU LEU A . n 
A 1 465 TYR 465 465 465 TYR TYR A . n 
A 1 466 TYR 466 466 466 TYR TYR A . n 
A 1 467 SER 467 467 467 SER SER A . n 
A 1 468 VAL 468 468 468 VAL VAL A . n 
B 1 1   SER 1   1   1   SER SER B . n 
B 1 2   ALA 2   2   2   ALA ALA B . n 
B 1 3   GLU 3   3   3   GLU GLU B . n 
B 1 4   HIS 4   4   4   HIS HIS B . n 
B 1 5   VAL 5   5   5   VAL VAL B . n 
B 1 6   LEU 6   6   6   LEU LEU B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   MET 8   8   8   MET MET B . n 
B 1 9   LEU 9   9   9   LEU LEU B . n 
B 1 10  ASN 10  10  10  ASN ASN B . n 
B 1 11  GLU 11  11  11  GLU GLU B . n 
B 1 12  HIS 12  12  12  HIS HIS B . n 
B 1 13  GLU 13  13  13  GLU GLU B . n 
B 1 14  VAL 14  14  14  VAL VAL B . n 
B 1 15  LYS 15  15  15  LYS LYS B . n 
B 1 16  PHE 16  16  16  PHE PHE B . n 
B 1 17  VAL 17  17  17  VAL VAL B . n 
B 1 18  ASP 18  18  18  ASP ASP B . n 
B 1 19  LEU 19  19  19  LEU LEU B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  PHE 21  21  21  PHE PHE B . n 
B 1 22  THR 22  22  22  THR THR B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  LYS 25  25  25  LYS LYS B . n 
B 1 26  GLY 26  26  26  GLY GLY B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  HIS 30  30  30  HIS HIS B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  THR 32  32  32  THR THR B . n 
B 1 33  ILE 33  33  33  ILE ILE B . n 
B 1 34  PRO 34  34  34  PRO PRO B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  HIS 36  36  36  HIS HIS B . n 
B 1 37  GLN 37  37  37  GLN GLN B . n 
B 1 38  VAL 38  38  38  VAL VAL B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  ALA 40  40  40  ALA ALA B . n 
B 1 41  GLU 41  41  41  GLU GLU B . n 
B 1 42  PHE 42  42  42  PHE PHE B . n 
B 1 43  PHE 43  43  43  PHE PHE B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  GLU 45  45  45  GLU GLU B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  MET 48  48  48  MET MET B . n 
B 1 49  PHE 49  49  49  PHE PHE B . n 
B 1 50  ASP 50  50  50  ASP ASP B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  SER 52  52  52  SER SER B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ILE 54  54  54  ILE ILE B . n 
B 1 55  GLY 55  55  55  GLY GLY B . n 
B 1 56  GLY 56  56  56  GLY GLY B . n 
B 1 57  TRP 57  57  57  TRP TRP B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  GLY 59  59  59  GLY GLY B . n 
B 1 60  ILE 60  60  60  ILE ILE B . n 
B 1 61  ASN 61  61  61  ASN ASN B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  MET 65  65  65  MET MET B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  MET 68  68  68  MET MET B . n 
B 1 69  PRO 69  69  69  PRO PRO B . n 
B 1 70  ASP 70  70  70  ASP ASP B . n 
B 1 71  ALA 71  71  71  ALA ALA B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  THR 73  73  73  THR THR B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  VAL 75  75  75  VAL VAL B . n 
B 1 76  ILE 76  76  76  ILE ILE B . n 
B 1 77  ASP 77  77  77  ASP ASP B . n 
B 1 78  PRO 78  78  78  PRO PRO B . n 
B 1 79  PHE 79  79  79  PHE PHE B . n 
B 1 80  PHE 80  80  80  PHE PHE B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  ASP 82  82  82  ASP ASP B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  LEU 85  85  85  LEU LEU B . n 
B 1 86  ILE 86  86  86  ILE ILE B . n 
B 1 87  ILE 87  87  87  ILE ILE B . n 
B 1 88  ARG 88  88  88  ARG ARG B . n 
B 1 89  CYS 89  89  89  CYS CYS B . n 
B 1 90  ASP 90  90  90  ASP ASP B . n 
B 1 91  ILE 91  91  91  ILE ILE B . n 
B 1 92  LEU 92  92  92  LEU LEU B . n 
B 1 93  GLU 93  93  93  GLU GLU B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  GLY 95  95  95  GLY GLY B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  GLN 98  98  98  GLN GLN B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 ARG 102 102 102 ARG ARG B . n 
B 1 103 ASP 103 103 103 ASP ASP B . n 
B 1 104 PRO 104 104 104 PRO PRO B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 SER 106 106 106 SER SER B . n 
B 1 107 ILE 107 107 107 ILE ILE B . n 
B 1 108 ALA 108 108 108 ALA ALA B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 ARG 110 110 110 ARG ARG B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 GLU 112 112 112 GLU GLU B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 LEU 115 115 115 LEU LEU B . n 
B 1 116 ARG 116 116 116 ARG ARG B . n 
B 1 117 ALA 117 117 117 ALA ALA B . n 
B 1 118 THR 118 118 118 THR THR B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 ILE 120 120 120 ILE ILE B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 THR 123 123 123 THR THR B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 PHE 126 126 126 PHE PHE B . n 
B 1 127 GLY 127 127 127 GLY GLY B . n 
B 1 128 PRO 128 128 128 PRO PRO B . n 
B 1 129 GLU 129 129 129 GLU GLU B . n 
B 1 130 PRO 130 130 130 PRO PRO B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 PHE 133 133 133 PHE PHE B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 PHE 135 135 135 PHE PHE B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 ASP 137 137 137 ASP ASP B . n 
B 1 138 ILE 138 138 138 ILE ILE B . n 
B 1 139 ARG 139 139 139 ARG ARG B . n 
B 1 140 PHE 140 140 140 PHE PHE B . n 
B 1 141 GLY 141 141 141 GLY GLY B . n 
B 1 142 ALA 142 142 142 ALA ALA B . n 
B 1 143 SER 143 143 143 SER SER B . n 
B 1 144 ILE 144 144 144 ILE ILE B . n 
B 1 145 SER 145 145 145 SER SER B . n 
B 1 146 GLY 146 146 146 GLY GLY B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 HIS 148 148 148 HIS HIS B . n 
B 1 149 VAL 149 149 149 VAL VAL B . n 
B 1 150 ALA 150 150 150 ALA ALA B . n 
B 1 151 ILE 151 151 151 ILE ILE B . n 
B 1 152 ASP 152 152 152 ASP ASP B . n 
B 1 153 ASP 153 153 153 ASP ASP B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 GLY 156 156 156 GLY GLY B . n 
B 1 157 ALA 157 157 157 ALA ALA B . n 
B 1 158 TRP 158 158 158 TRP TRP B . n 
B 1 159 ASN 159 159 159 ASN ASN B . n 
B 1 160 SER 160 160 160 SER SER B . n 
B 1 161 SER 161 161 161 SER SER B . n 
B 1 162 THR 162 162 162 THR THR B . n 
B 1 163 LYS 163 163 163 LYS LYS B . n 
B 1 164 TYR 164 164 164 TYR TYR B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 GLY 166 166 166 GLY GLY B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 ASN 168 168 168 ASN ASN B . n 
B 1 169 LYS 169 169 169 LYS LYS B . n 
B 1 170 GLY 170 170 170 GLY GLY B . n 
B 1 171 HIS 171 171 171 HIS HIS B . n 
B 1 172 ARG 172 172 172 ARG ARG B . n 
B 1 173 PRO 173 173 173 PRO PRO B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 LYS 176 176 176 LYS LYS B . n 
B 1 177 GLY 177 177 177 GLY GLY B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 TYR 179 179 179 TYR TYR B . n 
B 1 180 PHE 180 180 180 PHE PHE B . n 
B 1 181 PRO 181 181 181 PRO PRO B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 PRO 183 183 183 PRO PRO B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 ASP 186 186 186 ASP ASP B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 ALA 188 188 188 ALA ALA B . n 
B 1 189 GLN 189 189 189 GLN GLN B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 ILE 191 191 191 ILE ILE B . n 
B 1 192 ARG 192 192 192 ARG ARG B . n 
B 1 193 SER 193 193 193 SER SER B . n 
B 1 194 GLU 194 194 194 GLU GLU B . n 
B 1 195 MET 195 195 195 MET MET B . n 
B 1 196 CYS 196 196 196 CYS CYS B . n 
B 1 197 LEU 197 197 197 LEU LEU B . n 
B 1 198 VAL 198 198 198 VAL VAL B . n 
B 1 199 MET 199 199 199 MET MET B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 GLN 201 201 201 GLN GLN B . n 
B 1 202 MET 202 202 202 MET MET B . n 
B 1 203 GLY 203 203 203 GLY GLY B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 VAL 205 205 205 VAL VAL B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 GLU 207 207 207 GLU GLU B . n 
B 1 208 ALA 208 208 208 ALA ALA B . n 
B 1 209 HIS 209 209 209 HIS HIS B . n 
B 1 210 HIS 210 210 210 HIS HIS B . n 
B 1 211 HIS 211 211 211 HIS HIS B . n 
B 1 212 GLU 212 212 212 GLU GLU B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 ALA 214 214 214 ALA ALA B . n 
B 1 215 THR 215 215 215 THR THR B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 GLN 218 218 218 GLN GLN B . n 
B 1 219 ASN 219 219 219 ASN ASN B . n 
B 1 220 GLU 220 220 220 GLU GLU B . n 
B 1 221 VAL 221 221 221 VAL VAL B . n 
B 1 222 ALA 222 222 222 ALA ALA B . n 
B 1 223 THR 223 223 223 THR THR B . n 
B 1 224 ARG 224 224 224 ARG ARG B . n 
B 1 225 PHE 225 225 225 PHE PHE B . n 
B 1 226 ASN 226 226 226 ASN ASN B . n 
B 1 227 THR 227 227 227 THR THR B . n 
B 1 228 MET 228 228 228 MET MET B . n 
B 1 229 THR 229 229 229 THR THR B . n 
B 1 230 LYS 230 230 230 LYS LYS B . n 
B 1 231 LYS 231 231 231 LYS LYS B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 ASP 233 233 233 ASP ASP B . n 
B 1 234 GLU 234 234 234 GLU GLU B . n 
B 1 235 ILE 235 235 235 ILE ILE B . n 
B 1 236 GLN 236 236 236 GLN GLN B . n 
B 1 237 ILE 237 237 237 ILE ILE B . n 
B 1 238 TYR 238 238 238 TYR TYR B . n 
B 1 239 LYS 239 239 239 LYS LYS B . n 
B 1 240 TYR 240 240 240 TYR TYR B . n 
B 1 241 VAL 241 241 241 VAL VAL B . n 
B 1 242 VAL 242 242 242 VAL VAL B . n 
B 1 243 HIS 243 243 243 HIS HIS B . n 
B 1 244 ASN 244 244 244 ASN ASN B . n 
B 1 245 VAL 245 245 245 VAL VAL B . n 
B 1 246 ALA 246 246 246 ALA ALA B . n 
B 1 247 HIS 247 247 247 HIS HIS B . n 
B 1 248 ARG 248 248 248 ARG ARG B . n 
B 1 249 PHE 249 249 249 PHE PHE B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 LYS 251 251 251 LYS LYS B . n 
B 1 252 THR 252 252 252 THR THR B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 THR 254 254 254 THR THR B . n 
B 1 255 PHE 255 255 255 PHE PHE B . n 
B 1 256 MET 256 256 256 MET MET B . n 
B 1 257 PRO 257 257 257 PRO PRO B . n 
B 1 258 LYS 258 258 258 LYS LYS B . n 
B 1 259 PRO 259 259 259 PRO PRO B . n 
B 1 260 MET 260 260 260 MET MET B . n 
B 1 261 PHE 261 261 261 PHE PHE B . n 
B 1 262 GLY 262 262 262 GLY GLY B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 ASN 264 264 264 ASN ASN B . n 
B 1 265 GLY 265 265 265 GLY GLY B . n 
B 1 266 SER 266 266 266 SER SER B . n 
B 1 267 GLY 267 267 267 GLY GLY B . n 
B 1 268 MET 268 268 268 MET MET B . n 
B 1 269 HIS 269 269 269 HIS HIS B . n 
B 1 270 CYS 270 270 270 CYS CYS B . n 
B 1 271 HIS 271 271 271 HIS HIS B . n 
B 1 272 MET 272 272 272 MET MET B . n 
B 1 273 SER 273 273 273 SER SER B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 ALA 275 275 275 ALA ALA B . n 
B 1 276 LYS 276 276 276 LYS LYS B . n 
B 1 277 ASN 277 277 277 ASN ASN B . n 
B 1 278 GLY 278 278 278 GLY GLY B . n 
B 1 279 THR 279 279 279 THR THR B . n 
B 1 280 ASN 280 280 280 ASN ASN B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 PHE 282 282 282 PHE PHE B . n 
B 1 283 SER 283 283 283 SER SER B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 ASP 285 285 285 ASP ASP B . n 
B 1 286 LYS 286 286 286 LYS LYS B . n 
B 1 287 TYR 287 287 287 TYR TYR B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 GLY 289 289 289 GLY GLY B . n 
B 1 290 LEU 290 290 290 LEU LEU B . n 
B 1 291 SER 291 291 291 SER SER B . n 
B 1 292 GLU 292 292 292 GLU GLU B . n 
B 1 293 GLN 293 293 293 GLN GLN B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 TYR 296 296 296 TYR TYR B . n 
B 1 297 TYR 297 297 297 TYR TYR B . n 
B 1 298 ILE 298 298 298 ILE ILE B . n 
B 1 299 GLY 299 299 299 GLY GLY B . n 
B 1 300 GLY 300 300 300 GLY GLY B . n 
B 1 301 VAL 301 301 301 VAL VAL B . n 
B 1 302 ILE 302 302 302 ILE ILE B . n 
B 1 303 LYS 303 303 303 LYS LYS B . n 
B 1 304 HIS 304 304 304 HIS HIS B . n 
B 1 305 ALA 305 305 305 ALA ALA B . n 
B 1 306 LYS 306 306 306 LYS LYS B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ILE 308 308 308 ILE ILE B . n 
B 1 309 ASN 309 309 309 ASN ASN B . n 
B 1 310 ALA 310 310 310 ALA ALA B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 ALA 312 312 312 ALA ALA B . n 
B 1 313 ASN 313 313 313 ASN ASN B . n 
B 1 314 PRO 314 314 314 PRO PRO B . n 
B 1 315 THR 315 315 315 THR THR B . n 
B 1 316 THR 316 316 316 THR THR B . n 
B 1 317 ASN 317 317 317 ASN ASN B . n 
B 1 318 SER 318 318 318 SER SER B . n 
B 1 319 TYR 319 319 319 TYR TYR B . n 
B 1 320 LYS 320 320 320 LYS LYS B . n 
B 1 321 ARG 321 321 321 ARG ARG B . n 
B 1 322 LEU 322 322 322 LEU LEU B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 PRO 324 324 324 PRO PRO B . n 
B 1 325 GLY 325 325 325 GLY GLY B . n 
B 1 326 TYR 326 326 326 TYR TYR B . n 
B 1 327 GLU 327 327 327 GLU GLU B . n 
B 1 328 ALA 328 328 328 ALA ALA B . n 
B 1 329 PRO 329 329 329 PRO PRO B . n 
B 1 330 VAL 330 330 330 VAL VAL B . n 
B 1 331 MET 331 331 331 MET MET B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 ALA 333 333 333 ALA ALA B . n 
B 1 334 TYR 334 334 334 TYR TYR B . n 
B 1 335 SER 335 335 335 SER SER B . n 
B 1 336 ALA 336 336 336 ALA ALA B . n 
B 1 337 ARG 337 337 337 ARG ARG B . n 
B 1 338 ASN 338 338 338 ASN ASN B . n 
B 1 339 ARG 339 339 339 ARG ARG B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 ALA 341 341 341 ALA ALA B . n 
B 1 342 SER 342 342 342 SER SER B . n 
B 1 343 ILE 343 343 343 ILE ILE B . n 
B 1 344 ARG 344 344 344 ARG ARG B . n 
B 1 345 ILE 345 345 345 ILE ILE B . n 
B 1 346 PRO 346 346 346 PRO PRO B . n 
B 1 347 VAL 347 347 347 VAL VAL B . n 
B 1 348 VAL 348 348 348 VAL VAL B . n 
B 1 349 ALA 349 349 349 ALA ALA B . n 
B 1 350 SER 350 350 350 SER SER B . n 
B 1 351 PRO 351 351 351 PRO PRO B . n 
B 1 352 LYS 352 352 352 LYS LYS B . n 
B 1 353 ALA 353 353 353 ALA ALA B . n 
B 1 354 ARG 354 354 354 ARG ARG B . n 
B 1 355 ARG 355 355 355 ARG ARG B . n 
B 1 356 ILE 356 356 356 ILE ILE B . n 
B 1 357 GLU 357 357 357 GLU GLU B . n 
B 1 358 VAL 358 358 358 VAL VAL B . n 
B 1 359 ARG 359 359 359 ARG ARG B . n 
B 1 360 PHE 360 360 360 PHE PHE B . n 
B 1 361 PRO 361 361 361 PRO PRO B . n 
B 1 362 ASP 362 362 362 ASP ASP B . n 
B 1 363 PRO 363 363 363 PRO PRO B . n 
B 1 364 ALA 364 364 364 ALA ALA B . n 
B 1 365 ALA 365 365 365 ALA ALA B . n 
B 1 366 ASN 366 366 366 ASN ASN B . n 
B 1 367 PRO 367 367 367 PRO PRO B . n 
B 1 368 TYR 368 368 368 TYR TYR B . n 
B 1 369 LEU 369 369 369 LEU LEU B . n 
B 1 370 CYS 370 370 370 CYS CYS B . n 
B 1 371 PHE 371 371 371 PHE PHE B . n 
B 1 372 ALA 372 372 372 ALA ALA B . n 
B 1 373 ALA 373 373 373 ALA ALA B . n 
B 1 374 LEU 374 374 374 LEU LEU B . n 
B 1 375 LEU 375 375 375 LEU LEU B . n 
B 1 376 MET 376 376 376 MET MET B . n 
B 1 377 ALA 377 377 377 ALA ALA B . n 
B 1 378 GLY 378 378 378 GLY GLY B . n 
B 1 379 LEU 379 379 379 LEU LEU B . n 
B 1 380 ASP 380 380 380 ASP ASP B . n 
B 1 381 GLY 381 381 381 GLY GLY B . n 
B 1 382 ILE 382 382 382 ILE ILE B . n 
B 1 383 LYS 383 383 383 LYS LYS B . n 
B 1 384 ASN 384 384 384 ASN ASN B . n 
B 1 385 LYS 385 385 385 LYS LYS B . n 
B 1 386 ILE 386 386 386 ILE ILE B . n 
B 1 387 HIS 387 387 387 HIS HIS B . n 
B 1 388 PRO 388 388 388 PRO PRO B . n 
B 1 389 GLY 389 389 389 GLY GLY B . n 
B 1 390 GLU 390 390 390 GLU GLU B . n 
B 1 391 PRO 391 391 391 PRO PRO B . n 
B 1 392 MET 392 392 392 MET MET B . n 
B 1 393 ASP 393 393 393 ASP ASP B . n 
B 1 394 LYS 394 394 394 LYS LYS B . n 
B 1 395 ASN 395 395 395 ASN ASN B . n 
B 1 396 LEU 396 396 396 LEU LEU B . n 
B 1 397 TYR 397 397 397 TYR TYR B . n 
B 1 398 ASP 398 398 398 ASP ASP B . n 
B 1 399 LEU 399 399 399 LEU LEU B . n 
B 1 400 PRO 400 400 400 PRO PRO B . n 
B 1 401 PRO 401 401 401 PRO PRO B . n 
B 1 402 GLU 402 402 402 GLU GLU B . n 
B 1 403 GLU 403 403 403 GLU GLU B . n 
B 1 404 ALA 404 404 404 ALA ALA B . n 
B 1 405 LYS 405 405 405 LYS LYS B . n 
B 1 406 GLU 406 406 406 GLU GLU B . n 
B 1 407 ILE 407 407 407 ILE ILE B . n 
B 1 408 PRO 408 408 408 PRO PRO B . n 
B 1 409 GLN 409 409 409 GLN GLN B . n 
B 1 410 VAL 410 410 410 VAL VAL B . n 
B 1 411 ALA 411 411 411 ALA ALA B . n 
B 1 412 GLY 412 412 412 GLY GLY B . n 
B 1 413 SER 413 413 413 SER SER B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 GLU 415 415 415 GLU GLU B . n 
B 1 416 GLU 416 416 416 GLU GLU B . n 
B 1 417 ALA 417 417 417 ALA ALA B . n 
B 1 418 LEU 418 418 418 LEU LEU B . n 
B 1 419 ASN 419 419 419 ASN ASN B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 LEU 421 421 421 LEU LEU B . n 
B 1 422 ASP 422 422 422 ASP ASP B . n 
B 1 423 LEU 423 423 423 LEU LEU B . n 
B 1 424 ASP 424 424 424 ASP ASP B . n 
B 1 425 ARG 425 425 425 ARG ARG B . n 
B 1 426 GLU 426 426 426 GLU GLU B . n 
B 1 427 PHE 427 427 427 PHE PHE B . n 
B 1 428 LEU 428 428 428 LEU LEU B . n 
B 1 429 LYS 429 429 429 LYS LYS B . n 
B 1 430 ALA 430 430 430 ALA ALA B . n 
B 1 431 GLY 431 431 431 GLY GLY B . n 
B 1 432 GLY 432 432 432 GLY GLY B . n 
B 1 433 VAL 433 433 433 VAL VAL B . n 
B 1 434 PHE 434 434 434 PHE PHE B . n 
B 1 435 THR 435 435 435 THR THR B . n 
B 1 436 ASP 436 436 436 ASP ASP B . n 
B 1 437 GLU 437 437 437 GLU GLU B . n 
B 1 438 ALA 438 438 438 ALA ALA B . n 
B 1 439 ILE 439 439 439 ILE ILE B . n 
B 1 440 ASP 440 440 440 ASP ASP B . n 
B 1 441 ALA 441 441 441 ALA ALA B . n 
B 1 442 TYR 442 442 442 TYR TYR B . n 
B 1 443 ILE 443 443 443 ILE ILE B . n 
B 1 444 ALA 444 444 444 ALA ALA B . n 
B 1 445 LEU 445 445 445 LEU LEU B . n 
B 1 446 ARG 446 446 446 ARG ARG B . n 
B 1 447 ARG 447 447 447 ARG ARG B . n 
B 1 448 GLU 448 448 448 GLU GLU B . n 
B 1 449 GLU 449 449 449 GLU GLU B . n 
B 1 450 ASP 450 450 450 ASP ASP B . n 
B 1 451 ASP 451 451 451 ASP ASP B . n 
B 1 452 ARG 452 452 452 ARG ARG B . n 
B 1 453 VAL 453 453 453 VAL VAL B . n 
B 1 454 ARG 454 454 454 ARG ARG B . n 
B 1 455 MET 455 455 455 MET MET B . n 
B 1 456 THR 456 456 456 THR THR B . n 
B 1 457 PRO 457 457 457 PRO PRO B . n 
B 1 458 HIS 458 458 458 HIS HIS B . n 
B 1 459 PRO 459 459 459 PRO PRO B . n 
B 1 460 VAL 460 460 460 VAL VAL B . n 
B 1 461 GLU 461 461 461 GLU GLU B . n 
B 1 462 PHE 462 462 462 PHE PHE B . n 
B 1 463 GLU 463 463 463 GLU GLU B . n 
B 1 464 LEU 464 464 464 LEU LEU B . n 
B 1 465 TYR 465 465 465 TYR TYR B . n 
B 1 466 TYR 466 466 466 TYR TYR B . n 
B 1 467 SER 467 467 467 SER SER B . n 
B 1 468 VAL 468 468 468 VAL VAL B . n 
C 1 1   SER 1   1   1   SER SER C . n 
C 1 2   ALA 2   2   2   ALA ALA C . n 
C 1 3   GLU 3   3   3   GLU GLU C . n 
C 1 4   HIS 4   4   4   HIS HIS C . n 
C 1 5   VAL 5   5   5   VAL VAL C . n 
C 1 6   LEU 6   6   6   LEU LEU C . n 
C 1 7   THR 7   7   7   THR THR C . n 
C 1 8   MET 8   8   8   MET MET C . n 
C 1 9   LEU 9   9   9   LEU LEU C . n 
C 1 10  ASN 10  10  10  ASN ASN C . n 
C 1 11  GLU 11  11  11  GLU GLU C . n 
C 1 12  HIS 12  12  12  HIS HIS C . n 
C 1 13  GLU 13  13  13  GLU GLU C . n 
C 1 14  VAL 14  14  14  VAL VAL C . n 
C 1 15  LYS 15  15  15  LYS LYS C . n 
C 1 16  PHE 16  16  16  PHE PHE C . n 
C 1 17  VAL 17  17  17  VAL VAL C . n 
C 1 18  ASP 18  18  18  ASP ASP C . n 
C 1 19  LEU 19  19  19  LEU LEU C . n 
C 1 20  ARG 20  20  20  ARG ARG C . n 
C 1 21  PHE 21  21  21  PHE PHE C . n 
C 1 22  THR 22  22  22  THR THR C . n 
C 1 23  ASP 23  23  23  ASP ASP C . n 
C 1 24  THR 24  24  24  THR THR C . n 
C 1 25  LYS 25  25  25  LYS LYS C . n 
C 1 26  GLY 26  26  26  GLY GLY C . n 
C 1 27  LYS 27  27  27  LYS LYS C . n 
C 1 28  GLU 28  28  28  GLU GLU C . n 
C 1 29  GLN 29  29  29  GLN GLN C . n 
C 1 30  HIS 30  30  30  HIS HIS C . n 
C 1 31  VAL 31  31  31  VAL VAL C . n 
C 1 32  THR 32  32  32  THR THR C . n 
C 1 33  ILE 33  33  33  ILE ILE C . n 
C 1 34  PRO 34  34  34  PRO PRO C . n 
C 1 35  ALA 35  35  35  ALA ALA C . n 
C 1 36  HIS 36  36  36  HIS HIS C . n 
C 1 37  GLN 37  37  37  GLN GLN C . n 
C 1 38  VAL 38  38  38  VAL VAL C . n 
C 1 39  ASN 39  39  39  ASN ASN C . n 
C 1 40  ALA 40  40  40  ALA ALA C . n 
C 1 41  GLU 41  41  41  GLU GLU C . n 
C 1 42  PHE 42  42  42  PHE PHE C . n 
C 1 43  PHE 43  43  43  PHE PHE C . n 
C 1 44  GLU 44  44  44  GLU GLU C . n 
C 1 45  GLU 45  45  45  GLU GLU C . n 
C 1 46  GLY 46  46  46  GLY GLY C . n 
C 1 47  LYS 47  47  47  LYS LYS C . n 
C 1 48  MET 48  48  48  MET MET C . n 
C 1 49  PHE 49  49  49  PHE PHE C . n 
C 1 50  ASP 50  50  50  ASP ASP C . n 
C 1 51  GLY 51  51  51  GLY GLY C . n 
C 1 52  SER 52  52  52  SER SER C . n 
C 1 53  SER 53  53  53  SER SER C . n 
C 1 54  ILE 54  54  54  ILE ILE C . n 
C 1 55  GLY 55  55  55  GLY GLY C . n 
C 1 56  GLY 56  56  56  GLY GLY C . n 
C 1 57  TRP 57  57  57  TRP TRP C . n 
C 1 58  LYS 58  58  58  LYS LYS C . n 
C 1 59  GLY 59  59  59  GLY GLY C . n 
C 1 60  ILE 60  60  60  ILE ILE C . n 
C 1 61  ASN 61  61  61  ASN ASN C . n 
C 1 62  GLU 62  62  62  GLU GLU C . n 
C 1 63  SER 63  63  63  SER SER C . n 
C 1 64  ASP 64  64  64  ASP ASP C . n 
C 1 65  MET 65  65  65  MET MET C . n 
C 1 66  VAL 66  66  66  VAL VAL C . n 
C 1 67  LEU 67  67  67  LEU LEU C . n 
C 1 68  MET 68  68  68  MET MET C . n 
C 1 69  PRO 69  69  69  PRO PRO C . n 
C 1 70  ASP 70  70  70  ASP ASP C . n 
C 1 71  ALA 71  71  71  ALA ALA C . n 
C 1 72  SER 72  72  72  SER SER C . n 
C 1 73  THR 73  73  73  THR THR C . n 
C 1 74  ALA 74  74  74  ALA ALA C . n 
C 1 75  VAL 75  75  75  VAL VAL C . n 
C 1 76  ILE 76  76  76  ILE ILE C . n 
C 1 77  ASP 77  77  77  ASP ASP C . n 
C 1 78  PRO 78  78  78  PRO PRO C . n 
C 1 79  PHE 79  79  79  PHE PHE C . n 
C 1 80  PHE 80  80  80  PHE PHE C . n 
C 1 81  ALA 81  81  81  ALA ALA C . n 
C 1 82  ASP 82  82  82  ASP ASP C . n 
C 1 83  SER 83  83  83  SER SER C . n 
C 1 84  THR 84  84  84  THR THR C . n 
C 1 85  LEU 85  85  85  LEU LEU C . n 
C 1 86  ILE 86  86  86  ILE ILE C . n 
C 1 87  ILE 87  87  87  ILE ILE C . n 
C 1 88  ARG 88  88  88  ARG ARG C . n 
C 1 89  CYS 89  89  89  CYS CYS C . n 
C 1 90  ASP 90  90  90  ASP ASP C . n 
C 1 91  ILE 91  91  91  ILE ILE C . n 
C 1 92  LEU 92  92  92  LEU LEU C . n 
C 1 93  GLU 93  93  93  GLU GLU C . n 
C 1 94  PRO 94  94  94  PRO PRO C . n 
C 1 95  GLY 95  95  95  GLY GLY C . n 
C 1 96  THR 96  96  96  THR THR C . n 
C 1 97  LEU 97  97  97  LEU LEU C . n 
C 1 98  GLN 98  98  98  GLN GLN C . n 
C 1 99  GLY 99  99  99  GLY GLY C . n 
C 1 100 TYR 100 100 100 TYR TYR C . n 
C 1 101 ASP 101 101 101 ASP ASP C . n 
C 1 102 ARG 102 102 102 ARG ARG C . n 
C 1 103 ASP 103 103 103 ASP ASP C . n 
C 1 104 PRO 104 104 104 PRO PRO C . n 
C 1 105 ARG 105 105 105 ARG ARG C . n 
C 1 106 SER 106 106 106 SER SER C . n 
C 1 107 ILE 107 107 107 ILE ILE C . n 
C 1 108 ALA 108 108 108 ALA ALA C . n 
C 1 109 LYS 109 109 109 LYS LYS C . n 
C 1 110 ARG 110 110 110 ARG ARG C . n 
C 1 111 ALA 111 111 111 ALA ALA C . n 
C 1 112 GLU 112 112 112 GLU GLU C . n 
C 1 113 ASP 113 113 113 ASP ASP C . n 
C 1 114 TYR 114 114 114 TYR TYR C . n 
C 1 115 LEU 115 115 115 LEU LEU C . n 
C 1 116 ARG 116 116 116 ARG ARG C . n 
C 1 117 ALA 117 117 117 ALA ALA C . n 
C 1 118 THR 118 118 118 THR THR C . n 
C 1 119 GLY 119 119 119 GLY GLY C . n 
C 1 120 ILE 120 120 120 ILE ILE C . n 
C 1 121 ALA 121 121 121 ALA ALA C . n 
C 1 122 ASP 122 122 122 ASP ASP C . n 
C 1 123 THR 123 123 123 THR THR C . n 
C 1 124 VAL 124 124 124 VAL VAL C . n 
C 1 125 LEU 125 125 125 LEU LEU C . n 
C 1 126 PHE 126 126 126 PHE PHE C . n 
C 1 127 GLY 127 127 127 GLY GLY C . n 
C 1 128 PRO 128 128 128 PRO PRO C . n 
C 1 129 GLU 129 129 129 GLU GLU C . n 
C 1 130 PRO 130 130 130 PRO PRO C . n 
C 1 131 GLU 131 131 131 GLU GLU C . n 
C 1 132 PHE 132 132 132 PHE PHE C . n 
C 1 133 PHE 133 133 133 PHE PHE C . n 
C 1 134 LEU 134 134 134 LEU LEU C . n 
C 1 135 PHE 135 135 135 PHE PHE C . n 
C 1 136 ASP 136 136 136 ASP ASP C . n 
C 1 137 ASP 137 137 137 ASP ASP C . n 
C 1 138 ILE 138 138 138 ILE ILE C . n 
C 1 139 ARG 139 139 139 ARG ARG C . n 
C 1 140 PHE 140 140 140 PHE PHE C . n 
C 1 141 GLY 141 141 141 GLY GLY C . n 
C 1 142 ALA 142 142 142 ALA ALA C . n 
C 1 143 SER 143 143 143 SER SER C . n 
C 1 144 ILE 144 144 144 ILE ILE C . n 
C 1 145 SER 145 145 145 SER SER C . n 
C 1 146 GLY 146 146 146 GLY GLY C . n 
C 1 147 SER 147 147 147 SER SER C . n 
C 1 148 HIS 148 148 148 HIS HIS C . n 
C 1 149 VAL 149 149 149 VAL VAL C . n 
C 1 150 ALA 150 150 150 ALA ALA C . n 
C 1 151 ILE 151 151 151 ILE ILE C . n 
C 1 152 ASP 152 152 152 ASP ASP C . n 
C 1 153 ASP 153 153 153 ASP ASP C . n 
C 1 154 ILE 154 154 154 ILE ILE C . n 
C 1 155 GLU 155 155 155 GLU GLU C . n 
C 1 156 GLY 156 156 156 GLY GLY C . n 
C 1 157 ALA 157 157 157 ALA ALA C . n 
C 1 158 TRP 158 158 158 TRP TRP C . n 
C 1 159 ASN 159 159 159 ASN ASN C . n 
C 1 160 SER 160 160 160 SER SER C . n 
C 1 161 SER 161 161 161 SER SER C . n 
C 1 162 THR 162 162 162 THR THR C . n 
C 1 163 LYS 163 163 163 LYS LYS C . n 
C 1 164 TYR 164 164 164 TYR TYR C . n 
C 1 165 GLU 165 165 165 GLU GLU C . n 
C 1 166 GLY 166 166 166 GLY GLY C . n 
C 1 167 GLY 167 167 167 GLY GLY C . n 
C 1 168 ASN 168 168 168 ASN ASN C . n 
C 1 169 LYS 169 169 169 LYS LYS C . n 
C 1 170 GLY 170 170 170 GLY GLY C . n 
C 1 171 HIS 171 171 171 HIS HIS C . n 
C 1 172 ARG 172 172 172 ARG ARG C . n 
C 1 173 PRO 173 173 173 PRO PRO C . n 
C 1 174 GLY 174 174 174 GLY GLY C . n 
C 1 175 VAL 175 175 175 VAL VAL C . n 
C 1 176 LYS 176 176 176 LYS LYS C . n 
C 1 177 GLY 177 177 177 GLY GLY C . n 
C 1 178 GLY 178 178 178 GLY GLY C . n 
C 1 179 TYR 179 179 179 TYR TYR C . n 
C 1 180 PHE 180 180 180 PHE PHE C . n 
C 1 181 PRO 181 181 181 PRO PRO C . n 
C 1 182 VAL 182 182 182 VAL VAL C . n 
C 1 183 PRO 183 183 183 PRO PRO C . n 
C 1 184 PRO 184 184 184 PRO PRO C . n 
C 1 185 VAL 185 185 185 VAL VAL C . n 
C 1 186 ASP 186 186 186 ASP ASP C . n 
C 1 187 SER 187 187 187 SER SER C . n 
C 1 188 ALA 188 188 188 ALA ALA C . n 
C 1 189 GLN 189 189 189 GLN GLN C . n 
C 1 190 ASP 190 190 190 ASP ASP C . n 
C 1 191 ILE 191 191 191 ILE ILE C . n 
C 1 192 ARG 192 192 192 ARG ARG C . n 
C 1 193 SER 193 193 193 SER SER C . n 
C 1 194 GLU 194 194 194 GLU GLU C . n 
C 1 195 MET 195 195 195 MET MET C . n 
C 1 196 CYS 196 196 196 CYS CYS C . n 
C 1 197 LEU 197 197 197 LEU LEU C . n 
C 1 198 VAL 198 198 198 VAL VAL C . n 
C 1 199 MET 199 199 199 MET MET C . n 
C 1 200 GLU 200 200 200 GLU GLU C . n 
C 1 201 GLN 201 201 201 GLN GLN C . n 
C 1 202 MET 202 202 202 MET MET C . n 
C 1 203 GLY 203 203 203 GLY GLY C . n 
C 1 204 LEU 204 204 204 LEU LEU C . n 
C 1 205 VAL 205 205 205 VAL VAL C . n 
C 1 206 VAL 206 206 206 VAL VAL C . n 
C 1 207 GLU 207 207 207 GLU GLU C . n 
C 1 208 ALA 208 208 208 ALA ALA C . n 
C 1 209 HIS 209 209 209 HIS HIS C . n 
C 1 210 HIS 210 210 210 HIS HIS C . n 
C 1 211 HIS 211 211 211 HIS HIS C . n 
C 1 212 GLU 212 212 212 GLU GLU C . n 
C 1 213 VAL 213 213 213 VAL VAL C . n 
C 1 214 ALA 214 214 214 ALA ALA C . n 
C 1 215 THR 215 215 215 THR THR C . n 
C 1 216 ALA 216 216 216 ALA ALA C . n 
C 1 217 GLY 217 217 217 GLY GLY C . n 
C 1 218 GLN 218 218 218 GLN GLN C . n 
C 1 219 ASN 219 219 219 ASN ASN C . n 
C 1 220 GLU 220 220 220 GLU GLU C . n 
C 1 221 VAL 221 221 221 VAL VAL C . n 
C 1 222 ALA 222 222 222 ALA ALA C . n 
C 1 223 THR 223 223 223 THR THR C . n 
C 1 224 ARG 224 224 224 ARG ARG C . n 
C 1 225 PHE 225 225 225 PHE PHE C . n 
C 1 226 ASN 226 226 226 ASN ASN C . n 
C 1 227 THR 227 227 227 THR THR C . n 
C 1 228 MET 228 228 228 MET MET C . n 
C 1 229 THR 229 229 229 THR THR C . n 
C 1 230 LYS 230 230 230 LYS LYS C . n 
C 1 231 LYS 231 231 231 LYS LYS C . n 
C 1 232 ALA 232 232 232 ALA ALA C . n 
C 1 233 ASP 233 233 233 ASP ASP C . n 
C 1 234 GLU 234 234 234 GLU GLU C . n 
C 1 235 ILE 235 235 235 ILE ILE C . n 
C 1 236 GLN 236 236 236 GLN GLN C . n 
C 1 237 ILE 237 237 237 ILE ILE C . n 
C 1 238 TYR 238 238 238 TYR TYR C . n 
C 1 239 LYS 239 239 239 LYS LYS C . n 
C 1 240 TYR 240 240 240 TYR TYR C . n 
C 1 241 VAL 241 241 241 VAL VAL C . n 
C 1 242 VAL 242 242 242 VAL VAL C . n 
C 1 243 HIS 243 243 243 HIS HIS C . n 
C 1 244 ASN 244 244 244 ASN ASN C . n 
C 1 245 VAL 245 245 245 VAL VAL C . n 
C 1 246 ALA 246 246 246 ALA ALA C . n 
C 1 247 HIS 247 247 247 HIS HIS C . n 
C 1 248 ARG 248 248 248 ARG ARG C . n 
C 1 249 PHE 249 249 249 PHE PHE C . n 
C 1 250 GLY 250 250 250 GLY GLY C . n 
C 1 251 LYS 251 251 251 LYS LYS C . n 
C 1 252 THR 252 252 252 THR THR C . n 
C 1 253 ALA 253 253 253 ALA ALA C . n 
C 1 254 THR 254 254 254 THR THR C . n 
C 1 255 PHE 255 255 255 PHE PHE C . n 
C 1 256 MET 256 256 256 MET MET C . n 
C 1 257 PRO 257 257 257 PRO PRO C . n 
C 1 258 LYS 258 258 258 LYS LYS C . n 
C 1 259 PRO 259 259 259 PRO PRO C . n 
C 1 260 MET 260 260 260 MET MET C . n 
C 1 261 PHE 261 261 261 PHE PHE C . n 
C 1 262 GLY 262 262 262 GLY GLY C . n 
C 1 263 ASP 263 263 263 ASP ASP C . n 
C 1 264 ASN 264 264 264 ASN ASN C . n 
C 1 265 GLY 265 265 265 GLY GLY C . n 
C 1 266 SER 266 266 266 SER SER C . n 
C 1 267 GLY 267 267 267 GLY GLY C . n 
C 1 268 MET 268 268 268 MET MET C . n 
C 1 269 HIS 269 269 269 HIS HIS C . n 
C 1 270 CYS 270 270 270 CYS CYS C . n 
C 1 271 HIS 271 271 271 HIS HIS C . n 
C 1 272 MET 272 272 272 MET MET C . n 
C 1 273 SER 273 273 273 SER SER C . n 
C 1 274 LEU 274 274 274 LEU LEU C . n 
C 1 275 ALA 275 275 275 ALA ALA C . n 
C 1 276 LYS 276 276 276 LYS LYS C . n 
C 1 277 ASN 277 277 277 ASN ASN C . n 
C 1 278 GLY 278 278 278 GLY GLY C . n 
C 1 279 THR 279 279 279 THR THR C . n 
C 1 280 ASN 280 280 280 ASN ASN C . n 
C 1 281 LEU 281 281 281 LEU LEU C . n 
C 1 282 PHE 282 282 282 PHE PHE C . n 
C 1 283 SER 283 283 283 SER SER C . n 
C 1 284 GLY 284 284 284 GLY GLY C . n 
C 1 285 ASP 285 285 285 ASP ASP C . n 
C 1 286 LYS 286 286 286 LYS LYS C . n 
C 1 287 TYR 287 287 287 TYR TYR C . n 
C 1 288 ALA 288 288 288 ALA ALA C . n 
C 1 289 GLY 289 289 289 GLY GLY C . n 
C 1 290 LEU 290 290 290 LEU LEU C . n 
C 1 291 SER 291 291 291 SER SER C . n 
C 1 292 GLU 292 292 292 GLU GLU C . n 
C 1 293 GLN 293 293 293 GLN GLN C . n 
C 1 294 ALA 294 294 294 ALA ALA C . n 
C 1 295 LEU 295 295 295 LEU LEU C . n 
C 1 296 TYR 296 296 296 TYR TYR C . n 
C 1 297 TYR 297 297 297 TYR TYR C . n 
C 1 298 ILE 298 298 298 ILE ILE C . n 
C 1 299 GLY 299 299 299 GLY GLY C . n 
C 1 300 GLY 300 300 300 GLY GLY C . n 
C 1 301 VAL 301 301 301 VAL VAL C . n 
C 1 302 ILE 302 302 302 ILE ILE C . n 
C 1 303 LYS 303 303 303 LYS LYS C . n 
C 1 304 HIS 304 304 304 HIS HIS C . n 
C 1 305 ALA 305 305 305 ALA ALA C . n 
C 1 306 LYS 306 306 306 LYS LYS C . n 
C 1 307 ALA 307 307 307 ALA ALA C . n 
C 1 308 ILE 308 308 308 ILE ILE C . n 
C 1 309 ASN 309 309 309 ASN ASN C . n 
C 1 310 ALA 310 310 310 ALA ALA C . n 
C 1 311 LEU 311 311 311 LEU LEU C . n 
C 1 312 ALA 312 312 312 ALA ALA C . n 
C 1 313 ASN 313 313 313 ASN ASN C . n 
C 1 314 PRO 314 314 314 PRO PRO C . n 
C 1 315 THR 315 315 315 THR THR C . n 
C 1 316 THR 316 316 316 THR THR C . n 
C 1 317 ASN 317 317 317 ASN ASN C . n 
C 1 318 SER 318 318 318 SER SER C . n 
C 1 319 TYR 319 319 319 TYR TYR C . n 
C 1 320 LYS 320 320 320 LYS LYS C . n 
C 1 321 ARG 321 321 321 ARG ARG C . n 
C 1 322 LEU 322 322 322 LEU LEU C . n 
C 1 323 VAL 323 323 323 VAL VAL C . n 
C 1 324 PRO 324 324 324 PRO PRO C . n 
C 1 325 GLY 325 325 325 GLY GLY C . n 
C 1 326 TYR 326 326 326 TYR TYR C . n 
C 1 327 GLU 327 327 327 GLU GLU C . n 
C 1 328 ALA 328 328 328 ALA ALA C . n 
C 1 329 PRO 329 329 329 PRO PRO C . n 
C 1 330 VAL 330 330 330 VAL VAL C . n 
C 1 331 MET 331 331 331 MET MET C . n 
C 1 332 LEU 332 332 332 LEU LEU C . n 
C 1 333 ALA 333 333 333 ALA ALA C . n 
C 1 334 TYR 334 334 334 TYR TYR C . n 
C 1 335 SER 335 335 335 SER SER C . n 
C 1 336 ALA 336 336 336 ALA ALA C . n 
C 1 337 ARG 337 337 337 ARG ARG C . n 
C 1 338 ASN 338 338 338 ASN ASN C . n 
C 1 339 ARG 339 339 339 ARG ARG C . n 
C 1 340 SER 340 340 340 SER SER C . n 
C 1 341 ALA 341 341 341 ALA ALA C . n 
C 1 342 SER 342 342 342 SER SER C . n 
C 1 343 ILE 343 343 343 ILE ILE C . n 
C 1 344 ARG 344 344 344 ARG ARG C . n 
C 1 345 ILE 345 345 345 ILE ILE C . n 
C 1 346 PRO 346 346 346 PRO PRO C . n 
C 1 347 VAL 347 347 347 VAL VAL C . n 
C 1 348 VAL 348 348 348 VAL VAL C . n 
C 1 349 ALA 349 349 349 ALA ALA C . n 
C 1 350 SER 350 350 350 SER SER C . n 
C 1 351 PRO 351 351 351 PRO PRO C . n 
C 1 352 LYS 352 352 352 LYS LYS C . n 
C 1 353 ALA 353 353 353 ALA ALA C . n 
C 1 354 ARG 354 354 354 ARG ARG C . n 
C 1 355 ARG 355 355 355 ARG ARG C . n 
C 1 356 ILE 356 356 356 ILE ILE C . n 
C 1 357 GLU 357 357 357 GLU GLU C . n 
C 1 358 VAL 358 358 358 VAL VAL C . n 
C 1 359 ARG 359 359 359 ARG ARG C . n 
C 1 360 PHE 360 360 360 PHE PHE C . n 
C 1 361 PRO 361 361 361 PRO PRO C . n 
C 1 362 ASP 362 362 362 ASP ASP C . n 
C 1 363 PRO 363 363 363 PRO PRO C . n 
C 1 364 ALA 364 364 364 ALA ALA C . n 
C 1 365 ALA 365 365 365 ALA ALA C . n 
C 1 366 ASN 366 366 366 ASN ASN C . n 
C 1 367 PRO 367 367 367 PRO PRO C . n 
C 1 368 TYR 368 368 368 TYR TYR C . n 
C 1 369 LEU 369 369 369 LEU LEU C . n 
C 1 370 CYS 370 370 370 CYS CYS C . n 
C 1 371 PHE 371 371 371 PHE PHE C . n 
C 1 372 ALA 372 372 372 ALA ALA C . n 
C 1 373 ALA 373 373 373 ALA ALA C . n 
C 1 374 LEU 374 374 374 LEU LEU C . n 
C 1 375 LEU 375 375 375 LEU LEU C . n 
C 1 376 MET 376 376 376 MET MET C . n 
C 1 377 ALA 377 377 377 ALA ALA C . n 
C 1 378 GLY 378 378 378 GLY GLY C . n 
C 1 379 LEU 379 379 379 LEU LEU C . n 
C 1 380 ASP 380 380 380 ASP ASP C . n 
C 1 381 GLY 381 381 381 GLY GLY C . n 
C 1 382 ILE 382 382 382 ILE ILE C . n 
C 1 383 LYS 383 383 383 LYS LYS C . n 
C 1 384 ASN 384 384 384 ASN ASN C . n 
C 1 385 LYS 385 385 385 LYS LYS C . n 
C 1 386 ILE 386 386 386 ILE ILE C . n 
C 1 387 HIS 387 387 387 HIS HIS C . n 
C 1 388 PRO 388 388 388 PRO PRO C . n 
C 1 389 GLY 389 389 389 GLY GLY C . n 
C 1 390 GLU 390 390 390 GLU GLU C . n 
C 1 391 PRO 391 391 391 PRO PRO C . n 
C 1 392 MET 392 392 392 MET MET C . n 
C 1 393 ASP 393 393 393 ASP ASP C . n 
C 1 394 LYS 394 394 394 LYS LYS C . n 
C 1 395 ASN 395 395 395 ASN ASN C . n 
C 1 396 LEU 396 396 396 LEU LEU C . n 
C 1 397 TYR 397 397 397 TYR TYR C . n 
C 1 398 ASP 398 398 398 ASP ASP C . n 
C 1 399 LEU 399 399 399 LEU LEU C . n 
C 1 400 PRO 400 400 400 PRO PRO C . n 
C 1 401 PRO 401 401 401 PRO PRO C . n 
C 1 402 GLU 402 402 402 GLU GLU C . n 
C 1 403 GLU 403 403 403 GLU GLU C . n 
C 1 404 ALA 404 404 404 ALA ALA C . n 
C 1 405 LYS 405 405 405 LYS LYS C . n 
C 1 406 GLU 406 406 406 GLU GLU C . n 
C 1 407 ILE 407 407 407 ILE ILE C . n 
C 1 408 PRO 408 408 408 PRO PRO C . n 
C 1 409 GLN 409 409 409 GLN GLN C . n 
C 1 410 VAL 410 410 410 VAL VAL C . n 
C 1 411 ALA 411 411 411 ALA ALA C . n 
C 1 412 GLY 412 412 412 GLY GLY C . n 
C 1 413 SER 413 413 413 SER SER C . n 
C 1 414 LEU 414 414 414 LEU LEU C . n 
C 1 415 GLU 415 415 415 GLU GLU C . n 
C 1 416 GLU 416 416 416 GLU GLU C . n 
C 1 417 ALA 417 417 417 ALA ALA C . n 
C 1 418 LEU 418 418 418 LEU LEU C . n 
C 1 419 ASN 419 419 419 ASN ASN C . n 
C 1 420 ALA 420 420 420 ALA ALA C . n 
C 1 421 LEU 421 421 421 LEU LEU C . n 
C 1 422 ASP 422 422 422 ASP ASP C . n 
C 1 423 LEU 423 423 423 LEU LEU C . n 
C 1 424 ASP 424 424 424 ASP ASP C . n 
C 1 425 ARG 425 425 425 ARG ARG C . n 
C 1 426 GLU 426 426 426 GLU GLU C . n 
C 1 427 PHE 427 427 427 PHE PHE C . n 
C 1 428 LEU 428 428 428 LEU LEU C . n 
C 1 429 LYS 429 429 429 LYS LYS C . n 
C 1 430 ALA 430 430 430 ALA ALA C . n 
C 1 431 GLY 431 431 431 GLY GLY C . n 
C 1 432 GLY 432 432 432 GLY GLY C . n 
C 1 433 VAL 433 433 433 VAL VAL C . n 
C 1 434 PHE 434 434 434 PHE PHE C . n 
C 1 435 THR 435 435 435 THR THR C . n 
C 1 436 ASP 436 436 436 ASP ASP C . n 
C 1 437 GLU 437 437 437 GLU GLU C . n 
C 1 438 ALA 438 438 438 ALA ALA C . n 
C 1 439 ILE 439 439 439 ILE ILE C . n 
C 1 440 ASP 440 440 440 ASP ASP C . n 
C 1 441 ALA 441 441 441 ALA ALA C . n 
C 1 442 TYR 442 442 442 TYR TYR C . n 
C 1 443 ILE 443 443 443 ILE ILE C . n 
C 1 444 ALA 444 444 444 ALA ALA C . n 
C 1 445 LEU 445 445 445 LEU LEU C . n 
C 1 446 ARG 446 446 446 ARG ARG C . n 
C 1 447 ARG 447 447 447 ARG ARG C . n 
C 1 448 GLU 448 448 448 GLU GLU C . n 
C 1 449 GLU 449 449 449 GLU GLU C . n 
C 1 450 ASP 450 450 450 ASP ASP C . n 
C 1 451 ASP 451 451 451 ASP ASP C . n 
C 1 452 ARG 452 452 452 ARG ARG C . n 
C 1 453 VAL 453 453 453 VAL VAL C . n 
C 1 454 ARG 454 454 454 ARG ARG C . n 
C 1 455 MET 455 455 455 MET MET C . n 
C 1 456 THR 456 456 456 THR THR C . n 
C 1 457 PRO 457 457 457 PRO PRO C . n 
C 1 458 HIS 458 458 458 HIS HIS C . n 
C 1 459 PRO 459 459 459 PRO PRO C . n 
C 1 460 VAL 460 460 460 VAL VAL C . n 
C 1 461 GLU 461 461 461 GLU GLU C . n 
C 1 462 PHE 462 462 462 PHE PHE C . n 
C 1 463 GLU 463 463 463 GLU GLU C . n 
C 1 464 LEU 464 464 464 LEU LEU C . n 
C 1 465 TYR 465 465 465 TYR TYR C . n 
C 1 466 TYR 466 466 466 TYR TYR C . n 
C 1 467 SER 467 467 467 SER SER C . n 
C 1 468 VAL 468 468 468 VAL VAL C . n 
D 1 1   SER 1   1   1   SER SER D . n 
D 1 2   ALA 2   2   2   ALA ALA D . n 
D 1 3   GLU 3   3   3   GLU GLU D . n 
D 1 4   HIS 4   4   4   HIS HIS D . n 
D 1 5   VAL 5   5   5   VAL VAL D . n 
D 1 6   LEU 6   6   6   LEU LEU D . n 
D 1 7   THR 7   7   7   THR THR D . n 
D 1 8   MET 8   8   8   MET MET D . n 
D 1 9   LEU 9   9   9   LEU LEU D . n 
D 1 10  ASN 10  10  10  ASN ASN D . n 
D 1 11  GLU 11  11  11  GLU GLU D . n 
D 1 12  HIS 12  12  12  HIS HIS D . n 
D 1 13  GLU 13  13  13  GLU GLU D . n 
D 1 14  VAL 14  14  14  VAL VAL D . n 
D 1 15  LYS 15  15  15  LYS LYS D . n 
D 1 16  PHE 16  16  16  PHE PHE D . n 
D 1 17  VAL 17  17  17  VAL VAL D . n 
D 1 18  ASP 18  18  18  ASP ASP D . n 
D 1 19  LEU 19  19  19  LEU LEU D . n 
D 1 20  ARG 20  20  20  ARG ARG D . n 
D 1 21  PHE 21  21  21  PHE PHE D . n 
D 1 22  THR 22  22  22  THR THR D . n 
D 1 23  ASP 23  23  23  ASP ASP D . n 
D 1 24  THR 24  24  24  THR THR D . n 
D 1 25  LYS 25  25  25  LYS LYS D . n 
D 1 26  GLY 26  26  26  GLY GLY D . n 
D 1 27  LYS 27  27  27  LYS LYS D . n 
D 1 28  GLU 28  28  28  GLU GLU D . n 
D 1 29  GLN 29  29  29  GLN GLN D . n 
D 1 30  HIS 30  30  30  HIS HIS D . n 
D 1 31  VAL 31  31  31  VAL VAL D . n 
D 1 32  THR 32  32  32  THR THR D . n 
D 1 33  ILE 33  33  33  ILE ILE D . n 
D 1 34  PRO 34  34  34  PRO PRO D . n 
D 1 35  ALA 35  35  35  ALA ALA D . n 
D 1 36  HIS 36  36  36  HIS HIS D . n 
D 1 37  GLN 37  37  37  GLN GLN D . n 
D 1 38  VAL 38  38  38  VAL VAL D . n 
D 1 39  ASN 39  39  39  ASN ASN D . n 
D 1 40  ALA 40  40  40  ALA ALA D . n 
D 1 41  GLU 41  41  41  GLU GLU D . n 
D 1 42  PHE 42  42  42  PHE PHE D . n 
D 1 43  PHE 43  43  43  PHE PHE D . n 
D 1 44  GLU 44  44  44  GLU GLU D . n 
D 1 45  GLU 45  45  45  GLU GLU D . n 
D 1 46  GLY 46  46  46  GLY GLY D . n 
D 1 47  LYS 47  47  47  LYS LYS D . n 
D 1 48  MET 48  48  48  MET MET D . n 
D 1 49  PHE 49  49  49  PHE PHE D . n 
D 1 50  ASP 50  50  50  ASP ASP D . n 
D 1 51  GLY 51  51  51  GLY GLY D . n 
D 1 52  SER 52  52  52  SER SER D . n 
D 1 53  SER 53  53  53  SER SER D . n 
D 1 54  ILE 54  54  54  ILE ILE D . n 
D 1 55  GLY 55  55  55  GLY GLY D . n 
D 1 56  GLY 56  56  56  GLY GLY D . n 
D 1 57  TRP 57  57  57  TRP TRP D . n 
D 1 58  LYS 58  58  58  LYS LYS D . n 
D 1 59  GLY 59  59  59  GLY GLY D . n 
D 1 60  ILE 60  60  60  ILE ILE D . n 
D 1 61  ASN 61  61  61  ASN ASN D . n 
D 1 62  GLU 62  62  62  GLU GLU D . n 
D 1 63  SER 63  63  63  SER SER D . n 
D 1 64  ASP 64  64  64  ASP ASP D . n 
D 1 65  MET 65  65  65  MET MET D . n 
D 1 66  VAL 66  66  66  VAL VAL D . n 
D 1 67  LEU 67  67  67  LEU LEU D . n 
D 1 68  MET 68  68  68  MET MET D . n 
D 1 69  PRO 69  69  69  PRO PRO D . n 
D 1 70  ASP 70  70  70  ASP ASP D . n 
D 1 71  ALA 71  71  71  ALA ALA D . n 
D 1 72  SER 72  72  72  SER SER D . n 
D 1 73  THR 73  73  73  THR THR D . n 
D 1 74  ALA 74  74  74  ALA ALA D . n 
D 1 75  VAL 75  75  75  VAL VAL D . n 
D 1 76  ILE 76  76  76  ILE ILE D . n 
D 1 77  ASP 77  77  77  ASP ASP D . n 
D 1 78  PRO 78  78  78  PRO PRO D . n 
D 1 79  PHE 79  79  79  PHE PHE D . n 
D 1 80  PHE 80  80  80  PHE PHE D . n 
D 1 81  ALA 81  81  81  ALA ALA D . n 
D 1 82  ASP 82  82  82  ASP ASP D . n 
D 1 83  SER 83  83  83  SER SER D . n 
D 1 84  THR 84  84  84  THR THR D . n 
D 1 85  LEU 85  85  85  LEU LEU D . n 
D 1 86  ILE 86  86  86  ILE ILE D . n 
D 1 87  ILE 87  87  87  ILE ILE D . n 
D 1 88  ARG 88  88  88  ARG ARG D . n 
D 1 89  CYS 89  89  89  CYS CYS D . n 
D 1 90  ASP 90  90  90  ASP ASP D . n 
D 1 91  ILE 91  91  91  ILE ILE D . n 
D 1 92  LEU 92  92  92  LEU LEU D . n 
D 1 93  GLU 93  93  93  GLU GLU D . n 
D 1 94  PRO 94  94  94  PRO PRO D . n 
D 1 95  GLY 95  95  95  GLY GLY D . n 
D 1 96  THR 96  96  96  THR THR D . n 
D 1 97  LEU 97  97  97  LEU LEU D . n 
D 1 98  GLN 98  98  98  GLN GLN D . n 
D 1 99  GLY 99  99  99  GLY GLY D . n 
D 1 100 TYR 100 100 100 TYR TYR D . n 
D 1 101 ASP 101 101 101 ASP ASP D . n 
D 1 102 ARG 102 102 102 ARG ARG D . n 
D 1 103 ASP 103 103 103 ASP ASP D . n 
D 1 104 PRO 104 104 104 PRO PRO D . n 
D 1 105 ARG 105 105 105 ARG ARG D . n 
D 1 106 SER 106 106 106 SER SER D . n 
D 1 107 ILE 107 107 107 ILE ILE D . n 
D 1 108 ALA 108 108 108 ALA ALA D . n 
D 1 109 LYS 109 109 109 LYS LYS D . n 
D 1 110 ARG 110 110 110 ARG ARG D . n 
D 1 111 ALA 111 111 111 ALA ALA D . n 
D 1 112 GLU 112 112 112 GLU GLU D . n 
D 1 113 ASP 113 113 113 ASP ASP D . n 
D 1 114 TYR 114 114 114 TYR TYR D . n 
D 1 115 LEU 115 115 115 LEU LEU D . n 
D 1 116 ARG 116 116 116 ARG ARG D . n 
D 1 117 ALA 117 117 117 ALA ALA D . n 
D 1 118 THR 118 118 118 THR THR D . n 
D 1 119 GLY 119 119 119 GLY GLY D . n 
D 1 120 ILE 120 120 120 ILE ILE D . n 
D 1 121 ALA 121 121 121 ALA ALA D . n 
D 1 122 ASP 122 122 122 ASP ASP D . n 
D 1 123 THR 123 123 123 THR THR D . n 
D 1 124 VAL 124 124 124 VAL VAL D . n 
D 1 125 LEU 125 125 125 LEU LEU D . n 
D 1 126 PHE 126 126 126 PHE PHE D . n 
D 1 127 GLY 127 127 127 GLY GLY D . n 
D 1 128 PRO 128 128 128 PRO PRO D . n 
D 1 129 GLU 129 129 129 GLU GLU D . n 
D 1 130 PRO 130 130 130 PRO PRO D . n 
D 1 131 GLU 131 131 131 GLU GLU D . n 
D 1 132 PHE 132 132 132 PHE PHE D . n 
D 1 133 PHE 133 133 133 PHE PHE D . n 
D 1 134 LEU 134 134 134 LEU LEU D . n 
D 1 135 PHE 135 135 135 PHE PHE D . n 
D 1 136 ASP 136 136 136 ASP ASP D . n 
D 1 137 ASP 137 137 137 ASP ASP D . n 
D 1 138 ILE 138 138 138 ILE ILE D . n 
D 1 139 ARG 139 139 139 ARG ARG D . n 
D 1 140 PHE 140 140 140 PHE PHE D . n 
D 1 141 GLY 141 141 141 GLY GLY D . n 
D 1 142 ALA 142 142 142 ALA ALA D . n 
D 1 143 SER 143 143 143 SER SER D . n 
D 1 144 ILE 144 144 144 ILE ILE D . n 
D 1 145 SER 145 145 145 SER SER D . n 
D 1 146 GLY 146 146 146 GLY GLY D . n 
D 1 147 SER 147 147 147 SER SER D . n 
D 1 148 HIS 148 148 148 HIS HIS D . n 
D 1 149 VAL 149 149 149 VAL VAL D . n 
D 1 150 ALA 150 150 150 ALA ALA D . n 
D 1 151 ILE 151 151 151 ILE ILE D . n 
D 1 152 ASP 152 152 152 ASP ASP D . n 
D 1 153 ASP 153 153 153 ASP ASP D . n 
D 1 154 ILE 154 154 154 ILE ILE D . n 
D 1 155 GLU 155 155 155 GLU GLU D . n 
D 1 156 GLY 156 156 156 GLY GLY D . n 
D 1 157 ALA 157 157 157 ALA ALA D . n 
D 1 158 TRP 158 158 158 TRP TRP D . n 
D 1 159 ASN 159 159 159 ASN ASN D . n 
D 1 160 SER 160 160 160 SER SER D . n 
D 1 161 SER 161 161 161 SER SER D . n 
D 1 162 THR 162 162 162 THR THR D . n 
D 1 163 LYS 163 163 163 LYS LYS D . n 
D 1 164 TYR 164 164 164 TYR TYR D . n 
D 1 165 GLU 165 165 165 GLU GLU D . n 
D 1 166 GLY 166 166 166 GLY GLY D . n 
D 1 167 GLY 167 167 167 GLY GLY D . n 
D 1 168 ASN 168 168 168 ASN ASN D . n 
D 1 169 LYS 169 169 169 LYS LYS D . n 
D 1 170 GLY 170 170 170 GLY GLY D . n 
D 1 171 HIS 171 171 171 HIS HIS D . n 
D 1 172 ARG 172 172 172 ARG ARG D . n 
D 1 173 PRO 173 173 173 PRO PRO D . n 
D 1 174 GLY 174 174 174 GLY GLY D . n 
D 1 175 VAL 175 175 175 VAL VAL D . n 
D 1 176 LYS 176 176 176 LYS LYS D . n 
D 1 177 GLY 177 177 177 GLY GLY D . n 
D 1 178 GLY 178 178 178 GLY GLY D . n 
D 1 179 TYR 179 179 179 TYR TYR D . n 
D 1 180 PHE 180 180 180 PHE PHE D . n 
D 1 181 PRO 181 181 181 PRO PRO D . n 
D 1 182 VAL 182 182 182 VAL VAL D . n 
D 1 183 PRO 183 183 183 PRO PRO D . n 
D 1 184 PRO 184 184 184 PRO PRO D . n 
D 1 185 VAL 185 185 185 VAL VAL D . n 
D 1 186 ASP 186 186 186 ASP ASP D . n 
D 1 187 SER 187 187 187 SER SER D . n 
D 1 188 ALA 188 188 188 ALA ALA D . n 
D 1 189 GLN 189 189 189 GLN GLN D . n 
D 1 190 ASP 190 190 190 ASP ASP D . n 
D 1 191 ILE 191 191 191 ILE ILE D . n 
D 1 192 ARG 192 192 192 ARG ARG D . n 
D 1 193 SER 193 193 193 SER SER D . n 
D 1 194 GLU 194 194 194 GLU GLU D . n 
D 1 195 MET 195 195 195 MET MET D . n 
D 1 196 CYS 196 196 196 CYS CYS D . n 
D 1 197 LEU 197 197 197 LEU LEU D . n 
D 1 198 VAL 198 198 198 VAL VAL D . n 
D 1 199 MET 199 199 199 MET MET D . n 
D 1 200 GLU 200 200 200 GLU GLU D . n 
D 1 201 GLN 201 201 201 GLN GLN D . n 
D 1 202 MET 202 202 202 MET MET D . n 
D 1 203 GLY 203 203 203 GLY GLY D . n 
D 1 204 LEU 204 204 204 LEU LEU D . n 
D 1 205 VAL 205 205 205 VAL VAL D . n 
D 1 206 VAL 206 206 206 VAL VAL D . n 
D 1 207 GLU 207 207 207 GLU GLU D . n 
D 1 208 ALA 208 208 208 ALA ALA D . n 
D 1 209 HIS 209 209 209 HIS HIS D . n 
D 1 210 HIS 210 210 210 HIS HIS D . n 
D 1 211 HIS 211 211 211 HIS HIS D . n 
D 1 212 GLU 212 212 212 GLU GLU D . n 
D 1 213 VAL 213 213 213 VAL VAL D . n 
D 1 214 ALA 214 214 214 ALA ALA D . n 
D 1 215 THR 215 215 215 THR THR D . n 
D 1 216 ALA 216 216 216 ALA ALA D . n 
D 1 217 GLY 217 217 217 GLY GLY D . n 
D 1 218 GLN 218 218 218 GLN GLN D . n 
D 1 219 ASN 219 219 219 ASN ASN D . n 
D 1 220 GLU 220 220 220 GLU GLU D . n 
D 1 221 VAL 221 221 221 VAL VAL D . n 
D 1 222 ALA 222 222 222 ALA ALA D . n 
D 1 223 THR 223 223 223 THR THR D . n 
D 1 224 ARG 224 224 224 ARG ARG D . n 
D 1 225 PHE 225 225 225 PHE PHE D . n 
D 1 226 ASN 226 226 226 ASN ASN D . n 
D 1 227 THR 227 227 227 THR THR D . n 
D 1 228 MET 228 228 228 MET MET D . n 
D 1 229 THR 229 229 229 THR THR D . n 
D 1 230 LYS 230 230 230 LYS LYS D . n 
D 1 231 LYS 231 231 231 LYS LYS D . n 
D 1 232 ALA 232 232 232 ALA ALA D . n 
D 1 233 ASP 233 233 233 ASP ASP D . n 
D 1 234 GLU 234 234 234 GLU GLU D . n 
D 1 235 ILE 235 235 235 ILE ILE D . n 
D 1 236 GLN 236 236 236 GLN GLN D . n 
D 1 237 ILE 237 237 237 ILE ILE D . n 
D 1 238 TYR 238 238 238 TYR TYR D . n 
D 1 239 LYS 239 239 239 LYS LYS D . n 
D 1 240 TYR 240 240 240 TYR TYR D . n 
D 1 241 VAL 241 241 241 VAL VAL D . n 
D 1 242 VAL 242 242 242 VAL VAL D . n 
D 1 243 HIS 243 243 243 HIS HIS D . n 
D 1 244 ASN 244 244 244 ASN ASN D . n 
D 1 245 VAL 245 245 245 VAL VAL D . n 
D 1 246 ALA 246 246 246 ALA ALA D . n 
D 1 247 HIS 247 247 247 HIS HIS D . n 
D 1 248 ARG 248 248 248 ARG ARG D . n 
D 1 249 PHE 249 249 249 PHE PHE D . n 
D 1 250 GLY 250 250 250 GLY GLY D . n 
D 1 251 LYS 251 251 251 LYS LYS D . n 
D 1 252 THR 252 252 252 THR THR D . n 
D 1 253 ALA 253 253 253 ALA ALA D . n 
D 1 254 THR 254 254 254 THR THR D . n 
D 1 255 PHE 255 255 255 PHE PHE D . n 
D 1 256 MET 256 256 256 MET MET D . n 
D 1 257 PRO 257 257 257 PRO PRO D . n 
D 1 258 LYS 258 258 258 LYS LYS D . n 
D 1 259 PRO 259 259 259 PRO PRO D . n 
D 1 260 MET 260 260 260 MET MET D . n 
D 1 261 PHE 261 261 261 PHE PHE D . n 
D 1 262 GLY 262 262 262 GLY GLY D . n 
D 1 263 ASP 263 263 263 ASP ASP D . n 
D 1 264 ASN 264 264 264 ASN ASN D . n 
D 1 265 GLY 265 265 265 GLY GLY D . n 
D 1 266 SER 266 266 266 SER SER D . n 
D 1 267 GLY 267 267 267 GLY GLY D . n 
D 1 268 MET 268 268 268 MET MET D . n 
D 1 269 HIS 269 269 269 HIS HIS D . n 
D 1 270 CYS 270 270 270 CYS CYS D . n 
D 1 271 HIS 271 271 271 HIS HIS D . n 
D 1 272 MET 272 272 272 MET MET D . n 
D 1 273 SER 273 273 273 SER SER D . n 
D 1 274 LEU 274 274 274 LEU LEU D . n 
D 1 275 ALA 275 275 275 ALA ALA D . n 
D 1 276 LYS 276 276 276 LYS LYS D . n 
D 1 277 ASN 277 277 277 ASN ASN D . n 
D 1 278 GLY 278 278 278 GLY GLY D . n 
D 1 279 THR 279 279 279 THR THR D . n 
D 1 280 ASN 280 280 280 ASN ASN D . n 
D 1 281 LEU 281 281 281 LEU LEU D . n 
D 1 282 PHE 282 282 282 PHE PHE D . n 
D 1 283 SER 283 283 283 SER SER D . n 
D 1 284 GLY 284 284 284 GLY GLY D . n 
D 1 285 ASP 285 285 285 ASP ASP D . n 
D 1 286 LYS 286 286 286 LYS LYS D . n 
D 1 287 TYR 287 287 287 TYR TYR D . n 
D 1 288 ALA 288 288 288 ALA ALA D . n 
D 1 289 GLY 289 289 289 GLY GLY D . n 
D 1 290 LEU 290 290 290 LEU LEU D . n 
D 1 291 SER 291 291 291 SER SER D . n 
D 1 292 GLU 292 292 292 GLU GLU D . n 
D 1 293 GLN 293 293 293 GLN GLN D . n 
D 1 294 ALA 294 294 294 ALA ALA D . n 
D 1 295 LEU 295 295 295 LEU LEU D . n 
D 1 296 TYR 296 296 296 TYR TYR D . n 
D 1 297 TYR 297 297 297 TYR TYR D . n 
D 1 298 ILE 298 298 298 ILE ILE D . n 
D 1 299 GLY 299 299 299 GLY GLY D . n 
D 1 300 GLY 300 300 300 GLY GLY D . n 
D 1 301 VAL 301 301 301 VAL VAL D . n 
D 1 302 ILE 302 302 302 ILE ILE D . n 
D 1 303 LYS 303 303 303 LYS LYS D . n 
D 1 304 HIS 304 304 304 HIS HIS D . n 
D 1 305 ALA 305 305 305 ALA ALA D . n 
D 1 306 LYS 306 306 306 LYS LYS D . n 
D 1 307 ALA 307 307 307 ALA ALA D . n 
D 1 308 ILE 308 308 308 ILE ILE D . n 
D 1 309 ASN 309 309 309 ASN ASN D . n 
D 1 310 ALA 310 310 310 ALA ALA D . n 
D 1 311 LEU 311 311 311 LEU LEU D . n 
D 1 312 ALA 312 312 312 ALA ALA D . n 
D 1 313 ASN 313 313 313 ASN ASN D . n 
D 1 314 PRO 314 314 314 PRO PRO D . n 
D 1 315 THR 315 315 315 THR THR D . n 
D 1 316 THR 316 316 316 THR THR D . n 
D 1 317 ASN 317 317 317 ASN ASN D . n 
D 1 318 SER 318 318 318 SER SER D . n 
D 1 319 TYR 319 319 319 TYR TYR D . n 
D 1 320 LYS 320 320 320 LYS LYS D . n 
D 1 321 ARG 321 321 321 ARG ARG D . n 
D 1 322 LEU 322 322 322 LEU LEU D . n 
D 1 323 VAL 323 323 323 VAL VAL D . n 
D 1 324 PRO 324 324 324 PRO PRO D . n 
D 1 325 GLY 325 325 325 GLY GLY D . n 
D 1 326 TYR 326 326 326 TYR TYR D . n 
D 1 327 GLU 327 327 327 GLU GLU D . n 
D 1 328 ALA 328 328 328 ALA ALA D . n 
D 1 329 PRO 329 329 329 PRO PRO D . n 
D 1 330 VAL 330 330 330 VAL VAL D . n 
D 1 331 MET 331 331 331 MET MET D . n 
D 1 332 LEU 332 332 332 LEU LEU D . n 
D 1 333 ALA 333 333 333 ALA ALA D . n 
D 1 334 TYR 334 334 334 TYR TYR D . n 
D 1 335 SER 335 335 335 SER SER D . n 
D 1 336 ALA 336 336 336 ALA ALA D . n 
D 1 337 ARG 337 337 337 ARG ARG D . n 
D 1 338 ASN 338 338 338 ASN ASN D . n 
D 1 339 ARG 339 339 339 ARG ARG D . n 
D 1 340 SER 340 340 340 SER SER D . n 
D 1 341 ALA 341 341 341 ALA ALA D . n 
D 1 342 SER 342 342 342 SER SER D . n 
D 1 343 ILE 343 343 343 ILE ILE D . n 
D 1 344 ARG 344 344 344 ARG ARG D . n 
D 1 345 ILE 345 345 345 ILE ILE D . n 
D 1 346 PRO 346 346 346 PRO PRO D . n 
D 1 347 VAL 347 347 347 VAL VAL D . n 
D 1 348 VAL 348 348 348 VAL VAL D . n 
D 1 349 ALA 349 349 349 ALA ALA D . n 
D 1 350 SER 350 350 350 SER SER D . n 
D 1 351 PRO 351 351 351 PRO PRO D . n 
D 1 352 LYS 352 352 352 LYS LYS D . n 
D 1 353 ALA 353 353 353 ALA ALA D . n 
D 1 354 ARG 354 354 354 ARG ARG D . n 
D 1 355 ARG 355 355 355 ARG ARG D . n 
D 1 356 ILE 356 356 356 ILE ILE D . n 
D 1 357 GLU 357 357 357 GLU GLU D . n 
D 1 358 VAL 358 358 358 VAL VAL D . n 
D 1 359 ARG 359 359 359 ARG ARG D . n 
D 1 360 PHE 360 360 360 PHE PHE D . n 
D 1 361 PRO 361 361 361 PRO PRO D . n 
D 1 362 ASP 362 362 362 ASP ASP D . n 
D 1 363 PRO 363 363 363 PRO PRO D . n 
D 1 364 ALA 364 364 364 ALA ALA D . n 
D 1 365 ALA 365 365 365 ALA ALA D . n 
D 1 366 ASN 366 366 366 ASN ASN D . n 
D 1 367 PRO 367 367 367 PRO PRO D . n 
D 1 368 TYR 368 368 368 TYR TYR D . n 
D 1 369 LEU 369 369 369 LEU LEU D . n 
D 1 370 CYS 370 370 370 CYS CYS D . n 
D 1 371 PHE 371 371 371 PHE PHE D . n 
D 1 372 ALA 372 372 372 ALA ALA D . n 
D 1 373 ALA 373 373 373 ALA ALA D . n 
D 1 374 LEU 374 374 374 LEU LEU D . n 
D 1 375 LEU 375 375 375 LEU LEU D . n 
D 1 376 MET 376 376 376 MET MET D . n 
D 1 377 ALA 377 377 377 ALA ALA D . n 
D 1 378 GLY 378 378 378 GLY GLY D . n 
D 1 379 LEU 379 379 379 LEU LEU D . n 
D 1 380 ASP 380 380 380 ASP ASP D . n 
D 1 381 GLY 381 381 381 GLY GLY D . n 
D 1 382 ILE 382 382 382 ILE ILE D . n 
D 1 383 LYS 383 383 383 LYS LYS D . n 
D 1 384 ASN 384 384 384 ASN ASN D . n 
D 1 385 LYS 385 385 385 LYS LYS D . n 
D 1 386 ILE 386 386 386 ILE ILE D . n 
D 1 387 HIS 387 387 387 HIS HIS D . n 
D 1 388 PRO 388 388 388 PRO PRO D . n 
D 1 389 GLY 389 389 389 GLY GLY D . n 
D 1 390 GLU 390 390 390 GLU GLU D . n 
D 1 391 PRO 391 391 391 PRO PRO D . n 
D 1 392 MET 392 392 392 MET MET D . n 
D 1 393 ASP 393 393 393 ASP ASP D . n 
D 1 394 LYS 394 394 394 LYS LYS D . n 
D 1 395 ASN 395 395 395 ASN ASN D . n 
D 1 396 LEU 396 396 396 LEU LEU D . n 
D 1 397 TYR 397 397 397 TYR TYR D . n 
D 1 398 ASP 398 398 398 ASP ASP D . n 
D 1 399 LEU 399 399 399 LEU LEU D . n 
D 1 400 PRO 400 400 400 PRO PRO D . n 
D 1 401 PRO 401 401 401 PRO PRO D . n 
D 1 402 GLU 402 402 402 GLU GLU D . n 
D 1 403 GLU 403 403 403 GLU GLU D . n 
D 1 404 ALA 404 404 404 ALA ALA D . n 
D 1 405 LYS 405 405 405 LYS LYS D . n 
D 1 406 GLU 406 406 406 GLU GLU D . n 
D 1 407 ILE 407 407 407 ILE ILE D . n 
D 1 408 PRO 408 408 408 PRO PRO D . n 
D 1 409 GLN 409 409 409 GLN GLN D . n 
D 1 410 VAL 410 410 410 VAL VAL D . n 
D 1 411 ALA 411 411 411 ALA ALA D . n 
D 1 412 GLY 412 412 412 GLY GLY D . n 
D 1 413 SER 413 413 413 SER SER D . n 
D 1 414 LEU 414 414 414 LEU LEU D . n 
D 1 415 GLU 415 415 415 GLU GLU D . n 
D 1 416 GLU 416 416 416 GLU GLU D . n 
D 1 417 ALA 417 417 417 ALA ALA D . n 
D 1 418 LEU 418 418 418 LEU LEU D . n 
D 1 419 ASN 419 419 419 ASN ASN D . n 
D 1 420 ALA 420 420 420 ALA ALA D . n 
D 1 421 LEU 421 421 421 LEU LEU D . n 
D 1 422 ASP 422 422 422 ASP ASP D . n 
D 1 423 LEU 423 423 423 LEU LEU D . n 
D 1 424 ASP 424 424 424 ASP ASP D . n 
D 1 425 ARG 425 425 425 ARG ARG D . n 
D 1 426 GLU 426 426 426 GLU GLU D . n 
D 1 427 PHE 427 427 427 PHE PHE D . n 
D 1 428 LEU 428 428 428 LEU LEU D . n 
D 1 429 LYS 429 429 429 LYS LYS D . n 
D 1 430 ALA 430 430 430 ALA ALA D . n 
D 1 431 GLY 431 431 431 GLY GLY D . n 
D 1 432 GLY 432 432 432 GLY GLY D . n 
D 1 433 VAL 433 433 433 VAL VAL D . n 
D 1 434 PHE 434 434 434 PHE PHE D . n 
D 1 435 THR 435 435 435 THR THR D . n 
D 1 436 ASP 436 436 436 ASP ASP D . n 
D 1 437 GLU 437 437 437 GLU GLU D . n 
D 1 438 ALA 438 438 438 ALA ALA D . n 
D 1 439 ILE 439 439 439 ILE ILE D . n 
D 1 440 ASP 440 440 440 ASP ASP D . n 
D 1 441 ALA 441 441 441 ALA ALA D . n 
D 1 442 TYR 442 442 442 TYR TYR D . n 
D 1 443 ILE 443 443 443 ILE ILE D . n 
D 1 444 ALA 444 444 444 ALA ALA D . n 
D 1 445 LEU 445 445 445 LEU LEU D . n 
D 1 446 ARG 446 446 446 ARG ARG D . n 
D 1 447 ARG 447 447 447 ARG ARG D . n 
D 1 448 GLU 448 448 448 GLU GLU D . n 
D 1 449 GLU 449 449 449 GLU GLU D . n 
D 1 450 ASP 450 450 450 ASP ASP D . n 
D 1 451 ASP 451 451 451 ASP ASP D . n 
D 1 452 ARG 452 452 452 ARG ARG D . n 
D 1 453 VAL 453 453 453 VAL VAL D . n 
D 1 454 ARG 454 454 454 ARG ARG D . n 
D 1 455 MET 455 455 455 MET MET D . n 
D 1 456 THR 456 456 456 THR THR D . n 
D 1 457 PRO 457 457 457 PRO PRO D . n 
D 1 458 HIS 458 458 458 HIS HIS D . n 
D 1 459 PRO 459 459 459 PRO PRO D . n 
D 1 460 VAL 460 460 460 VAL VAL D . n 
D 1 461 GLU 461 461 461 GLU GLU D . n 
D 1 462 PHE 462 462 462 PHE PHE D . n 
D 1 463 GLU 463 463 463 GLU GLU D . n 
D 1 464 LEU 464 464 464 LEU LEU D . n 
D 1 465 TYR 465 465 465 TYR TYR D . n 
D 1 466 TYR 466 466 466 TYR TYR D . n 
D 1 467 SER 467 467 467 SER SER D . n 
D 1 468 VAL 468 468 468 VAL VAL D . n 
E 1 1   SER 1   1   1   SER SER E . n 
E 1 2   ALA 2   2   2   ALA ALA E . n 
E 1 3   GLU 3   3   3   GLU GLU E . n 
E 1 4   HIS 4   4   4   HIS HIS E . n 
E 1 5   VAL 5   5   5   VAL VAL E . n 
E 1 6   LEU 6   6   6   LEU LEU E . n 
E 1 7   THR 7   7   7   THR THR E . n 
E 1 8   MET 8   8   8   MET MET E . n 
E 1 9   LEU 9   9   9   LEU LEU E . n 
E 1 10  ASN 10  10  10  ASN ASN E . n 
E 1 11  GLU 11  11  11  GLU GLU E . n 
E 1 12  HIS 12  12  12  HIS HIS E . n 
E 1 13  GLU 13  13  13  GLU GLU E . n 
E 1 14  VAL 14  14  14  VAL VAL E . n 
E 1 15  LYS 15  15  15  LYS LYS E . n 
E 1 16  PHE 16  16  16  PHE PHE E . n 
E 1 17  VAL 17  17  17  VAL VAL E . n 
E 1 18  ASP 18  18  18  ASP ASP E . n 
E 1 19  LEU 19  19  19  LEU LEU E . n 
E 1 20  ARG 20  20  20  ARG ARG E . n 
E 1 21  PHE 21  21  21  PHE PHE E . n 
E 1 22  THR 22  22  22  THR THR E . n 
E 1 23  ASP 23  23  23  ASP ASP E . n 
E 1 24  THR 24  24  24  THR THR E . n 
E 1 25  LYS 25  25  25  LYS LYS E . n 
E 1 26  GLY 26  26  26  GLY GLY E . n 
E 1 27  LYS 27  27  27  LYS LYS E . n 
E 1 28  GLU 28  28  28  GLU GLU E . n 
E 1 29  GLN 29  29  29  GLN GLN E . n 
E 1 30  HIS 30  30  30  HIS HIS E . n 
E 1 31  VAL 31  31  31  VAL VAL E . n 
E 1 32  THR 32  32  32  THR THR E . n 
E 1 33  ILE 33  33  33  ILE ILE E . n 
E 1 34  PRO 34  34  34  PRO PRO E . n 
E 1 35  ALA 35  35  35  ALA ALA E . n 
E 1 36  HIS 36  36  36  HIS HIS E . n 
E 1 37  GLN 37  37  37  GLN GLN E . n 
E 1 38  VAL 38  38  38  VAL VAL E . n 
E 1 39  ASN 39  39  39  ASN ASN E . n 
E 1 40  ALA 40  40  40  ALA ALA E . n 
E 1 41  GLU 41  41  41  GLU GLU E . n 
E 1 42  PHE 42  42  42  PHE PHE E . n 
E 1 43  PHE 43  43  43  PHE PHE E . n 
E 1 44  GLU 44  44  44  GLU GLU E . n 
E 1 45  GLU 45  45  45  GLU GLU E . n 
E 1 46  GLY 46  46  46  GLY GLY E . n 
E 1 47  LYS 47  47  47  LYS LYS E . n 
E 1 48  MET 48  48  48  MET MET E . n 
E 1 49  PHE 49  49  49  PHE PHE E . n 
E 1 50  ASP 50  50  50  ASP ASP E . n 
E 1 51  GLY 51  51  51  GLY GLY E . n 
E 1 52  SER 52  52  52  SER SER E . n 
E 1 53  SER 53  53  53  SER SER E . n 
E 1 54  ILE 54  54  54  ILE ILE E . n 
E 1 55  GLY 55  55  55  GLY GLY E . n 
E 1 56  GLY 56  56  56  GLY GLY E . n 
E 1 57  TRP 57  57  57  TRP TRP E . n 
E 1 58  LYS 58  58  58  LYS LYS E . n 
E 1 59  GLY 59  59  59  GLY GLY E . n 
E 1 60  ILE 60  60  60  ILE ILE E . n 
E 1 61  ASN 61  61  61  ASN ASN E . n 
E 1 62  GLU 62  62  62  GLU GLU E . n 
E 1 63  SER 63  63  63  SER SER E . n 
E 1 64  ASP 64  64  64  ASP ASP E . n 
E 1 65  MET 65  65  65  MET MET E . n 
E 1 66  VAL 66  66  66  VAL VAL E . n 
E 1 67  LEU 67  67  67  LEU LEU E . n 
E 1 68  MET 68  68  68  MET MET E . n 
E 1 69  PRO 69  69  69  PRO PRO E . n 
E 1 70  ASP 70  70  70  ASP ASP E . n 
E 1 71  ALA 71  71  71  ALA ALA E . n 
E 1 72  SER 72  72  72  SER SER E . n 
E 1 73  THR 73  73  73  THR THR E . n 
E 1 74  ALA 74  74  74  ALA ALA E . n 
E 1 75  VAL 75  75  75  VAL VAL E . n 
E 1 76  ILE 76  76  76  ILE ILE E . n 
E 1 77  ASP 77  77  77  ASP ASP E . n 
E 1 78  PRO 78  78  78  PRO PRO E . n 
E 1 79  PHE 79  79  79  PHE PHE E . n 
E 1 80  PHE 80  80  80  PHE PHE E . n 
E 1 81  ALA 81  81  81  ALA ALA E . n 
E 1 82  ASP 82  82  82  ASP ASP E . n 
E 1 83  SER 83  83  83  SER SER E . n 
E 1 84  THR 84  84  84  THR THR E . n 
E 1 85  LEU 85  85  85  LEU LEU E . n 
E 1 86  ILE 86  86  86  ILE ILE E . n 
E 1 87  ILE 87  87  87  ILE ILE E . n 
E 1 88  ARG 88  88  88  ARG ARG E . n 
E 1 89  CYS 89  89  89  CYS CYS E . n 
E 1 90  ASP 90  90  90  ASP ASP E . n 
E 1 91  ILE 91  91  91  ILE ILE E . n 
E 1 92  LEU 92  92  92  LEU LEU E . n 
E 1 93  GLU 93  93  93  GLU GLU E . n 
E 1 94  PRO 94  94  94  PRO PRO E . n 
E 1 95  GLY 95  95  95  GLY GLY E . n 
E 1 96  THR 96  96  96  THR THR E . n 
E 1 97  LEU 97  97  97  LEU LEU E . n 
E 1 98  GLN 98  98  98  GLN GLN E . n 
E 1 99  GLY 99  99  99  GLY GLY E . n 
E 1 100 TYR 100 100 100 TYR TYR E . n 
E 1 101 ASP 101 101 101 ASP ASP E . n 
E 1 102 ARG 102 102 102 ARG ARG E . n 
E 1 103 ASP 103 103 103 ASP ASP E . n 
E 1 104 PRO 104 104 104 PRO PRO E . n 
E 1 105 ARG 105 105 105 ARG ARG E . n 
E 1 106 SER 106 106 106 SER SER E . n 
E 1 107 ILE 107 107 107 ILE ILE E . n 
E 1 108 ALA 108 108 108 ALA ALA E . n 
E 1 109 LYS 109 109 109 LYS LYS E . n 
E 1 110 ARG 110 110 110 ARG ARG E . n 
E 1 111 ALA 111 111 111 ALA ALA E . n 
E 1 112 GLU 112 112 112 GLU GLU E . n 
E 1 113 ASP 113 113 113 ASP ASP E . n 
E 1 114 TYR 114 114 114 TYR TYR E . n 
E 1 115 LEU 115 115 115 LEU LEU E . n 
E 1 116 ARG 116 116 116 ARG ARG E . n 
E 1 117 ALA 117 117 117 ALA ALA E . n 
E 1 118 THR 118 118 118 THR THR E . n 
E 1 119 GLY 119 119 119 GLY GLY E . n 
E 1 120 ILE 120 120 120 ILE ILE E . n 
E 1 121 ALA 121 121 121 ALA ALA E . n 
E 1 122 ASP 122 122 122 ASP ASP E . n 
E 1 123 THR 123 123 123 THR THR E . n 
E 1 124 VAL 124 124 124 VAL VAL E . n 
E 1 125 LEU 125 125 125 LEU LEU E . n 
E 1 126 PHE 126 126 126 PHE PHE E . n 
E 1 127 GLY 127 127 127 GLY GLY E . n 
E 1 128 PRO 128 128 128 PRO PRO E . n 
E 1 129 GLU 129 129 129 GLU GLU E . n 
E 1 130 PRO 130 130 130 PRO PRO E . n 
E 1 131 GLU 131 131 131 GLU GLU E . n 
E 1 132 PHE 132 132 132 PHE PHE E . n 
E 1 133 PHE 133 133 133 PHE PHE E . n 
E 1 134 LEU 134 134 134 LEU LEU E . n 
E 1 135 PHE 135 135 135 PHE PHE E . n 
E 1 136 ASP 136 136 136 ASP ASP E . n 
E 1 137 ASP 137 137 137 ASP ASP E . n 
E 1 138 ILE 138 138 138 ILE ILE E . n 
E 1 139 ARG 139 139 139 ARG ARG E . n 
E 1 140 PHE 140 140 140 PHE PHE E . n 
E 1 141 GLY 141 141 141 GLY GLY E . n 
E 1 142 ALA 142 142 142 ALA ALA E . n 
E 1 143 SER 143 143 143 SER SER E . n 
E 1 144 ILE 144 144 144 ILE ILE E . n 
E 1 145 SER 145 145 145 SER SER E . n 
E 1 146 GLY 146 146 146 GLY GLY E . n 
E 1 147 SER 147 147 147 SER SER E . n 
E 1 148 HIS 148 148 148 HIS HIS E . n 
E 1 149 VAL 149 149 149 VAL VAL E . n 
E 1 150 ALA 150 150 150 ALA ALA E . n 
E 1 151 ILE 151 151 151 ILE ILE E . n 
E 1 152 ASP 152 152 152 ASP ASP E . n 
E 1 153 ASP 153 153 153 ASP ASP E . n 
E 1 154 ILE 154 154 154 ILE ILE E . n 
E 1 155 GLU 155 155 155 GLU GLU E . n 
E 1 156 GLY 156 156 156 GLY GLY E . n 
E 1 157 ALA 157 157 157 ALA ALA E . n 
E 1 158 TRP 158 158 158 TRP TRP E . n 
E 1 159 ASN 159 159 159 ASN ASN E . n 
E 1 160 SER 160 160 160 SER SER E . n 
E 1 161 SER 161 161 161 SER SER E . n 
E 1 162 THR 162 162 162 THR THR E . n 
E 1 163 LYS 163 163 163 LYS LYS E . n 
E 1 164 TYR 164 164 164 TYR TYR E . n 
E 1 165 GLU 165 165 165 GLU GLU E . n 
E 1 166 GLY 166 166 166 GLY GLY E . n 
E 1 167 GLY 167 167 167 GLY GLY E . n 
E 1 168 ASN 168 168 168 ASN ASN E . n 
E 1 169 LYS 169 169 169 LYS LYS E . n 
E 1 170 GLY 170 170 170 GLY GLY E . n 
E 1 171 HIS 171 171 171 HIS HIS E . n 
E 1 172 ARG 172 172 172 ARG ARG E . n 
E 1 173 PRO 173 173 173 PRO PRO E . n 
E 1 174 GLY 174 174 174 GLY GLY E . n 
E 1 175 VAL 175 175 175 VAL VAL E . n 
E 1 176 LYS 176 176 176 LYS LYS E . n 
E 1 177 GLY 177 177 177 GLY GLY E . n 
E 1 178 GLY 178 178 178 GLY GLY E . n 
E 1 179 TYR 179 179 179 TYR TYR E . n 
E 1 180 PHE 180 180 180 PHE PHE E . n 
E 1 181 PRO 181 181 181 PRO PRO E . n 
E 1 182 VAL 182 182 182 VAL VAL E . n 
E 1 183 PRO 183 183 183 PRO PRO E . n 
E 1 184 PRO 184 184 184 PRO PRO E . n 
E 1 185 VAL 185 185 185 VAL VAL E . n 
E 1 186 ASP 186 186 186 ASP ASP E . n 
E 1 187 SER 187 187 187 SER SER E . n 
E 1 188 ALA 188 188 188 ALA ALA E . n 
E 1 189 GLN 189 189 189 GLN GLN E . n 
E 1 190 ASP 190 190 190 ASP ASP E . n 
E 1 191 ILE 191 191 191 ILE ILE E . n 
E 1 192 ARG 192 192 192 ARG ARG E . n 
E 1 193 SER 193 193 193 SER SER E . n 
E 1 194 GLU 194 194 194 GLU GLU E . n 
E 1 195 MET 195 195 195 MET MET E . n 
E 1 196 CYS 196 196 196 CYS CYS E . n 
E 1 197 LEU 197 197 197 LEU LEU E . n 
E 1 198 VAL 198 198 198 VAL VAL E . n 
E 1 199 MET 199 199 199 MET MET E . n 
E 1 200 GLU 200 200 200 GLU GLU E . n 
E 1 201 GLN 201 201 201 GLN GLN E . n 
E 1 202 MET 202 202 202 MET MET E . n 
E 1 203 GLY 203 203 203 GLY GLY E . n 
E 1 204 LEU 204 204 204 LEU LEU E . n 
E 1 205 VAL 205 205 205 VAL VAL E . n 
E 1 206 VAL 206 206 206 VAL VAL E . n 
E 1 207 GLU 207 207 207 GLU GLU E . n 
E 1 208 ALA 208 208 208 ALA ALA E . n 
E 1 209 HIS 209 209 209 HIS HIS E . n 
E 1 210 HIS 210 210 210 HIS HIS E . n 
E 1 211 HIS 211 211 211 HIS HIS E . n 
E 1 212 GLU 212 212 212 GLU GLU E . n 
E 1 213 VAL 213 213 213 VAL VAL E . n 
E 1 214 ALA 214 214 214 ALA ALA E . n 
E 1 215 THR 215 215 215 THR THR E . n 
E 1 216 ALA 216 216 216 ALA ALA E . n 
E 1 217 GLY 217 217 217 GLY GLY E . n 
E 1 218 GLN 218 218 218 GLN GLN E . n 
E 1 219 ASN 219 219 219 ASN ASN E . n 
E 1 220 GLU 220 220 220 GLU GLU E . n 
E 1 221 VAL 221 221 221 VAL VAL E . n 
E 1 222 ALA 222 222 222 ALA ALA E . n 
E 1 223 THR 223 223 223 THR THR E . n 
E 1 224 ARG 224 224 224 ARG ARG E . n 
E 1 225 PHE 225 225 225 PHE PHE E . n 
E 1 226 ASN 226 226 226 ASN ASN E . n 
E 1 227 THR 227 227 227 THR THR E . n 
E 1 228 MET 228 228 228 MET MET E . n 
E 1 229 THR 229 229 229 THR THR E . n 
E 1 230 LYS 230 230 230 LYS LYS E . n 
E 1 231 LYS 231 231 231 LYS LYS E . n 
E 1 232 ALA 232 232 232 ALA ALA E . n 
E 1 233 ASP 233 233 233 ASP ASP E . n 
E 1 234 GLU 234 234 234 GLU GLU E . n 
E 1 235 ILE 235 235 235 ILE ILE E . n 
E 1 236 GLN 236 236 236 GLN GLN E . n 
E 1 237 ILE 237 237 237 ILE ILE E . n 
E 1 238 TYR 238 238 238 TYR TYR E . n 
E 1 239 LYS 239 239 239 LYS LYS E . n 
E 1 240 TYR 240 240 240 TYR TYR E . n 
E 1 241 VAL 241 241 241 VAL VAL E . n 
E 1 242 VAL 242 242 242 VAL VAL E . n 
E 1 243 HIS 243 243 243 HIS HIS E . n 
E 1 244 ASN 244 244 244 ASN ASN E . n 
E 1 245 VAL 245 245 245 VAL VAL E . n 
E 1 246 ALA 246 246 246 ALA ALA E . n 
E 1 247 HIS 247 247 247 HIS HIS E . n 
E 1 248 ARG 248 248 248 ARG ARG E . n 
E 1 249 PHE 249 249 249 PHE PHE E . n 
E 1 250 GLY 250 250 250 GLY GLY E . n 
E 1 251 LYS 251 251 251 LYS LYS E . n 
E 1 252 THR 252 252 252 THR THR E . n 
E 1 253 ALA 253 253 253 ALA ALA E . n 
E 1 254 THR 254 254 254 THR THR E . n 
E 1 255 PHE 255 255 255 PHE PHE E . n 
E 1 256 MET 256 256 256 MET MET E . n 
E 1 257 PRO 257 257 257 PRO PRO E . n 
E 1 258 LYS 258 258 258 LYS LYS E . n 
E 1 259 PRO 259 259 259 PRO PRO E . n 
E 1 260 MET 260 260 260 MET MET E . n 
E 1 261 PHE 261 261 261 PHE PHE E . n 
E 1 262 GLY 262 262 262 GLY GLY E . n 
E 1 263 ASP 263 263 263 ASP ASP E . n 
E 1 264 ASN 264 264 264 ASN ASN E . n 
E 1 265 GLY 265 265 265 GLY GLY E . n 
E 1 266 SER 266 266 266 SER SER E . n 
E 1 267 GLY 267 267 267 GLY GLY E . n 
E 1 268 MET 268 268 268 MET MET E . n 
E 1 269 HIS 269 269 269 HIS HIS E . n 
E 1 270 CYS 270 270 270 CYS CYS E . n 
E 1 271 HIS 271 271 271 HIS HIS E . n 
E 1 272 MET 272 272 272 MET MET E . n 
E 1 273 SER 273 273 273 SER SER E . n 
E 1 274 LEU 274 274 274 LEU LEU E . n 
E 1 275 ALA 275 275 275 ALA ALA E . n 
E 1 276 LYS 276 276 276 LYS LYS E . n 
E 1 277 ASN 277 277 277 ASN ASN E . n 
E 1 278 GLY 278 278 278 GLY GLY E . n 
E 1 279 THR 279 279 279 THR THR E . n 
E 1 280 ASN 280 280 280 ASN ASN E . n 
E 1 281 LEU 281 281 281 LEU LEU E . n 
E 1 282 PHE 282 282 282 PHE PHE E . n 
E 1 283 SER 283 283 283 SER SER E . n 
E 1 284 GLY 284 284 284 GLY GLY E . n 
E 1 285 ASP 285 285 285 ASP ASP E . n 
E 1 286 LYS 286 286 286 LYS LYS E . n 
E 1 287 TYR 287 287 287 TYR TYR E . n 
E 1 288 ALA 288 288 288 ALA ALA E . n 
E 1 289 GLY 289 289 289 GLY GLY E . n 
E 1 290 LEU 290 290 290 LEU LEU E . n 
E 1 291 SER 291 291 291 SER SER E . n 
E 1 292 GLU 292 292 292 GLU GLU E . n 
E 1 293 GLN 293 293 293 GLN GLN E . n 
E 1 294 ALA 294 294 294 ALA ALA E . n 
E 1 295 LEU 295 295 295 LEU LEU E . n 
E 1 296 TYR 296 296 296 TYR TYR E . n 
E 1 297 TYR 297 297 297 TYR TYR E . n 
E 1 298 ILE 298 298 298 ILE ILE E . n 
E 1 299 GLY 299 299 299 GLY GLY E . n 
E 1 300 GLY 300 300 300 GLY GLY E . n 
E 1 301 VAL 301 301 301 VAL VAL E . n 
E 1 302 ILE 302 302 302 ILE ILE E . n 
E 1 303 LYS 303 303 303 LYS LYS E . n 
E 1 304 HIS 304 304 304 HIS HIS E . n 
E 1 305 ALA 305 305 305 ALA ALA E . n 
E 1 306 LYS 306 306 306 LYS LYS E . n 
E 1 307 ALA 307 307 307 ALA ALA E . n 
E 1 308 ILE 308 308 308 ILE ILE E . n 
E 1 309 ASN 309 309 309 ASN ASN E . n 
E 1 310 ALA 310 310 310 ALA ALA E . n 
E 1 311 LEU 311 311 311 LEU LEU E . n 
E 1 312 ALA 312 312 312 ALA ALA E . n 
E 1 313 ASN 313 313 313 ASN ASN E . n 
E 1 314 PRO 314 314 314 PRO PRO E . n 
E 1 315 THR 315 315 315 THR THR E . n 
E 1 316 THR 316 316 316 THR THR E . n 
E 1 317 ASN 317 317 317 ASN ASN E . n 
E 1 318 SER 318 318 318 SER SER E . n 
E 1 319 TYR 319 319 319 TYR TYR E . n 
E 1 320 LYS 320 320 320 LYS LYS E . n 
E 1 321 ARG 321 321 321 ARG ARG E . n 
E 1 322 LEU 322 322 322 LEU LEU E . n 
E 1 323 VAL 323 323 323 VAL VAL E . n 
E 1 324 PRO 324 324 324 PRO PRO E . n 
E 1 325 GLY 325 325 325 GLY GLY E . n 
E 1 326 TYR 326 326 326 TYR TYR E . n 
E 1 327 GLU 327 327 327 GLU GLU E . n 
E 1 328 ALA 328 328 328 ALA ALA E . n 
E 1 329 PRO 329 329 329 PRO PRO E . n 
E 1 330 VAL 330 330 330 VAL VAL E . n 
E 1 331 MET 331 331 331 MET MET E . n 
E 1 332 LEU 332 332 332 LEU LEU E . n 
E 1 333 ALA 333 333 333 ALA ALA E . n 
E 1 334 TYR 334 334 334 TYR TYR E . n 
E 1 335 SER 335 335 335 SER SER E . n 
E 1 336 ALA 336 336 336 ALA ALA E . n 
E 1 337 ARG 337 337 337 ARG ARG E . n 
E 1 338 ASN 338 338 338 ASN ASN E . n 
E 1 339 ARG 339 339 339 ARG ARG E . n 
E 1 340 SER 340 340 340 SER SER E . n 
E 1 341 ALA 341 341 341 ALA ALA E . n 
E 1 342 SER 342 342 342 SER SER E . n 
E 1 343 ILE 343 343 343 ILE ILE E . n 
E 1 344 ARG 344 344 344 ARG ARG E . n 
E 1 345 ILE 345 345 345 ILE ILE E . n 
E 1 346 PRO 346 346 346 PRO PRO E . n 
E 1 347 VAL 347 347 347 VAL VAL E . n 
E 1 348 VAL 348 348 348 VAL VAL E . n 
E 1 349 ALA 349 349 349 ALA ALA E . n 
E 1 350 SER 350 350 350 SER SER E . n 
E 1 351 PRO 351 351 351 PRO PRO E . n 
E 1 352 LYS 352 352 352 LYS LYS E . n 
E 1 353 ALA 353 353 353 ALA ALA E . n 
E 1 354 ARG 354 354 354 ARG ARG E . n 
E 1 355 ARG 355 355 355 ARG ARG E . n 
E 1 356 ILE 356 356 356 ILE ILE E . n 
E 1 357 GLU 357 357 357 GLU GLU E . n 
E 1 358 VAL 358 358 358 VAL VAL E . n 
E 1 359 ARG 359 359 359 ARG ARG E . n 
E 1 360 PHE 360 360 360 PHE PHE E . n 
E 1 361 PRO 361 361 361 PRO PRO E . n 
E 1 362 ASP 362 362 362 ASP ASP E . n 
E 1 363 PRO 363 363 363 PRO PRO E . n 
E 1 364 ALA 364 364 364 ALA ALA E . n 
E 1 365 ALA 365 365 365 ALA ALA E . n 
E 1 366 ASN 366 366 366 ASN ASN E . n 
E 1 367 PRO 367 367 367 PRO PRO E . n 
E 1 368 TYR 368 368 368 TYR TYR E . n 
E 1 369 LEU 369 369 369 LEU LEU E . n 
E 1 370 CYS 370 370 370 CYS CYS E . n 
E 1 371 PHE 371 371 371 PHE PHE E . n 
E 1 372 ALA 372 372 372 ALA ALA E . n 
E 1 373 ALA 373 373 373 ALA ALA E . n 
E 1 374 LEU 374 374 374 LEU LEU E . n 
E 1 375 LEU 375 375 375 LEU LEU E . n 
E 1 376 MET 376 376 376 MET MET E . n 
E 1 377 ALA 377 377 377 ALA ALA E . n 
E 1 378 GLY 378 378 378 GLY GLY E . n 
E 1 379 LEU 379 379 379 LEU LEU E . n 
E 1 380 ASP 380 380 380 ASP ASP E . n 
E 1 381 GLY 381 381 381 GLY GLY E . n 
E 1 382 ILE 382 382 382 ILE ILE E . n 
E 1 383 LYS 383 383 383 LYS LYS E . n 
E 1 384 ASN 384 384 384 ASN ASN E . n 
E 1 385 LYS 385 385 385 LYS LYS E . n 
E 1 386 ILE 386 386 386 ILE ILE E . n 
E 1 387 HIS 387 387 387 HIS HIS E . n 
E 1 388 PRO 388 388 388 PRO PRO E . n 
E 1 389 GLY 389 389 389 GLY GLY E . n 
E 1 390 GLU 390 390 390 GLU GLU E . n 
E 1 391 PRO 391 391 391 PRO PRO E . n 
E 1 392 MET 392 392 392 MET MET E . n 
E 1 393 ASP 393 393 393 ASP ASP E . n 
E 1 394 LYS 394 394 394 LYS LYS E . n 
E 1 395 ASN 395 395 395 ASN ASN E . n 
E 1 396 LEU 396 396 396 LEU LEU E . n 
E 1 397 TYR 397 397 397 TYR TYR E . n 
E 1 398 ASP 398 398 398 ASP ASP E . n 
E 1 399 LEU 399 399 399 LEU LEU E . n 
E 1 400 PRO 400 400 400 PRO PRO E . n 
E 1 401 PRO 401 401 401 PRO PRO E . n 
E 1 402 GLU 402 402 402 GLU GLU E . n 
E 1 403 GLU 403 403 403 GLU GLU E . n 
E 1 404 ALA 404 404 404 ALA ALA E . n 
E 1 405 LYS 405 405 405 LYS LYS E . n 
E 1 406 GLU 406 406 406 GLU GLU E . n 
E 1 407 ILE 407 407 407 ILE ILE E . n 
E 1 408 PRO 408 408 408 PRO PRO E . n 
E 1 409 GLN 409 409 409 GLN GLN E . n 
E 1 410 VAL 410 410 410 VAL VAL E . n 
E 1 411 ALA 411 411 411 ALA ALA E . n 
E 1 412 GLY 412 412 412 GLY GLY E . n 
E 1 413 SER 413 413 413 SER SER E . n 
E 1 414 LEU 414 414 414 LEU LEU E . n 
E 1 415 GLU 415 415 415 GLU GLU E . n 
E 1 416 GLU 416 416 416 GLU GLU E . n 
E 1 417 ALA 417 417 417 ALA ALA E . n 
E 1 418 LEU 418 418 418 LEU LEU E . n 
E 1 419 ASN 419 419 419 ASN ASN E . n 
E 1 420 ALA 420 420 420 ALA ALA E . n 
E 1 421 LEU 421 421 421 LEU LEU E . n 
E 1 422 ASP 422 422 422 ASP ASP E . n 
E 1 423 LEU 423 423 423 LEU LEU E . n 
E 1 424 ASP 424 424 424 ASP ASP E . n 
E 1 425 ARG 425 425 425 ARG ARG E . n 
E 1 426 GLU 426 426 426 GLU GLU E . n 
E 1 427 PHE 427 427 427 PHE PHE E . n 
E 1 428 LEU 428 428 428 LEU LEU E . n 
E 1 429 LYS 429 429 429 LYS LYS E . n 
E 1 430 ALA 430 430 430 ALA ALA E . n 
E 1 431 GLY 431 431 431 GLY GLY E . n 
E 1 432 GLY 432 432 432 GLY GLY E . n 
E 1 433 VAL 433 433 433 VAL VAL E . n 
E 1 434 PHE 434 434 434 PHE PHE E . n 
E 1 435 THR 435 435 435 THR THR E . n 
E 1 436 ASP 436 436 436 ASP ASP E . n 
E 1 437 GLU 437 437 437 GLU GLU E . n 
E 1 438 ALA 438 438 438 ALA ALA E . n 
E 1 439 ILE 439 439 439 ILE ILE E . n 
E 1 440 ASP 440 440 440 ASP ASP E . n 
E 1 441 ALA 441 441 441 ALA ALA E . n 
E 1 442 TYR 442 442 442 TYR TYR E . n 
E 1 443 ILE 443 443 443 ILE ILE E . n 
E 1 444 ALA 444 444 444 ALA ALA E . n 
E 1 445 LEU 445 445 445 LEU LEU E . n 
E 1 446 ARG 446 446 446 ARG ARG E . n 
E 1 447 ARG 447 447 447 ARG ARG E . n 
E 1 448 GLU 448 448 448 GLU GLU E . n 
E 1 449 GLU 449 449 449 GLU GLU E . n 
E 1 450 ASP 450 450 450 ASP ASP E . n 
E 1 451 ASP 451 451 451 ASP ASP E . n 
E 1 452 ARG 452 452 452 ARG ARG E . n 
E 1 453 VAL 453 453 453 VAL VAL E . n 
E 1 454 ARG 454 454 454 ARG ARG E . n 
E 1 455 MET 455 455 455 MET MET E . n 
E 1 456 THR 456 456 456 THR THR E . n 
E 1 457 PRO 457 457 457 PRO PRO E . n 
E 1 458 HIS 458 458 458 HIS HIS E . n 
E 1 459 PRO 459 459 459 PRO PRO E . n 
E 1 460 VAL 460 460 460 VAL VAL E . n 
E 1 461 GLU 461 461 461 GLU GLU E . n 
E 1 462 PHE 462 462 462 PHE PHE E . n 
E 1 463 GLU 463 463 463 GLU GLU E . n 
E 1 464 LEU 464 464 464 LEU LEU E . n 
E 1 465 TYR 465 465 465 TYR TYR E . n 
E 1 466 TYR 466 466 466 TYR TYR E . n 
E 1 467 SER 467 467 467 SER SER E . n 
E 1 468 VAL 468 468 468 VAL VAL E . n 
F 1 1   SER 1   1   1   SER SER F . n 
F 1 2   ALA 2   2   2   ALA ALA F . n 
F 1 3   GLU 3   3   3   GLU GLU F . n 
F 1 4   HIS 4   4   4   HIS HIS F . n 
F 1 5   VAL 5   5   5   VAL VAL F . n 
F 1 6   LEU 6   6   6   LEU LEU F . n 
F 1 7   THR 7   7   7   THR THR F . n 
F 1 8   MET 8   8   8   MET MET F . n 
F 1 9   LEU 9   9   9   LEU LEU F . n 
F 1 10  ASN 10  10  10  ASN ASN F . n 
F 1 11  GLU 11  11  11  GLU GLU F . n 
F 1 12  HIS 12  12  12  HIS HIS F . n 
F 1 13  GLU 13  13  13  GLU GLU F . n 
F 1 14  VAL 14  14  14  VAL VAL F . n 
F 1 15  LYS 15  15  15  LYS LYS F . n 
F 1 16  PHE 16  16  16  PHE PHE F . n 
F 1 17  VAL 17  17  17  VAL VAL F . n 
F 1 18  ASP 18  18  18  ASP ASP F . n 
F 1 19  LEU 19  19  19  LEU LEU F . n 
F 1 20  ARG 20  20  20  ARG ARG F . n 
F 1 21  PHE 21  21  21  PHE PHE F . n 
F 1 22  THR 22  22  22  THR THR F . n 
F 1 23  ASP 23  23  23  ASP ASP F . n 
F 1 24  THR 24  24  24  THR THR F . n 
F 1 25  LYS 25  25  25  LYS LYS F . n 
F 1 26  GLY 26  26  26  GLY GLY F . n 
F 1 27  LYS 27  27  27  LYS LYS F . n 
F 1 28  GLU 28  28  28  GLU GLU F . n 
F 1 29  GLN 29  29  29  GLN GLN F . n 
F 1 30  HIS 30  30  30  HIS HIS F . n 
F 1 31  VAL 31  31  31  VAL VAL F . n 
F 1 32  THR 32  32  32  THR THR F . n 
F 1 33  ILE 33  33  33  ILE ILE F . n 
F 1 34  PRO 34  34  34  PRO PRO F . n 
F 1 35  ALA 35  35  35  ALA ALA F . n 
F 1 36  HIS 36  36  36  HIS HIS F . n 
F 1 37  GLN 37  37  37  GLN GLN F . n 
F 1 38  VAL 38  38  38  VAL VAL F . n 
F 1 39  ASN 39  39  39  ASN ASN F . n 
F 1 40  ALA 40  40  40  ALA ALA F . n 
F 1 41  GLU 41  41  41  GLU GLU F . n 
F 1 42  PHE 42  42  42  PHE PHE F . n 
F 1 43  PHE 43  43  43  PHE PHE F . n 
F 1 44  GLU 44  44  44  GLU GLU F . n 
F 1 45  GLU 45  45  45  GLU GLU F . n 
F 1 46  GLY 46  46  46  GLY GLY F . n 
F 1 47  LYS 47  47  47  LYS LYS F . n 
F 1 48  MET 48  48  48  MET MET F . n 
F 1 49  PHE 49  49  49  PHE PHE F . n 
F 1 50  ASP 50  50  50  ASP ASP F . n 
F 1 51  GLY 51  51  51  GLY GLY F . n 
F 1 52  SER 52  52  52  SER SER F . n 
F 1 53  SER 53  53  53  SER SER F . n 
F 1 54  ILE 54  54  54  ILE ILE F . n 
F 1 55  GLY 55  55  55  GLY GLY F . n 
F 1 56  GLY 56  56  56  GLY GLY F . n 
F 1 57  TRP 57  57  57  TRP TRP F . n 
F 1 58  LYS 58  58  58  LYS LYS F . n 
F 1 59  GLY 59  59  59  GLY GLY F . n 
F 1 60  ILE 60  60  60  ILE ILE F . n 
F 1 61  ASN 61  61  61  ASN ASN F . n 
F 1 62  GLU 62  62  62  GLU GLU F . n 
F 1 63  SER 63  63  63  SER SER F . n 
F 1 64  ASP 64  64  64  ASP ASP F . n 
F 1 65  MET 65  65  65  MET MET F . n 
F 1 66  VAL 66  66  66  VAL VAL F . n 
F 1 67  LEU 67  67  67  LEU LEU F . n 
F 1 68  MET 68  68  68  MET MET F . n 
F 1 69  PRO 69  69  69  PRO PRO F . n 
F 1 70  ASP 70  70  70  ASP ASP F . n 
F 1 71  ALA 71  71  71  ALA ALA F . n 
F 1 72  SER 72  72  72  SER SER F . n 
F 1 73  THR 73  73  73  THR THR F . n 
F 1 74  ALA 74  74  74  ALA ALA F . n 
F 1 75  VAL 75  75  75  VAL VAL F . n 
F 1 76  ILE 76  76  76  ILE ILE F . n 
F 1 77  ASP 77  77  77  ASP ASP F . n 
F 1 78  PRO 78  78  78  PRO PRO F . n 
F 1 79  PHE 79  79  79  PHE PHE F . n 
F 1 80  PHE 80  80  80  PHE PHE F . n 
F 1 81  ALA 81  81  81  ALA ALA F . n 
F 1 82  ASP 82  82  82  ASP ASP F . n 
F 1 83  SER 83  83  83  SER SER F . n 
F 1 84  THR 84  84  84  THR THR F . n 
F 1 85  LEU 85  85  85  LEU LEU F . n 
F 1 86  ILE 86  86  86  ILE ILE F . n 
F 1 87  ILE 87  87  87  ILE ILE F . n 
F 1 88  ARG 88  88  88  ARG ARG F . n 
F 1 89  CYS 89  89  89  CYS CYS F . n 
F 1 90  ASP 90  90  90  ASP ASP F . n 
F 1 91  ILE 91  91  91  ILE ILE F . n 
F 1 92  LEU 92  92  92  LEU LEU F . n 
F 1 93  GLU 93  93  93  GLU GLU F . n 
F 1 94  PRO 94  94  94  PRO PRO F . n 
F 1 95  GLY 95  95  95  GLY GLY F . n 
F 1 96  THR 96  96  96  THR THR F . n 
F 1 97  LEU 97  97  97  LEU LEU F . n 
F 1 98  GLN 98  98  98  GLN GLN F . n 
F 1 99  GLY 99  99  99  GLY GLY F . n 
F 1 100 TYR 100 100 100 TYR TYR F . n 
F 1 101 ASP 101 101 101 ASP ASP F . n 
F 1 102 ARG 102 102 102 ARG ARG F . n 
F 1 103 ASP 103 103 103 ASP ASP F . n 
F 1 104 PRO 104 104 104 PRO PRO F . n 
F 1 105 ARG 105 105 105 ARG ARG F . n 
F 1 106 SER 106 106 106 SER SER F . n 
F 1 107 ILE 107 107 107 ILE ILE F . n 
F 1 108 ALA 108 108 108 ALA ALA F . n 
F 1 109 LYS 109 109 109 LYS LYS F . n 
F 1 110 ARG 110 110 110 ARG ARG F . n 
F 1 111 ALA 111 111 111 ALA ALA F . n 
F 1 112 GLU 112 112 112 GLU GLU F . n 
F 1 113 ASP 113 113 113 ASP ASP F . n 
F 1 114 TYR 114 114 114 TYR TYR F . n 
F 1 115 LEU 115 115 115 LEU LEU F . n 
F 1 116 ARG 116 116 116 ARG ARG F . n 
F 1 117 ALA 117 117 117 ALA ALA F . n 
F 1 118 THR 118 118 118 THR THR F . n 
F 1 119 GLY 119 119 119 GLY GLY F . n 
F 1 120 ILE 120 120 120 ILE ILE F . n 
F 1 121 ALA 121 121 121 ALA ALA F . n 
F 1 122 ASP 122 122 122 ASP ASP F . n 
F 1 123 THR 123 123 123 THR THR F . n 
F 1 124 VAL 124 124 124 VAL VAL F . n 
F 1 125 LEU 125 125 125 LEU LEU F . n 
F 1 126 PHE 126 126 126 PHE PHE F . n 
F 1 127 GLY 127 127 127 GLY GLY F . n 
F 1 128 PRO 128 128 128 PRO PRO F . n 
F 1 129 GLU 129 129 129 GLU GLU F . n 
F 1 130 PRO 130 130 130 PRO PRO F . n 
F 1 131 GLU 131 131 131 GLU GLU F . n 
F 1 132 PHE 132 132 132 PHE PHE F . n 
F 1 133 PHE 133 133 133 PHE PHE F . n 
F 1 134 LEU 134 134 134 LEU LEU F . n 
F 1 135 PHE 135 135 135 PHE PHE F . n 
F 1 136 ASP 136 136 136 ASP ASP F . n 
F 1 137 ASP 137 137 137 ASP ASP F . n 
F 1 138 ILE 138 138 138 ILE ILE F . n 
F 1 139 ARG 139 139 139 ARG ARG F . n 
F 1 140 PHE 140 140 140 PHE PHE F . n 
F 1 141 GLY 141 141 141 GLY GLY F . n 
F 1 142 ALA 142 142 142 ALA ALA F . n 
F 1 143 SER 143 143 143 SER SER F . n 
F 1 144 ILE 144 144 144 ILE ILE F . n 
F 1 145 SER 145 145 145 SER SER F . n 
F 1 146 GLY 146 146 146 GLY GLY F . n 
F 1 147 SER 147 147 147 SER SER F . n 
F 1 148 HIS 148 148 148 HIS HIS F . n 
F 1 149 VAL 149 149 149 VAL VAL F . n 
F 1 150 ALA 150 150 150 ALA ALA F . n 
F 1 151 ILE 151 151 151 ILE ILE F . n 
F 1 152 ASP 152 152 152 ASP ASP F . n 
F 1 153 ASP 153 153 153 ASP ASP F . n 
F 1 154 ILE 154 154 154 ILE ILE F . n 
F 1 155 GLU 155 155 155 GLU GLU F . n 
F 1 156 GLY 156 156 156 GLY GLY F . n 
F 1 157 ALA 157 157 157 ALA ALA F . n 
F 1 158 TRP 158 158 158 TRP TRP F . n 
F 1 159 ASN 159 159 159 ASN ASN F . n 
F 1 160 SER 160 160 160 SER SER F . n 
F 1 161 SER 161 161 161 SER SER F . n 
F 1 162 THR 162 162 162 THR THR F . n 
F 1 163 LYS 163 163 163 LYS LYS F . n 
F 1 164 TYR 164 164 164 TYR TYR F . n 
F 1 165 GLU 165 165 165 GLU GLU F . n 
F 1 166 GLY 166 166 166 GLY GLY F . n 
F 1 167 GLY 167 167 167 GLY GLY F . n 
F 1 168 ASN 168 168 168 ASN ASN F . n 
F 1 169 LYS 169 169 169 LYS LYS F . n 
F 1 170 GLY 170 170 170 GLY GLY F . n 
F 1 171 HIS 171 171 171 HIS HIS F . n 
F 1 172 ARG 172 172 172 ARG ARG F . n 
F 1 173 PRO 173 173 173 PRO PRO F . n 
F 1 174 GLY 174 174 174 GLY GLY F . n 
F 1 175 VAL 175 175 175 VAL VAL F . n 
F 1 176 LYS 176 176 176 LYS LYS F . n 
F 1 177 GLY 177 177 177 GLY GLY F . n 
F 1 178 GLY 178 178 178 GLY GLY F . n 
F 1 179 TYR 179 179 179 TYR TYR F . n 
F 1 180 PHE 180 180 180 PHE PHE F . n 
F 1 181 PRO 181 181 181 PRO PRO F . n 
F 1 182 VAL 182 182 182 VAL VAL F . n 
F 1 183 PRO 183 183 183 PRO PRO F . n 
F 1 184 PRO 184 184 184 PRO PRO F . n 
F 1 185 VAL 185 185 185 VAL VAL F . n 
F 1 186 ASP 186 186 186 ASP ASP F . n 
F 1 187 SER 187 187 187 SER SER F . n 
F 1 188 ALA 188 188 188 ALA ALA F . n 
F 1 189 GLN 189 189 189 GLN GLN F . n 
F 1 190 ASP 190 190 190 ASP ASP F . n 
F 1 191 ILE 191 191 191 ILE ILE F . n 
F 1 192 ARG 192 192 192 ARG ARG F . n 
F 1 193 SER 193 193 193 SER SER F . n 
F 1 194 GLU 194 194 194 GLU GLU F . n 
F 1 195 MET 195 195 195 MET MET F . n 
F 1 196 CYS 196 196 196 CYS CYS F . n 
F 1 197 LEU 197 197 197 LEU LEU F . n 
F 1 198 VAL 198 198 198 VAL VAL F . n 
F 1 199 MET 199 199 199 MET MET F . n 
F 1 200 GLU 200 200 200 GLU GLU F . n 
F 1 201 GLN 201 201 201 GLN GLN F . n 
F 1 202 MET 202 202 202 MET MET F . n 
F 1 203 GLY 203 203 203 GLY GLY F . n 
F 1 204 LEU 204 204 204 LEU LEU F . n 
F 1 205 VAL 205 205 205 VAL VAL F . n 
F 1 206 VAL 206 206 206 VAL VAL F . n 
F 1 207 GLU 207 207 207 GLU GLU F . n 
F 1 208 ALA 208 208 208 ALA ALA F . n 
F 1 209 HIS 209 209 209 HIS HIS F . n 
F 1 210 HIS 210 210 210 HIS HIS F . n 
F 1 211 HIS 211 211 211 HIS HIS F . n 
F 1 212 GLU 212 212 212 GLU GLU F . n 
F 1 213 VAL 213 213 213 VAL VAL F . n 
F 1 214 ALA 214 214 214 ALA ALA F . n 
F 1 215 THR 215 215 215 THR THR F . n 
F 1 216 ALA 216 216 216 ALA ALA F . n 
F 1 217 GLY 217 217 217 GLY GLY F . n 
F 1 218 GLN 218 218 218 GLN GLN F . n 
F 1 219 ASN 219 219 219 ASN ASN F . n 
F 1 220 GLU 220 220 220 GLU GLU F . n 
F 1 221 VAL 221 221 221 VAL VAL F . n 
F 1 222 ALA 222 222 222 ALA ALA F . n 
F 1 223 THR 223 223 223 THR THR F . n 
F 1 224 ARG 224 224 224 ARG ARG F . n 
F 1 225 PHE 225 225 225 PHE PHE F . n 
F 1 226 ASN 226 226 226 ASN ASN F . n 
F 1 227 THR 227 227 227 THR THR F . n 
F 1 228 MET 228 228 228 MET MET F . n 
F 1 229 THR 229 229 229 THR THR F . n 
F 1 230 LYS 230 230 230 LYS LYS F . n 
F 1 231 LYS 231 231 231 LYS LYS F . n 
F 1 232 ALA 232 232 232 ALA ALA F . n 
F 1 233 ASP 233 233 233 ASP ASP F . n 
F 1 234 GLU 234 234 234 GLU GLU F . n 
F 1 235 ILE 235 235 235 ILE ILE F . n 
F 1 236 GLN 236 236 236 GLN GLN F . n 
F 1 237 ILE 237 237 237 ILE ILE F . n 
F 1 238 TYR 238 238 238 TYR TYR F . n 
F 1 239 LYS 239 239 239 LYS LYS F . n 
F 1 240 TYR 240 240 240 TYR TYR F . n 
F 1 241 VAL 241 241 241 VAL VAL F . n 
F 1 242 VAL 242 242 242 VAL VAL F . n 
F 1 243 HIS 243 243 243 HIS HIS F . n 
F 1 244 ASN 244 244 244 ASN ASN F . n 
F 1 245 VAL 245 245 245 VAL VAL F . n 
F 1 246 ALA 246 246 246 ALA ALA F . n 
F 1 247 HIS 247 247 247 HIS HIS F . n 
F 1 248 ARG 248 248 248 ARG ARG F . n 
F 1 249 PHE 249 249 249 PHE PHE F . n 
F 1 250 GLY 250 250 250 GLY GLY F . n 
F 1 251 LYS 251 251 251 LYS LYS F . n 
F 1 252 THR 252 252 252 THR THR F . n 
F 1 253 ALA 253 253 253 ALA ALA F . n 
F 1 254 THR 254 254 254 THR THR F . n 
F 1 255 PHE 255 255 255 PHE PHE F . n 
F 1 256 MET 256 256 256 MET MET F . n 
F 1 257 PRO 257 257 257 PRO PRO F . n 
F 1 258 LYS 258 258 258 LYS LYS F . n 
F 1 259 PRO 259 259 259 PRO PRO F . n 
F 1 260 MET 260 260 260 MET MET F . n 
F 1 261 PHE 261 261 261 PHE PHE F . n 
F 1 262 GLY 262 262 262 GLY GLY F . n 
F 1 263 ASP 263 263 263 ASP ASP F . n 
F 1 264 ASN 264 264 264 ASN ASN F . n 
F 1 265 GLY 265 265 265 GLY GLY F . n 
F 1 266 SER 266 266 266 SER SER F . n 
F 1 267 GLY 267 267 267 GLY GLY F . n 
F 1 268 MET 268 268 268 MET MET F . n 
F 1 269 HIS 269 269 269 HIS HIS F . n 
F 1 270 CYS 270 270 270 CYS CYS F . n 
F 1 271 HIS 271 271 271 HIS HIS F . n 
F 1 272 MET 272 272 272 MET MET F . n 
F 1 273 SER 273 273 273 SER SER F . n 
F 1 274 LEU 274 274 274 LEU LEU F . n 
F 1 275 ALA 275 275 275 ALA ALA F . n 
F 1 276 LYS 276 276 276 LYS LYS F . n 
F 1 277 ASN 277 277 277 ASN ASN F . n 
F 1 278 GLY 278 278 278 GLY GLY F . n 
F 1 279 THR 279 279 279 THR THR F . n 
F 1 280 ASN 280 280 280 ASN ASN F . n 
F 1 281 LEU 281 281 281 LEU LEU F . n 
F 1 282 PHE 282 282 282 PHE PHE F . n 
F 1 283 SER 283 283 283 SER SER F . n 
F 1 284 GLY 284 284 284 GLY GLY F . n 
F 1 285 ASP 285 285 285 ASP ASP F . n 
F 1 286 LYS 286 286 286 LYS LYS F . n 
F 1 287 TYR 287 287 287 TYR TYR F . n 
F 1 288 ALA 288 288 288 ALA ALA F . n 
F 1 289 GLY 289 289 289 GLY GLY F . n 
F 1 290 LEU 290 290 290 LEU LEU F . n 
F 1 291 SER 291 291 291 SER SER F . n 
F 1 292 GLU 292 292 292 GLU GLU F . n 
F 1 293 GLN 293 293 293 GLN GLN F . n 
F 1 294 ALA 294 294 294 ALA ALA F . n 
F 1 295 LEU 295 295 295 LEU LEU F . n 
F 1 296 TYR 296 296 296 TYR TYR F . n 
F 1 297 TYR 297 297 297 TYR TYR F . n 
F 1 298 ILE 298 298 298 ILE ILE F . n 
F 1 299 GLY 299 299 299 GLY GLY F . n 
F 1 300 GLY 300 300 300 GLY GLY F . n 
F 1 301 VAL 301 301 301 VAL VAL F . n 
F 1 302 ILE 302 302 302 ILE ILE F . n 
F 1 303 LYS 303 303 303 LYS LYS F . n 
F 1 304 HIS 304 304 304 HIS HIS F . n 
F 1 305 ALA 305 305 305 ALA ALA F . n 
F 1 306 LYS 306 306 306 LYS LYS F . n 
F 1 307 ALA 307 307 307 ALA ALA F . n 
F 1 308 ILE 308 308 308 ILE ILE F . n 
F 1 309 ASN 309 309 309 ASN ASN F . n 
F 1 310 ALA 310 310 310 ALA ALA F . n 
F 1 311 LEU 311 311 311 LEU LEU F . n 
F 1 312 ALA 312 312 312 ALA ALA F . n 
F 1 313 ASN 313 313 313 ASN ASN F . n 
F 1 314 PRO 314 314 314 PRO PRO F . n 
F 1 315 THR 315 315 315 THR THR F . n 
F 1 316 THR 316 316 316 THR THR F . n 
F 1 317 ASN 317 317 317 ASN ASN F . n 
F 1 318 SER 318 318 318 SER SER F . n 
F 1 319 TYR 319 319 319 TYR TYR F . n 
F 1 320 LYS 320 320 320 LYS LYS F . n 
F 1 321 ARG 321 321 321 ARG ARG F . n 
F 1 322 LEU 322 322 322 LEU LEU F . n 
F 1 323 VAL 323 323 323 VAL VAL F . n 
F 1 324 PRO 324 324 324 PRO PRO F . n 
F 1 325 GLY 325 325 325 GLY GLY F . n 
F 1 326 TYR 326 326 326 TYR TYR F . n 
F 1 327 GLU 327 327 327 GLU GLU F . n 
F 1 328 ALA 328 328 328 ALA ALA F . n 
F 1 329 PRO 329 329 329 PRO PRO F . n 
F 1 330 VAL 330 330 330 VAL VAL F . n 
F 1 331 MET 331 331 331 MET MET F . n 
F 1 332 LEU 332 332 332 LEU LEU F . n 
F 1 333 ALA 333 333 333 ALA ALA F . n 
F 1 334 TYR 334 334 334 TYR TYR F . n 
F 1 335 SER 335 335 335 SER SER F . n 
F 1 336 ALA 336 336 336 ALA ALA F . n 
F 1 337 ARG 337 337 337 ARG ARG F . n 
F 1 338 ASN 338 338 338 ASN ASN F . n 
F 1 339 ARG 339 339 339 ARG ARG F . n 
F 1 340 SER 340 340 340 SER SER F . n 
F 1 341 ALA 341 341 341 ALA ALA F . n 
F 1 342 SER 342 342 342 SER SER F . n 
F 1 343 ILE 343 343 343 ILE ILE F . n 
F 1 344 ARG 344 344 344 ARG ARG F . n 
F 1 345 ILE 345 345 345 ILE ILE F . n 
F 1 346 PRO 346 346 346 PRO PRO F . n 
F 1 347 VAL 347 347 347 VAL VAL F . n 
F 1 348 VAL 348 348 348 VAL VAL F . n 
F 1 349 ALA 349 349 349 ALA ALA F . n 
F 1 350 SER 350 350 350 SER SER F . n 
F 1 351 PRO 351 351 351 PRO PRO F . n 
F 1 352 LYS 352 352 352 LYS LYS F . n 
F 1 353 ALA 353 353 353 ALA ALA F . n 
F 1 354 ARG 354 354 354 ARG ARG F . n 
F 1 355 ARG 355 355 355 ARG ARG F . n 
F 1 356 ILE 356 356 356 ILE ILE F . n 
F 1 357 GLU 357 357 357 GLU GLU F . n 
F 1 358 VAL 358 358 358 VAL VAL F . n 
F 1 359 ARG 359 359 359 ARG ARG F . n 
F 1 360 PHE 360 360 360 PHE PHE F . n 
F 1 361 PRO 361 361 361 PRO PRO F . n 
F 1 362 ASP 362 362 362 ASP ASP F . n 
F 1 363 PRO 363 363 363 PRO PRO F . n 
F 1 364 ALA 364 364 364 ALA ALA F . n 
F 1 365 ALA 365 365 365 ALA ALA F . n 
F 1 366 ASN 366 366 366 ASN ASN F . n 
F 1 367 PRO 367 367 367 PRO PRO F . n 
F 1 368 TYR 368 368 368 TYR TYR F . n 
F 1 369 LEU 369 369 369 LEU LEU F . n 
F 1 370 CYS 370 370 370 CYS CYS F . n 
F 1 371 PHE 371 371 371 PHE PHE F . n 
F 1 372 ALA 372 372 372 ALA ALA F . n 
F 1 373 ALA 373 373 373 ALA ALA F . n 
F 1 374 LEU 374 374 374 LEU LEU F . n 
F 1 375 LEU 375 375 375 LEU LEU F . n 
F 1 376 MET 376 376 376 MET MET F . n 
F 1 377 ALA 377 377 377 ALA ALA F . n 
F 1 378 GLY 378 378 378 GLY GLY F . n 
F 1 379 LEU 379 379 379 LEU LEU F . n 
F 1 380 ASP 380 380 380 ASP ASP F . n 
F 1 381 GLY 381 381 381 GLY GLY F . n 
F 1 382 ILE 382 382 382 ILE ILE F . n 
F 1 383 LYS 383 383 383 LYS LYS F . n 
F 1 384 ASN 384 384 384 ASN ASN F . n 
F 1 385 LYS 385 385 385 LYS LYS F . n 
F 1 386 ILE 386 386 386 ILE ILE F . n 
F 1 387 HIS 387 387 387 HIS HIS F . n 
F 1 388 PRO 388 388 388 PRO PRO F . n 
F 1 389 GLY 389 389 389 GLY GLY F . n 
F 1 390 GLU 390 390 390 GLU GLU F . n 
F 1 391 PRO 391 391 391 PRO PRO F . n 
F 1 392 MET 392 392 392 MET MET F . n 
F 1 393 ASP 393 393 393 ASP ASP F . n 
F 1 394 LYS 394 394 394 LYS LYS F . n 
F 1 395 ASN 395 395 395 ASN ASN F . n 
F 1 396 LEU 396 396 396 LEU LEU F . n 
F 1 397 TYR 397 397 397 TYR TYR F . n 
F 1 398 ASP 398 398 398 ASP ASP F . n 
F 1 399 LEU 399 399 399 LEU LEU F . n 
F 1 400 PRO 400 400 400 PRO PRO F . n 
F 1 401 PRO 401 401 401 PRO PRO F . n 
F 1 402 GLU 402 402 402 GLU GLU F . n 
F 1 403 GLU 403 403 403 GLU GLU F . n 
F 1 404 ALA 404 404 404 ALA ALA F . n 
F 1 405 LYS 405 405 405 LYS LYS F . n 
F 1 406 GLU 406 406 406 GLU GLU F . n 
F 1 407 ILE 407 407 407 ILE ILE F . n 
F 1 408 PRO 408 408 408 PRO PRO F . n 
F 1 409 GLN 409 409 409 GLN GLN F . n 
F 1 410 VAL 410 410 410 VAL VAL F . n 
F 1 411 ALA 411 411 411 ALA ALA F . n 
F 1 412 GLY 412 412 412 GLY GLY F . n 
F 1 413 SER 413 413 413 SER SER F . n 
F 1 414 LEU 414 414 414 LEU LEU F . n 
F 1 415 GLU 415 415 415 GLU GLU F . n 
F 1 416 GLU 416 416 416 GLU GLU F . n 
F 1 417 ALA 417 417 417 ALA ALA F . n 
F 1 418 LEU 418 418 418 LEU LEU F . n 
F 1 419 ASN 419 419 419 ASN ASN F . n 
F 1 420 ALA 420 420 420 ALA ALA F . n 
F 1 421 LEU 421 421 421 LEU LEU F . n 
F 1 422 ASP 422 422 422 ASP ASP F . n 
F 1 423 LEU 423 423 423 LEU LEU F . n 
F 1 424 ASP 424 424 424 ASP ASP F . n 
F 1 425 ARG 425 425 425 ARG ARG F . n 
F 1 426 GLU 426 426 426 GLU GLU F . n 
F 1 427 PHE 427 427 427 PHE PHE F . n 
F 1 428 LEU 428 428 428 LEU LEU F . n 
F 1 429 LYS 429 429 429 LYS LYS F . n 
F 1 430 ALA 430 430 430 ALA ALA F . n 
F 1 431 GLY 431 431 431 GLY GLY F . n 
F 1 432 GLY 432 432 432 GLY GLY F . n 
F 1 433 VAL 433 433 433 VAL VAL F . n 
F 1 434 PHE 434 434 434 PHE PHE F . n 
F 1 435 THR 435 435 435 THR THR F . n 
F 1 436 ASP 436 436 436 ASP ASP F . n 
F 1 437 GLU 437 437 437 GLU GLU F . n 
F 1 438 ALA 438 438 438 ALA ALA F . n 
F 1 439 ILE 439 439 439 ILE ILE F . n 
F 1 440 ASP 440 440 440 ASP ASP F . n 
F 1 441 ALA 441 441 441 ALA ALA F . n 
F 1 442 TYR 442 442 442 TYR TYR F . n 
F 1 443 ILE 443 443 443 ILE ILE F . n 
F 1 444 ALA 444 444 444 ALA ALA F . n 
F 1 445 LEU 445 445 445 LEU LEU F . n 
F 1 446 ARG 446 446 446 ARG ARG F . n 
F 1 447 ARG 447 447 447 ARG ARG F . n 
F 1 448 GLU 448 448 448 GLU GLU F . n 
F 1 449 GLU 449 449 449 GLU GLU F . n 
F 1 450 ASP 450 450 450 ASP ASP F . n 
F 1 451 ASP 451 451 451 ASP ASP F . n 
F 1 452 ARG 452 452 452 ARG ARG F . n 
F 1 453 VAL 453 453 453 VAL VAL F . n 
F 1 454 ARG 454 454 454 ARG ARG F . n 
F 1 455 MET 455 455 455 MET MET F . n 
F 1 456 THR 456 456 456 THR THR F . n 
F 1 457 PRO 457 457 457 PRO PRO F . n 
F 1 458 HIS 458 458 458 HIS HIS F . n 
F 1 459 PRO 459 459 459 PRO PRO F . n 
F 1 460 VAL 460 460 460 VAL VAL F . n 
F 1 461 GLU 461 461 461 GLU GLU F . n 
F 1 462 PHE 462 462 462 PHE PHE F . n 
F 1 463 GLU 463 463 463 GLU GLU F . n 
F 1 464 LEU 464 464 464 LEU LEU F . n 
F 1 465 TYR 465 465 465 TYR TYR F . n 
F 1 466 TYR 466 466 466 TYR TYR F . n 
F 1 467 SER 467 467 467 SER SER F . n 
F 1 468 VAL 468 468 468 VAL VAL F . n 
G 1 1   SER 1   1   1   SER SER G . n 
G 1 2   ALA 2   2   2   ALA ALA G . n 
G 1 3   GLU 3   3   3   GLU GLU G . n 
G 1 4   HIS 4   4   4   HIS HIS G . n 
G 1 5   VAL 5   5   5   VAL VAL G . n 
G 1 6   LEU 6   6   6   LEU LEU G . n 
G 1 7   THR 7   7   7   THR THR G . n 
G 1 8   MET 8   8   8   MET MET G . n 
G 1 9   LEU 9   9   9   LEU LEU G . n 
G 1 10  ASN 10  10  10  ASN ASN G . n 
G 1 11  GLU 11  11  11  GLU GLU G . n 
G 1 12  HIS 12  12  12  HIS HIS G . n 
G 1 13  GLU 13  13  13  GLU GLU G . n 
G 1 14  VAL 14  14  14  VAL VAL G . n 
G 1 15  LYS 15  15  15  LYS LYS G . n 
G 1 16  PHE 16  16  16  PHE PHE G . n 
G 1 17  VAL 17  17  17  VAL VAL G . n 
G 1 18  ASP 18  18  18  ASP ASP G . n 
G 1 19  LEU 19  19  19  LEU LEU G . n 
G 1 20  ARG 20  20  20  ARG ARG G . n 
G 1 21  PHE 21  21  21  PHE PHE G . n 
G 1 22  THR 22  22  22  THR THR G . n 
G 1 23  ASP 23  23  23  ASP ASP G . n 
G 1 24  THR 24  24  24  THR THR G . n 
G 1 25  LYS 25  25  25  LYS LYS G . n 
G 1 26  GLY 26  26  26  GLY GLY G . n 
G 1 27  LYS 27  27  27  LYS LYS G . n 
G 1 28  GLU 28  28  28  GLU GLU G . n 
G 1 29  GLN 29  29  29  GLN GLN G . n 
G 1 30  HIS 30  30  30  HIS HIS G . n 
G 1 31  VAL 31  31  31  VAL VAL G . n 
G 1 32  THR 32  32  32  THR THR G . n 
G 1 33  ILE 33  33  33  ILE ILE G . n 
G 1 34  PRO 34  34  34  PRO PRO G . n 
G 1 35  ALA 35  35  35  ALA ALA G . n 
G 1 36  HIS 36  36  36  HIS HIS G . n 
G 1 37  GLN 37  37  37  GLN GLN G . n 
G 1 38  VAL 38  38  38  VAL VAL G . n 
G 1 39  ASN 39  39  39  ASN ASN G . n 
G 1 40  ALA 40  40  40  ALA ALA G . n 
G 1 41  GLU 41  41  41  GLU GLU G . n 
G 1 42  PHE 42  42  42  PHE PHE G . n 
G 1 43  PHE 43  43  43  PHE PHE G . n 
G 1 44  GLU 44  44  44  GLU GLU G . n 
G 1 45  GLU 45  45  45  GLU GLU G . n 
G 1 46  GLY 46  46  46  GLY GLY G . n 
G 1 47  LYS 47  47  47  LYS LYS G . n 
G 1 48  MET 48  48  48  MET MET G . n 
G 1 49  PHE 49  49  49  PHE PHE G . n 
G 1 50  ASP 50  50  50  ASP ASP G . n 
G 1 51  GLY 51  51  51  GLY GLY G . n 
G 1 52  SER 52  52  52  SER SER G . n 
G 1 53  SER 53  53  53  SER SER G . n 
G 1 54  ILE 54  54  54  ILE ILE G . n 
G 1 55  GLY 55  55  55  GLY GLY G . n 
G 1 56  GLY 56  56  56  GLY GLY G . n 
G 1 57  TRP 57  57  57  TRP TRP G . n 
G 1 58  LYS 58  58  58  LYS LYS G . n 
G 1 59  GLY 59  59  59  GLY GLY G . n 
G 1 60  ILE 60  60  60  ILE ILE G . n 
G 1 61  ASN 61  61  61  ASN ASN G . n 
G 1 62  GLU 62  62  62  GLU GLU G . n 
G 1 63  SER 63  63  63  SER SER G . n 
G 1 64  ASP 64  64  64  ASP ASP G . n 
G 1 65  MET 65  65  65  MET MET G . n 
G 1 66  VAL 66  66  66  VAL VAL G . n 
G 1 67  LEU 67  67  67  LEU LEU G . n 
G 1 68  MET 68  68  68  MET MET G . n 
G 1 69  PRO 69  69  69  PRO PRO G . n 
G 1 70  ASP 70  70  70  ASP ASP G . n 
G 1 71  ALA 71  71  71  ALA ALA G . n 
G 1 72  SER 72  72  72  SER SER G . n 
G 1 73  THR 73  73  73  THR THR G . n 
G 1 74  ALA 74  74  74  ALA ALA G . n 
G 1 75  VAL 75  75  75  VAL VAL G . n 
G 1 76  ILE 76  76  76  ILE ILE G . n 
G 1 77  ASP 77  77  77  ASP ASP G . n 
G 1 78  PRO 78  78  78  PRO PRO G . n 
G 1 79  PHE 79  79  79  PHE PHE G . n 
G 1 80  PHE 80  80  80  PHE PHE G . n 
G 1 81  ALA 81  81  81  ALA ALA G . n 
G 1 82  ASP 82  82  82  ASP ASP G . n 
G 1 83  SER 83  83  83  SER SER G . n 
G 1 84  THR 84  84  84  THR THR G . n 
G 1 85  LEU 85  85  85  LEU LEU G . n 
G 1 86  ILE 86  86  86  ILE ILE G . n 
G 1 87  ILE 87  87  87  ILE ILE G . n 
G 1 88  ARG 88  88  88  ARG ARG G . n 
G 1 89  CYS 89  89  89  CYS CYS G . n 
G 1 90  ASP 90  90  90  ASP ASP G . n 
G 1 91  ILE 91  91  91  ILE ILE G . n 
G 1 92  LEU 92  92  92  LEU LEU G . n 
G 1 93  GLU 93  93  93  GLU GLU G . n 
G 1 94  PRO 94  94  94  PRO PRO G . n 
G 1 95  GLY 95  95  95  GLY GLY G . n 
G 1 96  THR 96  96  96  THR THR G . n 
G 1 97  LEU 97  97  97  LEU LEU G . n 
G 1 98  GLN 98  98  98  GLN GLN G . n 
G 1 99  GLY 99  99  99  GLY GLY G . n 
G 1 100 TYR 100 100 100 TYR TYR G . n 
G 1 101 ASP 101 101 101 ASP ASP G . n 
G 1 102 ARG 102 102 102 ARG ARG G . n 
G 1 103 ASP 103 103 103 ASP ASP G . n 
G 1 104 PRO 104 104 104 PRO PRO G . n 
G 1 105 ARG 105 105 105 ARG ARG G . n 
G 1 106 SER 106 106 106 SER SER G . n 
G 1 107 ILE 107 107 107 ILE ILE G . n 
G 1 108 ALA 108 108 108 ALA ALA G . n 
G 1 109 LYS 109 109 109 LYS LYS G . n 
G 1 110 ARG 110 110 110 ARG ARG G . n 
G 1 111 ALA 111 111 111 ALA ALA G . n 
G 1 112 GLU 112 112 112 GLU GLU G . n 
G 1 113 ASP 113 113 113 ASP ASP G . n 
G 1 114 TYR 114 114 114 TYR TYR G . n 
G 1 115 LEU 115 115 115 LEU LEU G . n 
G 1 116 ARG 116 116 116 ARG ARG G . n 
G 1 117 ALA 117 117 117 ALA ALA G . n 
G 1 118 THR 118 118 118 THR THR G . n 
G 1 119 GLY 119 119 119 GLY GLY G . n 
G 1 120 ILE 120 120 120 ILE ILE G . n 
G 1 121 ALA 121 121 121 ALA ALA G . n 
G 1 122 ASP 122 122 122 ASP ASP G . n 
G 1 123 THR 123 123 123 THR THR G . n 
G 1 124 VAL 124 124 124 VAL VAL G . n 
G 1 125 LEU 125 125 125 LEU LEU G . n 
G 1 126 PHE 126 126 126 PHE PHE G . n 
G 1 127 GLY 127 127 127 GLY GLY G . n 
G 1 128 PRO 128 128 128 PRO PRO G . n 
G 1 129 GLU 129 129 129 GLU GLU G . n 
G 1 130 PRO 130 130 130 PRO PRO G . n 
G 1 131 GLU 131 131 131 GLU GLU G . n 
G 1 132 PHE 132 132 132 PHE PHE G . n 
G 1 133 PHE 133 133 133 PHE PHE G . n 
G 1 134 LEU 134 134 134 LEU LEU G . n 
G 1 135 PHE 135 135 135 PHE PHE G . n 
G 1 136 ASP 136 136 136 ASP ASP G . n 
G 1 137 ASP 137 137 137 ASP ASP G . n 
G 1 138 ILE 138 138 138 ILE ILE G . n 
G 1 139 ARG 139 139 139 ARG ARG G . n 
G 1 140 PHE 140 140 140 PHE PHE G . n 
G 1 141 GLY 141 141 141 GLY GLY G . n 
G 1 142 ALA 142 142 142 ALA ALA G . n 
G 1 143 SER 143 143 143 SER SER G . n 
G 1 144 ILE 144 144 144 ILE ILE G . n 
G 1 145 SER 145 145 145 SER SER G . n 
G 1 146 GLY 146 146 146 GLY GLY G . n 
G 1 147 SER 147 147 147 SER SER G . n 
G 1 148 HIS 148 148 148 HIS HIS G . n 
G 1 149 VAL 149 149 149 VAL VAL G . n 
G 1 150 ALA 150 150 150 ALA ALA G . n 
G 1 151 ILE 151 151 151 ILE ILE G . n 
G 1 152 ASP 152 152 152 ASP ASP G . n 
G 1 153 ASP 153 153 153 ASP ASP G . n 
G 1 154 ILE 154 154 154 ILE ILE G . n 
G 1 155 GLU 155 155 155 GLU GLU G . n 
G 1 156 GLY 156 156 156 GLY GLY G . n 
G 1 157 ALA 157 157 157 ALA ALA G . n 
G 1 158 TRP 158 158 158 TRP TRP G . n 
G 1 159 ASN 159 159 159 ASN ASN G . n 
G 1 160 SER 160 160 160 SER SER G . n 
G 1 161 SER 161 161 161 SER SER G . n 
G 1 162 THR 162 162 162 THR THR G . n 
G 1 163 LYS 163 163 163 LYS LYS G . n 
G 1 164 TYR 164 164 164 TYR TYR G . n 
G 1 165 GLU 165 165 165 GLU GLU G . n 
G 1 166 GLY 166 166 166 GLY GLY G . n 
G 1 167 GLY 167 167 167 GLY GLY G . n 
G 1 168 ASN 168 168 168 ASN ASN G . n 
G 1 169 LYS 169 169 169 LYS LYS G . n 
G 1 170 GLY 170 170 170 GLY GLY G . n 
G 1 171 HIS 171 171 171 HIS HIS G . n 
G 1 172 ARG 172 172 172 ARG ARG G . n 
G 1 173 PRO 173 173 173 PRO PRO G . n 
G 1 174 GLY 174 174 174 GLY GLY G . n 
G 1 175 VAL 175 175 175 VAL VAL G . n 
G 1 176 LYS 176 176 176 LYS LYS G . n 
G 1 177 GLY 177 177 177 GLY GLY G . n 
G 1 178 GLY 178 178 178 GLY GLY G . n 
G 1 179 TYR 179 179 179 TYR TYR G . n 
G 1 180 PHE 180 180 180 PHE PHE G . n 
G 1 181 PRO 181 181 181 PRO PRO G . n 
G 1 182 VAL 182 182 182 VAL VAL G . n 
G 1 183 PRO 183 183 183 PRO PRO G . n 
G 1 184 PRO 184 184 184 PRO PRO G . n 
G 1 185 VAL 185 185 185 VAL VAL G . n 
G 1 186 ASP 186 186 186 ASP ASP G . n 
G 1 187 SER 187 187 187 SER SER G . n 
G 1 188 ALA 188 188 188 ALA ALA G . n 
G 1 189 GLN 189 189 189 GLN GLN G . n 
G 1 190 ASP 190 190 190 ASP ASP G . n 
G 1 191 ILE 191 191 191 ILE ILE G . n 
G 1 192 ARG 192 192 192 ARG ARG G . n 
G 1 193 SER 193 193 193 SER SER G . n 
G 1 194 GLU 194 194 194 GLU GLU G . n 
G 1 195 MET 195 195 195 MET MET G . n 
G 1 196 CYS 196 196 196 CYS CYS G . n 
G 1 197 LEU 197 197 197 LEU LEU G . n 
G 1 198 VAL 198 198 198 VAL VAL G . n 
G 1 199 MET 199 199 199 MET MET G . n 
G 1 200 GLU 200 200 200 GLU GLU G . n 
G 1 201 GLN 201 201 201 GLN GLN G . n 
G 1 202 MET 202 202 202 MET MET G . n 
G 1 203 GLY 203 203 203 GLY GLY G . n 
G 1 204 LEU 204 204 204 LEU LEU G . n 
G 1 205 VAL 205 205 205 VAL VAL G . n 
G 1 206 VAL 206 206 206 VAL VAL G . n 
G 1 207 GLU 207 207 207 GLU GLU G . n 
G 1 208 ALA 208 208 208 ALA ALA G . n 
G 1 209 HIS 209 209 209 HIS HIS G . n 
G 1 210 HIS 210 210 210 HIS HIS G . n 
G 1 211 HIS 211 211 211 HIS HIS G . n 
G 1 212 GLU 212 212 212 GLU GLU G . n 
G 1 213 VAL 213 213 213 VAL VAL G . n 
G 1 214 ALA 214 214 214 ALA ALA G . n 
G 1 215 THR 215 215 215 THR THR G . n 
G 1 216 ALA 216 216 216 ALA ALA G . n 
G 1 217 GLY 217 217 217 GLY GLY G . n 
G 1 218 GLN 218 218 218 GLN GLN G . n 
G 1 219 ASN 219 219 219 ASN ASN G . n 
G 1 220 GLU 220 220 220 GLU GLU G . n 
G 1 221 VAL 221 221 221 VAL VAL G . n 
G 1 222 ALA 222 222 222 ALA ALA G . n 
G 1 223 THR 223 223 223 THR THR G . n 
G 1 224 ARG 224 224 224 ARG ARG G . n 
G 1 225 PHE 225 225 225 PHE PHE G . n 
G 1 226 ASN 226 226 226 ASN ASN G . n 
G 1 227 THR 227 227 227 THR THR G . n 
G 1 228 MET 228 228 228 MET MET G . n 
G 1 229 THR 229 229 229 THR THR G . n 
G 1 230 LYS 230 230 230 LYS LYS G . n 
G 1 231 LYS 231 231 231 LYS LYS G . n 
G 1 232 ALA 232 232 232 ALA ALA G . n 
G 1 233 ASP 233 233 233 ASP ASP G . n 
G 1 234 GLU 234 234 234 GLU GLU G . n 
G 1 235 ILE 235 235 235 ILE ILE G . n 
G 1 236 GLN 236 236 236 GLN GLN G . n 
G 1 237 ILE 237 237 237 ILE ILE G . n 
G 1 238 TYR 238 238 238 TYR TYR G . n 
G 1 239 LYS 239 239 239 LYS LYS G . n 
G 1 240 TYR 240 240 240 TYR TYR G . n 
G 1 241 VAL 241 241 241 VAL VAL G . n 
G 1 242 VAL 242 242 242 VAL VAL G . n 
G 1 243 HIS 243 243 243 HIS HIS G . n 
G 1 244 ASN 244 244 244 ASN ASN G . n 
G 1 245 VAL 245 245 245 VAL VAL G . n 
G 1 246 ALA 246 246 246 ALA ALA G . n 
G 1 247 HIS 247 247 247 HIS HIS G . n 
G 1 248 ARG 248 248 248 ARG ARG G . n 
G 1 249 PHE 249 249 249 PHE PHE G . n 
G 1 250 GLY 250 250 250 GLY GLY G . n 
G 1 251 LYS 251 251 251 LYS LYS G . n 
G 1 252 THR 252 252 252 THR THR G . n 
G 1 253 ALA 253 253 253 ALA ALA G . n 
G 1 254 THR 254 254 254 THR THR G . n 
G 1 255 PHE 255 255 255 PHE PHE G . n 
G 1 256 MET 256 256 256 MET MET G . n 
G 1 257 PRO 257 257 257 PRO PRO G . n 
G 1 258 LYS 258 258 258 LYS LYS G . n 
G 1 259 PRO 259 259 259 PRO PRO G . n 
G 1 260 MET 260 260 260 MET MET G . n 
G 1 261 PHE 261 261 261 PHE PHE G . n 
G 1 262 GLY 262 262 262 GLY GLY G . n 
G 1 263 ASP 263 263 263 ASP ASP G . n 
G 1 264 ASN 264 264 264 ASN ASN G . n 
G 1 265 GLY 265 265 265 GLY GLY G . n 
G 1 266 SER 266 266 266 SER SER G . n 
G 1 267 GLY 267 267 267 GLY GLY G . n 
G 1 268 MET 268 268 268 MET MET G . n 
G 1 269 HIS 269 269 269 HIS HIS G . n 
G 1 270 CYS 270 270 270 CYS CYS G . n 
G 1 271 HIS 271 271 271 HIS HIS G . n 
G 1 272 MET 272 272 272 MET MET G . n 
G 1 273 SER 273 273 273 SER SER G . n 
G 1 274 LEU 274 274 274 LEU LEU G . n 
G 1 275 ALA 275 275 275 ALA ALA G . n 
G 1 276 LYS 276 276 276 LYS LYS G . n 
G 1 277 ASN 277 277 277 ASN ASN G . n 
G 1 278 GLY 278 278 278 GLY GLY G . n 
G 1 279 THR 279 279 279 THR THR G . n 
G 1 280 ASN 280 280 280 ASN ASN G . n 
G 1 281 LEU 281 281 281 LEU LEU G . n 
G 1 282 PHE 282 282 282 PHE PHE G . n 
G 1 283 SER 283 283 283 SER SER G . n 
G 1 284 GLY 284 284 284 GLY GLY G . n 
G 1 285 ASP 285 285 285 ASP ASP G . n 
G 1 286 LYS 286 286 286 LYS LYS G . n 
G 1 287 TYR 287 287 287 TYR TYR G . n 
G 1 288 ALA 288 288 288 ALA ALA G . n 
G 1 289 GLY 289 289 289 GLY GLY G . n 
G 1 290 LEU 290 290 290 LEU LEU G . n 
G 1 291 SER 291 291 291 SER SER G . n 
G 1 292 GLU 292 292 292 GLU GLU G . n 
G 1 293 GLN 293 293 293 GLN GLN G . n 
G 1 294 ALA 294 294 294 ALA ALA G . n 
G 1 295 LEU 295 295 295 LEU LEU G . n 
G 1 296 TYR 296 296 296 TYR TYR G . n 
G 1 297 TYR 297 297 297 TYR TYR G . n 
G 1 298 ILE 298 298 298 ILE ILE G . n 
G 1 299 GLY 299 299 299 GLY GLY G . n 
G 1 300 GLY 300 300 300 GLY GLY G . n 
G 1 301 VAL 301 301 301 VAL VAL G . n 
G 1 302 ILE 302 302 302 ILE ILE G . n 
G 1 303 LYS 303 303 303 LYS LYS G . n 
G 1 304 HIS 304 304 304 HIS HIS G . n 
G 1 305 ALA 305 305 305 ALA ALA G . n 
G 1 306 LYS 306 306 306 LYS LYS G . n 
G 1 307 ALA 307 307 307 ALA ALA G . n 
G 1 308 ILE 308 308 308 ILE ILE G . n 
G 1 309 ASN 309 309 309 ASN ASN G . n 
G 1 310 ALA 310 310 310 ALA ALA G . n 
G 1 311 LEU 311 311 311 LEU LEU G . n 
G 1 312 ALA 312 312 312 ALA ALA G . n 
G 1 313 ASN 313 313 313 ASN ASN G . n 
G 1 314 PRO 314 314 314 PRO PRO G . n 
G 1 315 THR 315 315 315 THR THR G . n 
G 1 316 THR 316 316 316 THR THR G . n 
G 1 317 ASN 317 317 317 ASN ASN G . n 
G 1 318 SER 318 318 318 SER SER G . n 
G 1 319 TYR 319 319 319 TYR TYR G . n 
G 1 320 LYS 320 320 320 LYS LYS G . n 
G 1 321 ARG 321 321 321 ARG ARG G . n 
G 1 322 LEU 322 322 322 LEU LEU G . n 
G 1 323 VAL 323 323 323 VAL VAL G . n 
G 1 324 PRO 324 324 324 PRO PRO G . n 
G 1 325 GLY 325 325 325 GLY GLY G . n 
G 1 326 TYR 326 326 326 TYR TYR G . n 
G 1 327 GLU 327 327 327 GLU GLU G . n 
G 1 328 ALA 328 328 328 ALA ALA G . n 
G 1 329 PRO 329 329 329 PRO PRO G . n 
G 1 330 VAL 330 330 330 VAL VAL G . n 
G 1 331 MET 331 331 331 MET MET G . n 
G 1 332 LEU 332 332 332 LEU LEU G . n 
G 1 333 ALA 333 333 333 ALA ALA G . n 
G 1 334 TYR 334 334 334 TYR TYR G . n 
G 1 335 SER 335 335 335 SER SER G . n 
G 1 336 ALA 336 336 336 ALA ALA G . n 
G 1 337 ARG 337 337 337 ARG ARG G . n 
G 1 338 ASN 338 338 338 ASN ASN G . n 
G 1 339 ARG 339 339 339 ARG ARG G . n 
G 1 340 SER 340 340 340 SER SER G . n 
G 1 341 ALA 341 341 341 ALA ALA G . n 
G 1 342 SER 342 342 342 SER SER G . n 
G 1 343 ILE 343 343 343 ILE ILE G . n 
G 1 344 ARG 344 344 344 ARG ARG G . n 
G 1 345 ILE 345 345 345 ILE ILE G . n 
G 1 346 PRO 346 346 346 PRO PRO G . n 
G 1 347 VAL 347 347 347 VAL VAL G . n 
G 1 348 VAL 348 348 348 VAL VAL G . n 
G 1 349 ALA 349 349 349 ALA ALA G . n 
G 1 350 SER 350 350 350 SER SER G . n 
G 1 351 PRO 351 351 351 PRO PRO G . n 
G 1 352 LYS 352 352 352 LYS LYS G . n 
G 1 353 ALA 353 353 353 ALA ALA G . n 
G 1 354 ARG 354 354 354 ARG ARG G . n 
G 1 355 ARG 355 355 355 ARG ARG G . n 
G 1 356 ILE 356 356 356 ILE ILE G . n 
G 1 357 GLU 357 357 357 GLU GLU G . n 
G 1 358 VAL 358 358 358 VAL VAL G . n 
G 1 359 ARG 359 359 359 ARG ARG G . n 
G 1 360 PHE 360 360 360 PHE PHE G . n 
G 1 361 PRO 361 361 361 PRO PRO G . n 
G 1 362 ASP 362 362 362 ASP ASP G . n 
G 1 363 PRO 363 363 363 PRO PRO G . n 
G 1 364 ALA 364 364 364 ALA ALA G . n 
G 1 365 ALA 365 365 365 ALA ALA G . n 
G 1 366 ASN 366 366 366 ASN ASN G . n 
G 1 367 PRO 367 367 367 PRO PRO G . n 
G 1 368 TYR 368 368 368 TYR TYR G . n 
G 1 369 LEU 369 369 369 LEU LEU G . n 
G 1 370 CYS 370 370 370 CYS CYS G . n 
G 1 371 PHE 371 371 371 PHE PHE G . n 
G 1 372 ALA 372 372 372 ALA ALA G . n 
G 1 373 ALA 373 373 373 ALA ALA G . n 
G 1 374 LEU 374 374 374 LEU LEU G . n 
G 1 375 LEU 375 375 375 LEU LEU G . n 
G 1 376 MET 376 376 376 MET MET G . n 
G 1 377 ALA 377 377 377 ALA ALA G . n 
G 1 378 GLY 378 378 378 GLY GLY G . n 
G 1 379 LEU 379 379 379 LEU LEU G . n 
G 1 380 ASP 380 380 380 ASP ASP G . n 
G 1 381 GLY 381 381 381 GLY GLY G . n 
G 1 382 ILE 382 382 382 ILE ILE G . n 
G 1 383 LYS 383 383 383 LYS LYS G . n 
G 1 384 ASN 384 384 384 ASN ASN G . n 
G 1 385 LYS 385 385 385 LYS LYS G . n 
G 1 386 ILE 386 386 386 ILE ILE G . n 
G 1 387 HIS 387 387 387 HIS HIS G . n 
G 1 388 PRO 388 388 388 PRO PRO G . n 
G 1 389 GLY 389 389 389 GLY GLY G . n 
G 1 390 GLU 390 390 390 GLU GLU G . n 
G 1 391 PRO 391 391 391 PRO PRO G . n 
G 1 392 MET 392 392 392 MET MET G . n 
G 1 393 ASP 393 393 393 ASP ASP G . n 
G 1 394 LYS 394 394 394 LYS LYS G . n 
G 1 395 ASN 395 395 395 ASN ASN G . n 
G 1 396 LEU 396 396 396 LEU LEU G . n 
G 1 397 TYR 397 397 397 TYR TYR G . n 
G 1 398 ASP 398 398 398 ASP ASP G . n 
G 1 399 LEU 399 399 399 LEU LEU G . n 
G 1 400 PRO 400 400 400 PRO PRO G . n 
G 1 401 PRO 401 401 401 PRO PRO G . n 
G 1 402 GLU 402 402 402 GLU GLU G . n 
G 1 403 GLU 403 403 403 GLU GLU G . n 
G 1 404 ALA 404 404 404 ALA ALA G . n 
G 1 405 LYS 405 405 405 LYS LYS G . n 
G 1 406 GLU 406 406 406 GLU GLU G . n 
G 1 407 ILE 407 407 407 ILE ILE G . n 
G 1 408 PRO 408 408 408 PRO PRO G . n 
G 1 409 GLN 409 409 409 GLN GLN G . n 
G 1 410 VAL 410 410 410 VAL VAL G . n 
G 1 411 ALA 411 411 411 ALA ALA G . n 
G 1 412 GLY 412 412 412 GLY GLY G . n 
G 1 413 SER 413 413 413 SER SER G . n 
G 1 414 LEU 414 414 414 LEU LEU G . n 
G 1 415 GLU 415 415 415 GLU GLU G . n 
G 1 416 GLU 416 416 416 GLU GLU G . n 
G 1 417 ALA 417 417 417 ALA ALA G . n 
G 1 418 LEU 418 418 418 LEU LEU G . n 
G 1 419 ASN 419 419 419 ASN ASN G . n 
G 1 420 ALA 420 420 420 ALA ALA G . n 
G 1 421 LEU 421 421 421 LEU LEU G . n 
G 1 422 ASP 422 422 422 ASP ASP G . n 
G 1 423 LEU 423 423 423 LEU LEU G . n 
G 1 424 ASP 424 424 424 ASP ASP G . n 
G 1 425 ARG 425 425 425 ARG ARG G . n 
G 1 426 GLU 426 426 426 GLU GLU G . n 
G 1 427 PHE 427 427 427 PHE PHE G . n 
G 1 428 LEU 428 428 428 LEU LEU G . n 
G 1 429 LYS 429 429 429 LYS LYS G . n 
G 1 430 ALA 430 430 430 ALA ALA G . n 
G 1 431 GLY 431 431 431 GLY GLY G . n 
G 1 432 GLY 432 432 432 GLY GLY G . n 
G 1 433 VAL 433 433 433 VAL VAL G . n 
G 1 434 PHE 434 434 434 PHE PHE G . n 
G 1 435 THR 435 435 435 THR THR G . n 
G 1 436 ASP 436 436 436 ASP ASP G . n 
G 1 437 GLU 437 437 437 GLU GLU G . n 
G 1 438 ALA 438 438 438 ALA ALA G . n 
G 1 439 ILE 439 439 439 ILE ILE G . n 
G 1 440 ASP 440 440 440 ASP ASP G . n 
G 1 441 ALA 441 441 441 ALA ALA G . n 
G 1 442 TYR 442 442 442 TYR TYR G . n 
G 1 443 ILE 443 443 443 ILE ILE G . n 
G 1 444 ALA 444 444 444 ALA ALA G . n 
G 1 445 LEU 445 445 445 LEU LEU G . n 
G 1 446 ARG 446 446 446 ARG ARG G . n 
G 1 447 ARG 447 447 447 ARG ARG G . n 
G 1 448 GLU 448 448 448 GLU GLU G . n 
G 1 449 GLU 449 449 449 GLU GLU G . n 
G 1 450 ASP 450 450 450 ASP ASP G . n 
G 1 451 ASP 451 451 451 ASP ASP G . n 
G 1 452 ARG 452 452 452 ARG ARG G . n 
G 1 453 VAL 453 453 453 VAL VAL G . n 
G 1 454 ARG 454 454 454 ARG ARG G . n 
G 1 455 MET 455 455 455 MET MET G . n 
G 1 456 THR 456 456 456 THR THR G . n 
G 1 457 PRO 457 457 457 PRO PRO G . n 
G 1 458 HIS 458 458 458 HIS HIS G . n 
G 1 459 PRO 459 459 459 PRO PRO G . n 
G 1 460 VAL 460 460 460 VAL VAL G . n 
G 1 461 GLU 461 461 461 GLU GLU G . n 
G 1 462 PHE 462 462 462 PHE PHE G . n 
G 1 463 GLU 463 463 463 GLU GLU G . n 
G 1 464 LEU 464 464 464 LEU LEU G . n 
G 1 465 TYR 465 465 465 TYR TYR G . n 
G 1 466 TYR 466 466 466 TYR TYR G . n 
G 1 467 SER 467 467 467 SER SER G . n 
G 1 468 VAL 468 468 468 VAL VAL G . n 
H 1 1   SER 1   1   1   SER SER H . n 
H 1 2   ALA 2   2   2   ALA ALA H . n 
H 1 3   GLU 3   3   3   GLU GLU H . n 
H 1 4   HIS 4   4   4   HIS HIS H . n 
H 1 5   VAL 5   5   5   VAL VAL H . n 
H 1 6   LEU 6   6   6   LEU LEU H . n 
H 1 7   THR 7   7   7   THR THR H . n 
H 1 8   MET 8   8   8   MET MET H . n 
H 1 9   LEU 9   9   9   LEU LEU H . n 
H 1 10  ASN 10  10  10  ASN ASN H . n 
H 1 11  GLU 11  11  11  GLU GLU H . n 
H 1 12  HIS 12  12  12  HIS HIS H . n 
H 1 13  GLU 13  13  13  GLU GLU H . n 
H 1 14  VAL 14  14  14  VAL VAL H . n 
H 1 15  LYS 15  15  15  LYS LYS H . n 
H 1 16  PHE 16  16  16  PHE PHE H . n 
H 1 17  VAL 17  17  17  VAL VAL H . n 
H 1 18  ASP 18  18  18  ASP ASP H . n 
H 1 19  LEU 19  19  19  LEU LEU H . n 
H 1 20  ARG 20  20  20  ARG ARG H . n 
H 1 21  PHE 21  21  21  PHE PHE H . n 
H 1 22  THR 22  22  22  THR THR H . n 
H 1 23  ASP 23  23  23  ASP ASP H . n 
H 1 24  THR 24  24  24  THR THR H . n 
H 1 25  LYS 25  25  25  LYS LYS H . n 
H 1 26  GLY 26  26  26  GLY GLY H . n 
H 1 27  LYS 27  27  27  LYS LYS H . n 
H 1 28  GLU 28  28  28  GLU GLU H . n 
H 1 29  GLN 29  29  29  GLN GLN H . n 
H 1 30  HIS 30  30  30  HIS HIS H . n 
H 1 31  VAL 31  31  31  VAL VAL H . n 
H 1 32  THR 32  32  32  THR THR H . n 
H 1 33  ILE 33  33  33  ILE ILE H . n 
H 1 34  PRO 34  34  34  PRO PRO H . n 
H 1 35  ALA 35  35  35  ALA ALA H . n 
H 1 36  HIS 36  36  36  HIS HIS H . n 
H 1 37  GLN 37  37  37  GLN GLN H . n 
H 1 38  VAL 38  38  38  VAL VAL H . n 
H 1 39  ASN 39  39  39  ASN ASN H . n 
H 1 40  ALA 40  40  40  ALA ALA H . n 
H 1 41  GLU 41  41  41  GLU GLU H . n 
H 1 42  PHE 42  42  42  PHE PHE H . n 
H 1 43  PHE 43  43  43  PHE PHE H . n 
H 1 44  GLU 44  44  44  GLU GLU H . n 
H 1 45  GLU 45  45  45  GLU GLU H . n 
H 1 46  GLY 46  46  46  GLY GLY H . n 
H 1 47  LYS 47  47  47  LYS LYS H . n 
H 1 48  MET 48  48  48  MET MET H . n 
H 1 49  PHE 49  49  49  PHE PHE H . n 
H 1 50  ASP 50  50  50  ASP ASP H . n 
H 1 51  GLY 51  51  51  GLY GLY H . n 
H 1 52  SER 52  52  52  SER SER H . n 
H 1 53  SER 53  53  53  SER SER H . n 
H 1 54  ILE 54  54  54  ILE ILE H . n 
H 1 55  GLY 55  55  55  GLY GLY H . n 
H 1 56  GLY 56  56  56  GLY GLY H . n 
H 1 57  TRP 57  57  57  TRP TRP H . n 
H 1 58  LYS 58  58  58  LYS LYS H . n 
H 1 59  GLY 59  59  59  GLY GLY H . n 
H 1 60  ILE 60  60  60  ILE ILE H . n 
H 1 61  ASN 61  61  61  ASN ASN H . n 
H 1 62  GLU 62  62  62  GLU GLU H . n 
H 1 63  SER 63  63  63  SER SER H . n 
H 1 64  ASP 64  64  64  ASP ASP H . n 
H 1 65  MET 65  65  65  MET MET H . n 
H 1 66  VAL 66  66  66  VAL VAL H . n 
H 1 67  LEU 67  67  67  LEU LEU H . n 
H 1 68  MET 68  68  68  MET MET H . n 
H 1 69  PRO 69  69  69  PRO PRO H . n 
H 1 70  ASP 70  70  70  ASP ASP H . n 
H 1 71  ALA 71  71  71  ALA ALA H . n 
H 1 72  SER 72  72  72  SER SER H . n 
H 1 73  THR 73  73  73  THR THR H . n 
H 1 74  ALA 74  74  74  ALA ALA H . n 
H 1 75  VAL 75  75  75  VAL VAL H . n 
H 1 76  ILE 76  76  76  ILE ILE H . n 
H 1 77  ASP 77  77  77  ASP ASP H . n 
H 1 78  PRO 78  78  78  PRO PRO H . n 
H 1 79  PHE 79  79  79  PHE PHE H . n 
H 1 80  PHE 80  80  80  PHE PHE H . n 
H 1 81  ALA 81  81  81  ALA ALA H . n 
H 1 82  ASP 82  82  82  ASP ASP H . n 
H 1 83  SER 83  83  83  SER SER H . n 
H 1 84  THR 84  84  84  THR THR H . n 
H 1 85  LEU 85  85  85  LEU LEU H . n 
H 1 86  ILE 86  86  86  ILE ILE H . n 
H 1 87  ILE 87  87  87  ILE ILE H . n 
H 1 88  ARG 88  88  88  ARG ARG H . n 
H 1 89  CYS 89  89  89  CYS CYS H . n 
H 1 90  ASP 90  90  90  ASP ASP H . n 
H 1 91  ILE 91  91  91  ILE ILE H . n 
H 1 92  LEU 92  92  92  LEU LEU H . n 
H 1 93  GLU 93  93  93  GLU GLU H . n 
H 1 94  PRO 94  94  94  PRO PRO H . n 
H 1 95  GLY 95  95  95  GLY GLY H . n 
H 1 96  THR 96  96  96  THR THR H . n 
H 1 97  LEU 97  97  97  LEU LEU H . n 
H 1 98  GLN 98  98  98  GLN GLN H . n 
H 1 99  GLY 99  99  99  GLY GLY H . n 
H 1 100 TYR 100 100 100 TYR TYR H . n 
H 1 101 ASP 101 101 101 ASP ASP H . n 
H 1 102 ARG 102 102 102 ARG ARG H . n 
H 1 103 ASP 103 103 103 ASP ASP H . n 
H 1 104 PRO 104 104 104 PRO PRO H . n 
H 1 105 ARG 105 105 105 ARG ARG H . n 
H 1 106 SER 106 106 106 SER SER H . n 
H 1 107 ILE 107 107 107 ILE ILE H . n 
H 1 108 ALA 108 108 108 ALA ALA H . n 
H 1 109 LYS 109 109 109 LYS LYS H . n 
H 1 110 ARG 110 110 110 ARG ARG H . n 
H 1 111 ALA 111 111 111 ALA ALA H . n 
H 1 112 GLU 112 112 112 GLU GLU H . n 
H 1 113 ASP 113 113 113 ASP ASP H . n 
H 1 114 TYR 114 114 114 TYR TYR H . n 
H 1 115 LEU 115 115 115 LEU LEU H . n 
H 1 116 ARG 116 116 116 ARG ARG H . n 
H 1 117 ALA 117 117 117 ALA ALA H . n 
H 1 118 THR 118 118 118 THR THR H . n 
H 1 119 GLY 119 119 119 GLY GLY H . n 
H 1 120 ILE 120 120 120 ILE ILE H . n 
H 1 121 ALA 121 121 121 ALA ALA H . n 
H 1 122 ASP 122 122 122 ASP ASP H . n 
H 1 123 THR 123 123 123 THR THR H . n 
H 1 124 VAL 124 124 124 VAL VAL H . n 
H 1 125 LEU 125 125 125 LEU LEU H . n 
H 1 126 PHE 126 126 126 PHE PHE H . n 
H 1 127 GLY 127 127 127 GLY GLY H . n 
H 1 128 PRO 128 128 128 PRO PRO H . n 
H 1 129 GLU 129 129 129 GLU GLU H . n 
H 1 130 PRO 130 130 130 PRO PRO H . n 
H 1 131 GLU 131 131 131 GLU GLU H . n 
H 1 132 PHE 132 132 132 PHE PHE H . n 
H 1 133 PHE 133 133 133 PHE PHE H . n 
H 1 134 LEU 134 134 134 LEU LEU H . n 
H 1 135 PHE 135 135 135 PHE PHE H . n 
H 1 136 ASP 136 136 136 ASP ASP H . n 
H 1 137 ASP 137 137 137 ASP ASP H . n 
H 1 138 ILE 138 138 138 ILE ILE H . n 
H 1 139 ARG 139 139 139 ARG ARG H . n 
H 1 140 PHE 140 140 140 PHE PHE H . n 
H 1 141 GLY 141 141 141 GLY GLY H . n 
H 1 142 ALA 142 142 142 ALA ALA H . n 
H 1 143 SER 143 143 143 SER SER H . n 
H 1 144 ILE 144 144 144 ILE ILE H . n 
H 1 145 SER 145 145 145 SER SER H . n 
H 1 146 GLY 146 146 146 GLY GLY H . n 
H 1 147 SER 147 147 147 SER SER H . n 
H 1 148 HIS 148 148 148 HIS HIS H . n 
H 1 149 VAL 149 149 149 VAL VAL H . n 
H 1 150 ALA 150 150 150 ALA ALA H . n 
H 1 151 ILE 151 151 151 ILE ILE H . n 
H 1 152 ASP 152 152 152 ASP ASP H . n 
H 1 153 ASP 153 153 153 ASP ASP H . n 
H 1 154 ILE 154 154 154 ILE ILE H . n 
H 1 155 GLU 155 155 155 GLU GLU H . n 
H 1 156 GLY 156 156 156 GLY GLY H . n 
H 1 157 ALA 157 157 157 ALA ALA H . n 
H 1 158 TRP 158 158 158 TRP TRP H . n 
H 1 159 ASN 159 159 159 ASN ASN H . n 
H 1 160 SER 160 160 160 SER SER H . n 
H 1 161 SER 161 161 161 SER SER H . n 
H 1 162 THR 162 162 162 THR THR H . n 
H 1 163 LYS 163 163 163 LYS LYS H . n 
H 1 164 TYR 164 164 164 TYR TYR H . n 
H 1 165 GLU 165 165 165 GLU GLU H . n 
H 1 166 GLY 166 166 166 GLY GLY H . n 
H 1 167 GLY 167 167 167 GLY GLY H . n 
H 1 168 ASN 168 168 168 ASN ASN H . n 
H 1 169 LYS 169 169 169 LYS LYS H . n 
H 1 170 GLY 170 170 170 GLY GLY H . n 
H 1 171 HIS 171 171 171 HIS HIS H . n 
H 1 172 ARG 172 172 172 ARG ARG H . n 
H 1 173 PRO 173 173 173 PRO PRO H . n 
H 1 174 GLY 174 174 174 GLY GLY H . n 
H 1 175 VAL 175 175 175 VAL VAL H . n 
H 1 176 LYS 176 176 176 LYS LYS H . n 
H 1 177 GLY 177 177 177 GLY GLY H . n 
H 1 178 GLY 178 178 178 GLY GLY H . n 
H 1 179 TYR 179 179 179 TYR TYR H . n 
H 1 180 PHE 180 180 180 PHE PHE H . n 
H 1 181 PRO 181 181 181 PRO PRO H . n 
H 1 182 VAL 182 182 182 VAL VAL H . n 
H 1 183 PRO 183 183 183 PRO PRO H . n 
H 1 184 PRO 184 184 184 PRO PRO H . n 
H 1 185 VAL 185 185 185 VAL VAL H . n 
H 1 186 ASP 186 186 186 ASP ASP H . n 
H 1 187 SER 187 187 187 SER SER H . n 
H 1 188 ALA 188 188 188 ALA ALA H . n 
H 1 189 GLN 189 189 189 GLN GLN H . n 
H 1 190 ASP 190 190 190 ASP ASP H . n 
H 1 191 ILE 191 191 191 ILE ILE H . n 
H 1 192 ARG 192 192 192 ARG ARG H . n 
H 1 193 SER 193 193 193 SER SER H . n 
H 1 194 GLU 194 194 194 GLU GLU H . n 
H 1 195 MET 195 195 195 MET MET H . n 
H 1 196 CYS 196 196 196 CYS CYS H . n 
H 1 197 LEU 197 197 197 LEU LEU H . n 
H 1 198 VAL 198 198 198 VAL VAL H . n 
H 1 199 MET 199 199 199 MET MET H . n 
H 1 200 GLU 200 200 200 GLU GLU H . n 
H 1 201 GLN 201 201 201 GLN GLN H . n 
H 1 202 MET 202 202 202 MET MET H . n 
H 1 203 GLY 203 203 203 GLY GLY H . n 
H 1 204 LEU 204 204 204 LEU LEU H . n 
H 1 205 VAL 205 205 205 VAL VAL H . n 
H 1 206 VAL 206 206 206 VAL VAL H . n 
H 1 207 GLU 207 207 207 GLU GLU H . n 
H 1 208 ALA 208 208 208 ALA ALA H . n 
H 1 209 HIS 209 209 209 HIS HIS H . n 
H 1 210 HIS 210 210 210 HIS HIS H . n 
H 1 211 HIS 211 211 211 HIS HIS H . n 
H 1 212 GLU 212 212 212 GLU GLU H . n 
H 1 213 VAL 213 213 213 VAL VAL H . n 
H 1 214 ALA 214 214 214 ALA ALA H . n 
H 1 215 THR 215 215 215 THR THR H . n 
H 1 216 ALA 216 216 216 ALA ALA H . n 
H 1 217 GLY 217 217 217 GLY GLY H . n 
H 1 218 GLN 218 218 218 GLN GLN H . n 
H 1 219 ASN 219 219 219 ASN ASN H . n 
H 1 220 GLU 220 220 220 GLU GLU H . n 
H 1 221 VAL 221 221 221 VAL VAL H . n 
H 1 222 ALA 222 222 222 ALA ALA H . n 
H 1 223 THR 223 223 223 THR THR H . n 
H 1 224 ARG 224 224 224 ARG ARG H . n 
H 1 225 PHE 225 225 225 PHE PHE H . n 
H 1 226 ASN 226 226 226 ASN ASN H . n 
H 1 227 THR 227 227 227 THR THR H . n 
H 1 228 MET 228 228 228 MET MET H . n 
H 1 229 THR 229 229 229 THR THR H . n 
H 1 230 LYS 230 230 230 LYS LYS H . n 
H 1 231 LYS 231 231 231 LYS LYS H . n 
H 1 232 ALA 232 232 232 ALA ALA H . n 
H 1 233 ASP 233 233 233 ASP ASP H . n 
H 1 234 GLU 234 234 234 GLU GLU H . n 
H 1 235 ILE 235 235 235 ILE ILE H . n 
H 1 236 GLN 236 236 236 GLN GLN H . n 
H 1 237 ILE 237 237 237 ILE ILE H . n 
H 1 238 TYR 238 238 238 TYR TYR H . n 
H 1 239 LYS 239 239 239 LYS LYS H . n 
H 1 240 TYR 240 240 240 TYR TYR H . n 
H 1 241 VAL 241 241 241 VAL VAL H . n 
H 1 242 VAL 242 242 242 VAL VAL H . n 
H 1 243 HIS 243 243 243 HIS HIS H . n 
H 1 244 ASN 244 244 244 ASN ASN H . n 
H 1 245 VAL 245 245 245 VAL VAL H . n 
H 1 246 ALA 246 246 246 ALA ALA H . n 
H 1 247 HIS 247 247 247 HIS HIS H . n 
H 1 248 ARG 248 248 248 ARG ARG H . n 
H 1 249 PHE 249 249 249 PHE PHE H . n 
H 1 250 GLY 250 250 250 GLY GLY H . n 
H 1 251 LYS 251 251 251 LYS LYS H . n 
H 1 252 THR 252 252 252 THR THR H . n 
H 1 253 ALA 253 253 253 ALA ALA H . n 
H 1 254 THR 254 254 254 THR THR H . n 
H 1 255 PHE 255 255 255 PHE PHE H . n 
H 1 256 MET 256 256 256 MET MET H . n 
H 1 257 PRO 257 257 257 PRO PRO H . n 
H 1 258 LYS 258 258 258 LYS LYS H . n 
H 1 259 PRO 259 259 259 PRO PRO H . n 
H 1 260 MET 260 260 260 MET MET H . n 
H 1 261 PHE 261 261 261 PHE PHE H . n 
H 1 262 GLY 262 262 262 GLY GLY H . n 
H 1 263 ASP 263 263 263 ASP ASP H . n 
H 1 264 ASN 264 264 264 ASN ASN H . n 
H 1 265 GLY 265 265 265 GLY GLY H . n 
H 1 266 SER 266 266 266 SER SER H . n 
H 1 267 GLY 267 267 267 GLY GLY H . n 
H 1 268 MET 268 268 268 MET MET H . n 
H 1 269 HIS 269 269 269 HIS HIS H . n 
H 1 270 CYS 270 270 270 CYS CYS H . n 
H 1 271 HIS 271 271 271 HIS HIS H . n 
H 1 272 MET 272 272 272 MET MET H . n 
H 1 273 SER 273 273 273 SER SER H . n 
H 1 274 LEU 274 274 274 LEU LEU H . n 
H 1 275 ALA 275 275 275 ALA ALA H . n 
H 1 276 LYS 276 276 276 LYS LYS H . n 
H 1 277 ASN 277 277 277 ASN ASN H . n 
H 1 278 GLY 278 278 278 GLY GLY H . n 
H 1 279 THR 279 279 279 THR THR H . n 
H 1 280 ASN 280 280 280 ASN ASN H . n 
H 1 281 LEU 281 281 281 LEU LEU H . n 
H 1 282 PHE 282 282 282 PHE PHE H . n 
H 1 283 SER 283 283 283 SER SER H . n 
H 1 284 GLY 284 284 284 GLY GLY H . n 
H 1 285 ASP 285 285 285 ASP ASP H . n 
H 1 286 LYS 286 286 286 LYS LYS H . n 
H 1 287 TYR 287 287 287 TYR TYR H . n 
H 1 288 ALA 288 288 288 ALA ALA H . n 
H 1 289 GLY 289 289 289 GLY GLY H . n 
H 1 290 LEU 290 290 290 LEU LEU H . n 
H 1 291 SER 291 291 291 SER SER H . n 
H 1 292 GLU 292 292 292 GLU GLU H . n 
H 1 293 GLN 293 293 293 GLN GLN H . n 
H 1 294 ALA 294 294 294 ALA ALA H . n 
H 1 295 LEU 295 295 295 LEU LEU H . n 
H 1 296 TYR 296 296 296 TYR TYR H . n 
H 1 297 TYR 297 297 297 TYR TYR H . n 
H 1 298 ILE 298 298 298 ILE ILE H . n 
H 1 299 GLY 299 299 299 GLY GLY H . n 
H 1 300 GLY 300 300 300 GLY GLY H . n 
H 1 301 VAL 301 301 301 VAL VAL H . n 
H 1 302 ILE 302 302 302 ILE ILE H . n 
H 1 303 LYS 303 303 303 LYS LYS H . n 
H 1 304 HIS 304 304 304 HIS HIS H . n 
H 1 305 ALA 305 305 305 ALA ALA H . n 
H 1 306 LYS 306 306 306 LYS LYS H . n 
H 1 307 ALA 307 307 307 ALA ALA H . n 
H 1 308 ILE 308 308 308 ILE ILE H . n 
H 1 309 ASN 309 309 309 ASN ASN H . n 
H 1 310 ALA 310 310 310 ALA ALA H . n 
H 1 311 LEU 311 311 311 LEU LEU H . n 
H 1 312 ALA 312 312 312 ALA ALA H . n 
H 1 313 ASN 313 313 313 ASN ASN H . n 
H 1 314 PRO 314 314 314 PRO PRO H . n 
H 1 315 THR 315 315 315 THR THR H . n 
H 1 316 THR 316 316 316 THR THR H . n 
H 1 317 ASN 317 317 317 ASN ASN H . n 
H 1 318 SER 318 318 318 SER SER H . n 
H 1 319 TYR 319 319 319 TYR TYR H . n 
H 1 320 LYS 320 320 320 LYS LYS H . n 
H 1 321 ARG 321 321 321 ARG ARG H . n 
H 1 322 LEU 322 322 322 LEU LEU H . n 
H 1 323 VAL 323 323 323 VAL VAL H . n 
H 1 324 PRO 324 324 324 PRO PRO H . n 
H 1 325 GLY 325 325 325 GLY GLY H . n 
H 1 326 TYR 326 326 326 TYR TYR H . n 
H 1 327 GLU 327 327 327 GLU GLU H . n 
H 1 328 ALA 328 328 328 ALA ALA H . n 
H 1 329 PRO 329 329 329 PRO PRO H . n 
H 1 330 VAL 330 330 330 VAL VAL H . n 
H 1 331 MET 331 331 331 MET MET H . n 
H 1 332 LEU 332 332 332 LEU LEU H . n 
H 1 333 ALA 333 333 333 ALA ALA H . n 
H 1 334 TYR 334 334 334 TYR TYR H . n 
H 1 335 SER 335 335 335 SER SER H . n 
H 1 336 ALA 336 336 336 ALA ALA H . n 
H 1 337 ARG 337 337 337 ARG ARG H . n 
H 1 338 ASN 338 338 338 ASN ASN H . n 
H 1 339 ARG 339 339 339 ARG ARG H . n 
H 1 340 SER 340 340 340 SER SER H . n 
H 1 341 ALA 341 341 341 ALA ALA H . n 
H 1 342 SER 342 342 342 SER SER H . n 
H 1 343 ILE 343 343 343 ILE ILE H . n 
H 1 344 ARG 344 344 344 ARG ARG H . n 
H 1 345 ILE 345 345 345 ILE ILE H . n 
H 1 346 PRO 346 346 346 PRO PRO H . n 
H 1 347 VAL 347 347 347 VAL VAL H . n 
H 1 348 VAL 348 348 348 VAL VAL H . n 
H 1 349 ALA 349 349 349 ALA ALA H . n 
H 1 350 SER 350 350 350 SER SER H . n 
H 1 351 PRO 351 351 351 PRO PRO H . n 
H 1 352 LYS 352 352 352 LYS LYS H . n 
H 1 353 ALA 353 353 353 ALA ALA H . n 
H 1 354 ARG 354 354 354 ARG ARG H . n 
H 1 355 ARG 355 355 355 ARG ARG H . n 
H 1 356 ILE 356 356 356 ILE ILE H . n 
H 1 357 GLU 357 357 357 GLU GLU H . n 
H 1 358 VAL 358 358 358 VAL VAL H . n 
H 1 359 ARG 359 359 359 ARG ARG H . n 
H 1 360 PHE 360 360 360 PHE PHE H . n 
H 1 361 PRO 361 361 361 PRO PRO H . n 
H 1 362 ASP 362 362 362 ASP ASP H . n 
H 1 363 PRO 363 363 363 PRO PRO H . n 
H 1 364 ALA 364 364 364 ALA ALA H . n 
H 1 365 ALA 365 365 365 ALA ALA H . n 
H 1 366 ASN 366 366 366 ASN ASN H . n 
H 1 367 PRO 367 367 367 PRO PRO H . n 
H 1 368 TYR 368 368 368 TYR TYR H . n 
H 1 369 LEU 369 369 369 LEU LEU H . n 
H 1 370 CYS 370 370 370 CYS CYS H . n 
H 1 371 PHE 371 371 371 PHE PHE H . n 
H 1 372 ALA 372 372 372 ALA ALA H . n 
H 1 373 ALA 373 373 373 ALA ALA H . n 
H 1 374 LEU 374 374 374 LEU LEU H . n 
H 1 375 LEU 375 375 375 LEU LEU H . n 
H 1 376 MET 376 376 376 MET MET H . n 
H 1 377 ALA 377 377 377 ALA ALA H . n 
H 1 378 GLY 378 378 378 GLY GLY H . n 
H 1 379 LEU 379 379 379 LEU LEU H . n 
H 1 380 ASP 380 380 380 ASP ASP H . n 
H 1 381 GLY 381 381 381 GLY GLY H . n 
H 1 382 ILE 382 382 382 ILE ILE H . n 
H 1 383 LYS 383 383 383 LYS LYS H . n 
H 1 384 ASN 384 384 384 ASN ASN H . n 
H 1 385 LYS 385 385 385 LYS LYS H . n 
H 1 386 ILE 386 386 386 ILE ILE H . n 
H 1 387 HIS 387 387 387 HIS HIS H . n 
H 1 388 PRO 388 388 388 PRO PRO H . n 
H 1 389 GLY 389 389 389 GLY GLY H . n 
H 1 390 GLU 390 390 390 GLU GLU H . n 
H 1 391 PRO 391 391 391 PRO PRO H . n 
H 1 392 MET 392 392 392 MET MET H . n 
H 1 393 ASP 393 393 393 ASP ASP H . n 
H 1 394 LYS 394 394 394 LYS LYS H . n 
H 1 395 ASN 395 395 395 ASN ASN H . n 
H 1 396 LEU 396 396 396 LEU LEU H . n 
H 1 397 TYR 397 397 397 TYR TYR H . n 
H 1 398 ASP 398 398 398 ASP ASP H . n 
H 1 399 LEU 399 399 399 LEU LEU H . n 
H 1 400 PRO 400 400 400 PRO PRO H . n 
H 1 401 PRO 401 401 401 PRO PRO H . n 
H 1 402 GLU 402 402 402 GLU GLU H . n 
H 1 403 GLU 403 403 403 GLU GLU H . n 
H 1 404 ALA 404 404 404 ALA ALA H . n 
H 1 405 LYS 405 405 405 LYS LYS H . n 
H 1 406 GLU 406 406 406 GLU GLU H . n 
H 1 407 ILE 407 407 407 ILE ILE H . n 
H 1 408 PRO 408 408 408 PRO PRO H . n 
H 1 409 GLN 409 409 409 GLN GLN H . n 
H 1 410 VAL 410 410 410 VAL VAL H . n 
H 1 411 ALA 411 411 411 ALA ALA H . n 
H 1 412 GLY 412 412 412 GLY GLY H . n 
H 1 413 SER 413 413 413 SER SER H . n 
H 1 414 LEU 414 414 414 LEU LEU H . n 
H 1 415 GLU 415 415 415 GLU GLU H . n 
H 1 416 GLU 416 416 416 GLU GLU H . n 
H 1 417 ALA 417 417 417 ALA ALA H . n 
H 1 418 LEU 418 418 418 LEU LEU H . n 
H 1 419 ASN 419 419 419 ASN ASN H . n 
H 1 420 ALA 420 420 420 ALA ALA H . n 
H 1 421 LEU 421 421 421 LEU LEU H . n 
H 1 422 ASP 422 422 422 ASP ASP H . n 
H 1 423 LEU 423 423 423 LEU LEU H . n 
H 1 424 ASP 424 424 424 ASP ASP H . n 
H 1 425 ARG 425 425 425 ARG ARG H . n 
H 1 426 GLU 426 426 426 GLU GLU H . n 
H 1 427 PHE 427 427 427 PHE PHE H . n 
H 1 428 LEU 428 428 428 LEU LEU H . n 
H 1 429 LYS 429 429 429 LYS LYS H . n 
H 1 430 ALA 430 430 430 ALA ALA H . n 
H 1 431 GLY 431 431 431 GLY GLY H . n 
H 1 432 GLY 432 432 432 GLY GLY H . n 
H 1 433 VAL 433 433 433 VAL VAL H . n 
H 1 434 PHE 434 434 434 PHE PHE H . n 
H 1 435 THR 435 435 435 THR THR H . n 
H 1 436 ASP 436 436 436 ASP ASP H . n 
H 1 437 GLU 437 437 437 GLU GLU H . n 
H 1 438 ALA 438 438 438 ALA ALA H . n 
H 1 439 ILE 439 439 439 ILE ILE H . n 
H 1 440 ASP 440 440 440 ASP ASP H . n 
H 1 441 ALA 441 441 441 ALA ALA H . n 
H 1 442 TYR 442 442 442 TYR TYR H . n 
H 1 443 ILE 443 443 443 ILE ILE H . n 
H 1 444 ALA 444 444 444 ALA ALA H . n 
H 1 445 LEU 445 445 445 LEU LEU H . n 
H 1 446 ARG 446 446 446 ARG ARG H . n 
H 1 447 ARG 447 447 447 ARG ARG H . n 
H 1 448 GLU 448 448 448 GLU GLU H . n 
H 1 449 GLU 449 449 449 GLU GLU H . n 
H 1 450 ASP 450 450 450 ASP ASP H . n 
H 1 451 ASP 451 451 451 ASP ASP H . n 
H 1 452 ARG 452 452 452 ARG ARG H . n 
H 1 453 VAL 453 453 453 VAL VAL H . n 
H 1 454 ARG 454 454 454 ARG ARG H . n 
H 1 455 MET 455 455 455 MET MET H . n 
H 1 456 THR 456 456 456 THR THR H . n 
H 1 457 PRO 457 457 457 PRO PRO H . n 
H 1 458 HIS 458 458 458 HIS HIS H . n 
H 1 459 PRO 459 459 459 PRO PRO H . n 
H 1 460 VAL 460 460 460 VAL VAL H . n 
H 1 461 GLU 461 461 461 GLU GLU H . n 
H 1 462 PHE 462 462 462 PHE PHE H . n 
H 1 463 GLU 463 463 463 GLU GLU H . n 
H 1 464 LEU 464 464 464 LEU LEU H . n 
H 1 465 TYR 465 465 465 TYR TYR H . n 
H 1 466 TYR 466 466 466 TYR TYR H . n 
H 1 467 SER 467 467 467 SER SER H . n 
H 1 468 VAL 468 468 468 VAL VAL H . n 
I 1 1   SER 1   1   1   SER SER I . n 
I 1 2   ALA 2   2   2   ALA ALA I . n 
I 1 3   GLU 3   3   3   GLU GLU I . n 
I 1 4   HIS 4   4   4   HIS HIS I . n 
I 1 5   VAL 5   5   5   VAL VAL I . n 
I 1 6   LEU 6   6   6   LEU LEU I . n 
I 1 7   THR 7   7   7   THR THR I . n 
I 1 8   MET 8   8   8   MET MET I . n 
I 1 9   LEU 9   9   9   LEU LEU I . n 
I 1 10  ASN 10  10  10  ASN ASN I . n 
I 1 11  GLU 11  11  11  GLU GLU I . n 
I 1 12  HIS 12  12  12  HIS HIS I . n 
I 1 13  GLU 13  13  13  GLU GLU I . n 
I 1 14  VAL 14  14  14  VAL VAL I . n 
I 1 15  LYS 15  15  15  LYS LYS I . n 
I 1 16  PHE 16  16  16  PHE PHE I . n 
I 1 17  VAL 17  17  17  VAL VAL I . n 
I 1 18  ASP 18  18  18  ASP ASP I . n 
I 1 19  LEU 19  19  19  LEU LEU I . n 
I 1 20  ARG 20  20  20  ARG ARG I . n 
I 1 21  PHE 21  21  21  PHE PHE I . n 
I 1 22  THR 22  22  22  THR THR I . n 
I 1 23  ASP 23  23  23  ASP ASP I . n 
I 1 24  THR 24  24  24  THR THR I . n 
I 1 25  LYS 25  25  25  LYS LYS I . n 
I 1 26  GLY 26  26  26  GLY GLY I . n 
I 1 27  LYS 27  27  27  LYS LYS I . n 
I 1 28  GLU 28  28  28  GLU GLU I . n 
I 1 29  GLN 29  29  29  GLN GLN I . n 
I 1 30  HIS 30  30  30  HIS HIS I . n 
I 1 31  VAL 31  31  31  VAL VAL I . n 
I 1 32  THR 32  32  32  THR THR I . n 
I 1 33  ILE 33  33  33  ILE ILE I . n 
I 1 34  PRO 34  34  34  PRO PRO I . n 
I 1 35  ALA 35  35  35  ALA ALA I . n 
I 1 36  HIS 36  36  36  HIS HIS I . n 
I 1 37  GLN 37  37  37  GLN GLN I . n 
I 1 38  VAL 38  38  38  VAL VAL I . n 
I 1 39  ASN 39  39  39  ASN ASN I . n 
I 1 40  ALA 40  40  40  ALA ALA I . n 
I 1 41  GLU 41  41  41  GLU GLU I . n 
I 1 42  PHE 42  42  42  PHE PHE I . n 
I 1 43  PHE 43  43  43  PHE PHE I . n 
I 1 44  GLU 44  44  44  GLU GLU I . n 
I 1 45  GLU 45  45  45  GLU GLU I . n 
I 1 46  GLY 46  46  46  GLY GLY I . n 
I 1 47  LYS 47  47  47  LYS LYS I . n 
I 1 48  MET 48  48  48  MET MET I . n 
I 1 49  PHE 49  49  49  PHE PHE I . n 
I 1 50  ASP 50  50  50  ASP ASP I . n 
I 1 51  GLY 51  51  51  GLY GLY I . n 
I 1 52  SER 52  52  52  SER SER I . n 
I 1 53  SER 53  53  53  SER SER I . n 
I 1 54  ILE 54  54  54  ILE ILE I . n 
I 1 55  GLY 55  55  55  GLY GLY I . n 
I 1 56  GLY 56  56  56  GLY GLY I . n 
I 1 57  TRP 57  57  57  TRP TRP I . n 
I 1 58  LYS 58  58  58  LYS LYS I . n 
I 1 59  GLY 59  59  59  GLY GLY I . n 
I 1 60  ILE 60  60  60  ILE ILE I . n 
I 1 61  ASN 61  61  61  ASN ASN I . n 
I 1 62  GLU 62  62  62  GLU GLU I . n 
I 1 63  SER 63  63  63  SER SER I . n 
I 1 64  ASP 64  64  64  ASP ASP I . n 
I 1 65  MET 65  65  65  MET MET I . n 
I 1 66  VAL 66  66  66  VAL VAL I . n 
I 1 67  LEU 67  67  67  LEU LEU I . n 
I 1 68  MET 68  68  68  MET MET I . n 
I 1 69  PRO 69  69  69  PRO PRO I . n 
I 1 70  ASP 70  70  70  ASP ASP I . n 
I 1 71  ALA 71  71  71  ALA ALA I . n 
I 1 72  SER 72  72  72  SER SER I . n 
I 1 73  THR 73  73  73  THR THR I . n 
I 1 74  ALA 74  74  74  ALA ALA I . n 
I 1 75  VAL 75  75  75  VAL VAL I . n 
I 1 76  ILE 76  76  76  ILE ILE I . n 
I 1 77  ASP 77  77  77  ASP ASP I . n 
I 1 78  PRO 78  78  78  PRO PRO I . n 
I 1 79  PHE 79  79  79  PHE PHE I . n 
I 1 80  PHE 80  80  80  PHE PHE I . n 
I 1 81  ALA 81  81  81  ALA ALA I . n 
I 1 82  ASP 82  82  82  ASP ASP I . n 
I 1 83  SER 83  83  83  SER SER I . n 
I 1 84  THR 84  84  84  THR THR I . n 
I 1 85  LEU 85  85  85  LEU LEU I . n 
I 1 86  ILE 86  86  86  ILE ILE I . n 
I 1 87  ILE 87  87  87  ILE ILE I . n 
I 1 88  ARG 88  88  88  ARG ARG I . n 
I 1 89  CYS 89  89  89  CYS CYS I . n 
I 1 90  ASP 90  90  90  ASP ASP I . n 
I 1 91  ILE 91  91  91  ILE ILE I . n 
I 1 92  LEU 92  92  92  LEU LEU I . n 
I 1 93  GLU 93  93  93  GLU GLU I . n 
I 1 94  PRO 94  94  94  PRO PRO I . n 
I 1 95  GLY 95  95  95  GLY GLY I . n 
I 1 96  THR 96  96  96  THR THR I . n 
I 1 97  LEU 97  97  97  LEU LEU I . n 
I 1 98  GLN 98  98  98  GLN GLN I . n 
I 1 99  GLY 99  99  99  GLY GLY I . n 
I 1 100 TYR 100 100 100 TYR TYR I . n 
I 1 101 ASP 101 101 101 ASP ASP I . n 
I 1 102 ARG 102 102 102 ARG ARG I . n 
I 1 103 ASP 103 103 103 ASP ASP I . n 
I 1 104 PRO 104 104 104 PRO PRO I . n 
I 1 105 ARG 105 105 105 ARG ARG I . n 
I 1 106 SER 106 106 106 SER SER I . n 
I 1 107 ILE 107 107 107 ILE ILE I . n 
I 1 108 ALA 108 108 108 ALA ALA I . n 
I 1 109 LYS 109 109 109 LYS LYS I . n 
I 1 110 ARG 110 110 110 ARG ARG I . n 
I 1 111 ALA 111 111 111 ALA ALA I . n 
I 1 112 GLU 112 112 112 GLU GLU I . n 
I 1 113 ASP 113 113 113 ASP ASP I . n 
I 1 114 TYR 114 114 114 TYR TYR I . n 
I 1 115 LEU 115 115 115 LEU LEU I . n 
I 1 116 ARG 116 116 116 ARG ARG I . n 
I 1 117 ALA 117 117 117 ALA ALA I . n 
I 1 118 THR 118 118 118 THR THR I . n 
I 1 119 GLY 119 119 119 GLY GLY I . n 
I 1 120 ILE 120 120 120 ILE ILE I . n 
I 1 121 ALA 121 121 121 ALA ALA I . n 
I 1 122 ASP 122 122 122 ASP ASP I . n 
I 1 123 THR 123 123 123 THR THR I . n 
I 1 124 VAL 124 124 124 VAL VAL I . n 
I 1 125 LEU 125 125 125 LEU LEU I . n 
I 1 126 PHE 126 126 126 PHE PHE I . n 
I 1 127 GLY 127 127 127 GLY GLY I . n 
I 1 128 PRO 128 128 128 PRO PRO I . n 
I 1 129 GLU 129 129 129 GLU GLU I . n 
I 1 130 PRO 130 130 130 PRO PRO I . n 
I 1 131 GLU 131 131 131 GLU GLU I . n 
I 1 132 PHE 132 132 132 PHE PHE I . n 
I 1 133 PHE 133 133 133 PHE PHE I . n 
I 1 134 LEU 134 134 134 LEU LEU I . n 
I 1 135 PHE 135 135 135 PHE PHE I . n 
I 1 136 ASP 136 136 136 ASP ASP I . n 
I 1 137 ASP 137 137 137 ASP ASP I . n 
I 1 138 ILE 138 138 138 ILE ILE I . n 
I 1 139 ARG 139 139 139 ARG ARG I . n 
I 1 140 PHE 140 140 140 PHE PHE I . n 
I 1 141 GLY 141 141 141 GLY GLY I . n 
I 1 142 ALA 142 142 142 ALA ALA I . n 
I 1 143 SER 143 143 143 SER SER I . n 
I 1 144 ILE 144 144 144 ILE ILE I . n 
I 1 145 SER 145 145 145 SER SER I . n 
I 1 146 GLY 146 146 146 GLY GLY I . n 
I 1 147 SER 147 147 147 SER SER I . n 
I 1 148 HIS 148 148 148 HIS HIS I . n 
I 1 149 VAL 149 149 149 VAL VAL I . n 
I 1 150 ALA 150 150 150 ALA ALA I . n 
I 1 151 ILE 151 151 151 ILE ILE I . n 
I 1 152 ASP 152 152 152 ASP ASP I . n 
I 1 153 ASP 153 153 153 ASP ASP I . n 
I 1 154 ILE 154 154 154 ILE ILE I . n 
I 1 155 GLU 155 155 155 GLU GLU I . n 
I 1 156 GLY 156 156 156 GLY GLY I . n 
I 1 157 ALA 157 157 157 ALA ALA I . n 
I 1 158 TRP 158 158 158 TRP TRP I . n 
I 1 159 ASN 159 159 159 ASN ASN I . n 
I 1 160 SER 160 160 160 SER SER I . n 
I 1 161 SER 161 161 161 SER SER I . n 
I 1 162 THR 162 162 162 THR THR I . n 
I 1 163 LYS 163 163 163 LYS LYS I . n 
I 1 164 TYR 164 164 164 TYR TYR I . n 
I 1 165 GLU 165 165 165 GLU GLU I . n 
I 1 166 GLY 166 166 166 GLY GLY I . n 
I 1 167 GLY 167 167 167 GLY GLY I . n 
I 1 168 ASN 168 168 168 ASN ASN I . n 
I 1 169 LYS 169 169 169 LYS LYS I . n 
I 1 170 GLY 170 170 170 GLY GLY I . n 
I 1 171 HIS 171 171 171 HIS HIS I . n 
I 1 172 ARG 172 172 172 ARG ARG I . n 
I 1 173 PRO 173 173 173 PRO PRO I . n 
I 1 174 GLY 174 174 174 GLY GLY I . n 
I 1 175 VAL 175 175 175 VAL VAL I . n 
I 1 176 LYS 176 176 176 LYS LYS I . n 
I 1 177 GLY 177 177 177 GLY GLY I . n 
I 1 178 GLY 178 178 178 GLY GLY I . n 
I 1 179 TYR 179 179 179 TYR TYR I . n 
I 1 180 PHE 180 180 180 PHE PHE I . n 
I 1 181 PRO 181 181 181 PRO PRO I . n 
I 1 182 VAL 182 182 182 VAL VAL I . n 
I 1 183 PRO 183 183 183 PRO PRO I . n 
I 1 184 PRO 184 184 184 PRO PRO I . n 
I 1 185 VAL 185 185 185 VAL VAL I . n 
I 1 186 ASP 186 186 186 ASP ASP I . n 
I 1 187 SER 187 187 187 SER SER I . n 
I 1 188 ALA 188 188 188 ALA ALA I . n 
I 1 189 GLN 189 189 189 GLN GLN I . n 
I 1 190 ASP 190 190 190 ASP ASP I . n 
I 1 191 ILE 191 191 191 ILE ILE I . n 
I 1 192 ARG 192 192 192 ARG ARG I . n 
I 1 193 SER 193 193 193 SER SER I . n 
I 1 194 GLU 194 194 194 GLU GLU I . n 
I 1 195 MET 195 195 195 MET MET I . n 
I 1 196 CYS 196 196 196 CYS CYS I . n 
I 1 197 LEU 197 197 197 LEU LEU I . n 
I 1 198 VAL 198 198 198 VAL VAL I . n 
I 1 199 MET 199 199 199 MET MET I . n 
I 1 200 GLU 200 200 200 GLU GLU I . n 
I 1 201 GLN 201 201 201 GLN GLN I . n 
I 1 202 MET 202 202 202 MET MET I . n 
I 1 203 GLY 203 203 203 GLY GLY I . n 
I 1 204 LEU 204 204 204 LEU LEU I . n 
I 1 205 VAL 205 205 205 VAL VAL I . n 
I 1 206 VAL 206 206 206 VAL VAL I . n 
I 1 207 GLU 207 207 207 GLU GLU I . n 
I 1 208 ALA 208 208 208 ALA ALA I . n 
I 1 209 HIS 209 209 209 HIS HIS I . n 
I 1 210 HIS 210 210 210 HIS HIS I . n 
I 1 211 HIS 211 211 211 HIS HIS I . n 
I 1 212 GLU 212 212 212 GLU GLU I . n 
I 1 213 VAL 213 213 213 VAL VAL I . n 
I 1 214 ALA 214 214 214 ALA ALA I . n 
I 1 215 THR 215 215 215 THR THR I . n 
I 1 216 ALA 216 216 216 ALA ALA I . n 
I 1 217 GLY 217 217 217 GLY GLY I . n 
I 1 218 GLN 218 218 218 GLN GLN I . n 
I 1 219 ASN 219 219 219 ASN ASN I . n 
I 1 220 GLU 220 220 220 GLU GLU I . n 
I 1 221 VAL 221 221 221 VAL VAL I . n 
I 1 222 ALA 222 222 222 ALA ALA I . n 
I 1 223 THR 223 223 223 THR THR I . n 
I 1 224 ARG 224 224 224 ARG ARG I . n 
I 1 225 PHE 225 225 225 PHE PHE I . n 
I 1 226 ASN 226 226 226 ASN ASN I . n 
I 1 227 THR 227 227 227 THR THR I . n 
I 1 228 MET 228 228 228 MET MET I . n 
I 1 229 THR 229 229 229 THR THR I . n 
I 1 230 LYS 230 230 230 LYS LYS I . n 
I 1 231 LYS 231 231 231 LYS LYS I . n 
I 1 232 ALA 232 232 232 ALA ALA I . n 
I 1 233 ASP 233 233 233 ASP ASP I . n 
I 1 234 GLU 234 234 234 GLU GLU I . n 
I 1 235 ILE 235 235 235 ILE ILE I . n 
I 1 236 GLN 236 236 236 GLN GLN I . n 
I 1 237 ILE 237 237 237 ILE ILE I . n 
I 1 238 TYR 238 238 238 TYR TYR I . n 
I 1 239 LYS 239 239 239 LYS LYS I . n 
I 1 240 TYR 240 240 240 TYR TYR I . n 
I 1 241 VAL 241 241 241 VAL VAL I . n 
I 1 242 VAL 242 242 242 VAL VAL I . n 
I 1 243 HIS 243 243 243 HIS HIS I . n 
I 1 244 ASN 244 244 244 ASN ASN I . n 
I 1 245 VAL 245 245 245 VAL VAL I . n 
I 1 246 ALA 246 246 246 ALA ALA I . n 
I 1 247 HIS 247 247 247 HIS HIS I . n 
I 1 248 ARG 248 248 248 ARG ARG I . n 
I 1 249 PHE 249 249 249 PHE PHE I . n 
I 1 250 GLY 250 250 250 GLY GLY I . n 
I 1 251 LYS 251 251 251 LYS LYS I . n 
I 1 252 THR 252 252 252 THR THR I . n 
I 1 253 ALA 253 253 253 ALA ALA I . n 
I 1 254 THR 254 254 254 THR THR I . n 
I 1 255 PHE 255 255 255 PHE PHE I . n 
I 1 256 MET 256 256 256 MET MET I . n 
I 1 257 PRO 257 257 257 PRO PRO I . n 
I 1 258 LYS 258 258 258 LYS LYS I . n 
I 1 259 PRO 259 259 259 PRO PRO I . n 
I 1 260 MET 260 260 260 MET MET I . n 
I 1 261 PHE 261 261 261 PHE PHE I . n 
I 1 262 GLY 262 262 262 GLY GLY I . n 
I 1 263 ASP 263 263 263 ASP ASP I . n 
I 1 264 ASN 264 264 264 ASN ASN I . n 
I 1 265 GLY 265 265 265 GLY GLY I . n 
I 1 266 SER 266 266 266 SER SER I . n 
I 1 267 GLY 267 267 267 GLY GLY I . n 
I 1 268 MET 268 268 268 MET MET I . n 
I 1 269 HIS 269 269 269 HIS HIS I . n 
I 1 270 CYS 270 270 270 CYS CYS I . n 
I 1 271 HIS 271 271 271 HIS HIS I . n 
I 1 272 MET 272 272 272 MET MET I . n 
I 1 273 SER 273 273 273 SER SER I . n 
I 1 274 LEU 274 274 274 LEU LEU I . n 
I 1 275 ALA 275 275 275 ALA ALA I . n 
I 1 276 LYS 276 276 276 LYS LYS I . n 
I 1 277 ASN 277 277 277 ASN ASN I . n 
I 1 278 GLY 278 278 278 GLY GLY I . n 
I 1 279 THR 279 279 279 THR THR I . n 
I 1 280 ASN 280 280 280 ASN ASN I . n 
I 1 281 LEU 281 281 281 LEU LEU I . n 
I 1 282 PHE 282 282 282 PHE PHE I . n 
I 1 283 SER 283 283 283 SER SER I . n 
I 1 284 GLY 284 284 284 GLY GLY I . n 
I 1 285 ASP 285 285 285 ASP ASP I . n 
I 1 286 LYS 286 286 286 LYS LYS I . n 
I 1 287 TYR 287 287 287 TYR TYR I . n 
I 1 288 ALA 288 288 288 ALA ALA I . n 
I 1 289 GLY 289 289 289 GLY GLY I . n 
I 1 290 LEU 290 290 290 LEU LEU I . n 
I 1 291 SER 291 291 291 SER SER I . n 
I 1 292 GLU 292 292 292 GLU GLU I . n 
I 1 293 GLN 293 293 293 GLN GLN I . n 
I 1 294 ALA 294 294 294 ALA ALA I . n 
I 1 295 LEU 295 295 295 LEU LEU I . n 
I 1 296 TYR 296 296 296 TYR TYR I . n 
I 1 297 TYR 297 297 297 TYR TYR I . n 
I 1 298 ILE 298 298 298 ILE ILE I . n 
I 1 299 GLY 299 299 299 GLY GLY I . n 
I 1 300 GLY 300 300 300 GLY GLY I . n 
I 1 301 VAL 301 301 301 VAL VAL I . n 
I 1 302 ILE 302 302 302 ILE ILE I . n 
I 1 303 LYS 303 303 303 LYS LYS I . n 
I 1 304 HIS 304 304 304 HIS HIS I . n 
I 1 305 ALA 305 305 305 ALA ALA I . n 
I 1 306 LYS 306 306 306 LYS LYS I . n 
I 1 307 ALA 307 307 307 ALA ALA I . n 
I 1 308 ILE 308 308 308 ILE ILE I . n 
I 1 309 ASN 309 309 309 ASN ASN I . n 
I 1 310 ALA 310 310 310 ALA ALA I . n 
I 1 311 LEU 311 311 311 LEU LEU I . n 
I 1 312 ALA 312 312 312 ALA ALA I . n 
I 1 313 ASN 313 313 313 ASN ASN I . n 
I 1 314 PRO 314 314 314 PRO PRO I . n 
I 1 315 THR 315 315 315 THR THR I . n 
I 1 316 THR 316 316 316 THR THR I . n 
I 1 317 ASN 317 317 317 ASN ASN I . n 
I 1 318 SER 318 318 318 SER SER I . n 
I 1 319 TYR 319 319 319 TYR TYR I . n 
I 1 320 LYS 320 320 320 LYS LYS I . n 
I 1 321 ARG 321 321 321 ARG ARG I . n 
I 1 322 LEU 322 322 322 LEU LEU I . n 
I 1 323 VAL 323 323 323 VAL VAL I . n 
I 1 324 PRO 324 324 324 PRO PRO I . n 
I 1 325 GLY 325 325 325 GLY GLY I . n 
I 1 326 TYR 326 326 326 TYR TYR I . n 
I 1 327 GLU 327 327 327 GLU GLU I . n 
I 1 328 ALA 328 328 328 ALA ALA I . n 
I 1 329 PRO 329 329 329 PRO PRO I . n 
I 1 330 VAL 330 330 330 VAL VAL I . n 
I 1 331 MET 331 331 331 MET MET I . n 
I 1 332 LEU 332 332 332 LEU LEU I . n 
I 1 333 ALA 333 333 333 ALA ALA I . n 
I 1 334 TYR 334 334 334 TYR TYR I . n 
I 1 335 SER 335 335 335 SER SER I . n 
I 1 336 ALA 336 336 336 ALA ALA I . n 
I 1 337 ARG 337 337 337 ARG ARG I . n 
I 1 338 ASN 338 338 338 ASN ASN I . n 
I 1 339 ARG 339 339 339 ARG ARG I . n 
I 1 340 SER 340 340 340 SER SER I . n 
I 1 341 ALA 341 341 341 ALA ALA I . n 
I 1 342 SER 342 342 342 SER SER I . n 
I 1 343 ILE 343 343 343 ILE ILE I . n 
I 1 344 ARG 344 344 344 ARG ARG I . n 
I 1 345 ILE 345 345 345 ILE ILE I . n 
I 1 346 PRO 346 346 346 PRO PRO I . n 
I 1 347 VAL 347 347 347 VAL VAL I . n 
I 1 348 VAL 348 348 348 VAL VAL I . n 
I 1 349 ALA 349 349 349 ALA ALA I . n 
I 1 350 SER 350 350 350 SER SER I . n 
I 1 351 PRO 351 351 351 PRO PRO I . n 
I 1 352 LYS 352 352 352 LYS LYS I . n 
I 1 353 ALA 353 353 353 ALA ALA I . n 
I 1 354 ARG 354 354 354 ARG ARG I . n 
I 1 355 ARG 355 355 355 ARG ARG I . n 
I 1 356 ILE 356 356 356 ILE ILE I . n 
I 1 357 GLU 357 357 357 GLU GLU I . n 
I 1 358 VAL 358 358 358 VAL VAL I . n 
I 1 359 ARG 359 359 359 ARG ARG I . n 
I 1 360 PHE 360 360 360 PHE PHE I . n 
I 1 361 PRO 361 361 361 PRO PRO I . n 
I 1 362 ASP 362 362 362 ASP ASP I . n 
I 1 363 PRO 363 363 363 PRO PRO I . n 
I 1 364 ALA 364 364 364 ALA ALA I . n 
I 1 365 ALA 365 365 365 ALA ALA I . n 
I 1 366 ASN 366 366 366 ASN ASN I . n 
I 1 367 PRO 367 367 367 PRO PRO I . n 
I 1 368 TYR 368 368 368 TYR TYR I . n 
I 1 369 LEU 369 369 369 LEU LEU I . n 
I 1 370 CYS 370 370 370 CYS CYS I . n 
I 1 371 PHE 371 371 371 PHE PHE I . n 
I 1 372 ALA 372 372 372 ALA ALA I . n 
I 1 373 ALA 373 373 373 ALA ALA I . n 
I 1 374 LEU 374 374 374 LEU LEU I . n 
I 1 375 LEU 375 375 375 LEU LEU I . n 
I 1 376 MET 376 376 376 MET MET I . n 
I 1 377 ALA 377 377 377 ALA ALA I . n 
I 1 378 GLY 378 378 378 GLY GLY I . n 
I 1 379 LEU 379 379 379 LEU LEU I . n 
I 1 380 ASP 380 380 380 ASP ASP I . n 
I 1 381 GLY 381 381 381 GLY GLY I . n 
I 1 382 ILE 382 382 382 ILE ILE I . n 
I 1 383 LYS 383 383 383 LYS LYS I . n 
I 1 384 ASN 384 384 384 ASN ASN I . n 
I 1 385 LYS 385 385 385 LYS LYS I . n 
I 1 386 ILE 386 386 386 ILE ILE I . n 
I 1 387 HIS 387 387 387 HIS HIS I . n 
I 1 388 PRO 388 388 388 PRO PRO I . n 
I 1 389 GLY 389 389 389 GLY GLY I . n 
I 1 390 GLU 390 390 390 GLU GLU I . n 
I 1 391 PRO 391 391 391 PRO PRO I . n 
I 1 392 MET 392 392 392 MET MET I . n 
I 1 393 ASP 393 393 393 ASP ASP I . n 
I 1 394 LYS 394 394 394 LYS LYS I . n 
I 1 395 ASN 395 395 395 ASN ASN I . n 
I 1 396 LEU 396 396 396 LEU LEU I . n 
I 1 397 TYR 397 397 397 TYR TYR I . n 
I 1 398 ASP 398 398 398 ASP ASP I . n 
I 1 399 LEU 399 399 399 LEU LEU I . n 
I 1 400 PRO 400 400 400 PRO PRO I . n 
I 1 401 PRO 401 401 401 PRO PRO I . n 
I 1 402 GLU 402 402 402 GLU GLU I . n 
I 1 403 GLU 403 403 403 GLU GLU I . n 
I 1 404 ALA 404 404 404 ALA ALA I . n 
I 1 405 LYS 405 405 405 LYS LYS I . n 
I 1 406 GLU 406 406 406 GLU GLU I . n 
I 1 407 ILE 407 407 407 ILE ILE I . n 
I 1 408 PRO 408 408 408 PRO PRO I . n 
I 1 409 GLN 409 409 409 GLN GLN I . n 
I 1 410 VAL 410 410 410 VAL VAL I . n 
I 1 411 ALA 411 411 411 ALA ALA I . n 
I 1 412 GLY 412 412 412 GLY GLY I . n 
I 1 413 SER 413 413 413 SER SER I . n 
I 1 414 LEU 414 414 414 LEU LEU I . n 
I 1 415 GLU 415 415 415 GLU GLU I . n 
I 1 416 GLU 416 416 416 GLU GLU I . n 
I 1 417 ALA 417 417 417 ALA ALA I . n 
I 1 418 LEU 418 418 418 LEU LEU I . n 
I 1 419 ASN 419 419 419 ASN ASN I . n 
I 1 420 ALA 420 420 420 ALA ALA I . n 
I 1 421 LEU 421 421 421 LEU LEU I . n 
I 1 422 ASP 422 422 422 ASP ASP I . n 
I 1 423 LEU 423 423 423 LEU LEU I . n 
I 1 424 ASP 424 424 424 ASP ASP I . n 
I 1 425 ARG 425 425 425 ARG ARG I . n 
I 1 426 GLU 426 426 426 GLU GLU I . n 
I 1 427 PHE 427 427 427 PHE PHE I . n 
I 1 428 LEU 428 428 428 LEU LEU I . n 
I 1 429 LYS 429 429 429 LYS LYS I . n 
I 1 430 ALA 430 430 430 ALA ALA I . n 
I 1 431 GLY 431 431 431 GLY GLY I . n 
I 1 432 GLY 432 432 432 GLY GLY I . n 
I 1 433 VAL 433 433 433 VAL VAL I . n 
I 1 434 PHE 434 434 434 PHE PHE I . n 
I 1 435 THR 435 435 435 THR THR I . n 
I 1 436 ASP 436 436 436 ASP ASP I . n 
I 1 437 GLU 437 437 437 GLU GLU I . n 
I 1 438 ALA 438 438 438 ALA ALA I . n 
I 1 439 ILE 439 439 439 ILE ILE I . n 
I 1 440 ASP 440 440 440 ASP ASP I . n 
I 1 441 ALA 441 441 441 ALA ALA I . n 
I 1 442 TYR 442 442 442 TYR TYR I . n 
I 1 443 ILE 443 443 443 ILE ILE I . n 
I 1 444 ALA 444 444 444 ALA ALA I . n 
I 1 445 LEU 445 445 445 LEU LEU I . n 
I 1 446 ARG 446 446 446 ARG ARG I . n 
I 1 447 ARG 447 447 447 ARG ARG I . n 
I 1 448 GLU 448 448 448 GLU GLU I . n 
I 1 449 GLU 449 449 449 GLU GLU I . n 
I 1 450 ASP 450 450 450 ASP ASP I . n 
I 1 451 ASP 451 451 451 ASP ASP I . n 
I 1 452 ARG 452 452 452 ARG ARG I . n 
I 1 453 VAL 453 453 453 VAL VAL I . n 
I 1 454 ARG 454 454 454 ARG ARG I . n 
I 1 455 MET 455 455 455 MET MET I . n 
I 1 456 THR 456 456 456 THR THR I . n 
I 1 457 PRO 457 457 457 PRO PRO I . n 
I 1 458 HIS 458 458 458 HIS HIS I . n 
I 1 459 PRO 459 459 459 PRO PRO I . n 
I 1 460 VAL 460 460 460 VAL VAL I . n 
I 1 461 GLU 461 461 461 GLU GLU I . n 
I 1 462 PHE 462 462 462 PHE PHE I . n 
I 1 463 GLU 463 463 463 GLU GLU I . n 
I 1 464 LEU 464 464 464 LEU LEU I . n 
I 1 465 TYR 465 465 465 TYR TYR I . n 
I 1 466 TYR 466 466 466 TYR TYR I . n 
I 1 467 SER 467 467 467 SER SER I . n 
I 1 468 VAL 468 468 468 VAL VAL I . n 
J 1 1   SER 1   1   1   SER SER J . n 
J 1 2   ALA 2   2   2   ALA ALA J . n 
J 1 3   GLU 3   3   3   GLU GLU J . n 
J 1 4   HIS 4   4   4   HIS HIS J . n 
J 1 5   VAL 5   5   5   VAL VAL J . n 
J 1 6   LEU 6   6   6   LEU LEU J . n 
J 1 7   THR 7   7   7   THR THR J . n 
J 1 8   MET 8   8   8   MET MET J . n 
J 1 9   LEU 9   9   9   LEU LEU J . n 
J 1 10  ASN 10  10  10  ASN ASN J . n 
J 1 11  GLU 11  11  11  GLU GLU J . n 
J 1 12  HIS 12  12  12  HIS HIS J . n 
J 1 13  GLU 13  13  13  GLU GLU J . n 
J 1 14  VAL 14  14  14  VAL VAL J . n 
J 1 15  LYS 15  15  15  LYS LYS J . n 
J 1 16  PHE 16  16  16  PHE PHE J . n 
J 1 17  VAL 17  17  17  VAL VAL J . n 
J 1 18  ASP 18  18  18  ASP ASP J . n 
J 1 19  LEU 19  19  19  LEU LEU J . n 
J 1 20  ARG 20  20  20  ARG ARG J . n 
J 1 21  PHE 21  21  21  PHE PHE J . n 
J 1 22  THR 22  22  22  THR THR J . n 
J 1 23  ASP 23  23  23  ASP ASP J . n 
J 1 24  THR 24  24  24  THR THR J . n 
J 1 25  LYS 25  25  25  LYS LYS J . n 
J 1 26  GLY 26  26  26  GLY GLY J . n 
J 1 27  LYS 27  27  27  LYS LYS J . n 
J 1 28  GLU 28  28  28  GLU GLU J . n 
J 1 29  GLN 29  29  29  GLN GLN J . n 
J 1 30  HIS 30  30  30  HIS HIS J . n 
J 1 31  VAL 31  31  31  VAL VAL J . n 
J 1 32  THR 32  32  32  THR THR J . n 
J 1 33  ILE 33  33  33  ILE ILE J . n 
J 1 34  PRO 34  34  34  PRO PRO J . n 
J 1 35  ALA 35  35  35  ALA ALA J . n 
J 1 36  HIS 36  36  36  HIS HIS J . n 
J 1 37  GLN 37  37  37  GLN GLN J . n 
J 1 38  VAL 38  38  38  VAL VAL J . n 
J 1 39  ASN 39  39  39  ASN ASN J . n 
J 1 40  ALA 40  40  40  ALA ALA J . n 
J 1 41  GLU 41  41  41  GLU GLU J . n 
J 1 42  PHE 42  42  42  PHE PHE J . n 
J 1 43  PHE 43  43  43  PHE PHE J . n 
J 1 44  GLU 44  44  44  GLU GLU J . n 
J 1 45  GLU 45  45  45  GLU GLU J . n 
J 1 46  GLY 46  46  46  GLY GLY J . n 
J 1 47  LYS 47  47  47  LYS LYS J . n 
J 1 48  MET 48  48  48  MET MET J . n 
J 1 49  PHE 49  49  49  PHE PHE J . n 
J 1 50  ASP 50  50  50  ASP ASP J . n 
J 1 51  GLY 51  51  51  GLY GLY J . n 
J 1 52  SER 52  52  52  SER SER J . n 
J 1 53  SER 53  53  53  SER SER J . n 
J 1 54  ILE 54  54  54  ILE ILE J . n 
J 1 55  GLY 55  55  55  GLY GLY J . n 
J 1 56  GLY 56  56  56  GLY GLY J . n 
J 1 57  TRP 57  57  57  TRP TRP J . n 
J 1 58  LYS 58  58  58  LYS LYS J . n 
J 1 59  GLY 59  59  59  GLY GLY J . n 
J 1 60  ILE 60  60  60  ILE ILE J . n 
J 1 61  ASN 61  61  61  ASN ASN J . n 
J 1 62  GLU 62  62  62  GLU GLU J . n 
J 1 63  SER 63  63  63  SER SER J . n 
J 1 64  ASP 64  64  64  ASP ASP J . n 
J 1 65  MET 65  65  65  MET MET J . n 
J 1 66  VAL 66  66  66  VAL VAL J . n 
J 1 67  LEU 67  67  67  LEU LEU J . n 
J 1 68  MET 68  68  68  MET MET J . n 
J 1 69  PRO 69  69  69  PRO PRO J . n 
J 1 70  ASP 70  70  70  ASP ASP J . n 
J 1 71  ALA 71  71  71  ALA ALA J . n 
J 1 72  SER 72  72  72  SER SER J . n 
J 1 73  THR 73  73  73  THR THR J . n 
J 1 74  ALA 74  74  74  ALA ALA J . n 
J 1 75  VAL 75  75  75  VAL VAL J . n 
J 1 76  ILE 76  76  76  ILE ILE J . n 
J 1 77  ASP 77  77  77  ASP ASP J . n 
J 1 78  PRO 78  78  78  PRO PRO J . n 
J 1 79  PHE 79  79  79  PHE PHE J . n 
J 1 80  PHE 80  80  80  PHE PHE J . n 
J 1 81  ALA 81  81  81  ALA ALA J . n 
J 1 82  ASP 82  82  82  ASP ASP J . n 
J 1 83  SER 83  83  83  SER SER J . n 
J 1 84  THR 84  84  84  THR THR J . n 
J 1 85  LEU 85  85  85  LEU LEU J . n 
J 1 86  ILE 86  86  86  ILE ILE J . n 
J 1 87  ILE 87  87  87  ILE ILE J . n 
J 1 88  ARG 88  88  88  ARG ARG J . n 
J 1 89  CYS 89  89  89  CYS CYS J . n 
J 1 90  ASP 90  90  90  ASP ASP J . n 
J 1 91  ILE 91  91  91  ILE ILE J . n 
J 1 92  LEU 92  92  92  LEU LEU J . n 
J 1 93  GLU 93  93  93  GLU GLU J . n 
J 1 94  PRO 94  94  94  PRO PRO J . n 
J 1 95  GLY 95  95  95  GLY GLY J . n 
J 1 96  THR 96  96  96  THR THR J . n 
J 1 97  LEU 97  97  97  LEU LEU J . n 
J 1 98  GLN 98  98  98  GLN GLN J . n 
J 1 99  GLY 99  99  99  GLY GLY J . n 
J 1 100 TYR 100 100 100 TYR TYR J . n 
J 1 101 ASP 101 101 101 ASP ASP J . n 
J 1 102 ARG 102 102 102 ARG ARG J . n 
J 1 103 ASP 103 103 103 ASP ASP J . n 
J 1 104 PRO 104 104 104 PRO PRO J . n 
J 1 105 ARG 105 105 105 ARG ARG J . n 
J 1 106 SER 106 106 106 SER SER J . n 
J 1 107 ILE 107 107 107 ILE ILE J . n 
J 1 108 ALA 108 108 108 ALA ALA J . n 
J 1 109 LYS 109 109 109 LYS LYS J . n 
J 1 110 ARG 110 110 110 ARG ARG J . n 
J 1 111 ALA 111 111 111 ALA ALA J . n 
J 1 112 GLU 112 112 112 GLU GLU J . n 
J 1 113 ASP 113 113 113 ASP ASP J . n 
J 1 114 TYR 114 114 114 TYR TYR J . n 
J 1 115 LEU 115 115 115 LEU LEU J . n 
J 1 116 ARG 116 116 116 ARG ARG J . n 
J 1 117 ALA 117 117 117 ALA ALA J . n 
J 1 118 THR 118 118 118 THR THR J . n 
J 1 119 GLY 119 119 119 GLY GLY J . n 
J 1 120 ILE 120 120 120 ILE ILE J . n 
J 1 121 ALA 121 121 121 ALA ALA J . n 
J 1 122 ASP 122 122 122 ASP ASP J . n 
J 1 123 THR 123 123 123 THR THR J . n 
J 1 124 VAL 124 124 124 VAL VAL J . n 
J 1 125 LEU 125 125 125 LEU LEU J . n 
J 1 126 PHE 126 126 126 PHE PHE J . n 
J 1 127 GLY 127 127 127 GLY GLY J . n 
J 1 128 PRO 128 128 128 PRO PRO J . n 
J 1 129 GLU 129 129 129 GLU GLU J . n 
J 1 130 PRO 130 130 130 PRO PRO J . n 
J 1 131 GLU 131 131 131 GLU GLU J . n 
J 1 132 PHE 132 132 132 PHE PHE J . n 
J 1 133 PHE 133 133 133 PHE PHE J . n 
J 1 134 LEU 134 134 134 LEU LEU J . n 
J 1 135 PHE 135 135 135 PHE PHE J . n 
J 1 136 ASP 136 136 136 ASP ASP J . n 
J 1 137 ASP 137 137 137 ASP ASP J . n 
J 1 138 ILE 138 138 138 ILE ILE J . n 
J 1 139 ARG 139 139 139 ARG ARG J . n 
J 1 140 PHE 140 140 140 PHE PHE J . n 
J 1 141 GLY 141 141 141 GLY GLY J . n 
J 1 142 ALA 142 142 142 ALA ALA J . n 
J 1 143 SER 143 143 143 SER SER J . n 
J 1 144 ILE 144 144 144 ILE ILE J . n 
J 1 145 SER 145 145 145 SER SER J . n 
J 1 146 GLY 146 146 146 GLY GLY J . n 
J 1 147 SER 147 147 147 SER SER J . n 
J 1 148 HIS 148 148 148 HIS HIS J . n 
J 1 149 VAL 149 149 149 VAL VAL J . n 
J 1 150 ALA 150 150 150 ALA ALA J . n 
J 1 151 ILE 151 151 151 ILE ILE J . n 
J 1 152 ASP 152 152 152 ASP ASP J . n 
J 1 153 ASP 153 153 153 ASP ASP J . n 
J 1 154 ILE 154 154 154 ILE ILE J . n 
J 1 155 GLU 155 155 155 GLU GLU J . n 
J 1 156 GLY 156 156 156 GLY GLY J . n 
J 1 157 ALA 157 157 157 ALA ALA J . n 
J 1 158 TRP 158 158 158 TRP TRP J . n 
J 1 159 ASN 159 159 159 ASN ASN J . n 
J 1 160 SER 160 160 160 SER SER J . n 
J 1 161 SER 161 161 161 SER SER J . n 
J 1 162 THR 162 162 162 THR THR J . n 
J 1 163 LYS 163 163 163 LYS LYS J . n 
J 1 164 TYR 164 164 164 TYR TYR J . n 
J 1 165 GLU 165 165 165 GLU GLU J . n 
J 1 166 GLY 166 166 166 GLY GLY J . n 
J 1 167 GLY 167 167 167 GLY GLY J . n 
J 1 168 ASN 168 168 168 ASN ASN J . n 
J 1 169 LYS 169 169 169 LYS LYS J . n 
J 1 170 GLY 170 170 170 GLY GLY J . n 
J 1 171 HIS 171 171 171 HIS HIS J . n 
J 1 172 ARG 172 172 172 ARG ARG J . n 
J 1 173 PRO 173 173 173 PRO PRO J . n 
J 1 174 GLY 174 174 174 GLY GLY J . n 
J 1 175 VAL 175 175 175 VAL VAL J . n 
J 1 176 LYS 176 176 176 LYS LYS J . n 
J 1 177 GLY 177 177 177 GLY GLY J . n 
J 1 178 GLY 178 178 178 GLY GLY J . n 
J 1 179 TYR 179 179 179 TYR TYR J . n 
J 1 180 PHE 180 180 180 PHE PHE J . n 
J 1 181 PRO 181 181 181 PRO PRO J . n 
J 1 182 VAL 182 182 182 VAL VAL J . n 
J 1 183 PRO 183 183 183 PRO PRO J . n 
J 1 184 PRO 184 184 184 PRO PRO J . n 
J 1 185 VAL 185 185 185 VAL VAL J . n 
J 1 186 ASP 186 186 186 ASP ASP J . n 
J 1 187 SER 187 187 187 SER SER J . n 
J 1 188 ALA 188 188 188 ALA ALA J . n 
J 1 189 GLN 189 189 189 GLN GLN J . n 
J 1 190 ASP 190 190 190 ASP ASP J . n 
J 1 191 ILE 191 191 191 ILE ILE J . n 
J 1 192 ARG 192 192 192 ARG ARG J . n 
J 1 193 SER 193 193 193 SER SER J . n 
J 1 194 GLU 194 194 194 GLU GLU J . n 
J 1 195 MET 195 195 195 MET MET J . n 
J 1 196 CYS 196 196 196 CYS CYS J . n 
J 1 197 LEU 197 197 197 LEU LEU J . n 
J 1 198 VAL 198 198 198 VAL VAL J . n 
J 1 199 MET 199 199 199 MET MET J . n 
J 1 200 GLU 200 200 200 GLU GLU J . n 
J 1 201 GLN 201 201 201 GLN GLN J . n 
J 1 202 MET 202 202 202 MET MET J . n 
J 1 203 GLY 203 203 203 GLY GLY J . n 
J 1 204 LEU 204 204 204 LEU LEU J . n 
J 1 205 VAL 205 205 205 VAL VAL J . n 
J 1 206 VAL 206 206 206 VAL VAL J . n 
J 1 207 GLU 207 207 207 GLU GLU J . n 
J 1 208 ALA 208 208 208 ALA ALA J . n 
J 1 209 HIS 209 209 209 HIS HIS J . n 
J 1 210 HIS 210 210 210 HIS HIS J . n 
J 1 211 HIS 211 211 211 HIS HIS J . n 
J 1 212 GLU 212 212 212 GLU GLU J . n 
J 1 213 VAL 213 213 213 VAL VAL J . n 
J 1 214 ALA 214 214 214 ALA ALA J . n 
J 1 215 THR 215 215 215 THR THR J . n 
J 1 216 ALA 216 216 216 ALA ALA J . n 
J 1 217 GLY 217 217 217 GLY GLY J . n 
J 1 218 GLN 218 218 218 GLN GLN J . n 
J 1 219 ASN 219 219 219 ASN ASN J . n 
J 1 220 GLU 220 220 220 GLU GLU J . n 
J 1 221 VAL 221 221 221 VAL VAL J . n 
J 1 222 ALA 222 222 222 ALA ALA J . n 
J 1 223 THR 223 223 223 THR THR J . n 
J 1 224 ARG 224 224 224 ARG ARG J . n 
J 1 225 PHE 225 225 225 PHE PHE J . n 
J 1 226 ASN 226 226 226 ASN ASN J . n 
J 1 227 THR 227 227 227 THR THR J . n 
J 1 228 MET 228 228 228 MET MET J . n 
J 1 229 THR 229 229 229 THR THR J . n 
J 1 230 LYS 230 230 230 LYS LYS J . n 
J 1 231 LYS 231 231 231 LYS LYS J . n 
J 1 232 ALA 232 232 232 ALA ALA J . n 
J 1 233 ASP 233 233 233 ASP ASP J . n 
J 1 234 GLU 234 234 234 GLU GLU J . n 
J 1 235 ILE 235 235 235 ILE ILE J . n 
J 1 236 GLN 236 236 236 GLN GLN J . n 
J 1 237 ILE 237 237 237 ILE ILE J . n 
J 1 238 TYR 238 238 238 TYR TYR J . n 
J 1 239 LYS 239 239 239 LYS LYS J . n 
J 1 240 TYR 240 240 240 TYR TYR J . n 
J 1 241 VAL 241 241 241 VAL VAL J . n 
J 1 242 VAL 242 242 242 VAL VAL J . n 
J 1 243 HIS 243 243 243 HIS HIS J . n 
J 1 244 ASN 244 244 244 ASN ASN J . n 
J 1 245 VAL 245 245 245 VAL VAL J . n 
J 1 246 ALA 246 246 246 ALA ALA J . n 
J 1 247 HIS 247 247 247 HIS HIS J . n 
J 1 248 ARG 248 248 248 ARG ARG J . n 
J 1 249 PHE 249 249 249 PHE PHE J . n 
J 1 250 GLY 250 250 250 GLY GLY J . n 
J 1 251 LYS 251 251 251 LYS LYS J . n 
J 1 252 THR 252 252 252 THR THR J . n 
J 1 253 ALA 253 253 253 ALA ALA J . n 
J 1 254 THR 254 254 254 THR THR J . n 
J 1 255 PHE 255 255 255 PHE PHE J . n 
J 1 256 MET 256 256 256 MET MET J . n 
J 1 257 PRO 257 257 257 PRO PRO J . n 
J 1 258 LYS 258 258 258 LYS LYS J . n 
J 1 259 PRO 259 259 259 PRO PRO J . n 
J 1 260 MET 260 260 260 MET MET J . n 
J 1 261 PHE 261 261 261 PHE PHE J . n 
J 1 262 GLY 262 262 262 GLY GLY J . n 
J 1 263 ASP 263 263 263 ASP ASP J . n 
J 1 264 ASN 264 264 264 ASN ASN J . n 
J 1 265 GLY 265 265 265 GLY GLY J . n 
J 1 266 SER 266 266 266 SER SER J . n 
J 1 267 GLY 267 267 267 GLY GLY J . n 
J 1 268 MET 268 268 268 MET MET J . n 
J 1 269 HIS 269 269 269 HIS HIS J . n 
J 1 270 CYS 270 270 270 CYS CYS J . n 
J 1 271 HIS 271 271 271 HIS HIS J . n 
J 1 272 MET 272 272 272 MET MET J . n 
J 1 273 SER 273 273 273 SER SER J . n 
J 1 274 LEU 274 274 274 LEU LEU J . n 
J 1 275 ALA 275 275 275 ALA ALA J . n 
J 1 276 LYS 276 276 276 LYS LYS J . n 
J 1 277 ASN 277 277 277 ASN ASN J . n 
J 1 278 GLY 278 278 278 GLY GLY J . n 
J 1 279 THR 279 279 279 THR THR J . n 
J 1 280 ASN 280 280 280 ASN ASN J . n 
J 1 281 LEU 281 281 281 LEU LEU J . n 
J 1 282 PHE 282 282 282 PHE PHE J . n 
J 1 283 SER 283 283 283 SER SER J . n 
J 1 284 GLY 284 284 284 GLY GLY J . n 
J 1 285 ASP 285 285 285 ASP ASP J . n 
J 1 286 LYS 286 286 286 LYS LYS J . n 
J 1 287 TYR 287 287 287 TYR TYR J . n 
J 1 288 ALA 288 288 288 ALA ALA J . n 
J 1 289 GLY 289 289 289 GLY GLY J . n 
J 1 290 LEU 290 290 290 LEU LEU J . n 
J 1 291 SER 291 291 291 SER SER J . n 
J 1 292 GLU 292 292 292 GLU GLU J . n 
J 1 293 GLN 293 293 293 GLN GLN J . n 
J 1 294 ALA 294 294 294 ALA ALA J . n 
J 1 295 LEU 295 295 295 LEU LEU J . n 
J 1 296 TYR 296 296 296 TYR TYR J . n 
J 1 297 TYR 297 297 297 TYR TYR J . n 
J 1 298 ILE 298 298 298 ILE ILE J . n 
J 1 299 GLY 299 299 299 GLY GLY J . n 
J 1 300 GLY 300 300 300 GLY GLY J . n 
J 1 301 VAL 301 301 301 VAL VAL J . n 
J 1 302 ILE 302 302 302 ILE ILE J . n 
J 1 303 LYS 303 303 303 LYS LYS J . n 
J 1 304 HIS 304 304 304 HIS HIS J . n 
J 1 305 ALA 305 305 305 ALA ALA J . n 
J 1 306 LYS 306 306 306 LYS LYS J . n 
J 1 307 ALA 307 307 307 ALA ALA J . n 
J 1 308 ILE 308 308 308 ILE ILE J . n 
J 1 309 ASN 309 309 309 ASN ASN J . n 
J 1 310 ALA 310 310 310 ALA ALA J . n 
J 1 311 LEU 311 311 311 LEU LEU J . n 
J 1 312 ALA 312 312 312 ALA ALA J . n 
J 1 313 ASN 313 313 313 ASN ASN J . n 
J 1 314 PRO 314 314 314 PRO PRO J . n 
J 1 315 THR 315 315 315 THR THR J . n 
J 1 316 THR 316 316 316 THR THR J . n 
J 1 317 ASN 317 317 317 ASN ASN J . n 
J 1 318 SER 318 318 318 SER SER J . n 
J 1 319 TYR 319 319 319 TYR TYR J . n 
J 1 320 LYS 320 320 320 LYS LYS J . n 
J 1 321 ARG 321 321 321 ARG ARG J . n 
J 1 322 LEU 322 322 322 LEU LEU J . n 
J 1 323 VAL 323 323 323 VAL VAL J . n 
J 1 324 PRO 324 324 324 PRO PRO J . n 
J 1 325 GLY 325 325 325 GLY GLY J . n 
J 1 326 TYR 326 326 326 TYR TYR J . n 
J 1 327 GLU 327 327 327 GLU GLU J . n 
J 1 328 ALA 328 328 328 ALA ALA J . n 
J 1 329 PRO 329 329 329 PRO PRO J . n 
J 1 330 VAL 330 330 330 VAL VAL J . n 
J 1 331 MET 331 331 331 MET MET J . n 
J 1 332 LEU 332 332 332 LEU LEU J . n 
J 1 333 ALA 333 333 333 ALA ALA J . n 
J 1 334 TYR 334 334 334 TYR TYR J . n 
J 1 335 SER 335 335 335 SER SER J . n 
J 1 336 ALA 336 336 336 ALA ALA J . n 
J 1 337 ARG 337 337 337 ARG ARG J . n 
J 1 338 ASN 338 338 338 ASN ASN J . n 
J 1 339 ARG 339 339 339 ARG ARG J . n 
J 1 340 SER 340 340 340 SER SER J . n 
J 1 341 ALA 341 341 341 ALA ALA J . n 
J 1 342 SER 342 342 342 SER SER J . n 
J 1 343 ILE 343 343 343 ILE ILE J . n 
J 1 344 ARG 344 344 344 ARG ARG J . n 
J 1 345 ILE 345 345 345 ILE ILE J . n 
J 1 346 PRO 346 346 346 PRO PRO J . n 
J 1 347 VAL 347 347 347 VAL VAL J . n 
J 1 348 VAL 348 348 348 VAL VAL J . n 
J 1 349 ALA 349 349 349 ALA ALA J . n 
J 1 350 SER 350 350 350 SER SER J . n 
J 1 351 PRO 351 351 351 PRO PRO J . n 
J 1 352 LYS 352 352 352 LYS LYS J . n 
J 1 353 ALA 353 353 353 ALA ALA J . n 
J 1 354 ARG 354 354 354 ARG ARG J . n 
J 1 355 ARG 355 355 355 ARG ARG J . n 
J 1 356 ILE 356 356 356 ILE ILE J . n 
J 1 357 GLU 357 357 357 GLU GLU J . n 
J 1 358 VAL 358 358 358 VAL VAL J . n 
J 1 359 ARG 359 359 359 ARG ARG J . n 
J 1 360 PHE 360 360 360 PHE PHE J . n 
J 1 361 PRO 361 361 361 PRO PRO J . n 
J 1 362 ASP 362 362 362 ASP ASP J . n 
J 1 363 PRO 363 363 363 PRO PRO J . n 
J 1 364 ALA 364 364 364 ALA ALA J . n 
J 1 365 ALA 365 365 365 ALA ALA J . n 
J 1 366 ASN 366 366 366 ASN ASN J . n 
J 1 367 PRO 367 367 367 PRO PRO J . n 
J 1 368 TYR 368 368 368 TYR TYR J . n 
J 1 369 LEU 369 369 369 LEU LEU J . n 
J 1 370 CYS 370 370 370 CYS CYS J . n 
J 1 371 PHE 371 371 371 PHE PHE J . n 
J 1 372 ALA 372 372 372 ALA ALA J . n 
J 1 373 ALA 373 373 373 ALA ALA J . n 
J 1 374 LEU 374 374 374 LEU LEU J . n 
J 1 375 LEU 375 375 375 LEU LEU J . n 
J 1 376 MET 376 376 376 MET MET J . n 
J 1 377 ALA 377 377 377 ALA ALA J . n 
J 1 378 GLY 378 378 378 GLY GLY J . n 
J 1 379 LEU 379 379 379 LEU LEU J . n 
J 1 380 ASP 380 380 380 ASP ASP J . n 
J 1 381 GLY 381 381 381 GLY GLY J . n 
J 1 382 ILE 382 382 382 ILE ILE J . n 
J 1 383 LYS 383 383 383 LYS LYS J . n 
J 1 384 ASN 384 384 384 ASN ASN J . n 
J 1 385 LYS 385 385 385 LYS LYS J . n 
J 1 386 ILE 386 386 386 ILE ILE J . n 
J 1 387 HIS 387 387 387 HIS HIS J . n 
J 1 388 PRO 388 388 388 PRO PRO J . n 
J 1 389 GLY 389 389 389 GLY GLY J . n 
J 1 390 GLU 390 390 390 GLU GLU J . n 
J 1 391 PRO 391 391 391 PRO PRO J . n 
J 1 392 MET 392 392 392 MET MET J . n 
J 1 393 ASP 393 393 393 ASP ASP J . n 
J 1 394 LYS 394 394 394 LYS LYS J . n 
J 1 395 ASN 395 395 395 ASN ASN J . n 
J 1 396 LEU 396 396 396 LEU LEU J . n 
J 1 397 TYR 397 397 397 TYR TYR J . n 
J 1 398 ASP 398 398 398 ASP ASP J . n 
J 1 399 LEU 399 399 399 LEU LEU J . n 
J 1 400 PRO 400 400 400 PRO PRO J . n 
J 1 401 PRO 401 401 401 PRO PRO J . n 
J 1 402 GLU 402 402 402 GLU GLU J . n 
J 1 403 GLU 403 403 403 GLU GLU J . n 
J 1 404 ALA 404 404 404 ALA ALA J . n 
J 1 405 LYS 405 405 405 LYS LYS J . n 
J 1 406 GLU 406 406 406 GLU GLU J . n 
J 1 407 ILE 407 407 407 ILE ILE J . n 
J 1 408 PRO 408 408 408 PRO PRO J . n 
J 1 409 GLN 409 409 409 GLN GLN J . n 
J 1 410 VAL 410 410 410 VAL VAL J . n 
J 1 411 ALA 411 411 411 ALA ALA J . n 
J 1 412 GLY 412 412 412 GLY GLY J . n 
J 1 413 SER 413 413 413 SER SER J . n 
J 1 414 LEU 414 414 414 LEU LEU J . n 
J 1 415 GLU 415 415 415 GLU GLU J . n 
J 1 416 GLU 416 416 416 GLU GLU J . n 
J 1 417 ALA 417 417 417 ALA ALA J . n 
J 1 418 LEU 418 418 418 LEU LEU J . n 
J 1 419 ASN 419 419 419 ASN ASN J . n 
J 1 420 ALA 420 420 420 ALA ALA J . n 
J 1 421 LEU 421 421 421 LEU LEU J . n 
J 1 422 ASP 422 422 422 ASP ASP J . n 
J 1 423 LEU 423 423 423 LEU LEU J . n 
J 1 424 ASP 424 424 424 ASP ASP J . n 
J 1 425 ARG 425 425 425 ARG ARG J . n 
J 1 426 GLU 426 426 426 GLU GLU J . n 
J 1 427 PHE 427 427 427 PHE PHE J . n 
J 1 428 LEU 428 428 428 LEU LEU J . n 
J 1 429 LYS 429 429 429 LYS LYS J . n 
J 1 430 ALA 430 430 430 ALA ALA J . n 
J 1 431 GLY 431 431 431 GLY GLY J . n 
J 1 432 GLY 432 432 432 GLY GLY J . n 
J 1 433 VAL 433 433 433 VAL VAL J . n 
J 1 434 PHE 434 434 434 PHE PHE J . n 
J 1 435 THR 435 435 435 THR THR J . n 
J 1 436 ASP 436 436 436 ASP ASP J . n 
J 1 437 GLU 437 437 437 GLU GLU J . n 
J 1 438 ALA 438 438 438 ALA ALA J . n 
J 1 439 ILE 439 439 439 ILE ILE J . n 
J 1 440 ASP 440 440 440 ASP ASP J . n 
J 1 441 ALA 441 441 441 ALA ALA J . n 
J 1 442 TYR 442 442 442 TYR TYR J . n 
J 1 443 ILE 443 443 443 ILE ILE J . n 
J 1 444 ALA 444 444 444 ALA ALA J . n 
J 1 445 LEU 445 445 445 LEU LEU J . n 
J 1 446 ARG 446 446 446 ARG ARG J . n 
J 1 447 ARG 447 447 447 ARG ARG J . n 
J 1 448 GLU 448 448 448 GLU GLU J . n 
J 1 449 GLU 449 449 449 GLU GLU J . n 
J 1 450 ASP 450 450 450 ASP ASP J . n 
J 1 451 ASP 451 451 451 ASP ASP J . n 
J 1 452 ARG 452 452 452 ARG ARG J . n 
J 1 453 VAL 453 453 453 VAL VAL J . n 
J 1 454 ARG 454 454 454 ARG ARG J . n 
J 1 455 MET 455 455 455 MET MET J . n 
J 1 456 THR 456 456 456 THR THR J . n 
J 1 457 PRO 457 457 457 PRO PRO J . n 
J 1 458 HIS 458 458 458 HIS HIS J . n 
J 1 459 PRO 459 459 459 PRO PRO J . n 
J 1 460 VAL 460 460 460 VAL VAL J . n 
J 1 461 GLU 461 461 461 GLU GLU J . n 
J 1 462 PHE 462 462 462 PHE PHE J . n 
J 1 463 GLU 463 463 463 GLU GLU J . n 
J 1 464 LEU 464 464 464 LEU LEU J . n 
J 1 465 TYR 465 465 465 TYR TYR J . n 
J 1 466 TYR 466 466 466 TYR TYR J . n 
J 1 467 SER 467 467 467 SER SER J . n 
J 1 468 VAL 468 468 468 VAL VAL J . n 
K 1 1   SER 1   1   1   SER SER K . n 
K 1 2   ALA 2   2   2   ALA ALA K . n 
K 1 3   GLU 3   3   3   GLU GLU K . n 
K 1 4   HIS 4   4   4   HIS HIS K . n 
K 1 5   VAL 5   5   5   VAL VAL K . n 
K 1 6   LEU 6   6   6   LEU LEU K . n 
K 1 7   THR 7   7   7   THR THR K . n 
K 1 8   MET 8   8   8   MET MET K . n 
K 1 9   LEU 9   9   9   LEU LEU K . n 
K 1 10  ASN 10  10  10  ASN ASN K . n 
K 1 11  GLU 11  11  11  GLU GLU K . n 
K 1 12  HIS 12  12  12  HIS HIS K . n 
K 1 13  GLU 13  13  13  GLU GLU K . n 
K 1 14  VAL 14  14  14  VAL VAL K . n 
K 1 15  LYS 15  15  15  LYS LYS K . n 
K 1 16  PHE 16  16  16  PHE PHE K . n 
K 1 17  VAL 17  17  17  VAL VAL K . n 
K 1 18  ASP 18  18  18  ASP ASP K . n 
K 1 19  LEU 19  19  19  LEU LEU K . n 
K 1 20  ARG 20  20  20  ARG ARG K . n 
K 1 21  PHE 21  21  21  PHE PHE K . n 
K 1 22  THR 22  22  22  THR THR K . n 
K 1 23  ASP 23  23  23  ASP ASP K . n 
K 1 24  THR 24  24  24  THR THR K . n 
K 1 25  LYS 25  25  25  LYS LYS K . n 
K 1 26  GLY 26  26  26  GLY GLY K . n 
K 1 27  LYS 27  27  27  LYS LYS K . n 
K 1 28  GLU 28  28  28  GLU GLU K . n 
K 1 29  GLN 29  29  29  GLN GLN K . n 
K 1 30  HIS 30  30  30  HIS HIS K . n 
K 1 31  VAL 31  31  31  VAL VAL K . n 
K 1 32  THR 32  32  32  THR THR K . n 
K 1 33  ILE 33  33  33  ILE ILE K . n 
K 1 34  PRO 34  34  34  PRO PRO K . n 
K 1 35  ALA 35  35  35  ALA ALA K . n 
K 1 36  HIS 36  36  36  HIS HIS K . n 
K 1 37  GLN 37  37  37  GLN GLN K . n 
K 1 38  VAL 38  38  38  VAL VAL K . n 
K 1 39  ASN 39  39  39  ASN ASN K . n 
K 1 40  ALA 40  40  40  ALA ALA K . n 
K 1 41  GLU 41  41  41  GLU GLU K . n 
K 1 42  PHE 42  42  42  PHE PHE K . n 
K 1 43  PHE 43  43  43  PHE PHE K . n 
K 1 44  GLU 44  44  44  GLU GLU K . n 
K 1 45  GLU 45  45  45  GLU GLU K . n 
K 1 46  GLY 46  46  46  GLY GLY K . n 
K 1 47  LYS 47  47  47  LYS LYS K . n 
K 1 48  MET 48  48  48  MET MET K . n 
K 1 49  PHE 49  49  49  PHE PHE K . n 
K 1 50  ASP 50  50  50  ASP ASP K . n 
K 1 51  GLY 51  51  51  GLY GLY K . n 
K 1 52  SER 52  52  52  SER SER K . n 
K 1 53  SER 53  53  53  SER SER K . n 
K 1 54  ILE 54  54  54  ILE ILE K . n 
K 1 55  GLY 55  55  55  GLY GLY K . n 
K 1 56  GLY 56  56  56  GLY GLY K . n 
K 1 57  TRP 57  57  57  TRP TRP K . n 
K 1 58  LYS 58  58  58  LYS LYS K . n 
K 1 59  GLY 59  59  59  GLY GLY K . n 
K 1 60  ILE 60  60  60  ILE ILE K . n 
K 1 61  ASN 61  61  61  ASN ASN K . n 
K 1 62  GLU 62  62  62  GLU GLU K . n 
K 1 63  SER 63  63  63  SER SER K . n 
K 1 64  ASP 64  64  64  ASP ASP K . n 
K 1 65  MET 65  65  65  MET MET K . n 
K 1 66  VAL 66  66  66  VAL VAL K . n 
K 1 67  LEU 67  67  67  LEU LEU K . n 
K 1 68  MET 68  68  68  MET MET K . n 
K 1 69  PRO 69  69  69  PRO PRO K . n 
K 1 70  ASP 70  70  70  ASP ASP K . n 
K 1 71  ALA 71  71  71  ALA ALA K . n 
K 1 72  SER 72  72  72  SER SER K . n 
K 1 73  THR 73  73  73  THR THR K . n 
K 1 74  ALA 74  74  74  ALA ALA K . n 
K 1 75  VAL 75  75  75  VAL VAL K . n 
K 1 76  ILE 76  76  76  ILE ILE K . n 
K 1 77  ASP 77  77  77  ASP ASP K . n 
K 1 78  PRO 78  78  78  PRO PRO K . n 
K 1 79  PHE 79  79  79  PHE PHE K . n 
K 1 80  PHE 80  80  80  PHE PHE K . n 
K 1 81  ALA 81  81  81  ALA ALA K . n 
K 1 82  ASP 82  82  82  ASP ASP K . n 
K 1 83  SER 83  83  83  SER SER K . n 
K 1 84  THR 84  84  84  THR THR K . n 
K 1 85  LEU 85  85  85  LEU LEU K . n 
K 1 86  ILE 86  86  86  ILE ILE K . n 
K 1 87  ILE 87  87  87  ILE ILE K . n 
K 1 88  ARG 88  88  88  ARG ARG K . n 
K 1 89  CYS 89  89  89  CYS CYS K . n 
K 1 90  ASP 90  90  90  ASP ASP K . n 
K 1 91  ILE 91  91  91  ILE ILE K . n 
K 1 92  LEU 92  92  92  LEU LEU K . n 
K 1 93  GLU 93  93  93  GLU GLU K . n 
K 1 94  PRO 94  94  94  PRO PRO K . n 
K 1 95  GLY 95  95  95  GLY GLY K . n 
K 1 96  THR 96  96  96  THR THR K . n 
K 1 97  LEU 97  97  97  LEU LEU K . n 
K 1 98  GLN 98  98  98  GLN GLN K . n 
K 1 99  GLY 99  99  99  GLY GLY K . n 
K 1 100 TYR 100 100 100 TYR TYR K . n 
K 1 101 ASP 101 101 101 ASP ASP K . n 
K 1 102 ARG 102 102 102 ARG ARG K . n 
K 1 103 ASP 103 103 103 ASP ASP K . n 
K 1 104 PRO 104 104 104 PRO PRO K . n 
K 1 105 ARG 105 105 105 ARG ARG K . n 
K 1 106 SER 106 106 106 SER SER K . n 
K 1 107 ILE 107 107 107 ILE ILE K . n 
K 1 108 ALA 108 108 108 ALA ALA K . n 
K 1 109 LYS 109 109 109 LYS LYS K . n 
K 1 110 ARG 110 110 110 ARG ARG K . n 
K 1 111 ALA 111 111 111 ALA ALA K . n 
K 1 112 GLU 112 112 112 GLU GLU K . n 
K 1 113 ASP 113 113 113 ASP ASP K . n 
K 1 114 TYR 114 114 114 TYR TYR K . n 
K 1 115 LEU 115 115 115 LEU LEU K . n 
K 1 116 ARG 116 116 116 ARG ARG K . n 
K 1 117 ALA 117 117 117 ALA ALA K . n 
K 1 118 THR 118 118 118 THR THR K . n 
K 1 119 GLY 119 119 119 GLY GLY K . n 
K 1 120 ILE 120 120 120 ILE ILE K . n 
K 1 121 ALA 121 121 121 ALA ALA K . n 
K 1 122 ASP 122 122 122 ASP ASP K . n 
K 1 123 THR 123 123 123 THR THR K . n 
K 1 124 VAL 124 124 124 VAL VAL K . n 
K 1 125 LEU 125 125 125 LEU LEU K . n 
K 1 126 PHE 126 126 126 PHE PHE K . n 
K 1 127 GLY 127 127 127 GLY GLY K . n 
K 1 128 PRO 128 128 128 PRO PRO K . n 
K 1 129 GLU 129 129 129 GLU GLU K . n 
K 1 130 PRO 130 130 130 PRO PRO K . n 
K 1 131 GLU 131 131 131 GLU GLU K . n 
K 1 132 PHE 132 132 132 PHE PHE K . n 
K 1 133 PHE 133 133 133 PHE PHE K . n 
K 1 134 LEU 134 134 134 LEU LEU K . n 
K 1 135 PHE 135 135 135 PHE PHE K . n 
K 1 136 ASP 136 136 136 ASP ASP K . n 
K 1 137 ASP 137 137 137 ASP ASP K . n 
K 1 138 ILE 138 138 138 ILE ILE K . n 
K 1 139 ARG 139 139 139 ARG ARG K . n 
K 1 140 PHE 140 140 140 PHE PHE K . n 
K 1 141 GLY 141 141 141 GLY GLY K . n 
K 1 142 ALA 142 142 142 ALA ALA K . n 
K 1 143 SER 143 143 143 SER SER K . n 
K 1 144 ILE 144 144 144 ILE ILE K . n 
K 1 145 SER 145 145 145 SER SER K . n 
K 1 146 GLY 146 146 146 GLY GLY K . n 
K 1 147 SER 147 147 147 SER SER K . n 
K 1 148 HIS 148 148 148 HIS HIS K . n 
K 1 149 VAL 149 149 149 VAL VAL K . n 
K 1 150 ALA 150 150 150 ALA ALA K . n 
K 1 151 ILE 151 151 151 ILE ILE K . n 
K 1 152 ASP 152 152 152 ASP ASP K . n 
K 1 153 ASP 153 153 153 ASP ASP K . n 
K 1 154 ILE 154 154 154 ILE ILE K . n 
K 1 155 GLU 155 155 155 GLU GLU K . n 
K 1 156 GLY 156 156 156 GLY GLY K . n 
K 1 157 ALA 157 157 157 ALA ALA K . n 
K 1 158 TRP 158 158 158 TRP TRP K . n 
K 1 159 ASN 159 159 159 ASN ASN K . n 
K 1 160 SER 160 160 160 SER SER K . n 
K 1 161 SER 161 161 161 SER SER K . n 
K 1 162 THR 162 162 162 THR THR K . n 
K 1 163 LYS 163 163 163 LYS LYS K . n 
K 1 164 TYR 164 164 164 TYR TYR K . n 
K 1 165 GLU 165 165 165 GLU GLU K . n 
K 1 166 GLY 166 166 166 GLY GLY K . n 
K 1 167 GLY 167 167 167 GLY GLY K . n 
K 1 168 ASN 168 168 168 ASN ASN K . n 
K 1 169 LYS 169 169 169 LYS LYS K . n 
K 1 170 GLY 170 170 170 GLY GLY K . n 
K 1 171 HIS 171 171 171 HIS HIS K . n 
K 1 172 ARG 172 172 172 ARG ARG K . n 
K 1 173 PRO 173 173 173 PRO PRO K . n 
K 1 174 GLY 174 174 174 GLY GLY K . n 
K 1 175 VAL 175 175 175 VAL VAL K . n 
K 1 176 LYS 176 176 176 LYS LYS K . n 
K 1 177 GLY 177 177 177 GLY GLY K . n 
K 1 178 GLY 178 178 178 GLY GLY K . n 
K 1 179 TYR 179 179 179 TYR TYR K . n 
K 1 180 PHE 180 180 180 PHE PHE K . n 
K 1 181 PRO 181 181 181 PRO PRO K . n 
K 1 182 VAL 182 182 182 VAL VAL K . n 
K 1 183 PRO 183 183 183 PRO PRO K . n 
K 1 184 PRO 184 184 184 PRO PRO K . n 
K 1 185 VAL 185 185 185 VAL VAL K . n 
K 1 186 ASP 186 186 186 ASP ASP K . n 
K 1 187 SER 187 187 187 SER SER K . n 
K 1 188 ALA 188 188 188 ALA ALA K . n 
K 1 189 GLN 189 189 189 GLN GLN K . n 
K 1 190 ASP 190 190 190 ASP ASP K . n 
K 1 191 ILE 191 191 191 ILE ILE K . n 
K 1 192 ARG 192 192 192 ARG ARG K . n 
K 1 193 SER 193 193 193 SER SER K . n 
K 1 194 GLU 194 194 194 GLU GLU K . n 
K 1 195 MET 195 195 195 MET MET K . n 
K 1 196 CYS 196 196 196 CYS CYS K . n 
K 1 197 LEU 197 197 197 LEU LEU K . n 
K 1 198 VAL 198 198 198 VAL VAL K . n 
K 1 199 MET 199 199 199 MET MET K . n 
K 1 200 GLU 200 200 200 GLU GLU K . n 
K 1 201 GLN 201 201 201 GLN GLN K . n 
K 1 202 MET 202 202 202 MET MET K . n 
K 1 203 GLY 203 203 203 GLY GLY K . n 
K 1 204 LEU 204 204 204 LEU LEU K . n 
K 1 205 VAL 205 205 205 VAL VAL K . n 
K 1 206 VAL 206 206 206 VAL VAL K . n 
K 1 207 GLU 207 207 207 GLU GLU K . n 
K 1 208 ALA 208 208 208 ALA ALA K . n 
K 1 209 HIS 209 209 209 HIS HIS K . n 
K 1 210 HIS 210 210 210 HIS HIS K . n 
K 1 211 HIS 211 211 211 HIS HIS K . n 
K 1 212 GLU 212 212 212 GLU GLU K . n 
K 1 213 VAL 213 213 213 VAL VAL K . n 
K 1 214 ALA 214 214 214 ALA ALA K . n 
K 1 215 THR 215 215 215 THR THR K . n 
K 1 216 ALA 216 216 216 ALA ALA K . n 
K 1 217 GLY 217 217 217 GLY GLY K . n 
K 1 218 GLN 218 218 218 GLN GLN K . n 
K 1 219 ASN 219 219 219 ASN ASN K . n 
K 1 220 GLU 220 220 220 GLU GLU K . n 
K 1 221 VAL 221 221 221 VAL VAL K . n 
K 1 222 ALA 222 222 222 ALA ALA K . n 
K 1 223 THR 223 223 223 THR THR K . n 
K 1 224 ARG 224 224 224 ARG ARG K . n 
K 1 225 PHE 225 225 225 PHE PHE K . n 
K 1 226 ASN 226 226 226 ASN ASN K . n 
K 1 227 THR 227 227 227 THR THR K . n 
K 1 228 MET 228 228 228 MET MET K . n 
K 1 229 THR 229 229 229 THR THR K . n 
K 1 230 LYS 230 230 230 LYS LYS K . n 
K 1 231 LYS 231 231 231 LYS LYS K . n 
K 1 232 ALA 232 232 232 ALA ALA K . n 
K 1 233 ASP 233 233 233 ASP ASP K . n 
K 1 234 GLU 234 234 234 GLU GLU K . n 
K 1 235 ILE 235 235 235 ILE ILE K . n 
K 1 236 GLN 236 236 236 GLN GLN K . n 
K 1 237 ILE 237 237 237 ILE ILE K . n 
K 1 238 TYR 238 238 238 TYR TYR K . n 
K 1 239 LYS 239 239 239 LYS LYS K . n 
K 1 240 TYR 240 240 240 TYR TYR K . n 
K 1 241 VAL 241 241 241 VAL VAL K . n 
K 1 242 VAL 242 242 242 VAL VAL K . n 
K 1 243 HIS 243 243 243 HIS HIS K . n 
K 1 244 ASN 244 244 244 ASN ASN K . n 
K 1 245 VAL 245 245 245 VAL VAL K . n 
K 1 246 ALA 246 246 246 ALA ALA K . n 
K 1 247 HIS 247 247 247 HIS HIS K . n 
K 1 248 ARG 248 248 248 ARG ARG K . n 
K 1 249 PHE 249 249 249 PHE PHE K . n 
K 1 250 GLY 250 250 250 GLY GLY K . n 
K 1 251 LYS 251 251 251 LYS LYS K . n 
K 1 252 THR 252 252 252 THR THR K . n 
K 1 253 ALA 253 253 253 ALA ALA K . n 
K 1 254 THR 254 254 254 THR THR K . n 
K 1 255 PHE 255 255 255 PHE PHE K . n 
K 1 256 MET 256 256 256 MET MET K . n 
K 1 257 PRO 257 257 257 PRO PRO K . n 
K 1 258 LYS 258 258 258 LYS LYS K . n 
K 1 259 PRO 259 259 259 PRO PRO K . n 
K 1 260 MET 260 260 260 MET MET K . n 
K 1 261 PHE 261 261 261 PHE PHE K . n 
K 1 262 GLY 262 262 262 GLY GLY K . n 
K 1 263 ASP 263 263 263 ASP ASP K . n 
K 1 264 ASN 264 264 264 ASN ASN K . n 
K 1 265 GLY 265 265 265 GLY GLY K . n 
K 1 266 SER 266 266 266 SER SER K . n 
K 1 267 GLY 267 267 267 GLY GLY K . n 
K 1 268 MET 268 268 268 MET MET K . n 
K 1 269 HIS 269 269 269 HIS HIS K . n 
K 1 270 CYS 270 270 270 CYS CYS K . n 
K 1 271 HIS 271 271 271 HIS HIS K . n 
K 1 272 MET 272 272 272 MET MET K . n 
K 1 273 SER 273 273 273 SER SER K . n 
K 1 274 LEU 274 274 274 LEU LEU K . n 
K 1 275 ALA 275 275 275 ALA ALA K . n 
K 1 276 LYS 276 276 276 LYS LYS K . n 
K 1 277 ASN 277 277 277 ASN ASN K . n 
K 1 278 GLY 278 278 278 GLY GLY K . n 
K 1 279 THR 279 279 279 THR THR K . n 
K 1 280 ASN 280 280 280 ASN ASN K . n 
K 1 281 LEU 281 281 281 LEU LEU K . n 
K 1 282 PHE 282 282 282 PHE PHE K . n 
K 1 283 SER 283 283 283 SER SER K . n 
K 1 284 GLY 284 284 284 GLY GLY K . n 
K 1 285 ASP 285 285 285 ASP ASP K . n 
K 1 286 LYS 286 286 286 LYS LYS K . n 
K 1 287 TYR 287 287 287 TYR TYR K . n 
K 1 288 ALA 288 288 288 ALA ALA K . n 
K 1 289 GLY 289 289 289 GLY GLY K . n 
K 1 290 LEU 290 290 290 LEU LEU K . n 
K 1 291 SER 291 291 291 SER SER K . n 
K 1 292 GLU 292 292 292 GLU GLU K . n 
K 1 293 GLN 293 293 293 GLN GLN K . n 
K 1 294 ALA 294 294 294 ALA ALA K . n 
K 1 295 LEU 295 295 295 LEU LEU K . n 
K 1 296 TYR 296 296 296 TYR TYR K . n 
K 1 297 TYR 297 297 297 TYR TYR K . n 
K 1 298 ILE 298 298 298 ILE ILE K . n 
K 1 299 GLY 299 299 299 GLY GLY K . n 
K 1 300 GLY 300 300 300 GLY GLY K . n 
K 1 301 VAL 301 301 301 VAL VAL K . n 
K 1 302 ILE 302 302 302 ILE ILE K . n 
K 1 303 LYS 303 303 303 LYS LYS K . n 
K 1 304 HIS 304 304 304 HIS HIS K . n 
K 1 305 ALA 305 305 305 ALA ALA K . n 
K 1 306 LYS 306 306 306 LYS LYS K . n 
K 1 307 ALA 307 307 307 ALA ALA K . n 
K 1 308 ILE 308 308 308 ILE ILE K . n 
K 1 309 ASN 309 309 309 ASN ASN K . n 
K 1 310 ALA 310 310 310 ALA ALA K . n 
K 1 311 LEU 311 311 311 LEU LEU K . n 
K 1 312 ALA 312 312 312 ALA ALA K . n 
K 1 313 ASN 313 313 313 ASN ASN K . n 
K 1 314 PRO 314 314 314 PRO PRO K . n 
K 1 315 THR 315 315 315 THR THR K . n 
K 1 316 THR 316 316 316 THR THR K . n 
K 1 317 ASN 317 317 317 ASN ASN K . n 
K 1 318 SER 318 318 318 SER SER K . n 
K 1 319 TYR 319 319 319 TYR TYR K . n 
K 1 320 LYS 320 320 320 LYS LYS K . n 
K 1 321 ARG 321 321 321 ARG ARG K . n 
K 1 322 LEU 322 322 322 LEU LEU K . n 
K 1 323 VAL 323 323 323 VAL VAL K . n 
K 1 324 PRO 324 324 324 PRO PRO K . n 
K 1 325 GLY 325 325 325 GLY GLY K . n 
K 1 326 TYR 326 326 326 TYR TYR K . n 
K 1 327 GLU 327 327 327 GLU GLU K . n 
K 1 328 ALA 328 328 328 ALA ALA K . n 
K 1 329 PRO 329 329 329 PRO PRO K . n 
K 1 330 VAL 330 330 330 VAL VAL K . n 
K 1 331 MET 331 331 331 MET MET K . n 
K 1 332 LEU 332 332 332 LEU LEU K . n 
K 1 333 ALA 333 333 333 ALA ALA K . n 
K 1 334 TYR 334 334 334 TYR TYR K . n 
K 1 335 SER 335 335 335 SER SER K . n 
K 1 336 ALA 336 336 336 ALA ALA K . n 
K 1 337 ARG 337 337 337 ARG ARG K . n 
K 1 338 ASN 338 338 338 ASN ASN K . n 
K 1 339 ARG 339 339 339 ARG ARG K . n 
K 1 340 SER 340 340 340 SER SER K . n 
K 1 341 ALA 341 341 341 ALA ALA K . n 
K 1 342 SER 342 342 342 SER SER K . n 
K 1 343 ILE 343 343 343 ILE ILE K . n 
K 1 344 ARG 344 344 344 ARG ARG K . n 
K 1 345 ILE 345 345 345 ILE ILE K . n 
K 1 346 PRO 346 346 346 PRO PRO K . n 
K 1 347 VAL 347 347 347 VAL VAL K . n 
K 1 348 VAL 348 348 348 VAL VAL K . n 
K 1 349 ALA 349 349 349 ALA ALA K . n 
K 1 350 SER 350 350 350 SER SER K . n 
K 1 351 PRO 351 351 351 PRO PRO K . n 
K 1 352 LYS 352 352 352 LYS LYS K . n 
K 1 353 ALA 353 353 353 ALA ALA K . n 
K 1 354 ARG 354 354 354 ARG ARG K . n 
K 1 355 ARG 355 355 355 ARG ARG K . n 
K 1 356 ILE 356 356 356 ILE ILE K . n 
K 1 357 GLU 357 357 357 GLU GLU K . n 
K 1 358 VAL 358 358 358 VAL VAL K . n 
K 1 359 ARG 359 359 359 ARG ARG K . n 
K 1 360 PHE 360 360 360 PHE PHE K . n 
K 1 361 PRO 361 361 361 PRO PRO K . n 
K 1 362 ASP 362 362 362 ASP ASP K . n 
K 1 363 PRO 363 363 363 PRO PRO K . n 
K 1 364 ALA 364 364 364 ALA ALA K . n 
K 1 365 ALA 365 365 365 ALA ALA K . n 
K 1 366 ASN 366 366 366 ASN ASN K . n 
K 1 367 PRO 367 367 367 PRO PRO K . n 
K 1 368 TYR 368 368 368 TYR TYR K . n 
K 1 369 LEU 369 369 369 LEU LEU K . n 
K 1 370 CYS 370 370 370 CYS CYS K . n 
K 1 371 PHE 371 371 371 PHE PHE K . n 
K 1 372 ALA 372 372 372 ALA ALA K . n 
K 1 373 ALA 373 373 373 ALA ALA K . n 
K 1 374 LEU 374 374 374 LEU LEU K . n 
K 1 375 LEU 375 375 375 LEU LEU K . n 
K 1 376 MET 376 376 376 MET MET K . n 
K 1 377 ALA 377 377 377 ALA ALA K . n 
K 1 378 GLY 378 378 378 GLY GLY K . n 
K 1 379 LEU 379 379 379 LEU LEU K . n 
K 1 380 ASP 380 380 380 ASP ASP K . n 
K 1 381 GLY 381 381 381 GLY GLY K . n 
K 1 382 ILE 382 382 382 ILE ILE K . n 
K 1 383 LYS 383 383 383 LYS LYS K . n 
K 1 384 ASN 384 384 384 ASN ASN K . n 
K 1 385 LYS 385 385 385 LYS LYS K . n 
K 1 386 ILE 386 386 386 ILE ILE K . n 
K 1 387 HIS 387 387 387 HIS HIS K . n 
K 1 388 PRO 388 388 388 PRO PRO K . n 
K 1 389 GLY 389 389 389 GLY GLY K . n 
K 1 390 GLU 390 390 390 GLU GLU K . n 
K 1 391 PRO 391 391 391 PRO PRO K . n 
K 1 392 MET 392 392 392 MET MET K . n 
K 1 393 ASP 393 393 393 ASP ASP K . n 
K 1 394 LYS 394 394 394 LYS LYS K . n 
K 1 395 ASN 395 395 395 ASN ASN K . n 
K 1 396 LEU 396 396 396 LEU LEU K . n 
K 1 397 TYR 397 397 397 TYR TYR K . n 
K 1 398 ASP 398 398 398 ASP ASP K . n 
K 1 399 LEU 399 399 399 LEU LEU K . n 
K 1 400 PRO 400 400 400 PRO PRO K . n 
K 1 401 PRO 401 401 401 PRO PRO K . n 
K 1 402 GLU 402 402 402 GLU GLU K . n 
K 1 403 GLU 403 403 403 GLU GLU K . n 
K 1 404 ALA 404 404 404 ALA ALA K . n 
K 1 405 LYS 405 405 405 LYS LYS K . n 
K 1 406 GLU 406 406 406 GLU GLU K . n 
K 1 407 ILE 407 407 407 ILE ILE K . n 
K 1 408 PRO 408 408 408 PRO PRO K . n 
K 1 409 GLN 409 409 409 GLN GLN K . n 
K 1 410 VAL 410 410 410 VAL VAL K . n 
K 1 411 ALA 411 411 411 ALA ALA K . n 
K 1 412 GLY 412 412 412 GLY GLY K . n 
K 1 413 SER 413 413 413 SER SER K . n 
K 1 414 LEU 414 414 414 LEU LEU K . n 
K 1 415 GLU 415 415 415 GLU GLU K . n 
K 1 416 GLU 416 416 416 GLU GLU K . n 
K 1 417 ALA 417 417 417 ALA ALA K . n 
K 1 418 LEU 418 418 418 LEU LEU K . n 
K 1 419 ASN 419 419 419 ASN ASN K . n 
K 1 420 ALA 420 420 420 ALA ALA K . n 
K 1 421 LEU 421 421 421 LEU LEU K . n 
K 1 422 ASP 422 422 422 ASP ASP K . n 
K 1 423 LEU 423 423 423 LEU LEU K . n 
K 1 424 ASP 424 424 424 ASP ASP K . n 
K 1 425 ARG 425 425 425 ARG ARG K . n 
K 1 426 GLU 426 426 426 GLU GLU K . n 
K 1 427 PHE 427 427 427 PHE PHE K . n 
K 1 428 LEU 428 428 428 LEU LEU K . n 
K 1 429 LYS 429 429 429 LYS LYS K . n 
K 1 430 ALA 430 430 430 ALA ALA K . n 
K 1 431 GLY 431 431 431 GLY GLY K . n 
K 1 432 GLY 432 432 432 GLY GLY K . n 
K 1 433 VAL 433 433 433 VAL VAL K . n 
K 1 434 PHE 434 434 434 PHE PHE K . n 
K 1 435 THR 435 435 435 THR THR K . n 
K 1 436 ASP 436 436 436 ASP ASP K . n 
K 1 437 GLU 437 437 437 GLU GLU K . n 
K 1 438 ALA 438 438 438 ALA ALA K . n 
K 1 439 ILE 439 439 439 ILE ILE K . n 
K 1 440 ASP 440 440 440 ASP ASP K . n 
K 1 441 ALA 441 441 441 ALA ALA K . n 
K 1 442 TYR 442 442 442 TYR TYR K . n 
K 1 443 ILE 443 443 443 ILE ILE K . n 
K 1 444 ALA 444 444 444 ALA ALA K . n 
K 1 445 LEU 445 445 445 LEU LEU K . n 
K 1 446 ARG 446 446 446 ARG ARG K . n 
K 1 447 ARG 447 447 447 ARG ARG K . n 
K 1 448 GLU 448 448 448 GLU GLU K . n 
K 1 449 GLU 449 449 449 GLU GLU K . n 
K 1 450 ASP 450 450 450 ASP ASP K . n 
K 1 451 ASP 451 451 451 ASP ASP K . n 
K 1 452 ARG 452 452 452 ARG ARG K . n 
K 1 453 VAL 453 453 453 VAL VAL K . n 
K 1 454 ARG 454 454 454 ARG ARG K . n 
K 1 455 MET 455 455 455 MET MET K . n 
K 1 456 THR 456 456 456 THR THR K . n 
K 1 457 PRO 457 457 457 PRO PRO K . n 
K 1 458 HIS 458 458 458 HIS HIS K . n 
K 1 459 PRO 459 459 459 PRO PRO K . n 
K 1 460 VAL 460 460 460 VAL VAL K . n 
K 1 461 GLU 461 461 461 GLU GLU K . n 
K 1 462 PHE 462 462 462 PHE PHE K . n 
K 1 463 GLU 463 463 463 GLU GLU K . n 
K 1 464 LEU 464 464 464 LEU LEU K . n 
K 1 465 TYR 465 465 465 TYR TYR K . n 
K 1 466 TYR 466 466 466 TYR TYR K . n 
K 1 467 SER 467 467 467 SER SER K . n 
K 1 468 VAL 468 468 468 VAL VAL K . n 
L 1 1   SER 1   1   1   SER SER L . n 
L 1 2   ALA 2   2   2   ALA ALA L . n 
L 1 3   GLU 3   3   3   GLU GLU L . n 
L 1 4   HIS 4   4   4   HIS HIS L . n 
L 1 5   VAL 5   5   5   VAL VAL L . n 
L 1 6   LEU 6   6   6   LEU LEU L . n 
L 1 7   THR 7   7   7   THR THR L . n 
L 1 8   MET 8   8   8   MET MET L . n 
L 1 9   LEU 9   9   9   LEU LEU L . n 
L 1 10  ASN 10  10  10  ASN ASN L . n 
L 1 11  GLU 11  11  11  GLU GLU L . n 
L 1 12  HIS 12  12  12  HIS HIS L . n 
L 1 13  GLU 13  13  13  GLU GLU L . n 
L 1 14  VAL 14  14  14  VAL VAL L . n 
L 1 15  LYS 15  15  15  LYS LYS L . n 
L 1 16  PHE 16  16  16  PHE PHE L . n 
L 1 17  VAL 17  17  17  VAL VAL L . n 
L 1 18  ASP 18  18  18  ASP ASP L . n 
L 1 19  LEU 19  19  19  LEU LEU L . n 
L 1 20  ARG 20  20  20  ARG ARG L . n 
L 1 21  PHE 21  21  21  PHE PHE L . n 
L 1 22  THR 22  22  22  THR THR L . n 
L 1 23  ASP 23  23  23  ASP ASP L . n 
L 1 24  THR 24  24  24  THR THR L . n 
L 1 25  LYS 25  25  25  LYS LYS L . n 
L 1 26  GLY 26  26  26  GLY GLY L . n 
L 1 27  LYS 27  27  27  LYS LYS L . n 
L 1 28  GLU 28  28  28  GLU GLU L . n 
L 1 29  GLN 29  29  29  GLN GLN L . n 
L 1 30  HIS 30  30  30  HIS HIS L . n 
L 1 31  VAL 31  31  31  VAL VAL L . n 
L 1 32  THR 32  32  32  THR THR L . n 
L 1 33  ILE 33  33  33  ILE ILE L . n 
L 1 34  PRO 34  34  34  PRO PRO L . n 
L 1 35  ALA 35  35  35  ALA ALA L . n 
L 1 36  HIS 36  36  36  HIS HIS L . n 
L 1 37  GLN 37  37  37  GLN GLN L . n 
L 1 38  VAL 38  38  38  VAL VAL L . n 
L 1 39  ASN 39  39  39  ASN ASN L . n 
L 1 40  ALA 40  40  40  ALA ALA L . n 
L 1 41  GLU 41  41  41  GLU GLU L . n 
L 1 42  PHE 42  42  42  PHE PHE L . n 
L 1 43  PHE 43  43  43  PHE PHE L . n 
L 1 44  GLU 44  44  44  GLU GLU L . n 
L 1 45  GLU 45  45  45  GLU GLU L . n 
L 1 46  GLY 46  46  46  GLY GLY L . n 
L 1 47  LYS 47  47  47  LYS LYS L . n 
L 1 48  MET 48  48  48  MET MET L . n 
L 1 49  PHE 49  49  49  PHE PHE L . n 
L 1 50  ASP 50  50  50  ASP ASP L . n 
L 1 51  GLY 51  51  51  GLY GLY L . n 
L 1 52  SER 52  52  52  SER SER L . n 
L 1 53  SER 53  53  53  SER SER L . n 
L 1 54  ILE 54  54  54  ILE ILE L . n 
L 1 55  GLY 55  55  55  GLY GLY L . n 
L 1 56  GLY 56  56  56  GLY GLY L . n 
L 1 57  TRP 57  57  57  TRP TRP L . n 
L 1 58  LYS 58  58  58  LYS LYS L . n 
L 1 59  GLY 59  59  59  GLY GLY L . n 
L 1 60  ILE 60  60  60  ILE ILE L . n 
L 1 61  ASN 61  61  61  ASN ASN L . n 
L 1 62  GLU 62  62  62  GLU GLU L . n 
L 1 63  SER 63  63  63  SER SER L . n 
L 1 64  ASP 64  64  64  ASP ASP L . n 
L 1 65  MET 65  65  65  MET MET L . n 
L 1 66  VAL 66  66  66  VAL VAL L . n 
L 1 67  LEU 67  67  67  LEU LEU L . n 
L 1 68  MET 68  68  68  MET MET L . n 
L 1 69  PRO 69  69  69  PRO PRO L . n 
L 1 70  ASP 70  70  70  ASP ASP L . n 
L 1 71  ALA 71  71  71  ALA ALA L . n 
L 1 72  SER 72  72  72  SER SER L . n 
L 1 73  THR 73  73  73  THR THR L . n 
L 1 74  ALA 74  74  74  ALA ALA L . n 
L 1 75  VAL 75  75  75  VAL VAL L . n 
L 1 76  ILE 76  76  76  ILE ILE L . n 
L 1 77  ASP 77  77  77  ASP ASP L . n 
L 1 78  PRO 78  78  78  PRO PRO L . n 
L 1 79  PHE 79  79  79  PHE PHE L . n 
L 1 80  PHE 80  80  80  PHE PHE L . n 
L 1 81  ALA 81  81  81  ALA ALA L . n 
L 1 82  ASP 82  82  82  ASP ASP L . n 
L 1 83  SER 83  83  83  SER SER L . n 
L 1 84  THR 84  84  84  THR THR L . n 
L 1 85  LEU 85  85  85  LEU LEU L . n 
L 1 86  ILE 86  86  86  ILE ILE L . n 
L 1 87  ILE 87  87  87  ILE ILE L . n 
L 1 88  ARG 88  88  88  ARG ARG L . n 
L 1 89  CYS 89  89  89  CYS CYS L . n 
L 1 90  ASP 90  90  90  ASP ASP L . n 
L 1 91  ILE 91  91  91  ILE ILE L . n 
L 1 92  LEU 92  92  92  LEU LEU L . n 
L 1 93  GLU 93  93  93  GLU GLU L . n 
L 1 94  PRO 94  94  94  PRO PRO L . n 
L 1 95  GLY 95  95  95  GLY GLY L . n 
L 1 96  THR 96  96  96  THR THR L . n 
L 1 97  LEU 97  97  97  LEU LEU L . n 
L 1 98  GLN 98  98  98  GLN GLN L . n 
L 1 99  GLY 99  99  99  GLY GLY L . n 
L 1 100 TYR 100 100 100 TYR TYR L . n 
L 1 101 ASP 101 101 101 ASP ASP L . n 
L 1 102 ARG 102 102 102 ARG ARG L . n 
L 1 103 ASP 103 103 103 ASP ASP L . n 
L 1 104 PRO 104 104 104 PRO PRO L . n 
L 1 105 ARG 105 105 105 ARG ARG L . n 
L 1 106 SER 106 106 106 SER SER L . n 
L 1 107 ILE 107 107 107 ILE ILE L . n 
L 1 108 ALA 108 108 108 ALA ALA L . n 
L 1 109 LYS 109 109 109 LYS LYS L . n 
L 1 110 ARG 110 110 110 ARG ARG L . n 
L 1 111 ALA 111 111 111 ALA ALA L . n 
L 1 112 GLU 112 112 112 GLU GLU L . n 
L 1 113 ASP 113 113 113 ASP ASP L . n 
L 1 114 TYR 114 114 114 TYR TYR L . n 
L 1 115 LEU 115 115 115 LEU LEU L . n 
L 1 116 ARG 116 116 116 ARG ARG L . n 
L 1 117 ALA 117 117 117 ALA ALA L . n 
L 1 118 THR 118 118 118 THR THR L . n 
L 1 119 GLY 119 119 119 GLY GLY L . n 
L 1 120 ILE 120 120 120 ILE ILE L . n 
L 1 121 ALA 121 121 121 ALA ALA L . n 
L 1 122 ASP 122 122 122 ASP ASP L . n 
L 1 123 THR 123 123 123 THR THR L . n 
L 1 124 VAL 124 124 124 VAL VAL L . n 
L 1 125 LEU 125 125 125 LEU LEU L . n 
L 1 126 PHE 126 126 126 PHE PHE L . n 
L 1 127 GLY 127 127 127 GLY GLY L . n 
L 1 128 PRO 128 128 128 PRO PRO L . n 
L 1 129 GLU 129 129 129 GLU GLU L . n 
L 1 130 PRO 130 130 130 PRO PRO L . n 
L 1 131 GLU 131 131 131 GLU GLU L . n 
L 1 132 PHE 132 132 132 PHE PHE L . n 
L 1 133 PHE 133 133 133 PHE PHE L . n 
L 1 134 LEU 134 134 134 LEU LEU L . n 
L 1 135 PHE 135 135 135 PHE PHE L . n 
L 1 136 ASP 136 136 136 ASP ASP L . n 
L 1 137 ASP 137 137 137 ASP ASP L . n 
L 1 138 ILE 138 138 138 ILE ILE L . n 
L 1 139 ARG 139 139 139 ARG ARG L . n 
L 1 140 PHE 140 140 140 PHE PHE L . n 
L 1 141 GLY 141 141 141 GLY GLY L . n 
L 1 142 ALA 142 142 142 ALA ALA L . n 
L 1 143 SER 143 143 143 SER SER L . n 
L 1 144 ILE 144 144 144 ILE ILE L . n 
L 1 145 SER 145 145 145 SER SER L . n 
L 1 146 GLY 146 146 146 GLY GLY L . n 
L 1 147 SER 147 147 147 SER SER L . n 
L 1 148 HIS 148 148 148 HIS HIS L . n 
L 1 149 VAL 149 149 149 VAL VAL L . n 
L 1 150 ALA 150 150 150 ALA ALA L . n 
L 1 151 ILE 151 151 151 ILE ILE L . n 
L 1 152 ASP 152 152 152 ASP ASP L . n 
L 1 153 ASP 153 153 153 ASP ASP L . n 
L 1 154 ILE 154 154 154 ILE ILE L . n 
L 1 155 GLU 155 155 155 GLU GLU L . n 
L 1 156 GLY 156 156 156 GLY GLY L . n 
L 1 157 ALA 157 157 157 ALA ALA L . n 
L 1 158 TRP 158 158 158 TRP TRP L . n 
L 1 159 ASN 159 159 159 ASN ASN L . n 
L 1 160 SER 160 160 160 SER SER L . n 
L 1 161 SER 161 161 161 SER SER L . n 
L 1 162 THR 162 162 162 THR THR L . n 
L 1 163 LYS 163 163 163 LYS LYS L . n 
L 1 164 TYR 164 164 164 TYR TYR L . n 
L 1 165 GLU 165 165 165 GLU GLU L . n 
L 1 166 GLY 166 166 166 GLY GLY L . n 
L 1 167 GLY 167 167 167 GLY GLY L . n 
L 1 168 ASN 168 168 168 ASN ASN L . n 
L 1 169 LYS 169 169 169 LYS LYS L . n 
L 1 170 GLY 170 170 170 GLY GLY L . n 
L 1 171 HIS 171 171 171 HIS HIS L . n 
L 1 172 ARG 172 172 172 ARG ARG L . n 
L 1 173 PRO 173 173 173 PRO PRO L . n 
L 1 174 GLY 174 174 174 GLY GLY L . n 
L 1 175 VAL 175 175 175 VAL VAL L . n 
L 1 176 LYS 176 176 176 LYS LYS L . n 
L 1 177 GLY 177 177 177 GLY GLY L . n 
L 1 178 GLY 178 178 178 GLY GLY L . n 
L 1 179 TYR 179 179 179 TYR TYR L . n 
L 1 180 PHE 180 180 180 PHE PHE L . n 
L 1 181 PRO 181 181 181 PRO PRO L . n 
L 1 182 VAL 182 182 182 VAL VAL L . n 
L 1 183 PRO 183 183 183 PRO PRO L . n 
L 1 184 PRO 184 184 184 PRO PRO L . n 
L 1 185 VAL 185 185 185 VAL VAL L . n 
L 1 186 ASP 186 186 186 ASP ASP L . n 
L 1 187 SER 187 187 187 SER SER L . n 
L 1 188 ALA 188 188 188 ALA ALA L . n 
L 1 189 GLN 189 189 189 GLN GLN L . n 
L 1 190 ASP 190 190 190 ASP ASP L . n 
L 1 191 ILE 191 191 191 ILE ILE L . n 
L 1 192 ARG 192 192 192 ARG ARG L . n 
L 1 193 SER 193 193 193 SER SER L . n 
L 1 194 GLU 194 194 194 GLU GLU L . n 
L 1 195 MET 195 195 195 MET MET L . n 
L 1 196 CYS 196 196 196 CYS CYS L . n 
L 1 197 LEU 197 197 197 LEU LEU L . n 
L 1 198 VAL 198 198 198 VAL VAL L . n 
L 1 199 MET 199 199 199 MET MET L . n 
L 1 200 GLU 200 200 200 GLU GLU L . n 
L 1 201 GLN 201 201 201 GLN GLN L . n 
L 1 202 MET 202 202 202 MET MET L . n 
L 1 203 GLY 203 203 203 GLY GLY L . n 
L 1 204 LEU 204 204 204 LEU LEU L . n 
L 1 205 VAL 205 205 205 VAL VAL L . n 
L 1 206 VAL 206 206 206 VAL VAL L . n 
L 1 207 GLU 207 207 207 GLU GLU L . n 
L 1 208 ALA 208 208 208 ALA ALA L . n 
L 1 209 HIS 209 209 209 HIS HIS L . n 
L 1 210 HIS 210 210 210 HIS HIS L . n 
L 1 211 HIS 211 211 211 HIS HIS L . n 
L 1 212 GLU 212 212 212 GLU GLU L . n 
L 1 213 VAL 213 213 213 VAL VAL L . n 
L 1 214 ALA 214 214 214 ALA ALA L . n 
L 1 215 THR 215 215 215 THR THR L . n 
L 1 216 ALA 216 216 216 ALA ALA L . n 
L 1 217 GLY 217 217 217 GLY GLY L . n 
L 1 218 GLN 218 218 218 GLN GLN L . n 
L 1 219 ASN 219 219 219 ASN ASN L . n 
L 1 220 GLU 220 220 220 GLU GLU L . n 
L 1 221 VAL 221 221 221 VAL VAL L . n 
L 1 222 ALA 222 222 222 ALA ALA L . n 
L 1 223 THR 223 223 223 THR THR L . n 
L 1 224 ARG 224 224 224 ARG ARG L . n 
L 1 225 PHE 225 225 225 PHE PHE L . n 
L 1 226 ASN 226 226 226 ASN ASN L . n 
L 1 227 THR 227 227 227 THR THR L . n 
L 1 228 MET 228 228 228 MET MET L . n 
L 1 229 THR 229 229 229 THR THR L . n 
L 1 230 LYS 230 230 230 LYS LYS L . n 
L 1 231 LYS 231 231 231 LYS LYS L . n 
L 1 232 ALA 232 232 232 ALA ALA L . n 
L 1 233 ASP 233 233 233 ASP ASP L . n 
L 1 234 GLU 234 234 234 GLU GLU L . n 
L 1 235 ILE 235 235 235 ILE ILE L . n 
L 1 236 GLN 236 236 236 GLN GLN L . n 
L 1 237 ILE 237 237 237 ILE ILE L . n 
L 1 238 TYR 238 238 238 TYR TYR L . n 
L 1 239 LYS 239 239 239 LYS LYS L . n 
L 1 240 TYR 240 240 240 TYR TYR L . n 
L 1 241 VAL 241 241 241 VAL VAL L . n 
L 1 242 VAL 242 242 242 VAL VAL L . n 
L 1 243 HIS 243 243 243 HIS HIS L . n 
L 1 244 ASN 244 244 244 ASN ASN L . n 
L 1 245 VAL 245 245 245 VAL VAL L . n 
L 1 246 ALA 246 246 246 ALA ALA L . n 
L 1 247 HIS 247 247 247 HIS HIS L . n 
L 1 248 ARG 248 248 248 ARG ARG L . n 
L 1 249 PHE 249 249 249 PHE PHE L . n 
L 1 250 GLY 250 250 250 GLY GLY L . n 
L 1 251 LYS 251 251 251 LYS LYS L . n 
L 1 252 THR 252 252 252 THR THR L . n 
L 1 253 ALA 253 253 253 ALA ALA L . n 
L 1 254 THR 254 254 254 THR THR L . n 
L 1 255 PHE 255 255 255 PHE PHE L . n 
L 1 256 MET 256 256 256 MET MET L . n 
L 1 257 PRO 257 257 257 PRO PRO L . n 
L 1 258 LYS 258 258 258 LYS LYS L . n 
L 1 259 PRO 259 259 259 PRO PRO L . n 
L 1 260 MET 260 260 260 MET MET L . n 
L 1 261 PHE 261 261 261 PHE PHE L . n 
L 1 262 GLY 262 262 262 GLY GLY L . n 
L 1 263 ASP 263 263 263 ASP ASP L . n 
L 1 264 ASN 264 264 264 ASN ASN L . n 
L 1 265 GLY 265 265 265 GLY GLY L . n 
L 1 266 SER 266 266 266 SER SER L . n 
L 1 267 GLY 267 267 267 GLY GLY L . n 
L 1 268 MET 268 268 268 MET MET L . n 
L 1 269 HIS 269 269 269 HIS HIS L . n 
L 1 270 CYS 270 270 270 CYS CYS L . n 
L 1 271 HIS 271 271 271 HIS HIS L . n 
L 1 272 MET 272 272 272 MET MET L . n 
L 1 273 SER 273 273 273 SER SER L . n 
L 1 274 LEU 274 274 274 LEU LEU L . n 
L 1 275 ALA 275 275 275 ALA ALA L . n 
L 1 276 LYS 276 276 276 LYS LYS L . n 
L 1 277 ASN 277 277 277 ASN ASN L . n 
L 1 278 GLY 278 278 278 GLY GLY L . n 
L 1 279 THR 279 279 279 THR THR L . n 
L 1 280 ASN 280 280 280 ASN ASN L . n 
L 1 281 LEU 281 281 281 LEU LEU L . n 
L 1 282 PHE 282 282 282 PHE PHE L . n 
L 1 283 SER 283 283 283 SER SER L . n 
L 1 284 GLY 284 284 284 GLY GLY L . n 
L 1 285 ASP 285 285 285 ASP ASP L . n 
L 1 286 LYS 286 286 286 LYS LYS L . n 
L 1 287 TYR 287 287 287 TYR TYR L . n 
L 1 288 ALA 288 288 288 ALA ALA L . n 
L 1 289 GLY 289 289 289 GLY GLY L . n 
L 1 290 LEU 290 290 290 LEU LEU L . n 
L 1 291 SER 291 291 291 SER SER L . n 
L 1 292 GLU 292 292 292 GLU GLU L . n 
L 1 293 GLN 293 293 293 GLN GLN L . n 
L 1 294 ALA 294 294 294 ALA ALA L . n 
L 1 295 LEU 295 295 295 LEU LEU L . n 
L 1 296 TYR 296 296 296 TYR TYR L . n 
L 1 297 TYR 297 297 297 TYR TYR L . n 
L 1 298 ILE 298 298 298 ILE ILE L . n 
L 1 299 GLY 299 299 299 GLY GLY L . n 
L 1 300 GLY 300 300 300 GLY GLY L . n 
L 1 301 VAL 301 301 301 VAL VAL L . n 
L 1 302 ILE 302 302 302 ILE ILE L . n 
L 1 303 LYS 303 303 303 LYS LYS L . n 
L 1 304 HIS 304 304 304 HIS HIS L . n 
L 1 305 ALA 305 305 305 ALA ALA L . n 
L 1 306 LYS 306 306 306 LYS LYS L . n 
L 1 307 ALA 307 307 307 ALA ALA L . n 
L 1 308 ILE 308 308 308 ILE ILE L . n 
L 1 309 ASN 309 309 309 ASN ASN L . n 
L 1 310 ALA 310 310 310 ALA ALA L . n 
L 1 311 LEU 311 311 311 LEU LEU L . n 
L 1 312 ALA 312 312 312 ALA ALA L . n 
L 1 313 ASN 313 313 313 ASN ASN L . n 
L 1 314 PRO 314 314 314 PRO PRO L . n 
L 1 315 THR 315 315 315 THR THR L . n 
L 1 316 THR 316 316 316 THR THR L . n 
L 1 317 ASN 317 317 317 ASN ASN L . n 
L 1 318 SER 318 318 318 SER SER L . n 
L 1 319 TYR 319 319 319 TYR TYR L . n 
L 1 320 LYS 320 320 320 LYS LYS L . n 
L 1 321 ARG 321 321 321 ARG ARG L . n 
L 1 322 LEU 322 322 322 LEU LEU L . n 
L 1 323 VAL 323 323 323 VAL VAL L . n 
L 1 324 PRO 324 324 324 PRO PRO L . n 
L 1 325 GLY 325 325 325 GLY GLY L . n 
L 1 326 TYR 326 326 326 TYR TYR L . n 
L 1 327 GLU 327 327 327 GLU GLU L . n 
L 1 328 ALA 328 328 328 ALA ALA L . n 
L 1 329 PRO 329 329 329 PRO PRO L . n 
L 1 330 VAL 330 330 330 VAL VAL L . n 
L 1 331 MET 331 331 331 MET MET L . n 
L 1 332 LEU 332 332 332 LEU LEU L . n 
L 1 333 ALA 333 333 333 ALA ALA L . n 
L 1 334 TYR 334 334 334 TYR TYR L . n 
L 1 335 SER 335 335 335 SER SER L . n 
L 1 336 ALA 336 336 336 ALA ALA L . n 
L 1 337 ARG 337 337 337 ARG ARG L . n 
L 1 338 ASN 338 338 338 ASN ASN L . n 
L 1 339 ARG 339 339 339 ARG ARG L . n 
L 1 340 SER 340 340 340 SER SER L . n 
L 1 341 ALA 341 341 341 ALA ALA L . n 
L 1 342 SER 342 342 342 SER SER L . n 
L 1 343 ILE 343 343 343 ILE ILE L . n 
L 1 344 ARG 344 344 344 ARG ARG L . n 
L 1 345 ILE 345 345 345 ILE ILE L . n 
L 1 346 PRO 346 346 346 PRO PRO L . n 
L 1 347 VAL 347 347 347 VAL VAL L . n 
L 1 348 VAL 348 348 348 VAL VAL L . n 
L 1 349 ALA 349 349 349 ALA ALA L . n 
L 1 350 SER 350 350 350 SER SER L . n 
L 1 351 PRO 351 351 351 PRO PRO L . n 
L 1 352 LYS 352 352 352 LYS LYS L . n 
L 1 353 ALA 353 353 353 ALA ALA L . n 
L 1 354 ARG 354 354 354 ARG ARG L . n 
L 1 355 ARG 355 355 355 ARG ARG L . n 
L 1 356 ILE 356 356 356 ILE ILE L . n 
L 1 357 GLU 357 357 357 GLU GLU L . n 
L 1 358 VAL 358 358 358 VAL VAL L . n 
L 1 359 ARG 359 359 359 ARG ARG L . n 
L 1 360 PHE 360 360 360 PHE PHE L . n 
L 1 361 PRO 361 361 361 PRO PRO L . n 
L 1 362 ASP 362 362 362 ASP ASP L . n 
L 1 363 PRO 363 363 363 PRO PRO L . n 
L 1 364 ALA 364 364 364 ALA ALA L . n 
L 1 365 ALA 365 365 365 ALA ALA L . n 
L 1 366 ASN 366 366 366 ASN ASN L . n 
L 1 367 PRO 367 367 367 PRO PRO L . n 
L 1 368 TYR 368 368 368 TYR TYR L . n 
L 1 369 LEU 369 369 369 LEU LEU L . n 
L 1 370 CYS 370 370 370 CYS CYS L . n 
L 1 371 PHE 371 371 371 PHE PHE L . n 
L 1 372 ALA 372 372 372 ALA ALA L . n 
L 1 373 ALA 373 373 373 ALA ALA L . n 
L 1 374 LEU 374 374 374 LEU LEU L . n 
L 1 375 LEU 375 375 375 LEU LEU L . n 
L 1 376 MET 376 376 376 MET MET L . n 
L 1 377 ALA 377 377 377 ALA ALA L . n 
L 1 378 GLY 378 378 378 GLY GLY L . n 
L 1 379 LEU 379 379 379 LEU LEU L . n 
L 1 380 ASP 380 380 380 ASP ASP L . n 
L 1 381 GLY 381 381 381 GLY GLY L . n 
L 1 382 ILE 382 382 382 ILE ILE L . n 
L 1 383 LYS 383 383 383 LYS LYS L . n 
L 1 384 ASN 384 384 384 ASN ASN L . n 
L 1 385 LYS 385 385 385 LYS LYS L . n 
L 1 386 ILE 386 386 386 ILE ILE L . n 
L 1 387 HIS 387 387 387 HIS HIS L . n 
L 1 388 PRO 388 388 388 PRO PRO L . n 
L 1 389 GLY 389 389 389 GLY GLY L . n 
L 1 390 GLU 390 390 390 GLU GLU L . n 
L 1 391 PRO 391 391 391 PRO PRO L . n 
L 1 392 MET 392 392 392 MET MET L . n 
L 1 393 ASP 393 393 393 ASP ASP L . n 
L 1 394 LYS 394 394 394 LYS LYS L . n 
L 1 395 ASN 395 395 395 ASN ASN L . n 
L 1 396 LEU 396 396 396 LEU LEU L . n 
L 1 397 TYR 397 397 397 TYR TYR L . n 
L 1 398 ASP 398 398 398 ASP ASP L . n 
L 1 399 LEU 399 399 399 LEU LEU L . n 
L 1 400 PRO 400 400 400 PRO PRO L . n 
L 1 401 PRO 401 401 401 PRO PRO L . n 
L 1 402 GLU 402 402 402 GLU GLU L . n 
L 1 403 GLU 403 403 403 GLU GLU L . n 
L 1 404 ALA 404 404 404 ALA ALA L . n 
L 1 405 LYS 405 405 405 LYS LYS L . n 
L 1 406 GLU 406 406 406 GLU GLU L . n 
L 1 407 ILE 407 407 407 ILE ILE L . n 
L 1 408 PRO 408 408 408 PRO PRO L . n 
L 1 409 GLN 409 409 409 GLN GLN L . n 
L 1 410 VAL 410 410 410 VAL VAL L . n 
L 1 411 ALA 411 411 411 ALA ALA L . n 
L 1 412 GLY 412 412 412 GLY GLY L . n 
L 1 413 SER 413 413 413 SER SER L . n 
L 1 414 LEU 414 414 414 LEU LEU L . n 
L 1 415 GLU 415 415 415 GLU GLU L . n 
L 1 416 GLU 416 416 416 GLU GLU L . n 
L 1 417 ALA 417 417 417 ALA ALA L . n 
L 1 418 LEU 418 418 418 LEU LEU L . n 
L 1 419 ASN 419 419 419 ASN ASN L . n 
L 1 420 ALA 420 420 420 ALA ALA L . n 
L 1 421 LEU 421 421 421 LEU LEU L . n 
L 1 422 ASP 422 422 422 ASP ASP L . n 
L 1 423 LEU 423 423 423 LEU LEU L . n 
L 1 424 ASP 424 424 424 ASP ASP L . n 
L 1 425 ARG 425 425 425 ARG ARG L . n 
L 1 426 GLU 426 426 426 GLU GLU L . n 
L 1 427 PHE 427 427 427 PHE PHE L . n 
L 1 428 LEU 428 428 428 LEU LEU L . n 
L 1 429 LYS 429 429 429 LYS LYS L . n 
L 1 430 ALA 430 430 430 ALA ALA L . n 
L 1 431 GLY 431 431 431 GLY GLY L . n 
L 1 432 GLY 432 432 432 GLY GLY L . n 
L 1 433 VAL 433 433 433 VAL VAL L . n 
L 1 434 PHE 434 434 434 PHE PHE L . n 
L 1 435 THR 435 435 435 THR THR L . n 
L 1 436 ASP 436 436 436 ASP ASP L . n 
L 1 437 GLU 437 437 437 GLU GLU L . n 
L 1 438 ALA 438 438 438 ALA ALA L . n 
L 1 439 ILE 439 439 439 ILE ILE L . n 
L 1 440 ASP 440 440 440 ASP ASP L . n 
L 1 441 ALA 441 441 441 ALA ALA L . n 
L 1 442 TYR 442 442 442 TYR TYR L . n 
L 1 443 ILE 443 443 443 ILE ILE L . n 
L 1 444 ALA 444 444 444 ALA ALA L . n 
L 1 445 LEU 445 445 445 LEU LEU L . n 
L 1 446 ARG 446 446 446 ARG ARG L . n 
L 1 447 ARG 447 447 447 ARG ARG L . n 
L 1 448 GLU 448 448 448 GLU GLU L . n 
L 1 449 GLU 449 449 449 GLU GLU L . n 
L 1 450 ASP 450 450 450 ASP ASP L . n 
L 1 451 ASP 451 451 451 ASP ASP L . n 
L 1 452 ARG 452 452 452 ARG ARG L . n 
L 1 453 VAL 453 453 453 VAL VAL L . n 
L 1 454 ARG 454 454 454 ARG ARG L . n 
L 1 455 MET 455 455 455 MET MET L . n 
L 1 456 THR 456 456 456 THR THR L . n 
L 1 457 PRO 457 457 457 PRO PRO L . n 
L 1 458 HIS 458 458 458 HIS HIS L . n 
L 1 459 PRO 459 459 459 PRO PRO L . n 
L 1 460 VAL 460 460 460 VAL VAL L . n 
L 1 461 GLU 461 461 461 GLU GLU L . n 
L 1 462 PHE 462 462 462 PHE PHE L . n 
L 1 463 GLU 463 463 463 GLU GLU L . n 
L 1 464 LEU 464 464 464 LEU LEU L . n 
L 1 465 TYR 465 465 465 TYR TYR L . n 
L 1 466 TYR 466 466 466 TYR TYR L . n 
L 1 467 SER 467 467 467 SER SER L . n 
L 1 468 VAL 468 468 468 VAL VAL L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M  2 MN  1   469  469  MN  MN  A . 
N  2 MN  1   470  470  MN  MN  A . 
O  3 ADP 1   4471 471  ADP ADP A . 
P  4 PPQ 1   5900 900  PPQ PPQ A . 
Q  2 MN  1   469  469  MN  MN  B . 
R  2 MN  1   470  470  MN  MN  B . 
S  3 ADP 1   4472 471  ADP ADP B . 
T  4 PPQ 1   5901 900  PPQ PPQ B . 
U  2 MN  1   469  469  MN  MN  C . 
V  2 MN  1   470  470  MN  MN  C . 
W  3 ADP 1   4473 471  ADP ADP C . 
X  4 PPQ 1   5902 900  PPQ PPQ C . 
Y  2 MN  1   469  469  MN  MN  D . 
Z  2 MN  1   470  470  MN  MN  D . 
AA 3 ADP 1   4474 471  ADP ADP D . 
BA 4 PPQ 1   5903 900  PPQ PPQ D . 
CA 2 MN  1   469  469  MN  MN  E . 
DA 2 MN  1   470  470  MN  MN  E . 
EA 3 ADP 1   4475 471  ADP ADP E . 
FA 4 PPQ 1   5904 900  PPQ PPQ E . 
GA 2 MN  1   469  469  MN  MN  F . 
HA 2 MN  1   470  470  MN  MN  F . 
IA 3 ADP 1   4476 471  ADP ADP F . 
JA 4 PPQ 1   5905 900  PPQ PPQ F . 
KA 2 MN  1   469  469  MN  MN  G . 
LA 2 MN  1   470  470  MN  MN  G . 
MA 3 ADP 1   4477 471  ADP ADP G . 
NA 4 PPQ 1   5906 900  PPQ PPQ G . 
OA 2 MN  1   469  469  MN  MN  H . 
PA 2 MN  1   470  470  MN  MN  H . 
QA 3 ADP 1   4478 471  ADP ADP H . 
RA 4 PPQ 1   5907 900  PPQ PPQ H . 
SA 2 MN  1   469  469  MN  MN  I . 
TA 2 MN  1   470  470  MN  MN  I . 
UA 3 ADP 1   4479 471  ADP ADP I . 
VA 4 PPQ 1   5908 900  PPQ PPQ I . 
WA 2 MN  1   469  469  MN  MN  J . 
XA 2 MN  1   470  470  MN  MN  J . 
YA 3 ADP 1   4480 471  ADP ADP J . 
ZA 4 PPQ 1   5909 900  PPQ PPQ J . 
AB 2 MN  1   469  469  MN  MN  K . 
BB 2 MN  1   470  470  MN  MN  K . 
CB 3 ADP 1   4481 471  ADP ADP K . 
DB 4 PPQ 1   5910 900  PPQ PPQ K . 
EB 2 MN  1   469  469  MN  MN  L . 
FB 2 MN  1   470  470  MN  MN  L . 
GB 3 ADP 1   4482 471  ADP ADP L . 
HB 4 PPQ 1   5911 900  PPQ PPQ L . 
IB 5 HOH 1   5901 902  HOH HOH A . 
IB 5 HOH 2   5902 903  HOH HOH A . 
IB 5 HOH 3   5903 905  HOH HOH A . 
IB 5 HOH 4   5904 906  HOH HOH A . 
IB 5 HOH 5   5905 907  HOH HOH A . 
IB 5 HOH 6   5906 908  HOH HOH A . 
IB 5 HOH 7   5907 909  HOH HOH A . 
IB 5 HOH 8   5908 910  HOH HOH A . 
IB 5 HOH 9   5909 911  HOH HOH A . 
IB 5 HOH 10  5910 912  HOH HOH A . 
IB 5 HOH 11  5911 913  HOH HOH A . 
IB 5 HOH 12  5912 914  HOH HOH A . 
IB 5 HOH 13  5913 915  HOH HOH A . 
IB 5 HOH 14  5914 916  HOH HOH A . 
IB 5 HOH 15  5915 917  HOH HOH A . 
IB 5 HOH 16  5916 918  HOH HOH A . 
IB 5 HOH 17  5917 919  HOH HOH A . 
IB 5 HOH 18  5918 920  HOH HOH A . 
IB 5 HOH 19  5919 921  HOH HOH A . 
IB 5 HOH 20  5920 922  HOH HOH A . 
IB 5 HOH 21  5921 923  HOH HOH A . 
IB 5 HOH 22  5922 924  HOH HOH A . 
IB 5 HOH 23  5923 925  HOH HOH A . 
IB 5 HOH 24  5924 926  HOH HOH A . 
IB 5 HOH 25  5925 927  HOH HOH A . 
IB 5 HOH 26  5926 928  HOH HOH A . 
IB 5 HOH 27  5927 929  HOH HOH A . 
IB 5 HOH 28  5928 930  HOH HOH A . 
IB 5 HOH 29  5929 931  HOH HOH A . 
IB 5 HOH 30  5930 932  HOH HOH A . 
IB 5 HOH 31  5931 933  HOH HOH A . 
IB 5 HOH 32  5932 934  HOH HOH A . 
IB 5 HOH 33  5933 935  HOH HOH A . 
IB 5 HOH 34  5934 936  HOH HOH A . 
IB 5 HOH 35  5935 937  HOH HOH A . 
IB 5 HOH 36  5936 938  HOH HOH A . 
IB 5 HOH 37  5937 939  HOH HOH A . 
IB 5 HOH 38  5938 940  HOH HOH A . 
IB 5 HOH 39  5939 941  HOH HOH A . 
IB 5 HOH 40  5940 942  HOH HOH A . 
IB 5 HOH 41  5941 943  HOH HOH A . 
IB 5 HOH 42  5942 944  HOH HOH A . 
IB 5 HOH 43  5943 945  HOH HOH A . 
IB 5 HOH 44  5944 946  HOH HOH A . 
IB 5 HOH 45  5945 947  HOH HOH A . 
IB 5 HOH 46  5946 948  HOH HOH A . 
IB 5 HOH 47  5947 949  HOH HOH A . 
IB 5 HOH 48  5948 950  HOH HOH A . 
IB 5 HOH 49  5949 951  HOH HOH A . 
IB 5 HOH 50  5950 952  HOH HOH A . 
IB 5 HOH 51  5951 953  HOH HOH A . 
IB 5 HOH 52  5952 954  HOH HOH A . 
IB 5 HOH 53  5953 955  HOH HOH A . 
IB 5 HOH 54  5954 956  HOH HOH A . 
IB 5 HOH 55  5955 957  HOH HOH A . 
IB 5 HOH 56  5956 958  HOH HOH A . 
IB 5 HOH 57  5957 959  HOH HOH A . 
IB 5 HOH 58  5958 960  HOH HOH A . 
IB 5 HOH 59  5959 962  HOH HOH A . 
IB 5 HOH 60  5960 963  HOH HOH A . 
IB 5 HOH 61  5961 964  HOH HOH A . 
IB 5 HOH 62  5962 965  HOH HOH A . 
IB 5 HOH 63  5963 966  HOH HOH A . 
IB 5 HOH 64  5964 967  HOH HOH A . 
IB 5 HOH 65  5965 968  HOH HOH A . 
IB 5 HOH 66  5966 969  HOH HOH A . 
IB 5 HOH 67  5967 970  HOH HOH A . 
IB 5 HOH 68  5968 971  HOH HOH A . 
IB 5 HOH 69  5969 972  HOH HOH A . 
IB 5 HOH 70  5970 973  HOH HOH A . 
IB 5 HOH 71  5971 974  HOH HOH A . 
IB 5 HOH 72  5972 975  HOH HOH A . 
IB 5 HOH 73  5973 976  HOH HOH A . 
IB 5 HOH 74  5974 977  HOH HOH A . 
IB 5 HOH 75  5975 978  HOH HOH A . 
IB 5 HOH 76  5976 979  HOH HOH A . 
IB 5 HOH 77  5977 980  HOH HOH A . 
IB 5 HOH 78  5978 981  HOH HOH A . 
IB 5 HOH 79  5979 982  HOH HOH A . 
IB 5 HOH 80  5980 983  HOH HOH A . 
IB 5 HOH 81  5981 985  HOH HOH A . 
IB 5 HOH 82  5982 986  HOH HOH A . 
IB 5 HOH 83  5983 987  HOH HOH A . 
IB 5 HOH 84  5984 988  HOH HOH A . 
IB 5 HOH 85  5985 989  HOH HOH A . 
IB 5 HOH 86  5986 990  HOH HOH A . 
IB 5 HOH 87  5987 991  HOH HOH A . 
IB 5 HOH 88  5988 992  HOH HOH A . 
IB 5 HOH 89  5989 993  HOH HOH A . 
IB 5 HOH 90  5990 995  HOH HOH A . 
IB 5 HOH 91  5991 996  HOH HOH A . 
IB 5 HOH 92  5992 997  HOH HOH A . 
IB 5 HOH 93  5993 998  HOH HOH A . 
IB 5 HOH 94  5994 999  HOH HOH A . 
IB 5 HOH 95  5995 1000 HOH HOH A . 
IB 5 HOH 96  5996 1003 HOH HOH A . 
IB 5 HOH 97  5997 1004 HOH HOH A . 
IB 5 HOH 98  5998 1005 HOH HOH A . 
IB 5 HOH 99  5999 1006 HOH HOH A . 
IB 5 HOH 100 6000 1007 HOH HOH A . 
IB 5 HOH 101 6001 1008 HOH HOH A . 
IB 5 HOH 102 6002 1009 HOH HOH A . 
IB 5 HOH 103 6003 1010 HOH HOH A . 
IB 5 HOH 104 6004 1012 HOH HOH A . 
IB 5 HOH 105 6005 1013 HOH HOH A . 
IB 5 HOH 106 6006 1014 HOH HOH A . 
IB 5 HOH 107 6007 1015 HOH HOH A . 
IB 5 HOH 108 6008 1016 HOH HOH A . 
IB 5 HOH 109 6009 1017 HOH HOH A . 
IB 5 HOH 110 6010 1018 HOH HOH A . 
IB 5 HOH 111 6011 1019 HOH HOH A . 
IB 5 HOH 112 6012 1020 HOH HOH A . 
IB 5 HOH 113 6013 1022 HOH HOH A . 
IB 5 HOH 114 6014 1023 HOH HOH A . 
IB 5 HOH 115 6015 1024 HOH HOH A . 
IB 5 HOH 116 6016 1025 HOH HOH A . 
IB 5 HOH 117 6017 1026 HOH HOH A . 
IB 5 HOH 118 6018 1027 HOH HOH A . 
IB 5 HOH 119 6019 1028 HOH HOH A . 
IB 5 HOH 120 6020 1029 HOH HOH A . 
IB 5 HOH 121 6021 1030 HOH HOH A . 
IB 5 HOH 122 6022 1031 HOH HOH A . 
IB 5 HOH 123 6023 1032 HOH HOH A . 
IB 5 HOH 124 6024 1033 HOH HOH A . 
IB 5 HOH 125 6025 1034 HOH HOH A . 
IB 5 HOH 126 6026 1035 HOH HOH A . 
IB 5 HOH 127 6027 1036 HOH HOH A . 
IB 5 HOH 128 6028 1037 HOH HOH A . 
IB 5 HOH 129 6029 1038 HOH HOH A . 
IB 5 HOH 130 6030 1039 HOH HOH A . 
IB 5 HOH 131 6031 1040 HOH HOH A . 
IB 5 HOH 132 6032 1041 HOH HOH A . 
IB 5 HOH 133 6033 1042 HOH HOH A . 
IB 5 HOH 134 6034 1043 HOH HOH A . 
IB 5 HOH 135 6035 1044 HOH HOH A . 
IB 5 HOH 136 6036 1045 HOH HOH A . 
IB 5 HOH 137 6037 1047 HOH HOH A . 
IB 5 HOH 138 6038 1048 HOH HOH A . 
IB 5 HOH 139 6039 1049 HOH HOH A . 
IB 5 HOH 140 6040 1050 HOH HOH A . 
IB 5 HOH 141 6041 1051 HOH HOH A . 
IB 5 HOH 142 6042 1053 HOH HOH A . 
IB 5 HOH 143 6043 904  HOH HOH A . 
IB 5 HOH 144 6044 961  HOH HOH A . 
IB 5 HOH 145 6045 984  HOH HOH A . 
IB 5 HOH 146 6046 994  HOH HOH A . 
IB 5 HOH 147 6047 1001 HOH HOH A . 
IB 5 HOH 148 6048 1002 HOH HOH A . 
IB 5 HOH 149 6049 901  HOH HOH A . 
IB 5 HOH 150 6050 1011 HOH HOH A . 
IB 5 HOH 151 6051 1021 HOH HOH A . 
IB 5 HOH 152 6052 1046 HOH HOH A . 
JB 5 HOH 1   5902 902  HOH HOH B . 
JB 5 HOH 2   5903 903  HOH HOH B . 
JB 5 HOH 3   5904 905  HOH HOH B . 
JB 5 HOH 4   5905 906  HOH HOH B . 
JB 5 HOH 5   5906 907  HOH HOH B . 
JB 5 HOH 6   5907 908  HOH HOH B . 
JB 5 HOH 7   5908 909  HOH HOH B . 
JB 5 HOH 8   5909 910  HOH HOH B . 
JB 5 HOH 9   5910 911  HOH HOH B . 
JB 5 HOH 10  5911 912  HOH HOH B . 
JB 5 HOH 11  5912 913  HOH HOH B . 
JB 5 HOH 12  5913 914  HOH HOH B . 
JB 5 HOH 13  5914 915  HOH HOH B . 
JB 5 HOH 14  5915 916  HOH HOH B . 
JB 5 HOH 15  5916 917  HOH HOH B . 
JB 5 HOH 16  5917 918  HOH HOH B . 
JB 5 HOH 17  5918 919  HOH HOH B . 
JB 5 HOH 18  5919 920  HOH HOH B . 
JB 5 HOH 19  5920 921  HOH HOH B . 
JB 5 HOH 20  5921 922  HOH HOH B . 
JB 5 HOH 21  5922 923  HOH HOH B . 
JB 5 HOH 22  5923 924  HOH HOH B . 
JB 5 HOH 23  5924 925  HOH HOH B . 
JB 5 HOH 24  5925 926  HOH HOH B . 
JB 5 HOH 25  5926 927  HOH HOH B . 
JB 5 HOH 26  5927 928  HOH HOH B . 
JB 5 HOH 27  5928 929  HOH HOH B . 
JB 5 HOH 28  5929 930  HOH HOH B . 
JB 5 HOH 29  5930 931  HOH HOH B . 
JB 5 HOH 30  5931 932  HOH HOH B . 
JB 5 HOH 31  5932 933  HOH HOH B . 
JB 5 HOH 32  5933 934  HOH HOH B . 
JB 5 HOH 33  5934 935  HOH HOH B . 
JB 5 HOH 34  5935 936  HOH HOH B . 
JB 5 HOH 35  5936 937  HOH HOH B . 
JB 5 HOH 36  5937 938  HOH HOH B . 
JB 5 HOH 37  5938 939  HOH HOH B . 
JB 5 HOH 38  5939 940  HOH HOH B . 
JB 5 HOH 39  5940 941  HOH HOH B . 
JB 5 HOH 40  5941 942  HOH HOH B . 
JB 5 HOH 41  5942 943  HOH HOH B . 
JB 5 HOH 42  5943 944  HOH HOH B . 
JB 5 HOH 43  5944 945  HOH HOH B . 
JB 5 HOH 44  5945 946  HOH HOH B . 
JB 5 HOH 45  5946 947  HOH HOH B . 
JB 5 HOH 46  5947 948  HOH HOH B . 
JB 5 HOH 47  5948 949  HOH HOH B . 
JB 5 HOH 48  5949 950  HOH HOH B . 
JB 5 HOH 49  5950 951  HOH HOH B . 
JB 5 HOH 50  5951 952  HOH HOH B . 
JB 5 HOH 51  5952 953  HOH HOH B . 
JB 5 HOH 52  5953 954  HOH HOH B . 
JB 5 HOH 53  5954 955  HOH HOH B . 
JB 5 HOH 54  5955 956  HOH HOH B . 
JB 5 HOH 55  5956 957  HOH HOH B . 
JB 5 HOH 56  5957 958  HOH HOH B . 
JB 5 HOH 57  5958 959  HOH HOH B . 
JB 5 HOH 58  5959 960  HOH HOH B . 
JB 5 HOH 59  5960 962  HOH HOH B . 
JB 5 HOH 60  5961 963  HOH HOH B . 
JB 5 HOH 61  5962 964  HOH HOH B . 
JB 5 HOH 62  5963 965  HOH HOH B . 
JB 5 HOH 63  5964 966  HOH HOH B . 
JB 5 HOH 64  5965 967  HOH HOH B . 
JB 5 HOH 65  5966 968  HOH HOH B . 
JB 5 HOH 66  5967 969  HOH HOH B . 
JB 5 HOH 67  5968 970  HOH HOH B . 
JB 5 HOH 68  5969 971  HOH HOH B . 
JB 5 HOH 69  5970 972  HOH HOH B . 
JB 5 HOH 70  5971 973  HOH HOH B . 
JB 5 HOH 71  5972 974  HOH HOH B . 
JB 5 HOH 72  5973 975  HOH HOH B . 
JB 5 HOH 73  5974 976  HOH HOH B . 
JB 5 HOH 74  5975 977  HOH HOH B . 
JB 5 HOH 75  5976 978  HOH HOH B . 
JB 5 HOH 76  5977 979  HOH HOH B . 
JB 5 HOH 77  5978 980  HOH HOH B . 
JB 5 HOH 78  5979 981  HOH HOH B . 
JB 5 HOH 79  5980 982  HOH HOH B . 
JB 5 HOH 80  5981 983  HOH HOH B . 
JB 5 HOH 81  5982 985  HOH HOH B . 
JB 5 HOH 82  5983 986  HOH HOH B . 
JB 5 HOH 83  5984 987  HOH HOH B . 
JB 5 HOH 84  5985 988  HOH HOH B . 
JB 5 HOH 85  5986 989  HOH HOH B . 
JB 5 HOH 86  5987 990  HOH HOH B . 
JB 5 HOH 87  5988 991  HOH HOH B . 
JB 5 HOH 88  5989 992  HOH HOH B . 
JB 5 HOH 89  5990 993  HOH HOH B . 
JB 5 HOH 90  5991 995  HOH HOH B . 
JB 5 HOH 91  5992 996  HOH HOH B . 
JB 5 HOH 92  5993 997  HOH HOH B . 
JB 5 HOH 93  5994 998  HOH HOH B . 
JB 5 HOH 94  5995 999  HOH HOH B . 
JB 5 HOH 95  5996 1000 HOH HOH B . 
JB 5 HOH 96  5997 1003 HOH HOH B . 
JB 5 HOH 97  5998 1004 HOH HOH B . 
JB 5 HOH 98  5999 1005 HOH HOH B . 
JB 5 HOH 99  6000 1006 HOH HOH B . 
JB 5 HOH 100 6001 1007 HOH HOH B . 
JB 5 HOH 101 6002 1008 HOH HOH B . 
JB 5 HOH 102 6003 1009 HOH HOH B . 
JB 5 HOH 103 6004 1010 HOH HOH B . 
JB 5 HOH 104 6005 1012 HOH HOH B . 
JB 5 HOH 105 6006 1013 HOH HOH B . 
JB 5 HOH 106 6007 1014 HOH HOH B . 
JB 5 HOH 107 6008 1015 HOH HOH B . 
JB 5 HOH 108 6009 1016 HOH HOH B . 
JB 5 HOH 109 6010 1017 HOH HOH B . 
JB 5 HOH 110 6011 1018 HOH HOH B . 
JB 5 HOH 111 6012 1019 HOH HOH B . 
JB 5 HOH 112 6013 1020 HOH HOH B . 
JB 5 HOH 113 6014 1022 HOH HOH B . 
JB 5 HOH 114 6015 1023 HOH HOH B . 
JB 5 HOH 115 6016 1024 HOH HOH B . 
JB 5 HOH 116 6017 1025 HOH HOH B . 
JB 5 HOH 117 6018 1026 HOH HOH B . 
JB 5 HOH 118 6019 1027 HOH HOH B . 
JB 5 HOH 119 6020 1028 HOH HOH B . 
JB 5 HOH 120 6021 1029 HOH HOH B . 
JB 5 HOH 121 6022 1030 HOH HOH B . 
JB 5 HOH 122 6023 1031 HOH HOH B . 
JB 5 HOH 123 6024 1032 HOH HOH B . 
JB 5 HOH 124 6025 1033 HOH HOH B . 
JB 5 HOH 125 6026 1034 HOH HOH B . 
JB 5 HOH 126 6027 1035 HOH HOH B . 
JB 5 HOH 127 6028 1036 HOH HOH B . 
JB 5 HOH 128 6029 1037 HOH HOH B . 
JB 5 HOH 129 6030 1038 HOH HOH B . 
JB 5 HOH 130 6031 1039 HOH HOH B . 
JB 5 HOH 131 6032 1040 HOH HOH B . 
JB 5 HOH 132 6033 1041 HOH HOH B . 
JB 5 HOH 133 6034 1042 HOH HOH B . 
JB 5 HOH 134 6035 1043 HOH HOH B . 
JB 5 HOH 135 6036 1044 HOH HOH B . 
JB 5 HOH 136 6037 1045 HOH HOH B . 
JB 5 HOH 137 6038 1047 HOH HOH B . 
JB 5 HOH 138 6039 1048 HOH HOH B . 
JB 5 HOH 139 6040 1049 HOH HOH B . 
JB 5 HOH 140 6041 1050 HOH HOH B . 
JB 5 HOH 141 6042 1051 HOH HOH B . 
JB 5 HOH 142 6043 1052 HOH HOH B . 
JB 5 HOH 143 6044 1053 HOH HOH B . 
JB 5 HOH 144 6045 904  HOH HOH B . 
JB 5 HOH 145 6046 911  HOH HOH B . 
JB 5 HOH 146 6047 926  HOH HOH B . 
JB 5 HOH 147 6048 961  HOH HOH B . 
JB 5 HOH 148 6049 984  HOH HOH B . 
JB 5 HOH 149 6050 994  HOH HOH B . 
JB 5 HOH 150 6051 1001 HOH HOH B . 
JB 5 HOH 151 6052 1002 HOH HOH B . 
JB 5 HOH 152 6053 901  HOH HOH B . 
JB 5 HOH 153 6054 1011 HOH HOH B . 
JB 5 HOH 154 6055 1021 HOH HOH B . 
JB 5 HOH 155 6056 1046 HOH HOH B . 
KB 5 HOH 1   5903 902  HOH HOH C . 
KB 5 HOH 2   5904 903  HOH HOH C . 
KB 5 HOH 3   5905 905  HOH HOH C . 
KB 5 HOH 4   5906 906  HOH HOH C . 
KB 5 HOH 5   5907 907  HOH HOH C . 
KB 5 HOH 6   5908 908  HOH HOH C . 
KB 5 HOH 7   5909 909  HOH HOH C . 
KB 5 HOH 8   5910 910  HOH HOH C . 
KB 5 HOH 9   5911 912  HOH HOH C . 
KB 5 HOH 10  5912 913  HOH HOH C . 
KB 5 HOH 11  5913 914  HOH HOH C . 
KB 5 HOH 12  5914 915  HOH HOH C . 
KB 5 HOH 13  5915 916  HOH HOH C . 
KB 5 HOH 14  5916 917  HOH HOH C . 
KB 5 HOH 15  5917 918  HOH HOH C . 
KB 5 HOH 16  5918 919  HOH HOH C . 
KB 5 HOH 17  5919 920  HOH HOH C . 
KB 5 HOH 18  5920 921  HOH HOH C . 
KB 5 HOH 19  5921 922  HOH HOH C . 
KB 5 HOH 20  5922 923  HOH HOH C . 
KB 5 HOH 21  5923 924  HOH HOH C . 
KB 5 HOH 22  5924 925  HOH HOH C . 
KB 5 HOH 23  5925 927  HOH HOH C . 
KB 5 HOH 24  5926 928  HOH HOH C . 
KB 5 HOH 25  5927 929  HOH HOH C . 
KB 5 HOH 26  5928 930  HOH HOH C . 
KB 5 HOH 27  5929 931  HOH HOH C . 
KB 5 HOH 28  5930 932  HOH HOH C . 
KB 5 HOH 29  5931 933  HOH HOH C . 
KB 5 HOH 30  5932 934  HOH HOH C . 
KB 5 HOH 31  5933 935  HOH HOH C . 
KB 5 HOH 32  5934 936  HOH HOH C . 
KB 5 HOH 33  5935 937  HOH HOH C . 
KB 5 HOH 34  5936 938  HOH HOH C . 
KB 5 HOH 35  5937 939  HOH HOH C . 
KB 5 HOH 36  5938 940  HOH HOH C . 
KB 5 HOH 37  5939 941  HOH HOH C . 
KB 5 HOH 38  5940 942  HOH HOH C . 
KB 5 HOH 39  5941 943  HOH HOH C . 
KB 5 HOH 40  5942 944  HOH HOH C . 
KB 5 HOH 41  5943 945  HOH HOH C . 
KB 5 HOH 42  5944 946  HOH HOH C . 
KB 5 HOH 43  5945 947  HOH HOH C . 
KB 5 HOH 44  5946 948  HOH HOH C . 
KB 5 HOH 45  5947 949  HOH HOH C . 
KB 5 HOH 46  5948 950  HOH HOH C . 
KB 5 HOH 47  5949 951  HOH HOH C . 
KB 5 HOH 48  5950 952  HOH HOH C . 
KB 5 HOH 49  5951 953  HOH HOH C . 
KB 5 HOH 50  5952 954  HOH HOH C . 
KB 5 HOH 51  5953 955  HOH HOH C . 
KB 5 HOH 52  5954 956  HOH HOH C . 
KB 5 HOH 53  5955 957  HOH HOH C . 
KB 5 HOH 54  5956 958  HOH HOH C . 
KB 5 HOH 55  5957 959  HOH HOH C . 
KB 5 HOH 56  5958 960  HOH HOH C . 
KB 5 HOH 57  5959 962  HOH HOH C . 
KB 5 HOH 58  5960 963  HOH HOH C . 
KB 5 HOH 59  5961 964  HOH HOH C . 
KB 5 HOH 60  5962 965  HOH HOH C . 
KB 5 HOH 61  5963 966  HOH HOH C . 
KB 5 HOH 62  5964 967  HOH HOH C . 
KB 5 HOH 63  5965 968  HOH HOH C . 
KB 5 HOH 64  5966 969  HOH HOH C . 
KB 5 HOH 65  5967 970  HOH HOH C . 
KB 5 HOH 66  5968 971  HOH HOH C . 
KB 5 HOH 67  5969 972  HOH HOH C . 
KB 5 HOH 68  5970 973  HOH HOH C . 
KB 5 HOH 69  5971 974  HOH HOH C . 
KB 5 HOH 70  5972 975  HOH HOH C . 
KB 5 HOH 71  5973 976  HOH HOH C . 
KB 5 HOH 72  5974 977  HOH HOH C . 
KB 5 HOH 73  5975 978  HOH HOH C . 
KB 5 HOH 74  5976 979  HOH HOH C . 
KB 5 HOH 75  5977 980  HOH HOH C . 
KB 5 HOH 76  5978 981  HOH HOH C . 
KB 5 HOH 77  5979 982  HOH HOH C . 
KB 5 HOH 78  5980 983  HOH HOH C . 
KB 5 HOH 79  5981 985  HOH HOH C . 
KB 5 HOH 80  5982 986  HOH HOH C . 
KB 5 HOH 81  5983 987  HOH HOH C . 
KB 5 HOH 82  5984 988  HOH HOH C . 
KB 5 HOH 83  5985 989  HOH HOH C . 
KB 5 HOH 84  5986 990  HOH HOH C . 
KB 5 HOH 85  5987 991  HOH HOH C . 
KB 5 HOH 86  5988 992  HOH HOH C . 
KB 5 HOH 87  5989 993  HOH HOH C . 
KB 5 HOH 88  5990 995  HOH HOH C . 
KB 5 HOH 89  5991 996  HOH HOH C . 
KB 5 HOH 90  5992 997  HOH HOH C . 
KB 5 HOH 91  5993 998  HOH HOH C . 
KB 5 HOH 92  5994 999  HOH HOH C . 
KB 5 HOH 93  5995 1000 HOH HOH C . 
KB 5 HOH 94  5996 1003 HOH HOH C . 
KB 5 HOH 95  5997 1004 HOH HOH C . 
KB 5 HOH 96  5998 1005 HOH HOH C . 
KB 5 HOH 97  5999 1006 HOH HOH C . 
KB 5 HOH 98  6000 1007 HOH HOH C . 
KB 5 HOH 99  6001 1008 HOH HOH C . 
KB 5 HOH 100 6002 1009 HOH HOH C . 
KB 5 HOH 101 6003 1010 HOH HOH C . 
KB 5 HOH 102 6004 1012 HOH HOH C . 
KB 5 HOH 103 6005 1013 HOH HOH C . 
KB 5 HOH 104 6006 1014 HOH HOH C . 
KB 5 HOH 105 6007 1015 HOH HOH C . 
KB 5 HOH 106 6008 1016 HOH HOH C . 
KB 5 HOH 107 6009 1017 HOH HOH C . 
KB 5 HOH 108 6010 1018 HOH HOH C . 
KB 5 HOH 109 6011 1019 HOH HOH C . 
KB 5 HOH 110 6012 1020 HOH HOH C . 
KB 5 HOH 111 6013 1022 HOH HOH C . 
KB 5 HOH 112 6014 1023 HOH HOH C . 
KB 5 HOH 113 6015 1024 HOH HOH C . 
KB 5 HOH 114 6016 1025 HOH HOH C . 
KB 5 HOH 115 6017 1026 HOH HOH C . 
KB 5 HOH 116 6018 1027 HOH HOH C . 
KB 5 HOH 117 6019 1028 HOH HOH C . 
KB 5 HOH 118 6020 1029 HOH HOH C . 
KB 5 HOH 119 6021 1030 HOH HOH C . 
KB 5 HOH 120 6022 1031 HOH HOH C . 
KB 5 HOH 121 6023 1032 HOH HOH C . 
KB 5 HOH 122 6024 1033 HOH HOH C . 
KB 5 HOH 123 6025 1034 HOH HOH C . 
KB 5 HOH 124 6026 1035 HOH HOH C . 
KB 5 HOH 125 6027 1036 HOH HOH C . 
KB 5 HOH 126 6028 1037 HOH HOH C . 
KB 5 HOH 127 6029 1038 HOH HOH C . 
KB 5 HOH 128 6030 1039 HOH HOH C . 
KB 5 HOH 129 6031 1040 HOH HOH C . 
KB 5 HOH 130 6032 1041 HOH HOH C . 
KB 5 HOH 131 6033 1042 HOH HOH C . 
KB 5 HOH 132 6034 1043 HOH HOH C . 
KB 5 HOH 133 6035 1044 HOH HOH C . 
KB 5 HOH 134 6036 1045 HOH HOH C . 
KB 5 HOH 135 6037 1047 HOH HOH C . 
KB 5 HOH 136 6038 1048 HOH HOH C . 
KB 5 HOH 137 6039 1049 HOH HOH C . 
KB 5 HOH 138 6040 1050 HOH HOH C . 
KB 5 HOH 139 6041 1051 HOH HOH C . 
KB 5 HOH 140 6042 1052 HOH HOH C . 
KB 5 HOH 141 6043 1053 HOH HOH C . 
KB 5 HOH 142 6044 904  HOH HOH C . 
KB 5 HOH 143 6045 961  HOH HOH C . 
KB 5 HOH 144 6046 984  HOH HOH C . 
KB 5 HOH 145 6047 994  HOH HOH C . 
KB 5 HOH 146 6048 1001 HOH HOH C . 
KB 5 HOH 147 6049 1002 HOH HOH C . 
KB 5 HOH 148 6050 1052 HOH HOH C . 
KB 5 HOH 149 6051 901  HOH HOH C . 
KB 5 HOH 150 6052 1011 HOH HOH C . 
KB 5 HOH 151 6053 1021 HOH HOH C . 
KB 5 HOH 152 6054 1046 HOH HOH C . 
LB 5 HOH 1   5904 902  HOH HOH D . 
LB 5 HOH 2   5905 903  HOH HOH D . 
LB 5 HOH 3   5906 905  HOH HOH D . 
LB 5 HOH 4   5907 906  HOH HOH D . 
LB 5 HOH 5   5908 907  HOH HOH D . 
LB 5 HOH 6   5909 908  HOH HOH D . 
LB 5 HOH 7   5910 909  HOH HOH D . 
LB 5 HOH 8   5911 910  HOH HOH D . 
LB 5 HOH 9   5912 911  HOH HOH D . 
LB 5 HOH 10  5913 912  HOH HOH D . 
LB 5 HOH 11  5914 913  HOH HOH D . 
LB 5 HOH 12  5915 914  HOH HOH D . 
LB 5 HOH 13  5916 915  HOH HOH D . 
LB 5 HOH 14  5917 916  HOH HOH D . 
LB 5 HOH 15  5918 917  HOH HOH D . 
LB 5 HOH 16  5919 918  HOH HOH D . 
LB 5 HOH 17  5920 919  HOH HOH D . 
LB 5 HOH 18  5921 920  HOH HOH D . 
LB 5 HOH 19  5922 921  HOH HOH D . 
LB 5 HOH 20  5923 922  HOH HOH D . 
LB 5 HOH 21  5924 923  HOH HOH D . 
LB 5 HOH 22  5925 924  HOH HOH D . 
LB 5 HOH 23  5926 925  HOH HOH D . 
LB 5 HOH 24  5927 926  HOH HOH D . 
LB 5 HOH 25  5928 927  HOH HOH D . 
LB 5 HOH 26  5929 928  HOH HOH D . 
LB 5 HOH 27  5930 929  HOH HOH D . 
LB 5 HOH 28  5931 930  HOH HOH D . 
LB 5 HOH 29  5932 931  HOH HOH D . 
LB 5 HOH 30  5933 932  HOH HOH D . 
LB 5 HOH 31  5934 933  HOH HOH D . 
LB 5 HOH 32  5935 934  HOH HOH D . 
LB 5 HOH 33  5936 935  HOH HOH D . 
LB 5 HOH 34  5937 936  HOH HOH D . 
LB 5 HOH 35  5938 937  HOH HOH D . 
LB 5 HOH 36  5939 938  HOH HOH D . 
LB 5 HOH 37  5940 939  HOH HOH D . 
LB 5 HOH 38  5941 940  HOH HOH D . 
LB 5 HOH 39  5942 941  HOH HOH D . 
LB 5 HOH 40  5943 942  HOH HOH D . 
LB 5 HOH 41  5944 943  HOH HOH D . 
LB 5 HOH 42  5945 944  HOH HOH D . 
LB 5 HOH 43  5946 945  HOH HOH D . 
LB 5 HOH 44  5947 946  HOH HOH D . 
LB 5 HOH 45  5948 947  HOH HOH D . 
LB 5 HOH 46  5949 948  HOH HOH D . 
LB 5 HOH 47  5950 949  HOH HOH D . 
LB 5 HOH 48  5951 950  HOH HOH D . 
LB 5 HOH 49  5952 951  HOH HOH D . 
LB 5 HOH 50  5953 952  HOH HOH D . 
LB 5 HOH 51  5954 953  HOH HOH D . 
LB 5 HOH 52  5955 954  HOH HOH D . 
LB 5 HOH 53  5956 955  HOH HOH D . 
LB 5 HOH 54  5957 956  HOH HOH D . 
LB 5 HOH 55  5958 957  HOH HOH D . 
LB 5 HOH 56  5959 958  HOH HOH D . 
LB 5 HOH 57  5960 959  HOH HOH D . 
LB 5 HOH 58  5961 960  HOH HOH D . 
LB 5 HOH 59  5962 962  HOH HOH D . 
LB 5 HOH 60  5963 963  HOH HOH D . 
LB 5 HOH 61  5964 964  HOH HOH D . 
LB 5 HOH 62  5965 965  HOH HOH D . 
LB 5 HOH 63  5966 966  HOH HOH D . 
LB 5 HOH 64  5967 967  HOH HOH D . 
LB 5 HOH 65  5968 968  HOH HOH D . 
LB 5 HOH 66  5969 969  HOH HOH D . 
LB 5 HOH 67  5970 970  HOH HOH D . 
LB 5 HOH 68  5971 971  HOH HOH D . 
LB 5 HOH 69  5972 972  HOH HOH D . 
LB 5 HOH 70  5973 973  HOH HOH D . 
LB 5 HOH 71  5974 974  HOH HOH D . 
LB 5 HOH 72  5975 975  HOH HOH D . 
LB 5 HOH 73  5976 976  HOH HOH D . 
LB 5 HOH 74  5977 977  HOH HOH D . 
LB 5 HOH 75  5978 978  HOH HOH D . 
LB 5 HOH 76  5979 979  HOH HOH D . 
LB 5 HOH 77  5980 980  HOH HOH D . 
LB 5 HOH 78  5981 981  HOH HOH D . 
LB 5 HOH 79  5982 982  HOH HOH D . 
LB 5 HOH 80  5983 983  HOH HOH D . 
LB 5 HOH 81  5984 985  HOH HOH D . 
LB 5 HOH 82  5985 986  HOH HOH D . 
LB 5 HOH 83  5986 987  HOH HOH D . 
LB 5 HOH 84  5987 988  HOH HOH D . 
LB 5 HOH 85  5988 989  HOH HOH D . 
LB 5 HOH 86  5989 990  HOH HOH D . 
LB 5 HOH 87  5990 991  HOH HOH D . 
LB 5 HOH 88  5991 992  HOH HOH D . 
LB 5 HOH 89  5992 993  HOH HOH D . 
LB 5 HOH 90  5993 995  HOH HOH D . 
LB 5 HOH 91  5994 996  HOH HOH D . 
LB 5 HOH 92  5995 997  HOH HOH D . 
LB 5 HOH 93  5996 998  HOH HOH D . 
LB 5 HOH 94  5997 999  HOH HOH D . 
LB 5 HOH 95  5998 1000 HOH HOH D . 
LB 5 HOH 96  5999 1003 HOH HOH D . 
LB 5 HOH 97  6000 1004 HOH HOH D . 
LB 5 HOH 98  6001 1005 HOH HOH D . 
LB 5 HOH 99  6002 1006 HOH HOH D . 
LB 5 HOH 100 6003 1007 HOH HOH D . 
LB 5 HOH 101 6004 1008 HOH HOH D . 
LB 5 HOH 102 6005 1009 HOH HOH D . 
LB 5 HOH 103 6006 1010 HOH HOH D . 
LB 5 HOH 104 6007 1012 HOH HOH D . 
LB 5 HOH 105 6008 1013 HOH HOH D . 
LB 5 HOH 106 6009 1014 HOH HOH D . 
LB 5 HOH 107 6010 1015 HOH HOH D . 
LB 5 HOH 108 6011 1016 HOH HOH D . 
LB 5 HOH 109 6012 1017 HOH HOH D . 
LB 5 HOH 110 6013 1018 HOH HOH D . 
LB 5 HOH 111 6014 1019 HOH HOH D . 
LB 5 HOH 112 6015 1020 HOH HOH D . 
LB 5 HOH 113 6016 1022 HOH HOH D . 
LB 5 HOH 114 6017 1023 HOH HOH D . 
LB 5 HOH 115 6018 1024 HOH HOH D . 
LB 5 HOH 116 6019 1025 HOH HOH D . 
LB 5 HOH 117 6020 1026 HOH HOH D . 
LB 5 HOH 118 6021 1027 HOH HOH D . 
LB 5 HOH 119 6022 1028 HOH HOH D . 
LB 5 HOH 120 6023 1029 HOH HOH D . 
LB 5 HOH 121 6024 1030 HOH HOH D . 
LB 5 HOH 122 6025 1031 HOH HOH D . 
LB 5 HOH 123 6026 1032 HOH HOH D . 
LB 5 HOH 124 6027 1033 HOH HOH D . 
LB 5 HOH 125 6028 1034 HOH HOH D . 
LB 5 HOH 126 6029 1035 HOH HOH D . 
LB 5 HOH 127 6030 1036 HOH HOH D . 
LB 5 HOH 128 6031 1037 HOH HOH D . 
LB 5 HOH 129 6032 1038 HOH HOH D . 
LB 5 HOH 130 6033 1039 HOH HOH D . 
LB 5 HOH 131 6034 1040 HOH HOH D . 
LB 5 HOH 132 6035 1041 HOH HOH D . 
LB 5 HOH 133 6036 1042 HOH HOH D . 
LB 5 HOH 134 6037 1043 HOH HOH D . 
LB 5 HOH 135 6038 1044 HOH HOH D . 
LB 5 HOH 136 6039 1045 HOH HOH D . 
LB 5 HOH 137 6040 1047 HOH HOH D . 
LB 5 HOH 138 6041 1048 HOH HOH D . 
LB 5 HOH 139 6042 1049 HOH HOH D . 
LB 5 HOH 140 6043 1050 HOH HOH D . 
LB 5 HOH 141 6044 1051 HOH HOH D . 
LB 5 HOH 142 6045 1053 HOH HOH D . 
LB 5 HOH 143 6046 904  HOH HOH D . 
LB 5 HOH 144 6047 911  HOH HOH D . 
LB 5 HOH 145 6048 961  HOH HOH D . 
LB 5 HOH 146 6049 984  HOH HOH D . 
LB 5 HOH 147 6050 994  HOH HOH D . 
LB 5 HOH 148 6051 1001 HOH HOH D . 
LB 5 HOH 149 6052 1002 HOH HOH D . 
LB 5 HOH 150 6053 901  HOH HOH D . 
LB 5 HOH 151 6054 1011 HOH HOH D . 
LB 5 HOH 152 6055 1021 HOH HOH D . 
LB 5 HOH 153 6056 1046 HOH HOH D . 
MB 5 HOH 1   614  902  HOH HOH E . 
MB 5 HOH 2   615  903  HOH HOH E . 
MB 5 HOH 3   617  905  HOH HOH E . 
MB 5 HOH 4   618  906  HOH HOH E . 
MB 5 HOH 5   619  907  HOH HOH E . 
MB 5 HOH 6   620  908  HOH HOH E . 
MB 5 HOH 7   621  909  HOH HOH E . 
MB 5 HOH 8   622  910  HOH HOH E . 
MB 5 HOH 9   624  912  HOH HOH E . 
MB 5 HOH 10  625  913  HOH HOH E . 
MB 5 HOH 11  626  914  HOH HOH E . 
MB 5 HOH 12  627  915  HOH HOH E . 
MB 5 HOH 13  628  916  HOH HOH E . 
MB 5 HOH 14  629  917  HOH HOH E . 
MB 5 HOH 15  630  918  HOH HOH E . 
MB 5 HOH 16  631  919  HOH HOH E . 
MB 5 HOH 17  632  920  HOH HOH E . 
MB 5 HOH 18  633  921  HOH HOH E . 
MB 5 HOH 19  634  922  HOH HOH E . 
MB 5 HOH 20  635  923  HOH HOH E . 
MB 5 HOH 21  636  924  HOH HOH E . 
MB 5 HOH 22  637  925  HOH HOH E . 
MB 5 HOH 23  638  926  HOH HOH E . 
MB 5 HOH 24  639  927  HOH HOH E . 
MB 5 HOH 25  640  928  HOH HOH E . 
MB 5 HOH 26  641  929  HOH HOH E . 
MB 5 HOH 27  642  930  HOH HOH E . 
MB 5 HOH 28  643  931  HOH HOH E . 
MB 5 HOH 29  644  932  HOH HOH E . 
MB 5 HOH 30  645  933  HOH HOH E . 
MB 5 HOH 31  646  934  HOH HOH E . 
MB 5 HOH 32  647  935  HOH HOH E . 
MB 5 HOH 33  648  936  HOH HOH E . 
MB 5 HOH 34  649  937  HOH HOH E . 
MB 5 HOH 35  650  938  HOH HOH E . 
MB 5 HOH 36  651  939  HOH HOH E . 
MB 5 HOH 37  652  940  HOH HOH E . 
MB 5 HOH 38  653  941  HOH HOH E . 
MB 5 HOH 39  654  942  HOH HOH E . 
MB 5 HOH 40  655  943  HOH HOH E . 
MB 5 HOH 41  656  944  HOH HOH E . 
MB 5 HOH 42  657  945  HOH HOH E . 
MB 5 HOH 43  658  946  HOH HOH E . 
MB 5 HOH 44  659  947  HOH HOH E . 
MB 5 HOH 45  660  948  HOH HOH E . 
MB 5 HOH 46  661  949  HOH HOH E . 
MB 5 HOH 47  662  950  HOH HOH E . 
MB 5 HOH 48  663  951  HOH HOH E . 
MB 5 HOH 49  664  952  HOH HOH E . 
MB 5 HOH 50  665  953  HOH HOH E . 
MB 5 HOH 51  666  954  HOH HOH E . 
MB 5 HOH 52  667  955  HOH HOH E . 
MB 5 HOH 53  668  956  HOH HOH E . 
MB 5 HOH 54  669  957  HOH HOH E . 
MB 5 HOH 55  670  958  HOH HOH E . 
MB 5 HOH 56  671  959  HOH HOH E . 
MB 5 HOH 57  672  960  HOH HOH E . 
MB 5 HOH 58  674  962  HOH HOH E . 
MB 5 HOH 59  675  963  HOH HOH E . 
MB 5 HOH 60  676  964  HOH HOH E . 
MB 5 HOH 61  677  965  HOH HOH E . 
MB 5 HOH 62  678  966  HOH HOH E . 
MB 5 HOH 63  679  967  HOH HOH E . 
MB 5 HOH 64  680  968  HOH HOH E . 
MB 5 HOH 65  681  969  HOH HOH E . 
MB 5 HOH 66  682  970  HOH HOH E . 
MB 5 HOH 67  683  971  HOH HOH E . 
MB 5 HOH 68  684  972  HOH HOH E . 
MB 5 HOH 69  685  973  HOH HOH E . 
MB 5 HOH 70  686  974  HOH HOH E . 
MB 5 HOH 71  687  975  HOH HOH E . 
MB 5 HOH 72  688  976  HOH HOH E . 
MB 5 HOH 73  689  977  HOH HOH E . 
MB 5 HOH 74  690  978  HOH HOH E . 
MB 5 HOH 75  691  979  HOH HOH E . 
MB 5 HOH 76  692  980  HOH HOH E . 
MB 5 HOH 77  693  981  HOH HOH E . 
MB 5 HOH 78  694  982  HOH HOH E . 
MB 5 HOH 79  695  983  HOH HOH E . 
MB 5 HOH 80  697  985  HOH HOH E . 
MB 5 HOH 81  698  986  HOH HOH E . 
MB 5 HOH 82  699  987  HOH HOH E . 
MB 5 HOH 83  700  988  HOH HOH E . 
MB 5 HOH 84  701  989  HOH HOH E . 
MB 5 HOH 85  702  990  HOH HOH E . 
MB 5 HOH 86  703  991  HOH HOH E . 
MB 5 HOH 87  704  992  HOH HOH E . 
MB 5 HOH 88  705  993  HOH HOH E . 
MB 5 HOH 89  707  995  HOH HOH E . 
MB 5 HOH 90  708  996  HOH HOH E . 
MB 5 HOH 91  709  997  HOH HOH E . 
MB 5 HOH 92  710  998  HOH HOH E . 
MB 5 HOH 93  711  999  HOH HOH E . 
MB 5 HOH 94  712  1000 HOH HOH E . 
MB 5 HOH 95  715  1003 HOH HOH E . 
MB 5 HOH 96  716  1004 HOH HOH E . 
MB 5 HOH 97  717  1005 HOH HOH E . 
MB 5 HOH 98  718  1006 HOH HOH E . 
MB 5 HOH 99  719  1007 HOH HOH E . 
MB 5 HOH 100 720  1008 HOH HOH E . 
MB 5 HOH 101 721  1009 HOH HOH E . 
MB 5 HOH 102 722  1010 HOH HOH E . 
MB 5 HOH 103 724  1012 HOH HOH E . 
MB 5 HOH 104 725  1013 HOH HOH E . 
MB 5 HOH 105 726  1014 HOH HOH E . 
MB 5 HOH 106 727  1015 HOH HOH E . 
MB 5 HOH 107 728  1016 HOH HOH E . 
MB 5 HOH 108 729  1017 HOH HOH E . 
MB 5 HOH 109 730  1018 HOH HOH E . 
MB 5 HOH 110 731  1019 HOH HOH E . 
MB 5 HOH 111 732  1020 HOH HOH E . 
MB 5 HOH 112 734  1022 HOH HOH E . 
MB 5 HOH 113 735  1023 HOH HOH E . 
MB 5 HOH 114 736  1024 HOH HOH E . 
MB 5 HOH 115 737  1025 HOH HOH E . 
MB 5 HOH 116 738  1026 HOH HOH E . 
MB 5 HOH 117 739  1027 HOH HOH E . 
MB 5 HOH 118 740  1028 HOH HOH E . 
MB 5 HOH 119 741  1029 HOH HOH E . 
MB 5 HOH 120 742  1030 HOH HOH E . 
MB 5 HOH 121 743  1031 HOH HOH E . 
MB 5 HOH 122 744  1032 HOH HOH E . 
MB 5 HOH 123 745  1033 HOH HOH E . 
MB 5 HOH 124 746  1034 HOH HOH E . 
MB 5 HOH 125 747  1035 HOH HOH E . 
MB 5 HOH 126 748  1036 HOH HOH E . 
MB 5 HOH 127 749  1037 HOH HOH E . 
MB 5 HOH 128 750  1038 HOH HOH E . 
MB 5 HOH 129 751  1039 HOH HOH E . 
MB 5 HOH 130 752  1040 HOH HOH E . 
MB 5 HOH 131 753  1041 HOH HOH E . 
MB 5 HOH 132 754  1042 HOH HOH E . 
MB 5 HOH 133 755  1043 HOH HOH E . 
MB 5 HOH 134 756  1044 HOH HOH E . 
MB 5 HOH 135 757  1045 HOH HOH E . 
MB 5 HOH 136 759  1047 HOH HOH E . 
MB 5 HOH 137 760  1048 HOH HOH E . 
MB 5 HOH 138 761  1049 HOH HOH E . 
MB 5 HOH 139 762  1050 HOH HOH E . 
MB 5 HOH 140 763  1051 HOH HOH E . 
MB 5 HOH 141 764  1052 HOH HOH E . 
MB 5 HOH 142 765  1053 HOH HOH E . 
MB 5 HOH 143 769  904  HOH HOH E . 
MB 5 HOH 144 776  911  HOH HOH E . 
MB 5 HOH 145 791  926  HOH HOH E . 
MB 5 HOH 146 826  961  HOH HOH E . 
MB 5 HOH 147 849  984  HOH HOH E . 
MB 5 HOH 148 859  994  HOH HOH E . 
MB 5 HOH 149 866  1001 HOH HOH E . 
MB 5 HOH 150 867  1002 HOH HOH E . 
MB 5 HOH 151 1531 901  HOH HOH E . 
MB 5 HOH 152 1641 1011 HOH HOH E . 
MB 5 HOH 153 1651 1021 HOH HOH E . 
MB 5 HOH 154 1676 1046 HOH HOH E . 
NB 5 HOH 1   5906 904  HOH HOH F . 
NB 5 HOH 2   5907 961  HOH HOH F . 
NB 5 HOH 3   5908 984  HOH HOH F . 
NB 5 HOH 4   5909 994  HOH HOH F . 
NB 5 HOH 5   5910 1001 HOH HOH F . 
NB 5 HOH 6   5911 1002 HOH HOH F . 
NB 5 HOH 7   5912 1052 HOH HOH F . 
NB 5 HOH 8   5913 902  HOH HOH F . 
NB 5 HOH 9   5914 903  HOH HOH F . 
NB 5 HOH 10  5915 905  HOH HOH F . 
NB 5 HOH 11  5916 906  HOH HOH F . 
NB 5 HOH 12  5917 907  HOH HOH F . 
NB 5 HOH 13  5918 908  HOH HOH F . 
NB 5 HOH 14  5919 909  HOH HOH F . 
NB 5 HOH 15  5920 910  HOH HOH F . 
NB 5 HOH 16  5921 912  HOH HOH F . 
NB 5 HOH 17  5922 913  HOH HOH F . 
NB 5 HOH 18  5923 914  HOH HOH F . 
NB 5 HOH 19  5924 915  HOH HOH F . 
NB 5 HOH 20  5925 916  HOH HOH F . 
NB 5 HOH 21  5926 917  HOH HOH F . 
NB 5 HOH 22  5927 918  HOH HOH F . 
NB 5 HOH 23  5928 919  HOH HOH F . 
NB 5 HOH 24  5929 920  HOH HOH F . 
NB 5 HOH 25  5930 921  HOH HOH F . 
NB 5 HOH 26  5931 922  HOH HOH F . 
NB 5 HOH 27  5932 923  HOH HOH F . 
NB 5 HOH 28  5933 924  HOH HOH F . 
NB 5 HOH 29  5934 925  HOH HOH F . 
NB 5 HOH 30  5935 927  HOH HOH F . 
NB 5 HOH 31  5936 928  HOH HOH F . 
NB 5 HOH 32  5937 929  HOH HOH F . 
NB 5 HOH 33  5938 930  HOH HOH F . 
NB 5 HOH 34  5939 931  HOH HOH F . 
NB 5 HOH 35  5940 932  HOH HOH F . 
NB 5 HOH 36  5941 933  HOH HOH F . 
NB 5 HOH 37  5942 934  HOH HOH F . 
NB 5 HOH 38  5943 935  HOH HOH F . 
NB 5 HOH 39  5944 936  HOH HOH F . 
NB 5 HOH 40  5945 937  HOH HOH F . 
NB 5 HOH 41  5946 938  HOH HOH F . 
NB 5 HOH 42  5947 939  HOH HOH F . 
NB 5 HOH 43  5948 940  HOH HOH F . 
NB 5 HOH 44  5949 941  HOH HOH F . 
NB 5 HOH 45  5950 942  HOH HOH F . 
NB 5 HOH 46  5951 943  HOH HOH F . 
NB 5 HOH 47  5952 944  HOH HOH F . 
NB 5 HOH 48  5953 945  HOH HOH F . 
NB 5 HOH 49  5954 946  HOH HOH F . 
NB 5 HOH 50  5955 947  HOH HOH F . 
NB 5 HOH 51  5956 948  HOH HOH F . 
NB 5 HOH 52  5957 949  HOH HOH F . 
NB 5 HOH 53  5958 950  HOH HOH F . 
NB 5 HOH 54  5959 951  HOH HOH F . 
NB 5 HOH 55  5960 952  HOH HOH F . 
NB 5 HOH 56  5961 953  HOH HOH F . 
NB 5 HOH 57  5962 954  HOH HOH F . 
NB 5 HOH 58  5963 955  HOH HOH F . 
NB 5 HOH 59  5964 956  HOH HOH F . 
NB 5 HOH 60  5965 957  HOH HOH F . 
NB 5 HOH 61  5966 958  HOH HOH F . 
NB 5 HOH 62  5967 959  HOH HOH F . 
NB 5 HOH 63  5968 960  HOH HOH F . 
NB 5 HOH 64  5969 962  HOH HOH F . 
NB 5 HOH 65  5970 963  HOH HOH F . 
NB 5 HOH 66  5971 964  HOH HOH F . 
NB 5 HOH 67  5972 965  HOH HOH F . 
NB 5 HOH 68  5973 966  HOH HOH F . 
NB 5 HOH 69  5974 967  HOH HOH F . 
NB 5 HOH 70  5975 968  HOH HOH F . 
NB 5 HOH 71  5976 969  HOH HOH F . 
NB 5 HOH 72  5977 970  HOH HOH F . 
NB 5 HOH 73  5978 971  HOH HOH F . 
NB 5 HOH 74  5979 972  HOH HOH F . 
NB 5 HOH 75  5980 973  HOH HOH F . 
NB 5 HOH 76  5981 974  HOH HOH F . 
NB 5 HOH 77  5982 975  HOH HOH F . 
NB 5 HOH 78  5983 976  HOH HOH F . 
NB 5 HOH 79  5984 977  HOH HOH F . 
NB 5 HOH 80  5985 978  HOH HOH F . 
NB 5 HOH 81  5986 979  HOH HOH F . 
NB 5 HOH 82  5987 980  HOH HOH F . 
NB 5 HOH 83  5988 981  HOH HOH F . 
NB 5 HOH 84  5989 982  HOH HOH F . 
NB 5 HOH 85  5990 983  HOH HOH F . 
NB 5 HOH 86  5991 985  HOH HOH F . 
NB 5 HOH 87  5992 986  HOH HOH F . 
NB 5 HOH 88  5993 987  HOH HOH F . 
NB 5 HOH 89  5994 988  HOH HOH F . 
NB 5 HOH 90  5995 989  HOH HOH F . 
NB 5 HOH 91  5996 990  HOH HOH F . 
NB 5 HOH 92  5997 991  HOH HOH F . 
NB 5 HOH 93  5998 992  HOH HOH F . 
NB 5 HOH 94  5999 993  HOH HOH F . 
NB 5 HOH 95  6000 995  HOH HOH F . 
NB 5 HOH 96  6001 996  HOH HOH F . 
NB 5 HOH 97  6002 997  HOH HOH F . 
NB 5 HOH 98  6003 998  HOH HOH F . 
NB 5 HOH 99  6004 999  HOH HOH F . 
NB 5 HOH 100 6005 1000 HOH HOH F . 
NB 5 HOH 101 6006 1003 HOH HOH F . 
NB 5 HOH 102 6007 1004 HOH HOH F . 
NB 5 HOH 103 6008 1005 HOH HOH F . 
NB 5 HOH 104 6009 1006 HOH HOH F . 
NB 5 HOH 105 6010 1007 HOH HOH F . 
NB 5 HOH 106 6011 1008 HOH HOH F . 
NB 5 HOH 107 6012 1009 HOH HOH F . 
NB 5 HOH 108 6013 1010 HOH HOH F . 
NB 5 HOH 109 6014 1012 HOH HOH F . 
NB 5 HOH 110 6015 1013 HOH HOH F . 
NB 5 HOH 111 6016 1014 HOH HOH F . 
NB 5 HOH 112 6017 1015 HOH HOH F . 
NB 5 HOH 113 6018 1016 HOH HOH F . 
NB 5 HOH 114 6019 1017 HOH HOH F . 
NB 5 HOH 115 6020 1018 HOH HOH F . 
NB 5 HOH 116 6021 1019 HOH HOH F . 
NB 5 HOH 117 6022 1020 HOH HOH F . 
NB 5 HOH 118 6023 1022 HOH HOH F . 
NB 5 HOH 119 6024 1023 HOH HOH F . 
NB 5 HOH 120 6025 1024 HOH HOH F . 
NB 5 HOH 121 6026 1025 HOH HOH F . 
NB 5 HOH 122 6027 1026 HOH HOH F . 
NB 5 HOH 123 6028 1027 HOH HOH F . 
NB 5 HOH 124 6029 1028 HOH HOH F . 
NB 5 HOH 125 6030 1029 HOH HOH F . 
NB 5 HOH 126 6031 1030 HOH HOH F . 
NB 5 HOH 127 6032 1031 HOH HOH F . 
NB 5 HOH 128 6033 1032 HOH HOH F . 
NB 5 HOH 129 6034 1033 HOH HOH F . 
NB 5 HOH 130 6035 1034 HOH HOH F . 
NB 5 HOH 131 6036 1035 HOH HOH F . 
NB 5 HOH 132 6037 1036 HOH HOH F . 
NB 5 HOH 133 6038 1037 HOH HOH F . 
NB 5 HOH 134 6039 1038 HOH HOH F . 
NB 5 HOH 135 6040 1039 HOH HOH F . 
NB 5 HOH 136 6041 1040 HOH HOH F . 
NB 5 HOH 137 6042 1041 HOH HOH F . 
NB 5 HOH 138 6043 1042 HOH HOH F . 
NB 5 HOH 139 6044 1043 HOH HOH F . 
NB 5 HOH 140 6045 1044 HOH HOH F . 
NB 5 HOH 141 6046 1045 HOH HOH F . 
NB 5 HOH 142 6047 1047 HOH HOH F . 
NB 5 HOH 143 6048 1048 HOH HOH F . 
NB 5 HOH 144 6049 1049 HOH HOH F . 
NB 5 HOH 145 6050 1050 HOH HOH F . 
NB 5 HOH 146 6051 1051 HOH HOH F . 
NB 5 HOH 147 6052 1052 HOH HOH F . 
NB 5 HOH 148 6053 1053 HOH HOH F . 
NB 5 HOH 149 6054 901  HOH HOH F . 
NB 5 HOH 150 6055 1011 HOH HOH F . 
NB 5 HOH 151 6056 1021 HOH HOH F . 
NB 5 HOH 152 6057 1046 HOH HOH F . 
OB 5 HOH 1   5907 901  HOH HOH G . 
OB 5 HOH 2   5908 1011 HOH HOH G . 
OB 5 HOH 3   5909 1021 HOH HOH G . 
OB 5 HOH 4   5910 1046 HOH HOH G . 
OB 5 HOH 5   5911 902  HOH HOH G . 
OB 5 HOH 6   5912 903  HOH HOH G . 
OB 5 HOH 7   5913 905  HOH HOH G . 
OB 5 HOH 8   5914 906  HOH HOH G . 
OB 5 HOH 9   5915 907  HOH HOH G . 
OB 5 HOH 10  5916 908  HOH HOH G . 
OB 5 HOH 11  5917 909  HOH HOH G . 
OB 5 HOH 12  5918 910  HOH HOH G . 
OB 5 HOH 13  5919 911  HOH HOH G . 
OB 5 HOH 14  5920 912  HOH HOH G . 
OB 5 HOH 15  5921 913  HOH HOH G . 
OB 5 HOH 16  5922 914  HOH HOH G . 
OB 5 HOH 17  5923 915  HOH HOH G . 
OB 5 HOH 18  5924 916  HOH HOH G . 
OB 5 HOH 19  5925 917  HOH HOH G . 
OB 5 HOH 20  5926 918  HOH HOH G . 
OB 5 HOH 21  5927 919  HOH HOH G . 
OB 5 HOH 22  5928 920  HOH HOH G . 
OB 5 HOH 23  5929 921  HOH HOH G . 
OB 5 HOH 24  5930 922  HOH HOH G . 
OB 5 HOH 25  5931 923  HOH HOH G . 
OB 5 HOH 26  5932 924  HOH HOH G . 
OB 5 HOH 27  5933 925  HOH HOH G . 
OB 5 HOH 28  5934 926  HOH HOH G . 
OB 5 HOH 29  5935 927  HOH HOH G . 
OB 5 HOH 30  5936 928  HOH HOH G . 
OB 5 HOH 31  5937 929  HOH HOH G . 
OB 5 HOH 32  5938 930  HOH HOH G . 
OB 5 HOH 33  5939 931  HOH HOH G . 
OB 5 HOH 34  5940 932  HOH HOH G . 
OB 5 HOH 35  5941 933  HOH HOH G . 
OB 5 HOH 36  5942 934  HOH HOH G . 
OB 5 HOH 37  5943 935  HOH HOH G . 
OB 5 HOH 38  5944 936  HOH HOH G . 
OB 5 HOH 39  5945 937  HOH HOH G . 
OB 5 HOH 40  5946 938  HOH HOH G . 
OB 5 HOH 41  5947 939  HOH HOH G . 
OB 5 HOH 42  5948 940  HOH HOH G . 
OB 5 HOH 43  5949 941  HOH HOH G . 
OB 5 HOH 44  5950 942  HOH HOH G . 
OB 5 HOH 45  5951 943  HOH HOH G . 
OB 5 HOH 46  5952 944  HOH HOH G . 
OB 5 HOH 47  5953 945  HOH HOH G . 
OB 5 HOH 48  5954 946  HOH HOH G . 
OB 5 HOH 49  5955 947  HOH HOH G . 
OB 5 HOH 50  5956 948  HOH HOH G . 
OB 5 HOH 51  5957 949  HOH HOH G . 
OB 5 HOH 52  5958 950  HOH HOH G . 
OB 5 HOH 53  5959 951  HOH HOH G . 
OB 5 HOH 54  5960 952  HOH HOH G . 
OB 5 HOH 55  5961 953  HOH HOH G . 
OB 5 HOH 56  5962 954  HOH HOH G . 
OB 5 HOH 57  5963 955  HOH HOH G . 
OB 5 HOH 58  5964 956  HOH HOH G . 
OB 5 HOH 59  5965 957  HOH HOH G . 
OB 5 HOH 60  5966 958  HOH HOH G . 
OB 5 HOH 61  5967 959  HOH HOH G . 
OB 5 HOH 62  5968 960  HOH HOH G . 
OB 5 HOH 63  5969 962  HOH HOH G . 
OB 5 HOH 64  5970 963  HOH HOH G . 
OB 5 HOH 65  5971 964  HOH HOH G . 
OB 5 HOH 66  5972 965  HOH HOH G . 
OB 5 HOH 67  5973 966  HOH HOH G . 
OB 5 HOH 68  5974 967  HOH HOH G . 
OB 5 HOH 69  5975 968  HOH HOH G . 
OB 5 HOH 70  5976 969  HOH HOH G . 
OB 5 HOH 71  5977 970  HOH HOH G . 
OB 5 HOH 72  5978 971  HOH HOH G . 
OB 5 HOH 73  5979 972  HOH HOH G . 
OB 5 HOH 74  5980 973  HOH HOH G . 
OB 5 HOH 75  5981 974  HOH HOH G . 
OB 5 HOH 76  5982 975  HOH HOH G . 
OB 5 HOH 77  5983 976  HOH HOH G . 
OB 5 HOH 78  5984 977  HOH HOH G . 
OB 5 HOH 79  5985 978  HOH HOH G . 
OB 5 HOH 80  5986 979  HOH HOH G . 
OB 5 HOH 81  5987 980  HOH HOH G . 
OB 5 HOH 82  5988 981  HOH HOH G . 
OB 5 HOH 83  5989 982  HOH HOH G . 
OB 5 HOH 84  5990 983  HOH HOH G . 
OB 5 HOH 85  5991 985  HOH HOH G . 
OB 5 HOH 86  5992 986  HOH HOH G . 
OB 5 HOH 87  5993 987  HOH HOH G . 
OB 5 HOH 88  5994 988  HOH HOH G . 
OB 5 HOH 89  5995 989  HOH HOH G . 
OB 5 HOH 90  5996 990  HOH HOH G . 
OB 5 HOH 91  5997 991  HOH HOH G . 
OB 5 HOH 92  5998 992  HOH HOH G . 
OB 5 HOH 93  5999 993  HOH HOH G . 
OB 5 HOH 94  6000 995  HOH HOH G . 
OB 5 HOH 95  6001 996  HOH HOH G . 
OB 5 HOH 96  6002 997  HOH HOH G . 
OB 5 HOH 97  6003 998  HOH HOH G . 
OB 5 HOH 98  6004 999  HOH HOH G . 
OB 5 HOH 99  6005 1000 HOH HOH G . 
OB 5 HOH 100 6006 1003 HOH HOH G . 
OB 5 HOH 101 6007 1004 HOH HOH G . 
OB 5 HOH 102 6008 1005 HOH HOH G . 
OB 5 HOH 103 6009 1006 HOH HOH G . 
OB 5 HOH 104 6010 1007 HOH HOH G . 
OB 5 HOH 105 6011 1008 HOH HOH G . 
OB 5 HOH 106 6012 1009 HOH HOH G . 
OB 5 HOH 107 6013 1010 HOH HOH G . 
OB 5 HOH 108 6014 1012 HOH HOH G . 
OB 5 HOH 109 6015 1013 HOH HOH G . 
OB 5 HOH 110 6016 1014 HOH HOH G . 
OB 5 HOH 111 6017 1015 HOH HOH G . 
OB 5 HOH 112 6018 1016 HOH HOH G . 
OB 5 HOH 113 6019 1017 HOH HOH G . 
OB 5 HOH 114 6020 1018 HOH HOH G . 
OB 5 HOH 115 6021 1019 HOH HOH G . 
OB 5 HOH 116 6022 1020 HOH HOH G . 
OB 5 HOH 117 6023 1022 HOH HOH G . 
OB 5 HOH 118 6024 1023 HOH HOH G . 
OB 5 HOH 119 6025 1024 HOH HOH G . 
OB 5 HOH 120 6026 1025 HOH HOH G . 
OB 5 HOH 121 6027 1026 HOH HOH G . 
OB 5 HOH 122 6028 1027 HOH HOH G . 
OB 5 HOH 123 6029 1028 HOH HOH G . 
OB 5 HOH 124 6030 1029 HOH HOH G . 
OB 5 HOH 125 6031 1030 HOH HOH G . 
OB 5 HOH 126 6032 1031 HOH HOH G . 
OB 5 HOH 127 6033 1032 HOH HOH G . 
OB 5 HOH 128 6034 1033 HOH HOH G . 
OB 5 HOH 129 6035 1034 HOH HOH G . 
OB 5 HOH 130 6036 1035 HOH HOH G . 
OB 5 HOH 131 6037 1036 HOH HOH G . 
OB 5 HOH 132 6038 1037 HOH HOH G . 
OB 5 HOH 133 6039 1038 HOH HOH G . 
OB 5 HOH 134 6040 1039 HOH HOH G . 
OB 5 HOH 135 6041 1040 HOH HOH G . 
OB 5 HOH 136 6042 1041 HOH HOH G . 
OB 5 HOH 137 6043 1042 HOH HOH G . 
OB 5 HOH 138 6044 1043 HOH HOH G . 
OB 5 HOH 139 6045 1044 HOH HOH G . 
OB 5 HOH 140 6046 1045 HOH HOH G . 
OB 5 HOH 141 6047 1047 HOH HOH G . 
OB 5 HOH 142 6048 1048 HOH HOH G . 
OB 5 HOH 143 6049 1049 HOH HOH G . 
OB 5 HOH 144 6050 1050 HOH HOH G . 
OB 5 HOH 145 6051 1051 HOH HOH G . 
OB 5 HOH 146 6052 1052 HOH HOH G . 
OB 5 HOH 147 6053 1053 HOH HOH G . 
OB 5 HOH 148 6054 904  HOH HOH G . 
OB 5 HOH 149 6055 911  HOH HOH G . 
OB 5 HOH 150 6056 926  HOH HOH G . 
OB 5 HOH 151 6057 961  HOH HOH G . 
OB 5 HOH 152 6058 984  HOH HOH G . 
OB 5 HOH 153 6059 994  HOH HOH G . 
OB 5 HOH 154 6060 1001 HOH HOH G . 
OB 5 HOH 155 6061 1002 HOH HOH G . 
PB 5 HOH 1   5908 901  HOH HOH H . 
PB 5 HOH 2   5909 1011 HOH HOH H . 
PB 5 HOH 3   5910 1021 HOH HOH H . 
PB 5 HOH 4   5911 1046 HOH HOH H . 
PB 5 HOH 5   5912 904  HOH HOH H . 
PB 5 HOH 6   5913 961  HOH HOH H . 
PB 5 HOH 7   5914 984  HOH HOH H . 
PB 5 HOH 8   5915 994  HOH HOH H . 
PB 5 HOH 9   5916 1001 HOH HOH H . 
PB 5 HOH 10  5917 1002 HOH HOH H . 
PB 5 HOH 11  5918 902  HOH HOH H . 
PB 5 HOH 12  5919 903  HOH HOH H . 
PB 5 HOH 13  5920 905  HOH HOH H . 
PB 5 HOH 14  5921 906  HOH HOH H . 
PB 5 HOH 15  5922 907  HOH HOH H . 
PB 5 HOH 16  5923 908  HOH HOH H . 
PB 5 HOH 17  5924 909  HOH HOH H . 
PB 5 HOH 18  5925 910  HOH HOH H . 
PB 5 HOH 19  5926 912  HOH HOH H . 
PB 5 HOH 20  5927 913  HOH HOH H . 
PB 5 HOH 21  5928 914  HOH HOH H . 
PB 5 HOH 22  5929 915  HOH HOH H . 
PB 5 HOH 23  5930 916  HOH HOH H . 
PB 5 HOH 24  5931 917  HOH HOH H . 
PB 5 HOH 25  5932 918  HOH HOH H . 
PB 5 HOH 26  5933 919  HOH HOH H . 
PB 5 HOH 27  5934 920  HOH HOH H . 
PB 5 HOH 28  5935 921  HOH HOH H . 
PB 5 HOH 29  5936 922  HOH HOH H . 
PB 5 HOH 30  5937 923  HOH HOH H . 
PB 5 HOH 31  5938 924  HOH HOH H . 
PB 5 HOH 32  5939 925  HOH HOH H . 
PB 5 HOH 33  5940 927  HOH HOH H . 
PB 5 HOH 34  5941 928  HOH HOH H . 
PB 5 HOH 35  5942 929  HOH HOH H . 
PB 5 HOH 36  5943 930  HOH HOH H . 
PB 5 HOH 37  5944 931  HOH HOH H . 
PB 5 HOH 38  5945 932  HOH HOH H . 
PB 5 HOH 39  5946 933  HOH HOH H . 
PB 5 HOH 40  5947 934  HOH HOH H . 
PB 5 HOH 41  5948 935  HOH HOH H . 
PB 5 HOH 42  5949 936  HOH HOH H . 
PB 5 HOH 43  5950 937  HOH HOH H . 
PB 5 HOH 44  5951 938  HOH HOH H . 
PB 5 HOH 45  5952 939  HOH HOH H . 
PB 5 HOH 46  5953 940  HOH HOH H . 
PB 5 HOH 47  5954 941  HOH HOH H . 
PB 5 HOH 48  5955 942  HOH HOH H . 
PB 5 HOH 49  5956 943  HOH HOH H . 
PB 5 HOH 50  5957 944  HOH HOH H . 
PB 5 HOH 51  5958 945  HOH HOH H . 
PB 5 HOH 52  5959 946  HOH HOH H . 
PB 5 HOH 53  5960 947  HOH HOH H . 
PB 5 HOH 54  5961 948  HOH HOH H . 
PB 5 HOH 55  5962 949  HOH HOH H . 
PB 5 HOH 56  5963 951  HOH HOH H . 
PB 5 HOH 57  5964 952  HOH HOH H . 
PB 5 HOH 58  5965 953  HOH HOH H . 
PB 5 HOH 59  5966 954  HOH HOH H . 
PB 5 HOH 60  5967 955  HOH HOH H . 
PB 5 HOH 61  5968 956  HOH HOH H . 
PB 5 HOH 62  5969 957  HOH HOH H . 
PB 5 HOH 63  5970 958  HOH HOH H . 
PB 5 HOH 64  5971 959  HOH HOH H . 
PB 5 HOH 65  5972 960  HOH HOH H . 
PB 5 HOH 66  5973 962  HOH HOH H . 
PB 5 HOH 67  5974 963  HOH HOH H . 
PB 5 HOH 68  5975 964  HOH HOH H . 
PB 5 HOH 69  5976 965  HOH HOH H . 
PB 5 HOH 70  5977 966  HOH HOH H . 
PB 5 HOH 71  5978 967  HOH HOH H . 
PB 5 HOH 72  5979 968  HOH HOH H . 
PB 5 HOH 73  5980 969  HOH HOH H . 
PB 5 HOH 74  5981 970  HOH HOH H . 
PB 5 HOH 75  5982 971  HOH HOH H . 
PB 5 HOH 76  5983 972  HOH HOH H . 
PB 5 HOH 77  5984 973  HOH HOH H . 
PB 5 HOH 78  5985 974  HOH HOH H . 
PB 5 HOH 79  5986 975  HOH HOH H . 
PB 5 HOH 80  5987 976  HOH HOH H . 
PB 5 HOH 81  5988 977  HOH HOH H . 
PB 5 HOH 82  5989 978  HOH HOH H . 
PB 5 HOH 83  5990 979  HOH HOH H . 
PB 5 HOH 84  5991 980  HOH HOH H . 
PB 5 HOH 85  5992 981  HOH HOH H . 
PB 5 HOH 86  5993 982  HOH HOH H . 
PB 5 HOH 87  5994 983  HOH HOH H . 
PB 5 HOH 88  5995 985  HOH HOH H . 
PB 5 HOH 89  5996 986  HOH HOH H . 
PB 5 HOH 90  5997 987  HOH HOH H . 
PB 5 HOH 91  5998 988  HOH HOH H . 
PB 5 HOH 92  5999 989  HOH HOH H . 
PB 5 HOH 93  6000 990  HOH HOH H . 
PB 5 HOH 94  6001 991  HOH HOH H . 
PB 5 HOH 95  6002 992  HOH HOH H . 
PB 5 HOH 96  6003 993  HOH HOH H . 
PB 5 HOH 97  6004 995  HOH HOH H . 
PB 5 HOH 98  6005 996  HOH HOH H . 
PB 5 HOH 99  6006 997  HOH HOH H . 
PB 5 HOH 100 6007 998  HOH HOH H . 
PB 5 HOH 101 6008 999  HOH HOH H . 
PB 5 HOH 102 6009 1000 HOH HOH H . 
PB 5 HOH 103 6010 1003 HOH HOH H . 
PB 5 HOH 104 6011 1004 HOH HOH H . 
PB 5 HOH 105 6012 1005 HOH HOH H . 
PB 5 HOH 106 6013 1006 HOH HOH H . 
PB 5 HOH 107 6014 1007 HOH HOH H . 
PB 5 HOH 108 6015 1008 HOH HOH H . 
PB 5 HOH 109 6016 1009 HOH HOH H . 
PB 5 HOH 110 6017 1010 HOH HOH H . 
PB 5 HOH 111 6018 1012 HOH HOH H . 
PB 5 HOH 112 6019 1013 HOH HOH H . 
PB 5 HOH 113 6020 1014 HOH HOH H . 
PB 5 HOH 114 6021 1015 HOH HOH H . 
PB 5 HOH 115 6022 1016 HOH HOH H . 
PB 5 HOH 116 6023 1017 HOH HOH H . 
PB 5 HOH 117 6024 1018 HOH HOH H . 
PB 5 HOH 118 6025 1019 HOH HOH H . 
PB 5 HOH 119 6026 1020 HOH HOH H . 
PB 5 HOH 120 6027 1022 HOH HOH H . 
PB 5 HOH 121 6028 1023 HOH HOH H . 
PB 5 HOH 122 6029 1024 HOH HOH H . 
PB 5 HOH 123 6030 1025 HOH HOH H . 
PB 5 HOH 124 6031 1026 HOH HOH H . 
PB 5 HOH 125 6032 1027 HOH HOH H . 
PB 5 HOH 126 6033 1028 HOH HOH H . 
PB 5 HOH 127 6034 1029 HOH HOH H . 
PB 5 HOH 128 6035 1030 HOH HOH H . 
PB 5 HOH 129 6036 1031 HOH HOH H . 
PB 5 HOH 130 6037 1032 HOH HOH H . 
PB 5 HOH 131 6038 1033 HOH HOH H . 
PB 5 HOH 132 6039 1034 HOH HOH H . 
PB 5 HOH 133 6040 1035 HOH HOH H . 
PB 5 HOH 134 6041 1036 HOH HOH H . 
PB 5 HOH 135 6042 1037 HOH HOH H . 
PB 5 HOH 136 6043 1038 HOH HOH H . 
PB 5 HOH 137 6044 1039 HOH HOH H . 
PB 5 HOH 138 6045 1040 HOH HOH H . 
PB 5 HOH 139 6046 1041 HOH HOH H . 
PB 5 HOH 140 6047 1042 HOH HOH H . 
PB 5 HOH 141 6048 1043 HOH HOH H . 
PB 5 HOH 142 6049 1044 HOH HOH H . 
PB 5 HOH 143 6050 1045 HOH HOH H . 
PB 5 HOH 144 6051 1047 HOH HOH H . 
PB 5 HOH 145 6052 1048 HOH HOH H . 
PB 5 HOH 146 6053 1049 HOH HOH H . 
PB 5 HOH 147 6054 1050 HOH HOH H . 
PB 5 HOH 148 6055 1051 HOH HOH H . 
PB 5 HOH 149 6056 1052 HOH HOH H . 
PB 5 HOH 150 6057 1053 HOH HOH H . 
QB 5 HOH 1   5909 901  HOH HOH I . 
QB 5 HOH 2   5910 1011 HOH HOH I . 
QB 5 HOH 3   5911 1021 HOH HOH I . 
QB 5 HOH 4   5912 1046 HOH HOH I . 
QB 5 HOH 5   5913 904  HOH HOH I . 
QB 5 HOH 6   5914 911  HOH HOH I . 
QB 5 HOH 7   5915 926  HOH HOH I . 
QB 5 HOH 8   5916 950  HOH HOH I . 
QB 5 HOH 9   5917 961  HOH HOH I . 
QB 5 HOH 10  5918 984  HOH HOH I . 
QB 5 HOH 11  5919 994  HOH HOH I . 
QB 5 HOH 12  5920 1001 HOH HOH I . 
QB 5 HOH 13  5921 1002 HOH HOH I . 
QB 5 HOH 14  5922 902  HOH HOH I . 
QB 5 HOH 15  5923 903  HOH HOH I . 
QB 5 HOH 16  5924 905  HOH HOH I . 
QB 5 HOH 17  5925 906  HOH HOH I . 
QB 5 HOH 18  5926 907  HOH HOH I . 
QB 5 HOH 19  5927 908  HOH HOH I . 
QB 5 HOH 20  5928 909  HOH HOH I . 
QB 5 HOH 21  5929 910  HOH HOH I . 
QB 5 HOH 22  5930 911  HOH HOH I . 
QB 5 HOH 23  5931 912  HOH HOH I . 
QB 5 HOH 24  5932 913  HOH HOH I . 
QB 5 HOH 25  5933 914  HOH HOH I . 
QB 5 HOH 26  5934 915  HOH HOH I . 
QB 5 HOH 27  5935 916  HOH HOH I . 
QB 5 HOH 28  5936 917  HOH HOH I . 
QB 5 HOH 29  5937 918  HOH HOH I . 
QB 5 HOH 30  5938 919  HOH HOH I . 
QB 5 HOH 31  5939 920  HOH HOH I . 
QB 5 HOH 32  5940 921  HOH HOH I . 
QB 5 HOH 33  5941 922  HOH HOH I . 
QB 5 HOH 34  5942 923  HOH HOH I . 
QB 5 HOH 35  5943 924  HOH HOH I . 
QB 5 HOH 36  5944 925  HOH HOH I . 
QB 5 HOH 37  5945 926  HOH HOH I . 
QB 5 HOH 38  5946 927  HOH HOH I . 
QB 5 HOH 39  5947 928  HOH HOH I . 
QB 5 HOH 40  5948 929  HOH HOH I . 
QB 5 HOH 41  5949 930  HOH HOH I . 
QB 5 HOH 42  5950 931  HOH HOH I . 
QB 5 HOH 43  5951 932  HOH HOH I . 
QB 5 HOH 44  5952 933  HOH HOH I . 
QB 5 HOH 45  5953 934  HOH HOH I . 
QB 5 HOH 46  5954 935  HOH HOH I . 
QB 5 HOH 47  5955 936  HOH HOH I . 
QB 5 HOH 48  5956 937  HOH HOH I . 
QB 5 HOH 49  5957 938  HOH HOH I . 
QB 5 HOH 50  5958 939  HOH HOH I . 
QB 5 HOH 51  5959 940  HOH HOH I . 
QB 5 HOH 52  5960 941  HOH HOH I . 
QB 5 HOH 53  5961 942  HOH HOH I . 
QB 5 HOH 54  5962 943  HOH HOH I . 
QB 5 HOH 55  5963 944  HOH HOH I . 
QB 5 HOH 56  5964 945  HOH HOH I . 
QB 5 HOH 57  5965 946  HOH HOH I . 
QB 5 HOH 58  5966 947  HOH HOH I . 
QB 5 HOH 59  5967 948  HOH HOH I . 
QB 5 HOH 60  5968 949  HOH HOH I . 
QB 5 HOH 61  5969 950  HOH HOH I . 
QB 5 HOH 62  5970 951  HOH HOH I . 
QB 5 HOH 63  5971 952  HOH HOH I . 
QB 5 HOH 64  5972 953  HOH HOH I . 
QB 5 HOH 65  5973 954  HOH HOH I . 
QB 5 HOH 66  5974 955  HOH HOH I . 
QB 5 HOH 67  5975 956  HOH HOH I . 
QB 5 HOH 68  5976 957  HOH HOH I . 
QB 5 HOH 69  5977 958  HOH HOH I . 
QB 5 HOH 70  5978 959  HOH HOH I . 
QB 5 HOH 71  5979 960  HOH HOH I . 
QB 5 HOH 72  5980 962  HOH HOH I . 
QB 5 HOH 73  5981 963  HOH HOH I . 
QB 5 HOH 74  5982 964  HOH HOH I . 
QB 5 HOH 75  5983 965  HOH HOH I . 
QB 5 HOH 76  5984 966  HOH HOH I . 
QB 5 HOH 77  5985 967  HOH HOH I . 
QB 5 HOH 78  5986 968  HOH HOH I . 
QB 5 HOH 79  5987 969  HOH HOH I . 
QB 5 HOH 80  5988 970  HOH HOH I . 
QB 5 HOH 81  5989 971  HOH HOH I . 
QB 5 HOH 82  5990 972  HOH HOH I . 
QB 5 HOH 83  5991 973  HOH HOH I . 
QB 5 HOH 84  5992 974  HOH HOH I . 
QB 5 HOH 85  5993 975  HOH HOH I . 
QB 5 HOH 86  5994 976  HOH HOH I . 
QB 5 HOH 87  5995 977  HOH HOH I . 
QB 5 HOH 88  5996 978  HOH HOH I . 
QB 5 HOH 89  5997 979  HOH HOH I . 
QB 5 HOH 90  5998 980  HOH HOH I . 
QB 5 HOH 91  5999 981  HOH HOH I . 
QB 5 HOH 92  6000 982  HOH HOH I . 
QB 5 HOH 93  6001 983  HOH HOH I . 
QB 5 HOH 94  6002 985  HOH HOH I . 
QB 5 HOH 95  6003 986  HOH HOH I . 
QB 5 HOH 96  6004 987  HOH HOH I . 
QB 5 HOH 97  6005 988  HOH HOH I . 
QB 5 HOH 98  6006 989  HOH HOH I . 
QB 5 HOH 99  6007 990  HOH HOH I . 
QB 5 HOH 100 6008 991  HOH HOH I . 
QB 5 HOH 101 6009 992  HOH HOH I . 
QB 5 HOH 102 6010 993  HOH HOH I . 
QB 5 HOH 103 6011 995  HOH HOH I . 
QB 5 HOH 104 6012 996  HOH HOH I . 
QB 5 HOH 105 6013 997  HOH HOH I . 
QB 5 HOH 106 6014 998  HOH HOH I . 
QB 5 HOH 107 6015 999  HOH HOH I . 
QB 5 HOH 108 6016 1000 HOH HOH I . 
QB 5 HOH 109 6017 1003 HOH HOH I . 
QB 5 HOH 110 6018 1004 HOH HOH I . 
QB 5 HOH 111 6019 1005 HOH HOH I . 
QB 5 HOH 112 6020 1006 HOH HOH I . 
QB 5 HOH 113 6021 1007 HOH HOH I . 
QB 5 HOH 114 6022 1008 HOH HOH I . 
QB 5 HOH 115 6023 1009 HOH HOH I . 
QB 5 HOH 116 6024 1010 HOH HOH I . 
QB 5 HOH 117 6025 1012 HOH HOH I . 
QB 5 HOH 118 6026 1013 HOH HOH I . 
QB 5 HOH 119 6027 1014 HOH HOH I . 
QB 5 HOH 120 6028 1015 HOH HOH I . 
QB 5 HOH 121 6029 1016 HOH HOH I . 
QB 5 HOH 122 6030 1017 HOH HOH I . 
QB 5 HOH 123 6031 1018 HOH HOH I . 
QB 5 HOH 124 6032 1019 HOH HOH I . 
QB 5 HOH 125 6033 1020 HOH HOH I . 
QB 5 HOH 126 6034 1022 HOH HOH I . 
QB 5 HOH 127 6035 1023 HOH HOH I . 
QB 5 HOH 128 6036 1024 HOH HOH I . 
QB 5 HOH 129 6037 1025 HOH HOH I . 
QB 5 HOH 130 6038 1026 HOH HOH I . 
QB 5 HOH 131 6039 1027 HOH HOH I . 
QB 5 HOH 132 6040 1028 HOH HOH I . 
QB 5 HOH 133 6041 1029 HOH HOH I . 
QB 5 HOH 134 6042 1030 HOH HOH I . 
QB 5 HOH 135 6043 1031 HOH HOH I . 
QB 5 HOH 136 6044 1032 HOH HOH I . 
QB 5 HOH 137 6045 1033 HOH HOH I . 
QB 5 HOH 138 6046 1034 HOH HOH I . 
QB 5 HOH 139 6047 1035 HOH HOH I . 
QB 5 HOH 140 6048 1036 HOH HOH I . 
QB 5 HOH 141 6049 1037 HOH HOH I . 
QB 5 HOH 142 6050 1038 HOH HOH I . 
QB 5 HOH 143 6051 1039 HOH HOH I . 
QB 5 HOH 144 6052 1040 HOH HOH I . 
QB 5 HOH 145 6053 1041 HOH HOH I . 
QB 5 HOH 146 6054 1042 HOH HOH I . 
QB 5 HOH 147 6055 1043 HOH HOH I . 
QB 5 HOH 148 6056 1044 HOH HOH I . 
QB 5 HOH 149 6057 1045 HOH HOH I . 
QB 5 HOH 150 6058 1047 HOH HOH I . 
QB 5 HOH 151 6059 1048 HOH HOH I . 
QB 5 HOH 152 6060 1049 HOH HOH I . 
QB 5 HOH 153 6061 1050 HOH HOH I . 
QB 5 HOH 154 6062 1051 HOH HOH I . 
QB 5 HOH 155 6063 1052 HOH HOH I . 
QB 5 HOH 156 6064 1053 HOH HOH I . 
RB 5 HOH 1   5910 901  HOH HOH J . 
RB 5 HOH 2   5911 1011 HOH HOH J . 
RB 5 HOH 3   5912 1021 HOH HOH J . 
RB 5 HOH 4   5913 1046 HOH HOH J . 
RB 5 HOH 5   5914 904  HOH HOH J . 
RB 5 HOH 6   5915 961  HOH HOH J . 
RB 5 HOH 7   5916 984  HOH HOH J . 
RB 5 HOH 8   5917 994  HOH HOH J . 
RB 5 HOH 9   5918 1001 HOH HOH J . 
RB 5 HOH 10  5919 1002 HOH HOH J . 
RB 5 HOH 11  5920 902  HOH HOH J . 
RB 5 HOH 12  5921 903  HOH HOH J . 
RB 5 HOH 13  5922 905  HOH HOH J . 
RB 5 HOH 14  5923 906  HOH HOH J . 
RB 5 HOH 15  5924 907  HOH HOH J . 
RB 5 HOH 16  5925 908  HOH HOH J . 
RB 5 HOH 17  5926 909  HOH HOH J . 
RB 5 HOH 18  5927 910  HOH HOH J . 
RB 5 HOH 19  5928 912  HOH HOH J . 
RB 5 HOH 20  5929 913  HOH HOH J . 
RB 5 HOH 21  5930 914  HOH HOH J . 
RB 5 HOH 22  5931 915  HOH HOH J . 
RB 5 HOH 23  5932 916  HOH HOH J . 
RB 5 HOH 24  5933 917  HOH HOH J . 
RB 5 HOH 25  5934 918  HOH HOH J . 
RB 5 HOH 26  5935 919  HOH HOH J . 
RB 5 HOH 27  5936 920  HOH HOH J . 
RB 5 HOH 28  5937 921  HOH HOH J . 
RB 5 HOH 29  5938 922  HOH HOH J . 
RB 5 HOH 30  5939 923  HOH HOH J . 
RB 5 HOH 31  5940 924  HOH HOH J . 
RB 5 HOH 32  5941 925  HOH HOH J . 
RB 5 HOH 33  5942 927  HOH HOH J . 
RB 5 HOH 34  5943 928  HOH HOH J . 
RB 5 HOH 35  5944 929  HOH HOH J . 
RB 5 HOH 36  5945 930  HOH HOH J . 
RB 5 HOH 37  5946 931  HOH HOH J . 
RB 5 HOH 38  5947 932  HOH HOH J . 
RB 5 HOH 39  5948 933  HOH HOH J . 
RB 5 HOH 40  5949 934  HOH HOH J . 
RB 5 HOH 41  5950 935  HOH HOH J . 
RB 5 HOH 42  5951 936  HOH HOH J . 
RB 5 HOH 43  5952 937  HOH HOH J . 
RB 5 HOH 44  5953 938  HOH HOH J . 
RB 5 HOH 45  5954 939  HOH HOH J . 
RB 5 HOH 46  5955 940  HOH HOH J . 
RB 5 HOH 47  5956 941  HOH HOH J . 
RB 5 HOH 48  5957 942  HOH HOH J . 
RB 5 HOH 49  5958 943  HOH HOH J . 
RB 5 HOH 50  5959 944  HOH HOH J . 
RB 5 HOH 51  5960 945  HOH HOH J . 
RB 5 HOH 52  5961 946  HOH HOH J . 
RB 5 HOH 53  5962 947  HOH HOH J . 
RB 5 HOH 54  5963 948  HOH HOH J . 
RB 5 HOH 55  5964 949  HOH HOH J . 
RB 5 HOH 56  5965 950  HOH HOH J . 
RB 5 HOH 57  5966 951  HOH HOH J . 
RB 5 HOH 58  5967 952  HOH HOH J . 
RB 5 HOH 59  5968 953  HOH HOH J . 
RB 5 HOH 60  5969 954  HOH HOH J . 
RB 5 HOH 61  5970 955  HOH HOH J . 
RB 5 HOH 62  5971 956  HOH HOH J . 
RB 5 HOH 63  5972 957  HOH HOH J . 
RB 5 HOH 64  5973 958  HOH HOH J . 
RB 5 HOH 65  5974 959  HOH HOH J . 
RB 5 HOH 66  5975 960  HOH HOH J . 
RB 5 HOH 67  5976 962  HOH HOH J . 
RB 5 HOH 68  5977 963  HOH HOH J . 
RB 5 HOH 69  5978 964  HOH HOH J . 
RB 5 HOH 70  5979 965  HOH HOH J . 
RB 5 HOH 71  5980 966  HOH HOH J . 
RB 5 HOH 72  5981 967  HOH HOH J . 
RB 5 HOH 73  5982 968  HOH HOH J . 
RB 5 HOH 74  5983 969  HOH HOH J . 
RB 5 HOH 75  5984 970  HOH HOH J . 
RB 5 HOH 76  5985 971  HOH HOH J . 
RB 5 HOH 77  5986 972  HOH HOH J . 
RB 5 HOH 78  5987 973  HOH HOH J . 
RB 5 HOH 79  5988 974  HOH HOH J . 
RB 5 HOH 80  5989 975  HOH HOH J . 
RB 5 HOH 81  5990 976  HOH HOH J . 
RB 5 HOH 82  5991 977  HOH HOH J . 
RB 5 HOH 83  5992 978  HOH HOH J . 
RB 5 HOH 84  5993 979  HOH HOH J . 
RB 5 HOH 85  5994 980  HOH HOH J . 
RB 5 HOH 86  5995 981  HOH HOH J . 
RB 5 HOH 87  5996 982  HOH HOH J . 
RB 5 HOH 88  5997 983  HOH HOH J . 
RB 5 HOH 89  5998 985  HOH HOH J . 
RB 5 HOH 90  5999 986  HOH HOH J . 
RB 5 HOH 91  6000 987  HOH HOH J . 
RB 5 HOH 92  6001 988  HOH HOH J . 
RB 5 HOH 93  6002 989  HOH HOH J . 
RB 5 HOH 94  6003 990  HOH HOH J . 
RB 5 HOH 95  6004 991  HOH HOH J . 
RB 5 HOH 96  6005 992  HOH HOH J . 
RB 5 HOH 97  6006 993  HOH HOH J . 
RB 5 HOH 98  6007 995  HOH HOH J . 
RB 5 HOH 99  6008 996  HOH HOH J . 
RB 5 HOH 100 6009 997  HOH HOH J . 
RB 5 HOH 101 6010 998  HOH HOH J . 
RB 5 HOH 102 6011 999  HOH HOH J . 
RB 5 HOH 103 6012 1000 HOH HOH J . 
RB 5 HOH 104 6013 1003 HOH HOH J . 
RB 5 HOH 105 6014 1004 HOH HOH J . 
RB 5 HOH 106 6015 1005 HOH HOH J . 
RB 5 HOH 107 6016 1006 HOH HOH J . 
RB 5 HOH 108 6017 1007 HOH HOH J . 
RB 5 HOH 109 6018 1008 HOH HOH J . 
RB 5 HOH 110 6019 1009 HOH HOH J . 
RB 5 HOH 111 6020 1010 HOH HOH J . 
RB 5 HOH 112 6021 1012 HOH HOH J . 
RB 5 HOH 113 6022 1013 HOH HOH J . 
RB 5 HOH 114 6023 1014 HOH HOH J . 
RB 5 HOH 115 6024 1015 HOH HOH J . 
RB 5 HOH 116 6025 1016 HOH HOH J . 
RB 5 HOH 117 6026 1017 HOH HOH J . 
RB 5 HOH 118 6027 1018 HOH HOH J . 
RB 5 HOH 119 6028 1019 HOH HOH J . 
RB 5 HOH 120 6029 1020 HOH HOH J . 
RB 5 HOH 121 6030 1022 HOH HOH J . 
RB 5 HOH 122 6031 1023 HOH HOH J . 
RB 5 HOH 123 6032 1024 HOH HOH J . 
RB 5 HOH 124 6033 1025 HOH HOH J . 
RB 5 HOH 125 6034 1026 HOH HOH J . 
RB 5 HOH 126 6035 1027 HOH HOH J . 
RB 5 HOH 127 6036 1028 HOH HOH J . 
RB 5 HOH 128 6037 1029 HOH HOH J . 
RB 5 HOH 129 6038 1030 HOH HOH J . 
RB 5 HOH 130 6039 1031 HOH HOH J . 
RB 5 HOH 131 6040 1032 HOH HOH J . 
RB 5 HOH 132 6041 1033 HOH HOH J . 
RB 5 HOH 133 6042 1034 HOH HOH J . 
RB 5 HOH 134 6043 1035 HOH HOH J . 
RB 5 HOH 135 6044 1036 HOH HOH J . 
RB 5 HOH 136 6045 1037 HOH HOH J . 
RB 5 HOH 137 6046 1038 HOH HOH J . 
RB 5 HOH 138 6047 1039 HOH HOH J . 
RB 5 HOH 139 6048 1040 HOH HOH J . 
RB 5 HOH 140 6049 1041 HOH HOH J . 
RB 5 HOH 141 6050 1042 HOH HOH J . 
RB 5 HOH 142 6051 1043 HOH HOH J . 
RB 5 HOH 143 6052 1044 HOH HOH J . 
RB 5 HOH 144 6053 1045 HOH HOH J . 
RB 5 HOH 145 6054 1047 HOH HOH J . 
RB 5 HOH 146 6055 1048 HOH HOH J . 
RB 5 HOH 147 6056 1049 HOH HOH J . 
RB 5 HOH 148 6057 1050 HOH HOH J . 
RB 5 HOH 149 6058 1051 HOH HOH J . 
RB 5 HOH 150 6059 1052 HOH HOH J . 
RB 5 HOH 151 6060 1053 HOH HOH J . 
SB 5 HOH 1   613  901  HOH HOH K . 
SB 5 HOH 2   723  1011 HOH HOH K . 
SB 5 HOH 3   733  1021 HOH HOH K . 
SB 5 HOH 4   758  1046 HOH HOH K . 
SB 5 HOH 5   1381 904  HOH HOH K . 
SB 5 HOH 6   1388 911  HOH HOH K . 
SB 5 HOH 7   1403 926  HOH HOH K . 
SB 5 HOH 8   1438 961  HOH HOH K . 
SB 5 HOH 9   1461 984  HOH HOH K . 
SB 5 HOH 10  1471 994  HOH HOH K . 
SB 5 HOH 11  1478 1001 HOH HOH K . 
SB 5 HOH 12  1479 1002 HOH HOH K . 
SB 5 HOH 13  1532 902  HOH HOH K . 
SB 5 HOH 14  1533 903  HOH HOH K . 
SB 5 HOH 15  1535 905  HOH HOH K . 
SB 5 HOH 16  1536 906  HOH HOH K . 
SB 5 HOH 17  1537 907  HOH HOH K . 
SB 5 HOH 18  1538 908  HOH HOH K . 
SB 5 HOH 19  1539 909  HOH HOH K . 
SB 5 HOH 20  1540 910  HOH HOH K . 
SB 5 HOH 21  1541 911  HOH HOH K . 
SB 5 HOH 22  1542 912  HOH HOH K . 
SB 5 HOH 23  1543 913  HOH HOH K . 
SB 5 HOH 24  1544 914  HOH HOH K . 
SB 5 HOH 25  1545 915  HOH HOH K . 
SB 5 HOH 26  1546 916  HOH HOH K . 
SB 5 HOH 27  1547 917  HOH HOH K . 
SB 5 HOH 28  1548 918  HOH HOH K . 
SB 5 HOH 29  1549 919  HOH HOH K . 
SB 5 HOH 30  1550 920  HOH HOH K . 
SB 5 HOH 31  1551 921  HOH HOH K . 
SB 5 HOH 32  1552 922  HOH HOH K . 
SB 5 HOH 33  1553 923  HOH HOH K . 
SB 5 HOH 34  1554 924  HOH HOH K . 
SB 5 HOH 35  1555 925  HOH HOH K . 
SB 5 HOH 36  1557 927  HOH HOH K . 
SB 5 HOH 37  1558 928  HOH HOH K . 
SB 5 HOH 38  1559 929  HOH HOH K . 
SB 5 HOH 39  1560 930  HOH HOH K . 
SB 5 HOH 40  1561 931  HOH HOH K . 
SB 5 HOH 41  1562 932  HOH HOH K . 
SB 5 HOH 42  1563 933  HOH HOH K . 
SB 5 HOH 43  1564 934  HOH HOH K . 
SB 5 HOH 44  1565 935  HOH HOH K . 
SB 5 HOH 45  1566 936  HOH HOH K . 
SB 5 HOH 46  1567 937  HOH HOH K . 
SB 5 HOH 47  1568 938  HOH HOH K . 
SB 5 HOH 48  1569 939  HOH HOH K . 
SB 5 HOH 49  1570 940  HOH HOH K . 
SB 5 HOH 50  1571 941  HOH HOH K . 
SB 5 HOH 51  1572 942  HOH HOH K . 
SB 5 HOH 52  1573 943  HOH HOH K . 
SB 5 HOH 53  1574 944  HOH HOH K . 
SB 5 HOH 54  1575 945  HOH HOH K . 
SB 5 HOH 55  1576 946  HOH HOH K . 
SB 5 HOH 56  1577 947  HOH HOH K . 
SB 5 HOH 57  1578 948  HOH HOH K . 
SB 5 HOH 58  1579 949  HOH HOH K . 
SB 5 HOH 59  1580 950  HOH HOH K . 
SB 5 HOH 60  1581 951  HOH HOH K . 
SB 5 HOH 61  1582 952  HOH HOH K . 
SB 5 HOH 62  1583 953  HOH HOH K . 
SB 5 HOH 63  1584 954  HOH HOH K . 
SB 5 HOH 64  1585 955  HOH HOH K . 
SB 5 HOH 65  1586 956  HOH HOH K . 
SB 5 HOH 66  1587 957  HOH HOH K . 
SB 5 HOH 67  1588 958  HOH HOH K . 
SB 5 HOH 68  1589 959  HOH HOH K . 
SB 5 HOH 69  1590 960  HOH HOH K . 
SB 5 HOH 70  1592 962  HOH HOH K . 
SB 5 HOH 71  1593 963  HOH HOH K . 
SB 5 HOH 72  1594 964  HOH HOH K . 
SB 5 HOH 73  1595 965  HOH HOH K . 
SB 5 HOH 74  1596 966  HOH HOH K . 
SB 5 HOH 75  1597 967  HOH HOH K . 
SB 5 HOH 76  1598 968  HOH HOH K . 
SB 5 HOH 77  1599 969  HOH HOH K . 
SB 5 HOH 78  1600 970  HOH HOH K . 
SB 5 HOH 79  1601 971  HOH HOH K . 
SB 5 HOH 80  1602 972  HOH HOH K . 
SB 5 HOH 81  1603 973  HOH HOH K . 
SB 5 HOH 82  1604 974  HOH HOH K . 
SB 5 HOH 83  1605 975  HOH HOH K . 
SB 5 HOH 84  1606 976  HOH HOH K . 
SB 5 HOH 85  1607 977  HOH HOH K . 
SB 5 HOH 86  1608 978  HOH HOH K . 
SB 5 HOH 87  1609 979  HOH HOH K . 
SB 5 HOH 88  1610 980  HOH HOH K . 
SB 5 HOH 89  1611 981  HOH HOH K . 
SB 5 HOH 90  1612 982  HOH HOH K . 
SB 5 HOH 91  1613 983  HOH HOH K . 
SB 5 HOH 92  1615 985  HOH HOH K . 
SB 5 HOH 93  1616 986  HOH HOH K . 
SB 5 HOH 94  1617 987  HOH HOH K . 
SB 5 HOH 95  1618 988  HOH HOH K . 
SB 5 HOH 96  1619 989  HOH HOH K . 
SB 5 HOH 97  1620 990  HOH HOH K . 
SB 5 HOH 98  1621 991  HOH HOH K . 
SB 5 HOH 99  1622 992  HOH HOH K . 
SB 5 HOH 100 1623 993  HOH HOH K . 
SB 5 HOH 101 1625 995  HOH HOH K . 
SB 5 HOH 102 1626 996  HOH HOH K . 
SB 5 HOH 103 1627 997  HOH HOH K . 
SB 5 HOH 104 1628 998  HOH HOH K . 
SB 5 HOH 105 1629 999  HOH HOH K . 
SB 5 HOH 106 1630 1000 HOH HOH K . 
SB 5 HOH 107 1633 1003 HOH HOH K . 
SB 5 HOH 108 1634 1004 HOH HOH K . 
SB 5 HOH 109 1635 1005 HOH HOH K . 
SB 5 HOH 110 1636 1006 HOH HOH K . 
SB 5 HOH 111 1637 1007 HOH HOH K . 
SB 5 HOH 112 1638 1008 HOH HOH K . 
SB 5 HOH 113 1639 1009 HOH HOH K . 
SB 5 HOH 114 1640 1010 HOH HOH K . 
SB 5 HOH 115 1642 1012 HOH HOH K . 
SB 5 HOH 116 1643 1013 HOH HOH K . 
SB 5 HOH 117 1644 1014 HOH HOH K . 
SB 5 HOH 118 1645 1015 HOH HOH K . 
SB 5 HOH 119 1646 1016 HOH HOH K . 
SB 5 HOH 120 1647 1017 HOH HOH K . 
SB 5 HOH 121 1648 1018 HOH HOH K . 
SB 5 HOH 122 1649 1019 HOH HOH K . 
SB 5 HOH 123 1650 1020 HOH HOH K . 
SB 5 HOH 124 1652 1022 HOH HOH K . 
SB 5 HOH 125 1653 1023 HOH HOH K . 
SB 5 HOH 126 1654 1024 HOH HOH K . 
SB 5 HOH 127 1655 1025 HOH HOH K . 
SB 5 HOH 128 1656 1026 HOH HOH K . 
SB 5 HOH 129 1657 1027 HOH HOH K . 
SB 5 HOH 130 1658 1028 HOH HOH K . 
SB 5 HOH 131 1659 1029 HOH HOH K . 
SB 5 HOH 132 1660 1030 HOH HOH K . 
SB 5 HOH 133 1661 1031 HOH HOH K . 
SB 5 HOH 134 1662 1032 HOH HOH K . 
SB 5 HOH 135 1663 1033 HOH HOH K . 
SB 5 HOH 136 1664 1034 HOH HOH K . 
SB 5 HOH 137 1665 1035 HOH HOH K . 
SB 5 HOH 138 1666 1036 HOH HOH K . 
SB 5 HOH 139 1667 1037 HOH HOH K . 
SB 5 HOH 140 1668 1038 HOH HOH K . 
SB 5 HOH 141 1669 1039 HOH HOH K . 
SB 5 HOH 142 1670 1040 HOH HOH K . 
SB 5 HOH 143 1671 1041 HOH HOH K . 
SB 5 HOH 144 1672 1042 HOH HOH K . 
SB 5 HOH 145 1673 1043 HOH HOH K . 
SB 5 HOH 146 1674 1044 HOH HOH K . 
SB 5 HOH 147 1675 1045 HOH HOH K . 
SB 5 HOH 148 1677 1047 HOH HOH K . 
SB 5 HOH 149 1678 1048 HOH HOH K . 
SB 5 HOH 150 1679 1049 HOH HOH K . 
SB 5 HOH 151 1680 1050 HOH HOH K . 
SB 5 HOH 152 1681 1051 HOH HOH K . 
SB 5 HOH 153 1683 1053 HOH HOH K . 
TB 5 HOH 1   766  901  HOH HOH L . 
TB 5 HOH 2   876  1011 HOH HOH L . 
TB 5 HOH 3   886  1021 HOH HOH L . 
TB 5 HOH 4   911  1046 HOH HOH L . 
TB 5 HOH 5   1534 904  HOH HOH L . 
TB 5 HOH 6   1556 926  HOH HOH L . 
TB 5 HOH 7   1591 961  HOH HOH L . 
TB 5 HOH 8   1614 984  HOH HOH L . 
TB 5 HOH 9   1624 994  HOH HOH L . 
TB 5 HOH 10  1631 1001 HOH HOH L . 
TB 5 HOH 11  1632 1002 HOH HOH L . 
TB 5 HOH 12  1682 1052 HOH HOH L . 
TB 5 HOH 13  1685 902  HOH HOH L . 
TB 5 HOH 14  1686 903  HOH HOH L . 
TB 5 HOH 15  1688 905  HOH HOH L . 
TB 5 HOH 16  1689 906  HOH HOH L . 
TB 5 HOH 17  1690 907  HOH HOH L . 
TB 5 HOH 18  1691 908  HOH HOH L . 
TB 5 HOH 19  1692 909  HOH HOH L . 
TB 5 HOH 20  1693 910  HOH HOH L . 
TB 5 HOH 21  1695 912  HOH HOH L . 
TB 5 HOH 22  1696 913  HOH HOH L . 
TB 5 HOH 23  1697 914  HOH HOH L . 
TB 5 HOH 24  1698 915  HOH HOH L . 
TB 5 HOH 25  1699 916  HOH HOH L . 
TB 5 HOH 26  1700 917  HOH HOH L . 
TB 5 HOH 27  1701 918  HOH HOH L . 
TB 5 HOH 28  1702 919  HOH HOH L . 
TB 5 HOH 29  1703 920  HOH HOH L . 
TB 5 HOH 30  1704 921  HOH HOH L . 
TB 5 HOH 31  1705 922  HOH HOH L . 
TB 5 HOH 32  1706 923  HOH HOH L . 
TB 5 HOH 33  1707 924  HOH HOH L . 
TB 5 HOH 34  1708 925  HOH HOH L . 
TB 5 HOH 35  1710 927  HOH HOH L . 
TB 5 HOH 36  1711 928  HOH HOH L . 
TB 5 HOH 37  1712 929  HOH HOH L . 
TB 5 HOH 38  1713 930  HOH HOH L . 
TB 5 HOH 39  1714 931  HOH HOH L . 
TB 5 HOH 40  1715 932  HOH HOH L . 
TB 5 HOH 41  1716 933  HOH HOH L . 
TB 5 HOH 42  1717 934  HOH HOH L . 
TB 5 HOH 43  1718 935  HOH HOH L . 
TB 5 HOH 44  1719 936  HOH HOH L . 
TB 5 HOH 45  1720 937  HOH HOH L . 
TB 5 HOH 46  1721 938  HOH HOH L . 
TB 5 HOH 47  1722 939  HOH HOH L . 
TB 5 HOH 48  1723 940  HOH HOH L . 
TB 5 HOH 49  1724 941  HOH HOH L . 
TB 5 HOH 50  1725 942  HOH HOH L . 
TB 5 HOH 51  1726 943  HOH HOH L . 
TB 5 HOH 52  1727 944  HOH HOH L . 
TB 5 HOH 53  1728 945  HOH HOH L . 
TB 5 HOH 54  1729 946  HOH HOH L . 
TB 5 HOH 55  1730 947  HOH HOH L . 
TB 5 HOH 56  1731 948  HOH HOH L . 
TB 5 HOH 57  1732 949  HOH HOH L . 
TB 5 HOH 58  1733 950  HOH HOH L . 
TB 5 HOH 59  1734 951  HOH HOH L . 
TB 5 HOH 60  1735 952  HOH HOH L . 
TB 5 HOH 61  1736 953  HOH HOH L . 
TB 5 HOH 62  1737 954  HOH HOH L . 
TB 5 HOH 63  1738 955  HOH HOH L . 
TB 5 HOH 64  1739 956  HOH HOH L . 
TB 5 HOH 65  1740 957  HOH HOH L . 
TB 5 HOH 66  1741 958  HOH HOH L . 
TB 5 HOH 67  1742 959  HOH HOH L . 
TB 5 HOH 68  1743 960  HOH HOH L . 
TB 5 HOH 69  1745 962  HOH HOH L . 
TB 5 HOH 70  1746 963  HOH HOH L . 
TB 5 HOH 71  1747 964  HOH HOH L . 
TB 5 HOH 72  1748 965  HOH HOH L . 
TB 5 HOH 73  1749 966  HOH HOH L . 
TB 5 HOH 74  1750 967  HOH HOH L . 
TB 5 HOH 75  1751 968  HOH HOH L . 
TB 5 HOH 76  1752 969  HOH HOH L . 
TB 5 HOH 77  1753 970  HOH HOH L . 
TB 5 HOH 78  1754 971  HOH HOH L . 
TB 5 HOH 79  1755 972  HOH HOH L . 
TB 5 HOH 80  1756 973  HOH HOH L . 
TB 5 HOH 81  1757 974  HOH HOH L . 
TB 5 HOH 82  1758 975  HOH HOH L . 
TB 5 HOH 83  1759 976  HOH HOH L . 
TB 5 HOH 84  1760 977  HOH HOH L . 
TB 5 HOH 85  1761 978  HOH HOH L . 
TB 5 HOH 86  1762 979  HOH HOH L . 
TB 5 HOH 87  1763 980  HOH HOH L . 
TB 5 HOH 88  1764 981  HOH HOH L . 
TB 5 HOH 89  1765 982  HOH HOH L . 
TB 5 HOH 90  1766 983  HOH HOH L . 
TB 5 HOH 91  1768 985  HOH HOH L . 
TB 5 HOH 92  1769 986  HOH HOH L . 
TB 5 HOH 93  1770 987  HOH HOH L . 
TB 5 HOH 94  1771 988  HOH HOH L . 
TB 5 HOH 95  1772 989  HOH HOH L . 
TB 5 HOH 96  1773 990  HOH HOH L . 
TB 5 HOH 97  1774 991  HOH HOH L . 
TB 5 HOH 98  1775 992  HOH HOH L . 
TB 5 HOH 99  1776 993  HOH HOH L . 
TB 5 HOH 100 1778 995  HOH HOH L . 
TB 5 HOH 101 1779 996  HOH HOH L . 
TB 5 HOH 102 1780 997  HOH HOH L . 
TB 5 HOH 103 1781 998  HOH HOH L . 
TB 5 HOH 104 1782 999  HOH HOH L . 
TB 5 HOH 105 1783 1000 HOH HOH L . 
TB 5 HOH 106 1786 1003 HOH HOH L . 
TB 5 HOH 107 1787 1004 HOH HOH L . 
TB 5 HOH 108 1788 1005 HOH HOH L . 
TB 5 HOH 109 1789 1006 HOH HOH L . 
TB 5 HOH 110 1790 1007 HOH HOH L . 
TB 5 HOH 111 1791 1008 HOH HOH L . 
TB 5 HOH 112 1792 1009 HOH HOH L . 
TB 5 HOH 113 1793 1010 HOH HOH L . 
TB 5 HOH 114 1795 1012 HOH HOH L . 
TB 5 HOH 115 1796 1013 HOH HOH L . 
TB 5 HOH 116 1797 1014 HOH HOH L . 
TB 5 HOH 117 1798 1015 HOH HOH L . 
TB 5 HOH 118 1799 1016 HOH HOH L . 
TB 5 HOH 119 1800 1017 HOH HOH L . 
TB 5 HOH 120 1801 1018 HOH HOH L . 
TB 5 HOH 121 1802 1019 HOH HOH L . 
TB 5 HOH 122 1803 1020 HOH HOH L . 
TB 5 HOH 123 1805 1022 HOH HOH L . 
TB 5 HOH 124 1806 1023 HOH HOH L . 
TB 5 HOH 125 1807 1024 HOH HOH L . 
TB 5 HOH 126 1808 1025 HOH HOH L . 
TB 5 HOH 127 1809 1026 HOH HOH L . 
TB 5 HOH 128 1810 1027 HOH HOH L . 
TB 5 HOH 129 1811 1028 HOH HOH L . 
TB 5 HOH 130 1812 1029 HOH HOH L . 
TB 5 HOH 131 1813 1030 HOH HOH L . 
TB 5 HOH 132 1814 1031 HOH HOH L . 
TB 5 HOH 133 1815 1032 HOH HOH L . 
TB 5 HOH 134 1816 1033 HOH HOH L . 
TB 5 HOH 135 1817 1034 HOH HOH L . 
TB 5 HOH 136 1818 1035 HOH HOH L . 
TB 5 HOH 137 1819 1036 HOH HOH L . 
TB 5 HOH 138 1820 1037 HOH HOH L . 
TB 5 HOH 139 1821 1038 HOH HOH L . 
TB 5 HOH 140 1822 1039 HOH HOH L . 
TB 5 HOH 141 1823 1040 HOH HOH L . 
TB 5 HOH 142 1824 1041 HOH HOH L . 
TB 5 HOH 143 1825 1042 HOH HOH L . 
TB 5 HOH 144 1826 1043 HOH HOH L . 
TB 5 HOH 145 1827 1044 HOH HOH L . 
TB 5 HOH 146 1828 1045 HOH HOH L . 
TB 5 HOH 147 1830 1047 HOH HOH L . 
TB 5 HOH 148 1831 1048 HOH HOH L . 
TB 5 HOH 149 1832 1049 HOH HOH L . 
TB 5 HOH 150 1833 1050 HOH HOH L . 
TB 5 HOH 151 1834 1051 HOH HOH L . 
TB 5 HOH 152 1835 1052 HOH HOH L . 
TB 5 HOH 153 1836 1053 HOH HOH L . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    'model building' .     ? 1 
X-PLOR    refinement       3.843 ? 2 
DENZO     'data reduction' .     ? 3 
SCALEPACK 'data scaling'   .     ? 4 
X-PLOR    phasing          .     ? 5 
# 
_cell.entry_id           1FPY 
_cell.length_a           230.600 
_cell.length_b           132.500 
_cell.length_c           195.900 
_cell.angle_alpha        90.00 
_cell.angle_beta         102.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              48 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FPY 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
_exptl.entry_id          1FPY 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   47.71 
_exptl_crystal.density_Matthews      2.35 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'ADP, MPD, spermine, manganese chloride, imidazole buffer, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1995-04-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12C' 
_diffrn_source.pdbx_wavelength             1.1 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12C 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FPY 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             15.0 
_reflns.d_resolution_high            2.89 
_reflns.number_obs                   87421 
_reflns.number_all                   87421 
_reflns.percent_possible_obs         70 
_reflns.pdbx_Rmerge_I_obs            0.0740000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        13.5 
_reflns.B_iso_Wilson_estimate        53 
_reflns.pdbx_redundancy              14.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              2.95 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   58.6 
_reflns_shell.Rmerge_I_obs           0.2880000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.number_unique_all      87421 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1FPY 
_refine.ls_number_reflns_obs                     87421 
_refine.ls_number_reflns_all                     87421 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             15.0 
_refine.ls_d_res_high                            2.89 
_refine.ls_percent_reflns_obs                    70 
_refine.ls_R_factor_obs                          0.2500000 
_refine.ls_R_factor_all                          0.2500000 
_refine.ls_R_factor_R_work                       0.2480000 
_refine.ls_R_factor_R_free                       0.2630000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  8757 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;The model was built using 12-fold NCS averaged maps and refined using (strict) 12-fold NCS-averaging, or constraints.  The phosphinothricin model was restrained to match small-molecule structure solutions (see article).  Some of the closely spaced waters are most likely a MPD molecule, such as O61 & O28.  A BULK SOLVENT CORRECTION and an anisotropic B-factor correction was 
applied to the data set (see XPLOR 3.843).  Alternate conformations B reflect the movements of catalytic loops upon phosphinothricin binding in the active site, whereas alternate conformations A reflect a native structure.  See article for details.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        44964 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         480 
_refine_hist.number_atoms_solvent             1836 
_refine_hist.number_atoms_total               47280 
_refine_hist.d_res_high                       2.89 
_refine_hist.d_res_low                        15.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d          1.9   ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 24.88 ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 1.81  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_database_PDB_matrix.entry_id          1FPY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_struct.entry_id                  1FPY 
_struct.title                     
'CRYSTAL STRUCTURE OF GLUTAMINE SYNTHETASE FROM SALMONELLA TYPHIMURIUM WITH INHIBITOR PHOSPHINOTHRICIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FPY 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'glutamine synthetase, phosphinothricin, inhibition, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 2 ? 
N  N N 2 ? 
O  N N 3 ? 
P  N N 4 ? 
Q  N N 2 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 4 ? 
U  N N 2 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 2 ? 
AA N N 3 ? 
BA N N 4 ? 
CA N N 2 ? 
DA N N 2 ? 
EA N N 3 ? 
FA N N 4 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 3 ? 
JA N N 4 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 3 ? 
NA N N 4 ? 
OA N N 2 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 4 ? 
SA N N 2 ? 
TA N N 2 ? 
UA N N 3 ? 
VA N N 4 ? 
WA N N 2 ? 
XA N N 2 ? 
YA N N 3 ? 
ZA N N 4 ? 
AB N N 2 ? 
BB N N 2 ? 
CB N N 3 ? 
DB N N 4 ? 
EB N N 2 ? 
FB N N 2 ? 
GB N N 3 ? 
HB N N 4 ? 
IB N N 5 ? 
JB N N 5 ? 
KB N N 5 ? 
LB N N 5 ? 
MB N N 5 ? 
NB N N 5 ? 
OB N N 5 ? 
PB N N 5 ? 
QB N N 5 ? 
RB N N 5 ? 
SB N N 5 ? 
TB N N 5 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    GLNA_SALTY 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P0A1P6 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SAEHVLTMLNEHEVKFVDLRFTDTKGKEQHVTIPAHQVNAEFFEEGKMFDGSSIGGWKGINESDMVLMPDASTAVIDPFF
ADSTLIIRCDILEPGTLQGYDRDPRSIAKRAEDYLRATGIADTVLFGPEPEFFLFDDIRFGASISGSHVAIDDIEGAWNS
STKYEGGNKGHRPGVKGGYFPVPPVDSAQDIRSEMCLVMEQMGLVVEAHHHEVATAGQNEVATRFNTMTKKADEIQIYKY
VVHNVAHRFGKTATFMPKPMFGDNGSGMHCHMSLAKNGTNLFSGDKYAGLSEQALYYIGGVIKHAKAINALANPTTNSYK
RLVPGYEAPVMLAYSARNRSASIRIPVVASPKARRIEVRFPDPAANPYLCFAALLMAGLDGIKNKIHPGEPMDKNLYDLP
PEEAKEIPQVAGSLEEALNALDLDREFLKAGGVFTDEAIDAYIALRREEDDRVRMTPHPVEFELYYSV
;
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1FPY A 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
2  1 1FPY B 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
3  1 1FPY C 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
4  1 1FPY D 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
5  1 1FPY E 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
6  1 1FPY F 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
7  1 1FPY G 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
8  1 1FPY H 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
9  1 1FPY I 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
10 1 1FPY J 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
11 1 1FPY K 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
12 1 1FPY L 1 ? 468 ? P0A1P6 1 ? 468 ? 1 468 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dodecameric 
_pdbx_struct_assembly.oligomeric_count     12 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 94800  ? 
1 MORE         -546   ? 
1 'SSA (A^2)'  167720 ? 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      
;A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,AA,BA,CA,DA,EA,FA,GA,HA,IA,JA,KA,LA,MA,NA,OA,PA,QA,RA,SA,TA,UA,VA,WA,XA,YA,ZA,AB,BB,CB,DB,EB,FB,GB,HB,IB,JB,KB,LB,MB,NB,OB,PB,QB,RB,SB,TB
;
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological complex is a dodecamer.' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 1   ? HIS A 12  ? SER A 1   HIS A 12  1 ? 12 
HELX_P HELX_P2   2   HIS A 36  ? VAL A 38  ? HIS A 36  VAL A 38  5 ? 3  
HELX_P HELX_P3   3   ASN A 39  ? GLY A 46  ? ASN A 39  GLY A 46  1 ? 8  
HELX_P HELX_P4   4   ALA A 71  ? ALA A 74  ? ALA A 71  ALA A 74  5 ? 4  
HELX_P HELX_P5   5   ASP A 103 ? THR A 118 ? ASP A 103 THR A 118 1 ? 16 
HELX_P HELX_P6   6   GLY A 156 ? SER A 161 ? GLY A 156 SER A 161 5 ? 6  
HELX_P HELX_P7   7   ALA A 188 ? MET A 202 ? ALA A 188 MET A 202 1 ? 15 
HELX_P HELX_P8   8   MET A 228 ? PHE A 249 ? MET A 228 PHE A 249 1 ? 22 
HELX_P HELX_P9   9   LYS A 286 ? GLY A 289 ? LYS A 286 GLY A 289 5 ? 4  
HELX_P HELX_P10  10  SER A 291 ? ALA A 305 ? SER A 291 ALA A 305 1 ? 15 
HELX_P HELX_P11  11  HIS A 304 ? ASN A 313 ? HIS A 304 ASN A 313 1 ? 10 
HELX_P HELX_P12  12  ASN A 317 ? LEU A 322 ? ASN A 317 LEU A 322 1 ? 6  
HELX_P HELX_P13  13  ASN A 366 ? ASN A 384 ? ASN A 366 ASN A 384 1 ? 19 
HELX_P HELX_P14  14  SER A 413 ? ASP A 424 ? SER A 413 ASP A 424 1 ? 12 
HELX_P HELX_P15  15  ARG A 425 ? ALA A 430 ? ARG A 425 ALA A 430 1 ? 6  
HELX_P HELX_P16  16  GLY A 431 ? VAL A 433 ? GLY A 431 VAL A 433 5 ? 3  
HELX_P HELX_P17  17  THR A 435 ? THR A 456 ? THR A 435 THR A 456 1 ? 22 
HELX_P HELX_P18  18  HIS A 458 ? TYR A 466 ? HIS A 458 TYR A 466 1 ? 9  
HELX_P HELX_P19  19  SER B 1   ? HIS B 12  ? SER B 1   HIS B 12  1 ? 12 
HELX_P HELX_P20  20  HIS B 36  ? VAL B 38  ? HIS B 36  VAL B 38  5 ? 3  
HELX_P HELX_P21  21  ASN B 39  ? GLY B 46  ? ASN B 39  GLY B 46  1 ? 8  
HELX_P HELX_P22  22  ALA B 71  ? ALA B 74  ? ALA B 71  ALA B 74  5 ? 4  
HELX_P HELX_P23  23  ASP B 103 ? THR B 118 ? ASP B 103 THR B 118 1 ? 16 
HELX_P HELX_P24  24  GLY B 156 ? SER B 161 ? GLY B 156 SER B 161 5 ? 6  
HELX_P HELX_P25  25  ALA B 188 ? MET B 202 ? ALA B 188 MET B 202 1 ? 15 
HELX_P HELX_P26  26  MET B 228 ? PHE B 249 ? MET B 228 PHE B 249 1 ? 22 
HELX_P HELX_P27  27  LYS B 286 ? GLY B 289 ? LYS B 286 GLY B 289 5 ? 4  
HELX_P HELX_P28  28  SER B 291 ? ALA B 305 ? SER B 291 ALA B 305 1 ? 15 
HELX_P HELX_P29  29  HIS B 304 ? ASN B 313 ? HIS B 304 ASN B 313 1 ? 10 
HELX_P HELX_P30  30  ASN B 317 ? LEU B 322 ? ASN B 317 LEU B 322 1 ? 6  
HELX_P HELX_P31  31  ASN B 366 ? ASN B 384 ? ASN B 366 ASN B 384 1 ? 19 
HELX_P HELX_P32  32  SER B 413 ? ASP B 424 ? SER B 413 ASP B 424 1 ? 12 
HELX_P HELX_P33  33  ARG B 425 ? ALA B 430 ? ARG B 425 ALA B 430 1 ? 6  
HELX_P HELX_P34  34  GLY B 431 ? VAL B 433 ? GLY B 431 VAL B 433 5 ? 3  
HELX_P HELX_P35  35  THR B 435 ? THR B 456 ? THR B 435 THR B 456 1 ? 22 
HELX_P HELX_P36  36  HIS B 458 ? TYR B 466 ? HIS B 458 TYR B 466 1 ? 9  
HELX_P HELX_P37  37  SER C 1   ? HIS C 12  ? SER C 1   HIS C 12  1 ? 12 
HELX_P HELX_P38  38  HIS C 36  ? VAL C 38  ? HIS C 36  VAL C 38  5 ? 3  
HELX_P HELX_P39  39  ASN C 39  ? GLY C 46  ? ASN C 39  GLY C 46  1 ? 8  
HELX_P HELX_P40  40  ALA C 71  ? ALA C 74  ? ALA C 71  ALA C 74  5 ? 4  
HELX_P HELX_P41  41  ASP C 103 ? THR C 118 ? ASP C 103 THR C 118 1 ? 16 
HELX_P HELX_P42  42  GLY C 156 ? SER C 161 ? GLY C 156 SER C 161 5 ? 6  
HELX_P HELX_P43  43  ALA C 188 ? MET C 202 ? ALA C 188 MET C 202 1 ? 15 
HELX_P HELX_P44  44  MET C 228 ? PHE C 249 ? MET C 228 PHE C 249 1 ? 22 
HELX_P HELX_P45  45  LYS C 286 ? GLY C 289 ? LYS C 286 GLY C 289 5 ? 4  
HELX_P HELX_P46  46  SER C 291 ? ALA C 305 ? SER C 291 ALA C 305 1 ? 15 
HELX_P HELX_P47  47  HIS C 304 ? ASN C 313 ? HIS C 304 ASN C 313 1 ? 10 
HELX_P HELX_P48  48  ASN C 317 ? LEU C 322 ? ASN C 317 LEU C 322 1 ? 6  
HELX_P HELX_P49  49  ASN C 366 ? ASN C 384 ? ASN C 366 ASN C 384 1 ? 19 
HELX_P HELX_P50  50  SER C 413 ? ASP C 424 ? SER C 413 ASP C 424 1 ? 12 
HELX_P HELX_P51  51  ARG C 425 ? ALA C 430 ? ARG C 425 ALA C 430 1 ? 6  
HELX_P HELX_P52  52  GLY C 431 ? VAL C 433 ? GLY C 431 VAL C 433 5 ? 3  
HELX_P HELX_P53  53  THR C 435 ? THR C 456 ? THR C 435 THR C 456 1 ? 22 
HELX_P HELX_P54  54  HIS C 458 ? TYR C 466 ? HIS C 458 TYR C 466 1 ? 9  
HELX_P HELX_P55  55  SER D 1   ? HIS D 12  ? SER D 1   HIS D 12  1 ? 12 
HELX_P HELX_P56  56  HIS D 36  ? VAL D 38  ? HIS D 36  VAL D 38  5 ? 3  
HELX_P HELX_P57  57  ASN D 39  ? GLY D 46  ? ASN D 39  GLY D 46  1 ? 8  
HELX_P HELX_P58  58  ALA D 71  ? ALA D 74  ? ALA D 71  ALA D 74  5 ? 4  
HELX_P HELX_P59  59  ASP D 103 ? THR D 118 ? ASP D 103 THR D 118 1 ? 16 
HELX_P HELX_P60  60  GLY D 156 ? SER D 161 ? GLY D 156 SER D 161 5 ? 6  
HELX_P HELX_P61  61  ALA D 188 ? MET D 202 ? ALA D 188 MET D 202 1 ? 15 
HELX_P HELX_P62  62  MET D 228 ? PHE D 249 ? MET D 228 PHE D 249 1 ? 22 
HELX_P HELX_P63  63  LYS D 286 ? GLY D 289 ? LYS D 286 GLY D 289 5 ? 4  
HELX_P HELX_P64  64  SER D 291 ? ALA D 305 ? SER D 291 ALA D 305 1 ? 15 
HELX_P HELX_P65  65  HIS D 304 ? ASN D 313 ? HIS D 304 ASN D 313 1 ? 10 
HELX_P HELX_P66  66  ASN D 317 ? LEU D 322 ? ASN D 317 LEU D 322 1 ? 6  
HELX_P HELX_P67  67  ASN D 366 ? ASN D 384 ? ASN D 366 ASN D 384 1 ? 19 
HELX_P HELX_P68  68  SER D 413 ? ASP D 424 ? SER D 413 ASP D 424 1 ? 12 
HELX_P HELX_P69  69  ARG D 425 ? ALA D 430 ? ARG D 425 ALA D 430 1 ? 6  
HELX_P HELX_P70  70  GLY D 431 ? VAL D 433 ? GLY D 431 VAL D 433 5 ? 3  
HELX_P HELX_P71  71  THR D 435 ? THR D 456 ? THR D 435 THR D 456 1 ? 22 
HELX_P HELX_P72  72  HIS D 458 ? TYR D 466 ? HIS D 458 TYR D 466 1 ? 9  
HELX_P HELX_P73  73  SER E 1   ? HIS E 12  ? SER E 1   HIS E 12  1 ? 12 
HELX_P HELX_P74  74  HIS E 36  ? VAL E 38  ? HIS E 36  VAL E 38  5 ? 3  
HELX_P HELX_P75  75  ASN E 39  ? GLY E 46  ? ASN E 39  GLY E 46  1 ? 8  
HELX_P HELX_P76  76  ALA E 71  ? ALA E 74  ? ALA E 71  ALA E 74  5 ? 4  
HELX_P HELX_P77  77  ASP E 103 ? THR E 118 ? ASP E 103 THR E 118 1 ? 16 
HELX_P HELX_P78  78  GLY E 156 ? SER E 161 ? GLY E 156 SER E 161 5 ? 6  
HELX_P HELX_P79  79  ALA E 188 ? MET E 202 ? ALA E 188 MET E 202 1 ? 15 
HELX_P HELX_P80  80  MET E 228 ? PHE E 249 ? MET E 228 PHE E 249 1 ? 22 
HELX_P HELX_P81  81  LYS E 286 ? GLY E 289 ? LYS E 286 GLY E 289 5 ? 4  
HELX_P HELX_P82  82  SER E 291 ? ALA E 305 ? SER E 291 ALA E 305 1 ? 15 
HELX_P HELX_P83  83  HIS E 304 ? ASN E 313 ? HIS E 304 ASN E 313 1 ? 10 
HELX_P HELX_P84  84  ASN E 317 ? LEU E 322 ? ASN E 317 LEU E 322 1 ? 6  
HELX_P HELX_P85  85  ASN E 366 ? ASN E 384 ? ASN E 366 ASN E 384 1 ? 19 
HELX_P HELX_P86  86  SER E 413 ? ASP E 424 ? SER E 413 ASP E 424 1 ? 12 
HELX_P HELX_P87  87  ARG E 425 ? ALA E 430 ? ARG E 425 ALA E 430 1 ? 6  
HELX_P HELX_P88  88  GLY E 431 ? VAL E 433 ? GLY E 431 VAL E 433 5 ? 3  
HELX_P HELX_P89  89  THR E 435 ? THR E 456 ? THR E 435 THR E 456 1 ? 22 
HELX_P HELX_P90  90  HIS E 458 ? TYR E 466 ? HIS E 458 TYR E 466 1 ? 9  
HELX_P HELX_P91  91  SER F 1   ? HIS F 12  ? SER F 1   HIS F 12  1 ? 12 
HELX_P HELX_P92  92  HIS F 36  ? VAL F 38  ? HIS F 36  VAL F 38  5 ? 3  
HELX_P HELX_P93  93  ASN F 39  ? GLY F 46  ? ASN F 39  GLY F 46  1 ? 8  
HELX_P HELX_P94  94  ALA F 71  ? ALA F 74  ? ALA F 71  ALA F 74  5 ? 4  
HELX_P HELX_P95  95  ASP F 103 ? THR F 118 ? ASP F 103 THR F 118 1 ? 16 
HELX_P HELX_P96  96  GLY F 156 ? SER F 161 ? GLY F 156 SER F 161 5 ? 6  
HELX_P HELX_P97  97  ALA F 188 ? MET F 202 ? ALA F 188 MET F 202 1 ? 15 
HELX_P HELX_P98  98  MET F 228 ? PHE F 249 ? MET F 228 PHE F 249 1 ? 22 
HELX_P HELX_P99  99  LYS F 286 ? GLY F 289 ? LYS F 286 GLY F 289 5 ? 4  
HELX_P HELX_P100 100 SER F 291 ? ALA F 305 ? SER F 291 ALA F 305 1 ? 15 
HELX_P HELX_P101 101 HIS F 304 ? ASN F 313 ? HIS F 304 ASN F 313 1 ? 10 
HELX_P HELX_P102 102 ASN F 317 ? LEU F 322 ? ASN F 317 LEU F 322 1 ? 6  
HELX_P HELX_P103 103 ASN F 366 ? ASN F 384 ? ASN F 366 ASN F 384 1 ? 19 
HELX_P HELX_P104 104 SER F 413 ? ASP F 424 ? SER F 413 ASP F 424 1 ? 12 
HELX_P HELX_P105 105 ARG F 425 ? ALA F 430 ? ARG F 425 ALA F 430 1 ? 6  
HELX_P HELX_P106 106 GLY F 431 ? VAL F 433 ? GLY F 431 VAL F 433 5 ? 3  
HELX_P HELX_P107 107 THR F 435 ? THR F 456 ? THR F 435 THR F 456 1 ? 22 
HELX_P HELX_P108 108 HIS F 458 ? TYR F 466 ? HIS F 458 TYR F 466 1 ? 9  
HELX_P HELX_P109 109 SER G 1   ? HIS G 12  ? SER G 1   HIS G 12  1 ? 12 
HELX_P HELX_P110 110 HIS G 36  ? VAL G 38  ? HIS G 36  VAL G 38  5 ? 3  
HELX_P HELX_P111 111 ASN G 39  ? GLY G 46  ? ASN G 39  GLY G 46  1 ? 8  
HELX_P HELX_P112 112 ALA G 71  ? ALA G 74  ? ALA G 71  ALA G 74  5 ? 4  
HELX_P HELX_P113 113 ASP G 103 ? THR G 118 ? ASP G 103 THR G 118 1 ? 16 
HELX_P HELX_P114 114 GLY G 156 ? SER G 161 ? GLY G 156 SER G 161 5 ? 6  
HELX_P HELX_P115 115 ALA G 188 ? MET G 202 ? ALA G 188 MET G 202 1 ? 15 
HELX_P HELX_P116 116 MET G 228 ? PHE G 249 ? MET G 228 PHE G 249 1 ? 22 
HELX_P HELX_P117 117 LYS G 286 ? GLY G 289 ? LYS G 286 GLY G 289 5 ? 4  
HELX_P HELX_P118 118 SER G 291 ? ALA G 305 ? SER G 291 ALA G 305 1 ? 15 
HELX_P HELX_P119 119 HIS G 304 ? ASN G 313 ? HIS G 304 ASN G 313 1 ? 10 
HELX_P HELX_P120 120 ASN G 317 ? LEU G 322 ? ASN G 317 LEU G 322 1 ? 6  
HELX_P HELX_P121 121 ASN G 366 ? ASN G 384 ? ASN G 366 ASN G 384 1 ? 19 
HELX_P HELX_P122 122 SER G 413 ? ASP G 424 ? SER G 413 ASP G 424 1 ? 12 
HELX_P HELX_P123 123 ARG G 425 ? ALA G 430 ? ARG G 425 ALA G 430 1 ? 6  
HELX_P HELX_P124 124 GLY G 431 ? VAL G 433 ? GLY G 431 VAL G 433 5 ? 3  
HELX_P HELX_P125 125 THR G 435 ? THR G 456 ? THR G 435 THR G 456 1 ? 22 
HELX_P HELX_P126 126 HIS G 458 ? TYR G 466 ? HIS G 458 TYR G 466 1 ? 9  
HELX_P HELX_P127 127 SER H 1   ? HIS H 12  ? SER H 1   HIS H 12  1 ? 12 
HELX_P HELX_P128 128 HIS H 36  ? VAL H 38  ? HIS H 36  VAL H 38  5 ? 3  
HELX_P HELX_P129 129 ASN H 39  ? GLY H 46  ? ASN H 39  GLY H 46  1 ? 8  
HELX_P HELX_P130 130 ALA H 71  ? ALA H 74  ? ALA H 71  ALA H 74  5 ? 4  
HELX_P HELX_P131 131 ASP H 103 ? THR H 118 ? ASP H 103 THR H 118 1 ? 16 
HELX_P HELX_P132 132 GLY H 156 ? SER H 161 ? GLY H 156 SER H 161 5 ? 6  
HELX_P HELX_P133 133 ALA H 188 ? MET H 202 ? ALA H 188 MET H 202 1 ? 15 
HELX_P HELX_P134 134 MET H 228 ? PHE H 249 ? MET H 228 PHE H 249 1 ? 22 
HELX_P HELX_P135 135 LYS H 286 ? GLY H 289 ? LYS H 286 GLY H 289 5 ? 4  
HELX_P HELX_P136 136 SER H 291 ? ALA H 305 ? SER H 291 ALA H 305 1 ? 15 
HELX_P HELX_P137 137 HIS H 304 ? ASN H 313 ? HIS H 304 ASN H 313 1 ? 10 
HELX_P HELX_P138 138 ASN H 317 ? LEU H 322 ? ASN H 317 LEU H 322 1 ? 6  
HELX_P HELX_P139 139 ASN H 366 ? ASN H 384 ? ASN H 366 ASN H 384 1 ? 19 
HELX_P HELX_P140 140 SER H 413 ? ASP H 424 ? SER H 413 ASP H 424 1 ? 12 
HELX_P HELX_P141 141 ARG H 425 ? ALA H 430 ? ARG H 425 ALA H 430 1 ? 6  
HELX_P HELX_P142 142 GLY H 431 ? VAL H 433 ? GLY H 431 VAL H 433 5 ? 3  
HELX_P HELX_P143 143 THR H 435 ? THR H 456 ? THR H 435 THR H 456 1 ? 22 
HELX_P HELX_P144 144 HIS H 458 ? TYR H 466 ? HIS H 458 TYR H 466 1 ? 9  
HELX_P HELX_P145 145 SER I 1   ? HIS I 12  ? SER I 1   HIS I 12  1 ? 12 
HELX_P HELX_P146 146 HIS I 36  ? VAL I 38  ? HIS I 36  VAL I 38  5 ? 3  
HELX_P HELX_P147 147 ASN I 39  ? GLY I 46  ? ASN I 39  GLY I 46  1 ? 8  
HELX_P HELX_P148 148 ALA I 71  ? ALA I 74  ? ALA I 71  ALA I 74  5 ? 4  
HELX_P HELX_P149 149 ASP I 103 ? THR I 118 ? ASP I 103 THR I 118 1 ? 16 
HELX_P HELX_P150 150 GLY I 156 ? SER I 161 ? GLY I 156 SER I 161 5 ? 6  
HELX_P HELX_P151 151 ALA I 188 ? MET I 202 ? ALA I 188 MET I 202 1 ? 15 
HELX_P HELX_P152 152 MET I 228 ? PHE I 249 ? MET I 228 PHE I 249 1 ? 22 
HELX_P HELX_P153 153 LYS I 286 ? GLY I 289 ? LYS I 286 GLY I 289 5 ? 4  
HELX_P HELX_P154 154 SER I 291 ? ALA I 305 ? SER I 291 ALA I 305 1 ? 15 
HELX_P HELX_P155 155 HIS I 304 ? ASN I 313 ? HIS I 304 ASN I 313 1 ? 10 
HELX_P HELX_P156 156 ASN I 317 ? LEU I 322 ? ASN I 317 LEU I 322 1 ? 6  
HELX_P HELX_P157 157 ASN I 366 ? ASN I 384 ? ASN I 366 ASN I 384 1 ? 19 
HELX_P HELX_P158 158 SER I 413 ? ASP I 424 ? SER I 413 ASP I 424 1 ? 12 
HELX_P HELX_P159 159 ARG I 425 ? ALA I 430 ? ARG I 425 ALA I 430 1 ? 6  
HELX_P HELX_P160 160 GLY I 431 ? VAL I 433 ? GLY I 431 VAL I 433 5 ? 3  
HELX_P HELX_P161 161 THR I 435 ? THR I 456 ? THR I 435 THR I 456 1 ? 22 
HELX_P HELX_P162 162 HIS I 458 ? TYR I 466 ? HIS I 458 TYR I 466 1 ? 9  
HELX_P HELX_P163 163 SER J 1   ? HIS J 12  ? SER J 1   HIS J 12  1 ? 12 
HELX_P HELX_P164 164 HIS J 36  ? VAL J 38  ? HIS J 36  VAL J 38  5 ? 3  
HELX_P HELX_P165 165 ASN J 39  ? GLY J 46  ? ASN J 39  GLY J 46  1 ? 8  
HELX_P HELX_P166 166 ALA J 71  ? ALA J 74  ? ALA J 71  ALA J 74  5 ? 4  
HELX_P HELX_P167 167 ASP J 103 ? THR J 118 ? ASP J 103 THR J 118 1 ? 16 
HELX_P HELX_P168 168 GLY J 156 ? SER J 161 ? GLY J 156 SER J 161 5 ? 6  
HELX_P HELX_P169 169 ALA J 188 ? MET J 202 ? ALA J 188 MET J 202 1 ? 15 
HELX_P HELX_P170 170 MET J 228 ? PHE J 249 ? MET J 228 PHE J 249 1 ? 22 
HELX_P HELX_P171 171 LYS J 286 ? GLY J 289 ? LYS J 286 GLY J 289 5 ? 4  
HELX_P HELX_P172 172 SER J 291 ? ALA J 305 ? SER J 291 ALA J 305 1 ? 15 
HELX_P HELX_P173 173 HIS J 304 ? ASN J 313 ? HIS J 304 ASN J 313 1 ? 10 
HELX_P HELX_P174 174 ASN J 317 ? LEU J 322 ? ASN J 317 LEU J 322 1 ? 6  
HELX_P HELX_P175 175 ASN J 366 ? ASN J 384 ? ASN J 366 ASN J 384 1 ? 19 
HELX_P HELX_P176 176 SER J 413 ? ASP J 424 ? SER J 413 ASP J 424 1 ? 12 
HELX_P HELX_P177 177 ARG J 425 ? ALA J 430 ? ARG J 425 ALA J 430 1 ? 6  
HELX_P HELX_P178 178 GLY J 431 ? VAL J 433 ? GLY J 431 VAL J 433 5 ? 3  
HELX_P HELX_P179 179 THR J 435 ? THR J 456 ? THR J 435 THR J 456 1 ? 22 
HELX_P HELX_P180 180 HIS J 458 ? TYR J 466 ? HIS J 458 TYR J 466 1 ? 9  
HELX_P HELX_P181 181 SER K 1   ? HIS K 12  ? SER K 1   HIS K 12  1 ? 12 
HELX_P HELX_P182 182 HIS K 36  ? VAL K 38  ? HIS K 36  VAL K 38  5 ? 3  
HELX_P HELX_P183 183 ASN K 39  ? GLY K 46  ? ASN K 39  GLY K 46  1 ? 8  
HELX_P HELX_P184 184 ALA K 71  ? ALA K 74  ? ALA K 71  ALA K 74  5 ? 4  
HELX_P HELX_P185 185 ASP K 103 ? THR K 118 ? ASP K 103 THR K 118 1 ? 16 
HELX_P HELX_P186 186 GLY K 156 ? SER K 161 ? GLY K 156 SER K 161 5 ? 6  
HELX_P HELX_P187 187 ALA K 188 ? MET K 202 ? ALA K 188 MET K 202 1 ? 15 
HELX_P HELX_P188 188 MET K 228 ? PHE K 249 ? MET K 228 PHE K 249 1 ? 22 
HELX_P HELX_P189 189 LYS K 286 ? GLY K 289 ? LYS K 286 GLY K 289 5 ? 4  
HELX_P HELX_P190 190 SER K 291 ? ALA K 305 ? SER K 291 ALA K 305 1 ? 15 
HELX_P HELX_P191 191 HIS K 304 ? ASN K 313 ? HIS K 304 ASN K 313 1 ? 10 
HELX_P HELX_P192 192 ASN K 317 ? LEU K 322 ? ASN K 317 LEU K 322 1 ? 6  
HELX_P HELX_P193 193 ASN K 366 ? ASN K 384 ? ASN K 366 ASN K 384 1 ? 19 
HELX_P HELX_P194 194 SER K 413 ? ASP K 424 ? SER K 413 ASP K 424 1 ? 12 
HELX_P HELX_P195 195 ARG K 425 ? ALA K 430 ? ARG K 425 ALA K 430 1 ? 6  
HELX_P HELX_P196 196 GLY K 431 ? VAL K 433 ? GLY K 431 VAL K 433 5 ? 3  
HELX_P HELX_P197 197 THR K 435 ? THR K 456 ? THR K 435 THR K 456 1 ? 22 
HELX_P HELX_P198 198 HIS K 458 ? TYR K 466 ? HIS K 458 TYR K 466 1 ? 9  
HELX_P HELX_P199 199 SER L 1   ? HIS L 12  ? SER L 1   HIS L 12  1 ? 12 
HELX_P HELX_P200 200 HIS L 36  ? VAL L 38  ? HIS L 36  VAL L 38  5 ? 3  
HELX_P HELX_P201 201 ASN L 39  ? GLY L 46  ? ASN L 39  GLY L 46  1 ? 8  
HELX_P HELX_P202 202 ALA L 71  ? ALA L 74  ? ALA L 71  ALA L 74  5 ? 4  
HELX_P HELX_P203 203 ASP L 103 ? THR L 118 ? ASP L 103 THR L 118 1 ? 16 
HELX_P HELX_P204 204 GLY L 156 ? SER L 161 ? GLY L 156 SER L 161 5 ? 6  
HELX_P HELX_P205 205 ALA L 188 ? MET L 202 ? ALA L 188 MET L 202 1 ? 15 
HELX_P HELX_P206 206 MET L 228 ? PHE L 249 ? MET L 228 PHE L 249 1 ? 22 
HELX_P HELX_P207 207 LYS L 286 ? GLY L 289 ? LYS L 286 GLY L 289 5 ? 4  
HELX_P HELX_P208 208 SER L 291 ? ALA L 305 ? SER L 291 ALA L 305 1 ? 15 
HELX_P HELX_P209 209 HIS L 304 ? ASN L 313 ? HIS L 304 ASN L 313 1 ? 10 
HELX_P HELX_P210 210 ASN L 317 ? LEU L 322 ? ASN L 317 LEU L 322 1 ? 6  
HELX_P HELX_P211 211 ASN L 366 ? ASN L 384 ? ASN L 366 ASN L 384 1 ? 19 
HELX_P HELX_P212 212 SER L 413 ? ASP L 424 ? SER L 413 ASP L 424 1 ? 12 
HELX_P HELX_P213 213 ARG L 425 ? ALA L 430 ? ARG L 425 ALA L 430 1 ? 6  
HELX_P HELX_P214 214 GLY L 431 ? VAL L 433 ? GLY L 431 VAL L 433 5 ? 3  
HELX_P HELX_P215 215 THR L 435 ? THR L 456 ? THR L 435 THR L 456 1 ? 22 
HELX_P HELX_P216 216 HIS L 458 ? TYR L 466 ? HIS L 458 TYR L 466 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1   metalc ? ? A  GLU 129 OE2 ? ? ? 1_555 N  MN  . MN  ? ? A GLU 129 A MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc2   metalc ? ? A  GLU 131 OE1 ? ? ? 1_555 M  MN  . MN  ? ? A GLU 131 A MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc3   metalc ? ? A  GLU 212 OE1 B ? ? 1_555 M  MN  . MN  ? ? A GLU 212 A MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc4   metalc ? ? A  GLU 220 OE1 A ? ? 1_555 M  MN  . MN  ? ? A GLU 220 A MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc5   metalc ? ? A  HIS 269 ND1 ? ? ? 1_555 N  MN  . MN  ? ? A HIS 269 A MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc6   metalc ? ? A  GLU 357 OE2 ? ? ? 1_555 N  MN  . MN  ? ? A GLU 357 A MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc7   metalc ? ? M  MN  .   MN  ? ? ? 1_555 P  PPQ . OEA ? ? A MN  469 A PPQ 5900 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc8   metalc ? ? N  MN  .   MN  ? ? ? 1_555 O  ADP . O2B ? ? A MN  470 A ADP 4471 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc9   metalc ? ? N  MN  .   MN  ? ? ? 1_555 O  ADP . O3B ? ? A MN  470 A ADP 4471 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc10  metalc ? ? B  GLU 129 OE2 ? ? ? 1_555 R  MN  . MN  ? ? B GLU 129 B MN  470  1_555 ? ? ? ? ? ? ? 1.934 ? ? 
metalc11  metalc ? ? B  GLU 131 OE1 ? ? ? 1_555 Q  MN  . MN  ? ? B GLU 131 B MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc12  metalc ? ? B  GLU 212 OE1 B ? ? 1_555 Q  MN  . MN  ? ? B GLU 212 B MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc13  metalc ? ? B  GLU 220 OE1 A ? ? 1_555 Q  MN  . MN  ? ? B GLU 220 B MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc14  metalc ? ? B  HIS 269 ND1 ? ? ? 1_555 R  MN  . MN  ? ? B HIS 269 B MN  470  1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc15  metalc ? ? B  GLU 357 OE2 ? ? ? 1_555 R  MN  . MN  ? ? B GLU 357 B MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc16  metalc ? ? Q  MN  .   MN  ? ? ? 1_555 T  PPQ . OEA ? ? B MN  469 B PPQ 5901 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc17  metalc ? ? R  MN  .   MN  ? ? ? 1_555 S  ADP . O3B ? ? B MN  470 B ADP 4472 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc18  metalc ? ? R  MN  .   MN  ? ? ? 1_555 S  ADP . O2B ? ? B MN  470 B ADP 4472 1_555 ? ? ? ? ? ? ? 2.354 ? ? 
metalc19  metalc ? ? C  GLU 129 OE2 ? ? ? 1_555 V  MN  . MN  ? ? C GLU 129 C MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc20  metalc ? ? C  GLU 131 OE1 ? ? ? 1_555 U  MN  . MN  ? ? C GLU 131 C MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc21  metalc ? ? C  GLU 212 OE1 B ? ? 1_555 U  MN  . MN  ? ? C GLU 212 C MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc22  metalc ? ? C  GLU 220 OE1 A ? ? 1_555 U  MN  . MN  ? ? C GLU 220 C MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc23  metalc ? ? C  HIS 269 ND1 ? ? ? 1_555 V  MN  . MN  ? ? C HIS 269 C MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc24  metalc ? ? C  GLU 357 OE2 ? ? ? 1_555 V  MN  . MN  ? ? C GLU 357 C MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc25  metalc ? ? U  MN  .   MN  ? ? ? 1_555 X  PPQ . OEA ? ? C MN  469 C PPQ 5902 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc26  metalc ? ? V  MN  .   MN  ? ? ? 1_555 W  ADP . O3B ? ? C MN  470 C ADP 4473 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc27  metalc ? ? V  MN  .   MN  ? ? ? 1_555 W  ADP . O2B ? ? C MN  470 C ADP 4473 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc28  metalc ? ? D  GLU 129 OE2 ? ? ? 1_555 Z  MN  . MN  ? ? D GLU 129 D MN  470  1_555 ? ? ? ? ? ? ? 1.932 ? ? 
metalc29  metalc ? ? D  GLU 131 OE1 ? ? ? 1_555 Y  MN  . MN  ? ? D GLU 131 D MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc30  metalc ? ? D  GLU 212 OE1 B ? ? 1_555 Y  MN  . MN  ? ? D GLU 212 D MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc31  metalc ? ? D  GLU 220 OE1 A ? ? 1_555 Y  MN  . MN  ? ? D GLU 220 D MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc32  metalc ? ? D  HIS 269 ND1 ? ? ? 1_555 Z  MN  . MN  ? ? D HIS 269 D MN  470  1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc33  metalc ? ? D  GLU 357 OE2 ? ? ? 1_555 Z  MN  . MN  ? ? D GLU 357 D MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc34  metalc ? ? Y  MN  .   MN  ? ? ? 1_555 BA PPQ . OEA ? ? D MN  469 D PPQ 5903 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc35  metalc ? ? Z  MN  .   MN  ? ? ? 1_555 AA ADP . O2B ? ? D MN  470 D ADP 4474 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc36  metalc ? ? Z  MN  .   MN  ? ? ? 1_555 AA ADP . O3B ? ? D MN  470 D ADP 4474 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc37  metalc ? ? E  GLU 129 OE2 ? ? ? 1_555 DA MN  . MN  ? ? E GLU 129 E MN  470  1_555 ? ? ? ? ? ? ? 1.934 ? ? 
metalc38  metalc ? ? E  GLU 131 OE1 ? ? ? 1_555 CA MN  . MN  ? ? E GLU 131 E MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc39  metalc ? ? E  GLU 212 OE1 B ? ? 1_555 CA MN  . MN  ? ? E GLU 212 E MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc40  metalc ? ? E  GLU 220 OE1 A ? ? 1_555 CA MN  . MN  ? ? E GLU 220 E MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc41  metalc ? ? E  HIS 269 ND1 ? ? ? 1_555 DA MN  . MN  ? ? E HIS 269 E MN  470  1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc42  metalc ? ? E  GLU 357 OE2 ? ? ? 1_555 DA MN  . MN  ? ? E GLU 357 E MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc43  metalc ? ? CA MN  .   MN  ? ? ? 1_555 FA PPQ . OEA ? ? E MN  469 E PPQ 5904 1_555 ? ? ? ? ? ? ? 2.612 ? ? 
metalc44  metalc ? ? DA MN  .   MN  ? ? ? 1_555 EA ADP . O2B ? ? E MN  470 E ADP 4475 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc45  metalc ? ? DA MN  .   MN  ? ? ? 1_555 EA ADP . O3B ? ? E MN  470 E ADP 4475 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc46  metalc ? ? F  GLU 129 OE2 ? ? ? 1_555 HA MN  . MN  ? ? F GLU 129 F MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc47  metalc ? ? F  GLU 131 OE1 ? ? ? 1_555 GA MN  . MN  ? ? F GLU 131 F MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc48  metalc ? ? F  GLU 212 OE1 B ? ? 1_555 GA MN  . MN  ? ? F GLU 212 F MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc49  metalc ? ? F  GLU 220 OE1 A ? ? 1_555 GA MN  . MN  ? ? F GLU 220 F MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc50  metalc ? ? F  HIS 269 ND1 ? ? ? 1_555 HA MN  . MN  ? ? F HIS 269 F MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc51  metalc ? ? F  GLU 357 OE2 ? ? ? 1_555 HA MN  . MN  ? ? F GLU 357 F MN  470  1_555 ? ? ? ? ? ? ? 2.213 ? ? 
metalc52  metalc ? ? GA MN  .   MN  ? ? ? 1_555 JA PPQ . OEA ? ? F MN  469 F PPQ 5905 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc53  metalc ? ? HA MN  .   MN  ? ? ? 1_555 IA ADP . O2B ? ? F MN  470 F ADP 4476 1_555 ? ? ? ? ? ? ? 2.354 ? ? 
metalc54  metalc ? ? HA MN  .   MN  ? ? ? 1_555 IA ADP . O3B ? ? F MN  470 F ADP 4476 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc55  metalc ? ? G  GLU 129 OE2 ? ? ? 1_555 LA MN  . MN  ? ? G GLU 129 G MN  470  1_555 ? ? ? ? ? ? ? 1.934 ? ? 
metalc56  metalc ? ? G  GLU 131 OE1 ? ? ? 1_555 KA MN  . MN  ? ? G GLU 131 G MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc57  metalc ? ? G  GLU 212 OE1 B ? ? 1_555 KA MN  . MN  ? ? G GLU 212 G MN  469  1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc58  metalc ? ? G  GLU 220 OE1 A ? ? 1_555 KA MN  . MN  ? ? G GLU 220 G MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc59  metalc ? ? G  HIS 269 ND1 ? ? ? 1_555 LA MN  . MN  ? ? G HIS 269 G MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc60  metalc ? ? G  GLU 357 OE2 ? ? ? 1_555 LA MN  . MN  ? ? G GLU 357 G MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc61  metalc ? ? KA MN  .   MN  ? ? ? 1_555 NA PPQ . OEA ? ? G MN  469 G PPQ 5906 1_555 ? ? ? ? ? ? ? 2.611 ? ? 
metalc62  metalc ? ? LA MN  .   MN  ? ? ? 1_555 MA ADP . O2B ? ? G MN  470 G ADP 4477 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc63  metalc ? ? LA MN  .   MN  ? ? ? 1_555 MA ADP . O3B ? ? G MN  470 G ADP 4477 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc64  metalc ? ? H  GLU 129 OE2 ? ? ? 1_555 PA MN  . MN  ? ? H GLU 129 H MN  470  1_555 ? ? ? ? ? ? ? 1.934 ? ? 
metalc65  metalc ? ? H  GLU 131 OE1 ? ? ? 1_555 OA MN  . MN  ? ? H GLU 131 H MN  469  1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc66  metalc ? ? H  GLU 212 OE1 B ? ? 1_555 OA MN  . MN  ? ? H GLU 212 H MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc67  metalc ? ? H  GLU 220 OE1 A ? ? 1_555 OA MN  . MN  ? ? H GLU 220 H MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc68  metalc ? ? H  HIS 269 ND1 ? ? ? 1_555 PA MN  . MN  ? ? H HIS 269 H MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc69  metalc ? ? H  GLU 357 OE2 ? ? ? 1_555 PA MN  . MN  ? ? H GLU 357 H MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc70  metalc ? ? OA MN  .   MN  ? ? ? 1_555 RA PPQ . OEA ? ? H MN  469 H PPQ 5907 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc71  metalc ? ? PA MN  .   MN  ? ? ? 1_555 QA ADP . O2B ? ? H MN  470 H ADP 4478 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc72  metalc ? ? PA MN  .   MN  ? ? ? 1_555 QA ADP . O3B ? ? H MN  470 H ADP 4478 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc73  metalc ? ? I  GLU 129 OE2 ? ? ? 1_555 TA MN  . MN  ? ? I GLU 129 I MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc74  metalc ? ? I  GLU 131 OE1 ? ? ? 1_555 SA MN  . MN  ? ? I GLU 131 I MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc75  metalc ? ? I  GLU 212 OE1 B ? ? 1_555 SA MN  . MN  ? ? I GLU 212 I MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc76  metalc ? ? I  GLU 220 OE1 A ? ? 1_555 SA MN  . MN  ? ? I GLU 220 I MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc77  metalc ? ? I  HIS 269 ND1 ? ? ? 1_555 TA MN  . MN  ? ? I HIS 269 I MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc78  metalc ? ? I  GLU 357 OE2 ? ? ? 1_555 TA MN  . MN  ? ? I GLU 357 I MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc79  metalc ? ? SA MN  .   MN  ? ? ? 1_555 VA PPQ . OEA ? ? I MN  469 I PPQ 5908 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc80  metalc ? ? TA MN  .   MN  ? ? ? 1_555 UA ADP . O2B ? ? I MN  470 I ADP 4479 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc81  metalc ? ? TA MN  .   MN  ? ? ? 1_555 UA ADP . O3B ? ? I MN  470 I ADP 4479 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc82  metalc ? ? J  GLU 129 OE2 ? ? ? 1_555 XA MN  . MN  ? ? J GLU 129 J MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc83  metalc ? ? J  GLU 131 OE1 ? ? ? 1_555 WA MN  . MN  ? ? J GLU 131 J MN  469  1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc84  metalc ? ? J  GLU 212 OE1 B ? ? 1_555 WA MN  . MN  ? ? J GLU 212 J MN  469  1_555 ? ? ? ? ? ? ? 2.424 ? ? 
metalc85  metalc ? ? J  GLU 220 OE1 A ? ? 1_555 WA MN  . MN  ? ? J GLU 220 J MN  469  1_555 ? ? ? ? ? ? ? 1.991 ? ? 
metalc86  metalc ? ? J  HIS 269 ND1 ? ? ? 1_555 XA MN  . MN  ? ? J HIS 269 J MN  470  1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc87  metalc ? ? J  GLU 357 OE2 ? ? ? 1_555 XA MN  . MN  ? ? J GLU 357 J MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc88  metalc ? ? WA MN  .   MN  ? ? ? 1_555 ZA PPQ . OEA ? ? J MN  469 J PPQ 5909 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc89  metalc ? ? XA MN  .   MN  ? ? ? 1_555 YA ADP . O2B ? ? J MN  470 J ADP 4480 1_555 ? ? ? ? ? ? ? 2.354 ? ? 
metalc90  metalc ? ? XA MN  .   MN  ? ? ? 1_555 YA ADP . O3B ? ? J MN  470 J ADP 4480 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc91  metalc ? ? K  GLU 129 OE2 ? ? ? 1_555 BB MN  . MN  ? ? K GLU 129 K MN  470  1_555 ? ? ? ? ? ? ? 1.934 ? ? 
metalc92  metalc ? ? K  GLU 131 OE1 ? ? ? 1_555 AB MN  . MN  ? ? K GLU 131 K MN  469  1_555 ? ? ? ? ? ? ? 2.315 ? ? 
metalc93  metalc ? ? K  GLU 212 OE1 B ? ? 1_555 AB MN  . MN  ? ? K GLU 212 K MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc94  metalc ? ? K  GLU 220 OE1 A ? ? 1_555 AB MN  . MN  ? ? K GLU 220 K MN  469  1_555 ? ? ? ? ? ? ? 1.993 ? ? 
metalc95  metalc ? ? K  HIS 269 ND1 ? ? ? 1_555 BB MN  . MN  ? ? K HIS 269 K MN  470  1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc96  metalc ? ? K  GLU 357 OE2 ? ? ? 1_555 BB MN  . MN  ? ? K GLU 357 K MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc97  metalc ? ? AB MN  .   MN  ? ? ? 1_555 DB PPQ . OEA ? ? K MN  469 K PPQ 5910 1_555 ? ? ? ? ? ? ? 2.610 ? ? 
metalc98  metalc ? ? BB MN  .   MN  ? ? ? 1_555 CB ADP . O2B ? ? K MN  470 K ADP 4481 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc99  metalc ? ? BB MN  .   MN  ? ? ? 1_555 CB ADP . O3B ? ? K MN  470 K ADP 4481 1_555 ? ? ? ? ? ? ? 2.582 ? ? 
metalc100 metalc ? ? L  GLU 129 OE2 ? ? ? 1_555 FB MN  . MN  ? ? L GLU 129 L MN  470  1_555 ? ? ? ? ? ? ? 1.933 ? ? 
metalc101 metalc ? ? L  GLU 131 OE1 ? ? ? 1_555 EB MN  . MN  ? ? L GLU 131 L MN  469  1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc102 metalc ? ? L  GLU 212 OE1 B ? ? 1_555 EB MN  . MN  ? ? L GLU 212 L MN  469  1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc103 metalc ? ? L  GLU 220 OE1 A ? ? 1_555 EB MN  . MN  ? ? L GLU 220 L MN  469  1_555 ? ? ? ? ? ? ? 1.992 ? ? 
metalc104 metalc ? ? L  HIS 269 ND1 ? ? ? 1_555 FB MN  . MN  ? ? L HIS 269 L MN  470  1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc105 metalc ? ? L  GLU 357 OE2 ? ? ? 1_555 FB MN  . MN  ? ? L GLU 357 L MN  470  1_555 ? ? ? ? ? ? ? 2.214 ? ? 
metalc106 metalc ? ? EB MN  .   MN  ? ? ? 1_555 HB PPQ . OEA ? ? L MN  469 L PPQ 5911 1_555 ? ? ? ? ? ? ? 2.611 ? ? 
metalc107 metalc ? ? FB MN  .   MN  ? ? ? 1_555 GB ADP . O2B ? ? L MN  470 L ADP 4482 1_555 ? ? ? ? ? ? ? 2.355 ? ? 
metalc108 metalc ? ? FB MN  .   MN  ? ? ? 1_555 GB ADP . O3B ? ? L MN  470 L ADP 4482 1_555 ? ? ? ? ? ? ? 2.581 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OE2 ? A  GLU 129 ? A GLU 129  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 ND1 ? A  HIS 269 ? A HIS 269  ? 1_555 83.0  ? 
2   OE2 ? A  GLU 129 ? A GLU 129  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 OE2 ? A  GLU 357 ? A GLU 357  ? 1_555 85.0  ? 
3   ND1 ? A  HIS 269 ? A HIS 269  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 OE2 ? A  GLU 357 ? A GLU 357  ? 1_555 92.6  ? 
4   OE2 ? A  GLU 129 ? A GLU 129  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O2B ? O  ADP .   ? A ADP 4471 ? 1_555 104.4 ? 
5   ND1 ? A  HIS 269 ? A HIS 269  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O2B ? O  ADP .   ? A ADP 4471 ? 1_555 162.7 ? 
6   OE2 ? A  GLU 357 ? A GLU 357  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O2B ? O  ADP .   ? A ADP 4471 ? 1_555 72.9  ? 
7   OE2 ? A  GLU 129 ? A GLU 129  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O3B ? O  ADP .   ? A ADP 4471 ? 1_555 80.5  ? 
8   ND1 ? A  HIS 269 ? A HIS 269  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O3B ? O  ADP .   ? A ADP 4471 ? 1_555 133.2 ? 
9   OE2 ? A  GLU 357 ? A GLU 357  ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O3B ? O  ADP .   ? A ADP 4471 ? 1_555 128.8 ? 
10  O2B ? O  ADP .   ? A ADP 4471 ? 1_555 MN ? N  MN . ? A MN 470 ? 1_555 O3B ? O  ADP .   ? A ADP 4471 ? 1_555 64.0  ? 
11  OE1 ? A  GLU 131 ? A GLU 131  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OE1 B A  GLU 212 ? A GLU 212  ? 1_555 106.1 ? 
12  OE1 ? A  GLU 131 ? A GLU 131  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OE1 A A  GLU 220 ? A GLU 220  ? 1_555 85.3  ? 
13  OE1 B A  GLU 212 ? A GLU 212  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OE1 A A  GLU 220 ? A GLU 220  ? 1_555 104.1 ? 
14  OE1 ? A  GLU 131 ? A GLU 131  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OEA ? P  PPQ .   ? A PPQ 5900 ? 1_555 83.2  ? 
15  OE1 B A  GLU 212 ? A GLU 212  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OEA ? P  PPQ .   ? A PPQ 5900 ? 1_555 74.9  ? 
16  OE1 A A  GLU 220 ? A GLU 220  ? 1_555 MN ? M  MN . ? A MN 469 ? 1_555 OEA ? P  PPQ .   ? A PPQ 5900 ? 1_555 167.7 ? 
17  OE2 ? B  GLU 129 ? B GLU 129  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 ND1 ? B  HIS 269 ? B HIS 269  ? 1_555 83.0  ? 
18  OE2 ? B  GLU 129 ? B GLU 129  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 OE2 ? B  GLU 357 ? B GLU 357  ? 1_555 85.0  ? 
19  ND1 ? B  HIS 269 ? B HIS 269  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 OE2 ? B  GLU 357 ? B GLU 357  ? 1_555 92.6  ? 
20  OE2 ? B  GLU 129 ? B GLU 129  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O3B ? S  ADP .   ? B ADP 4472 ? 1_555 80.5  ? 
21  ND1 ? B  HIS 269 ? B HIS 269  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O3B ? S  ADP .   ? B ADP 4472 ? 1_555 133.2 ? 
22  OE2 ? B  GLU 357 ? B GLU 357  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O3B ? S  ADP .   ? B ADP 4472 ? 1_555 128.8 ? 
23  OE2 ? B  GLU 129 ? B GLU 129  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O2B ? S  ADP .   ? B ADP 4472 ? 1_555 104.4 ? 
24  ND1 ? B  HIS 269 ? B HIS 269  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O2B ? S  ADP .   ? B ADP 4472 ? 1_555 162.7 ? 
25  OE2 ? B  GLU 357 ? B GLU 357  ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O2B ? S  ADP .   ? B ADP 4472 ? 1_555 72.9  ? 
26  O3B ? S  ADP .   ? B ADP 4472 ? 1_555 MN ? R  MN . ? B MN 470 ? 1_555 O2B ? S  ADP .   ? B ADP 4472 ? 1_555 64.0  ? 
27  OE1 ? B  GLU 131 ? B GLU 131  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OE1 B B  GLU 212 ? B GLU 212  ? 1_555 106.1 ? 
28  OE1 ? B  GLU 131 ? B GLU 131  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OE1 A B  GLU 220 ? B GLU 220  ? 1_555 85.3  ? 
29  OE1 B B  GLU 212 ? B GLU 212  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OE1 A B  GLU 220 ? B GLU 220  ? 1_555 104.1 ? 
30  OE1 ? B  GLU 131 ? B GLU 131  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OEA ? T  PPQ .   ? B PPQ 5901 ? 1_555 83.2  ? 
31  OE1 B B  GLU 212 ? B GLU 212  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OEA ? T  PPQ .   ? B PPQ 5901 ? 1_555 75.0  ? 
32  OE1 A B  GLU 220 ? B GLU 220  ? 1_555 MN ? Q  MN . ? B MN 469 ? 1_555 OEA ? T  PPQ .   ? B PPQ 5901 ? 1_555 167.6 ? 
33  OE2 ? C  GLU 129 ? C GLU 129  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 ND1 ? C  HIS 269 ? C HIS 269  ? 1_555 83.0  ? 
34  OE2 ? C  GLU 129 ? C GLU 129  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 OE2 ? C  GLU 357 ? C GLU 357  ? 1_555 85.1  ? 
35  ND1 ? C  HIS 269 ? C HIS 269  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 OE2 ? C  GLU 357 ? C GLU 357  ? 1_555 92.6  ? 
36  OE2 ? C  GLU 129 ? C GLU 129  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O3B ? W  ADP .   ? C ADP 4473 ? 1_555 80.5  ? 
37  ND1 ? C  HIS 269 ? C HIS 269  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O3B ? W  ADP .   ? C ADP 4473 ? 1_555 133.2 ? 
38  OE2 ? C  GLU 357 ? C GLU 357  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O3B ? W  ADP .   ? C ADP 4473 ? 1_555 128.8 ? 
39  OE2 ? C  GLU 129 ? C GLU 129  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O2B ? W  ADP .   ? C ADP 4473 ? 1_555 104.4 ? 
40  ND1 ? C  HIS 269 ? C HIS 269  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O2B ? W  ADP .   ? C ADP 4473 ? 1_555 162.7 ? 
41  OE2 ? C  GLU 357 ? C GLU 357  ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O2B ? W  ADP .   ? C ADP 4473 ? 1_555 72.9  ? 
42  O3B ? W  ADP .   ? C ADP 4473 ? 1_555 MN ? V  MN . ? C MN 470 ? 1_555 O2B ? W  ADP .   ? C ADP 4473 ? 1_555 64.0  ? 
43  OE1 ? C  GLU 131 ? C GLU 131  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OE1 B C  GLU 212 ? C GLU 212  ? 1_555 106.1 ? 
44  OE1 ? C  GLU 131 ? C GLU 131  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OE1 A C  GLU 220 ? C GLU 220  ? 1_555 85.3  ? 
45  OE1 B C  GLU 212 ? C GLU 212  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OE1 A C  GLU 220 ? C GLU 220  ? 1_555 104.1 ? 
46  OE1 ? C  GLU 131 ? C GLU 131  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OEA ? X  PPQ .   ? C PPQ 5902 ? 1_555 83.2  ? 
47  OE1 B C  GLU 212 ? C GLU 212  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OEA ? X  PPQ .   ? C PPQ 5902 ? 1_555 75.0  ? 
48  OE1 A C  GLU 220 ? C GLU 220  ? 1_555 MN ? U  MN . ? C MN 469 ? 1_555 OEA ? X  PPQ .   ? C PPQ 5902 ? 1_555 167.7 ? 
49  OE2 ? D  GLU 129 ? D GLU 129  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 ND1 ? D  HIS 269 ? D HIS 269  ? 1_555 83.0  ? 
50  OE2 ? D  GLU 129 ? D GLU 129  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 OE2 ? D  GLU 357 ? D GLU 357  ? 1_555 85.0  ? 
51  ND1 ? D  HIS 269 ? D HIS 269  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 OE2 ? D  GLU 357 ? D GLU 357  ? 1_555 92.6  ? 
52  OE2 ? D  GLU 129 ? D GLU 129  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O2B ? AA ADP .   ? D ADP 4474 ? 1_555 104.4 ? 
53  ND1 ? D  HIS 269 ? D HIS 269  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O2B ? AA ADP .   ? D ADP 4474 ? 1_555 162.7 ? 
54  OE2 ? D  GLU 357 ? D GLU 357  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O2B ? AA ADP .   ? D ADP 4474 ? 1_555 72.9  ? 
55  OE2 ? D  GLU 129 ? D GLU 129  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O3B ? AA ADP .   ? D ADP 4474 ? 1_555 80.5  ? 
56  ND1 ? D  HIS 269 ? D HIS 269  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O3B ? AA ADP .   ? D ADP 4474 ? 1_555 133.2 ? 
57  OE2 ? D  GLU 357 ? D GLU 357  ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O3B ? AA ADP .   ? D ADP 4474 ? 1_555 128.8 ? 
58  O2B ? AA ADP .   ? D ADP 4474 ? 1_555 MN ? Z  MN . ? D MN 470 ? 1_555 O3B ? AA ADP .   ? D ADP 4474 ? 1_555 64.0  ? 
59  OE1 ? D  GLU 131 ? D GLU 131  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OE1 B D  GLU 212 ? D GLU 212  ? 1_555 106.1 ? 
60  OE1 ? D  GLU 131 ? D GLU 131  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OE1 A D  GLU 220 ? D GLU 220  ? 1_555 85.3  ? 
61  OE1 B D  GLU 212 ? D GLU 212  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OE1 A D  GLU 220 ? D GLU 220  ? 1_555 104.0 ? 
62  OE1 ? D  GLU 131 ? D GLU 131  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OEA ? BA PPQ .   ? D PPQ 5903 ? 1_555 83.3  ? 
63  OE1 B D  GLU 212 ? D GLU 212  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OEA ? BA PPQ .   ? D PPQ 5903 ? 1_555 74.9  ? 
64  OE1 A D  GLU 220 ? D GLU 220  ? 1_555 MN ? Y  MN . ? D MN 469 ? 1_555 OEA ? BA PPQ .   ? D PPQ 5903 ? 1_555 167.7 ? 
65  OE2 ? E  GLU 129 ? E GLU 129  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 ND1 ? E  HIS 269 ? E HIS 269  ? 1_555 83.0  ? 
66  OE2 ? E  GLU 129 ? E GLU 129  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 OE2 ? E  GLU 357 ? E GLU 357  ? 1_555 85.0  ? 
67  ND1 ? E  HIS 269 ? E HIS 269  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 OE2 ? E  GLU 357 ? E GLU 357  ? 1_555 92.6  ? 
68  OE2 ? E  GLU 129 ? E GLU 129  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O2B ? EA ADP .   ? E ADP 4475 ? 1_555 104.4 ? 
69  ND1 ? E  HIS 269 ? E HIS 269  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O2B ? EA ADP .   ? E ADP 4475 ? 1_555 162.7 ? 
70  OE2 ? E  GLU 357 ? E GLU 357  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O2B ? EA ADP .   ? E ADP 4475 ? 1_555 72.8  ? 
71  OE2 ? E  GLU 129 ? E GLU 129  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O3B ? EA ADP .   ? E ADP 4475 ? 1_555 80.5  ? 
72  ND1 ? E  HIS 269 ? E HIS 269  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O3B ? EA ADP .   ? E ADP 4475 ? 1_555 133.2 ? 
73  OE2 ? E  GLU 357 ? E GLU 357  ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O3B ? EA ADP .   ? E ADP 4475 ? 1_555 128.8 ? 
74  O2B ? EA ADP .   ? E ADP 4475 ? 1_555 MN ? DA MN . ? E MN 470 ? 1_555 O3B ? EA ADP .   ? E ADP 4475 ? 1_555 64.0  ? 
75  OE1 ? E  GLU 131 ? E GLU 131  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OE1 B E  GLU 212 ? E GLU 212  ? 1_555 106.1 ? 
76  OE1 ? E  GLU 131 ? E GLU 131  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OE1 A E  GLU 220 ? E GLU 220  ? 1_555 85.3  ? 
77  OE1 B E  GLU 212 ? E GLU 212  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OE1 A E  GLU 220 ? E GLU 220  ? 1_555 104.1 ? 
78  OE1 ? E  GLU 131 ? E GLU 131  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OEA ? FA PPQ .   ? E PPQ 5904 ? 1_555 83.2  ? 
79  OE1 B E  GLU 212 ? E GLU 212  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OEA ? FA PPQ .   ? E PPQ 5904 ? 1_555 74.9  ? 
80  OE1 A E  GLU 220 ? E GLU 220  ? 1_555 MN ? CA MN . ? E MN 469 ? 1_555 OEA ? FA PPQ .   ? E PPQ 5904 ? 1_555 167.6 ? 
81  OE2 ? F  GLU 129 ? F GLU 129  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 ND1 ? F  HIS 269 ? F HIS 269  ? 1_555 83.0  ? 
82  OE2 ? F  GLU 129 ? F GLU 129  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 OE2 ? F  GLU 357 ? F GLU 357  ? 1_555 85.1  ? 
83  ND1 ? F  HIS 269 ? F HIS 269  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 OE2 ? F  GLU 357 ? F GLU 357  ? 1_555 92.6  ? 
84  OE2 ? F  GLU 129 ? F GLU 129  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O2B ? IA ADP .   ? F ADP 4476 ? 1_555 104.4 ? 
85  ND1 ? F  HIS 269 ? F HIS 269  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O2B ? IA ADP .   ? F ADP 4476 ? 1_555 162.7 ? 
86  OE2 ? F  GLU 357 ? F GLU 357  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O2B ? IA ADP .   ? F ADP 4476 ? 1_555 72.9  ? 
87  OE2 ? F  GLU 129 ? F GLU 129  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O3B ? IA ADP .   ? F ADP 4476 ? 1_555 80.5  ? 
88  ND1 ? F  HIS 269 ? F HIS 269  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O3B ? IA ADP .   ? F ADP 4476 ? 1_555 133.2 ? 
89  OE2 ? F  GLU 357 ? F GLU 357  ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O3B ? IA ADP .   ? F ADP 4476 ? 1_555 128.8 ? 
90  O2B ? IA ADP .   ? F ADP 4476 ? 1_555 MN ? HA MN . ? F MN 470 ? 1_555 O3B ? IA ADP .   ? F ADP 4476 ? 1_555 63.9  ? 
91  OE1 ? F  GLU 131 ? F GLU 131  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OE1 B F  GLU 212 ? F GLU 212  ? 1_555 106.1 ? 
92  OE1 ? F  GLU 131 ? F GLU 131  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OE1 A F  GLU 220 ? F GLU 220  ? 1_555 85.3  ? 
93  OE1 B F  GLU 212 ? F GLU 212  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OE1 A F  GLU 220 ? F GLU 220  ? 1_555 104.1 ? 
94  OE1 ? F  GLU 131 ? F GLU 131  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OEA ? JA PPQ .   ? F PPQ 5905 ? 1_555 83.2  ? 
95  OE1 B F  GLU 212 ? F GLU 212  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OEA ? JA PPQ .   ? F PPQ 5905 ? 1_555 74.9  ? 
96  OE1 A F  GLU 220 ? F GLU 220  ? 1_555 MN ? GA MN . ? F MN 469 ? 1_555 OEA ? JA PPQ .   ? F PPQ 5905 ? 1_555 167.6 ? 
97  OE2 ? G  GLU 129 ? G GLU 129  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 ND1 ? G  HIS 269 ? G HIS 269  ? 1_555 83.0  ? 
98  OE2 ? G  GLU 129 ? G GLU 129  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 OE2 ? G  GLU 357 ? G GLU 357  ? 1_555 85.0  ? 
99  ND1 ? G  HIS 269 ? G HIS 269  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 OE2 ? G  GLU 357 ? G GLU 357  ? 1_555 92.6  ? 
100 OE2 ? G  GLU 129 ? G GLU 129  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O2B ? MA ADP .   ? G ADP 4477 ? 1_555 104.4 ? 
101 ND1 ? G  HIS 269 ? G HIS 269  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O2B ? MA ADP .   ? G ADP 4477 ? 1_555 162.7 ? 
102 OE2 ? G  GLU 357 ? G GLU 357  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O2B ? MA ADP .   ? G ADP 4477 ? 1_555 72.9  ? 
103 OE2 ? G  GLU 129 ? G GLU 129  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O3B ? MA ADP .   ? G ADP 4477 ? 1_555 80.5  ? 
104 ND1 ? G  HIS 269 ? G HIS 269  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O3B ? MA ADP .   ? G ADP 4477 ? 1_555 133.2 ? 
105 OE2 ? G  GLU 357 ? G GLU 357  ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O3B ? MA ADP .   ? G ADP 4477 ? 1_555 128.8 ? 
106 O2B ? MA ADP .   ? G ADP 4477 ? 1_555 MN ? LA MN . ? G MN 470 ? 1_555 O3B ? MA ADP .   ? G ADP 4477 ? 1_555 63.9  ? 
107 OE1 ? G  GLU 131 ? G GLU 131  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OE1 B G  GLU 212 ? G GLU 212  ? 1_555 106.1 ? 
108 OE1 ? G  GLU 131 ? G GLU 131  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OE1 A G  GLU 220 ? G GLU 220  ? 1_555 85.3  ? 
109 OE1 B G  GLU 212 ? G GLU 212  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OE1 A G  GLU 220 ? G GLU 220  ? 1_555 104.1 ? 
110 OE1 ? G  GLU 131 ? G GLU 131  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OEA ? NA PPQ .   ? G PPQ 5906 ? 1_555 83.2  ? 
111 OE1 B G  GLU 212 ? G GLU 212  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OEA ? NA PPQ .   ? G PPQ 5906 ? 1_555 74.9  ? 
112 OE1 A G  GLU 220 ? G GLU 220  ? 1_555 MN ? KA MN . ? G MN 469 ? 1_555 OEA ? NA PPQ .   ? G PPQ 5906 ? 1_555 167.6 ? 
113 OE2 ? H  GLU 129 ? H GLU 129  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 ND1 ? H  HIS 269 ? H HIS 269  ? 1_555 83.0  ? 
114 OE2 ? H  GLU 129 ? H GLU 129  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 OE2 ? H  GLU 357 ? H GLU 357  ? 1_555 85.0  ? 
115 ND1 ? H  HIS 269 ? H HIS 269  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 OE2 ? H  GLU 357 ? H GLU 357  ? 1_555 92.6  ? 
116 OE2 ? H  GLU 129 ? H GLU 129  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O2B ? QA ADP .   ? H ADP 4478 ? 1_555 104.4 ? 
117 ND1 ? H  HIS 269 ? H HIS 269  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O2B ? QA ADP .   ? H ADP 4478 ? 1_555 162.7 ? 
118 OE2 ? H  GLU 357 ? H GLU 357  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O2B ? QA ADP .   ? H ADP 4478 ? 1_555 72.8  ? 
119 OE2 ? H  GLU 129 ? H GLU 129  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O3B ? QA ADP .   ? H ADP 4478 ? 1_555 80.5  ? 
120 ND1 ? H  HIS 269 ? H HIS 269  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O3B ? QA ADP .   ? H ADP 4478 ? 1_555 133.2 ? 
121 OE2 ? H  GLU 357 ? H GLU 357  ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O3B ? QA ADP .   ? H ADP 4478 ? 1_555 128.8 ? 
122 O2B ? QA ADP .   ? H ADP 4478 ? 1_555 MN ? PA MN . ? H MN 470 ? 1_555 O3B ? QA ADP .   ? H ADP 4478 ? 1_555 64.0  ? 
123 OE1 ? H  GLU 131 ? H GLU 131  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OE1 B H  GLU 212 ? H GLU 212  ? 1_555 106.1 ? 
124 OE1 ? H  GLU 131 ? H GLU 131  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OE1 A H  GLU 220 ? H GLU 220  ? 1_555 85.3  ? 
125 OE1 B H  GLU 212 ? H GLU 212  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OE1 A H  GLU 220 ? H GLU 220  ? 1_555 104.0 ? 
126 OE1 ? H  GLU 131 ? H GLU 131  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OEA ? RA PPQ .   ? H PPQ 5907 ? 1_555 83.3  ? 
127 OE1 B H  GLU 212 ? H GLU 212  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OEA ? RA PPQ .   ? H PPQ 5907 ? 1_555 74.9  ? 
128 OE1 A H  GLU 220 ? H GLU 220  ? 1_555 MN ? OA MN . ? H MN 469 ? 1_555 OEA ? RA PPQ .   ? H PPQ 5907 ? 1_555 167.7 ? 
129 OE2 ? I  GLU 129 ? I GLU 129  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 ND1 ? I  HIS 269 ? I HIS 269  ? 1_555 83.0  ? 
130 OE2 ? I  GLU 129 ? I GLU 129  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 OE2 ? I  GLU 357 ? I GLU 357  ? 1_555 85.0  ? 
131 ND1 ? I  HIS 269 ? I HIS 269  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 OE2 ? I  GLU 357 ? I GLU 357  ? 1_555 92.6  ? 
132 OE2 ? I  GLU 129 ? I GLU 129  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O2B ? UA ADP .   ? I ADP 4479 ? 1_555 104.4 ? 
133 ND1 ? I  HIS 269 ? I HIS 269  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O2B ? UA ADP .   ? I ADP 4479 ? 1_555 162.7 ? 
134 OE2 ? I  GLU 357 ? I GLU 357  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O2B ? UA ADP .   ? I ADP 4479 ? 1_555 72.8  ? 
135 OE2 ? I  GLU 129 ? I GLU 129  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O3B ? UA ADP .   ? I ADP 4479 ? 1_555 80.5  ? 
136 ND1 ? I  HIS 269 ? I HIS 269  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O3B ? UA ADP .   ? I ADP 4479 ? 1_555 133.2 ? 
137 OE2 ? I  GLU 357 ? I GLU 357  ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O3B ? UA ADP .   ? I ADP 4479 ? 1_555 128.8 ? 
138 O2B ? UA ADP .   ? I ADP 4479 ? 1_555 MN ? TA MN . ? I MN 470 ? 1_555 O3B ? UA ADP .   ? I ADP 4479 ? 1_555 64.0  ? 
139 OE1 ? I  GLU 131 ? I GLU 131  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OE1 B I  GLU 212 ? I GLU 212  ? 1_555 106.1 ? 
140 OE1 ? I  GLU 131 ? I GLU 131  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OE1 A I  GLU 220 ? I GLU 220  ? 1_555 85.3  ? 
141 OE1 B I  GLU 212 ? I GLU 212  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OE1 A I  GLU 220 ? I GLU 220  ? 1_555 104.1 ? 
142 OE1 ? I  GLU 131 ? I GLU 131  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OEA ? VA PPQ .   ? I PPQ 5908 ? 1_555 83.3  ? 
143 OE1 B I  GLU 212 ? I GLU 212  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OEA ? VA PPQ .   ? I PPQ 5908 ? 1_555 75.0  ? 
144 OE1 A I  GLU 220 ? I GLU 220  ? 1_555 MN ? SA MN . ? I MN 469 ? 1_555 OEA ? VA PPQ .   ? I PPQ 5908 ? 1_555 167.7 ? 
145 OE2 ? J  GLU 129 ? J GLU 129  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 ND1 ? J  HIS 269 ? J HIS 269  ? 1_555 83.0  ? 
146 OE2 ? J  GLU 129 ? J GLU 129  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 OE2 ? J  GLU 357 ? J GLU 357  ? 1_555 85.0  ? 
147 ND1 ? J  HIS 269 ? J HIS 269  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 OE2 ? J  GLU 357 ? J GLU 357  ? 1_555 92.6  ? 
148 OE2 ? J  GLU 129 ? J GLU 129  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O2B ? YA ADP .   ? J ADP 4480 ? 1_555 104.4 ? 
149 ND1 ? J  HIS 269 ? J HIS 269  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O2B ? YA ADP .   ? J ADP 4480 ? 1_555 162.7 ? 
150 OE2 ? J  GLU 357 ? J GLU 357  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O2B ? YA ADP .   ? J ADP 4480 ? 1_555 72.9  ? 
151 OE2 ? J  GLU 129 ? J GLU 129  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O3B ? YA ADP .   ? J ADP 4480 ? 1_555 80.5  ? 
152 ND1 ? J  HIS 269 ? J HIS 269  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O3B ? YA ADP .   ? J ADP 4480 ? 1_555 133.2 ? 
153 OE2 ? J  GLU 357 ? J GLU 357  ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O3B ? YA ADP .   ? J ADP 4480 ? 1_555 128.8 ? 
154 O2B ? YA ADP .   ? J ADP 4480 ? 1_555 MN ? XA MN . ? J MN 470 ? 1_555 O3B ? YA ADP .   ? J ADP 4480 ? 1_555 64.0  ? 
155 OE1 ? J  GLU 131 ? J GLU 131  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OE1 B J  GLU 212 ? J GLU 212  ? 1_555 106.1 ? 
156 OE1 ? J  GLU 131 ? J GLU 131  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OE1 A J  GLU 220 ? J GLU 220  ? 1_555 85.3  ? 
157 OE1 B J  GLU 212 ? J GLU 212  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OE1 A J  GLU 220 ? J GLU 220  ? 1_555 104.1 ? 
158 OE1 ? J  GLU 131 ? J GLU 131  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OEA ? ZA PPQ .   ? J PPQ 5909 ? 1_555 83.2  ? 
159 OE1 B J  GLU 212 ? J GLU 212  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OEA ? ZA PPQ .   ? J PPQ 5909 ? 1_555 74.9  ? 
160 OE1 A J  GLU 220 ? J GLU 220  ? 1_555 MN ? WA MN . ? J MN 469 ? 1_555 OEA ? ZA PPQ .   ? J PPQ 5909 ? 1_555 167.7 ? 
161 OE2 ? K  GLU 129 ? K GLU 129  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 ND1 ? K  HIS 269 ? K HIS 269  ? 1_555 83.0  ? 
162 OE2 ? K  GLU 129 ? K GLU 129  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 OE2 ? K  GLU 357 ? K GLU 357  ? 1_555 85.0  ? 
163 ND1 ? K  HIS 269 ? K HIS 269  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 OE2 ? K  GLU 357 ? K GLU 357  ? 1_555 92.6  ? 
164 OE2 ? K  GLU 129 ? K GLU 129  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O2B ? CB ADP .   ? K ADP 4481 ? 1_555 104.4 ? 
165 ND1 ? K  HIS 269 ? K HIS 269  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O2B ? CB ADP .   ? K ADP 4481 ? 1_555 162.7 ? 
166 OE2 ? K  GLU 357 ? K GLU 357  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O2B ? CB ADP .   ? K ADP 4481 ? 1_555 72.9  ? 
167 OE2 ? K  GLU 129 ? K GLU 129  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O3B ? CB ADP .   ? K ADP 4481 ? 1_555 80.5  ? 
168 ND1 ? K  HIS 269 ? K HIS 269  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O3B ? CB ADP .   ? K ADP 4481 ? 1_555 133.2 ? 
169 OE2 ? K  GLU 357 ? K GLU 357  ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O3B ? CB ADP .   ? K ADP 4481 ? 1_555 128.8 ? 
170 O2B ? CB ADP .   ? K ADP 4481 ? 1_555 MN ? BB MN . ? K MN 470 ? 1_555 O3B ? CB ADP .   ? K ADP 4481 ? 1_555 64.0  ? 
171 OE1 ? K  GLU 131 ? K GLU 131  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OE1 B K  GLU 212 ? K GLU 212  ? 1_555 106.1 ? 
172 OE1 ? K  GLU 131 ? K GLU 131  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OE1 A K  GLU 220 ? K GLU 220  ? 1_555 85.3  ? 
173 OE1 B K  GLU 212 ? K GLU 212  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OE1 A K  GLU 220 ? K GLU 220  ? 1_555 104.1 ? 
174 OE1 ? K  GLU 131 ? K GLU 131  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OEA ? DB PPQ .   ? K PPQ 5910 ? 1_555 83.2  ? 
175 OE1 B K  GLU 212 ? K GLU 212  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OEA ? DB PPQ .   ? K PPQ 5910 ? 1_555 74.9  ? 
176 OE1 A K  GLU 220 ? K GLU 220  ? 1_555 MN ? AB MN . ? K MN 469 ? 1_555 OEA ? DB PPQ .   ? K PPQ 5910 ? 1_555 167.7 ? 
177 OE2 ? L  GLU 129 ? L GLU 129  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 ND1 ? L  HIS 269 ? L HIS 269  ? 1_555 83.0  ? 
178 OE2 ? L  GLU 129 ? L GLU 129  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 OE2 ? L  GLU 357 ? L GLU 357  ? 1_555 85.0  ? 
179 ND1 ? L  HIS 269 ? L HIS 269  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 OE2 ? L  GLU 357 ? L GLU 357  ? 1_555 92.6  ? 
180 OE2 ? L  GLU 129 ? L GLU 129  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O2B ? GB ADP .   ? L ADP 4482 ? 1_555 104.4 ? 
181 ND1 ? L  HIS 269 ? L HIS 269  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O2B ? GB ADP .   ? L ADP 4482 ? 1_555 162.7 ? 
182 OE2 ? L  GLU 357 ? L GLU 357  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O2B ? GB ADP .   ? L ADP 4482 ? 1_555 72.9  ? 
183 OE2 ? L  GLU 129 ? L GLU 129  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O3B ? GB ADP .   ? L ADP 4482 ? 1_555 80.5  ? 
184 ND1 ? L  HIS 269 ? L HIS 269  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O3B ? GB ADP .   ? L ADP 4482 ? 1_555 133.3 ? 
185 OE2 ? L  GLU 357 ? L GLU 357  ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O3B ? GB ADP .   ? L ADP 4482 ? 1_555 128.8 ? 
186 O2B ? GB ADP .   ? L ADP 4482 ? 1_555 MN ? FB MN . ? L MN 470 ? 1_555 O3B ? GB ADP .   ? L ADP 4482 ? 1_555 64.0  ? 
187 OE1 ? L  GLU 131 ? L GLU 131  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OE1 B L  GLU 212 ? L GLU 212  ? 1_555 106.1 ? 
188 OE1 ? L  GLU 131 ? L GLU 131  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OE1 A L  GLU 220 ? L GLU 220  ? 1_555 85.3  ? 
189 OE1 B L  GLU 212 ? L GLU 212  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OE1 A L  GLU 220 ? L GLU 220  ? 1_555 104.1 ? 
190 OE1 ? L  GLU 131 ? L GLU 131  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OEA ? HB PPQ .   ? L PPQ 5911 ? 1_555 83.3  ? 
191 OE1 B L  GLU 212 ? L GLU 212  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OEA ? HB PPQ .   ? L PPQ 5911 ? 1_555 74.9  ? 
192 OE1 A L  GLU 220 ? L GLU 220  ? 1_555 MN ? EB MN . ? L MN 469 ? 1_555 OEA ? HB PPQ .   ? L PPQ 5911 ? 1_555 167.7 ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PRO 183 A . ? PRO 183 A PRO 184 A ? PRO 184 A 1 -0.61 
2  PRO 183 B . ? PRO 183 B PRO 184 B ? PRO 184 B 1 -0.55 
3  PRO 183 C . ? PRO 183 C PRO 184 C ? PRO 184 C 1 -0.61 
4  PRO 183 D . ? PRO 183 D PRO 184 D ? PRO 184 D 1 -0.61 
5  PRO 183 E . ? PRO 183 E PRO 184 E ? PRO 184 E 1 -0.62 
6  PRO 183 F . ? PRO 183 F PRO 184 F ? PRO 184 F 1 -0.54 
7  PRO 183 G . ? PRO 183 G PRO 184 G ? PRO 184 G 1 -0.63 
8  PRO 183 H . ? PRO 183 H PRO 184 H ? PRO 184 H 1 -0.55 
9  PRO 183 I . ? PRO 183 I PRO 184 I ? PRO 184 I 1 -0.63 
10 PRO 183 J . ? PRO 183 J PRO 184 J ? PRO 184 J 1 -0.54 
11 PRO 183 K . ? PRO 183 K PRO 184 K ? PRO 184 K 1 -0.61 
12 PRO 183 L . ? PRO 183 L PRO 184 L ? PRO 184 L 1 -0.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7  ? 
B  ? 13 ? 
C  ? 4  ? 
D  ? 2  ? 
E  ? 7  ? 
F  ? 13 ? 
G  ? 4  ? 
H  ? 2  ? 
I  ? 7  ? 
J  ? 13 ? 
K  ? 4  ? 
L  ? 2  ? 
M  ? 7  ? 
N  ? 13 ? 
O  ? 4  ? 
P  ? 2  ? 
Q  ? 7  ? 
R  ? 13 ? 
S  ? 4  ? 
T  ? 2  ? 
U  ? 7  ? 
V  ? 13 ? 
W  ? 4  ? 
X  ? 2  ? 
Y  ? 7  ? 
Z  ? 13 ? 
AA ? 2  ? 
BB ? 7  ? 
CC ? 13 ? 
DD ? 2  ? 
EE ? 7  ? 
FF ? 13 ? 
GG ? 2  ? 
HH ? 7  ? 
II ? 13 ? 
JJ ? 2  ? 
KK ? 7  ? 
LL ? 13 ? 
MM ? 2  ? 
NN ? 7  ? 
OO ? 13 ? 
PP ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1  2  ? anti-parallel 
A  2  3  ? parallel      
A  3  4  ? anti-parallel 
A  4  5  ? anti-parallel 
A  5  6  ? anti-parallel 
A  6  7  ? anti-parallel 
B  1  2  ? anti-parallel 
B  2  3  ? anti-parallel 
B  3  4  ? anti-parallel 
B  4  5  ? anti-parallel 
B  5  6  ? anti-parallel 
B  6  7  ? anti-parallel 
B  7  8  ? anti-parallel 
B  8  9  ? anti-parallel 
B  9  10 ? anti-parallel 
B  10 11 ? anti-parallel 
B  11 12 ? anti-parallel 
B  12 13 ? parallel      
C  1  2  ? anti-parallel 
C  2  3  ? anti-parallel 
C  3  4  ? anti-parallel 
D  1  2  ? parallel      
E  1  2  ? anti-parallel 
E  2  3  ? parallel      
E  3  4  ? anti-parallel 
E  4  5  ? anti-parallel 
E  5  6  ? anti-parallel 
E  6  7  ? anti-parallel 
F  1  2  ? anti-parallel 
F  2  3  ? anti-parallel 
F  3  4  ? anti-parallel 
F  4  5  ? anti-parallel 
F  5  6  ? anti-parallel 
F  6  7  ? anti-parallel 
F  7  8  ? anti-parallel 
F  8  9  ? anti-parallel 
F  9  10 ? anti-parallel 
F  10 11 ? anti-parallel 
F  11 12 ? anti-parallel 
F  12 13 ? parallel      
G  1  2  ? anti-parallel 
G  2  3  ? anti-parallel 
G  3  4  ? anti-parallel 
H  1  2  ? parallel      
I  1  2  ? anti-parallel 
I  2  3  ? parallel      
I  3  4  ? anti-parallel 
I  4  5  ? anti-parallel 
I  5  6  ? anti-parallel 
I  6  7  ? anti-parallel 
J  1  2  ? anti-parallel 
J  2  3  ? anti-parallel 
J  3  4  ? anti-parallel 
J  4  5  ? anti-parallel 
J  5  6  ? anti-parallel 
J  6  7  ? anti-parallel 
J  7  8  ? anti-parallel 
J  8  9  ? anti-parallel 
J  9  10 ? anti-parallel 
J  10 11 ? anti-parallel 
J  11 12 ? anti-parallel 
J  12 13 ? parallel      
K  1  2  ? anti-parallel 
K  2  3  ? anti-parallel 
K  3  4  ? anti-parallel 
L  1  2  ? parallel      
M  1  2  ? anti-parallel 
M  2  3  ? parallel      
M  3  4  ? anti-parallel 
M  4  5  ? anti-parallel 
M  5  6  ? anti-parallel 
M  6  7  ? anti-parallel 
N  1  2  ? anti-parallel 
N  2  3  ? anti-parallel 
N  3  4  ? anti-parallel 
N  4  5  ? anti-parallel 
N  5  6  ? anti-parallel 
N  6  7  ? anti-parallel 
N  7  8  ? anti-parallel 
N  8  9  ? anti-parallel 
N  9  10 ? anti-parallel 
N  10 11 ? anti-parallel 
N  11 12 ? anti-parallel 
N  12 13 ? parallel      
O  1  2  ? anti-parallel 
O  2  3  ? anti-parallel 
O  3  4  ? anti-parallel 
P  1  2  ? parallel      
Q  1  2  ? anti-parallel 
Q  2  3  ? parallel      
Q  3  4  ? anti-parallel 
Q  4  5  ? anti-parallel 
Q  5  6  ? anti-parallel 
Q  6  7  ? anti-parallel 
R  1  2  ? anti-parallel 
R  2  3  ? anti-parallel 
R  3  4  ? anti-parallel 
R  4  5  ? anti-parallel 
R  5  6  ? anti-parallel 
R  6  7  ? anti-parallel 
R  7  8  ? anti-parallel 
R  8  9  ? anti-parallel 
R  9  10 ? anti-parallel 
R  10 11 ? anti-parallel 
R  11 12 ? anti-parallel 
R  12 13 ? parallel      
S  1  2  ? anti-parallel 
S  2  3  ? anti-parallel 
S  3  4  ? anti-parallel 
T  1  2  ? parallel      
U  1  2  ? anti-parallel 
U  2  3  ? parallel      
U  3  4  ? anti-parallel 
U  4  5  ? anti-parallel 
U  5  6  ? anti-parallel 
U  6  7  ? anti-parallel 
V  1  2  ? anti-parallel 
V  2  3  ? anti-parallel 
V  3  4  ? anti-parallel 
V  4  5  ? anti-parallel 
V  5  6  ? anti-parallel 
V  6  7  ? anti-parallel 
V  7  8  ? anti-parallel 
V  8  9  ? anti-parallel 
V  9  10 ? anti-parallel 
V  10 11 ? anti-parallel 
V  11 12 ? anti-parallel 
V  12 13 ? parallel      
W  1  2  ? anti-parallel 
W  2  3  ? anti-parallel 
W  3  4  ? anti-parallel 
X  1  2  ? parallel      
Y  1  2  ? anti-parallel 
Y  2  3  ? parallel      
Y  3  4  ? anti-parallel 
Y  4  5  ? anti-parallel 
Y  5  6  ? anti-parallel 
Y  6  7  ? anti-parallel 
Z  1  2  ? anti-parallel 
Z  2  3  ? anti-parallel 
Z  3  4  ? anti-parallel 
Z  4  5  ? anti-parallel 
Z  5  6  ? anti-parallel 
Z  6  7  ? anti-parallel 
Z  7  8  ? anti-parallel 
Z  8  9  ? anti-parallel 
Z  9  10 ? anti-parallel 
Z  10 11 ? anti-parallel 
Z  11 12 ? anti-parallel 
Z  12 13 ? parallel      
AA 1  2  ? parallel      
BB 1  2  ? anti-parallel 
BB 2  3  ? parallel      
BB 3  4  ? anti-parallel 
BB 4  5  ? anti-parallel 
BB 5  6  ? anti-parallel 
BB 6  7  ? anti-parallel 
CC 1  2  ? anti-parallel 
CC 2  3  ? anti-parallel 
CC 3  4  ? anti-parallel 
CC 4  5  ? anti-parallel 
CC 5  6  ? anti-parallel 
CC 6  7  ? anti-parallel 
CC 7  8  ? anti-parallel 
CC 8  9  ? anti-parallel 
CC 9  10 ? anti-parallel 
CC 10 11 ? anti-parallel 
CC 11 12 ? anti-parallel 
CC 12 13 ? parallel      
DD 1  2  ? parallel      
EE 1  2  ? anti-parallel 
EE 2  3  ? parallel      
EE 3  4  ? anti-parallel 
EE 4  5  ? anti-parallel 
EE 5  6  ? anti-parallel 
EE 6  7  ? anti-parallel 
FF 1  2  ? anti-parallel 
FF 2  3  ? anti-parallel 
FF 3  4  ? anti-parallel 
FF 4  5  ? anti-parallel 
FF 5  6  ? anti-parallel 
FF 6  7  ? anti-parallel 
FF 7  8  ? anti-parallel 
FF 8  9  ? anti-parallel 
FF 9  10 ? anti-parallel 
FF 10 11 ? anti-parallel 
FF 11 12 ? anti-parallel 
FF 12 13 ? parallel      
GG 1  2  ? parallel      
HH 1  2  ? anti-parallel 
HH 2  3  ? parallel      
HH 3  4  ? anti-parallel 
HH 4  5  ? anti-parallel 
HH 5  6  ? anti-parallel 
HH 6  7  ? anti-parallel 
II 1  2  ? anti-parallel 
II 2  3  ? anti-parallel 
II 3  4  ? anti-parallel 
II 4  5  ? anti-parallel 
II 5  6  ? anti-parallel 
II 6  7  ? anti-parallel 
II 7  8  ? anti-parallel 
II 8  9  ? anti-parallel 
II 9  10 ? anti-parallel 
II 10 11 ? anti-parallel 
II 11 12 ? anti-parallel 
II 12 13 ? parallel      
JJ 1  2  ? parallel      
KK 1  2  ? anti-parallel 
KK 2  3  ? parallel      
KK 3  4  ? anti-parallel 
KK 4  5  ? anti-parallel 
KK 5  6  ? anti-parallel 
KK 6  7  ? anti-parallel 
LL 1  2  ? anti-parallel 
LL 2  3  ? anti-parallel 
LL 3  4  ? anti-parallel 
LL 4  5  ? anti-parallel 
LL 5  6  ? anti-parallel 
LL 6  7  ? anti-parallel 
LL 7  8  ? anti-parallel 
LL 8  9  ? anti-parallel 
LL 9  10 ? anti-parallel 
LL 10 11 ? anti-parallel 
LL 11 12 ? anti-parallel 
LL 12 13 ? parallel      
MM 1  2  ? parallel      
NN 1  2  ? anti-parallel 
NN 2  3  ? parallel      
NN 3  4  ? anti-parallel 
NN 4  5  ? anti-parallel 
NN 5  6  ? anti-parallel 
NN 6  7  ? anti-parallel 
OO 1  2  ? anti-parallel 
OO 2  3  ? anti-parallel 
OO 3  4  ? anti-parallel 
OO 4  5  ? anti-parallel 
OO 5  6  ? anti-parallel 
OO 6  7  ? anti-parallel 
OO 7  8  ? anti-parallel 
OO 8  9  ? anti-parallel 
OO 9  10 ? anti-parallel 
OO 10 11 ? anti-parallel 
OO 11 12 ? anti-parallel 
OO 12 13 ? parallel      
PP 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1  GLU A 28  ? PRO A 34  ? GLU A 28  PRO A 34  
A  2  PHE A 16  ? THR A 22  ? PHE A 16  THR A 22  
A  3  THR A 84  ? LEU A 92  ? THR A 84  LEU A 92  
A  4  VAL A 75  ? ILE A 76  ? VAL A 75  ILE A 76  
A  5  THR A 84  ? LEU A 92  ? THR A 84  LEU A 92  
A  6  ASP A 64  ? PRO A 69  ? ASP A 64  PRO A 69  
A  7  LYS A 47  ? ASP A 50  ? LYS A 47  ASP A 50  
B  1  VAL A 206 ? HIS A 211 ? VAL A 206 HIS A 211 
B  2  GLN A 218 ? THR A 223 ? GLN A 218 THR A 223 
B  3  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  4  THR A 252 ? THR A 254 ? THR A 252 THR A 254 
B  5  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  6  ASN A 226 ? THR A 227 ? ASN A 226 THR A 227 
B  7  THR A 123 ? PHE A 135 ? THR A 123 PHE A 135 
B  8  MET A 268 ? LYS A 276 ? MET A 268 LYS A 276 
B  9  THR A 279 ? ASN A 280 ? THR A 279 ASN A 280 
B  10 MET A 268 ? LYS A 276 ? MET A 268 LYS A 276 
B  11 ILE A 356 ? VAL A 358 ? ILE A 356 VAL A 358 
B  12 ALA A 341 ? ARG A 344 ? ALA A 341 ARG A 344 
B  13 MET A 331 ? SER A 335 ? MET A 331 SER A 335 
C  1  ASP A 137 ? SER A 143 ? ASP A 137 SER A 143 
C  2  GLY A 146 ? ASP A 152 ? GLY A 146 ASP A 152 
C  3  GLY G 146 ? ASP G 152 ? GLY G 146 ASP G 152 
C  4  ASP G 137 ? SER G 143 ? ASP G 137 SER G 143 
D  1  GLY A 265 ? SER A 266 ? GLY A 265 SER A 266 
D  2  GLY A 265 ? SER A 266 ? GLY A 265 SER A 266 
E  1  GLU B 28  ? PRO B 34  ? GLU B 28  PRO B 34  
E  2  PHE B 16  ? THR B 22  ? PHE B 16  THR B 22  
E  3  THR B 84  ? LEU B 92  ? THR B 84  LEU B 92  
E  4  VAL B 75  ? ILE B 76  ? VAL B 75  ILE B 76  
E  5  THR B 84  ? LEU B 92  ? THR B 84  LEU B 92  
E  6  ASP B 64  ? PRO B 69  ? ASP B 64  PRO B 69  
E  7  LYS B 47  ? ASP B 50  ? LYS B 47  ASP B 50  
F  1  VAL B 206 ? HIS B 211 ? VAL B 206 HIS B 211 
F  2  GLN B 218 ? THR B 223 ? GLN B 218 THR B 223 
F  3  THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
F  4  ASN B 226 ? THR B 227 ? ASN B 226 THR B 227 
F  5  THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
F  6  THR B 252 ? THR B 254 ? THR B 252 THR B 254 
F  7  THR B 123 ? PHE B 135 ? THR B 123 PHE B 135 
F  8  MET B 268 ? LYS B 276 ? MET B 268 LYS B 276 
F  9  THR B 279 ? ASN B 280 ? THR B 279 ASN B 280 
F  10 MET B 268 ? LYS B 276 ? MET B 268 LYS B 276 
F  11 ILE B 356 ? VAL B 358 ? ILE B 356 VAL B 358 
F  12 ALA B 341 ? ARG B 344 ? ALA B 341 ARG B 344 
F  13 MET B 331 ? SER B 335 ? MET B 331 SER B 335 
G  1  ASP B 137 ? SER B 143 ? ASP B 137 SER B 143 
G  2  GLY B 146 ? ASP B 152 ? GLY B 146 ASP B 152 
G  3  GLY H 146 ? ASP H 152 ? GLY H 146 ASP H 152 
G  4  ASP H 137 ? SER H 143 ? ASP H 137 SER H 143 
H  1  GLY B 265 ? SER B 266 ? GLY B 265 SER B 266 
H  2  GLY B 265 ? SER B 266 ? GLY B 265 SER B 266 
I  1  GLU C 28  ? PRO C 34  ? GLU C 28  PRO C 34  
I  2  PHE C 16  ? THR C 22  ? PHE C 16  THR C 22  
I  3  THR C 84  ? LEU C 92  ? THR C 84  LEU C 92  
I  4  VAL C 75  ? ILE C 76  ? VAL C 75  ILE C 76  
I  5  THR C 84  ? LEU C 92  ? THR C 84  LEU C 92  
I  6  ASP C 64  ? PRO C 69  ? ASP C 64  PRO C 69  
I  7  LYS C 47  ? ASP C 50  ? LYS C 47  ASP C 50  
J  1  VAL C 206 ? HIS C 211 ? VAL C 206 HIS C 211 
J  2  GLN C 218 ? THR C 223 ? GLN C 218 THR C 223 
J  3  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
J  4  ASN C 226 ? THR C 227 ? ASN C 226 THR C 227 
J  5  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
J  6  THR C 252 ? THR C 254 ? THR C 252 THR C 254 
J  7  THR C 123 ? PHE C 135 ? THR C 123 PHE C 135 
J  8  MET C 268 ? LYS C 276 ? MET C 268 LYS C 276 
J  9  THR C 279 ? ASN C 280 ? THR C 279 ASN C 280 
J  10 MET C 268 ? LYS C 276 ? MET C 268 LYS C 276 
J  11 ILE C 356 ? VAL C 358 ? ILE C 356 VAL C 358 
J  12 ALA C 341 ? ARG C 344 ? ALA C 341 ARG C 344 
J  13 MET C 331 ? SER C 335 ? MET C 331 SER C 335 
K  1  ASP C 137 ? SER C 143 ? ASP C 137 SER C 143 
K  2  GLY C 146 ? ASP C 152 ? GLY C 146 ASP C 152 
K  3  GLY I 146 ? ASP I 152 ? GLY I 146 ASP I 152 
K  4  ASP I 137 ? SER I 143 ? ASP I 137 SER I 143 
L  1  GLY C 265 ? SER C 266 ? GLY C 265 SER C 266 
L  2  GLY C 265 ? SER C 266 ? GLY C 265 SER C 266 
M  1  GLU D 28  ? PRO D 34  ? GLU D 28  PRO D 34  
M  2  PHE D 16  ? THR D 22  ? PHE D 16  THR D 22  
M  3  THR D 84  ? LEU D 92  ? THR D 84  LEU D 92  
M  4  VAL D 75  ? ILE D 76  ? VAL D 75  ILE D 76  
M  5  THR D 84  ? LEU D 92  ? THR D 84  LEU D 92  
M  6  ASP D 64  ? PRO D 69  ? ASP D 64  PRO D 69  
M  7  LYS D 47  ? ASP D 50  ? LYS D 47  ASP D 50  
N  1  VAL D 206 ? HIS D 211 ? VAL D 206 HIS D 211 
N  2  GLN D 218 ? THR D 223 ? GLN D 218 THR D 223 
N  3  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
N  4  ASN D 226 ? THR D 227 ? ASN D 226 THR D 227 
N  5  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
N  6  THR D 252 ? THR D 254 ? THR D 252 THR D 254 
N  7  THR D 123 ? PHE D 135 ? THR D 123 PHE D 135 
N  8  MET D 268 ? LYS D 276 ? MET D 268 LYS D 276 
N  9  THR D 279 ? ASN D 280 ? THR D 279 ASN D 280 
N  10 MET D 268 ? LYS D 276 ? MET D 268 LYS D 276 
N  11 ILE D 356 ? VAL D 358 ? ILE D 356 VAL D 358 
N  12 ALA D 341 ? ARG D 344 ? ALA D 341 ARG D 344 
N  13 MET D 331 ? SER D 335 ? MET D 331 SER D 335 
O  1  ASP D 137 ? SER D 143 ? ASP D 137 SER D 143 
O  2  GLY D 146 ? ASP D 152 ? GLY D 146 ASP D 152 
O  3  GLY J 146 ? ASP J 152 ? GLY J 146 ASP J 152 
O  4  ASP J 137 ? SER J 143 ? ASP J 137 SER J 143 
P  1  GLY D 265 ? SER D 266 ? GLY D 265 SER D 266 
P  2  GLY D 265 ? SER D 266 ? GLY D 265 SER D 266 
Q  1  GLU E 28  ? PRO E 34  ? GLU E 28  PRO E 34  
Q  2  PHE E 16  ? THR E 22  ? PHE E 16  THR E 22  
Q  3  THR E 84  ? LEU E 92  ? THR E 84  LEU E 92  
Q  4  VAL E 75  ? ILE E 76  ? VAL E 75  ILE E 76  
Q  5  THR E 84  ? LEU E 92  ? THR E 84  LEU E 92  
Q  6  ASP E 64  ? PRO E 69  ? ASP E 64  PRO E 69  
Q  7  LYS E 47  ? ASP E 50  ? LYS E 47  ASP E 50  
R  1  VAL E 206 ? HIS E 211 ? VAL E 206 HIS E 211 
R  2  GLN E 218 ? THR E 223 ? GLN E 218 THR E 223 
R  3  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
R  4  ASN E 226 ? THR E 227 ? ASN E 226 THR E 227 
R  5  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
R  6  THR E 252 ? THR E 254 ? THR E 252 THR E 254 
R  7  THR E 123 ? PHE E 135 ? THR E 123 PHE E 135 
R  8  MET E 268 ? LYS E 276 ? MET E 268 LYS E 276 
R  9  THR E 279 ? ASN E 280 ? THR E 279 ASN E 280 
R  10 MET E 268 ? LYS E 276 ? MET E 268 LYS E 276 
R  11 ILE E 356 ? VAL E 358 ? ILE E 356 VAL E 358 
R  12 ALA E 341 ? ARG E 344 ? ALA E 341 ARG E 344 
R  13 MET E 331 ? SER E 335 ? MET E 331 SER E 335 
S  1  ASP E 137 ? SER E 143 ? ASP E 137 SER E 143 
S  2  GLY E 146 ? ASP E 152 ? GLY E 146 ASP E 152 
S  3  GLY K 146 ? ASP K 152 ? GLY K 146 ASP K 152 
S  4  ASP K 137 ? SER K 143 ? ASP K 137 SER K 143 
T  1  GLY E 265 ? SER E 266 ? GLY E 265 SER E 266 
T  2  GLY E 265 ? SER E 266 ? GLY E 265 SER E 266 
U  1  GLU F 28  ? PRO F 34  ? GLU F 28  PRO F 34  
U  2  PHE F 16  ? THR F 22  ? PHE F 16  THR F 22  
U  3  THR F 84  ? LEU F 92  ? THR F 84  LEU F 92  
U  4  VAL F 75  ? ILE F 76  ? VAL F 75  ILE F 76  
U  5  THR F 84  ? LEU F 92  ? THR F 84  LEU F 92  
U  6  ASP F 64  ? PRO F 69  ? ASP F 64  PRO F 69  
U  7  LYS F 47  ? ASP F 50  ? LYS F 47  ASP F 50  
V  1  VAL F 206 ? HIS F 211 ? VAL F 206 HIS F 211 
V  2  GLN F 218 ? THR F 223 ? GLN F 218 THR F 223 
V  3  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
V  4  ASN F 226 ? THR F 227 ? ASN F 226 THR F 227 
V  5  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
V  6  THR F 252 ? THR F 254 ? THR F 252 THR F 254 
V  7  THR F 123 ? PHE F 135 ? THR F 123 PHE F 135 
V  8  MET F 268 ? LYS F 276 ? MET F 268 LYS F 276 
V  9  THR F 279 ? ASN F 280 ? THR F 279 ASN F 280 
V  10 MET F 268 ? LYS F 276 ? MET F 268 LYS F 276 
V  11 ILE F 356 ? VAL F 358 ? ILE F 356 VAL F 358 
V  12 ALA F 341 ? ARG F 344 ? ALA F 341 ARG F 344 
V  13 MET F 331 ? SER F 335 ? MET F 331 SER F 335 
W  1  ASP F 137 ? SER F 143 ? ASP F 137 SER F 143 
W  2  GLY F 146 ? ASP F 152 ? GLY F 146 ASP F 152 
W  3  GLY L 146 ? ASP L 152 ? GLY L 146 ASP L 152 
W  4  ASP L 137 ? SER L 143 ? ASP L 137 SER L 143 
X  1  GLY F 265 ? SER F 266 ? GLY F 265 SER F 266 
X  2  GLY F 265 ? SER F 266 ? GLY F 265 SER F 266 
Y  1  GLU G 28  ? PRO G 34  ? GLU G 28  PRO G 34  
Y  2  PHE G 16  ? THR G 22  ? PHE G 16  THR G 22  
Y  3  THR G 84  ? LEU G 92  ? THR G 84  LEU G 92  
Y  4  VAL G 75  ? ILE G 76  ? VAL G 75  ILE G 76  
Y  5  THR G 84  ? LEU G 92  ? THR G 84  LEU G 92  
Y  6  ASP G 64  ? PRO G 69  ? ASP G 64  PRO G 69  
Y  7  LYS G 47  ? ASP G 50  ? LYS G 47  ASP G 50  
Z  1  VAL G 206 ? HIS G 211 ? VAL G 206 HIS G 211 
Z  2  GLN G 218 ? THR G 223 ? GLN G 218 THR G 223 
Z  3  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
Z  4  ASN G 226 ? THR G 227 ? ASN G 226 THR G 227 
Z  5  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
Z  6  THR G 252 ? THR G 254 ? THR G 252 THR G 254 
Z  7  THR G 123 ? PHE G 135 ? THR G 123 PHE G 135 
Z  8  MET G 268 ? LYS G 276 ? MET G 268 LYS G 276 
Z  9  THR G 279 ? ASN G 280 ? THR G 279 ASN G 280 
Z  10 MET G 268 ? LYS G 276 ? MET G 268 LYS G 276 
Z  11 ILE G 356 ? VAL G 358 ? ILE G 356 VAL G 358 
Z  12 ALA G 341 ? ARG G 344 ? ALA G 341 ARG G 344 
Z  13 MET G 331 ? SER G 335 ? MET G 331 SER G 335 
AA 1  GLY G 265 ? SER G 266 ? GLY G 265 SER G 266 
AA 2  GLY G 265 ? SER G 266 ? GLY G 265 SER G 266 
BB 1  GLU H 28  ? PRO H 34  ? GLU H 28  PRO H 34  
BB 2  PHE H 16  ? THR H 22  ? PHE H 16  THR H 22  
BB 3  THR H 84  ? LEU H 92  ? THR H 84  LEU H 92  
BB 4  VAL H 75  ? ILE H 76  ? VAL H 75  ILE H 76  
BB 5  THR H 84  ? LEU H 92  ? THR H 84  LEU H 92  
BB 6  ASP H 64  ? PRO H 69  ? ASP H 64  PRO H 69  
BB 7  LYS H 47  ? ASP H 50  ? LYS H 47  ASP H 50  
CC 1  VAL H 206 ? HIS H 211 ? VAL H 206 HIS H 211 
CC 2  GLN H 218 ? THR H 223 ? GLN H 218 THR H 223 
CC 3  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
CC 4  ASN H 226 ? THR H 227 ? ASN H 226 THR H 227 
CC 5  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
CC 6  THR H 252 ? THR H 254 ? THR H 252 THR H 254 
CC 7  THR H 123 ? PHE H 135 ? THR H 123 PHE H 135 
CC 8  MET H 268 ? LYS H 276 ? MET H 268 LYS H 276 
CC 9  THR H 279 ? ASN H 280 ? THR H 279 ASN H 280 
CC 10 MET H 268 ? LYS H 276 ? MET H 268 LYS H 276 
CC 11 ILE H 356 ? VAL H 358 ? ILE H 356 VAL H 358 
CC 12 ALA H 341 ? ARG H 344 ? ALA H 341 ARG H 344 
CC 13 MET H 331 ? SER H 335 ? MET H 331 SER H 335 
DD 1  GLY H 265 ? SER H 266 ? GLY H 265 SER H 266 
DD 2  GLY H 265 ? SER H 266 ? GLY H 265 SER H 266 
EE 1  GLU I 28  ? PRO I 34  ? GLU I 28  PRO I 34  
EE 2  PHE I 16  ? THR I 22  ? PHE I 16  THR I 22  
EE 3  THR I 84  ? LEU I 92  ? THR I 84  LEU I 92  
EE 4  VAL I 75  ? ILE I 76  ? VAL I 75  ILE I 76  
EE 5  THR I 84  ? LEU I 92  ? THR I 84  LEU I 92  
EE 6  ASP I 64  ? PRO I 69  ? ASP I 64  PRO I 69  
EE 7  LYS I 47  ? ASP I 50  ? LYS I 47  ASP I 50  
FF 1  VAL I 206 ? HIS I 211 ? VAL I 206 HIS I 211 
FF 2  GLN I 218 ? THR I 223 ? GLN I 218 THR I 223 
FF 3  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
FF 4  ASN I 226 ? THR I 227 ? ASN I 226 THR I 227 
FF 5  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
FF 6  THR I 252 ? THR I 254 ? THR I 252 THR I 254 
FF 7  THR I 123 ? PHE I 135 ? THR I 123 PHE I 135 
FF 8  MET I 268 ? LYS I 276 ? MET I 268 LYS I 276 
FF 9  THR I 279 ? ASN I 280 ? THR I 279 ASN I 280 
FF 10 MET I 268 ? LYS I 276 ? MET I 268 LYS I 276 
FF 11 ILE I 356 ? VAL I 358 ? ILE I 356 VAL I 358 
FF 12 ALA I 341 ? ARG I 344 ? ALA I 341 ARG I 344 
FF 13 MET I 331 ? SER I 335 ? MET I 331 SER I 335 
GG 1  GLY I 265 ? SER I 266 ? GLY I 265 SER I 266 
GG 2  GLY I 265 ? SER I 266 ? GLY I 265 SER I 266 
HH 1  GLU J 28  ? PRO J 34  ? GLU J 28  PRO J 34  
HH 2  PHE J 16  ? THR J 22  ? PHE J 16  THR J 22  
HH 3  THR J 84  ? LEU J 92  ? THR J 84  LEU J 92  
HH 4  VAL J 75  ? ILE J 76  ? VAL J 75  ILE J 76  
HH 5  THR J 84  ? LEU J 92  ? THR J 84  LEU J 92  
HH 6  ASP J 64  ? PRO J 69  ? ASP J 64  PRO J 69  
HH 7  LYS J 47  ? ASP J 50  ? LYS J 47  ASP J 50  
II 1  VAL J 206 ? HIS J 211 ? VAL J 206 HIS J 211 
II 2  GLN J 218 ? THR J 223 ? GLN J 218 THR J 223 
II 3  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
II 4  ASN J 226 ? THR J 227 ? ASN J 226 THR J 227 
II 5  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
II 6  THR J 252 ? THR J 254 ? THR J 252 THR J 254 
II 7  THR J 123 ? PHE J 135 ? THR J 123 PHE J 135 
II 8  MET J 268 ? LYS J 276 ? MET J 268 LYS J 276 
II 9  THR J 279 ? ASN J 280 ? THR J 279 ASN J 280 
II 10 MET J 268 ? LYS J 276 ? MET J 268 LYS J 276 
II 11 ILE J 356 ? VAL J 358 ? ILE J 356 VAL J 358 
II 12 ALA J 341 ? ARG J 344 ? ALA J 341 ARG J 344 
II 13 MET J 331 ? SER J 335 ? MET J 331 SER J 335 
JJ 1  GLY J 265 ? SER J 266 ? GLY J 265 SER J 266 
JJ 2  GLY J 265 ? SER J 266 ? GLY J 265 SER J 266 
KK 1  GLU K 28  ? PRO K 34  ? GLU K 28  PRO K 34  
KK 2  PHE K 16  ? THR K 22  ? PHE K 16  THR K 22  
KK 3  THR K 84  ? LEU K 92  ? THR K 84  LEU K 92  
KK 4  VAL K 75  ? ILE K 76  ? VAL K 75  ILE K 76  
KK 5  THR K 84  ? LEU K 92  ? THR K 84  LEU K 92  
KK 6  ASP K 64  ? PRO K 69  ? ASP K 64  PRO K 69  
KK 7  LYS K 47  ? ASP K 50  ? LYS K 47  ASP K 50  
LL 1  VAL K 206 ? HIS K 211 ? VAL K 206 HIS K 211 
LL 2  GLN K 218 ? THR K 223 ? GLN K 218 THR K 223 
LL 3  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
LL 4  ASN K 226 ? THR K 227 ? ASN K 226 THR K 227 
LL 5  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
LL 6  THR K 252 ? THR K 254 ? THR K 252 THR K 254 
LL 7  THR K 123 ? PHE K 135 ? THR K 123 PHE K 135 
LL 8  MET K 268 ? LYS K 276 ? MET K 268 LYS K 276 
LL 9  THR K 279 ? ASN K 280 ? THR K 279 ASN K 280 
LL 10 MET K 268 ? LYS K 276 ? MET K 268 LYS K 276 
LL 11 ILE K 356 ? VAL K 358 ? ILE K 356 VAL K 358 
LL 12 ALA K 341 ? ARG K 344 ? ALA K 341 ARG K 344 
LL 13 MET K 331 ? SER K 335 ? MET K 331 SER K 335 
MM 1  GLY K 265 ? SER K 266 ? GLY K 265 SER K 266 
MM 2  GLY K 265 ? SER K 266 ? GLY K 265 SER K 266 
NN 1  GLU L 28  ? PRO L 34  ? GLU L 28  PRO L 34  
NN 2  PHE L 16  ? THR L 22  ? PHE L 16  THR L 22  
NN 3  THR L 84  ? LEU L 92  ? THR L 84  LEU L 92  
NN 4  VAL L 75  ? ILE L 76  ? VAL L 75  ILE L 76  
NN 5  THR L 84  ? LEU L 92  ? THR L 84  LEU L 92  
NN 6  ASP L 64  ? PRO L 69  ? ASP L 64  PRO L 69  
NN 7  LYS L 47  ? ASP L 50  ? LYS L 47  ASP L 50  
OO 1  VAL L 206 ? HIS L 211 ? VAL L 206 HIS L 211 
OO 2  GLN L 218 ? THR L 223 ? GLN L 218 THR L 223 
OO 3  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
OO 4  ASN L 226 ? THR L 227 ? ASN L 226 THR L 227 
OO 5  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
OO 6  THR L 252 ? THR L 254 ? THR L 252 THR L 254 
OO 7  THR L 123 ? PHE L 135 ? THR L 123 PHE L 135 
OO 8  MET L 268 ? LYS L 276 ? MET L 268 LYS L 276 
OO 9  THR L 279 ? ASN L 280 ? THR L 279 ASN L 280 
OO 10 MET L 268 ? LYS L 276 ? MET L 268 LYS L 276 
OO 11 ILE L 356 ? VAL L 358 ? ILE L 356 VAL L 358 
OO 12 ALA L 341 ? ARG L 344 ? ALA L 341 ARG L 344 
OO 13 MET L 331 ? SER L 335 ? MET L 331 SER L 335 
PP 1  GLY L 265 ? SER L 266 ? GLY L 265 SER L 266 
PP 2  GLY L 265 ? SER L 266 ? GLY L 265 SER L 266 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1  2  O ILE A 33  ? O ILE A 33  N VAL A 17  ? N VAL A 17  
A  2  3  N ASP A 18  ? N ASP A 18  O LEU A 85  ? O LEU A 85  
A  3  4  N ILE A 86  ? N ILE A 86  O VAL A 75  ? O VAL A 75  
A  4  5  O VAL A 75  ? O VAL A 75  N ILE A 86  ? N ILE A 86  
A  5  6  N LEU A 92  ? N LEU A 92  O VAL A 66  ? O VAL A 66  
A  6  7  N LEU A 67  ? N LEU A 67  O LYS A 47  ? O LYS A 47  
B  1  2  N HIS A 210 ? N HIS A 210 O GLU A 220 ? O GLU A 220 
B  2  3  N THR A 223 ? N THR A 223 O PRO A 128 ? O PRO A 128 
B  3  4  N PHE A 135 ? N PHE A 135 O THR A 252 ? O THR A 252 
B  4  5  O THR A 254 ? O THR A 254 N PHE A 133 ? N PHE A 133 
B  5  6  N PHE A 126 ? N PHE A 126 O ASN A 226 ? O ASN A 226 
B  6  7  O ASN A 226 ? O ASN A 226 N PHE A 126 ? N PHE A 126 
B  7  8  N GLU A 129 ? N GLU A 129 O HIS A 269 ? O HIS A 269 
B  8  9  O LYS A 276 ? O LYS A 276 N THR A 279 ? N THR A 279 
B  9  10 O THR A 279 ? O THR A 279 N LYS A 276 ? N LYS A 276 
B  10 11 O MET A 272 ? O MET A 272 N ILE A 356 ? N ILE A 356 
B  11 12 O GLU A 357 ? O GLU A 357 N ARG A 344 ? N ARG A 344 
B  12 13 N SER A 342 ? N SER A 342 O MET A 331 ? O MET A 331 
C  1  2  N SER A 143 ? N SER A 143 O GLY A 146 ? O GLY A 146 
C  2  3  N VAL A 149 ? N VAL A 149 O SER G 147 ? O SER G 147 
C  3  4  O ASP G 152 ? O ASP G 152 N ASP G 137 ? N ASP G 137 
D  1  2  N SER A 266 ? N SER A 266 O GLY A 265 ? O GLY A 265 
E  1  2  O ILE B 33  ? O ILE B 33  N VAL B 17  ? N VAL B 17  
E  2  3  N ASP B 18  ? N ASP B 18  O LEU B 85  ? O LEU B 85  
E  3  4  N ILE B 86  ? N ILE B 86  O VAL B 75  ? O VAL B 75  
E  4  5  O VAL B 75  ? O VAL B 75  N ILE B 86  ? N ILE B 86  
E  5  6  N LEU B 92  ? N LEU B 92  O VAL B 66  ? O VAL B 66  
E  6  7  N LEU B 67  ? N LEU B 67  O LYS B 47  ? O LYS B 47  
F  1  2  N HIS B 210 ? N HIS B 210 O GLU B 220 ? O GLU B 220 
F  2  3  N THR B 223 ? N THR B 223 O PRO B 128 ? O PRO B 128 
F  3  4  N PHE B 126 ? N PHE B 126 O ASN B 226 ? O ASN B 226 
F  4  5  O ASN B 226 ? O ASN B 226 N PHE B 126 ? N PHE B 126 
F  5  6  N PHE B 135 ? N PHE B 135 O THR B 252 ? O THR B 252 
F  6  7  O THR B 254 ? O THR B 254 N PHE B 133 ? N PHE B 133 
F  7  8  N GLU B 129 ? N GLU B 129 O HIS B 269 ? O HIS B 269 
F  8  9  O LYS B 276 ? O LYS B 276 N THR B 279 ? N THR B 279 
F  9  10 O THR B 279 ? O THR B 279 N LYS B 276 ? N LYS B 276 
F  10 11 O MET B 272 ? O MET B 272 N ILE B 356 ? N ILE B 356 
F  11 12 O GLU B 357 ? O GLU B 357 N ARG B 344 ? N ARG B 344 
F  12 13 N SER B 342 ? N SER B 342 O MET B 331 ? O MET B 331 
G  1  2  N SER B 143 ? N SER B 143 O GLY B 146 ? O GLY B 146 
G  2  3  N VAL B 149 ? N VAL B 149 O SER H 147 ? O SER H 147 
G  3  4  O ASP H 152 ? O ASP H 152 N ASP H 137 ? N ASP H 137 
I  1  2  O ILE C 33  ? O ILE C 33  N VAL C 17  ? N VAL C 17  
I  2  3  N ASP C 18  ? N ASP C 18  O LEU C 85  ? O LEU C 85  
I  3  4  N ILE C 86  ? N ILE C 86  O VAL C 75  ? O VAL C 75  
I  4  5  O VAL C 75  ? O VAL C 75  N ILE C 86  ? N ILE C 86  
I  5  6  N LEU C 92  ? N LEU C 92  O VAL C 66  ? O VAL C 66  
I  6  7  N LEU C 67  ? N LEU C 67  O LYS C 47  ? O LYS C 47  
J  1  2  N HIS C 210 ? N HIS C 210 O GLU C 220 ? O GLU C 220 
J  2  3  N THR C 223 ? N THR C 223 O PRO C 128 ? O PRO C 128 
J  3  4  N PHE C 126 ? N PHE C 126 O ASN C 226 ? O ASN C 226 
J  4  5  O ASN C 226 ? O ASN C 226 N PHE C 126 ? N PHE C 126 
J  5  6  N PHE C 135 ? N PHE C 135 O THR C 252 ? O THR C 252 
J  6  7  O THR C 254 ? O THR C 254 N PHE C 133 ? N PHE C 133 
J  7  8  N GLU C 129 ? N GLU C 129 O HIS C 269 ? O HIS C 269 
J  8  9  O LYS C 276 ? O LYS C 276 N THR C 279 ? N THR C 279 
J  9  10 O THR C 279 ? O THR C 279 N LYS C 276 ? N LYS C 276 
J  10 11 O MET C 272 ? O MET C 272 N ILE C 356 ? N ILE C 356 
J  11 12 O GLU C 357 ? O GLU C 357 N ARG C 344 ? N ARG C 344 
J  12 13 N SER C 342 ? N SER C 342 O MET C 331 ? O MET C 331 
K  1  2  N SER C 143 ? N SER C 143 O GLY C 146 ? O GLY C 146 
K  2  3  N VAL C 149 ? N VAL C 149 O SER I 147 ? O SER I 147 
K  3  4  O ASP I 152 ? O ASP I 152 N ASP I 137 ? N ASP I 137 
M  1  2  O ILE D 33  ? O ILE D 33  N VAL D 17  ? N VAL D 17  
M  2  3  N ASP D 18  ? N ASP D 18  O LEU D 85  ? O LEU D 85  
M  3  4  N ILE D 86  ? N ILE D 86  O VAL D 75  ? O VAL D 75  
M  4  5  O VAL D 75  ? O VAL D 75  N ILE D 86  ? N ILE D 86  
M  5  6  N LEU D 92  ? N LEU D 92  O VAL D 66  ? O VAL D 66  
M  6  7  N LEU D 67  ? N LEU D 67  O LYS D 47  ? O LYS D 47  
N  1  2  N HIS D 210 ? N HIS D 210 O GLU D 220 ? O GLU D 220 
N  2  3  N THR D 223 ? N THR D 223 O PRO D 128 ? O PRO D 128 
N  3  4  N PHE D 126 ? N PHE D 126 O ASN D 226 ? O ASN D 226 
N  4  5  O ASN D 226 ? O ASN D 226 N PHE D 126 ? N PHE D 126 
N  5  6  N PHE D 135 ? N PHE D 135 O THR D 252 ? O THR D 252 
N  6  7  O THR D 254 ? O THR D 254 N PHE D 133 ? N PHE D 133 
N  7  8  N GLU D 129 ? N GLU D 129 O HIS D 269 ? O HIS D 269 
N  8  9  O LYS D 276 ? O LYS D 276 N THR D 279 ? N THR D 279 
N  9  10 O THR D 279 ? O THR D 279 N LYS D 276 ? N LYS D 276 
N  10 11 O MET D 272 ? O MET D 272 N ILE D 356 ? N ILE D 356 
N  11 12 O GLU D 357 ? O GLU D 357 N ARG D 344 ? N ARG D 344 
N  12 13 N SER D 342 ? N SER D 342 O MET D 331 ? O MET D 331 
O  1  2  N SER D 143 ? N SER D 143 O GLY D 146 ? O GLY D 146 
O  2  3  N VAL D 149 ? N VAL D 149 O SER J 147 ? O SER J 147 
O  3  4  O ASP J 152 ? O ASP J 152 N ASP J 137 ? N ASP J 137 
Q  1  2  O ILE E 33  ? O ILE E 33  N VAL E 17  ? N VAL E 17  
Q  2  3  N ASP E 18  ? N ASP E 18  O LEU E 85  ? O LEU E 85  
Q  3  4  N ILE E 86  ? N ILE E 86  O VAL E 75  ? O VAL E 75  
Q  4  5  O VAL E 75  ? O VAL E 75  N ILE E 86  ? N ILE E 86  
Q  5  6  N LEU E 92  ? N LEU E 92  O VAL E 66  ? O VAL E 66  
Q  6  7  N LEU E 67  ? N LEU E 67  O LYS E 47  ? O LYS E 47  
R  1  2  N HIS E 210 ? N HIS E 210 O GLU E 220 ? O GLU E 220 
R  2  3  N THR E 223 ? N THR E 223 O PRO E 128 ? O PRO E 128 
R  3  4  N PHE E 126 ? N PHE E 126 O ASN E 226 ? O ASN E 226 
R  4  5  O ASN E 226 ? O ASN E 226 N PHE E 126 ? N PHE E 126 
R  5  6  N PHE E 135 ? N PHE E 135 O THR E 252 ? O THR E 252 
R  6  7  O THR E 254 ? O THR E 254 N PHE E 133 ? N PHE E 133 
R  7  8  N GLU E 129 ? N GLU E 129 O HIS E 269 ? O HIS E 269 
R  8  9  O LYS E 276 ? O LYS E 276 N THR E 279 ? N THR E 279 
R  9  10 O THR E 279 ? O THR E 279 N LYS E 276 ? N LYS E 276 
R  10 11 O MET E 272 ? O MET E 272 N ILE E 356 ? N ILE E 356 
R  11 12 O GLU E 357 ? O GLU E 357 N ARG E 344 ? N ARG E 344 
R  12 13 N SER E 342 ? N SER E 342 O MET E 331 ? O MET E 331 
S  1  2  N SER E 143 ? N SER E 143 O GLY E 146 ? O GLY E 146 
S  2  3  N VAL E 149 ? N VAL E 149 O SER K 147 ? O SER K 147 
S  3  4  O ASP K 152 ? O ASP K 152 N ASP K 137 ? N ASP K 137 
U  1  2  O ILE F 33  ? O ILE F 33  N VAL F 17  ? N VAL F 17  
U  2  3  N ASP F 18  ? N ASP F 18  O LEU F 85  ? O LEU F 85  
U  3  4  N ILE F 86  ? N ILE F 86  O VAL F 75  ? O VAL F 75  
U  4  5  O VAL F 75  ? O VAL F 75  N ILE F 86  ? N ILE F 86  
U  5  6  N LEU F 92  ? N LEU F 92  O VAL F 66  ? O VAL F 66  
U  6  7  N LEU F 67  ? N LEU F 67  O LYS F 47  ? O LYS F 47  
V  1  2  N HIS F 210 ? N HIS F 210 O GLU F 220 ? O GLU F 220 
V  2  3  N THR F 223 ? N THR F 223 O PRO F 128 ? O PRO F 128 
V  3  4  N PHE F 126 ? N PHE F 126 O ASN F 226 ? O ASN F 226 
V  4  5  O ASN F 226 ? O ASN F 226 N PHE F 126 ? N PHE F 126 
V  5  6  N PHE F 135 ? N PHE F 135 O THR F 252 ? O THR F 252 
V  6  7  O THR F 254 ? O THR F 254 N PHE F 133 ? N PHE F 133 
V  7  8  N GLU F 129 ? N GLU F 129 O HIS F 269 ? O HIS F 269 
V  8  9  O LYS F 276 ? O LYS F 276 N THR F 279 ? N THR F 279 
V  9  10 O THR F 279 ? O THR F 279 N LYS F 276 ? N LYS F 276 
V  10 11 O MET F 272 ? O MET F 272 N ILE F 356 ? N ILE F 356 
V  11 12 O GLU F 357 ? O GLU F 357 N ARG F 344 ? N ARG F 344 
V  12 13 N SER F 342 ? N SER F 342 O MET F 331 ? O MET F 331 
W  1  2  N SER F 143 ? N SER F 143 O GLY F 146 ? O GLY F 146 
W  2  3  N VAL F 149 ? N VAL F 149 O SER L 147 ? O SER L 147 
W  3  4  O ASP L 152 ? O ASP L 152 N ASP L 137 ? N ASP L 137 
Y  1  2  O ILE G 33  ? O ILE G 33  N VAL G 17  ? N VAL G 17  
Y  2  3  N ASP G 18  ? N ASP G 18  O LEU G 85  ? O LEU G 85  
Y  3  4  N ILE G 86  ? N ILE G 86  O VAL G 75  ? O VAL G 75  
Y  4  5  O VAL G 75  ? O VAL G 75  N ILE G 86  ? N ILE G 86  
Y  5  6  N LEU G 92  ? N LEU G 92  O VAL G 66  ? O VAL G 66  
Y  6  7  N LEU G 67  ? N LEU G 67  O LYS G 47  ? O LYS G 47  
Z  1  2  N HIS G 210 ? N HIS G 210 O GLU G 220 ? O GLU G 220 
Z  2  3  N THR G 223 ? N THR G 223 O PRO G 128 ? O PRO G 128 
Z  3  4  N PHE G 126 ? N PHE G 126 O ASN G 226 ? O ASN G 226 
Z  4  5  O ASN G 226 ? O ASN G 226 N PHE G 126 ? N PHE G 126 
Z  5  6  N PHE G 135 ? N PHE G 135 O THR G 252 ? O THR G 252 
Z  6  7  O THR G 254 ? O THR G 254 N PHE G 133 ? N PHE G 133 
Z  7  8  N GLU G 129 ? N GLU G 129 O HIS G 269 ? O HIS G 269 
Z  8  9  O LYS G 276 ? O LYS G 276 N THR G 279 ? N THR G 279 
Z  9  10 O THR G 279 ? O THR G 279 N LYS G 276 ? N LYS G 276 
Z  10 11 O MET G 272 ? O MET G 272 N ILE G 356 ? N ILE G 356 
Z  11 12 O GLU G 357 ? O GLU G 357 N ARG G 344 ? N ARG G 344 
Z  12 13 N SER G 342 ? N SER G 342 O MET G 331 ? O MET G 331 
BB 1  2  O ILE H 33  ? O ILE H 33  N VAL H 17  ? N VAL H 17  
BB 2  3  N ASP H 18  ? N ASP H 18  O LEU H 85  ? O LEU H 85  
BB 3  4  N ILE H 86  ? N ILE H 86  O VAL H 75  ? O VAL H 75  
BB 4  5  O VAL H 75  ? O VAL H 75  N ILE H 86  ? N ILE H 86  
BB 5  6  N LEU H 92  ? N LEU H 92  O VAL H 66  ? O VAL H 66  
BB 6  7  N LEU H 67  ? N LEU H 67  O LYS H 47  ? O LYS H 47  
CC 1  2  N HIS H 210 ? N HIS H 210 O GLU H 220 ? O GLU H 220 
CC 2  3  N THR H 223 ? N THR H 223 O PRO H 128 ? O PRO H 128 
CC 3  4  N PHE H 126 ? N PHE H 126 O ASN H 226 ? O ASN H 226 
CC 4  5  O ASN H 226 ? O ASN H 226 N PHE H 126 ? N PHE H 126 
CC 5  6  N PHE H 135 ? N PHE H 135 O THR H 252 ? O THR H 252 
CC 6  7  O THR H 254 ? O THR H 254 N PHE H 133 ? N PHE H 133 
CC 7  8  N GLU H 129 ? N GLU H 129 O HIS H 269 ? O HIS H 269 
CC 8  9  O LYS H 276 ? O LYS H 276 N THR H 279 ? N THR H 279 
CC 9  10 O THR H 279 ? O THR H 279 N LYS H 276 ? N LYS H 276 
CC 10 11 O MET H 272 ? O MET H 272 N ILE H 356 ? N ILE H 356 
CC 11 12 O GLU H 357 ? O GLU H 357 N ARG H 344 ? N ARG H 344 
CC 12 13 N SER H 342 ? N SER H 342 O MET H 331 ? O MET H 331 
EE 1  2  O ILE I 33  ? O ILE I 33  N VAL I 17  ? N VAL I 17  
EE 2  3  N ASP I 18  ? N ASP I 18  O LEU I 85  ? O LEU I 85  
EE 3  4  N ILE I 86  ? N ILE I 86  O VAL I 75  ? O VAL I 75  
EE 4  5  O VAL I 75  ? O VAL I 75  N ILE I 86  ? N ILE I 86  
EE 5  6  N LEU I 92  ? N LEU I 92  O VAL I 66  ? O VAL I 66  
EE 6  7  N LEU I 67  ? N LEU I 67  O LYS I 47  ? O LYS I 47  
FF 1  2  N HIS I 210 ? N HIS I 210 O GLU I 220 ? O GLU I 220 
FF 2  3  N THR I 223 ? N THR I 223 O PRO I 128 ? O PRO I 128 
FF 3  4  N PHE I 126 ? N PHE I 126 O ASN I 226 ? O ASN I 226 
FF 4  5  O ASN I 226 ? O ASN I 226 N PHE I 126 ? N PHE I 126 
FF 5  6  N PHE I 135 ? N PHE I 135 O THR I 252 ? O THR I 252 
FF 6  7  O THR I 254 ? O THR I 254 N PHE I 133 ? N PHE I 133 
FF 7  8  N GLU I 129 ? N GLU I 129 O HIS I 269 ? O HIS I 269 
FF 8  9  O LYS I 276 ? O LYS I 276 N THR I 279 ? N THR I 279 
FF 9  10 O THR I 279 ? O THR I 279 N LYS I 276 ? N LYS I 276 
FF 10 11 O MET I 272 ? O MET I 272 N ILE I 356 ? N ILE I 356 
FF 11 12 O GLU I 357 ? O GLU I 357 N ARG I 344 ? N ARG I 344 
FF 12 13 N SER I 342 ? N SER I 342 O MET I 331 ? O MET I 331 
HH 1  2  O ILE J 33  ? O ILE J 33  N VAL J 17  ? N VAL J 17  
HH 2  3  N ASP J 18  ? N ASP J 18  O LEU J 85  ? O LEU J 85  
HH 3  4  N ILE J 86  ? N ILE J 86  O VAL J 75  ? O VAL J 75  
HH 4  5  O VAL J 75  ? O VAL J 75  N ILE J 86  ? N ILE J 86  
HH 5  6  N LEU J 92  ? N LEU J 92  O VAL J 66  ? O VAL J 66  
HH 6  7  N LEU J 67  ? N LEU J 67  O LYS J 47  ? O LYS J 47  
II 1  2  N HIS J 210 ? N HIS J 210 O GLU J 220 ? O GLU J 220 
II 2  3  N THR J 223 ? N THR J 223 O PRO J 128 ? O PRO J 128 
II 3  4  N PHE J 126 ? N PHE J 126 O ASN J 226 ? O ASN J 226 
II 4  5  O ASN J 226 ? O ASN J 226 N PHE J 126 ? N PHE J 126 
II 5  6  N PHE J 135 ? N PHE J 135 O THR J 252 ? O THR J 252 
II 6  7  O THR J 254 ? O THR J 254 N PHE J 133 ? N PHE J 133 
II 7  8  N GLU J 129 ? N GLU J 129 O HIS J 269 ? O HIS J 269 
II 8  9  O LYS J 276 ? O LYS J 276 N THR J 279 ? N THR J 279 
II 9  10 O THR J 279 ? O THR J 279 N LYS J 276 ? N LYS J 276 
II 10 11 O MET J 272 ? O MET J 272 N ILE J 356 ? N ILE J 356 
II 11 12 O GLU J 357 ? O GLU J 357 N ARG J 344 ? N ARG J 344 
II 12 13 N SER J 342 ? N SER J 342 O MET J 331 ? O MET J 331 
JJ 1  2  N SER J 266 ? N SER J 266 O GLY J 265 ? O GLY J 265 
KK 1  2  O ILE K 33  ? O ILE K 33  N VAL K 17  ? N VAL K 17  
KK 2  3  N ASP K 18  ? N ASP K 18  O LEU K 85  ? O LEU K 85  
KK 3  4  N ILE K 86  ? N ILE K 86  O VAL K 75  ? O VAL K 75  
KK 4  5  O VAL K 75  ? O VAL K 75  N ILE K 86  ? N ILE K 86  
KK 5  6  N LEU K 92  ? N LEU K 92  O VAL K 66  ? O VAL K 66  
KK 6  7  N LEU K 67  ? N LEU K 67  O LYS K 47  ? O LYS K 47  
LL 1  2  N HIS K 210 ? N HIS K 210 O GLU K 220 ? O GLU K 220 
LL 2  3  N THR K 223 ? N THR K 223 O PRO K 128 ? O PRO K 128 
LL 3  4  N PHE K 126 ? N PHE K 126 O ASN K 226 ? O ASN K 226 
LL 4  5  O ASN K 226 ? O ASN K 226 N PHE K 126 ? N PHE K 126 
LL 5  6  N PHE K 135 ? N PHE K 135 O THR K 252 ? O THR K 252 
LL 6  7  O THR K 254 ? O THR K 254 N PHE K 133 ? N PHE K 133 
LL 7  8  N GLU K 129 ? N GLU K 129 O HIS K 269 ? O HIS K 269 
LL 8  9  O LYS K 276 ? O LYS K 276 N THR K 279 ? N THR K 279 
LL 9  10 O THR K 279 ? O THR K 279 N LYS K 276 ? N LYS K 276 
LL 10 11 O MET K 272 ? O MET K 272 N ILE K 356 ? N ILE K 356 
LL 11 12 O GLU K 357 ? O GLU K 357 N ARG K 344 ? N ARG K 344 
LL 12 13 N SER K 342 ? N SER K 342 O MET K 331 ? O MET K 331 
NN 1  2  O ILE L 33  ? O ILE L 33  N VAL L 17  ? N VAL L 17  
NN 2  3  N ASP L 18  ? N ASP L 18  O LEU L 85  ? O LEU L 85  
NN 3  4  N ILE L 86  ? N ILE L 86  O VAL L 75  ? O VAL L 75  
NN 4  5  O VAL L 75  ? O VAL L 75  N ILE L 86  ? N ILE L 86  
NN 5  6  N LEU L 92  ? N LEU L 92  O VAL L 66  ? O VAL L 66  
NN 6  7  N LEU L 67  ? N LEU L 67  O LYS L 47  ? O LYS L 47  
OO 1  2  N HIS L 210 ? N HIS L 210 O GLU L 220 ? O GLU L 220 
OO 2  3  N THR L 223 ? N THR L 223 O PRO L 128 ? O PRO L 128 
OO 3  4  N PHE L 126 ? N PHE L 126 O ASN L 226 ? O ASN L 226 
OO 4  5  O ASN L 226 ? O ASN L 226 N PHE L 126 ? N PHE L 126 
OO 5  6  N PHE L 135 ? N PHE L 135 O THR L 252 ? O THR L 252 
OO 6  7  O THR L 254 ? O THR L 254 N PHE L 133 ? N PHE L 133 
OO 7  8  N GLU L 129 ? N GLU L 129 O HIS L 269 ? O HIS L 269 
OO 8  9  O LYS L 276 ? O LYS L 276 N THR L 279 ? N THR L 279 
OO 9  10 O THR L 279 ? O THR L 279 N LYS L 276 ? N LYS L 276 
OO 10 11 O MET L 272 ? O MET L 272 N ILE L 356 ? N ILE L 356 
OO 11 12 O GLU L 357 ? O GLU L 357 N ARG L 344 ? N ARG L 344 
OO 12 13 N SER L 342 ? N SER L 342 O MET L 331 ? O MET L 331 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  469  ? 4  'BINDING SITE FOR RESIDUE MN A 469'   
AC2 Software A MN  470  ? 5  'BINDING SITE FOR RESIDUE MN A 470'   
AC3 Software B MN  469  ? 4  'BINDING SITE FOR RESIDUE MN B 469'   
AC4 Software B MN  470  ? 5  'BINDING SITE FOR RESIDUE MN B 470'   
AC5 Software C MN  469  ? 4  'BINDING SITE FOR RESIDUE MN C 469'   
AC6 Software C MN  470  ? 5  'BINDING SITE FOR RESIDUE MN C 470'   
AC7 Software D MN  469  ? 4  'BINDING SITE FOR RESIDUE MN D 469'   
AC8 Software D MN  470  ? 5  'BINDING SITE FOR RESIDUE MN D 470'   
AC9 Software E MN  469  ? 4  'BINDING SITE FOR RESIDUE MN E 469'   
BC1 Software E MN  470  ? 5  'BINDING SITE FOR RESIDUE MN E 470'   
BC2 Software F MN  469  ? 4  'BINDING SITE FOR RESIDUE MN F 469'   
BC3 Software F MN  470  ? 5  'BINDING SITE FOR RESIDUE MN F 470'   
BC4 Software G MN  469  ? 4  'BINDING SITE FOR RESIDUE MN G 469'   
BC5 Software G MN  470  ? 5  'BINDING SITE FOR RESIDUE MN G 470'   
BC6 Software H MN  469  ? 4  'BINDING SITE FOR RESIDUE MN H 469'   
BC7 Software H MN  470  ? 5  'BINDING SITE FOR RESIDUE MN H 470'   
BC8 Software I MN  469  ? 4  'BINDING SITE FOR RESIDUE MN I 469'   
BC9 Software I MN  470  ? 5  'BINDING SITE FOR RESIDUE MN I 470'   
CC1 Software J MN  469  ? 4  'BINDING SITE FOR RESIDUE MN J 469'   
CC2 Software J MN  470  ? 5  'BINDING SITE FOR RESIDUE MN J 470'   
CC3 Software K MN  469  ? 4  'BINDING SITE FOR RESIDUE MN K 469'   
CC4 Software K MN  470  ? 5  'BINDING SITE FOR RESIDUE MN K 470'   
CC5 Software L MN  469  ? 4  'BINDING SITE FOR RESIDUE MN L 469'   
CC6 Software L MN  470  ? 5  'BINDING SITE FOR RESIDUE MN L 470'   
CC7 Software A ADP 4471 ? 13 'BINDING SITE FOR RESIDUE ADP A 4471' 
CC8 Software B ADP 4472 ? 13 'BINDING SITE FOR RESIDUE ADP B 4472' 
CC9 Software C ADP 4473 ? 13 'BINDING SITE FOR RESIDUE ADP C 4473' 
DC1 Software D ADP 4474 ? 13 'BINDING SITE FOR RESIDUE ADP D 4474' 
DC2 Software E ADP 4475 ? 13 'BINDING SITE FOR RESIDUE ADP E 4475' 
DC3 Software F ADP 4476 ? 13 'BINDING SITE FOR RESIDUE ADP F 4476' 
DC4 Software G ADP 4477 ? 13 'BINDING SITE FOR RESIDUE ADP G 4477' 
DC5 Software H ADP 4478 ? 13 'BINDING SITE FOR RESIDUE ADP H 4478' 
DC6 Software I ADP 4479 ? 13 'BINDING SITE FOR RESIDUE ADP I 4479' 
DC7 Software J ADP 4480 ? 13 'BINDING SITE FOR RESIDUE ADP J 4480' 
DC8 Software K ADP 4481 ? 13 'BINDING SITE FOR RESIDUE ADP K 4481' 
DC9 Software L ADP 4482 ? 13 'BINDING SITE FOR RESIDUE ADP L 4482' 
EC1 Software A PPQ 5900 ? 12 'BINDING SITE FOR RESIDUE PPQ A 5900' 
EC2 Software B PPQ 5901 ? 12 'BINDING SITE FOR RESIDUE PPQ B 5901' 
EC3 Software C PPQ 5902 ? 12 'BINDING SITE FOR RESIDUE PPQ C 5902' 
EC4 Software D PPQ 5903 ? 12 'BINDING SITE FOR RESIDUE PPQ D 5903' 
EC5 Software E PPQ 5904 ? 12 'BINDING SITE FOR RESIDUE PPQ E 5904' 
EC6 Software F PPQ 5905 ? 12 'BINDING SITE FOR RESIDUE PPQ F 5905' 
EC7 Software G PPQ 5906 ? 12 'BINDING SITE FOR RESIDUE PPQ G 5906' 
EC8 Software H PPQ 5907 ? 12 'BINDING SITE FOR RESIDUE PPQ H 5907' 
EC9 Software I PPQ 5908 ? 12 'BINDING SITE FOR RESIDUE PPQ I 5908' 
FC1 Software J PPQ 5909 ? 12 'BINDING SITE FOR RESIDUE PPQ J 5909' 
FC2 Software K PPQ 5910 ? 12 'BINDING SITE FOR RESIDUE PPQ K 5910' 
FC3 Software L PPQ 5911 ? 12 'BINDING SITE FOR RESIDUE PPQ L 5911' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  GLU A  131 ? GLU A 131  . ? 1_555 ? 
2   AC1 4  GLU A  212 ? GLU A 212  . ? 1_555 ? 
3   AC1 4  GLU A  220 ? GLU A 220  . ? 1_555 ? 
4   AC1 4  PPQ P  .   ? PPQ A 5900 . ? 1_555 ? 
5   AC2 5  GLU A  129 ? GLU A 129  . ? 1_555 ? 
6   AC2 5  HIS A  269 ? HIS A 269  . ? 1_555 ? 
7   AC2 5  GLU A  357 ? GLU A 357  . ? 1_555 ? 
8   AC2 5  ADP O  .   ? ADP A 4471 . ? 1_555 ? 
9   AC2 5  PPQ P  .   ? PPQ A 5900 . ? 1_555 ? 
10  AC3 4  GLU B  131 ? GLU B 131  . ? 1_555 ? 
11  AC3 4  GLU B  212 ? GLU B 212  . ? 1_555 ? 
12  AC3 4  GLU B  220 ? GLU B 220  . ? 1_555 ? 
13  AC3 4  PPQ T  .   ? PPQ B 5901 . ? 1_555 ? 
14  AC4 5  GLU B  129 ? GLU B 129  . ? 1_555 ? 
15  AC4 5  HIS B  269 ? HIS B 269  . ? 1_555 ? 
16  AC4 5  GLU B  357 ? GLU B 357  . ? 1_555 ? 
17  AC4 5  ADP S  .   ? ADP B 4472 . ? 1_555 ? 
18  AC4 5  PPQ T  .   ? PPQ B 5901 . ? 1_555 ? 
19  AC5 4  GLU C  131 ? GLU C 131  . ? 1_555 ? 
20  AC5 4  GLU C  212 ? GLU C 212  . ? 1_555 ? 
21  AC5 4  GLU C  220 ? GLU C 220  . ? 1_555 ? 
22  AC5 4  PPQ X  .   ? PPQ C 5902 . ? 1_555 ? 
23  AC6 5  GLU C  129 ? GLU C 129  . ? 1_555 ? 
24  AC6 5  HIS C  269 ? HIS C 269  . ? 1_555 ? 
25  AC6 5  GLU C  357 ? GLU C 357  . ? 1_555 ? 
26  AC6 5  ADP W  .   ? ADP C 4473 . ? 1_555 ? 
27  AC6 5  PPQ X  .   ? PPQ C 5902 . ? 1_555 ? 
28  AC7 4  GLU D  131 ? GLU D 131  . ? 1_555 ? 
29  AC7 4  GLU D  212 ? GLU D 212  . ? 1_555 ? 
30  AC7 4  GLU D  220 ? GLU D 220  . ? 1_555 ? 
31  AC7 4  PPQ BA .   ? PPQ D 5903 . ? 1_555 ? 
32  AC8 5  GLU D  129 ? GLU D 129  . ? 1_555 ? 
33  AC8 5  HIS D  269 ? HIS D 269  . ? 1_555 ? 
34  AC8 5  GLU D  357 ? GLU D 357  . ? 1_555 ? 
35  AC8 5  ADP AA .   ? ADP D 4474 . ? 1_555 ? 
36  AC8 5  PPQ BA .   ? PPQ D 5903 . ? 1_555 ? 
37  AC9 4  GLU E  131 ? GLU E 131  . ? 1_555 ? 
38  AC9 4  GLU E  212 ? GLU E 212  . ? 1_555 ? 
39  AC9 4  GLU E  220 ? GLU E 220  . ? 1_555 ? 
40  AC9 4  PPQ FA .   ? PPQ E 5904 . ? 1_555 ? 
41  BC1 5  GLU E  129 ? GLU E 129  . ? 1_555 ? 
42  BC1 5  HIS E  269 ? HIS E 269  . ? 1_555 ? 
43  BC1 5  GLU E  357 ? GLU E 357  . ? 1_555 ? 
44  BC1 5  ADP EA .   ? ADP E 4475 . ? 1_555 ? 
45  BC1 5  PPQ FA .   ? PPQ E 5904 . ? 1_555 ? 
46  BC2 4  GLU F  131 ? GLU F 131  . ? 1_555 ? 
47  BC2 4  GLU F  212 ? GLU F 212  . ? 1_555 ? 
48  BC2 4  GLU F  220 ? GLU F 220  . ? 1_555 ? 
49  BC2 4  PPQ JA .   ? PPQ F 5905 . ? 1_555 ? 
50  BC3 5  GLU F  129 ? GLU F 129  . ? 1_555 ? 
51  BC3 5  HIS F  269 ? HIS F 269  . ? 1_555 ? 
52  BC3 5  GLU F  357 ? GLU F 357  . ? 1_555 ? 
53  BC3 5  ADP IA .   ? ADP F 4476 . ? 1_555 ? 
54  BC3 5  PPQ JA .   ? PPQ F 5905 . ? 1_555 ? 
55  BC4 4  GLU G  131 ? GLU G 131  . ? 1_555 ? 
56  BC4 4  GLU G  212 ? GLU G 212  . ? 1_555 ? 
57  BC4 4  GLU G  220 ? GLU G 220  . ? 1_555 ? 
58  BC4 4  PPQ NA .   ? PPQ G 5906 . ? 1_555 ? 
59  BC5 5  GLU G  129 ? GLU G 129  . ? 1_555 ? 
60  BC5 5  HIS G  269 ? HIS G 269  . ? 1_555 ? 
61  BC5 5  GLU G  357 ? GLU G 357  . ? 1_555 ? 
62  BC5 5  ADP MA .   ? ADP G 4477 . ? 1_555 ? 
63  BC5 5  PPQ NA .   ? PPQ G 5906 . ? 1_555 ? 
64  BC6 4  GLU H  131 ? GLU H 131  . ? 1_555 ? 
65  BC6 4  GLU H  212 ? GLU H 212  . ? 1_555 ? 
66  BC6 4  GLU H  220 ? GLU H 220  . ? 1_555 ? 
67  BC6 4  PPQ RA .   ? PPQ H 5907 . ? 1_555 ? 
68  BC7 5  GLU H  129 ? GLU H 129  . ? 1_555 ? 
69  BC7 5  HIS H  269 ? HIS H 269  . ? 1_555 ? 
70  BC7 5  GLU H  357 ? GLU H 357  . ? 1_555 ? 
71  BC7 5  ADP QA .   ? ADP H 4478 . ? 1_555 ? 
72  BC7 5  PPQ RA .   ? PPQ H 5907 . ? 1_555 ? 
73  BC8 4  GLU I  131 ? GLU I 131  . ? 1_555 ? 
74  BC8 4  GLU I  212 ? GLU I 212  . ? 1_555 ? 
75  BC8 4  GLU I  220 ? GLU I 220  . ? 1_555 ? 
76  BC8 4  PPQ VA .   ? PPQ I 5908 . ? 1_555 ? 
77  BC9 5  GLU I  129 ? GLU I 129  . ? 1_555 ? 
78  BC9 5  HIS I  269 ? HIS I 269  . ? 1_555 ? 
79  BC9 5  GLU I  357 ? GLU I 357  . ? 1_555 ? 
80  BC9 5  ADP UA .   ? ADP I 4479 . ? 1_555 ? 
81  BC9 5  PPQ VA .   ? PPQ I 5908 . ? 1_555 ? 
82  CC1 4  GLU J  131 ? GLU J 131  . ? 1_555 ? 
83  CC1 4  GLU J  212 ? GLU J 212  . ? 1_555 ? 
84  CC1 4  GLU J  220 ? GLU J 220  . ? 1_555 ? 
85  CC1 4  PPQ ZA .   ? PPQ J 5909 . ? 1_555 ? 
86  CC2 5  GLU J  129 ? GLU J 129  . ? 1_555 ? 
87  CC2 5  HIS J  269 ? HIS J 269  . ? 1_555 ? 
88  CC2 5  GLU J  357 ? GLU J 357  . ? 1_555 ? 
89  CC2 5  ADP YA .   ? ADP J 4480 . ? 1_555 ? 
90  CC2 5  PPQ ZA .   ? PPQ J 5909 . ? 1_555 ? 
91  CC3 4  GLU K  131 ? GLU K 131  . ? 1_555 ? 
92  CC3 4  GLU K  212 ? GLU K 212  . ? 1_555 ? 
93  CC3 4  GLU K  220 ? GLU K 220  . ? 1_555 ? 
94  CC3 4  PPQ DB .   ? PPQ K 5910 . ? 1_555 ? 
95  CC4 5  GLU K  129 ? GLU K 129  . ? 1_555 ? 
96  CC4 5  HIS K  269 ? HIS K 269  . ? 1_555 ? 
97  CC4 5  GLU K  357 ? GLU K 357  . ? 1_555 ? 
98  CC4 5  ADP CB .   ? ADP K 4481 . ? 1_555 ? 
99  CC4 5  PPQ DB .   ? PPQ K 5910 . ? 1_555 ? 
100 CC5 4  GLU L  131 ? GLU L 131  . ? 1_555 ? 
101 CC5 4  GLU L  212 ? GLU L 212  . ? 1_555 ? 
102 CC5 4  GLU L  220 ? GLU L 220  . ? 1_555 ? 
103 CC5 4  PPQ HB .   ? PPQ L 5911 . ? 1_555 ? 
104 CC6 5  GLU L  129 ? GLU L 129  . ? 1_555 ? 
105 CC6 5  HIS L  269 ? HIS L 269  . ? 1_555 ? 
106 CC6 5  GLU L  357 ? GLU L 357  . ? 1_555 ? 
107 CC6 5  ADP GB .   ? ADP L 4482 . ? 1_555 ? 
108 CC6 5  PPQ HB .   ? PPQ L 5911 . ? 1_555 ? 
109 CC7 13 GLY A  127 ? GLY A 127  . ? 1_555 ? 
110 CC7 13 GLU A  129 ? GLU A 129  . ? 1_555 ? 
111 CC7 13 GLU A  207 ? GLU A 207  . ? 1_555 ? 
112 CC7 13 THR A  223 ? THR A 223  . ? 1_555 ? 
113 CC7 13 ARG A  224 ? ARG A 224  . ? 1_555 ? 
114 CC7 13 PHE A  225 ? PHE A 225  . ? 1_555 ? 
115 CC7 13 HIS A  271 ? HIS A 271  . ? 1_555 ? 
116 CC7 13 SER A  273 ? SER A 273  . ? 1_555 ? 
117 CC7 13 ARG A  355 ? ARG A 355  . ? 1_555 ? 
118 CC7 13 GLU A  357 ? GLU A 357  . ? 1_555 ? 
119 CC7 13 MN  N  .   ? MN  A 470  . ? 1_555 ? 
120 CC7 13 HOH IB .   ? HOH A 5976 . ? 1_555 ? 
121 CC7 13 HOH IB .   ? HOH A 6045 . ? 1_555 ? 
122 CC8 13 GLY B  127 ? GLY B 127  . ? 1_555 ? 
123 CC8 13 GLU B  129 ? GLU B 129  . ? 1_555 ? 
124 CC8 13 GLU B  207 ? GLU B 207  . ? 1_555 ? 
125 CC8 13 THR B  223 ? THR B 223  . ? 1_555 ? 
126 CC8 13 ARG B  224 ? ARG B 224  . ? 1_555 ? 
127 CC8 13 PHE B  225 ? PHE B 225  . ? 1_555 ? 
128 CC8 13 HIS B  271 ? HIS B 271  . ? 1_555 ? 
129 CC8 13 SER B  273 ? SER B 273  . ? 1_555 ? 
130 CC8 13 ARG B  355 ? ARG B 355  . ? 1_555 ? 
131 CC8 13 GLU B  357 ? GLU B 357  . ? 1_555 ? 
132 CC8 13 MN  R  .   ? MN  B 470  . ? 1_555 ? 
133 CC8 13 HOH JB .   ? HOH B 5977 . ? 1_555 ? 
134 CC8 13 HOH JB .   ? HOH B 6049 . ? 1_555 ? 
135 CC9 13 GLY C  127 ? GLY C 127  . ? 1_555 ? 
136 CC9 13 GLU C  129 ? GLU C 129  . ? 1_555 ? 
137 CC9 13 GLU C  207 ? GLU C 207  . ? 1_555 ? 
138 CC9 13 THR C  223 ? THR C 223  . ? 1_555 ? 
139 CC9 13 ARG C  224 ? ARG C 224  . ? 1_555 ? 
140 CC9 13 PHE C  225 ? PHE C 225  . ? 1_555 ? 
141 CC9 13 HIS C  271 ? HIS C 271  . ? 1_555 ? 
142 CC9 13 SER C  273 ? SER C 273  . ? 1_555 ? 
143 CC9 13 ARG C  355 ? ARG C 355  . ? 1_555 ? 
144 CC9 13 GLU C  357 ? GLU C 357  . ? 1_555 ? 
145 CC9 13 MN  V  .   ? MN  C 470  . ? 1_555 ? 
146 CC9 13 HOH KB .   ? HOH C 5976 . ? 1_555 ? 
147 CC9 13 HOH KB .   ? HOH C 6046 . ? 1_555 ? 
148 DC1 13 GLY D  127 ? GLY D 127  . ? 1_555 ? 
149 DC1 13 GLU D  129 ? GLU D 129  . ? 1_555 ? 
150 DC1 13 GLU D  207 ? GLU D 207  . ? 1_555 ? 
151 DC1 13 THR D  223 ? THR D 223  . ? 1_555 ? 
152 DC1 13 ARG D  224 ? ARG D 224  . ? 1_555 ? 
153 DC1 13 PHE D  225 ? PHE D 225  . ? 1_555 ? 
154 DC1 13 HIS D  271 ? HIS D 271  . ? 1_555 ? 
155 DC1 13 SER D  273 ? SER D 273  . ? 1_555 ? 
156 DC1 13 ARG D  355 ? ARG D 355  . ? 1_555 ? 
157 DC1 13 GLU D  357 ? GLU D 357  . ? 1_555 ? 
158 DC1 13 MN  Z  .   ? MN  D 470  . ? 1_555 ? 
159 DC1 13 HOH LB .   ? HOH D 5979 . ? 1_555 ? 
160 DC1 13 HOH LB .   ? HOH D 6049 . ? 1_555 ? 
161 DC2 13 GLY E  127 ? GLY E 127  . ? 1_555 ? 
162 DC2 13 GLU E  129 ? GLU E 129  . ? 1_555 ? 
163 DC2 13 GLU E  207 ? GLU E 207  . ? 1_555 ? 
164 DC2 13 THR E  223 ? THR E 223  . ? 1_555 ? 
165 DC2 13 ARG E  224 ? ARG E 224  . ? 1_555 ? 
166 DC2 13 PHE E  225 ? PHE E 225  . ? 1_555 ? 
167 DC2 13 HIS E  271 ? HIS E 271  . ? 1_555 ? 
168 DC2 13 SER E  273 ? SER E 273  . ? 1_555 ? 
169 DC2 13 ARG E  355 ? ARG E 355  . ? 1_555 ? 
170 DC2 13 GLU E  357 ? GLU E 357  . ? 1_555 ? 
171 DC2 13 MN  DA .   ? MN  E 470  . ? 1_555 ? 
172 DC2 13 HOH MB .   ? HOH E 691  . ? 1_555 ? 
173 DC2 13 HOH MB .   ? HOH E 849  . ? 1_555 ? 
174 DC3 13 GLY F  127 ? GLY F 127  . ? 1_555 ? 
175 DC3 13 GLU F  129 ? GLU F 129  . ? 1_555 ? 
176 DC3 13 GLU F  207 ? GLU F 207  . ? 1_555 ? 
177 DC3 13 THR F  223 ? THR F 223  . ? 1_555 ? 
178 DC3 13 ARG F  224 ? ARG F 224  . ? 1_555 ? 
179 DC3 13 PHE F  225 ? PHE F 225  . ? 1_555 ? 
180 DC3 13 HIS F  271 ? HIS F 271  . ? 1_555 ? 
181 DC3 13 SER F  273 ? SER F 273  . ? 1_555 ? 
182 DC3 13 ARG F  355 ? ARG F 355  . ? 1_555 ? 
183 DC3 13 GLU F  357 ? GLU F 357  . ? 1_555 ? 
184 DC3 13 MN  HA .   ? MN  F 470  . ? 1_555 ? 
185 DC3 13 HOH NB .   ? HOH F 5908 . ? 1_555 ? 
186 DC3 13 HOH NB .   ? HOH F 5986 . ? 1_555 ? 
187 DC4 13 GLY G  127 ? GLY G 127  . ? 1_555 ? 
188 DC4 13 GLU G  129 ? GLU G 129  . ? 1_555 ? 
189 DC4 13 GLU G  207 ? GLU G 207  . ? 1_555 ? 
190 DC4 13 THR G  223 ? THR G 223  . ? 1_555 ? 
191 DC4 13 ARG G  224 ? ARG G 224  . ? 1_555 ? 
192 DC4 13 PHE G  225 ? PHE G 225  . ? 1_555 ? 
193 DC4 13 HIS G  271 ? HIS G 271  . ? 1_555 ? 
194 DC4 13 SER G  273 ? SER G 273  . ? 1_555 ? 
195 DC4 13 ARG G  355 ? ARG G 355  . ? 1_555 ? 
196 DC4 13 GLU G  357 ? GLU G 357  . ? 1_555 ? 
197 DC4 13 MN  LA .   ? MN  G 470  . ? 1_555 ? 
198 DC4 13 HOH OB .   ? HOH G 5986 . ? 1_555 ? 
199 DC4 13 HOH OB .   ? HOH G 6058 . ? 1_555 ? 
200 DC5 13 GLY H  127 ? GLY H 127  . ? 1_555 ? 
201 DC5 13 GLU H  129 ? GLU H 129  . ? 1_555 ? 
202 DC5 13 GLU H  207 ? GLU H 207  . ? 1_555 ? 
203 DC5 13 THR H  223 ? THR H 223  . ? 1_555 ? 
204 DC5 13 ARG H  224 ? ARG H 224  . ? 1_555 ? 
205 DC5 13 PHE H  225 ? PHE H 225  . ? 1_555 ? 
206 DC5 13 HIS H  271 ? HIS H 271  . ? 1_555 ? 
207 DC5 13 SER H  273 ? SER H 273  . ? 1_555 ? 
208 DC5 13 ARG H  355 ? ARG H 355  . ? 1_555 ? 
209 DC5 13 GLU H  357 ? GLU H 357  . ? 1_555 ? 
210 DC5 13 MN  PA .   ? MN  H 470  . ? 1_555 ? 
211 DC5 13 HOH PB .   ? HOH H 5914 . ? 1_555 ? 
212 DC5 13 HOH PB .   ? HOH H 5990 . ? 1_555 ? 
213 DC6 13 GLY I  127 ? GLY I 127  . ? 1_555 ? 
214 DC6 13 GLU I  129 ? GLU I 129  . ? 1_555 ? 
215 DC6 13 GLU I  207 ? GLU I 207  . ? 1_555 ? 
216 DC6 13 THR I  223 ? THR I 223  . ? 1_555 ? 
217 DC6 13 ARG I  224 ? ARG I 224  . ? 1_555 ? 
218 DC6 13 PHE I  225 ? PHE I 225  . ? 1_555 ? 
219 DC6 13 HIS I  271 ? HIS I 271  . ? 1_555 ? 
220 DC6 13 SER I  273 ? SER I 273  . ? 1_555 ? 
221 DC6 13 ARG I  355 ? ARG I 355  . ? 1_555 ? 
222 DC6 13 GLU I  357 ? GLU I 357  . ? 1_555 ? 
223 DC6 13 MN  TA .   ? MN  I 470  . ? 1_555 ? 
224 DC6 13 HOH QB .   ? HOH I 5918 . ? 1_555 ? 
225 DC6 13 HOH QB .   ? HOH I 5997 . ? 1_555 ? 
226 DC7 13 GLY J  127 ? GLY J 127  . ? 1_555 ? 
227 DC7 13 GLU J  129 ? GLU J 129  . ? 1_555 ? 
228 DC7 13 GLU J  207 ? GLU J 207  . ? 1_555 ? 
229 DC7 13 THR J  223 ? THR J 223  . ? 1_555 ? 
230 DC7 13 ARG J  224 ? ARG J 224  . ? 1_555 ? 
231 DC7 13 PHE J  225 ? PHE J 225  . ? 1_555 ? 
232 DC7 13 HIS J  271 ? HIS J 271  . ? 1_555 ? 
233 DC7 13 SER J  273 ? SER J 273  . ? 1_555 ? 
234 DC7 13 ARG J  355 ? ARG J 355  . ? 1_555 ? 
235 DC7 13 GLU J  357 ? GLU J 357  . ? 1_555 ? 
236 DC7 13 MN  XA .   ? MN  J 470  . ? 1_555 ? 
237 DC7 13 HOH RB .   ? HOH J 5916 . ? 1_555 ? 
238 DC7 13 HOH RB .   ? HOH J 5993 . ? 1_555 ? 
239 DC8 13 GLY K  127 ? GLY K 127  . ? 1_555 ? 
240 DC8 13 GLU K  129 ? GLU K 129  . ? 1_555 ? 
241 DC8 13 GLU K  207 ? GLU K 207  . ? 1_555 ? 
242 DC8 13 THR K  223 ? THR K 223  . ? 1_555 ? 
243 DC8 13 ARG K  224 ? ARG K 224  . ? 1_555 ? 
244 DC8 13 PHE K  225 ? PHE K 225  . ? 1_555 ? 
245 DC8 13 HIS K  271 ? HIS K 271  . ? 1_555 ? 
246 DC8 13 SER K  273 ? SER K 273  . ? 1_555 ? 
247 DC8 13 ARG K  355 ? ARG K 355  . ? 1_555 ? 
248 DC8 13 GLU K  357 ? GLU K 357  . ? 1_555 ? 
249 DC8 13 MN  BB .   ? MN  K 470  . ? 1_555 ? 
250 DC8 13 HOH SB .   ? HOH K 1461 . ? 1_555 ? 
251 DC8 13 HOH SB .   ? HOH K 1609 . ? 1_555 ? 
252 DC9 13 GLY L  127 ? GLY L 127  . ? 1_555 ? 
253 DC9 13 GLU L  129 ? GLU L 129  . ? 1_555 ? 
254 DC9 13 GLU L  207 ? GLU L 207  . ? 1_555 ? 
255 DC9 13 THR L  223 ? THR L 223  . ? 1_555 ? 
256 DC9 13 ARG L  224 ? ARG L 224  . ? 1_555 ? 
257 DC9 13 PHE L  225 ? PHE L 225  . ? 1_555 ? 
258 DC9 13 HIS L  271 ? HIS L 271  . ? 1_555 ? 
259 DC9 13 SER L  273 ? SER L 273  . ? 1_555 ? 
260 DC9 13 ARG L  355 ? ARG L 355  . ? 1_555 ? 
261 DC9 13 GLU L  357 ? GLU L 357  . ? 1_555 ? 
262 DC9 13 MN  FB .   ? MN  L 470  . ? 1_555 ? 
263 DC9 13 HOH TB .   ? HOH L 1614 . ? 1_555 ? 
264 DC9 13 HOH TB .   ? HOH L 1762 . ? 1_555 ? 
265 EC1 12 GLU A  131 ? GLU A 131  . ? 1_555 ? 
266 EC1 12 GLU A  212 ? GLU A 212  . ? 1_555 ? 
267 EC1 12 ASN A  264 ? ASN A 264  . ? 1_555 ? 
268 EC1 12 GLY A  265 ? GLY A 265  . ? 1_555 ? 
269 EC1 12 SER A  266 ? SER A 266  . ? 1_555 ? 
270 EC1 12 GLY A  267 ? GLY A 267  . ? 1_555 ? 
271 EC1 12 HIS A  269 ? HIS A 269  . ? 1_555 ? 
272 EC1 12 ARG A  321 ? ARG A 321  . ? 1_555 ? 
273 EC1 12 GLU A  327 ? GLU A 327  . ? 1_555 ? 
274 EC1 12 ARG A  359 ? ARG A 359  . ? 1_555 ? 
275 EC1 12 MN  M  .   ? MN  A 469  . ? 1_555 ? 
276 EC1 12 MN  N  .   ? MN  A 470  . ? 1_555 ? 
277 EC2 12 GLU B  131 ? GLU B 131  . ? 1_555 ? 
278 EC2 12 GLU B  212 ? GLU B 212  . ? 1_555 ? 
279 EC2 12 ASN B  264 ? ASN B 264  . ? 1_555 ? 
280 EC2 12 GLY B  265 ? GLY B 265  . ? 1_555 ? 
281 EC2 12 SER B  266 ? SER B 266  . ? 1_555 ? 
282 EC2 12 GLY B  267 ? GLY B 267  . ? 1_555 ? 
283 EC2 12 HIS B  269 ? HIS B 269  . ? 1_555 ? 
284 EC2 12 ARG B  321 ? ARG B 321  . ? 1_555 ? 
285 EC2 12 GLU B  327 ? GLU B 327  . ? 1_555 ? 
286 EC2 12 ARG B  359 ? ARG B 359  . ? 1_555 ? 
287 EC2 12 MN  Q  .   ? MN  B 469  . ? 1_555 ? 
288 EC2 12 MN  R  .   ? MN  B 470  . ? 1_555 ? 
289 EC3 12 GLU C  131 ? GLU C 131  . ? 1_555 ? 
290 EC3 12 GLU C  212 ? GLU C 212  . ? 1_555 ? 
291 EC3 12 ASN C  264 ? ASN C 264  . ? 1_555 ? 
292 EC3 12 GLY C  265 ? GLY C 265  . ? 1_555 ? 
293 EC3 12 SER C  266 ? SER C 266  . ? 1_555 ? 
294 EC3 12 GLY C  267 ? GLY C 267  . ? 1_555 ? 
295 EC3 12 HIS C  269 ? HIS C 269  . ? 1_555 ? 
296 EC3 12 ARG C  321 ? ARG C 321  . ? 1_555 ? 
297 EC3 12 GLU C  327 ? GLU C 327  . ? 1_555 ? 
298 EC3 12 ARG C  359 ? ARG C 359  . ? 1_555 ? 
299 EC3 12 MN  U  .   ? MN  C 469  . ? 1_555 ? 
300 EC3 12 MN  V  .   ? MN  C 470  . ? 1_555 ? 
301 EC4 12 GLU D  131 ? GLU D 131  . ? 1_555 ? 
302 EC4 12 GLU D  212 ? GLU D 212  . ? 1_555 ? 
303 EC4 12 ASN D  264 ? ASN D 264  . ? 1_555 ? 
304 EC4 12 GLY D  265 ? GLY D 265  . ? 1_555 ? 
305 EC4 12 SER D  266 ? SER D 266  . ? 1_555 ? 
306 EC4 12 GLY D  267 ? GLY D 267  . ? 1_555 ? 
307 EC4 12 HIS D  269 ? HIS D 269  . ? 1_555 ? 
308 EC4 12 ARG D  321 ? ARG D 321  . ? 1_555 ? 
309 EC4 12 GLU D  327 ? GLU D 327  . ? 1_555 ? 
310 EC4 12 ARG D  359 ? ARG D 359  . ? 1_555 ? 
311 EC4 12 MN  Y  .   ? MN  D 469  . ? 1_555 ? 
312 EC4 12 MN  Z  .   ? MN  D 470  . ? 1_555 ? 
313 EC5 12 GLU E  131 ? GLU E 131  . ? 1_555 ? 
314 EC5 12 GLU E  212 ? GLU E 212  . ? 1_555 ? 
315 EC5 12 ASN E  264 ? ASN E 264  . ? 1_555 ? 
316 EC5 12 GLY E  265 ? GLY E 265  . ? 1_555 ? 
317 EC5 12 SER E  266 ? SER E 266  . ? 1_555 ? 
318 EC5 12 GLY E  267 ? GLY E 267  . ? 1_555 ? 
319 EC5 12 HIS E  269 ? HIS E 269  . ? 1_555 ? 
320 EC5 12 ARG E  321 ? ARG E 321  . ? 1_555 ? 
321 EC5 12 GLU E  327 ? GLU E 327  . ? 1_555 ? 
322 EC5 12 ARG E  359 ? ARG E 359  . ? 1_555 ? 
323 EC5 12 MN  CA .   ? MN  E 469  . ? 1_555 ? 
324 EC5 12 MN  DA .   ? MN  E 470  . ? 1_555 ? 
325 EC6 12 GLU F  131 ? GLU F 131  . ? 1_555 ? 
326 EC6 12 GLU F  212 ? GLU F 212  . ? 1_555 ? 
327 EC6 12 ASN F  264 ? ASN F 264  . ? 1_555 ? 
328 EC6 12 GLY F  265 ? GLY F 265  . ? 1_555 ? 
329 EC6 12 SER F  266 ? SER F 266  . ? 1_555 ? 
330 EC6 12 GLY F  267 ? GLY F 267  . ? 1_555 ? 
331 EC6 12 HIS F  269 ? HIS F 269  . ? 1_555 ? 
332 EC6 12 ARG F  321 ? ARG F 321  . ? 1_555 ? 
333 EC6 12 GLU F  327 ? GLU F 327  . ? 1_555 ? 
334 EC6 12 ARG F  359 ? ARG F 359  . ? 1_555 ? 
335 EC6 12 MN  GA .   ? MN  F 469  . ? 1_555 ? 
336 EC6 12 MN  HA .   ? MN  F 470  . ? 1_555 ? 
337 EC7 12 GLU G  131 ? GLU G 131  . ? 1_555 ? 
338 EC7 12 GLU G  212 ? GLU G 212  . ? 1_555 ? 
339 EC7 12 ASN G  264 ? ASN G 264  . ? 1_555 ? 
340 EC7 12 GLY G  265 ? GLY G 265  . ? 1_555 ? 
341 EC7 12 SER G  266 ? SER G 266  . ? 1_555 ? 
342 EC7 12 GLY G  267 ? GLY G 267  . ? 1_555 ? 
343 EC7 12 HIS G  269 ? HIS G 269  . ? 1_555 ? 
344 EC7 12 ARG G  321 ? ARG G 321  . ? 1_555 ? 
345 EC7 12 GLU G  327 ? GLU G 327  . ? 1_555 ? 
346 EC7 12 ARG G  359 ? ARG G 359  . ? 1_555 ? 
347 EC7 12 MN  KA .   ? MN  G 469  . ? 1_555 ? 
348 EC7 12 MN  LA .   ? MN  G 470  . ? 1_555 ? 
349 EC8 12 GLU H  131 ? GLU H 131  . ? 1_555 ? 
350 EC8 12 GLU H  212 ? GLU H 212  . ? 1_555 ? 
351 EC8 12 ASN H  264 ? ASN H 264  . ? 1_555 ? 
352 EC8 12 GLY H  265 ? GLY H 265  . ? 1_555 ? 
353 EC8 12 SER H  266 ? SER H 266  . ? 1_555 ? 
354 EC8 12 GLY H  267 ? GLY H 267  . ? 1_555 ? 
355 EC8 12 HIS H  269 ? HIS H 269  . ? 1_555 ? 
356 EC8 12 ARG H  321 ? ARG H 321  . ? 1_555 ? 
357 EC8 12 GLU H  327 ? GLU H 327  . ? 1_555 ? 
358 EC8 12 ARG H  359 ? ARG H 359  . ? 1_555 ? 
359 EC8 12 MN  OA .   ? MN  H 469  . ? 1_555 ? 
360 EC8 12 MN  PA .   ? MN  H 470  . ? 1_555 ? 
361 EC9 12 GLU I  131 ? GLU I 131  . ? 1_555 ? 
362 EC9 12 GLU I  212 ? GLU I 212  . ? 1_555 ? 
363 EC9 12 ASN I  264 ? ASN I 264  . ? 1_555 ? 
364 EC9 12 GLY I  265 ? GLY I 265  . ? 1_555 ? 
365 EC9 12 SER I  266 ? SER I 266  . ? 1_555 ? 
366 EC9 12 GLY I  267 ? GLY I 267  . ? 1_555 ? 
367 EC9 12 HIS I  269 ? HIS I 269  . ? 1_555 ? 
368 EC9 12 ARG I  321 ? ARG I 321  . ? 1_555 ? 
369 EC9 12 GLU I  327 ? GLU I 327  . ? 1_555 ? 
370 EC9 12 ARG I  359 ? ARG I 359  . ? 1_555 ? 
371 EC9 12 MN  SA .   ? MN  I 469  . ? 1_555 ? 
372 EC9 12 MN  TA .   ? MN  I 470  . ? 1_555 ? 
373 FC1 12 GLU J  131 ? GLU J 131  . ? 1_555 ? 
374 FC1 12 GLU J  212 ? GLU J 212  . ? 1_555 ? 
375 FC1 12 ASN J  264 ? ASN J 264  . ? 1_555 ? 
376 FC1 12 GLY J  265 ? GLY J 265  . ? 1_555 ? 
377 FC1 12 SER J  266 ? SER J 266  . ? 1_555 ? 
378 FC1 12 GLY J  267 ? GLY J 267  . ? 1_555 ? 
379 FC1 12 HIS J  269 ? HIS J 269  . ? 1_555 ? 
380 FC1 12 ARG J  321 ? ARG J 321  . ? 1_555 ? 
381 FC1 12 GLU J  327 ? GLU J 327  . ? 1_555 ? 
382 FC1 12 ARG J  359 ? ARG J 359  . ? 1_555 ? 
383 FC1 12 MN  WA .   ? MN  J 469  . ? 1_555 ? 
384 FC1 12 MN  XA .   ? MN  J 470  . ? 1_555 ? 
385 FC2 12 GLU K  131 ? GLU K 131  . ? 1_555 ? 
386 FC2 12 GLU K  212 ? GLU K 212  . ? 1_555 ? 
387 FC2 12 ASN K  264 ? ASN K 264  . ? 1_555 ? 
388 FC2 12 GLY K  265 ? GLY K 265  . ? 1_555 ? 
389 FC2 12 SER K  266 ? SER K 266  . ? 1_555 ? 
390 FC2 12 GLY K  267 ? GLY K 267  . ? 1_555 ? 
391 FC2 12 HIS K  269 ? HIS K 269  . ? 1_555 ? 
392 FC2 12 ARG K  321 ? ARG K 321  . ? 1_555 ? 
393 FC2 12 GLU K  327 ? GLU K 327  . ? 1_555 ? 
394 FC2 12 ARG K  359 ? ARG K 359  . ? 1_555 ? 
395 FC2 12 MN  AB .   ? MN  K 469  . ? 1_555 ? 
396 FC2 12 MN  BB .   ? MN  K 470  . ? 1_555 ? 
397 FC3 12 GLU L  131 ? GLU L 131  . ? 1_555 ? 
398 FC3 12 GLU L  212 ? GLU L 212  . ? 1_555 ? 
399 FC3 12 ASN L  264 ? ASN L 264  . ? 1_555 ? 
400 FC3 12 GLY L  265 ? GLY L 265  . ? 1_555 ? 
401 FC3 12 SER L  266 ? SER L 266  . ? 1_555 ? 
402 FC3 12 GLY L  267 ? GLY L 267  . ? 1_555 ? 
403 FC3 12 HIS L  269 ? HIS L 269  . ? 1_555 ? 
404 FC3 12 ARG L  321 ? ARG L 321  . ? 1_555 ? 
405 FC3 12 GLU L  327 ? GLU L 327  . ? 1_555 ? 
406 FC3 12 ARG L  359 ? ARG L 359  . ? 1_555 ? 
407 FC3 12 MN  EB .   ? MN  L 469  . ? 1_555 ? 
408 FC3 12 MN  FB .   ? MN  L 470  . ? 1_555 ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CB A PHE 180 ? B CG A PHE 180 ? B CD1 A PHE 180 ? B 116.47 120.80 -4.33  0.70 N 
2  1 C  A ASP 362 ? ? N  A PRO 363 ? ? CD  A PRO 363 ? ? 114.24 128.40 -14.16 2.10 Y 
3  1 CB B PHE 180 ? B CG B PHE 180 ? B CD1 B PHE 180 ? B 116.46 120.80 -4.34  0.70 N 
4  1 C  B ASP 362 ? ? N  B PRO 363 ? ? CD  B PRO 363 ? ? 114.24 128.40 -14.16 2.10 Y 
5  1 CB C PHE 180 ? B CG C PHE 180 ? B CD1 C PHE 180 ? B 116.41 120.80 -4.39  0.70 N 
6  1 C  C ASP 362 ? ? N  C PRO 363 ? ? CD  C PRO 363 ? ? 114.19 128.40 -14.21 2.10 Y 
7  1 CB D PHE 180 ? B CG D PHE 180 ? B CD1 D PHE 180 ? B 116.47 120.80 -4.33  0.70 N 
8  1 C  D ASP 362 ? ? N  D PRO 363 ? ? CD  D PRO 363 ? ? 114.24 128.40 -14.16 2.10 Y 
9  1 CB E PHE 180 ? B CG E PHE 180 ? B CD1 E PHE 180 ? B 116.45 120.80 -4.35  0.70 N 
10 1 C  E ASP 362 ? ? N  E PRO 363 ? ? CD  E PRO 363 ? ? 114.21 128.40 -14.19 2.10 Y 
11 1 CB F PHE 180 ? B CG F PHE 180 ? B CD1 F PHE 180 ? B 116.47 120.80 -4.33  0.70 N 
12 1 C  F ASP 362 ? ? N  F PRO 363 ? ? CD  F PRO 363 ? ? 114.22 128.40 -14.18 2.10 Y 
13 1 CB G PHE 180 ? B CG G PHE 180 ? B CD1 G PHE 180 ? B 116.47 120.80 -4.33  0.70 N 
14 1 C  G ASP 362 ? ? N  G PRO 363 ? ? CD  G PRO 363 ? ? 114.26 128.40 -14.14 2.10 Y 
15 1 CB H PHE 180 ? B CG H PHE 180 ? B CD1 H PHE 180 ? B 116.45 120.80 -4.35  0.70 N 
16 1 C  H ASP 362 ? ? N  H PRO 363 ? ? CD  H PRO 363 ? ? 114.22 128.40 -14.18 2.10 Y 
17 1 CB I PHE 180 ? B CG I PHE 180 ? B CD1 I PHE 180 ? B 116.46 120.80 -4.34  0.70 N 
18 1 C  I ASP 362 ? ? N  I PRO 363 ? ? CD  I PRO 363 ? ? 114.25 128.40 -14.15 2.10 Y 
19 1 CB J PHE 180 ? B CG J PHE 180 ? B CD1 J PHE 180 ? B 116.47 120.80 -4.33  0.70 N 
20 1 C  J ASP 362 ? ? N  J PRO 363 ? ? CD  J PRO 363 ? ? 114.23 128.40 -14.17 2.10 Y 
21 1 CB K PHE 180 ? B CG K PHE 180 ? B CD1 K PHE 180 ? B 116.42 120.80 -4.38  0.70 N 
22 1 C  K ASP 362 ? ? N  K PRO 363 ? ? CD  K PRO 363 ? ? 114.28 128.40 -14.12 2.10 Y 
23 1 CB L PHE 180 ? B CG L PHE 180 ? B CD1 L PHE 180 ? B 116.48 120.80 -4.32  0.70 N 
24 1 C  L ASP 362 ? ? N  L PRO 363 ? ? CD  L PRO 363 ? ? 114.23 128.40 -14.17 2.10 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 SER A 53  ? ? -91.90  39.15   
2   1 LYS A 58  ? ? -35.05  163.09  
3   1 ILE A 60  ? ? -72.47  37.69   
4   1 ASN A 61  ? ? -144.69 -50.06  
5   1 SER A 83  ? ? -53.32  103.93  
6   1 ALA A 208 ? ? 174.00  170.52  
7   1 VAL A 213 ? A -23.58  -60.43  
8   1 PHE A 225 ? ? -57.45  174.65  
9   1 ASN A 264 ? B -7.37   98.60   
10  1 LEU A 281 ? ? -58.45  -8.92   
11  1 TYR A 287 ? ? -37.63  126.87  
12  1 ASN A 313 ? ? -156.91 61.82   
13  1 LEU A 322 ? ? -67.43  75.34   
14  1 ARG A 337 ? ? -90.85  -80.91  
15  1 ALA A 349 ? ? -34.35  -81.82  
16  1 ARG A 355 ? ? -172.49 -172.56 
17  1 LYS A 385 ? ? 35.61   52.19   
18  1 LYS A 394 ? ? -89.73  -149.55 
19  1 LEU A 396 ? ? -54.11  -108.62 
20  1 TYR A 397 ? ? -90.41  -60.31  
21  1 PRO A 401 ? ? -57.70  59.27   
22  1 GLU A 403 ? ? -149.48 25.95   
23  1 ALA A 404 ? ? 36.51   71.40   
24  1 GLU A 406 ? ? -114.22 58.08   
25  1 LEU A 423 ? ? -62.70  -70.50  
26  1 ASP A 424 ? ? -64.98  31.40   
27  1 SER B 53  ? ? -91.88  39.10   
28  1 LYS B 58  ? ? -35.06  163.04  
29  1 ILE B 60  ? ? -72.44  37.67   
30  1 ASN B 61  ? ? -144.63 -50.08  
31  1 SER B 83  ? ? -53.31  103.94  
32  1 ALA B 208 ? ? 173.97  170.51  
33  1 VAL B 213 ? A -23.64  -60.39  
34  1 PHE B 225 ? ? -57.51  174.65  
35  1 ASN B 264 ? B -7.41   98.59   
36  1 LEU B 281 ? ? -58.47  -8.92   
37  1 TYR B 287 ? ? -37.67  126.84  
38  1 ASN B 313 ? ? -156.87 61.87   
39  1 LEU B 322 ? ? -67.47  75.35   
40  1 ARG B 337 ? ? -90.84  -80.96  
41  1 ALA B 349 ? ? -34.33  -81.85  
42  1 ARG B 355 ? ? -172.47 -172.56 
43  1 LYS B 385 ? ? 35.58   52.27   
44  1 LYS B 394 ? ? -89.69  -149.52 
45  1 LEU B 396 ? ? -54.10  -108.57 
46  1 TYR B 397 ? ? -90.48  -60.28  
47  1 PRO B 401 ? ? -57.71  59.25   
48  1 GLU B 403 ? ? -149.49 25.95   
49  1 ALA B 404 ? ? 36.47   71.43   
50  1 GLU B 406 ? ? -114.17 58.12   
51  1 LEU B 423 ? ? -62.73  -70.51  
52  1 ASP B 424 ? ? -64.95  31.35   
53  1 SER C 53  ? ? -91.96  39.20   
54  1 LYS C 58  ? ? -34.96  163.03  
55  1 ILE C 60  ? ? -72.49  37.64   
56  1 ASN C 61  ? ? -144.66 -50.05  
57  1 SER C 83  ? ? -53.33  103.92  
58  1 ALA C 208 ? ? 174.00  170.54  
59  1 VAL C 213 ? A -23.57  -60.48  
60  1 PHE C 225 ? ? -57.38  174.63  
61  1 ASN C 264 ? B -7.41   98.59   
62  1 LEU C 281 ? ? -58.54  -8.85   
63  1 TYR C 287 ? ? -37.59  126.88  
64  1 ASN C 313 ? ? -156.90 61.79   
65  1 LEU C 322 ? ? -67.40  75.30   
66  1 ARG C 337 ? ? -90.87  -80.87  
67  1 ALA C 349 ? ? -34.27  -81.82  
68  1 ARG C 355 ? ? -172.51 -172.54 
69  1 LYS C 385 ? ? 35.64   52.14   
70  1 LYS C 394 ? ? -89.70  -149.55 
71  1 LEU C 396 ? ? -54.16  -108.57 
72  1 TYR C 397 ? ? -90.41  -60.37  
73  1 PRO C 401 ? ? -57.71  59.30   
74  1 GLU C 403 ? ? -149.53 25.98   
75  1 ALA C 404 ? ? 36.53   71.35   
76  1 GLU C 406 ? ? -114.27 58.14   
77  1 LEU C 423 ? ? -62.68  -70.56  
78  1 ASP C 424 ? ? -64.95  31.42   
79  1 SER D 53  ? ? -91.89  39.09   
80  1 LYS D 58  ? ? -35.00  163.01  
81  1 ILE D 60  ? ? -72.47  37.68   
82  1 ASN D 61  ? ? -144.65 -50.11  
83  1 SER D 83  ? ? -53.33  103.97  
84  1 ALA D 208 ? ? 174.01  170.50  
85  1 VAL D 213 ? A -23.62  -60.35  
86  1 PHE D 225 ? ? -57.44  174.68  
87  1 ASN D 264 ? B -7.33   98.55   
88  1 LEU D 281 ? ? -58.49  -8.86   
89  1 TYR D 287 ? ? -37.65  126.87  
90  1 ASN D 313 ? ? -156.91 61.86   
91  1 LEU D 322 ? ? -67.41  75.36   
92  1 ARG D 337 ? ? -90.87  -80.93  
93  1 ALA D 349 ? ? -34.34  -81.82  
94  1 ARG D 355 ? ? -172.50 -172.56 
95  1 LYS D 385 ? ? 35.60   52.20   
96  1 LYS D 394 ? ? -89.76  -149.55 
97  1 LEU D 396 ? ? -54.09  -108.63 
98  1 TYR D 397 ? ? -90.39  -60.33  
99  1 PRO D 401 ? ? -57.76  59.30   
100 1 GLU D 403 ? ? -149.48 25.95   
101 1 ALA D 404 ? ? 36.56   71.36   
102 1 GLU D 406 ? ? -114.19 58.12   
103 1 LEU D 423 ? ? -62.72  -70.55  
104 1 ASP D 424 ? ? -64.92  31.33   
105 1 SER E 53  ? ? -91.91  39.18   
106 1 LYS E 58  ? ? -35.01  163.04  
107 1 ILE E 60  ? ? -72.46  37.70   
108 1 ASN E 61  ? ? -144.67 -50.03  
109 1 SER E 83  ? ? -53.29  103.92  
110 1 ALA E 208 ? ? 173.99  170.52  
111 1 VAL E 213 ? A -23.63  -60.41  
112 1 PHE E 225 ? ? -57.41  174.67  
113 1 ASN E 264 ? B -7.39   98.61   
114 1 LEU E 281 ? ? -58.40  -8.92   
115 1 TYR E 287 ? ? -37.59  126.85  
116 1 ASN E 313 ? ? -156.89 61.74   
117 1 LEU E 322 ? ? -67.38  75.34   
118 1 ARG E 337 ? ? -90.83  -80.99  
119 1 ALA E 349 ? ? -34.38  -81.85  
120 1 ARG E 355 ? ? -172.49 -172.59 
121 1 LYS E 385 ? ? 35.65   52.18   
122 1 LYS E 394 ? ? -89.79  -149.58 
123 1 LEU E 396 ? ? -54.04  -108.65 
124 1 TYR E 397 ? ? -90.41  -60.34  
125 1 PRO E 401 ? ? -57.72  59.30   
126 1 GLU E 403 ? ? -149.50 25.95   
127 1 ALA E 404 ? ? 36.49   71.43   
128 1 GLU E 406 ? ? -114.22 58.07   
129 1 LEU E 423 ? ? -62.72  -70.50  
130 1 ASP E 424 ? ? -64.99  31.37   
131 1 SER F 53  ? ? -91.94  39.17   
132 1 LYS F 58  ? ? -35.07  163.06  
133 1 ILE F 60  ? ? -72.51  37.72   
134 1 ASN F 61  ? ? -144.70 -50.02  
135 1 SER F 83  ? ? -53.31  103.87  
136 1 ALA F 208 ? ? 173.98  170.56  
137 1 VAL F 213 ? A -23.57  -60.41  
138 1 PHE F 225 ? ? -57.46  174.69  
139 1 ASN F 264 ? B -7.45   98.63   
140 1 LEU F 281 ? ? -58.49  -8.91   
141 1 TYR F 287 ? ? -37.62  126.84  
142 1 ASN F 313 ? ? -156.90 61.83   
143 1 LEU F 322 ? ? -67.45  75.33   
144 1 ARG F 337 ? ? -90.84  -80.89  
145 1 ALA F 349 ? ? -34.36  -81.86  
146 1 ARG F 355 ? ? -172.52 -172.57 
147 1 LYS F 385 ? ? 35.62   52.21   
148 1 LYS F 394 ? ? -89.77  -149.55 
149 1 LEU F 396 ? ? -54.09  -108.63 
150 1 TYR F 397 ? ? -90.39  -60.33  
151 1 PRO F 401 ? ? -57.80  59.37   
152 1 GLU F 403 ? ? -149.46 25.96   
153 1 ALA F 404 ? ? 36.49   71.41   
154 1 GLU F 406 ? ? -114.19 58.09   
155 1 LEU F 423 ? ? -62.71  -70.48  
156 1 ASP F 424 ? ? -64.98  31.37   
157 1 SER G 53  ? ? -91.93  39.20   
158 1 LYS G 58  ? ? -35.00  163.07  
159 1 ILE G 60  ? ? -72.42  37.68   
160 1 ASN G 61  ? ? -144.68 -50.05  
161 1 SER G 83  ? ? -53.40  103.92  
162 1 ALA G 208 ? ? 174.03  170.52  
163 1 VAL G 213 ? A -23.58  -60.46  
164 1 PHE G 225 ? ? -57.43  174.65  
165 1 ASN G 264 ? B -7.42   98.58   
166 1 LEU G 281 ? ? -58.48  -8.88   
167 1 TYR G 287 ? ? -37.62  126.91  
168 1 ASN G 313 ? ? -156.91 61.76   
169 1 LEU G 322 ? ? -67.39  75.32   
170 1 ARG G 337 ? ? -90.96  -80.84  
171 1 ALA G 349 ? ? -34.32  -81.84  
172 1 ARG G 355 ? ? -172.49 -172.55 
173 1 LYS G 385 ? ? 35.59   52.21   
174 1 LYS G 394 ? ? -89.65  -149.61 
175 1 LEU G 396 ? ? -54.20  -108.60 
176 1 TYR G 397 ? ? -90.40  -60.27  
177 1 PRO G 401 ? ? -57.67  59.25   
178 1 GLU G 403 ? ? -149.50 25.98   
179 1 ALA G 404 ? ? 36.48   71.39   
180 1 GLU G 406 ? ? -114.20 58.09   
181 1 LEU G 423 ? ? -62.68  -70.46  
182 1 ASP G 424 ? ? -64.99  31.40   
183 1 SER H 53  ? ? -91.87  39.14   
184 1 LYS H 58  ? ? -34.99  163.04  
185 1 ILE H 60  ? ? -72.46  37.73   
186 1 ASN H 61  ? ? -144.74 -50.03  
187 1 SER H 83  ? ? -53.31  103.96  
188 1 ALA H 208 ? ? 174.01  170.52  
189 1 VAL H 213 ? A -23.54  -60.51  
190 1 PHE H 225 ? ? -57.45  174.68  
191 1 ASN H 264 ? B -7.31   98.56   
192 1 LEU H 281 ? ? -58.46  -8.91   
193 1 TYR H 287 ? ? -37.60  126.84  
194 1 ASN H 313 ? ? -156.89 61.78   
195 1 LEU H 322 ? ? -67.39  75.34   
196 1 ARG H 337 ? ? -90.84  -80.90  
197 1 ALA H 349 ? ? -34.30  -81.82  
198 1 ARG H 355 ? ? -172.48 -172.61 
199 1 LYS H 385 ? ? 35.57   52.23   
200 1 LYS H 394 ? ? -89.74  -149.50 
201 1 LEU H 396 ? ? -54.09  -108.58 
202 1 TYR H 397 ? ? -90.47  -60.28  
203 1 PRO H 401 ? ? -57.73  59.25   
204 1 GLU H 403 ? ? -149.41 25.96   
205 1 ALA H 404 ? ? 36.50   71.38   
206 1 GLU H 406 ? ? -114.22 58.06   
207 1 LEU H 423 ? ? -62.74  -70.48  
208 1 ASP H 424 ? ? -64.94  31.34   
209 1 SER I 53  ? ? -91.90  39.19   
210 1 LYS I 58  ? ? -35.07  163.09  
211 1 ILE I 60  ? ? -72.44  37.69   
212 1 ASN I 61  ? ? -144.65 -50.12  
213 1 SER I 83  ? ? -53.31  103.95  
214 1 ALA I 208 ? ? 173.98  170.54  
215 1 VAL I 213 ? A -23.62  -60.43  
216 1 PHE I 225 ? ? -57.42  174.64  
217 1 ASN I 264 ? B -7.30   98.57   
218 1 LEU I 281 ? ? -58.49  -8.89   
219 1 TYR I 287 ? ? -37.60  126.86  
220 1 ASN I 313 ? ? -156.91 61.85   
221 1 LEU I 322 ? ? -67.39  75.31   
222 1 ARG I 337 ? ? -90.89  -80.90  
223 1 ALA I 349 ? ? -34.36  -81.83  
224 1 ARG I 355 ? ? -172.50 -172.59 
225 1 LYS I 385 ? ? 35.64   52.16   
226 1 LYS I 394 ? ? -89.75  -149.54 
227 1 LEU I 396 ? ? -54.08  -108.65 
228 1 TYR I 397 ? ? -90.41  -60.27  
229 1 PRO I 401 ? ? -57.75  59.31   
230 1 GLU I 403 ? ? -149.48 25.91   
231 1 ALA I 404 ? ? 36.52   71.44   
232 1 GLU I 406 ? ? -114.27 58.08   
233 1 LEU I 423 ? ? -62.75  -70.45  
234 1 ASP I 424 ? ? -64.99  31.44   
235 1 SER J 53  ? ? -91.90  39.13   
236 1 LYS J 58  ? ? -35.07  163.11  
237 1 ILE J 60  ? ? -72.46  37.68   
238 1 ASN J 61  ? ? -144.65 -50.11  
239 1 SER J 83  ? ? -53.31  103.87  
240 1 ALA J 208 ? ? 174.02  170.57  
241 1 VAL J 213 ? A -23.54  -60.47  
242 1 PHE J 225 ? ? -57.43  174.65  
243 1 ASN J 264 ? B -7.37   98.59   
244 1 LEU J 281 ? ? -58.50  -8.98   
245 1 TYR J 287 ? ? -37.64  126.87  
246 1 ASN J 313 ? ? -156.93 61.82   
247 1 LEU J 322 ? ? -67.42  75.37   
248 1 ARG J 337 ? ? -90.90  -80.89  
249 1 ALA J 349 ? ? -34.35  -81.83  
250 1 ARG J 355 ? ? -172.45 -172.59 
251 1 LYS J 385 ? ? 35.64   52.19   
252 1 LYS J 394 ? ? -89.76  -149.52 
253 1 LEU J 396 ? ? -54.17  -108.65 
254 1 TYR J 397 ? ? -90.38  -60.34  
255 1 PRO J 401 ? ? -57.63  59.27   
256 1 GLU J 403 ? ? -149.54 25.93   
257 1 ALA J 404 ? ? 36.47   71.44   
258 1 GLU J 406 ? ? -114.25 58.16   
259 1 LEU J 423 ? ? -62.70  -70.47  
260 1 ASP J 424 ? ? -65.03  31.42   
261 1 SER K 53  ? ? -91.89  39.15   
262 1 LYS K 58  ? ? -35.08  163.14  
263 1 ILE K 60  ? ? -72.48  37.71   
264 1 ASN K 61  ? ? -144.72 -50.05  
265 1 SER K 83  ? ? -53.25  103.90  
266 1 ALA K 208 ? ? 174.02  170.52  
267 1 VAL K 213 ? A -23.59  -60.44  
268 1 PHE K 225 ? ? -57.47  174.64  
269 1 ASN K 264 ? B -7.41   98.61   
270 1 LEU K 281 ? ? -58.44  -8.88   
271 1 TYR K 287 ? ? -37.64  126.89  
272 1 ASN K 313 ? ? -156.87 61.82   
273 1 LEU K 322 ? ? -67.47  75.40   
274 1 ARG K 337 ? ? -90.84  -80.90  
275 1 ALA K 349 ? ? -34.38  -81.79  
276 1 ARG K 355 ? ? -172.45 -172.53 
277 1 LYS K 385 ? ? 35.53   52.29   
278 1 LYS K 394 ? ? -89.69  -149.54 
279 1 LEU K 396 ? ? -54.10  -108.62 
280 1 TYR K 397 ? ? -90.43  -60.30  
281 1 PRO K 401 ? ? -57.70  59.30   
282 1 GLU K 403 ? ? -149.51 25.89   
283 1 ALA K 404 ? ? 36.59   71.38   
284 1 GLU K 406 ? ? -114.26 58.03   
285 1 LEU K 423 ? ? -62.75  -70.49  
286 1 ASP K 424 ? ? -64.95  31.39   
287 1 SER L 53  ? ? -91.88  39.13   
288 1 LYS L 58  ? ? -34.98  163.05  
289 1 ILE L 60  ? ? -72.39  37.62   
290 1 ASN L 61  ? ? -144.68 -50.03  
291 1 SER L 83  ? ? -53.32  103.96  
292 1 ALA L 208 ? ? 174.00  170.53  
293 1 VAL L 213 ? A -23.54  -60.44  
294 1 PHE L 225 ? ? -57.50  174.63  
295 1 ASN L 264 ? B -7.46   98.63   
296 1 LEU L 281 ? ? -58.48  -8.86   
297 1 TYR L 287 ? ? -37.58  126.85  
298 1 ASN L 313 ? ? -156.93 61.86   
299 1 LEU L 322 ? ? -67.37  75.28   
300 1 ARG L 337 ? ? -90.87  -80.85  
301 1 ALA L 349 ? ? -34.39  -81.75  
302 1 ARG L 355 ? ? -172.48 -172.54 
303 1 LYS L 385 ? ? 35.69   52.16   
304 1 LYS L 394 ? ? -89.77  -149.52 
305 1 LEU L 396 ? ? -54.04  -108.61 
306 1 TYR L 397 ? ? -90.43  -60.33  
307 1 PRO L 401 ? ? -57.74  59.23   
308 1 GLU L 403 ? ? -149.53 25.97   
309 1 ALA L 404 ? ? 36.48   71.45   
310 1 GLU L 406 ? ? -114.19 58.06   
311 1 LEU L 423 ? ? -62.72  -70.54  
312 1 ASP L 424 ? ? -64.92  31.32   
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 ALA A 208 ? ? -10.32 
2  1 ALA B 208 ? ? -10.30 
3  1 ALA C 208 ? ? -10.31 
4  1 ALA D 208 ? ? -10.29 
5  1 ALA E 208 ? ? -10.33 
6  1 ALA F 208 ? ? -10.33 
7  1 ALA G 208 ? ? -10.35 
8  1 ALA H 208 ? ? -10.32 
9  1 ALA I 208 ? ? -10.33 
10 1 ALA J 208 ? ? -10.32 
11 1 ALA K 208 ? ? -10.35 
12 1 ALA L 208 ? ? -10.33 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ADP PB     P  N N 1   
ADP O1B    O  N N 2   
ADP O2B    O  N N 3   
ADP O3B    O  N N 4   
ADP PA     P  N S 5   
ADP O1A    O  N N 6   
ADP O2A    O  N N 7   
ADP O3A    O  N N 8   
ADP "O5'"  O  N N 9   
ADP "C5'"  C  N N 10  
ADP "C4'"  C  N R 11  
ADP "O4'"  O  N N 12  
ADP "C3'"  C  N S 13  
ADP "O3'"  O  N N 14  
ADP "C2'"  C  N R 15  
ADP "O2'"  O  N N 16  
ADP "C1'"  C  N R 17  
ADP N9     N  Y N 18  
ADP C8     C  Y N 19  
ADP N7     N  Y N 20  
ADP C5     C  Y N 21  
ADP C6     C  Y N 22  
ADP N6     N  N N 23  
ADP N1     N  Y N 24  
ADP C2     C  Y N 25  
ADP N3     N  Y N 26  
ADP C4     C  Y N 27  
ADP HOB2   H  N N 28  
ADP HOB3   H  N N 29  
ADP HOA2   H  N N 30  
ADP "H5'1" H  N N 31  
ADP "H5'2" H  N N 32  
ADP "H4'"  H  N N 33  
ADP "H3'"  H  N N 34  
ADP "HO3'" H  N N 35  
ADP "H2'"  H  N N 36  
ADP "HO2'" H  N N 37  
ADP "H1'"  H  N N 38  
ADP H8     H  N N 39  
ADP HN61   H  N N 40  
ADP HN62   H  N N 41  
ADP H2     H  N N 42  
ALA N      N  N N 43  
ALA CA     C  N S 44  
ALA C      C  N N 45  
ALA O      O  N N 46  
ALA CB     C  N N 47  
ALA OXT    O  N N 48  
ALA H      H  N N 49  
ALA H2     H  N N 50  
ALA HA     H  N N 51  
ALA HB1    H  N N 52  
ALA HB2    H  N N 53  
ALA HB3    H  N N 54  
ALA HXT    H  N N 55  
ARG N      N  N N 56  
ARG CA     C  N S 57  
ARG C      C  N N 58  
ARG O      O  N N 59  
ARG CB     C  N N 60  
ARG CG     C  N N 61  
ARG CD     C  N N 62  
ARG NE     N  N N 63  
ARG CZ     C  N N 64  
ARG NH1    N  N N 65  
ARG NH2    N  N N 66  
ARG OXT    O  N N 67  
ARG H      H  N N 68  
ARG H2     H  N N 69  
ARG HA     H  N N 70  
ARG HB2    H  N N 71  
ARG HB3    H  N N 72  
ARG HG2    H  N N 73  
ARG HG3    H  N N 74  
ARG HD2    H  N N 75  
ARG HD3    H  N N 76  
ARG HE     H  N N 77  
ARG HH11   H  N N 78  
ARG HH12   H  N N 79  
ARG HH21   H  N N 80  
ARG HH22   H  N N 81  
ARG HXT    H  N N 82  
ASN N      N  N N 83  
ASN CA     C  N S 84  
ASN C      C  N N 85  
ASN O      O  N N 86  
ASN CB     C  N N 87  
ASN CG     C  N N 88  
ASN OD1    O  N N 89  
ASN ND2    N  N N 90  
ASN OXT    O  N N 91  
ASN H      H  N N 92  
ASN H2     H  N N 93  
ASN HA     H  N N 94  
ASN HB2    H  N N 95  
ASN HB3    H  N N 96  
ASN HD21   H  N N 97  
ASN HD22   H  N N 98  
ASN HXT    H  N N 99  
ASP N      N  N N 100 
ASP CA     C  N S 101 
ASP C      C  N N 102 
ASP O      O  N N 103 
ASP CB     C  N N 104 
ASP CG     C  N N 105 
ASP OD1    O  N N 106 
ASP OD2    O  N N 107 
ASP OXT    O  N N 108 
ASP H      H  N N 109 
ASP H2     H  N N 110 
ASP HA     H  N N 111 
ASP HB2    H  N N 112 
ASP HB3    H  N N 113 
ASP HD2    H  N N 114 
ASP HXT    H  N N 115 
CYS N      N  N N 116 
CYS CA     C  N R 117 
CYS C      C  N N 118 
CYS O      O  N N 119 
CYS CB     C  N N 120 
CYS SG     S  N N 121 
CYS OXT    O  N N 122 
CYS H      H  N N 123 
CYS H2     H  N N 124 
CYS HA     H  N N 125 
CYS HB2    H  N N 126 
CYS HB3    H  N N 127 
CYS HG     H  N N 128 
CYS HXT    H  N N 129 
GLN N      N  N N 130 
GLN CA     C  N S 131 
GLN C      C  N N 132 
GLN O      O  N N 133 
GLN CB     C  N N 134 
GLN CG     C  N N 135 
GLN CD     C  N N 136 
GLN OE1    O  N N 137 
GLN NE2    N  N N 138 
GLN OXT    O  N N 139 
GLN H      H  N N 140 
GLN H2     H  N N 141 
GLN HA     H  N N 142 
GLN HB2    H  N N 143 
GLN HB3    H  N N 144 
GLN HG2    H  N N 145 
GLN HG3    H  N N 146 
GLN HE21   H  N N 147 
GLN HE22   H  N N 148 
GLN HXT    H  N N 149 
GLU N      N  N N 150 
GLU CA     C  N S 151 
GLU C      C  N N 152 
GLU O      O  N N 153 
GLU CB     C  N N 154 
GLU CG     C  N N 155 
GLU CD     C  N N 156 
GLU OE1    O  N N 157 
GLU OE2    O  N N 158 
GLU OXT    O  N N 159 
GLU H      H  N N 160 
GLU H2     H  N N 161 
GLU HA     H  N N 162 
GLU HB2    H  N N 163 
GLU HB3    H  N N 164 
GLU HG2    H  N N 165 
GLU HG3    H  N N 166 
GLU HE2    H  N N 167 
GLU HXT    H  N N 168 
GLY N      N  N N 169 
GLY CA     C  N N 170 
GLY C      C  N N 171 
GLY O      O  N N 172 
GLY OXT    O  N N 173 
GLY H      H  N N 174 
GLY H2     H  N N 175 
GLY HA2    H  N N 176 
GLY HA3    H  N N 177 
GLY HXT    H  N N 178 
HIS N      N  N N 179 
HIS CA     C  N S 180 
HIS C      C  N N 181 
HIS O      O  N N 182 
HIS CB     C  N N 183 
HIS CG     C  Y N 184 
HIS ND1    N  Y N 185 
HIS CD2    C  Y N 186 
HIS CE1    C  Y N 187 
HIS NE2    N  Y N 188 
HIS OXT    O  N N 189 
HIS H      H  N N 190 
HIS H2     H  N N 191 
HIS HA     H  N N 192 
HIS HB2    H  N N 193 
HIS HB3    H  N N 194 
HIS HD1    H  N N 195 
HIS HD2    H  N N 196 
HIS HE1    H  N N 197 
HIS HE2    H  N N 198 
HIS HXT    H  N N 199 
HOH O      O  N N 200 
HOH H1     H  N N 201 
HOH H2     H  N N 202 
ILE N      N  N N 203 
ILE CA     C  N S 204 
ILE C      C  N N 205 
ILE O      O  N N 206 
ILE CB     C  N S 207 
ILE CG1    C  N N 208 
ILE CG2    C  N N 209 
ILE CD1    C  N N 210 
ILE OXT    O  N N 211 
ILE H      H  N N 212 
ILE H2     H  N N 213 
ILE HA     H  N N 214 
ILE HB     H  N N 215 
ILE HG12   H  N N 216 
ILE HG13   H  N N 217 
ILE HG21   H  N N 218 
ILE HG22   H  N N 219 
ILE HG23   H  N N 220 
ILE HD11   H  N N 221 
ILE HD12   H  N N 222 
ILE HD13   H  N N 223 
ILE HXT    H  N N 224 
LEU N      N  N N 225 
LEU CA     C  N S 226 
LEU C      C  N N 227 
LEU O      O  N N 228 
LEU CB     C  N N 229 
LEU CG     C  N N 230 
LEU CD1    C  N N 231 
LEU CD2    C  N N 232 
LEU OXT    O  N N 233 
LEU H      H  N N 234 
LEU H2     H  N N 235 
LEU HA     H  N N 236 
LEU HB2    H  N N 237 
LEU HB3    H  N N 238 
LEU HG     H  N N 239 
LEU HD11   H  N N 240 
LEU HD12   H  N N 241 
LEU HD13   H  N N 242 
LEU HD21   H  N N 243 
LEU HD22   H  N N 244 
LEU HD23   H  N N 245 
LEU HXT    H  N N 246 
LYS N      N  N N 247 
LYS CA     C  N S 248 
LYS C      C  N N 249 
LYS O      O  N N 250 
LYS CB     C  N N 251 
LYS CG     C  N N 252 
LYS CD     C  N N 253 
LYS CE     C  N N 254 
LYS NZ     N  N N 255 
LYS OXT    O  N N 256 
LYS H      H  N N 257 
LYS H2     H  N N 258 
LYS HA     H  N N 259 
LYS HB2    H  N N 260 
LYS HB3    H  N N 261 
LYS HG2    H  N N 262 
LYS HG3    H  N N 263 
LYS HD2    H  N N 264 
LYS HD3    H  N N 265 
LYS HE2    H  N N 266 
LYS HE3    H  N N 267 
LYS HZ1    H  N N 268 
LYS HZ2    H  N N 269 
LYS HZ3    H  N N 270 
LYS HXT    H  N N 271 
MET N      N  N N 272 
MET CA     C  N S 273 
MET C      C  N N 274 
MET O      O  N N 275 
MET CB     C  N N 276 
MET CG     C  N N 277 
MET SD     S  N N 278 
MET CE     C  N N 279 
MET OXT    O  N N 280 
MET H      H  N N 281 
MET H2     H  N N 282 
MET HA     H  N N 283 
MET HB2    H  N N 284 
MET HB3    H  N N 285 
MET HG2    H  N N 286 
MET HG3    H  N N 287 
MET HE1    H  N N 288 
MET HE2    H  N N 289 
MET HE3    H  N N 290 
MET HXT    H  N N 291 
MN  MN     MN N N 292 
PHE N      N  N N 293 
PHE CA     C  N S 294 
PHE C      C  N N 295 
PHE O      O  N N 296 
PHE CB     C  N N 297 
PHE CG     C  Y N 298 
PHE CD1    C  Y N 299 
PHE CD2    C  Y N 300 
PHE CE1    C  Y N 301 
PHE CE2    C  Y N 302 
PHE CZ     C  Y N 303 
PHE OXT    O  N N 304 
PHE H      H  N N 305 
PHE H2     H  N N 306 
PHE HA     H  N N 307 
PHE HB2    H  N N 308 
PHE HB3    H  N N 309 
PHE HD1    H  N N 310 
PHE HD2    H  N N 311 
PHE HE1    H  N N 312 
PHE HE2    H  N N 313 
PHE HZ     H  N N 314 
PHE HXT    H  N N 315 
PPQ NP     N  N N 316 
PPQ CAP    C  N S 317 
PPQ CBP    C  N N 318 
PPQ CGP    C  N N 319 
PPQ PDP    P  N R 320 
PPQ CEP    C  N N 321 
PPQ OEA    O  N N 322 
PPQ OEB    O  N N 323 
PPQ CP     C  N N 324 
PPQ OP     O  N N 325 
PPQ OTP    O  N N 326 
PPQ HNP1   H  N N 327 
PPQ HNP2   H  N N 328 
PPQ HAP    H  N N 329 
PPQ HBP1   H  N N 330 
PPQ HBP2   H  N N 331 
PPQ HGP1   H  N N 332 
PPQ HGP2   H  N N 333 
PPQ HEP1   H  N N 334 
PPQ HEP2   H  N N 335 
PPQ HEP3   H  N N 336 
PPQ HEB    H  N N 337 
PPQ HTP    H  N N 338 
PRO N      N  N N 339 
PRO CA     C  N S 340 
PRO C      C  N N 341 
PRO O      O  N N 342 
PRO CB     C  N N 343 
PRO CG     C  N N 344 
PRO CD     C  N N 345 
PRO OXT    O  N N 346 
PRO H      H  N N 347 
PRO HA     H  N N 348 
PRO HB2    H  N N 349 
PRO HB3    H  N N 350 
PRO HG2    H  N N 351 
PRO HG3    H  N N 352 
PRO HD2    H  N N 353 
PRO HD3    H  N N 354 
PRO HXT    H  N N 355 
SER N      N  N N 356 
SER CA     C  N S 357 
SER C      C  N N 358 
SER O      O  N N 359 
SER CB     C  N N 360 
SER OG     O  N N 361 
SER OXT    O  N N 362 
SER H      H  N N 363 
SER H2     H  N N 364 
SER HA     H  N N 365 
SER HB2    H  N N 366 
SER HB3    H  N N 367 
SER HG     H  N N 368 
SER HXT    H  N N 369 
THR N      N  N N 370 
THR CA     C  N S 371 
THR C      C  N N 372 
THR O      O  N N 373 
THR CB     C  N R 374 
THR OG1    O  N N 375 
THR CG2    C  N N 376 
THR OXT    O  N N 377 
THR H      H  N N 378 
THR H2     H  N N 379 
THR HA     H  N N 380 
THR HB     H  N N 381 
THR HG1    H  N N 382 
THR HG21   H  N N 383 
THR HG22   H  N N 384 
THR HG23   H  N N 385 
THR HXT    H  N N 386 
TRP N      N  N N 387 
TRP CA     C  N S 388 
TRP C      C  N N 389 
TRP O      O  N N 390 
TRP CB     C  N N 391 
TRP CG     C  Y N 392 
TRP CD1    C  Y N 393 
TRP CD2    C  Y N 394 
TRP NE1    N  Y N 395 
TRP CE2    C  Y N 396 
TRP CE3    C  Y N 397 
TRP CZ2    C  Y N 398 
TRP CZ3    C  Y N 399 
TRP CH2    C  Y N 400 
TRP OXT    O  N N 401 
TRP H      H  N N 402 
TRP H2     H  N N 403 
TRP HA     H  N N 404 
TRP HB2    H  N N 405 
TRP HB3    H  N N 406 
TRP HD1    H  N N 407 
TRP HE1    H  N N 408 
TRP HE3    H  N N 409 
TRP HZ2    H  N N 410 
TRP HZ3    H  N N 411 
TRP HH2    H  N N 412 
TRP HXT    H  N N 413 
TYR N      N  N N 414 
TYR CA     C  N S 415 
TYR C      C  N N 416 
TYR O      O  N N 417 
TYR CB     C  N N 418 
TYR CG     C  Y N 419 
TYR CD1    C  Y N 420 
TYR CD2    C  Y N 421 
TYR CE1    C  Y N 422 
TYR CE2    C  Y N 423 
TYR CZ     C  Y N 424 
TYR OH     O  N N 425 
TYR OXT    O  N N 426 
TYR H      H  N N 427 
TYR H2     H  N N 428 
TYR HA     H  N N 429 
TYR HB2    H  N N 430 
TYR HB3    H  N N 431 
TYR HD1    H  N N 432 
TYR HD2    H  N N 433 
TYR HE1    H  N N 434 
TYR HE2    H  N N 435 
TYR HH     H  N N 436 
TYR HXT    H  N N 437 
VAL N      N  N N 438 
VAL CA     C  N S 439 
VAL C      C  N N 440 
VAL O      O  N N 441 
VAL CB     C  N N 442 
VAL CG1    C  N N 443 
VAL CG2    C  N N 444 
VAL OXT    O  N N 445 
VAL H      H  N N 446 
VAL H2     H  N N 447 
VAL HA     H  N N 448 
VAL HB     H  N N 449 
VAL HG11   H  N N 450 
VAL HG12   H  N N 451 
VAL HG13   H  N N 452 
VAL HG21   H  N N 453 
VAL HG22   H  N N 454 
VAL HG23   H  N N 455 
VAL HXT    H  N N 456 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ADP PB    O1B    doub N N 1   
ADP PB    O2B    sing N N 2   
ADP PB    O3B    sing N N 3   
ADP PB    O3A    sing N N 4   
ADP O2B   HOB2   sing N N 5   
ADP O3B   HOB3   sing N N 6   
ADP PA    O1A    doub N N 7   
ADP PA    O2A    sing N N 8   
ADP PA    O3A    sing N N 9   
ADP PA    "O5'"  sing N N 10  
ADP O2A   HOA2   sing N N 11  
ADP "O5'" "C5'"  sing N N 12  
ADP "C5'" "C4'"  sing N N 13  
ADP "C5'" "H5'1" sing N N 14  
ADP "C5'" "H5'2" sing N N 15  
ADP "C4'" "O4'"  sing N N 16  
ADP "C4'" "C3'"  sing N N 17  
ADP "C4'" "H4'"  sing N N 18  
ADP "O4'" "C1'"  sing N N 19  
ADP "C3'" "O3'"  sing N N 20  
ADP "C3'" "C2'"  sing N N 21  
ADP "C3'" "H3'"  sing N N 22  
ADP "O3'" "HO3'" sing N N 23  
ADP "C2'" "O2'"  sing N N 24  
ADP "C2'" "C1'"  sing N N 25  
ADP "C2'" "H2'"  sing N N 26  
ADP "O2'" "HO2'" sing N N 27  
ADP "C1'" N9     sing N N 28  
ADP "C1'" "H1'"  sing N N 29  
ADP N9    C8     sing Y N 30  
ADP N9    C4     sing Y N 31  
ADP C8    N7     doub Y N 32  
ADP C8    H8     sing N N 33  
ADP N7    C5     sing Y N 34  
ADP C5    C6     sing Y N 35  
ADP C5    C4     doub Y N 36  
ADP C6    N6     sing N N 37  
ADP C6    N1     doub Y N 38  
ADP N6    HN61   sing N N 39  
ADP N6    HN62   sing N N 40  
ADP N1    C2     sing Y N 41  
ADP C2    N3     doub Y N 42  
ADP C2    H2     sing N N 43  
ADP N3    C4     sing Y N 44  
ALA N     CA     sing N N 45  
ALA N     H      sing N N 46  
ALA N     H2     sing N N 47  
ALA CA    C      sing N N 48  
ALA CA    CB     sing N N 49  
ALA CA    HA     sing N N 50  
ALA C     O      doub N N 51  
ALA C     OXT    sing N N 52  
ALA CB    HB1    sing N N 53  
ALA CB    HB2    sing N N 54  
ALA CB    HB3    sing N N 55  
ALA OXT   HXT    sing N N 56  
ARG N     CA     sing N N 57  
ARG N     H      sing N N 58  
ARG N     H2     sing N N 59  
ARG CA    C      sing N N 60  
ARG CA    CB     sing N N 61  
ARG CA    HA     sing N N 62  
ARG C     O      doub N N 63  
ARG C     OXT    sing N N 64  
ARG CB    CG     sing N N 65  
ARG CB    HB2    sing N N 66  
ARG CB    HB3    sing N N 67  
ARG CG    CD     sing N N 68  
ARG CG    HG2    sing N N 69  
ARG CG    HG3    sing N N 70  
ARG CD    NE     sing N N 71  
ARG CD    HD2    sing N N 72  
ARG CD    HD3    sing N N 73  
ARG NE    CZ     sing N N 74  
ARG NE    HE     sing N N 75  
ARG CZ    NH1    sing N N 76  
ARG CZ    NH2    doub N N 77  
ARG NH1   HH11   sing N N 78  
ARG NH1   HH12   sing N N 79  
ARG NH2   HH21   sing N N 80  
ARG NH2   HH22   sing N N 81  
ARG OXT   HXT    sing N N 82  
ASN N     CA     sing N N 83  
ASN N     H      sing N N 84  
ASN N     H2     sing N N 85  
ASN CA    C      sing N N 86  
ASN CA    CB     sing N N 87  
ASN CA    HA     sing N N 88  
ASN C     O      doub N N 89  
ASN C     OXT    sing N N 90  
ASN CB    CG     sing N N 91  
ASN CB    HB2    sing N N 92  
ASN CB    HB3    sing N N 93  
ASN CG    OD1    doub N N 94  
ASN CG    ND2    sing N N 95  
ASN ND2   HD21   sing N N 96  
ASN ND2   HD22   sing N N 97  
ASN OXT   HXT    sing N N 98  
ASP N     CA     sing N N 99  
ASP N     H      sing N N 100 
ASP N     H2     sing N N 101 
ASP CA    C      sing N N 102 
ASP CA    CB     sing N N 103 
ASP CA    HA     sing N N 104 
ASP C     O      doub N N 105 
ASP C     OXT    sing N N 106 
ASP CB    CG     sing N N 107 
ASP CB    HB2    sing N N 108 
ASP CB    HB3    sing N N 109 
ASP CG    OD1    doub N N 110 
ASP CG    OD2    sing N N 111 
ASP OD2   HD2    sing N N 112 
ASP OXT   HXT    sing N N 113 
CYS N     CA     sing N N 114 
CYS N     H      sing N N 115 
CYS N     H2     sing N N 116 
CYS CA    C      sing N N 117 
CYS CA    CB     sing N N 118 
CYS CA    HA     sing N N 119 
CYS C     O      doub N N 120 
CYS C     OXT    sing N N 121 
CYS CB    SG     sing N N 122 
CYS CB    HB2    sing N N 123 
CYS CB    HB3    sing N N 124 
CYS SG    HG     sing N N 125 
CYS OXT   HXT    sing N N 126 
GLN N     CA     sing N N 127 
GLN N     H      sing N N 128 
GLN N     H2     sing N N 129 
GLN CA    C      sing N N 130 
GLN CA    CB     sing N N 131 
GLN CA    HA     sing N N 132 
GLN C     O      doub N N 133 
GLN C     OXT    sing N N 134 
GLN CB    CG     sing N N 135 
GLN CB    HB2    sing N N 136 
GLN CB    HB3    sing N N 137 
GLN CG    CD     sing N N 138 
GLN CG    HG2    sing N N 139 
GLN CG    HG3    sing N N 140 
GLN CD    OE1    doub N N 141 
GLN CD    NE2    sing N N 142 
GLN NE2   HE21   sing N N 143 
GLN NE2   HE22   sing N N 144 
GLN OXT   HXT    sing N N 145 
GLU N     CA     sing N N 146 
GLU N     H      sing N N 147 
GLU N     H2     sing N N 148 
GLU CA    C      sing N N 149 
GLU CA    CB     sing N N 150 
GLU CA    HA     sing N N 151 
GLU C     O      doub N N 152 
GLU C     OXT    sing N N 153 
GLU CB    CG     sing N N 154 
GLU CB    HB2    sing N N 155 
GLU CB    HB3    sing N N 156 
GLU CG    CD     sing N N 157 
GLU CG    HG2    sing N N 158 
GLU CG    HG3    sing N N 159 
GLU CD    OE1    doub N N 160 
GLU CD    OE2    sing N N 161 
GLU OE2   HE2    sing N N 162 
GLU OXT   HXT    sing N N 163 
GLY N     CA     sing N N 164 
GLY N     H      sing N N 165 
GLY N     H2     sing N N 166 
GLY CA    C      sing N N 167 
GLY CA    HA2    sing N N 168 
GLY CA    HA3    sing N N 169 
GLY C     O      doub N N 170 
GLY C     OXT    sing N N 171 
GLY OXT   HXT    sing N N 172 
HIS N     CA     sing N N 173 
HIS N     H      sing N N 174 
HIS N     H2     sing N N 175 
HIS CA    C      sing N N 176 
HIS CA    CB     sing N N 177 
HIS CA    HA     sing N N 178 
HIS C     O      doub N N 179 
HIS C     OXT    sing N N 180 
HIS CB    CG     sing N N 181 
HIS CB    HB2    sing N N 182 
HIS CB    HB3    sing N N 183 
HIS CG    ND1    sing Y N 184 
HIS CG    CD2    doub Y N 185 
HIS ND1   CE1    doub Y N 186 
HIS ND1   HD1    sing N N 187 
HIS CD2   NE2    sing Y N 188 
HIS CD2   HD2    sing N N 189 
HIS CE1   NE2    sing Y N 190 
HIS CE1   HE1    sing N N 191 
HIS NE2   HE2    sing N N 192 
HIS OXT   HXT    sing N N 193 
HOH O     H1     sing N N 194 
HOH O     H2     sing N N 195 
ILE N     CA     sing N N 196 
ILE N     H      sing N N 197 
ILE N     H2     sing N N 198 
ILE CA    C      sing N N 199 
ILE CA    CB     sing N N 200 
ILE CA    HA     sing N N 201 
ILE C     O      doub N N 202 
ILE C     OXT    sing N N 203 
ILE CB    CG1    sing N N 204 
ILE CB    CG2    sing N N 205 
ILE CB    HB     sing N N 206 
ILE CG1   CD1    sing N N 207 
ILE CG1   HG12   sing N N 208 
ILE CG1   HG13   sing N N 209 
ILE CG2   HG21   sing N N 210 
ILE CG2   HG22   sing N N 211 
ILE CG2   HG23   sing N N 212 
ILE CD1   HD11   sing N N 213 
ILE CD1   HD12   sing N N 214 
ILE CD1   HD13   sing N N 215 
ILE OXT   HXT    sing N N 216 
LEU N     CA     sing N N 217 
LEU N     H      sing N N 218 
LEU N     H2     sing N N 219 
LEU CA    C      sing N N 220 
LEU CA    CB     sing N N 221 
LEU CA    HA     sing N N 222 
LEU C     O      doub N N 223 
LEU C     OXT    sing N N 224 
LEU CB    CG     sing N N 225 
LEU CB    HB2    sing N N 226 
LEU CB    HB3    sing N N 227 
LEU CG    CD1    sing N N 228 
LEU CG    CD2    sing N N 229 
LEU CG    HG     sing N N 230 
LEU CD1   HD11   sing N N 231 
LEU CD1   HD12   sing N N 232 
LEU CD1   HD13   sing N N 233 
LEU CD2   HD21   sing N N 234 
LEU CD2   HD22   sing N N 235 
LEU CD2   HD23   sing N N 236 
LEU OXT   HXT    sing N N 237 
LYS N     CA     sing N N 238 
LYS N     H      sing N N 239 
LYS N     H2     sing N N 240 
LYS CA    C      sing N N 241 
LYS CA    CB     sing N N 242 
LYS CA    HA     sing N N 243 
LYS C     O      doub N N 244 
LYS C     OXT    sing N N 245 
LYS CB    CG     sing N N 246 
LYS CB    HB2    sing N N 247 
LYS CB    HB3    sing N N 248 
LYS CG    CD     sing N N 249 
LYS CG    HG2    sing N N 250 
LYS CG    HG3    sing N N 251 
LYS CD    CE     sing N N 252 
LYS CD    HD2    sing N N 253 
LYS CD    HD3    sing N N 254 
LYS CE    NZ     sing N N 255 
LYS CE    HE2    sing N N 256 
LYS CE    HE3    sing N N 257 
LYS NZ    HZ1    sing N N 258 
LYS NZ    HZ2    sing N N 259 
LYS NZ    HZ3    sing N N 260 
LYS OXT   HXT    sing N N 261 
MET N     CA     sing N N 262 
MET N     H      sing N N 263 
MET N     H2     sing N N 264 
MET CA    C      sing N N 265 
MET CA    CB     sing N N 266 
MET CA    HA     sing N N 267 
MET C     O      doub N N 268 
MET C     OXT    sing N N 269 
MET CB    CG     sing N N 270 
MET CB    HB2    sing N N 271 
MET CB    HB3    sing N N 272 
MET CG    SD     sing N N 273 
MET CG    HG2    sing N N 274 
MET CG    HG3    sing N N 275 
MET SD    CE     sing N N 276 
MET CE    HE1    sing N N 277 
MET CE    HE2    sing N N 278 
MET CE    HE3    sing N N 279 
MET OXT   HXT    sing N N 280 
PHE N     CA     sing N N 281 
PHE N     H      sing N N 282 
PHE N     H2     sing N N 283 
PHE CA    C      sing N N 284 
PHE CA    CB     sing N N 285 
PHE CA    HA     sing N N 286 
PHE C     O      doub N N 287 
PHE C     OXT    sing N N 288 
PHE CB    CG     sing N N 289 
PHE CB    HB2    sing N N 290 
PHE CB    HB3    sing N N 291 
PHE CG    CD1    doub Y N 292 
PHE CG    CD2    sing Y N 293 
PHE CD1   CE1    sing Y N 294 
PHE CD1   HD1    sing N N 295 
PHE CD2   CE2    doub Y N 296 
PHE CD2   HD2    sing N N 297 
PHE CE1   CZ     doub Y N 298 
PHE CE1   HE1    sing N N 299 
PHE CE2   CZ     sing Y N 300 
PHE CE2   HE2    sing N N 301 
PHE CZ    HZ     sing N N 302 
PHE OXT   HXT    sing N N 303 
PPQ NP    CAP    sing N N 304 
PPQ NP    HNP1   sing N N 305 
PPQ NP    HNP2   sing N N 306 
PPQ CAP   CBP    sing N N 307 
PPQ CAP   CP     sing N N 308 
PPQ CAP   HAP    sing N N 309 
PPQ CBP   CGP    sing N N 310 
PPQ CBP   HBP1   sing N N 311 
PPQ CBP   HBP2   sing N N 312 
PPQ CGP   PDP    sing N N 313 
PPQ CGP   HGP1   sing N N 314 
PPQ CGP   HGP2   sing N N 315 
PPQ PDP   CEP    sing N N 316 
PPQ PDP   OEA    doub N N 317 
PPQ PDP   OEB    sing N N 318 
PPQ CEP   HEP1   sing N N 319 
PPQ CEP   HEP2   sing N N 320 
PPQ CEP   HEP3   sing N N 321 
PPQ OEB   HEB    sing N N 322 
PPQ CP    OP     doub N N 323 
PPQ CP    OTP    sing N N 324 
PPQ OTP   HTP    sing N N 325 
PRO N     CA     sing N N 326 
PRO N     CD     sing N N 327 
PRO N     H      sing N N 328 
PRO CA    C      sing N N 329 
PRO CA    CB     sing N N 330 
PRO CA    HA     sing N N 331 
PRO C     O      doub N N 332 
PRO C     OXT    sing N N 333 
PRO CB    CG     sing N N 334 
PRO CB    HB2    sing N N 335 
PRO CB    HB3    sing N N 336 
PRO CG    CD     sing N N 337 
PRO CG    HG2    sing N N 338 
PRO CG    HG3    sing N N 339 
PRO CD    HD2    sing N N 340 
PRO CD    HD3    sing N N 341 
PRO OXT   HXT    sing N N 342 
SER N     CA     sing N N 343 
SER N     H      sing N N 344 
SER N     H2     sing N N 345 
SER CA    C      sing N N 346 
SER CA    CB     sing N N 347 
SER CA    HA     sing N N 348 
SER C     O      doub N N 349 
SER C     OXT    sing N N 350 
SER CB    OG     sing N N 351 
SER CB    HB2    sing N N 352 
SER CB    HB3    sing N N 353 
SER OG    HG     sing N N 354 
SER OXT   HXT    sing N N 355 
THR N     CA     sing N N 356 
THR N     H      sing N N 357 
THR N     H2     sing N N 358 
THR CA    C      sing N N 359 
THR CA    CB     sing N N 360 
THR CA    HA     sing N N 361 
THR C     O      doub N N 362 
THR C     OXT    sing N N 363 
THR CB    OG1    sing N N 364 
THR CB    CG2    sing N N 365 
THR CB    HB     sing N N 366 
THR OG1   HG1    sing N N 367 
THR CG2   HG21   sing N N 368 
THR CG2   HG22   sing N N 369 
THR CG2   HG23   sing N N 370 
THR OXT   HXT    sing N N 371 
TRP N     CA     sing N N 372 
TRP N     H      sing N N 373 
TRP N     H2     sing N N 374 
TRP CA    C      sing N N 375 
TRP CA    CB     sing N N 376 
TRP CA    HA     sing N N 377 
TRP C     O      doub N N 378 
TRP C     OXT    sing N N 379 
TRP CB    CG     sing N N 380 
TRP CB    HB2    sing N N 381 
TRP CB    HB3    sing N N 382 
TRP CG    CD1    doub Y N 383 
TRP CG    CD2    sing Y N 384 
TRP CD1   NE1    sing Y N 385 
TRP CD1   HD1    sing N N 386 
TRP CD2   CE2    doub Y N 387 
TRP CD2   CE3    sing Y N 388 
TRP NE1   CE2    sing Y N 389 
TRP NE1   HE1    sing N N 390 
TRP CE2   CZ2    sing Y N 391 
TRP CE3   CZ3    doub Y N 392 
TRP CE3   HE3    sing N N 393 
TRP CZ2   CH2    doub Y N 394 
TRP CZ2   HZ2    sing N N 395 
TRP CZ3   CH2    sing Y N 396 
TRP CZ3   HZ3    sing N N 397 
TRP CH2   HH2    sing N N 398 
TRP OXT   HXT    sing N N 399 
TYR N     CA     sing N N 400 
TYR N     H      sing N N 401 
TYR N     H2     sing N N 402 
TYR CA    C      sing N N 403 
TYR CA    CB     sing N N 404 
TYR CA    HA     sing N N 405 
TYR C     O      doub N N 406 
TYR C     OXT    sing N N 407 
TYR CB    CG     sing N N 408 
TYR CB    HB2    sing N N 409 
TYR CB    HB3    sing N N 410 
TYR CG    CD1    doub Y N 411 
TYR CG    CD2    sing Y N 412 
TYR CD1   CE1    sing Y N 413 
TYR CD1   HD1    sing N N 414 
TYR CD2   CE2    doub Y N 415 
TYR CD2   HD2    sing N N 416 
TYR CE1   CZ     doub Y N 417 
TYR CE1   HE1    sing N N 418 
TYR CE2   CZ     sing Y N 419 
TYR CE2   HE2    sing N N 420 
TYR CZ    OH     sing N N 421 
TYR OH    HH     sing N N 422 
TYR OXT   HXT    sing N N 423 
VAL N     CA     sing N N 424 
VAL N     H      sing N N 425 
VAL N     H2     sing N N 426 
VAL CA    C      sing N N 427 
VAL CA    CB     sing N N 428 
VAL CA    HA     sing N N 429 
VAL C     O      doub N N 430 
VAL C     OXT    sing N N 431 
VAL CB    CG1    sing N N 432 
VAL CB    CG2    sing N N 433 
VAL CB    HB     sing N N 434 
VAL CG1   HG11   sing N N 435 
VAL CG1   HG12   sing N N 436 
VAL CG1   HG13   sing N N 437 
VAL CG2   HG21   sing N N 438 
VAL CG2   HG22   sing N N 439 
VAL CG2   HG23   sing N N 440 
VAL OXT   HXT    sing N N 441 
# 
_atom_sites.entry_id                    1FPY 
_atom_sites.fract_transf_matrix[1][1]   0.00434 
_atom_sites.fract_transf_matrix[1][2]   0.00000 
_atom_sites.fract_transf_matrix[1][3]   0.00095 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.00755 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00523 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1 1   ? -87.868  -11.477 -96.506  0.69 76.40  ? 1    SER A N     1 
ATOM   2     C  CA    . SER A  1 1   ? -86.679  -11.675 -97.390  0.69 76.37  ? 1    SER A CA    1 
ATOM   3     C  C     . SER A  1 1   ? -86.056  -13.095 -97.289  0.69 76.16  ? 1    SER A C     1 
ATOM   4     O  O     . SER A  1 1   ? -84.855  -13.242 -96.984  0.69 75.93  ? 1    SER A O     1 
ATOM   5     C  CB    . SER A  1 1   ? -85.640  -10.630 -97.062  0.69 77.26  ? 1    SER A CB    1 
ATOM   6     O  OG    . SER A  1 1   ? -84.737  -11.045 -96.055  0.69 78.95  ? 1    SER A OG    1 
ATOM   7     N  N     . ALA A  1 2   ? -86.863  -14.143 -97.503  0.69 52.90  ? 2    ALA A N     1 
ATOM   8     C  CA    . ALA A  1 2   ? -86.266  -15.498 -97.417  0.69 45.88  ? 2    ALA A CA    1 
ATOM   9     C  C     . ALA A  1 2   ? -85.105  -15.541 -98.420  0.69 48.38  ? 2    ALA A C     1 
ATOM   10    O  O     . ALA A  1 2   ? -83.917  -15.816 -98.092  0.69 48.40  ? 2    ALA A O     1 
ATOM   11    C  CB    . ALA A  1 2   ? -87.301  -16.601 -97.710  0.69 71.08  ? 2    ALA A CB    1 
ATOM   12    N  N     . GLU A  1 3   ? -85.461  -15.165 -99.665  0.69 56.15  ? 3    GLU A N     1 
ATOM   13    C  CA    . GLU A  1 3   ? -84.492  -15.066 -100.737 0.69 57.63  ? 3    GLU A CA    1 
ATOM   14    C  C     . GLU A  1 3   ? -83.343  -14.088 -100.394 0.69 48.61  ? 3    GLU A C     1 
ATOM   15    O  O     . GLU A  1 3   ? -82.174  -14.476 -100.399 0.69 40.70  ? 3    GLU A O     1 
ATOM   16    C  CB    . GLU A  1 3   ? -85.195  -14.651 -102.052 0.69 80.00  ? 3    GLU A CB    1 
ATOM   17    C  CG    . GLU A  1 3   ? -84.313  -13.930 -103.063 0.69 97.96  ? 3    GLU A CG    1 
ATOM   18    C  CD    . GLU A  1 3   ? -83.281  -14.848 -103.718 0.69 100.00 ? 3    GLU A CD    1 
ATOM   19    O  OE1   . GLU A  1 3   ? -82.081  -14.719 -103.384 0.69 100.00 ? 3    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A  1 3   ? -83.670  -15.698 -104.543 0.69 100.00 ? 3    GLU A OE2   1 
ATOM   21    N  N     . HIS A  1 4   ? -83.687  -12.825 -100.117 0.69 51.19  ? 4    HIS A N     1 
ATOM   22    C  CA    . HIS A  1 4   ? -82.716  -11.784 -99.776  0.69 57.10  ? 4    HIS A CA    1 
ATOM   23    C  C     . HIS A  1 4   ? -81.658  -12.279 -98.780  0.69 55.48  ? 4    HIS A C     1 
ATOM   24    O  O     . HIS A  1 4   ? -80.446  -12.190 -99.067  0.69 63.44  ? 4    HIS A O     1 
ATOM   25    C  CB    . HIS A  1 4   ? -83.476  -10.584 -99.217  0.69 86.23  ? 4    HIS A CB    1 
ATOM   26    C  CG    . HIS A  1 4   ? -82.617  -9.503  -98.621  0.69 88.45  ? 4    HIS A CG    1 
ATOM   27    N  ND1   . HIS A  1 4   ? -82.976  -8.829  -97.448  0.69 100.00 ? 4    HIS A ND1   1 
ATOM   28    C  CD2   . HIS A  1 4   ? -81.475  -8.900  -99.053  0.69 82.38  ? 4    HIS A CD2   1 
ATOM   29    C  CE1   . HIS A  1 4   ? -82.099  -7.854  -97.211  0.69 91.57  ? 4    HIS A CE1   1 
ATOM   30    N  NE2   . HIS A  1 4   ? -81.174  -7.880  -98.174  0.69 94.62  ? 4    HIS A NE2   1 
ATOM   31    N  N     . VAL A  1 5   ? -82.130  -12.863 -97.673  0.69 43.76  ? 5    VAL A N     1 
ATOM   32    C  CA    . VAL A  1 5   ? -81.240  -13.410 -96.650  0.69 23.59  ? 5    VAL A CA    1 
ATOM   33    C  C     . VAL A  1 5   ? -80.206  -14.379 -97.224  0.69 37.20  ? 5    VAL A C     1 
ATOM   34    O  O     . VAL A  1 5   ? -79.012  -14.255 -96.918  0.69 40.88  ? 5    VAL A O     1 
ATOM   35    C  CB    . VAL A  1 5   ? -82.024  -14.152 -95.583  0.69 16.15  ? 5    VAL A CB    1 
ATOM   36    C  CG1   . VAL A  1 5   ? -81.096  -14.827 -94.626  0.69 21.34  ? 5    VAL A CG1   1 
ATOM   37    C  CG2   . VAL A  1 5   ? -82.843  -13.195 -94.821  0.69 23.21  ? 5    VAL A CG2   1 
ATOM   38    N  N     . LEU A  1 6   ? -80.649  -15.343 -98.034  0.69 35.92  ? 6    LEU A N     1 
ATOM   39    C  CA    . LEU A  1 6   ? -79.693  -16.296 -98.590  0.69 51.14  ? 6    LEU A CA    1 
ATOM   40    C  C     . LEU A  1 6   ? -78.579  -15.631 -99.335  0.69 55.27  ? 6    LEU A C     1 
ATOM   41    O  O     . LEU A  1 6   ? -77.415  -16.006 -99.198  0.69 62.72  ? 6    LEU A O     1 
ATOM   42    C  CB    . LEU A  1 6   ? -80.414  -17.310 -99.467  0.69 57.84  ? 6    LEU A CB    1 
ATOM   43    C  CG    . LEU A  1 6   ? -80.816  -18.627 -98.780  0.69 74.74  ? 6    LEU A CG    1 
ATOM   44    C  CD1   . LEU A  1 6   ? -79.604  -19.259 -98.114  0.69 76.36  ? 6    LEU A CD1   1 
ATOM   45    C  CD2   . LEU A  1 6   ? -81.925  -18.406 -97.761  0.69 59.51  ? 6    LEU A CD2   1 
ATOM   46    N  N     . THR A  1 7   ? -78.907  -14.621 -100.130 0.69 43.57  ? 7    THR A N     1 
ATOM   47    C  CA    . THR A  1 7   ? -77.894  -13.888 -100.904 0.69 65.97  ? 7    THR A CA    1 
ATOM   48    C  C     . THR A  1 7   ? -76.952  -13.149 -99.937  0.69 56.45  ? 7    THR A C     1 
ATOM   49    O  O     . THR A  1 7   ? -75.722  -13.119 -100.128 0.69 67.89  ? 7    THR A O     1 
ATOM   50    C  CB    . THR A  1 7   ? -78.535  -12.879 -101.895 0.69 77.65  ? 7    THR A CB    1 
ATOM   51    O  OG1   . THR A  1 7   ? -78.215  -11.557 -101.478 0.69 58.56  ? 7    THR A OG1   1 
ATOM   52    C  CG2   . THR A  1 7   ? -80.037  -13.067 -101.932 0.69 67.89  ? 7    THR A CG2   1 
ATOM   53    N  N     . MET A  1 8   ? -77.562  -12.581 -98.911  0.69 48.73  ? 8    MET A N     1 
ATOM   54    C  CA    . MET A  1 8   ? -76.839  -11.839 -97.877  0.69 47.87  ? 8    MET A CA    1 
ATOM   55    C  C     . MET A  1 8   ? -75.822  -12.688 -97.078  0.69 49.13  ? 8    MET A C     1 
ATOM   56    O  O     . MET A  1 8   ? -74.871  -12.164 -96.481  0.69 56.29  ? 8    MET A O     1 
ATOM   57    C  CB    . MET A  1 8   ? -77.849  -11.172 -96.940  0.69 48.20  ? 8    MET A CB    1 
ATOM   58    C  CG    . MET A  1 8   ? -77.336  -9.914  -96.274  0.69 55.26  ? 8    MET A CG    1 
ATOM   59    S  SD    . MET A  1 8   ? -78.659  -8.785  -95.783  0.69 71.40  ? 8    MET A SD    1 
ATOM   60    C  CE    . MET A  1 8   ? -78.073  -8.274  -94.169  0.69 66.81  ? 8    MET A CE    1 
ATOM   61    N  N     . LEU A  1 9   ? -76.021  -14.010 -97.063  0.69 45.58  ? 9    LEU A N     1 
ATOM   62    C  CA    . LEU A  1 9   ? -75.093  -14.882 -96.358  0.69 39.19  ? 9    LEU A CA    1 
ATOM   63    C  C     . LEU A  1 9   ? -73.799  -14.964 -97.192  0.69 52.30  ? 9    LEU A C     1 
ATOM   64    O  O     . LEU A  1 9   ? -72.684  -14.780 -96.645  0.69 51.78  ? 9    LEU A O     1 
ATOM   65    C  CB    . LEU A  1 9   ? -75.702  -16.266 -96.156  0.69 27.42  ? 9    LEU A CB    1 
ATOM   66    C  CG    . LEU A  1 9   ? -76.863  -16.252 -95.158  0.69 26.66  ? 9    LEU A CG    1 
ATOM   67    C  CD1   . LEU A  1 9   ? -77.390  -17.644 -94.959  0.69 28.75  ? 9    LEU A CD1   1 
ATOM   68    C  CD2   . LEU A  1 9   ? -76.430  -15.695 -93.818  0.69 25.08  ? 9    LEU A CD2   1 
ATOM   69    N  N     . ASN A  1 10  ? -73.966  -15.144 -98.511  0.69 52.83  ? 10   ASN A N     1 
ATOM   70    C  CA    . ASN A  1 10  ? -72.814  -15.253 -99.422  0.69 54.51  ? 10   ASN A CA    1 
ATOM   71    C  C     . ASN A  1 10  ? -72.116  -13.926 -99.624  0.69 38.63  ? 10   ASN A C     1 
ATOM   72    O  O     . ASN A  1 10  ? -70.893  -13.860 -99.803  0.69 53.01  ? 10   ASN A O     1 
ATOM   73    C  CB    . ASN A  1 10  ? -73.273  -15.816 -100.770 0.69 42.00  ? 10   ASN A CB    1 
ATOM   74    C  CG    . ASN A  1 10  ? -73.829  -17.240 -100.622 0.69 71.88  ? 10   ASN A CG    1 
ATOM   75    O  OD1   . ASN A  1 10  ? -75.003  -17.438 -100.157 0.69 69.47  ? 10   ASN A OD1   1 
ATOM   76    N  ND2   . ASN A  1 10  ? -72.970  -18.256 -100.938 0.69 61.26  ? 10   ASN A ND2   1 
ATOM   77    N  N     . GLU A  1 11  ? -72.909  -12.871 -99.490  0.69 40.50  ? 11   GLU A N     1 
ATOM   78    C  CA    . GLU A  1 11  ? -72.417  -11.520 -99.692  0.69 54.09  ? 11   GLU A CA    1 
ATOM   79    C  C     . GLU A  1 11  ? -71.486  -11.047 -98.580  0.69 44.74  ? 11   GLU A C     1 
ATOM   80    O  O     . GLU A  1 11  ? -70.610  -10.184 -98.809  0.69 50.70  ? 11   GLU A O     1 
ATOM   81    C  CB    . GLU A  1 11  ? -73.600  -10.547 -99.825  0.69 77.03  ? 11   GLU A CB    1 
ATOM   82    C  CG    . GLU A  1 11  ? -73.216  -9.070  -100.110 0.69 75.16  ? 11   GLU A CG    1 
ATOM   83    C  CD    . GLU A  1 11  ? -74.510  -8.202  -100.308 0.69 96.50  ? 11   GLU A CD    1 
ATOM   84    O  OE1   . GLU A  1 11  ? -75.172  -8.369  -101.402 0.69 94.78  ? 11   GLU A OE1   1 
ATOM   85    O  OE2   . GLU A  1 11  ? -74.881  -7.398  -99.360  0.69 91.33  ? 11   GLU A OE2   1 
ATOM   86    N  N     . HIS A  1 12  ? -71.700  -11.577 -97.379  0.69 52.12  ? 12   HIS A N     1 
ATOM   87    C  CA    . HIS A  1 12  ? -70.857  -11.182 -96.244  0.69 54.70  ? 12   HIS A CA    1 
ATOM   88    C  C     . HIS A  1 12  ? -70.053  -12.353 -95.688  0.69 43.27  ? 12   HIS A C     1 
ATOM   89    O  O     . HIS A  1 12  ? -69.487  -12.222 -94.587  0.69 37.68  ? 12   HIS A O     1 
ATOM   90    C  CB    . HIS A  1 12  ? -71.718  -10.575 -95.130  0.69 58.80  ? 12   HIS A CB    1 
ATOM   91    C  CG    . HIS A  1 12  ? -72.200  -9.170  -95.392  0.69 67.86  ? 12   HIS A CG    1 
ATOM   92    N  ND1   . HIS A  1 12  ? -71.376  -8.055  -95.149  0.69 63.08  ? 12   HIS A ND1   1 
ATOM   93    C  CD2   . HIS A  1 12  ? -73.403  -8.681  -95.790  0.69 56.34  ? 12   HIS A CD2   1 
ATOM   94    C  CE1   . HIS A  1 12  ? -72.098  -6.955  -95.376  0.69 65.35  ? 12   HIS A CE1   1 
ATOM   95    N  NE2   . HIS A  1 12  ? -73.317  -7.306  -95.760  0.69 52.71  ? 12   HIS A NE2   1 
ATOM   96    N  N     . GLU A  1 13  ? -70.025  -13.483 -96.413  0.69 39.09  ? 13   GLU A N     1 
ATOM   97    C  CA    . GLU A  1 13  ? -69.321  -14.689 -95.961  0.69 32.42  ? 13   GLU A CA    1 
ATOM   98    C  C     . GLU A  1 13  ? -69.688  -14.874 -94.494  0.69 34.34  ? 13   GLU A C     1 
ATOM   99    O  O     . GLU A  1 13  ? -68.815  -14.898 -93.601  0.69 40.58  ? 13   GLU A O     1 
ATOM   100   C  CB    . GLU A  1 13  ? -67.814  -14.500 -96.115  0.69 41.40  ? 13   GLU A CB    1 
ATOM   101   C  CG    . GLU A  1 13  ? -67.400  -14.252 -97.563  0.69 62.55  ? 13   GLU A CG    1 
ATOM   102   C  CD    . GLU A  1 13  ? -66.063  -13.471 -97.658  0.69 65.26  ? 13   GLU A CD    1 
ATOM   103   O  OE1   . GLU A  1 13  ? -66.112  -12.207 -97.438  0.69 86.80  ? 13   GLU A OE1   1 
ATOM   104   O  OE2   . GLU A  1 13  ? -64.985  -14.105 -97.943  0.69 60.62  ? 13   GLU A OE2   1 
ATOM   105   N  N     . VAL A  1 14  ? -70.996  -14.839 -94.247  1.00 34.96  ? 14   VAL A N     1 
ATOM   106   C  CA    . VAL A  1 14  ? -71.526  -14.965 -92.912  1.00 42.66  ? 14   VAL A CA    1 
ATOM   107   C  C     . VAL A  1 14  ? -71.225  -16.337 -92.361  1.00 50.26  ? 14   VAL A C     1 
ATOM   108   O  O     . VAL A  1 14  ? -71.397  -17.349 -93.048  1.00 61.69  ? 14   VAL A O     1 
ATOM   109   C  CB    . VAL A  1 14  ? -73.030  -14.744 -92.899  1.00 46.86  ? 14   VAL A CB    1 
ATOM   110   C  CG1   . VAL A  1 14  ? -73.568  -14.813 -91.479  1.00 32.95  ? 14   VAL A CG1   1 
ATOM   111   C  CG2   . VAL A  1 14  ? -73.358  -13.415 -93.557  1.00 44.29  ? 14   VAL A CG2   1 
ATOM   112   N  N     . LYS A  1 15  ? -70.745  -16.368 -91.126  1.00 46.09  ? 15   LYS A N     1 
ATOM   113   C  CA    . LYS A  1 15  ? -70.420  -17.617 -90.478  1.00 50.11  ? 15   LYS A CA    1 
ATOM   114   C  C     . LYS A  1 15  ? -71.549  -18.036 -89.529  1.00 47.99  ? 15   LYS A C     1 
ATOM   115   O  O     . LYS A  1 15  ? -71.889  -19.220 -89.432  1.00 47.38  ? 15   LYS A O     1 
ATOM   116   C  CB    . LYS A  1 15  ? -69.086  -17.483 -89.752  1.00 38.15  ? 15   LYS A CB    1 
ATOM   117   C  CG    . LYS A  1 15  ? -67.910  -17.159 -90.694  1.00 54.22  ? 15   LYS A CG    1 
ATOM   118   C  CD    . LYS A  1 15  ? -67.474  -18.400 -91.507  1.00 91.21  ? 15   LYS A CD    1 
ATOM   119   C  CE    . LYS A  1 15  ? -66.472  -18.099 -92.690  1.00 94.57  ? 15   LYS A CE    1 
ATOM   120   N  NZ    . LYS A  1 15  ? -67.107  -17.844 -94.081  1.00 99.04  ? 15   LYS A NZ    1 
ATOM   121   N  N     . PHE A  1 16  ? -72.178  -17.065 -88.882  1.00 42.35  ? 16   PHE A N     1 
ATOM   122   C  CA    . PHE A  1 16  ? -73.256  -17.396 -87.954  1.00 49.44  ? 16   PHE A CA    1 
ATOM   123   C  C     . PHE A  1 16  ? -74.504  -16.574 -88.128  1.00 48.31  ? 16   PHE A C     1 
ATOM   124   O  O     . PHE A  1 16  ? -74.512  -15.552 -88.818  1.00 45.71  ? 16   PHE A O     1 
ATOM   125   C  CB    . PHE A  1 16  ? -72.803  -17.266 -86.499  1.00 37.61  ? 16   PHE A CB    1 
ATOM   126   C  CG    . PHE A  1 16  ? -71.619  -18.110 -86.161  1.00 40.76  ? 16   PHE A CG    1 
ATOM   127   C  CD1   . PHE A  1 16  ? -70.332  -17.620 -86.332  1.00 42.75  ? 16   PHE A CD1   1 
ATOM   128   C  CD2   . PHE A  1 16  ? -71.787  -19.406 -85.699  1.00 47.36  ? 16   PHE A CD2   1 
ATOM   129   C  CE1   . PHE A  1 16  ? -69.236  -18.406 -86.052  1.00 31.45  ? 16   PHE A CE1   1 
ATOM   130   C  CE2   . PHE A  1 16  ? -70.690  -20.208 -85.414  1.00 43.75  ? 16   PHE A CE2   1 
ATOM   131   C  CZ    . PHE A  1 16  ? -69.412  -19.707 -85.592  1.00 51.33  ? 16   PHE A CZ    1 
ATOM   132   N  N     . VAL A  1 17  ? -75.560  -17.040 -87.472  1.00 42.09  ? 17   VAL A N     1 
ATOM   133   C  CA    . VAL A  1 17  ? -76.837  -16.373 -87.500  1.00 35.59  ? 17   VAL A CA    1 
ATOM   134   C  C     . VAL A  1 17  ? -77.316  -16.262 -86.073  1.00 39.10  ? 17   VAL A C     1 
ATOM   135   O  O     . VAL A  1 17  ? -77.350  -17.242 -85.308  1.00 30.67  ? 17   VAL A O     1 
ATOM   136   C  CB    . VAL A  1 17  ? -77.845  -17.106 -88.372  1.00 28.10  ? 17   VAL A CB    1 
ATOM   137   C  CG1   . VAL A  1 17  ? -79.218  -16.503 -88.181  1.00 29.83  ? 17   VAL A CG1   1 
ATOM   138   C  CG2   . VAL A  1 17  ? -77.424  -16.993 -89.845  1.00 35.93  ? 17   VAL A CG2   1 
ATOM   139   N  N     . ASP A  1 18  ? -77.594  -15.027 -85.690  1.00 34.50  ? 18   ASP A N     1 
ATOM   140   C  CA    . ASP A  1 18  ? -78.026  -14.789 -84.350  1.00 47.07  ? 18   ASP A CA    1 
ATOM   141   C  C     . ASP A  1 18  ? -79.512  -14.530 -84.285  1.00 49.40  ? 18   ASP A C     1 
ATOM   142   O  O     . ASP A  1 18  ? -80.036  -13.553 -84.816  1.00 50.60  ? 18   ASP A O     1 
ATOM   143   C  CB    . ASP A  1 18  ? -77.218  -13.668 -83.717  1.00 33.46  ? 18   ASP A CB    1 
ATOM   144   C  CG    . ASP A  1 18  ? -77.110  -13.834 -82.224  1.00 55.57  ? 18   ASP A CG    1 
ATOM   145   O  OD1   . ASP A  1 18  ? -77.347  -12.856 -81.484  1.00 25.65  ? 18   ASP A OD1   1 
ATOM   146   O  OD2   . ASP A  1 18  ? -76.816  -14.969 -81.791  1.00 46.78  ? 18   ASP A OD2   1 
ATOM   147   N  N     . LEU A  1 19  ? -80.195  -15.466 -83.661  1.00 30.51  ? 19   LEU A N     1 
ATOM   148   C  CA    . LEU A  1 19  ? -81.618  -15.380 -83.526  1.00 29.79  ? 19   LEU A CA    1 
ATOM   149   C  C     . LEU A  1 19  ? -81.924  -14.560 -82.321  1.00 34.98  ? 19   LEU A C     1 
ATOM   150   O  O     . LEU A  1 19  ? -81.500  -14.892 -81.226  1.00 39.74  ? 19   LEU A O     1 
ATOM   151   C  CB    . LEU A  1 19  ? -82.189  -16.775 -83.339  1.00 32.86  ? 19   LEU A CB    1 
ATOM   152   C  CG    . LEU A  1 19  ? -82.578  -17.545 -84.600  1.00 39.25  ? 19   LEU A CG    1 
ATOM   153   C  CD1   . LEU A  1 19  ? -81.853  -17.062 -85.851  1.00 28.76  ? 19   LEU A CD1   1 
ATOM   154   C  CD2   . LEU A  1 19  ? -82.318  -19.006 -84.338  1.00 37.37  ? 19   LEU A CD2   1 
ATOM   155   N  N     . ARG A  1 20  ? -82.658  -13.480 -82.514  1.00 38.49  ? 20   ARG A N     1 
ATOM   156   C  CA    . ARG A  1 20  ? -83.010  -12.658 -81.376  1.00 37.68  ? 20   ARG A CA    1 
ATOM   157   C  C     . ARG A  1 20  ? -84.499  -12.448 -81.265  1.00 41.16  ? 20   ARG A C     1 
ATOM   158   O  O     . ARG A  1 20  ? -85.219  -12.357 -82.261  1.00 50.40  ? 20   ARG A O     1 
ATOM   159   C  CB    . ARG A  1 20  ? -82.296  -11.314 -81.426  1.00 37.42  ? 20   ARG A CB    1 
ATOM   160   C  CG    . ARG A  1 20  ? -80.824  -11.454 -81.642  1.00 49.10  ? 20   ARG A CG    1 
ATOM   161   C  CD    . ARG A  1 20  ? -80.095  -10.213 -81.252  1.00 31.44  ? 20   ARG A CD    1 
ATOM   162   N  NE    . ARG A  1 20  ? -78.681  -10.355 -81.550  1.00 39.63  ? 20   ARG A NE    1 
ATOM   163   C  CZ    . ARG A  1 20  ? -77.845  -9.338  -81.676  1.00 33.63  ? 20   ARG A CZ    1 
ATOM   164   N  NH1   . ARG A  1 20  ? -76.575  -9.563  -81.956  1.00 47.49  ? 20   ARG A NH1   1 
ATOM   165   N  NH2   . ARG A  1 20  ? -78.276  -8.100  -81.510  1.00 38.55  ? 20   ARG A NH2   1 
ATOM   166   N  N     . PHE A  1 21  ? -84.940  -12.335 -80.027  1.00 37.32  ? 21   PHE A N     1 
ATOM   167   C  CA    . PHE A  1 21  ? -86.329  -12.125 -79.727  1.00 39.84  ? 21   PHE A CA    1 
ATOM   168   C  C     . PHE A  1 21  ? -86.366  -11.425 -78.386  1.00 36.60  ? 21   PHE A C     1 
ATOM   169   O  O     . PHE A  1 21  ? -85.361  -11.376 -77.683  1.00 39.55  ? 21   PHE A O     1 
ATOM   170   C  CB    . PHE A  1 21  ? -87.025  -13.452 -79.647  1.00 31.99  ? 21   PHE A CB    1 
ATOM   171   C  CG    . PHE A  1 21  ? -86.573  -14.285 -78.506  1.00 33.71  ? 21   PHE A CG    1 
ATOM   172   C  CD1   . PHE A  1 21  ? -87.200  -14.176 -77.260  1.00 28.60  ? 21   PHE A CD1   1 
ATOM   173   C  CD2   . PHE A  1 21  ? -85.561  -15.224 -78.679  1.00 36.84  ? 21   PHE A CD2   1 
ATOM   174   C  CE1   . PHE A  1 21  ? -86.830  -15.009 -76.198  1.00 38.13  ? 21   PHE A CE1   1 
ATOM   175   C  CE2   . PHE A  1 21  ? -85.179  -16.064 -77.625  1.00 35.24  ? 21   PHE A CE2   1 
ATOM   176   C  CZ    . PHE A  1 21  ? -85.816  -15.960 -76.382  1.00 33.60  ? 21   PHE A CZ    1 
ATOM   177   N  N     . THR A  1 22  ? -87.553  -11.015 -77.969  1.00 49.11  ? 22   THR A N     1 
ATOM   178   C  CA    . THR A  1 22  ? -87.664  -10.251 -76.742  1.00 26.95  ? 22   THR A CA    1 
ATOM   179   C  C     . THR A  1 22  ? -88.521  -10.878 -75.666  1.00 28.18  ? 22   THR A C     1 
ATOM   180   O  O     . THR A  1 22  ? -89.640  -11.299 -75.930  1.00 43.58  ? 22   THR A O     1 
ATOM   181   C  CB    . THR A  1 22  ? -88.216  -8.875  -77.073  1.00 34.12  ? 22   THR A CB    1 
ATOM   182   O  OG1   . THR A  1 22  ? -87.421  -8.259  -78.117  1.00 44.12  ? 22   THR A OG1   1 
ATOM   183   C  CG2   . THR A  1 22  ? -88.281  -8.039  -75.817  1.00 15.15  ? 22   THR A CG2   1 
ATOM   184   N  N     . ASP A  1 23  ? -88.011  -10.874 -74.438  1.00 34.37  ? 23   ASP A N     1 
ATOM   185   C  CA    . ASP A  1 23  ? -88.719  -11.469 -73.313  1.00 28.45  ? 23   ASP A CA    1 
ATOM   186   C  C     . ASP A  1 23  ? -89.757  -10.528 -72.757  1.00 35.45  ? 23   ASP A C     1 
ATOM   187   O  O     . ASP A  1 23  ? -89.849  -9.370  -73.170  1.00 35.04  ? 23   ASP A O     1 
ATOM   188   C  CB    . ASP A  1 23  ? -87.741  -11.954 -72.227  1.00 41.52  ? 23   ASP A CB    1 
ATOM   189   C  CG    . ASP A  1 23  ? -87.618  -10.999 -71.057  1.00 50.44  ? 23   ASP A CG    1 
ATOM   190   O  OD1   . ASP A  1 23  ? -87.120  -9.878  -71.255  1.00 54.22  ? 23   ASP A OD1   1 
ATOM   191   O  OD2   . ASP A  1 23  ? -88.023  -11.380 -69.934  1.00 86.53  ? 23   ASP A OD2   1 
ATOM   192   N  N     . THR A  1 24  ? -90.530  -11.034 -71.807  1.00 40.32  ? 24   THR A N     1 
ATOM   193   C  CA    . THR A  1 24  ? -91.606  -10.263 -71.217  1.00 38.83  ? 24   THR A CA    1 
ATOM   194   C  C     . THR A  1 24  ? -91.168  -8.932  -70.631  1.00 48.07  ? 24   THR A C     1 
ATOM   195   O  O     . THR A  1 24  ? -91.780  -7.901  -70.949  1.00 44.59  ? 24   THR A O     1 
ATOM   196   C  CB    . THR A  1 24  ? -92.412  -11.101 -70.169  1.00 53.68  ? 24   THR A CB    1 
ATOM   197   O  OG1   . THR A  1 24  ? -93.246  -12.060 -70.839  1.00 59.50  ? 24   THR A OG1   1 
ATOM   198   C  CG2   . THR A  1 24  ? -93.298  -10.211 -69.333  1.00 37.57  ? 24   THR A CG2   1 
ATOM   199   N  N     . LYS A  1 25  ? -90.121  -8.944  -69.794  1.00 42.96  ? 25   LYS A N     1 
ATOM   200   C  CA    . LYS A  1 25  ? -89.633  -7.704  -69.163  1.00 32.51  ? 25   LYS A CA    1 
ATOM   201   C  C     . LYS A  1 25  ? -89.156  -6.702  -70.215  1.00 39.43  ? 25   LYS A C     1 
ATOM   202   O  O     . LYS A  1 25  ? -89.245  -5.480  -70.027  1.00 55.35  ? 25   LYS A O     1 
ATOM   203   C  CB    . LYS A  1 25  ? -88.538  -7.980  -68.127  1.00 30.87  ? 25   LYS A CB    1 
ATOM   204   C  CG    . LYS A  1 25  ? -89.026  -8.393  -66.716  1.00 23.55  ? 25   LYS A CG    1 
ATOM   205   C  CD    . LYS A  1 25  ? -88.561  -9.809  -66.346  1.00 55.69  ? 25   LYS A CD    1 
ATOM   206   C  CE    . LYS A  1 25  ? -87.750  -9.841  -65.040  1.00 63.44  ? 25   LYS A CE    1 
ATOM   207   N  NZ    . LYS A  1 25  ? -88.581  -9.758  -63.792  1.00 49.97  ? 25   LYS A NZ    1 
ATOM   208   N  N     . GLY A  1 26  ? -88.699  -7.221  -71.347  1.00 30.78  ? 26   GLY A N     1 
ATOM   209   C  CA    . GLY A  1 26  ? -88.265  -6.337  -72.406  1.00 26.01  ? 26   GLY A CA    1 
ATOM   210   C  C     . GLY A  1 26  ? -86.846  -6.579  -72.834  1.00 42.58  ? 26   GLY A C     1 
ATOM   211   O  O     . GLY A  1 26  ? -86.383  -5.986  -73.810  1.00 35.62  ? 26   GLY A O     1 
ATOM   212   N  N     . LYS A  1 27  ? -86.158  -7.460  -72.114  1.00 47.06  ? 27   LYS A N     1 
ATOM   213   C  CA    . LYS A  1 27  ? -84.774  -7.769  -72.422  1.00 43.65  ? 27   LYS A CA    1 
ATOM   214   C  C     . LYS A  1 27  ? -84.675  -8.637  -73.674  1.00 35.42  ? 27   LYS A C     1 
ATOM   215   O  O     . LYS A  1 27  ? -85.343  -9.662  -73.796  1.00 54.17  ? 27   LYS A O     1 
ATOM   216   C  CB    . LYS A  1 27  ? -84.081  -8.429  -71.215  1.00 48.84  ? 27   LYS A CB    1 
ATOM   217   C  CG    . LYS A  1 27  ? -82.534  -8.352  -71.240  1.00 63.74  ? 27   LYS A CG    1 
ATOM   218   C  CD    . LYS A  1 27  ? -82.039  -6.903  -71.254  1.00 73.27  ? 27   LYS A CD    1 
ATOM   219   C  CE    . LYS A  1 27  ? -80.580  -6.774  -71.692  1.00 71.86  ? 27   LYS A CE    1 
ATOM   220   N  NZ    . LYS A  1 27  ? -80.217  -5.352  -72.014  1.00 77.77  ? 27   LYS A NZ    1 
ATOM   221   N  N     . GLU A  1 28  ? -83.890  -8.168  -74.636  1.00 28.01  ? 28   GLU A N     1 
ATOM   222   C  CA    . GLU A  1 28  ? -83.662  -8.872  -75.897  1.00 36.69  ? 28   GLU A CA    1 
ATOM   223   C  C     . GLU A  1 28  ? -82.810  -10.129 -75.648  1.00 33.01  ? 28   GLU A C     1 
ATOM   224   O  O     . GLU A  1 28  ? -81.795  -10.055 -74.957  1.00 38.69  ? 28   GLU A O     1 
ATOM   225   C  CB    . GLU A  1 28  ? -82.925  -7.915  -76.822  1.00 32.71  ? 28   GLU A CB    1 
ATOM   226   C  CG    . GLU A  1 28  ? -82.812  -8.300  -78.282  1.00 11.54  ? 28   GLU A CG    1 
ATOM   227   C  CD    . GLU A  1 28  ? -81.926  -7.306  -79.037  1.00 50.53  ? 28   GLU A CD    1 
ATOM   228   O  OE1   . GLU A  1 28  ? -81.815  -7.432  -80.270  1.00 43.20  ? 28   GLU A OE1   1 
ATOM   229   O  OE2   . GLU A  1 28  ? -81.335  -6.390  -78.402  1.00 61.53  ? 28   GLU A OE2   1 
ATOM   230   N  N     A GLN A  1 29  ? -83.246  -11.278 -76.168  0.83 28.51  ? 29   GLN A N     1 
ATOM   231   C  CA    A GLN A  1 29  ? -82.519  -12.543 -76.004  0.83 28.87  ? 29   GLN A CA    1 
ATOM   232   C  C     A GLN A  1 29  ? -81.977  -12.992 -77.361  0.83 30.22  ? 29   GLN A C     1 
ATOM   233   O  O     A GLN A  1 29  ? -82.473  -12.545 -78.404  0.83 32.43  ? 29   GLN A O     1 
ATOM   234   C  CB    A GLN A  1 29  ? -83.440  -13.612 -75.451  0.83 28.29  ? 29   GLN A CB    1 
ATOM   235   C  CG    A GLN A  1 29  ? -84.405  -13.138 -74.370  0.83 29.70  ? 29   GLN A CG    1 
ATOM   236   C  CD    A GLN A  1 29  ? -83.721  -12.692 -73.107  0.83 31.38  ? 29   GLN A CD    1 
ATOM   237   O  OE1   A GLN A  1 29  ? -83.388  -13.501 -72.248  0.83 32.13  ? 29   GLN A OE1   1 
ATOM   238   N  NE2   A GLN A  1 29  ? -83.537  -11.390 -72.967  0.83 33.25  ? 29   GLN A NE2   1 
ATOM   239   N  N     A HIS A  1 30  ? -80.995  -13.896 -77.359  0.87 29.23  ? 30   HIS A N     1 
ATOM   240   C  CA    A HIS A  1 30  ? -80.416  -14.343 -78.616  0.87 29.37  ? 30   HIS A CA    1 
ATOM   241   C  C     A HIS A  1 30  ? -79.890  -15.773 -78.648  0.87 29.36  ? 30   HIS A C     1 
ATOM   242   O  O     A HIS A  1 30  ? -79.609  -16.359 -77.647  0.87 27.99  ? 30   HIS A O     1 
ATOM   243   C  CB    A HIS A  1 30  ? -79.292  -13.387 -79.036  0.87 30.94  ? 30   HIS A CB    1 
ATOM   244   C  CG    A HIS A  1 30  ? -77.954  -13.703 -78.433  0.87 31.96  ? 30   HIS A CG    1 
ATOM   245   N  ND1   A HIS A  1 30  ? -77.621  -13.376 -77.135  0.87 33.24  ? 30   HIS A ND1   1 
ATOM   246   C  CD2   A HIS A  1 30  ? -76.845  -14.261 -78.976  0.87 31.89  ? 30   HIS A CD2   1 
ATOM   247   C  CE1   A HIS A  1 30  ? -76.358  -13.702 -76.912  0.87 32.94  ? 30   HIS A CE1   1 
ATOM   248   N  NE2   A HIS A  1 30  ? -75.867  -14.249 -78.011  0.87 33.22  ? 30   HIS A NE2   1 
ATOM   249   N  N     . VAL A  1 31  ? -79.752  -16.361 -79.821  1.00 40.86  ? 31   VAL A N     1 
ATOM   250   C  CA    . VAL A  1 31  ? -79.203  -17.695 -79.868  1.00 25.85  ? 31   VAL A CA    1 
ATOM   251   C  C     . VAL A  1 31  ? -78.520  -17.846 -81.196  1.00 32.60  ? 31   VAL A C     1 
ATOM   252   O  O     . VAL A  1 31  ? -78.987  -17.357 -82.231  1.00 45.75  ? 31   VAL A O     1 
ATOM   253   C  CB    . VAL A  1 31  ? -80.236  -18.765 -79.609  1.00 30.13  ? 31   VAL A CB    1 
ATOM   254   C  CG1   . VAL A  1 31  ? -81.363  -18.691 -80.616  1.00 48.09  ? 31   VAL A CG1   1 
ATOM   255   C  CG2   . VAL A  1 31  ? -79.572  -20.082 -79.651  1.00 30.91  ? 31   VAL A CG2   1 
ATOM   256   N  N     . THR A  1 32  ? -77.378  -18.493 -81.164  1.00 27.68  ? 32   THR A N     1 
ATOM   257   C  CA    . THR A  1 32  ? -76.632  -18.576 -82.383  1.00 30.56  ? 32   THR A CA    1 
ATOM   258   C  C     . THR A  1 32  ? -76.611  -19.900 -83.060  1.00 38.65  ? 32   THR A C     1 
ATOM   259   O  O     . THR A  1 32  ? -76.317  -20.935 -82.460  1.00 31.87  ? 32   THR A O     1 
ATOM   260   C  CB    . THR A  1 32  ? -75.231  -18.095 -82.174  1.00 40.42  ? 32   THR A CB    1 
ATOM   261   O  OG1   . THR A  1 32  ? -75.242  -17.027 -81.218  1.00 41.38  ? 32   THR A OG1   1 
ATOM   262   C  CG2   . THR A  1 32  ? -74.680  -17.615 -83.479  1.00 27.45  ? 32   THR A CG2   1 
ATOM   263   N  N     . ILE A  1 33  ? -76.757  -19.796 -84.369  1.00 38.13  ? 33   ILE A N     1 
ATOM   264   C  CA    . ILE A  1 33  ? -76.825  -20.923 -85.265  1.00 29.56  ? 33   ILE A CA    1 
ATOM   265   C  C     . ILE A  1 33  ? -75.839  -20.696 -86.388  1.00 35.24  ? 33   ILE A C     1 
ATOM   266   O  O     . ILE A  1 33  ? -75.674  -19.573 -86.872  1.00 44.06  ? 33   ILE A O     1 
ATOM   267   C  CB    . ILE A  1 33  ? -78.314  -21.036 -85.781  1.00 43.52  ? 33   ILE A CB    1 
ATOM   268   C  CG1   . ILE A  1 33  ? -78.949  -22.226 -85.121  1.00 37.89  ? 33   ILE A CG1   1 
ATOM   269   C  CG2   . ILE A  1 33  ? -78.489  -21.039 -87.325  1.00 34.07  ? 33   ILE A CG2   1 
ATOM   270   C  CD1   . ILE A  1 33  ? -79.005  -22.061 -83.667  1.00 64.48  ? 33   ILE A CD1   1 
ATOM   271   N  N     . PRO A  1 34  ? -75.120  -21.749 -86.779  1.00 33.52  ? 34   PRO A N     1 
ATOM   272   C  CA    . PRO A  1 34  ? -74.135  -21.642 -87.864  1.00 32.02  ? 34   PRO A CA    1 
ATOM   273   C  C     . PRO A  1 34  ? -74.903  -21.324 -89.123  1.00 38.23  ? 34   PRO A C     1 
ATOM   274   O  O     . PRO A  1 34  ? -76.034  -21.755 -89.275  1.00 39.14  ? 34   PRO A O     1 
ATOM   275   C  CB    . PRO A  1 34  ? -73.539  -23.049 -87.938  1.00 23.97  ? 34   PRO A CB    1 
ATOM   276   C  CG    . PRO A  1 34  ? -73.730  -23.586 -86.534  1.00 26.84  ? 34   PRO A CG    1 
ATOM   277   C  CD    . PRO A  1 34  ? -75.110  -23.084 -86.161  1.00 38.44  ? 34   PRO A CD    1 
ATOM   278   N  N     . ALA A  1 35  ? -74.305  -20.566 -90.023  1.00 42.79  ? 35   ALA A N     1 
ATOM   279   C  CA    . ALA A  1 35  ? -74.993  -20.215 -91.251  1.00 31.18  ? 35   ALA A CA    1 
ATOM   280   C  C     . ALA A  1 35  ? -75.482  -21.450 -92.015  1.00 39.21  ? 35   ALA A C     1 
ATOM   281   O  O     . ALA A  1 35  ? -76.550  -21.426 -92.630  1.00 48.65  ? 35   ALA A O     1 
ATOM   282   C  CB    . ALA A  1 35  ? -74.087  -19.369 -92.123  1.00 44.64  ? 35   ALA A CB    1 
ATOM   283   N  N     . HIS A  1 36  ? -74.733  -22.546 -91.939  1.00 41.63  ? 36   HIS A N     1 
ATOM   284   C  CA    . HIS A  1 36  ? -75.129  -23.755 -92.660  1.00 36.84  ? 36   HIS A CA    1 
ATOM   285   C  C     . HIS A  1 36  ? -76.432  -24.369 -92.154  1.00 34.79  ? 36   HIS A C     1 
ATOM   286   O  O     . HIS A  1 36  ? -77.099  -25.128 -92.866  1.00 55.36  ? 36   HIS A O     1 
ATOM   287   C  CB    . HIS A  1 36  ? -73.991  -24.796 -92.696  1.00 37.42  ? 36   HIS A CB    1 
ATOM   288   C  CG    . HIS A  1 36  ? -73.584  -25.326 -91.355  1.00 47.51  ? 36   HIS A CG    1 
ATOM   289   N  ND1   . HIS A  1 36  ? -74.482  -25.868 -90.460  1.00 58.36  ? 36   HIS A ND1   1 
ATOM   290   C  CD2   . HIS A  1 36  ? -72.364  -25.439 -90.778  1.00 39.94  ? 36   HIS A CD2   1 
ATOM   291   C  CE1   . HIS A  1 36  ? -73.833  -26.295 -89.391  1.00 55.80  ? 36   HIS A CE1   1 
ATOM   292   N  NE2   . HIS A  1 36  ? -72.547  -26.047 -89.558  1.00 37.36  ? 36   HIS A NE2   1 
ATOM   293   N  N     . GLN A  1 37  ? -76.800  -24.018 -90.929  1.00 30.72  ? 37   GLN A N     1 
ATOM   294   C  CA    . GLN A  1 37  ? -78.025  -24.519 -90.318  1.00 37.29  ? 37   GLN A CA    1 
ATOM   295   C  C     . GLN A  1 37  ? -79.251  -23.800 -90.873  1.00 50.37  ? 37   GLN A C     1 
ATOM   296   O  O     . GLN A  1 37  ? -80.406  -24.125 -90.529  1.00 42.53  ? 37   GLN A O     1 
ATOM   297   C  CB    . GLN A  1 37  ? -77.962  -24.329 -88.810  1.00 39.12  ? 37   GLN A CB    1 
ATOM   298   C  CG    . GLN A  1 37  ? -77.113  -25.335 -88.125  1.00 55.59  ? 37   GLN A CG    1 
ATOM   299   C  CD    . GLN A  1 37  ? -77.544  -26.730 -88.461  1.00 48.79  ? 37   GLN A CD    1 
ATOM   300   O  OE1   . GLN A  1 37  ? -76.904  -27.393 -89.266  1.00 59.80  ? 37   GLN A OE1   1 
ATOM   301   N  NE2   . GLN A  1 37  ? -78.653  -27.179 -87.867  1.00 60.31  ? 37   GLN A NE2   1 
ATOM   302   N  N     . VAL A  1 38  ? -78.984  -22.803 -91.713  1.00 41.89  ? 38   VAL A N     1 
ATOM   303   C  CA    . VAL A  1 38  ? -80.030  -22.016 -92.345  1.00 57.33  ? 38   VAL A CA    1 
ATOM   304   C  C     . VAL A  1 38  ? -80.352  -22.557 -93.721  1.00 67.71  ? 38   VAL A C     1 
ATOM   305   O  O     . VAL A  1 38  ? -79.540  -22.470 -94.655  1.00 68.77  ? 38   VAL A O     1 
ATOM   306   C  CB    . VAL A  1 38  ? -79.622  -20.569 -92.453  1.00 56.46  ? 38   VAL A CB    1 
ATOM   307   C  CG1   . VAL A  1 38  ? -80.589  -19.814 -93.340  1.00 57.39  ? 38   VAL A CG1   1 
ATOM   308   C  CG2   . VAL A  1 38  ? -79.585  -19.978 -91.066  1.00 45.82  ? 38   VAL A CG2   1 
ATOM   309   N  N     . ASN A  1 39  ? -81.566  -23.088 -93.829  1.00 69.83  ? 39   ASN A N     1 
ATOM   310   C  CA    . ASN A  1 39  ? -82.052  -23.690 -95.057  1.00 76.77  ? 39   ASN A CA    1 
ATOM   311   C  C     . ASN A  1 39  ? -83.486  -23.306 -95.347  1.00 76.78  ? 39   ASN A C     1 
ATOM   312   O  O     . ASN A  1 39  ? -84.108  -22.521 -94.619  1.00 63.57  ? 39   ASN A O     1 
ATOM   313   C  CB    . ASN A  1 39  ? -81.976  -25.208 -94.949  1.00 66.66  ? 39   ASN A CB    1 
ATOM   314   C  CG    . ASN A  1 39  ? -82.649  -25.726 -93.697  1.00 69.31  ? 39   ASN A CG    1 
ATOM   315   O  OD1   . ASN A  1 39  ? -83.573  -25.106 -93.162  1.00 75.50  ? 39   ASN A OD1   1 
ATOM   316   N  ND2   . ASN A  1 39  ? -82.173  -26.855 -93.206  1.00 80.88  ? 39   ASN A ND2   1 
ATOM   317   N  N     . ALA A  1 40  ? -84.016  -23.971 -96.367  1.00 85.27  ? 40   ALA A N     1 
ATOM   318   C  CA    . ALA A  1 40  ? -85.366  -23.772 -96.847  1.00 75.44  ? 40   ALA A CA    1 
ATOM   319   C  C     . ALA A  1 40  ? -86.446  -23.810 -95.762  1.00 77.65  ? 40   ALA A C     1 
ATOM   320   O  O     . ALA A  1 40  ? -87.121  -22.801 -95.513  1.00 74.65  ? 40   ALA A O     1 
ATOM   321   C  CB    . ALA A  1 40  ? -85.661  -24.805 -97.921  1.00 100.00 ? 40   ALA A CB    1 
ATOM   322   N  N     . GLU A  1 41  ? -86.588  -24.958 -95.102  1.00 64.81  ? 41   GLU A N     1 
ATOM   323   C  CA    . GLU A  1 41  ? -87.624  -25.119 -94.079  1.00 88.88  ? 41   GLU A CA    1 
ATOM   324   C  C     . GLU A  1 41  ? -87.423  -24.285 -92.835  1.00 88.16  ? 41   GLU A C     1 
ATOM   325   O  O     . GLU A  1 41  ? -88.389  -23.962 -92.139  1.00 85.38  ? 41   GLU A O     1 
ATOM   326   C  CB    . GLU A  1 41  ? -87.834  -26.592 -93.690  1.00 97.33  ? 41   GLU A CB    1 
ATOM   327   C  CG    . GLU A  1 41  ? -86.644  -27.272 -93.024  0.49 62.97  ? 41   GLU A CG    1 
ATOM   328   C  CD    . GLU A  1 41  ? -85.808  -28.082 -94.006  0.49 75.79  ? 41   GLU A CD    1 
ATOM   329   O  OE1   . GLU A  1 41  ? -85.608  -27.619 -95.162  0.49 71.24  ? 41   GLU A OE1   1 
ATOM   330   O  OE2   . GLU A  1 41  ? -85.353  -29.184 -93.615  0.49 66.95  ? 41   GLU A OE2   1 
ATOM   331   N  N     . PHE A  1 42  ? -86.169  -23.965 -92.540  1.00 92.70  ? 42   PHE A N     1 
ATOM   332   C  CA    . PHE A  1 42  ? -85.855  -23.146 -91.384  1.00 84.83  ? 42   PHE A CA    1 
ATOM   333   C  C     . PHE A  1 42  ? -86.770  -21.913 -91.392  1.00 73.93  ? 42   PHE A C     1 
ATOM   334   O  O     . PHE A  1 42  ? -87.312  -21.511 -90.358  1.00 66.04  ? 42   PHE A O     1 
ATOM   335   C  CB    . PHE A  1 42  ? -84.386  -22.721 -91.435  1.00 76.66  ? 42   PHE A CB    1 
ATOM   336   C  CG    . PHE A  1 42  ? -84.059  -21.577 -90.520  1.00 85.54  ? 42   PHE A CG    1 
ATOM   337   C  CD1   . PHE A  1 42  ? -83.452  -20.422 -91.016  1.00 87.38  ? 42   PHE A CD1   1 
ATOM   338   C  CD2   . PHE A  1 42  ? -84.407  -21.625 -89.171  1.00 82.55  ? 42   PHE A CD2   1 
ATOM   339   C  CE1   . PHE A  1 42  ? -83.199  -19.320 -90.184  1.00 48.60  ? 42   PHE A CE1   1 
ATOM   340   C  CE2   . PHE A  1 42  ? -84.160  -20.534 -88.330  1.00 76.10  ? 42   PHE A CE2   1 
ATOM   341   C  CZ    . PHE A  1 42  ? -83.554  -19.375 -88.841  1.00 58.68  ? 42   PHE A CZ    1 
ATOM   342   N  N     . PHE A  1 43  ? -87.000  -21.372 -92.584  1.00 63.87  ? 43   PHE A N     1 
ATOM   343   C  CA    . PHE A  1 43  ? -87.845  -20.198 -92.735  1.00 65.47  ? 43   PHE A CA    1 
ATOM   344   C  C     . PHE A  1 43  ? -89.331  -20.389 -92.590  1.00 82.47  ? 43   PHE A C     1 
ATOM   345   O  O     . PHE A  1 43  ? -90.027  -19.492 -92.100  1.00 83.05  ? 43   PHE A O     1 
ATOM   346   C  CB    . PHE A  1 43  ? -87.553  -19.498 -94.045  1.00 55.54  ? 43   PHE A CB    1 
ATOM   347   C  CG    . PHE A  1 43  ? -86.494  -18.479 -93.918  0.63 42.46  ? 43   PHE A CG    1 
ATOM   348   C  CD1   . PHE A  1 43  ? -85.217  -18.721 -94.405  0.63 33.10  ? 43   PHE A CD1   1 
ATOM   349   C  CD2   . PHE A  1 43  ? -86.748  -17.298 -93.223  0.63 52.88  ? 43   PHE A CD2   1 
ATOM   350   C  CE1   . PHE A  1 43  ? -84.200  -17.806 -94.197  0.63 43.49  ? 43   PHE A CE1   1 
ATOM   351   C  CE2   . PHE A  1 43  ? -85.742  -16.376 -93.006  0.63 43.90  ? 43   PHE A CE2   1 
ATOM   352   C  CZ    . PHE A  1 43  ? -84.462  -16.628 -93.492  0.63 44.85  ? 43   PHE A CZ    1 
ATOM   353   N  N     . GLU A  1 44  ? -89.826  -21.532 -93.048  1.00 88.69  ? 44   GLU A N     1 
ATOM   354   C  CA    . GLU A  1 44  ? -91.245  -21.806 -92.956  1.00 86.14  ? 44   GLU A CA    1 
ATOM   355   C  C     . GLU A  1 44  ? -91.664  -22.453 -91.642  1.00 81.17  ? 44   GLU A C     1 
ATOM   356   O  O     . GLU A  1 44  ? -92.782  -22.228 -91.186  1.00 97.71  ? 44   GLU A O     1 
ATOM   357   C  CB    . GLU A  1 44  ? -91.715  -22.588 -94.178  1.00 84.81  ? 44   GLU A CB    1 
ATOM   358   C  CG    . GLU A  1 44  ? -91.672  -21.733 -95.448  0.49 59.41  ? 44   GLU A CG    1 
ATOM   359   C  CD    . GLU A  1 44  ? -91.289  -22.519 -96.700  0.49 78.74  ? 44   GLU A CD    1 
ATOM   360   O  OE1   . GLU A  1 44  ? -91.671  -22.070 -97.805  0.49 79.95  ? 44   GLU A OE1   1 
ATOM   361   O  OE2   . GLU A  1 44  ? -90.602  -23.571 -96.591  0.49 72.17  ? 44   GLU A OE2   1 
ATOM   362   N  N     . GLU A  1 45  ? -90.765  -23.194 -90.995  1.00 68.13  ? 45   GLU A N     1 
ATOM   363   C  CA    . GLU A  1 45  ? -91.111  -23.819 -89.715  1.00 75.45  ? 45   GLU A CA    1 
ATOM   364   C  C     . GLU A  1 45  ? -90.260  -23.404 -88.500  1.00 77.08  ? 45   GLU A C     1 
ATOM   365   O  O     . GLU A  1 45  ? -90.488  -23.885 -87.389  1.00 76.83  ? 45   GLU A O     1 
ATOM   366   C  CB    . GLU A  1 45  ? -91.172  -25.346 -89.846  1.00 74.78  ? 45   GLU A CB    1 
ATOM   367   C  CG    . GLU A  1 45  ? -89.859  -26.010 -90.251  0.53 73.21  ? 45   GLU A CG    1 
ATOM   368   C  CD    . GLU A  1 45  ? -90.029  -27.473 -90.671  0.53 74.02  ? 45   GLU A CD    1 
ATOM   369   O  OE1   . GLU A  1 45  ? -91.184  -27.894 -90.933  0.53 57.17  ? 45   GLU A OE1   1 
ATOM   370   O  OE2   . GLU A  1 45  ? -89.001  -28.196 -90.752  0.53 48.89  ? 45   GLU A OE2   1 
ATOM   371   N  N     . GLY A  1 46  ? -89.303  -22.500 -88.704  1.00 72.83  ? 46   GLY A N     1 
ATOM   372   C  CA    . GLY A  1 46  ? -88.466  -22.040 -87.606  1.00 71.47  ? 46   GLY A CA    1 
ATOM   373   C  C     . GLY A  1 46  ? -87.650  -23.125 -86.927  1.00 72.62  ? 46   GLY A C     1 
ATOM   374   O  O     . GLY A  1 46  ? -87.368  -24.167 -87.526  1.00 81.98  ? 46   GLY A O     1 
ATOM   375   N  N     . LYS A  1 47  ? -87.235  -22.862 -85.690  1.00 63.24  ? 47   LYS A N     1 
ATOM   376   C  CA    . LYS A  1 47  ? -86.444  -23.820 -84.924  1.00 64.52  ? 47   LYS A CA    1 
ATOM   377   C  C     . LYS A  1 47  ? -87.073  -24.021 -83.569  1.00 68.04  ? 47   LYS A C     1 
ATOM   378   O  O     . LYS A  1 47  ? -87.799  -23.166 -83.064  1.00 58.58  ? 47   LYS A O     1 
ATOM   379   C  CB    . LYS A  1 47  ? -84.989  -23.358 -84.739  1.00 53.18  ? 47   LYS A CB    1 
ATOM   380   C  CG    . LYS A  1 47  ? -84.019  -23.695 -85.885  0.75 35.34  ? 47   LYS A CG    1 
ATOM   381   C  CD    . LYS A  1 47  ? -83.704  -25.197 -85.985  0.75 75.19  ? 47   LYS A CD    1 
ATOM   382   C  CE    . LYS A  1 47  ? -82.390  -25.475 -86.761  0.75 73.00  ? 47   LYS A CE    1 
ATOM   383   N  NZ    . LYS A  1 47  ? -82.376  -25.031 -88.201  0.75 60.37  ? 47   LYS A NZ    1 
ATOM   384   N  N     . MET A  1 48  ? -86.769  -25.166 -82.979  1.00 78.67  ? 48   MET A N     1 
ATOM   385   C  CA    . MET A  1 48  ? -87.299  -25.514 -81.682  1.00 63.65  ? 48   MET A CA    1 
ATOM   386   C  C     . MET A  1 48  ? -86.448  -25.037 -80.543  1.00 66.82  ? 48   MET A C     1 
ATOM   387   O  O     . MET A  1 48  ? -85.223  -24.974 -80.657  1.00 92.08  ? 48   MET A O     1 
ATOM   388   C  CB    . MET A  1 48  ? -87.459  -27.024 -81.576  1.00 80.57  ? 48   MET A CB    1 
ATOM   389   C  CG    . MET A  1 48  ? -88.782  -27.493 -82.101  0.52 57.00  ? 48   MET A CG    1 
ATOM   390   S  SD    . MET A  1 48  ? -90.057  -26.379 -81.474  0.52 60.16  ? 48   MET A SD    1 
ATOM   391   C  CE    . MET A  1 48  ? -90.279  -26.967 -79.797  0.52 59.44  ? 48   MET A CE    1 
ATOM   392   N  N     . PHE A  1 49  ? -87.106  -24.683 -79.446  1.00 55.68  ? 49   PHE A N     1 
ATOM   393   C  CA    . PHE A  1 49  ? -86.401  -24.256 -78.243  1.00 63.21  ? 49   PHE A CA    1 
ATOM   394   C  C     . PHE A  1 49  ? -87.331  -24.231 -77.024  1.00 71.77  ? 49   PHE A C     1 
ATOM   395   O  O     . PHE A  1 49  ? -88.556  -24.082 -77.160  1.00 72.19  ? 49   PHE A O     1 
ATOM   396   C  CB    . PHE A  1 49  ? -85.726  -22.894 -78.444  1.00 52.67  ? 49   PHE A CB    1 
ATOM   397   C  CG    . PHE A  1 49  ? -86.563  -21.735 -78.006  1.00 60.95  ? 49   PHE A CG    1 
ATOM   398   C  CD1   . PHE A  1 49  ? -86.298  -21.092 -76.797  1.00 48.50  ? 49   PHE A CD1   1 
ATOM   399   C  CD2   . PHE A  1 49  ? -87.657  -21.323 -78.762  1.00 68.22  ? 49   PHE A CD2   1 
ATOM   400   C  CE1   . PHE A  1 49  ? -87.124  -20.055 -76.340  1.00 58.07  ? 49   PHE A CE1   1 
ATOM   401   C  CE2   . PHE A  1 49  ? -88.485  -20.289 -78.315  1.00 75.74  ? 49   PHE A CE2   1 
ATOM   402   C  CZ    . PHE A  1 49  ? -88.220  -19.655 -77.100  1.00 62.75  ? 49   PHE A CZ    1 
ATOM   403   N  N     . ASP A  1 50  ? -86.739  -24.406 -75.843  1.00 63.72  ? 50   ASP A N     1 
ATOM   404   C  CA    . ASP A  1 50  ? -87.478  -24.397 -74.585  1.00 71.93  ? 50   ASP A CA    1 
ATOM   405   C  C     . ASP A  1 50  ? -87.487  -23.012 -73.938  1.00 76.06  ? 50   ASP A C     1 
ATOM   406   O  O     . ASP A  1 50  ? -86.438  -22.478 -73.570  1.00 63.08  ? 50   ASP A O     1 
ATOM   407   C  CB    . ASP A  1 50  ? -86.882  -25.413 -73.602  1.00 65.88  ? 50   ASP A CB    1 
ATOM   408   C  CG    . ASP A  1 50  ? -87.359  -25.190 -72.168  0.40 57.80  ? 50   ASP A CG    1 
ATOM   409   O  OD1   . ASP A  1 50  ? -86.663  -24.465 -71.407  0.40 47.23  ? 50   ASP A OD1   1 
ATOM   410   O  OD2   . ASP A  1 50  ? -88.438  -25.722 -71.818  0.40 40.94  ? 50   ASP A OD2   1 
ATOM   411   N  N     . GLY A  1 51  ? -88.681  -22.462 -73.748  1.00 85.35  ? 51   GLY A N     1 
ATOM   412   C  CA    . GLY A  1 51  ? -88.787  -21.154 -73.138  1.00 82.68  ? 51   GLY A CA    1 
ATOM   413   C  C     . GLY A  1 51  ? -88.783  -21.195 -71.624  1.00 69.33  ? 51   GLY A C     1 
ATOM   414   O  O     . GLY A  1 51  ? -88.529  -20.183 -70.989  1.00 85.24  ? 51   GLY A O     1 
ATOM   415   N  N     . SER A  1 52  ? -89.017  -22.372 -71.053  1.00 64.74  ? 52   SER A N     1 
ATOM   416   C  CA    . SER A  1 52  ? -89.093  -22.579 -69.603  1.00 65.41  ? 52   SER A CA    1 
ATOM   417   C  C     . SER A  1 52  ? -88.226  -21.722 -68.676  1.00 65.41  ? 52   SER A C     1 
ATOM   418   O  O     . SER A  1 52  ? -88.708  -21.234 -67.648  1.00 81.89  ? 52   SER A O     1 
ATOM   419   C  CB    . SER A  1 52  ? -88.888  -24.060 -69.282  1.00 59.31  ? 52   SER A CB    1 
ATOM   420   O  OG    . SER A  1 52  ? -88.958  -24.311 -67.892  0.56 81.80  ? 52   SER A OG    1 
ATOM   421   N  N     . SER A  1 53  ? -86.959  -21.534 -69.033  1.00 83.12  ? 53   SER A N     1 
ATOM   422   C  CA    . SER A  1 53  ? -86.041  -20.744 -68.207  1.00 81.43  ? 53   SER A CA    1 
ATOM   423   C  C     . SER A  1 53  ? -86.016  -19.275 -68.615  1.00 76.53  ? 53   SER A C     1 
ATOM   424   O  O     . SER A  1 53  ? -84.971  -18.622 -68.635  1.00 78.14  ? 53   SER A O     1 
ATOM   425   C  CB    . SER A  1 53  ? -84.647  -21.334 -68.289  1.00 62.56  ? 53   SER A CB    1 
ATOM   426   O  OG    . SER A  1 53  ? -84.743  -22.733 -68.477  0.70 74.73  ? 53   SER A OG    1 
ATOM   427   N  N     . ILE A  1 54  ? -87.196  -18.770 -68.946  1.00 76.24  ? 54   ILE A N     1 
ATOM   428   C  CA    . ILE A  1 54  ? -87.371  -17.389 -69.340  1.00 69.18  ? 54   ILE A CA    1 
ATOM   429   C  C     . ILE A  1 54  ? -88.422  -16.778 -68.425  1.00 72.13  ? 54   ILE A C     1 
ATOM   430   O  O     . ILE A  1 54  ? -89.298  -17.471 -67.887  1.00 64.78  ? 54   ILE A O     1 
ATOM   431   C  CB    . ILE A  1 54  ? -87.741  -17.291 -70.837  1.00 60.37  ? 54   ILE A CB    1 
ATOM   432   C  CG1   . ILE A  1 54  ? -86.491  -17.566 -71.668  1.00 44.23  ? 54   ILE A CG1   1 
ATOM   433   C  CG2   . ILE A  1 54  ? -88.319  -15.929 -71.195  1.00 40.33  ? 54   ILE A CG2   1 
ATOM   434   C  CD1   . ILE A  1 54  ? -86.707  -17.425 -73.141  1.00 53.25  ? 54   ILE A CD1   1 
ATOM   435   N  N     . GLY A  1 55  ? -88.249  -15.493 -68.161  1.00 87.22  ? 55   GLY A N     1 
ATOM   436   C  CA    . GLY A  1 55  ? -89.169  -14.792 -67.294  1.00 93.04  ? 55   GLY A CA    1 
ATOM   437   C  C     . GLY A  1 55  ? -90.623  -14.847 -67.718  1.00 87.23  ? 55   GLY A C     1 
ATOM   438   O  O     . GLY A  1 55  ? -90.975  -14.356 -68.797  1.00 93.46  ? 55   GLY A O     1 
ATOM   439   N  N     . GLY A  1 56  ? -91.434  -15.523 -66.900  1.00 76.83  ? 56   GLY A N     1 
ATOM   440   C  CA    . GLY A  1 56  ? -92.871  -15.614 -67.120  1.00 78.24  ? 56   GLY A CA    1 
ATOM   441   C  C     . GLY A  1 56  ? -93.440  -16.307 -68.340  1.00 84.67  ? 56   GLY A C     1 
ATOM   442   O  O     . GLY A  1 56  ? -94.525  -15.946 -68.817  1.00 89.55  ? 56   GLY A O     1 
ATOM   443   N  N     . TRP A  1 57  ? -92.684  -17.232 -68.869  1.00 86.54  ? 57   TRP A N     1 
ATOM   444   C  CA    . TRP A  1 57  ? -93.066  -18.035 -70.022  1.00 84.52  ? 57   TRP A CA    1 
ATOM   445   C  C     . TRP A  1 57  ? -93.019  -19.437 -69.522  1.00 90.25  ? 57   TRP A C     1 
ATOM   446   O  O     . TRP A  1 57  ? -93.365  -20.443 -70.154  1.00 91.10  ? 57   TRP A O     1 
ATOM   447   C  CB    . TRP A  1 57  ? -92.086  -17.926 -71.183  1.00 58.70  ? 57   TRP A CB    1 
ATOM   448   C  CG    . TRP A  1 57  ? -92.100  -16.608 -71.854  0.94 52.85  ? 57   TRP A CG    1 
ATOM   449   C  CD1   . TRP A  1 57  ? -92.755  -15.469 -71.476  0.94 56.35  ? 57   TRP A CD1   1 
ATOM   450   C  CD2   . TRP A  1 57  ? -91.380  -16.284 -73.039  0.94 46.54  ? 57   TRP A CD2   1 
ATOM   451   N  NE1   . TRP A  1 57  ? -92.485  -14.452 -72.360  0.94 47.63  ? 57   TRP A NE1   1 
ATOM   452   C  CE2   . TRP A  1 57  ? -91.644  -14.926 -73.333  0.94 53.01  ? 57   TRP A CE2   1 
ATOM   453   C  CE3   . TRP A  1 57  ? -90.537  -17.010 -73.887  0.94 37.82  ? 57   TRP A CE3   1 
ATOM   454   C  CZ2   . TRP A  1 57  ? -91.093  -14.278 -74.446  0.94 54.30  ? 57   TRP A CZ2   1 
ATOM   455   C  CZ3   . TRP A  1 57  ? -89.988  -16.368 -74.993  0.94 52.69  ? 57   TRP A CZ3   1 
ATOM   456   C  CH2   . TRP A  1 57  ? -90.270  -15.014 -75.262  0.94 31.24  ? 57   TRP A CH2   1 
ATOM   457   N  N     . LYS A  1 58  ? -92.597  -19.408 -68.295  0.56 84.10  ? 58   LYS A N     1 
ATOM   458   C  CA    . LYS A  1 58  ? -92.396  -20.573 -67.492  0.56 76.24  ? 58   LYS A CA    1 
ATOM   459   C  C     . LYS A  1 58  ? -93.474  -21.482 -67.925  0.56 72.15  ? 58   LYS A C     1 
ATOM   460   O  O     . LYS A  1 58  ? -94.476  -21.099 -68.534  0.56 73.02  ? 58   LYS A O     1 
ATOM   461   C  CB    . LYS A  1 58  ? -92.477  -20.235 -66.029  0.56 69.81  ? 58   LYS A CB    1 
ATOM   462   C  CG    . LYS A  1 58  ? -91.131  -20.404 -65.332  0.56 70.40  ? 58   LYS A CG    1 
ATOM   463   C  CD    . LYS A  1 58  ? -91.282  -21.258 -64.082  0.56 77.68  ? 58   LYS A CD    1 
ATOM   464   C  CE    . LYS A  1 58  ? -91.145  -22.758 -64.358  0.56 82.60  ? 58   LYS A CE    1 
ATOM   465   N  NZ    . LYS A  1 58  ? -91.080  -23.539 -63.088  0.56 74.61  ? 58   LYS A NZ    1 
ATOM   466   N  N     . GLY A  1 59  ? -93.252  -22.705 -67.569  0.56 74.67  ? 59   GLY A N     1 
ATOM   467   C  CA    . GLY A  1 59  ? -94.127  -23.780 -67.938  0.56 76.74  ? 59   GLY A CA    1 
ATOM   468   C  C     . GLY A  1 59  ? -93.189  -24.935 -68.129  0.56 91.04  ? 59   GLY A C     1 
ATOM   469   O  O     . GLY A  1 59  ? -92.968  -25.407 -69.239  0.56 98.73  ? 59   GLY A O     1 
ATOM   470   N  N     . ILE A  1 60  ? -92.641  -25.362 -67.010  0.56 94.06  ? 60   ILE A N     1 
ATOM   471   C  CA    . ILE A  1 60  ? -91.636  -26.407 -67.081  0.56 96.17  ? 60   ILE A CA    1 
ATOM   472   C  C     . ILE A  1 60  ? -92.352  -27.690 -67.417  0.56 100.00 ? 60   ILE A C     1 
ATOM   473   O  O     . ILE A  1 60  ? -91.923  -28.741 -66.948  0.56 100.00 ? 60   ILE A O     1 
ATOM   474   C  CB    . ILE A  1 60  ? -90.886  -26.424 -65.766  0.56 91.34  ? 60   ILE A CB    1 
ATOM   475   C  CG1   . ILE A  1 60  ? -89.566  -27.116 -66.090  0.56 75.78  ? 60   ILE A CG1   1 
ATOM   476   C  CG2   . ILE A  1 60  ? -91.626  -27.160 -64.669  0.56 94.97  ? 60   ILE A CG2   1 
ATOM   477   C  CD1   . ILE A  1 60  ? -88.640  -27.255 -64.903  0.56 52.25  ? 60   ILE A CD1   1 
ATOM   478   N  N     . ASN A  1 61  ? -93.355  -27.577 -68.272  0.56 63.89  ? 61   ASN A N     1 
ATOM   479   C  CA    . ASN A  1 61  ? -94.094  -28.726 -68.692  0.56 63.65  ? 61   ASN A CA    1 
ATOM   480   C  C     . ASN A  1 61  ? -94.547  -28.640 -70.161  0.56 63.76  ? 61   ASN A C     1 
ATOM   481   O  O     . ASN A  1 61  ? -94.381  -29.538 -71.021  0.56 64.61  ? 61   ASN A O     1 
ATOM   482   C  CB    . ASN A  1 61  ? -95.303  -28.904 -67.773  0.56 62.87  ? 61   ASN A CB    1 
ATOM   483   C  CG    . ASN A  1 61  ? -94.988  -28.563 -66.323  0.56 62.60  ? 61   ASN A CG    1 
ATOM   484   O  OD1   . ASN A  1 61  ? -95.261  -27.458 -65.850  0.56 62.30  ? 61   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A  1 61  ? -94.422  -29.534 -65.604  0.56 62.16  ? 61   ASN A ND2   1 
ATOM   486   N  N     . GLU A  1 62  ? -95.159  -27.519 -70.512  0.56 63.39  ? 62   GLU A N     1 
ATOM   487   C  CA    . GLU A  1 62  ? -95.720  -27.338 -71.884  0.56 73.99  ? 62   GLU A CA    1 
ATOM   488   C  C     . GLU A  1 62  ? -94.969  -26.374 -72.857  0.56 72.03  ? 62   GLU A C     1 
ATOM   489   O  O     . GLU A  1 62  ? -95.015  -26.549 -74.072  0.56 45.16  ? 62   GLU A O     1 
ATOM   490   C  CB    . GLU A  1 62  ? -97.203  -26.917 -71.748  0.56 77.89  ? 62   GLU A CB    1 
ATOM   491   C  CG    . GLU A  1 62  ? -97.427  -25.546 -71.101  0.56 83.42  ? 62   GLU A CG    1 
ATOM   492   C  CD    . GLU A  1 62  ? -98.075  -25.664 -69.734  0.56 86.44  ? 62   GLU A CD    1 
ATOM   493   O  OE1   . GLU A  1 62  ? -97.347  -25.490 -68.722  0.56 85.51  ? 62   GLU A OE1   1 
ATOM   494   O  OE2   . GLU A  1 62  ? -99.299  -25.920 -69.656  0.56 79.93  ? 62   GLU A OE2   1 
ATOM   495   N  N     . SER A  1 63  ? -94.284  -25.355 -72.309  0.56 83.50  ? 63   SER A N     1 
ATOM   496   C  CA    . SER A  1 63  ? -93.629  -24.257 -73.076  0.56 94.18  ? 63   SER A CA    1 
ATOM   497   C  C     . SER A  1 63  ? -92.358  -24.594 -73.861  0.56 85.05  ? 63   SER A C     1 
ATOM   498   O  O     . SER A  1 63  ? -91.262  -24.094 -73.608  0.56 68.36  ? 63   SER A O     1 
ATOM   499   C  CB    . SER A  1 63  ? -93.376  -23.080 -72.136  0.56 89.72  ? 63   SER A CB    1 
ATOM   500   O  OG    . SER A  1 63  ? -92.336  -23.378 -71.225  0.56 99.68  ? 63   SER A OG    1 
ATOM   501   N  N     . ASP A  1 64  ? -92.542  -25.468 -74.821  0.56 67.93  ? 64   ASP A N     1 
ATOM   502   C  CA    . ASP A  1 64  ? -91.522  -25.821 -75.786  0.56 45.13  ? 64   ASP A CA    1 
ATOM   503   C  C     . ASP A  1 64  ? -92.002  -25.110 -77.023  0.56 50.80  ? 64   ASP A C     1 
ATOM   504   O  O     . ASP A  1 64  ? -92.801  -25.647 -77.775  0.56 43.14  ? 64   ASP A O     1 
ATOM   505   C  CB    . ASP A  1 64  ? -91.451  -27.327 -76.029  0.56 31.38  ? 64   ASP A CB    1 
ATOM   506   C  CG    . ASP A  1 64  ? -90.044  -27.876 -75.938  0.56 48.35  ? 64   ASP A CG    1 
ATOM   507   O  OD1   . ASP A  1 64  ? -89.746  -28.663 -75.010  0.56 53.52  ? 64   ASP A OD1   1 
ATOM   508   O  OD2   . ASP A  1 64  ? -89.231  -27.511 -76.813  0.56 55.76  ? 64   ASP A OD2   1 
ATOM   509   N  N     . MET A  1 65  ? -91.493  -23.893 -77.231  1.00 60.34  ? 65   MET A N     1 
ATOM   510   C  CA    . MET A  1 65  ? -91.911  -23.035 -78.334  1.00 59.27  ? 65   MET A CA    1 
ATOM   511   C  C     . MET A  1 65  ? -91.035  -22.966 -79.579  1.00 62.23  ? 65   MET A C     1 
ATOM   512   O  O     . MET A  1 65  ? -89.910  -23.483 -79.607  1.00 65.14  ? 65   MET A O     1 
ATOM   513   C  CB    . MET A  1 65  ? -92.173  -21.615 -77.816  1.00 70.37  ? 65   MET A CB    1 
ATOM   514   C  CG    . MET A  1 65  ? -93.649  -21.293 -77.519  0.54 30.17  ? 65   MET A CG    1 
ATOM   515   S  SD    . MET A  1 65  ? -94.351  -22.133 -76.075  0.54 64.92  ? 65   MET A SD    1 
ATOM   516   C  CE    . MET A  1 65  ? -93.883  -20.998 -74.773  0.54 65.24  ? 65   MET A CE    1 
ATOM   517   N  N     . VAL A  1 66  ? -91.567  -22.271 -80.589  1.00 52.49  ? 66   VAL A N     1 
ATOM   518   C  CA    . VAL A  1 66  ? -90.915  -22.074 -81.888  1.00 65.14  ? 66   VAL A CA    1 
ATOM   519   C  C     . VAL A  1 66  ? -90.361  -20.671 -82.157  1.00 63.74  ? 66   VAL A C     1 
ATOM   520   O  O     . VAL A  1 66  ? -91.049  -19.664 -81.987  1.00 65.61  ? 66   VAL A O     1 
ATOM   521   C  CB    . VAL A  1 66  ? -91.889  -22.328 -83.047  1.00 63.37  ? 66   VAL A CB    1 
ATOM   522   C  CG1   . VAL A  1 66  ? -91.127  -22.380 -84.370  1.00 69.21  ? 66   VAL A CG1   1 
ATOM   523   C  CG2   . VAL A  1 66  ? -92.673  -23.582 -82.806  1.00 89.67  ? 66   VAL A CG2   1 
ATOM   524   N  N     . LEU A  1 67  ? -89.133  -20.620 -82.648  1.00 49.17  ? 67   LEU A N     1 
ATOM   525   C  CA    . LEU A  1 67  ? -88.520  -19.358 -83.002  1.00 43.50  ? 67   LEU A CA    1 
ATOM   526   C  C     . LEU A  1 67  ? -88.799  -19.158 -84.467  1.00 50.39  ? 67   LEU A C     1 
ATOM   527   O  O     . LEU A  1 67  ? -88.286  -19.903 -85.311  1.00 49.49  ? 67   LEU A O     1 
ATOM   528   C  CB    . LEU A  1 67  ? -87.019  -19.410 -82.796  1.00 48.70  ? 67   LEU A CB    1 
ATOM   529   C  CG    . LEU A  1 67  ? -86.607  -19.087 -81.375  1.00 47.53  ? 67   LEU A CG    1 
ATOM   530   C  CD1   . LEU A  1 67  ? -85.185  -19.500 -81.216  1.00 39.38  ? 67   LEU A CD1   1 
ATOM   531   C  CD2   . LEU A  1 67  ? -86.790  -17.608 -81.099  1.00 41.98  ? 67   LEU A CD2   1 
ATOM   532   N  N     . MET A  1 68  ? -89.615  -18.162 -84.781  1.00 42.36  ? 68   MET A N     1 
ATOM   533   C  CA    . MET A  1 68  ? -89.924  -17.934 -86.167  1.00 40.37  ? 68   MET A CA    1 
ATOM   534   C  C     . MET A  1 68  ? -89.215  -16.742 -86.750  1.00 37.10  ? 68   MET A C     1 
ATOM   535   O  O     . MET A  1 68  ? -89.597  -15.592 -86.517  1.00 51.70  ? 68   MET A O     1 
ATOM   536   C  CB    . MET A  1 68  ? -91.428  -17.813 -86.393  1.00 60.92  ? 68   MET A CB    1 
ATOM   537   C  CG    . MET A  1 68  ? -91.833  -17.706 -87.872  1.00 73.44  ? 68   MET A CG    1 
ATOM   538   S  SD    . MET A  1 68  ? -91.196  -19.070 -88.915  1.00 59.47  ? 68   MET A SD    1 
ATOM   539   C  CE    . MET A  1 68  ? -91.972  -20.486 -88.113  1.00 47.47  ? 68   MET A CE    1 
ATOM   540   N  N     . PRO A  1 69  ? -88.173  -17.009 -87.546  1.00 32.56  ? 69   PRO A N     1 
ATOM   541   C  CA    . PRO A  1 69  ? -87.379  -15.973 -88.204  1.00 34.74  ? 69   PRO A CA    1 
ATOM   542   C  C     . PRO A  1 69  ? -88.240  -15.060 -89.054  1.00 34.06  ? 69   PRO A C     1 
ATOM   543   O  O     . PRO A  1 69  ? -89.231  -15.476 -89.653  1.00 54.58  ? 69   PRO A O     1 
ATOM   544   C  CB    . PRO A  1 69  ? -86.402  -16.776 -89.075  1.00 30.95  ? 69   PRO A CB    1 
ATOM   545   C  CG    . PRO A  1 69  ? -87.041  -18.129 -89.205  1.00 37.68  ? 69   PRO A CG    1 
ATOM   546   C  CD    . PRO A  1 69  ? -87.631  -18.346 -87.840  1.00 31.39  ? 69   PRO A CD    1 
ATOM   547   N  N     . ASP A  1 70  ? -87.881  -13.790 -89.036  1.00 38.21  ? 70   ASP A N     1 
ATOM   548   C  CA    . ASP A  1 70  ? -88.572  -12.790 -89.807  1.00 31.32  ? 70   ASP A CA    1 
ATOM   549   C  C     . ASP A  1 70  ? -87.550  -12.282 -90.830  1.00 37.90  ? 70   ASP A C     1 
ATOM   550   O  O     . ASP A  1 70  ? -86.743  -11.386 -90.562  1.00 35.31  ? 70   ASP A O     1 
ATOM   551   C  CB    . ASP A  1 70  ? -89.068  -11.698 -88.873  1.00 29.20  ? 70   ASP A CB    1 
ATOM   552   C  CG    . ASP A  1 70  ? -89.719  -10.525 -89.610  1.00 62.08  ? 70   ASP A CG    1 
ATOM   553   O  OD1   . ASP A  1 70  ? -89.465  -10.320 -90.826  1.00 45.11  ? 70   ASP A OD1   1 
ATOM   554   O  OD2   . ASP A  1 70  ? -90.473  -9.780  -88.940  1.00 34.93  ? 70   ASP A OD2   1 
ATOM   555   N  N     . ALA A  1 71  ? -87.609  -12.873 -92.014  1.00 37.34  ? 71   ALA A N     1 
ATOM   556   C  CA    . ALA A  1 71  ? -86.696  -12.550 -93.096  1.00 38.95  ? 71   ALA A CA    1 
ATOM   557   C  C     . ALA A  1 71  ? -86.407  -11.074 -93.295  1.00 40.50  ? 71   ALA A C     1 
ATOM   558   O  O     . ALA A  1 71  ? -85.326  -10.710 -93.750  1.00 58.31  ? 71   ALA A O     1 
ATOM   559   C  CB    . ALA A  1 71  ? -87.212  -13.149 -94.383  1.00 68.60  ? 71   ALA A CB    1 
ATOM   560   N  N     . SER A  1 72  ? -87.365  -10.217 -92.972  1.00 45.68  ? 72   SER A N     1 
ATOM   561   C  CA    . SER A  1 72  ? -87.157  -8.785  -93.172  1.00 56.27  ? 72   SER A CA    1 
ATOM   562   C  C     . SER A  1 72  ? -86.142  -8.141  -92.218  1.00 56.95  ? 72   SER A C     1 
ATOM   563   O  O     . SER A  1 72  ? -85.350  -7.294  -92.634  1.00 56.72  ? 72   SER A O     1 
ATOM   564   C  CB    . SER A  1 72  ? -88.490  -8.039  -93.083  1.00 44.84  ? 72   SER A CB    1 
ATOM   565   O  OG    . SER A  1 72  ? -88.960  -7.988  -91.743  1.00 46.37  ? 72   SER A OG    1 
ATOM   566   N  N     . THR A  1 73  ? -86.161  -8.574  -90.957  1.00 45.43  ? 73   THR A N     1 
ATOM   567   C  CA    . THR A  1 73  ? -85.296  -8.049  -89.894  1.00 39.83  ? 73   THR A CA    1 
ATOM   568   C  C     . THR A  1 73  ? -83.778  -8.282  -89.990  1.00 50.06  ? 73   THR A C     1 
ATOM   569   O  O     . THR A  1 73  ? -83.010  -7.730  -89.190  1.00 58.13  ? 73   THR A O     1 
ATOM   570   C  CB    . THR A  1 73  ? -85.739  -8.600  -88.521  1.00 43.80  ? 73   THR A CB    1 
ATOM   571   O  OG1   . THR A  1 73  ? -85.463  -10.010 -88.440  1.00 41.84  ? 73   THR A OG1   1 
ATOM   572   C  CG2   . THR A  1 73  ? -87.208  -8.379  -88.328  1.00 39.73  ? 73   THR A CG2   1 
ATOM   573   N  N     . ALA A  1 74  ? -83.348  -9.071  -90.968  1.00 48.28  ? 74   ALA A N     1 
ATOM   574   C  CA    . ALA A  1 74  ? -81.937  -9.414  -91.127  1.00 54.21  ? 74   ALA A CA    1 
ATOM   575   C  C     . ALA A  1 74  ? -80.927  -8.300  -91.292  1.00 54.33  ? 74   ALA A C     1 
ATOM   576   O  O     . ALA A  1 74  ? -81.036  -7.461  -92.191  1.00 69.51  ? 74   ALA A O     1 
ATOM   577   C  CB    . ALA A  1 74  ? -81.760  -10.410 -92.255  1.00 45.40  ? 74   ALA A CB    1 
ATOM   578   N  N     . VAL A  1 75  ? -79.916  -8.333  -90.432  1.00 44.49  ? 75   VAL A N     1 
ATOM   579   C  CA    . VAL A  1 75  ? -78.829  -7.376  -90.502  1.00 49.30  ? 75   VAL A CA    1 
ATOM   580   C  C     . VAL A  1 75  ? -77.603  -7.813  -89.706  1.00 52.58  ? 75   VAL A C     1 
ATOM   581   O  O     . VAL A  1 75  ? -77.706  -8.408  -88.627  1.00 44.34  ? 75   VAL A O     1 
ATOM   582   C  CB    . VAL A  1 75  ? -79.249  -5.976  -90.092  1.00 40.75  ? 75   VAL A CB    1 
ATOM   583   C  CG1   . VAL A  1 75  ? -79.564  -5.932  -88.604  1.00 21.78  ? 75   VAL A CG1   1 
ATOM   584   C  CG2   . VAL A  1 75  ? -78.162  -4.970  -90.516  1.00 65.03  ? 75   VAL A CG2   1 
ATOM   585   N  N     . ILE A  1 76  ? -76.445  -7.530  -90.292  1.00 35.15  ? 76   ILE A N     1 
ATOM   586   C  CA    . ILE A  1 76  ? -75.150  -7.866  -89.725  1.00 51.10  ? 76   ILE A CA    1 
ATOM   587   C  C     . ILE A  1 76  ? -74.887  -7.294  -88.334  1.00 51.19  ? 76   ILE A C     1 
ATOM   588   O  O     . ILE A  1 76  ? -75.284  -6.162  -88.038  1.00 56.70  ? 76   ILE A O     1 
ATOM   589   C  CB    . ILE A  1 76  ? -74.046  -7.347  -90.660  1.00 39.39  ? 76   ILE A CB    1 
ATOM   590   C  CG1   . ILE A  1 76  ? -74.101  -8.096  -91.984  1.00 44.10  ? 76   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A  1 76  ? -72.680  -7.481  -90.014  1.00 46.03  ? 76   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A  1 76  ? -73.930  -9.592  -91.821  1.00 55.34  ? 76   ILE A CD1   1 
ATOM   593   N  N     . ASP A  1 77  ? -74.238  -8.085  -87.479  1.00 38.62  ? 77   ASP A N     1 
ATOM   594   C  CA    . ASP A  1 77  ? -73.873  -7.598  -86.154  1.00 33.64  ? 77   ASP A CA    1 
ATOM   595   C  C     . ASP A  1 77  ? -72.515  -6.925  -86.341  1.00 30.31  ? 77   ASP A C     1 
ATOM   596   O  O     . ASP A  1 77  ? -71.542  -7.553  -86.754  1.00 41.54  ? 77   ASP A O     1 
ATOM   597   C  CB    . ASP A  1 77  ? -73.775  -8.707  -85.138  1.00 15.10  ? 77   ASP A CB    1 
ATOM   598   C  CG    . ASP A  1 77  ? -73.562  -8.171  -83.756  1.00 40.32  ? 77   ASP A CG    1 
ATOM   599   O  OD1   . ASP A  1 77  ? -74.492  -8.273  -82.935  1.00 27.37  ? 77   ASP A OD1   1 
ATOM   600   O  OD2   . ASP A  1 77  ? -72.481  -7.604  -83.505  1.00 34.48  ? 77   ASP A OD2   1 
ATOM   601   N  N     . PRO A  1 78  ? -72.418  -5.654  -85.951  1.00 31.96  ? 78   PRO A N     1 
ATOM   602   C  CA    . PRO A  1 78  ? -71.185  -4.898  -86.111  1.00 33.00  ? 78   PRO A CA    1 
ATOM   603   C  C     . PRO A  1 78  ? -70.170  -5.020  -85.009  1.00 38.50  ? 78   PRO A C     1 
ATOM   604   O  O     . PRO A  1 78  ? -69.107  -4.427  -85.097  1.00 34.27  ? 78   PRO A O     1 
ATOM   605   C  CB    . PRO A  1 78  ? -71.715  -3.480  -86.214  1.00 31.81  ? 78   PRO A CB    1 
ATOM   606   C  CG    . PRO A  1 78  ? -72.775  -3.478  -85.140  1.00 28.54  ? 78   PRO A CG    1 
ATOM   607   C  CD    . PRO A  1 78  ? -73.427  -4.855  -85.229  1.00 22.70  ? 78   PRO A CD    1 
ATOM   608   N  N     . PHE A  1 79  ? -70.500  -5.775  -83.974  1.00 34.04  ? 79   PHE A N     1 
ATOM   609   C  CA    . PHE A  1 79  ? -69.610  -5.943  -82.832  1.00 33.84  ? 79   PHE A CA    1 
ATOM   610   C  C     . PHE A  1 79  ? -68.933  -7.316  -82.780  1.00 38.92  ? 79   PHE A C     1 
ATOM   611   O  O     . PHE A  1 79  ? -67.797  -7.449  -82.322  1.00 52.72  ? 79   PHE A O     1 
ATOM   612   C  CB    . PHE A  1 79  ? -70.389  -5.732  -81.531  1.00 36.37  ? 79   PHE A CB    1 
ATOM   613   C  CG    . PHE A  1 79  ? -71.151  -4.444  -81.474  1.00 43.25  ? 79   PHE A CG    1 
ATOM   614   C  CD1   . PHE A  1 79  ? -70.484  -3.231  -81.433  1.00 40.97  ? 79   PHE A CD1   1 
ATOM   615   C  CD2   . PHE A  1 79  ? -72.539  -4.447  -81.423  1.00 38.17  ? 79   PHE A CD2   1 
ATOM   616   C  CE1   . PHE A  1 79  ? -71.193  -2.030  -81.336  1.00 54.80  ? 79   PHE A CE1   1 
ATOM   617   C  CE2   . PHE A  1 79  ? -73.253  -3.262  -81.327  1.00 61.29  ? 79   PHE A CE2   1 
ATOM   618   C  CZ    . PHE A  1 79  ? -72.580  -2.048  -81.282  1.00 58.71  ? 79   PHE A CZ    1 
ATOM   619   N  N     . PHE A  1 80  ? -69.658  -8.340  -83.206  1.00 36.31  ? 80   PHE A N     1 
ATOM   620   C  CA    . PHE A  1 80  ? -69.149  -9.702  -83.191  1.00 34.22  ? 80   PHE A CA    1 
ATOM   621   C  C     . PHE A  1 80  ? -67.921  -9.871  -84.069  1.00 35.69  ? 80   PHE A C     1 
ATOM   622   O  O     . PHE A  1 80  ? -67.847  -9.311  -85.175  1.00 59.30  ? 80   PHE A O     1 
ATOM   623   C  CB    . PHE A  1 80  ? -70.239  -10.680 -83.626  1.00 43.66  ? 80   PHE A CB    1 
ATOM   624   C  CG    . PHE A  1 80  ? -71.369  -10.803 -82.647  1.00 40.32  ? 80   PHE A CG    1 
ATOM   625   C  CD1   . PHE A  1 80  ? -72.504  -11.526 -82.973  1.00 36.84  ? 80   PHE A CD1   1 
ATOM   626   C  CD2   . PHE A  1 80  ? -71.311  -10.169 -81.416  1.00 47.84  ? 80   PHE A CD2   1 
ATOM   627   C  CE1   . PHE A  1 80  ? -73.565  -11.612 -82.094  1.00 37.67  ? 80   PHE A CE1   1 
ATOM   628   C  CE2   . PHE A  1 80  ? -72.364  -10.247 -80.532  1.00 54.28  ? 80   PHE A CE2   1 
ATOM   629   C  CZ    . PHE A  1 80  ? -73.497  -10.971 -80.873  1.00 34.13  ? 80   PHE A CZ    1 
ATOM   630   N  N     . ALA A  1 81  ? -66.996  -10.699 -83.585  1.00 25.40  ? 81   ALA A N     1 
ATOM   631   C  CA    . ALA A  1 81  ? -65.734  -10.952 -84.264  1.00 28.52  ? 81   ALA A CA    1 
ATOM   632   C  C     . ALA A  1 81  ? -65.851  -11.731 -85.547  1.00 32.74  ? 81   ALA A C     1 
ATOM   633   O  O     . ALA A  1 81  ? -65.192  -11.414 -86.531  1.00 50.97  ? 81   ALA A O     1 
ATOM   634   C  CB    . ALA A  1 81  ? -64.782  -11.646 -83.336  1.00 19.55  ? 81   ALA A CB    1 
ATOM   635   N  N     . ASP A  1 82  ? -66.664  -12.777 -85.528  1.00 45.35  ? 82   ASP A N     1 
ATOM   636   C  CA    . ASP A  1 82  ? -66.834  -13.594 -86.719  1.00 50.06  ? 82   ASP A CA    1 
ATOM   637   C  C     . ASP A  1 82  ? -68.084  -13.051 -87.395  1.00 46.64  ? 82   ASP A C     1 
ATOM   638   O  O     . ASP A  1 82  ? -69.037  -12.690 -86.716  1.00 38.69  ? 82   ASP A O     1 
ATOM   639   C  CB    . ASP A  1 82  ? -66.974  -15.059 -86.308  1.00 38.39  ? 82   ASP A CB    1 
ATOM   640   C  CG    . ASP A  1 82  ? -66.107  -15.405 -85.098  1.00 52.22  ? 82   ASP A CG    1 
ATOM   641   O  OD1   . ASP A  1 82  ? -64.975  -15.917 -85.304  1.00 44.31  ? 82   ASP A OD1   1 
ATOM   642   O  OD2   . ASP A  1 82  ? -66.551  -15.125 -83.946  1.00 67.40  ? 82   ASP A OD2   1 
ATOM   643   N  N     . SER A  1 83  ? -68.084  -12.947 -88.718  1.00 51.36  ? 83   SER A N     1 
ATOM   644   C  CA    . SER A  1 83  ? -69.203  -12.368 -89.447  1.00 45.01  ? 83   SER A CA    1 
ATOM   645   C  C     . SER A  1 83  ? -70.534  -13.010 -89.108  1.00 38.56  ? 83   SER A C     1 
ATOM   646   O  O     . SER A  1 83  ? -70.801  -14.106 -89.588  1.00 56.39  ? 83   SER A O     1 
ATOM   647   C  CB    . SER A  1 83  ? -68.962  -12.451 -90.953  1.00 45.31  ? 83   SER A CB    1 
ATOM   648   O  OG    . SER A  1 83  ? -69.706  -11.449 -91.627  1.00 56.64  ? 83   SER A OG    1 
ATOM   649   N  N     . THR A  1 84  ? -71.376  -12.353 -88.313  1.00 35.12  ? 84   THR A N     1 
ATOM   650   C  CA    . THR A  1 84  ? -72.667  -12.988 -88.039  1.00 31.82  ? 84   THR A CA    1 
ATOM   651   C  C     . THR A  1 84  ? -73.866  -12.094 -88.407  1.00 43.63  ? 84   THR A C     1 
ATOM   652   O  O     . THR A  1 84  ? -73.842  -10.864 -88.270  1.00 42.60  ? 84   THR A O     1 
ATOM   653   C  CB    . THR A  1 84  ? -72.785  -13.412 -86.578  1.00 38.88  ? 84   THR A CB    1 
ATOM   654   O  OG1   . THR A  1 84  ? -73.897  -12.722 -85.991  1.00 43.51  ? 84   THR A OG1   1 
ATOM   655   C  CG2   . THR A  1 84  ? -71.518  -13.065 -85.811  1.00 15.94  ? 84   THR A CG2   1 
ATOM   656   N  N     . LEU A  1 85  ? -74.928  -12.789 -88.887  1.00 41.53  ? 85   LEU A N     1 
ATOM   657   C  CA    . LEU A  1 85  ? -76.181  -12.162 -89.276  1.00 36.49  ? 85   LEU A CA    1 
ATOM   658   C  C     . LEU A  1 85  ? -77.243  -12.315 -88.191  1.00 41.39  ? 85   LEU A C     1 
ATOM   659   O  O     . LEU A  1 85  ? -77.470  -13.409 -87.671  1.00 51.03  ? 85   LEU A O     1 
ATOM   660   C  CB    . LEU A  1 85  ? -76.686  -12.761 -90.581  1.00 41.32  ? 85   LEU A CB    1 
ATOM   661   C  CG    . LEU A  1 85  ? -77.947  -12.068 -91.090  1.00 45.06  ? 85   LEU A CG    1 
ATOM   662   C  CD1   . LEU A  1 85  ? -77.638  -10.638 -91.460  1.00 38.57  ? 85   LEU A CD1   1 
ATOM   663   C  CD2   . LEU A  1 85  ? -78.476  -12.803 -92.288  1.00 34.33  ? 85   LEU A CD2   1 
ATOM   664   N  N     . ILE A  1 86  ? -77.882  -11.203 -87.847  1.00 43.31  ? 86   ILE A N     1 
ATOM   665   C  CA    . ILE A  1 86  ? -78.916  -11.201 -86.820  1.00 36.64  ? 86   ILE A CA    1 
ATOM   666   C  C     . ILE A  1 86  ? -80.272  -11.308 -87.493  1.00 44.96  ? 86   ILE A C     1 
ATOM   667   O  O     . ILE A  1 86  ? -80.493  -10.757 -88.572  1.00 59.93  ? 86   ILE A O     1 
ATOM   668   C  CB    . ILE A  1 86  ? -78.918  -9.882  -86.013  1.00 38.09  ? 86   ILE A CB    1 
ATOM   669   C  CG1   . ILE A  1 86  ? -77.534  -9.602  -85.437  1.00 43.82  ? 86   ILE A CG1   1 
ATOM   670   C  CG2   . ILE A  1 86  ? -79.948  -9.948  -84.884  1.00 25.38  ? 86   ILE A CG2   1 
ATOM   671   C  CD1   . ILE A  1 86  ? -77.331  -8.158  -85.021  1.00 25.66  ? 86   ILE A CD1   1 
ATOM   672   N  N     . ILE A  1 87  ? -81.176  -12.037 -86.854  1.00 42.15  ? 87   ILE A N     1 
ATOM   673   C  CA    . ILE A  1 87  ? -82.526  -12.186 -87.359  1.00 34.55  ? 87   ILE A CA    1 
ATOM   674   C  C     . ILE A  1 87  ? -83.469  -12.221 -86.183  1.00 39.08  ? 87   ILE A C     1 
ATOM   675   O  O     . ILE A  1 87  ? -83.362  -13.062 -85.283  1.00 37.66  ? 87   ILE A O     1 
ATOM   676   C  CB    . ILE A  1 87  ? -82.715  -13.451 -88.189  1.00 38.96  ? 87   ILE A CB    1 
ATOM   677   C  CG1   . ILE A  1 87  ? -81.865  -13.373 -89.453  1.00 44.92  ? 87   ILE A CG1   1 
ATOM   678   C  CG2   . ILE A  1 87  ? -84.171  -13.582 -88.599  1.00 46.88  ? 87   ILE A CG2   1 
ATOM   679   C  CD1   . ILE A  1 87  ? -81.855  -14.651 -90.240  1.00 44.45  ? 87   ILE A CD1   1 
ATOM   680   N  N     . ARG A  1 88  ? -84.352  -11.237 -86.178  1.00 37.62  ? 88   ARG A N     1 
ATOM   681   C  CA    . ARG A  1 88  ? -85.347  -11.095 -85.147  1.00 29.13  ? 88   ARG A CA    1 
ATOM   682   C  C     . ARG A  1 88  ? -86.361  -12.209 -85.377  1.00 31.73  ? 88   ARG A C     1 
ATOM   683   O  O     . ARG A  1 88  ? -86.706  -12.541 -86.508  1.00 42.98  ? 88   ARG A O     1 
ATOM   684   C  CB    . ARG A  1 88  ? -85.971  -9.711  -85.281  1.00 22.83  ? 88   ARG A CB    1 
ATOM   685   C  CG    . ARG A  1 88  ? -86.908  -9.335  -84.193  1.00 39.05  ? 88   ARG A CG    1 
ATOM   686   C  CD    . ARG A  1 88  ? -86.665  -7.914  -83.786  1.00 27.23  ? 88   ARG A CD    1 
ATOM   687   N  NE    . ARG A  1 88  ? -86.012  -7.915  -82.487  1.00 54.32  ? 88   ARG A NE    1 
ATOM   688   C  CZ    . ARG A  1 88  ? -84.793  -7.430  -82.265  1.00 59.30  ? 88   ARG A CZ    1 
ATOM   689   N  NH1   . ARG A  1 88  ? -84.288  -7.489  -81.044  1.00 50.38  ? 88   ARG A NH1   1 
ATOM   690   N  NH2   . ARG A  1 88  ? -84.093  -6.854  -83.245  1.00 34.98  ? 88   ARG A NH2   1 
ATOM   691   N  N     . CYS A  1 89  ? -86.796  -12.827 -84.301  1.00 35.79  ? 89   CYS A N     1 
ATOM   692   C  CA    . CYS A  1 89  ? -87.743  -13.914 -84.415  1.00 40.14  ? 89   CYS A CA    1 
ATOM   693   C  C     . CYS A  1 89  ? -88.994  -13.601 -83.639  1.00 46.51  ? 89   CYS A C     1 
ATOM   694   O  O     . CYS A  1 89  ? -88.997  -12.710 -82.779  1.00 47.35  ? 89   CYS A O     1 
ATOM   695   C  CB    . CYS A  1 89  ? -87.136  -15.206 -83.848  1.00 26.42  ? 89   CYS A CB    1 
ATOM   696   S  SG    . CYS A  1 89  ? -85.761  -15.861 -84.776  1.00 53.10  ? 89   CYS A SG    1 
ATOM   697   N  N     . ASP A  1 90  ? -90.048  -14.354 -83.955  1.00 48.28  ? 90   ASP A N     1 
ATOM   698   C  CA    . ASP A  1 90  ? -91.340  -14.264 -83.279  1.00 38.67  ? 90   ASP A CA    1 
ATOM   699   C  C     . ASP A  1 90  ? -91.465  -15.586 -82.550  1.00 43.31  ? 90   ASP A C     1 
ATOM   700   O  O     . ASP A  1 90  ? -90.979  -16.624 -83.025  1.00 34.64  ? 90   ASP A O     1 
ATOM   701   C  CB    . ASP A  1 90  ? -92.512  -14.221 -84.267  1.00 59.44  ? 90   ASP A CB    1 
ATOM   702   C  CG    . ASP A  1 90  ? -92.570  -12.953 -85.068  1.00 64.27  ? 90   ASP A CG    1 
ATOM   703   O  OD1   . ASP A  1 90  ? -92.952  -11.911 -84.494  1.00 43.99  ? 90   ASP A OD1   1 
ATOM   704   O  OD2   . ASP A  1 90  ? -92.269  -13.019 -86.283  1.00 80.65  ? 90   ASP A OD2   1 
ATOM   705   N  N     . ILE A  1 91  ? -92.142  -15.559 -81.415  1.00 42.70  ? 91   ILE A N     1 
ATOM   706   C  CA    . ILE A  1 91  ? -92.357  -16.775 -80.662  1.00 46.25  ? 91   ILE A CA    1 
ATOM   707   C  C     . ILE A  1 91  ? -93.743  -17.296 -80.998  1.00 56.92  ? 91   ILE A C     1 
ATOM   708   O  O     . ILE A  1 91  ? -94.761  -16.663 -80.695  1.00 69.26  ? 91   ILE A O     1 
ATOM   709   C  CB    . ILE A  1 91  ? -92.239  -16.536 -79.166  1.00 44.23  ? 91   ILE A CB    1 
ATOM   710   C  CG1   . ILE A  1 91  ? -90.856  -15.973 -78.849  1.00 49.80  ? 91   ILE A CG1   1 
ATOM   711   C  CG2   . ILE A  1 91  ? -92.439  -17.835 -78.420  1.00 35.82  ? 91   ILE A CG2   1 
ATOM   712   C  CD1   . ILE A  1 91  ? -89.718  -16.857 -79.334  1.00 55.22  ? 91   ILE A CD1   1 
ATOM   713   N  N     . LEU A  1 92  ? -93.763  -18.431 -81.683  1.00 66.99  ? 92   LEU A N     1 
ATOM   714   C  CA    . LEU A  1 92  ? -95.003  -19.063 -82.094  1.00 64.15  ? 92   LEU A CA    1 
ATOM   715   C  C     . LEU A  1 92  ? -95.288  -20.275 -81.243  1.00 70.10  ? 92   LEU A C     1 
ATOM   716   O  O     . LEU A  1 92  ? -94.369  -20.868 -80.667  1.00 57.13  ? 92   LEU A O     1 
ATOM   717   C  CB    . LEU A  1 92  ? -94.906  -19.508 -83.550  1.00 48.38  ? 92   LEU A CB    1 
ATOM   718   C  CG    . LEU A  1 92  ? -94.498  -18.441 -84.566  1.00 66.25  ? 92   LEU A CG    1 
ATOM   719   C  CD1   . LEU A  1 92  ? -94.638  -19.039 -85.942  1.00 68.69  ? 92   LEU A CD1   1 
ATOM   720   C  CD2   . LEU A  1 92  ? -95.338  -17.169 -84.445  1.00 36.07  ? 92   LEU A CD2   1 
ATOM   721   N  N     . GLU A  1 93  ? -96.570  -20.633 -81.178  1.00 90.51  ? 93   GLU A N     1 
ATOM   722   C  CA    . GLU A  1 93  ? -97.026  -21.801 -80.430  1.00 82.53  ? 93   GLU A CA    1 
ATOM   723   C  C     . GLU A  1 93  ? -96.707  -23.043 -81.298  1.00 79.32  ? 93   GLU A C     1 
ATOM   724   O  O     . GLU A  1 93  ? -96.960  -23.049 -82.512  1.00 74.36  ? 93   GLU A O     1 
ATOM   725   C  CB    . GLU A  1 93  ? -98.529  -21.673 -80.160  1.00 66.69  ? 93   GLU A CB    1 
ATOM   726   C  CG    . GLU A  1 93  ? -99.061  -22.644 -79.116  0.53 72.98  ? 93   GLU A CG    1 
ATOM   727   C  CD    . GLU A  1 93  ? -98.570  -22.324 -77.715  0.53 60.19  ? 93   GLU A CD    1 
ATOM   728   O  OE1   . GLU A  1 93  ? -98.888  -21.215 -77.231  0.53 45.60  ? 93   GLU A OE1   1 
ATOM   729   O  OE2   . GLU A  1 93  ? -97.882  -23.181 -77.102  0.53 47.60  ? 93   GLU A OE2   1 
ATOM   730   N  N     . PRO A  1 94  ? -96.141  -24.106 -80.693  1.00 78.46  ? 94   PRO A N     1 
ATOM   731   C  CA    . PRO A  1 94  ? -95.811  -25.299 -81.483  1.00 72.96  ? 94   PRO A CA    1 
ATOM   732   C  C     . PRO A  1 94  ? -97.027  -25.950 -82.165  1.00 89.07  ? 94   PRO A C     1 
ATOM   733   O  O     . PRO A  1 94  ? -98.110  -26.077 -81.564  1.00 93.67  ? 94   PRO A O     1 
ATOM   734   C  CB    . PRO A  1 94  ? -95.127  -26.206 -80.453  1.00 63.81  ? 94   PRO A CB    1 
ATOM   735   C  CG    . PRO A  1 94  ? -95.813  -25.824 -79.152  1.00 92.26  ? 94   PRO A CG    1 
ATOM   736   C  CD    . PRO A  1 94  ? -95.889  -24.326 -79.253  1.00 79.25  ? 94   PRO A CD    1 
ATOM   737   N  N     . GLY A  1 95  ? -96.856  -26.308 -83.439  1.00 83.00  ? 95   GLY A N     1 
ATOM   738   C  CA    . GLY A  1 95  ? -97.938  -26.925 -84.190  1.00 78.35  ? 95   GLY A CA    1 
ATOM   739   C  C     . GLY A  1 95  ? -98.945  -25.906 -84.698  1.00 83.77  ? 95   GLY A C     1 
ATOM   740   O  O     . GLY A  1 95  ? -99.046  -25.678 -85.910  1.00 73.99  ? 95   GLY A O     1 
ATOM   741   N  N     . THR A  1 96  ? -99.684  -25.290 -83.772  1.00 82.46  ? 96   THR A N     1 
ATOM   742   C  CA    . THR A  1 96  ? -100.686 -24.270 -84.108  1.00 81.49  ? 96   THR A CA    1 
ATOM   743   C  C     . THR A  1 96  ? -100.019 -23.185 -84.967  1.00 81.85  ? 96   THR A C     1 
ATOM   744   O  O     . THR A  1 96  ? -100.540 -22.781 -86.017  1.00 62.36  ? 96   THR A O     1 
ATOM   745   C  CB    . THR A  1 96  ? -101.302 -23.627 -82.820  1.00 87.57  ? 96   THR A CB    1 
ATOM   746   O  OG1   . THR A  1 96  ? -100.671 -22.371 -82.545  0.70 79.95  ? 96   THR A OG1   1 
ATOM   747   C  CG2   . THR A  1 96  ? -101.118 -24.552 -81.603  0.70 79.18  ? 96   THR A CG2   1 
ATOM   748   N  N     . LEU A  1 97  ? -98.864  -22.723 -84.491  1.00 77.51  ? 97   LEU A N     1 
ATOM   749   C  CA    . LEU A  1 97  ? -98.043  -21.730 -85.173  1.00 67.81  ? 97   LEU A CA    1 
ATOM   750   C  C     . LEU A  1 97  ? -98.610  -20.334 -85.445  1.00 79.35  ? 97   LEU A C     1 
ATOM   751   O  O     . LEU A  1 97  ? -98.174  -19.680 -86.403  1.00 75.20  ? 97   LEU A O     1 
ATOM   752   C  CB    . LEU A  1 97  ? -97.507  -22.324 -86.487  1.00 55.36  ? 97   LEU A CB    1 
ATOM   753   C  CG    . LEU A  1 97  ? -96.092  -22.916 -86.507  1.00 73.10  ? 97   LEU A CG    1 
ATOM   754   C  CD1   . LEU A  1 97  ? -95.906  -23.983 -85.426  1.00 79.79  ? 97   LEU A CD1   1 
ATOM   755   C  CD2   . LEU A  1 97  ? -95.802  -23.482 -87.898  1.00 70.36  ? 97   LEU A CD2   1 
ATOM   756   N  N     . GLN A  1 98  ? -99.542  -19.838 -84.635  1.00 80.51  ? 98   GLN A N     1 
ATOM   757   C  CA    . GLN A  1 98  ? -100.040 -18.498 -84.947  1.00 100.00 ? 98   GLN A CA    1 
ATOM   758   C  C     . GLN A  1 98  ? -99.566  -17.367 -84.023  1.00 100.00 ? 98   GLN A C     1 
ATOM   759   O  O     . GLN A  1 98  ? -99.867  -16.188 -84.272  1.00 100.00 ? 98   GLN A O     1 
ATOM   760   C  CB    . GLN A  1 98  ? -101.564 -18.461 -85.252  1.00 87.42  ? 98   GLN A CB    1 
ATOM   761   C  CG    . GLN A  1 98  ? -102.497 -18.382 -84.062  0.62 72.06  ? 98   GLN A CG    1 
ATOM   762   C  CD    . GLN A  1 98  ? -102.333 -19.565 -83.138  0.62 88.21  ? 98   GLN A CD    1 
ATOM   763   O  OE1   . GLN A  1 98  ? -102.806 -20.671 -83.436  0.62 80.82  ? 98   GLN A OE1   1 
ATOM   764   N  NE2   . GLN A  1 98  ? -101.628 -19.355 -82.020  0.62 82.53  ? 98   GLN A NE2   1 
ATOM   765   N  N     . GLY A  1 99  ? -98.801  -17.702 -82.982  1.00 70.08  ? 99   GLY A N     1 
ATOM   766   C  CA    . GLY A  1 99  ? -98.289  -16.633 -82.143  1.00 66.20  ? 99   GLY A CA    1 
ATOM   767   C  C     . GLY A  1 99  ? -98.579  -16.688 -80.673  1.00 53.62  ? 99   GLY A C     1 
ATOM   768   O  O     . GLY A  1 99  ? -99.700  -16.435 -80.251  1.00 64.94  ? 99   GLY A O     1 
ATOM   769   N  N     . TYR A  1 100 ? -97.518  -16.886 -79.898  1.00 49.20  ? 100  TYR A N     1 
ATOM   770   C  CA    . TYR A  1 100 ? -97.585  -16.987 -78.443  1.00 41.88  ? 100  TYR A CA    1 
ATOM   771   C  C     . TYR A  1 100 ? -98.254  -15.803 -77.734  1.00 53.18  ? 100  TYR A C     1 
ATOM   772   O  O     . TYR A  1 100 ? -97.948  -14.627 -77.967  1.00 46.88  ? 100  TYR A O     1 
ATOM   773   C  CB    . TYR A  1 100 ? -96.184  -17.232 -77.870  1.00 60.93  ? 100  TYR A CB    1 
ATOM   774   C  CG    . TYR A  1 100 ? -96.150  -17.599 -76.398  1.00 72.03  ? 100  TYR A CG    1 
ATOM   775   C  CD1   . TYR A  1 100 ? -97.178  -18.341 -75.821  1.00 58.37  ? 100  TYR A CD1   1 
ATOM   776   C  CD2   . TYR A  1 100 ? -95.077  -17.222 -75.584  1.00 65.83  ? 100  TYR A CD2   1 
ATOM   777   C  CE1   . TYR A  1 100 ? -97.140  -18.704 -74.471  1.00 80.53  ? 100  TYR A CE1   1 
ATOM   778   C  CE2   . TYR A  1 100 ? -95.031  -17.582 -74.226  1.00 67.34  ? 100  TYR A CE2   1 
ATOM   779   C  CZ    . TYR A  1 100 ? -96.068  -18.326 -73.679  1.00 67.84  ? 100  TYR A CZ    1 
ATOM   780   O  OH    . TYR A  1 100 ? -96.034  -18.718 -72.349  1.00 78.44  ? 100  TYR A OH    1 
ATOM   781   N  N     . ASP A  1 101 ? -99.155  -16.160 -76.832  1.00 53.60  ? 101  ASP A N     1 
ATOM   782   C  CA    . ASP A  1 101 ? -99.933  -15.226 -76.041  1.00 59.73  ? 101  ASP A CA    1 
ATOM   783   C  C     . ASP A  1 101 ? -99.094  -14.239 -75.270  1.00 62.74  ? 101  ASP A C     1 
ATOM   784   O  O     . ASP A  1 101 ? -99.540  -13.122 -74.972  1.00 62.67  ? 101  ASP A O     1 
ATOM   785   C  CB    . ASP A  1 101 ? -100.758 -16.020 -75.039  1.00 86.12  ? 101  ASP A CB    1 
ATOM   786   C  CG    . ASP A  1 101 ? -102.206 -16.131 -75.431  1.00 90.95  ? 101  ASP A CG    1 
ATOM   787   O  OD1   . ASP A  1 101 ? -103.016 -16.239 -74.485  1.00 82.15  ? 101  ASP A OD1   1 
ATOM   788   O  OD2   . ASP A  1 101 ? -102.529 -16.103 -76.650  1.00 73.37  ? 101  ASP A OD2   1 
ATOM   789   N  N     . ARG A  1 102 ? -97.918  -14.707 -74.867  1.00 56.30  ? 102  ARG A N     1 
ATOM   790   C  CA    . ARG A  1 102 ? -96.992  -13.903 -74.099  1.00 39.42  ? 102  ARG A CA    1 
ATOM   791   C  C     . ARG A  1 102 ? -95.840  -13.279 -74.866  1.00 45.59  ? 102  ARG A C     1 
ATOM   792   O  O     . ARG A  1 102 ? -95.089  -12.480 -74.289  1.00 55.52  ? 102  ARG A O     1 
ATOM   793   C  CB    . ARG A  1 102 ? -96.500  -14.673 -72.886  1.00 34.09  ? 102  ARG A CB    1 
ATOM   794   C  CG    . ARG A  1 102 ? -97.488  -14.612 -71.742  1.00 58.63  ? 102  ARG A CG    1 
ATOM   795   C  CD    . ARG A  1 102 ? -98.156  -15.945 -71.497  1.00 63.31  ? 102  ARG A CD    1 
ATOM   796   N  NE    . ARG A  1 102 ? -97.503  -16.682 -70.417  1.00 68.14  ? 102  ARG A NE    1 
ATOM   797   C  CZ    . ARG A  1 102 ? -98.156  -17.368 -69.482  1.00 82.50  ? 102  ARG A CZ    1 
ATOM   798   N  NH1   . ARG A  1 102 ? -97.484  -18.009 -68.536  1.00 74.70  ? 102  ARG A NH1   1 
ATOM   799   N  NH2   . ARG A  1 102 ? -99.486  -17.419 -69.496  1.00 85.13  ? 102  ARG A NH2   1 
ATOM   800   N  N     . ASP A  1 103 ? -95.704  -13.625 -76.150  1.00 32.88  ? 103  ASP A N     1 
ATOM   801   C  CA    . ASP A  1 103 ? -94.660  -13.037 -76.991  1.00 35.80  ? 103  ASP A CA    1 
ATOM   802   C  C     . ASP A  1 103 ? -95.048  -11.575 -77.240  1.00 42.20  ? 103  ASP A C     1 
ATOM   803   O  O     . ASP A  1 103 ? -95.928  -11.284 -78.057  1.00 49.96  ? 103  ASP A O     1 
ATOM   804   C  CB    . ASP A  1 103 ? -94.528  -13.783 -78.323  1.00 25.89  ? 103  ASP A CB    1 
ATOM   805   C  CG    . ASP A  1 103 ? -93.682  -13.021 -79.341  1.00 55.47  ? 103  ASP A CG    1 
ATOM   806   O  OD1   . ASP A  1 103 ? -92.924  -12.106 -78.935  1.00 56.97  ? 103  ASP A OD1   1 
ATOM   807   O  OD2   . ASP A  1 103 ? -93.788  -13.327 -80.554  1.00 54.09  ? 103  ASP A OD2   1 
ATOM   808   N  N     . PRO A  1 104 ? -94.333  -10.638 -76.589  1.00 43.75  ? 104  PRO A N     1 
ATOM   809   C  CA    . PRO A  1 104 ? -94.561  -9.197  -76.686  1.00 31.67  ? 104  PRO A CA    1 
ATOM   810   C  C     . PRO A  1 104 ? -94.576  -8.720  -78.112  1.00 36.06  ? 104  PRO A C     1 
ATOM   811   O  O     . PRO A  1 104 ? -95.330  -7.821  -78.454  1.00 48.38  ? 104  PRO A O     1 
ATOM   812   C  CB    . PRO A  1 104 ? -93.375  -8.615  -75.934  1.00 35.12  ? 104  PRO A CB    1 
ATOM   813   C  CG    . PRO A  1 104 ? -93.064  -9.669  -74.939  1.00 53.09  ? 104  PRO A CG    1 
ATOM   814   C  CD    . PRO A  1 104 ? -93.117  -10.895 -75.806  1.00 50.08  ? 104  PRO A CD    1 
ATOM   815   N  N     . ARG A  1 105 ? -93.766  -9.334  -78.958  1.00 30.09  ? 105  ARG A N     1 
ATOM   816   C  CA    . ARG A  1 105 ? -93.752  -8.908  -80.340  1.00 40.85  ? 105  ARG A CA    1 
ATOM   817   C  C     . ARG A  1 105 ? -95.044  -9.309  -81.025  1.00 51.64  ? 105  ARG A C     1 
ATOM   818   O  O     . ARG A  1 105 ? -95.558  -8.565  -81.864  1.00 54.05  ? 105  ARG A O     1 
ATOM   819   C  CB    . ARG A  1 105 ? -92.569  -9.490  -81.095  1.00 41.95  ? 105  ARG A CB    1 
ATOM   820   C  CG    . ARG A  1 105 ? -92.242  -8.690  -82.345  1.00 53.34  ? 105  ARG A CG    1 
ATOM   821   C  CD    . ARG A  1 105 ? -91.142  -9.334  -83.155  1.00 42.87  ? 105  ARG A CD    1 
ATOM   822   N  NE    . ARG A  1 105 ? -90.613  -8.451  -84.194  1.00 39.45  ? 105  ARG A NE    1 
ATOM   823   C  CZ    . ARG A  1 105 ? -90.507  -8.778  -85.483  1.00 57.59  ? 105  ARG A CZ    1 
ATOM   824   N  NH1   . ARG A  1 105 ? -89.990  -7.910  -86.338  1.00 47.21  ? 105  ARG A NH1   1 
ATOM   825   N  NH2   . ARG A  1 105 ? -90.942  -9.955  -85.926  1.00 42.52  ? 105  ARG A NH2   1 
ATOM   826   N  N     . SER A  1 106 ? -95.564  -10.489 -80.687  1.00 57.29  ? 106  SER A N     1 
ATOM   827   C  CA    . SER A  1 106 ? -96.817  -10.947 -81.285  1.00 59.63  ? 106  SER A CA    1 
ATOM   828   C  C     . SER A  1 106 ? -97.926  -9.998  -80.846  1.00 48.11  ? 106  SER A C     1 
ATOM   829   O  O     . SER A  1 106 ? -98.696  -9.501  -81.672  1.00 49.31  ? 106  SER A O     1 
ATOM   830   C  CB    . SER A  1 106 ? -97.121  -12.395 -80.899  1.00 45.68  ? 106  SER A CB    1 
ATOM   831   O  OG    . SER A  1 106 ? -96.451  -13.292 -81.781  1.00 68.25  ? 106  SER A OG    1 
ATOM   832   N  N     . ILE A  1 107 ? -97.925  -9.677  -79.556  1.00 27.75  ? 107  ILE A N     1 
ATOM   833   C  CA    . ILE A  1 107 ? -98.892  -8.755  -78.980  1.00 27.50  ? 107  ILE A CA    1 
ATOM   834   C  C     . ILE A  1 107 ? -98.878  -7.396  -79.676  1.00 32.84  ? 107  ILE A C     1 
ATOM   835   O  O     . ILE A  1 107 ? -99.920  -6.785  -79.887  1.00 48.29  ? 107  ILE A O     1 
ATOM   836   C  CB    . ILE A  1 107 ? -98.597  -8.525  -77.505  1.00 33.62  ? 107  ILE A CB    1 
ATOM   837   C  CG1   . ILE A  1 107 ? -98.618  -9.868  -76.766  1.00 45.40  ? 107  ILE A CG1   1 
ATOM   838   C  CG2   . ILE A  1 107 ? -99.558  -7.454  -76.921  1.00 24.08  ? 107  ILE A CG2   1 
ATOM   839   C  CD1   . ILE A  1 107 ? -98.432  -9.752  -75.270  1.00 48.11  ? 107  ILE A CD1   1 
ATOM   840   N  N     . ALA A  1 108 ? -97.692  -6.919  -80.016  1.00 36.59  ? 108  ALA A N     1 
ATOM   841   C  CA    . ALA A  1 108 ? -97.575  -5.632  -80.677  1.00 48.96  ? 108  ALA A CA    1 
ATOM   842   C  C     . ALA A  1 108 ? -98.177  -5.718  -82.055  1.00 52.07  ? 108  ALA A C     1 
ATOM   843   O  O     . ALA A  1 108 ? -98.850  -4.789  -82.494  1.00 61.62  ? 108  ALA A O     1 
ATOM   844   C  CB    . ALA A  1 108 ? -96.133  -5.209  -80.768  1.00 55.98  ? 108  ALA A CB    1 
ATOM   845   N  N     . LYS A  1 109 ? -97.937  -6.839  -82.732  1.00 46.48  ? 109  LYS A N     1 
ATOM   846   C  CA    . LYS A  1 109 ? -98.462  -7.050  -84.078  1.00 52.90  ? 109  LYS A CA    1 
ATOM   847   C  C     . LYS A  1 109 ? -99.977  -7.164  -84.019  1.00 56.09  ? 109  LYS A C     1 
ATOM   848   O  O     . LYS A  1 109 ? -100.669 -6.561  -84.837  1.00 51.34  ? 109  LYS A O     1 
ATOM   849   C  CB    . LYS A  1 109 ? -97.856  -8.298  -84.708  1.00 48.58  ? 109  LYS A CB    1 
ATOM   850   C  CG    . LYS A  1 109 ? -96.417  -8.128  -85.177  0.90 45.49  ? 109  LYS A CG    1 
ATOM   851   C  CD    . LYS A  1 109 ? -95.784  -9.483  -85.528  0.90 43.59  ? 109  LYS A CD    1 
ATOM   852   C  CE    . LYS A  1 109 ? -94.777  -9.362  -86.675  0.90 24.65  ? 109  LYS A CE    1 
ATOM   853   N  NZ    . LYS A  1 109 ? -94.196  -10.679 -87.031  0.90 41.90  ? 109  LYS A NZ    1 
ATOM   854   N  N     . ARG A  1 110 ? -100.476 -7.905  -83.026  1.00 47.86  ? 110  ARG A N     1 
ATOM   855   C  CA    . ARG A  1 110 ? -101.910 -8.082  -82.824  1.00 53.90  ? 110  ARG A CA    1 
ATOM   856   C  C     . ARG A  1 110 ? -102.567 -6.708  -82.745  1.00 52.94  ? 110  ARG A C     1 
ATOM   857   O  O     . ARG A  1 110 ? -103.567 -6.444  -83.410  1.00 75.92  ? 110  ARG A O     1 
ATOM   858   C  CB    . ARG A  1 110 ? -102.194 -8.826  -81.516  1.00 50.89  ? 110  ARG A CB    1 
ATOM   859   C  CG    . ARG A  1 110 ? -101.892 -10.307 -81.522  1.00 43.92  ? 110  ARG A CG    1 
ATOM   860   C  CD    . ARG A  1 110 ? -102.339 -10.934 -80.188  1.00 48.34  ? 110  ARG A CD    1 
ATOM   861   N  NE    . ARG A  1 110 ? -101.987 -12.355 -80.092  1.00 49.73  ? 110  ARG A NE    1 
ATOM   862   C  CZ    . ARG A  1 110 ? -101.994 -13.063 -78.963  1.00 58.19  ? 110  ARG A CZ    1 
ATOM   863   N  NH1   . ARG A  1 110 ? -101.657 -14.350 -78.988  1.00 53.36  ? 110  ARG A NH1   1 
ATOM   864   N  NH2   . ARG A  1 110 ? -102.323 -12.489 -77.808  1.00 76.21  ? 110  ARG A NH2   1 
ATOM   865   N  N     . ALA A  1 111 ? -102.005 -5.845  -81.909  1.00 40.32  ? 111  ALA A N     1 
ATOM   866   C  CA    . ALA A  1 111 ? -102.514 -4.494  -81.744  1.00 51.50  ? 111  ALA A CA    1 
ATOM   867   C  C     . ALA A  1 111 ? -102.500 -3.702  -83.064  1.00 45.98  ? 111  ALA A C     1 
ATOM   868   O  O     . ALA A  1 111 ? -103.394 -2.909  -83.310  1.00 61.42  ? 111  ALA A O     1 
ATOM   869   C  CB    . ALA A  1 111 ? -101.712 -3.769  -80.682  1.00 38.05  ? 111  ALA A CB    1 
ATOM   870   N  N     . GLU A  1 112 ? -101.484 -3.900  -83.899  1.00 45.88  ? 112  GLU A N     1 
ATOM   871   C  CA    . GLU A  1 112 ? -101.413 -3.193  -85.180  1.00 54.47  ? 112  GLU A CA    1 
ATOM   872   C  C     . GLU A  1 112 ? -102.498 -3.709  -86.134  1.00 68.63  ? 112  GLU A C     1 
ATOM   873   O  O     . GLU A  1 112 ? -103.035 -2.949  -86.940  1.00 63.19  ? 112  GLU A O     1 
ATOM   874   C  CB    . GLU A  1 112 ? -100.021 -3.335  -85.836  1.00 61.22  ? 112  GLU A CB    1 
ATOM   875   C  CG    . GLU A  1 112 ? -98.913  -2.471  -85.209  1.00 68.58  ? 112  GLU A CG    1 
ATOM   876   C  CD    . GLU A  1 112 ? -98.001  -1.777  -86.242  1.00 86.87  ? 112  GLU A CD    1 
ATOM   877   O  OE1   . GLU A  1 112 ? -98.380  -0.687  -86.761  1.00 79.80  ? 112  GLU A OE1   1 
ATOM   878   O  OE2   . GLU A  1 112 ? -96.892  -2.308  -86.508  1.00 55.55  ? 112  GLU A OE2   1 
ATOM   879   N  N     . ASP A  1 113 ? -102.803 -5.005  -86.041  1.00 66.24  ? 113  ASP A N     1 
ATOM   880   C  CA    . ASP A  1 113 ? -103.831 -5.636  -86.870  1.00 58.62  ? 113  ASP A CA    1 
ATOM   881   C  C     . ASP A  1 113 ? -105.192 -5.038  -86.506  1.00 64.19  ? 113  ASP A C     1 
ATOM   882   O  O     . ASP A  1 113 ? -105.928 -4.548  -87.371  1.00 75.36  ? 113  ASP A O     1 
ATOM   883   C  CB    . ASP A  1 113 ? -103.851 -7.151  -86.632  1.00 54.93  ? 113  ASP A CB    1 
ATOM   884   C  CG    . ASP A  1 113 ? -102.625 -7.859  -87.206  1.00 83.77  ? 113  ASP A CG    1 
ATOM   885   O  OD1   . ASP A  1 113 ? -102.070 -7.372  -88.224  1.00 74.45  ? 113  ASP A OD1   1 
ATOM   886   O  OD2   . ASP A  1 113 ? -102.226 -8.913  -86.646  1.00 85.61  ? 113  ASP A OD2   1 
ATOM   887   N  N     . TYR A  1 114 ? -105.486 -5.063  -85.209  1.00 45.94  ? 114  TYR A N     1 
ATOM   888   C  CA    . TYR A  1 114 ? -106.713 -4.525  -84.640  1.00 45.28  ? 114  TYR A CA    1 
ATOM   889   C  C     . TYR A  1 114 ? -106.928 -3.056  -85.020  1.00 52.86  ? 114  TYR A C     1 
ATOM   890   O  O     . TYR A  1 114 ? -108.052 -2.573  -85.024  1.00 75.84  ? 114  TYR A O     1 
ATOM   891   C  CB    . TYR A  1 114 ? -106.645 -4.665  -83.125  1.00 33.88  ? 114  TYR A CB    1 
ATOM   892   C  CG    . TYR A  1 114 ? -107.796 -4.065  -82.351  0.73 40.19  ? 114  TYR A CG    1 
ATOM   893   C  CD1   . TYR A  1 114 ? -107.845 -2.700  -82.077  0.73 38.47  ? 114  TYR A CD1   1 
ATOM   894   C  CD2   . TYR A  1 114 ? -108.806 -4.874  -81.831  0.73 42.77  ? 114  TYR A CD2   1 
ATOM   895   C  CE1   . TYR A  1 114 ? -108.872 -2.159  -81.298  0.73 47.26  ? 114  TYR A CE1   1 
ATOM   896   C  CE2   . TYR A  1 114 ? -109.834 -4.342  -81.049  0.73 31.00  ? 114  TYR A CE2   1 
ATOM   897   C  CZ    . TYR A  1 114 ? -109.859 -2.988  -80.788  0.73 51.99  ? 114  TYR A CZ    1 
ATOM   898   O  OH    . TYR A  1 114 ? -110.863 -2.459  -80.011  0.73 66.59  ? 114  TYR A OH    1 
ATOM   899   N  N     . LEU A  1 115 ? -105.859 -2.340  -85.328  1.00 48.34  ? 115  LEU A N     1 
ATOM   900   C  CA    . LEU A  1 115 ? -105.997 -0.944  -85.702  1.00 50.56  ? 115  LEU A CA    1 
ATOM   901   C  C     . LEU A  1 115 ? -106.647 -0.895  -87.081  1.00 58.74  ? 115  LEU A C     1 
ATOM   902   O  O     . LEU A  1 115 ? -107.633 -0.181  -87.279  1.00 62.65  ? 115  LEU A O     1 
ATOM   903   C  CB    . LEU A  1 115 ? -104.625 -0.263  -85.727  1.00 48.83  ? 115  LEU A CB    1 
ATOM   904   C  CG    . LEU A  1 115 ? -104.484 1.267   -85.634  1.00 50.41  ? 115  LEU A CG    1 
ATOM   905   C  CD1   . LEU A  1 115 ? -103.908 1.822   -86.925  1.00 53.07  ? 115  LEU A CD1   1 
ATOM   906   C  CD2   . LEU A  1 115 ? -105.789 1.953   -85.263  1.00 41.61  ? 115  LEU A CD2   1 
ATOM   907   N  N     . ARG A  1 116 ? -106.104 -1.669  -88.021  1.00 57.12  ? 116  ARG A N     1 
ATOM   908   C  CA    . ARG A  1 116 ? -106.643 -1.715  -89.378  1.00 79.87  ? 116  ARG A CA    1 
ATOM   909   C  C     . ARG A  1 116 ? -108.023 -2.358  -89.386  1.00 82.70  ? 116  ARG A C     1 
ATOM   910   O  O     . ARG A  1 116 ? -108.888 -1.987  -90.183  1.00 92.27  ? 116  ARG A O     1 
ATOM   911   C  CB    . ARG A  1 116 ? -105.705 -2.473  -90.316  1.00 68.10  ? 116  ARG A CB    1 
ATOM   912   C  CG    . ARG A  1 116 ? -104.642 -1.595  -90.968  0.62 59.83  ? 116  ARG A CG    1 
ATOM   913   C  CD    . ARG A  1 116 ? -103.777 -2.400  -91.928  0.62 58.07  ? 116  ARG A CD    1 
ATOM   914   N  NE    . ARG A  1 116 ? -103.236 -3.576  -91.252  0.62 63.29  ? 116  ARG A NE    1 
ATOM   915   C  CZ    . ARG A  1 116 ? -102.074 -3.608  -90.607  0.62 67.16  ? 116  ARG A CZ    1 
ATOM   916   N  NH1   . ARG A  1 116 ? -101.682 -4.727  -90.006  0.62 69.71  ? 116  ARG A NH1   1 
ATOM   917   N  NH2   . ARG A  1 116 ? -101.284 -2.539  -90.601  0.62 67.47  ? 116  ARG A NH2   1 
ATOM   918   N  N     . ALA A  1 117 ? -108.224 -3.301  -88.472  1.00 71.67  ? 117  ALA A N     1 
ATOM   919   C  CA    . ALA A  1 117 ? -109.494 -3.993  -88.335  1.00 78.38  ? 117  ALA A CA    1 
ATOM   920   C  C     . ALA A  1 117 ? -110.630 -3.041  -87.932  1.00 76.34  ? 117  ALA A C     1 
ATOM   921   O  O     . ALA A  1 117 ? -111.707 -3.090  -88.517  1.00 100.00 ? 117  ALA A O     1 
ATOM   922   C  CB    . ALA A  1 117 ? -109.371 -5.135  -87.332  1.00 81.59  ? 117  ALA A CB    1 
ATOM   923   N  N     . THR A  1 118 ? -110.409 -2.184  -86.939  1.00 63.94  ? 118  THR A N     1 
ATOM   924   C  CA    . THR A  1 118 ? -111.454 -1.237  -86.531  1.00 74.67  ? 118  THR A CA    1 
ATOM   925   C  C     . THR A  1 118 ? -111.619 -0.164  -87.595  1.00 69.19  ? 118  THR A C     1 
ATOM   926   O  O     . THR A  1 118 ? -112.386 0.782   -87.412  1.00 69.88  ? 118  THR A O     1 
ATOM   927   C  CB    . THR A  1 118 ? -111.116 -0.485  -85.226  1.00 87.31  ? 118  THR A CB    1 
ATOM   928   O  OG1   . THR A  1 118 ? -109.979 0.364   -85.443  1.00 65.46  ? 118  THR A OG1   1 
ATOM   929   C  CG2   . THR A  1 118 ? -110.854 -1.456  -84.089  1.00 83.58  ? 118  THR A CG2   1 
ATOM   930   N  N     . GLY A  1 119 ? -110.813 -0.263  -88.650  1.00 66.99  ? 119  GLY A N     1 
ATOM   931   C  CA    . GLY A  1 119 ? -110.862 0.697   -89.737  1.00 69.88  ? 119  GLY A CA    1 
ATOM   932   C  C     . GLY A  1 119 ? -110.579 2.135   -89.334  1.00 72.06  ? 119  GLY A C     1 
ATOM   933   O  O     . GLY A  1 119 ? -110.632 3.024   -90.189  1.00 68.57  ? 119  GLY A O     1 
ATOM   934   N  N     . ILE A  1 120 ? -110.281 2.365   -88.049  1.00 62.59  ? 120  ILE A N     1 
ATOM   935   C  CA    . ILE A  1 120 ? -109.983 3.705   -87.540  1.00 53.47  ? 120  ILE A CA    1 
ATOM   936   C  C     . ILE A  1 120 ? -108.805 4.347   -88.272  1.00 59.57  ? 120  ILE A C     1 
ATOM   937   O  O     . ILE A  1 120 ? -108.839 5.540   -88.575  1.00 62.26  ? 120  ILE A O     1 
ATOM   938   C  CB    . ILE A  1 120 ? -109.676 3.694   -86.045  1.00 40.73  ? 120  ILE A CB    1 
ATOM   939   C  CG1   . ILE A  1 120 ? -110.859 3.127   -85.270  1.00 47.61  ? 120  ILE A CG1   1 
ATOM   940   C  CG2   . ILE A  1 120 ? -109.427 5.109   -85.557  1.00 47.79  ? 120  ILE A CG2   1 
ATOM   941   C  CD1   . ILE A  1 120 ? -110.703 3.233   -83.763  1.00 59.72  ? 120  ILE A CD1   1 
ATOM   942   N  N     . ALA A  1 121 ? -107.770 3.550   -88.548  1.00 61.44  ? 121  ALA A N     1 
ATOM   943   C  CA    . ALA A  1 121 ? -106.576 4.002   -89.279  1.00 57.55  ? 121  ALA A CA    1 
ATOM   944   C  C     . ALA A  1 121 ? -105.863 2.783   -89.854  1.00 60.77  ? 121  ALA A C     1 
ATOM   945   O  O     . ALA A  1 121 ? -106.211 1.643   -89.501  1.00 58.62  ? 121  ALA A O     1 
ATOM   946   C  CB    . ALA A  1 121 ? -105.642 4.757   -88.361  1.00 66.06  ? 121  ALA A CB    1 
ATOM   947   N  N     . ASP A  1 122 ? -104.900 3.004   -90.755  1.00 48.43  ? 122  ASP A N     1 
ATOM   948   C  CA    . ASP A  1 122 ? -104.166 1.872   -91.322  1.00 63.57  ? 122  ASP A CA    1 
ATOM   949   C  C     . ASP A  1 122 ? -102.720 1.675   -90.858  1.00 63.62  ? 122  ASP A C     1 
ATOM   950   O  O     . ASP A  1 122 ? -102.106 0.654   -91.179  1.00 87.59  ? 122  ASP A O     1 
ATOM   951   C  CB    . ASP A  1 122 ? -104.288 1.793   -92.851  1.00 57.08  ? 122  ASP A CB    1 
ATOM   952   C  CG    . ASP A  1 122 ? -103.854 3.051   -93.548  1.00 73.16  ? 122  ASP A CG    1 
ATOM   953   O  OD1   . ASP A  1 122 ? -102.893 3.710   -93.092  1.00 83.23  ? 122  ASP A OD1   1 
ATOM   954   O  OD2   . ASP A  1 122 ? -104.480 3.366   -94.581  1.00 82.24  ? 122  ASP A OD2   1 
ATOM   955   N  N     . THR A  1 123 ? -102.182 2.647   -90.118  1.00 65.61  ? 123  THR A N     1 
ATOM   956   C  CA    . THR A  1 123 ? -100.823 2.569   -89.550  1.00 75.68  ? 123  THR A CA    1 
ATOM   957   C  C     . THR A  1 123 ? -100.658 3.504   -88.352  1.00 67.07  ? 123  THR A C     1 
ATOM   958   O  O     . THR A  1 123 ? -101.225 4.605   -88.335  1.00 46.04  ? 123  THR A O     1 
ATOM   959   C  CB    . THR A  1 123 ? -99.688  2.894   -90.570  1.00 69.91  ? 123  THR A CB    1 
ATOM   960   O  OG1   . THR A  1 123 ? -100.077 3.990   -91.396  1.00 36.49  ? 123  THR A OG1   1 
ATOM   961   C  CG2   . THR A  1 123 ? -99.328  1.673   -91.430  1.00 69.68  ? 123  THR A CG2   1 
ATOM   962   N  N     . VAL A  1 124 ? -99.932  3.025   -87.334  1.00 70.05  ? 124  VAL A N     1 
ATOM   963   C  CA    . VAL A  1 124 ? -99.650  3.812   -86.126  1.00 51.32  ? 124  VAL A CA    1 
ATOM   964   C  C     . VAL A  1 124 ? -98.211  4.276   -86.201  1.00 60.18  ? 124  VAL A C     1 
ATOM   965   O  O     . VAL A  1 124 ? -97.322  3.508   -86.586  1.00 63.79  ? 124  VAL A O     1 
ATOM   966   C  CB    . VAL A  1 124 ? -99.714  3.007   -84.827  1.00 46.79  ? 124  VAL A CB    1 
ATOM   967   C  CG1   . VAL A  1 124 ? -99.959  3.952   -83.665  1.00 46.46  ? 124  VAL A CG1   1 
ATOM   968   C  CG2   . VAL A  1 124 ? -100.740 1.905   -84.892  1.00 55.36  ? 124  VAL A CG2   1 
ATOM   969   N  N     . LEU A  1 125 ? -97.968  5.511   -85.785  1.00 48.03  ? 125  LEU A N     1 
ATOM   970   C  CA    . LEU A  1 125 ? -96.619  6.048   -85.818  1.00 48.63  ? 125  LEU A CA    1 
ATOM   971   C  C     . LEU A  1 125 ? -96.055  6.364   -84.449  1.00 55.75  ? 125  LEU A C     1 
ATOM   972   O  O     . LEU A  1 125 ? -96.685  7.062   -83.639  1.00 58.71  ? 125  LEU A O     1 
ATOM   973   C  CB    . LEU A  1 125 ? -96.570  7.271   -86.711  1.00 55.99  ? 125  LEU A CB    1 
ATOM   974   C  CG    . LEU A  1 125 ? -96.101  6.996   -88.136  1.00 57.94  ? 125  LEU A CG    1 
ATOM   975   C  CD1   . LEU A  1 125 ? -96.276  5.538   -88.515  1.00 50.95  ? 125  LEU A CD1   1 
ATOM   976   C  CD2   . LEU A  1 125 ? -96.841  7.919   -89.087  1.00 47.19  ? 125  LEU A CD2   1 
ATOM   977   N  N     . PHE A  1 126 ? -94.873  5.808   -84.193  1.00 57.25  ? 126  PHE A N     1 
ATOM   978   C  CA    . PHE A  1 126 ? -94.171  5.998   -82.931  1.00 50.51  ? 126  PHE A CA    1 
ATOM   979   C  C     . PHE A  1 126 ? -92.783  6.588   -83.125  1.00 57.67  ? 126  PHE A C     1 
ATOM   980   O  O     . PHE A  1 126 ? -92.006  6.161   -83.991  1.00 49.26  ? 126  PHE A O     1 
ATOM   981   C  CB    . PHE A  1 126 ? -94.058  4.684   -82.162  1.00 40.00  ? 126  PHE A CB    1 
ATOM   982   C  CG    . PHE A  1 126 ? -95.274  4.346   -81.336  1.00 46.36  ? 126  PHE A CG    1 
ATOM   983   C  CD1   . PHE A  1 126 ? -96.409  3.791   -81.925  1.00 37.52  ? 126  PHE A CD1   1 
ATOM   984   C  CD2   . PHE A  1 126 ? -95.268  4.555   -79.957  1.00 44.59  ? 126  PHE A CD2   1 
ATOM   985   C  CE1   . PHE A  1 126 ? -97.512  3.450   -81.150  1.00 40.30  ? 126  PHE A CE1   1 
ATOM   986   C  CE2   . PHE A  1 126 ? -96.380  4.216   -79.164  1.00 45.86  ? 126  PHE A CE2   1 
ATOM   987   C  CZ    . PHE A  1 126 ? -97.497  3.664   -79.761  1.00 43.42  ? 126  PHE A CZ    1 
ATOM   988   N  N     . GLY A  1 127 ? -92.501  7.597   -82.312  1.00 53.04  ? 127  GLY A N     1 
ATOM   989   C  CA    . GLY A  1 127 ? -91.220  8.271   -82.342  1.00 46.78  ? 127  GLY A CA    1 
ATOM   990   C  C     . GLY A  1 127 ? -90.825  8.484   -80.894  1.00 57.60  ? 127  GLY A C     1 
ATOM   991   O  O     . GLY A  1 127 ? -91.276  9.439   -80.251  1.00 62.77  ? 127  GLY A O     1 
ATOM   992   N  N     . PRO A  1 128 ? -90.036  7.561   -80.326  1.00 52.56  ? 128  PRO A N     1 
ATOM   993   C  CA    . PRO A  1 128 ? -89.580  7.642   -78.937  1.00 39.31  ? 128  PRO A CA    1 
ATOM   994   C  C     . PRO A  1 128 ? -88.206  8.306   -78.810  1.00 48.83  ? 128  PRO A C     1 
ATOM   995   O  O     . PRO A  1 128 ? -87.345  8.209   -79.714  1.00 56.97  ? 128  PRO A O     1 
ATOM   996   C  CB    . PRO A  1 128 ? -89.535  6.177   -78.504  1.00 30.63  ? 128  PRO A CB    1 
ATOM   997   C  CG    . PRO A  1 128 ? -90.004  5.379   -79.735  1.00 39.27  ? 128  PRO A CG    1 
ATOM   998   C  CD    . PRO A  1 128 ? -89.699  6.256   -80.895  1.00 28.89  ? 128  PRO A CD    1 
ATOM   999   N  N     . GLU A  1 129 ? -88.039  9.018   -77.695  1.00 55.45  ? 129  GLU A N     1 
ATOM   1000  C  CA    . GLU A  1 129 ? -86.810  9.751   -77.365  1.00 62.47  ? 129  GLU A CA    1 
ATOM   1001  C  C     . GLU A  1 129 ? -86.268  9.076   -76.132  1.00 50.00  ? 129  GLU A C     1 
ATOM   1002  O  O     . GLU A  1 129 ? -86.484  9.517   -75.001  1.00 65.91  ? 129  GLU A O     1 
ATOM   1003  C  CB    . GLU A  1 129 ? -87.137  11.214  -77.070  1.00 77.21  ? 129  GLU A CB    1 
ATOM   1004  C  CG    . GLU A  1 129 ? -87.738  11.886  -78.266  1.00 43.07  ? 129  GLU A CG    1 
ATOM   1005  C  CD    . GLU A  1 129 ? -88.483  13.150  -77.966  1.00 63.50  ? 129  GLU A CD    1 
ATOM   1006  O  OE1   . GLU A  1 129 ? -88.687  13.881  -78.938  1.00 55.89  ? 129  GLU A OE1   1 
ATOM   1007  O  OE2   . GLU A  1 129 ? -88.892  13.416  -76.815  1.00 45.54  ? 129  GLU A OE2   1 
ATOM   1008  N  N     . PRO A  1 130 ? -85.525  7.999   -76.345  1.00 42.17  ? 130  PRO A N     1 
ATOM   1009  C  CA    . PRO A  1 130 ? -84.939  7.219   -75.265  1.00 45.45  ? 130  PRO A CA    1 
ATOM   1010  C  C     . PRO A  1 130 ? -83.603  7.763   -74.792  1.00 41.33  ? 130  PRO A C     1 
ATOM   1011  O  O     . PRO A  1 130 ? -82.594  7.671   -75.493  1.00 53.87  ? 130  PRO A O     1 
ATOM   1012  C  CB    . PRO A  1 130 ? -84.811  5.820   -75.889  1.00 28.73  ? 130  PRO A CB    1 
ATOM   1013  C  CG    . PRO A  1 130 ? -85.034  6.033   -77.367  1.00 31.35  ? 130  PRO A CG    1 
ATOM   1014  C  CD    . PRO A  1 130 ? -85.034  7.528   -77.646  1.00 56.46  ? 130  PRO A CD    1 
ATOM   1015  N  N     . GLU A  1 131 ? -83.614  8.312   -73.582  1.00 47.40  ? 131  GLU A N     1 
ATOM   1016  C  CA    . GLU A  1 131 ? -82.425  8.888   -72.943  1.00 41.49  ? 131  GLU A CA    1 
ATOM   1017  C  C     . GLU A  1 131 ? -81.612  7.830   -72.151  1.00 35.08  ? 131  GLU A C     1 
ATOM   1018  O  O     . GLU A  1 131 ? -82.096  6.732   -71.878  1.00 49.81  ? 131  GLU A O     1 
ATOM   1019  C  CB    . GLU A  1 131 ? -82.850  10.069  -72.031  1.00 37.38  ? 131  GLU A CB    1 
ATOM   1020  C  CG    . GLU A  1 131 ? -83.218  11.382  -72.788  1.00 20.47  ? 131  GLU A CG    1 
ATOM   1021  C  CD    . GLU A  1 131 ? -84.036  12.421  -71.970  1.00 58.88  ? 131  GLU A CD    1 
ATOM   1022  O  OE1   . GLU A  1 131 ? -84.225  13.599  -72.457  1.00 19.77  ? 131  GLU A OE1   1 
ATOM   1023  O  OE2   . GLU A  1 131 ? -84.506  12.033  -70.861  1.00 25.22  ? 131  GLU A OE2   1 
ATOM   1024  N  N     . PHE A  1 132 ? -80.352  8.132   -71.858  1.00 46.25  ? 132  PHE A N     1 
ATOM   1025  C  CA    . PHE A  1 132 ? -79.500  7.215   -71.096  1.00 41.19  ? 132  PHE A CA    1 
ATOM   1026  C  C     . PHE A  1 132 ? -78.283  7.900   -70.509  1.00 41.64  ? 132  PHE A C     1 
ATOM   1027  O  O     . PHE A  1 132 ? -77.993  9.069   -70.795  1.00 45.58  ? 132  PHE A O     1 
ATOM   1028  C  CB    . PHE A  1 132 ? -79.015  6.082   -71.972  1.00 18.53  ? 132  PHE A CB    1 
ATOM   1029  C  CG    . PHE A  1 132 ? -78.280  6.540   -73.193  1.00 33.76  ? 132  PHE A CG    1 
ATOM   1030  C  CD1   . PHE A  1 132 ? -78.961  6.733   -74.383  1.00 35.12  ? 132  PHE A CD1   1 
ATOM   1031  C  CD2   . PHE A  1 132 ? -76.901  6.736   -73.171  1.00 34.32  ? 132  PHE A CD2   1 
ATOM   1032  C  CE1   . PHE A  1 132 ? -78.281  7.109   -75.537  1.00 36.01  ? 132  PHE A CE1   1 
ATOM   1033  C  CE2   . PHE A  1 132 ? -76.216  7.113   -74.322  1.00 32.28  ? 132  PHE A CE2   1 
ATOM   1034  C  CZ    . PHE A  1 132 ? -76.909  7.297   -75.505  1.00 31.07  ? 132  PHE A CZ    1 
ATOM   1035  N  N     . PHE A  1 133 ? -77.558  7.140   -69.704  1.00 36.40  ? 133  PHE A N     1 
ATOM   1036  C  CA    . PHE A  1 133 ? -76.349  7.632   -69.068  1.00 37.03  ? 133  PHE A CA    1 
ATOM   1037  C  C     . PHE A  1 133 ? -75.141  6.791   -69.454  1.00 36.86  ? 133  PHE A C     1 
ATOM   1038  O  O     . PHE A  1 133 ? -75.263  5.596   -69.737  1.00 42.98  ? 133  PHE A O     1 
ATOM   1039  C  CB    . PHE A  1 133 ? -76.485  7.554   -67.558  1.00 22.76  ? 133  PHE A CB    1 
ATOM   1040  C  CG    . PHE A  1 133 ? -77.276  8.661   -66.954  1.00 26.98  ? 133  PHE A CG    1 
ATOM   1041  C  CD1   . PHE A  1 133 ? -78.628  8.508   -66.708  1.00 39.62  ? 133  PHE A CD1   1 
ATOM   1042  C  CD2   . PHE A  1 133 ? -76.649  9.828   -66.548  1.00 33.62  ? 133  PHE A CD2   1 
ATOM   1043  C  CE1   . PHE A  1 133 ? -79.337  9.500   -66.058  1.00 33.36  ? 133  PHE A CE1   1 
ATOM   1044  C  CE2   . PHE A  1 133 ? -77.344  10.812  -65.902  1.00 27.53  ? 133  PHE A CE2   1 
ATOM   1045  C  CZ    . PHE A  1 133 ? -78.695  10.649  -65.654  1.00 33.38  ? 133  PHE A CZ    1 
ATOM   1046  N  N     . LEU A  1 134 ? -73.969  7.412   -69.398  1.00 37.28  ? 134  LEU A N     1 
ATOM   1047  C  CA    . LEU A  1 134 ? -72.709  6.737   -69.689  1.00 30.93  ? 134  LEU A CA    1 
ATOM   1048  C  C     . LEU A  1 134 ? -71.740  6.938   -68.521  1.00 34.40  ? 134  LEU A C     1 
ATOM   1049  O  O     . LEU A  1 134 ? -71.271  8.051   -68.252  1.00 51.39  ? 134  LEU A O     1 
ATOM   1050  C  CB    . LEU A  1 134 ? -72.102  7.266   -70.977  1.00 16.92  ? 134  LEU A CB    1 
ATOM   1051  C  CG    . LEU A  1 134 ? -72.862  6.948   -72.260  1.00 23.89  ? 134  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A  1 134 ? -72.118  7.508   -73.467  1.00 22.90  ? 134  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A  1 134 ? -73.005  5.439   -72.387  1.00 39.99  ? 134  LEU A CD2   1 
ATOM   1054  N  N     . PHE A  1 135 ? -71.488  5.851   -67.813  1.00 27.63  ? 135  PHE A N     1 
ATOM   1055  C  CA    . PHE A  1 135 ? -70.595  5.870   -66.662  1.00 30.56  ? 135  PHE A CA    1 
ATOM   1056  C  C     . PHE A  1 135 ? -69.304  5.130   -66.969  1.00 28.43  ? 135  PHE A C     1 
ATOM   1057  O  O     . PHE A  1 135 ? -69.132  4.541   -68.048  1.00 35.66  ? 135  PHE A O     1 
ATOM   1058  C  CB    . PHE A  1 135 ? -71.282  5.255   -65.443  1.00 14.73  ? 135  PHE A CB    1 
ATOM   1059  C  CG    . PHE A  1 135 ? -72.641  5.821   -65.170  1.00 29.11  ? 135  PHE A CG    1 
ATOM   1060  C  CD1   . PHE A  1 135 ? -73.733  4.985   -65.011  1.00 28.01  ? 135  PHE A CD1   1 
ATOM   1061  C  CD2   . PHE A  1 135 ? -72.825  7.188   -65.075  1.00 46.19  ? 135  PHE A CD2   1 
ATOM   1062  C  CE1   . PHE A  1 135 ? -74.989  5.504   -64.760  1.00 42.18  ? 135  PHE A CE1   1 
ATOM   1063  C  CE2   . PHE A  1 135 ? -74.078  7.715   -64.825  1.00 21.69  ? 135  PHE A CE2   1 
ATOM   1064  C  CZ    . PHE A  1 135 ? -75.161  6.872   -64.666  1.00 38.46  ? 135  PHE A CZ    1 
ATOM   1065  N  N     . ASP A  1 136 ? -68.395  5.185   -66.012  1.00 29.78  ? 136  ASP A N     1 
ATOM   1066  C  CA    . ASP A  1 136 ? -67.087  4.569   -66.165  1.00 31.08  ? 136  ASP A CA    1 
ATOM   1067  C  C     . ASP A  1 136 ? -67.071  3.402   -65.211  1.00 26.16  ? 136  ASP A C     1 
ATOM   1068  O  O     . ASP A  1 136 ? -66.424  2.387   -65.455  1.00 33.16  ? 136  ASP A O     1 
ATOM   1069  C  CB    . ASP A  1 136 ? -65.963  5.535   -65.762  1.00 15.02  ? 136  ASP A CB    1 
ATOM   1070  C  CG    . ASP A  1 136 ? -65.645  6.550   -66.835  1.00 39.29  ? 136  ASP A CG    1 
ATOM   1071  O  OD1   . ASP A  1 136 ? -65.206  7.662   -66.475  1.00 39.63  ? 136  ASP A OD1   1 
ATOM   1072  O  OD2   . ASP A  1 136 ? -65.816  6.227   -68.031  1.00 38.56  ? 136  ASP A OD2   1 
ATOM   1073  N  N     . ASP A  1 137 ? -67.788  3.563   -64.107  1.00 28.39  ? 137  ASP A N     1 
ATOM   1074  C  CA    . ASP A  1 137 ? -67.822  2.537   -63.094  1.00 24.93  ? 137  ASP A CA    1 
ATOM   1075  C  C     . ASP A  1 137 ? -69.136  2.578   -62.335  1.00 28.38  ? 137  ASP A C     1 
ATOM   1076  O  O     . ASP A  1 137 ? -69.646  3.649   -61.976  1.00 36.51  ? 137  ASP A O     1 
ATOM   1077  C  CB    . ASP A  1 137 ? -66.592  2.726   -62.191  1.00 33.96  ? 137  ASP A CB    1 
ATOM   1078  C  CG    . ASP A  1 137 ? -66.649  1.956   -60.862  1.00 38.64  ? 137  ASP A CG    1 
ATOM   1079  O  OD1   . ASP A  1 137 ? -66.318  0.735   -60.793  1.00 44.18  ? 137  ASP A OD1   1 
ATOM   1080  O  OD2   . ASP A  1 137 ? -66.913  2.638   -59.847  1.00 24.76  ? 137  ASP A OD2   1 
ATOM   1081  N  N     . ILE A  1 138 ? -69.699  1.383   -62.171  1.00 20.08  ? 138  ILE A N     1 
ATOM   1082  C  CA    . ILE A  1 138 ? -70.946  1.165   -61.460  1.00 26.89  ? 138  ILE A CA    1 
ATOM   1083  C  C     . ILE A  1 138 ? -70.849  -0.060  -60.552  1.00 25.83  ? 138  ILE A C     1 
ATOM   1084  O  O     . ILE A  1 138 ? -70.606  -1.182  -61.012  1.00 29.53  ? 138  ILE A O     1 
ATOM   1085  C  CB    . ILE A  1 138 ? -72.130  0.971   -62.440  1.00 32.51  ? 138  ILE A CB    1 
ATOM   1086  C  CG1   . ILE A  1 138 ? -73.415  0.723   -61.661  1.00 13.10  ? 138  ILE A CG1   1 
ATOM   1087  C  CG2   . ILE A  1 138 ? -71.862  -0.162  -63.395  1.00 30.38  ? 138  ILE A CG2   1 
ATOM   1088  C  CD1   . ILE A  1 138 ? -73.795  1.877   -60.741  1.00 52.72  ? 138  ILE A CD1   1 
ATOM   1089  N  N     . ARG A  1 139 ? -71.051  0.156   -59.258  1.00 27.37  ? 139  ARG A N     1 
ATOM   1090  C  CA    . ARG A  1 139 ? -70.993  -0.939  -58.297  1.00 29.84  ? 139  ARG A CA    1 
ATOM   1091  C  C     . ARG A  1 139 ? -72.197  -0.845  -57.382  1.00 41.73  ? 139  ARG A C     1 
ATOM   1092  O  O     . ARG A  1 139 ? -72.679  0.250   -57.060  1.00 49.78  ? 139  ARG A O     1 
ATOM   1093  C  CB    . ARG A  1 139 ? -69.699  -0.888  -57.465  1.00 35.65  ? 139  ARG A CB    1 
ATOM   1094  C  CG    . ARG A  1 139 ? -68.404  -0.773  -58.287  1.00 40.74  ? 139  ARG A CG    1 
ATOM   1095  C  CD    . ARG A  1 139 ? -67.124  -0.871  -57.442  1.00 38.05  ? 139  ARG A CD    1 
ATOM   1096  N  NE    . ARG A  1 139 ? -67.136  -0.069  -56.213  1.00 47.97  ? 139  ARG A NE    1 
ATOM   1097  C  CZ    . ARG A  1 139 ? -66.949  1.249   -56.169  1.00 50.05  ? 139  ARG A CZ    1 
ATOM   1098  N  NH1   . ARG A  1 139 ? -66.964  1.893   -55.000  1.00 36.13  ? 139  ARG A NH1   1 
ATOM   1099  N  NH2   . ARG A  1 139 ? -66.779  1.933   -57.297  1.00 36.23  ? 139  ARG A NH2   1 
ATOM   1100  N  N     . PHE A  1 140 ? -72.672  -2.005  -56.958  1.00 25.57  ? 140  PHE A N     1 
ATOM   1101  C  CA    . PHE A  1 140 ? -73.826  -2.086  -56.076  1.00 29.28  ? 140  PHE A CA    1 
ATOM   1102  C  C     . PHE A  1 140 ? -73.982  -3.497  -55.532  1.00 36.24  ? 140  PHE A C     1 
ATOM   1103  O  O     . PHE A  1 140 ? -73.433  -4.465  -56.085  1.00 29.76  ? 140  PHE A O     1 
ATOM   1104  C  CB    . PHE A  1 140 ? -75.101  -1.726  -56.834  1.00 28.30  ? 140  PHE A CB    1 
ATOM   1105  C  CG    . PHE A  1 140 ? -75.356  -2.600  -58.040  1.00 33.35  ? 140  PHE A CG    1 
ATOM   1106  C  CD1   . PHE A  1 140 ? -75.869  -3.896  -57.894  1.00 48.42  ? 140  PHE A CD1   1 
ATOM   1107  C  CD2   . PHE A  1 140 ? -75.056  -2.135  -59.330  1.00 31.41  ? 140  PHE A CD2   1 
ATOM   1108  C  CE1   . PHE A  1 140 ? -76.077  -4.728  -59.015  1.00 31.42  ? 140  PHE A CE1   1 
ATOM   1109  C  CE2   . PHE A  1 140 ? -75.257  -2.952  -60.464  1.00 24.83  ? 140  PHE A CE2   1 
ATOM   1110  C  CZ    . PHE A  1 140 ? -75.770  -4.256  -60.302  1.00 28.90  ? 140  PHE A CZ    1 
ATOM   1111  N  N     . GLY A  1 141 ? -74.814  -3.617  -54.506  1.00 36.33  ? 141  GLY A N     1 
ATOM   1112  C  CA    . GLY A  1 141 ? -75.047  -4.913  -53.915  1.00 28.03  ? 141  GLY A CA    1 
ATOM   1113  C  C     . GLY A  1 141 ? -75.898  -4.846  -52.681  1.00 26.66  ? 141  GLY A C     1 
ATOM   1114  O  O     . GLY A  1 141 ? -76.050  -3.789  -52.060  1.00 41.54  ? 141  GLY A O     1 
ATOM   1115  N  N     . ALA A  1 142 ? -76.454  -5.995  -52.328  1.00 37.61  ? 142  ALA A N     1 
ATOM   1116  C  CA    . ALA A  1 142 ? -77.296  -6.117  -51.150  1.00 21.40  ? 142  ALA A CA    1 
ATOM   1117  C  C     . ALA A  1 142 ? -77.053  -7.477  -50.542  1.00 32.18  ? 142  ALA A C     1 
ATOM   1118  O  O     . ALA A  1 142 ? -77.050  -8.509  -51.226  1.00 36.66  ? 142  ALA A O     1 
ATOM   1119  C  CB    . ALA A  1 142 ? -78.742  -5.968  -51.513  1.00 34.98  ? 142  ALA A CB    1 
ATOM   1120  N  N     . SER A  1 143 ? -76.842  -7.443  -49.240  1.00 40.47  ? 143  SER A N     1 
ATOM   1121  C  CA    . SER A  1 143 ? -76.566  -8.601  -48.432  1.00 21.34  ? 143  SER A CA    1 
ATOM   1122  C  C     . SER A  1 143 ? -77.326  -8.329  -47.131  1.00 37.92  ? 143  SER A C     1 
ATOM   1123  O  O     . SER A  1 143 ? -77.927  -7.255  -46.950  1.00 34.33  ? 143  SER A O     1 
ATOM   1124  C  CB    . SER A  1 143 ? -75.041  -8.688  -48.198  1.00 26.51  ? 143  SER A CB    1 
ATOM   1125  O  OG    . SER A  1 143 ? -74.673  -8.705  -46.818  1.00 48.38  ? 143  SER A OG    1 
ATOM   1126  N  N     . ILE A  1 144 ? -77.296  -9.290  -46.221  1.00 19.34  ? 144  ILE A N     1 
ATOM   1127  C  CA    . ILE A  1 144 ? -77.996  -9.131  -44.967  1.00 27.71  ? 144  ILE A CA    1 
ATOM   1128  C  C     . ILE A  1 144 ? -77.475  -7.957  -44.132  1.00 26.00  ? 144  ILE A C     1 
ATOM   1129  O  O     . ILE A  1 144 ? -78.270  -7.194  -43.565  1.00 41.79  ? 144  ILE A O     1 
ATOM   1130  C  CB    . ILE A  1 144 ? -77.998  -10.456 -44.155  1.00 29.53  ? 144  ILE A CB    1 
ATOM   1131  C  CG1   . ILE A  1 144 ? -78.622  -10.237 -42.772  1.00 28.72  ? 144  ILE A CG1   1 
ATOM   1132  C  CG2   . ILE A  1 144 ? -76.596  -11.006 -44.047  1.00 16.90  ? 144  ILE A CG2   1 
ATOM   1133  C  CD1   . ILE A  1 144 ? -78.737  -11.492 -41.939  1.00 38.65  ? 144  ILE A CD1   1 
ATOM   1134  N  N     . SER A  1 145 ? -76.154  -7.780  -44.134  1.00 33.03  ? 145  SER A N     1 
ATOM   1135  C  CA    . SER A  1 145 ? -75.480  -6.734  -43.358  1.00 33.19  ? 145  SER A CA    1 
ATOM   1136  C  C     . SER A  1 145 ? -75.507  -5.329  -43.948  1.00 32.04  ? 145  SER A C     1 
ATOM   1137  O  O     . SER A  1 145 ? -75.046  -4.378  -43.310  1.00 43.61  ? 145  SER A O     1 
ATOM   1138  C  CB    . SER A  1 145 ? -74.042  -7.139  -43.072  1.00 25.77  ? 145  SER A CB    1 
ATOM   1139  O  OG    . SER A  1 145 ? -73.439  -7.564  -44.274  1.00 41.97  ? 145  SER A OG    1 
ATOM   1140  N  N     . GLY A  1 146 ? -76.003  -5.208  -45.176  1.00 20.81  ? 146  GLY A N     1 
ATOM   1141  C  CA    . GLY A  1 146 ? -76.119  -3.898  -45.797  1.00 25.98  ? 146  GLY A CA    1 
ATOM   1142  C  C     . GLY A  1 146 ? -76.415  -3.934  -47.283  1.00 25.80  ? 146  GLY A C     1 
ATOM   1143  O  O     . GLY A  1 146 ? -76.756  -4.976  -47.852  1.00 34.60  ? 146  GLY A O     1 
ATOM   1144  N  N     . SER A  1 147 ? -76.315  -2.772  -47.911  1.00 18.08  ? 147  SER A N     1 
ATOM   1145  C  CA    . SER A  1 147 ? -76.530  -2.664  -49.347  1.00 28.08  ? 147  SER A CA    1 
ATOM   1146  C  C     . SER A  1 147 ? -75.908  -1.362  -49.781  1.00 33.08  ? 147  SER A C     1 
ATOM   1147  O  O     . SER A  1 147 ? -75.613  -0.491  -48.933  1.00 29.78  ? 147  SER A O     1 
ATOM   1148  C  CB    . SER A  1 147 ? -78.022  -2.674  -49.698  1.00 42.67  ? 147  SER A CB    1 
ATOM   1149  O  OG    . SER A  1 147 ? -78.738  -1.610  -49.083  1.00 24.12  ? 147  SER A OG    1 
ATOM   1150  N  N     . HIS A  1 148 ? -75.705  -1.222  -51.091  1.00 23.69  ? 148  HIS A N     1 
ATOM   1151  C  CA    . HIS A  1 148 ? -75.104  0.003   -51.615  1.00 30.06  ? 148  HIS A CA    1 
ATOM   1152  C  C     . HIS A  1 148 ? -75.124  0.116   -53.119  1.00 26.08  ? 148  HIS A C     1 
ATOM   1153  O  O     . HIS A  1 148 ? -75.366  -0.848  -53.843  1.00 30.65  ? 148  HIS A O     1 
ATOM   1154  C  CB    . HIS A  1 148 ? -73.645  0.085   -51.198  1.00 32.24  ? 148  HIS A CB    1 
ATOM   1155  C  CG    . HIS A  1 148 ? -72.788  -0.932  -51.875  1.00 40.04  ? 148  HIS A CG    1 
ATOM   1156  N  ND1   . HIS A  1 148 ? -72.806  -2.269  -51.526  1.00 50.31  ? 148  HIS A ND1   1 
ATOM   1157  C  CD2   . HIS A  1 148 ? -71.954  -0.826  -52.938  1.00 15.28  ? 148  HIS A CD2   1 
ATOM   1158  C  CE1   . HIS A  1 148 ? -72.025  -2.940  -52.353  1.00 45.02  ? 148  HIS A CE1   1 
ATOM   1159  N  NE2   . HIS A  1 148 ? -71.497  -2.088  -53.218  1.00 33.56  ? 148  HIS A NE2   1 
ATOM   1160  N  N     . VAL A  1 149 ? -74.770  1.309   -53.568  1.00 31.12  ? 149  VAL A N     1 
ATOM   1161  C  CA    . VAL A  1 149 ? -74.666  1.623   -54.977  1.00 29.88  ? 149  VAL A CA    1 
ATOM   1162  C  C     . VAL A  1 149 ? -73.642  2.753   -55.097  1.00 47.20  ? 149  VAL A C     1 
ATOM   1163  O  O     . VAL A  1 149 ? -73.593  3.682   -54.250  1.00 29.33  ? 149  VAL A O     1 
ATOM   1164  C  CB    . VAL A  1 149 ? -75.988  2.097   -55.545  1.00 25.00  ? 149  VAL A CB    1 
ATOM   1165  C  CG1   . VAL A  1 149 ? -76.504  3.274   -54.737  1.00 42.58  ? 149  VAL A CG1   1 
ATOM   1166  C  CG2   . VAL A  1 149 ? -75.807  2.483   -56.997  1.00 11.15  ? 149  VAL A CG2   1 
ATOM   1167  N  N     . ALA A  1 150 ? -72.814  2.660   -56.133  1.00 34.00  ? 150  ALA A N     1 
ATOM   1168  C  CA    . ALA A  1 150 ? -71.795  3.662   -56.362  1.00 10.99  ? 150  ALA A CA    1 
ATOM   1169  C  C     . ALA A  1 150 ? -71.641  3.921   -57.840  1.00 26.21  ? 150  ALA A C     1 
ATOM   1170  O  O     . ALA A  1 150 ? -71.351  3.022   -58.643  1.00 33.38  ? 150  ALA A O     1 
ATOM   1171  C  CB    . ALA A  1 150 ? -70.498  3.218   -55.783  1.00 13.48  ? 150  ALA A CB    1 
ATOM   1172  N  N     . ILE A  1 151 ? -71.846  5.174   -58.196  1.00 21.08  ? 151  ILE A N     1 
ATOM   1173  C  CA    . ILE A  1 151 ? -71.737  5.569   -59.576  1.00 20.60  ? 151  ILE A CA    1 
ATOM   1174  C  C     . ILE A  1 151 ? -70.511  6.423   -59.744  1.00 27.22  ? 151  ILE A C     1 
ATOM   1175  O  O     . ILE A  1 151 ? -70.060  7.126   -58.817  1.00 37.43  ? 151  ILE A O     1 
ATOM   1176  C  CB    . ILE A  1 151 ? -72.943  6.416   -60.015  1.00 26.03  ? 151  ILE A CB    1 
ATOM   1177  C  CG1   . ILE A  1 151 ? -74.228  5.733   -59.597  1.00 15.91  ? 151  ILE A CG1   1 
ATOM   1178  C  CG2   . ILE A  1 151 ? -72.961  6.587   -61.529  1.00 32.40  ? 151  ILE A CG2   1 
ATOM   1179  C  CD1   . ILE A  1 151 ? -75.444  6.490   -59.972  1.00 36.49  ? 151  ILE A CD1   1 
ATOM   1180  N  N     . ASP A  1 152 ? -69.930  6.295   -60.921  1.00 18.85  ? 152  ASP A N     1 
ATOM   1181  C  CA    . ASP A  1 152 ? -68.805  7.104   -61.241  1.00 21.75  ? 152  ASP A CA    1 
ATOM   1182  C  C     . ASP A  1 152 ? -68.562  7.254   -62.714  1.00 27.02  ? 152  ASP A C     1 
ATOM   1183  O  O     . ASP A  1 152 ? -68.689  6.304   -63.504  1.00 33.84  ? 152  ASP A O     1 
ATOM   1184  C  CB    . ASP A  1 152 ? -67.543  6.640   -60.540  1.00 19.75  ? 152  ASP A CB    1 
ATOM   1185  C  CG    . ASP A  1 152 ? -66.615  7.802   -60.203  1.00 48.03  ? 152  ASP A CG    1 
ATOM   1186  O  OD1   . ASP A  1 152 ? -66.834  8.931   -60.717  1.00 41.56  ? 152  ASP A OD1   1 
ATOM   1187  O  OD2   . ASP A  1 152 ? -65.679  7.594   -59.406  1.00 45.07  ? 152  ASP A OD2   1 
ATOM   1188  N  N     . ASP A  1 153 ? -68.348  8.510   -63.075  1.00 16.49  ? 153  ASP A N     1 
ATOM   1189  C  CA    . ASP A  1 153 ? -68.012  8.866   -64.427  1.00 37.22  ? 153  ASP A CA    1 
ATOM   1190  C  C     . ASP A  1 153 ? -67.042  10.006  -64.358  1.00 32.46  ? 153  ASP A C     1 
ATOM   1191  O  O     . ASP A  1 153 ? -66.967  10.735  -63.369  1.00 40.24  ? 153  ASP A O     1 
ATOM   1192  C  CB    . ASP A  1 153 ? -69.195  9.323   -65.270  1.00 24.06  ? 153  ASP A CB    1 
ATOM   1193  C  CG    . ASP A  1 153 ? -68.861  9.295   -66.749  1.00 39.19  ? 153  ASP A CG    1 
ATOM   1194  O  OD1   . ASP A  1 153 ? -68.298  8.263   -67.150  1.00 37.81  ? 153  ASP A OD1   1 
ATOM   1195  O  OD2   . ASP A  1 153 ? -69.105  10.269  -67.504  1.00 44.10  ? 153  ASP A OD2   1 
ATOM   1196  N  N     . ILE A  1 154 ? -66.299  10.133  -65.439  1.00 35.73  ? 154  ILE A N     1 
ATOM   1197  C  CA    . ILE A  1 154 ? -65.325  11.176  -65.626  1.00 31.45  ? 154  ILE A CA    1 
ATOM   1198  C  C     . ILE A  1 154 ? -66.080  12.526  -65.617  1.00 43.96  ? 154  ILE A C     1 
ATOM   1199  O  O     . ILE A  1 154 ? -65.542  13.556  -65.182  1.00 33.27  ? 154  ILE A O     1 
ATOM   1200  C  CB    . ILE A  1 154 ? -64.644  10.950  -67.000  1.00 27.25  ? 154  ILE A CB    1 
ATOM   1201  C  CG1   . ILE A  1 154 ? -63.560  11.976  -67.257  1.00 36.19  ? 154  ILE A CG1   1 
ATOM   1202  C  CG2   . ILE A  1 154 ? -65.668  10.933  -68.129  1.00 54.62  ? 154  ILE A CG2   1 
ATOM   1203  C  CD1   . ILE A  1 154 ? -62.286  11.545  -66.675  1.00 26.84  ? 154  ILE A CD1   1 
ATOM   1204  N  N     . GLU A  1 155 ? -67.343  12.501  -66.050  1.00 31.57  ? 155  GLU A N     1 
ATOM   1205  C  CA    . GLU A  1 155 ? -68.131  13.725  -66.107  1.00 35.89  ? 155  GLU A CA    1 
ATOM   1206  C  C     . GLU A  1 155 ? -68.771  14.103  -64.785  1.00 31.38  ? 155  GLU A C     1 
ATOM   1207  O  O     . GLU A  1 155 ? -69.165  15.241  -64.586  1.00 33.05  ? 155  GLU A O     1 
ATOM   1208  C  CB    . GLU A  1 155 ? -69.201  13.638  -67.199  1.00 17.72  ? 155  GLU A CB    1 
ATOM   1209  C  CG    . GLU A  1 155 ? -68.670  13.714  -68.641  1.00 28.38  ? 155  GLU A CG    1 
ATOM   1210  C  CD    . GLU A  1 155 ? -69.786  13.827  -69.673  1.00 28.08  ? 155  GLU A CD    1 
ATOM   1211  O  OE1   . GLU A  1 155 ? -70.935  14.041  -69.254  1.00 30.28  ? 155  GLU A OE1   1 
ATOM   1212  O  OE2   . GLU A  1 155 ? -69.529  13.710  -70.891  1.00 51.94  ? 155  GLU A OE2   1 
ATOM   1213  N  N     . GLY A  1 156 ? -68.839  13.153  -63.869  1.00 23.39  ? 156  GLY A N     1 
ATOM   1214  C  CA    . GLY A  1 156 ? -69.463  13.417  -62.587  1.00 29.12  ? 156  GLY A CA    1 
ATOM   1215  C  C     . GLY A  1 156 ? -68.977  14.656  -61.874  1.00 23.06  ? 156  GLY A C     1 
ATOM   1216  O  O     . GLY A  1 156 ? -67.807  14.784  -61.549  1.00 35.15  ? 156  GLY A O     1 
ATOM   1217  N  N     . ALA A  1 157 ? -69.897  15.565  -61.609  1.00 31.35  ? 157  ALA A N     1 
ATOM   1218  C  CA    . ALA A  1 157 ? -69.560  16.800  -60.933  1.00 33.37  ? 157  ALA A CA    1 
ATOM   1219  C  C     . ALA A  1 157 ? -68.787  16.585  -59.640  1.00 31.57  ? 157  ALA A C     1 
ATOM   1220  O  O     . ALA A  1 157 ? -67.940  17.404  -59.280  1.00 37.27  ? 157  ALA A O     1 
ATOM   1221  C  CB    . ALA A  1 157 ? -70.800  17.565  -60.660  1.00 16.23  ? 157  ALA A CB    1 
ATOM   1222  N  N     . TRP A  1 158 ? -69.048  15.472  -58.963  1.00 28.16  ? 158  TRP A N     1 
ATOM   1223  C  CA    . TRP A  1 158 ? -68.372  15.179  -57.701  1.00 29.89  ? 158  TRP A CA    1 
ATOM   1224  C  C     . TRP A  1 158 ? -66.851  15.032  -57.840  1.00 31.49  ? 158  TRP A C     1 
ATOM   1225  O  O     . TRP A  1 158 ? -66.102  15.265  -56.884  1.00 42.34  ? 158  TRP A O     1 
ATOM   1226  C  CB    . TRP A  1 158 ? -68.985  13.937  -57.058  1.00 40.91  ? 158  TRP A CB    1 
ATOM   1227  C  CG    . TRP A  1 158 ? -69.028  12.730  -57.951  1.00 45.31  ? 158  TRP A CG    1 
ATOM   1228  C  CD1   . TRP A  1 158 ? -68.060  11.778  -58.090  1.00 54.13  ? 158  TRP A CD1   1 
ATOM   1229  C  CD2   . TRP A  1 158 ? -70.108  12.326  -58.795  1.00 40.96  ? 158  TRP A CD2   1 
ATOM   1230  N  NE1   . TRP A  1 158 ? -68.469  10.802  -58.966  1.00 38.11  ? 158  TRP A NE1   1 
ATOM   1231  C  CE2   . TRP A  1 158 ? -69.725  11.112  -59.414  1.00 48.20  ? 158  TRP A CE2   1 
ATOM   1232  C  CE3   . TRP A  1 158 ? -71.362  12.869  -59.093  1.00 38.10  ? 158  TRP A CE3   1 
ATOM   1233  C  CZ2   . TRP A  1 158 ? -70.554  10.432  -60.313  1.00 42.62  ? 158  TRP A CZ2   1 
ATOM   1234  C  CZ3   . TRP A  1 158 ? -72.184  12.194  -59.990  1.00 28.91  ? 158  TRP A CZ3   1 
ATOM   1235  C  CH2   . TRP A  1 158 ? -71.775  10.988  -60.588  1.00 31.90  ? 158  TRP A CH2   1 
ATOM   1236  N  N     . ASN A  1 159 ? -66.407  14.703  -59.051  1.00 28.92  ? 159  ASN A N     1 
ATOM   1237  C  CA    . ASN A  1 159 ? -64.992  14.540  -59.365  1.00 30.99  ? 159  ASN A CA    1 
ATOM   1238  C  C     . ASN A  1 159 ? -64.176  15.829  -59.544  1.00 26.39  ? 159  ASN A C     1 
ATOM   1239  O  O     . ASN A  1 159 ? -62.979  15.793  -59.840  1.00 34.81  ? 159  ASN A O     1 
ATOM   1240  C  CB    . ASN A  1 159 ? -64.829  13.634  -60.589  1.00 34.27  ? 159  ASN A CB    1 
ATOM   1241  C  CG    . ASN A  1 159 ? -65.064  12.167  -60.253  1.00 47.67  ? 159  ASN A CG    1 
ATOM   1242  O  OD1   . ASN A  1 159 ? -64.750  11.731  -59.154  1.00 40.39  ? 159  ASN A OD1   1 
ATOM   1243  N  ND2   . ASN A  1 159 ? -65.628  11.408  -61.191  1.00 42.49  ? 159  ASN A ND2   1 
ATOM   1244  N  N     . SER A  1 160 ? -64.801  16.971  -59.323  1.00 29.15  ? 160  SER A N     1 
ATOM   1245  C  CA    . SER A  1 160 ? -64.097  18.244  -59.453  1.00 37.29  ? 160  SER A CA    1 
ATOM   1246  C  C     . SER A  1 160 ? -62.926  18.286  -58.469  1.00 25.34  ? 160  SER A C     1 
ATOM   1247  O  O     . SER A  1 160 ? -61.912  18.952  -58.708  1.00 44.80  ? 160  SER A O     1 
ATOM   1248  C  CB    . SER A  1 160 ? -65.059  19.368  -59.110  1.00 25.75  ? 160  SER A CB    1 
ATOM   1249  O  OG    . SER A  1 160 ? -65.600  19.147  -57.814  1.00 45.39  ? 160  SER A OG    1 
ATOM   1250  N  N     . SER A  1 161 ? -63.091  17.523  -57.389  1.00 21.38  ? 161  SER A N     1 
ATOM   1251  C  CA    . SER A  1 161 ? -62.144  17.420  -56.276  1.00 39.87  ? 161  SER A CA    1 
ATOM   1252  C  C     . SER A  1 161 ? -61.179  16.236  -56.326  1.00 35.14  ? 161  SER A C     1 
ATOM   1253  O  O     . SER A  1 161 ? -60.147  16.229  -55.673  1.00 42.29  ? 161  SER A O     1 
ATOM   1254  C  CB    . SER A  1 161 ? -62.947  17.285  -54.985  1.00 37.15  ? 161  SER A CB    1 
ATOM   1255  O  OG    . SER A  1 161 ? -63.757  16.126  -55.047  1.00 39.01  ? 161  SER A OG    1 
ATOM   1256  N  N     . THR A  1 162 ? -61.592  15.214  -57.043  1.00 22.87  ? 162  THR A N     1 
ATOM   1257  C  CA    . THR A  1 162 ? -60.886  13.961  -57.209  1.00 28.49  ? 162  THR A CA    1 
ATOM   1258  C  C     . THR A  1 162 ? -59.489  14.007  -57.811  1.00 32.17  ? 162  THR A C     1 
ATOM   1259  O  O     . THR A  1 162 ? -59.284  14.692  -58.817  1.00 32.63  ? 162  THR A O     1 
ATOM   1260  C  CB    . THR A  1 162 ? -61.785  13.062  -58.057  1.00 25.89  ? 162  THR A CB    1 
ATOM   1261  O  OG1   . THR A  1 162 ? -63.003  12.822  -57.329  1.00 43.48  ? 162  THR A OG1   1 
ATOM   1262  C  CG2   . THR A  1 162 ? -61.093  11.769  -58.449  1.00 14.18  ? 162  THR A CG2   1 
ATOM   1263  N  N     . LYS A  1 163 ? -58.545  13.252  -57.219  1.00 31.78  ? 163  LYS A N     1 
ATOM   1264  C  CA    . LYS A  1 163 ? -57.160  13.212  -57.734  1.00 36.99  ? 163  LYS A CA    1 
ATOM   1265  C  C     . LYS A  1 163 ? -57.038  12.169  -58.833  1.00 28.43  ? 163  LYS A C     1 
ATOM   1266  O  O     . LYS A  1 163 ? -57.564  11.071  -58.710  1.00 36.85  ? 163  LYS A O     1 
ATOM   1267  C  CB    . LYS A  1 163 ? -56.136  12.912  -56.645  1.00 23.43  ? 163  LYS A CB    1 
ATOM   1268  C  CG    . LYS A  1 163 ? -56.050  13.954  -55.566  1.00 41.78  ? 163  LYS A CG    1 
ATOM   1269  C  CD    . LYS A  1 163 ? -54.747  13.861  -54.816  1.00 41.69  ? 163  LYS A CD    1 
ATOM   1270  C  CE    . LYS A  1 163 ? -54.947  14.304  -53.372  1.00 65.77  ? 163  LYS A CE    1 
ATOM   1271  N  NZ    . LYS A  1 163 ? -53.665  14.297  -52.617  1.00 77.71  ? 163  LYS A NZ    1 
ATOM   1272  N  N     . TYR A  1 164 ? -56.356  12.509  -59.915  1.00 32.66  ? 164  TYR A N     1 
ATOM   1273  C  CA    . TYR A  1 164 ? -56.244  11.568  -61.019  1.00 18.21  ? 164  TYR A CA    1 
ATOM   1274  C  C     . TYR A  1 164 ? -54.808  11.226  -61.307  1.00 40.78  ? 164  TYR A C     1 
ATOM   1275  O  O     . TYR A  1 164 ? -53.902  12.014  -61.022  1.00 43.57  ? 164  TYR A O     1 
ATOM   1276  C  CB    . TYR A  1 164 ? -56.914  12.115  -62.292  1.00 21.43  ? 164  TYR A CB    1 
ATOM   1277  C  CG    . TYR A  1 164 ? -58.432  11.937  -62.347  1.00 28.55  ? 164  TYR A CG    1 
ATOM   1278  C  CD1   . TYR A  1 164 ? -59.003  10.902  -63.093  1.00 53.08  ? 164  TYR A CD1   1 
ATOM   1279  C  CD2   . TYR A  1 164 ? -59.301  12.802  -61.658  1.00 36.71  ? 164  TYR A CD2   1 
ATOM   1280  C  CE1   . TYR A  1 164 ? -60.395  10.721  -63.155  1.00 61.06  ? 164  TYR A CE1   1 
ATOM   1281  C  CE2   . TYR A  1 164 ? -60.709  12.625  -61.717  1.00 38.22  ? 164  TYR A CE2   1 
ATOM   1282  C  CZ    . TYR A  1 164 ? -61.239  11.580  -62.464  1.00 45.14  ? 164  TYR A CZ    1 
ATOM   1283  O  OH    . TYR A  1 164 ? -62.598  11.347  -62.503  1.00 54.67  ? 164  TYR A OH    1 
ATOM   1284  N  N     . GLU A  1 165 ? -54.629  10.048  -61.899  1.00 59.89  ? 165  GLU A N     1 
ATOM   1285  C  CA    . GLU A  1 165 ? -53.327  9.515   -62.245  1.00 48.88  ? 165  GLU A CA    1 
ATOM   1286  C  C     . GLU A  1 165 ? -52.469  10.553  -62.953  1.00 51.91  ? 165  GLU A C     1 
ATOM   1287  O  O     . GLU A  1 165 ? -51.393  10.925  -62.460  1.00 46.97  ? 165  GLU A O     1 
ATOM   1288  C  CB    . GLU A  1 165 ? -53.502  8.267   -63.114  1.00 90.12  ? 165  GLU A CB    1 
ATOM   1289  C  CG    . GLU A  1 165 ? -52.756  7.025   -62.607  0.64 68.26  ? 165  GLU A CG    1 
ATOM   1290  C  CD    . GLU A  1 165 ? -51.242  7.214   -62.572  0.64 74.03  ? 165  GLU A CD    1 
ATOM   1291  O  OE1   . GLU A  1 165 ? -50.711  7.662   -61.525  0.64 59.83  ? 165  GLU A OE1   1 
ATOM   1292  O  OE2   . GLU A  1 165 ? -50.583  6.915   -63.596  0.64 61.90  ? 165  GLU A OE2   1 
ATOM   1293  N  N     . GLY A  1 166 ? -52.953  11.048  -64.088  1.00 47.42  ? 166  GLY A N     1 
ATOM   1294  C  CA    . GLY A  1 166 ? -52.189  12.059  -64.803  1.00 43.29  ? 166  GLY A CA    1 
ATOM   1295  C  C     . GLY A  1 166 ? -52.693  13.483  -64.600  1.00 43.01  ? 166  GLY A C     1 
ATOM   1296  O  O     . GLY A  1 166 ? -52.527  14.330  -65.479  1.00 40.78  ? 166  GLY A O     1 
ATOM   1297  N  N     . GLY A  1 167 ? -53.283  13.756  -63.436  1.00 49.96  ? 167  GLY A N     1 
ATOM   1298  C  CA    . GLY A  1 167 ? -53.818  15.077  -63.160  1.00 38.47  ? 167  GLY A CA    1 
ATOM   1299  C  C     . GLY A  1 167 ? -55.291  15.197  -63.538  1.00 45.98  ? 167  GLY A C     1 
ATOM   1300  O  O     . GLY A  1 167 ? -55.755  14.563  -64.494  1.00 42.92  ? 167  GLY A O     1 
ATOM   1301  N  N     . ASN A  1 168 ? -56.024  15.997  -62.765  1.00 35.08  ? 168  ASN A N     1 
ATOM   1302  C  CA    . ASN A  1 168 ? -57.448  16.277  -62.981  1.00 39.88  ? 168  ASN A CA    1 
ATOM   1303  C  C     . ASN A  1 168 ? -57.593  17.415  -63.974  1.00 32.85  ? 168  ASN A C     1 
ATOM   1304  O  O     . ASN A  1 168 ? -57.158  18.538  -63.709  1.00 39.31  ? 168  ASN A O     1 
ATOM   1305  C  CB    . ASN A  1 168 ? -58.101  16.609  -61.630  1.00 32.27  ? 168  ASN A CB    1 
ATOM   1306  C  CG    . ASN A  1 168 ? -59.602  16.777  -61.729  1.00 47.27  ? 168  ASN A CG    1 
ATOM   1307  O  OD1   . ASN A  1 168 ? -60.130  17.139  -62.775  1.00 38.03  ? 168  ASN A OD1   1 
ATOM   1308  N  ND2   . ASN A  1 168 ? -60.302  16.514  -60.628  1.00 37.70  ? 168  ASN A ND2   1 
ATOM   1309  N  N     . LYS A  1 169 ? -58.216  17.154  -65.138  1.00 26.23  ? 169  LYS A N     1 
ATOM   1310  C  CA    . LYS A  1 169 ? -58.331  18.184  -66.211  1.00 21.54  ? 169  LYS A CA    1 
ATOM   1311  C  C     . LYS A  1 169 ? -59.601  19.097  -66.085  1.00 34.97  ? 169  LYS A C     1 
ATOM   1312  O  O     . LYS A  1 169 ? -59.838  19.972  -66.920  1.00 30.32  ? 169  LYS A O     1 
ATOM   1313  C  CB    . LYS A  1 169 ? -58.243  17.479  -67.567  1.00 16.97  ? 169  LYS A CB    1 
ATOM   1314  C  CG    . LYS A  1 169 ? -57.119  16.464  -67.689  1.00 26.17  ? 169  LYS A CG    1 
ATOM   1315  C  CD    . LYS A  1 169 ? -55.782  17.047  -67.258  1.00 24.60  ? 169  LYS A CD    1 
ATOM   1316  C  CE    . LYS A  1 169 ? -54.630  16.063  -67.470  1.00 37.56  ? 169  LYS A CE    1 
ATOM   1317  N  NZ    . LYS A  1 169 ? -53.302  16.722  -67.328  1.00 23.78  ? 169  LYS A NZ    1 
ATOM   1318  N  N     . GLY A  1 170 ? -60.342  18.846  -65.018  1.00 35.42  ? 170  GLY A N     1 
ATOM   1319  C  CA    . GLY A  1 170 ? -61.515  19.580  -64.477  1.00 39.25  ? 170  GLY A CA    1 
ATOM   1320  C  C     . GLY A  1 170 ? -62.635  20.113  -65.373  1.00 47.34  ? 170  GLY A C     1 
ATOM   1321  O  O     . GLY A  1 170 ? -63.448  20.889  -64.878  1.00 79.50  ? 170  GLY A O     1 
ATOM   1322  N  N     . HIS A  1 171 ? -62.849  19.764  -66.655  1.00 44.03  ? 171  HIS A N     1 
ATOM   1323  C  CA    . HIS A  1 171 ? -64.018  20.336  -67.388  1.00 31.61  ? 171  HIS A CA    1 
ATOM   1324  C  C     . HIS A  1 171 ? -65.259  19.414  -67.345  1.00 48.46  ? 171  HIS A C     1 
ATOM   1325  O  O     . HIS A  1 171 ? -65.478  18.586  -68.232  1.00 66.44  ? 171  HIS A O     1 
ATOM   1326  C  CB    . HIS A  1 171 ? -63.676  20.730  -68.813  1.00 56.40  ? 171  HIS A CB    1 
ATOM   1327  C  CG    . HIS A  1 171 ? -62.674  21.913  -68.849  1.00 39.20  ? 171  HIS A CG    1 
ATOM   1328  N  ND1   . HIS A  1 171 ? -62.913  23.145  -68.277  1.00 40.43  ? 171  HIS A ND1   1 
ATOM   1329  C  CD2   . HIS A  1 171 ? -61.431  21.983  -69.387  1.00 51.61  ? 171  HIS A CD2   1 
ATOM   1330  C  CE1   . HIS A  1 171 ? -61.864  23.928  -68.466  1.00 24.58  ? 171  HIS A CE1   1 
ATOM   1331  N  NE2   . HIS A  1 171 ? -60.952  23.247  -69.136  1.00 39.83  ? 171  HIS A NE2   1 
ATOM   1332  N  N     . ARG A  1 172 ? -66.020  19.569  -66.273  1.00 26.18  ? 172  ARG A N     1 
ATOM   1333  C  CA    . ARG A  1 172 ? -67.163  18.715  -66.029  1.00 38.72  ? 172  ARG A CA    1 
ATOM   1334  C  C     . ARG A  1 172 ? -68.461  19.480  -65.976  1.00 39.43  ? 172  ARG A C     1 
ATOM   1335  O  O     . ARG A  1 172 ? -68.501  20.640  -65.558  1.00 46.87  ? 172  ARG A O     1 
ATOM   1336  C  CB    . ARG A  1 172 ? -66.987  17.967  -64.687  1.00 33.64  ? 172  ARG A CB    1 
ATOM   1337  C  CG    . ARG A  1 172 ? -65.852  16.987  -64.670  1.00 17.54  ? 172  ARG A CG    1 
ATOM   1338  C  CD    . ARG A  1 172 ? -65.552  16.452  -63.288  1.00 45.86  ? 172  ARG A CD    1 
ATOM   1339  N  NE    . ARG A  1 172 ? -64.348  15.635  -63.376  1.00 22.16  ? 172  ARG A NE    1 
ATOM   1340  C  CZ    . ARG A  1 172 ? -63.119  16.135  -63.338  1.00 42.46  ? 172  ARG A CZ    1 
ATOM   1341  N  NH1   . ARG A  1 172 ? -62.072  15.325  -63.464  1.00 54.80  ? 172  ARG A NH1   1 
ATOM   1342  N  NH2   . ARG A  1 172 ? -62.936  17.434  -63.090  1.00 52.01  ? 172  ARG A NH2   1 
ATOM   1343  N  N     A PRO A  1 173 ? -69.552  18.811  -66.372  1.00 32.64  ? 173  PRO A N     1 
ATOM   1344  C  CA    A PRO A  1 173 ? -70.913  19.338  -66.394  1.00 37.41  ? 173  PRO A CA    1 
ATOM   1345  C  C     A PRO A  1 173 ? -71.364  19.414  -64.945  1.00 35.91  ? 173  PRO A C     1 
ATOM   1346  O  O     A PRO A  1 173 ? -71.147  18.462  -64.190  1.00 35.77  ? 173  PRO A O     1 
ATOM   1347  C  CB    A PRO A  1 173 ? -71.683  18.229  -67.105  1.00 22.35  ? 173  PRO A CB    1 
ATOM   1348  C  CG    A PRO A  1 173 ? -70.648  17.504  -67.893  1.00 45.11  ? 173  PRO A CG    1 
ATOM   1349  C  CD    A PRO A  1 173 ? -69.522  17.451  -66.938  1.00 39.77  ? 173  PRO A CD    1 
ATOM   1350  N  N     A GLY A  1 174 ? -71.938  20.542  -64.535  0.86 23.08  ? 174  GLY A N     1 
ATOM   1351  N  N     B GLY A  1 174 ? -72.145  20.285  -66.453  0.14 38.91  ? 174  GLY A N     1 
ATOM   1352  C  CA    A GLY A  1 174 ? -72.413  20.652  -63.157  0.86 21.34  ? 174  GLY A CA    1 
ATOM   1353  C  CA    B GLY A  1 174 ? -72.544  19.932  -65.100  0.14 38.96  ? 174  GLY A CA    1 
ATOM   1354  C  C     A GLY A  1 174 ? -73.757  19.949  -63.024  0.86 25.83  ? 174  GLY A C     1 
ATOM   1355  C  C     B GLY A  1 174 ? -74.067  19.771  -64.998  0.14 40.43  ? 174  GLY A C     1 
ATOM   1356  O  O     A GLY A  1 174 ? -74.232  19.346  -63.997  0.86 17.03  ? 174  GLY A O     1 
ATOM   1357  O  O     B GLY A  1 174 ? -74.733  19.611  -66.025  0.14 42.48  ? 174  GLY A O     1 
ATOM   1358  N  N     A VAL A  1 175 ? -74.357  19.946  -61.834  0.86 30.63  ? 175  VAL A N     1 
ATOM   1359  N  N     B VAL A  1 175 ? -74.608  19.802  -63.782  0.14 38.99  ? 175  VAL A N     1 
ATOM   1360  C  CA    A VAL A  1 175 ? -75.677  19.308  -61.689  0.86 25.26  ? 175  VAL A CA    1 
ATOM   1361  C  CA    B VAL A  1 175 ? -76.040  19.646  -63.584  0.14 40.56  ? 175  VAL A CA    1 
ATOM   1362  C  C     A VAL A  1 175 ? -76.658  20.011  -62.643  0.86 30.80  ? 175  VAL A C     1 
ATOM   1363  C  C     B VAL A  1 175 ? -76.829  20.416  -64.660  0.14 40.87  ? 175  VAL A C     1 
ATOM   1364  O  O     A VAL A  1 175 ? -76.766  21.241  -62.649  0.86 52.25  ? 175  VAL A O     1 
ATOM   1365  O  O     B VAL A  1 175 ? -76.711  21.646  -64.761  0.14 41.08  ? 175  VAL A O     1 
ATOM   1366  C  CB    A VAL A  1 175 ? -76.175  19.348  -60.243  0.86 14.39  ? 175  VAL A CB    1 
ATOM   1367  C  CB    B VAL A  1 175 ? -76.462  20.090  -62.167  0.14 38.76  ? 175  VAL A CB    1 
ATOM   1368  C  CG1   A VAL A  1 175 ? -77.581  18.843  -60.171  0.86 33.90  ? 175  VAL A CG1   1 
ATOM   1369  C  CG1   B VAL A  1 175 ? -77.671  21.008  -62.247  0.14 38.90  ? 175  VAL A CG1   1 
ATOM   1370  C  CG2   A VAL A  1 175 ? -75.275  18.484  -59.374  0.86 12.92  ? 175  VAL A CG2   1 
ATOM   1371  C  CG2   B VAL A  1 175 ? -76.773  18.885  -61.301  0.14 37.07  ? 175  VAL A CG2   1 
ATOM   1372  N  N     A LYS A  1 176 ? -77.270  19.232  -63.529  0.86 33.29  ? 176  LYS A N     1 
ATOM   1373  N  N     B LYS A  1 176 ? -77.630  19.692  -65.463  0.14 43.10  ? 176  LYS A N     1 
ATOM   1374  C  CA    A LYS A  1 176 ? -78.172  19.748  -64.564  0.86 34.72  ? 176  LYS A CA    1 
ATOM   1375  C  CA    B LYS A  1 176 ? -78.414  20.343  -66.497  0.14 35.57  ? 176  LYS A CA    1 
ATOM   1376  C  C     A LYS A  1 176 ? -77.338  20.610  -65.518  0.86 34.47  ? 176  LYS A C     1 
ATOM   1377  C  C     B LYS A  1 176 ? -77.535  20.735  -67.680  0.14 25.78  ? 176  LYS A C     1 
ATOM   1378  O  O     A LYS A  1 176 ? -77.872  21.309  -66.384  0.86 33.38  ? 176  LYS A O     1 
ATOM   1379  O  O     B LYS A  1 176 ? -77.890  21.528  -68.543  0.14 2.00   ? 176  LYS A O     1 
ATOM   1380  C  CB    A LYS A  1 176 ? -79.342  20.543  -63.977  0.86 17.55  ? 176  LYS A CB    1 
ATOM   1381  C  CB    B LYS A  1 176 ? -79.120  21.580  -65.950  0.14 29.05  ? 176  LYS A CB    1 
ATOM   1382  C  CG    A LYS A  1 176 ? -80.195  19.769  -62.976  0.91 33.92  ? 176  LYS A CG    1 
ATOM   1383  C  CD    A LYS A  1 176 ? -81.590  20.371  -62.853  0.91 33.63  ? 176  LYS A CD    1 
ATOM   1384  C  CE    A LYS A  1 176 ? -82.275  19.943  -61.561  0.91 64.32  ? 176  LYS A CE    1 
ATOM   1385  N  NZ    A LYS A  1 176 ? -83.683  20.427  -61.485  0.91 73.73  ? 176  LYS A NZ    1 
ATOM   1386  N  N     A GLY A  1 177 ? -76.050  20.543  -65.354  0.86 48.93  ? 177  GLY A N     1 
ATOM   1387  N  N     B GLY A  1 177 ? -76.350  20.103  -67.606  0.14 37.17  ? 177  GLY A N     1 
ATOM   1388  C  CA    A GLY A  1 177 ? -75.178  21.329  -66.189  0.86 41.15  ? 177  GLY A CA    1 
ATOM   1389  C  CA    B GLY A  1 177 ? -75.244  20.172  -68.542  0.14 37.73  ? 177  GLY A CA    1 
ATOM   1390  C  C     A GLY A  1 177 ? -75.043  20.855  -67.631  0.86 21.52  ? 177  GLY A C     1 
ATOM   1391  C  C     B GLY A  1 177 ? -75.338  21.395  -69.424  0.14 43.70  ? 177  GLY A C     1 
ATOM   1392  O  O     A GLY A  1 177 ? -74.735  21.682  -68.490  0.86 51.48  ? 177  GLY A O     1 
ATOM   1393  O  O     B GLY A  1 177 ? -74.627  21.514  -70.423  0.14 44.68  ? 177  GLY A O     1 
ATOM   1394  N  N     A GLY A  1 178 ? -75.253  19.517  -67.793  0.86 35.66  ? 178  GLY A N     1 
ATOM   1395  N  N     B GLY A  1 178 ? -76.243  22.323  -69.066  0.14 45.24  ? 178  GLY A N     1 
ATOM   1396  C  CA    A GLY A  1 178 ? -75.067  18.726  -69.020  0.86 51.73  ? 178  GLY A CA    1 
ATOM   1397  C  CA    B GLY A  1 178 ? -76.393  23.477  -69.933  0.14 41.06  ? 178  GLY A CA    1 
ATOM   1398  C  C     A GLY A  1 178 ? -75.966  19.014  -70.213  0.86 46.48  ? 178  GLY A C     1 
ATOM   1399  C  C     B GLY A  1 178 ? -75.939  22.952  -71.265  0.14 44.47  ? 178  GLY A C     1 
ATOM   1400  O  O     A GLY A  1 178 ? -76.558  18.120  -70.817  0.86 84.99  ? 178  GLY A O     1 
ATOM   1401  O  O     B GLY A  1 178 ? -74.757  23.030  -71.590  0.14 48.34  ? 178  GLY A O     1 
ATOM   1402  N  N     A TYR A  1 179 ? -76.059  20.252  -70.544  0.86 45.12  ? 179  TYR A N     1 
ATOM   1403  N  N     B TYR A  1 179 ? -76.853  22.438  -72.024  0.14 34.26  ? 179  TYR A N     1 
ATOM   1404  C  CA    A TYR A  1 179 ? -76.839  20.473  -71.725  0.86 50.04  ? 179  TYR A CA    1 
ATOM   1405  C  CA    B TYR A  1 179 ? -76.345  21.730  -73.160  0.14 38.51  ? 179  TYR A CA    1 
ATOM   1406  C  C     A TYR A  1 179 ? -76.120  21.423  -72.606  0.86 54.14  ? 179  TYR A C     1 
ATOM   1407  C  C     B TYR A  1 179 ? -76.035  22.460  -74.409  0.14 40.46  ? 179  TYR A C     1 
ATOM   1408  O  O     A TYR A  1 179 ? -75.961  22.612  -72.382  0.86 65.77  ? 179  TYR A O     1 
ATOM   1409  O  O     B TYR A  1 179 ? -76.513  23.569  -74.695  0.14 42.09  ? 179  TYR A O     1 
ATOM   1410  C  CB    A TYR A  1 179 ? -78.246  20.892  -71.341  0.86 19.96  ? 179  TYR A CB    1 
ATOM   1411  C  CB    B TYR A  1 179 ? -77.264  20.583  -73.447  0.14 37.59  ? 179  TYR A CB    1 
ATOM   1412  C  CG    A TYR A  1 179 ? -79.336  20.688  -72.407  0.86 43.09  ? 179  TYR A CG    1 
ATOM   1413  C  CG    B TYR A  1 179 ? -76.602  19.418  -72.854  0.14 41.80  ? 179  TYR A CG    1 
ATOM   1414  C  CD1   A TYR A  1 179 ? -79.802  19.432  -72.819  0.86 49.76  ? 179  TYR A CD1   1 
ATOM   1415  C  CD1   B TYR A  1 179 ? -77.095  18.843  -71.705  0.14 43.47  ? 179  TYR A CD1   1 
ATOM   1416  C  CD2   A TYR A  1 179 ? -79.907  21.817  -72.964  0.86 63.87  ? 179  TYR A CD2   1 
ATOM   1417  C  CD2   B TYR A  1 179 ? -75.446  18.903  -73.444  0.14 40.91  ? 179  TYR A CD2   1 
ATOM   1418  C  CE1   A TYR A  1 179 ? -80.839  19.328  -73.730  0.86 38.26  ? 179  TYR A CE1   1 
ATOM   1419  C  CE1   B TYR A  1 179 ? -76.419  17.799  -71.148  0.14 43.07  ? 179  TYR A CE1   1 
ATOM   1420  C  CE2   A TYR A  1 179 ? -80.919  21.727  -73.878  0.86 50.54  ? 179  TYR A CE2   1 
ATOM   1421  C  CE2   B TYR A  1 179 ? -74.764  17.856  -72.872  0.14 37.75  ? 179  TYR A CE2   1 
ATOM   1422  C  CZ    A TYR A  1 179 ? -81.386  20.480  -74.243  0.86 44.23  ? 179  TYR A CZ    1 
ATOM   1423  C  CZ    B TYR A  1 179 ? -75.265  17.314  -71.717  0.14 37.57  ? 179  TYR A CZ    1 
ATOM   1424  O  OH    A TYR A  1 179 ? -82.435  20.387  -75.120  0.86 51.21  ? 179  TYR A OH    1 
ATOM   1425  O  OH    B TYR A  1 179 ? -74.609  16.251  -71.138  0.14 39.80  ? 179  TYR A OH    1 
ATOM   1426  N  N     A PHE A  1 180 ? -75.714  20.764  -73.654  0.86 47.43  ? 180  PHE A N     1 
ATOM   1427  N  N     B PHE A  1 180 ? -75.182  21.744  -75.144  0.14 38.51  ? 180  PHE A N     1 
ATOM   1428  C  CA    A PHE A  1 180 ? -75.067  21.354  -74.790  0.86 22.71  ? 180  PHE A CA    1 
ATOM   1429  C  CA    B PHE A  1 180 ? -74.662  22.087  -76.445  0.14 37.70  ? 180  PHE A CA    1 
ATOM   1430  C  C     A PHE A  1 180 ? -73.727  22.016  -74.521  0.86 29.08  ? 180  PHE A C     1 
ATOM   1431  C  C     B PHE A  1 180 ? -73.688  23.262  -76.391  0.14 37.25  ? 180  PHE A C     1 
ATOM   1432  O  O     A PHE A  1 180 ? -73.189  22.598  -75.470  0.86 44.97  ? 180  PHE A O     1 
ATOM   1433  C  CB    A PHE A  1 180 ? -76.038  22.272  -75.506  0.86 63.92  ? 180  PHE A CB    1 
ATOM   1434  C  CB    B PHE A  1 180 ? -75.798  22.393  -77.418  0.14 40.34  ? 180  PHE A CB    1 
ATOM   1435  C  CG    A PHE A  1 180 ? -77.232  21.588  -76.148  0.86 51.60  ? 180  PHE A CG    1 
ATOM   1436  C  CG    B PHE A  1 180 ? -76.949  21.421  -77.535  0.14 40.01  ? 180  PHE A CG    1 
ATOM   1437  C  CD1   A PHE A  1 180 ? -77.568  20.270  -75.897  0.86 32.13  ? 180  PHE A CD1   1 
ATOM   1438  C  CD1   B PHE A  1 180 ? -77.987  21.809  -78.301  0.14 41.66  ? 180  PHE A CD1   1 
ATOM   1439  C  CD2   A PHE A  1 180 ? -78.018  22.324  -76.996  0.86 55.48  ? 180  PHE A CD2   1 
ATOM   1440  C  CD2   B PHE A  1 180 ? -76.989  20.184  -76.916  0.14 39.44  ? 180  PHE A CD2   1 
ATOM   1441  C  CE1   A PHE A  1 180 ? -78.699  19.701  -76.477  0.86 55.26  ? 180  PHE A CE1   1 
ATOM   1442  C  CE1   B PHE A  1 180 ? -79.070  21.008  -78.501  0.14 41.66  ? 180  PHE A CE1   1 
ATOM   1443  C  CE2   A PHE A  1 180 ? -79.153  21.792  -77.584  0.86 61.35  ? 180  PHE A CE2   1 
ATOM   1444  C  CE2   B PHE A  1 180 ? -78.076  19.355  -77.122  0.14 43.95  ? 180  PHE A CE2   1 
ATOM   1445  C  CZ    A PHE A  1 180 ? -79.479  20.477  -77.321  0.86 60.35  ? 180  PHE A CZ    1 
ATOM   1446  C  CZ    B PHE A  1 180 ? -79.108  19.781  -77.917  0.14 42.78  ? 180  PHE A CZ    1 
ATOM   1447  N  N     A PRO A  1 181 ? -73.084  22.021  -73.339  1.00 26.62  ? 181  PRO A N     1 
ATOM   1448  C  CA    A PRO A  1 181 ? -71.696  22.586  -73.399  1.00 32.27  ? 181  PRO A CA    1 
ATOM   1449  C  C     A PRO A  1 181 ? -70.852  21.948  -74.527  1.00 43.97  ? 181  PRO A C     1 
ATOM   1450  O  O     A PRO A  1 181 ? -70.997  20.778  -74.860  1.00 57.42  ? 181  PRO A O     1 
ATOM   1451  C  CB    A PRO A  1 181 ? -71.210  22.435  -71.992  1.00 43.71  ? 181  PRO A CB    1 
ATOM   1452  C  CG    A PRO A  1 181 ? -72.433  22.733  -71.201  1.00 26.23  ? 181  PRO A CG    1 
ATOM   1453  C  CD    A PRO A  1 181 ? -73.643  22.474  -72.055  1.00 56.76  ? 181  PRO A CD    1 
ATOM   1454  N  N     . VAL A  1 182 ? -69.981  22.747  -75.093  1.00 37.03  ? 182  VAL A N     1 
ATOM   1455  C  CA    . VAL A  1 182 ? -69.092  22.253  -76.120  1.00 40.48  ? 182  VAL A CA    1 
ATOM   1456  C  C     . VAL A  1 182 ? -68.042  21.460  -75.431  1.00 44.93  ? 182  VAL A C     1 
ATOM   1457  O  O     . VAL A  1 182 ? -67.692  21.763  -74.294  1.00 44.13  ? 182  VAL A O     1 
ATOM   1458  C  CB    . VAL A  1 182 ? -68.379  23.384  -76.872  1.00 40.71  ? 182  VAL A CB    1 
ATOM   1459  C  CG1   . VAL A  1 182 ? -69.308  23.983  -77.917  1.00 28.75  ? 182  VAL A CG1   1 
ATOM   1460  C  CG2   . VAL A  1 182 ? -67.885  24.471  -75.917  1.00 60.63  ? 182  VAL A CG2   1 
ATOM   1461  N  N     . PRO A  1 183 ? -67.508  20.469  -76.075  1.00 40.42  ? 183  PRO A N     1 
ATOM   1462  C  CA    . PRO A  1 183 ? -66.352  19.786  -75.494  1.00 40.04  ? 183  PRO A CA    1 
ATOM   1463  C  C     . PRO A  1 183 ? -65.314  20.847  -75.150  1.00 47.29  ? 183  PRO A C     1 
ATOM   1464  O  O     . PRO A  1 183 ? -65.298  21.955  -75.746  1.00 52.12  ? 183  PRO A O     1 
ATOM   1465  C  CB    . PRO A  1 183 ? -65.876  18.928  -76.645  1.00 44.70  ? 183  PRO A CB    1 
ATOM   1466  C  CG    . PRO A  1 183 ? -67.181  18.477  -77.251  1.00 48.23  ? 183  PRO A CG    1 
ATOM   1467  C  CD    . PRO A  1 183 ? -67.988  19.763  -77.273  1.00 46.17  ? 183  PRO A CD    1 
ATOM   1468  N  N     . PRO A  1 184 ? -64.426  20.545  -74.207  1.00 40.39  ? 184  PRO A N     1 
ATOM   1469  C  CA    . PRO A  1 184 ? -64.347  19.298  -73.451  1.00 45.37  ? 184  PRO A CA    1 
ATOM   1470  C  C     . PRO A  1 184 ? -65.313  19.074  -72.332  1.00 41.11  ? 184  PRO A C     1 
ATOM   1471  O  O     . PRO A  1 184 ? -65.270  17.990  -71.746  1.00 53.79  ? 184  PRO A O     1 
ATOM   1472  C  CB    . PRO A  1 184 ? -62.911  19.311  -72.959  1.00 53.66  ? 184  PRO A CB    1 
ATOM   1473  C  CG    . PRO A  1 184 ? -62.717  20.762  -72.647  1.00 27.49  ? 184  PRO A CG    1 
ATOM   1474  C  CD    . PRO A  1 184 ? -63.351  21.472  -73.816  1.00 43.50  ? 184  PRO A CD    1 
ATOM   1475  N  N     . VAL A  1 185 ? -66.180  20.025  -72.164  1.00 35.00  ? 185  VAL A N     1 
ATOM   1476  C  CA    . VAL A  1 185 ? -67.095  19.766  -71.040  1.00 32.37  ? 185  VAL A CA    1 
ATOM   1477  C  C     . VAL A  1 185 ? -67.896  18.479  -71.310  1.00 34.91  ? 185  VAL A C     1 
ATOM   1478  O  O     . VAL A  1 185 ? -68.070  17.632  -70.425  1.00 47.08  ? 185  VAL A O     1 
ATOM   1479  C  CB    . VAL A  1 185 ? -68.067  20.944  -70.848  1.00 23.18  ? 185  VAL A CB    1 
ATOM   1480  C  CG1   . VAL A  1 185 ? -68.985  20.701  -69.654  1.00 18.64  ? 185  VAL A CG1   1 
ATOM   1481  C  CG2   . VAL A  1 185 ? -67.278  22.244  -70.673  1.00 28.43  ? 185  VAL A CG2   1 
ATOM   1482  N  N     . ASP A  1 186 ? -68.298  18.324  -72.585  1.00 30.35  ? 186  ASP A N     1 
ATOM   1483  C  CA    . ASP A  1 186 ? -69.039  17.193  -73.124  1.00 34.21  ? 186  ASP A CA    1 
ATOM   1484  C  C     . ASP A  1 186 ? -68.003  16.172  -73.644  1.00 31.87  ? 186  ASP A C     1 
ATOM   1485  O  O     . ASP A  1 186 ? -67.530  16.234  -74.787  1.00 52.47  ? 186  ASP A O     1 
ATOM   1486  C  CB    . ASP A  1 186 ? -69.967  17.691  -74.250  1.00 33.36  ? 186  ASP A CB    1 
ATOM   1487  C  CG    . ASP A  1 186 ? -70.574  16.559  -75.080  1.00 42.27  ? 186  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A  1 186 ? -70.988  16.849  -76.217  1.00 41.44  ? 186  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A  1 186 ? -70.629  15.386  -74.631  1.00 46.84  ? 186  ASP A OD2   1 
ATOM   1490  N  N     . SER A  1 187 ? -67.670  15.206  -72.806  1.00 42.09  ? 187  SER A N     1 
ATOM   1491  C  CA    . SER A  1 187 ? -66.689  14.206  -73.172  1.00 37.33  ? 187  SER A CA    1 
ATOM   1492  C  C     . SER A  1 187 ? -67.200  13.221  -74.195  1.00 45.18  ? 187  SER A C     1 
ATOM   1493  O  O     . SER A  1 187 ? -66.547  12.217  -74.431  1.00 43.09  ? 187  SER A O     1 
ATOM   1494  C  CB    . SER A  1 187 ? -66.267  13.419  -71.918  1.00 39.47  ? 187  SER A CB    1 
ATOM   1495  O  OG    . SER A  1 187 ? -67.225  12.426  -71.605  1.00 44.42  ? 187  SER A OG    1 
ATOM   1496  N  N     . ALA A  1 188 ? -68.352  13.451  -74.820  1.00 36.65  ? 188  ALA A N     1 
ATOM   1497  C  CA    . ALA A  1 188 ? -68.861  12.322  -75.622  1.00 24.86  ? 188  ALA A CA    1 
ATOM   1498  C  C     . ALA A  1 188 ? -69.252  12.535  -77.093  1.00 37.91  ? 188  ALA A C     1 
ATOM   1499  O  O     . ALA A  1 188 ? -70.105  11.802  -77.584  1.00 24.07  ? 188  ALA A O     1 
ATOM   1500  C  CB    . ALA A  1 188 ? -70.049  11.736  -74.878  1.00 12.58  ? 188  ALA A CB    1 
ATOM   1501  N  N     . GLN A  1 189 ? -68.658  13.481  -77.808  1.00 31.41  ? 189  GLN A N     1 
ATOM   1502  C  CA    . GLN A  1 189 ? -69.054  13.632  -79.207  1.00 32.34  ? 189  GLN A CA    1 
ATOM   1503  C  C     . GLN A  1 189 ? -68.781  12.386  -79.990  1.00 33.31  ? 189  GLN A C     1 
ATOM   1504  O  O     . GLN A  1 189 ? -69.690  11.771  -80.551  1.00 50.86  ? 189  GLN A O     1 
ATOM   1505  C  CB    . GLN A  1 189 ? -68.306  14.792  -79.852  1.00 16.49  ? 189  GLN A CB    1 
ATOM   1506  C  CG    . GLN A  1 189 ? -69.121  16.054  -80.063  1.00 40.86  ? 189  GLN A CG    1 
ATOM   1507  C  CD    . GLN A  1 189 ? -70.187  15.834  -81.102  1.00 32.32  ? 189  GLN A CD    1 
ATOM   1508  O  OE1   . GLN A  1 189 ? -69.915  15.402  -82.219  1.00 40.60  ? 189  GLN A OE1   1 
ATOM   1509  N  NE2   . GLN A  1 189 ? -71.480  16.055  -80.944  1.00 69.68  ? 189  GLN A NE2   1 
ATOM   1510  N  N     . ASP A  1 190 ? -67.507  12.033  -80.010  1.00 39.38  ? 190  ASP A N     1 
ATOM   1511  C  CA    . ASP A  1 190 ? -67.041  10.886  -80.744  1.00 41.62  ? 190  ASP A CA    1 
ATOM   1512  C  C     . ASP A  1 190 ? -67.800  9.590   -80.467  1.00 36.71  ? 190  ASP A C     1 
ATOM   1513  O  O     . ASP A  1 190 ? -68.074  8.815   -81.392  1.00 35.93  ? 190  ASP A O     1 
ATOM   1514  C  CB    . ASP A  1 190 ? -65.547  10.751  -80.507  1.00 27.34  ? 190  ASP A CB    1 
ATOM   1515  C  CG    . ASP A  1 190 ? -64.748  11.752  -81.317  1.00 33.67  ? 190  ASP A CG    1 
ATOM   1516  O  OD1   . ASP A  1 190 ? -63.556  11.941  -81.008  1.00 41.76  ? 190  ASP A OD1   1 
ATOM   1517  O  OD2   . ASP A  1 190 ? -65.304  12.326  -82.292  1.00 47.59  ? 190  ASP A OD2   1 
ATOM   1518  N  N     . ILE A  1 191 ? -68.200  9.416   -79.209  1.00 28.50  ? 191  ILE A N     1 
ATOM   1519  C  CA    . ILE A  1 191 ? -68.940  8.244   -78.761  1.00 34.37  ? 191  ILE A CA    1 
ATOM   1520  C  C     . ILE A  1 191 ? -70.322  8.244   -79.399  1.00 34.46  ? 191  ILE A C     1 
ATOM   1521  O  O     . ILE A  1 191 ? -70.681  7.315   -80.127  1.00 38.10  ? 191  ILE A O     1 
ATOM   1522  C  CB    . ILE A  1 191 ? -69.080  8.222   -77.208  1.00 42.93  ? 191  ILE A CB    1 
ATOM   1523  C  CG1   . ILE A  1 191 ? -67.819  8.840   -76.565  1.00 71.95  ? 191  ILE A CG1   1 
ATOM   1524  C  CG2   . ILE A  1 191 ? -69.273  6.785   -76.721  1.00 14.97  ? 191  ILE A CG2   1 
ATOM   1525  C  CD1   . ILE A  1 191 ? -67.725  8.739   -75.025  1.00 46.71  ? 191  ILE A CD1   1 
ATOM   1526  N  N     A ARG A  1 192 ? -71.088  9.299   -79.142  0.83 26.42  ? 192  ARG A N     1 
ATOM   1527  C  CA    A ARG A  1 192 ? -72.429  9.403   -79.703  0.83 26.13  ? 192  ARG A CA    1 
ATOM   1528  C  C     A ARG A  1 192 ? -72.381  9.257   -81.222  0.83 26.89  ? 192  ARG A C     1 
ATOM   1529  O  O     A ARG A  1 192 ? -73.112  8.445   -81.808  0.83 26.85  ? 192  ARG A O     1 
ATOM   1530  C  CB    A ARG A  1 192 ? -73.088  10.720  -79.305  0.83 25.41  ? 192  ARG A CB    1 
ATOM   1531  C  CG    A ARG A  1 192 ? -73.378  10.850  -77.801  0.83 27.01  ? 192  ARG A CG    1 
ATOM   1532  C  CD    A ARG A  1 192 ? -74.290  12.043  -77.502  0.83 29.32  ? 192  ARG A CD    1 
ATOM   1533  N  NE    A ARG A  1 192 ? -73.904  13.261  -78.221  0.83 32.50  ? 192  ARG A NE    1 
ATOM   1534  C  CZ    A ARG A  1 192 ? -73.079  14.196  -77.749  0.83 33.88  ? 192  ARG A CZ    1 
ATOM   1535  N  NH1   A ARG A  1 192 ? -72.789  15.272  -78.480  0.83 36.72  ? 192  ARG A NH1   1 
ATOM   1536  N  NH2   A ARG A  1 192 ? -72.616  14.100  -76.515  0.83 31.85  ? 192  ARG A NH2   1 
ATOM   1537  N  N     . SER A  1 193 ? -71.468  9.977   -81.857  1.00 29.18  ? 193  SER A N     1 
ATOM   1538  C  CA    . SER A  1 193 ? -71.358  9.872   -83.299  1.00 33.25  ? 193  SER A CA    1 
ATOM   1539  C  C     . SER A  1 193 ? -71.184  8.426   -83.771  1.00 34.73  ? 193  SER A C     1 
ATOM   1540  O  O     . SER A  1 193 ? -71.727  8.057   -84.812  1.00 39.87  ? 193  SER A O     1 
ATOM   1541  C  CB    . SER A  1 193 ? -70.251  10.776  -83.838  1.00 33.28  ? 193  SER A CB    1 
ATOM   1542  O  OG    . SER A  1 193 ? -70.660  12.134  -83.823  1.00 40.66  ? 193  SER A OG    1 
ATOM   1543  N  N     . GLU A  1 194 ? -70.475  7.600   -82.997  1.00 25.14  ? 194  GLU A N     1 
ATOM   1544  C  CA    . GLU A  1 194 ? -70.288  6.181   -83.376  1.00 28.69  ? 194  GLU A CA    1 
ATOM   1545  C  C     . GLU A  1 194 ? -71.637  5.492   -83.280  1.00 37.89  ? 194  GLU A C     1 
ATOM   1546  O  O     . GLU A  1 194 ? -72.116  4.895   -84.259  1.00 34.33  ? 194  GLU A O     1 
ATOM   1547  C  CB    . GLU A  1 194 ? -69.299  5.446   -82.454  1.00 24.52  ? 194  GLU A CB    1 
ATOM   1548  C  CG    . GLU A  1 194 ? -67.910  5.209   -83.037  1.00 45.53  ? 194  GLU A CG    1 
ATOM   1549  C  CD    . GLU A  1 194 ? -67.893  4.212   -84.185  1.00 64.67  ? 194  GLU A CD    1 
ATOM   1550  O  OE1   . GLU A  1 194 ? -67.632  4.631   -85.338  1.00 84.79  ? 194  GLU A OE1   1 
ATOM   1551  O  OE2   . GLU A  1 194 ? -68.103  3.006   -83.931  1.00 71.98  ? 194  GLU A OE2   1 
ATOM   1552  N  N     . MET A  1 195 ? -72.264  5.616   -82.109  1.00 20.81  ? 195  MET A N     1 
ATOM   1553  C  CA    . MET A  1 195 ? -73.577  5.020   -81.892  1.00 30.29  ? 195  MET A CA    1 
ATOM   1554  C  C     . MET A  1 195 ? -74.469  5.385   -83.076  1.00 35.04  ? 195  MET A C     1 
ATOM   1555  O  O     . MET A  1 195 ? -75.155  4.530   -83.630  1.00 36.13  ? 195  MET A O     1 
ATOM   1556  C  CB    . MET A  1 195 ? -74.182  5.520   -80.586  1.00 14.94  ? 195  MET A CB    1 
ATOM   1557  C  CG    . MET A  1 195 ? -73.219  5.467   -79.408  1.00 26.05  ? 195  MET A CG    1 
ATOM   1558  S  SD    . MET A  1 195 ? -74.005  5.934   -77.856  1.00 39.20  ? 195  MET A SD    1 
ATOM   1559  C  CE    . MET A  1 195 ? -73.438  4.654   -76.787  1.00 42.92  ? 195  MET A CE    1 
ATOM   1560  N  N     . CYS A  1 196 ? -74.368  6.631   -83.532  1.00 22.49  ? 196  CYS A N     1 
ATOM   1561  C  CA    . CYS A  1 196 ? -75.159  7.055   -84.671  1.00 25.79  ? 196  CYS A CA    1 
ATOM   1562  C  C     . CYS A  1 196 ? -74.794  6.276   -85.920  1.00 28.56  ? 196  CYS A C     1 
ATOM   1563  O  O     . CYS A  1 196 ? -75.609  5.530   -86.439  1.00 43.44  ? 196  CYS A O     1 
ATOM   1564  C  CB    . CYS A  1 196 ? -75.017  8.545   -84.904  1.00 13.40  ? 196  CYS A CB    1 
ATOM   1565  S  SG    . CYS A  1 196 ? -75.825  9.507   -83.589  1.00 38.84  ? 196  CYS A SG    1 
ATOM   1566  N  N     . LEU A  1 197 ? -73.549  6.384   -86.353  1.00 27.92  ? 197  LEU A N     1 
ATOM   1567  C  CA    . LEU A  1 197 ? -73.099  5.672   -87.540  1.00 38.78  ? 197  LEU A CA    1 
ATOM   1568  C  C     . LEU A  1 197 ? -73.569  4.237   -87.529  1.00 34.02  ? 197  LEU A C     1 
ATOM   1569  O  O     . LEU A  1 197 ? -74.202  3.767   -88.484  1.00 47.94  ? 197  LEU A O     1 
ATOM   1570  C  CB    . LEU A  1 197 ? -71.581  5.669   -87.597  1.00 34.44  ? 197  LEU A CB    1 
ATOM   1571  C  CG    . LEU A  1 197 ? -70.875  7.023   -87.601  1.00 34.29  ? 197  LEU A CG    1 
ATOM   1572  C  CD1   . LEU A  1 197 ? -69.393  6.819   -87.437  1.00 49.90  ? 197  LEU A CD1   1 
ATOM   1573  C  CD2   . LEU A  1 197 ? -71.166  7.742   -88.889  1.00 26.31  ? 197  LEU A CD2   1 
ATOM   1574  N  N     . VAL A  1 198 ? -73.302  3.570   -86.413  1.00 29.67  ? 198  VAL A N     1 
ATOM   1575  C  CA    . VAL A  1 198 ? -73.666  2.168   -86.231  1.00 41.70  ? 198  VAL A CA    1 
ATOM   1576  C  C     . VAL A  1 198 ? -75.148  1.935   -86.344  1.00 39.70  ? 198  VAL A C     1 
ATOM   1577  O  O     . VAL A  1 198 ? -75.573  1.088   -87.122  1.00 44.44  ? 198  VAL A O     1 
ATOM   1578  C  CB    . VAL A  1 198 ? -73.179  1.635   -84.891  1.00 48.08  ? 198  VAL A CB    1 
ATOM   1579  C  CG1   . VAL A  1 198 ? -73.673  0.211   -84.675  1.00 42.26  ? 198  VAL A CG1   1 
ATOM   1580  C  CG2   . VAL A  1 198 ? -71.665  1.687   -84.858  1.00 23.76  ? 198  VAL A CG2   1 
ATOM   1581  N  N     . MET A  1 199 ? -75.925  2.667   -85.551  1.00 36.46  ? 199  MET A N     1 
ATOM   1582  C  CA    . MET A  1 199 ? -77.384  2.569   -85.594  1.00 39.73  ? 199  MET A CA    1 
ATOM   1583  C  C     . MET A  1 199 ? -77.900  2.639   -87.033  1.00 43.35  ? 199  MET A C     1 
ATOM   1584  O  O     . MET A  1 199 ? -78.758  1.854   -87.427  1.00 48.81  ? 199  MET A O     1 
ATOM   1585  C  CB    . MET A  1 199 ? -78.016  3.689   -84.777  1.00 16.40  ? 199  MET A CB    1 
ATOM   1586  C  CG    . MET A  1 199 ? -77.944  3.419   -83.320  1.00 24.66  ? 199  MET A CG    1 
ATOM   1587  S  SD    . MET A  1 199 ? -78.670  4.743   -82.418  1.00 34.41  ? 199  MET A SD    1 
ATOM   1588  C  CE    . MET A  1 199 ? -78.503  4.150   -80.744  1.00 27.94  ? 199  MET A CE    1 
ATOM   1589  N  N     . GLU A  1 200 ? -77.353  3.565   -87.815  1.00 23.83  ? 200  GLU A N     1 
ATOM   1590  C  CA    . GLU A  1 200 ? -77.753  3.713   -89.205  1.00 43.44  ? 200  GLU A CA    1 
ATOM   1591  C  C     . GLU A  1 200 ? -77.382  2.497   -90.015  1.00 44.69  ? 200  GLU A C     1 
ATOM   1592  O  O     . GLU A  1 200 ? -78.198  2.021   -90.805  1.00 62.29  ? 200  GLU A O     1 
ATOM   1593  C  CB    . GLU A  1 200 ? -77.169  4.979   -89.822  1.00 25.77  ? 200  GLU A CB    1 
ATOM   1594  C  CG    . GLU A  1 200 ? -77.726  6.218   -89.151  1.00 57.85  ? 200  GLU A CG    1 
ATOM   1595  C  CD    . GLU A  1 200 ? -77.840  7.397   -90.077  1.00 54.66  ? 200  GLU A CD    1 
ATOM   1596  O  OE1   . GLU A  1 200 ? -78.813  8.176   -89.915  1.00 40.25  ? 200  GLU A OE1   1 
ATOM   1597  O  OE2   . GLU A  1 200 ? -76.958  7.536   -90.956  1.00 54.15  ? 200  GLU A OE2   1 
ATOM   1598  N  N     . GLN A  1 201 ? -76.166  1.991   -89.808  1.00 33.36  ? 201  GLN A N     1 
ATOM   1599  C  CA    . GLN A  1 201 ? -75.702  0.786   -90.504  1.00 47.07  ? 201  GLN A CA    1 
ATOM   1600  C  C     . GLN A  1 201 ? -76.622  -0.390  -90.182  1.00 43.28  ? 201  GLN A C     1 
ATOM   1601  O  O     . GLN A  1 201 ? -76.679  -1.374  -90.916  1.00 68.10  ? 201  GLN A O     1 
ATOM   1602  C  CB    . GLN A  1 201 ? -74.317  0.383   -90.029  1.00 28.30  ? 201  GLN A CB    1 
ATOM   1603  C  CG    . GLN A  1 201 ? -73.234  1.401   -90.208  0.55 57.65  ? 201  GLN A CG    1 
ATOM   1604  C  CD    . GLN A  1 201 ? -72.026  1.059   -89.351  0.55 58.42  ? 201  GLN A CD    1 
ATOM   1605  O  OE1   . GLN A  1 201 ? -71.771  -0.115  -89.051  0.55 30.38  ? 201  GLN A OE1   1 
ATOM   1606  N  NE2   . GLN A  1 201 ? -71.299  2.085   -88.920  0.55 55.14  ? 201  GLN A NE2   1 
ATOM   1607  N  N     . MET A  1 202 ? -77.268  -0.316  -89.028  1.00 39.65  ? 202  MET A N     1 
ATOM   1608  C  CA    . MET A  1 202 ? -78.179  -1.358  -88.596  1.00 47.87  ? 202  MET A CA    1 
ATOM   1609  C  C     . MET A  1 202 ? -79.625  -1.021  -88.942  1.00 48.62  ? 202  MET A C     1 
ATOM   1610  O  O     . MET A  1 202 ? -80.554  -1.499  -88.291  1.00 57.39  ? 202  MET A O     1 
ATOM   1611  C  CB    . MET A  1 202 ? -78.028  -1.606  -87.093  1.00 35.73  ? 202  MET A CB    1 
ATOM   1612  C  CG    . MET A  1 202 ? -76.734  -2.331  -86.747  1.00 46.33  ? 202  MET A CG    1 
ATOM   1613  S  SD    . MET A  1 202 ? -76.665  -2.806  -85.040  1.00 49.45  ? 202  MET A SD    1 
ATOM   1614  C  CE    . MET A  1 202 ? -77.508  -4.368  -85.103  1.00 36.52  ? 202  MET A CE    1 
ATOM   1615  N  N     . GLY A  1 203 ? -79.810  -0.165  -89.940  1.00 42.66  ? 203  GLY A N     1 
ATOM   1616  C  CA    . GLY A  1 203 ? -81.154  0.189   -90.353  1.00 53.61  ? 203  GLY A CA    1 
ATOM   1617  C  C     . GLY A  1 203 ? -81.878  1.384   -89.754  1.00 43.44  ? 203  GLY A C     1 
ATOM   1618  O  O     . GLY A  1 203 ? -82.858  1.849   -90.343  1.00 63.29  ? 203  GLY A O     1 
ATOM   1619  N  N     . LEU A  1 204 ? -81.491  1.837   -88.567  1.00 41.50  ? 204  LEU A N     1 
ATOM   1620  C  CA    . LEU A  1 204 ? -82.155  3.002   -87.988  1.00 45.63  ? 204  LEU A CA    1 
ATOM   1621  C  C     . LEU A  1 204 ? -81.803  4.293   -88.742  1.00 45.62  ? 204  LEU A C     1 
ATOM   1622  O  O     . LEU A  1 204 ? -80.870  4.319   -89.573  1.00 42.46  ? 204  LEU A O     1 
ATOM   1623  C  CB    . LEU A  1 204 ? -81.814  3.155   -86.504  1.00 27.74  ? 204  LEU A CB    1 
ATOM   1624  C  CG    . LEU A  1 204 ? -82.665  2.292   -85.575  1.00 47.12  ? 204  LEU A CG    1 
ATOM   1625  C  CD1   . LEU A  1 204 ? -82.296  0.847   -85.741  1.00 46.32  ? 204  LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A  1 204 ? -82.475  2.723   -84.132  1.00 51.90  ? 204  LEU A CD2   1 
ATOM   1627  N  N     . VAL A  1 205 ? -82.619  5.328   -88.531  1.00 40.42  ? 205  VAL A N     1 
ATOM   1628  C  CA    . VAL A  1 205 ? -82.373  6.624   -89.157  1.00 35.46  ? 205  VAL A CA    1 
ATOM   1629  C  C     . VAL A  1 205 ? -82.230  7.662   -88.065  1.00 46.94  ? 205  VAL A C     1 
ATOM   1630  O  O     . VAL A  1 205 ? -83.165  7.937   -87.294  1.00 39.70  ? 205  VAL A O     1 
ATOM   1631  C  CB    . VAL A  1 205 ? -83.460  7.019   -90.157  1.00 35.36  ? 205  VAL A CB    1 
ATOM   1632  C  CG1   . VAL A  1 205 ? -83.320  8.464   -90.537  1.00 24.39  ? 205  VAL A CG1   1 
ATOM   1633  C  CG2   . VAL A  1 205 ? -83.300  6.205   -91.398  1.00 40.98  ? 205  VAL A CG2   1 
ATOM   1634  N  N     . VAL A  1 206 ? -81.026  8.214   -88.002  1.00 42.76  ? 206  VAL A N     1 
ATOM   1635  C  CA    . VAL A  1 206 ? -80.686  9.178   -86.982  1.00 44.60  ? 206  VAL A CA    1 
ATOM   1636  C  C     . VAL A  1 206 ? -80.989  10.595  -87.375  1.00 36.42  ? 206  VAL A C     1 
ATOM   1637  O  O     . VAL A  1 206 ? -80.524  11.077  -88.411  1.00 53.24  ? 206  VAL A O     1 
ATOM   1638  C  CB    . VAL A  1 206 ? -79.201  9.059   -86.602  1.00 40.00  ? 206  VAL A CB    1 
ATOM   1639  C  CG1   . VAL A  1 206 ? -78.888  9.935   -85.409  1.00 46.67  ? 206  VAL A CG1   1 
ATOM   1640  C  CG2   . VAL A  1 206 ? -78.876  7.631   -86.274  1.00 47.94  ? 206  VAL A CG2   1 
ATOM   1641  N  N     . GLU A  1 207 ? -81.789  11.255  -86.547  1.00 34.80  ? 207  GLU A N     1 
ATOM   1642  C  CA    . GLU A  1 207 ? -82.137  12.644  -86.798  1.00 46.16  ? 207  GLU A CA    1 
ATOM   1643  C  C     . GLU A  1 207 ? -81.164  13.565  -86.102  1.00 45.62  ? 207  GLU A C     1 
ATOM   1644  O  O     . GLU A  1 207 ? -80.866  14.656  -86.603  1.00 60.74  ? 207  GLU A O     1 
ATOM   1645  C  CB    . GLU A  1 207 ? -83.582  12.931  -86.396  1.00 42.46  ? 207  GLU A CB    1 
ATOM   1646  C  CG    . GLU A  1 207 ? -84.554  12.328  -87.409  0.69 39.59  ? 207  GLU A CG    1 
ATOM   1647  C  CD    . GLU A  1 207 ? -86.021  12.506  -87.068  0.69 49.86  ? 207  GLU A CD    1 
ATOM   1648  O  OE1   . GLU A  1 207 ? -86.364  12.802  -85.899  0.69 58.93  ? 207  GLU A OE1   1 
ATOM   1649  O  OE2   . GLU A  1 207 ? -86.840  12.320  -87.992  0.69 56.50  ? 207  GLU A OE2   1 
ATOM   1650  N  N     . ALA A  1 208 ? -80.596  13.076  -85.000  1.00 52.51  ? 208  ALA A N     1 
ATOM   1651  C  CA    . ALA A  1 208 ? -79.637  13.861  -84.237  1.00 58.52  ? 208  ALA A CA    1 
ATOM   1652  C  C     . ALA A  1 208 ? -79.203  13.206  -82.940  1.00 53.16  ? 208  ALA A C     1 
ATOM   1653  O  O     . ALA A  1 208 ? -79.972  12.455  -82.360  1.00 61.16  ? 208  ALA A O     1 
ATOM   1654  C  CB    . ALA A  1 208 ? -80.264  15.153  -83.901  1.00 31.68  ? 208  ALA A CB    1 
ATOM   1655  N  N     A HIS A  1 209 ? -78.170  13.847  -82.353  1.00 43.05  ? 209  HIS A N     1 
ATOM   1656  C  CA    A HIS A  1 209 ? -77.577  13.488  -81.049  1.00 40.36  ? 209  HIS A CA    1 
ATOM   1657  C  C     A HIS A  1 209 ? -77.053  14.691  -80.275  1.00 31.48  ? 209  HIS A C     1 
ATOM   1658  O  O     A HIS A  1 209 ? -76.601  15.690  -80.848  1.00 27.72  ? 209  HIS A O     1 
ATOM   1659  C  CB    A HIS A  1 209 ? -76.476  12.411  -81.144  1.00 42.81  ? 209  HIS A CB    1 
ATOM   1660  C  CG    A HIS A  1 209 ? -75.119  12.918  -81.546  1.00 33.90  ? 209  HIS A CG    1 
ATOM   1661  N  ND1   A HIS A  1 209 ? -74.397  13.810  -80.785  1.00 42.01  ? 209  HIS A ND1   1 
ATOM   1662  C  CD2   A HIS A  1 209 ? -74.312  12.566  -82.578  1.00 45.58  ? 209  HIS A CD2   1 
ATOM   1663  C  CE1   A HIS A  1 209 ? -73.203  13.980  -81.325  1.00 56.86  ? 209  HIS A CE1   1 
ATOM   1664  N  NE2   A HIS A  1 209 ? -73.124  13.236  -82.414  1.00 26.36  ? 209  HIS A NE2   1 
ATOM   1665  N  N     A HIS A  1 210 ? -77.039  14.545  -78.961  0.86 11.56  ? 210  HIS A N     1 
ATOM   1666  N  N     B HIS A  1 210 ? -77.706  13.224  -79.340  0.14 35.02  ? 210  HIS A N     1 
ATOM   1667  C  CA    A HIS A  1 210 ? -76.596  15.620  -78.095  0.86 20.98  ? 210  HIS A CA    1 
ATOM   1668  C  CA    B HIS A  1 210 ? -77.772  14.518  -78.661  0.14 40.17  ? 210  HIS A CA    1 
ATOM   1669  C  C     A HIS A  1 210 ? -76.390  15.136  -76.667  0.86 19.61  ? 210  HIS A C     1 
ATOM   1670  C  C     B HIS A  1 210 ? -77.690  14.362  -77.123  0.14 43.32  ? 210  HIS A C     1 
ATOM   1671  O  O     A HIS A  1 210 ? -76.888  14.075  -76.286  0.86 19.08  ? 210  HIS A O     1 
ATOM   1672  O  O     B HIS A  1 210 ? -78.283  13.451  -76.539  0.14 38.03  ? 210  HIS A O     1 
ATOM   1673  C  CB    A HIS A  1 210 ? -77.666  16.712  -78.089  0.86 9.46   ? 210  HIS A CB    1 
ATOM   1674  C  CB    B HIS A  1 210 ? -79.037  15.260  -79.043  0.14 34.06  ? 210  HIS A CB    1 
ATOM   1675  C  CG    A HIS A  1 210 ? -79.018  16.253  -77.615  0.98 28.50  ? 210  HIS A CG    1 
ATOM   1676  N  ND1   A HIS A  1 210 ? -79.435  16.384  -76.309  0.98 26.21  ? 210  HIS A ND1   1 
ATOM   1677  C  CD2   A HIS A  1 210 ? -80.062  15.705  -78.285  0.98 21.52  ? 210  HIS A CD2   1 
ATOM   1678  C  CE1   A HIS A  1 210 ? -80.675  15.941  -76.193  0.98 23.01  ? 210  HIS A CE1   1 
ATOM   1679  N  NE2   A HIS A  1 210 ? -81.081  15.524  -77.378  0.98 36.87  ? 210  HIS A NE2   1 
ATOM   1680  N  N     A HIS A  1 211 ? -75.629  15.893  -75.883  0.86 19.02  ? 211  HIS A N     1 
ATOM   1681  N  N     B HIS A  1 211 ? -76.942  15.260  -76.466  0.14 38.56  ? 211  HIS A N     1 
ATOM   1682  C  CA    A HIS A  1 211 ? -75.466  15.528  -74.492  0.86 20.46  ? 211  HIS A CA    1 
ATOM   1683  C  CA    B HIS A  1 211 ? -76.660  15.255  -75.026  0.14 37.60  ? 211  HIS A CA    1 
ATOM   1684  C  C     A HIS A  1 211 ? -76.834  15.829  -73.890  0.86 17.00  ? 211  HIS A C     1 
ATOM   1685  C  C     B HIS A  1 211 ? -77.714  16.007  -74.190  0.14 38.22  ? 211  HIS A C     1 
ATOM   1686  O  O     A HIS A  1 211 ? -77.682  16.385  -74.571  0.86 24.80  ? 211  HIS A O     1 
ATOM   1687  O  O     B HIS A  1 211 ? -78.599  16.639  -74.768  0.14 42.40  ? 211  HIS A O     1 
ATOM   1688  C  CB    A HIS A  1 211 ? -74.438  16.393  -73.805  0.86 27.72  ? 211  HIS A CB    1 
ATOM   1689  C  CB    B HIS A  1 211 ? -75.263  15.806  -74.933  0.14 36.62  ? 211  HIS A CB    1 
ATOM   1690  C  CG    A HIS A  1 211 ? -74.063  15.887  -72.449  0.86 32.83  ? 211  HIS A CG    1 
ATOM   1691  C  CG    B HIS A  1 211 ? -74.693  15.977  -76.332  0.14 39.13  ? 211  HIS A CG    1 
ATOM   1692  N  ND1   A HIS A  1 211 ? -72.923  15.150  -72.225  0.86 30.00  ? 211  HIS A ND1   1 
ATOM   1693  N  ND1   B HIS A  1 211 ? -73.870  16.990  -76.763  0.14 36.38  ? 211  HIS A ND1   1 
ATOM   1694  C  CD2   A HIS A  1 211 ? -74.680  15.997  -71.250  0.86 27.93  ? 211  HIS A CD2   1 
ATOM   1695  C  CD2   B HIS A  1 211 ? -74.934  15.197  -77.418  0.14 40.67  ? 211  HIS A CD2   1 
ATOM   1696  C  CE1   A HIS A  1 211 ? -72.853  14.829  -70.946  0.86 19.82  ? 211  HIS A CE1   1 
ATOM   1697  C  CE1   B HIS A  1 211 ? -73.621  16.845  -78.059  0.14 41.13  ? 211  HIS A CE1   1 
ATOM   1698  N  NE2   A HIS A  1 211 ? -73.906  15.327  -70.332  0.86 10.18  ? 211  HIS A NE2   1 
ATOM   1699  N  NE2   B HIS A  1 211 ? -74.269  15.755  -78.484  0.14 47.26  ? 211  HIS A NE2   1 
ATOM   1700  N  N     A GLU A  1 212 ? -77.033  15.522  -72.612  0.75 24.09  ? 212  GLU A N     1 
ATOM   1701  N  N     B GLU A  1 212 ? -77.641  15.944  -72.834  0.14 35.72  ? 212  GLU A N     1 
ATOM   1702  C  CA    A GLU A  1 212 ? -78.339  15.757  -72.015  0.75 25.13  ? 212  GLU A CA    1 
ATOM   1703  C  CA    B GLU A  1 212 ? -78.677  16.598  -72.082  0.14 36.14  ? 212  GLU A CA    1 
ATOM   1704  C  C     A GLU A  1 212 ? -78.156  16.317  -70.602  0.75 25.33  ? 212  GLU A C     1 
ATOM   1705  C  C     B GLU A  1 212 ? -78.776  15.857  -70.748  0.14 31.73  ? 212  GLU A C     1 
ATOM   1706  O  O     A GLU A  1 212 ? -77.146  16.058  -69.967  0.75 26.21  ? 212  GLU A O     1 
ATOM   1707  C  CB    A GLU A  1 212 ? -79.144  14.448  -72.119  0.75 26.27  ? 212  GLU A CB    1 
ATOM   1708  C  CB    B GLU A  1 212 ? -80.029  16.234  -72.704  0.14 40.17  ? 212  GLU A CB    1 
ATOM   1709  C  CG    A GLU A  1 212 ? -80.438  14.359  -71.323  0.75 30.64  ? 212  GLU A CG    1 
ATOM   1710  C  CG    B GLU A  1 212 ? -79.978  15.463  -74.029  0.14 42.13  ? 212  GLU A CG    1 
ATOM   1711  C  CD    A GLU A  1 212 ? -81.562  15.256  -71.816  0.75 32.75  ? 212  GLU A CD    1 
ATOM   1712  C  CD    B GLU A  1 212 ? -81.366  15.284  -74.670  0.14 38.20  ? 212  GLU A CD    1 
ATOM   1713  O  OE1   A GLU A  1 212 ? -81.744  15.382  -73.041  0.75 32.89  ? 212  GLU A OE1   1 
ATOM   1714  O  OE1   B GLU A  1 212 ? -82.246  16.150  -74.436  0.14 35.11  ? 212  GLU A OE1   1 
ATOM   1715  O  OE2   A GLU A  1 212 ? -82.277  15.835  -70.960  0.75 34.88  ? 212  GLU A OE2   1 
ATOM   1716  O  OE2   B GLU A  1 212 ? -81.561  14.300  -75.400  0.14 36.86  ? 212  GLU A OE2   1 
ATOM   1717  N  N     A VAL A  1 213 ? -79.134  17.084  -70.111  0.93 20.00  ? 213  VAL A N     1 
ATOM   1718  C  CA    A VAL A  1 213 ? -79.136  17.799  -68.817  0.93 20.00  ? 213  VAL A CA    1 
ATOM   1719  C  C     A VAL A  1 213 ? -78.240  17.320  -67.658  0.93 20.00  ? 213  VAL A C     1 
ATOM   1720  O  O     A VAL A  1 213 ? -77.369  18.056  -67.209  0.93 20.00  ? 213  VAL A O     1 
ATOM   1721  C  CB    A VAL A  1 213 ? -80.580  17.903  -68.279  0.93 20.00  ? 213  VAL A CB    1 
ATOM   1722  C  CG1   A VAL A  1 213 ? -80.614  18.629  -66.945  0.93 20.00  ? 213  VAL A CG1   1 
ATOM   1723  C  CG2   A VAL A  1 213 ? -81.477  18.629  -69.275  0.93 20.00  ? 213  VAL A CG2   1 
ATOM   1724  N  N     . ALA A  1 214 ? -78.421  16.099  -67.182  1.00 14.94  ? 214  ALA A N     1 
ATOM   1725  C  CA    . ALA A  1 214 ? -77.669  15.586  -66.016  1.00 33.57  ? 214  ALA A CA    1 
ATOM   1726  C  C     . ALA A  1 214 ? -76.149  15.419  -66.178  1.00 38.39  ? 214  ALA A C     1 
ATOM   1727  O  O     . ALA A  1 214 ? -75.654  15.070  -67.249  1.00 37.10  ? 214  ALA A O     1 
ATOM   1728  C  CB    . ALA A  1 214 ? -78.287  14.272  -65.572  1.00 30.97  ? 214  ALA A CB    1 
ATOM   1729  N  N     . THR A  1 215 ? -75.448  15.665  -65.070  1.00 34.62  ? 215  THR A N     1 
ATOM   1730  C  CA    . THR A  1 215 ? -73.996  15.482  -65.027  1.00 22.51  ? 215  THR A CA    1 
ATOM   1731  C  C     . THR A  1 215 ? -73.752  13.971  -65.126  1.00 35.48  ? 215  THR A C     1 
ATOM   1732  O  O     . THR A  1 215 ? -74.701  13.180  -65.163  1.00 39.45  ? 215  THR A O     1 
ATOM   1733  C  CB    . THR A  1 215 ? -73.376  16.008  -63.685  1.00 28.96  ? 215  THR A CB    1 
ATOM   1734  O  OG1   . THR A  1 215 ? -71.946  15.876  -63.716  1.00 54.72  ? 215  THR A OG1   1 
ATOM   1735  C  CG2   . THR A  1 215 ? -73.897  15.230  -62.497  1.00 11.31  ? 215  THR A CG2   1 
ATOM   1736  N  N     . ALA A  1 216 ? -72.488  13.570  -65.179  1.00 29.86  ? 216  ALA A N     1 
ATOM   1737  C  CA    . ALA A  1 216 ? -72.154  12.157  -65.250  1.00 25.68  ? 216  ALA A CA    1 
ATOM   1738  C  C     . ALA A  1 216 ? -72.659  11.437  -66.494  1.00 18.17  ? 216  ALA A C     1 
ATOM   1739  O  O     . ALA A  1 216 ? -73.240  10.358  -66.402  1.00 41.28  ? 216  ALA A O     1 
ATOM   1740  C  CB    . ALA A  1 216 ? -72.683  11.453  -64.012  1.00 21.19  ? 216  ALA A CB    1 
ATOM   1741  N  N     . GLY A  1 217 ? -72.458  12.048  -67.652  1.00 30.73  ? 217  GLY A N     1 
ATOM   1742  C  CA    . GLY A  1 217 ? -72.745  11.416  -68.939  1.00 30.14  ? 217  GLY A CA    1 
ATOM   1743  C  C     . GLY A  1 217 ? -74.171  11.115  -69.404  1.00 25.36  ? 217  GLY A C     1 
ATOM   1744  O  O     . GLY A  1 217 ? -74.381  10.120  -70.093  1.00 42.91  ? 217  GLY A O     1 
ATOM   1745  N  N     . GLN A  1 218 ? -75.164  11.933  -69.076  1.00 23.89  ? 218  GLN A N     1 
ATOM   1746  C  CA    . GLN A  1 218 ? -76.477  11.660  -69.641  1.00 24.97  ? 218  GLN A CA    1 
ATOM   1747  C  C     . GLN A  1 218 ? -76.438  12.083  -71.110  1.00 29.12  ? 218  GLN A C     1 
ATOM   1748  O  O     . GLN A  1 218 ? -75.990  13.177  -71.435  1.00 30.49  ? 218  GLN A O     1 
ATOM   1749  C  CB    . GLN A  1 218 ? -77.573  12.402  -68.917  1.00 27.27  ? 218  GLN A CB    1 
ATOM   1750  C  CG    . GLN A  1 218 ? -78.937  11.996  -69.436  1.00 39.69  ? 218  GLN A CG    1 
ATOM   1751  C  CD    . GLN A  1 218 ? -80.073  12.570  -68.625  1.00 53.61  ? 218  GLN A CD    1 
ATOM   1752  O  OE1   . GLN A  1 218 ? -80.897  11.840  -68.058  1.00 50.86  ? 218  GLN A OE1   1 
ATOM   1753  N  NE2   . GLN A  1 218 ? -80.312  13.856  -68.432  1.00 57.11  ? 218  GLN A NE2   1 
ATOM   1754  N  N     . ASN A  1 219 ? -76.920  11.219  -72.000  1.00 35.65  ? 219  ASN A N     1 
ATOM   1755  C  CA    . ASN A  1 219 ? -76.916  11.496  -73.441  1.00 40.47  ? 219  ASN A CA    1 
ATOM   1756  C  C     . ASN A  1 219 ? -78.168  10.960  -74.102  1.00 36.89  ? 219  ASN A C     1 
ATOM   1757  O  O     . ASN A  1 219 ? -78.838  10.098  -73.534  1.00 42.98  ? 219  ASN A O     1 
ATOM   1758  C  CB    . ASN A  1 219 ? -75.721  10.837  -74.103  1.00 38.31  ? 219  ASN A CB    1 
ATOM   1759  C  CG    . ASN A  1 219 ? -74.431  11.415  -73.645  1.00 40.81  ? 219  ASN A CG    1 
ATOM   1760  O  OD1   . ASN A  1 219 ? -73.980  11.140  -72.534  1.00 36.02  ? 219  ASN A OD1   1 
ATOM   1761  N  ND2   . ASN A  1 219 ? -73.823  12.246  -74.489  1.00 38.15  ? 219  ASN A ND2   1 
ATOM   1762  N  N     A GLU A  1 220 ? -78.437  11.433  -75.319  0.80 23.13  ? 220  GLU A N     1 
ATOM   1763  C  CA    A GLU A  1 220 ? -79.612  11.022  -76.077  0.80 24.42  ? 220  GLU A CA    1 
ATOM   1764  C  C     A GLU A  1 220 ? -79.262  11.052  -77.552  0.80 23.92  ? 220  GLU A C     1 
ATOM   1765  O  O     A GLU A  1 220 ? -78.458  11.888  -77.991  0.80 23.17  ? 220  GLU A O     1 
ATOM   1766  C  CB    A GLU A  1 220 ? -80.846  11.950  -75.821  0.80 26.61  ? 220  GLU A CB    1 
ATOM   1767  C  CG    A GLU A  1 220 ? -82.205  11.491  -76.509  0.80 28.88  ? 220  GLU A CG    1 
ATOM   1768  C  CD    A GLU A  1 220 ? -83.361  12.516  -76.387  0.80 31.62  ? 220  GLU A CD    1 
ATOM   1769  O  OE1   A GLU A  1 220 ? -83.639  13.061  -75.274  0.80 30.47  ? 220  GLU A OE1   1 
ATOM   1770  O  OE2   A GLU A  1 220 ? -84.016  12.786  -77.426  0.80 35.08  ? 220  GLU A OE2   1 
ATOM   1771  N  N     . VAL A  1 221 ? -79.833  10.091  -78.284  1.00 37.21  ? 221  VAL A N     1 
ATOM   1772  C  CA    . VAL A  1 221 ? -79.714  9.974   -79.735  1.00 33.11  ? 221  VAL A CA    1 
ATOM   1773  C  C     . VAL A  1 221 ? -81.141  9.882   -80.270  1.00 45.93  ? 221  VAL A C     1 
ATOM   1774  O  O     . VAL A  1 221 ? -81.894  8.955   -79.952  1.00 60.40  ? 221  VAL A O     1 
ATOM   1775  C  CB    . VAL A  1 221 ? -78.963  8.735   -80.186  1.00 37.54  ? 221  VAL A CB    1 
ATOM   1776  C  CG1   . VAL A  1 221 ? -79.098  8.587   -81.714  1.00 32.68  ? 221  VAL A CG1   1 
ATOM   1777  C  CG2   . VAL A  1 221 ? -77.506  8.853   -79.807  1.00 34.66  ? 221  VAL A CG2   1 
ATOM   1778  N  N     . ALA A  1 222 ? -81.514  10.885  -81.049  1.00 48.34  ? 222  ALA A N     1 
ATOM   1779  C  CA    . ALA A  1 222 ? -82.837  10.966  -81.632  1.00 44.43  ? 222  ALA A CA    1 
ATOM   1780  C  C     . ALA A  1 222 ? -82.896  10.219  -82.941  1.00 46.52  ? 222  ALA A C     1 
ATOM   1781  O  O     . ALA A  1 222 ? -82.115  10.457  -83.864  1.00 41.47  ? 222  ALA A O     1 
ATOM   1782  C  CB    . ALA A  1 222 ? -83.228  12.409  -81.844  1.00 47.76  ? 222  ALA A CB    1 
ATOM   1783  N  N     . THR A  1 223 ? -83.875  9.337   -83.022  1.00 57.24  ? 223  THR A N     1 
ATOM   1784  C  CA    . THR A  1 223 ? -84.058  8.539   -84.207  1.00 45.15  ? 223  THR A CA    1 
ATOM   1785  C  C     . THR A  1 223 ? -85.435  8.781   -84.788  1.00 52.47  ? 223  THR A C     1 
ATOM   1786  O  O     . THR A  1 223 ? -86.399  9.091   -84.063  1.00 55.42  ? 223  THR A O     1 
ATOM   1787  C  CB    . THR A  1 223 ? -83.870  7.061   -83.870  1.00 44.65  ? 223  THR A CB    1 
ATOM   1788  O  OG1   . THR A  1 223 ? -84.433  6.786   -82.572  1.00 44.82  ? 223  THR A OG1   1 
ATOM   1789  C  CG2   . THR A  1 223 ? -82.395  6.742   -83.850  1.00 55.46  ? 223  THR A CG2   1 
ATOM   1790  N  N     . ARG A  1 224 ? -85.505  8.664   -86.108  1.00 49.02  ? 224  ARG A N     1 
ATOM   1791  C  CA    . ARG A  1 224 ? -86.748  8.853   -86.832  1.00 50.81  ? 224  ARG A CA    1 
ATOM   1792  C  C     . ARG A  1 224 ? -87.760  7.767   -86.522  1.00 52.16  ? 224  ARG A C     1 
ATOM   1793  O  O     . ARG A  1 224 ? -87.413  6.583   -86.431  1.00 55.40  ? 224  ARG A O     1 
ATOM   1794  C  CB    . ARG A  1 224 ? -86.491  8.889   -88.335  1.00 57.58  ? 224  ARG A CB    1 
ATOM   1795  C  CG    . ARG A  1 224 ? -87.746  9.113   -89.140  1.00 48.52  ? 224  ARG A CG    1 
ATOM   1796  C  CD    . ARG A  1 224 ? -87.442  9.729   -90.501  1.00 73.23  ? 224  ARG A CD    1 
ATOM   1797  N  NE    . ARG A  1 224 ? -87.209  8.792   -91.608  1.00 74.06  ? 224  ARG A NE    1 
ATOM   1798  C  CZ    . ARG A  1 224 ? -87.418  7.470   -91.612  1.00 87.79  ? 224  ARG A CZ    1 
ATOM   1799  N  NH1   . ARG A  1 224 ? -87.159  6.793   -92.728  1.00 59.00  ? 224  ARG A NH1   1 
ATOM   1800  N  NH2   . ARG A  1 224 ? -87.841  6.807   -90.530  1.00 78.78  ? 224  ARG A NH2   1 
ATOM   1801  N  N     . PHE A  1 225 ? -89.013  8.204   -86.411  1.00 52.52  ? 225  PHE A N     1 
ATOM   1802  C  CA    . PHE A  1 225 ? -90.182  7.372   -86.119  1.00 47.71  ? 225  PHE A CA    1 
ATOM   1803  C  C     . PHE A  1 225 ? -90.350  6.263   -87.140  1.00 52.34  ? 225  PHE A C     1 
ATOM   1804  O  O     . PHE A  1 225 ? -89.680  6.246   -88.183  1.00 61.33  ? 225  PHE A O     1 
ATOM   1805  C  CB    . PHE A  1 225 ? -91.447  8.233   -86.193  1.00 55.02  ? 225  PHE A CB    1 
ATOM   1806  C  CG    . PHE A  1 225 ? -91.815  8.646   -87.609  1.00 62.34  ? 225  PHE A CG    1 
ATOM   1807  C  CD1   . PHE A  1 225 ? -91.214  9.745   -88.208  1.00 64.74  ? 225  PHE A CD1   1 
ATOM   1808  C  CD2   . PHE A  1 225 ? -92.697  7.877   -88.372  1.00 70.79  ? 225  PHE A CD2   1 
ATOM   1809  C  CE1   . PHE A  1 225 ? -91.476  10.066  -89.546  1.00 68.91  ? 225  PHE A CE1   1 
ATOM   1810  C  CE2   . PHE A  1 225 ? -92.964  8.190   -89.713  1.00 41.96  ? 225  PHE A CE2   1 
ATOM   1811  C  CZ    . PHE A  1 225 ? -92.351  9.281   -90.296  1.00 49.55  ? 225  PHE A CZ    1 
ATOM   1812  N  N     . ASN A  1 226 ? -91.328  5.402   -86.872  1.00 49.95  ? 226  ASN A N     1 
ATOM   1813  C  CA    . ASN A  1 226 ? -91.669  4.294   -87.762  1.00 48.06  ? 226  ASN A CA    1 
ATOM   1814  C  C     . ASN A  1 226 ? -92.951  3.596   -87.293  1.00 40.16  ? 226  ASN A C     1 
ATOM   1815  O  O     . ASN A  1 226 ? -93.493  3.925   -86.225  1.00 42.84  ? 226  ASN A O     1 
ATOM   1816  C  CB    . ASN A  1 226 ? -90.521  3.288   -87.857  1.00 45.98  ? 226  ASN A CB    1 
ATOM   1817  C  CG    . ASN A  1 226 ? -90.546  2.503   -89.155  1.00 62.98  ? 226  ASN A CG    1 
ATOM   1818  O  OD1   . ASN A  1 226 ? -91.537  2.520   -89.897  1.00 67.51  ? 226  ASN A OD1   1 
ATOM   1819  N  ND2   . ASN A  1 226 ? -89.449  1.816   -89.445  1.00 66.88  ? 226  ASN A ND2   1 
ATOM   1820  N  N     . THR A  1 227 ? -93.445  2.660   -88.108  1.00 33.53  ? 227  THR A N     1 
ATOM   1821  C  CA    . THR A  1 227 ? -94.656  1.912   -87.784  1.00 41.38  ? 227  THR A CA    1 
ATOM   1822  C  C     . THR A  1 227 ? -94.427  1.321   -86.387  1.00 44.89  ? 227  THR A C     1 
ATOM   1823  O  O     . THR A  1 227 ? -93.356  0.785   -86.110  1.00 45.41  ? 227  THR A O     1 
ATOM   1824  C  CB    . THR A  1 227 ? -94.933  0.775   -88.818  1.00 47.59  ? 227  THR A CB    1 
ATOM   1825  O  OG1   . THR A  1 227 ? -94.254  -0.431  -88.423  1.00 68.98  ? 227  THR A OG1   1 
ATOM   1826  C  CG2   . THR A  1 227 ? -94.463  1.177   -90.223  1.00 28.16  ? 227  THR A CG2   1 
ATOM   1827  N  N     . MET A  1 228 ? -95.415  1.451   -85.508  1.00 46.12  ? 228  MET A N     1 
ATOM   1828  C  CA    . MET A  1 228 ? -95.294  0.962   -84.138  1.00 48.07  ? 228  MET A CA    1 
ATOM   1829  C  C     . MET A  1 228 ? -94.430  -0.274  -83.906  1.00 42.61  ? 228  MET A C     1 
ATOM   1830  O  O     . MET A  1 228 ? -93.492  -0.223  -83.117  1.00 57.95  ? 228  MET A O     1 
ATOM   1831  C  CB    . MET A  1 228 ? -96.664  0.745   -83.485  1.00 48.95  ? 228  MET A CB    1 
ATOM   1832  C  CG    . MET A  1 228 ? -96.536  0.340   -82.028  1.00 37.13  ? 228  MET A CG    1 
ATOM   1833  S  SD    . MET A  1 228 ? -98.044  0.089   -81.097  1.00 55.98  ? 228  MET A SD    1 
ATOM   1834  C  CE    . MET A  1 228 ? -98.125  -1.693  -81.055  1.00 41.35  ? 228  MET A CE    1 
ATOM   1835  N  N     . THR A  1 229 ? -94.708  -1.373  -84.593  1.00 44.08  ? 229  THR A N     1 
ATOM   1836  C  CA    . THR A  1 229 ? -93.915  -2.574  -84.349  1.00 49.93  ? 229  THR A CA    1 
ATOM   1837  C  C     . THR A  1 229 ? -92.461  -2.477  -84.799  1.00 44.12  ? 229  THR A C     1 
ATOM   1838  O  O     . THR A  1 229 ? -91.559  -2.829  -84.048  1.00 45.86  ? 229  THR A O     1 
ATOM   1839  C  CB    . THR A  1 229 ? -94.604  -3.839  -84.884  1.00 56.73  ? 229  THR A CB    1 
ATOM   1840  O  OG1   . THR A  1 229 ? -95.804  -4.070  -84.131  1.00 54.92  ? 229  THR A OG1   1 
ATOM   1841  C  CG2   . THR A  1 229 ? -93.699  -5.049  -84.739  1.00 51.47  ? 229  THR A CG2   1 
ATOM   1842  N  N     . LYS A  1 230 ? -92.222  -1.962  -85.996  1.00 47.95  ? 230  LYS A N     1 
ATOM   1843  C  CA    . LYS A  1 230 ? -90.851  -1.813  -86.472  1.00 46.92  ? 230  LYS A CA    1 
ATOM   1844  C  C     . LYS A  1 230 ? -90.071  -0.887  -85.521  1.00 37.78  ? 230  LYS A C     1 
ATOM   1845  O  O     . LYS A  1 230 ? -88.880  -1.091  -85.289  1.00 52.54  ? 230  LYS A O     1 
ATOM   1846  C  CB    . LYS A  1 230 ? -90.846  -1.255  -87.897  1.00 35.77  ? 230  LYS A CB    1 
ATOM   1847  C  CG    . LYS A  1 230 ? -89.548  -1.420  -88.708  0.65 39.61  ? 230  LYS A CG    1 
ATOM   1848  C  CD    . LYS A  1 230 ? -89.881  -1.874  -90.148  0.65 64.52  ? 230  LYS A CD    1 
ATOM   1849  C  CE    . LYS A  1 230 ? -91.039  -1.048  -90.749  0.65 85.44  ? 230  LYS A CE    1 
ATOM   1850  N  NZ    . LYS A  1 230 ? -91.734  -1.681  -91.907  0.65 64.38  ? 230  LYS A NZ    1 
ATOM   1851  N  N     . LYS A  1 231 ? -90.750  0.095   -84.932  1.00 38.97  ? 231  LYS A N     1 
ATOM   1852  C  CA    . LYS A  1 231 ? -90.082  1.012   -84.019  1.00 42.04  ? 231  LYS A CA    1 
ATOM   1853  C  C     . LYS A  1 231 ? -89.617  0.331   -82.737  1.00 41.15  ? 231  LYS A C     1 
ATOM   1854  O  O     . LYS A  1 231 ? -88.478  0.531   -82.317  1.00 63.24  ? 231  LYS A O     1 
ATOM   1855  C  CB    . LYS A  1 231 ? -90.935  2.242   -83.705  1.00 28.92  ? 231  LYS A CB    1 
ATOM   1856  C  CG    . LYS A  1 231 ? -90.131  3.389   -83.069  1.00 42.75  ? 231  LYS A CG    1 
ATOM   1857  C  CD    . LYS A  1 231 ? -88.846  3.683   -83.873  1.00 32.75  ? 231  LYS A CD    1 
ATOM   1858  C  CE    . LYS A  1 231 ? -88.077  4.906   -83.370  1.00 50.32  ? 231  LYS A CE    1 
ATOM   1859  N  NZ    . LYS A  1 231 ? -86.863  5.161   -84.208  1.00 34.20  ? 231  LYS A NZ    1 
ATOM   1860  N  N     . ALA A  1 232 ? -90.475  -0.474  -82.120  1.00 33.98  ? 232  ALA A N     1 
ATOM   1861  C  CA    . ALA A  1 232 ? -90.080  -1.197  -80.904  1.00 47.94  ? 232  ALA A CA    1 
ATOM   1862  C  C     . ALA A  1 232 ? -88.877  -2.116  -81.209  1.00 52.75  ? 232  ALA A C     1 
ATOM   1863  O  O     . ALA A  1 232 ? -88.059  -2.400  -80.327  1.00 59.69  ? 232  ALA A O     1 
ATOM   1864  C  CB    . ALA A  1 232 ? -91.249  -1.997  -80.345  1.00 37.06  ? 232  ALA A CB    1 
ATOM   1865  N  N     . ASP A  1 233 ? -88.780  -2.565  -82.464  1.00 45.24  ? 233  ASP A N     1 
ATOM   1866  C  CA    . ASP A  1 233 ? -87.660  -3.385  -82.923  1.00 48.73  ? 233  ASP A CA    1 
ATOM   1867  C  C     . ASP A  1 233 ? -86.426  -2.484  -82.821  1.00 55.68  ? 233  ASP A C     1 
ATOM   1868  O  O     . ASP A  1 233 ? -85.437  -2.800  -82.139  1.00 52.22  ? 233  ASP A O     1 
ATOM   1869  C  CB    . ASP A  1 233 ? -87.823  -3.745  -84.405  1.00 64.87  ? 233  ASP A CB    1 
ATOM   1870  C  CG    . ASP A  1 233 ? -88.723  -4.947  -84.644  1.00 67.38  ? 233  ASP A CG    1 
ATOM   1871  O  OD1   . ASP A  1 233 ? -89.157  -5.591  -83.663  1.00 41.43  ? 233  ASP A OD1   1 
ATOM   1872  O  OD2   . ASP A  1 233 ? -88.974  -5.251  -85.838  1.00 52.47  ? 233  ASP A OD2   1 
ATOM   1873  N  N     . GLU A  1 234 ? -86.516  -1.354  -83.522  1.00 34.91  ? 234  GLU A N     1 
ATOM   1874  C  CA    . GLU A  1 234 ? -85.459  -0.357  -83.566  1.00 41.13  ? 234  GLU A CA    1 
ATOM   1875  C  C     . GLU A  1 234 ? -85.002  0.053   -82.174  1.00 41.17  ? 234  GLU A C     1 
ATOM   1876  O  O     . GLU A  1 234 ? -83.823  0.345   -81.974  1.00 50.07  ? 234  GLU A O     1 
ATOM   1877  C  CB    . GLU A  1 234 ? -85.919  0.859   -84.362  1.00 29.37  ? 234  GLU A CB    1 
ATOM   1878  C  CG    . GLU A  1 234 ? -86.288  0.525   -85.801  1.00 38.36  ? 234  GLU A CG    1 
ATOM   1879  C  CD    . GLU A  1 234 ? -86.391  1.754   -86.698  1.00 55.50  ? 234  GLU A CD    1 
ATOM   1880  O  OE1   . GLU A  1 234 ? -86.473  2.894   -86.172  1.00 32.22  ? 234  GLU A OE1   1 
ATOM   1881  O  OE2   . GLU A  1 234 ? -86.380  1.576   -87.942  1.00 53.02  ? 234  GLU A OE2   1 
ATOM   1882  N  N     . ILE A  1 235 ? -85.923  0.054   -81.213  1.00 20.75  ? 235  ILE A N     1 
ATOM   1883  C  CA    . ILE A  1 235 ? -85.576  0.402   -79.839  1.00 25.84  ? 235  ILE A CA    1 
ATOM   1884  C  C     . ILE A  1 235 ? -84.584  -0.608  -79.300  1.00 40.12  ? 235  ILE A C     1 
ATOM   1885  O  O     . ILE A  1 235 ? -83.542  -0.243  -78.742  1.00 43.57  ? 235  ILE A O     1 
ATOM   1886  C  CB    . ILE A  1 235 ? -86.812  0.439   -78.931  1.00 25.40  ? 235  ILE A CB    1 
ATOM   1887  C  CG1   . ILE A  1 235 ? -87.563  1.739   -79.160  1.00 38.62  ? 235  ILE A CG1   1 
ATOM   1888  C  CG2   . ILE A  1 235 ? -86.437  0.317   -77.488  1.00 22.03  ? 235  ILE A CG2   1 
ATOM   1889  C  CD1   . ILE A  1 235 ? -86.688  2.959   -79.124  1.00 25.70  ? 235  ILE A CD1   1 
ATOM   1890  N  N     . GLN A  1 236 ? -84.907  -1.880  -79.480  1.00 33.53  ? 236  GLN A N     1 
ATOM   1891  C  CA    . GLN A  1 236 ? -84.021  -2.933  -79.025  1.00 40.09  ? 236  GLN A CA    1 
ATOM   1892  C  C     . GLN A  1 236 ? -82.654  -2.784  -79.695  1.00 48.92  ? 236  GLN A C     1 
ATOM   1893  O  O     . GLN A  1 236 ? -81.619  -2.908  -79.033  1.00 65.86  ? 236  GLN A O     1 
ATOM   1894  C  CB    . GLN A  1 236 ? -84.615  -4.300  -79.339  1.00 25.12  ? 236  GLN A CB    1 
ATOM   1895  C  CG    . GLN A  1 236 ? -85.949  -4.557  -78.696  1.00 18.85  ? 236  GLN A CG    1 
ATOM   1896  C  CD    . GLN A  1 236 ? -85.894  -4.644  -77.182  1.00 48.92  ? 236  GLN A CD    1 
ATOM   1897  O  OE1   . GLN A  1 236 ? -85.742  -3.631  -76.472  1.00 55.42  ? 236  GLN A OE1   1 
ATOM   1898  N  NE2   . GLN A  1 236 ? -86.062  -5.860  -76.669  1.00 33.81  ? 236  GLN A NE2   1 
ATOM   1899  N  N     . ILE A  1 237 ? -82.647  -2.479  -80.992  1.00 29.21  ? 237  ILE A N     1 
ATOM   1900  C  CA    . ILE A  1 237 ? -81.381  -2.308  -81.713  1.00 37.60  ? 237  ILE A CA    1 
ATOM   1901  C  C     . ILE A  1 237 ? -80.616  -1.129  -81.124  1.00 37.61  ? 237  ILE A C     1 
ATOM   1902  O  O     . ILE A  1 237 ? -79.416  -1.216  -80.859  1.00 37.27  ? 237  ILE A O     1 
ATOM   1903  C  CB    . ILE A  1 237 ? -81.621  -2.080  -83.215  1.00 35.53  ? 237  ILE A CB    1 
ATOM   1904  C  CG1   . ILE A  1 237 ? -82.139  -3.379  -83.845  1.00 33.69  ? 237  ILE A CG1   1 
ATOM   1905  C  CG2   . ILE A  1 237 ? -80.348  -1.590  -83.895  1.00 34.13  ? 237  ILE A CG2   1 
ATOM   1906  C  CD1   . ILE A  1 237 ? -82.706  -3.233  -85.248  1.00 71.82  ? 237  ILE A CD1   1 
ATOM   1907  N  N     . TYR A  1 238 ? -81.361  -0.057  -80.907  1.00 27.34  ? 238  TYR A N     1 
ATOM   1908  C  CA    . TYR A  1 238 ? -80.861  1.163   -80.285  1.00 31.11  ? 238  TYR A CA    1 
ATOM   1909  C  C     . TYR A  1 238 ? -80.074  0.843   -79.022  1.00 32.78  ? 238  TYR A C     1 
ATOM   1910  O  O     . TYR A  1 238 ? -78.871  1.099   -78.932  1.00 43.90  ? 238  TYR A O     1 
ATOM   1911  C  CB    . TYR A  1 238 ? -82.010  2.118   -79.998  1.00 24.08  ? 238  TYR A CB    1 
ATOM   1912  C  CG    . TYR A  1 238 ? -81.709  3.483   -79.417  1.00 30.18  ? 238  TYR A CG    1 
ATOM   1913  C  CD1   . TYR A  1 238 ? -81.619  4.600   -80.234  1.00 17.80  ? 238  TYR A CD1   1 
ATOM   1914  C  CD2   . TYR A  1 238 ? -81.515  3.652   -78.052  1.00 32.82  ? 238  TYR A CD2   1 
ATOM   1915  C  CE1   . TYR A  1 238 ? -81.347  5.849   -79.710  1.00 26.50  ? 238  TYR A CE1   1 
ATOM   1916  C  CE2   . TYR A  1 238 ? -81.242  4.897   -77.518  1.00 31.53  ? 238  TYR A CE2   1 
ATOM   1917  C  CZ    . TYR A  1 238 ? -81.159  5.992   -78.351  1.00 28.85  ? 238  TYR A CZ    1 
ATOM   1918  O  OH    . TYR A  1 238 ? -80.888  7.234   -77.824  1.00 27.28  ? 238  TYR A OH    1 
ATOM   1919  N  N     . LYS A  1 239 ? -80.791  0.237   -78.081  1.00 23.92  ? 239  LYS A N     1 
ATOM   1920  C  CA    . LYS A  1 239 ? -80.210  -0.131  -76.791  1.00 46.39  ? 239  LYS A CA    1 
ATOM   1921  C  C     . LYS A  1 239 ? -78.988  -1.011  -76.954  1.00 33.22  ? 239  LYS A C     1 
ATOM   1922  O  O     . LYS A  1 239 ? -78.000  -0.871  -76.233  1.00 36.31  ? 239  LYS A O     1 
ATOM   1923  C  CB    . LYS A  1 239 ? -81.257  -0.836  -75.914  1.00 17.03  ? 239  LYS A CB    1 
ATOM   1924  C  CG    . LYS A  1 239 ? -82.451  0.053   -75.622  1.00 35.70  ? 239  LYS A CG    1 
ATOM   1925  C  CD    . LYS A  1 239 ? -83.615  -0.708  -75.062  1.00 34.00  ? 239  LYS A CD    1 
ATOM   1926  C  CE    . LYS A  1 239 ? -83.760  -0.501  -73.574  1.00 46.25  ? 239  LYS A CE    1 
ATOM   1927  N  NZ    . LYS A  1 239 ? -84.979  -1.212  -73.107  1.00 57.02  ? 239  LYS A NZ    1 
ATOM   1928  N  N     . TYR A  1 240 ? -79.053  -1.909  -77.923  1.00 37.16  ? 240  TYR A N     1 
ATOM   1929  C  CA    . TYR A  1 240 ? -77.945  -2.801  -78.156  1.00 31.38  ? 240  TYR A CA    1 
ATOM   1930  C  C     . TYR A  1 240 ? -76.757  -1.961  -78.584  1.00 37.27  ? 240  TYR A C     1 
ATOM   1931  O  O     . TYR A  1 240 ? -75.737  -1.937  -77.898  1.00 38.74  ? 240  TYR A O     1 
ATOM   1932  C  CB    . TYR A  1 240 ? -78.314  -3.806  -79.227  1.00 28.64  ? 240  TYR A CB    1 
ATOM   1933  C  CG    . TYR A  1 240 ? -77.241  -4.819  -79.510  1.00 41.73  ? 240  TYR A CG    1 
ATOM   1934  C  CD1   . TYR A  1 240 ? -76.843  -5.740  -78.529  1.00 37.07  ? 240  TYR A CD1   1 
ATOM   1935  C  CD2   . TYR A  1 240 ? -76.634  -4.878  -80.769  1.00 35.32  ? 240  TYR A CD2   1 
ATOM   1936  C  CE1   . TYR A  1 240 ? -75.858  -6.703  -78.799  1.00 33.74  ? 240  TYR A CE1   1 
ATOM   1937  C  CE2   . TYR A  1 240 ? -75.657  -5.825  -81.055  1.00 26.79  ? 240  TYR A CE2   1 
ATOM   1938  C  CZ    . TYR A  1 240 ? -75.264  -6.737  -80.074  1.00 42.75  ? 240  TYR A CZ    1 
ATOM   1939  O  OH    . TYR A  1 240 ? -74.256  -7.644  -80.376  1.00 42.43  ? 240  TYR A OH    1 
ATOM   1940  N  N     . VAL A  1 241 ? -76.917  -1.229  -79.683  1.00 35.38  ? 241  VAL A N     1 
ATOM   1941  C  CA    . VAL A  1 241 ? -75.855  -0.371  -80.190  1.00 26.81  ? 241  VAL A CA    1 
ATOM   1942  C  C     . VAL A  1 241 ? -75.303  0.505   -79.083  1.00 26.97  ? 241  VAL A C     1 
ATOM   1943  O  O     . VAL A  1 241 ? -74.095  0.557   -78.888  1.00 29.45  ? 241  VAL A O     1 
ATOM   1944  C  CB    . VAL A  1 241 ? -76.335  0.510   -81.332  1.00 27.66  ? 241  VAL A CB    1 
ATOM   1945  C  CG1   . VAL A  1 241 ? -75.253  1.459   -81.731  1.00 26.63  ? 241  VAL A CG1   1 
ATOM   1946  C  CG2   . VAL A  1 241 ? -76.698  -0.354  -82.517  1.00 51.02  ? 241  VAL A CG2   1 
ATOM   1947  N  N     . VAL A  1 242 ? -76.189  1.132   -78.315  1.00 21.37  ? 242  VAL A N     1 
ATOM   1948  C  CA    . VAL A  1 242 ? -75.768  1.996   -77.205  1.00 28.39  ? 242  VAL A CA    1 
ATOM   1949  C  C     . VAL A  1 242 ? -74.944  1.200   -76.205  1.00 21.43  ? 242  VAL A C     1 
ATOM   1950  O  O     . VAL A  1 242 ? -73.767  1.465   -76.012  1.00 26.81  ? 242  VAL A O     1 
ATOM   1951  C  CB    . VAL A  1 242 ? -76.984  2.640   -76.454  1.00 30.31  ? 242  VAL A CB    1 
ATOM   1952  C  CG1   . VAL A  1 242 ? -76.533  3.275   -75.147  1.00 17.27  ? 242  VAL A CG1   1 
ATOM   1953  C  CG2   . VAL A  1 242 ? -77.653  3.704   -77.316  1.00 40.52  ? 242  VAL A CG2   1 
ATOM   1954  N  N     . HIS A  1 243 ? -75.563  0.197   -75.601  1.00 33.91  ? 243  HIS A N     1 
ATOM   1955  C  CA    . HIS A  1 243 ? -74.895  -0.643  -74.614  1.00 40.01  ? 243  HIS A CA    1 
ATOM   1956  C  C     . HIS A  1 243 ? -73.515  -1.128  -75.016  1.00 32.25  ? 243  HIS A C     1 
ATOM   1957  O  O     . HIS A  1 243 ? -72.580  -1.079  -74.216  1.00 38.11  ? 243  HIS A O     1 
ATOM   1958  C  CB    . HIS A  1 243 ? -75.752  -1.864  -74.304  1.00 14.55  ? 243  HIS A CB    1 
ATOM   1959  C  CG    . HIS A  1 243 ? -76.756  -1.635  -73.221  1.00 23.97  ? 243  HIS A CG    1 
ATOM   1960  N  ND1   . HIS A  1 243 ? -78.053  -2.080  -73.311  1.00 28.83  ? 243  HIS A ND1   1 
ATOM   1961  C  CD2   . HIS A  1 243 ? -76.635  -1.066  -71.999  1.00 25.76  ? 243  HIS A CD2   1 
ATOM   1962  C  CE1   . HIS A  1 243 ? -78.691  -1.802  -72.186  1.00 43.39  ? 243  HIS A CE1   1 
ATOM   1963  N  NE2   . HIS A  1 243 ? -77.854  -1.186  -71.374  1.00 46.78  ? 243  HIS A NE2   1 
ATOM   1964  N  N     . ASN A  1 244 ? -73.412  -1.582  -76.262  1.00 31.56  ? 244  ASN A N     1 
ATOM   1965  C  CA    . ASN A  1 244 ? -72.191  -2.142  -76.819  1.00 30.43  ? 244  ASN A CA    1 
ATOM   1966  C  C     . ASN A  1 244 ? -71.140  -1.157  -77.280  1.00 38.08  ? 244  ASN A C     1 
ATOM   1967  O  O     . ASN A  1 244 ? -69.947  -1.374  -77.061  1.00 47.70  ? 244  ASN A O     1 
ATOM   1968  C  CB    . ASN A  1 244 ? -72.527  -3.149  -77.926  1.00 33.28  ? 244  ASN A CB    1 
ATOM   1969  C  CG    . ASN A  1 244 ? -73.028  -4.478  -77.368  1.00 54.20  ? 244  ASN A CG    1 
ATOM   1970  O  OD1   . ASN A  1 244 ? -74.218  -4.652  -77.110  1.00 56.73  ? 244  ASN A OD1   1 
ATOM   1971  N  ND2   . ASN A  1 244 ? -72.112  -5.412  -77.160  1.00 39.67  ? 244  ASN A ND2   1 
ATOM   1972  N  N     . VAL A  1 245 ? -71.550  -0.101  -77.966  1.00 37.51  ? 245  VAL A N     1 
ATOM   1973  C  CA    . VAL A  1 245 ? -70.574  0.900   -78.381  1.00 31.62  ? 245  VAL A CA    1 
ATOM   1974  C  C     . VAL A  1 245 ? -69.964  1.448   -77.084  1.00 33.06  ? 245  VAL A C     1 
ATOM   1975  O  O     . VAL A  1 245 ? -68.741  1.532   -76.953  1.00 28.04  ? 245  VAL A O     1 
ATOM   1976  C  CB    . VAL A  1 245 ? -71.235  2.008   -79.218  1.00 29.98  ? 245  VAL A CB    1 
ATOM   1977  C  CG1   . VAL A  1 245 ? -70.379  3.241   -79.255  1.00 35.94  ? 245  VAL A CG1   1 
ATOM   1978  C  CG2   . VAL A  1 245 ? -71.448  1.504   -80.628  1.00 44.61  ? 245  VAL A CG2   1 
ATOM   1979  N  N     . ALA A  1 246 ? -70.821  1.694   -76.090  1.00 21.22  ? 246  ALA A N     1 
ATOM   1980  C  CA    . ALA A  1 246 ? -70.385  2.191   -74.785  1.00 27.71  ? 246  ALA A CA    1 
ATOM   1981  C  C     . ALA A  1 246 ? -69.336  1.251   -74.216  1.00 32.14  ? 246  ALA A C     1 
ATOM   1982  O  O     . ALA A  1 246 ? -68.239  1.655   -73.825  1.00 34.15  ? 246  ALA A O     1 
ATOM   1983  C  CB    . ALA A  1 246 ? -71.568  2.262   -73.825  1.00 19.94  ? 246  ALA A CB    1 
ATOM   1984  N  N     . HIS A  1 247 ? -69.684  -0.023  -74.217  1.00 36.28  ? 247  HIS A N     1 
ATOM   1985  C  CA    . HIS A  1 247 ? -68.810  -1.044  -73.698  1.00 37.74  ? 247  HIS A CA    1 
ATOM   1986  C  C     . HIS A  1 247 ? -67.456  -0.994  -74.366  1.00 27.14  ? 247  HIS A C     1 
ATOM   1987  O  O     . HIS A  1 247 ? -66.433  -0.960  -73.686  1.00 39.68  ? 247  HIS A O     1 
ATOM   1988  C  CB    . HIS A  1 247 ? -69.428  -2.405  -73.901  1.00 51.14  ? 247  HIS A CB    1 
ATOM   1989  C  CG    . HIS A  1 247 ? -68.565  -3.509  -73.406  1.00 46.28  ? 247  HIS A CG    1 
ATOM   1990  N  ND1   . HIS A  1 247 ? -68.561  -3.906  -72.088  1.00 58.89  ? 247  HIS A ND1   1 
ATOM   1991  C  CD2   . HIS A  1 247 ? -67.631  -4.257  -74.035  1.00 49.53  ? 247  HIS A CD2   1 
ATOM   1992  C  CE1   . HIS A  1 247 ? -67.657  -4.856  -71.924  1.00 22.96  ? 247  HIS A CE1   1 
ATOM   1993  N  NE2   . HIS A  1 247 ? -67.078  -5.085  -73.090  1.00 47.89  ? 247  HIS A NE2   1 
ATOM   1994  N  N     . ARG A  1 248 ? -67.476  -0.994  -75.696  1.00 34.14  ? 248  ARG A N     1 
ATOM   1995  C  CA    . ARG A  1 248 ? -66.275  -0.927  -76.517  1.00 35.69  ? 248  ARG A CA    1 
ATOM   1996  C  C     . ARG A  1 248 ? -65.460  0.350   -76.270  1.00 35.79  ? 248  ARG A C     1 
ATOM   1997  O  O     . ARG A  1 248 ? -64.317  0.422   -76.670  1.00 36.84  ? 248  ARG A O     1 
ATOM   1998  C  CB    . ARG A  1 248 ? -66.617  -1.012  -78.017  1.00 32.44  ? 248  ARG A CB    1 
ATOM   1999  C  CG    . ARG A  1 248 ? -66.690  -2.429  -78.642  0.54 57.42  ? 248  ARG A CG    1 
ATOM   2000  C  CD    . ARG A  1 248 ? -66.088  -2.441  -80.091  0.54 72.01  ? 248  ARG A CD    1 
ATOM   2001  N  NE    . ARG A  1 248 ? -66.750  -1.515  -81.038  0.54 85.03  ? 248  ARG A NE    1 
ATOM   2002  C  CZ    . ARG A  1 248 ? -66.245  -0.364  -81.516  0.54 66.17  ? 248  ARG A CZ    1 
ATOM   2003  N  NH1   . ARG A  1 248 ? -66.963  0.367   -82.370  0.54 50.22  ? 248  ARG A NH1   1 
ATOM   2004  N  NH2   . ARG A  1 248 ? -65.042  0.074   -81.148  0.54 53.54  ? 248  ARG A NH2   1 
ATOM   2005  N  N     . PHE A  1 249 ? -66.053  1.390   -75.696  1.00 27.02  ? 249  PHE A N     1 
ATOM   2006  C  CA    . PHE A  1 249 ? -65.274  2.604   -75.423  1.00 29.46  ? 249  PHE A CA    1 
ATOM   2007  C  C     . PHE A  1 249 ? -64.892  2.595   -73.968  1.00 38.69  ? 249  PHE A C     1 
ATOM   2008  O  O     . PHE A  1 249 ? -64.534  3.620   -73.398  1.00 37.73  ? 249  PHE A O     1 
ATOM   2009  C  CB    . PHE A  1 249 ? -66.055  3.888   -75.703  1.00 31.62  ? 249  PHE A CB    1 
ATOM   2010  C  CG    . PHE A  1 249 ? -66.046  4.308   -77.138  1.00 41.79  ? 249  PHE A CG    1 
ATOM   2011  C  CD1   . PHE A  1 249 ? -65.693  5.602   -77.482  1.00 29.21  ? 249  PHE A CD1   1 
ATOM   2012  C  CD2   . PHE A  1 249 ? -66.421  3.424   -78.146  1.00 52.14  ? 249  PHE A CD2   1 
ATOM   2013  C  CE1   . PHE A  1 249 ? -65.712  6.020   -78.816  1.00 35.26  ? 249  PHE A CE1   1 
ATOM   2014  C  CE2   . PHE A  1 249 ? -66.446  3.830   -79.480  1.00 57.94  ? 249  PHE A CE2   1 
ATOM   2015  C  CZ    . PHE A  1 249 ? -66.091  5.134   -79.813  1.00 41.01  ? 249  PHE A CZ    1 
ATOM   2016  N  N     . GLY A  1 250 ? -65.000  1.430   -73.353  1.00 37.14  ? 250  GLY A N     1 
ATOM   2017  C  CA    . GLY A  1 250 ? -64.652  1.336   -71.958  1.00 33.47  ? 250  GLY A CA    1 
ATOM   2018  C  C     . GLY A  1 250 ? -65.647  2.060   -71.083  1.00 34.04  ? 250  GLY A C     1 
ATOM   2019  O  O     . GLY A  1 250 ? -65.315  2.523   -69.987  1.00 29.21  ? 250  GLY A O     1 
ATOM   2020  N  N     . LYS A  1 251 ? -66.843  2.272   -71.610  1.00 33.74  ? 251  LYS A N     1 
ATOM   2021  C  CA    . LYS A  1 251 ? -67.868  2.881   -70.796  1.00 28.21  ? 251  LYS A CA    1 
ATOM   2022  C  C     . LYS A  1 251 ? -68.934  1.829   -70.517  1.00 28.28  ? 251  LYS A C     1 
ATOM   2023  O  O     . LYS A  1 251 ? -68.817  0.674   -70.937  1.00 43.22  ? 251  LYS A O     1 
ATOM   2024  C  CB    . LYS A  1 251 ? -68.416  4.150   -71.441  1.00 32.52  ? 251  LYS A CB    1 
ATOM   2025  C  CG    . LYS A  1 251 ? -67.480  5.370   -71.298  1.00 14.44  ? 251  LYS A CG    1 
ATOM   2026  C  CD    . LYS A  1 251 ? -68.237  6.665   -71.526  1.00 45.38  ? 251  LYS A CD    1 
ATOM   2027  C  CE    . LYS A  1 251 ? -67.536  7.854   -70.888  1.00 61.22  ? 251  LYS A CE    1 
ATOM   2028  N  NZ    . LYS A  1 251 ? -67.502  7.632   -69.431  1.00 27.43  ? 251  LYS A NZ    1 
ATOM   2029  N  N     . THR A  1 252 ? -69.894  2.185   -69.687  1.00 35.35  ? 252  THR A N     1 
ATOM   2030  C  CA    . THR A  1 252 ? -70.972  1.274   -69.335  1.00 33.78  ? 252  THR A CA    1 
ATOM   2031  C  C     . THR A  1 252 ? -72.261  2.088   -69.404  1.00 36.52  ? 252  THR A C     1 
ATOM   2032  O  O     . THR A  1 252 ? -72.386  3.104   -68.716  1.00 43.29  ? 252  THR A O     1 
ATOM   2033  C  CB    . THR A  1 252 ? -70.755  0.703   -67.908  1.00 30.36  ? 252  THR A CB    1 
ATOM   2034  O  OG1   . THR A  1 252 ? -71.954  0.087   -67.430  1.00 22.70  ? 252  THR A OG1   1 
ATOM   2035  C  CG2   . THR A  1 252 ? -70.351  1.792   -66.938  1.00 45.08  ? 252  THR A CG2   1 
ATOM   2036  N  N     . ALA A  1 253 ? -73.196  1.684   -70.263  1.00 39.18  ? 253  ALA A N     1 
ATOM   2037  C  CA    . ALA A  1 253 ? -74.456  2.432   -70.392  1.00 34.87  ? 253  ALA A CA    1 
ATOM   2038  C  C     . ALA A  1 253 ? -75.621  1.848   -69.623  1.00 29.28  ? 253  ALA A C     1 
ATOM   2039  O  O     . ALA A  1 253 ? -75.688  0.642   -69.424  1.00 39.28  ? 253  ALA A O     1 
ATOM   2040  C  CB    . ALA A  1 253 ? -74.852  2.561   -71.853  1.00 30.00  ? 253  ALA A CB    1 
ATOM   2041  N  N     . THR A  1 254 ? -76.515  2.715   -69.153  1.00 28.90  ? 254  THR A N     1 
ATOM   2042  C  CA    . THR A  1 254 ? -77.723  2.250   -68.473  1.00 31.04  ? 254  THR A CA    1 
ATOM   2043  C  C     . THR A  1 254 ? -78.971  3.012   -68.892  1.00 39.57  ? 254  THR A C     1 
ATOM   2044  O  O     . THR A  1 254 ? -78.999  4.256   -69.001  1.00 38.46  ? 254  THR A O     1 
ATOM   2045  C  CB    . THR A  1 254 ? -77.641  2.288   -66.940  1.00 27.64  ? 254  THR A CB    1 
ATOM   2046  O  OG1   . THR A  1 254 ? -78.899  1.870   -66.377  1.00 32.52  ? 254  THR A OG1   1 
ATOM   2047  C  CG2   . THR A  1 254 ? -77.352  3.668   -66.467  1.00 30.66  ? 254  THR A CG2   1 
ATOM   2048  N  N     . PHE A  1 255 ? -80.012  2.250   -69.166  1.00 32.02  ? 255  PHE A N     1 
ATOM   2049  C  CA    . PHE A  1 255 ? -81.246  2.898   -69.509  1.00 31.87  ? 255  PHE A CA    1 
ATOM   2050  C  C     . PHE A  1 255 ? -82.166  2.982   -68.305  1.00 20.83  ? 255  PHE A C     1 
ATOM   2051  O  O     . PHE A  1 255 ? -83.332  3.283   -68.448  1.00 34.26  ? 255  PHE A O     1 
ATOM   2052  C  CB    . PHE A  1 255 ? -81.911  2.196   -70.663  1.00 8.94   ? 255  PHE A CB    1 
ATOM   2053  C  CG    . PHE A  1 255 ? -81.217  2.413   -71.966  1.00 19.03  ? 255  PHE A CG    1 
ATOM   2054  C  CD1   . PHE A  1 255 ? -81.535  3.502   -72.763  1.00 32.02  ? 255  PHE A CD1   1 
ATOM   2055  C  CD2   . PHE A  1 255 ? -80.298  1.498   -72.432  1.00 21.73  ? 255  PHE A CD2   1 
ATOM   2056  C  CE1   . PHE A  1 255 ? -80.948  3.663   -74.027  1.00 27.89  ? 255  PHE A CE1   1 
ATOM   2057  C  CE2   . PHE A  1 255 ? -79.705  1.647   -73.690  1.00 39.86  ? 255  PHE A CE2   1 
ATOM   2058  C  CZ    . PHE A  1 255 ? -80.035  2.729   -74.489  1.00 28.91  ? 255  PHE A CZ    1 
ATOM   2059  N  N     . MET A  1 256 ? -81.648  2.749   -67.106  1.00 29.85  ? 256  MET A N     1 
ATOM   2060  C  CA    . MET A  1 256 ? -82.517  2.846   -65.948  1.00 25.67  ? 256  MET A CA    1 
ATOM   2061  C  C     . MET A  1 256 ? -82.940  4.307   -65.815  1.00 29.07  ? 256  MET A C     1 
ATOM   2062  O  O     . MET A  1 256 ? -82.171  5.224   -66.126  1.00 44.60  ? 256  MET A O     1 
ATOM   2063  C  CB    . MET A  1 256 ? -81.867  2.265   -64.688  1.00 32.49  ? 256  MET A CB    1 
ATOM   2064  C  CG    . MET A  1 256 ? -80.837  3.100   -64.028  1.00 31.25  ? 256  MET A CG    1 
ATOM   2065  S  SD    . MET A  1 256 ? -80.203  2.160   -62.682  1.00 40.64  ? 256  MET A SD    1 
ATOM   2066  C  CE    . MET A  1 256 ? -81.519  2.171   -61.475  1.00 23.27  ? 256  MET A CE    1 
ATOM   2067  N  N     . PRO A  1 257 ? -84.223  4.526   -65.512  1.00 30.30  ? 257  PRO A N     1 
ATOM   2068  C  CA    . PRO A  1 257 ? -84.862  5.831   -65.351  1.00 21.25  ? 257  PRO A CA    1 
ATOM   2069  C  C     . PRO A  1 257 ? -84.312  6.865   -64.375  1.00 42.71  ? 257  PRO A C     1 
ATOM   2070  O  O     . PRO A  1 257 ? -84.243  8.065   -64.718  1.00 34.98  ? 257  PRO A O     1 
ATOM   2071  C  CB    . PRO A  1 257 ? -86.323  5.463   -65.060  1.00 28.71  ? 257  PRO A CB    1 
ATOM   2072  C  CG    . PRO A  1 257 ? -86.266  4.058   -64.539  1.00 34.80  ? 257  PRO A CG    1 
ATOM   2073  C  CD    . PRO A  1 257 ? -85.226  3.449   -65.418  1.00 33.70  ? 257  PRO A CD    1 
ATOM   2074  N  N     . LYS A  1 258 ? -83.936  6.436   -63.174  1.00 29.40  ? 258  LYS A N     1 
ATOM   2075  C  CA    . LYS A  1 258 ? -83.428  7.390   -62.185  1.00 26.61  ? 258  LYS A CA    1 
ATOM   2076  C  C     . LYS A  1 258 ? -82.213  6.849   -61.417  1.00 30.11  ? 258  LYS A C     1 
ATOM   2077  O  O     . LYS A  1 258 ? -82.314  6.471   -60.239  1.00 31.23  ? 258  LYS A O     1 
ATOM   2078  C  CB    . LYS A  1 258 ? -84.565  7.778   -61.227  1.00 27.15  ? 258  LYS A CB    1 
ATOM   2079  C  CG    . LYS A  1 258 ? -84.373  9.053   -60.394  1.00 24.48  ? 258  LYS A CG    1 
ATOM   2080  C  CD    . LYS A  1 258 ? -84.280  10.336  -61.235  1.00 38.47  ? 258  LYS A CD    1 
ATOM   2081  C  CE    . LYS A  1 258 ? -84.417  11.614  -60.369  1.00 19.04  ? 258  LYS A CE    1 
ATOM   2082  N  NZ    . LYS A  1 258 ? -84.867  12.724  -61.234  1.00 42.47  ? 258  LYS A NZ    1 
ATOM   2083  N  N     . PRO A  1 259 ? -81.039  6.832   -62.078  1.00 32.45  ? 259  PRO A N     1 
ATOM   2084  C  CA    . PRO A  1 259 ? -79.800  6.334   -61.470  1.00 30.05  ? 259  PRO A CA    1 
ATOM   2085  C  C     . PRO A  1 259 ? -79.375  7.223   -60.331  1.00 14.76  ? 259  PRO A C     1 
ATOM   2086  O  O     . PRO A  1 259 ? -79.199  6.774   -59.192  1.00 38.58  ? 259  PRO A O     1 
ATOM   2087  C  CB    . PRO A  1 259 ? -78.826  6.365   -62.636  1.00 18.41  ? 259  PRO A CB    1 
ATOM   2088  C  CG    . PRO A  1 259 ? -79.318  7.484   -63.472  1.00 27.05  ? 259  PRO A CG    1 
ATOM   2089  C  CD    . PRO A  1 259 ? -80.803  7.316   -63.456  1.00 23.77  ? 259  PRO A CD    1 
ATOM   2090  N  N     A MET A  1 260 ? -79.209  8.505   -60.627  1.00 38.87  ? 260  MET A N     1 
ATOM   2091  C  CA    A MET A  1 260 ? -78.879  9.453   -59.605  1.00 39.18  ? 260  MET A CA    1 
ATOM   2092  C  C     A MET A  1 260 ? -80.115  10.244  -59.241  1.00 43.67  ? 260  MET A C     1 
ATOM   2093  O  O     A MET A  1 260 ? -81.059  10.354  -60.007  1.00 62.96  ? 260  MET A O     1 
ATOM   2094  C  CB    A MET A  1 260 ? -77.821  10.455  -60.057  1.00 20.72  ? 260  MET A CB    1 
ATOM   2095  C  CG    A MET A  1 260 ? -76.474  9.816   -60.343  1.00 40.94  ? 260  MET A CG    1 
ATOM   2096  S  SD    A MET A  1 260 ? -75.423  10.845  -61.390  1.00 39.56  ? 260  MET A SD    1 
ATOM   2097  C  CE    A MET A  1 260 ? -76.275  10.729  -62.962  1.00 9.61   ? 260  MET A CE    1 
ATOM   2098  N  N     A PHE A  1 261 ? -80.061  10.775  -58.041  0.98 14.16  ? 261  PHE A N     1 
ATOM   2099  N  N     B PHE A  1 261 ? -80.174  10.547  -57.979  0.02 41.72  ? 261  PHE A N     1 
ATOM   2100  C  CA    A PHE A  1 261 ? -81.078  11.635  -57.403  0.98 20.45  ? 261  PHE A CA    1 
ATOM   2101  C  CA    B PHE A  1 261 ? -81.292  11.309  -57.448  0.02 39.95  ? 261  PHE A CA    1 
ATOM   2102  C  C     A PHE A  1 261 ? -80.594  13.076  -57.345  0.98 28.34  ? 261  PHE A C     1 
ATOM   2103  C  C     B PHE A  1 261 ? -81.159  12.664  -58.083  0.02 40.18  ? 261  PHE A C     1 
ATOM   2104  O  O     A PHE A  1 261 ? -79.496  13.342  -56.853  0.98 52.48  ? 261  PHE A O     1 
ATOM   2105  O  O     B PHE A  1 261 ? -82.132  13.243  -58.564  0.02 40.25  ? 261  PHE A O     1 
ATOM   2106  C  CB    A PHE A  1 261 ? -81.285  11.225  -55.925  0.98 17.45  ? 261  PHE A CB    1 
ATOM   2107  C  CB    B PHE A  1 261 ? -81.197  11.411  -55.918  0.02 40.09  ? 261  PHE A CB    1 
ATOM   2108  C  CG    A PHE A  1 261 ? -81.947  12.310  -55.034  0.98 38.24  ? 261  PHE A CG    1 
ATOM   2109  C  CG    B PHE A  1 261 ? -81.565  12.768  -55.367  0.02 39.92  ? 261  PHE A CG    1 
ATOM   2110  C  CD1   A PHE A  1 261 ? -83.329  12.545  -55.071  0.98 67.06  ? 261  PHE A CD1   1 
ATOM   2111  C  CD1   B PHE A  1 261 ? -80.582  13.597  -54.839  0.02 40.16  ? 261  PHE A CD1   1 
ATOM   2112  C  CD2   A PHE A  1 261 ? -81.189  13.070  -54.142  0.98 69.89  ? 261  PHE A CD2   1 
ATOM   2113  C  CD2   B PHE A  1 261 ? -82.883  13.222  -55.391  0.02 40.19  ? 261  PHE A CD2   1 
ATOM   2114  C  CE1   A PHE A  1 261 ? -83.937  13.516  -54.232  0.98 52.85  ? 261  PHE A CE1   1 
ATOM   2115  C  CE1   B PHE A  1 261 ? -80.898  14.857  -54.345  0.02 39.89  ? 261  PHE A CE1   1 
ATOM   2116  C  CE2   A PHE A  1 261 ? -81.799  14.049  -53.299  0.98 60.24  ? 261  PHE A CE2   1 
ATOM   2117  C  CE2   B PHE A  1 261 ? -83.209  14.484  -54.898  0.02 40.01  ? 261  PHE A CE2   1 
ATOM   2118  C  CZ    A PHE A  1 261 ? -83.166  14.263  -53.348  0.98 30.75  ? 261  PHE A CZ    1 
ATOM   2119  C  CZ    B PHE A  1 261 ? -82.214  15.303  -54.376  0.02 39.48  ? 261  PHE A CZ    1 
ATOM   2120  N  N     A GLY A  1 262 ? -81.444  14.026  -57.698  0.98 35.31  ? 262  GLY A N     1 
ATOM   2121  N  N     B GLY A  1 262 ? -79.909  13.110  -58.111  0.02 40.50  ? 262  GLY A N     1 
ATOM   2122  C  CA    A GLY A  1 262 ? -80.993  15.405  -57.617  0.98 37.36  ? 262  GLY A CA    1 
ATOM   2123  C  CA    B GLY A  1 262 ? -79.534  14.380  -58.678  0.02 40.25  ? 262  GLY A CA    1 
ATOM   2124  C  C     A GLY A  1 262 ? -80.623  15.971  -58.959  0.98 25.79  ? 262  GLY A C     1 
ATOM   2125  C  C     B GLY A  1 262 ? -80.585  15.253  -59.318  0.02 40.45  ? 262  GLY A C     1 
ATOM   2126  O  O     A GLY A  1 262 ? -80.241  17.138  -59.068  0.98 43.51  ? 262  GLY A O     1 
ATOM   2127  O  O     B GLY A  1 262 ? -81.197  16.083  -58.636  0.02 40.06  ? 262  GLY A O     1 
ATOM   2128  N  N     A ASP A  1 263 ? -80.651  15.137  -59.965  0.98 18.07  ? 263  ASP A N     1 
ATOM   2129  N  N     B ASP A  1 263 ? -80.816  15.065  -60.619  0.02 41.46  ? 263  ASP A N     1 
ATOM   2130  C  CA    A ASP A  1 263 ? -80.384  15.523  -61.317  0.98 17.73  ? 263  ASP A CA    1 
ATOM   2131  C  CA    B ASP A  1 263 ? -81.742  15.937  -61.349  0.02 45.99  ? 263  ASP A CA    1 
ATOM   2132  C  C     A ASP A  1 263 ? -81.378  14.767  -62.150  0.98 12.67  ? 263  ASP A C     1 
ATOM   2133  C  C     B ASP A  1 263 ? -82.392  15.431  -62.658  0.02 52.54  ? 263  ASP A C     1 
ATOM   2134  O  O     A ASP A  1 263 ? -82.067  13.880  -61.668  0.98 32.85  ? 263  ASP A O     1 
ATOM   2135  O  O     B ASP A  1 263 ? -82.424  14.218  -62.868  0.02 45.76  ? 263  ASP A O     1 
ATOM   2136  C  CB    A ASP A  1 263 ? -78.942  15.257  -61.755  0.98 15.55  ? 263  ASP A CB    1 
ATOM   2137  C  CB    B ASP A  1 263 ? -81.000  17.215  -61.706  0.02 41.26  ? 263  ASP A CB    1 
ATOM   2138  C  CG    A ASP A  1 263 ? -78.484  16.199  -62.867  0.98 25.15  ? 263  ASP A CG    1 
ATOM   2139  C  CG    B ASP A  1 263 ? -79.759  17.469  -60.852  0.02 40.32  ? 263  ASP A CG    1 
ATOM   2140  O  OD1   A ASP A  1 263 ? -77.322  16.631  -62.820  0.98 46.29  ? 263  ASP A OD1   1 
ATOM   2141  O  OD1   B ASP A  1 263 ? -78.742  16.784  -61.077  0.02 39.37  ? 263  ASP A OD1   1 
ATOM   2142  O  OD2   A ASP A  1 263 ? -79.279  16.490  -63.769  0.98 37.81  ? 263  ASP A OD2   1 
ATOM   2143  O  OD2   B ASP A  1 263 ? -79.803  18.352  -59.965  0.02 40.64  ? 263  ASP A OD2   1 
ATOM   2144  N  N     A ASN A  1 264 ? -81.427  15.115  -63.388  0.10 9.19   ? 264  ASN A N     1 
ATOM   2145  N  N     B ASN A  1 264 ? -83.020  16.376  -63.417  0.90 78.57  ? 264  ASN A N     1 
ATOM   2146  C  CA    A ASN A  1 264 ? -82.373  14.535  -64.277  0.10 12.01  ? 264  ASN A CA    1 
ATOM   2147  C  CA    B ASN A  1 264 ? -83.597  16.207  -64.683  0.90 79.34  ? 264  ASN A CA    1 
ATOM   2148  C  C     A ASN A  1 264 ? -82.373  13.048  -64.346  0.10 12.08  ? 264  ASN A C     1 
ATOM   2149  C  C     B ASN A  1 264 ? -83.207  14.772  -65.124  0.90 76.97  ? 264  ASN A C     1 
ATOM   2150  O  O     A ASN A  1 264 ? -81.340  12.376  -64.276  0.10 2.00   ? 264  ASN A O     1 
ATOM   2151  O  O     B ASN A  1 264 ? -82.103  14.561  -65.604  0.90 55.95  ? 264  ASN A O     1 
ATOM   2152  C  CB    A ASN A  1 264 ? -82.126  15.079  -65.681  0.10 32.26  ? 264  ASN A CB    1 
ATOM   2153  C  CB    B ASN A  1 264 ? -83.132  17.375  -65.551  0.90 48.98  ? 264  ASN A CB    1 
ATOM   2154  C  CG    A ASN A  1 264 ? -82.957  16.313  -65.959  0.10 31.44  ? 264  ASN A CG    1 
ATOM   2155  C  CG    B ASN A  1 264 ? -83.168  17.146  -67.037  0.90 64.44  ? 264  ASN A CG    1 
ATOM   2156  O  OD1   A ASN A  1 264 ? -83.287  16.594  -67.111  0.10 36.70  ? 264  ASN A OD1   1 
ATOM   2157  O  OD1   B ASN A  1 264 ? -83.687  16.139  -67.512  0.90 69.77  ? 264  ASN A OD1   1 
ATOM   2158  N  ND2   A ASN A  1 264 ? -83.297  17.057  -64.917  0.10 39.19  ? 264  ASN A ND2   1 
ATOM   2159  N  ND2   B ASN A  1 264 ? -82.610  18.095  -67.796  0.90 100.00 ? 264  ASN A ND2   1 
ATOM   2160  N  N     A GLY A  1 265 ? -83.582  12.567  -64.503  0.98 32.98  ? 265  GLY A N     1 
ATOM   2161  N  N     B GLY A  1 265 ? -84.103  13.797  -64.958  0.02 55.39  ? 265  GLY A N     1 
ATOM   2162  C  CA    A GLY A  1 265 ? -83.829  11.198  -64.716  0.98 38.62  ? 265  GLY A CA    1 
ATOM   2163  C  CA    B GLY A  1 265 ? -83.735  12.385  -65.216  0.02 46.41  ? 265  GLY A CA    1 
ATOM   2164  C  C     A GLY A  1 265 ? -83.881  11.068  -66.228  0.98 27.33  ? 265  GLY A C     1 
ATOM   2165  C  C     B GLY A  1 265 ? -83.756  11.880  -66.665  0.02 41.53  ? 265  GLY A C     1 
ATOM   2166  O  O     A GLY A  1 265 ? -84.092  12.051  -66.922  0.98 41.66  ? 265  GLY A O     1 
ATOM   2167  O  O     B GLY A  1 265 ? -83.811  12.676  -67.609  0.02 40.06  ? 265  GLY A O     1 
ATOM   2168  N  N     A SER A  1 266 ? -83.697  9.851   -66.734  0.98 8.02   ? 266  SER A N     1 
ATOM   2169  N  N     B SER A  1 266 ? -83.697  10.538  -66.828  0.02 40.00  ? 266  SER A N     1 
ATOM   2170  C  CA    A SER A  1 266 ? -83.756  9.618   -68.149  0.98 44.82  ? 266  SER A CA    1 
ATOM   2171  C  CA    B SER A  1 266 ? -83.725  9.837   -68.149  0.02 39.41  ? 266  SER A CA    1 
ATOM   2172  C  C     A SER A  1 266 ? -85.120  9.080   -68.466  0.98 45.15  ? 266  SER A C     1 
ATOM   2173  C  C     B SER A  1 266 ? -85.120  9.236   -68.404  0.02 38.18  ? 266  SER A C     1 
ATOM   2174  O  O     A SER A  1 266 ? -85.653  8.243   -67.735  0.98 44.60  ? 266  SER A O     1 
ATOM   2175  O  O     B SER A  1 266 ? -85.653  8.493   -67.579  0.02 39.08  ? 266  SER A O     1 
ATOM   2176  C  CB    A SER A  1 266 ? -82.675  8.616   -68.580  0.98 8.59   ? 266  SER A CB    1 
ATOM   2177  C  CB    B SER A  1 266 ? -82.644  8.772   -68.236  0.02 39.88  ? 266  SER A CB    1 
ATOM   2178  O  OG    A SER A  1 266 ? -81.965  8.112   -67.461  0.98 69.76  ? 266  SER A OG    1 
ATOM   2179  O  OG    B SER A  1 266 ? -82.590  7.987   -67.055  0.02 40.62  ? 266  SER A OG    1 
ATOM   2180  N  N     A GLY A  1 267 ? -85.673  9.566   -69.545  1.00 39.72  ? 267  GLY A N     1 
ATOM   2181  C  CA    A GLY A  1 267 ? -87.011  9.186   -69.946  1.00 34.85  ? 267  GLY A CA    1 
ATOM   2182  C  C     A GLY A  1 267 ? -87.166  8.909   -71.432  1.00 44.11  ? 267  GLY A C     1 
ATOM   2183  O  O     A GLY A  1 267 ? -86.333  9.284   -72.251  1.00 52.38  ? 267  GLY A O     1 
ATOM   2184  N  N     . MET A  1 268 ? -88.255  8.242   -71.784  1.00 48.08  ? 268  MET A N     1 
ATOM   2185  C  CA    . MET A  1 268 ? -88.530  7.930   -73.176  1.00 50.67  ? 268  MET A CA    1 
ATOM   2186  C  C     . MET A  1 268 ? -89.884  8.489   -73.631  1.00 48.38  ? 268  MET A C     1 
ATOM   2187  O  O     . MET A  1 268 ? -90.899  7.795   -73.576  1.00 54.97  ? 268  MET A O     1 
ATOM   2188  C  CB    . MET A  1 268 ? -88.498  6.429   -73.367  1.00 54.00  ? 268  MET A CB    1 
ATOM   2189  C  CG    . MET A  1 268 ? -88.636  5.957   -74.796  1.00 37.28  ? 268  MET A CG    1 
ATOM   2190  S  SD    . MET A  1 268 ? -88.835  4.160   -74.686  1.00 43.73  ? 268  MET A SD    1 
ATOM   2191  C  CE    . MET A  1 268 ? -87.779  3.654   -76.030  1.00 58.93  ? 268  MET A CE    1 
ATOM   2192  N  N     . HIS A  1 269 ? -89.893  9.759   -74.037  1.00 54.27  ? 269  HIS A N     1 
ATOM   2193  C  CA    . HIS A  1 269 ? -91.106  10.431  -74.509  1.00 39.85  ? 269  HIS A CA    1 
ATOM   2194  C  C     . HIS A  1 269 ? -91.588  9.725   -75.765  1.00 53.27  ? 269  HIS A C     1 
ATOM   2195  O  O     . HIS A  1 269 ? -90.773  9.267   -76.589  1.00 41.16  ? 269  HIS A O     1 
ATOM   2196  C  CB    . HIS A  1 269 ? -90.836  11.898  -74.854  1.00 37.60  ? 269  HIS A CB    1 
ATOM   2197  C  CG    . HIS A  1 269 ? -90.141  12.662  -73.773  1.00 57.67  ? 269  HIS A CG    1 
ATOM   2198  N  ND1   . HIS A  1 269 ? -89.461  13.838  -74.017  1.00 34.89  ? 269  HIS A ND1   1 
ATOM   2199  C  CD2   . HIS A  1 269 ? -89.983  12.399  -72.452  1.00 52.51  ? 269  HIS A CD2   1 
ATOM   2200  C  CE1   . HIS A  1 269 ? -88.910  14.257  -72.891  1.00 68.47  ? 269  HIS A CE1   1 
ATOM   2201  N  NE2   . HIS A  1 269 ? -89.211  13.406  -71.926  1.00 37.20  ? 269  HIS A NE2   1 
ATOM   2202  N  N     . CYS A  1 270 ? -92.911  9.663   -75.918  1.00 39.20  ? 270  CYS A N     1 
ATOM   2203  C  CA    . CYS A  1 270 ? -93.503  8.996   -77.060  1.00 37.11  ? 270  CYS A CA    1 
ATOM   2204  C  C     . CYS A  1 270 ? -94.389  9.818   -77.950  1.00 45.33  ? 270  CYS A C     1 
ATOM   2205  O  O     . CYS A  1 270 ? -95.508  10.197  -77.590  1.00 53.63  ? 270  CYS A O     1 
ATOM   2206  C  CB    . CYS A  1 270 ? -94.241  7.749   -76.625  1.00 48.28  ? 270  CYS A CB    1 
ATOM   2207  S  SG    . CYS A  1 270 ? -93.139  6.405   -76.240  1.00 47.02  ? 270  CYS A SG    1 
ATOM   2208  N  N     . HIS A  1 271 ? -93.851  10.089  -79.127  1.00 44.41  ? 271  HIS A N     1 
ATOM   2209  C  CA    . HIS A  1 271 ? -94.546  10.833  -80.149  1.00 49.32  ? 271  HIS A CA    1 
ATOM   2210  C  C     . HIS A  1 271 ? -95.378  9.841   -80.911  1.00 53.43  ? 271  HIS A C     1 
ATOM   2211  O  O     . HIS A  1 271 ? -94.904  8.765   -81.273  1.00 50.60  ? 271  HIS A O     1 
ATOM   2212  C  CB    . HIS A  1 271 ? -93.558  11.507  -81.091  1.00 57.98  ? 271  HIS A CB    1 
ATOM   2213  C  CG    . HIS A  1 271 ? -92.890  12.705  -80.498  1.00 68.47  ? 271  HIS A CG    1 
ATOM   2214  N  ND1   . HIS A  1 271 ? -92.379  13.730  -81.263  1.00 60.85  ? 271  HIS A ND1   1 
ATOM   2215  C  CD2   . HIS A  1 271 ? -92.690  13.061  -79.209  1.00 56.43  ? 271  HIS A CD2   1 
ATOM   2216  C  CE1   . HIS A  1 271 ? -91.897  14.669  -80.471  1.00 63.29  ? 271  HIS A CE1   1 
ATOM   2217  N  NE2   . HIS A  1 271 ? -92.074  14.288  -79.219  1.00 49.29  ? 271  HIS A NE2   1 
ATOM   2218  N  N     . MET A  1 272 ? -96.625  10.212  -81.150  1.00 68.92  ? 272  MET A N     1 
ATOM   2219  C  CA    . MET A  1 272 ? -97.545  9.355   -81.852  1.00 56.81  ? 272  MET A CA    1 
ATOM   2220  C  C     . MET A  1 272 ? -98.466  10.153  -82.736  1.00 63.63  ? 272  MET A C     1 
ATOM   2221  O  O     . MET A  1 272 ? -98.685  11.353  -82.522  1.00 62.42  ? 272  MET A O     1 
ATOM   2222  C  CB    . MET A  1 272 ? -98.386  8.593   -80.843  1.00 37.42  ? 272  MET A CB    1 
ATOM   2223  C  CG    . MET A  1 272 ? -97.692  7.428   -80.204  1.00 36.29  ? 272  MET A CG    1 
ATOM   2224  S  SD    . MET A  1 272 ? -98.545  6.889   -78.705  1.00 55.92  ? 272  MET A SD    1 
ATOM   2225  C  CE    . MET A  1 272 ? -98.607  8.443   -77.832  1.00 15.71  ? 272  MET A CE    1 
ATOM   2226  N  N     . SER A  1 273 ? -99.039  9.439   -83.697  1.00 64.41  ? 273  SER A N     1 
ATOM   2227  C  CA    . SER A  1 273 ? -99.998  9.972   -84.656  1.00 64.19  ? 273  SER A CA    1 
ATOM   2228  C  C     . SER A  1 273 ? -100.499 8.795   -85.477  1.00 64.75  ? 273  SER A C     1 
ATOM   2229  O  O     . SER A  1 273 ? -99.789  7.801   -85.659  1.00 64.39  ? 273  SER A O     1 
ATOM   2230  C  CB    . SER A  1 273 ? -99.346  10.997  -85.585  1.00 65.71  ? 273  SER A CB    1 
ATOM   2231  O  OG    . SER A  1 273 ? -98.470  10.351  -86.485  0.74 67.70  ? 273  SER A OG    1 
ATOM   2232  N  N     . LEU A  1 274 ? -101.727 8.899   -85.964  1.00 72.35  ? 274  LEU A N     1 
ATOM   2233  C  CA    . LEU A  1 274 ? -102.291 7.831   -86.770  1.00 56.37  ? 274  LEU A CA    1 
ATOM   2234  C  C     . LEU A  1 274 ? -102.437 8.274   -88.203  1.00 55.71  ? 274  LEU A C     1 
ATOM   2235  O  O     . LEU A  1 274 ? -102.559 9.466   -88.488  1.00 59.36  ? 274  LEU A O     1 
ATOM   2236  C  CB    . LEU A  1 274 ? -103.628 7.377   -86.201  1.00 41.79  ? 274  LEU A CB    1 
ATOM   2237  C  CG    . LEU A  1 274 ? -103.485 6.533   -84.936  1.00 49.83  ? 274  LEU A CG    1 
ATOM   2238  C  CD1   . LEU A  1 274 ? -104.806 6.405   -84.208  1.00 44.38  ? 274  LEU A CD1   1 
ATOM   2239  C  CD2   . LEU A  1 274 ? -102.935 5.173   -85.310  1.00 67.03  ? 274  LEU A CD2   1 
ATOM   2240  N  N     . ALA A  1 275 ? -102.387 7.308   -89.109  1.00 65.47  ? 275  ALA A N     1 
ATOM   2241  C  CA    . ALA A  1 275 ? -102.510 7.609   -90.526  1.00 80.03  ? 275  ALA A CA    1 
ATOM   2242  C  C     . ALA A  1 275 ? -103.450 6.655   -91.260  1.00 85.95  ? 275  ALA A C     1 
ATOM   2243  O  O     . ALA A  1 275 ? -103.771 5.565   -90.776  1.00 88.51  ? 275  ALA A O     1 
ATOM   2244  C  CB    . ALA A  1 275 ? -101.136 7.609   -91.175  1.00 75.87  ? 275  ALA A CB    1 
ATOM   2245  N  N     . LYS A  1 276 ? -103.904 7.100   -92.426  1.00 89.11  ? 276  LYS A N     1 
ATOM   2246  C  CA    . LYS A  1 276 ? -104.800 6.326   -93.274  1.00 85.53  ? 276  LYS A CA    1 
ATOM   2247  C  C     . LYS A  1 276 ? -104.595 6.850   -94.687  1.00 76.83  ? 276  LYS A C     1 
ATOM   2248  O  O     . LYS A  1 276 ? -104.801 8.034   -94.952  1.00 82.49  ? 276  LYS A O     1 
ATOM   2249  C  CB    . LYS A  1 276 ? -106.259 6.503   -92.825  1.00 79.08  ? 276  LYS A CB    1 
ATOM   2250  C  CG    . LYS A  1 276 ? -107.252 5.474   -93.373  1.00 84.36  ? 276  LYS A CG    1 
ATOM   2251  C  CD    . LYS A  1 276 ? -108.646 5.676   -92.744  1.00 96.73  ? 276  LYS A CD    1 
ATOM   2252  C  CE    . LYS A  1 276 ? -109.657 4.626   -93.202  1.00 94.78  ? 276  LYS A CE    1 
ATOM   2253  N  NZ    . LYS A  1 276 ? -109.251 3.234   -92.817  1.00 99.70  ? 276  LYS A NZ    1 
ATOM   2254  N  N     . ASN A  1 277 ? -104.074 5.985   -95.555  1.00 85.06  ? 277  ASN A N     1 
ATOM   2255  C  CA    . ASN A  1 277 ? -103.818 6.317   -96.956  1.00 83.70  ? 277  ASN A CA    1 
ATOM   2256  C  C     . ASN A  1 277 ? -103.015 7.602   -97.070  1.00 86.05  ? 277  ASN A C     1 
ATOM   2257  O  O     . ASN A  1 277 ? -103.514 8.616   -97.568  1.00 85.45  ? 277  ASN A O     1 
ATOM   2258  C  CB    . ASN A  1 277 ? -105.139 6.459   -97.728  1.00 78.74  ? 277  ASN A CB    1 
ATOM   2259  C  CG    . ASN A  1 277 ? -106.113 5.327   -97.435  0.54 75.12  ? 277  ASN A CG    1 
ATOM   2260  O  OD1   . ASN A  1 277 ? -105.827 4.156   -97.709  0.54 67.48  ? 277  ASN A OD1   1 
ATOM   2261  N  ND2   . ASN A  1 277 ? -107.262 5.670   -96.851  0.54 35.59  ? 277  ASN A ND2   1 
ATOM   2262  N  N     . GLY A  1 278 ? -101.801 7.572   -96.528  1.00 87.90  ? 278  GLY A N     1 
ATOM   2263  C  CA    . GLY A  1 278 ? -100.924 8.731   -96.579  1.00 91.65  ? 278  GLY A CA    1 
ATOM   2264  C  C     . GLY A  1 278 ? -101.404 10.039  -95.959  1.00 88.45  ? 278  GLY A C     1 
ATOM   2265  O  O     . GLY A  1 278 ? -100.713 11.055  -96.089  1.00 93.44  ? 278  GLY A O     1 
ATOM   2266  N  N     . THR A  1 279 ? -102.567 10.036  -95.301  1.00 67.29  ? 279  THR A N     1 
ATOM   2267  C  CA    . THR A  1 279 ? -103.084 11.256  -94.676  1.00 77.01  ? 279  THR A CA    1 
ATOM   2268  C  C     . THR A  1 279 ? -102.943 11.201  -93.162  1.00 80.72  ? 279  THR A C     1 
ATOM   2269  O  O     . THR A  1 279 ? -103.188 10.166  -92.541  1.00 76.15  ? 279  THR A O     1 
ATOM   2270  C  CB    . THR A  1 279 ? -104.555 11.497  -95.014  1.00 71.74  ? 279  THR A CB    1 
ATOM   2271  O  OG1   . THR A  1 279 ? -104.776 11.229  -96.405  0.69 76.56  ? 279  THR A OG1   1 
ATOM   2272  C  CG2   . THR A  1 279 ? -104.922 12.951  -94.709  0.69 57.42  ? 279  THR A CG2   1 
ATOM   2273  N  N     . ASN A  1 280 ? -102.562 12.321  -92.561  1.00 74.97  ? 280  ASN A N     1 
ATOM   2274  C  CA    . ASN A  1 280 ? -102.377 12.347  -91.120  1.00 70.22  ? 280  ASN A CA    1 
ATOM   2275  C  C     . ASN A  1 280 ? -103.657 12.666  -90.367  1.00 71.22  ? 280  ASN A C     1 
ATOM   2276  O  O     . ASN A  1 280 ? -104.021 13.829  -90.176  1.00 84.86  ? 280  ASN A O     1 
ATOM   2277  C  CB    . ASN A  1 280 ? -101.265 13.323  -90.740  1.00 73.67  ? 280  ASN A CB    1 
ATOM   2278  C  CG    . ASN A  1 280 ? -100.901 13.260  -89.260  0.71 65.54  ? 280  ASN A CG    1 
ATOM   2279  O  OD1   . ASN A  1 280 ? -101.648 12.728  -88.433  0.71 50.89  ? 280  ASN A OD1   1 
ATOM   2280  N  ND2   . ASN A  1 280 ? -99.746  13.823  -88.921  0.71 64.49  ? 280  ASN A ND2   1 
ATOM   2281  N  N     . LEU A  1 281 ? -104.294 11.612  -89.880  1.00 57.81  ? 281  LEU A N     1 
ATOM   2282  C  CA    . LEU A  1 281 ? -105.537 11.720  -89.128  1.00 60.99  ? 281  LEU A CA    1 
ATOM   2283  C  C     . LEU A  1 281 ? -105.466 12.575  -87.871  1.00 64.26  ? 281  LEU A C     1 
ATOM   2284  O  O     . LEU A  1 281 ? -106.492 12.842  -87.253  1.00 76.56  ? 281  LEU A O     1 
ATOM   2285  C  CB    . LEU A  1 281 ? -106.043 10.325  -88.743  1.00 64.98  ? 281  LEU A CB    1 
ATOM   2286  C  CG    . LEU A  1 281 ? -106.744 9.503   -89.830  1.00 76.75  ? 281  LEU A CG    1 
ATOM   2287  C  CD1   . LEU A  1 281 ? -105.909 9.442   -91.100  1.00 78.38  ? 281  LEU A CD1   1 
ATOM   2288  C  CD2   . LEU A  1 281 ? -107.041 8.111   -89.311  1.00 75.53  ? 281  LEU A CD2   1 
ATOM   2289  N  N     . PHE A  1 282 ? -104.269 12.989  -87.472  1.00 73.98  ? 282  PHE A N     1 
ATOM   2290  C  CA    . PHE A  1 282 ? -104.137 13.792  -86.262  1.00 69.88  ? 282  PHE A CA    1 
ATOM   2291  C  C     . PHE A  1 282 ? -104.164 15.294  -86.472  1.00 72.30  ? 282  PHE A C     1 
ATOM   2292  O  O     . PHE A  1 282 ? -104.057 16.047  -85.508  1.00 73.42  ? 282  PHE A O     1 
ATOM   2293  C  CB    . PHE A  1 282 ? -102.895 13.387  -85.465  1.00 69.78  ? 282  PHE A CB    1 
ATOM   2294  C  CG    . PHE A  1 282 ? -103.118 12.222  -84.537  1.00 69.24  ? 282  PHE A CG    1 
ATOM   2295  C  CD1   . PHE A  1 282 ? -103.896 11.134  -84.926  1.00 80.05  ? 282  PHE A CD1   1 
ATOM   2296  C  CD2   . PHE A  1 282 ? -102.545 12.212  -83.269  1.00 72.65  ? 282  PHE A CD2   1 
ATOM   2297  C  CE1   . PHE A  1 282 ? -104.100 10.057  -84.066  1.00 68.22  ? 282  PHE A CE1   1 
ATOM   2298  C  CE2   . PHE A  1 282 ? -102.743 11.136  -82.401  1.00 65.19  ? 282  PHE A CE2   1 
ATOM   2299  C  CZ    . PHE A  1 282 ? -103.522 10.058  -82.801  1.00 63.00  ? 282  PHE A CZ    1 
ATOM   2300  N  N     . SER A  1 283 ? -104.284 15.736  -87.722  1.00 75.21  ? 283  SER A N     1 
ATOM   2301  C  CA    . SER A  1 283 ? -104.345 17.172  -87.996  1.00 78.19  ? 283  SER A CA    1 
ATOM   2302  C  C     . SER A  1 283 ? -105.802 17.580  -88.182  1.00 75.12  ? 283  SER A C     1 
ATOM   2303  O  O     . SER A  1 283 ? -106.607 16.815  -88.713  1.00 65.38  ? 283  SER A O     1 
ATOM   2304  C  CB    . SER A  1 283 ? -103.537 17.550  -89.245  1.00 77.30  ? 283  SER A CB    1 
ATOM   2305  O  OG    . SER A  1 283 ? -104.291 17.376  -90.436  1.00 75.10  ? 283  SER A OG    1 
ATOM   2306  N  N     . GLY A  1 284 ? -106.131 18.785  -87.738  1.00 76.96  ? 284  GLY A N     1 
ATOM   2307  C  CA    . GLY A  1 284 ? -107.488 19.279  -87.866  1.00 88.02  ? 284  GLY A CA    1 
ATOM   2308  C  C     . GLY A  1 284 ? -107.529 20.766  -87.605  1.00 93.87  ? 284  GLY A C     1 
ATOM   2309  O  O     . GLY A  1 284 ? -106.534 21.462  -87.818  1.00 100.00 ? 284  GLY A O     1 
ATOM   2310  N  N     . ASP A  1 285 ? -108.664 21.249  -87.107  1.00 92.59  ? 285  ASP A N     1 
ATOM   2311  C  CA    . ASP A  1 285 ? -108.842 22.673  -86.818  1.00 98.86  ? 285  ASP A CA    1 
ATOM   2312  C  C     . ASP A  1 285 ? -109.110 23.002  -85.343  1.00 100.00 ? 285  ASP A C     1 
ATOM   2313  O  O     . ASP A  1 285 ? -109.433 24.148  -84.999  1.00 100.00 ? 285  ASP A O     1 
ATOM   2314  C  CB    . ASP A  1 285 ? -109.943 23.261  -87.712  1.00 83.40  ? 285  ASP A CB    1 
ATOM   2315  C  CG    . ASP A  1 285 ? -111.083 22.279  -87.964  0.57 79.06  ? 285  ASP A CG    1 
ATOM   2316  O  OD1   . ASP A  1 285 ? -111.775 21.873  -86.994  0.57 54.62  ? 285  ASP A OD1   1 
ATOM   2317  O  OD2   . ASP A  1 285 ? -111.274 21.912  -89.147  0.57 70.32  ? 285  ASP A OD2   1 
ATOM   2318  N  N     . LYS A  1 286 ? -108.993 21.997  -84.477  1.00 89.96  ? 286  LYS A N     1 
ATOM   2319  C  CA    . LYS A  1 286 ? -109.162 22.199  -83.043  1.00 78.09  ? 286  LYS A CA    1 
ATOM   2320  C  C     . LYS A  1 286 ? -107.817 22.637  -82.460  1.00 78.19  ? 286  LYS A C     1 
ATOM   2321  O  O     . LYS A  1 286 ? -106.898 23.020  -83.182  1.00 73.31  ? 286  LYS A O     1 
ATOM   2322  C  CB    . LYS A  1 286 ? -109.681 20.940  -82.344  1.00 55.23  ? 286  LYS A CB    1 
ATOM   2323  C  CG    . LYS A  1 286 ? -110.643 20.114  -83.190  0.60 56.73  ? 286  LYS A CG    1 
ATOM   2324  C  CD    . LYS A  1 286 ? -112.075 20.575  -83.058  0.60 67.11  ? 286  LYS A CD    1 
ATOM   2325  C  CE    . LYS A  1 286 ? -113.029 19.577  -83.681  0.60 68.47  ? 286  LYS A CE    1 
ATOM   2326  N  NZ    . LYS A  1 286 ? -112.760 19.371  -85.127  0.60 62.81  ? 286  LYS A NZ    1 
ATOM   2327  N  N     . TYR A  1 287 ? -107.711 22.562  -81.138  1.00 70.48  ? 287  TYR A N     1 
ATOM   2328  C  CA    . TYR A  1 287 ? -106.473 22.976  -80.459  1.00 64.07  ? 287  TYR A CA    1 
ATOM   2329  C  C     . TYR A  1 287 ? -105.141 22.652  -81.153  1.00 57.00  ? 287  TYR A C     1 
ATOM   2330  O  O     . TYR A  1 287 ? -104.887 21.524  -81.572  1.00 62.40  ? 287  TYR A O     1 
ATOM   2331  C  CB    . TYR A  1 287 ? -106.446 22.408  -79.044  1.00 68.06  ? 287  TYR A CB    1 
ATOM   2332  C  CG    . TYR A  1 287 ? -105.364 22.980  -78.159  1.00 67.67  ? 287  TYR A CG    1 
ATOM   2333  C  CD1   . TYR A  1 287 ? -105.611 24.100  -77.376  1.00 89.48  ? 287  TYR A CD1   1 
ATOM   2334  C  CD2   . TYR A  1 287 ? -104.117 22.369  -78.056  1.00 65.71  ? 287  TYR A CD2   1 
ATOM   2335  C  CE1   . TYR A  1 287 ? -104.648 24.598  -76.501  1.00 95.64  ? 287  TYR A CE1   1 
ATOM   2336  C  CE2   . TYR A  1 287 ? -103.145 22.860  -77.184  1.00 58.63  ? 287  TYR A CE2   1 
ATOM   2337  C  CZ    . TYR A  1 287 ? -103.420 23.973  -76.407  1.00 69.90  ? 287  TYR A CZ    1 
ATOM   2338  O  OH    . TYR A  1 287 ? -102.486 24.463  -75.519  1.00 95.19  ? 287  TYR A OH    1 
ATOM   2339  N  N     . ALA A  1 288 ? -104.317 23.672  -81.327  1.00 54.53  ? 288  ALA A N     1 
ATOM   2340  C  CA    . ALA A  1 288 ? -102.998 23.496  -81.923  1.00 65.92  ? 288  ALA A CA    1 
ATOM   2341  C  C     . ALA A  1 288 ? -102.892 22.818  -83.297  1.00 65.48  ? 288  ALA A C     1 
ATOM   2342  O  O     . ALA A  1 288 ? -101.825 22.316  -83.663  1.00 73.98  ? 288  ALA A O     1 
ATOM   2343  C  CB    . ALA A  1 288 ? -102.108 22.781  -80.929  1.00 65.85  ? 288  ALA A CB    1 
ATOM   2344  N  N     . GLY A  1 289 ? -103.973 22.813  -84.064  1.00 60.50  ? 289  GLY A N     1 
ATOM   2345  C  CA    . GLY A  1 289 ? -103.923 22.196  -85.379  1.00 67.72  ? 289  GLY A CA    1 
ATOM   2346  C  C     . GLY A  1 289 ? -104.278 20.720  -85.374  1.00 71.44  ? 289  GLY A C     1 
ATOM   2347  O  O     . GLY A  1 289 ? -104.119 20.028  -86.392  1.00 68.93  ? 289  GLY A O     1 
ATOM   2348  N  N     . LEU A  1 290 ? -104.774 20.259  -84.224  1.00 56.20  ? 290  LEU A N     1 
ATOM   2349  C  CA    . LEU A  1 290 ? -105.178 18.872  -84.006  1.00 59.16  ? 290  LEU A CA    1 
ATOM   2350  C  C     . LEU A  1 290 ? -106.541 18.510  -84.565  1.00 60.02  ? 290  LEU A C     1 
ATOM   2351  O  O     . LEU A  1 290 ? -107.423 19.354  -84.678  1.00 80.43  ? 290  LEU A O     1 
ATOM   2352  C  CB    . LEU A  1 290 ? -105.224 18.570  -82.506  1.00 64.26  ? 290  LEU A CB    1 
ATOM   2353  C  CG    . LEU A  1 290 ? -103.924 18.386  -81.729  1.00 65.01  ? 290  LEU A CG    1 
ATOM   2354  C  CD1   . LEU A  1 290 ? -104.236 18.158  -80.256  1.00 66.38  ? 290  LEU A CD1   1 
ATOM   2355  C  CD2   . LEU A  1 290 ? -103.179 17.197  -82.296  1.00 65.57  ? 290  LEU A CD2   1 
ATOM   2356  N  N     . SER A  1 291 ? -106.720 17.232  -84.869  1.00 56.24  ? 291  SER A N     1 
ATOM   2357  C  CA    . SER A  1 291 ? -107.996 16.738  -85.351  1.00 60.12  ? 291  SER A CA    1 
ATOM   2358  C  C     . SER A  1 291 ? -108.815 16.314  -84.135  1.00 65.88  ? 291  SER A C     1 
ATOM   2359  O  O     . SER A  1 291 ? -108.310 16.235  -83.010  1.00 55.98  ? 291  SER A O     1 
ATOM   2360  C  CB    . SER A  1 291 ? -107.812 15.523  -86.263  1.00 56.77  ? 291  SER A CB    1 
ATOM   2361  O  OG    . SER A  1 291 ? -107.547 14.355  -85.504  1.00 71.38  ? 291  SER A OG    1 
ATOM   2362  N  N     . GLU A  1 292 ? -110.082 16.016  -84.383  1.00 82.50  ? 292  GLU A N     1 
ATOM   2363  C  CA    . GLU A  1 292 ? -110.982 15.572  -83.339  1.00 84.48  ? 292  GLU A CA    1 
ATOM   2364  C  C     . GLU A  1 292 ? -110.384 14.268  -82.832  1.00 76.30  ? 292  GLU A C     1 
ATOM   2365  O  O     . GLU A  1 292 ? -110.141 14.106  -81.639  1.00 77.32  ? 292  GLU A O     1 
ATOM   2366  C  CB    . GLU A  1 292 ? -112.365 15.337  -83.945  1.00 98.90  ? 292  GLU A CB    1 
ATOM   2367  C  CG    . GLU A  1 292 ? -113.461 15.028  -82.947  0.59 80.68  ? 292  GLU A CG    1 
ATOM   2368  C  CD    . GLU A  1 292 ? -114.815 14.890  -83.618  0.59 74.79  ? 292  GLU A CD    1 
ATOM   2369  O  OE1   . GLU A  1 292 ? -115.543 15.907  -83.673  0.59 57.69  ? 292  GLU A OE1   1 
ATOM   2370  O  OE2   . GLU A  1 292 ? -115.137 13.772  -84.094  0.59 48.47  ? 292  GLU A OE2   1 
ATOM   2371  N  N     . GLN A  1 293 ? -110.044 13.409  -83.788  1.00 73.48  ? 293  GLN A N     1 
ATOM   2372  C  CA    . GLN A  1 293 ? -109.447 12.092  -83.565  1.00 80.68  ? 293  GLN A CA    1 
ATOM   2373  C  C     . GLN A  1 293 ? -108.380 12.082  -82.461  1.00 82.93  ? 293  GLN A C     1 
ATOM   2374  O  O     . GLN A  1 293 ? -108.468 11.325  -81.484  1.00 68.92  ? 293  GLN A O     1 
ATOM   2375  C  CB    . GLN A  1 293 ? -108.801 11.630  -84.876  1.00 90.36  ? 293  GLN A CB    1 
ATOM   2376  C  CG    . GLN A  1 293 ? -108.619 10.124  -85.030  0.44 67.46  ? 293  GLN A CG    1 
ATOM   2377  C  CD    . GLN A  1 293 ? -109.712 9.487   -85.887  0.44 75.60  ? 293  GLN A CD    1 
ATOM   2378  O  OE1   . GLN A  1 293 ? -109.443 8.577   -86.684  0.44 72.11  ? 293  GLN A OE1   1 
ATOM   2379  N  NE2   . GLN A  1 293 ? -110.951 9.970   -85.734  0.44 55.19  ? 293  GLN A NE2   1 
ATOM   2380  N  N     . ALA A  1 294 ? -107.367 12.924  -82.648  1.00 73.34  ? 294  ALA A N     1 
ATOM   2381  C  CA    . ALA A  1 294 ? -106.262 13.051  -81.717  1.00 54.30  ? 294  ALA A CA    1 
ATOM   2382  C  C     . ALA A  1 294 ? -106.729 13.270  -80.284  1.00 62.94  ? 294  ALA A C     1 
ATOM   2383  O  O     . ALA A  1 294 ? -106.258 12.603  -79.356  1.00 58.70  ? 294  ALA A O     1 
ATOM   2384  C  CB    . ALA A  1 294 ? -105.365 14.188  -82.150  1.00 40.15  ? 294  ALA A CB    1 
ATOM   2385  N  N     . LEU A  1 295 ? -107.674 14.185  -80.105  1.00 56.96  ? 295  LEU A N     1 
ATOM   2386  C  CA    . LEU A  1 295 ? -108.144 14.477  -78.769  1.00 57.83  ? 295  LEU A CA    1 
ATOM   2387  C  C     . LEU A  1 295 ? -108.836 13.308  -78.092  1.00 56.73  ? 295  LEU A C     1 
ATOM   2388  O  O     . LEU A  1 295 ? -108.807 13.184  -76.873  1.00 61.21  ? 295  LEU A O     1 
ATOM   2389  C  CB    . LEU A  1 295 ? -108.961 15.748  -78.794  1.00 53.31  ? 295  LEU A CB    1 
ATOM   2390  C  CG    . LEU A  1 295 ? -108.146 16.990  -79.132  1.00 78.26  ? 295  LEU A CG    1 
ATOM   2391  C  CD1   . LEU A  1 295 ? -108.658 17.650  -80.403  1.00 75.45  ? 295  LEU A CD1   1 
ATOM   2392  C  CD2   . LEU A  1 295 ? -108.174 17.990  -77.979  1.00 54.33  ? 295  LEU A CD2   1 
ATOM   2393  N  N     . TYR A  1 296 ? -109.463 12.443  -78.877  1.00 41.00  ? 296  TYR A N     1 
ATOM   2394  C  CA    . TYR A  1 296 ? -110.077 11.261  -78.300  1.00 68.76  ? 296  TYR A CA    1 
ATOM   2395  C  C     . TYR A  1 296 ? -108.959 10.311  -77.866  1.00 70.30  ? 296  TYR A C     1 
ATOM   2396  O  O     . TYR A  1 296 ? -109.027 9.708   -76.789  1.00 61.43  ? 296  TYR A O     1 
ATOM   2397  C  CB    . TYR A  1 296 ? -111.027 10.607  -79.298  1.00 73.44  ? 296  TYR A CB    1 
ATOM   2398  C  CG    . TYR A  1 296 ? -112.340 11.352  -79.409  0.64 69.23  ? 296  TYR A CG    1 
ATOM   2399  C  CD1   . TYR A  1 296 ? -112.946 11.904  -78.273  0.64 52.63  ? 296  TYR A CD1   1 
ATOM   2400  C  CD2   . TYR A  1 296 ? -112.967 11.525  -80.644  0.64 62.60  ? 296  TYR A CD2   1 
ATOM   2401  C  CE1   . TYR A  1 296 ? -114.140 12.611  -78.362  0.64 43.73  ? 296  TYR A CE1   1 
ATOM   2402  C  CE2   . TYR A  1 296 ? -114.165 12.230  -80.745  0.64 60.19  ? 296  TYR A CE2   1 
ATOM   2403  C  CZ    . TYR A  1 296 ? -114.746 12.772  -79.601  0.64 65.64  ? 296  TYR A CZ    1 
ATOM   2404  O  OH    . TYR A  1 296 ? -115.926 13.479  -79.702  0.64 72.90  ? 296  TYR A OH    1 
ATOM   2405  N  N     . TYR A  1 297 ? -107.901 10.248  -78.679  1.00 65.70  ? 297  TYR A N     1 
ATOM   2406  C  CA    . TYR A  1 297 ? -106.731 9.419   -78.390  1.00 52.86  ? 297  TYR A CA    1 
ATOM   2407  C  C     . TYR A  1 297 ? -106.218 9.887   -77.034  1.00 58.36  ? 297  TYR A C     1 
ATOM   2408  O  O     . TYR A  1 297 ? -106.113 9.096   -76.087  1.00 51.22  ? 297  TYR A O     1 
ATOM   2409  C  CB    . TYR A  1 297 ? -105.651 9.654   -79.449  1.00 47.42  ? 297  TYR A CB    1 
ATOM   2410  C  CG    . TYR A  1 297 ? -104.622 8.547   -79.573  1.00 67.59  ? 297  TYR A CG    1 
ATOM   2411  C  CD1   . TYR A  1 297 ? -104.815 7.491   -80.467  1.00 66.13  ? 297  TYR A CD1   1 
ATOM   2412  C  CD2   . TYR A  1 297 ? -103.440 8.572   -78.830  1.00 57.90  ? 297  TYR A CD2   1 
ATOM   2413  C  CE1   . TYR A  1 297 ? -103.859 6.485   -80.625  1.00 75.98  ? 297  TYR A CE1   1 
ATOM   2414  C  CE2   . TYR A  1 297 ? -102.472 7.568   -78.978  1.00 68.64  ? 297  TYR A CE2   1 
ATOM   2415  C  CZ    . TYR A  1 297 ? -102.687 6.526   -79.881  1.00 78.30  ? 297  TYR A CZ    1 
ATOM   2416  O  OH    . TYR A  1 297 ? -101.732 5.532   -80.051  1.00 60.73  ? 297  TYR A OH    1 
ATOM   2417  N  N     . ILE A  1 298 ? -105.979 11.197  -76.940  1.00 39.74  ? 298  ILE A N     1 
ATOM   2418  C  CA    . ILE A  1 298 ? -105.500 11.824  -75.718  1.00 28.87  ? 298  ILE A CA    1 
ATOM   2419  C  C     . ILE A  1 298 ? -106.378 11.490  -74.530  1.00 44.31  ? 298  ILE A C     1 
ATOM   2420  O  O     . ILE A  1 298 ? -105.892 11.202  -73.438  1.00 41.21  ? 298  ILE A O     1 
ATOM   2421  C  CB    . ILE A  1 298 ? -105.479 13.335  -75.846  1.00 32.76  ? 298  ILE A CB    1 
ATOM   2422  C  CG1   . ILE A  1 298 ? -104.598 13.736  -77.034  1.00 36.91  ? 298  ILE A CG1   1 
ATOM   2423  C  CG2   . ILE A  1 298 ? -105.032 13.967  -74.501  1.00 23.36  ? 298  ILE A CG2   1 
ATOM   2424  C  CD1   . ILE A  1 298 ? -104.050 15.157  -76.955  1.00 35.17  ? 298  ILE A CD1   1 
ATOM   2425  N  N     . GLY A  1 299 ? -107.682 11.546  -74.753  1.00 48.75  ? 299  GLY A N     1 
ATOM   2426  C  CA    . GLY A  1 299 ? -108.613 11.239  -73.689  1.00 62.55  ? 299  GLY A CA    1 
ATOM   2427  C  C     . GLY A  1 299 ? -108.433 9.817   -73.214  1.00 54.57  ? 299  GLY A C     1 
ATOM   2428  O  O     . GLY A  1 299 ? -108.458 9.555   -72.009  1.00 56.43  ? 299  GLY A O     1 
ATOM   2429  N  N     . GLY A  1 300 ? -108.230 8.904   -74.167  1.00 44.62  ? 300  GLY A N     1 
ATOM   2430  C  CA    . GLY A  1 300 ? -108.043 7.504   -73.829  1.00 42.36  ? 300  GLY A CA    1 
ATOM   2431  C  C     . GLY A  1 300 ? -106.780 7.312   -73.015  1.00 60.30  ? 300  GLY A C     1 
ATOM   2432  O  O     . GLY A  1 300 ? -106.801 6.723   -71.919  1.00 49.84  ? 300  GLY A O     1 
ATOM   2433  N  N     . VAL A  1 301 ? -105.683 7.851   -73.544  1.00 48.50  ? 301  VAL A N     1 
ATOM   2434  C  CA    . VAL A  1 301 ? -104.389 7.767   -72.889  1.00 42.90  ? 301  VAL A CA    1 
ATOM   2435  C  C     . VAL A  1 301 ? -104.510 8.270   -71.459  1.00 44.53  ? 301  VAL A C     1 
ATOM   2436  O  O     . VAL A  1 301 ? -104.079 7.611   -70.515  1.00 44.92  ? 301  VAL A O     1 
ATOM   2437  C  CB    . VAL A  1 301 ? -103.339 8.603   -73.626  1.00 41.17  ? 301  VAL A CB    1 
ATOM   2438  C  CG1   . VAL A  1 301 ? -102.025 8.498   -72.926  1.00 52.62  ? 301  VAL A CG1   1 
ATOM   2439  C  CG2   . VAL A  1 301 ? -103.191 8.131   -75.066  1.00 56.28  ? 301  VAL A CG2   1 
ATOM   2440  N  N     . ILE A  1 302 ? -105.142 9.425   -71.304  1.00 27.63  ? 302  ILE A N     1 
ATOM   2441  C  CA    . ILE A  1 302 ? -105.337 9.998   -69.983  1.00 34.13  ? 302  ILE A CA    1 
ATOM   2442  C  C     . ILE A  1 302 ? -106.220 9.111   -69.101  1.00 42.66  ? 302  ILE A C     1 
ATOM   2443  O  O     . ILE A  1 302 ? -106.007 9.015   -67.889  1.00 45.81  ? 302  ILE A O     1 
ATOM   2444  C  CB    . ILE A  1 302 ? -105.984 11.398  -70.058  1.00 37.42  ? 302  ILE A CB    1 
ATOM   2445  C  CG1   . ILE A  1 302 ? -105.116 12.337  -70.899  1.00 40.29  ? 302  ILE A CG1   1 
ATOM   2446  C  CG2   . ILE A  1 302 ? -106.178 11.959  -68.648  1.00 20.68  ? 302  ILE A CG2   1 
ATOM   2447  C  CD1   . ILE A  1 302 ? -105.450 13.805  -70.744  1.00 70.76  ? 302  ILE A CD1   1 
ATOM   2448  N  N     . LYS A  1 303 ? -107.208 8.457   -69.705  1.00 48.26  ? 303  LYS A N     1 
ATOM   2449  C  CA    . LYS A  1 303 ? -108.102 7.617   -68.927  1.00 55.62  ? 303  LYS A CA    1 
ATOM   2450  C  C     . LYS A  1 303 ? -107.390 6.399   -68.378  1.00 60.10  ? 303  LYS A C     1 
ATOM   2451  O  O     . LYS A  1 303 ? -107.485 6.096   -67.184  1.00 51.22  ? 303  LYS A O     1 
ATOM   2452  C  CB    . LYS A  1 303 ? -109.322 7.172   -69.749  1.00 58.42  ? 303  LYS A CB    1 
ATOM   2453  C  CG    . LYS A  1 303 ? -110.303 6.307   -68.933  0.60 54.54  ? 303  LYS A CG    1 
ATOM   2454  C  CD    . LYS A  1 303 ? -111.587 5.980   -69.684  0.60 51.38  ? 303  LYS A CD    1 
ATOM   2455  C  CE    . LYS A  1 303 ? -112.565 5.204   -68.798  0.60 55.66  ? 303  LYS A CE    1 
ATOM   2456  N  NZ    . LYS A  1 303 ? -113.894 4.959   -69.455  0.60 40.79  ? 303  LYS A NZ    1 
ATOM   2457  N  N     . HIS A  1 304 ? -106.631 5.747   -69.252  1.00 59.48  ? 304  HIS A N     1 
ATOM   2458  C  CA    . HIS A  1 304 ? -105.913 4.525   -68.909  1.00 71.02  ? 304  HIS A CA    1 
ATOM   2459  C  C     . HIS A  1 304 ? -104.484 4.701   -68.406  1.00 70.34  ? 304  HIS A C     1 
ATOM   2460  O  O     . HIS A  1 304 ? -103.769 3.721   -68.191  1.00 66.39  ? 304  HIS A O     1 
ATOM   2461  C  CB    . HIS A  1 304 ? -105.912 3.613   -70.127  1.00 67.34  ? 304  HIS A CB    1 
ATOM   2462  C  CG    . HIS A  1 304 ? -107.274 3.372   -70.691  1.00 71.54  ? 304  HIS A CG    1 
ATOM   2463  N  ND1   . HIS A  1 304 ? -108.321 2.899   -69.928  1.00 56.81  ? 304  HIS A ND1   1 
ATOM   2464  C  CD2   . HIS A  1 304 ? -107.763 3.533   -71.943  1.00 76.19  ? 304  HIS A CD2   1 
ATOM   2465  C  CE1   . HIS A  1 304 ? -109.393 2.775   -70.686  1.00 54.71  ? 304  HIS A CE1   1 
ATOM   2466  N  NE2   . HIS A  1 304 ? -109.082 3.154   -71.914  1.00 68.73  ? 304  HIS A NE2   1 
ATOM   2467  N  N     . ALA A  1 305 ? -104.081 5.947   -68.207  1.00 55.25  ? 305  ALA A N     1 
ATOM   2468  C  CA    . ALA A  1 305 ? -102.739 6.265   -67.752  1.00 52.58  ? 305  ALA A CA    1 
ATOM   2469  C  C     . ALA A  1 305 ? -102.121 5.304   -66.732  1.00 51.50  ? 305  ALA A C     1 
ATOM   2470  O  O     . ALA A  1 305 ? -101.152 4.612   -67.052  1.00 55.79  ? 305  ALA A O     1 
ATOM   2471  C  CB    . ALA A  1 305 ? -102.698 7.681   -67.238  1.00 39.29  ? 305  ALA A CB    1 
ATOM   2472  N  N     . LYS A  1 306 ? -102.694 5.223   -65.532  1.00 36.93  ? 306  LYS A N     1 
ATOM   2473  C  CA    . LYS A  1 306 ? -102.141 4.340   -64.512  1.00 41.36  ? 306  LYS A CA    1 
ATOM   2474  C  C     . LYS A  1 306 ? -101.905 2.903   -65.001  1.00 50.98  ? 306  LYS A C     1 
ATOM   2475  O  O     . LYS A  1 306 ? -100.925 2.257   -64.625  1.00 59.83  ? 306  LYS A O     1 
ATOM   2476  C  CB    . LYS A  1 306 ? -103.016 4.338   -63.262  1.00 35.14  ? 306  LYS A CB    1 
ATOM   2477  C  CG    . LYS A  1 306 ? -103.115 5.670   -62.567  0.87 25.89  ? 306  LYS A CG    1 
ATOM   2478  C  CD    . LYS A  1 306 ? -103.917 5.525   -61.279  0.87 51.92  ? 306  LYS A CD    1 
ATOM   2479  C  CE    . LYS A  1 306 ? -104.335 6.864   -60.717  0.87 51.08  ? 306  LYS A CE    1 
ATOM   2480  N  NZ    . LYS A  1 306 ? -103.155 7.711   -60.380  0.87 75.12  ? 306  LYS A NZ    1 
ATOM   2481  N  N     . ALA A  1 307 ? -102.787 2.406   -65.855  1.00 46.80  ? 307  ALA A N     1 
ATOM   2482  C  CA    . ALA A  1 307 ? -102.618 1.060   -66.360  1.00 41.99  ? 307  ALA A CA    1 
ATOM   2483  C  C     . ALA A  1 307 ? -101.464 1.090   -67.327  1.00 37.97  ? 307  ALA A C     1 
ATOM   2484  O  O     . ALA A  1 307 ? -100.578 0.232   -67.266  1.00 47.48  ? 307  ALA A O     1 
ATOM   2485  C  CB    . ALA A  1 307 ? -103.874 0.577   -67.042  1.00 51.78  ? 307  ALA A CB    1 
ATOM   2486  N  N     . ILE A  1 308 ? -101.453 2.087   -68.207  1.00 30.20  ? 308  ILE A N     1 
ATOM   2487  C  CA    . ILE A  1 308 ? -100.358 2.208   -69.170  1.00 38.32  ? 308  ILE A CA    1 
ATOM   2488  C  C     . ILE A  1 308 ? -99.024  2.313   -68.425  1.00 44.49  ? 308  ILE A C     1 
ATOM   2489  O  O     . ILE A  1 308 ? -98.012  1.766   -68.866  1.00 37.29  ? 308  ILE A O     1 
ATOM   2490  C  CB    . ILE A  1 308 ? -100.508 3.424   -70.080  1.00 37.96  ? 308  ILE A CB    1 
ATOM   2491  C  CG1   . ILE A  1 308 ? -101.919 3.468   -70.674  1.00 42.95  ? 308  ILE A CG1   1 
ATOM   2492  C  CG2   . ILE A  1 308 ? -99.498  3.326   -71.202  1.00 34.14  ? 308  ILE A CG2   1 
ATOM   2493  C  CD1   . ILE A  1 308 ? -102.164 4.647   -71.606  1.00 43.22  ? 308  ILE A CD1   1 
ATOM   2494  N  N     . ASN A  1 309 ? -99.039  2.983   -67.274  1.00 39.11  ? 309  ASN A N     1 
ATOM   2495  C  CA    . ASN A  1 309 ? -97.841  3.123   -66.451  1.00 34.40  ? 309  ASN A CA    1 
ATOM   2496  C  C     . ASN A  1 309 ? -97.162  1.782   -66.253  1.00 32.85  ? 309  ASN A C     1 
ATOM   2497  O  O     . ASN A  1 309 ? -95.985  1.641   -66.558  1.00 47.24  ? 309  ASN A O     1 
ATOM   2498  C  CB    . ASN A  1 309 ? -98.169  3.740   -65.094  1.00 30.22  ? 309  ASN A CB    1 
ATOM   2499  C  CG    . ASN A  1 309 ? -98.310  5.258   -65.161  1.00 65.22  ? 309  ASN A CG    1 
ATOM   2500  O  OD1   . ASN A  1 309 ? -99.002  5.877   -64.329  1.00 35.81  ? 309  ASN A OD1   1 
ATOM   2501  N  ND2   . ASN A  1 309 ? -97.632  5.873   -66.148  1.00 24.04  ? 309  ASN A ND2   1 
ATOM   2502  N  N     . ALA A  1 310 ? -97.920  0.785   -65.810  1.00 36.44  ? 310  ALA A N     1 
ATOM   2503  C  CA    . ALA A  1 310 ? -97.387  -0.559  -65.604  1.00 42.01  ? 310  ALA A CA    1 
ATOM   2504  C  C     . ALA A  1 310 ? -96.554  -1.066  -66.793  1.00 45.39  ? 310  ALA A C     1 
ATOM   2505  O  O     . ALA A  1 310 ? -95.652  -1.882  -66.613  1.00 43.10  ? 310  ALA A O     1 
ATOM   2506  C  CB    . ALA A  1 310 ? -98.514  -1.536  -65.289  1.00 39.03  ? 310  ALA A CB    1 
ATOM   2507  N  N     . LEU A  1 311 ? -96.838  -0.589  -68.001  1.00 42.35  ? 311  LEU A N     1 
ATOM   2508  C  CA    . LEU A  1 311 ? -96.051  -1.024  -69.154  1.00 47.69  ? 311  LEU A CA    1 
ATOM   2509  C  C     . LEU A  1 311 ? -94.928  -0.080  -69.527  1.00 47.31  ? 311  LEU A C     1 
ATOM   2510  O  O     . LEU A  1 311 ? -93.843  -0.525  -69.902  1.00 54.61  ? 311  LEU A O     1 
ATOM   2511  C  CB    . LEU A  1 311 ? -96.927  -1.209  -70.376  1.00 57.32  ? 311  LEU A CB    1 
ATOM   2512  C  CG    . LEU A  1 311 ? -98.003  -2.254  -70.224  1.00 48.73  ? 311  LEU A CG    1 
ATOM   2513  C  CD1   . LEU A  1 311 ? -98.257  -2.794  -71.600  1.00 78.27  ? 311  LEU A CD1   1 
ATOM   2514  C  CD2   . LEU A  1 311 ? -97.536  -3.358  -69.324  1.00 30.89  ? 311  LEU A CD2   1 
ATOM   2515  N  N     . ALA A  1 312 ? -95.219  1.217   -69.449  1.00 34.10  ? 312  ALA A N     1 
ATOM   2516  C  CA    . ALA A  1 312 ? -94.277  2.270   -69.793  1.00 43.30  ? 312  ALA A CA    1 
ATOM   2517  C  C     . ALA A  1 312 ? -93.446  2.797   -68.617  1.00 43.16  ? 312  ALA A C     1 
ATOM   2518  O  O     . ALA A  1 312 ? -92.684  3.749   -68.776  1.00 49.34  ? 312  ALA A O     1 
ATOM   2519  C  CB    . ALA A  1 312 ? -95.021  3.411   -70.448  1.00 33.11  ? 312  ALA A CB    1 
ATOM   2520  N  N     . ASN A  1 313 ? -93.620  2.206   -67.436  1.00 34.37  ? 313  ASN A N     1 
ATOM   2521  C  CA    . ASN A  1 313 ? -92.902  2.601   -66.211  1.00 28.60  ? 313  ASN A CA    1 
ATOM   2522  C  C     . ASN A  1 313 ? -92.949  1.357   -65.324  1.00 39.62  ? 313  ASN A C     1 
ATOM   2523  O  O     . ASN A  1 313 ? -93.420  1.431   -64.186  1.00 51.19  ? 313  ASN A O     1 
ATOM   2524  C  CB    . ASN A  1 313 ? -93.662  3.745   -65.509  1.00 22.37  ? 313  ASN A CB    1 
ATOM   2525  C  CG    . ASN A  1 313 ? -93.850  4.966   -66.408  1.00 31.18  ? 313  ASN A CG    1 
ATOM   2526  O  OD1   . ASN A  1 313 ? -93.105  5.935   -66.318  1.00 49.83  ? 313  ASN A OD1   1 
ATOM   2527  N  ND2   . ASN A  1 313 ? -94.841  4.908   -67.293  1.00 54.54  ? 313  ASN A ND2   1 
ATOM   2528  N  N     . PRO A  1 314 ? -92.349  0.236   -65.787  1.00 29.47  ? 314  PRO A N     1 
ATOM   2529  C  CA    . PRO A  1 314 ? -92.296  -1.077  -65.131  1.00 26.75  ? 314  PRO A CA    1 
ATOM   2530  C  C     . PRO A  1 314 ? -91.391  -1.256  -63.938  1.00 40.96  ? 314  PRO A C     1 
ATOM   2531  O  O     . PRO A  1 314 ? -91.308  -2.361  -63.367  1.00 50.93  ? 314  PRO A O     1 
ATOM   2532  C  CB    . PRO A  1 314 ? -91.839  -2.002  -66.262  1.00 31.24  ? 314  PRO A CB    1 
ATOM   2533  C  CG    . PRO A  1 314 ? -91.620  -1.092  -67.479  1.00 45.18  ? 314  PRO A CG    1 
ATOM   2534  C  CD    . PRO A  1 314 ? -91.370  0.248   -66.877  1.00 11.56  ? 314  PRO A CD    1 
ATOM   2535  N  N     . THR A  1 315 ? -90.747  -0.174  -63.527  1.00 42.28  ? 315  THR A N     1 
ATOM   2536  C  CA    . THR A  1 315 ? -89.804  -0.262  -62.429  1.00 29.34  ? 315  THR A CA    1 
ATOM   2537  C  C     . THR A  1 315 ? -90.121  0.628   -61.259  1.00 38.35  ? 315  THR A C     1 
ATOM   2538  O  O     . THR A  1 315 ? -90.626  1.747   -61.425  1.00 44.78  ? 315  THR A O     1 
ATOM   2539  C  CB    . THR A  1 315 ? -88.395  0.136   -62.905  1.00 39.82  ? 315  THR A CB    1 
ATOM   2540  O  OG1   . THR A  1 315 ? -88.315  1.564   -63.009  1.00 41.99  ? 315  THR A OG1   1 
ATOM   2541  C  CG2   . THR A  1 315 ? -88.087  -0.465  -64.290  1.00 24.81  ? 315  THR A CG2   1 
ATOM   2542  N  N     . THR A  1 316 ? -89.760  0.150   -60.075  1.00 20.74  ? 316  THR A N     1 
ATOM   2543  C  CA    . THR A  1 316 ? -89.942  0.948   -58.868  1.00 38.13  ? 316  THR A CA    1 
ATOM   2544  C  C     . THR A  1 316 ? -89.158  2.255   -59.058  1.00 37.79  ? 316  THR A C     1 
ATOM   2545  O  O     . THR A  1 316 ? -89.606  3.333   -58.658  1.00 45.07  ? 316  THR A O     1 
ATOM   2546  C  CB    . THR A  1 316 ? -89.385  0.219   -57.645  1.00 29.65  ? 316  THR A CB    1 
ATOM   2547  O  OG1   . THR A  1 316 ? -88.017  -0.147  -57.882  1.00 49.73  ? 316  THR A OG1   1 
ATOM   2548  C  CG2   . THR A  1 316 ? -90.193  -1.018  -57.378  1.00 31.23  ? 316  THR A CG2   1 
ATOM   2549  N  N     . ASN A  1 317 ? -87.995  2.128   -59.702  1.00 37.41  ? 317  ASN A N     1 
ATOM   2550  C  CA    . ASN A  1 317 ? -87.098  3.241   -59.997  1.00 42.25  ? 317  ASN A CA    1 
ATOM   2551  C  C     . ASN A  1 317 ? -87.820  4.256   -60.877  1.00 43.69  ? 317  ASN A C     1 
ATOM   2552  O  O     . ASN A  1 317 ? -87.609  5.461   -60.732  1.00 38.65  ? 317  ASN A O     1 
ATOM   2553  C  CB    . ASN A  1 317 ? -85.844  2.718   -60.730  1.00 33.02  ? 317  ASN A CB    1 
ATOM   2554  C  CG    . ASN A  1 317 ? -84.740  3.778   -60.889  1.00 34.23  ? 317  ASN A CG    1 
ATOM   2555  O  OD1   . ASN A  1 317 ? -84.438  4.245   -61.994  1.00 33.29  ? 317  ASN A OD1   1 
ATOM   2556  N  ND2   . ASN A  1 317 ? -84.103  4.113   -59.792  1.00 22.23  ? 317  ASN A ND2   1 
ATOM   2557  N  N     . SER A  1 318 ? -88.681  3.755   -61.768  1.00 40.38  ? 318  SER A N     1 
ATOM   2558  C  CA    . SER A  1 318 ? -89.438  4.582   -62.703  1.00 30.51  ? 318  SER A CA    1 
ATOM   2559  C  C     . SER A  1 318 ? -90.148  5.704   -61.989  1.00 31.36  ? 318  SER A C     1 
ATOM   2560  O  O     . SER A  1 318 ? -90.194  6.843   -62.470  1.00 30.19  ? 318  SER A O     1 
ATOM   2561  C  CB    . SER A  1 318 ? -90.461  3.731   -63.451  1.00 33.70  ? 318  SER A CB    1 
ATOM   2562  O  OG    . SER A  1 318 ? -89.883  3.070   -64.569  1.00 30.15  ? 318  SER A OG    1 
ATOM   2563  N  N     . TYR A  1 319 ? -90.622  5.365   -60.779  1.00 34.03  ? 319  TYR A N     1 
ATOM   2564  C  CA    . TYR A  1 319 ? -91.354  6.287   -59.915  1.00 38.83  ? 319  TYR A CA    1 
ATOM   2565  C  C     . TYR A  1 319 ? -90.494  7.246   -59.144  1.00 35.59  ? 319  TYR A C     1 
ATOM   2566  O  O     . TYR A  1 319 ? -90.994  8.174   -58.523  1.00 46.21  ? 319  TYR A O     1 
ATOM   2567  C  CB    . TYR A  1 319 ? -92.251  5.472   -59.001  1.00 37.62  ? 319  TYR A CB    1 
ATOM   2568  C  CG    . TYR A  1 319 ? -93.155  4.723   -59.920  1.00 55.62  ? 319  TYR A CG    1 
ATOM   2569  C  CD1   . TYR A  1 319 ? -92.915  3.388   -60.211  1.00 57.21  ? 319  TYR A CD1   1 
ATOM   2570  C  CD2   . TYR A  1 319 ? -94.218  5.352   -60.522  1.00 49.68  ? 319  TYR A CD2   1 
ATOM   2571  C  CE1   . TYR A  1 319 ? -93.710  2.699   -61.074  1.00 55.12  ? 319  TYR A CE1   1 
ATOM   2572  C  CE2   . TYR A  1 319 ? -95.021  4.670   -61.417  1.00 37.88  ? 319  TYR A CE2   1 
ATOM   2573  C  CZ    . TYR A  1 319 ? -94.762  3.344   -61.689  1.00 42.49  ? 319  TYR A CZ    1 
ATOM   2574  O  OH    . TYR A  1 319 ? -95.558  2.661   -62.581  1.00 57.10  ? 319  TYR A OH    1 
ATOM   2575  N  N     . LYS A  1 320 ? -89.192  7.030   -59.185  1.00 47.79  ? 320  LYS A N     1 
ATOM   2576  C  CA    . LYS A  1 320 ? -88.257  7.931   -58.515  1.00 45.88  ? 320  LYS A CA    1 
ATOM   2577  C  C     . LYS A  1 320 ? -87.981  9.120   -59.454  1.00 40.38  ? 320  LYS A C     1 
ATOM   2578  O  O     . LYS A  1 320 ? -87.560  10.197  -59.019  1.00 35.63  ? 320  LYS A O     1 
ATOM   2579  C  CB    . LYS A  1 320 ? -86.969  7.191   -58.145  1.00 26.08  ? 320  LYS A CB    1 
ATOM   2580  C  CG    . LYS A  1 320 ? -86.876  6.768   -56.667  1.00 36.15  ? 320  LYS A CG    1 
ATOM   2581  C  CD    . LYS A  1 320 ? -87.273  5.313   -56.394  1.00 32.96  ? 320  LYS A CD    1 
ATOM   2582  C  CE    . LYS A  1 320 ? -86.911  4.913   -54.962  1.00 33.82  ? 320  LYS A CE    1 
ATOM   2583  N  NZ    . LYS A  1 320 ? -87.443  3.576   -54.567  1.00 40.67  ? 320  LYS A NZ    1 
ATOM   2584  N  N     . ARG A  1 321 ? -88.292  8.913   -60.733  1.00 35.58  ? 321  ARG A N     1 
ATOM   2585  C  CA    . ARG A  1 321 ? -88.141  9.911   -61.787  1.00 34.35  ? 321  ARG A CA    1 
ATOM   2586  C  C     . ARG A  1 321 ? -89.335  10.835  -61.870  1.00 46.75  ? 321  ARG A C     1 
ATOM   2587  O  O     . ARG A  1 321 ? -89.179  12.036  -62.093  1.00 64.65  ? 321  ARG A O     1 
ATOM   2588  C  CB    . ARG A  1 321 ? -88.023  9.215   -63.129  1.00 46.72  ? 321  ARG A CB    1 
ATOM   2589  C  CG    . ARG A  1 321 ? -88.461  10.054  -64.309  1.00 24.77  ? 321  ARG A CG    1 
ATOM   2590  C  CD    . ARG A  1 321 ? -87.844  9.499   -65.582  1.00 56.43  ? 321  ARG A CD    1 
ATOM   2591  N  NE    . ARG A  1 321 ? -88.375  10.132  -66.779  1.00 31.53  ? 321  ARG A NE    1 
ATOM   2592  C  CZ    . ARG A  1 321 ? -89.590  9.889   -67.251  1.00 54.72  ? 321  ARG A CZ    1 
ATOM   2593  N  NH1   . ARG A  1 321 ? -89.985  10.509  -68.351  1.00 23.58  ? 321  ARG A NH1   1 
ATOM   2594  N  NH2   . ARG A  1 321 ? -90.402  9.021   -66.627  1.00 49.20  ? 321  ARG A NH2   1 
ATOM   2595  N  N     . LEU A  1 322 ? -90.520  10.225  -61.818  1.00 45.28  ? 322  LEU A N     1 
ATOM   2596  C  CA    . LEU A  1 322 ? -91.801  10.921  -61.885  1.00 35.93  ? 322  LEU A CA    1 
ATOM   2597  C  C     . LEU A  1 322 ? -92.047  11.788  -60.651  1.00 50.25  ? 322  LEU A C     1 
ATOM   2598  O  O     . LEU A  1 322 ? -92.815  11.426  -59.739  1.00 41.51  ? 322  LEU A O     1 
ATOM   2599  C  CB    . LEU A  1 322 ? -92.944  9.912   -62.072  1.00 28.18  ? 322  LEU A CB    1 
ATOM   2600  C  CG    . LEU A  1 322 ? -92.871  9.014   -63.324  1.00 42.50  ? 322  LEU A CG    1 
ATOM   2601  C  CD1   . LEU A  1 322 ? -93.962  7.977   -63.288  1.00 34.13  ? 322  LEU A CD1   1 
ATOM   2602  C  CD2   . LEU A  1 322 ? -92.962  9.807   -64.625  1.00 18.16  ? 322  LEU A CD2   1 
ATOM   2603  N  N     . VAL A  1 323 ? -91.339  12.918  -60.634  1.00 55.32  ? 323  VAL A N     1 
ATOM   2604  C  CA    . VAL A  1 323 ? -91.408  13.931  -59.587  1.00 71.00  ? 323  VAL A CA    1 
ATOM   2605  C  C     . VAL A  1 323 ? -91.174  15.337  -60.203  1.00 80.36  ? 323  VAL A C     1 
ATOM   2606  O  O     . VAL A  1 323 ? -90.557  15.492  -61.278  1.00 75.33  ? 323  VAL A O     1 
ATOM   2607  C  CB    . VAL A  1 323 ? -90.381  13.665  -58.442  1.00 71.53  ? 323  VAL A CB    1 
ATOM   2608  C  CG1   . VAL A  1 323 ? -90.777  12.433  -57.627  1.00 44.93  ? 323  VAL A CG1   1 
ATOM   2609  C  CG2   . VAL A  1 323 ? -88.977  13.510  -59.004  1.00 81.45  ? 323  VAL A CG2   1 
ATOM   2610  N  N     . PRO A  1 324 ? -91.683  16.381  -59.532  0.88 81.06  ? 324  PRO A N     1 
ATOM   2611  C  CA    . PRO A  1 324 ? -91.528  17.751  -60.018  0.88 62.53  ? 324  PRO A CA    1 
ATOM   2612  C  C     . PRO A  1 324 ? -90.089  18.237  -60.047  0.88 59.22  ? 324  PRO A C     1 
ATOM   2613  O  O     . PRO A  1 324 ? -89.247  17.769  -59.284  0.88 62.08  ? 324  PRO A O     1 
ATOM   2614  C  CB    . PRO A  1 324 ? -92.326  18.554  -58.994  0.88 65.78  ? 324  PRO A CB    1 
ATOM   2615  C  CG    . PRO A  1 324 ? -93.360  17.572  -58.512  0.88 87.67  ? 324  PRO A CG    1 
ATOM   2616  C  CD    . PRO A  1 324 ? -92.520  16.354  -58.320  0.88 70.80  ? 324  PRO A CD    1 
ATOM   2617  N  N     . GLY A  1 325 ? -89.813  19.150  -60.969  0.88 63.43  ? 325  GLY A N     1 
ATOM   2618  C  CA    . GLY A  1 325 ? -88.499  19.767  -61.047  0.88 70.98  ? 325  GLY A CA    1 
ATOM   2619  C  C     . GLY A  1 325 ? -87.431  19.198  -61.940  0.88 71.18  ? 325  GLY A C     1 
ATOM   2620  O  O     . GLY A  1 325 ? -86.410  19.850  -62.174  0.88 77.92  ? 325  GLY A O     1 
ATOM   2621  N  N     . TYR A  1 326 ? -87.692  18.014  -62.528  0.88 82.25  ? 326  TYR A N     1 
ATOM   2622  C  CA    . TYR A  1 326 ? -86.658  17.371  -63.329  0.88 79.37  ? 326  TYR A CA    1 
ATOM   2623  C  C     . TYR A  1 326 ? -87.169  17.067  -64.730  0.88 73.56  ? 326  TYR A C     1 
ATOM   2624  O  O     . TYR A  1 326 ? -86.740  16.041  -65.335  0.88 68.73  ? 326  TYR A O     1 
ATOM   2625  C  CB    . TYR A  1 326 ? -86.159  16.099  -62.641  0.88 73.40  ? 326  TYR A CB    1 
ATOM   2626  C  CG    . TYR A  1 326 ? -85.808  16.288  -61.181  0.88 64.74  ? 326  TYR A CG    1 
ATOM   2627  C  CD1   . TYR A  1 326 ? -86.754  16.085  -60.188  0.88 83.83  ? 326  TYR A CD1   1 
ATOM   2628  C  CD2   . TYR A  1 326 ? -84.528  16.671  -60.797  0.88 33.21  ? 326  TYR A CD2   1 
ATOM   2629  C  CE1   . TYR A  1 326 ? -86.440  16.255  -58.853  0.88 100.00 ? 326  TYR A CE1   1 
ATOM   2630  C  CE2   . TYR A  1 326 ? -84.202  16.841  -59.465  0.88 53.52  ? 326  TYR A CE2   1 
ATOM   2631  C  CZ    . TYR A  1 326 ? -85.163  16.632  -58.497  0.88 95.72  ? 326  TYR A CZ    1 
ATOM   2632  O  OH    . TYR A  1 326 ? -84.842  16.803  -57.170  0.88 100.00 ? 326  TYR A OH    1 
ATOM   2633  N  N     . GLU A  1 327 ? -87.981  17.931  -65.297  0.88 76.98  ? 327  GLU A N     1 
ATOM   2634  C  CA    . GLU A  1 327 ? -88.526  17.781  -66.643  0.88 69.43  ? 327  GLU A CA    1 
ATOM   2635  C  C     . GLU A  1 327 ? -89.331  16.486  -66.831  0.88 71.71  ? 327  GLU A C     1 
ATOM   2636  O  O     . GLU A  1 327 ? -89.536  16.029  -67.958  0.88 64.36  ? 327  GLU A O     1 
ATOM   2637  C  CB    . GLU A  1 327 ? -87.403  17.888  -67.669  0.88 58.84  ? 327  GLU A CB    1 
ATOM   2638  C  CG    . GLU A  1 327 ? -86.310  18.881  -67.268  0.88 76.58  ? 327  GLU A CG    1 
ATOM   2639  C  CD    . GLU A  1 327 ? -85.662  19.593  -68.453  0.88 100.00 ? 327  GLU A CD    1 
ATOM   2640  O  OE1   . GLU A  1 327 ? -86.320  19.777  -69.514  0.88 100.00 ? 327  GLU A OE1   1 
ATOM   2641  O  OE2   . GLU A  1 327 ? -84.476  19.970  -68.305  0.88 100.00 ? 327  GLU A OE2   1 
ATOM   2642  N  N     . ALA A  1 328 ? -89.809  15.931  -65.713  0.88 69.77  ? 328  ALA A N     1 
ATOM   2643  C  CA    . ALA A  1 328 ? -90.613  14.708  -65.688  0.88 67.09  ? 328  ALA A CA    1 
ATOM   2644  C  C     . ALA A  1 328 ? -92.015  15.119  -65.283  0.88 70.89  ? 328  ALA A C     1 
ATOM   2645  O  O     . ALA A  1 328 ? -92.268  15.462  -64.128  0.88 67.20  ? 328  ALA A O     1 
ATOM   2646  C  CB    . ALA A  1 328 ? -90.049  13.732  -64.686  0.88 100.00 ? 328  ALA A CB    1 
ATOM   2647  N  N     . PRO A  1 329 ? -92.951  15.079  -66.229  0.88 65.02  ? 329  PRO A N     1 
ATOM   2648  C  CA    . PRO A  1 329 ? -94.328  15.471  -65.945  0.88 71.45  ? 329  PRO A CA    1 
ATOM   2649  C  C     . PRO A  1 329 ? -95.134  14.362  -65.324  0.88 69.45  ? 329  PRO A C     1 
ATOM   2650  O  O     . PRO A  1 329 ? -95.078  13.223  -65.781  0.88 57.92  ? 329  PRO A O     1 
ATOM   2651  C  CB    . PRO A  1 329 ? -94.874  15.826  -67.330  0.88 92.64  ? 329  PRO A CB    1 
ATOM   2652  C  CG    . PRO A  1 329 ? -93.637  15.938  -68.216  0.88 100.00 ? 329  PRO A CG    1 
ATOM   2653  C  CD    . PRO A  1 329 ? -92.775  14.847  -67.664  0.88 78.75  ? 329  PRO A CD    1 
ATOM   2654  N  N     . VAL A  1 330 ? -95.914  14.738  -64.313  1.00 65.64  ? 330  VAL A N     1 
ATOM   2655  C  CA    . VAL A  1 330 ? -96.789  13.826  -63.573  1.00 68.76  ? 330  VAL A CA    1 
ATOM   2656  C  C     . VAL A  1 330 ? -98.261  14.126  -63.862  1.00 72.17  ? 330  VAL A C     1 
ATOM   2657  O  O     . VAL A  1 330 ? -99.135  13.268  -63.698  1.00 64.92  ? 330  VAL A O     1 
ATOM   2658  C  CB    . VAL A  1 330 ? -96.565  13.966  -62.052  1.00 60.66  ? 330  VAL A CB    1 
ATOM   2659  C  CG1   . VAL A  1 330 ? -95.174  13.504  -61.702  1.00 86.09  ? 330  VAL A CG1   1 
ATOM   2660  C  CG2   . VAL A  1 330 ? -96.741  15.424  -61.612  1.00 76.84  ? 330  VAL A CG2   1 
ATOM   2661  N  N     . MET A  1 331 ? -98.514  15.371  -64.258  1.00 77.55  ? 331  MET A N     1 
ATOM   2662  C  CA    . MET A  1 331 ? -99.851  15.856  -64.565  1.00 56.31  ? 331  MET A CA    1 
ATOM   2663  C  C     . MET A  1 331 ? -100.384 15.277  -65.848  1.00 62.54  ? 331  MET A C     1 
ATOM   2664  O  O     . MET A  1 331 ? -99.814  15.493  -66.923  1.00 57.92  ? 331  MET A O     1 
ATOM   2665  C  CB    . MET A  1 331 ? -99.863  17.383  -64.683  1.00 56.95  ? 331  MET A CB    1 
ATOM   2666  C  CG    . MET A  1 331 ? -99.615  18.112  -63.379  0.58 40.02  ? 331  MET A CG    1 
ATOM   2667  S  SD    . MET A  1 331 ? -100.690 17.547  -62.042  0.58 55.94  ? 331  MET A SD    1 
ATOM   2668  C  CE    . MET A  1 331 ? -99.753  18.023  -60.584  0.58 49.24  ? 331  MET A CE    1 
ATOM   2669  N  N     . LEU A  1 332 ? -101.514 14.589  -65.723  1.00 50.99  ? 332  LEU A N     1 
ATOM   2670  C  CA    . LEU A  1 332 ? -102.189 13.970  -66.850  1.00 42.62  ? 332  LEU A CA    1 
ATOM   2671  C  C     . LEU A  1 332 ? -103.037 15.002  -67.597  1.00 59.96  ? 332  LEU A C     1 
ATOM   2672  O  O     . LEU A  1 332 ? -104.273 15.014  -67.509  1.00 79.86  ? 332  LEU A O     1 
ATOM   2673  C  CB    . LEU A  1 332 ? -103.055 12.830  -66.342  1.00 43.67  ? 332  LEU A CB    1 
ATOM   2674  C  CG    . LEU A  1 332 ? -102.679 11.393  -66.695  1.00 54.17  ? 332  LEU A CG    1 
ATOM   2675  C  CD1   . LEU A  1 332 ? -101.280 11.303  -67.262  1.00 61.57  ? 332  LEU A CD1   1 
ATOM   2676  C  CD2   . LEU A  1 332 ? -102.834 10.528  -65.456  1.00 46.00  ? 332  LEU A CD2   1 
ATOM   2677  N  N     . ALA A  1 333 ? -102.355 15.873  -68.330  1.00 56.05  ? 333  ALA A N     1 
ATOM   2678  C  CA    . ALA A  1 333 ? -103.013 16.918  -69.093  1.00 52.02  ? 333  ALA A CA    1 
ATOM   2679  C  C     . ALA A  1 333 ? -102.298 17.121  -70.404  1.00 50.87  ? 333  ALA A C     1 
ATOM   2680  O  O     . ALA A  1 333 ? -101.224 16.564  -70.631  1.00 60.03  ? 333  ALA A O     1 
ATOM   2681  C  CB    . ALA A  1 333 ? -103.000 18.200  -68.313  1.00 51.48  ? 333  ALA A CB    1 
ATOM   2682  N  N     . TYR A  1 334 ? -102.895 17.911  -71.280  1.00 38.29  ? 334  TYR A N     1 
ATOM   2683  C  CA    . TYR A  1 334 ? -102.247 18.176  -72.544  1.00 48.41  ? 334  TYR A CA    1 
ATOM   2684  C  C     . TYR A  1 334 ? -102.146 19.675  -72.756  1.00 59.39  ? 334  TYR A C     1 
ATOM   2685  O  O     . TYR A  1 334 ? -102.884 20.454  -72.145  1.00 59.27  ? 334  TYR A O     1 
ATOM   2686  C  CB    . TYR A  1 334 ? -102.968 17.490  -73.696  1.00 47.18  ? 334  TYR A CB    1 
ATOM   2687  C  CG    . TYR A  1 334 ? -104.340 18.040  -73.987  0.76 55.75  ? 334  TYR A CG    1 
ATOM   2688  C  CD1   . TYR A  1 334 ? -105.374 17.934  -73.053  0.76 67.35  ? 334  TYR A CD1   1 
ATOM   2689  C  CD2   . TYR A  1 334 ? -104.611 18.654  -75.208  0.76 51.49  ? 334  TYR A CD2   1 
ATOM   2690  C  CE1   . TYR A  1 334 ? -106.644 18.425  -73.335  0.76 66.75  ? 334  TYR A CE1   1 
ATOM   2691  C  CE2   . TYR A  1 334 ? -105.873 19.147  -75.499  0.76 59.35  ? 334  TYR A CE2   1 
ATOM   2692  C  CZ    . TYR A  1 334 ? -106.885 19.030  -74.560  0.76 63.34  ? 334  TYR A CZ    1 
ATOM   2693  O  OH    . TYR A  1 334 ? -108.131 19.527  -74.846  0.76 68.25  ? 334  TYR A OH    1 
ATOM   2694  N  N     . SER A  1 335 ? -101.160 20.066  -73.556  1.00 62.31  ? 335  SER A N     1 
ATOM   2695  C  CA    . SER A  1 335 ? -100.901 21.460  -73.875  1.00 57.44  ? 335  SER A CA    1 
ATOM   2696  C  C     . SER A  1 335 ? -99.779  21.564  -74.890  1.00 63.60  ? 335  SER A C     1 
ATOM   2697  O  O     . SER A  1 335 ? -98.969  20.653  -75.029  1.00 82.23  ? 335  SER A O     1 
ATOM   2698  C  CB    . SER A  1 335 ? -100.502 22.236  -72.625  1.00 47.77  ? 335  SER A CB    1 
ATOM   2699  O  OG    . SER A  1 335 ? -100.125 23.564  -72.968  1.00 77.83  ? 335  SER A OG    1 
ATOM   2700  N  N     . ALA A  1 336 ? -99.757  22.668  -75.624  1.00 66.46  ? 336  ALA A N     1 
ATOM   2701  C  CA    . ALA A  1 336 ? -98.712  22.904  -76.578  1.00 77.45  ? 336  ALA A CA    1 
ATOM   2702  C  C     . ALA A  1 336 ? -97.675  23.824  -75.899  1.00 78.25  ? 336  ALA A C     1 
ATOM   2703  O  O     . ALA A  1 336 ? -96.495  23.872  -76.286  1.00 73.67  ? 336  ALA A O     1 
ATOM   2704  C  CB    . ALA A  1 336 ? -99.254  23.547  -77.840  1.00 63.94  ? 336  ALA A CB    1 
ATOM   2705  N  N     . ARG A  1 337 ? -98.165  24.566  -74.880  1.00 88.23  ? 337  ARG A N     1 
ATOM   2706  C  CA    . ARG A  1 337 ? -97.398  25.527  -74.107  1.00 99.65  ? 337  ARG A CA    1 
ATOM   2707  C  C     . ARG A  1 337 ? -96.731  24.960  -72.867  1.00 99.34  ? 337  ARG A C     1 
ATOM   2708  O  O     . ARG A  1 337 ? -95.544  24.645  -72.838  1.00 100.00 ? 337  ARG A O     1 
ATOM   2709  C  CB    . ARG A  1 337 ? -98.284  26.677  -73.564  1.00 100.00 ? 337  ARG A CB    1 
ATOM   2710  C  CG    . ARG A  1 337 ? -98.308  26.787  -72.028  0.34 89.37  ? 337  ARG A CG    1 
ATOM   2711  C  CD    . ARG A  1 337 ? -97.086  27.504  -71.431  0.34 79.49  ? 337  ARG A CD    1 
ATOM   2712  N  NE    . ARG A  1 337 ? -97.019  28.928  -71.811  0.34 62.50  ? 337  ARG A NE    1 
ATOM   2713  C  CZ    . ARG A  1 337 ? -96.531  29.968  -71.069  0.34 58.01  ? 337  ARG A CZ    1 
ATOM   2714  N  NH1   . ARG A  1 337 ? -96.043  29.761  -69.845  0.34 47.98  ? 337  ARG A NH1   1 
ATOM   2715  N  NH2   . ARG A  1 337 ? -96.553  31.192  -71.575  0.34 52.69  ? 337  ARG A NH2   1 
ATOM   2716  N  N     . ASN A  1 338 ? -97.576  24.860  -71.837  1.00 97.94  ? 338  ASN A N     1 
ATOM   2717  C  CA    . ASN A  1 338 ? -97.202  24.407  -70.521  1.00 89.42  ? 338  ASN A CA    1 
ATOM   2718  C  C     . ASN A  1 338 ? -96.517  23.036  -70.535  1.00 86.48  ? 338  ASN A C     1 
ATOM   2719  O  O     . ASN A  1 338 ? -97.068  22.041  -71.015  1.00 91.33  ? 338  ASN A O     1 
ATOM   2720  C  CB    . ASN A  1 338 ? -98.450  24.376  -69.630  1.00 70.69  ? 338  ASN A CB    1 
ATOM   2721  C  CG    . ASN A  1 338 ? -98.159  23.875  -68.228  0.47 52.12  ? 338  ASN A CG    1 
ATOM   2722  O  OD1   . ASN A  1 338 ? -97.193  24.300  -67.588  0.47 59.08  ? 338  ASN A OD1   1 
ATOM   2723  N  ND2   . ASN A  1 338 ? -98.998  22.966  -67.740  0.47 52.52  ? 338  ASN A ND2   1 
ATOM   2724  N  N     . ARG A  1 339 ? -95.309  22.993  -69.983  1.00 97.55  ? 339  ARG A N     1 
ATOM   2725  C  CA    . ARG A  1 339 ? -94.552  21.757  -69.962  1.00 100.00 ? 339  ARG A CA    1 
ATOM   2726  C  C     . ARG A  1 339 ? -94.580  21.034  -68.620  1.00 92.88  ? 339  ARG A C     1 
ATOM   2727  O  O     . ARG A  1 339 ? -93.673  20.267  -68.274  1.00 100.00 ? 339  ARG A O     1 
ATOM   2728  C  CB    . ARG A  1 339 ? -93.141  21.975  -70.539  1.00 100.00 ? 339  ARG A CB    1 
ATOM   2729  C  CG    . ARG A  1 339 ? -93.164  22.258  -72.075  0.42 98.48  ? 339  ARG A CG    1 
ATOM   2730  C  CD    . ARG A  1 339 ? -91.816  22.727  -72.685  0.42 87.04  ? 339  ARG A CD    1 
ATOM   2731  N  NE    . ARG A  1 339 ? -91.569  24.173  -72.579  0.42 64.22  ? 339  ARG A NE    1 
ATOM   2732  C  CZ    . ARG A  1 339 ? -91.116  24.948  -73.570  0.42 56.68  ? 339  ARG A CZ    1 
ATOM   2733  N  NH1   . ARG A  1 339 ? -90.924  26.242  -73.361  0.42 26.49  ? 339  ARG A NH1   1 
ATOM   2734  N  NH2   . ARG A  1 339 ? -90.872  24.447  -74.774  0.42 43.74  ? 339  ARG A NH2   1 
ATOM   2735  N  N     . SER A  1 340 ? -95.657  21.287  -67.882  1.00 74.49  ? 340  SER A N     1 
ATOM   2736  C  CA    . SER A  1 340 ? -95.922  20.621  -66.609  1.00 82.37  ? 340  SER A CA    1 
ATOM   2737  C  C     . SER A  1 340 ? -96.836  19.436  -66.972  1.00 89.49  ? 340  SER A C     1 
ATOM   2738  O  O     . SER A  1 340 ? -97.059  18.517  -66.169  1.00 100.00 ? 340  SER A O     1 
ATOM   2739  C  CB    . SER A  1 340 ? -96.663  21.556  -65.654  1.00 54.60  ? 340  SER A CB    1 
ATOM   2740  O  OG    . SER A  1 340 ? -96.281  22.905  -65.856  0.67 70.37  ? 340  SER A OG    1 
ATOM   2741  N  N     . ALA A  1 341 ? -97.338  19.488  -68.210  1.00 88.65  ? 341  ALA A N     1 
ATOM   2742  C  CA    . ALA A  1 341 ? -98.235  18.501  -68.808  1.00 72.62  ? 341  ALA A CA    1 
ATOM   2743  C  C     . ALA A  1 341 ? -97.491  17.307  -69.379  1.00 67.06  ? 341  ALA A C     1 
ATOM   2744  O  O     . ALA A  1 341 ? -96.532  17.468  -70.151  1.00 57.48  ? 341  ALA A O     1 
ATOM   2745  C  CB    . ALA A  1 341 ? -99.044  19.159  -69.908  1.00 66.56  ? 341  ALA A CB    1 
ATOM   2746  N  N     . SER A  1 342 ? -97.978  16.114  -69.037  1.00 42.46  ? 342  SER A N     1 
ATOM   2747  C  CA    . SER A  1 342 ? -97.366  14.874  -69.499  1.00 45.28  ? 342  SER A CA    1 
ATOM   2748  C  C     . SER A  1 342 ? -97.596  14.635  -70.980  1.00 45.05  ? 342  SER A C     1 
ATOM   2749  O  O     . SER A  1 342 ? -96.867  13.862  -71.611  1.00 56.09  ? 342  SER A O     1 
ATOM   2750  C  CB    . SER A  1 342 ? -97.844  13.698  -68.669  1.00 27.45  ? 342  SER A CB    1 
ATOM   2751  O  OG    . SER A  1 342 ? -99.241  13.767  -68.519  1.00 68.39  ? 342  SER A OG    1 
ATOM   2752  N  N     . ILE A  1 343 ? -98.660  15.223  -71.522  1.00 49.67  ? 343  ILE A N     1 
ATOM   2753  C  CA    . ILE A  1 343 ? -98.891  15.111  -72.959  1.00 53.03  ? 343  ILE A CA    1 
ATOM   2754  C  C     . ILE A  1 343 ? -98.625  16.511  -73.458  1.00 54.84  ? 343  ILE A C     1 
ATOM   2755  O  O     . ILE A  1 343 ? -99.188  17.480  -72.960  1.00 57.04  ? 343  ILE A O     1 
ATOM   2756  C  CB    . ILE A  1 343 ? -100.328 14.732  -73.388  1.00 43.50  ? 343  ILE A CB    1 
ATOM   2757  C  CG1   . ILE A  1 343 ? -100.756 13.392  -72.807  1.00 23.99  ? 343  ILE A CG1   1 
ATOM   2758  C  CG2   . ILE A  1 343 ? -100.380 14.598  -74.902  1.00 52.60  ? 343  ILE A CG2   1 
ATOM   2759  C  CD1   . ILE A  1 343 ? -101.305 13.489  -71.412  1.00 53.94  ? 343  ILE A CD1   1 
ATOM   2760  N  N     . ARG A  1 344 ? -97.733  16.617  -74.420  1.00 45.51  ? 344  ARG A N     1 
ATOM   2761  C  CA    . ARG A  1 344 ? -97.392  17.908  -74.952  1.00 53.30  ? 344  ARG A CA    1 
ATOM   2762  C  C     . ARG A  1 344 ? -97.722  17.824  -76.429  1.00 63.73  ? 344  ARG A C     1 
ATOM   2763  O  O     . ARG A  1 344 ? -97.599  16.753  -77.040  1.00 55.85  ? 344  ARG A O     1 
ATOM   2764  C  CB    . ARG A  1 344 ? -95.901  18.176  -74.730  1.00 49.47  ? 344  ARG A CB    1 
ATOM   2765  C  CG    . ARG A  1 344 ? -95.543  19.556  -74.155  0.47 57.20  ? 344  ARG A CG    1 
ATOM   2766  C  CD    . ARG A  1 344 ? -94.154  19.948  -74.651  0.47 55.20  ? 344  ARG A CD    1 
ATOM   2767  N  NE    . ARG A  1 344 ? -93.985  19.515  -76.047  0.47 51.73  ? 344  ARG A NE    1 
ATOM   2768  C  CZ    . ARG A  1 344 ? -92.869  19.629  -76.769  0.47 61.65  ? 344  ARG A CZ    1 
ATOM   2769  N  NH1   . ARG A  1 344 ? -92.847  19.184  -78.024  0.47 46.51  ? 344  ARG A NH1   1 
ATOM   2770  N  NH2   . ARG A  1 344 ? -91.785  20.202  -76.255  0.47 53.05  ? 344  ARG A NH2   1 
ATOM   2771  N  N     . ILE A  1 345 ? -98.230  18.924  -76.978  1.00 65.87  ? 345  ILE A N     1 
ATOM   2772  C  CA    . ILE A  1 345 ? -98.580  18.964  -78.385  1.00 60.08  ? 345  ILE A CA    1 
ATOM   2773  C  C     . ILE A  1 345 ? -97.536  19.768  -79.117  1.00 65.80  ? 345  ILE A C     1 
ATOM   2774  O  O     . ILE A  1 345 ? -97.418  20.981  -78.937  1.00 65.60  ? 345  ILE A O     1 
ATOM   2775  C  CB    . ILE A  1 345 ? -99.952  19.603  -78.638  1.00 56.03  ? 345  ILE A CB    1 
ATOM   2776  C  CG1   . ILE A  1 345 ? -100.997 19.066  -77.645  1.00 66.07  ? 345  ILE A CG1   1 
ATOM   2777  C  CG2   . ILE A  1 345 ? -100.361 19.358  -80.100  1.00 49.36  ? 345  ILE A CG2   1 
ATOM   2778  C  CD1   . ILE A  1 345 ? -101.316 17.578  -77.772  1.00 48.86  ? 345  ILE A CD1   1 
ATOM   2779  N  N     . PRO A  1 346 ? -96.705  19.086  -79.903  1.00 77.88  ? 346  PRO A N     1 
ATOM   2780  C  CA    . PRO A  1 346 ? -95.684  19.824  -80.632  1.00 79.31  ? 346  PRO A CA    1 
ATOM   2781  C  C     . PRO A  1 346 ? -96.347  20.716  -81.666  1.00 72.56  ? 346  PRO A C     1 
ATOM   2782  O  O     . PRO A  1 346 ? -97.295  20.322  -82.370  1.00 72.98  ? 346  PRO A O     1 
ATOM   2783  C  CB    . PRO A  1 346 ? -94.838  18.712  -81.258  1.00 78.80  ? 346  PRO A CB    1 
ATOM   2784  C  CG    . PRO A  1 346 ? -95.808  17.597  -81.433  1.00 81.99  ? 346  PRO A CG    1 
ATOM   2785  C  CD    . PRO A  1 346 ? -96.595  17.639  -80.148  1.00 88.92  ? 346  PRO A CD    1 
ATOM   2786  N  N     . VAL A  1 347 ? -95.920  21.966  -81.646  1.00 79.12  ? 347  VAL A N     1 
ATOM   2787  C  CA    . VAL A  1 347 ? -96.423  22.952  -82.573  1.00 84.03  ? 347  VAL A CA    1 
ATOM   2788  C  C     . VAL A  1 347 ? -95.552  22.814  -83.810  1.00 88.94  ? 347  VAL A C     1 
ATOM   2789  O  O     . VAL A  1 347 ? -94.326  22.676  -83.705  1.00 90.30  ? 347  VAL A O     1 
ATOM   2790  C  CB    . VAL A  1 347 ? -96.281  24.363  -81.985  1.00 86.26  ? 347  VAL A CB    1 
ATOM   2791  C  CG1   . VAL A  1 347 ? -96.907  25.392  -82.917  0.70 74.90  ? 347  VAL A CG1   1 
ATOM   2792  C  CG2   . VAL A  1 347 ? -96.933  24.417  -80.609  0.70 51.10  ? 347  VAL A CG2   1 
ATOM   2793  N  N     . VAL A  1 348 ? -96.182  22.814  -84.977  1.00 84.05  ? 348  VAL A N     1 
ATOM   2794  C  CA    . VAL A  1 348 ? -95.418  22.679  -86.204  1.00 96.96  ? 348  VAL A CA    1 
ATOM   2795  C  C     . VAL A  1 348 ? -96.120  23.189  -87.468  1.00 100.00 ? 348  VAL A C     1 
ATOM   2796  O  O     . VAL A  1 348 ? -97.342  23.064  -87.628  1.00 96.85  ? 348  VAL A O     1 
ATOM   2797  C  CB    . VAL A  1 348 ? -94.936  21.209  -86.383  1.00 89.21  ? 348  VAL A CB    1 
ATOM   2798  C  CG1   . VAL A  1 348 ? -96.118  20.248  -86.302  0.89 64.91  ? 348  VAL A CG1   1 
ATOM   2799  C  CG2   . VAL A  1 348 ? -94.169  21.043  -87.697  0.89 92.36  ? 348  VAL A CG2   1 
ATOM   2800  N  N     . ALA A  1 349 ? -95.332  23.844  -88.321  1.00 100.00 ? 349  ALA A N     1 
ATOM   2801  C  CA    . ALA A  1 349 ? -95.810  24.399  -89.598  1.00 100.00 ? 349  ALA A CA    1 
ATOM   2802  C  C     . ALA A  1 349 ? -96.904  23.599  -90.319  1.00 100.00 ? 349  ALA A C     1 
ATOM   2803  O  O     . ALA A  1 349 ? -98.082  23.926  -90.213  1.00 100.00 ? 349  ALA A O     1 
ATOM   2804  C  CB    . ALA A  1 349 ? -94.614  24.608  -90.519  1.00 98.12  ? 349  ALA A CB    1 
ATOM   2805  N  N     . SER A  1 350 ? -96.507  22.557  -91.054  1.00 100.00 ? 350  SER A N     1 
ATOM   2806  C  CA    . SER A  1 350 ? -97.501  21.789  -91.837  1.00 95.08  ? 350  SER A CA    1 
ATOM   2807  C  C     . SER A  1 350 ? -98.468  20.992  -90.951  1.00 90.00  ? 350  SER A C     1 
ATOM   2808  O  O     . SER A  1 350 ? -98.359  20.986  -89.733  1.00 95.66  ? 350  SER A O     1 
ATOM   2809  C  CB    . SER A  1 350 ? -96.787  20.863  -92.848  1.00 86.47  ? 350  SER A CB    1 
ATOM   2810  O  OG    . SER A  1 350 ? -95.916  19.961  -92.182  1.00 81.50  ? 350  SER A OG    1 
ATOM   2811  N  N     . PRO A  1 351 ? -99.401  20.317  -91.609  1.00 93.72  ? 351  PRO A N     1 
ATOM   2812  C  CA    . PRO A  1 351 ? -100.290 19.362  -90.953  1.00 97.43  ? 351  PRO A CA    1 
ATOM   2813  C  C     . PRO A  1 351 ? -99.677  17.963  -91.050  1.00 94.45  ? 351  PRO A C     1 
ATOM   2814  O  O     . PRO A  1 351 ? -99.954  17.094  -90.219  1.00 79.35  ? 351  PRO A O     1 
ATOM   2815  C  CB    . PRO A  1 351 ? -101.560 19.469  -91.793  1.00 94.33  ? 351  PRO A CB    1 
ATOM   2816  C  CG    . PRO A  1 351 ? -101.008 19.684  -93.185  0.64 80.67  ? 351  PRO A CG    1 
ATOM   2817  C  CD    . PRO A  1 351 ? -99.919  20.711  -92.933  0.64 89.17  ? 351  PRO A CD    1 
ATOM   2818  N  N     . LYS A  1 352 ? -98.807  17.781  -92.047  1.00 85.23  ? 352  LYS A N     1 
ATOM   2819  C  CA    . LYS A  1 352 ? -98.157  16.499  -92.295  1.00 86.35  ? 352  LYS A CA    1 
ATOM   2820  C  C     . LYS A  1 352 ? -97.431  15.956  -91.073  1.00 79.64  ? 352  LYS A C     1 
ATOM   2821  O  O     . LYS A  1 352 ? -97.343  14.743  -90.885  1.00 72.81  ? 352  LYS A O     1 
ATOM   2822  C  CB    . LYS A  1 352 ? -97.198  16.589  -93.499  1.00 80.16  ? 352  LYS A CB    1 
ATOM   2823  C  CG    . LYS A  1 352 ? -97.861  16.610  -94.908  0.54 75.03  ? 352  LYS A CG    1 
ATOM   2824  C  CD    . LYS A  1 352 ? -98.669  15.321  -95.247  0.54 68.27  ? 352  LYS A CD    1 
ATOM   2825  C  CE    . LYS A  1 352 ? -100.172 15.453  -94.875  0.54 77.43  ? 352  LYS A CE    1 
ATOM   2826  N  NZ    . LYS A  1 352 ? -101.008 14.201  -94.976  0.54 46.58  ? 352  LYS A NZ    1 
ATOM   2827  N  N     . ALA A  1 353 ? -97.000  16.859  -90.200  1.00 75.53  ? 353  ALA A N     1 
ATOM   2828  C  CA    . ALA A  1 353 ? -96.266  16.478  -89.002  1.00 68.51  ? 353  ALA A CA    1 
ATOM   2829  C  C     . ALA A  1 353 ? -97.004  16.640  -87.670  1.00 66.19  ? 353  ALA A C     1 
ATOM   2830  O  O     . ALA A  1 353 ? -96.388  16.559  -86.610  1.00 79.78  ? 353  ALA A O     1 
ATOM   2831  C  CB    . ALA A  1 353 ? -94.943  17.237  -88.962  1.00 81.02  ? 353  ALA A CB    1 
ATOM   2832  N  N     . ARG A  1 354 ? -98.313  16.848  -87.702  1.00 73.70  ? 354  ARG A N     1 
ATOM   2833  C  CA    . ARG A  1 354 ? -99.060  17.022  -86.458  1.00 65.85  ? 354  ARG A CA    1 
ATOM   2834  C  C     . ARG A  1 354 ? -99.072  15.702  -85.692  1.00 66.35  ? 354  ARG A C     1 
ATOM   2835  O  O     . ARG A  1 354 ? -99.170  14.631  -86.299  1.00 68.95  ? 354  ARG A O     1 
ATOM   2836  C  CB    . ARG A  1 354 ? -100.493 17.471  -86.760  1.00 68.16  ? 354  ARG A CB    1 
ATOM   2837  C  CG    . ARG A  1 354 ? -101.153 18.252  -85.633  0.67 59.65  ? 354  ARG A CG    1 
ATOM   2838  C  CD    . ARG A  1 354 ? -100.742 19.716  -85.664  0.67 50.62  ? 354  ARG A CD    1 
ATOM   2839  N  NE    . ARG A  1 354 ? -101.124 20.334  -86.933  0.67 63.00  ? 354  ARG A NE    1 
ATOM   2840  C  CZ    . ARG A  1 354 ? -100.534 21.408  -87.445  0.67 72.74  ? 354  ARG A CZ    1 
ATOM   2841  N  NH1   . ARG A  1 354 ? -100.938 21.894  -88.613  0.67 57.74  ? 354  ARG A NH1   1 
ATOM   2842  N  NH2   . ARG A  1 354 ? -99.545  22.000  -86.780  0.67 67.33  ? 354  ARG A NH2   1 
ATOM   2843  N  N     . ARG A  1 355 ? -98.979  15.771  -84.366  1.00 65.32  ? 355  ARG A N     1 
ATOM   2844  C  CA    . ARG A  1 355 ? -98.974  14.550  -83.550  1.00 54.20  ? 355  ARG A CA    1 
ATOM   2845  C  C     . ARG A  1 355 ? -99.046  14.916  -82.081  1.00 53.55  ? 355  ARG A C     1 
ATOM   2846  O  O     . ARG A  1 355 ? -99.202  16.090  -81.731  1.00 56.46  ? 355  ARG A O     1 
ATOM   2847  C  CB    . ARG A  1 355 ? -97.654  13.830  -83.759  1.00 67.47  ? 355  ARG A CB    1 
ATOM   2848  C  CG    . ARG A  1 355 ? -96.508  14.767  -83.467  0.79 31.03  ? 355  ARG A CG    1 
ATOM   2849  C  CD    . ARG A  1 355 ? -95.170  14.105  -83.425  0.79 50.67  ? 355  ARG A CD    1 
ATOM   2850  N  NE    . ARG A  1 355 ? -94.155  15.137  -83.251  0.79 41.60  ? 355  ARG A NE    1 
ATOM   2851  C  CZ    . ARG A  1 355 ? -93.665  15.868  -84.249  0.79 57.44  ? 355  ARG A CZ    1 
ATOM   2852  N  NH1   . ARG A  1 355 ? -92.760  16.801  -84.005  0.79 31.90  ? 355  ARG A NH1   1 
ATOM   2853  N  NH2   . ARG A  1 355 ? -94.045  15.634  -85.500  0.79 69.28  ? 355  ARG A NH2   1 
ATOM   2854  N  N     . ILE A  1 356 ? -98.894  13.908  -81.226  1.00 46.64  ? 356  ILE A N     1 
ATOM   2855  C  CA    . ILE A  1 356 ? -98.873  14.131  -79.784  1.00 52.94  ? 356  ILE A CA    1 
ATOM   2856  C  C     . ILE A  1 356 ? -97.622  13.486  -79.189  1.00 53.39  ? 356  ILE A C     1 
ATOM   2857  O  O     . ILE A  1 356 ? -97.038  12.588  -79.795  1.00 50.48  ? 356  ILE A O     1 
ATOM   2858  C  CB    . ILE A  1 356 ? -100.092 13.544  -79.078  1.00 35.56  ? 356  ILE A CB    1 
ATOM   2859  C  CG1   . ILE A  1 356 ? -100.190 12.054  -79.356  1.00 39.71  ? 356  ILE A CG1   1 
ATOM   2860  C  CG2   . ILE A  1 356 ? -101.335 14.249  -79.516  1.00 49.32  ? 356  ILE A CG2   1 
ATOM   2861  C  CD1   . ILE A  1 356 ? -101.123 11.377  -78.415  1.00 44.70  ? 356  ILE A CD1   1 
ATOM   2862  N  N     . GLU A  1 357 ? -97.204  13.972  -78.021  1.00 45.77  ? 357  GLU A N     1 
ATOM   2863  C  CA    . GLU A  1 357 ? -96.036  13.441  -77.327  1.00 35.20  ? 357  GLU A CA    1 
ATOM   2864  C  C     . GLU A  1 357 ? -96.424  13.129  -75.908  1.00 42.50  ? 357  GLU A C     1 
ATOM   2865  O  O     . GLU A  1 357 ? -96.764  14.026  -75.127  1.00 30.71  ? 357  GLU A O     1 
ATOM   2866  C  CB    . GLU A  1 357 ? -94.859  14.440  -77.311  1.00 29.47  ? 357  GLU A CB    1 
ATOM   2867  C  CG    . GLU A  1 357 ? -93.703  14.039  -76.356  1.00 52.75  ? 357  GLU A CG    1 
ATOM   2868  C  CD    . GLU A  1 357 ? -92.535  15.048  -76.255  1.00 55.96  ? 357  GLU A CD    1 
ATOM   2869  O  OE1   . GLU A  1 357 ? -92.747  16.167  -75.764  1.00 77.25  ? 357  GLU A OE1   1 
ATOM   2870  O  OE2   . GLU A  1 357 ? -91.382  14.701  -76.598  1.00 56.07  ? 357  GLU A OE2   1 
ATOM   2871  N  N     . VAL A  1 358 ? -96.401  11.845  -75.588  1.00 48.50  ? 358  VAL A N     1 
ATOM   2872  C  CA    . VAL A  1 358 ? -96.710  11.398  -74.243  1.00 46.88  ? 358  VAL A CA    1 
ATOM   2873  C  C     . VAL A  1 358 ? -95.369  11.230  -73.550  1.00 55.76  ? 358  VAL A C     1 
ATOM   2874  O  O     . VAL A  1 358 ? -94.647  10.263  -73.781  1.00 58.97  ? 358  VAL A O     1 
ATOM   2875  C  CB    . VAL A  1 358 ? -97.452  10.086  -74.282  1.00 51.99  ? 358  VAL A CB    1 
ATOM   2876  C  CG1   . VAL A  1 358 ? -97.877  9.705   -72.887  1.00 31.24  ? 358  VAL A CG1   1 
ATOM   2877  C  CG2   . VAL A  1 358 ? -98.651  10.219  -75.196  1.00 48.87  ? 358  VAL A CG2   1 
ATOM   2878  N  N     . ARG A  1 359 ? -95.104  12.166  -72.678  1.00 56.07  ? 359  ARG A N     1 
ATOM   2879  C  CA    . ARG A  1 359 ? -93.826  12.230  -72.016  1.00 58.67  ? 359  ARG A CA    1 
ATOM   2880  C  C     . ARG A  1 359 ? -93.575  11.287  -70.836  1.00 46.46  ? 359  ARG A C     1 
ATOM   2881  O  O     . ARG A  1 359 ? -92.416  11.064  -70.517  1.00 58.65  ? 359  ARG A O     1 
ATOM   2882  C  CB    . ARG A  1 359 ? -93.609  13.652  -71.578  1.00 37.07  ? 359  ARG A CB    1 
ATOM   2883  C  CG    . ARG A  1 359 ? -92.436  13.798  -70.635  0.56 95.17  ? 359  ARG A CG    1 
ATOM   2884  C  CD    . ARG A  1 359 ? -92.161  15.276  -70.438  0.56 86.40  ? 359  ARG A CD    1 
ATOM   2885  N  NE    . ARG A  1 359 ? -92.004  15.974  -71.716  0.56 20.74  ? 359  ARG A NE    1 
ATOM   2886  C  CZ    . ARG A  1 359 ? -90.894  16.652  -71.985  0.56 52.32  ? 359  ARG A CZ    1 
ATOM   2887  N  NH1   . ARG A  1 359 ? -89.928  16.682  -71.075  0.56 22.33  ? 359  ARG A NH1   1 
ATOM   2888  N  NH2   . ARG A  1 359 ? -90.743  17.290  -73.130  0.56 52.23  ? 359  ARG A NH2   1 
ATOM   2889  N  N     . PHE A  1 360 ? -94.562  10.712  -70.158  1.00 41.67  ? 360  PHE A N     1 
ATOM   2890  C  CA    . PHE A  1 360 ? -94.232  9.935   -68.952  1.00 42.08  ? 360  PHE A CA    1 
ATOM   2891  C  C     . PHE A  1 360 ? -93.517  8.589   -69.133  1.00 45.09  ? 360  PHE A C     1 
ATOM   2892  O  O     . PHE A  1 360 ? -92.868  8.132   -68.197  1.00 48.39  ? 360  PHE A O     1 
ATOM   2893  C  CB    . PHE A  1 360 ? -95.480  9.764   -68.096  1.00 49.34  ? 360  PHE A CB    1 
ATOM   2894  C  CG    . PHE A  1 360 ? -96.587  9.001   -68.747  1.00 46.41  ? 360  PHE A CG    1 
ATOM   2895  C  CD1   . PHE A  1 360 ? -97.618  9.633   -69.424  1.00 47.28  ? 360  PHE A CD1   1 
ATOM   2896  C  CD2   . PHE A  1 360 ? -96.594  7.618   -68.663  1.00 57.59  ? 360  PHE A CD2   1 
ATOM   2897  C  CE1   . PHE A  1 360 ? -98.636  8.895   -70.010  1.00 45.49  ? 360  PHE A CE1   1 
ATOM   2898  C  CE2   . PHE A  1 360 ? -97.608  6.873   -69.248  1.00 56.55  ? 360  PHE A CE2   1 
ATOM   2899  C  CZ    . PHE A  1 360 ? -98.630  7.512   -69.925  1.00 41.84  ? 360  PHE A CZ    1 
ATOM   2900  N  N     . PRO A  1 361 ? -93.630  7.940   -70.304  1.00 38.67  ? 361  PRO A N     1 
ATOM   2901  C  CA    . PRO A  1 361 ? -92.874  6.679   -70.475  1.00 52.96  ? 361  PRO A CA    1 
ATOM   2902  C  C     . PRO A  1 361 ? -91.361  6.800   -70.188  1.00 43.38  ? 361  PRO A C     1 
ATOM   2903  O  O     . PRO A  1 361 ? -90.779  7.833   -70.500  1.00 38.71  ? 361  PRO A O     1 
ATOM   2904  C  CB    . PRO A  1 361 ? -93.270  6.247   -71.876  1.00 42.40  ? 361  PRO A CB    1 
ATOM   2905  C  CG    . PRO A  1 361 ? -94.715  6.615   -71.880  1.00 46.91  ? 361  PRO A CG    1 
ATOM   2906  C  CD    . PRO A  1 361 ? -94.963  7.719   -70.876  1.00 60.55  ? 361  PRO A CD    1 
ATOM   2907  N  N     . ASP A  1 362 ? -90.715  5.755   -69.611  1.00 43.75  ? 362  ASP A N     1 
ATOM   2908  C  CA    . ASP A  1 362 ? -89.260  5.773   -69.462  1.00 47.57  ? 362  ASP A CA    1 
ATOM   2909  C  C     . ASP A  1 362 ? -88.662  4.555   -70.207  1.00 28.89  ? 362  ASP A C     1 
ATOM   2910  O  O     . ASP A  1 362 ? -89.369  3.688   -70.727  1.00 39.26  ? 362  ASP A O     1 
ATOM   2911  C  CB    . ASP A  1 362 ? -88.801  5.942   -68.010  1.00 45.43  ? 362  ASP A CB    1 
ATOM   2912  C  CG    . ASP A  1 362 ? -89.381  4.924   -67.071  1.00 60.13  ? 362  ASP A CG    1 
ATOM   2913  O  OD1   . ASP A  1 362 ? -89.318  3.725   -67.391  1.00 21.36  ? 362  ASP A OD1   1 
ATOM   2914  O  OD2   . ASP A  1 362 ? -89.916  5.326   -66.017  1.00 47.28  ? 362  ASP A OD2   1 
ATOM   2915  N  N     . PRO A  1 363 ? -87.291  4.511   -70.260  1.00 43.52  ? 363  PRO A N     1 
ATOM   2916  C  CA    . PRO A  1 363 ? -86.473  3.504   -71.007  1.00 18.43  ? 363  PRO A CA    1 
ATOM   2917  C  C     . PRO A  1 363 ? -86.692  2.065   -70.693  1.00 42.40  ? 363  PRO A C     1 
ATOM   2918  O  O     . PRO A  1 363 ? -86.658  1.192   -71.554  1.00 44.36  ? 363  PRO A O     1 
ATOM   2919  C  CB    . PRO A  1 363 ? -85.055  4.013   -70.836  1.00 43.29  ? 363  PRO A CB    1 
ATOM   2920  C  CG    . PRO A  1 363 ? -85.238  5.499   -70.905  1.00 35.05  ? 363  PRO A CG    1 
ATOM   2921  C  CD    . PRO A  1 363 ? -86.657  5.808   -70.501  1.00 34.00  ? 363  PRO A CD    1 
ATOM   2922  N  N     . ALA A  1 364 ? -86.906  1.867   -69.416  1.00 27.67  ? 364  ALA A N     1 
ATOM   2923  C  CA    . ALA A  1 364 ? -87.085  0.552   -68.887  1.00 36.68  ? 364  ALA A CA    1 
ATOM   2924  C  C     . ALA A  1 364 ? -88.286  -0.192  -69.453  1.00 49.65  ? 364  ALA A C     1 
ATOM   2925  O  O     . ALA A  1 364 ? -88.365  -1.420  -69.348  1.00 57.01  ? 364  ALA A O     1 
ATOM   2926  C  CB    . ALA A  1 364 ? -87.188  0.635   -67.386  1.00 34.47  ? 364  ALA A CB    1 
ATOM   2927  N  N     . ALA A  1 365 ? -89.213  0.531   -70.068  1.00 49.66  ? 365  ALA A N     1 
ATOM   2928  C  CA    . ALA A  1 365 ? -90.429  -0.027  -70.621  1.00 50.05  ? 365  ALA A CA    1 
ATOM   2929  C  C     . ALA A  1 365 ? -90.177  -1.034  -71.728  1.00 51.63  ? 365  ALA A C     1 
ATOM   2930  O  O     . ALA A  1 365 ? -89.227  -0.880  -72.499  1.00 39.94  ? 365  ALA A O     1 
ATOM   2931  C  CB    . ALA A  1 365 ? -91.300  1.110   -71.146  1.00 50.51  ? 365  ALA A CB    1 
ATOM   2932  N  N     . ASN A  1 366 ? -90.997  -2.088  -71.769  1.00 49.29  ? 366  ASN A N     1 
ATOM   2933  C  CA    . ASN A  1 366 ? -90.886  -3.074  -72.834  1.00 30.19  ? 366  ASN A CA    1 
ATOM   2934  C  C     . ASN A  1 366 ? -91.507  -2.330  -74.008  1.00 37.74  ? 366  ASN A C     1 
ATOM   2935  O  O     . ASN A  1 366 ? -92.715  -2.123  -74.033  1.00 52.50  ? 366  ASN A O     1 
ATOM   2936  C  CB    . ASN A  1 366 ? -91.713  -4.318  -72.519  1.00 38.75  ? 366  ASN A CB    1 
ATOM   2937  C  CG    . ASN A  1 366 ? -91.653  -5.353  -73.637  1.00 44.41  ? 366  ASN A CG    1 
ATOM   2938  O  OD1   . ASN A  1 366 ? -91.688  -5.015  -74.827  1.00 45.70  ? 366  ASN A OD1   1 
ATOM   2939  N  ND2   . ASN A  1 366 ? -91.549  -6.617  -73.259  1.00 37.45  ? 366  ASN A ND2   1 
ATOM   2940  N  N     . PRO A  1 367 ? -90.701  -1.947  -75.009  1.00 28.88  ? 367  PRO A N     1 
ATOM   2941  C  CA    . PRO A  1 367 ? -91.180  -1.208  -76.187  1.00 38.68  ? 367  PRO A CA    1 
ATOM   2942  C  C     . PRO A  1 367 ? -92.526  -1.712  -76.689  1.00 47.46  ? 367  PRO A C     1 
ATOM   2943  O  O     . PRO A  1 367 ? -93.528  -1.014  -76.618  1.00 51.67  ? 367  PRO A O     1 
ATOM   2944  C  CB    . PRO A  1 367 ? -90.072  -1.450  -77.212  1.00 36.65  ? 367  PRO A CB    1 
ATOM   2945  C  CG    . PRO A  1 367 ? -88.880  -1.570  -76.377  1.00 50.54  ? 367  PRO A CG    1 
ATOM   2946  C  CD    . PRO A  1 367 ? -89.348  -2.461  -75.255  1.00 33.36  ? 367  PRO A CD    1 
ATOM   2947  N  N     . TYR A  1 368 ? -92.547  -2.972  -77.093  1.00 40.55  ? 368  TYR A N     1 
ATOM   2948  C  CA    . TYR A  1 368 ? -93.744  -3.612  -77.599  1.00 34.20  ? 368  TYR A CA    1 
ATOM   2949  C  C     . TYR A  1 368 ? -94.953  -3.409  -76.682  1.00 39.30  ? 368  TYR A C     1 
ATOM   2950  O  O     . TYR A  1 368 ? -95.942  -2.788  -77.069  1.00 41.68  ? 368  TYR A O     1 
ATOM   2951  C  CB    . TYR A  1 368 ? -93.458  -5.092  -77.781  1.00 39.21  ? 368  TYR A CB    1 
ATOM   2952  C  CG    . TYR A  1 368 ? -92.271  -5.358  -78.672  1.00 38.81  ? 368  TYR A CG    1 
ATOM   2953  C  CD1   . TYR A  1 368 ? -91.111  -5.937  -78.163  1.00 42.55  ? 368  TYR A CD1   1 
ATOM   2954  C  CD2   . TYR A  1 368 ? -92.305  -5.033  -80.029  1.00 37.63  ? 368  TYR A CD2   1 
ATOM   2955  C  CE1   . TYR A  1 368 ? -89.999  -6.192  -78.989  1.00 23.69  ? 368  TYR A CE1   1 
ATOM   2956  C  CE2   . TYR A  1 368 ? -91.203  -5.282  -80.863  1.00 47.73  ? 368  TYR A CE2   1 
ATOM   2957  C  CZ    . TYR A  1 368 ? -90.056  -5.863  -80.335  1.00 43.01  ? 368  TYR A CZ    1 
ATOM   2958  O  OH    . TYR A  1 368 ? -88.973  -6.137  -81.142  1.00 40.81  ? 368  TYR A OH    1 
ATOM   2959  N  N     . LEU A  1 369 ? -94.857  -3.894  -75.453  1.00 25.29  ? 369  LEU A N     1 
ATOM   2960  C  CA    . LEU A  1 369 ? -95.959  -3.748  -74.519  1.00 30.36  ? 369  LEU A CA    1 
ATOM   2961  C  C     . LEU A  1 369 ? -96.350  -2.300  -74.308  1.00 38.82  ? 369  LEU A C     1 
ATOM   2962  O  O     . LEU A  1 369 ? -97.517  -1.944  -74.411  1.00 54.30  ? 369  LEU A O     1 
ATOM   2963  C  CB    . LEU A  1 369 ? -95.616  -4.386  -73.177  1.00 23.43  ? 369  LEU A CB    1 
ATOM   2964  C  CG    . LEU A  1 369 ? -95.175  -5.843  -73.280  1.00 35.87  ? 369  LEU A CG    1 
ATOM   2965  C  CD1   . LEU A  1 369 ? -95.403  -6.473  -71.919  1.00 39.27  ? 369  LEU A CD1   1 
ATOM   2966  C  CD2   . LEU A  1 369 ? -95.962  -6.592  -74.370  1.00 16.53  ? 369  LEU A CD2   1 
ATOM   2967  N  N     . CYS A  1 370 ? -95.361  -1.469  -74.029  1.00 37.05  ? 370  CYS A N     1 
ATOM   2968  C  CA    . CYS A  1 370 ? -95.583  -0.062  -73.785  1.00 34.84  ? 370  CYS A CA    1 
ATOM   2969  C  C     . CYS A  1 370 ? -96.311  0.599   -74.948  1.00 40.40  ? 370  CYS A C     1 
ATOM   2970  O  O     . CYS A  1 370 ? -97.356  1.224   -74.759  1.00 57.26  ? 370  CYS A O     1 
ATOM   2971  C  CB    . CYS A  1 370 ? -94.256  0.619   -73.552  1.00 39.84  ? 370  CYS A CB    1 
ATOM   2972  S  SG    . CYS A  1 370 ? -94.402  2.357   -73.334  1.00 41.40  ? 370  CYS A SG    1 
ATOM   2973  N  N     . PHE A  1 371 ? -95.780  0.432   -76.153  1.00 28.70  ? 371  PHE A N     1 
ATOM   2974  C  CA    . PHE A  1 371 ? -96.402  1.004   -77.350  1.00 40.10  ? 371  PHE A CA    1 
ATOM   2975  C  C     . PHE A  1 371 ? -97.831  0.549   -77.545  1.00 44.44  ? 371  PHE A C     1 
ATOM   2976  O  O     . PHE A  1 371 ? -98.704  1.369   -77.788  1.00 48.42  ? 371  PHE A O     1 
ATOM   2977  C  CB    . PHE A  1 371 ? -95.607  0.657   -78.596  1.00 27.47  ? 371  PHE A CB    1 
ATOM   2978  C  CG    . PHE A  1 371 ? -94.249  1.259   -78.620  1.00 41.75  ? 371  PHE A CG    1 
ATOM   2979  C  CD1   . PHE A  1 371 ? -93.427  1.088   -79.728  1.00 44.45  ? 371  PHE A CD1   1 
ATOM   2980  C  CD2   . PHE A  1 371 ? -93.784  2.002   -77.529  1.00 38.08  ? 371  PHE A CD2   1 
ATOM   2981  C  CE1   . PHE A  1 371 ? -92.156  1.645   -79.762  1.00 34.13  ? 371  PHE A CE1   1 
ATOM   2982  C  CE2   . PHE A  1 371 ? -92.521  2.563   -77.545  1.00 33.63  ? 371  PHE A CE2   1 
ATOM   2983  C  CZ    . PHE A  1 371 ? -91.701  2.386   -78.667  1.00 37.05  ? 371  PHE A CZ    1 
ATOM   2984  N  N     . ALA A  1 372 ? -98.051  -0.760  -77.475  1.00 39.87  ? 372  ALA A N     1 
ATOM   2985  C  CA    . ALA A  1 372 ? -99.383  -1.326  -77.613  1.00 42.65  ? 372  ALA A CA    1 
ATOM   2986  C  C     . ALA A  1 372 ? -100.358 -0.650  -76.646  1.00 49.49  ? 372  ALA A C     1 
ATOM   2987  O  O     . ALA A  1 372 ? -101.382 -0.113  -77.068  1.00 65.04  ? 372  ALA A O     1 
ATOM   2988  C  CB    . ALA A  1 372 ? -99.339  -2.791  -77.335  1.00 29.01  ? 372  ALA A CB    1 
ATOM   2989  N  N     . ALA A  1 373 ? -100.010 -0.634  -75.361  1.00 36.18  ? 373  ALA A N     1 
ATOM   2990  C  CA    . ALA A  1 373 ? -100.854 -0.028  -74.329  1.00 51.25  ? 373  ALA A CA    1 
ATOM   2991  C  C     . ALA A  1 373 ? -101.224 1.403   -74.691  1.00 61.82  ? 373  ALA A C     1 
ATOM   2992  O  O     . ALA A  1 373 ? -102.354 1.839   -74.489  1.00 70.92  ? 373  ALA A O     1 
ATOM   2993  C  CB    . ALA A  1 373 ? -100.152 -0.065  -72.975  1.00 43.56  ? 373  ALA A CB    1 
ATOM   2994  N  N     . LEU A  1 374 ? -100.257 2.136   -75.216  1.00 49.24  ? 374  LEU A N     1 
ATOM   2995  C  CA    . LEU A  1 374 ? -100.501 3.502   -75.622  1.00 49.42  ? 374  LEU A CA    1 
ATOM   2996  C  C     . LEU A  1 374 ? -101.534 3.508   -76.743  1.00 49.95  ? 374  LEU A C     1 
ATOM   2997  O  O     . LEU A  1 374 ? -102.528 4.218   -76.667  1.00 56.60  ? 374  LEU A O     1 
ATOM   2998  C  CB    . LEU A  1 374 ? -99.203  4.139   -76.115  1.00 49.66  ? 374  LEU A CB    1 
ATOM   2999  C  CG    . LEU A  1 374 ? -98.522  5.188   -75.240  1.00 44.36  ? 374  LEU A CG    1 
ATOM   3000  C  CD1   . LEU A  1 374 ? -99.061  5.203   -73.832  1.00 37.78  ? 374  LEU A CD1   1 
ATOM   3001  C  CD2   . LEU A  1 374 ? -97.054  4.880   -75.239  1.00 55.50  ? 374  LEU A CD2   1 
ATOM   3002  N  N     . LEU A  1 375 ? -101.308 2.668   -77.750  1.00 49.38  ? 375  LEU A N     1 
ATOM   3003  C  CA    . LEU A  1 375 ? -102.179 2.560   -78.920  1.00 39.44  ? 375  LEU A CA    1 
ATOM   3004  C  C     . LEU A  1 375 ? -103.589 2.137   -78.586  1.00 44.13  ? 375  LEU A C     1 
ATOM   3005  O  O     . LEU A  1 375 ? -104.544 2.762   -79.027  1.00 52.72  ? 375  LEU A O     1 
ATOM   3006  C  CB    . LEU A  1 375 ? -101.581 1.577   -79.925  1.00 47.06  ? 375  LEU A CB    1 
ATOM   3007  C  CG    . LEU A  1 375 ? -102.212 1.402   -81.306  1.00 41.57  ? 375  LEU A CG    1 
ATOM   3008  C  CD1   . LEU A  1 375 ? -103.092 0.196   -81.291  1.00 65.81  ? 375  LEU A CD1   1 
ATOM   3009  C  CD2   . LEU A  1 375 ? -102.969 2.652   -81.735  1.00 44.13  ? 375  LEU A CD2   1 
ATOM   3010  N  N     . MET A  1 376 ? -103.707 1.079   -77.797  1.00 37.91  ? 376  MET A N     1 
ATOM   3011  C  CA    . MET A  1 376 ? -105.003 0.543   -77.401  1.00 46.67  ? 376  MET A CA    1 
ATOM   3012  C  C     . MET A  1 376 ? -105.820 1.504   -76.545  1.00 47.52  ? 376  MET A C     1 
ATOM   3013  O  O     . MET A  1 376 ? -107.049 1.489   -76.597  1.00 73.20  ? 376  MET A O     1 
ATOM   3014  C  CB    . MET A  1 376 ? -104.829 -0.788  -76.666  1.00 35.47  ? 376  MET A CB    1 
ATOM   3015  C  CG    . MET A  1 376 ? -104.104 -1.851  -77.473  1.00 55.75  ? 376  MET A CG    1 
ATOM   3016  S  SD    . MET A  1 376 ? -105.007 -2.497  -78.897  1.00 60.35  ? 376  MET A SD    1 
ATOM   3017  C  CE    . MET A  1 376 ? -106.154 -3.597  -78.025  1.00 62.77  ? 376  MET A CE    1 
ATOM   3018  N  N     . ALA A  1 377 ? -105.146 2.299   -75.726  1.00 46.41  ? 377  ALA A N     1 
ATOM   3019  C  CA    . ALA A  1 377 ? -105.844 3.262   -74.882  1.00 53.99  ? 377  ALA A CA    1 
ATOM   3020  C  C     . ALA A  1 377 ? -106.277 4.400   -75.779  1.00 51.91  ? 377  ALA A C     1 
ATOM   3021  O  O     . ALA A  1 377 ? -107.257 5.074   -75.504  1.00 62.51  ? 377  ALA A O     1 
ATOM   3022  C  CB    . ALA A  1 377 ? -104.925 3.787   -73.780  1.00 48.96  ? 377  ALA A CB    1 
ATOM   3023  N  N     . GLY A  1 378 ? -105.524 4.612   -76.853  1.00 58.17  ? 378  GLY A N     1 
ATOM   3024  C  CA    . GLY A  1 378 ? -105.836 5.679   -77.782  1.00 63.79  ? 378  GLY A CA    1 
ATOM   3025  C  C     . GLY A  1 378 ? -107.060 5.314   -78.583  1.00 71.02  ? 378  GLY A C     1 
ATOM   3026  O  O     . GLY A  1 378 ? -107.952 6.134   -78.780  1.00 78.94  ? 378  GLY A O     1 
ATOM   3027  N  N     . LEU A  1 379 ? -107.105 4.061   -79.023  1.00 60.12  ? 379  LEU A N     1 
ATOM   3028  C  CA    . LEU A  1 379 ? -108.226 3.553   -79.800  1.00 56.20  ? 379  LEU A CA    1 
ATOM   3029  C  C     . LEU A  1 379 ? -109.503 3.553   -78.964  1.00 60.91  ? 379  LEU A C     1 
ATOM   3030  O  O     . LEU A  1 379 ? -110.561 3.955   -79.437  1.00 72.90  ? 379  LEU A O     1 
ATOM   3031  C  CB    . LEU A  1 379 ? -107.923 2.142   -80.321  1.00 45.19  ? 379  LEU A CB    1 
ATOM   3032  C  CG    . LEU A  1 379 ? -106.754 2.069   -81.318  1.00 58.86  ? 379  LEU A CG    1 
ATOM   3033  C  CD1   . LEU A  1 379 ? -106.613 0.669   -81.888  1.00 33.57  ? 379  LEU A CD1   1 
ATOM   3034  C  CD2   . LEU A  1 379 ? -106.961 3.069   -82.444  1.00 55.71  ? 379  LEU A CD2   1 
ATOM   3035  N  N     . ASP A  1 380 ? -109.387 3.144   -77.706  1.00 58.70  ? 380  ASP A N     1 
ATOM   3036  C  CA    . ASP A  1 380 ? -110.534 3.102   -76.808  1.00 53.77  ? 380  ASP A CA    1 
ATOM   3037  C  C     . ASP A  1 380 ? -111.074 4.496   -76.541  1.00 57.05  ? 380  ASP A C     1 
ATOM   3038  O  O     . ASP A  1 380 ? -112.254 4.662   -76.260  1.00 77.82  ? 380  ASP A O     1 
ATOM   3039  C  CB    . ASP A  1 380 ? -110.154 2.431   -75.486  1.00 56.22  ? 380  ASP A CB    1 
ATOM   3040  C  CG    . ASP A  1 380 ? -111.298 2.410   -74.484  1.00 51.40  ? 380  ASP A CG    1 
ATOM   3041  O  OD1   . ASP A  1 380 ? -112.073 1.428   -74.465  1.00 80.43  ? 380  ASP A OD1   1 
ATOM   3042  O  OD2   . ASP A  1 380 ? -111.418 3.379   -73.709  1.00 74.04  ? 380  ASP A OD2   1 
ATOM   3043  N  N     . GLY A  1 381 ? -110.202 5.493   -76.609  1.00 62.69  ? 381  GLY A N     1 
ATOM   3044  C  CA    . GLY A  1 381 ? -110.629 6.859   -76.373  1.00 55.71  ? 381  GLY A CA    1 
ATOM   3045  C  C     . GLY A  1 381 ? -111.417 7.372   -77.556  1.00 63.45  ? 381  GLY A C     1 
ATOM   3046  O  O     . GLY A  1 381 ? -112.284 8.230   -77.409  1.00 67.80  ? 381  GLY A O     1 
ATOM   3047  N  N     . ILE A  1 382 ? -111.089 6.835   -78.729  1.00 57.31  ? 382  ILE A N     1 
ATOM   3048  C  CA    . ILE A  1 382 ? -111.734 7.177   -79.990  1.00 57.07  ? 382  ILE A CA    1 
ATOM   3049  C  C     . ILE A  1 382 ? -113.100 6.491   -80.127  1.00 64.47  ? 382  ILE A C     1 
ATOM   3050  O  O     . ILE A  1 382 ? -114.116 7.149   -80.383  1.00 67.12  ? 382  ILE A O     1 
ATOM   3051  C  CB    . ILE A  1 382 ? -110.807 6.798   -81.159  1.00 49.83  ? 382  ILE A CB    1 
ATOM   3052  C  CG1   . ILE A  1 382 ? -109.753 7.890   -81.339  1.00 62.92  ? 382  ILE A CG1   1 
ATOM   3053  C  CG2   . ILE A  1 382 ? -111.588 6.531   -82.435  1.00 54.81  ? 382  ILE A CG2   1 
ATOM   3054  C  CD1   . ILE A  1 382 ? -108.675 7.543   -82.349  1.00 63.87  ? 382  ILE A CD1   1 
ATOM   3055  N  N     . LYS A  1 383 ? -113.117 5.168   -79.972  1.00 66.24  ? 383  LYS A N     1 
ATOM   3056  C  CA    . LYS A  1 383 ? -114.357 4.413   -80.052  1.00 55.21  ? 383  LYS A CA    1 
ATOM   3057  C  C     . LYS A  1 383 ? -115.369 5.031   -79.104  1.00 64.36  ? 383  LYS A C     1 
ATOM   3058  O  O     . LYS A  1 383 ? -116.442 5.432   -79.543  1.00 99.24  ? 383  LYS A O     1 
ATOM   3059  C  CB    . LYS A  1 383 ? -114.135 2.941   -79.694  1.00 43.76  ? 383  LYS A CB    1 
ATOM   3060  C  CG    . LYS A  1 383 ? -113.375 2.162   -80.772  0.61 40.97  ? 383  LYS A CG    1 
ATOM   3061  C  CD    . LYS A  1 383 ? -113.382 0.641   -80.548  0.61 52.19  ? 383  LYS A CD    1 
ATOM   3062  C  CE    . LYS A  1 383 ? -112.434 0.186   -79.423  0.61 71.96  ? 383  LYS A CE    1 
ATOM   3063  N  NZ    . LYS A  1 383 ? -112.948 0.375   -78.025  0.61 81.87  ? 383  LYS A NZ    1 
ATOM   3064  N  N     . ASN A  1 384 ? -115.021 5.159   -77.834  1.00 59.96  ? 384  ASN A N     1 
ATOM   3065  C  CA    . ASN A  1 384 ? -115.897 5.745   -76.816  1.00 60.76  ? 384  ASN A CA    1 
ATOM   3066  C  C     . ASN A  1 384 ? -115.903 7.298   -76.739  1.00 55.36  ? 384  ASN A C     1 
ATOM   3067  O  O     . ASN A  1 384 ? -116.323 7.865   -75.729  1.00 57.39  ? 384  ASN A O     1 
ATOM   3068  C  CB    . ASN A  1 384 ? -115.563 5.069   -75.482  1.00 45.01  ? 384  ASN A CB    1 
ATOM   3069  C  CG    . ASN A  1 384 ? -115.887 3.592   -75.493  1.00 69.47  ? 384  ASN A CG    1 
ATOM   3070  O  OD1   . ASN A  1 384 ? -116.127 2.990   -74.454  1.00 85.03  ? 384  ASN A OD1   1 
ATOM   3071  N  ND2   . ASN A  1 384 ? -115.899 3.007   -76.690  1.00 49.09  ? 384  ASN A ND2   1 
ATOM   3072  N  N     . LYS A  1 385 ? -115.440 8.011   -77.775  1.00 53.30  ? 385  LYS A N     1 
ATOM   3073  C  CA    . LYS A  1 385 ? -115.414 9.501   -77.801  1.00 65.43  ? 385  LYS A CA    1 
ATOM   3074  C  C     . LYS A  1 385 ? -115.115 10.162  -76.442  1.00 71.57  ? 385  LYS A C     1 
ATOM   3075  O  O     . LYS A  1 385 ? -115.855 11.036  -75.963  1.00 80.94  ? 385  LYS A O     1 
ATOM   3076  C  CB    . LYS A  1 385 ? -116.729 10.014  -78.392  1.00 81.24  ? 385  LYS A CB    1 
ATOM   3077  C  CG    . LYS A  1 385 ? -117.147 9.295   -79.673  0.66 68.90  ? 385  LYS A CG    1 
ATOM   3078  C  CD    . LYS A  1 385 ? -116.807 10.072  -80.946  0.66 66.34  ? 385  LYS A CD    1 
ATOM   3079  C  CE    . LYS A  1 385 ? -117.164 9.265   -82.187  0.66 59.02  ? 385  LYS A CE    1 
ATOM   3080  N  NZ    . LYS A  1 385 ? -116.783 9.966   -83.446  0.66 63.08  ? 385  LYS A NZ    1 
ATOM   3081  N  N     . ILE A  1 386 ? -114.014 9.706   -75.834  1.00 78.17  ? 386  ILE A N     1 
ATOM   3082  C  CA    . ILE A  1 386 ? -113.614 10.222  -74.543  1.00 72.86  ? 386  ILE A CA    1 
ATOM   3083  C  C     . ILE A  1 386 ? -113.000 11.594  -74.646  1.00 71.78  ? 386  ILE A C     1 
ATOM   3084  O  O     . ILE A  1 386 ? -111.909 11.768  -75.196  1.00 59.88  ? 386  ILE A O     1 
ATOM   3085  C  CB    . ILE A  1 386 ? -112.619 9.284   -73.870  1.00 56.07  ? 386  ILE A CB    1 
ATOM   3086  C  CG1   . ILE A  1 386 ? -113.060 7.831   -74.084  1.00 45.72  ? 386  ILE A CG1   1 
ATOM   3087  C  CG2   . ILE A  1 386 ? -112.471 9.616   -72.399  1.00 55.49  ? 386  ILE A CG2   1 
ATOM   3088  C  CD1   . ILE A  1 386 ? -112.691 6.904   -72.947  1.00 66.19  ? 386  ILE A CD1   1 
ATOM   3089  N  N     . HIS A  1 387 ? -113.690 12.579  -74.098  1.00 73.30  ? 387  HIS A N     1 
ATOM   3090  C  CA    . HIS A  1 387 ? -113.155 13.913  -74.197  1.00 75.41  ? 387  HIS A CA    1 
ATOM   3091  C  C     . HIS A  1 387 ? -112.052 14.199  -73.197  1.00 72.70  ? 387  HIS A C     1 
ATOM   3092  O  O     . HIS A  1 387 ? -112.174 13.903  -72.007  1.00 83.59  ? 387  HIS A O     1 
ATOM   3093  C  CB    . HIS A  1 387 ? -114.248 14.976  -74.127  1.00 73.82  ? 387  HIS A CB    1 
ATOM   3094  C  CG    . HIS A  1 387 ? -113.920 16.205  -74.917  0.58 48.89  ? 387  HIS A CG    1 
ATOM   3095  N  ND1   . HIS A  1 387 ? -113.250 17.281  -74.377  0.58 44.42  ? 387  HIS A ND1   1 
ATOM   3096  C  CD2   . HIS A  1 387 ? -114.113 16.500  -76.226  0.58 54.51  ? 387  HIS A CD2   1 
ATOM   3097  C  CE1   . HIS A  1 387 ? -113.039 18.185  -75.319  0.58 39.97  ? 387  HIS A CE1   1 
ATOM   3098  N  NE2   . HIS A  1 387 ? -113.553 17.735  -76.450  0.58 51.49  ? 387  HIS A NE2   1 
ATOM   3099  N  N     . PRO A  1 388 ? -110.919 14.714  -73.702  1.00 66.59  ? 388  PRO A N     1 
ATOM   3100  C  CA    . PRO A  1 388 ? -109.712 15.084  -72.960  1.00 69.98  ? 388  PRO A CA    1 
ATOM   3101  C  C     . PRO A  1 388 ? -109.852 16.369  -72.147  1.00 73.32  ? 388  PRO A C     1 
ATOM   3102  O  O     . PRO A  1 388 ? -108.902 16.808  -71.499  1.00 81.73  ? 388  PRO A O     1 
ATOM   3103  C  CB    . PRO A  1 388 ? -108.671 15.249  -74.073  1.00 75.67  ? 388  PRO A CB    1 
ATOM   3104  C  CG    . PRO A  1 388 ? -109.476 15.700  -75.235  1.00 55.52  ? 388  PRO A CG    1 
ATOM   3105  C  CD    . PRO A  1 388 ? -110.670 14.783  -75.155  1.00 63.15  ? 388  PRO A CD    1 
ATOM   3106  N  N     . GLY A  1 389 ? -111.024 16.988  -72.212  1.00 65.85  ? 389  GLY A N     1 
ATOM   3107  C  CA    . GLY A  1 389 ? -111.241 18.211  -71.471  1.00 63.66  ? 389  GLY A CA    1 
ATOM   3108  C  C     . GLY A  1 389 ? -110.470 19.371  -72.059  1.00 66.39  ? 389  GLY A C     1 
ATOM   3109  O  O     . GLY A  1 389 ? -110.078 19.333  -73.226  1.00 67.13  ? 389  GLY A O     1 
ATOM   3110  N  N     . GLU A  1 390 ? -110.246 20.395  -71.240  1.00 78.60  ? 390  GLU A N     1 
ATOM   3111  C  CA    . GLU A  1 390 ? -109.526 21.589  -71.662  1.00 78.91  ? 390  GLU A CA    1 
ATOM   3112  C  C     . GLU A  1 390 ? -108.027 21.519  -71.399  1.00 85.95  ? 390  GLU A C     1 
ATOM   3113  O  O     . GLU A  1 390 ? -107.586 20.991  -70.377  1.00 100.00 ? 390  GLU A O     1 
ATOM   3114  C  CB    . GLU A  1 390 ? -110.120 22.829  -70.981  1.00 80.82  ? 390  GLU A CB    1 
ATOM   3115  C  CG    . GLU A  1 390 ? -111.536 23.165  -71.441  0.49 68.03  ? 390  GLU A CG    1 
ATOM   3116  C  CD    . GLU A  1 390 ? -111.647 23.300  -72.964  0.49 77.13  ? 390  GLU A CD    1 
ATOM   3117  O  OE1   . GLU A  1 390 ? -110.757 23.937  -73.580  0.49 65.43  ? 390  GLU A OE1   1 
ATOM   3118  O  OE2   . GLU A  1 390 ? -112.621 22.762  -73.545  0.49 53.78  ? 390  GLU A OE2   1 
ATOM   3119  N  N     . PRO A  1 391 ? -107.223 22.032  -72.342  1.00 77.61  ? 391  PRO A N     1 
ATOM   3120  C  CA    . PRO A  1 391 ? -105.753 22.060  -72.262  1.00 72.63  ? 391  PRO A CA    1 
ATOM   3121  C  C     . PRO A  1 391 ? -105.248 22.895  -71.092  1.00 67.03  ? 391  PRO A C     1 
ATOM   3122  O  O     . PRO A  1 391 ? -105.891 23.869  -70.685  1.00 79.31  ? 391  PRO A O     1 
ATOM   3123  C  CB    . PRO A  1 391 ? -105.347 22.717  -73.578  1.00 63.44  ? 391  PRO A CB    1 
ATOM   3124  C  CG    . PRO A  1 391 ? -106.472 22.340  -74.506  0.72 91.19  ? 391  PRO A CG    1 
ATOM   3125  C  CD    . PRO A  1 391 ? -107.696 22.507  -73.654  0.72 77.26  ? 391  PRO A CD    1 
ATOM   3126  N  N     . MET A  1 392 ? -104.101 22.502  -70.548  1.00 69.91  ? 392  MET A N     1 
ATOM   3127  C  CA    . MET A  1 392 ? -103.494 23.221  -69.433  1.00 73.02  ? 392  MET A CA    1 
ATOM   3128  C  C     . MET A  1 392 ? -102.592 24.301  -69.966  1.00 83.33  ? 392  MET A C     1 
ATOM   3129  O  O     . MET A  1 392 ? -101.564 24.011  -70.569  1.00 88.34  ? 392  MET A O     1 
ATOM   3130  C  CB    . MET A  1 392 ? -102.663 22.289  -68.550  1.00 64.56  ? 392  MET A CB    1 
ATOM   3131  C  CG    . MET A  1 392 ? -103.487 21.362  -67.701  0.47 54.06  ? 392  MET A CG    1 
ATOM   3132  S  SD    . MET A  1 392 ? -104.691 22.270  -66.727  0.47 68.33  ? 392  MET A SD    1 
ATOM   3133  C  CE    . MET A  1 392 ? -106.217 22.046  -67.682  0.47 62.45  ? 392  MET A CE    1 
ATOM   3134  N  N     . ASP A  1 393 ? -102.959 25.556  -69.762  0.42 41.55  ? 393  ASP A N     1 
ATOM   3135  C  CA    . ASP A  1 393 ? -102.096 26.630  -70.233  0.42 42.39  ? 393  ASP A CA    1 
ATOM   3136  C  C     . ASP A  1 393 ? -101.662 27.523  -69.057  0.42 43.22  ? 393  ASP A C     1 
ATOM   3137  O  O     . ASP A  1 393 ? -101.192 28.654  -69.251  0.42 43.40  ? 393  ASP A O     1 
ATOM   3138  C  CB    . ASP A  1 393 ? -102.777 27.407  -71.368  0.42 41.15  ? 393  ASP A CB    1 
ATOM   3139  C  CG    . ASP A  1 393 ? -103.010 26.541  -72.607  0.42 40.74  ? 393  ASP A CG    1 
ATOM   3140  O  OD1   . ASP A  1 393 ? -102.020 26.088  -73.224  0.42 40.15  ? 393  ASP A OD1   1 
ATOM   3141  O  OD2   . ASP A  1 393 ? -104.183 26.290  -72.951  0.42 40.49  ? 393  ASP A OD2   1 
ATOM   3142  N  N     . LYS A  1 394 ? -101.737 26.935  -67.852  0.42 43.60  ? 394  LYS A N     1 
ATOM   3143  C  CA    . LYS A  1 394 ? -101.388 27.581  -66.570  0.42 44.88  ? 394  LYS A CA    1 
ATOM   3144  C  C     . LYS A  1 394 ? -99.903  27.433  -66.127  0.42 45.47  ? 394  LYS A C     1 
ATOM   3145  O  O     . LYS A  1 394 ? -98.990  27.322  -66.971  0.42 45.72  ? 394  LYS A O     1 
ATOM   3146  C  CB    . LYS A  1 394 ? -102.343 27.078  -65.455  0.42 44.58  ? 394  LYS A CB    1 
ATOM   3147  C  CG    . LYS A  1 394 ? -103.170 28.168  -64.700  0.42 44.87  ? 394  LYS A CG    1 
ATOM   3148  C  CD    . LYS A  1 394 ? -102.357 28.943  -63.634  0.42 44.94  ? 394  LYS A CD    1 
ATOM   3149  C  CE    . LYS A  1 394 ? -102.089 30.397  -64.050  0.42 44.89  ? 394  LYS A CE    1 
ATOM   3150  N  NZ    . LYS A  1 394 ? -101.294 31.147  -63.029  0.42 44.90  ? 394  LYS A NZ    1 
ATOM   3151  N  N     . ASN A  1 395 ? -99.684  27.413  -64.803  0.42 46.57  ? 395  ASN A N     1 
ATOM   3152  C  CA    . ASN A  1 395 ? -98.308  27.353  -64.235  0.42 47.33  ? 395  ASN A CA    1 
ATOM   3153  C  C     . ASN A  1 395 ? -97.744  25.921  -63.963  0.42 47.62  ? 395  ASN A C     1 
ATOM   3154  O  O     . ASN A  1 395 ? -98.461  24.945  -63.738  0.42 47.93  ? 395  ASN A O     1 
ATOM   3155  C  CB    . ASN A  1 395 ? -98.213  28.351  -63.054  0.42 47.92  ? 395  ASN A CB    1 
ATOM   3156  C  CG    . ASN A  1 395 ? -97.701  29.710  -63.535  0.42 48.78  ? 395  ASN A CG    1 
ATOM   3157  O  OD1   . ASN A  1 395 ? -98.468  30.649  -63.779  0.42 48.70  ? 395  ASN A OD1   1 
ATOM   3158  N  ND2   . ASN A  1 395 ? -96.384  29.817  -63.676  0.42 48.48  ? 395  ASN A ND2   1 
ATOM   3159  N  N     . LEU A  1 396 ? -96.416  25.878  -64.002  0.42 47.66  ? 396  LEU A N     1 
ATOM   3160  C  CA    . LEU A  1 396 ? -95.546  24.686  -63.962  0.42 48.08  ? 396  LEU A CA    1 
ATOM   3161  C  C     . LEU A  1 396 ? -95.690  23.652  -62.804  0.42 47.56  ? 396  LEU A C     1 
ATOM   3162  O  O     . LEU A  1 396 ? -96.694  22.944  -62.781  0.42 47.00  ? 396  LEU A O     1 
ATOM   3163  C  CB    . LEU A  1 396 ? -94.106  25.160  -64.139  0.42 48.07  ? 396  LEU A CB    1 
ATOM   3164  C  CG    . LEU A  1 396 ? -93.498  26.049  -63.057  0.42 48.05  ? 396  LEU A CG    1 
ATOM   3165  C  CD1   . LEU A  1 396 ? -92.046  25.662  -62.795  0.42 47.44  ? 396  LEU A CD1   1 
ATOM   3166  C  CD2   . LEU A  1 396 ? -93.597  27.528  -63.423  0.42 47.36  ? 396  LEU A CD2   1 
ATOM   3167  N  N     . TYR A  1 397 ? -94.764  23.528  -61.839  0.42 47.33  ? 397  TYR A N     1 
ATOM   3168  C  CA    . TYR A  1 397 ? -94.862  22.397  -60.877  0.42 46.81  ? 397  TYR A CA    1 
ATOM   3169  C  C     . TYR A  1 397 ? -95.657  22.575  -59.553  0.42 47.09  ? 397  TYR A C     1 
ATOM   3170  O  O     . TYR A  1 397 ? -96.613  21.837  -59.321  0.42 47.71  ? 397  TYR A O     1 
ATOM   3171  C  CB    . TYR A  1 397 ? -93.445  21.888  -60.631  0.42 45.94  ? 397  TYR A CB    1 
ATOM   3172  C  CG    . TYR A  1 397 ? -92.874  21.050  -61.755  0.42 44.75  ? 397  TYR A CG    1 
ATOM   3173  C  CD1   . TYR A  1 397 ? -91.743  21.473  -62.456  0.42 43.75  ? 397  TYR A CD1   1 
ATOM   3174  C  CD2   . TYR A  1 397 ? -93.446  19.827  -62.116  0.42 44.35  ? 397  TYR A CD2   1 
ATOM   3175  C  CE1   . TYR A  1 397 ? -91.201  20.721  -63.487  0.42 43.21  ? 397  TYR A CE1   1 
ATOM   3176  C  CE2   . TYR A  1 397 ? -92.914  19.075  -63.167  0.42 43.79  ? 397  TYR A CE2   1 
ATOM   3177  C  CZ    . TYR A  1 397 ? -91.797  19.538  -63.845  0.42 43.19  ? 397  TYR A CZ    1 
ATOM   3178  O  OH    . TYR A  1 397 ? -91.285  18.814  -64.899  0.42 43.35  ? 397  TYR A OH    1 
ATOM   3179  N  N     . ASP A  1 398 ? -95.271  23.506  -58.699  0.42 47.32  ? 398  ASP A N     1 
ATOM   3180  C  CA    . ASP A  1 398 ? -96.060  23.777  -57.488  0.42 47.97  ? 398  ASP A CA    1 
ATOM   3181  C  C     . ASP A  1 398 ? -96.523  25.211  -57.176  0.42 48.02  ? 398  ASP A C     1 
ATOM   3182  O  O     . ASP A  1 398 ? -96.179  25.839  -56.157  0.42 47.99  ? 398  ASP A O     1 
ATOM   3183  C  CB    . ASP A  1 398 ? -95.539  23.028  -56.241  0.42 48.11  ? 398  ASP A CB    1 
ATOM   3184  C  CG    . ASP A  1 398 ? -96.686  22.368  -55.428  0.42 48.80  ? 398  ASP A CG    1 
ATOM   3185  O  OD1   . ASP A  1 398 ? -96.813  22.657  -54.210  0.42 49.53  ? 398  ASP A OD1   1 
ATOM   3186  O  OD2   . ASP A  1 398 ? -97.471  21.573  -56.014  0.42 49.17  ? 398  ASP A OD2   1 
ATOM   3187  N  N     . LEU A  1 399 ? -97.325  25.674  -58.137  0.42 47.92  ? 399  LEU A N     1 
ATOM   3188  C  CA    . LEU A  1 399 ? -98.031  26.950  -58.104  0.42 47.18  ? 399  LEU A CA    1 
ATOM   3189  C  C     . LEU A  1 399 ? -99.491  26.564  -57.902  0.42 47.30  ? 399  LEU A C     1 
ATOM   3190  O  O     . LEU A  1 399 ? -100.287 27.293  -57.302  0.42 47.74  ? 399  LEU A O     1 
ATOM   3191  C  CB    . LEU A  1 399 ? -97.825  27.729  -59.423  0.42 47.24  ? 399  LEU A CB    1 
ATOM   3192  C  CG    . LEU A  1 399 ? -98.609  29.045  -59.612  0.42 47.12  ? 399  LEU A CG    1 
ATOM   3193  C  CD1   . LEU A  1 399 ? -100.043 28.775  -60.063  0.42 46.78  ? 399  LEU A CD1   1 
ATOM   3194  C  CD2   . LEU A  1 399 ? -98.617  29.846  -58.318  0.42 46.47  ? 399  LEU A CD2   1 
ATOM   3195  N  N     . PRO A  1 400 ? -99.821  25.347  -58.450  0.42 47.64  ? 400  PRO A N     1 
ATOM   3196  C  CA    . PRO A  1 400 ? -101.186 24.755  -58.411  0.42 46.51  ? 400  PRO A CA    1 
ATOM   3197  C  C     . PRO A  1 400 ? -101.938 24.749  -57.081  0.42 47.66  ? 400  PRO A C     1 
ATOM   3198  O  O     . PRO A  1 400 ? -103.010 25.297  -57.053  0.42 47.73  ? 400  PRO A O     1 
ATOM   3199  C  CB    . PRO A  1 400 ? -101.047 23.434  -59.154  0.42 47.22  ? 400  PRO A CB    1 
ATOM   3200  C  CG    . PRO A  1 400 ? -100.096 23.802  -60.254  0.42 47.13  ? 400  PRO A CG    1 
ATOM   3201  C  CD    . PRO A  1 400 ? -99.249  24.935  -59.762  0.42 47.32  ? 400  PRO A CD    1 
ATOM   3202  N  N     . PRO A  1 401 ? -101.504 24.104  -55.956  0.42 48.38  ? 401  PRO A N     1 
ATOM   3203  C  CA    . PRO A  1 401 ? -102.434 24.046  -54.804  0.42 47.85  ? 401  PRO A CA    1 
ATOM   3204  C  C     . PRO A  1 401 ? -102.924 25.419  -54.258  0.42 49.26  ? 401  PRO A C     1 
ATOM   3205  O  O     . PRO A  1 401 ? -102.732 25.741  -53.077  0.42 48.98  ? 401  PRO A O     1 
ATOM   3206  C  CB    . PRO A  1 401 ? -101.663 23.212  -53.759  0.42 47.38  ? 401  PRO A CB    1 
ATOM   3207  C  CG    . PRO A  1 401 ? -100.863 22.285  -54.604  0.42 47.13  ? 401  PRO A CG    1 
ATOM   3208  C  CD    . PRO A  1 401 ? -100.326 23.252  -55.687  0.42 47.41  ? 401  PRO A CD    1 
ATOM   3209  N  N     . GLU A  1 402 ? -103.578 26.201  -55.126  0.42 50.86  ? 402  GLU A N     1 
ATOM   3210  C  CA    . GLU A  1 402 ? -104.141 27.518  -54.855  0.42 53.42  ? 402  GLU A CA    1 
ATOM   3211  C  C     . GLU A  1 402 ? -105.634 27.295  -54.616  0.42 56.86  ? 402  GLU A C     1 
ATOM   3212  O  O     . GLU A  1 402 ? -106.365 28.147  -54.081  0.42 56.30  ? 402  GLU A O     1 
ATOM   3213  C  CB    . GLU A  1 402 ? -103.970 28.425  -56.100  0.42 51.49  ? 402  GLU A CB    1 
ATOM   3214  C  CG    . GLU A  1 402 ? -105.051 28.263  -57.206  0.42 49.99  ? 402  GLU A CG    1 
ATOM   3215  C  CD    . GLU A  1 402 ? -104.601 27.546  -58.491  0.42 49.55  ? 402  GLU A CD    1 
ATOM   3216  O  OE1   . GLU A  1 402 ? -105.220 26.516  -58.852  0.42 48.87  ? 402  GLU A OE1   1 
ATOM   3217  O  OE2   . GLU A  1 402 ? -103.645 28.020  -59.148  0.42 48.57  ? 402  GLU A OE2   1 
ATOM   3218  N  N     . GLU A  1 403 ? -106.043 26.126  -55.088  0.42 59.12  ? 403  GLU A N     1 
ATOM   3219  C  CA    . GLU A  1 403 ? -107.358 25.558  -55.066  0.42 61.02  ? 403  GLU A CA    1 
ATOM   3220  C  C     . GLU A  1 403 ? -107.101 24.057  -54.996  0.42 62.71  ? 403  GLU A C     1 
ATOM   3221  O  O     . GLU A  1 403 ? -107.887 23.206  -55.421  0.42 65.00  ? 403  GLU A O     1 
ATOM   3222  C  CB    . GLU A  1 403 ? -108.108 26.015  -56.326  0.42 60.67  ? 403  GLU A CB    1 
ATOM   3223  C  CG    . GLU A  1 403 ? -109.443 25.390  -56.629  0.42 56.42  ? 403  GLU A CG    1 
ATOM   3224  C  CD    . GLU A  1 403 ? -109.990 25.935  -57.937  0.42 54.59  ? 403  GLU A CD    1 
ATOM   3225  O  OE1   . GLU A  1 403 ? -111.207 26.221  -57.991  0.42 52.04  ? 403  GLU A OE1   1 
ATOM   3226  O  OE2   . GLU A  1 403 ? -109.201 26.088  -58.893  0.42 52.37  ? 403  GLU A OE2   1 
ATOM   3227  N  N     . ALA A  1 404 ? -105.904 23.795  -54.428  1.00 66.94  ? 404  ALA A N     1 
ATOM   3228  C  CA    . ALA A  1 404 ? -105.266 22.481  -54.249  1.00 69.72  ? 404  ALA A CA    1 
ATOM   3229  C  C     . ALA A  1 404 ? -105.608 21.651  -55.479  1.00 72.17  ? 404  ALA A C     1 
ATOM   3230  O  O     . ALA A  1 404 ? -106.399 20.720  -55.391  1.00 73.60  ? 404  ALA A O     1 
ATOM   3231  C  CB    . ALA A  1 404 ? -105.739 21.811  -52.972  1.00 67.69  ? 404  ALA A CB    1 
ATOM   3232  N  N     . LYS A  1 405 ? -105.002 22.007  -56.624  1.00 74.42  ? 405  LYS A N     1 
ATOM   3233  C  CA    . LYS A  1 405 ? -105.385 21.308  -57.840  1.00 76.27  ? 405  LYS A CA    1 
ATOM   3234  C  C     . LYS A  1 405 ? -105.121 19.816  -57.787  1.00 75.42  ? 405  LYS A C     1 
ATOM   3235  O  O     . LYS A  1 405 ? -103.974 19.403  -57.701  1.00 76.92  ? 405  LYS A O     1 
ATOM   3236  C  CB    . LYS A  1 405 ? -104.649 21.931  -59.016  1.00 78.35  ? 405  LYS A CB    1 
ATOM   3237  C  CG    . LYS A  1 405 ? -105.492 22.905  -59.810  1.00 81.36  ? 405  LYS A CG    1 
ATOM   3238  C  CD    . LYS A  1 405 ? -106.823 22.272  -60.174  1.00 83.28  ? 405  LYS A CD    1 
ATOM   3239  C  CE    . LYS A  1 405 ? -107.964 23.007  -59.480  1.00 84.85  ? 405  LYS A CE    1 
ATOM   3240  N  NZ    . LYS A  1 405 ? -108.596 22.168  -58.435  1.00 84.27  ? 405  LYS A NZ    1 
ATOM   3241  N  N     . GLU A  1 406 ? -106.151 18.986  -57.846  1.00 72.71  ? 406  GLU A N     1 
ATOM   3242  C  CA    . GLU A  1 406 ? -106.008 17.578  -57.903  1.00 73.37  ? 406  GLU A CA    1 
ATOM   3243  C  C     . GLU A  1 406 ? -106.502 17.006  -59.240  1.00 73.73  ? 406  GLU A C     1 
ATOM   3244  O  O     . GLU A  1 406 ? -107.451 16.209  -59.264  1.00 74.85  ? 406  GLU A O     1 
ATOM   3245  C  CB    . GLU A  1 406 ? -106.843 16.977  -56.763  1.00 69.76  ? 406  GLU A CB    1 
ATOM   3246  C  CG    . GLU A  1 406 ? -108.145 17.777  -56.434  0.55 67.98  ? 406  GLU A CG    1 
ATOM   3247  C  CD    . GLU A  1 406 ? -109.090 18.022  -57.645  0.55 68.66  ? 406  GLU A CD    1 
ATOM   3248  O  OE1   . GLU A  1 406 ? -110.205 17.439  -57.649  0.55 68.62  ? 406  GLU A OE1   1 
ATOM   3249  O  OE2   . GLU A  1 406 ? -108.741 18.813  -58.571  0.55 66.90  ? 406  GLU A OE2   1 
ATOM   3250  N  N     . ILE A  1 407 ? -105.933 17.458  -60.356  1.00 100.00 ? 407  ILE A N     1 
ATOM   3251  C  CA    . ILE A  1 407 ? -106.333 16.899  -61.647  1.00 90.76  ? 407  ILE A CA    1 
ATOM   3252  C  C     . ILE A  1 407 ? -105.645 15.525  -61.758  1.00 85.18  ? 407  ILE A C     1 
ATOM   3253  O  O     . ILE A  1 407 ? -104.674 15.249  -61.040  1.00 93.98  ? 407  ILE A O     1 
ATOM   3254  C  CB    . ILE A  1 407 ? -105.950 17.816  -62.825  1.00 71.38  ? 407  ILE A CB    1 
ATOM   3255  C  CG1   . ILE A  1 407 ? -104.439 17.972  -62.920  0.65 55.42  ? 407  ILE A CG1   1 
ATOM   3256  C  CG2   . ILE A  1 407 ? -106.624 19.164  -62.664  0.65 89.37  ? 407  ILE A CG2   1 
ATOM   3257  C  CD1   . ILE A  1 407 ? -103.997 18.746  -64.140  0.65 72.17  ? 407  ILE A CD1   1 
ATOM   3258  N  N     . PRO A  1 408 ? -106.125 14.658  -62.661  1.00 67.29  ? 408  PRO A N     1 
ATOM   3259  C  CA    . PRO A  1 408 ? -105.548 13.319  -62.834  1.00 73.13  ? 408  PRO A CA    1 
ATOM   3260  C  C     . PRO A  1 408 ? -104.014 13.258  -62.957  1.00 79.17  ? 408  PRO A C     1 
ATOM   3261  O  O     . PRO A  1 408 ? -103.369 14.130  -63.563  1.00 65.29  ? 408  PRO A O     1 
ATOM   3262  C  CB    . PRO A  1 408 ? -106.258 12.812  -64.089  1.00 64.91  ? 408  PRO A CB    1 
ATOM   3263  C  CG    . PRO A  1 408 ? -106.518 14.095  -64.865  1.00 68.52  ? 408  PRO A CG    1 
ATOM   3264  C  CD    . PRO A  1 408 ? -107.034 14.980  -63.774  1.00 73.39  ? 408  PRO A CD    1 
ATOM   3265  N  N     . GLN A  1 409 ? -103.434 12.220  -62.362  1.00 64.10  ? 409  GLN A N     1 
ATOM   3266  C  CA    . GLN A  1 409 ? -101.993 12.044  -62.400  1.00 59.83  ? 409  GLN A CA    1 
ATOM   3267  C  C     . GLN A  1 409 ? -101.570 10.613  -62.585  1.00 54.86  ? 409  GLN A C     1 
ATOM   3268  O  O     . GLN A  1 409 ? -102.320 9.693   -62.268  1.00 57.45  ? 409  GLN A O     1 
ATOM   3269  C  CB    . GLN A  1 409 ? -101.370 12.567  -61.128  1.00 43.47  ? 409  GLN A CB    1 
ATOM   3270  C  CG    . GLN A  1 409 ? -101.108 14.029  -61.163  0.60 44.68  ? 409  GLN A CG    1 
ATOM   3271  C  CD    . GLN A  1 409 ? -100.782 14.544  -59.795  0.60 57.45  ? 409  GLN A CD    1 
ATOM   3272  O  OE1   . GLN A  1 409 ? -101.525 15.359  -59.236  0.60 71.64  ? 409  GLN A OE1   1 
ATOM   3273  N  NE2   . GLN A  1 409 ? -99.687  14.045  -59.217  0.60 34.46  ? 409  GLN A NE2   1 
ATOM   3274  N  N     . VAL A  1 410 ? -100.359 10.437  -63.107  1.00 43.55  ? 410  VAL A N     1 
ATOM   3275  C  CA    . VAL A  1 410 ? -99.800  9.106   -63.334  1.00 39.91  ? 410  VAL A CA    1 
ATOM   3276  C  C     . VAL A  1 410 ? -99.654  8.362   -62.014  1.00 37.51  ? 410  VAL A C     1 
ATOM   3277  O  O     . VAL A  1 410 ? -99.622  8.978   -60.946  1.00 45.56  ? 410  VAL A O     1 
ATOM   3278  C  CB    . VAL A  1 410 ? -98.438  9.186   -63.995  1.00 41.21  ? 410  VAL A CB    1 
ATOM   3279  C  CG1   . VAL A  1 410 ? -98.581  9.709   -65.418  1.00 30.57  ? 410  VAL A CG1   1 
ATOM   3280  C  CG2   . VAL A  1 410 ? -97.523  10.081  -63.163  1.00 39.42  ? 410  VAL A CG2   1 
ATOM   3281  N  N     . ALA A  1 411 ? -99.549  7.040   -62.097  1.00 31.84  ? 411  ALA A N     1 
ATOM   3282  C  CA    . ALA A  1 411 ? -99.433  6.199   -60.909  1.00 46.85  ? 411  ALA A CA    1 
ATOM   3283  C  C     . ALA A  1 411 ? -98.336  6.678   -59.948  1.00 48.68  ? 411  ALA A C     1 
ATOM   3284  O  O     . ALA A  1 411 ? -97.253  7.070   -60.369  1.00 51.63  ? 411  ALA A O     1 
ATOM   3285  C  CB    . ALA A  1 411 ? -99.206  4.753   -61.324  1.00 43.00  ? 411  ALA A CB    1 
ATOM   3286  N  N     . GLY A  1 412 ? -98.633  6.682   -58.656  1.00 50.79  ? 412  GLY A N     1 
ATOM   3287  C  CA    . GLY A  1 412 ? -97.646  7.135   -57.688  1.00 60.08  ? 412  GLY A CA    1 
ATOM   3288  C  C     . GLY A  1 412 ? -96.540  6.143   -57.371  1.00 43.49  ? 412  GLY A C     1 
ATOM   3289  O  O     . GLY A  1 412 ? -95.431  6.521   -56.989  1.00 49.95  ? 412  GLY A O     1 
ATOM   3290  N  N     . SER A  1 413 ? -96.859  4.865   -57.497  1.00 49.58  ? 413  SER A N     1 
ATOM   3291  C  CA    . SER A  1 413 ? -95.913  3.801   -57.223  1.00 39.99  ? 413  SER A CA    1 
ATOM   3292  C  C     . SER A  1 413 ? -96.048  2.739   -58.298  1.00 46.35  ? 413  SER A C     1 
ATOM   3293  O  O     . SER A  1 413 ? -96.717  2.944   -59.306  1.00 51.04  ? 413  SER A O     1 
ATOM   3294  C  CB    . SER A  1 413 ? -96.192  3.196   -55.847  1.00 50.22  ? 413  SER A CB    1 
ATOM   3295  O  OG    . SER A  1 413 ? -97.527  2.744   -55.752  1.00 46.94  ? 413  SER A OG    1 
ATOM   3296  N  N     . LEU A  1 414 ? -95.371  1.619   -58.111  1.00 59.40  ? 414  LEU A N     1 
ATOM   3297  C  CA    . LEU A  1 414 ? -95.466  0.555   -59.085  1.00 48.53  ? 414  LEU A CA    1 
ATOM   3298  C  C     . LEU A  1 414 ? -96.659  -0.328  -58.738  1.00 54.76  ? 414  LEU A C     1 
ATOM   3299  O  O     . LEU A  1 414 ? -97.417  -0.721  -59.623  1.00 51.40  ? 414  LEU A O     1 
ATOM   3300  C  CB    . LEU A  1 414 ? -94.183  -0.261  -59.106  1.00 38.50  ? 414  LEU A CB    1 
ATOM   3301  C  CG    . LEU A  1 414 ? -94.229  -1.391  -60.127  1.00 40.90  ? 414  LEU A CG    1 
ATOM   3302  C  CD1   . LEU A  1 414 ? -94.304  -0.829  -61.550  1.00 28.98  ? 414  LEU A CD1   1 
ATOM   3303  C  CD2   . LEU A  1 414 ? -93.020  -2.279  -59.935  1.00 30.20  ? 414  LEU A CD2   1 
ATOM   3304  N  N     . GLU A  1 415 ? -96.830  -0.612  -57.446  1.00 58.95  ? 415  GLU A N     1 
ATOM   3305  C  CA    . GLU A  1 415 ? -97.932  -1.448  -56.957  1.00 59.31  ? 415  GLU A CA    1 
ATOM   3306  C  C     . GLU A  1 415 ? -99.227  -0.881  -57.514  1.00 65.31  ? 415  GLU A C     1 
ATOM   3307  O  O     . GLU A  1 415 ? -100.094 -1.614  -57.999  1.00 74.44  ? 415  GLU A O     1 
ATOM   3308  C  CB    . GLU A  1 415 ? -97.964  -1.409  -55.430  1.00 51.96  ? 415  GLU A CB    1 
ATOM   3309  C  CG    . GLU A  1 415 ? -98.990  -2.322  -54.756  0.59 48.76  ? 415  GLU A CG    1 
ATOM   3310  C  CD    . GLU A  1 415 ? -98.976  -2.190  -53.221  0.59 64.04  ? 415  GLU A CD    1 
ATOM   3311  O  OE1   . GLU A  1 415 ? -99.911  -2.706  -52.561  0.59 54.85  ? 415  GLU A OE1   1 
ATOM   3312  O  OE2   . GLU A  1 415 ? -98.030  -1.570  -52.671  0.59 57.15  ? 415  GLU A OE2   1 
ATOM   3313  N  N     . GLU A  1 416 ? -99.320  0.444   -57.457  1.00 46.64  ? 416  GLU A N     1 
ATOM   3314  C  CA    . GLU A  1 416 ? -100.464 1.176   -57.958  1.00 42.79  ? 416  GLU A CA    1 
ATOM   3315  C  C     . GLU A  1 416 ? -100.609 0.870   -59.453  1.00 50.60  ? 416  GLU A C     1 
ATOM   3316  O  O     . GLU A  1 416 ? -101.538 0.182   -59.854  1.00 64.15  ? 416  GLU A O     1 
ATOM   3317  C  CB    . GLU A  1 416 ? -100.242 2.670   -57.712  1.00 49.86  ? 416  GLU A CB    1 
ATOM   3318  C  CG    . GLU A  1 416 ? -101.350 3.607   -58.180  1.00 60.72  ? 416  GLU A CG    1 
ATOM   3319  C  CD    . GLU A  1 416 ? -101.307 4.968   -57.483  1.00 69.82  ? 416  GLU A CD    1 
ATOM   3320  O  OE1   . GLU A  1 416 ? -102.105 5.852   -57.861  1.00 64.28  ? 416  GLU A OE1   1 
ATOM   3321  O  OE2   . GLU A  1 416 ? -100.494 5.147   -56.543  1.00 74.88  ? 416  GLU A OE2   1 
ATOM   3322  N  N     . ALA A  1 417 ? -99.640  1.306   -60.252  1.00 47.41  ? 417  ALA A N     1 
ATOM   3323  C  CA    . ALA A  1 417 ? -99.656  1.088   -61.696  1.00 43.26  ? 417  ALA A CA    1 
ATOM   3324  C  C     . ALA A  1 417 ? -100.048 -0.333  -62.060  1.00 45.99  ? 417  ALA A C     1 
ATOM   3325  O  O     . ALA A  1 417 ? -100.746 -0.567  -63.046  1.00 51.89  ? 417  ALA A O     1 
ATOM   3326  C  CB    . ALA A  1 417 ? -98.282  1.405   -62.295  1.00 39.36  ? 417  ALA A CB    1 
ATOM   3327  N  N     . LEU A  1 418 ? -99.594  -1.279  -61.253  1.00 32.78  ? 418  LEU A N     1 
ATOM   3328  C  CA    . LEU A  1 418 ? -99.880  -2.668  -61.516  1.00 35.30  ? 418  LEU A CA    1 
ATOM   3329  C  C     . LEU A  1 418 ? -101.336 -2.953  -61.242  1.00 48.80  ? 418  LEU A C     1 
ATOM   3330  O  O     . LEU A  1 418 ? -102.087 -3.343  -62.140  1.00 61.07  ? 418  LEU A O     1 
ATOM   3331  C  CB    . LEU A  1 418 ? -98.999  -3.570  -60.657  1.00 37.54  ? 418  LEU A CB    1 
ATOM   3332  C  CG    . LEU A  1 418 ? -97.533  -3.759  -61.056  1.00 39.92  ? 418  LEU A CG    1 
ATOM   3333  C  CD1   . LEU A  1 418 ? -96.960  -4.808  -60.140  1.00 45.05  ? 418  LEU A CD1   1 
ATOM   3334  C  CD2   . LEU A  1 418 ? -97.382  -4.209  -62.515  1.00 18.87  ? 418  LEU A CD2   1 
ATOM   3335  N  N     . ASN A  1 419 ? -101.734 -2.738  -59.996  1.00 49.77  ? 419  ASN A N     1 
ATOM   3336  C  CA    . ASN A  1 419 ? -103.108 -2.960  -59.588  1.00 50.85  ? 419  ASN A CA    1 
ATOM   3337  C  C     . ASN A  1 419 ? -104.099 -2.272  -60.566  1.00 41.59  ? 419  ASN A C     1 
ATOM   3338  O  O     . ASN A  1 419 ? -105.158 -2.818  -60.868  1.00 44.18  ? 419  ASN A O     1 
ATOM   3339  C  CB    . ASN A  1 419 ? -103.280 -2.497  -58.143  1.00 34.93  ? 419  ASN A CB    1 
ATOM   3340  C  CG    . ASN A  1 419 ? -104.634 -1.941  -57.895  0.58 53.78  ? 419  ASN A CG    1 
ATOM   3341  O  OD1   . ASN A  1 419 ? -104.814 -0.723  -57.910  0.58 55.08  ? 419  ASN A OD1   1 
ATOM   3342  N  ND2   . ASN A  1 419 ? -105.627 -2.823  -57.758  0.58 38.37  ? 419  ASN A ND2   1 
ATOM   3343  N  N     . ALA A  1 420 ? -103.721 -1.103  -61.083  1.00 38.85  ? 420  ALA A N     1 
ATOM   3344  C  CA    . ALA A  1 420 ? -104.526 -0.364  -62.058  1.00 48.02  ? 420  ALA A CA    1 
ATOM   3345  C  C     . ALA A  1 420 ? -104.655 -1.195  -63.335  1.00 39.04  ? 420  ALA A C     1 
ATOM   3346  O  O     . ALA A  1 420 ? -105.745 -1.367  -63.867  1.00 65.80  ? 420  ALA A O     1 
ATOM   3347  C  CB    . ALA A  1 420 ? -103.878 0.991   -62.384  1.00 34.76  ? 420  ALA A CB    1 
ATOM   3348  N  N     . LEU A  1 421 ? -103.538 -1.685  -63.843  1.00 39.83  ? 421  LEU A N     1 
ATOM   3349  C  CA    . LEU A  1 421 ? -103.570 -2.518  -65.033  1.00 47.22  ? 421  LEU A CA    1 
ATOM   3350  C  C     . LEU A  1 421 ? -104.397 -3.773  -64.736  1.00 50.02  ? 421  LEU A C     1 
ATOM   3351  O  O     . LEU A  1 421 ? -105.004 -4.345  -65.634  1.00 56.06  ? 421  LEU A O     1 
ATOM   3352  C  CB    . LEU A  1 421 ? -102.152 -2.919  -65.435  1.00 47.87  ? 421  LEU A CB    1 
ATOM   3353  C  CG    . LEU A  1 421 ? -102.053 -4.115  -66.382  1.00 50.04  ? 421  LEU A CG    1 
ATOM   3354  C  CD1   . LEU A  1 421 ? -102.411 -3.693  -67.795  1.00 49.33  ? 421  LEU A CD1   1 
ATOM   3355  C  CD2   . LEU A  1 421 ? -100.661 -4.707  -66.325  1.00 33.05  ? 421  LEU A CD2   1 
ATOM   3356  N  N     . ASP A  1 422 ? -104.410 -4.207  -63.479  1.00 45.74  ? 422  ASP A N     1 
ATOM   3357  C  CA    . ASP A  1 422 ? -105.183 -5.385  -63.095  1.00 54.08  ? 422  ASP A CA    1 
ATOM   3358  C  C     . ASP A  1 422 ? -106.646 -5.110  -63.452  1.00 65.66  ? 422  ASP A C     1 
ATOM   3359  O  O     . ASP A  1 422 ? -107.229 -5.762  -64.328  1.00 60.97  ? 422  ASP A O     1 
ATOM   3360  C  CB    . ASP A  1 422 ? -105.038 -5.608  -61.587  1.00 51.10  ? 422  ASP A CB    1 
ATOM   3361  C  CG    . ASP A  1 422 ? -105.783 -6.835  -61.085  1.00 60.39  ? 422  ASP A CG    1 
ATOM   3362  O  OD1   . ASP A  1 422 ? -106.310 -7.628  -61.903  1.00 55.91  ? 422  ASP A OD1   1 
ATOM   3363  O  OD2   . ASP A  1 422 ? -105.821 -7.006  -59.845  1.00 62.24  ? 422  ASP A OD2   1 
ATOM   3364  N  N     . LEU A  1 423 ? -107.196 -4.087  -62.804  1.00 52.07  ? 423  LEU A N     1 
ATOM   3365  C  CA    . LEU A  1 423 ? -108.572 -3.658  -63.000  1.00 44.63  ? 423  LEU A CA    1 
ATOM   3366  C  C     . LEU A  1 423 ? -108.884 -3.169  -64.417  1.00 46.68  ? 423  LEU A C     1 
ATOM   3367  O  O     . LEU A  1 423 ? -109.592 -3.836  -65.177  1.00 75.37  ? 423  LEU A O     1 
ATOM   3368  C  CB    . LEU A  1 423 ? -108.901 -2.559  -61.991  1.00 26.08  ? 423  LEU A CB    1 
ATOM   3369  C  CG    . LEU A  1 423 ? -108.457 -2.911  -60.563  1.00 49.68  ? 423  LEU A CG    1 
ATOM   3370  C  CD1   . LEU A  1 423 ? -108.936 -1.878  -59.543  1.00 56.86  ? 423  LEU A CD1   1 
ATOM   3371  C  CD2   . LEU A  1 423 ? -108.969 -4.275  -60.197  1.00 40.63  ? 423  LEU A CD2   1 
ATOM   3372  N  N     . ASP A  1 424 ? -108.344 -2.008  -64.769  1.00 37.22  ? 424  ASP A N     1 
ATOM   3373  C  CA    . ASP A  1 424 ? -108.563 -1.395  -66.081  1.00 40.32  ? 424  ASP A CA    1 
ATOM   3374  C  C     . ASP A  1 424 ? -107.973 -2.222  -67.244  1.00 43.84  ? 424  ASP A C     1 
ATOM   3375  O  O     . ASP A  1 424 ? -107.619 -1.686  -68.300  1.00 40.75  ? 424  ASP A O     1 
ATOM   3376  C  CB    . ASP A  1 424 ? -108.003 0.040   -66.045  1.00 40.61  ? 424  ASP A CB    1 
ATOM   3377  C  CG    . ASP A  1 424 ? -108.267 0.839   -67.320  1.00 59.24  ? 424  ASP A CG    1 
ATOM   3378  O  OD1   . ASP A  1 424 ? -107.626 1.908   -67.444  1.00 72.22  ? 424  ASP A OD1   1 
ATOM   3379  O  OD2   . ASP A  1 424 ? -109.085 0.429   -68.184  1.00 68.02  ? 424  ASP A OD2   1 
ATOM   3380  N  N     . ARG A  1 425 ? -107.950 -3.542  -67.085  1.00 32.51  ? 425  ARG A N     1 
ATOM   3381  C  CA    . ARG A  1 425 ? -107.398 -4.399  -68.122  1.00 45.46  ? 425  ARG A CA    1 
ATOM   3382  C  C     . ARG A  1 425 ? -108.269 -4.560  -69.348  1.00 53.88  ? 425  ARG A C     1 
ATOM   3383  O  O     . ARG A  1 425 ? -107.828 -5.092  -70.377  1.00 55.45  ? 425  ARG A O     1 
ATOM   3384  C  CB    . ARG A  1 425 ? -107.125 -5.780  -67.561  1.00 42.66  ? 425  ARG A CB    1 
ATOM   3385  C  CG    . ARG A  1 425 ? -108.343 -6.596  -67.360  1.00 37.87  ? 425  ARG A CG    1 
ATOM   3386  C  CD    . ARG A  1 425 ? -107.950 -8.010  -67.022  1.00 56.99  ? 425  ARG A CD    1 
ATOM   3387  N  NE    . ARG A  1 425 ? -107.328 -8.095  -65.707  1.00 46.84  ? 425  ARG A NE    1 
ATOM   3388  C  CZ    . ARG A  1 425 ? -106.511 -9.071  -65.337  1.00 53.82  ? 425  ARG A CZ    1 
ATOM   3389  N  NH1   . ARG A  1 425 ? -105.995 -9.066  -64.117  1.00 52.22  ? 425  ARG A NH1   1 
ATOM   3390  N  NH2   . ARG A  1 425 ? -106.200 -10.043 -66.191  1.00 38.44  ? 425  ARG A NH2   1 
ATOM   3391  N  N     . GLU A  1 426 ? -109.499 -4.086  -69.253  1.00 61.51  ? 426  GLU A N     1 
ATOM   3392  C  CA    . GLU A  1 426 ? -110.403 -4.277  -70.355  1.00 57.17  ? 426  GLU A CA    1 
ATOM   3393  C  C     . GLU A  1 426 ? -110.002 -3.764  -71.720  1.00 58.72  ? 426  GLU A C     1 
ATOM   3394  O  O     . GLU A  1 426 ? -110.001 -4.536  -72.690  1.00 51.04  ? 426  GLU A O     1 
ATOM   3395  C  CB    . GLU A  1 426 ? -111.816 -3.877  -69.961  1.00 82.02  ? 426  GLU A CB    1 
ATOM   3396  C  CG    . GLU A  1 426 ? -112.442 -4.876  -68.971  0.67 63.86  ? 426  GLU A CG    1 
ATOM   3397  C  CD    . GLU A  1 426 ? -112.305 -6.357  -69.405  0.67 69.85  ? 426  GLU A CD    1 
ATOM   3398  O  OE1   . GLU A  1 426 ? -111.981 -7.206  -68.532  0.67 42.48  ? 426  GLU A OE1   1 
ATOM   3399  O  OE2   . GLU A  1 426 ? -112.526 -6.680  -70.604  0.67 52.41  ? 426  GLU A OE2   1 
ATOM   3400  N  N     . PHE A  1 427 ? -109.544 -2.521  -71.795  1.00 48.04  ? 427  PHE A N     1 
ATOM   3401  C  CA    . PHE A  1 427 ? -109.186 -1.988  -73.104  1.00 46.76  ? 427  PHE A CA    1 
ATOM   3402  C  C     . PHE A  1 427 ? -108.030 -2.706  -73.784  1.00 47.54  ? 427  PHE A C     1 
ATOM   3403  O  O     . PHE A  1 427 ? -107.835 -2.576  -74.994  1.00 49.10  ? 427  PHE A O     1 
ATOM   3404  C  CB    . PHE A  1 427 ? -108.903 -0.498  -73.025  1.00 53.02  ? 427  PHE A CB    1 
ATOM   3405  C  CG    . PHE A  1 427 ? -107.599 -0.171  -72.403  1.00 65.19  ? 427  PHE A CG    1 
ATOM   3406  C  CD1   . PHE A  1 427 ? -106.563 0.343   -73.180  1.00 52.16  ? 427  PHE A CD1   1 
ATOM   3407  C  CD2   . PHE A  1 427 ? -107.392 -0.386  -71.044  1.00 71.64  ? 427  PHE A CD2   1 
ATOM   3408  C  CE1   . PHE A  1 427 ? -105.339 0.635   -72.614  1.00 60.80  ? 427  PHE A CE1   1 
ATOM   3409  C  CE2   . PHE A  1 427 ? -106.168 -0.095  -70.465  1.00 45.67  ? 427  PHE A CE2   1 
ATOM   3410  C  CZ    . PHE A  1 427 ? -105.139 0.415   -71.252  1.00 51.13  ? 427  PHE A CZ    1 
ATOM   3411  N  N     . LEU A  1 428 ? -107.265 -3.465  -73.010  1.00 53.85  ? 428  LEU A N     1 
ATOM   3412  C  CA    . LEU A  1 428 ? -106.127 -4.185  -73.568  1.00 56.65  ? 428  LEU A CA    1 
ATOM   3413  C  C     . LEU A  1 428 ? -106.525 -5.516  -74.163  1.00 61.58  ? 428  LEU A C     1 
ATOM   3414  O  O     . LEU A  1 428 ? -105.927 -5.968  -75.150  1.00 57.46  ? 428  LEU A O     1 
ATOM   3415  C  CB    . LEU A  1 428 ? -105.064 -4.425  -72.499  1.00 59.43  ? 428  LEU A CB    1 
ATOM   3416  C  CG    . LEU A  1 428 ? -103.843 -3.505  -72.351  1.00 64.38  ? 428  LEU A CG    1 
ATOM   3417  C  CD1   . LEU A  1 428 ? -103.822 -2.344  -73.349  1.00 60.39  ? 428  LEU A CD1   1 
ATOM   3418  C  CD2   . LEU A  1 428 ? -103.806 -3.003  -70.920  1.00 32.46  ? 428  LEU A CD2   1 
ATOM   3419  N  N     . LYS A  1 429 ? -107.519 -6.151  -73.545  1.00 58.45  ? 429  LYS A N     1 
ATOM   3420  C  CA    . LYS A  1 429 ? -107.993 -7.453  -74.006  1.00 60.34  ? 429  LYS A CA    1 
ATOM   3421  C  C     . LYS A  1 429 ? -108.775 -7.361  -75.313  1.00 60.48  ? 429  LYS A C     1 
ATOM   3422  O  O     . LYS A  1 429 ? -108.978 -8.366  -76.008  1.00 55.37  ? 429  LYS A O     1 
ATOM   3423  C  CB    . LYS A  1 429 ? -108.806 -8.121  -72.908  1.00 41.38  ? 429  LYS A CB    1 
ATOM   3424  C  CG    . LYS A  1 429 ? -108.009 -8.326  -71.638  1.00 61.76  ? 429  LYS A CG    1 
ATOM   3425  C  CD    . LYS A  1 429 ? -108.897 -8.495  -70.426  1.00 79.60  ? 429  LYS A CD    1 
ATOM   3426  C  CE    . LYS A  1 429 ? -109.834 -9.682  -70.566  1.00 67.45  ? 429  LYS A CE    1 
ATOM   3427  N  NZ    . LYS A  1 429 ? -110.689 -9.791  -69.355  1.00 74.74  ? 429  LYS A NZ    1 
ATOM   3428  N  N     . ALA A  1 430 ? -109.182 -6.139  -75.652  1.00 50.26  ? 430  ALA A N     1 
ATOM   3429  C  CA    . ALA A  1 430 ? -109.902 -5.872  -76.889  1.00 49.08  ? 430  ALA A CA    1 
ATOM   3430  C  C     . ALA A  1 430 ? -109.146 -6.477  -78.065  1.00 50.24  ? 430  ALA A C     1 
ATOM   3431  O  O     . ALA A  1 430 ? -107.916 -6.523  -78.061  1.00 76.51  ? 430  ALA A O     1 
ATOM   3432  C  CB    . ALA A  1 430 ? -110.034 -4.380  -77.097  1.00 48.05  ? 430  ALA A CB    1 
ATOM   3433  N  N     . GLY A  1 431 ? -109.888 -6.930  -79.069  1.00 62.54  ? 431  GLY A N     1 
ATOM   3434  C  CA    . GLY A  1 431 ? -109.288 -7.535  -80.248  1.00 46.94  ? 431  GLY A CA    1 
ATOM   3435  C  C     . GLY A  1 431 ? -108.418 -8.734  -79.934  1.00 63.74  ? 431  GLY A C     1 
ATOM   3436  O  O     . GLY A  1 431 ? -107.659 -9.174  -80.806  1.00 68.92  ? 431  GLY A O     1 
ATOM   3437  N  N     . GLY A  1 432 ? -108.526 -9.255  -78.703  1.00 60.95  ? 432  GLY A N     1 
ATOM   3438  C  CA    . GLY A  1 432 ? -107.723 -10.398 -78.283  1.00 65.99  ? 432  GLY A CA    1 
ATOM   3439  C  C     . GLY A  1 432 ? -106.225 -10.117 -78.349  1.00 71.02  ? 432  GLY A C     1 
ATOM   3440  O  O     . GLY A  1 432 ? -105.422 -11.030 -78.564  1.00 60.93  ? 432  GLY A O     1 
ATOM   3441  N  N     . VAL A  1 433 ? -105.870 -8.836  -78.210  1.00 68.44  ? 433  VAL A N     1 
ATOM   3442  C  CA    . VAL A  1 433 ? -104.489 -8.365  -78.248  1.00 54.42  ? 433  VAL A CA    1 
ATOM   3443  C  C     . VAL A  1 433 ? -103.800 -8.860  -76.990  1.00 57.84  ? 433  VAL A C     1 
ATOM   3444  O  O     . VAL A  1 433 ? -102.805 -9.590  -77.053  1.00 49.92  ? 433  VAL A O     1 
ATOM   3445  C  CB    . VAL A  1 433 ? -104.437 -6.822  -78.312  1.00 55.02  ? 433  VAL A CB    1 
ATOM   3446  C  CG1   . VAL A  1 433 ? -103.024 -6.337  -78.152  1.00 59.86  ? 433  VAL A CG1   1 
ATOM   3447  C  CG2   . VAL A  1 433 ? -104.964 -6.343  -79.649  1.00 44.65  ? 433  VAL A CG2   1 
ATOM   3448  N  N     . PHE A  1 434 ? -104.324 -8.440  -75.845  1.00 47.49  ? 434  PHE A N     1 
ATOM   3449  C  CA    . PHE A  1 434 ? -103.784 -8.887  -74.578  1.00 47.12  ? 434  PHE A CA    1 
ATOM   3450  C  C     . PHE A  1 434 ? -104.723 -9.920  -74.030  1.00 49.45  ? 434  PHE A C     1 
ATOM   3451  O  O     . PHE A  1 434 ? -105.941 -9.804  -74.148  1.00 58.91  ? 434  PHE A O     1 
ATOM   3452  C  CB    . PHE A  1 434 ? -103.666 -7.746  -73.580  1.00 55.90  ? 434  PHE A CB    1 
ATOM   3453  C  CG    . PHE A  1 434 ? -102.435 -6.921  -73.754  1.00 73.19  ? 434  PHE A CG    1 
ATOM   3454  C  CD1   . PHE A  1 434 ? -101.294 -7.194  -73.014  1.00 63.66  ? 434  PHE A CD1   1 
ATOM   3455  C  CD2   . PHE A  1 434 ? -102.407 -5.873  -74.666  1.00 73.53  ? 434  PHE A CD2   1 
ATOM   3456  C  CE1   . PHE A  1 434 ? -100.140 -6.429  -73.186  1.00 54.47  ? 434  PHE A CE1   1 
ATOM   3457  C  CE2   . PHE A  1 434 ? -101.251 -5.103  -74.839  1.00 66.55  ? 434  PHE A CE2   1 
ATOM   3458  C  CZ    . PHE A  1 434 ? -100.124 -5.382  -74.101  1.00 58.18  ? 434  PHE A CZ    1 
ATOM   3459  N  N     . THR A  1 435 ? -104.150 -10.955 -73.455  1.00 40.22  ? 435  THR A N     1 
ATOM   3460  C  CA    . THR A  1 435 ? -104.953 -12.004 -72.877  1.00 37.38  ? 435  THR A CA    1 
ATOM   3461  C  C     . THR A  1 435 ? -104.796 -11.879 -71.381  1.00 42.92  ? 435  THR A C     1 
ATOM   3462  O  O     . THR A  1 435 ? -103.846 -11.269 -70.900  1.00 58.30  ? 435  THR A O     1 
ATOM   3463  C  CB    . THR A  1 435 ? -104.470 -13.364 -73.330  1.00 34.51  ? 435  THR A CB    1 
ATOM   3464  O  OG1   . THR A  1 435 ? -103.550 -13.884 -72.361  1.00 52.76  ? 435  THR A OG1   1 
ATOM   3465  C  CG2   . THR A  1 435 ? -103.777 -13.230 -74.687  1.00 41.79  ? 435  THR A CG2   1 
ATOM   3466  N  N     . ASP A  1 436 ? -105.708 -12.489 -70.645  1.00 49.51  ? 436  ASP A N     1 
ATOM   3467  C  CA    . ASP A  1 436 ? -105.657 -12.405 -69.208  1.00 51.53  ? 436  ASP A CA    1 
ATOM   3468  C  C     . ASP A  1 436 ? -104.386 -12.936 -68.600  1.00 51.86  ? 436  ASP A C     1 
ATOM   3469  O  O     . ASP A  1 436 ? -103.702 -12.189 -67.912  1.00 63.05  ? 436  ASP A O     1 
ATOM   3470  C  CB    . ASP A  1 436 ? -106.880 -13.053 -68.586  1.00 76.53  ? 436  ASP A CB    1 
ATOM   3471  C  CG    . ASP A  1 436 ? -108.122 -12.234 -68.805  1.00 76.16  ? 436  ASP A CG    1 
ATOM   3472  O  OD1   . ASP A  1 436 ? -109.083 -12.754 -69.409  1.00 84.14  ? 436  ASP A OD1   1 
ATOM   3473  O  OD2   . ASP A  1 436 ? -108.113 -11.055 -68.395  1.00 65.45  ? 436  ASP A OD2   1 
ATOM   3474  N  N     . GLU A  1 437 ? -104.024 -14.187 -68.866  1.00 46.06  ? 437  GLU A N     1 
ATOM   3475  C  CA    . GLU A  1 437 ? -102.791 -14.683 -68.258  1.00 71.64  ? 437  GLU A CA    1 
ATOM   3476  C  C     . GLU A  1 437 ? -101.543 -13.972 -68.785  1.00 58.93  ? 437  GLU A C     1 
ATOM   3477  O  O     . GLU A  1 437 ? -100.554 -13.864 -68.062  1.00 70.80  ? 437  GLU A O     1 
ATOM   3478  C  CB    . GLU A  1 437 ? -102.642 -16.220 -68.284  1.00 73.85  ? 437  GLU A CB    1 
ATOM   3479  C  CG    . GLU A  1 437 ? -103.670 -16.988 -69.083  0.58 60.27  ? 437  GLU A CG    1 
ATOM   3480  C  CD    . GLU A  1 437 ? -103.633 -16.627 -70.550  0.58 80.35  ? 437  GLU A CD    1 
ATOM   3481  O  OE1   . GLU A  1 437 ? -104.602 -15.974 -71.009  0.58 76.44  ? 437  GLU A OE1   1 
ATOM   3482  O  OE2   . GLU A  1 437 ? -102.629 -16.970 -71.228  0.58 62.30  ? 437  GLU A OE2   1 
ATOM   3483  N  N     . ALA A  1 438 ? -101.601 -13.434 -70.004  1.00 46.80  ? 438  ALA A N     1 
ATOM   3484  C  CA    . ALA A  1 438 ? -100.446 -12.702 -70.537  1.00 53.39  ? 438  ALA A CA    1 
ATOM   3485  C  C     . ALA A  1 438 ? -100.248 -11.539 -69.569  1.00 47.16  ? 438  ALA A C     1 
ATOM   3486  O  O     . ALA A  1 438 ? -99.145  -11.306 -69.050  1.00 55.87  ? 438  ALA A O     1 
ATOM   3487  C  CB    . ALA A  1 438 ? -100.722 -12.183 -71.954  1.00 43.83  ? 438  ALA A CB    1 
ATOM   3488  N  N     . ILE A  1 439 ? -101.366 -10.905 -69.241  1.00 26.08  ? 439  ILE A N     1 
ATOM   3489  C  CA    . ILE A  1 439 ? -101.396 -9.783  -68.318  1.00 33.78  ? 439  ILE A CA    1 
ATOM   3490  C  C     . ILE A  1 439 ? -101.169 -10.212 -66.859  1.00 32.68  ? 439  ILE A C     1 
ATOM   3491  O  O     . ILE A  1 439 ? -100.498 -9.525  -66.097  1.00 46.37  ? 439  ILE A O     1 
ATOM   3492  C  CB    . ILE A  1 439 ? -102.747 -9.053  -68.440  1.00 36.80  ? 439  ILE A CB    1 
ATOM   3493  C  CG1   . ILE A  1 439 ? -102.856 -8.396  -69.812  1.00 42.15  ? 439  ILE A CG1   1 
ATOM   3494  C  CG2   . ILE A  1 439 ? -102.948 -8.049  -67.316  1.00 25.59  ? 439  ILE A CG2   1 
ATOM   3495  C  CD1   . ILE A  1 439 ? -104.169 -7.695  -70.008  1.00 49.41  ? 439  ILE A CD1   1 
ATOM   3496  N  N     . ASP A  1 440 ? -101.715 -11.352 -66.469  1.00 35.94  ? 440  ASP A N     1 
ATOM   3497  C  CA    . ASP A  1 440 ? -101.554 -11.802 -65.092  1.00 53.48  ? 440  ASP A CA    1 
ATOM   3498  C  C     . ASP A  1 440 ? -100.126 -12.236 -64.815  1.00 56.19  ? 440  ASP A C     1 
ATOM   3499  O  O     . ASP A  1 440 ? -99.652  -12.116 -63.675  1.00 64.35  ? 440  ASP A O     1 
ATOM   3500  C  CB    . ASP A  1 440 ? -102.536 -12.936 -64.759  1.00 63.62  ? 440  ASP A CB    1 
ATOM   3501  C  CG    . ASP A  1 440 ? -103.986 -12.468 -64.716  1.00 67.59  ? 440  ASP A CG    1 
ATOM   3502  O  OD1   . ASP A  1 440 ? -104.274 -11.485 -63.998  1.00 60.92  ? 440  ASP A OD1   1 
ATOM   3503  O  OD2   . ASP A  1 440 ? -104.834 -13.085 -65.399  1.00 65.96  ? 440  ASP A OD2   1 
ATOM   3504  N  N     . ALA A  1 441 ? -99.453  -12.730 -65.861  1.00 46.04  ? 441  ALA A N     1 
ATOM   3505  C  CA    . ALA A  1 441 ? -98.066  -13.190 -65.764  1.00 43.43  ? 441  ALA A CA    1 
ATOM   3506  C  C     . ALA A  1 441 ? -97.167  -11.988 -65.559  1.00 55.81  ? 441  ALA A C     1 
ATOM   3507  O  O     . ALA A  1 441 ? -96.315  -12.000 -64.673  1.00 51.28  ? 441  ALA A O     1 
ATOM   3508  C  CB    . ALA A  1 441 ? -97.648  -13.936 -67.020  1.00 43.84  ? 441  ALA A CB    1 
ATOM   3509  N  N     . TYR A  1 442 ? -97.361  -10.959 -66.386  1.00 47.32  ? 442  TYR A N     1 
ATOM   3510  C  CA    . TYR A  1 442 ? -96.587  -9.724  -66.290  1.00 30.60  ? 442  TYR A CA    1 
ATOM   3511  C  C     . TYR A  1 442 ? -96.705  -9.169  -64.869  1.00 38.54  ? 442  TYR A C     1 
ATOM   3512  O  O     . TYR A  1 442 ? -95.705  -8.942  -64.187  1.00 51.07  ? 442  TYR A O     1 
ATOM   3513  C  CB    . TYR A  1 442 ? -97.125  -8.701  -67.283  1.00 27.28  ? 442  TYR A CB    1 
ATOM   3514  C  CG    . TYR A  1 442 ? -96.332  -7.410  -67.395  1.00 30.21  ? 442  TYR A CG    1 
ATOM   3515  C  CD1   . TYR A  1 442 ? -96.540  -6.350  -66.511  1.00 40.96  ? 442  TYR A CD1   1 
ATOM   3516  C  CD2   . TYR A  1 442 ? -95.369  -7.250  -68.393  1.00 44.05  ? 442  TYR A CD2   1 
ATOM   3517  C  CE1   . TYR A  1 442 ? -95.795  -5.156  -66.621  1.00 45.39  ? 442  TYR A CE1   1 
ATOM   3518  C  CE2   . TYR A  1 442 ? -94.628  -6.075  -68.509  1.00 50.36  ? 442  TYR A CE2   1 
ATOM   3519  C  CZ    . TYR A  1 442 ? -94.841  -5.031  -67.622  1.00 49.72  ? 442  TYR A CZ    1 
ATOM   3520  O  OH    . TYR A  1 442 ? -94.095  -3.871  -67.761  1.00 63.75  ? 442  TYR A OH    1 
ATOM   3521  N  N     . ILE A  1 443 ? -97.934  -9.006  -64.404  1.00 28.55  ? 443  ILE A N     1 
ATOM   3522  C  CA    . ILE A  1 443 ? -98.161  -8.475  -63.070  1.00 39.64  ? 443  ILE A CA    1 
ATOM   3523  C  C     . ILE A  1 443 ? -97.397  -9.273  -62.020  1.00 41.07  ? 443  ILE A C     1 
ATOM   3524  O  O     . ILE A  1 443 ? -96.754  -8.705  -61.150  1.00 49.84  ? 443  ILE A O     1 
ATOM   3525  C  CB    . ILE A  1 443 ? -99.676  -8.423  -62.749  1.00 47.70  ? 443  ILE A CB    1 
ATOM   3526  C  CG1   . ILE A  1 443 ? -100.350 -7.379  -63.644  1.00 46.62  ? 443  ILE A CG1   1 
ATOM   3527  C  CG2   . ILE A  1 443 ? -99.921  -8.072  -61.278  1.00 36.67  ? 443  ILE A CG2   1 
ATOM   3528  C  CD1   . ILE A  1 443 ? -101.848 -7.510  -63.706  1.00 72.21  ? 443  ILE A CD1   1 
ATOM   3529  N  N     . ALA A  1 444 ? -97.395  -10.588 -62.160  1.00 38.37  ? 444  ALA A N     1 
ATOM   3530  C  CA    . ALA A  1 444 ? -96.702  -11.460 -61.214  1.00 45.57  ? 444  ALA A CA    1 
ATOM   3531  C  C     . ALA A  1 444 ? -95.190  -11.189 -61.093  1.00 45.45  ? 444  ALA A C     1 
ATOM   3532  O  O     . ALA A  1 444 ? -94.631  -11.171 -59.987  1.00 52.99  ? 444  ALA A O     1 
ATOM   3533  C  CB    . ALA A  1 444 ? -96.929  -12.900 -61.618  1.00 40.94  ? 444  ALA A CB    1 
ATOM   3534  N  N     . LEU A  1 445 ? -94.550  -11.034 -62.251  1.00 33.00  ? 445  LEU A N     1 
ATOM   3535  C  CA    . LEU A  1 445 ? -93.119  -10.791 -62.385  1.00 32.89  ? 445  LEU A CA    1 
ATOM   3536  C  C     . LEU A  1 445 ? -92.703  -9.518  -61.702  1.00 53.06  ? 445  LEU A C     1 
ATOM   3537  O  O     . LEU A  1 445 ? -91.725  -9.458  -60.936  1.00 57.32  ? 445  LEU A O     1 
ATOM   3538  C  CB    . LEU A  1 445 ? -92.767  -10.634 -63.857  1.00 33.79  ? 445  LEU A CB    1 
ATOM   3539  C  CG    . LEU A  1 445 ? -92.717  -11.896 -64.703  1.00 43.15  ? 445  LEU A CG    1 
ATOM   3540  C  CD1   . LEU A  1 445 ? -92.443  -11.523 -66.139  1.00 34.97  ? 445  LEU A CD1   1 
ATOM   3541  C  CD2   . LEU A  1 445 ? -91.638  -12.817 -64.182  1.00 42.37  ? 445  LEU A CD2   1 
ATOM   3542  N  N     . ARG A  1 446 ? -93.402  -8.472  -62.099  1.00 28.88  ? 446  ARG A N     1 
ATOM   3543  C  CA    . ARG A  1 446 ? -93.160  -7.165  -61.568  1.00 23.09  ? 446  ARG A CA    1 
ATOM   3544  C  C     . ARG A  1 446 ? -93.475  -7.133  -60.068  1.00 32.65  ? 446  ARG A C     1 
ATOM   3545  O  O     . ARG A  1 446 ? -92.804  -6.450  -59.286  1.00 38.64  ? 446  ARG A O     1 
ATOM   3546  C  CB    . ARG A  1 446 ? -94.004  -6.174  -62.359  1.00 28.02  ? 446  ARG A CB    1 
ATOM   3547  C  CG    . ARG A  1 446 ? -93.690  -6.168  -63.870  1.00 31.48  ? 446  ARG A CG    1 
ATOM   3548  C  CD    . ARG A  1 446 ? -92.249  -5.806  -64.115  1.00 35.92  ? 446  ARG A CD    1 
ATOM   3549  N  NE    . ARG A  1 446 ? -91.965  -5.400  -65.486  1.00 43.75  ? 446  ARG A NE    1 
ATOM   3550  C  CZ    . ARG A  1 446 ? -90.731  -5.235  -65.966  1.00 50.10  ? 446  ARG A CZ    1 
ATOM   3551  N  NH1   . ARG A  1 446 ? -90.538  -4.856  -67.227  1.00 37.47  ? 446  ARG A NH1   1 
ATOM   3552  N  NH2   . ARG A  1 446 ? -89.681  -5.465  -65.187  1.00 53.32  ? 446  ARG A NH2   1 
ATOM   3553  N  N     . ARG A  1 447 ? -94.452  -7.929  -59.654  1.00 34.22  ? 447  ARG A N     1 
ATOM   3554  C  CA    . ARG A  1 447 ? -94.830  -7.955  -58.251  1.00 45.79  ? 447  ARG A CA    1 
ATOM   3555  C  C     . ARG A  1 447 ? -93.682  -8.459  -57.401  1.00 54.23  ? 447  ARG A C     1 
ATOM   3556  O  O     . ARG A  1 447 ? -93.457  -7.951  -56.297  1.00 40.23  ? 447  ARG A O     1 
ATOM   3557  C  CB    . ARG A  1 447 ? -96.094  -8.805  -58.027  1.00 57.55  ? 447  ARG A CB    1 
ATOM   3558  C  CG    . ARG A  1 447 ? -97.419  -8.047  -58.222  0.71 29.04  ? 447  ARG A CG    1 
ATOM   3559  C  CD    . ARG A  1 447 ? -97.700  -7.113  -57.030  0.71 71.43  ? 447  ARG A CD    1 
ATOM   3560  N  NE    . ARG A  1 447 ? -98.747  -6.091  -57.227  0.71 68.00  ? 447  ARG A NE    1 
ATOM   3561  C  CZ    . ARG A  1 447 ? -99.993  -6.300  -57.669  0.71 60.85  ? 447  ARG A CZ    1 
ATOM   3562  N  NH1   . ARG A  1 447 ? -100.819 -5.265  -57.767  0.71 61.59  ? 447  ARG A NH1   1 
ATOM   3563  N  NH2   . ARG A  1 447 ? -100.412 -7.508  -58.056  0.71 18.99  ? 447  ARG A NH2   1 
ATOM   3564  N  N     . GLU A  1 448 ? -92.921  -9.419  -57.929  1.00 47.83  ? 448  GLU A N     1 
ATOM   3565  C  CA    . GLU A  1 448 ? -91.815  -9.958  -57.156  1.00 49.46  ? 448  GLU A CA    1 
ATOM   3566  C  C     . GLU A  1 448 ? -90.638  -9.006  -57.149  1.00 41.11  ? 448  GLU A C     1 
ATOM   3567  O  O     . GLU A  1 448 ? -89.896  -8.962  -56.176  1.00 45.62  ? 448  GLU A O     1 
ATOM   3568  C  CB    . GLU A  1 448 ? -91.426  -11.358 -57.607  1.00 37.11  ? 448  GLU A CB    1 
ATOM   3569  C  CG    . GLU A  1 448 ? -90.774  -11.427 -58.964  0.68 53.68  ? 448  GLU A CG    1 
ATOM   3570  C  CD    . GLU A  1 448 ? -90.364  -12.841 -59.328  0.68 55.29  ? 448  GLU A CD    1 
ATOM   3571  O  OE1   . GLU A  1 448 ? -90.161  -13.661 -58.400  0.68 35.93  ? 448  GLU A OE1   1 
ATOM   3572  O  OE2   . GLU A  1 448 ? -90.247  -13.129 -60.540  0.68 54.09  ? 448  GLU A OE2   1 
ATOM   3573  N  N     . GLU A  1 449 ? -90.477  -8.234  -58.223  1.00 43.29  ? 449  GLU A N     1 
ATOM   3574  C  CA    . GLU A  1 449 ? -89.416  -7.222  -58.277  1.00 24.20  ? 449  GLU A CA    1 
ATOM   3575  C  C     . GLU A  1 449 ? -89.748  -6.138  -57.255  1.00 37.24  ? 449  GLU A C     1 
ATOM   3576  O  O     . GLU A  1 449 ? -88.906  -5.760  -56.426  1.00 46.00  ? 449  GLU A O     1 
ATOM   3577  C  CB    . GLU A  1 449 ? -89.343  -6.570  -59.646  1.00 28.70  ? 449  GLU A CB    1 
ATOM   3578  C  CG    . GLU A  1 449 ? -88.838  -7.486  -60.759  1.00 26.49  ? 449  GLU A CG    1 
ATOM   3579  C  CD    . GLU A  1 449 ? -88.777  -6.762  -62.090  1.00 47.49  ? 449  GLU A CD    1 
ATOM   3580  O  OE1   . GLU A  1 449 ? -89.481  -5.716  -62.241  1.00 54.60  ? 449  GLU A OE1   1 
ATOM   3581  O  OE2   . GLU A  1 449 ? -88.006  -7.228  -62.967  1.00 43.30  ? 449  GLU A OE2   1 
ATOM   3582  N  N     . ASP A  1 450 ? -90.989  -5.655  -57.302  1.00 24.30  ? 450  ASP A N     1 
ATOM   3583  C  CA    . ASP A  1 450 ? -91.437  -4.636  -56.359  1.00 28.41  ? 450  ASP A CA    1 
ATOM   3584  C  C     . ASP A  1 450 ? -91.226  -5.148  -54.918  1.00 34.83  ? 450  ASP A C     1 
ATOM   3585  O  O     . ASP A  1 450 ? -90.761  -4.397  -54.054  1.00 34.08  ? 450  ASP A O     1 
ATOM   3586  C  CB    . ASP A  1 450 ? -92.902  -4.254  -56.654  1.00 28.26  ? 450  ASP A CB    1 
ATOM   3587  C  CG    . ASP A  1 450 ? -93.509  -3.281  -55.616  1.00 50.75  ? 450  ASP A CG    1 
ATOM   3588  O  OD1   . ASP A  1 450 ? -93.229  -2.058  -55.653  1.00 60.09  ? 450  ASP A OD1   1 
ATOM   3589  O  OD2   . ASP A  1 450 ? -94.326  -3.746  -54.786  1.00 83.15  ? 450  ASP A OD2   1 
ATOM   3590  N  N     . ASP A  1 451 ? -91.444  -6.445  -54.689  1.00 35.79  ? 451  ASP A N     1 
ATOM   3591  C  CA    . ASP A  1 451 ? -91.270  -7.011  -53.344  1.00 42.37  ? 451  ASP A CA    1 
ATOM   3592  C  C     . ASP A  1 451 ? -89.882  -6.756  -52.811  1.00 44.87  ? 451  ASP A C     1 
ATOM   3593  O  O     . ASP A  1 451 ? -89.707  -6.322  -51.677  1.00 48.22  ? 451  ASP A O     1 
ATOM   3594  C  CB    . ASP A  1 451 ? -91.487  -8.525  -53.330  1.00 45.71  ? 451  ASP A CB    1 
ATOM   3595  C  CG    . ASP A  1 451 ? -92.946  -8.916  -53.329  1.00 66.11  ? 451  ASP A CG    1 
ATOM   3596  O  OD1   . ASP A  1 451 ? -93.222  -10.062 -53.736  1.00 77.42  ? 451  ASP A OD1   1 
ATOM   3597  O  OD2   . ASP A  1 451 ? -93.809  -8.103  -52.920  1.00 67.97  ? 451  ASP A OD2   1 
ATOM   3598  N  N     . ARG A  1 452 ? -88.898  -7.014  -53.661  1.00 40.00  ? 452  ARG A N     1 
ATOM   3599  C  CA    . ARG A  1 452 ? -87.509  -6.862  -53.290  1.00 32.89  ? 452  ARG A CA    1 
ATOM   3600  C  C     . ARG A  1 452 ? -87.196  -5.479  -52.804  1.00 39.74  ? 452  ARG A C     1 
ATOM   3601  O  O     . ARG A  1 452 ? -86.694  -5.292  -51.688  1.00 43.81  ? 452  ARG A O     1 
ATOM   3602  C  CB    . ARG A  1 452 ? -86.619  -7.254  -54.452  1.00 17.49  ? 452  ARG A CB    1 
ATOM   3603  C  CG    . ARG A  1 452 ? -86.737  -8.739  -54.759  1.00 69.84  ? 452  ARG A CG    1 
ATOM   3604  C  CD    . ARG A  1 452 ? -85.394  -9.379  -55.037  1.00 62.77  ? 452  ARG A CD    1 
ATOM   3605  N  NE    . ARG A  1 452 ? -84.388  -8.923  -54.087  1.00 69.85  ? 452  ARG A NE    1 
ATOM   3606  C  CZ    . ARG A  1 452 ? -83.155  -8.586  -54.442  1.00 80.54  ? 452  ARG A CZ    1 
ATOM   3607  N  NH1   . ARG A  1 452 ? -82.282  -8.154  -53.519  1.00 48.78  ? 452  ARG A NH1   1 
ATOM   3608  N  NH2   . ARG A  1 452 ? -82.801  -8.706  -55.726  1.00 54.56  ? 452  ARG A NH2   1 
ATOM   3609  N  N     . VAL A  1 453 ? -87.561  -4.496  -53.606  1.00 27.88  ? 453  VAL A N     1 
ATOM   3610  C  CA    . VAL A  1 453 ? -87.304  -3.127  -53.207  1.00 32.78  ? 453  VAL A CA    1 
ATOM   3611  C  C     . VAL A  1 453 ? -88.114  -2.762  -51.972  1.00 24.43  ? 453  VAL A C     1 
ATOM   3612  O  O     . VAL A  1 453 ? -87.620  -2.084  -51.064  1.00 44.07  ? 453  VAL A O     1 
ATOM   3613  C  CB    . VAL A  1 453 ? -87.673  -2.160  -54.320  1.00 30.92  ? 453  VAL A CB    1 
ATOM   3614  C  CG1   . VAL A  1 453 ? -87.374  -0.743  -53.896  1.00 12.92  ? 453  VAL A CG1   1 
ATOM   3615  C  CG2   . VAL A  1 453 ? -86.935  -2.529  -55.594  1.00 21.68  ? 453  VAL A CG2   1 
ATOM   3616  N  N     . ARG A  1 454 ? -89.356  -3.228  -51.926  1.00 34.57  ? 454  ARG A N     1 
ATOM   3617  C  CA    . ARG A  1 454 ? -90.217  -2.887  -50.808  1.00 47.16  ? 454  ARG A CA    1 
ATOM   3618  C  C     . ARG A  1 454 ? -89.795  -3.524  -49.517  1.00 41.00  ? 454  ARG A C     1 
ATOM   3619  O  O     . ARG A  1 454 ? -90.041  -2.976  -48.445  1.00 42.39  ? 454  ARG A O     1 
ATOM   3620  C  CB    . ARG A  1 454 ? -91.662  -3.264  -51.083  1.00 38.90  ? 454  ARG A CB    1 
ATOM   3621  C  CG    . ARG A  1 454 ? -92.524  -2.201  -51.804  0.58 71.48  ? 454  ARG A CG    1 
ATOM   3622  C  CD    . ARG A  1 454 ? -94.041  -2.514  -51.651  0.58 61.78  ? 454  ARG A CD    1 
ATOM   3623  N  NE    . ARG A  1 454 ? -94.336  -3.947  -51.807  0.58 62.43  ? 454  ARG A NE    1 
ATOM   3624  C  CZ    . ARG A  1 454 ? -94.279  -4.853  -50.823  0.58 63.07  ? 454  ARG A CZ    1 
ATOM   3625  N  NH1   . ARG A  1 454 ? -94.549  -6.133  -51.075  0.58 55.90  ? 454  ARG A NH1   1 
ATOM   3626  N  NH2   . ARG A  1 454 ? -93.959  -4.484  -49.581  0.58 40.88  ? 454  ARG A NH2   1 
ATOM   3627  N  N     . MET A  1 455 ? -89.120  -4.659  -49.625  1.00 43.37  ? 455  MET A N     1 
ATOM   3628  C  CA    . MET A  1 455 ? -88.714  -5.394  -48.443  1.00 39.22  ? 455  MET A CA    1 
ATOM   3629  C  C     . MET A  1 455 ? -87.298  -5.184  -47.945  1.00 46.27  ? 455  MET A C     1 
ATOM   3630  O  O     . MET A  1 455 ? -87.026  -5.452  -46.779  1.00 43.55  ? 455  MET A O     1 
ATOM   3631  C  CB    . MET A  1 455 ? -88.954  -6.878  -48.661  1.00 45.62  ? 455  MET A CB    1 
ATOM   3632  C  CG    . MET A  1 455 ? -90.409  -7.273  -48.743  1.00 66.28  ? 455  MET A CG    1 
ATOM   3633  S  SD    . MET A  1 455 ? -90.507  -8.923  -49.414  1.00 73.80  ? 455  MET A SD    1 
ATOM   3634  C  CE    . MET A  1 455 ? -90.331  -9.901  -47.915  1.00 68.18  ? 455  MET A CE    1 
ATOM   3635  N  N     . THR A  1 456 ? -86.396  -4.748  -48.824  1.00 48.05  ? 456  THR A N     1 
ATOM   3636  C  CA    . THR A  1 456 ? -84.988  -4.524  -48.463  1.00 30.94  ? 456  THR A CA    1 
ATOM   3637  C  C     . THR A  1 456 ? -84.785  -3.128  -47.854  1.00 34.99  ? 456  THR A C     1 
ATOM   3638  O  O     . THR A  1 456 ? -85.136  -2.118  -48.473  1.00 38.48  ? 456  THR A O     1 
ATOM   3639  C  CB    . THR A  1 456 ? -84.089  -4.657  -49.712  1.00 39.29  ? 456  THR A CB    1 
ATOM   3640  O  OG1   . THR A  1 456 ? -84.024  -6.031  -50.149  1.00 45.39  ? 456  THR A OG1   1 
ATOM   3641  C  CG2   . THR A  1 456 ? -82.708  -4.141  -49.411  1.00 34.41  ? 456  THR A CG2   1 
ATOM   3642  N  N     . PRO A  1 457 ? -84.191  -3.046  -46.647  1.00 24.15  ? 457  PRO A N     1 
ATOM   3643  C  CA    . PRO A  1 457 ? -83.974  -1.734  -46.013  1.00 29.36  ? 457  PRO A CA    1 
ATOM   3644  C  C     . PRO A  1 457 ? -83.232  -0.781  -46.942  1.00 27.83  ? 457  PRO A C     1 
ATOM   3645  O  O     . PRO A  1 457 ? -82.349  -1.187  -47.692  1.00 41.77  ? 457  PRO A O     1 
ATOM   3646  C  CB    . PRO A  1 457 ? -83.147  -2.076  -44.765  1.00 24.69  ? 457  PRO A CB    1 
ATOM   3647  C  CG    . PRO A  1 457 ? -83.639  -3.443  -44.380  1.00 10.17  ? 457  PRO A CG    1 
ATOM   3648  C  CD    . PRO A  1 457 ? -83.747  -4.138  -45.765  1.00 27.76  ? 457  PRO A CD    1 
ATOM   3649  N  N     . HIS A  1 458 ? -83.626  0.480   -46.917  1.00 28.04  ? 458  HIS A N     1 
ATOM   3650  C  CA    . HIS A  1 458 ? -83.007  1.485   -47.760  1.00 26.26  ? 458  HIS A CA    1 
ATOM   3651  C  C     . HIS A  1 458 ? -81.993  2.248   -46.929  1.00 30.28  ? 458  HIS A C     1 
ATOM   3652  O  O     . HIS A  1 458 ? -82.242  2.558   -45.768  1.00 32.73  ? 458  HIS A O     1 
ATOM   3653  C  CB    . HIS A  1 458 ? -84.080  2.433   -48.292  1.00 15.36  ? 458  HIS A CB    1 
ATOM   3654  C  CG    . HIS A  1 458 ? -83.569  3.454   -49.249  1.00 26.57  ? 458  HIS A CG    1 
ATOM   3655  N  ND1   . HIS A  1 458 ? -83.919  3.464   -50.583  1.00 36.75  ? 458  HIS A ND1   1 
ATOM   3656  C  CD2   . HIS A  1 458 ? -82.733  4.501   -49.069  1.00 27.41  ? 458  HIS A CD2   1 
ATOM   3657  C  CE1   . HIS A  1 458 ? -83.320  4.474   -51.187  1.00 14.00  ? 458  HIS A CE1   1 
ATOM   3658  N  NE2   . HIS A  1 458 ? -82.595  5.120   -50.290  1.00 52.72  ? 458  HIS A NE2   1 
ATOM   3659  N  N     . PRO A  1 459 ? -80.826  2.543   -47.513  1.00 34.12  ? 459  PRO A N     1 
ATOM   3660  C  CA    . PRO A  1 459 ? -79.762  3.276   -46.820  1.00 24.07  ? 459  PRO A CA    1 
ATOM   3661  C  C     . PRO A  1 459 ? -80.297  4.488   -46.059  1.00 37.94  ? 459  PRO A C     1 
ATOM   3662  O  O     . PRO A  1 459 ? -80.058  4.639   -44.843  1.00 36.30  ? 459  PRO A O     1 
ATOM   3663  C  CB    . PRO A  1 459 ? -78.858  3.690   -47.967  1.00 26.15  ? 459  PRO A CB    1 
ATOM   3664  C  CG    . PRO A  1 459 ? -78.951  2.476   -48.893  1.00 24.52  ? 459  PRO A CG    1 
ATOM   3665  C  CD    . PRO A  1 459 ? -80.427  2.189   -48.892  1.00 28.56  ? 459  PRO A CD    1 
ATOM   3666  N  N     . VAL A  1 460 ? -81.118  5.277   -46.753  1.00 27.80  ? 460  VAL A N     1 
ATOM   3667  C  CA    . VAL A  1 460 ? -81.709  6.488   -46.186  1.00 30.67  ? 460  VAL A CA    1 
ATOM   3668  C  C     . VAL A  1 460 ? -82.503  6.248   -44.906  1.00 42.33  ? 460  VAL A C     1 
ATOM   3669  O  O     . VAL A  1 460 ? -82.653  7.149   -44.055  1.00 31.33  ? 460  VAL A O     1 
ATOM   3670  C  CB    . VAL A  1 460 ? -82.588  7.177   -47.216  1.00 23.11  ? 460  VAL A CB    1 
ATOM   3671  C  CG1   . VAL A  1 460 ? -83.354  8.307   -46.594  1.00 36.67  ? 460  VAL A CG1   1 
ATOM   3672  C  CG2   . VAL A  1 460 ? -81.718  7.717   -48.338  1.00 13.85  ? 460  VAL A CG2   1 
ATOM   3673  N  N     . GLU A  1 461 ? -83.022  5.034   -44.767  1.00 19.79  ? 461  GLU A N     1 
ATOM   3674  C  CA    . GLU A  1 461 ? -83.763  4.714   -43.568  1.00 25.93  ? 461  GLU A CA    1 
ATOM   3675  C  C     . GLU A  1 461 ? -82.853  4.787   -42.355  1.00 28.98  ? 461  GLU A C     1 
ATOM   3676  O  O     . GLU A  1 461 ? -83.289  5.132   -41.267  1.00 35.42  ? 461  GLU A O     1 
ATOM   3677  C  CB    . GLU A  1 461 ? -84.402  3.340   -43.696  1.00 21.99  ? 461  GLU A CB    1 
ATOM   3678  C  CG    . GLU A  1 461 ? -85.309  3.272   -44.916  1.00 44.09  ? 461  GLU A CG    1 
ATOM   3679  C  CD    . GLU A  1 461 ? -86.252  2.089   -44.915  1.00 46.76  ? 461  GLU A CD    1 
ATOM   3680  O  OE1   . GLU A  1 461 ? -87.424  2.280   -45.303  1.00 42.38  ? 461  GLU A OE1   1 
ATOM   3681  O  OE2   . GLU A  1 461 ? -85.821  0.972   -44.562  1.00 39.94  ? 461  GLU A OE2   1 
ATOM   3682  N  N     . PHE A  1 462 ? -81.574  4.524   -42.564  1.00 21.08  ? 462  PHE A N     1 
ATOM   3683  C  CA    . PHE A  1 462 ? -80.662  4.575   -41.429  1.00 28.75  ? 462  PHE A CA    1 
ATOM   3684  C  C     . PHE A  1 462 ? -80.364  6.015   -41.044  1.00 29.97  ? 462  PHE A C     1 
ATOM   3685  O  O     . PHE A  1 462 ? -80.393  6.389   -39.887  1.00 36.01  ? 462  PHE A O     1 
ATOM   3686  C  CB    . PHE A  1 462 ? -79.360  3.808   -41.716  1.00 12.01  ? 462  PHE A CB    1 
ATOM   3687  C  CG    . PHE A  1 462 ? -79.708  2.364   -41.907  1.00 42.64  ? 462  PHE A CG    1 
ATOM   3688  C  CD1   . PHE A  1 462 ? -80.139  1.901   -43.139  1.00 39.80  ? 462  PHE A CD1   1 
ATOM   3689  C  CD2   . PHE A  1 462 ? -79.606  1.473   -40.855  1.00 35.73  ? 462  PHE A CD2   1 
ATOM   3690  C  CE1   . PHE A  1 462 ? -80.463  0.569   -43.318  1.00 35.83  ? 462  PHE A CE1   1 
ATOM   3691  C  CE2   . PHE A  1 462 ? -79.928  0.140   -41.026  1.00 24.63  ? 462  PHE A CE2   1 
ATOM   3692  C  CZ    . PHE A  1 462 ? -80.356  -0.313  -42.259  1.00 34.81  ? 462  PHE A CZ    1 
ATOM   3693  N  N     . GLU A  1 463 ? -80.221  6.784   -42.110  1.00 31.94  ? 463  GLU A N     1 
ATOM   3694  C  CA    . GLU A  1 463 ? -79.972  8.199   -41.970  1.00 29.84  ? 463  GLU A CA    1 
ATOM   3695  C  C     . GLU A  1 463 ? -81.116  8.788   -41.187  1.00 33.63  ? 463  GLU A C     1 
ATOM   3696  O  O     . GLU A  1 463 ? -80.910  9.486   -40.204  1.00 43.18  ? 463  GLU A O     1 
ATOM   3697  C  CB    . GLU A  1 463 ? -79.945  8.821   -43.342  1.00 29.25  ? 463  GLU A CB    1 
ATOM   3698  C  CG    . GLU A  1 463 ? -79.591  10.247  -43.317  0.71 36.31  ? 463  GLU A CG    1 
ATOM   3699  C  CD    . GLU A  1 463 ? -79.437  10.791  -44.700  0.71 59.19  ? 463  GLU A CD    1 
ATOM   3700  O  OE1   . GLU A  1 463 ? -78.821  10.115  -45.565  0.71 37.88  ? 463  GLU A OE1   1 
ATOM   3701  O  OE2   . GLU A  1 463 ? -79.940  11.906  -44.915  0.71 57.04  ? 463  GLU A OE2   1 
ATOM   3702  N  N     . LEU A  1 464 ? -82.325  8.445   -41.593  1.00 37.28  ? 464  LEU A N     1 
ATOM   3703  C  CA    . LEU A  1 464 ? -83.555  8.909   -40.964  1.00 26.92  ? 464  LEU A CA    1 
ATOM   3704  C  C     . LEU A  1 464 ? -83.932  8.208   -39.682  1.00 28.52  ? 464  LEU A C     1 
ATOM   3705  O  O     . LEU A  1 464 ? -84.483  8.841   -38.787  1.00 36.59  ? 464  LEU A O     1 
ATOM   3706  C  CB    . LEU A  1 464 ? -84.722  8.677   -41.925  1.00 32.93  ? 464  LEU A CB    1 
ATOM   3707  C  CG    . LEU A  1 464 ? -85.220  9.823   -42.813  1.00 20.40  ? 464  LEU A CG    1 
ATOM   3708  C  CD1   . LEU A  1 464 ? -84.098  10.819  -43.077  1.00 53.96  ? 464  LEU A CD1   1 
ATOM   3709  C  CD2   . LEU A  1 464 ? -85.785  9.284   -44.116  1.00 33.26  ? 464  LEU A CD2   1 
ATOM   3710  N  N     . TYR A  1 465 ? -83.655  6.909   -39.547  1.00 27.03  ? 465  TYR A N     1 
ATOM   3711  C  CA    . TYR A  1 465 ? -84.235  6.253   -38.370  1.00 24.26  ? 465  TYR A CA    1 
ATOM   3712  C  C     . TYR A  1 465 ? -83.299  5.528   -37.374  1.00 27.17  ? 465  TYR A C     1 
ATOM   3713  O  O     . TYR A  1 465 ? -83.738  5.144   -36.291  1.00 41.86  ? 465  TYR A O     1 
ATOM   3714  C  CB    . TYR A  1 465 ? -85.268  5.271   -38.884  1.00 29.78  ? 465  TYR A CB    1 
ATOM   3715  C  CG    . TYR A  1 465 ? -86.327  5.866   -39.761  1.00 29.24  ? 465  TYR A CG    1 
ATOM   3716  C  CD1   . TYR A  1 465 ? -87.214  6.819   -39.265  1.00 31.26  ? 465  TYR A CD1   1 
ATOM   3717  C  CD2   . TYR A  1 465 ? -86.473  5.470   -41.094  1.00 45.45  ? 465  TYR A CD2   1 
ATOM   3718  C  CE1   . TYR A  1 465 ? -88.219  7.351   -40.056  1.00 38.39  ? 465  TYR A CE1   1 
ATOM   3719  C  CE2   . TYR A  1 465 ? -87.490  6.007   -41.873  1.00 44.94  ? 465  TYR A CE2   1 
ATOM   3720  C  CZ    . TYR A  1 465 ? -88.358  6.943   -41.366  1.00 39.71  ? 465  TYR A CZ    1 
ATOM   3721  O  OH    . TYR A  1 465 ? -89.370  7.456   -42.154  1.00 59.78  ? 465  TYR A OH    1 
ATOM   3722  N  N     . TYR A  1 466 ? -82.045  5.351   -37.714  1.00 37.41  ? 466  TYR A N     1 
ATOM   3723  C  CA    . TYR A  1 466 ? -81.165  4.608   -36.804  1.00 30.01  ? 466  TYR A CA    1 
ATOM   3724  C  C     . TYR A  1 466 ? -81.172  5.100   -35.360  1.00 23.16  ? 466  TYR A C     1 
ATOM   3725  O  O     . TYR A  1 466 ? -81.206  4.308   -34.427  1.00 33.75  ? 466  TYR A O     1 
ATOM   3726  C  CB    . TYR A  1 466 ? -79.745  4.636   -37.367  1.00 38.62  ? 466  TYR A CB    1 
ATOM   3727  C  CG    . TYR A  1 466 ? -78.771  3.789   -36.599  1.00 39.89  ? 466  TYR A CG    1 
ATOM   3728  C  CD1   . TYR A  1 466 ? -78.636  2.420   -36.867  1.00 46.76  ? 466  TYR A CD1   1 
ATOM   3729  C  CD2   . TYR A  1 466 ? -78.019  4.338   -35.567  1.00 31.31  ? 466  TYR A CD2   1 
ATOM   3730  C  CE1   . TYR A  1 466 ? -77.774  1.621   -36.110  1.00 27.81  ? 466  TYR A CE1   1 
ATOM   3731  C  CE2   . TYR A  1 466 ? -77.159  3.555   -34.805  1.00 35.22  ? 466  TYR A CE2   1 
ATOM   3732  C  CZ    . TYR A  1 466 ? -77.040  2.203   -35.072  1.00 37.36  ? 466  TYR A CZ    1 
ATOM   3733  O  OH    . TYR A  1 466 ? -76.199  1.422   -34.311  1.00 38.58  ? 466  TYR A OH    1 
ATOM   3734  N  N     . SER A  1 467 ? -81.129  6.417   -35.206  1.00 36.92  ? 467  SER A N     1 
ATOM   3735  C  CA    . SER A  1 467 ? -81.044  6.982   -33.871  1.00 38.53  ? 467  SER A CA    1 
ATOM   3736  C  C     . SER A  1 467 ? -82.391  7.188   -33.231  1.00 31.55  ? 467  SER A C     1 
ATOM   3737  O  O     . SER A  1 467 ? -82.535  7.917   -32.249  1.00 37.19  ? 467  SER A O     1 
ATOM   3738  C  CB    . SER A  1 467 ? -80.233  8.281   -33.885  1.00 24.54  ? 467  SER A CB    1 
ATOM   3739  O  OG    . SER A  1 467 ? -78.989  8.108   -34.535  1.00 76.23  ? 467  SER A OG    1 
ATOM   3740  N  N     . VAL A  1 468 ? -83.369  6.464   -33.739  1.00 37.96  ? 468  VAL A N     1 
ATOM   3741  C  CA    . VAL A  1 468 ? -84.721  6.563   -33.222  1.00 35.14  ? 468  VAL A CA    1 
ATOM   3742  C  C     . VAL A  1 468 ? -84.859  6.117   -31.759  1.00 42.00  ? 468  VAL A C     1 
ATOM   3743  O  O     . VAL A  1 468 ? -84.049  5.276   -31.279  1.00 62.63  ? 468  VAL A O     1 
ATOM   3744  C  CB    . VAL A  1 468 ? -85.677  5.805   -34.154  1.00 22.07  ? 468  VAL A CB    1 
ATOM   3745  C  CG1   . VAL A  1 468 ? -86.128  4.487   -33.547  1.00 35.67  ? 468  VAL A CG1   1 
ATOM   3746  C  CG2   . VAL A  1 468 ? -86.798  6.709   -34.593  1.00 42.50  ? 468  VAL A CG2   1 
ATOM   3747  O  OXT   . VAL A  1 468 ? -85.759  6.674   -31.102  1.00 35.97  ? 468  VAL A OXT   1 
ATOM   3748  N  N     . SER B  1 1   ? -73.762  31.284  -97.334  0.69 76.40  ? 1    SER B N     1 
ATOM   3749  C  CA    . SER B  1 1   ? -73.267  30.194  -98.229  0.69 76.37  ? 1    SER B CA    1 
ATOM   3750  C  C     . SER B  1 1   ? -74.183  28.939  -98.249  0.69 76.16  ? 1    SER B C     1 
ATOM   3751  O  O     . SER B  1 1   ? -73.727  27.815  -97.955  0.69 75.93  ? 1    SER B O     1 
ATOM   3752  C  CB    . SER B  1 1   ? -71.869  29.808  -97.809  0.69 77.26  ? 1    SER B CB    1 
ATOM   3753  O  OG    . SER B  1 1   ? -71.848  28.777  -96.840  0.69 78.95  ? 1    SER B OG    1 
ATOM   3754  N  N     . ALA B  1 2   ? -75.475  29.119  -98.555  0.69 52.90  ? 2    ALA B N     1 
ATOM   3755  C  CA    . ALA B  1 2   ? -76.347  27.919  -98.585  0.69 45.88  ? 2    ALA B CA    1 
ATOM   3756  C  C     . ALA B  1 2   ? -75.723  26.936  -99.585  0.69 48.38  ? 2    ALA B C     1 
ATOM   3757  O  O     . ALA B  1 2   ? -75.386  25.758  -99.279  0.69 48.40  ? 2    ALA B O     1 
ATOM   3758  C  CB    . ALA B  1 2   ? -77.795  28.272  -98.974  0.69 71.08  ? 2    ALA B CB    1 
ATOM   3759  N  N     . GLU B  1 3   ? -75.484  27.484  -100.794 0.69 56.15  ? 3    GLU B N     1 
ATOM   3760  C  CA    . GLU B  1 3   ? -74.830  26.741  -101.851 0.69 57.63  ? 3    GLU B CA    1 
ATOM   3761  C  C     . GLU B  1 3   ? -73.435  26.226  -101.422 0.69 48.61  ? 3    GLU B C     1 
ATOM   3762  O  O     . GLU B  1 3   ? -73.180  25.021  -101.458 0.69 40.70  ? 3    GLU B O     1 
ATOM   3763  C  CB    . GLU B  1 3   ? -74.727  27.612  -103.127 0.69 80.00  ? 3    GLU B CB    1 
ATOM   3764  C  CG    . GLU B  1 3   ? -73.586  27.254  -104.070 0.69 97.96  ? 3    GLU B CG    1 
ATOM   3765  C  CD    . GLU B  1 3   ? -73.806  25.929  -104.799 0.69 100.00 ? 3    GLU B CD    1 
ATOM   3766  O  OE1   . GLU B  1 3   ? -73.116  24.943  -104.453 0.69 100.00 ? 3    GLU B OE1   1 
ATOM   3767  O  OE2   . GLU B  1 3   ? -74.671  25.872  -105.696 0.69 100.00 ? 3    GLU B OE2   1 
ATOM   3768  N  N     . HIS B  1 4   ? -72.543  27.145  -101.038 0.69 51.19  ? 4    HIS B N     1 
ATOM   3769  C  CA    . HIS B  1 4   ? -71.184  26.815  -100.606 0.69 57.10  ? 4    HIS B CA    1 
ATOM   3770  C  C     . HIS B  1 4   ? -71.152  25.611  -99.654  0.69 55.48  ? 4    HIS B C     1 
ATOM   3771  O  O     . HIS B  1 4   ? -70.443  24.621  -99.930  0.69 63.44  ? 4    HIS B O     1 
ATOM   3772  C  CB    . HIS B  1 4   ? -70.576  28.051  -99.947  0.69 86.23  ? 4    HIS B CB    1 
ATOM   3773  C  CG    . HIS B  1 4   ? -69.258  27.827  -99.258  0.69 88.45  ? 4    HIS B CG    1 
ATOM   3774  N  ND1   . HIS B  1 4   ? -68.948  28.426  -98.032  0.69 100.00 ? 4    HIS B ND1   1 
ATOM   3775  C  CD2   . HIS B  1 4   ? -68.131  27.161  -99.634  0.69 82.38  ? 4    HIS B CD2   1 
ATOM   3776  C  CE1   . HIS B  1 4   ? -67.685  28.148  -97.710  0.69 91.57  ? 4    HIS B CE1   1 
ATOM   3777  N  NE2   . HIS B  1 4   ? -67.169  27.376  -98.670  0.69 94.62  ? 4    HIS B NE2   1 
ATOM   3778  N  N     . VAL B  1 5   ? -71.976  25.680  -98.603  0.69 43.76  ? 5    VAL B N     1 
ATOM   3779  C  CA    . VAL B  1 5   ? -72.076  24.594  -97.629  0.69 23.59  ? 5    VAL B CA    1 
ATOM   3780  C  C     . VAL B  1 5   ? -72.346  23.238  -98.282  0.69 37.20  ? 5    VAL B C     1 
ATOM   3781  O  O     . VAL B  1 5   ? -71.661  22.256  -97.964  0.69 40.88  ? 5    VAL B O     1 
ATOM   3782  C  CB    . VAL B  1 5   ? -73.190  24.854  -96.632  0.69 16.15  ? 5    VAL B CB    1 
ATOM   3783  C  CG1   . VAL B  1 5   ? -73.376  23.674  -95.735  0.69 21.34  ? 5    VAL B CG1   1 
ATOM   3784  C  CG2   . VAL B  1 5   ? -72.837  26.011  -95.792  0.69 23.21  ? 5    VAL B CG2   1 
ATOM   3785  N  N     . LEU B  1 6   ? -73.337  23.170  -99.173  0.69 35.92  ? 6    LEU B N     1 
ATOM   3786  C  CA    . LEU B  1 6   ? -73.633  21.889  -99.807  0.69 51.14  ? 6    LEU B CA    1 
ATOM   3787  C  C     . LEU B  1 6   ? -72.443  21.292  -100.490 0.69 55.27  ? 6    LEU B C     1 
ATOM   3788  O  O     . LEU B  1 6   ? -72.190  20.092  -100.383 0.69 62.72  ? 6    LEU B O     1 
ATOM   3789  C  CB    . LEU B  1 6   ? -74.803  22.039  -100.770 0.69 57.84  ? 6    LEU B CB    1 
ATOM   3790  C  CG    . LEU B  1 6   ? -76.191  21.697  -100.201 0.69 74.74  ? 6    LEU B CG    1 
ATOM   3791  C  CD1   . LEU B  1 6   ? -76.174  20.305  -99.589  0.69 76.36  ? 6    LEU B CD1   1 
ATOM   3792  C  CD2   . LEU B  1 6   ? -76.636  22.724  -99.169  0.69 59.51  ? 6    LEU B CD2   1 
ATOM   3793  N  N     . THR B  1 7   ? -71.679  22.115  -101.195 0.69 43.57  ? 7    THR B N     1 
ATOM   3794  C  CA    . THR B  1 7   ? -70.480  21.640  -101.901 0.69 65.97  ? 7    THR B CA    1 
ATOM   3795  C  C     . THR B  1 7   ? -69.442  21.157  -100.871 0.69 56.45  ? 7    THR B C     1 
ATOM   3796  O  O     . THR B  1 7   ? -68.783  20.118  -101.056 0.69 67.89  ? 7    THR B O     1 
ATOM   3797  C  CB    . THR B  1 7   ? -69.859  22.742  -102.802 0.69 77.65  ? 7    THR B CB    1 
ATOM   3798  O  OG1   . THR B  1 7   ? -68.592  23.111  -102.272 0.69 58.56  ? 7    THR B OG1   1 
ATOM   3799  C  CG2   . THR B  1 7   ? -70.775  23.946  -102.859 0.69 67.89  ? 7    THR B CG2   1 
ATOM   3800  N  N     . MET B  1 8   ? -69.339  21.927  -99.801  0.69 48.73  ? 8    MET B N     1 
ATOM   3801  C  CA    . MET B  1 8   ? -68.414  21.632  -98.706  0.69 47.87  ? 8    MET B CA    1 
ATOM   3802  C  C     . MET B  1 8   ? -68.693  20.294  -97.981  0.69 49.13  ? 8    MET B C     1 
ATOM   3803  O  O     . MET B  1 8   ? -67.808  19.710  -97.338  0.69 56.29  ? 8    MET B O     1 
ATOM   3804  C  CB    . MET B  1 8   ? -68.420  22.800  -97.717  0.69 48.20  ? 8    MET B CB    1 
ATOM   3805  C  CG    . MET B  1 8   ? -67.130  22.961  -96.944  0.69 55.26  ? 8    MET B CG    1 
ATOM   3806  S  SD    . MET B  1 8   ? -66.862  24.650  -96.360  0.69 71.40  ? 8    MET B SD    1 
ATOM   3807  C  CE    . MET B  1 8   ? -66.249  24.333  -94.706  0.69 66.81  ? 8    MET B CE    1 
ATOM   3808  N  N     . LEU B  1 9   ? -69.932  19.801  -98.080  0.69 45.58  ? 9    LEU B N     1 
ATOM   3809  C  CA    . LEU B  1 9   ? -70.268  18.533  -97.451  0.69 39.19  ? 9    LEU B CA    1 
ATOM   3810  C  C     . LEU B  1 9   ? -69.624  17.408  -98.286  0.69 52.30  ? 9    LEU B C     1 
ATOM   3811  O  O     . LEU B  1 9   ? -68.945  16.515  -97.723  0.69 51.78  ? 9    LEU B O     1 
ATOM   3812  C  CB    . LEU B  1 9   ? -71.781  18.356  -97.371  0.69 27.42  ? 9    LEU B CB    1 
ATOM   3813  C  CG    . LEU B  1 9   ? -72.430  19.324  -96.378  0.69 26.66  ? 9    LEU B CG    1 
ATOM   3814  C  CD1   . LEU B  1 9   ? -73.908  19.072  -96.301  0.69 28.75  ? 9    LEU B CD1   1 
ATOM   3815  C  CD2   . LEU B  1 9   ? -71.834  19.174  -94.994  0.69 25.08  ? 9    LEU B CD2   1 
ATOM   3816  N  N     . ASN B  1 10  ? -69.763  17.517  -99.616  0.69 52.83  ? 10   ASN B N     1 
ATOM   3817  C  CA    . ASN B  1 10  ? -69.208  16.505  -100.530 0.69 54.51  ? 10   ASN B CA    1 
ATOM   3818  C  C     . ASN B  1 10  ? -67.699  16.577  -100.616 0.69 38.63  ? 10   ASN B C     1 
ATOM   3819  O  O     . ASN B  1 10  ? -67.012  15.561  -100.785 0.69 53.01  ? 10   ASN B O     1 
ATOM   3820  C  CB    . ASN B  1 10  ? -69.821  16.675  -101.923 0.69 42.00  ? 10   ASN B CB    1 
ATOM   3821  C  CG    . ASN B  1 10  ? -71.338  16.434  -101.900 0.69 71.88  ? 10   ASN B CG    1 
ATOM   3822  O  OD1   . ASN B  1 10  ? -72.135  17.329  -101.456 0.69 69.47  ? 10   ASN B OD1   1 
ATOM   3823  N  ND2   . ASN B  1 10  ? -71.755  15.195  -102.300 0.69 61.26  ? 10   ASN B ND2   1 
ATOM   3824  N  N     . GLU B  1 11  ? -67.200  17.786  -100.393 0.69 40.50  ? 11   GLU B N     1 
ATOM   3825  C  CA    . GLU B  1 11  ? -65.775  18.047  -100.476 0.69 54.09  ? 11   GLU B CA    1 
ATOM   3826  C  C     . GLU B  1 11  ? -64.983  17.434  -99.325  0.69 44.74  ? 11   GLU B C     1 
ATOM   3827  O  O     . GLU B  1 11  ? -63.782  17.120  -99.477  0.69 50.70  ? 11   GLU B O     1 
ATOM   3828  C  CB    . GLU B  1 11  ? -65.523  19.563  -100.527 0.69 77.03  ? 11   GLU B CB    1 
ATOM   3829  C  CG    . GLU B  1 11  ? -64.037  19.985  -100.683 0.69 75.16  ? 11   GLU B CG    1 
ATOM   3830  C  CD    . GLU B  1 11  ? -63.927  21.547  -100.808 0.69 96.50  ? 11   GLU B CD    1 
ATOM   3831  O  OE1   . GLU B  1 11  ? -64.322  22.080  -101.914 0.69 94.78  ? 11   GLU B OE1   1 
ATOM   3832  O  OE2   . GLU B  1 11  ? -63.494  22.231  -99.795  0.69 91.33  ? 11   GLU B OE2   1 
ATOM   3833  N  N     . HIS B  1 12  ? -65.638  17.303  -98.175  0.69 52.12  ? 12   HIS B N     1 
ATOM   3834  C  CA    . HIS B  1 12  ? -64.959  16.726  -97.008  0.69 54.70  ? 12   HIS B CA    1 
ATOM   3835  C  C     . HIS B  1 12  ? -65.604  15.421  -96.554  0.69 43.27  ? 12   HIS B C     1 
ATOM   3836  O  O     . HIS B  1 12  ? -65.290  14.952  -95.444  0.69 37.68  ? 12   HIS B O     1 
ATOM   3837  C  CB    . HIS B  1 12  ? -64.955  17.728  -95.848  0.69 58.80  ? 12   HIS B CB    1 
ATOM   3838  C  CG    . HIS B  1 12  ? -63.969  18.861  -95.989  0.69 67.86  ? 12   HIS B CG    1 
ATOM   3839  N  ND1   . HIS B  1 12  ? -62.613  18.699  -95.649  0.69 63.08  ? 12   HIS B ND1   1 
ATOM   3840  C  CD2   . HIS B  1 12  ? -64.124  20.162  -96.346  0.69 56.34  ? 12   HIS B CD2   1 
ATOM   3841  C  CE1   . HIS B  1 12  ? -62.013  19.884  -95.781  0.69 65.35  ? 12   HIS B CE1   1 
ATOM   3842  N  NE2   . HIS B  1 12  ? -62.900  20.777  -96.197  0.69 52.71  ? 12   HIS B NE2   1 
ATOM   3843  N  N     . GLU B  1 13  ? -66.507  14.859  -97.373  0.69 39.09  ? 13   GLU B N     1 
ATOM   3844  C  CA    . GLU B  1 13  ? -67.225  13.627  -97.026  0.69 32.42  ? 13   GLU B CA    1 
ATOM   3845  C  C     . GLU B  1 13  ? -67.680  13.790  -95.581  0.69 34.34  ? 13   GLU B C     1 
ATOM   3846  O  O     . GLU B  1 13  ? -67.329  12.987  -94.691  0.69 40.58  ? 13   GLU B O     1 
ATOM   3847  C  CB    . GLU B  1 13  ? -66.291  12.426  -97.159  0.69 41.40  ? 13   GLU B CB    1 
ATOM   3848  C  CG    . GLU B  1 13  ? -65.760  12.253  -98.580  0.69 62.55  ? 13   GLU B CG    1 
ATOM   3849  C  CD    . GLU B  1 13  ? -64.407  11.494  -98.604  0.69 65.26  ? 13   GLU B CD    1 
ATOM   3850  O  OE1   . GLU B  1 13  ? -63.361  12.162  -98.276  0.69 86.80  ? 13   GLU B OE1   1 
ATOM   3851  O  OE2   . GLU B  1 13  ? -64.388  10.257  -98.940  0.69 60.62  ? 13   GLU B OE2   1 
ATOM   3852  N  N     . VAL B  1 14  ? -68.328  14.927  -95.335  1.00 34.96  ? 14   VAL B N     1 
ATOM   3853  C  CA    . VAL B  1 14  ? -68.804  15.266  -94.017  1.00 42.66  ? 14   VAL B CA    1 
ATOM   3854  C  C     . VAL B  1 14  ? -69.875  14.295  -93.586  1.00 50.26  ? 14   VAL B C     1 
ATOM   3855  O  O     . VAL B  1 14  ? -70.780  13.964  -94.358  1.00 61.69  ? 14   VAL B O     1 
ATOM   3856  C  CB    . VAL B  1 14  ? -69.372  16.676  -93.988  1.00 46.86  ? 14   VAL B CB    1 
ATOM   3857  C  CG1   . VAL B  1 14  ? -69.810  17.047  -92.581  1.00 32.95  ? 14   VAL B CG1   1 
ATOM   3858  C  CG2   . VAL B  1 14  ? -68.344  17.654  -94.530  1.00 44.29  ? 14   VAL B CG2   1 
ATOM   3859  N  N     . LYS B  1 15  ? -69.753  13.813  -92.357  1.00 46.09  ? 15   LYS B N     1 
ATOM   3860  C  CA    . LYS B  1 15  ? -70.713  12.879  -91.819  1.00 50.11  ? 15   LYS B CA    1 
ATOM   3861  C  C     . LYS B  1 15  ? -71.715  13.604  -90.912  1.00 47.99  ? 15   LYS B C     1 
ATOM   3862  O  O     . LYS B  1 15  ? -72.912  13.299  -90.918  1.00 47.38  ? 15   LYS B O     1 
ATOM   3863  C  CB    . LYS B  1 15  ? -69.981  11.763  -91.081  1.00 38.15  ? 15   LYS B CB    1 
ATOM   3864  C  CG    . LYS B  1 15  ? -69.039  10.949  -91.988  1.00 54.22  ? 15   LYS B CG    1 
ATOM   3865  C  CD    . LYS B  1 15  ? -69.825  9.983   -92.905  1.00 91.21  ? 15   LYS B CD    1 
ATOM   3866  C  CE    . LYS B  1 15  ? -68.972  9.318   -94.055  1.00 94.57  ? 15   LYS B CE    1 
ATOM   3867  N  NZ    . LYS B  1 15  ? -68.967  10.052  -95.420  1.00 99.04  ? 15   LYS B NZ    1 
ATOM   3868  N  N     . PHE B  1 16  ? -71.245  14.608  -90.185  1.00 42.35  ? 16   PHE B N     1 
ATOM   3869  C  CA    . PHE B  1 16  ? -72.143  15.335  -89.291  1.00 49.44  ? 16   PHE B CA    1 
ATOM   3870  C  C     . PHE B  1 16  ? -72.051  16.833  -89.397  1.00 48.31  ? 16   PHE B C     1 
ATOM   3871  O  O     . PHE B  1 16  ? -71.123  17.381  -89.996  1.00 45.71  ? 16   PHE B O     1 
ATOM   3872  C  CB    . PHE B  1 16  ? -71.913  14.948  -87.830  1.00 37.61  ? 16   PHE B CB    1 
ATOM   3873  C  CG    . PHE B  1 16  ? -72.069  13.488  -87.563  1.00 40.76  ? 16   PHE B CG    1 
ATOM   3874  C  CD1   . PHE B  1 16  ? -70.986  12.629  -87.688  1.00 42.75  ? 16   PHE B CD1   1 
ATOM   3875  C  CD2   . PHE B  1 16  ? -73.303  12.963  -87.215  1.00 47.36  ? 16   PHE B CD2   1 
ATOM   3876  C  CE1   . PHE B  1 16  ? -71.131  11.276  -87.475  1.00 31.45  ? 16   PHE B CE1   1 
ATOM   3877  C  CE2   . PHE B  1 16  ? -73.463  11.601  -86.998  1.00 43.75  ? 16   PHE B CE2   1 
ATOM   3878  C  CZ    . PHE B  1 16  ? -72.374  10.756  -87.129  1.00 51.33  ? 16   PHE B CZ    1 
ATOM   3879  N  N     . VAL B  1 17  ? -73.034  17.484  -88.786  1.00 42.09  ? 17   VAL B N     1 
ATOM   3880  C  CA    . VAL B  1 17  ? -73.101  18.923  -88.759  1.00 35.59  ? 17   VAL B CA    1 
ATOM   3881  C  C     . VAL B  1 17  ? -73.355  19.333  -87.329  1.00 39.10  ? 17   VAL B C     1 
ATOM   3882  O  O     . VAL B  1 17  ? -74.273  18.839  -86.651  1.00 30.67  ? 17   VAL B O     1 
ATOM   3883  C  CB    . VAL B  1 17  ? -74.173  19.462  -89.693  1.00 28.10  ? 17   VAL B CB    1 
ATOM   3884  C  CG1   . VAL B  1 17  ? -74.361  20.943  -89.454  1.00 29.83  ? 17   VAL B CG1   1 
ATOM   3885  C  CG2   . VAL B  1 17  ? -73.753  19.216  -91.150  1.00 35.93  ? 17   VAL B CG2   1 
ATOM   3886  N  N     . ASP B  1 18  ? -72.461  20.177  -86.841  1.00 34.50  ? 18   ASP B N     1 
ATOM   3887  C  CA    . ASP B  1 18  ? -72.575  20.614  -85.487  1.00 47.07  ? 18   ASP B CA    1 
ATOM   3888  C  C     . ASP B  1 18  ? -73.106  22.025  -85.403  1.00 49.40  ? 18   ASP B C     1 
ATOM   3889  O  O     . ASP B  1 18  ? -72.489  22.990  -85.849  1.00 50.60  ? 18   ASP B O     1 
ATOM   3890  C  CB    . ASP B  1 18  ? -71.252  20.453  -84.757  1.00 33.46  ? 18   ASP B CB    1 
ATOM   3891  C  CG    . ASP B  1 18  ? -71.453  20.214  -83.284  1.00 55.57  ? 18   ASP B CG    1 
ATOM   3892  O  OD1   . ASP B  1 18  ? -70.787  20.879  -82.463  1.00 25.65  ? 18   ASP B OD1   1 
ATOM   3893  O  OD2   . ASP B  1 18  ? -72.315  19.372  -82.950  1.00 46.78  ? 18   ASP B OD2   1 
ATOM   3894  N  N     . LEU B  1 19  ? -74.303  22.119  -84.864  1.00 30.51  ? 19   LEU B N     1 
ATOM   3895  C  CA    . LEU B  1 19  ? -74.956  23.386  -84.725  1.00 29.79  ? 19   LEU B CA    1 
ATOM   3896  C  C     . LEU B  1 19  ? -74.496  24.012  -83.454  1.00 34.98  ? 19   LEU B C     1 
ATOM   3897  O  O     . LEU B  1 19  ? -74.651  23.434  -82.391  1.00 39.74  ? 19   LEU B O     1 
ATOM   3898  C  CB    . LEU B  1 19  ? -76.458  23.171  -84.660  1.00 32.86  ? 19   LEU B CB    1 
ATOM   3899  C  CG    . LEU B  1 19  ? -77.221  23.173  -85.984  1.00 39.25  ? 19   LEU B CG    1 
ATOM   3900  C  CD1   . LEU B  1 19  ? -76.346  22.841  -87.187  1.00 28.76  ? 19   LEU B CD1   1 
ATOM   3901  C  CD2   . LEU B  1 19  ? -78.367  22.204  -85.849  1.00 37.37  ? 19   LEU B CD2   1 
ATOM   3902  N  N     . ARG B  1 20  ? -73.921  25.197  -83.555  1.00 38.49  ? 20   ARG B N     1 
ATOM   3903  C  CA    . ARG B  1 20  ? -73.478  25.866  -82.351  1.00 37.68  ? 20   ARG B CA    1 
ATOM   3904  C  C     . ARG B  1 20  ? -74.055  27.253  -82.226  1.00 41.16  ? 20   ARG B C     1 
ATOM   3905  O  O     . ARG B  1 20  ? -74.264  27.962  -83.212  1.00 50.40  ? 20   ARG B O     1 
ATOM   3906  C  CB    . ARG B  1 20  ? -71.958  25.926  -82.283  1.00 37.42  ? 20   ARG B CB    1 
ATOM   3907  C  CG    . ARG B  1 20  ? -71.320  24.593  -82.507  1.00 49.10  ? 20   ARG B CG    1 
ATOM   3908  C  CD    . ARG B  1 20  ? -69.915  24.570  -82.010  1.00 31.44  ? 20   ARG B CD    1 
ATOM   3909  N  NE    . ARG B  1 20  ? -69.302  23.290  -82.316  1.00 39.63  ? 20   ARG B NE    1 
ATOM   3910  C  CZ    . ARG B  1 20  ? -67.996  23.083  -82.352  1.00 33.63  ? 20   ARG B CZ    1 
ATOM   3911  N  NH1   . ARG B  1 20  ? -67.529  21.885  -82.647  1.00 47.49  ? 20   ARG B NH1   1 
ATOM   3912  N  NH2   . ARG B  1 20  ? -67.160  24.070  -82.080  1.00 38.55  ? 20   ARG B NH2   1 
ATOM   3913  N  N     . PHE B  1 21  ? -74.274  27.639  -80.984  1.00 37.32  ? 21   PHE B N     1 
ATOM   3914  C  CA    . PHE B  1 21  ? -74.816  28.932  -80.670  1.00 39.84  ? 21   PHE B CA    1 
ATOM   3915  C  C     . PHE B  1 21  ? -74.334  29.260  -79.274  1.00 36.60  ? 21   PHE B C     1 
ATOM   3916  O  O     . PHE B  1 21  ? -73.838  28.387  -78.567  1.00 39.55  ? 21   PHE B O     1 
ATOM   3917  C  CB    . PHE B  1 21  ? -76.314  28.864  -80.706  1.00 31.99  ? 21   PHE B CB    1 
ATOM   3918  C  CG    . PHE B  1 21  ? -76.890  28.008  -79.641  1.00 33.71  ? 21   PHE B CG    1 
ATOM   3919  C  CD1   . PHE B  1 21  ? -77.206  28.553  -78.391  1.00 28.60  ? 21   PHE B CD1   1 
ATOM   3920  C  CD2   . PHE B  1 21  ? -77.175  26.669  -79.892  1.00 36.84  ? 21   PHE B CD2   1 
ATOM   3921  C  CE1   . PHE B  1 21  ? -77.817  27.771  -77.404  1.00 38.13  ? 21   PHE B CE1   1 
ATOM   3922  C  CE2   . PHE B  1 21  ? -77.785  25.874  -78.913  1.00 35.24  ? 21   PHE B CE2   1 
ATOM   3923  C  CZ    . PHE B  1 21  ? -78.111  26.425  -77.667  1.00 33.60  ? 21   PHE B CZ    1 
ATOM   3924  N  N     . THR B  1 22  ? -74.610  30.474  -78.825  1.00 49.11  ? 22   THR B N     1 
ATOM   3925  C  CA    . THR B  1 22  ? -74.102  30.902  -77.537  1.00 26.95  ? 22   THR B CA    1 
ATOM   3926  C  C     . THR B  1 22  ? -75.154  31.283  -76.521  1.00 28.18  ? 22   THR B C     1 
ATOM   3927  O  O     . THR B  1 22  ? -76.060  32.049  -76.823  1.00 43.58  ? 22   THR B O     1 
ATOM   3928  C  CB    . THR B  1 22  ? -73.171  32.084  -77.749  1.00 34.12  ? 22   THR B CB    1 
ATOM   3929  O  OG1   . THR B  1 22  ? -72.161  31.750  -78.735  1.00 44.12  ? 22   THR B OG1   1 
ATOM   3930  C  CG2   . THR B  1 22  ? -72.579  32.507  -76.426  1.00 15.15  ? 22   THR B CG2   1 
ATOM   3931  N  N     . ASP B  1 23  ? -74.987  30.794  -75.296  1.00 34.37  ? 23   ASP B N     1 
ATOM   3932  C  CA    . ASP B  1 23  ? -75.941  31.060  -74.229  1.00 28.45  ? 23   ASP B CA    1 
ATOM   3933  C  C     . ASP B  1 23  ? -75.696  32.406  -73.596  1.00 35.45  ? 23   ASP B C     1 
ATOM   3934  O  O     . ASP B  1 23  ? -74.715  33.084  -73.908  1.00 35.04  ? 23   ASP B O     1 
ATOM   3935  C  CB    . ASP B  1 23  ? -75.948  29.926  -73.186  1.00 41.52  ? 23   ASP B CB    1 
ATOM   3936  C  CG    . ASP B  1 23  ? -75.153  30.251  -71.938  1.00 50.44  ? 23   ASP B CG    1 
ATOM   3937  O  OD1   . ASP B  1 23  ? -73.922  30.392  -72.037  1.00 54.22  ? 23   ASP B OD1   1 
ATOM   3938  O  OD2   . ASP B  1 23  ? -75.770  30.363  -70.853  1.00 86.53  ? 23   ASP B OD2   1 
ATOM   3939  N  N     . THR B  1 24  ? -76.593  32.780  -72.695  1.00 40.32  ? 24   THR B N     1 
ATOM   3940  C  CA    . THR B  1 24  ? -76.516  34.072  -72.043  1.00 38.83  ? 24   THR B CA    1 
ATOM   3941  C  C     . THR B  1 24  ? -75.195  34.338  -71.343  1.00 48.07  ? 24   THR B C     1 
ATOM   3942  O  O     . THR B  1 24  ? -74.592  35.397  -71.572  1.00 44.59  ? 24   THR B O     1 
ATOM   3943  C  CB    . THR B  1 24  ? -77.723  34.304  -71.073  1.00 53.68  ? 24   THR B CB    1 
ATOM   3944  O  OG1   . THR B  1 24  ? -78.917  34.571  -71.825  1.00 59.50  ? 24   THR B OG1   1 
ATOM   3945  C  CG2   . THR B  1 24  ? -77.467  35.482  -70.165  1.00 37.57  ? 24   THR B CG2   1 
ATOM   3946  N  N     . LYS B  1 25  ? -74.741  33.392  -70.508  1.00 42.96  ? 25   LYS B N     1 
ATOM   3947  C  CA    . LYS B  1 25  ? -73.476  33.567  -69.771  1.00 32.51  ? 25   LYS B CA    1 
ATOM   3948  C  C     . LYS B  1 25  ? -72.294  33.702  -70.732  1.00 39.43  ? 25   LYS B C     1 
ATOM   3949  O  O     . LYS B  1 25  ? -71.301  34.384  -70.439  1.00 55.35  ? 25   LYS B O     1 
ATOM   3950  C  CB    . LYS B  1 25  ? -73.240  32.440  -68.760  1.00 30.87  ? 25   LYS B CB    1 
ATOM   3951  C  CG    . LYS B  1 25  ? -73.948  32.595  -67.391  1.00 23.55  ? 25   LYS B CG    1 
ATOM   3952  C  CD    . LYS B  1 25  ? -74.961  31.467  -67.144  1.00 55.69  ? 25   LYS B CD    1 
ATOM   3953  C  CE    . LYS B  1 25  ? -74.679  30.696  -65.844  1.00 63.44  ? 25   LYS B CE    1 
ATOM   3954  N  NZ    . LYS B  1 25  ? -75.120  31.404  -64.595  1.00 49.97  ? 25   LYS B NZ    1 
ATOM   3955  N  N     . GLY B  1 26  ? -72.424  33.093  -71.903  1.00 30.78  ? 26   GLY B N     1 
ATOM   3956  C  CA    . GLY B  1 26  ? -71.365  33.206  -72.881  1.00 26.01  ? 26   GLY B CA    1 
ATOM   3957  C  C     . GLY B  1 26  ? -70.826  31.877  -73.325  1.00 42.58  ? 26   GLY B C     1 
ATOM   3958  O  O     . GLY B  1 26  ? -70.008  31.815  -74.245  1.00 35.62  ? 26   GLY B O     1 
ATOM   3959  N  N     . LYS B  1 27  ? -71.292  30.810  -72.682  1.00 47.06  ? 27   LYS B N     1 
ATOM   3960  C  CA    . LYS B  1 27  ? -70.837  29.472  -73.012  1.00 43.65  ? 27   LYS B CA    1 
ATOM   3961  C  C     . LYS B  1 27  ? -71.439  29.003  -74.335  1.00 35.42  ? 27   LYS B C     1 
ATOM   3962  O  O     . LYS B  1 27  ? -72.649  29.071  -74.546  1.00 54.17  ? 27   LYS B O     1 
ATOM   3963  C  CB    . LYS B  1 27  ? -71.148  28.492  -71.865  1.00 48.84  ? 27   LYS B CB    1 
ATOM   3964  C  CG    . LYS B  1 27  ? -70.300  27.196  -71.880  1.00 63.74  ? 27   LYS B CG    1 
ATOM   3965  C  CD    . LYS B  1 27  ? -68.803  27.496  -71.768  1.00 73.27  ? 27   LYS B CD    1 
ATOM   3966  C  CE    . LYS B  1 27  ? -67.924  26.319  -72.190  1.00 71.86  ? 27   LYS B CE    1 
ATOM   3967  N  NZ    . LYS B  1 27  ? -66.493  26.732  -72.387  1.00 77.77  ? 27   LYS B NZ    1 
ATOM   3968  N  N     . GLU B  1 28  ? -70.568  28.600  -75.251  1.00 28.01  ? 28   GLU B N     1 
ATOM   3969  C  CA    . GLU B  1 28  ? -70.963  28.102  -76.567  1.00 36.69  ? 28   GLU B CA    1 
ATOM   3970  C  C     . GLU B  1 28  ? -71.634  26.725  -76.426  1.00 33.01  ? 28   GLU B C     1 
ATOM   3971  O  O     . GLU B  1 28  ? -71.112  25.857  -75.729  1.00 38.69  ? 28   GLU B O     1 
ATOM   3972  C  CB    . GLU B  1 28  ? -69.698  27.985  -77.404  1.00 32.71  ? 28   GLU B CB    1 
ATOM   3973  C  CG    . GLU B  1 28  ? -69.862  27.754  -78.892  1.00 11.54  ? 28   GLU B CG    1 
ATOM   3974  C  CD    . GLU B  1 28  ? -68.503  27.519  -79.556  1.00 50.53  ? 28   GLU B CD    1 
ATOM   3975  O  OE1   . GLU B  1 28  ? -68.462  27.411  -80.795  1.00 43.20  ? 28   GLU B OE1   1 
ATOM   3976  O  OE2   . GLU B  1 28  ? -67.465  27.442  -78.843  1.00 61.53  ? 28   GLU B OE2   1 
ATOM   3977  N  N     A GLN B  1 29  ? -72.803  26.546  -77.044  0.83 28.51  ? 29   GLN B N     1 
ATOM   3978  C  CA    A GLN B  1 29  ? -73.538  25.276  -76.988  0.83 28.87  ? 29   GLN B CA    1 
ATOM   3979  C  C     A GLN B  1 29  ? -73.549  24.639  -78.378  0.83 30.22  ? 29   GLN B C     1 
ATOM   3980  O  O     A GLN B  1 29  ? -73.335  25.335  -79.379  0.83 32.43  ? 29   GLN B O     1 
ATOM   3981  C  CB    A GLN B  1 29  ? -74.964  25.512  -76.532  0.83 28.29  ? 29   GLN B CB    1 
ATOM   3982  C  CG    A GLN B  1 29  ? -75.124  26.539  -75.416  0.83 29.70  ? 29   GLN B CG    1 
ATOM   3983  C  CD    A GLN B  1 29  ? -74.491  26.120  -74.118  0.83 31.38  ? 29   GLN B CD    1 
ATOM   3984  O  OE1   A GLN B  1 29  ? -75.085  25.390  -73.331  0.83 32.13  ? 29   GLN B OE1   1 
ATOM   3985  N  NE2   A GLN B  1 29  ? -73.289  26.609  -73.865  0.83 33.25  ? 29   GLN B NE2   1 
ATOM   3986  N  N     A HIS B  1 30  ? -73.832  23.337  -78.451  0.87 29.23  ? 30   HIS B N     1 
ATOM   3987  C  CA    A HIS B  1 30  ? -73.830  22.665  -79.741  0.87 29.37  ? 30   HIS B CA    1 
ATOM   3988  C  C     A HIS B  1 30  ? -74.793  21.494  -79.895  0.87 29.36  ? 30   HIS B C     1 
ATOM   3989  O  O     A HIS B  1 30  ? -75.232  20.915  -78.948  0.87 27.99  ? 30   HIS B O     1 
ATOM   3990  C  CB    A HIS B  1 30  ? -72.409  22.191  -80.074  0.87 30.94  ? 30   HIS B CB    1 
ATOM   3991  C  CG    A HIS B  1 30  ? -72.053  20.852  -79.498  0.87 31.96  ? 30   HIS B CG    1 
ATOM   3992  N  ND1   A HIS B  1 30  ? -71.702  20.674  -78.176  0.87 33.24  ? 30   HIS B ND1   1 
ATOM   3993  C  CD2   A HIS B  1 30  ? -71.933  19.636  -80.084  0.87 31.89  ? 30   HIS B CD2   1 
ATOM   3994  C  CE1   A HIS B  1 30  ? -71.363  19.410  -77.979  0.87 32.94  ? 30   HIS B CE1   1 
ATOM   3995  N  NE2   A HIS B  1 30  ? -71.503  18.757  -79.120  0.87 33.22  ? 30   HIS B NE2   1 
ATOM   3996  N  N     . VAL B  1 31  ? -75.141  21.128  -81.114  1.00 40.86  ? 31   VAL B N     1 
ATOM   3997  C  CA    . VAL B  1 31  ? -76.009  19.986  -81.275  1.00 25.85  ? 31   VAL B CA    1 
ATOM   3998  C  C     . VAL B  1 31  ? -75.694  19.375  -82.610  1.00 32.60  ? 31   VAL B C     1 
ATOM   3999  O  O     . VAL B  1 31  ? -75.430  20.067  -83.600  1.00 45.75  ? 31   VAL B O     1 
ATOM   4000  C  CB    . VAL B  1 31  ? -77.469  20.330  -81.112  1.00 30.13  ? 31   VAL B CB    1 
ATOM   4001  C  CG1   . VAL B  1 31  ? -77.897  21.383  -82.111  1.00 48.09  ? 31   VAL B CG1   1 
ATOM   4002  C  CG2   . VAL B  1 31  ? -78.265  19.097  -81.266  1.00 30.91  ? 31   VAL B CG2   1 
ATOM   4003  N  N     . THR B  1 32  ? -75.678  18.063  -82.631  1.00 27.68  ? 32   THR B N     1 
ATOM   4004  C  CA    . THR B  1 32  ? -75.281  17.427  -83.851  1.00 30.56  ? 32   THR B CA    1 
ATOM   4005  C  C     . THR B  1 32  ? -76.359  16.772  -84.640  1.00 38.65  ? 32   THR B C     1 
ATOM   4006  O  O     . THR B  1 32  ? -77.147  15.974  -84.131  1.00 31.87  ? 32   THR B O     1 
ATOM   4007  C  CB    . THR B  1 32  ? -74.177  16.450  -83.598  1.00 40.42  ? 32   THR B CB    1 
ATOM   4008  O  OG1   . THR B  1 32  ? -73.336  16.956  -82.553  1.00 41.38  ? 32   THR B OG1   1 
ATOM   4009  C  CG2   . THR B  1 32  ? -73.388  16.269  -84.855  1.00 27.45  ? 32   THR B CG2   1 
ATOM   4010  N  N     . ILE B  1 33  ? -76.243  17.005  -85.935  1.00 38.13  ? 33   ILE B N     1 
ATOM   4011  C  CA    . ILE B  1 33  ? -77.180  16.535  -86.925  1.00 29.56  ? 33   ILE B CA    1 
ATOM   4012  C  C     . ILE B  1 33  ? -76.403  15.844  -88.022  1.00 35.24  ? 33   ILE B C     1 
ATOM   4013  O  O     . ILE B  1 33  ? -75.316  16.286  -88.407  1.00 44.06  ? 33   ILE B O     1 
ATOM   4014  C  CB    . ILE B  1 33  ? -77.988  17.786  -87.452  1.00 43.52  ? 33   ILE B CB    1 
ATOM   4015  C  CG1   . ILE B  1 33  ? -79.382  17.710  -86.899  1.00 37.89  ? 33   ILE B CG1   1 
ATOM   4016  C  CG2   . ILE B  1 33  ? -77.962  18.000  -88.991  1.00 34.07  ? 33   ILE B CG2   1 
ATOM   4017  C  CD1   . ILE B  1 33  ? -79.378  17.781  -85.436  1.00 64.48  ? 33   ILE B CD1   1 
ATOM   4018  N  N     . PRO B  1 34  ? -76.917  14.711  -88.501  1.00 33.52  ? 34   PRO B N     1 
ATOM   4019  C  CA    . PRO B  1 34  ? -76.246  13.959  -89.570  1.00 32.02  ? 34   PRO B CA    1 
ATOM   4020  C  C     . PRO B  1 34  ? -76.264  14.834  -90.799  1.00 38.23  ? 34   PRO B C     1 
ATOM   4021  O  O     . PRO B  1 34  ? -77.193  15.601  -90.990  1.00 39.14  ? 34   PRO B O     1 
ATOM   4022  C  CB    . PRO B  1 34  ? -77.151  12.740  -89.764  1.00 23.97  ? 34   PRO B CB    1 
ATOM   4023  C  CG    . PRO B  1 34  ? -77.816  12.578  -88.412  1.00 26.84  ? 34   PRO B CG    1 
ATOM   4024  C  CD    . PRO B  1 34  ? -78.107  14.006  -88.001  1.00 38.44  ? 34   PRO B CD    1 
ATOM   4025  N  N     . ALA B  1 35  ? -75.243  14.735  -91.629  1.00 42.79  ? 35   ALA B N     1 
ATOM   4026  C  CA    . ALA B  1 35  ? -75.194  15.557  -92.823  1.00 31.18  ? 35   ALA B CA    1 
ATOM   4027  C  C     . ALA B  1 35  ? -76.445  15.391  -93.692  1.00 39.21  ? 35   ALA B C     1 
ATOM   4028  O  O     . ALA B  1 35  ? -76.916  16.351  -94.305  1.00 48.65  ? 35   ALA B O     1 
ATOM   4029  C  CB    . ALA B  1 35  ? -73.944  15.235  -93.617  1.00 44.64  ? 35   ALA B CB    1 
ATOM   4030  N  N     . HIS B  1 36  ? -77.017  14.191  -93.710  1.00 41.63  ? 36   HIS B N     1 
ATOM   4031  C  CA    . HIS B  1 36  ? -78.202  13.956  -94.533  1.00 36.84  ? 36   HIS B CA    1 
ATOM   4032  C  C     . HIS B  1 36  ? -79.425  14.752  -94.085  1.00 34.79  ? 36   HIS B C     1 
ATOM   4033  O  O     . HIS B  1 36  ? -80.360  14.977  -94.862  1.00 55.36  ? 36   HIS B O     1 
ATOM   4034  C  CB    . HIS B  1 36  ? -78.522  12.451  -94.656  1.00 37.42  ? 36   HIS B CB    1 
ATOM   4035  C  CG    . HIS B  1 36  ? -78.875  11.778  -93.365  1.00 47.51  ? 36   HIS B CG    1 
ATOM   4036  N  ND1   . HIS B  1 36  ? -79.861  12.245  -92.522  1.00 58.36  ? 36   HIS B ND1   1 
ATOM   4037  C  CD2   . HIS B  1 36  ? -78.401  10.643  -92.797  1.00 39.94  ? 36   HIS B CD2   1 
ATOM   4038  C  CE1   . HIS B  1 36  ? -79.983  11.425  -91.493  1.00 55.80  ? 36   HIS B CE1   1 
ATOM   4039  N  NE2   . HIS B  1 36  ? -79.109  10.446  -91.635  1.00 37.36  ? 36   HIS B NE2   1 
ATOM   4040  N  N     . GLN B  1 37  ? -79.401  15.195  -92.835  1.00 30.72  ? 37   GLN B N     1 
ATOM   4041  C  CA    . GLN B  1 37  ? -80.496  15.977  -92.273  1.00 37.29  ? 37   GLN B CA    1 
ATOM   4042  C  C     . GLN B  1 37  ? -80.453  17.420  -92.766  1.00 50.37  ? 37   GLN B C     1 
ATOM   4043  O  O     . GLN B  1 37  ? -81.340  18.240  -92.454  1.00 42.53  ? 37   GLN B O     1 
ATOM   4044  C  CB    . GLN B  1 37  ? -80.415  15.955  -90.754  1.00 39.12  ? 37   GLN B CB    1 
ATOM   4045  C  CG    . GLN B  1 37  ? -80.905  14.688  -90.156  1.00 55.59  ? 37   GLN B CG    1 
ATOM   4046  C  CD    . GLN B  1 37  ? -82.297  14.374  -90.612  1.00 48.79  ? 37   GLN B CD    1 
ATOM   4047  O  OE1   . GLN B  1 37  ? -82.484  13.522  -91.470  1.00 59.80  ? 37   GLN B OE1   1 
ATOM   4048  N  NE2   . GLN B  1 37  ? -83.287  15.082  -90.062  1.00 60.31  ? 37   GLN B NE2   1 
ATOM   4049  N  N     . VAL B  1 38  ? -79.397  17.724  -93.516  1.00 41.89  ? 38   VAL B N     1 
ATOM   4050  C  CA    . VAL B  1 38  ? -79.198  19.049  -94.080  1.00 57.33  ? 38   VAL B CA    1 
ATOM   4051  C  C     . VAL B  1 38  ? -79.722  19.113  -95.499  1.00 67.71  ? 38   VAL B C     1 
ATOM   4052  O  O     . VAL B  1 38  ? -79.167  18.494  -96.420  1.00 68.77  ? 38   VAL B O     1 
ATOM   4053  C  CB    . VAL B  1 38  ? -77.739  19.428  -94.062  1.00 56.46  ? 38   VAL B CB    1 
ATOM   4054  C  CG1   . VAL B  1 38  ? -77.510  20.679  -94.883  1.00 57.39  ? 38   VAL B CG1   1 
ATOM   4055  C  CG2   . VAL B  1 38  ? -77.317  19.635  -92.629  1.00 45.82  ? 38   VAL B CG2   1 
ATOM   4056  N  N     . ASN B  1 39  ? -80.782  19.900  -95.655  1.00 69.83  ? 39   ASN B N     1 
ATOM   4057  C  CA    . ASN B  1 39  ? -81.452  20.068  -96.932  1.00 76.77  ? 39   ASN B CA    1 
ATOM   4058  C  C     . ASN B  1 39  ? -81.822  21.512  -97.191  1.00 76.78  ? 39   ASN B C     1 
ATOM   4059  O  O     . ASN B  1 39  ? -81.515  22.413  -96.399  1.00 63.57  ? 39   ASN B O     1 
ATOM   4060  C  CB    . ASN B  1 39  ? -82.728  19.236  -96.955  1.00 66.66  ? 39   ASN B CB    1 
ATOM   4061  C  CG    . ASN B  1 39  ? -83.608  19.505  -95.754  1.00 69.31  ? 39   ASN B CG    1 
ATOM   4062  O  OD1   . ASN B  1 39  ? -83.580  20.593  -95.169  1.00 75.50  ? 39   ASN B OD1   1 
ATOM   4063  N  ND2   . ASN B  1 39  ? -84.377  18.507  -95.361  1.00 80.88  ? 39   ASN B ND2   1 
ATOM   4064  N  N     . ALA B  1 40  ? -82.584  21.678  -98.265  1.00 85.27  ? 40   ALA B N     1 
ATOM   4065  C  CA    . ALA B  1 40  ? -83.056  22.964  -98.729  1.00 75.44  ? 40   ALA B CA    1 
ATOM   4066  C  C     . ALA B  1 40  ? -83.715  23.833  -97.654  1.00 77.65  ? 40   ALA B C     1 
ATOM   4067  O  O     . ALA B  1 40  ? -83.206  24.912  -97.321  1.00 74.65  ? 40   ALA B O     1 
ATOM   4068  C  CB    . ALA B  1 40  ? -84.013  22.745  -99.889  1.00 100.00 ? 40   ALA B CB    1 
ATOM   4069  N  N     . GLU B  1 41  ? -84.825  23.352  -97.096  1.00 64.81  ? 41   GLU B N     1 
ATOM   4070  C  CA    . GLU B  1 41  ? -85.563  24.124  -96.093  1.00 88.88  ? 41   GLU B CA    1 
ATOM   4071  C  C     . GLU B  1 41  ? -84.838  24.317  -94.781  1.00 88.16  ? 41   GLU B C     1 
ATOM   4072  O  O     . GLU B  1 41  ? -85.099  25.285  -94.062  1.00 85.38  ? 41   GLU B O     1 
ATOM   4073  C  CB    . GLU B  1 41  ? -86.965  23.549  -95.833  1.00 97.33  ? 41   GLU B CB    1 
ATOM   4074  C  CG    . GLU B  1 41  ? -87.002  22.152  -95.226  0.49 62.97  ? 41   GLU B CG    1 
ATOM   4075  C  CD    . GLU B  1 41  ? -87.203  21.064  -96.272  0.49 75.79  ? 41   GLU B CD    1 
ATOM   4076  O  OE1   . GLU B  1 41  ? -86.616  21.172  -97.384  0.49 71.24  ? 41   GLU B OE1   1 
ATOM   4077  O  OE2   . GLU B  1 41  ? -87.952  20.102  -95.977  0.49 66.95  ? 41   GLU B OE2   1 
ATOM   4078  N  N     . PHE B  1 42  ? -83.953  23.382  -94.457  1.00 92.70  ? 42   PHE B N     1 
ATOM   4079  C  CA    . PHE B  1 42  ? -83.178  23.474  -93.234  1.00 84.83  ? 42   PHE B CA    1 
ATOM   4080  C  C     . PHE B  1 42  ? -82.577  24.884  -93.138  1.00 73.93  ? 42   PHE B C     1 
ATOM   4081  O  O     . PHE B  1 42  ? -82.583  25.511  -92.074  1.00 66.04  ? 42   PHE B O     1 
ATOM   4082  C  CB    . PHE B  1 42  ? -82.068  22.421  -93.245  1.00 76.66  ? 42   PHE B CB    1 
ATOM   4083  C  CG    . PHE B  1 42  ? -80.988  22.674  -92.234  1.00 85.54  ? 42   PHE B CG    1 
ATOM   4084  C  CD1   . PHE B  1 42  ? -79.651  22.750  -92.627  1.00 87.38  ? 42   PHE B CD1   1 
ATOM   4085  C  CD2   . PHE B  1 42  ? -81.307  22.895  -90.895  1.00 82.55  ? 42   PHE B CD2   1 
ATOM   4086  C  CE1   . PHE B  1 42  ? -78.638  23.051  -91.702  1.00 48.60  ? 42   PHE B CE1   1 
ATOM   4087  C  CE2   . PHE B  1 42  ? -80.308  23.194  -89.962  1.00 76.10  ? 42   PHE B CE2   1 
ATOM   4088  C  CZ    . PHE B  1 42  ? -78.966  23.274  -90.370  1.00 58.68  ? 42   PHE B CZ    1 
ATOM   4089  N  N     . PHE B  1 43  ? -82.137  25.404  -94.279  1.00 63.87  ? 43   PHE B N     1 
ATOM   4090  C  CA    . PHE B  1 43  ? -81.541  26.729  -94.330  1.00 65.47  ? 43   PHE B CA    1 
ATOM   4091  C  C     . PHE B  1 43  ? -82.465  27.911  -94.205  1.00 82.47  ? 43   PHE B C     1 
ATOM   4092  O  O     . PHE B  1 43  ? -82.081  28.942  -93.641  1.00 83.05  ? 43   PHE B O     1 
ATOM   4093  C  CB    . PHE B  1 43  ? -80.692  26.883  -95.574  1.00 55.54  ? 43   PHE B CB    1 
ATOM   4094  C  CG    . PHE B  1 43  ? -79.292  26.474  -95.357  0.63 42.46  ? 43   PHE B CG    1 
ATOM   4095  C  CD1   . PHE B  1 43  ? -78.820  25.270  -95.860  0.63 33.10  ? 43   PHE B CD1   1 
ATOM   4096  C  CD2   . PHE B  1 43  ? -78.456  27.258  -94.563  0.63 52.88  ? 43   PHE B CD2   1 
ATOM   4097  C  CE1   . PHE B  1 43  ? -77.536  24.842  -95.572  0.63 43.49  ? 43   PHE B CE1   1 
ATOM   4098  C  CE2   . PHE B  1 43  ? -77.172  26.843  -94.265  0.63 43.90  ? 43   PHE B CE2   1 
ATOM   4099  C  CZ    . PHE B  1 43  ? -76.708  25.631  -94.768  0.63 44.85  ? 43   PHE B CZ    1 
ATOM   4100  N  N     . GLU B  1 44  ? -83.663  27.784  -94.761  1.00 88.69  ? 44   GLU B N     1 
ATOM   4101  C  CA    . GLU B  1 44  ? -84.621  28.868  -94.697  1.00 86.14  ? 44   GLU B CA    1 
ATOM   4102  C  C     . GLU B  1 44  ? -85.488  28.851  -93.444  1.00 81.17  ? 44   GLU B C     1 
ATOM   4103  O  O     . GLU B  1 44  ? -85.892  29.911  -92.973  1.00 97.71  ? 44   GLU B O     1 
ATOM   4104  C  CB    . GLU B  1 44  ? -85.438  28.932  -95.983  1.00 84.81  ? 44   GLU B CB    1 
ATOM   4105  C  CG    . GLU B  1 44  ? -84.584  29.377  -97.174  0.49 59.41  ? 44   GLU B CG    1 
ATOM   4106  C  CD    . GLU B  1 44  ? -84.973  28.704  -98.488  0.49 78.74  ? 44   GLU B CD    1 
ATOM   4107  O  OE1   . GLU B  1 44  ? -84.695  29.305  -99.551  0.49 79.95  ? 44   GLU B OE1   1 
ATOM   4108  O  OE2   . GLU B  1 44  ? -85.540  27.578  -98.469  0.49 72.17  ? 44   GLU B OE2   1 
ATOM   4109  N  N     . GLU B  1 45  ? -85.722  27.675  -92.862  1.00 68.13  ? 45   GLU B N     1 
ATOM   4110  C  CA    . GLU B  1 45  ? -86.531  27.607  -91.641  1.00 75.45  ? 45   GLU B CA    1 
ATOM   4111  C  C     . GLU B  1 45  ? -85.837  27.030  -90.393  1.00 77.08  ? 45   GLU B C     1 
ATOM   4112  O  O     . GLU B  1 45  ? -86.450  26.939  -89.328  1.00 76.83  ? 45   GLU B O     1 
ATOM   4113  C  CB    . GLU B  1 45  ? -87.866  26.899  -91.904  1.00 74.78  ? 45   GLU B CB    1 
ATOM   4114  C  CG    . GLU B  1 45  ? -87.745  25.448  -92.362  0.53 73.21  ? 45   GLU B CG    1 
ATOM   4115  C  CD    . GLU B  1 45  ? -89.058  24.878  -92.907  0.53 74.02  ? 45   GLU B CD    1 
ATOM   4116  O  OE1   . GLU B  1 45  ? -89.982  25.675  -93.207  0.53 57.17  ? 45   GLU B OE1   1 
ATOM   4117  O  OE2   . GLU B  1 45  ? -89.156  23.630  -93.048  0.53 48.89  ? 45   GLU B OE2   1 
ATOM   4118  N  N     . GLY B  1 46  ? -84.562  26.666  -90.516  1.00 72.83  ? 46   GLY B N     1 
ATOM   4119  C  CA    . GLY B  1 46  ? -83.828  26.128  -89.381  1.00 71.47  ? 46   GLY B CA    1 
ATOM   4120  C  C     . GLY B  1 46  ? -84.402  24.850  -88.796  1.00 72.62  ? 46   GLY B C     1 
ATOM   4121  O  O     . GLY B  1 46  ? -85.111  24.108  -89.482  1.00 81.98  ? 46   GLY B O     1 
ATOM   4122  N  N     . LYS B  1 47  ? -84.060  24.572  -87.540  1.00 63.24  ? 47   LYS B N     1 
ATOM   4123  C  CA    . LYS B  1 47  ? -84.544  23.376  -86.858  1.00 64.52  ? 47   LYS B CA    1 
ATOM   4124  C  C     . LYS B  1 47  ? -85.136  23.762  -85.527  1.00 68.04  ? 47   LYS B C     1 
ATOM   4125  O  O     . LYS B  1 47  ? -84.805  24.798  -84.951  1.00 58.58  ? 47   LYS B O     1 
ATOM   4126  C  CB    . LYS B  1 47  ? -83.427  22.344  -86.630  1.00 53.18  ? 47   LYS B CB    1 
ATOM   4127  C  CG    . LYS B  1 47  ? -83.142  21.384  -87.799  0.75 35.34  ? 47   LYS B CG    1 
ATOM   4128  C  CD    . LYS B  1 47  ? -84.268  20.362  -88.027  0.75 75.19  ? 47   LYS B CD    1 
ATOM   4129  C  CE    . LYS B  1 47  ? -83.787  19.120  -88.821  0.75 73.00  ? 47   LYS B CE    1 
ATOM   4130  N  NZ    . LYS B  1 47  ? -83.289  19.390  -90.218  0.75 60.37  ? 47   LYS B NZ    1 
ATOM   4131  N  N     . MET B  1 48  ? -86.013  22.900  -85.037  1.00 78.67  ? 48   MET B N     1 
ATOM   4132  C  CA    . MET B  1 48  ? -86.678  23.130  -83.776  1.00 63.65  ? 48   MET B CA    1 
ATOM   4133  C  C     . MET B  1 48  ? -85.925  22.587  -82.598  1.00 66.82  ? 48   MET B C     1 
ATOM   4134  O  O     . MET B  1 48  ? -85.245  21.565  -82.703  1.00 92.08  ? 48   MET B O     1 
ATOM   4135  C  CB    . MET B  1 48  ? -88.066  22.505  -83.801  1.00 80.57  ? 48   MET B CB    1 
ATOM   4136  C  CG    . MET B  1 48  ? -89.096  23.435  -84.368  0.52 57.00  ? 48   MET B CG    1 
ATOM   4137  S  SD    . MET B  1 48  ? -88.827  25.069  -83.650  0.52 60.16  ? 48   MET B SD    1 
ATOM   4138  C  CE    . MET B  1 48  ? -89.572  24.896  -82.030  0.52 59.44  ? 48   MET B CE    1 
ATOM   4139  N  N     . PHE B  1 49  ? -86.035  23.287  -81.476  1.00 55.68  ? 49   PHE B N     1 
ATOM   4140  C  CA    . PHE B  1 49  ? -85.403  22.843  -80.239  1.00 63.21  ? 49   PHE B CA    1 
ATOM   4141  C  C     . PHE B  1 49  ? -85.943  23.608  -79.025  1.00 71.77  ? 49   PHE B C     1 
ATOM   4142  O  O     . PHE B  1 49  ? -86.421  24.747  -79.150  1.00 72.19  ? 49   PHE B O     1 
ATOM   4143  C  CB    . PHE B  1 49  ? -83.876  22.952  -80.320  1.00 52.67  ? 49   PHE B CB    1 
ATOM   4144  C  CG    . PHE B  1 49  ? -83.334  24.238  -79.786  1.00 60.95  ? 49   PHE B CG    1 
ATOM   4145  C  CD1   . PHE B  1 49  ? -82.738  24.282  -78.525  1.00 48.50  ? 49   PHE B CD1   1 
ATOM   4146  C  CD2   . PHE B  1 49  ? -83.473  25.422  -80.506  1.00 68.22  ? 49   PHE B CD2   1 
ATOM   4147  C  CE1   . PHE B  1 49  ? -82.297  25.497  -77.982  1.00 58.07  ? 49   PHE B CE1   1 
ATOM   4148  C  CE2   . PHE B  1 49  ? -83.034  26.638  -79.973  1.00 75.74  ? 49   PHE B CE2   1 
ATOM   4149  C  CZ    . PHE B  1 49  ? -82.447  26.676  -78.707  1.00 62.75  ? 49   PHE B CZ    1 
ATOM   4150  N  N     . ASP B  1 50  ? -85.885  22.960  -77.862  1.00 63.72  ? 50   ASP B N     1 
ATOM   4151  C  CA    . ASP B  1 50  ? -86.344  23.550  -76.609  1.00 71.93  ? 50   ASP B CA    1 
ATOM   4152  C  C     . ASP B  1 50  ? -85.206  24.227  -75.845  1.00 76.06  ? 50   ASP B C     1 
ATOM   4153  O  O     . ASP B  1 50  ? -84.246  23.573  -75.430  1.00 63.08  ? 50   ASP B O     1 
ATOM   4154  C  CB    . ASP B  1 50  ? -86.993  22.485  -75.717  1.00 65.88  ? 50   ASP B CB    1 
ATOM   4155  C  CG    . ASP B  1 50  ? -87.150  22.949  -74.270  0.40 57.80  ? 50   ASP B CG    1 
ATOM   4156  O  OD1   . ASP B  1 50  ? -86.233  22.680  -73.447  0.40 47.23  ? 50   ASP B OD1   1 
ATOM   4157  O  OD2   . ASP B  1 50  ? -88.178  23.600  -73.969  0.40 40.94  ? 50   ASP B OD2   1 
ATOM   4158  N  N     . GLY B  1 51  ? -85.349  25.526  -75.611  1.00 85.35  ? 51   GLY B N     1 
ATOM   4159  C  CA    . GLY B  1 51  ? -84.323  26.249  -74.891  1.00 82.68  ? 51   GLY B CA    1 
ATOM   4160  C  C     . GLY B  1 51  ? -84.471  26.162  -73.386  1.00 69.33  ? 51   GLY B C     1 
ATOM   4161  O  O     . GLY B  1 51  ? -83.520  26.424  -72.665  1.00 85.24  ? 51   GLY B O     1 
ATOM   4162  N  N     . SER B  1 52  ? -85.645  25.750  -72.919  1.00 64.74  ? 52   SER B N     1 
ATOM   4163  C  CA    . SER B  1 52  ? -85.971  25.651  -71.493  1.00 65.41  ? 52   SER B CA    1 
ATOM   4164  C  C     . SER B  1 52  ? -84.867  25.294  -70.493  1.00 65.41  ? 52   SER B C     1 
ATOM   4165  O  O     . SER B  1 52  ? -84.768  25.913  -69.428  1.00 81.89  ? 52   SER B O     1 
ATOM   4166  C  CB    . SER B  1 52  ? -87.166  24.717  -71.300  1.00 59.31  ? 52   SER B CB    1 
ATOM   4167  O  OG    . SER B  1 52  ? -87.523  24.594  -69.937  0.56 81.80  ? 52   SER B OG    1 
ATOM   4168  N  N     . SER B  1 53  ? -84.040  24.309  -70.830  1.00 83.12  ? 53   SER B N     1 
ATOM   4169  C  CA    . SER B  1 53  ? -82.960  23.878  -69.937  1.00 81.43  ? 53   SER B CA    1 
ATOM   4170  C  C     . SER B  1 53  ? -81.653  24.611  -70.216  1.00 76.53  ? 53   SER B C     1 
ATOM   4171  O  O     . SER B  1 53  ? -80.563  24.037  -70.177  1.00 78.14  ? 53   SER B O     1 
ATOM   4172  C  CB    . SER B  1 53  ? -82.759  22.381  -70.066  1.00 62.56  ? 53   SER B CB    1 
ATOM   4173  O  OG    . SER B  1 53  ? -83.997  21.769  -70.374  0.70 74.73  ? 53   SER B OG    1 
ATOM   4174  N  N     . ILE B  1 54  ? -81.787  25.897  -70.505  1.00 76.24  ? 54   ILE B N     1 
ATOM   4175  C  CA    . ILE B  1 54  ? -80.657  26.758  -70.779  1.00 69.18  ? 54   ILE B CA    1 
ATOM   4176  C  C     . ILE B  1 54  ? -80.730  27.935  -69.817  1.00 72.13  ? 54   ILE B C     1 
ATOM   4177  O  O     . ILE B  1 54  ? -81.809  28.321  -69.343  1.00 64.78  ? 54   ILE B O     1 
ATOM   4178  C  CB    . ILE B  1 54  ? -80.646  27.189  -72.262  1.00 60.37  ? 54   ILE B CB    1 
ATOM   4179  C  CG1   . ILE B  1 54  ? -80.190  26.006  -73.111  1.00 44.23  ? 54   ILE B CG1   1 
ATOM   4180  C  CG2   . ILE B  1 54  ? -79.738  28.387  -72.503  1.00 40.33  ? 54   ILE B CG2   1 
ATOM   4181  C  CD1   . ILE B  1 54  ? -80.066  26.324  -74.567  1.00 53.25  ? 54   ILE B CD1   1 
ATOM   4182  N  N     . GLY B  1 55  ? -79.557  28.420  -69.442  1.00 87.22  ? 55   GLY B N     1 
ATOM   4183  C  CA    . GLY B  1 55  ? -79.483  29.530  -68.520  1.00 93.04  ? 55   GLY B CA    1 
ATOM   4184  C  C     . GLY B  1 55  ? -80.231  30.776  -68.951  1.00 87.23  ? 55   GLY B C     1 
ATOM   4185  O  O     . GLY B  1 55  ? -79.904  31.372  -69.984  1.00 93.46  ? 55   GLY B O     1 
ATOM   4186  N  N     . GLY B  1 56  ? -81.283  31.104  -68.196  1.00 76.83  ? 56   GLY B N     1 
ATOM   4187  C  CA    . GLY B  1 56  ? -82.068  32.308  -68.426  1.00 78.24  ? 56   GLY B CA    1 
ATOM   4188  C  C     . GLY B  1 56  ? -82.859  32.503  -69.703  1.00 84.67  ? 56   GLY B C     1 
ATOM   4189  O  O     . GLY B  1 56  ? -83.059  33.641  -70.149  1.00 89.55  ? 56   GLY B O     1 
ATOM   4190  N  N     . TRP B  1 57  ? -83.234  31.407  -70.308  1.00 86.54  ? 57   TRP B N     1 
ATOM   4191  C  CA    . TRP B  1 57  ? -84.030  31.382  -71.527  1.00 84.52  ? 57   TRP B CA    1 
ATOM   4192  C  C     . TRP B  1 57  ? -85.251  30.617  -71.150  1.00 90.25  ? 57   TRP B C     1 
ATOM   4193  O  O     . TRP B  1 57  ? -86.243  30.437  -71.867  1.00 91.10  ? 57   TRP B O     1 
ATOM   4194  C  CB    . TRP B  1 57  ? -83.355  30.638  -72.672  1.00 58.70  ? 57   TRP B CB    1 
ATOM   4195  C  CG    . TRP B  1 57  ? -82.177  31.340  -73.227  0.94 52.85  ? 57   TRP B CG    1 
ATOM   4196  C  CD1   . TRP B  1 57  ? -81.555  32.462  -72.753  0.94 56.35  ? 57   TRP B CD1   1 
ATOM   4197  C  CD2   . TRP B  1 57  ? -81.446  30.930  -74.378  0.94 46.54  ? 57   TRP B CD2   1 
ATOM   4198  N  NE1   . TRP B  1 57  ? -80.477  32.776  -73.545  0.94 47.63  ? 57   TRP B NE1   1 
ATOM   4199  C  CE2   . TRP B  1 57  ? -80.388  31.852  -74.554  0.94 53.01  ? 57   TRP B CE2   1 
ATOM   4200  C  CE3   . TRP B  1 57  ? -81.581  29.872  -75.283  0.94 37.82  ? 57   TRP B CE3   1 
ATOM   4201  C  CZ2   . TRP B  1 57  ? -79.468  31.747  -75.605  0.94 54.30  ? 57   TRP B CZ2   1 
ATOM   4202  C  CZ3   . TRP B  1 57  ? -80.669  29.766  -76.328  0.94 52.69  ? 57   TRP B CZ3   1 
ATOM   4203  C  CH2   . TRP B  1 57  ? -79.625  30.701  -76.480  0.94 31.24  ? 57   TRP B CH2   1 
ATOM   4204  N  N     . LYS B  1 58  ? -85.106  30.216  -69.924  0.56 84.10  ? 58   LYS B N     1 
ATOM   4205  C  CA    . LYS B  1 58  ? -86.068  29.424  -69.224  0.56 76.24  ? 58   LYS B CA    1 
ATOM   4206  C  C     . LYS B  1 58  ? -87.361  29.917  -69.736  0.56 72.15  ? 58   LYS B C     1 
ATOM   4207  O  O     . LYS B  1 58  ? -87.490  31.000  -70.312  0.56 73.02  ? 58   LYS B O     1 
ATOM   4208  C  CB    . LYS B  1 58  ? -85.929  29.603  -67.737  0.56 69.81  ? 58   LYS B CB    1 
ATOM   4209  C  CG    . LYS B  1 58  ? -85.449  28.326  -67.055  0.56 70.40  ? 58   LYS B CG    1 
ATOM   4210  C  CD    . LYS B  1 58  ? -86.355  27.976  -65.883  0.56 77.68  ? 58   LYS B CD    1 
ATOM   4211  C  CE    . LYS B  1 58  ? -87.556  27.116  -66.288  0.56 82.60  ? 58   LYS B CE    1 
ATOM   4212  N  NZ    . LYS B  1 58  ? -88.291  26.615  -65.090  0.56 74.61  ? 58   LYS B NZ    1 
ATOM   4213  N  N     . GLY B  1 59  ? -88.328  29.096  -69.487  0.56 74.67  ? 59   GLY B N     1 
ATOM   4214  C  CA    . GLY B  1 59  ? -89.666  29.328  -69.949  0.56 76.74  ? 59   GLY B CA    1 
ATOM   4215  C  C     . GLY B  1 59  ? -90.173  27.946  -70.237  0.56 91.04  ? 59   GLY B C     1 
ATOM   4216  O  O     . GLY B  1 59  ? -90.384  27.564  -71.383  0.56 98.73  ? 59   GLY B O     1 
ATOM   4217  N  N     . ILE B  1 60  ? -90.349  27.211  -69.158  0.56 94.06  ? 60   ILE B N     1 
ATOM   4218  C  CA    . ILE B  1 60  ? -90.737  25.822  -69.317  0.56 96.17  ? 60   ILE B CA    1 
ATOM   4219  C  C     . ILE B  1 60  ? -92.176  25.810  -69.764  0.56 100.00 ? 60   ILE B C     1 
ATOM   4220  O  O     . ILE B  1 60  ? -92.900  24.892  -69.386  0.56 100.00 ? 60   ILE B O     1 
ATOM   4221  C  CB    . ILE B  1 60  ? -90.473  25.110  -68.006  0.56 91.34  ? 60   ILE B CB    1 
ATOM   4222  C  CG1   . ILE B  1 60  ? -90.379  23.636  -68.386  0.56 75.78  ? 60   ILE B CG1   1 
ATOM   4223  C  CG2   . ILE B  1 60  ? -91.563  25.335  -66.979  0.56 94.97  ? 60   ILE B CG2   1 
ATOM   4224  C  CD1   . ILE B  1 60  ? -90.123  22.717  -67.213  0.56 52.25  ? 60   ILE B CD1   1 
ATOM   4225  N  N     . ASN B  1 61  ? -92.520  26.769  -70.608  0.56 63.89  ? 61   ASN B N     1 
ATOM   4226  C  CA    . ASN B  1 61  ? -93.849  26.848  -71.127  0.56 63.65  ? 61   ASN B CA    1 
ATOM   4227  C  C     . ASN B  1 61  ? -93.892  27.343  -72.585  0.56 63.76  ? 61   ASN B C     1 
ATOM   4228  O  O     . ASN B  1 61  ? -94.516  26.785  -73.519  0.56 64.61  ? 61   ASN B O     1 
ATOM   4229  C  CB    . ASN B  1 61  ? -94.681  27.764  -70.230  0.56 62.87  ? 61   ASN B CB    1 
ATOM   4230  C  CG    . ASN B  1 61  ? -94.338  27.603  -68.755  0.56 62.60  ? 61   ASN B CG    1 
ATOM   4231  O  OD1   . ASN B  1 61  ? -93.561  28.374  -68.189  0.56 62.30  ? 61   ASN B OD1   1 
ATOM   4232  N  ND2   . ASN B  1 61  ? -94.943  26.597  -68.122  0.56 62.16  ? 61   ASN B ND2   1 
ATOM   4233  N  N     . GLU B  1 62  ? -93.209  28.449  -72.839  0.56 63.39  ? 62   GLU B N     1 
ATOM   4234  C  CA    . GLU B  1 62  ? -93.232  29.082  -74.191  0.56 73.99  ? 62   GLU B CA    1 
ATOM   4235  C  C     . GLU B  1 62  ? -91.950  28.957  -75.076  0.56 72.03  ? 62   GLU B C     1 
ATOM   4236  O  O     . GLU B  1 62  ? -92.032  28.960  -76.301  0.56 45.16  ? 62   GLU B O     1 
ATOM   4237  C  CB    . GLU B  1 62  ? -93.627  30.568  -74.023  0.56 77.89  ? 62   GLU B CB    1 
ATOM   4238  C  CG    . GLU B  1 62  ? -92.609  31.423  -73.260  0.56 83.42  ? 62   GLU B CG    1 
ATOM   4239  C  CD    . GLU B  1 62  ? -93.140  31.867  -71.910  0.56 86.44  ? 62   GLU B CD    1 
ATOM   4240  O  OE1   . GLU B  1 62  ? -92.700  31.283  -70.885  0.56 85.51  ? 62   GLU B OE1   1 
ATOM   4241  O  OE2   . GLU B  1 62  ? -93.983  32.793  -71.857  0.56 79.93  ? 62   GLU B OE2   1 
ATOM   4242  N  N     . SER B  1 63  ? -90.770  28.854  -74.440  0.56 83.50  ? 63   SER B N     1 
ATOM   4243  C  CA    . SER B  1 63  ? -89.437  28.872  -75.108  0.56 94.18  ? 63   SER B CA    1 
ATOM   4244  C  C     . SER B  1 63  ? -89.027  27.637  -75.916  0.56 85.05  ? 63   SER B C     1 
ATOM   4245  O  O     . SER B  1 63  ? -88.064  26.931  -75.619  0.56 68.36  ? 63   SER B O     1 
ATOM   4246  C  CB    . SER B  1 63  ? -88.368  29.205  -74.069  0.56 89.72  ? 63   SER B CB    1 
ATOM   4247  O  OG    . SER B  1 63  ? -88.169  28.119  -73.185  0.56 99.68  ? 63   SER B OG    1 
ATOM   4248  N  N     . ASP B  1 64  ? -89.799  27.397  -76.949  0.56 67.93  ? 64   ASP B N     1 
ATOM   4249  C  CA    . ASP B  1 64  ? -89.516  26.379  -77.938  0.56 45.13  ? 64   ASP B CA    1 
ATOM   4250  C  C     . ASP B  1 64  ? -89.052  27.202  -79.110  0.56 50.80  ? 64   ASP B C     1 
ATOM   4251  O  O     . ASP B  1 64  ? -89.860  27.654  -79.908  0.56 43.14  ? 64   ASP B O     1 
ATOM   4252  C  CB    . ASP B  1 64  ? -90.758  25.571  -78.310  0.56 31.38  ? 64   ASP B CB    1 
ATOM   4253  C  CG    . ASP B  1 64  ? -90.528  24.077  -78.264  0.56 48.35  ? 64   ASP B CG    1 
ATOM   4254  O  OD1   . ASP B  1 64  ? -91.126  23.386  -77.406  0.56 53.52  ? 64   ASP B OD1   1 
ATOM   4255  O  OD2   . ASP B  1 64  ? -89.738  23.594  -79.102  0.56 55.76  ? 64   ASP B OD2   1 
ATOM   4256  N  N     . MET B  1 65  ? -87.733  27.382  -79.211  1.00 60.34  ? 65   MET B N     1 
ATOM   4257  C  CA    . MET B  1 65  ? -87.121  28.219  -80.237  1.00 59.27  ? 65   MET B CA    1 
ATOM   4258  C  C     . MET B  1 65  ? -86.526  27.549  -81.469  1.00 62.23  ? 65   MET B C     1 
ATOM   4259  O  O     . MET B  1 65  ? -86.403  26.319  -81.539  1.00 65.14  ? 65   MET B O     1 
ATOM   4260  C  CB    . MET B  1 65  ? -86.071  29.137  -79.599  1.00 70.37  ? 65   MET B CB    1 
ATOM   4261  C  CG    . MET B  1 65  ? -86.560  30.561  -79.279  0.54 30.17  ? 65   MET B CG    1 
ATOM   4262  S  SD    . MET B  1 65  ? -87.745  30.686  -77.914  0.54 64.92  ? 65   MET B SD    1 
ATOM   4263  C  CE    . MET B  1 65  ? -86.632  30.798  -76.518  0.54 65.24  ? 65   MET B CE    1 
ATOM   4264  N  N     . VAL B  1 66  ? -86.120  28.399  -82.417  1.00 52.49  ? 66   VAL B N     1 
ATOM   4265  C  CA    . VAL B  1 66  ? -85.524  27.989  -83.692  1.00 65.14  ? 66   VAL B CA    1 
ATOM   4266  C  C     . VAL B  1 66  ? -84.017  28.226  -83.838  1.00 63.74  ? 66   VAL B C     1 
ATOM   4267  O  O     . VAL B  1 66  ? -83.510  29.319  -83.583  1.00 65.61  ? 66   VAL B O     1 
ATOM   4268  C  CB    . VAL B  1 66  ? -86.145  28.751  -84.871  1.00 63.37  ? 66   VAL B CB    1 
ATOM   4269  C  CG1   . VAL B  1 66  ? -85.706  28.122  -86.192  1.00 69.21  ? 66   VAL B CG1   1 
ATOM   4270  C  CG2   . VAL B  1 66  ? -87.637  28.789  -84.741  1.00 89.67  ? 66   VAL B CG2   1 
ATOM   4271  N  N     . LEU B  1 67  ? -83.317  27.211  -84.320  1.00 49.17  ? 67   LEU B N     1 
ATOM   4272  C  CA    . LEU B  1 67  ? -81.896  27.330  -84.562  1.00 43.50  ? 67   LEU B CA    1 
ATOM   4273  C  C     . LEU B  1 67  ? -81.753  27.732  -86.005  1.00 50.39  ? 67   LEU B C     1 
ATOM   4274  O  O     . LEU B  1 67  ? -82.072  26.950  -86.909  1.00 49.49  ? 67   LEU B O     1 
ATOM   4275  C  CB    . LEU B  1 67  ? -81.200  25.998  -84.358  1.00 48.70  ? 67   LEU B CB    1 
ATOM   4276  C  CG    . LEU B  1 67  ? -80.822  25.746  -82.914  1.00 47.53  ? 67   LEU B CG    1 
ATOM   4277  C  CD1   . LEU B  1 67  ? -80.473  24.303  -82.788  1.00 39.38  ? 67   LEU B CD1   1 
ATOM   4278  C  CD2   . LEU B  1 67  ? -79.662  26.635  -82.511  1.00 41.98  ? 67   LEU B CD2   1 
ATOM   4279  N  N     . MET B  1 68  ? -81.283  28.950  -86.234  1.00 42.36  ? 68   MET B N     1 
ATOM   4280  C  CA    . MET B  1 68  ? -81.138  29.389  -87.596  1.00 40.37  ? 68   MET B CA    1 
ATOM   4281  C  C     . MET B  1 68  ? -79.711  29.399  -88.072  1.00 37.10  ? 68   MET B C     1 
ATOM   4282  O  O     . MET B  1 68  ? -78.931  30.297  -87.741  1.00 51.70  ? 68   MET B O     1 
ATOM   4283  C  CB    . MET B  1 68  ? -81.774  30.758  -87.814  1.00 60.92  ? 68   MET B CB    1 
ATOM   4284  C  CG    . MET B  1 68  ? -81.774  31.223  -89.279  1.00 73.44  ? 68   MET B CG    1 
ATOM   4285  S  SD    . MET B  1 68  ? -82.548  30.032  -90.434  1.00 59.47  ? 68   MET B SD    1 
ATOM   4286  C  CE    . MET B  1 68  ? -84.218  29.958  -89.759  1.00 47.47  ? 68   MET B CE    1 
ATOM   4287  N  N     . PRO B  1 69  ? -79.355  28.398  -88.886  1.00 32.56  ? 69   PRO B N     1 
ATOM   4288  C  CA    . PRO B  1 69  ? -78.014  28.260  -89.450  1.00 34.74  ? 69   PRO B CA    1 
ATOM   4289  C  C     . PRO B  1 69  ? -77.598  29.497  -90.220  1.00 34.06  ? 69   PRO B C     1 
ATOM   4290  O  O     . PRO B  1 69  ? -78.409  30.169  -90.855  1.00 54.58  ? 69   PRO B O     1 
ATOM   4291  C  CB    . PRO B  1 69  ? -78.147  27.049  -90.385  1.00 30.95  ? 69   PRO B CB    1 
ATOM   4292  C  CG    . PRO B  1 69  ? -79.623  26.927  -90.633  1.00 37.68  ? 69   PRO B CG    1 
ATOM   4293  C  CD    . PRO B  1 69  ? -80.210  27.271  -89.293  1.00 31.39  ? 69   PRO B CD    1 
ATOM   4294  N  N     . ASP B  1 70  ? -76.325  29.824  -90.091  1.00 38.21  ? 70   ASP B N     1 
ATOM   4295  C  CA    . ASP B  1 70  ? -75.754  30.955  -90.775  1.00 31.32  ? 70   ASP B CA    1 
ATOM   4296  C  C     . ASP B  1 70  ? -74.725  30.369  -91.748  1.00 37.90  ? 70   ASP B C     1 
ATOM   4297  O  O     . ASP B  1 70  ? -73.568  30.111  -91.402  1.00 35.31  ? 70   ASP B O     1 
ATOM   4298  C  CB    . ASP B  1 70  ? -75.135  31.893  -89.751  1.00 29.20  ? 70   ASP B CB    1 
ATOM   4299  C  CG    . ASP B  1 70  ? -74.398  33.074  -90.386  1.00 62.08  ? 70   ASP B CG    1 
ATOM   4300  O  OD1   . ASP B  1 70  ? -74.001  33.008  -91.579  1.00 45.11  ? 70   ASP B OD1   1 
ATOM   4301  O  OD2   . ASP B  1 70  ? -74.187  34.072  -89.655  1.00 34.93  ? 70   ASP B OD2   1 
ATOM   4302  N  N     . ALA B  1 71  ? -75.173  30.173  -92.978  1.00 37.34  ? 71   ALA B N     1 
ATOM   4303  C  CA    . ALA B  1 71  ? -74.354  29.591  -94.026  1.00 38.95  ? 71   ALA B CA    1 
ATOM   4304  C  C     . ALA B  1 71  ? -72.923  30.091  -94.097  1.00 40.50  ? 71   ALA B C     1 
ATOM   4305  O  O     . ALA B  1 71  ? -72.031  29.359  -94.516  1.00 58.31  ? 71   ALA B O     1 
ATOM   4306  C  CB    . ALA B  1 71  ? -75.032  29.790  -95.362  1.00 68.60  ? 71   ALA B CB    1 
ATOM   4307  N  N     . SER B  1 72  ? -72.692  31.335  -93.703  1.00 45.68  ? 72   SER B N     1 
ATOM   4308  C  CA    . SER B  1 72  ? -71.340  31.883  -93.778  1.00 56.27  ? 72   SER B CA    1 
ATOM   4309  C  C     . SER B  1 72  ? -70.347  31.290  -92.770  1.00 56.95  ? 72   SER B C     1 
ATOM   4310  O  O     . SER B  1 72  ? -69.188  31.048  -93.109  1.00 56.72  ? 72   SER B O     1 
ATOM   4311  C  CB    . SER B  1 72  ? -71.376  33.405  -93.628  1.00 44.84  ? 72   SER B CB    1 
ATOM   4312  O  OG    . SER B  1 72  ? -71.671  33.781  -92.290  1.00 46.37  ? 72   SER B OG    1 
ATOM   4313  N  N     . THR B  1 73  ? -70.825  31.036  -91.551  1.00 45.43  ? 73   THR B N     1 
ATOM   4314  C  CA    . THR B  1 73  ? -70.018  30.508  -90.445  1.00 39.83  ? 73   THR B CA    1 
ATOM   4315  C  C     . THR B  1 73  ? -69.446  29.084  -90.557  1.00 50.06  ? 73   THR B C     1 
ATOM   4316  O  O     . THR B  1 73  ? -68.645  28.665  -89.710  1.00 58.13  ? 73   THR B O     1 
ATOM   4317  C  CB    . THR B  1 73  ? -70.819  30.557  -89.125  1.00 43.80  ? 73   THR B CB    1 
ATOM   4318  O  OG1   . THR B  1 73  ? -71.899  29.608  -89.166  1.00 41.84  ? 73   THR B OG1   1 
ATOM   4319  C  CG2   . THR B  1 73  ? -71.383  31.929  -88.917  1.00 39.73  ? 73   THR B CG2   1 
ATOM   4320  N  N     . ALA B  1 74  ? -69.835  28.357  -91.598  1.00 48.28  ? 74   ALA B N     1 
ATOM   4321  C  CA    . ALA B  1 74  ? -69.407  26.973  -91.783  1.00 54.21  ? 74   ALA B CA    1 
ATOM   4322  C  C     . ALA B  1 74  ? -67.927  26.666  -91.849  1.00 54.33  ? 74   ALA B C     1 
ATOM   4323  O  O     . ALA B  1 74  ? -67.192  27.219  -92.672  1.00 69.51  ? 74   ALA B O     1 
ATOM   4324  C  CB    . ALA B  1 74  ? -70.089  26.367  -92.993  1.00 45.40  ? 74   ALA B CB    1 
ATOM   4325  N  N     . VAL B  1 75  ? -67.511  25.741  -90.993  1.00 44.49  ? 75   VAL B N     1 
ATOM   4326  C  CA    . VAL B  1 75  ? -66.135  25.285  -90.977  1.00 49.30  ? 75   VAL B CA    1 
ATOM   4327  C  C     . VAL B  1 75  ? -65.954  23.973  -90.219  1.00 52.58  ? 75   VAL B C     1 
ATOM   4328  O  O     . VAL B  1 75  ? -66.599  23.719  -89.196  1.00 44.34  ? 75   VAL B O     1 
ATOM   4329  C  CB    . VAL B  1 75  ? -65.173  26.334  -90.449  1.00 40.75  ? 75   VAL B CB    1 
ATOM   4330  C  CG1   . VAL B  1 75  ? -65.406  26.566  -88.963  1.00 21.78  ? 75   VAL B CG1   1 
ATOM   4331  C  CG2   . VAL B  1 75  ? -63.727  25.917  -90.782  1.00 65.03  ? 75   VAL B CG2   1 
ATOM   4332  N  N     . ILE B  1 76  ? -65.082  23.140  -90.776  1.00 35.15  ? 76   ILE B N     1 
ATOM   4333  C  CA    . ILE B  1 76  ? -64.762  21.829  -90.237  1.00 51.10  ? 76   ILE B CA    1 
ATOM   4334  C  C     . ILE B  1 76  ? -64.243  21.831  -88.801  1.00 51.19  ? 76   ILE B C     1 
ATOM   4335  O  O     . ILE B  1 76  ? -63.491  22.730  -88.410  1.00 56.70  ? 76   ILE B O     1 
ATOM   4336  C  CB    . ILE B  1 76  ? -63.689  21.174  -91.121  1.00 39.39  ? 76   ILE B CB    1 
ATOM   4337  C  CG1   . ILE B  1 76  ? -64.260  20.901  -92.505  1.00 44.10  ? 76   ILE B CG1   1 
ATOM   4338  C  CG2   . ILE B  1 76  ? -63.165  19.900  -90.486  1.00 46.03  ? 76   ILE B CG2   1 
ATOM   4339  C  CD1   . ILE B  1 76  ? -65.474  19.995  -92.472  1.00 55.34  ? 76   ILE B CD1   1 
ATOM   4340  N  N     . ASP B  1 77  ? -64.661  20.838  -88.016  1.00 38.62  ? 77   ASP B N     1 
ATOM   4341  C  CA    . ASP B  1 77  ? -64.159  20.712  -86.653  1.00 33.64  ? 77   ASP B CA    1 
ATOM   4342  C  C     . ASP B  1 77  ? -62.881  19.884  -86.779  1.00 30.31  ? 77   ASP B C     1 
ATOM   4343  O  O     . ASP B  1 77  ? -62.900  18.746  -87.242  1.00 41.54  ? 77   ASP B O     1 
ATOM   4344  C  CB    . ASP B  1 77  ? -65.141  20.028  -85.737  1.00 15.10  ? 77   ASP B CB    1 
ATOM   4345  C  CG    . ASP B  1 77  ? -64.677  20.056  -84.313  1.00 40.32  ? 77   ASP B CG    1 
ATOM   4346  O  OD1   . ASP B  1 77  ? -65.295  20.774  -83.506  1.00 27.37  ? 77   ASP B OD1   1 
ATOM   4347  O  OD2   . ASP B  1 77  ? -63.663  19.396  -84.012  1.00 34.48  ? 77   ASP B OD2   1 
ATOM   4348  N  N     . PRO B  1 78  ? -61.768  20.422  -86.280  1.00 31.96  ? 78   PRO B N     1 
ATOM   4349  C  CA    . PRO B  1 78  ? -60.484  19.743  -86.371  1.00 33.00  ? 78   PRO B CA    1 
ATOM   4350  C  C     . PRO B  1 78  ? -60.162  18.760  -85.282  1.00 38.50  ? 78   PRO B C     1 
ATOM   4351  O  O     . PRO B  1 78  ? -59.109  18.143  -85.316  1.00 34.27  ? 78   PRO B O     1 
ATOM   4352  C  CB    . PRO B  1 78  ? -59.523  20.917  -86.353  1.00 31.81  ? 78   PRO B CB    1 
ATOM   4353  C  CG    . PRO B  1 78  ? -60.137  21.789  -85.285  1.00 28.54  ? 78   PRO B CG    1 
ATOM   4354  C  CD    . PRO B  1 78  ? -61.644  21.665  -85.494  1.00 22.70  ? 78   PRO B CD    1 
ATOM   4355  N  N     . PHE B  1 79  ? -61.056  18.623  -84.316  1.00 34.04  ? 79   PHE B N     1 
ATOM   4356  C  CA    . PHE B  1 79  ? -60.839  17.722  -83.191  1.00 33.84  ? 79   PHE B CA    1 
ATOM   4357  C  C     . PHE B  1 79  ? -61.683  16.446  -83.256  1.00 38.92  ? 79   PHE B C     1 
ATOM   4358  O  O     . PHE B  1 79  ? -61.260  15.379  -82.809  1.00 52.72  ? 79   PHE B O     1 
ATOM   4359  C  CB    . PHE B  1 79  ? -61.148  18.447  -81.879  1.00 36.37  ? 79   PHE B CB    1 
ATOM   4360  C  CG    . PHE B  1 79  ? -60.428  19.749  -81.712  1.00 43.25  ? 79   PHE B CG    1 
ATOM   4361  C  CD1   . PHE B  1 79  ? -59.051  19.780  -81.565  1.00 40.97  ? 79   PHE B CD1   1 
ATOM   4362  C  CD2   . PHE B  1 79  ? -61.134  20.945  -81.665  1.00 38.17  ? 79   PHE B CD2   1 
ATOM   4363  C  CE1   . PHE B  1 79  ? -58.382  20.992  -81.366  1.00 54.80  ? 79   PHE B CE1   1 
ATOM   4364  C  CE2   . PHE B  1 79  ? -60.481  22.152  -81.469  1.00 61.29  ? 79   PHE B CE2   1 
ATOM   4365  C  CZ    . PHE B  1 79  ? -59.100  22.179  -81.317  1.00 58.71  ? 79   PHE B CZ    1 
ATOM   4366  N  N     . PHE B  1 80  ? -62.897  16.576  -83.771  1.00 36.31  ? 80   PHE B N     1 
ATOM   4367  C  CA    . PHE B  1 80  ? -63.814  15.452  -83.872  1.00 34.22  ? 80   PHE B CA    1 
ATOM   4368  C  C     . PHE B  1 80  ? -63.274  14.342  -84.759  1.00 35.69  ? 80   PHE B C     1 
ATOM   4369  O  O     . PHE B  1 80  ? -62.671  14.606  -85.812  1.00 59.30  ? 80   PHE B O     1 
ATOM   4370  C  CB    . PHE B  1 80  ? -65.172  15.920  -84.393  1.00 43.66  ? 80   PHE B CB    1 
ATOM   4371  C  CG    . PHE B  1 80  ? -65.921  16.794  -83.431  1.00 40.32  ? 80   PHE B CG    1 
ATOM   4372  C  CD1   . PHE B  1 80  ? -67.090  17.425  -83.820  1.00 36.84  ? 80   PHE B CD1   1 
ATOM   4373  C  CD2   . PHE B  1 80  ? -65.439  17.011  -82.149  1.00 47.84  ? 80   PHE B CD2   1 
ATOM   4374  C  CE1   . PHE B  1 80  ? -67.765  18.262  -82.955  1.00 37.67  ? 80   PHE B CE1   1 
ATOM   4375  C  CE2   . PHE B  1 80  ? -66.104  17.845  -81.278  1.00 54.28  ? 80   PHE B CE2   1 
ATOM   4376  C  CZ    . PHE B  1 80  ? -67.272  18.474  -81.683  1.00 34.13  ? 80   PHE B CZ    1 
ATOM   4377  N  N     . ALA B  1 81  ? -63.558  13.108  -84.346  1.00 25.40  ? 81   ALA B N     1 
ATOM   4378  C  CA    . ALA B  1 81  ? -63.088  11.919  -85.042  1.00 28.52  ? 81   ALA B CA    1 
ATOM   4379  C  C     . ALA B  1 81  ? -63.720  11.682  -86.387  1.00 32.74  ? 81   ALA B C     1 
ATOM   4380  O  O     . ALA B  1 81  ? -63.041  11.313  -87.339  1.00 50.97  ? 81   ALA B O     1 
ATOM   4381  C  CB    . ALA B  1 81  ? -63.276  10.709  -84.175  1.00 19.55  ? 81   ALA B CB    1 
ATOM   4382  N  N     . ASP B  1 82  ? -65.031  11.858  -86.461  1.00 45.35  ? 82   ASP B N     1 
ATOM   4383  C  CA    . ASP B  1 82  ? -65.730  11.644  -87.718  1.00 50.06  ? 82   ASP B CA    1 
ATOM   4384  C  C     . ASP B  1 82  ? -65.841  13.025  -88.347  1.00 46.64  ? 82   ASP B C     1 
ATOM   4385  O  O     . ASP B  1 82  ? -66.062  14.001  -87.642  1.00 38.69  ? 82   ASP B O     1 
ATOM   4386  C  CB    . ASP B  1 82  ? -67.092  11.013  -87.435  1.00 38.39  ? 82   ASP B CB    1 
ATOM   4387  C  CG    . ASP B  1 82  ? -67.045  10.040  -86.258  1.00 52.22  ? 82   ASP B CG    1 
ATOM   4388  O  OD1   . ASP B  1 82  ? -66.900  8.813   -86.505  1.00 44.31  ? 82   ASP B OD1   1 
ATOM   4389  O  OD2   . ASP B  1 82  ? -67.115  10.516  -85.087  1.00 67.40  ? 82   ASP B OD2   1 
ATOM   4390  N  N     . SER B  1 83  ? -65.651  13.132  -89.657  1.00 51.36  ? 83   SER B N     1 
ATOM   4391  C  CA    . SER B  1 83  ? -65.662  14.420  -90.335  1.00 45.01  ? 83   SER B CA    1 
ATOM   4392  C  C     . SER B  1 83  ? -66.910  15.233  -90.056  1.00 38.56  ? 83   SER B C     1 
ATOM   4393  O  O     . SER B  1 83  ? -67.951  14.933  -90.630  1.00 56.39  ? 83   SER B O     1 
ATOM   4394  C  CB    . SER B  1 83  ? -65.497  14.232  -91.842  1.00 45.31  ? 83   SER B CB    1 
ATOM   4395  O  OG    . SER B  1 83  ? -64.959  15.406  -92.429  1.00 56.64  ? 83   SER B OG    1 
ATOM   4396  N  N     . THR B  1 84  ? -66.829  16.257  -89.209  1.00 35.12  ? 84   THR B N     1 
ATOM   4397  C  CA    . THR B  1 84  ? -68.047  17.042  -88.994  1.00 31.82  ? 84   THR B CA    1 
ATOM   4398  C  C     . THR B  1 84  ? -67.853  18.542  -89.286  1.00 43.63  ? 84   THR B C     1 
ATOM   4399  O  O     . THR B  1 84  ? -66.793  19.133  -89.043  1.00 42.60  ? 84   THR B O     1 
ATOM   4400  C  CB    . THR B  1 84  ? -68.582  16.871  -87.575  1.00 38.88  ? 84   THR B CB    1 
ATOM   4401  O  OG1   . THR B  1 84  ? -68.592  18.153  -86.934  1.00 43.51  ? 84   THR B OG1   1 
ATOM   4402  C  CG2   . THR B  1 84  ? -67.703  15.919  -86.778  1.00 15.94  ? 84   THR B CG2   1 
ATOM   4403  N  N     . LEU B  1 85  ? -68.950  19.131  -89.827  1.00 41.53  ? 85   LEU B N     1 
ATOM   4404  C  CA    . LEU B  1 85  ? -69.012  20.544  -90.163  1.00 36.49  ? 85   LEU B CA    1 
ATOM   4405  C  C     . LEU B  1 85  ? -69.761  21.339  -89.098  1.00 41.39  ? 85   LEU B C     1 
ATOM   4406  O  O     . LEU B  1 85  ? -70.856  20.965  -88.675  1.00 51.03  ? 85   LEU B O     1 
ATOM   4407  C  CB    . LEU B  1 85  ? -69.683  20.734  -91.516  1.00 41.32  ? 85   LEU B CB    1 
ATOM   4408  C  CG    . LEU B  1 85  ? -69.684  22.192  -91.966  1.00 45.06  ? 85   LEU B CG    1 
ATOM   4409  C  CD1   . LEU B  1 85  ? -68.269  22.658  -92.211  1.00 38.57  ? 85   LEU B CD1   1 
ATOM   4410  C  CD2   . LEU B  1 85  ? -70.492  22.330  -93.225  1.00 34.33  ? 85   LEU B CD2   1 
ATOM   4411  N  N     . ILE B  1 86  ? -69.152  22.435  -88.661  1.00 43.31  ? 86   ILE B N     1 
ATOM   4412  C  CA    . ILE B  1 86  ? -69.749  23.287  -87.640  1.00 36.64  ? 86   ILE B CA    1 
ATOM   4413  C  C     . ILE B  1 86  ? -70.473  24.433  -88.322  1.00 44.96  ? 86   ILE B C     1 
ATOM   4414  O  O     . ILE B  1 86  ? -70.029  24.945  -89.350  1.00 59.93  ? 86   ILE B O     1 
ATOM   4415  C  CB    . ILE B  1 86  ? -68.676  23.917  -86.722  1.00 38.09  ? 86   ILE B CB    1 
ATOM   4416  C  CG1   . ILE B  1 86  ? -67.782  22.838  -86.121  1.00 43.82  ? 86   ILE B CG1   1 
ATOM   4417  C  CG2   . ILE B  1 86  ? -69.337  24.727  -85.605  1.00 25.38  ? 86   ILE B CG2   1 
ATOM   4418  C  CD1   . ILE B  1 86  ? -66.468  23.371  -85.581  1.00 25.66  ? 86   ILE B CD1   1 
ATOM   4419  N  N     . ILE B  1 87  ? -71.604  24.821  -87.751  1.00 42.15  ? 87   ILE B N     1 
ATOM   4420  C  CA    . ILE B  1 87  ? -72.374  25.933  -88.270  1.00 34.55  ? 87   ILE B CA    1 
ATOM   4421  C  C     . ILE B  1 87  ? -72.969  26.682  -87.103  1.00 39.08  ? 87   ILE B C     1 
ATOM   4422  O  O     . ILE B  1 87  ? -73.707  26.130  -86.279  1.00 37.66  ? 87   ILE B O     1 
ATOM   4423  C  CB    . ILE B  1 87  ? -73.495  25.496  -89.206  1.00 38.96  ? 87   ILE B CB    1 
ATOM   4424  C  CG1   . ILE B  1 87  ? -72.904  24.853  -90.457  1.00 44.92  ? 87   ILE B CG1   1 
ATOM   4425  C  CG2   . ILE B  1 87  ? -74.310  26.705  -89.630  1.00 46.88  ? 87   ILE B CG2   1 
ATOM   4426  C  CD1   . ILE B  1 87  ? -73.939  24.236  -91.351  1.00 44.45  ? 87   ILE B CD1   1 
ATOM   4427  N  N     . ARG B  1 88  ? -72.567  27.938  -87.016  1.00 37.62  ? 88   ARG B N     1 
ATOM   4428  C  CA    . ARG B  1 88  ? -73.024  28.826  -85.978  1.00 29.13  ? 88   ARG B CA    1 
ATOM   4429  C  C     . ARG B  1 88  ? -74.476  29.152  -86.306  1.00 31.73  ? 88   ARG B C     1 
ATOM   4430  O  O     . ARG B  1 88  ? -74.850  29.331  -87.462  1.00 42.98  ? 88   ARG B O     1 
ATOM   4431  C  CB    . ARG B  1 88  ? -72.137  30.066  -85.994  1.00 22.83  ? 88   ARG B CB    1 
ATOM   4432  C  CG    . ARG B  1 88  ? -72.368  31.019  -84.880  1.00 39.05  ? 88   ARG B CG    1 
ATOM   4433  C  CD    . ARG B  1 88  ? -71.054  31.505  -84.351  1.00 27.23  ? 88   ARG B CD    1 
ATOM   4434  N  NE    . ARG B  1 88  ? -70.824  30.887  -83.055  1.00 54.32  ? 88   ARG B NE    1 
ATOM   4435  C  CZ    . ARG B  1 88  ? -69.810  30.068  -82.789  1.00 59.30  ? 88   ARG B CZ    1 
ATOM   4436  N  NH1   . ARG B  1 88  ? -69.698  29.551  -81.577  1.00 50.38  ? 88   ARG B NH1   1 
ATOM   4437  N  NH2   . ARG B  1 88  ? -68.887  29.793  -83.714  1.00 34.98  ? 88   ARG B NH2   1 
ATOM   4438  N  N     . CYS B  1 89  ? -75.309  29.173  -85.288  1.00 35.79  ? 89   CYS B N     1 
ATOM   4439  C  CA    . CYS B  1 89  ? -76.712  29.450  -85.498  1.00 40.14  ? 89   CYS B CA    1 
ATOM   4440  C  C     . CYS B  1 89  ? -77.132  30.656  -84.701  1.00 46.51  ? 89   CYS B C     1 
ATOM   4441  O  O     . CYS B  1 89  ? -76.432  31.070  -83.767  1.00 47.35  ? 89   CYS B O     1 
ATOM   4442  C  CB    . CYS B  1 89  ? -77.561  28.254  -85.043  1.00 26.42  ? 89   CYS B CB    1 
ATOM   4443  S  SG    . CYS B  1 89  ? -77.362  26.776  -86.021  1.00 53.10  ? 89   CYS B SG    1 
ATOM   4444  N  N     . ASP B  1 90  ? -78.287  31.201  -85.083  1.00 48.28  ? 90   ASP B N     1 
ATOM   4445  C  CA    . ASP B  1 90  ? -78.912  32.335  -84.405  1.00 38.67  ? 90   ASP B CA    1 
ATOM   4446  C  C     . ASP B  1 90  ? -80.167  31.749  -83.793  1.00 43.31  ? 90   ASP B C     1 
ATOM   4447  O  O     . ASP B  1 90  ? -80.780  30.828  -84.355  1.00 34.64  ? 90   ASP B O     1 
ATOM   4448  C  CB    . ASP B  1 90  ? -79.390  33.410  -85.388  1.00 59.44  ? 90   ASP B CB    1 
ATOM   4449  C  CG    . ASP B  1 90  ? -78.267  34.130  -86.077  1.00 64.27  ? 90   ASP B CG    1 
ATOM   4450  O  OD1   . ASP B  1 90  ? -77.607  34.959  -85.416  1.00 43.99  ? 90   ASP B OD1   1 
ATOM   4451  O  OD2   . ASP B  1 90  ? -78.081  33.887  -87.292  1.00 80.65  ? 90   ASP B OD2   1 
ATOM   4452  N  N     . ILE B  1 91  ? -80.571  32.300  -82.661  1.00 42.70  ? 91   ILE B N     1 
ATOM   4453  C  CA    . ILE B  1 91  ? -81.783  31.844  -82.017  1.00 46.25  ? 91   ILE B CA    1 
ATOM   4454  C  C     . ILE B  1 91  ? -82.904  32.794  -82.400  1.00 56.92  ? 91   ILE B C     1 
ATOM   4455  O  O     . ILE B  1 91  ? -82.895  33.978  -82.045  1.00 69.26  ? 91   ILE B O     1 
ATOM   4456  C  CB    . ILE B  1 91  ? -81.631  31.800  -80.505  1.00 44.23  ? 91   ILE B CB    1 
ATOM   4457  C  CG1   . ILE B  1 91  ? -80.474  30.875  -80.138  1.00 49.80  ? 91   ILE B CG1   1 
ATOM   4458  C  CG2   . ILE B  1 91  ? -82.906  31.290  -79.875  1.00 35.82  ? 91   ILE B CG2   1 
ATOM   4459  C  CD1   . ILE B  1 91  ? -80.625  29.468  -80.695  1.00 55.22  ? 91   ILE B CD1   1 
ATOM   4460  N  N     . LEU B  1 92  ? -83.839  32.270  -83.180  1.00 66.99  ? 92   LEU B N     1 
ATOM   4461  C  CA    . LEU B  1 92  ? -84.976  33.041  -83.647  1.00 64.15  ? 92   LEU B CA    1 
ATOM   4462  C  C     . LEU B  1 92  ? -86.227  32.643  -82.905  1.00 70.10  ? 92   LEU B C     1 
ATOM   4463  O  O     . LEU B  1 92  ? -86.318  31.527  -82.380  1.00 57.13  ? 92   LEU B O     1 
ATOM   4464  C  CB    . LEU B  1 92  ? -85.200  32.794  -85.136  1.00 48.38  ? 92   LEU B CB    1 
ATOM   4465  C  CG    . LEU B  1 92  ? -83.999  33.019  -86.055  1.00 66.25  ? 92   LEU B CG    1 
ATOM   4466  C  CD1   . LEU B  1 92  ? -84.480  32.897  -87.478  1.00 68.69  ? 92   LEU B CD1   1 
ATOM   4467  C  CD2   . LEU B  1 92  ? -83.337  34.378  -85.826  1.00 36.07  ? 92   LEU B CD2   1 
ATOM   4468  N  N     . GLU B  1 93  ? -87.186  33.568  -82.874  1.00 90.51  ? 93   GLU B N     1 
ATOM   4469  C  CA    . GLU B  1 93  ? -88.477  33.344  -82.230  1.00 82.53  ? 93   GLU B CA    1 
ATOM   4470  C  C     . GLU B  1 93  ? -89.320  32.481  -83.202  1.00 79.32  ? 93   GLU B C     1 
ATOM   4471  O  O     . GLU B  1 93  ? -89.360  32.747  -84.412  1.00 74.36  ? 93   GLU B O     1 
ATOM   4472  C  CB    . GLU B  1 93  ? -89.145  34.696  -81.954  1.00 66.69  ? 93   GLU B CB    1 
ATOM   4473  C  CG    . GLU B  1 93  ? -90.327  34.625  -80.999  0.53 72.98  ? 93   GLU B CG    1 
ATOM   4474  C  CD    . GLU B  1 93  ? -89.911  34.303  -79.574  0.53 60.19  ? 93   GLU B CD    1 
ATOM   4475  O  OE1   . GLU B  1 93  ? -89.153  35.114  -78.997  0.53 45.60  ? 93   GLU B OE1   1 
ATOM   4476  O  OE2   . GLU B  1 93  ? -90.348  33.253  -79.036  0.53 47.60  ? 93   GLU B OE2   1 
ATOM   4477  N  N     . PRO B  1 94  ? -89.995  31.434  -82.689  1.00 78.46  ? 94   PRO B N     1 
ATOM   4478  C  CA    . PRO B  1 94  ? -90.796  30.582  -83.579  1.00 72.96  ? 94   PRO B CA    1 
ATOM   4479  C  C     . PRO B  1 94  ? -91.917  31.334  -84.317  1.00 89.07  ? 94   PRO B C     1 
ATOM   4480  O  O     . PRO B  1 94  ? -92.617  32.181  -83.732  1.00 93.67  ? 94   PRO B O     1 
ATOM   4481  C  CB    . PRO B  1 94  ? -91.310  29.494  -82.629  1.00 63.81  ? 94   PRO B CB    1 
ATOM   4482  C  CG    . PRO B  1 94  ? -91.425  30.224  -81.302  1.00 92.26  ? 94   PRO B CG    1 
ATOM   4483  C  CD    . PRO B  1 94  ? -90.167  31.046  -81.273  1.00 79.25  ? 94   PRO B CD    1 
ATOM   4484  N  N     . GLY B  1 95  ? -92.042  31.060  -85.617  1.00 83.00  ? 95   GLY B N     1 
ATOM   4485  C  CA    . GLY B  1 95  ? -93.061  31.716  -86.421  1.00 78.35  ? 95   GLY B CA    1 
ATOM   4486  C  C     . GLY B  1 95  ? -92.653  33.119  -86.841  1.00 83.77  ? 95   GLY B C     1 
ATOM   4487  O  O     . GLY B  1 95  ? -92.416  33.371  -88.029  1.00 73.99  ? 95   GLY B O     1 
ATOM   4488  N  N     . THR B  1 96  ? -92.566  34.028  -85.867  1.00 82.46  ? 96   THR B N     1 
ATOM   4489  C  CA    . THR B  1 96  ? -92.167  35.419  -86.116  1.00 81.49  ? 96   THR B CA    1 
ATOM   4490  C  C     . THR B  1 96  ? -90.832  35.424  -86.877  1.00 81.85  ? 96   THR B C     1 
ATOM   4491  O  O     . THR B  1 96  ? -90.668  36.120  -87.889  1.00 62.36  ? 96   THR B O     1 
ATOM   4492  C  CB    . THR B  1 96  ? -92.022  36.221  -84.779  1.00 87.57  ? 96   THR B CB    1 
ATOM   4493  O  OG1   . THR B  1 96  ? -90.644  36.295  -84.395  0.70 79.95  ? 96   THR B OG1   1 
ATOM   4494  C  CG2   . THR B  1 96  ? -92.817  35.547  -83.646  0.70 79.18  ? 96   THR B CG2   1 
ATOM   4495  N  N     . LEU B  1 97  ? -89.889  34.638  -86.360  1.00 77.51  ? 97   LEU B N     1 
ATOM   4496  C  CA    . LEU B  1 97  ? -88.569  34.456  -86.952  1.00 67.81  ? 97   LEU B CA    1 
ATOM   4497  C  C     . LEU B  1 97  ? -87.633  35.658  -87.103  1.00 79.35  ? 97   LEU B C     1 
ATOM   4498  O  O     . LEU B  1 97  ? -86.778  35.649  -88.000  1.00 75.20  ? 97   LEU B O     1 
ATOM   4499  C  CB    . LEU B  1 97  ? -88.711  33.749  -88.311  1.00 55.36  ? 97   LEU B CB    1 
ATOM   4500  C  CG    . LEU B  1 97  ? -88.506  32.230  -88.379  1.00 73.10  ? 97   LEU B CG    1 
ATOM   4501  C  CD1   . LEU B  1 97  ? -89.412  31.489  -87.393  1.00 79.79  ? 97   LEU B CD1   1 
ATOM   4502  C  CD2   . LEU B  1 97  ? -88.742  31.753  -89.813  1.00 70.36  ? 97   LEU B CD2   1 
ATOM   4503  N  N     . GLN B  1 98  ? -87.737  36.678  -86.256  1.00 80.51  ? 98   GLN B N     1 
ATOM   4504  C  CA    . GLN B  1 98  ? -86.811  37.794  -86.452  1.00 100.00 ? 98   GLN B CA    1 
ATOM   4505  C  C     . GLN B  1 98  ? -85.669  37.914  -85.433  1.00 100.00 ? 98   GLN B C     1 
ATOM   4506  O  O     . GLN B  1 98  ? -84.787  38.776  -85.580  1.00 100.00 ? 98   GLN B O     1 
ATOM   4507  C  CB    . GLN B  1 98  ? -87.524  39.142  -86.756  1.00 87.42  ? 98   GLN B CB    1 
ATOM   4508  C  CG    . GLN B  1 98  ? -88.016  39.938  -85.566  0.62 72.06  ? 98   GLN B CG    1 
ATOM   4509  C  CD    . GLN B  1 98  ? -89.021  39.164  -84.747  0.62 88.21  ? 98   GLN B CD    1 
ATOM   4510  O  OE1   . GLN B  1 98  ? -90.189  39.030  -85.141  0.62 80.82  ? 98   GLN B OE1   1 
ATOM   4511  N  NE2   . GLN B  1 98  ? -88.570  38.614  -83.614  0.62 82.53  ? 98   GLN B NE2   1 
ATOM   4512  N  N     . GLY B  1 99  ? -85.651  37.042  -84.423  1.00 70.08  ? 99   GLY B N     1 
ATOM   4513  C  CA    . GLY B  1 99  ? -84.537  37.101  -83.493  1.00 66.20  ? 99   GLY B CA    1 
ATOM   4514  C  C     . GLY B  1 99  ? -84.841  37.263  -82.034  1.00 53.62  ? 99   GLY B C     1 
ATOM   4515  O  O     . GLY B  1 99  ? -85.220  38.341  -81.595  1.00 64.94  ? 99   GLY B O     1 
ATOM   4516  N  N     . TYR B  1 100 ? -84.536  36.215  -81.277  1.00 49.20  ? 100  TYR B N     1 
ATOM   4517  C  CA    . TYR B  1 100 ? -84.767  36.162  -79.836  1.00 41.88  ? 100  TYR B CA    1 
ATOM   4518  C  C     . TYR B  1 100 ? -84.139  37.304  -79.029  1.00 53.18  ? 100  TYR B C     1 
ATOM   4519  O  O     . TYR B  1 100 ? -82.955  37.640  -79.159  1.00 46.88  ? 100  TYR B O     1 
ATOM   4520  C  CB    . TYR B  1 100 ? -84.315  34.805  -79.283  1.00 60.93  ? 100  TYR B CB    1 
ATOM   4521  C  CG    . TYR B  1 100 ? -84.726  34.530  -77.848  1.00 72.03  ? 100  TYR B CG    1 
ATOM   4522  C  CD1   . TYR B  1 100 ? -85.926  35.021  -77.340  1.00 58.37  ? 100  TYR B CD1   1 
ATOM   4523  C  CD2   . TYR B  1 100 ? -83.922  33.758  -77.003  1.00 65.83  ? 100  TYR B CD2   1 
ATOM   4524  C  CE1   . TYR B  1 100 ? -86.321  34.750  -76.026  1.00 80.53  ? 100  TYR B CE1   1 
ATOM   4525  C  CE2   . TYR B  1 100 ? -84.312  33.481  -75.681  1.00 67.34  ? 100  TYR B CE2   1 
ATOM   4526  C  CZ    . TYR B  1 100 ? -85.516  33.981  -75.202  1.00 67.84  ? 100  TYR B CZ    1 
ATOM   4527  O  OH    . TYR B  1 100 ? -85.937  33.700  -73.911  1.00 78.44  ? 100  TYR B OH    1 
ATOM   4528  N  N     . ASP B  1 101 ? -84.968  37.866  -78.163  1.00 53.60  ? 101  ASP B N     1 
ATOM   4529  C  CA    . ASP B  1 101 ? -84.616  38.974  -77.297  1.00 59.73  ? 101  ASP B CA    1 
ATOM   4530  C  C     . ASP B  1 101 ? -83.403  38.713  -76.441  1.00 62.74  ? 101  ASP B C     1 
ATOM   4531  O  O     . ASP B  1 101 ? -82.689  39.647  -76.049  1.00 62.67  ? 101  ASP B O     1 
ATOM   4532  C  CB    . ASP B  1 101 ? -85.791  39.247  -76.369  1.00 86.12  ? 101  ASP B CB    1 
ATOM   4533  C  CG    . ASP B  1 101 ? -86.586  40.458  -76.772  1.00 90.95  ? 101  ASP B CG    1 
ATOM   4534  O  OD1   . ASP B  1 101 ? -87.159  41.064  -75.841  1.00 82.15  ? 101  ASP B OD1   1 
ATOM   4535  O  OD2   . ASP B  1 101 ? -86.633  40.802  -77.985  1.00 73.37  ? 101  ASP B OD2   1 
ATOM   4536  N  N     . ARG B  1 102 ? -83.244  37.445  -76.078  1.00 56.30  ? 102  ARG B N     1 
ATOM   4537  C  CA    . ARG B  1 102 ? -82.143  37.017  -75.241  1.00 39.42  ? 102  ARG B CA    1 
ATOM   4538  C  C     . ARG B  1 102 ? -80.968  36.367  -75.948  1.00 45.59  ? 102  ARG B C     1 
ATOM   4539  O  O     . ARG B  1 102 ? -79.946  36.096  -75.303  1.00 55.52  ? 102  ARG B O     1 
ATOM   4540  C  CB    . ARG B  1 102 ? -82.650  36.155  -74.098  1.00 34.09  ? 102  ARG B CB    1 
ATOM   4541  C  CG    . ARG B  1 102 ? -83.182  36.992  -72.955  1.00 58.63  ? 102  ARG B CG    1 
ATOM   4542  C  CD    . ARG B  1 102 ? -84.684  36.889  -72.828  1.00 63.31  ? 102  ARG B CD    1 
ATOM   4543  N  NE    . ARG B  1 102 ? -85.071  35.911  -71.814  1.00 68.14  ? 102  ARG B NE    1 
ATOM   4544  C  CZ    . ARG B  1 102 ? -86.061  36.091  -70.943  1.00 82.50  ? 102  ARG B CZ    1 
ATOM   4545  N  NH1   . ARG B  1 102 ? -86.346  35.150  -70.054  1.00 74.70  ? 102  ARG B NH1   1 
ATOM   4546  N  NH2   . ARG B  1 102 ? -86.774  37.215  -70.964  1.00 85.13  ? 102  ARG B NH2   1 
ATOM   4547  N  N     . ASP B  1 103 ? -81.100  36.129  -77.257  1.00 32.88  ? 103  ASP B N     1 
ATOM   4548  C  CA    . ASP B  1 103 ? -80.004  35.558  -78.042  1.00 35.80  ? 103  ASP B CA    1 
ATOM   4549  C  C     . ASP B  1 103 ? -78.923  36.637  -78.165  1.00 42.20  ? 103  ASP B C     1 
ATOM   4550  O  O     . ASP B  1 103 ? -79.054  37.577  -78.955  1.00 49.96  ? 103  ASP B O     1 
ATOM   4551  C  CB    . ASP B  1 103 ? -80.479  35.124  -79.433  1.00 25.89  ? 103  ASP B CB    1 
ATOM   4552  C  CG    . ASP B  1 103 ? -79.320  34.818  -80.380  1.00 55.47  ? 103  ASP B CG    1 
ATOM   4553  O  OD1   . ASP B  1 103 ? -78.182  34.606  -79.894  1.00 56.97  ? 103  ASP B OD1   1 
ATOM   4554  O  OD2   . ASP B  1 103 ? -79.545  34.807  -81.615  1.00 54.09  ? 103  ASP B OD2   1 
ATOM   4555  N  N     . PRO B  1 104 ? -77.806  36.463  -77.434  1.00 43.75  ? 104  PRO B N     1 
ATOM   4556  C  CA    . PRO B  1 104 ? -76.673  37.387  -77.406  1.00 31.67  ? 104  PRO B CA    1 
ATOM   4557  C  C     . PRO B  1 104 ? -76.162  37.699  -78.786  1.00 36.06  ? 104  PRO B C     1 
ATOM   4558  O  O     . PRO B  1 104 ? -75.743  38.816  -79.051  1.00 48.38  ? 104  PRO B O     1 
ATOM   4559  C  CB    . PRO B  1 104 ? -75.632  36.624  -76.604  1.00 35.12  ? 104  PRO B CB    1 
ATOM   4560  C  CG    . PRO B  1 104 ? -76.458  35.784  -75.703  1.00 53.09  ? 104  PRO B CG    1 
ATOM   4561  C  CD    . PRO B  1 104 ? -77.474  35.251  -76.673  1.00 50.08  ? 104  PRO B CD    1 
ATOM   4562  N  N     . ARG B  1 105 ? -76.219  36.726  -79.680  1.00 30.09  ? 105  ARG B N     1 
ATOM   4563  C  CA    . ARG B  1 105 ? -75.740  36.985  -81.020  1.00 40.85  ? 105  ARG B CA    1 
ATOM   4564  C  C     . ARG B  1 105 ? -76.684  37.928  -81.740  1.00 51.64  ? 105  ARG B C     1 
ATOM   4565  O  O     . ARG B  1 105 ? -76.239  38.781  -82.513  1.00 54.05  ? 105  ARG B O     1 
ATOM   4566  C  CB    . ARG B  1 105 ? -75.588  35.702  -81.819  1.00 41.95  ? 105  ARG B CB    1 
ATOM   4567  C  CG    . ARG B  1 105 ? -74.640  35.873  -82.995  1.00 53.34  ? 105  ARG B CG    1 
ATOM   4568  C  CD    . ARG B  1 105 ? -74.579  34.634  -83.855  1.00 42.87  ? 105  ARG B CD    1 
ATOM   4569  N  NE    . ARG B  1 105 ? -73.474  34.663  -84.813  1.00 39.45  ? 105  ARG B NE    1 
ATOM   4570  C  CZ    . ARG B  1 105 ? -73.604  34.461  -86.125  1.00 57.59  ? 105  ARG B CZ    1 
ATOM   4571  N  NH1   . ARG B  1 105 ? -72.532  34.485  -86.901  1.00 47.21  ? 105  ARG B NH1   1 
ATOM   4572  N  NH2   . ARG B  1 105 ? -74.803  34.264  -86.669  1.00 42.52  ? 105  ARG B NH2   1 
ATOM   4573  N  N     . SER B  1 106 ? -77.987  37.771  -81.506  1.00 57.29  ? 106  SER B N     1 
ATOM   4574  C  CA    . SER B  1 106 ? -78.967  38.648  -82.144  1.00 59.63  ? 106  SER B CA    1 
ATOM   4575  C  C     . SER B  1 106 ? -78.742  40.065  -81.628  1.00 48.11  ? 106  SER B C     1 
ATOM   4576  O  O     . SER B  1 106 ? -78.640  41.014  -82.409  1.00 49.31  ? 106  SER B O     1 
ATOM   4577  C  CB    . SER B  1 106 ? -80.396  38.168  -81.885  1.00 45.68  ? 106  SER B CB    1 
ATOM   4578  O  OG    . SER B  1 106 ? -80.763  37.176  -82.840  1.00 68.25  ? 106  SER B OG    1 
ATOM   4579  N  N     . ILE B  1 107 ? -78.563  40.171  -80.315  1.00 27.75  ? 107  ILE B N     1 
ATOM   4580  C  CA    . ILE B  1 107 ? -78.301  41.446  -79.663  1.00 27.50  ? 107  ILE B CA    1 
ATOM   4581  C  C     . ILE B  1 107 ? -77.072  42.145  -80.239  1.00 32.84  ? 107  ILE B C     1 
ATOM   4582  O  O     . ILE B  1 107 ? -77.055  43.360  -80.399  1.00 48.29  ? 107  ILE B O     1 
ATOM   4583  C  CB    . ILE B  1 107 ? -78.066  41.245  -78.173  1.00 33.62  ? 107  ILE B CB    1 
ATOM   4584  C  CG1   . ILE B  1 107 ? -79.288  40.558  -77.553  1.00 45.40  ? 107  ILE B CG1   1 
ATOM   4585  C  CG2   . ILE B  1 107 ? -77.673  42.589  -77.501  1.00 24.08  ? 107  ILE B CG2   1 
ATOM   4586  C  CD1   . ILE B  1 107 ? -79.208  40.394  -76.052  1.00 48.11  ? 107  ILE B CD1   1 
ATOM   4587  N  N     . ALA B  1 108 ? -76.038  41.374  -80.534  1.00 36.59  ? 108  ALA B N     1 
ATOM   4588  C  CA    . ALA B  1 108 ? -74.821  41.946  -81.081  1.00 48.96  ? 108  ALA B CA    1 
ATOM   4589  C  C     . ALA B  1 108 ? -75.094  42.480  -82.463  1.00 52.07  ? 108  ALA B C     1 
ATOM   4590  O  O     . ALA B  1 108 ? -74.601  43.546  -82.822  1.00 61.62  ? 108  ALA B O     1 
ATOM   4591  C  CB    . ALA B  1 108 ? -73.724  40.917  -81.132  1.00 55.98  ? 108  ALA B CB    1 
ATOM   4592  N  N     . LYS B  1 109 ? -75.887  41.738  -83.234  1.00 46.48  ? 109  LYS B N     1 
ATOM   4593  C  CA    . LYS B  1 109 ? -76.231  42.142  -84.594  1.00 52.90  ? 109  LYS B CA    1 
ATOM   4594  C  C     . LYS B  1 109 ? -77.097  43.391  -84.549  1.00 56.09  ? 109  LYS B C     1 
ATOM   4595  O  O     . LYS B  1 109 ? -76.864  44.325  -85.313  1.00 51.34  ? 109  LYS B O     1 
ATOM   4596  C  CB    . LYS B  1 109 ? -76.952  41.018  -85.328  1.00 48.58  ? 109  LYS B CB    1 
ATOM   4597  C  CG    . LYS B  1 109 ? -76.045  39.880  -85.777  0.90 45.49  ? 109  LYS B CG    1 
ATOM   4598  C  CD    . LYS B  1 109 ? -76.866  38.667  -86.243  0.90 43.59  ? 109  LYS B CD    1 
ATOM   4599  C  CE    . LYS B  1 109 ? -76.167  37.906  -87.373  0.90 24.65  ? 109  LYS B CE    1 
ATOM   4600  N  NZ    . LYS B  1 109 ? -76.981  36.757  -87.840  0.90 41.90  ? 109  LYS B NZ    1 
ATOM   4601  N  N     . ARG B  1 110 ? -78.061  43.409  -83.624  1.00 47.86  ? 110  ARG B N     1 
ATOM   4602  C  CA    . ARG B  1 110 ? -78.951  44.550  -83.442  1.00 53.90  ? 110  ARG B CA    1 
ATOM   4603  C  C     . ARG B  1 110 ? -78.105  45.804  -83.246  1.00 52.94  ? 110  ARG B C     1 
ATOM   4604  O  O     . ARG B  1 110 ? -78.332  46.828  -83.888  1.00 75.92  ? 110  ARG B O     1 
ATOM   4605  C  CB    . ARG B  1 110 ? -79.833  44.368  -82.204  1.00 50.89  ? 110  ARG B CB    1 
ATOM   4606  C  CG    . ARG B  1 110 ? -80.955  43.364  -82.337  1.00 43.92  ? 110  ARG B CG    1 
ATOM   4607  C  CD    . ARG B  1 110 ? -81.821  43.380  -81.063  1.00 48.34  ? 110  ARG B CD    1 
ATOM   4608  N  NE    . ARG B  1 110 ? -82.874  42.358  -81.089  1.00 49.73  ? 110  ARG B NE    1 
ATOM   4609  C  CZ    . ARG B  1 110 ? -83.572  41.962  -80.026  1.00 58.19  ? 110  ARG B CZ    1 
ATOM   4610  N  NH1   . ARG B  1 110 ? -84.508  41.026  -80.161  1.00 53.36  ? 110  ARG B NH1   1 
ATOM   4611  N  NH2   . ARG B  1 110 ? -83.331  42.486  -78.826  1.00 76.21  ? 110  ARG B NH2   1 
ATOM   4612  N  N     . ALA B  1 111 ? -77.143  45.717  -82.337  1.00 40.32  ? 111  ALA B N     1 
ATOM   4613  C  CA    . ALA B  1 111 ? -76.249  46.828  -82.057  1.00 51.50  ? 111  ALA B CA    1 
ATOM   4614  C  C     . ALA B  1 111 ? -75.461  47.269  -83.304  1.00 45.98  ? 111  ALA B C     1 
ATOM   4615  O  O     . ALA B  1 111 ? -75.210  48.449  -83.483  1.00 61.42  ? 111  ALA B O     1 
ATOM   4616  C  CB    . ALA B  1 111 ? -75.302  46.456  -80.935  1.00 38.05  ? 111  ALA B CB    1 
ATOM   4617  N  N     . GLU B  1 112 ? -75.056  46.326  -84.151  1.00 45.88  ? 112  GLU B N     1 
ATOM   4618  C  CA    . GLU B  1 112 ? -74.315  46.673  -85.366  1.00 54.47  ? 112  GLU B CA    1 
ATOM   4619  C  C     . GLU B  1 112 ? -75.233  47.391  -86.363  1.00 68.63  ? 112  GLU B C     1 
ATOM   4620  O  O     . GLU B  1 112 ? -74.789  48.270  -87.102  1.00 63.19  ? 112  GLU B O     1 
ATOM   4621  C  CB    . GLU B  1 112 ? -73.686  45.427  -86.028  1.00 61.22  ? 112  GLU B CB    1 
ATOM   4622  C  CG    . GLU B  1 112 ? -72.432  44.877  -85.326  1.00 68.58  ? 112  GLU B CG    1 
ATOM   4623  C  CD    . GLU B  1 112 ? -71.297  44.481  -86.294  1.00 86.87  ? 112  GLU B CD    1 
ATOM   4624  O  OE1   . GLU B  1 112 ? -70.511  45.377  -86.717  1.00 79.80  ? 112  GLU B OE1   1 
ATOM   4625  O  OE2   . GLU B  1 112 ? -71.175  43.267  -86.602  1.00 55.55  ? 112  GLU B OE2   1 
ATOM   4626  N  N     . ASP B  1 113 ? -76.509  47.000  -86.383  1.00 66.24  ? 113  ASP B N     1 
ATOM   4627  C  CA    . ASP B  1 113 ? -77.507  47.606  -87.266  1.00 58.62  ? 113  ASP B CA    1 
ATOM   4628  C  C     . ASP B  1 113 ? -77.706  49.067  -86.855  1.00 64.19  ? 113  ASP B C     1 
ATOM   4629  O  O     . ASP B  1 113 ? -77.589  49.984  -87.676  1.00 75.36  ? 113  ASP B O     1 
ATOM   4630  C  CB    . ASP B  1 113 ? -78.839  46.853  -87.160  1.00 54.93  ? 113  ASP B CB    1 
ATOM   4631  C  CG    . ASP B  1 113 ? -78.787  45.462  -87.790  1.00 83.77  ? 113  ASP B CG    1 
ATOM   4632  O  OD1   . ASP B  1 113 ? -78.011  45.269  -88.761  1.00 74.45  ? 113  ASP B OD1   1 
ATOM   4633  O  OD2   . ASP B  1 113 ? -79.536  44.565  -87.322  1.00 85.61  ? 113  ASP B OD2   1 
ATOM   4634  N  N     . TYR B  1 114 ? -77.974  49.254  -85.565  1.00 45.94  ? 114  TYR B N     1 
ATOM   4635  C  CA    . TYR B  1 114 ? -78.172  50.561  -84.955  1.00 45.28  ? 114  TYR B CA    1 
ATOM   4636  C  C     . TYR B  1 114 ? -76.987  51.500  -85.207  1.00 52.86  ? 114  TYR B C     1 
ATOM   4637  O  O     . TYR B  1 114 ? -77.137  52.713  -85.172  1.00 75.84  ? 114  TYR B O     1 
ATOM   4638  C  CB    . TYR B  1 114 ? -78.373  50.369  -83.457  1.00 33.88  ? 114  TYR B CB    1 
ATOM   4639  C  CG    . TYR B  1 114 ? -78.495  51.632  -82.637  0.73 40.19  ? 114  TYR B CG    1 
ATOM   4640  C  CD1   . TYR B  1 114 ? -77.366  52.348  -82.246  0.73 38.47  ? 114  TYR B CD1   1 
ATOM   4641  C  CD2   . TYR B  1 114 ? -79.739  52.077  -82.191  0.73 42.77  ? 114  TYR B CD2   1 
ATOM   4642  C  CE1   . TYR B  1 114 ? -77.476  53.475  -81.426  0.73 47.26  ? 114  TYR B CE1   1 
ATOM   4643  C  CE2   . TYR B  1 114 ? -79.858  53.199  -81.369  0.73 31.00  ? 114  TYR B CE2   1 
ATOM   4644  C  CZ    . TYR B  1 114 ? -78.726  53.890  -80.992  0.73 51.99  ? 114  TYR B CZ    1 
ATOM   4645  O  OH    . TYR B  1 114 ? -78.835  54.990  -80.174  0.73 66.59  ? 114  TYR B OH    1 
ATOM   4646  N  N     . LEU B  1 115 ? -75.809  50.948  -85.450  1.00 48.34  ? 115  LEU B N     1 
ATOM   4647  C  CA    . LEU B  1 115 ? -74.649  51.784  -85.702  1.00 50.56  ? 115  LEU B CA    1 
ATOM   4648  C  C     . LEU B  1 115 ? -74.830  52.427  -87.073  1.00 58.74  ? 115  LEU B C     1 
ATOM   4649  O  O     . LEU B  1 115 ? -74.697  53.646  -87.211  1.00 62.65  ? 115  LEU B O     1 
ATOM   4650  C  CB    . LEU B  1 115 ? -73.370  50.942  -85.665  1.00 48.83  ? 115  LEU B CB    1 
ATOM   4651  C  CG    . LEU B  1 115 ? -71.989  51.584  -85.440  1.00 50.41  ? 115  LEU B CG    1 
ATOM   4652  C  CD1   . LEU B  1 115 ? -71.124  51.419  -86.677  1.00 53.07  ? 115  LEU B CD1   1 
ATOM   4653  C  CD2   . LEU B  1 115 ? -72.085  53.040  -85.014  1.00 41.61  ? 115  LEU B CD2   1 
ATOM   4654  N  N     . ARG B  1 116 ? -75.151  51.609  -88.075  1.00 57.12  ? 116  ARG B N     1 
ATOM   4655  C  CA    . ARG B  1 116 ? -75.360  52.108  -89.432  1.00 79.87  ? 116  ARG B CA    1 
ATOM   4656  C  C     . ARG B  1 116 ? -76.607  52.977  -89.499  1.00 82.70  ? 116  ARG B C     1 
ATOM   4657  O  O     . ARG B  1 116 ? -76.664  53.944  -90.263  1.00 92.27  ? 116  ARG B O     1 
ATOM   4658  C  CB    . ARG B  1 116 ? -75.468  50.956  -90.430  1.00 68.10  ? 116  ARG B CB    1 
ATOM   4659  C  CG    . ARG B  1 116 ? -74.128  50.505  -91.001  0.62 59.83  ? 116  ARG B CG    1 
ATOM   4660  C  CD    . ARG B  1 116 ? -74.312  49.394  -92.025  0.62 58.07  ? 116  ARG B CD    1 
ATOM   4661  N  NE    . ARG B  1 116 ? -75.103  48.308  -91.452  0.62 63.29  ? 116  ARG B NE    1 
ATOM   4662  C  CZ    . ARG B  1 116 ? -74.594  47.261  -90.810  0.62 67.16  ? 116  ARG B CZ    1 
ATOM   4663  N  NH1   . ARG B  1 116 ? -75.405  46.336  -90.307  0.62 69.71  ? 116  ARG B NH1   1 
ATOM   4664  N  NH2   . ARG B  1 116 ? -73.276  47.115  -90.710  0.62 67.47  ? 116  ARG B NH2   1 
ATOM   4665  N  N     . ALA B  1 117 ? -77.589  52.639  -88.670  1.00 71.67  ? 117  ALA B N     1 
ATOM   4666  C  CA    . ALA B  1 117 ? -78.835  53.383  -88.596  1.00 78.38  ? 117  ALA B CA    1 
ATOM   4667  C  C     . ALA B  1 117 ? -78.619  54.826  -88.115  1.00 76.34  ? 117  ALA B C     1 
ATOM   4668  O  O     . ALA B  1 117 ? -79.159  55.756  -88.705  1.00 100.00 ? 117  ALA B O     1 
ATOM   4669  C  CB    . ALA B  1 117 ? -79.832  52.662  -87.696  1.00 81.59  ? 117  ALA B CB    1 
ATOM   4670  N  N     . THR B  1 118 ? -77.845  55.024  -87.052  1.00 63.94  ? 118  THR B N     1 
ATOM   4671  C  CA    . THR B  1 118 ? -77.587  56.385  -86.566  1.00 74.67  ? 118  THR B CA    1 
ATOM   4672  C  C     . THR B  1 118 ? -76.667  57.111  -87.533  1.00 69.19  ? 118  THR B C     1 
ATOM   4673  O  O     . THR B  1 118 ? -76.253  58.241  -87.271  1.00 69.88  ? 118  THR B O     1 
ATOM   4674  C  CB    . THR B  1 118 ? -76.869  56.417  -85.200  1.00 87.31  ? 118  THR B CB    1 
ATOM   4675  O  OG1   . THR B  1 118 ? -75.549  55.870  -85.340  1.00 65.46  ? 118  THR B OG1   1 
ATOM   4676  C  CG2   . THR B  1 118 ? -77.659  55.656  -84.150  1.00 83.58  ? 118  THR B CG2   1 
ATOM   4677  N  N     . GLY B  1 119 ? -76.266  56.409  -88.591  1.00 66.99  ? 119  GLY B N     1 
ATOM   4678  C  CA    . GLY B  1 119 ? -75.382  56.978  -89.591  1.00 69.88  ? 119  GLY B CA    1 
ATOM   4679  C  C     . GLY B  1 119 ? -74.033  57.439  -89.065  1.00 72.06  ? 119  GLY B C     1 
ATOM   4680  O  O     . GLY B  1 119 ? -73.229  57.966  -89.840  1.00 68.57  ? 119  GLY B O     1 
ATOM   4681  N  N     . ILE B  1 120 ? -73.782  57.243  -87.764  1.00 62.59  ? 120  ILE B N     1 
ATOM   4682  C  CA    . ILE B  1 120 ? -72.517  57.637  -87.141  1.00 53.47  ? 120  ILE B CA    1 
ATOM   4683  C  C     . ILE B  1 120 ? -71.316  56.973  -87.812  1.00 59.57  ? 120  ILE B C     1 
ATOM   4684  O  O     . ILE B  1 120 ? -70.283  57.613  -88.011  1.00 62.26  ? 120  ILE B O     1 
ATOM   4685  C  CB    . ILE B  1 120 ? -72.485  57.305  -85.652  1.00 40.73  ? 120  ILE B CB    1 
ATOM   4686  C  CG1   . ILE B  1 120 ? -73.628  58.010  -84.931  1.00 47.61  ? 120  ILE B CG1   1 
ATOM   4687  C  CG2   . ILE B  1 120 ? -71.179  57.780  -85.043  1.00 47.79  ? 120  ILE B CG2   1 
ATOM   4688  C  CD1   . ILE B  1 120 ? -73.572  57.866  -83.420  1.00 59.72  ? 120  ILE B CD1   1 
ATOM   4689  N  N     . ALA B  1 121 ? -71.459  55.690  -88.153  1.00 61.44  ? 121  ALA B N     1 
ATOM   4690  C  CA    . ALA B  1 121 ? -70.414  54.916  -88.840  1.00 57.55  ? 121  ALA B CA    1 
ATOM   4691  C  C     . ALA B  1 121 ? -71.060  53.712  -89.516  1.00 60.77  ? 121  ALA B C     1 
ATOM   4692  O  O     . ALA B  1 121 ? -72.243  53.425  -89.264  1.00 58.62  ? 121  ALA B O     1 
ATOM   4693  C  CB    . ALA B  1 121 ? -69.363  54.450  -87.858  1.00 66.06  ? 121  ALA B CB    1 
ATOM   4694  N  N     . ASP B  1 122 ? -70.316  53.028  -90.393  1.00 48.43  ? 122  ASP B N     1 
ATOM   4695  C  CA    . ASP B  1 122 ? -70.878  51.849  -91.054  1.00 63.57  ? 122  ASP B CA    1 
ATOM   4696  C  C     . ASP B  1 122 ? -70.354  50.482  -90.605  1.00 63.62  ? 122  ASP B C     1 
ATOM   4697  O  O     . ASP B  1 122 ? -70.899  49.452  -91.012  1.00 87.59  ? 122  ASP B O     1 
ATOM   4698  C  CB    . ASP B  1 122 ? -70.891  51.979  -92.584  1.00 57.08  ? 122  ASP B CB    1 
ATOM   4699  C  CG    . ASP B  1 122 ? -69.537  52.264  -93.169  1.00 73.16  ? 122  ASP B CG    1 
ATOM   4700  O  OD1   . ASP B  1 122 ? -68.521  51.746  -92.655  1.00 83.23  ? 122  ASP B OD1   1 
ATOM   4701  O  OD2   . ASP B  1 122 ? -69.503  53.006  -94.172  1.00 82.24  ? 122  ASP B OD2   1 
ATOM   4702  N  N     . THR B  1 123 ? -69.303  50.474  -89.783  1.00 65.61  ? 123  THR B N     1 
ATOM   4703  C  CA    . THR B  1 123 ? -68.728  49.238  -89.220  1.00 75.68  ? 123  THR B CA    1 
ATOM   4704  C  C     . THR B  1 123 ? -67.931  49.515  -87.946  1.00 67.07  ? 123  THR B C     1 
ATOM   4705  O  O     . THR B  1 123 ? -67.271  50.557  -87.835  1.00 46.04  ? 123  THR B O     1 
ATOM   4706  C  CB    . THR B  1 123 ? -67.800  48.463  -90.206  1.00 69.91  ? 123  THR B CB    1 
ATOM   4707  O  OG1   . THR B  1 123 ? -66.990  49.383  -90.935  1.00 36.49  ? 123  THR B OG1   1 
ATOM   4708  C  CG2   . THR B  1 123 ? -68.604  47.575  -91.167  1.00 69.68  ? 123  THR B CG2   1 
ATOM   4709  N  N     . VAL B  1 124 ? -68.055  48.605  -86.971  1.00 70.05  ? 124  VAL B N     1 
ATOM   4710  C  CA    . VAL B  1 124 ? -67.327  48.706  -85.699  1.00 51.32  ? 124  VAL B CA    1 
ATOM   4711  C  C     . VAL B  1 124 ? -66.197  47.699  -85.731  1.00 60.18  ? 124  VAL B C     1 
ATOM   4712  O  O     . VAL B  1 124 ? -66.381  46.562  -86.178  1.00 63.79  ? 124  VAL B O     1 
ATOM   4713  C  CB    . VAL B  1 124 ? -68.150  48.303  -84.475  1.00 46.79  ? 124  VAL B CB    1 
ATOM   4714  C  CG1   . VAL B  1 124 ? -67.549  48.941  -83.236  1.00 46.46  ? 124  VAL B CG1   1 
ATOM   4715  C  CG2   . VAL B  1 124 ? -69.611  48.639  -84.637  1.00 55.36  ? 124  VAL B CG2   1 
ATOM   4716  N  N     . LEU B  1 125 ? -65.044  48.092  -85.209  1.00 48.03  ? 125  LEU B N     1 
ATOM   4717  C  CA    . LEU B  1 125 ? -63.899  47.198  -85.192  1.00 48.63  ? 125  LEU B CA    1 
ATOM   4718  C  C     . LEU B  1 125 ? -63.447  46.812  -83.800  1.00 55.75  ? 125  LEU B C     1 
ATOM   4719  O  O     . LEU B  1 125 ? -63.225  47.673  -82.934  1.00 58.71  ? 125  LEU B O     1 
ATOM   4720  C  CB    . LEU B  1 125 ? -62.755  47.806  -85.976  1.00 55.99  ? 125  LEU B CB    1 
ATOM   4721  C  CG    . LEU B  1 125 ? -62.647  47.322  -87.419  1.00 57.94  ? 125  LEU B CG    1 
ATOM   4722  C  CD1   . LEU B  1 125 ? -63.961  46.757  -87.922  1.00 50.95  ? 125  LEU B CD1   1 
ATOM   4723  C  CD2   . LEU B  1 125 ? -62.154  48.465  -88.288  1.00 47.19  ? 125  LEU B CD2   1 
ATOM   4724  N  N     . PHE B  1 126 ? -63.350  45.501  -83.590  1.00 57.25  ? 126  PHE B N     1 
ATOM   4725  C  CA    . PHE B  1 126 ? -62.928  44.938  -82.315  1.00 50.51  ? 126  PHE B CA    1 
ATOM   4726  C  C     . PHE B  1 126 ? -61.706  44.043  -82.454  1.00 57.67  ? 126  PHE B C     1 
ATOM   4727  O  O     . PHE B  1 126 ? -61.617  43.194  -83.352  1.00 49.26  ? 126  PHE B O     1 
ATOM   4728  C  CB    . PHE B  1 126 ? -64.060  44.149  -81.662  1.00 40.00  ? 126  PHE B CB    1 
ATOM   4729  C  CG    . PHE B  1 126 ? -65.026  44.995  -80.871  1.00 46.36  ? 126  PHE B CG    1 
ATOM   4730  C  CD1   . PHE B  1 126 ? -66.031  45.721  -81.508  1.00 37.52  ? 126  PHE B CD1   1 
ATOM   4731  C  CD2   . PHE B  1 126 ? -64.948  45.038  -79.479  1.00 44.59  ? 126  PHE B CD2   1 
ATOM   4732  C  CE1   . PHE B  1 126 ? -66.939  46.471  -80.768  1.00 40.30  ? 126  PHE B CE1   1 
ATOM   4733  C  CE2   . PHE B  1 126 ? -65.860  45.795  -78.721  1.00 45.86  ? 126  PHE B CE2   1 
ATOM   4734  C  CZ    . PHE B  1 126 ? -66.852  46.508  -79.366  1.00 43.42  ? 126  PHE B CZ    1 
ATOM   4735  N  N     . GLY B  1 127 ? -60.758  44.272  -81.556  1.00 53.04  ? 127  GLY B N     1 
ATOM   4736  C  CA    . GLY B  1 127 ? -59.530  43.505  -81.525  1.00 46.78  ? 127  GLY B CA    1 
ATOM   4737  C  C     . GLY B  1 127 ? -59.257  43.211  -80.063  1.00 57.60  ? 127  GLY B C     1 
ATOM   4738  O  O     . GLY B  1 127 ? -58.712  44.053  -79.341  1.00 62.77  ? 127  GLY B O     1 
ATOM   4739  N  N     . PRO B  1 128 ? -59.697  42.042  -79.575  1.00 52.56  ? 128  PRO B N     1 
ATOM   4740  C  CA    . PRO B  1 128 ? -59.503  41.631  -78.183  1.00 39.31  ? 128  PRO B CA    1 
ATOM   4741  C  C     . PRO B  1 128 ? -58.249  40.773  -77.996  1.00 48.83  ? 128  PRO B C     1 
ATOM   4742  O  O     . PRO B  1 128 ? -57.831  40.018  -78.903  1.00 56.97  ? 128  PRO B O     1 
ATOM   4743  C  CB    . PRO B  1 128 ? -60.774  40.839  -77.878  1.00 30.63  ? 128  PRO B CB    1 
ATOM   4744  C  CG    . PRO B  1 128 ? -61.604  40.895  -79.175  1.00 39.27  ? 128  PRO B CG    1 
ATOM   4745  C  CD    . PRO B  1 128 ? -60.607  41.120  -80.254  1.00 28.89  ? 128  PRO B CD    1 
ATOM   4746  N  N     . GLU B  1 129 ? -57.637  40.939  -76.824  1.00 55.45  ? 129  GLU B N     1 
ATOM   4747  C  CA    . GLU B  1 129 ? -56.412  40.232  -76.429  1.00 62.47  ? 129  GLU B CA    1 
ATOM   4748  C  C     . GLU B  1 129 ? -56.813  39.374  -75.257  1.00 50.00  ? 129  GLU B C     1 
ATOM   4749  O  O     . GLU B  1 129 ? -56.628  39.735  -74.093  1.00 65.91  ? 129  GLU B O     1 
ATOM   4750  C  CB    . GLU B  1 129 ? -55.340  41.237  -76.009  1.00 77.21  ? 129  GLU B CB    1 
ATOM   4751  C  CG    . GLU B  1 129 ? -54.974  42.143  -77.144  1.00 43.07  ? 129  GLU B CG    1 
ATOM   4752  C  CD    . GLU B  1 129 ? -54.284  43.409  -76.738  1.00 63.50  ? 129  GLU B CD    1 
ATOM   4753  O  OE1   . GLU B  1 129 ? -53.684  43.992  -77.643  1.00 55.89  ? 129  GLU B OE1   1 
ATOM   4754  O  OE2   . GLU B  1 129 ? -54.349  43.848  -75.569  1.00 45.54  ? 129  GLU B OE2   1 
ATOM   4755  N  N     . PRO B  1 130 ? -57.350  38.200  -75.561  1.00 42.17  ? 130  PRO B N     1 
ATOM   4756  C  CA    . PRO B  1 130 ? -57.807  37.257  -74.551  1.00 45.45  ? 130  PRO B CA    1 
ATOM   4757  C  C     . PRO B  1 130 ? -56.702  36.357  -74.030  1.00 41.33  ? 130  PRO B C     1 
ATOM   4758  O  O     . PRO B  1 130 ? -56.220  35.468  -74.734  1.00 53.87  ? 130  PRO B O     1 
ATOM   4759  C  CB    . PRO B  1 130 ? -58.900  36.470  -75.293  1.00 28.73  ? 130  PRO B CB    1 
ATOM   4760  C  CG    . PRO B  1 130 ? -58.717  36.831  -76.748  1.00 31.35  ? 130  PRO B CG    1 
ATOM   4761  C  CD    . PRO B  1 130 ? -57.409  37.594  -76.897  1.00 56.46  ? 130  PRO B CD    1 
ATOM   4762  N  N     . GLU B  1 131 ? -56.327  36.592  -72.777  1.00 47.40  ? 131  GLU B N     1 
ATOM   4763  C  CA    . GLU B  1 131 ? -55.281  35.827  -72.088  1.00 41.49  ? 131  GLU B CA    1 
ATOM   4764  C  C     . GLU B  1 131 ? -55.842  34.561  -71.388  1.00 35.08  ? 131  GLU B C     1 
ATOM   4765  O  O     . GLU B  1 131 ? -57.051  34.416  -71.212  1.00 49.81  ? 131  GLU B O     1 
ATOM   4766  C  CB    . GLU B  1 131 ? -54.548  36.749  -71.078  1.00 37.38  ? 131  GLU B CB    1 
ATOM   4767  C  CG    . GLU B  1 131 ? -53.546  37.758  -71.720  1.00 20.47  ? 131  GLU B CG    1 
ATOM   4768  C  CD    . GLU B  1 131 ? -53.126  38.952  -70.817  1.00 58.88  ? 131  GLU B CD    1 
ATOM   4769  O  OE1   . GLU B  1 131 ? -52.170  39.727  -71.201  1.00 19.77  ? 131  GLU B OE1   1 
ATOM   4770  O  OE2   . GLU B  1 131 ? -53.780  39.117  -69.747  1.00 25.22  ? 131  GLU B OE2   1 
ATOM   4771  N  N     . PHE B  1 132 ? -54.969  33.612  -71.067  1.00 46.25  ? 132  PHE B N     1 
ATOM   4772  C  CA    . PHE B  1 132 ? -55.387  32.384  -70.385  1.00 41.19  ? 132  PHE B CA    1 
ATOM   4773  C  C     . PHE B  1 132 ? -54.229  31.652  -69.739  1.00 41.64  ? 132  PHE B C     1 
ATOM   4774  O  O     . PHE B  1 132 ? -53.055  32.000  -69.922  1.00 45.58  ? 132  PHE B O     1 
ATOM   4775  C  CB    . PHE B  1 132 ? -56.051  31.432  -71.355  1.00 18.53  ? 132  PHE B CB    1 
ATOM   4776  C  CG    . PHE B  1 132 ? -55.194  31.078  -72.530  1.00 33.76  ? 132  PHE B CG    1 
ATOM   4777  C  CD1   . PHE B  1 132 ? -55.281  31.813  -73.701  1.00 35.12  ? 132  PHE B CD1   1 
ATOM   4778  C  CD2   . PHE B  1 132 ? -54.333  29.984  -72.488  1.00 34.32  ? 132  PHE B CD2   1 
ATOM   4779  C  CE1   . PHE B  1 132 ? -54.528  31.462  -74.816  1.00 36.01  ? 132  PHE B CE1   1 
ATOM   4780  C  CE2   . PHE B  1 132 ? -53.576  29.630  -73.601  1.00 32.28  ? 132  PHE B CE2   1 
ATOM   4781  C  CZ    . PHE B  1 132 ? -53.677  30.370  -74.765  1.00 31.07  ? 132  PHE B CZ    1 
ATOM   4782  N  N     . PHE B  1 133 ? -54.579  30.611  -69.001  1.00 36.40  ? 133  PHE B N     1 
ATOM   4783  C  CA    . PHE B  1 133 ? -53.594  29.787  -68.322  1.00 37.03  ? 133  PHE B CA    1 
ATOM   4784  C  C     . PHE B  1 133 ? -53.680  28.337  -68.776  1.00 36.86  ? 133  PHE B C     1 
ATOM   4785  O  O     . PHE B  1 133 ? -54.749  27.854  -69.162  1.00 42.98  ? 133  PHE B O     1 
ATOM   4786  C  CB    . PHE B  1 133 ? -53.844  29.803  -66.824  1.00 22.76  ? 133  PHE B CB    1 
ATOM   4787  C  CG    . PHE B  1 133 ? -53.336  31.016  -66.129  1.00 26.98  ? 133  PHE B CG    1 
ATOM   4788  C  CD1   . PHE B  1 133 ? -54.167  32.097  -65.900  1.00 39.62  ? 133  PHE B CD1   1 
ATOM   4789  C  CD2   . PHE B  1 133 ? -52.047  31.044  -65.622  1.00 33.62  ? 133  PHE B CD2   1 
ATOM   4790  C  CE1   . PHE B  1 133 ? -53.720  33.181  -65.169  1.00 33.36  ? 133  PHE B CE1   1 
ATOM   4791  C  CE2   . PHE B  1 133 ? -51.599  32.111  -64.895  1.00 27.53  ? 133  PHE B CE2   1 
ATOM   4792  C  CZ    . PHE B  1 133 ? -52.438  33.186  -64.665  1.00 33.38  ? 133  PHE B CZ    1 
ATOM   4793  N  N     . LEU B  1 134 ? -52.560  27.634  -68.664  1.00 37.28  ? 134  LEU B N     1 
ATOM   4794  C  CA    . LEU B  1 134 ? -52.484  26.219  -69.009  1.00 30.93  ? 134  LEU B CA    1 
ATOM   4795  C  C     . LEU B  1 134 ? -51.911  25.434  -67.826  1.00 34.40  ? 134  LEU B C     1 
ATOM   4796  O  O     . LEU B  1 134 ? -50.738  25.577  -67.461  1.00 51.39  ? 134  LEU B O     1 
ATOM   4797  C  CB    . LEU B  1 134 ? -51.625  26.014  -70.246  1.00 16.92  ? 134  LEU B CB    1 
ATOM   4798  C  CG    . LEU B  1 134 ? -52.185  26.564  -71.553  1.00 23.89  ? 134  LEU B CG    1 
ATOM   4799  C  CD1   . LEU B  1 134 ? -51.237  26.252  -72.705  1.00 22.90  ? 134  LEU B CD1   1 
ATOM   4800  C  CD2   . LEU B  1 134 ? -53.546  25.935  -71.810  1.00 39.99  ? 134  LEU B CD2   1 
ATOM   4801  N  N     . PHE B  1 135 ? -52.773  24.641  -67.214  1.00 27.63  ? 135  PHE B N     1 
ATOM   4802  C  CA    . PHE B  1 135 ? -52.394  23.832  -66.064  1.00 30.56  ? 135  PHE B CA    1 
ATOM   4803  C  C     . PHE B  1 135 ? -52.358  22.358  -66.431  1.00 28.43  ? 135  PHE B C     1 
ATOM   4804  O  O     . PHE B  1 135 ? -52.696  21.958  -67.556  1.00 35.66  ? 135  PHE B O     1 
ATOM   4805  C  CB    . PHE B  1 135 ? -53.362  24.066  -64.904  1.00 14.73  ? 135  PHE B CB    1 
ATOM   4806  C  CG    . PHE B  1 135 ? -53.580  25.513  -64.586  1.00 29.11  ? 135  PHE B CG    1 
ATOM   4807  C  CD1   . PHE B  1 135 ? -54.862  26.030  -64.503  1.00 28.01  ? 135  PHE B CD1   1 
ATOM   4808  C  CD2   . PHE B  1 135 ? -52.504  26.354  -64.374  1.00 46.19  ? 135  PHE B CD2   1 
ATOM   4809  C  CE1   . PHE B  1 135 ? -55.067  27.365  -64.211  1.00 42.18  ? 135  PHE B CE1   1 
ATOM   4810  C  CE2   . PHE B  1 135 ? -52.700  27.691  -64.082  1.00 21.69  ? 135  PHE B CE2   1 
ATOM   4811  C  CZ    . PHE B  1 135 ? -53.983  28.196  -63.999  1.00 38.46  ? 135  PHE B CZ    1 
ATOM   4812  N  N     . ASP B  1 136 ? -51.925  21.560  -65.470  1.00 29.78  ? 136  ASP B N     1 
ATOM   4813  C  CA    . ASP B  1 136 ? -51.784  20.128  -65.673  1.00 31.08  ? 136  ASP B CA    1 
ATOM   4814  C  C     . ASP B  1 136 ? -52.853  19.488  -64.823  1.00 26.16  ? 136  ASP B C     1 
ATOM   4815  O  O     . ASP B  1 136 ? -53.382  18.430  -65.153  1.00 33.16  ? 136  ASP B O     1 
ATOM   4816  C  CB    . ASP B  1 136 ? -50.417  19.625  -65.185  1.00 15.02  ? 136  ASP B CB    1 
ATOM   4817  C  CG    . ASP B  1 136 ? -49.303  19.904  -66.166  1.00 39.29  ? 136  ASP B CG    1 
ATOM   4818  O  OD1   . ASP B  1 136 ? -48.152  20.068  -65.710  1.00 39.63  ? 136  ASP B OD1   1 
ATOM   4819  O  OD2   . ASP B  1 136 ? -49.576  19.940  -67.386  1.00 38.56  ? 136  ASP B OD2   1 
ATOM   4820  N  N     . ASP B  1 137 ? -53.159  20.143  -63.711  1.00 28.39  ? 137  ASP B N     1 
ATOM   4821  C  CA    . ASP B  1 137 ? -54.136  19.615  -62.791  1.00 24.93  ? 137  ASP B CA    1 
ATOM   4822  C  C     . ASP B  1 137 ? -54.820  20.739  -62.034  1.00 28.38  ? 137  ASP B C     1 
ATOM   4823  O  O     . ASP B  1 137 ? -54.182  21.702  -61.585  1.00 36.51  ? 137  ASP B O     1 
ATOM   4824  C  CB    . ASP B  1 137 ? -53.422  18.610  -61.872  1.00 33.96  ? 137  ASP B CB    1 
ATOM   4825  C  CG    . ASP B  1 137 ? -54.214  18.217  -60.614  1.00 38.64  ? 137  ASP B CG    1 
ATOM   4826  O  OD1   . ASP B  1 137 ? -55.103  17.315  -60.650  1.00 44.18  ? 137  ASP B OD1   1 
ATOM   4827  O  OD2   . ASP B  1 137 ? -53.837  18.745  -59.545  1.00 24.76  ? 137  ASP B OD2   1 
ATOM   4828  N  N     . ILE B  1 138 ? -56.144  20.619  -61.975  1.00 20.08  ? 138  ILE B N     1 
ATOM   4829  C  CA    . ILE B  1 138 ? -57.014  21.557  -61.288  1.00 26.89  ? 138  ILE B CA    1 
ATOM   4830  C  C     . ILE B  1 138 ? -58.088  20.820  -60.489  1.00 25.83  ? 138  ILE B C     1 
ATOM   4831  O  O     . ILE B  1 138 ? -58.896  20.066  -61.044  1.00 29.53  ? 138  ILE B O     1 
ATOM   4832  C  CB    . ILE B  1 138 ? -57.703  22.523  -62.284  1.00 32.51  ? 138  ILE B CB    1 
ATOM   4833  C  CG1   . ILE B  1 138 ? -58.623  23.476  -61.532  1.00 13.10  ? 138  ILE B CG1   1 
ATOM   4834  C  CG2   . ILE B  1 138 ? -58.471  21.762  -63.333  1.00 30.38  ? 138  ILE B CG2   1 
ATOM   4835  C  CD1   . ILE B  1 138 ? -57.891  24.346  -60.517  1.00 52.72  ? 138  ILE B CD1   1 
ATOM   4836  N  N     . ARG B  1 139 ? -58.102  21.050  -59.182  1.00 27.37  ? 139  ARG B N     1 
ATOM   4837  C  CA    . ARG B  1 139 ? -59.088  20.410  -58.319  1.00 29.84  ? 139  ARG B CA    1 
ATOM   4838  C  C     . ARG B  1 139 ? -59.683  21.459  -57.402  1.00 41.73  ? 139  ARG B C     1 
ATOM   4839  O  O     . ARG B  1 139 ? -59.008  22.412  -56.988  1.00 49.78  ? 139  ARG B O     1 
ATOM   4840  C  CB    . ARG B  1 139 ? -58.455  19.283  -57.483  1.00 35.65  ? 139  ARG B CB    1 
ATOM   4841  C  CG    . ARG B  1 139 ? -57.641  18.256  -58.289  1.00 40.74  ? 139  ARG B CG    1 
ATOM   4842  C  CD    . ARG B  1 139 ? -57.145  17.066  -57.452  1.00 38.05  ? 139  ARG B CD    1 
ATOM   4843  N  NE    . ARG B  1 139 ? -56.554  17.428  -56.159  1.00 47.97  ? 139  ARG B NE    1 
ATOM   4844  C  CZ    . ARG B  1 139 ? -55.329  17.926  -56.001  1.00 50.05  ? 139  ARG B CZ    1 
ATOM   4845  N  NH1   . ARG B  1 139 ? -54.871  18.214  -54.780  1.00 36.13  ? 139  ARG B NH1   1 
ATOM   4846  N  NH2   . ARG B  1 139 ? -54.569  18.170  -57.065  1.00 36.23  ? 139  ARG B NH2   1 
ATOM   4847  N  N     . PHE B  1 140 ? -60.952  21.269  -57.081  1.00 25.57  ? 140  PHE B N     1 
ATOM   4848  C  CA    . PHE B  1 140 ? -61.670  22.189  -56.212  1.00 29.28  ? 140  PHE B CA    1 
ATOM   4849  C  C     . PHE B  1 140 ? -63.004  21.593  -55.792  1.00 36.24  ? 140  PHE B C     1 
ATOM   4850  O  O     . PHE B  1 140 ? -63.519  20.656  -56.425  1.00 29.76  ? 140  PHE B O     1 
ATOM   4851  C  CB    . PHE B  1 140 ? -61.945  23.503  -56.939  1.00 28.30  ? 140  PHE B CB    1 
ATOM   4852  C  CG    . PHE B  1 140 ? -62.734  23.334  -58.216  1.00 33.35  ? 140  PHE B CG    1 
ATOM   4853  C  CD1   . PHE B  1 140 ? -64.119  23.121  -58.184  1.00 48.42  ? 140  PHE B CD1   1 
ATOM   4854  C  CD2   . PHE B  1 140 ? -62.085  23.362  -59.461  1.00 31.41  ? 140  PHE B CD2   1 
ATOM   4855  C  CE1   . PHE B  1 140 ? -64.855  22.929  -59.373  1.00 31.42  ? 140  PHE B CE1   1 
ATOM   4856  C  CE2   . PHE B  1 140 ? -62.804  23.173  -60.661  1.00 24.83  ? 140  PHE B CE2   1 
ATOM   4857  C  CZ    . PHE B  1 140 ? -64.197  22.955  -60.614  1.00 28.90  ? 140  PHE B CZ    1 
ATOM   4858  N  N     . GLY B  1 141 ? -63.604  22.209  -54.782  1.00 36.33  ? 141  GLY B N     1 
ATOM   4859  C  CA    . GLY B  1 141 ? -64.882  21.735  -54.306  1.00 28.03  ? 141  GLY B CA    1 
ATOM   4860  C  C     . GLY B  1 141 ? -65.346  22.452  -53.073  1.00 26.66  ? 141  GLY B C     1 
ATOM   4861  O  O     . GLY B  1 141 ? -64.560  23.089  -52.363  1.00 41.54  ? 141  GLY B O     1 
ATOM   4862  N  N     . ALA B  1 142 ? -66.642  22.341  -52.821  1.00 37.61  ? 142  ALA B N     1 
ATOM   4863  C  CA    . ALA B  1 142 ? -67.260  22.958  -51.660  1.00 21.40  ? 142  ALA B CA    1 
ATOM   4864  C  C     . ALA B  1 142 ? -68.354  22.040  -51.171  1.00 32.18  ? 142  ALA B C     1 
ATOM   4865  O  O     . ALA B  1 142 ? -69.189  21.548  -51.942  1.00 36.66  ? 142  ALA B O     1 
ATOM   4866  C  CB    . ALA B  1 142 ? -67.833  24.297  -52.012  1.00 34.98  ? 142  ALA B CB    1 
ATOM   4867  N  N     . SER B  1 143 ? -68.317  21.821  -49.871  1.00 40.47  ? 143  SER B N     1 
ATOM   4868  C  CA    . SER B  1 143 ? -69.236  20.968  -49.165  1.00 21.34  ? 143  SER B CA    1 
ATOM   4869  C  C     . SER B  1 143 ? -69.483  21.707  -47.847  1.00 37.92  ? 143  SER B C     1 
ATOM   4870  O  O     . SER B  1 143 ? -68.875  22.758  -47.576  1.00 34.33  ? 143  SER B O     1 
ATOM   4871  C  CB    . SER B  1 143 ? -68.560  19.597  -48.936  1.00 26.51  ? 143  SER B CB    1 
ATOM   4872  O  OG    . SER B  1 143 ? -68.494  19.213  -47.562  1.00 48.38  ? 143  SER B OG    1 
ATOM   4873  N  N     . ILE B  1 144 ? -70.364  21.161  -47.024  1.00 19.34  ? 144  ILE B N     1 
ATOM   4874  C  CA    . ILE B  1 144 ? -70.675  21.793  -45.762  1.00 27.71  ? 144  ILE B CA    1 
ATOM   4875  C  C     . ILE B  1 144 ? -69.465  21.898  -44.828  1.00 26.00  ? 144  ILE B C     1 
ATOM   4876  O  O     . ILE B  1 144 ? -69.252  22.944  -44.199  1.00 41.79  ? 144  ILE B O     1 
ATOM   4877  C  CB    . ILE B  1 144 ? -71.877  21.096  -45.068  1.00 29.53  ? 144  ILE B CB    1 
ATOM   4878  C  CG1   . ILE B  1 144 ? -72.108  21.688  -43.672  1.00 28.72  ? 144  ILE B CG1   1 
ATOM   4879  C  CG2   . ILE B  1 144 ? -71.653  19.604  -45.004  1.00 16.90  ? 144  ILE B CG2   1 
ATOM   4880  C  CD1   . ILE B  1 144 ? -73.309  21.122  -42.951  1.00 38.65  ? 144  ILE B CD1   1 
ATOM   4881  N  N     . SER B  1 145 ? -68.647  20.846  -44.811  1.00 33.03  ? 145  SER B N     1 
ATOM   4882  C  CA    . SER B  1 145 ? -67.466  20.756  -43.946  1.00 33.19  ? 145  SER B CA    1 
ATOM   4883  C  C     . SER B  1 145 ? -66.226  21.509  -44.413  1.00 32.04  ? 145  SER B C     1 
ATOM   4884  O  O     . SER B  1 145 ? -65.224  21.562  -43.694  1.00 43.61  ? 145  SER B O     1 
ATOM   4885  C  CB    . SER B  1 145 ? -67.112  19.299  -43.693  1.00 25.77  ? 145  SER B CB    1 
ATOM   4886  O  OG    . SER B  1 145 ? -67.083  18.614  -44.926  1.00 41.97  ? 145  SER B OG    1 
ATOM   4887  N  N     . GLY B  1 146 ? -66.279  22.050  -45.627  1.00 20.81  ? 146  GLY B N     1 
ATOM   4888  C  CA    . GLY B  1 146 ? -65.163  22.833  -46.133  1.00 25.98  ? 146  GLY B CA    1 
ATOM   4889  C  C     . GLY B  1 146 ? -65.231  23.133  -47.617  1.00 25.80  ? 146  GLY B C     1 
ATOM   4890  O  O     . GLY B  1 146 ? -66.256  22.928  -48.275  1.00 34.60  ? 146  GLY B O     1 
ATOM   4891  N  N     . SER B  1 147 ? -64.133  23.656  -48.142  1.00 18.08  ? 147  SER B N     1 
ATOM   4892  C  CA    . SER B  1 147 ? -64.039  23.955  -49.564  1.00 28.08  ? 147  SER B CA    1 
ATOM   4893  C  C     . SER B  1 147 ? -62.573  24.090  -49.883  1.00 33.08  ? 147  SER B C     1 
ATOM   4894  O  O     . SER B  1 147 ? -61.739  24.237  -48.962  1.00 29.78  ? 147  SER B O     1 
ATOM   4895  C  CB    . SER B  1 147 ? -64.773  25.254  -49.918  1.00 42.67  ? 147  SER B CB    1 
ATOM   4896  O  OG    . SER B  1 147 ? -64.265  26.381  -49.215  1.00 24.12  ? 147  SER B OG    1 
ATOM   4897  N  N     . HIS B  1 148 ? -62.251  24.039  -51.175  1.00 23.69  ? 148  HIS B N     1 
ATOM   4898  C  CA    . HIS B  1 148 ? -60.854  24.157  -51.590  1.00 30.06  ? 148  HIS B CA    1 
ATOM   4899  C  C     . HIS B  1 148 ? -60.653  24.293  -53.079  1.00 26.08  ? 148  HIS B C     1 
ATOM   4900  O  O     . HIS B  1 148 ? -61.550  24.048  -53.884  1.00 30.65  ? 148  HIS B O     1 
ATOM   4901  C  CB    . HIS B  1 148 ? -60.080  22.920  -51.164  1.00 32.24  ? 148  HIS B CB    1 
ATOM   4902  C  CG    . HIS B  1 148 ? -60.472  21.697  -51.924  1.00 40.04  ? 148  HIS B CG    1 
ATOM   4903  N  ND1   . HIS B  1 148 ? -61.658  21.027  -51.692  1.00 50.31  ? 148  HIS B ND1   1 
ATOM   4904  C  CD2   . HIS B  1 148 ? -59.881  21.074  -52.972  1.00 15.28  ? 148  HIS B CD2   1 
ATOM   4905  C  CE1   . HIS B  1 148 ? -61.780  20.050  -52.572  1.00 45.02  ? 148  HIS B CE1   1 
ATOM   4906  N  NE2   . HIS B  1 148 ? -60.715  20.057  -53.359  1.00 33.56  ? 148  HIS B NE2   1 
ATOM   4907  N  N     . VAL B  1 149 ? -59.414  24.605  -53.422  1.00 31.12  ? 149  VAL B N     1 
ATOM   4908  C  CA    . VAL B  1 149 ? -58.985  24.731  -54.799  1.00 29.88  ? 149  VAL B CA    1 
ATOM   4909  C  C     . VAL B  1 149 ? -57.487  24.419  -54.818  1.00 47.20  ? 149  VAL B C     1 
ATOM   4910  O  O     . VAL B  1 149 ? -56.728  24.808  -53.894  1.00 29.33  ? 149  VAL B O     1 
ATOM   4911  C  CB    . VAL B  1 149 ? -59.200  26.135  -55.326  1.00 25.00  ? 149  VAL B CB    1 
ATOM   4912  C  CG1   . VAL B  1 149 ? -58.508  27.138  -54.421  1.00 42.58  ? 149  VAL B CG1   1 
ATOM   4913  C  CG2   . VAL B  1 149 ? -58.666  26.232  -56.739  1.00 11.15  ? 149  VAL B CG2   1 
ATOM   4914  N  N     . ALA B  1 150 ? -57.072  23.700  -55.856  1.00 34.00  ? 150  ALA B N     1 
ATOM   4915  C  CA    . ALA B  1 150 ? -55.679  23.332  -55.996  1.00 10.99  ? 150  ALA B CA    1 
ATOM   4916  C  C     . ALA B  1 150 ? -55.267  23.391  -57.445  1.00 26.21  ? 150  ALA B C     1 
ATOM   4917  O  O     . ALA B  1 150 ? -55.833  22.722  -58.322  1.00 33.38  ? 150  ALA B O     1 
ATOM   4918  C  CB    . ALA B  1 150 ? -55.452  21.965  -55.454  1.00 13.48  ? 150  ALA B CB    1 
ATOM   4919  N  N     . ILE B  1 151 ? -54.265  24.211  -57.692  1.00 21.08  ? 151  ILE B N     1 
ATOM   4920  C  CA    . ILE B  1 151 ? -53.765  24.373  -59.033  1.00 20.60  ? 151  ILE B CA    1 
ATOM   4921  C  C     . ILE B  1 151 ? -52.400  23.750  -59.124  1.00 27.22  ? 151  ILE B C     1 
ATOM   4922  O  O     . ILE B  1 151 ? -51.638  23.674  -58.138  1.00 37.43  ? 151  ILE B O     1 
ATOM   4923  C  CB    . ILE B  1 151 ? -53.611  25.858  -59.400  1.00 26.03  ? 151  ILE B CB    1 
ATOM   4924  C  CG1   . ILE B  1 151 ? -54.877  26.608  -59.045  1.00 15.91  ? 151  ILE B CG1   1 
ATOM   4925  C  CG2   . ILE B  1 151 ? -53.358  26.022  -60.893  1.00 32.40  ? 151  ILE B CG2   1 
ATOM   4926  C  CD1   . ILE B  1 151 ? -54.810  28.054  -59.356  1.00 36.49  ? 151  ILE B CD1   1 
ATOM   4927  N  N     . ASP B  1 152 ? -52.128  23.232  -60.306  1.00 18.85  ? 152  ASP B N     1 
ATOM   4928  C  CA    . ASP B  1 152 ? -50.841  22.680  -60.552  1.00 21.75  ? 152  ASP B CA    1 
ATOM   4929  C  C     . ASP B  1 152 ? -50.478  22.606  -62.006  1.00 27.02  ? 152  ASP B C     1 
ATOM   4930  O  O     . ASP B  1 152 ? -51.300  22.272  -62.876  1.00 33.84  ? 152  ASP B O     1 
ATOM   4931  C  CB    . ASP B  1 152 ? -50.658  21.328  -59.891  1.00 19.75  ? 152  ASP B CB    1 
ATOM   4932  C  CG    . ASP B  1 152 ? -49.216  21.095  -59.453  1.00 48.03  ? 152  ASP B CG    1 
ATOM   4933  O  OD1   . ASP B  1 152 ? -48.316  21.873  -59.868  1.00 41.56  ? 152  ASP B OD1   1 
ATOM   4934  O  OD2   . ASP B  1 152 ? -48.984  20.149  -58.675  1.00 45.07  ? 152  ASP B OD2   1 
ATOM   4935  N  N     . ASP B  1 153 ? -49.262  23.067  -62.257  1.00 16.49  ? 153  ASP B N     1 
ATOM   4936  C  CA    . ASP B  1 153 ? -48.684  23.012  -63.572  1.00 37.22  ? 153  ASP B CA    1 
ATOM   4937  C  C     . ASP B  1 153 ? -47.220  22.743  -63.403  1.00 32.46  ? 153  ASP B C     1 
ATOM   4938  O  O     . ASP B  1 153 ? -46.630  23.003  -62.355  1.00 40.24  ? 153  ASP B O     1 
ATOM   4939  C  CB    . ASP B  1 153 ? -48.823  24.298  -64.376  1.00 24.06  ? 153  ASP B CB    1 
ATOM   4940  C  CG    . ASP B  1 153 ? -48.567  24.057  -65.851  1.00 39.19  ? 153  ASP B CG    1 
ATOM   4941  O  OD1   . ASP B  1 153 ? -49.141  23.069  -66.338  1.00 37.81  ? 153  ASP B OD1   1 
ATOM   4942  O  OD2   . ASP B  1 153 ? -47.794  24.788  -66.519  1.00 44.10  ? 153  ASP B OD2   1 
ATOM   4943  N  N     . ILE B  1 154 ? -46.654  22.210  -64.467  1.00 35.73  ? 154  ILE B N     1 
ATOM   4944  C  CA    . ILE B  1 154 ? -45.252  21.900  -64.561  1.00 31.45  ? 154  ILE B CA    1 
ATOM   4945  C  C     . ILE B  1 154 ? -44.471  23.230  -64.438  1.00 43.96  ? 154  ILE B C     1 
ATOM   4946  O  O     . ILE B  1 154 ? -43.347  23.264  -63.914  1.00 33.27  ? 154  ILE B O     1 
ATOM   4947  C  CB    . ILE B  1 154 ? -44.999  21.255  -65.948  1.00 27.25  ? 154  ILE B CB    1 
ATOM   4948  C  CG1   . ILE B  1 154 ? -43.551  20.845  -66.113  1.00 36.19  ? 154  ILE B CG1   1 
ATOM   4949  C  CG2   . ILE B  1 154 ? -45.444  22.178  -67.077  1.00 54.62  ? 154  ILE B CG2   1 
ATOM   4950  C  CD1   . ILE B  1 154 ? -43.324  19.504  -65.568  1.00 26.84  ? 154  ILE B CD1   1 
ATOM   4951  N  N     . GLU B  1 155 ? -45.096  24.326  -64.874  1.00 31.57  ? 155  GLU B N     1 
ATOM   4952  C  CA    . GLU B  1 155 ? -44.436  25.624  -64.827  1.00 35.89  ? 155  GLU B CA    1 
ATOM   4953  C  C     . GLU B  1 155 ? -44.533  26.311  -63.479  1.00 31.38  ? 155  GLU B C     1 
ATOM   4954  O  O     . GLU B  1 155 ? -43.767  27.215  -63.183  1.00 33.05  ? 155  GLU B O     1 
ATOM   4955  C  CB    . GLU B  1 155 ? -44.967  26.550  -65.925  1.00 17.72  ? 155  GLU B CB    1 
ATOM   4956  C  CG    . GLU B  1 155 ? -44.525  26.189  -67.354  1.00 28.38  ? 155  GLU B CG    1 
ATOM   4957  C  CD    . GLU B  1 155 ? -44.911  27.253  -68.375  1.00 28.08  ? 155  GLU B CD    1 
ATOM   4958  O  OE1   . GLU B  1 155 ? -45.338  28.335  -67.941  1.00 30.28  ? 155  GLU B OE1   1 
ATOM   4959  O  OE2   . GLU B  1 155 ? -44.790  27.022  -69.597  1.00 51.94  ? 155  GLU B OE2   1 
ATOM   4960  N  N     . GLY B  1 156 ? -45.454  25.855  -62.648  1.00 23.39  ? 156  GLY B N     1 
ATOM   4961  C  CA    . GLY B  1 156 ? -45.638  26.473  -61.350  1.00 29.12  ? 156  GLY B CA    1 
ATOM   4962  C  C     . GLY B  1 156 ? -44.381  26.646  -60.531  1.00 23.06  ? 156  GLY B C     1 
ATOM   4963  O  O     . GLY B  1 156 ? -43.706  25.686  -60.194  1.00 35.15  ? 156  GLY B O     1 
ATOM   4964  N  N     . ALA B  1 157 ? -44.083  27.886  -60.191  1.00 31.35  ? 157  ALA B N     1 
ATOM   4965  C  CA    . ALA B  1 157 ? -42.901  28.187  -59.410  1.00 33.37  ? 157  ALA B CA    1 
ATOM   4966  C  C     . ALA B  1 157 ? -42.795  27.358  -58.139  1.00 31.57  ? 157  ALA B C     1 
ATOM   4967  O  O     . ALA B  1 157 ? -41.691  27.022  -57.707  1.00 37.27  ? 157  ALA B O     1 
ATOM   4968  C  CB    . ALA B  1 157 ? -42.888  29.631  -59.075  1.00 16.23  ? 157  ALA B CB    1 
ATOM   4969  N  N     . TRP B  1 158 ? -43.935  26.996  -57.561  1.00 28.16  ? 158  TRP B N     1 
ATOM   4970  C  CA    . TRP B  1 158 ? -43.943  26.213  -56.327  1.00 29.89  ? 158  TRP B CA    1 
ATOM   4971  C  C     . TRP B  1 158 ? -43.292  24.831  -56.475  1.00 31.49  ? 158  TRP B C     1 
ATOM   4972  O  O     . TRP B  1 158 ? -42.787  24.261  -55.501  1.00 42.34  ? 158  TRP B O     1 
ATOM   4973  C  CB    . TRP B  1 158 ? -45.369  26.092  -55.795  1.00 40.91  ? 158  TRP B CB    1 
ATOM   4974  C  CG    . TRP B  1 158 ? -46.362  25.560  -56.789  1.00 45.31  ? 158  TRP B CG    1 
ATOM   4975  C  CD1   . TRP B  1 158 ? -46.683  24.252  -57.008  1.00 54.13  ? 158  TRP B CD1   1 
ATOM   4976  C  CD2   . TRP B  1 158 ? -47.189  26.325  -57.668  1.00 40.96  ? 158  TRP B CD2   1 
ATOM   4977  N  NE1   . TRP B  1 158 ? -47.662  24.152  -57.966  1.00 38.11  ? 158  TRP B NE1   1 
ATOM   4978  C  CE2   . TRP B  1 158 ? -47.994  25.411  -58.388  1.00 48.20  ? 158  TRP B CE2   1 
ATOM   4979  C  CE3   . TRP B  1 158 ? -47.331  27.694  -57.920  1.00 38.10  ? 158  TRP B CE3   1 
ATOM   4980  C  CZ2   . TRP B  1 158 ? -48.929  25.823  -59.344  1.00 42.62  ? 158  TRP B CZ2   1 
ATOM   4981  C  CZ3   . TRP B  1 158 ? -48.258  28.102  -58.874  1.00 28.91  ? 158  TRP B CZ3   1 
ATOM   4982  C  CH2   . TRP B  1 158 ? -49.045  27.168  -59.573  1.00 31.90  ? 158  TRP B CH2   1 
ATOM   4983  N  N     . ASN B  1 159 ? -43.260  24.332  -57.709  1.00 28.92  ? 159  ASN B N     1 
ATOM   4984  C  CA    . ASN B  1 159 ? -42.664  23.041  -58.033  1.00 30.99  ? 159  ASN B CA    1 
ATOM   4985  C  C     . ASN B  1 159 ? -41.130  22.991  -58.098  1.00 26.39  ? 159  ASN B C     1 
ATOM   4986  O  O     . ASN B  1 159 ? -40.536  21.951  -58.393  1.00 34.81  ? 159  ASN B O     1 
ATOM   4987  C  CB    . ASN B  1 159 ? -43.269  22.496  -59.330  1.00 34.27  ? 159  ASN B CB    1 
ATOM   4988  C  CG    . ASN B  1 159 ? -44.675  21.949  -59.122  1.00 47.67  ? 159  ASN B CG    1 
ATOM   4989  O  OD1   . ASN B  1 159 ? -44.975  21.413  -58.064  1.00 40.39  ? 159  ASN B OD1   1 
ATOM   4990  N  ND2   . ASN B  1 159 ? -45.541  22.094  -60.124  1.00 42.49  ? 159  ASN B ND2   1 
ATOM   4991  N  N     . SER B  1 160 ? -40.479  24.095  -57.780  1.00 29.15  ? 160  SER B N     1 
ATOM   4992  C  CA    . SER B  1 160 ? -39.019  24.131  -57.798  1.00 37.29  ? 160  SER B CA    1 
ATOM   4993  C  C     . SER B  1 160 ? -38.467  23.100  -56.812  1.00 25.34  ? 160  SER B C     1 
ATOM   4994  O  O     . SER B  1 160 ? -37.365  22.568  -56.990  1.00 44.80  ? 160  SER B O     1 
ATOM   4995  C  CB    . SER B  1 160 ? -38.562  25.512  -57.362  1.00 25.75  ? 160  SER B CB    1 
ATOM   4996  O  OG    . SER B  1 160 ? -39.123  25.815  -56.091  1.00 45.39  ? 160  SER B OG    1 
ATOM   4997  N  N     . SER B  1 161 ? -39.289  22.814  -55.802  1.00 21.38  ? 161  SER B N     1 
ATOM   4998  C  CA    . SER B  1 161 ? -38.985  21.898  -54.700  1.00 39.87  ? 161  SER B CA    1 
ATOM   4999  C  C     . SER B  1 161 ? -39.514  20.473  -54.850  1.00 35.14  ? 161  SER B C     1 
ATOM   5000  O  O     . SER B  1 161 ? -39.049  19.550  -54.197  1.00 42.29  ? 161  SER B O     1 
ATOM   5001  C  CB    . SER B  1 161 ? -39.603  22.471  -53.427  1.00 37.15  ? 161  SER B CB    1 
ATOM   5002  O  OG    . SER B  1 161 ? -41.004  22.591  -53.591  1.00 39.01  ? 161  SER B OG    1 
ATOM   5003  N  N     . THR B  1 162 ? -40.547  20.346  -55.653  1.00 22.87  ? 162  THR B N     1 
ATOM   5004  C  CA    . THR B  1 162 ? -41.257  19.114  -55.925  1.00 28.49  ? 162  THR B CA    1 
ATOM   5005  C  C     . THR B  1 162 ? -40.468  17.955  -56.518  1.00 32.17  ? 162  THR B C     1 
ATOM   5006  O  O     . THR B  1 162 ? -39.699  18.164  -57.460  1.00 32.63  ? 162  THR B O     1 
ATOM   5007  C  CB    . THR B  1 162 ? -42.419  19.474  -56.850  1.00 25.89  ? 162  THR B CB    1 
ATOM   5008  O  OG1   . THR B  1 162 ? -43.294  20.376  -56.148  1.00 43.48  ? 162  THR B OG1   1 
ATOM   5009  C  CG2   . THR B  1 162 ? -43.154  18.244  -57.350  1.00 14.18  ? 162  THR B CG2   1 
ATOM   5010  N  N     . LYS B  1 163 ? -40.687  16.736  -55.991  1.00 31.78  ? 163  LYS B N     1 
ATOM   5011  C  CA    . LYS B  1 163 ? -39.985  15.541  -56.504  1.00 36.99  ? 163  LYS B CA    1 
ATOM   5012  C  C     . LYS B  1 163 ? -40.738  14.958  -57.689  1.00 28.43  ? 163  LYS B C     1 
ATOM   5013  O  O     . LYS B  1 163 ? -41.957  14.856  -57.663  1.00 36.85  ? 163  LYS B O     1 
ATOM   5014  C  CB    . LYS B  1 163 ? -39.810  14.461  -55.443  1.00 23.43  ? 163  LYS B CB    1 
ATOM   5015  C  CG    . LYS B  1 163 ? -38.951  14.865  -54.278  1.00 41.78  ? 163  LYS B CG    1 
ATOM   5016  C  CD    . LYS B  1 163 ? -38.432  13.661  -53.536  1.00 41.69  ? 163  LYS B CD    1 
ATOM   5017  C  CE    . LYS B  1 163 ? -38.261  13.996  -52.059  1.00 65.77  ? 163  LYS B CE    1 
ATOM   5018  N  NZ    . LYS B  1 163 ? -37.678  12.854  -51.305  1.00 77.71  ? 163  LYS B NZ    1 
ATOM   5019  N  N     . TYR B  1 164 ? -40.020  14.584  -58.736  1.00 32.66  ? 164  TYR B N     1 
ATOM   5020  C  CA    . TYR B  1 164 ? -40.689  14.061  -59.917  1.00 18.21  ? 164  TYR B CA    1 
ATOM   5021  C  C     . TYR B  1 164 ? -40.238  12.661  -60.230  1.00 40.78  ? 164  TYR B C     1 
ATOM   5022  O  O     . TYR B  1 164 ? -39.126  12.262  -59.876  1.00 43.57  ? 164  TYR B O     1 
ATOM   5023  C  CB    . TYR B  1 164 ? -40.460  14.967  -61.140  1.00 21.43  ? 164  TYR B CB    1 
ATOM   5024  C  CG    . TYR B  1 164 ? -41.373  16.191  -61.213  1.00 28.55  ? 164  TYR B CG    1 
ATOM   5025  C  CD1   . TYR B  1 164 ? -42.495  16.196  -62.047  1.00 53.08  ? 164  TYR B CD1   1 
ATOM   5026  C  CD2   . TYR B  1 164 ? -41.119  17.348  -60.454  1.00 36.71  ? 164  TYR B CD2   1 
ATOM   5027  C  CE1   . TYR B  1 164 ? -43.347  17.310  -62.128  1.00 61.06  ? 164  TYR B CE1   1 
ATOM   5028  C  CE2   . TYR B  1 164 ? -41.976  18.478  -60.531  1.00 38.22  ? 164  TYR B CE2   1 
ATOM   5029  C  CZ    . TYR B  1 164 ? -43.086  18.442  -61.367  1.00 45.14  ? 164  TYR B CZ    1 
ATOM   5030  O  OH    . TYR B  1 164 ? -43.968  19.500  -61.429  1.00 54.67  ? 164  TYR B OH    1 
ATOM   5031  N  N     . GLU B  1 165 ? -41.117  11.939  -60.921  1.00 59.89  ? 165  GLU B N     1 
ATOM   5032  C  CA    . GLU B  1 165 ? -40.894  10.561  -61.309  1.00 48.88  ? 165  GLU B CA    1 
ATOM   5033  C  C     . GLU B  1 165 ? -39.515  10.371  -61.923  1.00 51.91  ? 165  GLU B C     1 
ATOM   5034  O  O     . GLU B  1 165 ? -38.690  9.607   -61.397  1.00 46.97  ? 165  GLU B O     1 
ATOM   5035  C  CB    . GLU B  1 165 ? -41.990  10.122  -62.283  1.00 90.12  ? 165  GLU B CB    1 
ATOM   5036  C  CG    . GLU B  1 165 ? -42.721  8.833   -61.883  0.64 68.26  ? 165  GLU B CG    1 
ATOM   5037  C  CD    . GLU B  1 165 ? -41.799  7.619   -61.829  0.64 74.03  ? 165  GLU B CD    1 
ATOM   5038  O  OE1   . GLU B  1 165 ? -41.225  7.341   -60.746  0.64 59.83  ? 165  GLU B OE1   1 
ATOM   5039  O  OE2   . GLU B  1 165 ? -41.646  6.942   -62.873  0.64 61.90  ? 165  GLU B OE2   1 
ATOM   5040  N  N     . GLY B  1 166 ? -39.247  11.084  -63.012  1.00 47.42  ? 166  GLY B N     1 
ATOM   5041  C  CA    . GLY B  1 166 ? -37.937  10.962  -63.635  1.00 43.29  ? 166  GLY B CA    1 
ATOM   5042  C  C     . GLY B  1 166 ? -36.981  12.103  -63.311  1.00 43.01  ? 166  GLY B C     1 
ATOM   5043  O  O     . GLY B  1 166 ? -36.102  12.422  -64.113  1.00 40.78  ? 166  GLY B O     1 
ATOM   5044  N  N     . GLY B  1 167 ? -37.132  12.702  -62.129  1.00 49.96  ? 167  GLY B N     1 
ATOM   5045  C  CA    . GLY B  1 167 ? -36.285  13.816  -61.741  1.00 38.47  ? 167  GLY B CA    1 
ATOM   5046  C  C     . GLY B  1 167 ? -36.896  15.164  -62.111  1.00 45.98  ? 167  GLY B C     1 
ATOM   5047  O  O     . GLY B  1 167 ? -37.602  15.286  -63.119  1.00 42.92  ? 167  GLY B O     1 
ATOM   5048  N  N     . ASN B  1 168 ? -36.635  16.167  -61.273  1.00 35.08  ? 168  ASN B N     1 
ATOM   5049  C  CA    . ASN B  1 168 ? -37.095  17.546  -61.468  1.00 39.88  ? 168  ASN B CA    1 
ATOM   5050  C  C     . ASN B  1 168 ? -36.114  18.284  -62.359  1.00 32.85  ? 168  ASN B C     1 
ATOM   5051  O  O     . ASN B  1 168 ? -34.948  18.461  -61.997  1.00 39.31  ? 168  ASN B O     1 
ATOM   5052  C  CB    . ASN B  1 168 ? -37.241  18.221  -60.095  1.00 32.27  ? 168  ASN B CB    1 
ATOM   5053  C  CG    . ASN B  1 168 ? -37.845  19.606  -60.182  1.00 47.27  ? 168  ASN B CG    1 
ATOM   5054  O  OD1   . ASN B  1 168 ? -37.720  20.288  -61.194  1.00 38.03  ? 168  ASN B OD1   1 
ATOM   5055  N  ND2   . ASN B  1 168 ? -38.507  20.033  -59.110  1.00 37.70  ? 168  ASN B ND2   1 
ATOM   5056  N  N     . LYS B  1 169 ? -36.564  18.740  -63.543  1.00 26.23  ? 169  LYS B N     1 
ATOM   5057  C  CA    . LYS B  1 169 ? -35.654  19.401  -64.523  1.00 21.54  ? 169  LYS B CA    1 
ATOM   5058  C  C     . LYS B  1 169 ? -35.518  20.951  -64.322  1.00 34.97  ? 169  LYS B C     1 
ATOM   5059  O  O     . LYS B  1 169 ? -34.821  21.630  -65.078  1.00 30.32  ? 169  LYS B O     1 
ATOM   5060  C  CB    . LYS B  1 169 ? -36.114  19.027  -65.935  1.00 16.97  ? 169  LYS B CB    1 
ATOM   5061  C  CG    . LYS B  1 169 ? -36.412  17.552  -66.141  1.00 26.17  ? 169  LYS B CG    1 
ATOM   5062  C  CD    . LYS B  1 169 ? -35.269  16.671  -65.658  1.00 24.60  ? 169  LYS B CD    1 
ATOM   5063  C  CE    . LYS B  1 169 ? -35.520  15.191  -65.952  1.00 37.56  ? 169  LYS B CE    1 
ATOM   5064  N  NZ    . LYS B  1 169 ? -34.294  14.369  -65.751  1.00 23.78  ? 169  LYS B NZ    1 
ATOM   5065  N  N     . GLY B  1 170 ? -36.188  21.421  -63.282  1.00 35.42  ? 170  GLY B N     1 
ATOM   5066  C  CA    . GLY B  1 170 ? -36.188  22.780  -62.682  1.00 39.25  ? 170  GLY B CA    1 
ATOM   5067  C  C     . GLY B  1 170 ? -36.226  24.052  -63.531  1.00 47.34  ? 170  GLY B C     1 
ATOM   5068  O  O     . GLY B  1 170 ? -36.005  25.124  -62.973  1.00 79.50  ? 170  GLY B O     1 
ATOM   5069  N  N     . HIS B  1 171 ? -36.537  24.115  -64.839  1.00 44.03  ? 171  HIS B N     1 
ATOM   5070  C  CA    . HIS B  1 171 ? -36.578  25.443  -65.523  1.00 31.61  ? 171  HIS B CA    1 
ATOM   5071  C  C     . HIS B  1 171 ? -38.000  26.050  -65.562  1.00 48.46  ? 171  HIS B C     1 
ATOM   5072  O  O     . HIS B  1 171 ? -38.755  25.860  -66.518  1.00 66.44  ? 171  HIS B O     1 
ATOM   5073  C  CB    . HIS B  1 171 ? -35.959  25.404  -66.908  1.00 56.40  ? 171  HIS B CB    1 
ATOM   5074  C  CG    . HIS B  1 171 ? -34.433  25.134  -66.839  1.00 39.20  ? 171  HIS B CG    1 
ATOM   5075  N  ND1   . HIS B  1 171 ? -33.537  25.935  -66.163  1.00 40.43  ? 171  HIS B ND1   1 
ATOM   5076  C  CD2   . HIS B  1 171 ? -33.706  24.118  -67.366  1.00 51.61  ? 171  HIS B CD2   1 
ATOM   5077  C  CE1   . HIS B  1 171 ? -32.320  25.430  -66.282  1.00 24.58  ? 171  HIS B CE1   1 
ATOM   5078  N  NE2   . HIS B  1 171 ? -32.396  24.328  -67.006  1.00 39.83  ? 171  HIS B NE2   1 
ATOM   5079  N  N     . ARG B  1 172 ? -38.331  26.741  -64.483  1.00 26.18  ? 172  ARG B N     1 
ATOM   5080  C  CA    . ARG B  1 172 ? -39.660  27.289  -64.316  1.00 38.72  ? 172  ARG B CA    1 
ATOM   5081  C  C     . ARG B  1 172 ? -39.660  28.792  -64.200  1.00 39.43  ? 172  ARG B C     1 
ATOM   5082  O  O     . ARG B  1 172 ? -38.713  29.392  -63.684  1.00 46.87  ? 172  ARG B O     1 
ATOM   5083  C  CB    . ARG B  1 172 ? -40.317  26.706  -63.043  1.00 33.64  ? 172  ARG B CB    1 
ATOM   5084  C  CG    . ARG B  1 172 ? -40.589  25.233  -63.108  1.00 17.54  ? 172  ARG B CG    1 
ATOM   5085  C  CD    . ARG B  1 172 ? -41.003  24.648  -61.777  1.00 45.86  ? 172  ARG B CD    1 
ATOM   5086  N  NE    . ARG B  1 172 ? -41.093  23.201  -61.932  1.00 22.16  ? 172  ARG B NE    1 
ATOM   5087  C  CZ    . ARG B  1 172 ? -40.047  22.389  -61.849  1.00 42.46  ? 172  ARG B CZ    1 
ATOM   5088  N  NH1   . ARG B  1 172 ? -40.207  21.083  -62.042  1.00 54.80  ? 172  ARG B NH1   1 
ATOM   5089  N  NH2   . ARG B  1 172 ? -38.856  22.873  -61.489  1.00 52.01  ? 172  ARG B NH2   1 
ATOM   5090  N  N     A PRO B  1 173 ? -40.755  29.416  -64.655  1.00 32.64  ? 173  PRO B N     1 
ATOM   5091  C  CA    A PRO B  1 173 ? -40.985  30.857  -64.634  1.00 37.41  ? 173  PRO B CA    1 
ATOM   5092  C  C     A PRO B  1 173 ? -41.257  31.224  -63.185  1.00 35.91  ? 173  PRO B C     1 
ATOM   5093  O  O     A PRO B  1 173 ? -42.024  30.528  -62.515  1.00 35.77  ? 173  PRO B O     1 
ATOM   5094  C  CB    A PRO B  1 173 ? -42.274  30.995  -65.440  1.00 22.35  ? 173  PRO B CB    1 
ATOM   5095  C  CG    A PRO B  1 173 ? -42.316  29.769  -66.286  1.00 45.11  ? 173  PRO B CG    1 
ATOM   5096  C  CD    A PRO B  1 173 ? -41.867  28.730  -65.336  1.00 39.77  ? 173  PRO B CD    1 
ATOM   5097  N  N     A GLY B  1 174 ? -40.606  32.269  -62.681  0.86 23.08  ? 174  GLY B N     1 
ATOM   5098  N  N     B GLY B  1 174 ? -40.786  32.399  -64.614  0.14 38.91  ? 174  GLY B N     1 
ATOM   5099  C  CA    A GLY B  1 174 ? -40.855  32.678  -61.300  0.86 21.34  ? 174  GLY B CA    1 
ATOM   5100  C  CA    B GLY B  1 174 ? -41.394  32.510  -63.298  0.14 38.96  ? 174  GLY B CA    1 
ATOM   5101  C  C     A GLY B  1 174 ? -42.147  33.480  -61.231  0.86 25.83  ? 174  GLY B C     1 
ATOM   5102  C  C     B GLY B  1 174 ? -42.307  33.741  -63.213  0.14 40.43  ? 174  GLY B C     1 
ATOM   5103  O  O     A GLY B  1 174 ? -42.832  33.628  -62.253  0.86 17.03  ? 174  GLY B O     1 
ATOM   5104  O  O     B GLY B  1 174 ? -42.703  34.278  -64.252  0.14 42.48  ? 174  GLY B O     1 
ATOM   5105  N  N     A VAL B  1 175 ? -42.542  33.948  -60.047  0.86 30.63  ? 175  VAL B N     1 
ATOM   5106  N  N     B VAL B  1 175 ? -42.645  34.173  -62.001  0.14 38.99  ? 175  VAL B N     1 
ATOM   5107  C  CA    A VAL B  1 175 ? -43.767  34.762  -59.961  0.86 25.26  ? 175  VAL B CA    1 
ATOM   5108  C  CA    B VAL B  1 175 ? -43.516  35.324  -61.820  0.14 40.56  ? 175  VAL B CA    1 
ATOM   5109  C  C     A VAL B  1 175 ? -43.584  36.002  -60.852  0.86 30.80  ? 175  VAL B C     1 
ATOM   5110  C  C     B VAL B  1 175 ? -43.169  36.436  -62.827  0.14 40.87  ? 175  VAL B C     1 
ATOM   5111  O  O     A VAL B  1 175 ? -42.580  36.713  -60.752  0.86 52.25  ? 175  VAL B O     1 
ATOM   5112  O  O     B VAL B  1 175 ? -42.043  36.956  -62.821  0.14 41.08  ? 175  VAL B O     1 
ATOM   5113  C  CB    A VAL B  1 175 ? -44.093  35.152  -58.518  0.86 14.39  ? 175  VAL B CB    1 
ATOM   5114  C  CB    B VAL B  1 175 ? -43.454  35.852  -60.371  0.14 38.76  ? 175  VAL B CB    1 
ATOM   5115  C  CG1   A VAL B  1 175 ? -45.241  36.110  -58.493  0.86 33.90  ? 175  VAL B CG1   1 
ATOM   5116  C  CG1   B VAL B  1 175 ? -43.267  37.361  -60.374  0.14 38.90  ? 175  VAL B CG1   1 
ATOM   5117  C  CG2   A VAL B  1 175 ? -44.449  33.905  -57.724  0.86 12.92  ? 175  VAL B CG2   1 
ATOM   5118  C  CG2   B VAL B  1 175 ? -44.713  35.480  -59.613  0.14 37.07  ? 175  VAL B CG2   1 
ATOM   5119  N  N     A LYS B  1 176 ? -44.496  36.176  -61.804  0.86 33.29  ? 176  LYS B N     1 
ATOM   5120  N  N     B LYS B  1 176 ? -44.135  36.798  -63.692  0.14 43.10  ? 176  LYS B N     1 
ATOM   5121  C  CA    A LYS B  1 176 ? -44.428  37.257  -62.792  0.86 34.72  ? 176  LYS B CA    1 
ATOM   5122  C  CA    B LYS B  1 176 ? -43.891  37.845  -64.667  0.14 35.57  ? 176  LYS B CA    1 
ATOM   5123  C  C     A LYS B  1 176 ? -43.193  37.009  -63.667  0.86 34.47  ? 176  LYS B C     1 
ATOM   5124  C  C     B LYS B  1 176 ? -43.021  37.332  -65.810  0.14 25.78  ? 176  LYS B C     1 
ATOM   5125  O  O     A LYS B  1 176 ? -42.795  37.857  -64.470  0.86 33.38  ? 176  LYS B O     1 
ATOM   5126  O  O     B LYS B  1 176 ? -42.452  38.073  -66.602  0.14 2.00   ? 176  LYS B O     1 
ATOM   5127  C  CB    A LYS B  1 176 ? -44.377  38.643  -62.142  0.86 17.55  ? 176  LYS B CB    1 
ATOM   5128  C  CB    B LYS B  1 176 ? -43.224  39.053  -64.017  0.14 29.05  ? 176  LYS B CB    1 
ATOM   5129  C  CG    A LYS B  1 176 ? -45.549  38.949  -61.213  0.91 33.92  ? 176  LYS B CG    1 
ATOM   5130  C  CD    A LYS B  1 176 ? -45.743  40.452  -61.042  0.91 33.63  ? 176  LYS B CD    1 
ATOM   5131  C  CE    A LYS B  1 176 ? -46.554  40.775  -59.793  0.91 64.32  ? 176  LYS B CE    1 
ATOM   5132  N  NZ    A LYS B  1 176 ? -46.853  42.231  -59.679  0.91 73.73  ? 176  LYS B NZ    1 
ATOM   5133  N  N     A GLY B  1 177 ? -42.615  35.856  -63.506  0.86 48.93  ? 177  GLY B N     1 
ATOM   5134  N  N     B GLY B  1 177 ? -42.974  35.988  -65.788  0.14 37.17  ? 177  GLY B N     1 
ATOM   5135  C  CA    A GLY B  1 177 ? -41.436  35.532  -64.268  0.86 41.15  ? 177  GLY B CA    1 
ATOM   5136  C  CA    B GLY B  1 177 ? -42.287  35.106  -66.712  0.14 37.73  ? 177  GLY B CA    1 
ATOM   5137  C  C     A GLY B  1 177 ? -41.667  35.237  -65.745  0.86 21.52  ? 177  GLY B C     1 
ATOM   5138  C  C     B GLY B  1 177 ? -41.215  35.838  -67.486  0.14 43.70  ? 177  GLY B C     1 
ATOM   5139  O  O     A GLY B  1 177 ? -40.735  35.422  -66.529  0.86 51.48  ? 177  GLY B O     1 
ATOM   5140  O  O     B GLY B  1 177 ? -40.678  35.325  -68.469  0.14 44.68  ? 177  GLY B O     1 
ATOM   5141  N  N     A GLY B  1 178 ? -42.911  34.754  -66.023  0.86 35.66  ? 178  GLY B N     1 
ATOM   5142  N  N     B GLY B  1 178 ? -40.899  37.071  -67.051  0.14 45.24  ? 178  GLY B N     1 
ATOM   5143  C  CA    A GLY B  1 178 ? -43.405  34.247  -67.313  0.86 51.73  ? 178  GLY B CA    1 
ATOM   5144  C  CA    B GLY B  1 178 ? -39.916  37.816  -67.815  0.14 41.06  ? 178  GLY B CA    1 
ATOM   5145  C  C     A GLY B  1 178 ? -43.520  35.218  -68.479  0.86 46.48  ? 178  GLY B C     1 
ATOM   5146  C  C     B GLY B  1 178 ? -40.038  37.215  -69.187  0.14 44.47  ? 178  GLY B C     1 
ATOM   5147  O  O     A GLY B  1 178 ? -44.542  35.305  -69.159  0.86 84.99  ? 178  GLY B O     1 
ATOM   5148  O  O     B GLY B  1 178 ? -39.351  36.247  -69.501  0.14 48.34  ? 178  GLY B O     1 
ATOM   5149  N  N     A TYR B  1 179 ? -42.477  35.933  -68.702  0.86 45.12  ? 179  TYR B N     1 
ATOM   5150  N  N     B TYR B  1 179 ? -40.883  37.778  -69.989  0.14 34.26  ? 179  TYR B N     1 
ATOM   5151  C  CA    A TYR B  1 179 ? -42.590  36.767  -69.861  0.86 50.04  ? 179  TYR B CA    1 
ATOM   5152  C  CA    B TYR B  1 179 ? -41.151  37.031  -71.181  0.14 38.51  ? 179  TYR B CA    1 
ATOM   5153  C  C     A TYR B  1 179 ? -41.343  36.660  -70.655  0.86 54.14  ? 179  TYR B C     1 
ATOM   5154  C  C     B TYR B  1 179 ? -40.272  37.182  -72.362  0.14 40.46  ? 179  TYR B C     1 
ATOM   5155  O  O     A TYR B  1 179 ? -40.257  37.110  -70.329  0.86 65.77  ? 179  TYR B O     1 
ATOM   5156  O  O     B TYR B  1 179 ? -39.536  38.163  -72.552  0.14 42.09  ? 179  TYR B O     1 
ATOM   5157  C  CB    A TYR B  1 179 ? -42.967  38.177  -69.446  0.86 19.96  ? 179  TYR B CB    1 
ATOM   5158  C  CB    B TYR B  1 179 ? -42.579  37.261  -71.568  0.14 37.59  ? 179  TYR B CB    1 
ATOM   5159  C  CG    A TYR B  1 179 ? -43.611  39.060  -70.528  0.86 43.09  ? 179  TYR B CG    1 
ATOM   5160  C  CG    B TYR B  1 179 ? -43.293  36.080  -71.076  0.14 41.80  ? 179  TYR B CG    1 
ATOM   5161  C  CD1   A TYR B  1 179 ? -44.895  38.850  -71.048  0.86 49.76  ? 179  TYR B CD1   1 
ATOM   5162  C  CD1   B TYR B  1 179 ? -44.123  36.169  -69.982  0.14 43.47  ? 179  TYR B CD1   1 
ATOM   5163  C  CD2   A TYR B  1 179 ? -42.885  40.144  -70.986  0.86 63.87  ? 179  TYR B CD2   1 
ATOM   5164  C  CD2   B TYR B  1 179 ? -43.109  34.847  -71.706  0.14 40.91  ? 179  TYR B CD2   1 
ATOM   5165  C  CE1   A TYR B  1 179 ? -45.438  39.731  -71.967  0.86 38.26  ? 179  TYR B CE1   1 
ATOM   5166  C  CE1   B TYR B  1 179 ? -44.723  35.038  -69.516  0.14 43.07  ? 179  TYR B CE1   1 
ATOM   5167  C  CE2   A TYR B  1 179 ? -43.403  41.011  -71.907  0.86 50.54  ? 179  TYR B CE2   1 
ATOM   5168  C  CE2   B TYR B  1 179 ? -43.710  33.708  -71.225  0.14 37.75  ? 179  TYR B CE2   1 
ATOM   5169  C  CZ    A TYR B  1 179 ? -44.684  40.803  -72.379  0.86 44.23  ? 179  TYR B CZ    1 
ATOM   5170  C  CZ    B TYR B  1 179 ? -44.516  33.821  -70.122  0.14 37.57  ? 179  TYR B CZ    1 
ATOM   5171  O  OH    A TYR B  1 179 ? -45.226  41.699  -73.264  0.86 51.21  ? 179  TYR B OH    1 
ATOM   5172  O  OH    B TYR B  1 179 ? -45.144  32.697  -69.636  0.14 39.80  ? 179  TYR B OH    1 
ATOM   5173  N  N     A PHE B  1 180 ? -41.627  36.021  -71.755  0.86 47.43  ? 180  PHE B N     1 
ATOM   5174  N  N     B PHE B  1 180 ? -40.402  36.116  -73.154  0.14 38.51  ? 180  PHE B N     1 
ATOM   5175  C  CA    A PHE B  1 180 ? -40.707  35.806  -72.834  0.86 22.71  ? 180  PHE B CA    1 
ATOM   5176  C  CA    B PHE B  1 180 ? -39.747  35.893  -74.419  0.14 37.70  ? 180  PHE B CA    1 
ATOM   5177  C  C     A PHE B  1 180 ? -39.483  34.970  -72.506  0.86 29.08  ? 180  PHE B C     1 
ATOM   5178  C  C     B PHE B  1 180 ? -38.249  35.639  -74.262  0.14 37.25  ? 180  PHE B C     1 
ATOM   5179  O  O     A PHE B  1 180 ? -38.639  34.836  -73.400  0.86 44.97  ? 180  PHE B O     1 
ATOM   5180  C  CB    A PHE B  1 180 ? -40.352  37.135  -73.471  0.86 63.92  ? 180  PHE B CB    1 
ATOM   5181  C  CB    B PHE B  1 180 ? -39.982  37.068  -75.365  0.14 40.34  ? 180  PHE B CB    1 
ATOM   5182  C  CG    A PHE B  1 180 ? -41.493  37.850  -74.172  0.86 51.60  ? 180  PHE B CG    1 
ATOM   5183  C  CG    B PHE B  1 180 ? -41.389  37.579  -75.568  0.14 40.01  ? 180  PHE B CG    1 
ATOM   5184  C  CD1   A PHE B  1 180 ? -42.816  37.468  -74.037  0.86 32.13  ? 180  PHE B CD1   1 
ATOM   5185  C  CD1   B PHE B  1 180 ? -41.520  38.703  -76.300  0.14 41.66  ? 180  PHE B CD1   1 
ATOM   5186  C  CD2   A PHE B  1 180 ? -41.192  38.934  -74.955  0.86 55.48  ? 180  PHE B CD2   1 
ATOM   5187  C  CD2   B PHE B  1 180 ? -42.521  36.967  -75.058  0.14 39.44  ? 180  PHE B CD2   1 
ATOM   5188  C  CE1   A PHE B  1 180 ? -43.831  38.184  -74.666  0.86 55.26  ? 180  PHE B CE1   1 
ATOM   5189  C  CE1   B PHE B  1 180 ? -42.740  39.244  -76.571  0.14 41.66  ? 180  PHE B CE1   1 
ATOM   5190  C  CE2   A PHE B  1 180 ? -42.177  39.672  -75.590  0.86 61.35  ? 180  PHE B CE2   1 
ATOM   5191  C  CE2   B PHE B  1 180 ? -43.766  37.499  -75.337  0.14 43.95  ? 180  PHE B CE2   1 
ATOM   5192  C  CZ    A PHE B  1 180 ? -43.492  39.282  -75.442  0.86 60.35  ? 180  PHE B CZ    1 
ATOM   5193  C  CZ    B PHE B  1 180 ? -43.859  38.637  -76.095  0.14 42.78  ? 180  PHE B CZ    1 
ATOM   5194  N  N     A PRO B  1 181 ? -39.244  34.368  -71.327  1.00 26.62  ? 181  PRO B N     1 
ATOM   5195  C  CA    A PRO B  1 181 ? -38.054  33.455  -71.335  1.00 32.27  ? 181  PRO B CA    1 
ATOM   5196  C  C     A PRO B  1 181 ? -38.092  32.452  -72.512  1.00 43.97  ? 181  PRO B C     1 
ATOM   5197  O  O     A PRO B  1 181 ? -39.147  32.004  -72.945  1.00 57.42  ? 181  PRO B O     1 
ATOM   5198  C  CB    A PRO B  1 181 ? -38.046  32.901  -69.945  1.00 43.71  ? 181  PRO B CB    1 
ATOM   5199  C  CG    A PRO B  1 181 ? -38.465  34.074  -69.134  1.00 26.23  ? 181  PRO B CG    1 
ATOM   5200  C  CD    A PRO B  1 181 ? -39.233  35.025  -70.010  1.00 56.76  ? 181  PRO B CD    1 
ATOM   5201  N  N     . VAL B  1 182 ? -36.923  32.124  -73.004  1.00 37.03  ? 182  VAL B N     1 
ATOM   5202  C  CA    . VAL B  1 182 ? -36.823  31.151  -74.068  1.00 40.48  ? 182  VAL B CA    1 
ATOM   5203  C  C     . VAL B  1 182 ? -37.028  29.817  -73.448  1.00 44.93  ? 182  VAL B C     1 
ATOM   5204  O  O     . VAL B  1 182 ? -36.677  29.620  -72.288  1.00 44.13  ? 182  VAL B O     1 
ATOM   5205  C  CB    . VAL B  1 182 ? -35.433  31.134  -74.718  1.00 40.71  ? 182  VAL B CB    1 
ATOM   5206  C  CG1   . VAL B  1 182 ? -35.307  32.281  -75.710  1.00 28.75  ? 182  VAL B CG1   1 
ATOM   5207  C  CG2   . VAL B  1 182 ? -34.321  31.213  -73.672  1.00 60.63  ? 182  VAL B CG2   1 
ATOM   5208  N  N     . PRO B  1 183 ? -37.563  28.885  -74.174  1.00 40.42  ? 183  PRO B N     1 
ATOM   5209  C  CA    . PRO B  1 183 ? -37.613  27.520  -73.651  1.00 40.04  ? 183  PRO B CA    1 
ATOM   5210  C  C     . PRO B  1 183 ? -36.203  27.141  -73.215  1.00 47.29  ? 183  PRO B C     1 
ATOM   5211  O  O     . PRO B  1 183 ? -35.196  27.708  -73.713  1.00 52.12  ? 183  PRO B O     1 
ATOM   5212  C  CB    . PRO B  1 183 ? -38.024  26.725  -74.871  1.00 44.70  ? 183  PRO B CB    1 
ATOM   5213  C  CG    . PRO B  1 183 ? -39.024  27.651  -75.517  1.00 48.23  ? 183  PRO B CG    1 
ATOM   5214  C  CD    . PRO B  1 183 ? -38.322  28.995  -75.429  1.00 46.17  ? 183  PRO B CD    1 
ATOM   5215  N  N     . PRO B  1 184 ? -36.087  26.183  -72.299  1.00 40.39  ? 184  PRO B N     1 
ATOM   5216  C  CA    . PRO B  1 184 ? -37.178  25.458  -71.654  1.00 45.37  ? 184  PRO B CA    1 
ATOM   5217  C  C     . PRO B  1 184 ? -37.942  26.133  -70.560  1.00 41.11  ? 184  PRO B C     1 
ATOM   5218  O  O     . PRO B  1 184 ? -38.897  25.528  -70.070  1.00 53.79  ? 184  PRO B O     1 
ATOM   5219  C  CB    . PRO B  1 184 ? -36.480  24.203  -71.159  1.00 53.66  ? 184  PRO B CB    1 
ATOM   5220  C  CG    . PRO B  1 184 ? -35.158  24.751  -70.722  1.00 27.49  ? 184  PRO B CG    1 
ATOM   5221  C  CD    . PRO B  1 184 ? -34.777  25.704  -71.827  1.00 43.50  ? 184  PRO B CD    1 
ATOM   5222  N  N     . VAL B  1 185 ? -37.573  27.353  -70.313  1.00 35.00  ? 185  VAL B N     1 
ATOM   5223  C  CA    . VAL B  1 185 ? -38.342  27.966  -69.217  1.00 32.37  ? 185  VAL B CA    1 
ATOM   5224  C  C     . VAL B  1 185 ? -39.832  28.023  -69.599  1.00 34.91  ? 185  VAL B C     1 
ATOM   5225  O  O     . VAL B  1 185 ? -40.716  27.712  -68.791  1.00 47.08  ? 185  VAL B O     1 
ATOM   5226  C  CB    . VAL B  1 185 ? -37.832  29.389  -68.927  1.00 23.18  ? 185  VAL B CB    1 
ATOM   5227  C  CG1   . VAL B  1 185 ? -38.594  30.011  -67.760  1.00 18.64  ? 185  VAL B CG1   1 
ATOM   5228  C  CG2   . VAL B  1 185 ? -36.329  29.353  -68.638  1.00 28.43  ? 185  VAL B CG2   1 
ATOM   5229  N  N     . ASP B  1 186 ? -40.072  28.346  -70.884  1.00 30.35  ? 186  ASP B N     1 
ATOM   5230  C  CA    . ASP B  1 186 ? -41.377  28.441  -71.520  1.00 34.21  ? 186  ASP B CA    1 
ATOM   5231  C  C     . ASP B  1 186 ? -41.695  27.055  -72.124  1.00 31.87  ? 186  ASP B C     1 
ATOM   5232  O  O     . ASP B  1 186 ? -41.316  26.725  -73.256  1.00 52.47  ? 186  ASP B O     1 
ATOM   5233  C  CB    . ASP B  1 186 ? -41.331  29.539  -72.601  1.00 33.36  ? 186  ASP B CB    1 
ATOM   5234  C  CG    . ASP B  1 186 ? -42.548  29.529  -73.527  1.00 42.27  ? 186  ASP B CG    1 
ATOM   5235  O  OD1   . ASP B  1 186 ? -42.421  30.080  -74.636  1.00 41.44  ? 186  ASP B OD1   1 
ATOM   5236  O  OD2   . ASP B  1 186 ? -43.619  28.969  -73.181  1.00 46.84  ? 186  ASP B OD2   1 
ATOM   5237  N  N     . SER B  1 187 ? -42.422  26.247  -71.372  1.00 42.09  ? 187  SER B N     1 
ATOM   5238  C  CA    . SER B  1 187 ? -42.760  24.913  -71.821  1.00 37.33  ? 187  SER B CA    1 
ATOM   5239  C  C     . SER B  1 187 ? -43.788  24.902  -72.926  1.00 45.18  ? 187  SER B C     1 
ATOM   5240  O  O     . SER B  1 187 ? -44.305  23.844  -73.246  1.00 43.09  ? 187  SER B O     1 
ATOM   5241  C  CB    . SER B  1 187 ? -43.320  24.101  -70.638  1.00 39.47  ? 187  SER B CB    1 
ATOM   5242  O  OG    . SER B  1 187 ? -44.681  24.417  -70.414  1.00 44.42  ? 187  SER B OG    1 
ATOM   5243  N  N     . ALA B  1 188 ? -44.123  26.039  -73.531  1.00 36.65  ? 188  ALA B N     1 
ATOM   5244  C  CA    . ALA B  1 188 ? -45.290  25.945  -74.429  1.00 24.86  ? 188  ALA B CA    1 
ATOM   5245  C  C     . ALA B  1 188 ? -45.192  26.451  -75.877  1.00 37.91  ? 188  ALA B C     1 
ATOM   5246  O  O     . ALA B  1 188 ? -46.216  26.840  -76.432  1.00 24.07  ? 188  ALA B O     1 
ATOM   5247  C  CB    . ALA B  1 188 ? -46.449  26.646  -73.741  1.00 12.58  ? 188  ALA B CB    1 
ATOM   5248  N  N     . GLN B  1 189 ? -44.025  26.442  -76.506  1.00 31.41  ? 189  GLN B N     1 
ATOM   5249  C  CA    . GLN B  1 189 ? -43.988  26.918  -77.888  1.00 32.34  ? 189  GLN B CA    1 
ATOM   5250  C  C     . GLN B  1 189 ? -44.864  26.090  -78.775  1.00 33.31  ? 189  GLN B C     1 
ATOM   5251  O  O     . GLN B  1 189 ? -45.808  26.589  -79.389  1.00 50.86  ? 189  GLN B O     1 
ATOM   5252  C  CB    . GLN B  1 189 ? -42.565  26.881  -78.429  1.00 16.49  ? 189  GLN B CB    1 
ATOM   5253  C  CG    . GLN B  1 189 ? -41.873  28.228  -78.532  1.00 40.86  ? 189  GLN B CG    1 
ATOM   5254  C  CD    . GLN B  1 189 ? -42.521  29.081  -79.588  1.00 32.32  ? 189  GLN B CD    1 
ATOM   5255  O  OE1   . GLN B  1 189 ? -42.671  28.676  -80.738  1.00 40.60  ? 189  GLN B OE1   1 
ATOM   5256  N  NE2   . GLN B  1 189 ? -42.994  30.303  -79.415  1.00 69.68  ? 189  GLN B NE2   1 
ATOM   5257  N  N     . ASP B  1 190 ? -44.524  24.813  -78.823  1.00 39.38  ? 190  ASP B N     1 
ATOM   5258  C  CA    . ASP B  1 190 ? -45.221  23.865  -79.652  1.00 41.62  ? 190  ASP B CA    1 
ATOM   5259  C  C     . ASP B  1 190 ? -46.740  23.858  -79.490  1.00 36.71  ? 190  ASP B C     1 
ATOM   5260  O  O     . ASP B  1 190 ? -47.474  23.744  -80.479  1.00 35.93  ? 190  ASP B O     1 
ATOM   5261  C  CB    . ASP B  1 190 ? -44.602  22.496  -79.424  1.00 27.34  ? 190  ASP B CB    1 
ATOM   5262  C  CG    . ASP B  1 190 ? -43.277  22.342  -80.143  1.00 33.67  ? 190  ASP B CG    1 
ATOM   5263  O  OD1   . ASP B  1 190 ? -42.538  21.395  -79.816  1.00 41.76  ? 190  ASP B OD1   1 
ATOM   5264  O  OD2   . ASP B  1 190 ? -42.990  23.151  -81.066  1.00 47.59  ? 190  ASP B OD2   1 
ATOM   5265  N  N     . ILE B  1 191 ? -47.186  24.064  -78.252  1.00 28.50  ? 191  ILE B N     1 
ATOM   5266  C  CA    . ILE B  1 191 ? -48.601  24.096  -77.909  1.00 34.37  ? 191  ILE B CA    1 
ATOM   5267  C  C     . ILE B  1 191 ? -49.249  25.317  -78.548  1.00 34.46  ? 191  ILE B C     1 
ATOM   5268  O  O     . ILE B  1 191 ? -50.174  25.191  -79.354  1.00 38.10  ? 191  ILE B O     1 
ATOM   5269  C  CB    . ILE B  1 191 ? -48.808  24.142  -76.364  1.00 42.93  ? 191  ILE B CB    1 
ATOM   5270  C  CG1   . ILE B  1 191 ? -47.690  23.336  -75.667  1.00 71.95  ? 191  ILE B CG1   1 
ATOM   5271  C  CG2   . ILE B  1 191 ? -50.179  23.567  -76.003  1.00 14.97  ? 191  ILE B CG2   1 
ATOM   5272  C  CD1   . ILE B  1 191 ? -47.846  23.140  -74.141  1.00 46.71  ? 191  ILE B CD1   1 
ATOM   5273  N  N     A ARG B  1 192 ? -48.747  26.497  -78.202  0.83 26.42  ? 192  ARG B N     1 
ATOM   5274  C  CA    A ARG B  1 192 ? -49.290  27.731  -78.755  0.83 26.13  ? 192  ARG B CA    1 
ATOM   5275  C  C     A ARG B  1 192 ? -49.277  27.680  -80.281  0.83 26.89  ? 192  ARG B C     1 
ATOM   5276  O  O     A ARG B  1 192 ? -50.299  27.928  -80.937  0.83 26.85  ? 192  ARG B O     1 
ATOM   5277  C  CB    A ARG B  1 192 ? -48.519  28.945  -78.246  0.83 25.41  ? 192  ARG B CB    1 
ATOM   5278  C  CG    A ARG B  1 192 ? -48.667  29.199  -76.737  0.83 27.01  ? 192  ARG B CG    1 
ATOM   5279  C  CD    A ARG B  1 192 ? -48.122  30.573  -76.339  0.83 29.32  ? 192  ARG B CD    1 
ATOM   5280  N  NE    A ARG B  1 192 ? -46.825  30.881  -76.949  0.83 32.50  ? 192  ARG B NE    1 
ATOM   5281  C  CZ    A ARG B  1 192 ? -45.641  30.618  -76.396  0.83 33.88  ? 192  ARG B CZ    1 
ATOM   5282  N  NH1   A ARG B  1 192 ? -44.514  30.938  -77.031  0.83 36.72  ? 192  ARG B NH1   1 
ATOM   5283  N  NH2   A ARG B  1 192 ? -45.584  30.119  -75.174  0.83 31.85  ? 192  ARG B NH2   1 
ATOM   5284  N  N     . SER B  1 193 ? -48.149  27.279  -80.849  1.00 29.18  ? 193  SER B N     1 
ATOM   5285  C  CA    . SER B  1 193 ? -48.075  27.191  -82.295  1.00 33.25  ? 193  SER B CA    1 
ATOM   5286  C  C     . SER B  1 193 ? -49.196  26.334  -82.889  1.00 34.73  ? 193  SER B C     1 
ATOM   5287  O  O     . SER B  1 193 ? -49.708  26.661  -83.960  1.00 39.87  ? 193  SER B O     1 
ATOM   5288  C  CB    . SER B  1 193 ? -46.698  26.711  -82.751  1.00 33.28  ? 193  SER B CB    1 
ATOM   5289  O  OG    . SER B  1 193 ? -45.737  27.745  -82.620  1.00 40.66  ? 193  SER B OG    1 
ATOM   5290  N  N     . GLU B  1 194 ? -49.608  25.275  -82.188  1.00 25.14  ? 194  GLU B N     1 
ATOM   5291  C  CA    . GLU B  1 194 ? -50.706  24.417  -82.688  1.00 28.69  ? 194  GLU B CA    1 
ATOM   5292  C  C     . GLU B  1 194 ? -51.986  25.232  -82.655  1.00 37.89  ? 194  GLU B C     1 
ATOM   5293  O  O     . GLU B  1 194 ? -52.667  25.387  -83.683  1.00 34.33  ? 194  GLU B O     1 
ATOM   5294  C  CB    . GLU B  1 194 ? -50.910  23.155  -81.830  1.00 24.52  ? 194  GLU B CB    1 
ATOM   5295  C  CG    . GLU B  1 194 ? -50.370  21.861  -82.428  1.00 45.53  ? 194  GLU B CG    1 
ATOM   5296  C  CD    . GLU B  1 194 ? -51.133  21.393  -83.658  1.00 64.67  ? 194  GLU B CD    1 
ATOM   5297  O  OE1   . GLU B  1 194 ? -50.553  21.426  -84.770  1.00 84.79  ? 194  GLU B OE1   1 
ATOM   5298  O  OE2   . GLU B  1 194 ? -52.295  20.958  -83.510  1.00 71.98  ? 194  GLU B OE2   1 
ATOM   5299  N  N     . MET B  1 195 ? -52.284  25.788  -81.479  1.00 20.81  ? 195  MET B N     1 
ATOM   5300  C  CA    . MET B  1 195 ? -53.474  26.614  -81.317  1.00 30.29  ? 195  MET B CA    1 
ATOM   5301  C  C     . MET B  1 195 ? -53.520  27.617  -82.467  1.00 35.04  ? 195  MET B C     1 
ATOM   5302  O  O     . MET B  1 195 ? -54.559  27.803  -83.094  1.00 36.13  ? 195  MET B O     1 
ATOM   5303  C  CB    . MET B  1 195 ? -53.448  27.333  -79.974  1.00 14.94  ? 195  MET B CB    1 
ATOM   5304  C  CG    . MET B  1 195 ? -53.097  26.426  -78.803  1.00 26.05  ? 195  MET B CG    1 
ATOM   5305  S  SD    . MET B  1 195 ? -53.209  27.275  -77.218  1.00 39.20  ? 195  MET B SD    1 
ATOM   5306  C  CE    . MET B  1 195 ? -54.106  26.098  -76.262  1.00 42.92  ? 195  MET B CE    1 
ATOM   5307  N  N     . CYS B  1 196 ? -52.362  28.174  -82.814  1.00 22.49  ? 196  CYS B N     1 
ATOM   5308  C  CA    . CYS B  1 196 ? -52.310  29.117  -83.914  1.00 25.79  ? 196  CYS B CA    1 
ATOM   5309  C  C     . CYS B  1 196 ? -52.701  28.463  -85.224  1.00 28.56  ? 196  CYS B C     1 
ATOM   5310  O  O     . CYS B  1 196 ? -53.715  28.814  -85.808  1.00 43.44  ? 196  CYS B O     1 
ATOM   5311  C  CB    . CYS B  1 196 ? -50.938  29.752  -84.017  1.00 13.40  ? 196  CYS B CB    1 
ATOM   5312  S  SG    . CYS B  1 196 ? -50.617  30.879  -82.625  1.00 38.84  ? 196  CYS B SG    1 
ATOM   5313  N  N     . LEU B  1 197 ? -51.949  27.459  -85.644  1.00 27.92  ? 197  LEU B N     1 
ATOM   5314  C  CA    . LEU B  1 197 ? -52.245  26.763  -86.887  1.00 38.78  ? 197  LEU B CA    1 
ATOM   5315  C  C     . LEU B  1 197 ? -53.717  26.448  -87.001  1.00 34.02  ? 197  LEU B C     1 
ATOM   5316  O  O     . LEU B  1 197 ? -54.368  26.798  -87.994  1.00 47.94  ? 197  LEU B O     1 
ATOM   5317  C  CB    . LEU B  1 197 ? -51.478  25.452  -86.940  1.00 34.44  ? 197  LEU B CB    1 
ATOM   5318  C  CG    . LEU B  1 197 ? -49.957  25.522  -86.826  1.00 34.29  ? 197  LEU B CG    1 
ATOM   5319  C  CD1   . LEU B  1 197 ? -49.399  24.133  -86.676  1.00 49.90  ? 197  LEU B CD1   1 
ATOM   5320  C  CD2   . LEU B  1 197 ? -49.387  26.188  -88.047  1.00 26.31  ? 197  LEU B CD2   1 
ATOM   5321  N  N     . VAL B  1 198 ? -54.241  25.836  -85.946  1.00 29.67  ? 198  VAL B N     1 
ATOM   5322  C  CA    . VAL B  1 198 ? -55.645  25.439  -85.886  1.00 41.70  ? 198  VAL B CA    1 
ATOM   5323  C  C     . VAL B  1 198 ? -56.583  26.607  -86.022  1.00 39.70  ? 198  VAL B C     1 
ATOM   5324  O  O     . VAL B  1 198 ? -57.467  26.581  -86.872  1.00 44.44  ? 198  VAL B O     1 
ATOM   5325  C  CB    . VAL B  1 198 ? -55.960  24.695  -84.596  1.00 48.08  ? 198  VAL B CB    1 
ATOM   5326  C  CG1   . VAL B  1 198 ? -57.450  24.398  -84.505  1.00 42.26  ? 198  VAL B CG1   1 
ATOM   5327  C  CG2   . VAL B  1 198 ? -55.155  23.412  -84.555  1.00 23.76  ? 198  VAL B CG2   1 
ATOM   5328  N  N     . MET B  1 199 ? -56.405  27.613  -85.171  1.00 36.46  ? 199  MET B N     1 
ATOM   5329  C  CA    . MET B  1 199 ? -57.221  28.826  -85.226  1.00 39.73  ? 199  MET B CA    1 
ATOM   5330  C  C     . MET B  1 199 ? -57.311  29.366  -86.654  1.00 43.35  ? 199  MET B C     1 
ATOM   5331  O  O     . MET B  1 199 ? -58.389  29.730  -87.117  1.00 48.81  ? 199  MET B O     1 
ATOM   5332  C  CB    . MET B  1 199 ? -56.637  29.900  -84.316  1.00 16.40  ? 199  MET B CB    1 
ATOM   5333  C  CG    . MET B  1 199 ? -56.944  29.642  -82.888  1.00 24.66  ? 199  MET B CG    1 
ATOM   5334  S  SD    . MET B  1 199 ? -56.238  30.896  -81.877  1.00 34.41  ? 199  MET B SD    1 
ATOM   5335  C  CE    . MET B  1 199 ? -56.791  30.385  -80.260  1.00 27.94  ? 199  MET B CE    1 
ATOM   5336  N  N     . GLU B  1 200 ? -56.180  29.391  -87.352  1.00 23.83  ? 200  GLU B N     1 
ATOM   5337  C  CA    . GLU B  1 200 ? -56.149  29.869  -88.725  1.00 43.44  ? 200  GLU B CA    1 
ATOM   5338  C  C     . GLU B  1 200 ? -56.947  28.971  -89.636  1.00 44.69  ? 200  GLU B C     1 
ATOM   5339  O  O     . GLU B  1 200 ? -57.708  29.470  -90.466  1.00 62.29  ? 200  GLU B O     1 
ATOM   5340  C  CB    . GLU B  1 200 ? -54.718  30.025  -89.229  1.00 25.77  ? 200  GLU B CB    1 
ATOM   5341  C  CG    . GLU B  1 200 ? -53.984  31.101  -88.455  1.00 57.85  ? 200  GLU B CG    1 
ATOM   5342  C  CD    . GLU B  1 200 ? -52.956  31.830  -89.276  1.00 54.66  ? 200  GLU B CD    1 
ATOM   5343  O  OE1   . GLU B  1 200 ? -52.788  33.054  -89.049  1.00 40.25  ? 200  GLU B OE1   1 
ATOM   5344  O  OE2   . GLU B  1 200 ? -52.326  31.174  -90.138  1.00 54.15  ? 200  GLU B OE2   1 
ATOM   5345  N  N     . GLN B  1 201 ? -56.785  27.658  -89.471  1.00 33.36  ? 201  GLN B N     1 
ATOM   5346  C  CA    . GLN B  1 201 ? -57.536  26.681  -90.267  1.00 47.07  ? 201  GLN B CA    1 
ATOM   5347  C  C     . GLN B  1 201 ? -59.036  26.872  -90.050  1.00 43.28  ? 201  GLN B C     1 
ATOM   5348  O  O     . GLN B  1 201 ? -59.856  26.458  -90.867  1.00 68.10  ? 201  GLN B O     1 
ATOM   5349  C  CB    . GLN B  1 201 ? -57.221  25.263  -89.826  1.00 28.30  ? 201  GLN B CB    1 
ATOM   5350  C  CG    . GLN B  1 201 ? -55.786  24.846  -89.914  0.55 57.65  ? 201  GLN B CG    1 
ATOM   5351  C  CD    . GLN B  1 201 ? -55.537  23.595  -89.087  0.55 58.42  ? 201  GLN B CD    1 
ATOM   5352  O  OE1   . GLN B  1 201 ? -56.441  22.773  -88.889  0.55 30.38  ? 201  GLN B OE1   1 
ATOM   5353  N  NE2   . GLN B  1 201 ? -54.320  23.464  -88.567  0.55 55.14  ? 201  GLN B NE2   1 
ATOM   5354  N  N     . MET B  1 202 ? -59.385  27.420  -88.896  1.00 39.65  ? 202  MET B N     1 
ATOM   5355  C  CA    . MET B  1 202 ? -60.773  27.666  -88.557  1.00 47.87  ? 202  MET B CA    1 
ATOM   5356  C  C     . MET B  1 202 ? -61.185  29.098  -88.876  1.00 48.62  ? 202  MET B C     1 
ATOM   5357  O  O     . MET B  1 202 ? -62.114  29.634  -88.271  1.00 57.39  ? 202  MET B O     1 
ATOM   5358  C  CB    . MET B  1 202 ? -61.024  27.348  -87.081  1.00 35.73  ? 202  MET B CB    1 
ATOM   5359  C  CG    . MET B  1 202 ? -61.023  25.852  -86.796  1.00 46.33  ? 202  MET B CG    1 
ATOM   5360  S  SD    . MET B  1 202 ? -61.526  25.483  -85.136  1.00 49.45  ? 202  MET B SD    1 
ATOM   5361  C  CE    . MET B  1 202 ? -63.290  25.430  -85.336  1.00 36.52  ? 202  MET B CE    1 
ATOM   5362  N  N     . GLY B  1 203 ? -60.466  29.729  -89.797  1.00 42.66  ? 203  GLY B N     1 
ATOM   5363  C  CA    . GLY B  1 203 ? -60.807  31.085  -90.181  1.00 53.61  ? 203  GLY B CA    1 
ATOM   5364  C  C     . GLY B  1 203 ? -60.189  32.286  -89.483  1.00 43.44  ? 203  GLY B C     1 
ATOM   5365  O  O     . GLY B  1 203 ? -60.238  33.390  -90.032  1.00 63.29  ? 203  GLY B O     1 
ATOM   5366  N  N     . LEU B  1 204 ? -59.694  32.129  -88.260  1.00 41.50  ? 204  LEU B N     1 
ATOM   5367  C  CA    . LEU B  1 204 ? -59.070  33.264  -87.584  1.00 45.63  ? 204  LEU B CA    1 
ATOM   5368  C  C     . LEU B  1 204 ? -57.725  33.639  -88.223  1.00 45.62  ? 204  LEU B C     1 
ATOM   5369  O  O     . LEU B  1 204 ? -57.169  32.881  -89.047  1.00 42.46  ? 204  LEU B O     1 
ATOM   5370  C  CB    . LEU B  1 204 ? -58.879  32.984  -86.092  1.00 27.74  ? 204  LEU B CB    1 
ATOM   5371  C  CG    . LEU B  1 204 ? -60.121  33.248  -85.243  1.00 47.12  ? 204  LEU B CG    1 
ATOM   5372  C  CD1   . LEU B  1 204 ? -61.166  32.210  -85.532  1.00 46.32  ? 204  LEU B CD1   1 
ATOM   5373  C  CD2   . LEU B  1 204 ? -59.764  33.240  -83.767  1.00 51.90  ? 204  LEU B CD2   1 
ATOM   5374  N  N     . VAL B  1 205 ? -57.261  34.855  -87.925  1.00 40.42  ? 205  VAL B N     1 
ATOM   5375  C  CA    . VAL B  1 205 ? -55.975  35.319  -88.436  1.00 35.46  ? 205  VAL B CA    1 
ATOM   5376  C  C     . VAL B  1 205 ? -55.092  35.671  -87.259  1.00 46.94  ? 205  VAL B C     1 
ATOM   5377  O  O     . VAL B  1 205 ? -55.385  36.585  -86.469  1.00 39.70  ? 205  VAL B O     1 
ATOM   5378  C  CB    . VAL B  1 205 ? -56.106  36.498  -89.401  1.00 35.36  ? 205  VAL B CB    1 
ATOM   5379  C  CG1   . VAL B  1 205 ? -54.764  37.118  -89.655  1.00 24.39  ? 205  VAL B CG1   1 
ATOM   5380  C  CG2   . VAL B  1 205 ? -56.632  36.003  -90.707  1.00 40.98  ? 205  VAL B CG2   1 
ATOM   5381  N  N     . VAL B  1 206 ? -54.015  34.906  -87.145  1.00 42.76  ? 206  VAL B N     1 
ATOM   5382  C  CA    . VAL B  1 206 ? -53.092  35.054  -86.045  1.00 44.60  ? 206  VAL B CA    1 
ATOM   5383  C  C     . VAL B  1 206 ? -51.995  36.043  -86.315  1.00 36.42  ? 206  VAL B C     1 
ATOM   5384  O  O     . VAL B  1 206 ? -51.268  35.926  -87.305  1.00 53.24  ? 206  VAL B O     1 
ATOM   5385  C  CB    . VAL B  1 206 ? -52.475  33.695  -85.674  1.00 40.00  ? 206  VAL B CB    1 
ATOM   5386  C  CG1   . VAL B  1 206 ? -51.654  33.815  -84.409  1.00 46.67  ? 206  VAL B CG1   1 
ATOM   5387  C  CG2   . VAL B  1 206 ? -53.565  32.684  -85.469  1.00 47.94  ? 206  VAL B CG2   1 
ATOM   5388  N  N     . GLU B  1 207 ? -51.893  37.031  -85.435  1.00 34.80  ? 207  GLU B N     1 
ATOM   5389  C  CA    . GLU B  1 207 ? -50.854  38.039  -85.566  1.00 46.16  ? 207  GLU B CA    1 
ATOM   5390  C  C     . GLU B  1 207 ? -49.624  37.632  -84.791  1.00 45.62  ? 207  GLU B C     1 
ATOM   5391  O  O     . GLU B  1 207 ? -48.497  37.943  -85.195  1.00 60.74  ? 207  GLU B O     1 
ATOM   5392  C  CB    . GLU B  1 207 ? -51.365  39.415  -85.144  1.00 42.46  ? 207  GLU B CB    1 
ATOM   5393  C  CG    . GLU B  1 207 ? -52.297  39.994  -86.207  0.69 39.59  ? 207  GLU B CG    1 
ATOM   5394  C  CD    . GLU B  1 207 ? -52.909  41.337  -85.856  0.69 49.86  ? 207  GLU B CD    1 
ATOM   5395  O  OE1   . GLU B  1 207 ? -52.915  41.733  -84.666  0.69 58.93  ? 207  GLU B OE1   1 
ATOM   5396  O  OE2   . GLU B  1 207 ? -53.411  41.989  -86.794  0.69 56.50  ? 207  GLU B OE2   1 
ATOM   5397  N  N     . ALA B  1 208 ? -49.842  36.850  -83.734  1.00 52.51  ? 208  ALA B N     1 
ATOM   5398  C  CA    . ALA B  1 208 ? -48.741  36.384  -82.904  1.00 58.52  ? 208  ALA B CA    1 
ATOM   5399  C  C     . ALA B  1 208 ? -49.185  35.627  -81.667  1.00 53.16  ? 208  ALA B C     1 
ATOM   5400  O  O     . ALA B  1 208 ? -50.262  35.890  -81.156  1.00 61.16  ? 208  ALA B O     1 
ATOM   5401  C  CB    . ALA B  1 208 ? -47.971  37.561  -82.459  1.00 31.68  ? 208  ALA B CB    1 
ATOM   5402  N  N     A HIS B  1 209 ? -48.157  35.032  -81.025  1.00 43.05  ? 209  HIS B N     1 
ATOM   5403  C  CA    A HIS B  1 209 ? -48.266  34.285  -79.755  1.00 40.36  ? 209  HIS B CA    1 
ATOM   5404  C  C     A HIS B  1 209 ? -47.026  34.404  -78.879  1.00 31.48  ? 209  HIS B C     1 
ATOM   5405  O  O     A HIS B  1 209 ? -45.895  34.539  -79.362  1.00 27.72  ? 209  HIS B O     1 
ATOM   5406  C  CB    A HIS B  1 209 ? -48.631  32.797  -79.940  1.00 42.81  ? 209  HIS B CB    1 
ATOM   5407  C  CG    A HIS B  1 209 ? -47.481  31.896  -80.294  1.00 33.90  ? 209  HIS B CG    1 
ATOM   5408  N  ND1   A HIS B  1 209 ? -46.407  31.689  -79.457  1.00 42.01  ? 209  HIS B ND1   1 
ATOM   5409  C  CD2   A HIS B  1 209 ? -47.299  31.065  -81.351  1.00 45.58  ? 209  HIS B CD2   1 
ATOM   5410  C  CE1   A HIS B  1 209 ? -45.618  30.765  -79.978  1.00 56.86  ? 209  HIS B CE1   1 
ATOM   5411  N  NE2   A HIS B  1 209 ? -46.136  30.369  -81.127  1.00 26.36  ? 209  HIS B NE2   1 
ATOM   5412  N  N     A HIS B  1 210 ? -47.244  34.264  -77.582  0.86 11.56  ? 210  HIS B N     1 
ATOM   5413  N  N     B HIS B  1 210 ? -48.688  34.193  -78.076  0.14 35.02  ? 210  HIS B N     1 
ATOM   5414  C  CA    A HIS B  1 210 ? -46.161  34.385  -76.626  0.86 20.98  ? 210  HIS B CA    1 
ATOM   5415  C  CA    B HIS B  1 210 ? -47.659  34.872  -77.288  0.14 40.17  ? 210  HIS B CA    1 
ATOM   5416  C  C     A HIS B  1 210 ? -46.582  33.905  -75.244  0.86 19.61  ? 210  HIS B C     1 
ATOM   5417  C  C     B HIS B  1 210 ? -47.868  34.659  -75.769  0.14 43.32  ? 210  HIS B C     1 
ATOM   5418  O  O     A HIS B  1 210 ? -47.775  33.787  -74.958  0.86 19.08  ? 210  HIS B O     1 
ATOM   5419  O  O     B HIS B  1 210 ? -48.995  34.689  -75.267  0.14 38.03  ? 210  HIS B O     1 
ATOM   5420  C  CB    A HIS B  1 210 ? -45.761  35.858  -76.528  0.86 9.46   ? 210  HIS B CB    1 
ATOM   5421  C  CB    B HIS B  1 210 ? -47.629  36.353  -77.607  0.14 34.06  ? 210  HIS B CB    1 
ATOM   5422  C  CG    A HIS B  1 210 ? -46.873  36.776  -76.098  0.98 28.50  ? 210  HIS B CG    1 
ATOM   5423  N  ND1   A HIS B  1 210 ? -47.069  37.147  -74.787  0.98 26.21  ? 210  HIS B ND1   1 
ATOM   5424  C  CD2   A HIS B  1 210 ? -47.820  37.430  -76.816  0.98 21.52  ? 210  HIS B CD2   1 
ATOM   5425  C  CE1   A HIS B  1 210 ? -48.084  37.991  -74.712  0.98 23.01  ? 210  HIS B CE1   1 
ATOM   5426  N  NE2   A HIS B  1 210 ? -48.557  38.182  -75.930  0.98 36.87  ? 210  HIS B NE2   1 
ATOM   5427  N  N     A HIS B  1 211 ? -45.607  33.595  -74.396  0.86 19.02  ? 211  HIS B N     1 
ATOM   5428  N  N     B HIS B  1 211 ? -46.769  34.436  -75.035  0.14 38.56  ? 211  HIS B N     1 
ATOM   5429  C  CA    A HIS B  1 211 ? -45.944  33.213  -73.042  0.86 20.46  ? 211  HIS B CA    1 
ATOM   5430  C  CA    B HIS B  1 211 ? -46.740  34.130  -73.600  0.14 37.60  ? 211  HIS B CA    1 
ATOM   5431  C  C     A HIS B  1 211 ? -46.420  34.521  -72.419  0.86 17.00  ? 211  HIS B C     1 
ATOM   5432  C  C     B HIS B  1 211 ? -46.687  35.383  -72.705  0.14 38.22  ? 211  HIS B C     1 
ATOM   5433  O  O     A HIS B  1 211 ? -46.317  35.561  -73.051  0.86 24.80  ? 211  HIS B O     1 
ATOM   5434  O  O     B HIS B  1 211 ? -46.545  36.489  -73.228  0.14 42.40  ? 211  HIS B O     1 
ATOM   5435  C  CB    A HIS B  1 211 ? -44.734  32.731  -72.280  0.86 27.72  ? 211  HIS B CB    1 
ATOM   5436  C  CB    B HIS B  1 211 ? -45.569  33.196  -73.456  0.14 36.62  ? 211  HIS B CB    1 
ATOM   5437  C  CG    A HIS B  1 211 ? -45.083  32.097  -70.972  0.86 32.83  ? 211  HIS B CG    1 
ATOM   5438  C  CG    B HIS B  1 211 ? -45.029  32.848  -74.834  0.14 39.13  ? 211  HIS B CG    1 
ATOM   5439  N  ND1   A HIS B  1 211 ? -45.160  30.733  -70.810  0.86 30.00  ? 211  HIS B ND1   1 
ATOM   5440  N  ND1   B HIS B  1 211 ? -43.710  32.663  -75.174  0.14 36.38  ? 211  HIS B ND1   1 
ATOM   5441  C  CD2   A HIS B  1 211 ? -45.390  32.635  -69.769  0.86 27.93  ? 211  HIS B CD2   1 
ATOM   5442  C  CD2   B HIS B  1 211 ? -45.739  32.709  -75.984  0.14 40.67  ? 211  HIS B CD2   1 
ATOM   5443  C  CE1   A HIS B  1 211 ? -45.498  30.458  -69.563  0.86 19.82  ? 211  HIS B CE1   1 
ATOM   5444  C  CE1   B HIS B  1 211 ? -43.611  32.429  -76.477  0.14 41.13  ? 211  HIS B CE1   1 
ATOM   5445  N  NE2   A HIS B  1 211 ? -45.646  31.592  -68.911  0.86 10.18  ? 211  HIS B NE2   1 
ATOM   5446  N  NE2   B HIS B  1 211 ? -44.843  32.459  -76.996  0.14 47.26  ? 211  HIS B NE2   1 
ATOM   5447  N  N     A GLU B  1 212 ? -46.881  34.486  -71.173  0.75 24.09  ? 212  GLU B N     1 
ATOM   5448  N  N     B GLU B  1 212 ? -46.807  35.232  -71.359  0.14 35.72  ? 212  GLU B N     1 
ATOM   5449  C  CA    A GLU B  1 212 ? -47.382  35.707  -70.561  0.75 25.13  ? 212  GLU B CA    1 
ATOM   5450  C  CA    B GLU B  1 212 ? -46.823  36.424  -70.556  0.14 36.14  ? 212  GLU B CA    1 
ATOM   5451  C  C     A GLU B  1 212 ? -46.915  35.772  -69.104  0.75 25.33  ? 212  GLU B C     1 
ATOM   5452  C  C     B GLU B  1 212 ? -47.612  36.082  -69.291  0.14 31.73  ? 212  GLU B C     1 
ATOM   5453  O  O     A GLU B  1 212 ? -46.677  34.743  -68.492  0.75 26.21  ? 212  GLU B O     1 
ATOM   5454  C  CB    A GLU B  1 212 ? -48.906  35.750  -70.779  0.75 26.27  ? 212  GLU B CB    1 
ATOM   5455  C  CB    B GLU B  1 212 ? -47.770  37.435  -71.210  0.14 40.17  ? 212  GLU B CB    1 
ATOM   5456  C  CG    A GLU B  1 212 ? -49.695  36.790  -69.997  0.75 30.64  ? 212  GLU B CG    1 
ATOM   5457  C  CG    B GLU B  1 212 ? -48.308  37.059  -72.596  0.14 42.13  ? 212  GLU B CG    1 
ATOM   5458  C  CD    A GLU B  1 212 ? -49.451  38.232  -70.413  0.75 32.75  ? 212  GLU B CD    1 
ATOM   5459  C  CD    B GLU B  1 212 ? -49.112  38.195  -73.254  0.14 38.20  ? 212  GLU B CD    1 
ATOM   5460  O  OE1   A GLU B  1 212 ? -49.342  38.503  -71.623  0.75 32.89  ? 212  GLU B OE1   1 
ATOM   5461  O  OE1   B GLU B  1 212 ? -48.828  39.380  -72.948  0.14 35.11  ? 212  GLU B OE1   1 
ATOM   5462  O  OE2   A GLU B  1 212 ? -49.378  39.105  -69.512  0.75 34.88  ? 212  GLU B OE2   1 
ATOM   5463  O  OE2   B GLU B  1 212 ? -50.002  37.900  -74.066  0.14 36.86  ? 212  GLU B OE2   1 
ATOM   5464  N  N     A VAL B  1 213 ? -46.785  36.981  -68.551  0.93 20.00  ? 213  VAL B N     1 
ATOM   5465  C  CA    A VAL B  1 213 ? -46.268  37.288  -67.200  0.93 20.00  ? 213  VAL B CA    1 
ATOM   5466  C  C     A VAL B  1 213 ? -46.317  36.226  -66.085  0.93 20.00  ? 213  VAL B C     1 
ATOM   5467  O  O     A VAL B  1 213 ? -45.279  35.824  -65.572  0.93 20.00  ? 213  VAL B O     1 
ATOM   5468  C  CB    A VAL B  1 213 ? -46.947  38.565  -66.658  0.93 20.00  ? 213  VAL B CB    1 
ATOM   5469  C  CG1   A VAL B  1 213 ? -46.440  38.904  -65.267  0.93 20.00  ? 213  VAL B CG1   1 
ATOM   5470  C  CG2   A VAL B  1 213 ? -46.699  39.746  -67.590  0.93 20.00  ? 213  VAL B CG2   1 
ATOM   5471  N  N     . ALA B  1 214 ? -47.495  35.749  -65.716  1.00 14.94  ? 214  ALA B N     1 
ATOM   5472  C  CA    . ALA B  1 214 ? -47.646  34.794  -64.597  1.00 33.57  ? 214  ALA B CA    1 
ATOM   5473  C  C     . ALA B  1 214 ? -47.012  33.403  -64.770  1.00 38.39  ? 214  ALA B C     1 
ATOM   5474  O  O     . ALA B  1 214 ? -46.981  32.845  -65.866  1.00 37.10  ? 214  ALA B O     1 
ATOM   5475  C  CB    . ALA B  1 214 ? -49.121  34.649  -64.270  1.00 30.97  ? 214  ALA B CB    1 
ATOM   5476  N  N     . THR B  1 215 ? -46.531  32.875  -63.643  1.00 34.62  ? 215  THR B N     1 
ATOM   5477  C  CA    . THR B  1 215 ? -45.960  31.527  -63.613  1.00 22.51  ? 215  THR B CA    1 
ATOM   5478  C  C     . THR B  1 215 ? -47.130  30.562  -63.841  1.00 35.48  ? 215  THR B C     1 
ATOM   5479  O  O     . THR B  1 215 ? -48.286  30.986  -63.948  1.00 39.45  ? 215  THR B O     1 
ATOM   5480  C  CB    . THR B  1 215 ? -45.297  31.200  -62.229  1.00 28.96  ? 215  THR B CB    1 
ATOM   5481  O  OG1   . THR B  1 215 ? -44.688  29.900  -62.268  1.00 54.72  ? 215  THR B OG1   1 
ATOM   5482  C  CG2   . THR B  1 215 ? -46.319  31.210  -61.114  1.00 11.31  ? 215  THR B CG2   1 
ATOM   5483  N  N     . ALA B  1 216 ? -46.834  29.271  -63.926  1.00 29.86  ? 216  ALA B N     1 
ATOM   5484  C  CA    . ALA B  1 216 ? -47.876  28.276  -64.118  1.00 25.68  ? 216  ALA B CA    1 
ATOM   5485  C  C     . ALA B  1 216 ? -48.656  28.403  -65.420  1.00 18.17  ? 216  ALA B C     1 
ATOM   5486  O  O     . ALA B  1 216 ? -49.884  28.359  -65.423  1.00 41.28  ? 216  ALA B O     1 
ATOM   5487  C  CB    . ALA B  1 216 ? -48.843  28.328  -62.946  1.00 21.19  ? 216  ALA B CB    1 
ATOM   5488  N  N     . GLY B  1 217 ? -47.941  28.584  -66.521  1.00 30.73  ? 217  GLY B N     1 
ATOM   5489  C  CA    . GLY B  1 217 ? -48.532  28.568  -67.858  1.00 30.14  ? 217  GLY B CA    1 
ATOM   5490  C  C     . GLY B  1 217 ? -49.475  29.668  -68.351  1.00 25.36  ? 217  GLY B C     1 
ATOM   5491  O  O     . GLY B  1 217 ? -50.384  29.378  -69.124  1.00 42.91  ? 217  GLY B O     1 
ATOM   5492  N  N     . GLN B  1 218 ? -49.296  30.923  -67.956  1.00 23.89  ? 218  GLN B N     1 
ATOM   5493  C  CA    . GLN B  1 218 ? -50.149  31.943  -68.545  1.00 24.97  ? 218  GLN B CA    1 
ATOM   5494  C  C     . GLN B  1 218 ? -49.654  32.183  -69.972  1.00 29.12  ? 218  GLN B C     1 
ATOM   5495  O  O     . GLN B  1 218 ? -48.463  32.359  -70.200  1.00 30.49  ? 218  GLN B O     1 
ATOM   5496  C  CB    . GLN B  1 218 ? -50.118  33.233  -67.762  1.00 27.27  ? 218  GLN B CB    1 
ATOM   5497  C  CG    . GLN B  1 218 ? -51.115  34.229  -68.317  1.00 39.69  ? 218  GLN B CG    1 
ATOM   5498  C  CD    . GLN B  1 218 ? -51.255  35.465  -67.463  1.00 53.61  ? 218  GLN B CD    1 
ATOM   5499  O  OE1   . GLN B  1 218 ? -52.341  35.786  -66.963  1.00 50.86  ? 218  GLN B OE1   1 
ATOM   5500  N  NE2   . GLN B  1 218 ? -50.283  36.309  -67.160  1.00 57.11  ? 218  GLN B NE2   1 
ATOM   5501  N  N     . ASN B  1 219 ? -50.573  32.203  -70.934  1.00 35.65  ? 219  ASN B N     1 
ATOM   5502  C  CA    . ASN B  1 219 ? -50.224  32.398  -72.346  1.00 40.47  ? 219  ASN B CA    1 
ATOM   5503  C  C     . ASN B  1 219 ? -51.265  33.238  -73.054  1.00 36.89  ? 219  ASN B C     1 
ATOM   5504  O  O     . ASN B  1 219 ? -52.388  33.361  -72.564  1.00 42.98  ? 219  ASN B O     1 
ATOM   5505  C  CB    . ASN B  1 219 ? -50.139  31.063  -73.060  1.00 38.31  ? 219  ASN B CB    1 
ATOM   5506  C  CG    . ASN B  1 219 ? -49.026  30.219  -72.551  1.00 40.81  ? 219  ASN B CG    1 
ATOM   5507  O  OD1   . ASN B  1 219 ? -49.120  29.646  -71.466  1.00 36.02  ? 219  ASN B OD1   1 
ATOM   5508  N  ND2   . ASN B  1 219 ? -47.941  30.146  -73.318  1.00 38.15  ? 219  ASN B ND2   1 
ATOM   5509  N  N     A GLU B  1 220 ? -50.902  33.758  -74.226  0.80 23.13  ? 220  GLU B N     1 
ATOM   5510  C  CA    A GLU B  1 220 ? -51.790  34.599  -75.019  0.80 24.42  ? 220  GLU B CA    1 
ATOM   5511  C  C     A GLU B  1 220 ? -51.476  34.373  -76.485  0.80 23.92  ? 220  GLU B C     1 
ATOM   5512  O  O     A GLU B  1 220 ? -50.318  34.116  -76.849  0.80 23.17  ? 220  GLU B O     1 
ATOM   5513  C  CB    A GLU B  1 220 ? -51.632  36.120  -74.687  0.80 26.61  ? 220  GLU B CB    1 
ATOM   5514  C  CG    A GLU B  1 220 ? -52.660  37.092  -75.415  0.80 28.88  ? 220  GLU B CG    1 
ATOM   5515  C  CD    A GLU B  1 220 ? -52.369  38.600  -75.208  0.80 31.62  ? 220  GLU B CD    1 
ATOM   5516  O  OE1   A GLU B  1 220 ? -52.125  39.068  -74.052  0.80 30.47  ? 220  GLU B OE1   1 
ATOM   5517  O  OE2   A GLU B  1 220 ? -52.388  39.345  -76.221  0.80 35.08  ? 220  GLU B OE2   1 
ATOM   5518  N  N     . VAL B  1 221 ? -52.535  34.414  -77.299  1.00 37.21  ? 221  VAL B N     1 
ATOM   5519  C  CA    . VAL B  1 221 ? -52.466  34.313  -78.754  1.00 33.11  ? 221  VAL B CA    1 
ATOM   5520  C  C     . VAL B  1 221 ? -53.224  35.521  -79.299  1.00 45.93  ? 221  VAL B C     1 
ATOM   5521  O  O     . VAL B  1 221 ? -54.425  35.693  -79.064  1.00 60.40  ? 221  VAL B O     1 
ATOM   5522  C  CB    . VAL B  1 221 ? -53.120  33.061  -79.309  1.00 37.54  ? 221  VAL B CB    1 
ATOM   5523  C  CG1   . VAL B  1 221 ? -53.199  33.166  -80.844  1.00 32.68  ? 221  VAL B CG1   1 
ATOM   5524  C  CG2   . VAL B  1 221 ? -52.313  31.845  -78.918  1.00 34.66  ? 221  VAL B CG2   1 
ATOM   5525  N  N     . ALA B  1 222 ? -52.489  36.379  -79.989  1.00 48.34  ? 222  ALA B N     1 
ATOM   5526  C  CA    . ALA B  1 222 ? -53.042  37.587  -80.566  1.00 44.43  ? 222  ALA B CA    1 
ATOM   5527  C  C     . ALA B  1 222 ? -53.615  37.317  -81.934  1.00 46.52  ? 222  ALA B C     1 
ATOM   5528  O  O     . ALA B  1 222 ? -52.947  36.801  -82.832  1.00 41.47  ? 222  ALA B O     1 
ATOM   5529  C  CB    . ALA B  1 222 ? -51.981  38.658  -80.653  1.00 47.76  ? 222  ALA B CB    1 
ATOM   5530  N  N     . THR B  1 223 ? -54.861  37.724  -82.094  1.00 57.24  ? 223  THR B N     1 
ATOM   5531  C  CA    . THR B  1 223 ? -55.550  37.530  -83.343  1.00 45.15  ? 223  THR B CA    1 
ATOM   5532  C  C     . THR B  1 223 ? -55.992  38.866  -83.905  1.00 52.47  ? 223  THR B C     1 
ATOM   5533  O  O     . THR B  1 223 ? -56.266  39.824  -83.158  1.00 55.42  ? 223  THR B O     1 
ATOM   5534  C  CB    . THR B  1 223 ? -56.753  36.612  -83.135  1.00 44.65  ? 223  THR B CB    1 
ATOM   5535  O  OG1   . THR B  1 223 ? -57.372  36.906  -81.867  1.00 44.82  ? 223  THR B OG1   1 
ATOM   5536  C  CG2   . THR B  1 223 ? -56.286  35.177  -83.139  1.00 55.46  ? 223  THR B CG2   1 
ATOM   5537  N  N     . ARG B  1 224 ? -56.028  38.922  -85.230  1.00 49.02  ? 224  ARG B N     1 
ATOM   5538  C  CA    . ARG B  1 224 ? -56.436  40.121  -85.938  1.00 50.81  ? 224  ARG B CA    1 
ATOM   5539  C  C     . ARG B  1 224 ? -57.904  40.437  -85.725  1.00 52.16  ? 224  ARG B C     1 
ATOM   5540  O  O     . ARG B  1 224 ? -58.755  39.539  -85.736  1.00 55.40  ? 224  ARG B O     1 
ATOM   5541  C  CB    . ARG B  1 224 ? -56.162  39.979  -87.431  1.00 57.58  ? 224  ARG B CB    1 
ATOM   5542  C  CG    . ARG B  1 224 ? -56.541  41.209  -88.217  1.00 48.52  ? 224  ARG B CG    1 
ATOM   5543  C  CD    . ARG B  1 224 ? -55.754  41.313  -89.519  1.00 73.23  ? 224  ARG B CD    1 
ATOM   5544  N  NE    . ARG B  1 224 ? -56.359  40.687  -90.702  1.00 74.06  ? 224  ARG B NE    1 
ATOM   5545  C  CZ    . ARG B  1 224 ? -57.602  40.204  -90.821  1.00 87.79  ? 224  ARG B CZ    1 
ATOM   5546  N  NH1   . ARG B  1 224 ? -57.970  39.687  -91.990  1.00 59.00  ? 224  ARG B NH1   1 
ATOM   5547  N  NH2   . ARG B  1 224 ? -58.468  40.192  -89.801  1.00 78.78  ? 224  ARG B NH2   1 
ATOM   5548  N  N     . PHE B  1 225 ? -58.168  41.734  -85.580  1.00 52.52  ? 225  PHE B N     1 
ATOM   5549  C  CA    . PHE B  1 225 ? -59.495  42.314  -85.363  1.00 47.71  ? 225  PHE B CA    1 
ATOM   5550  C  C     . PHE B  1 225 ? -60.456  41.945  -86.476  1.00 52.34  ? 225  PHE B C     1 
ATOM   5551  O  O     . PHE B  1 225 ? -60.054  41.401  -87.515  1.00 61.33  ? 225  PHE B O     1 
ATOM   5552  C  CB    . PHE B  1 225 ? -59.385  43.842  -85.365  1.00 55.02  ? 225  PHE B CB    1 
ATOM   5553  C  CG    . PHE B  1 225 ? -59.108  44.426  -86.741  1.00 62.34  ? 225  PHE B CG    1 
ATOM   5554  C  CD1   . PHE B  1 225 ? -57.814  44.484  -87.242  1.00 64.74  ? 225  PHE B CD1   1 
ATOM   5555  C  CD2   . PHE B  1 225 ? -60.156  44.834  -87.570  1.00 70.79  ? 225  PHE B CD2   1 
ATOM   5556  C  CE1   . PHE B  1 225 ? -57.569  44.927  -88.548  1.00 68.91  ? 225  PHE B CE1   1 
ATOM   5557  C  CE2   . PHE B  1 225 ? -59.920  45.277  -88.879  1.00 41.96  ? 225  PHE B CE2   1 
ATOM   5558  C  CZ    . PHE B  1 225 ? -58.628  45.320  -89.365  1.00 49.55  ? 225  PHE B CZ    1 
ATOM   5559  N  N     . ASN B  1 226 ? -61.710  42.346  -86.286  1.00 49.95  ? 226  ASN B N     1 
ATOM   5560  C  CA    . ASN B  1 226 ? -62.768  42.122  -87.269  1.00 48.06  ? 226  ASN B CA    1 
ATOM   5561  C  C     . ASN B  1 226 ? -64.050  42.859  -86.865  1.00 40.16  ? 226  ASN B C     1 
ATOM   5562  O  O     . ASN B  1 226 ? -64.121  43.448  -85.774  1.00 42.84  ? 226  ASN B O     1 
ATOM   5563  C  CB    . ASN B  1 226 ? -63.048  40.629  -87.448  1.00 45.98  ? 226  ASN B CB    1 
ATOM   5564  C  CG    . ASN B  1 226 ? -63.638  40.310  -88.809  1.00 62.98  ? 226  ASN B CG    1 
ATOM   5565  O  OD1   . ASN B  1 226 ? -64.066  41.206  -89.549  1.00 67.51  ? 226  ASN B OD1   1 
ATOM   5566  N  ND2   . ASN B  1 226 ? -63.655  39.030  -89.155  1.00 66.88  ? 226  ASN B ND2   1 
ATOM   5567  N  N     . THR B  1 227 ? -65.043  42.850  -87.759  1.00 33.53  ? 227  THR B N     1 
ATOM   5568  C  CA    . THR B  1 227 ? -66.321  43.507  -87.504  1.00 41.38  ? 227  THR B CA    1 
ATOM   5569  C  C     . THR B  1 227 ? -66.820  42.955  -86.162  1.00 44.89  ? 227  THR B C     1 
ATOM   5570  O  O     . THR B  1 227 ? -66.763  41.749  -85.930  1.00 45.41  ? 227  THR B O     1 
ATOM   5571  C  CB    . THR B  1 227 ? -67.360  43.219  -88.633  1.00 47.59  ? 227  THR B CB    1 
ATOM   5572  O  OG1   . THR B  1 227 ? -68.086  42.010  -88.342  1.00 68.98  ? 227  THR B OG1   1 
ATOM   5573  C  CG2   . THR B  1 227 ? -66.671  43.073  -89.997  1.00 28.16  ? 227  THR B CG2   1 
ATOM   5574  N  N     . MET B  1 228 ? -67.272  43.837  -85.278  1.00 46.12  ? 228  MET B N     1 
ATOM   5575  C  CA    . MET B  1 228 ? -67.736  43.430  -83.955  1.00 48.07  ? 228  MET B CA    1 
ATOM   5576  C  C     . MET B  1 228 ? -68.382  42.053  -83.828  1.00 42.61  ? 228  MET B C     1 
ATOM   5577  O  O     . MET B  1 228 ? -67.925  41.236  -83.036  1.00 57.95  ? 228  MET B O     1 
ATOM   5578  C  CB    . MET B  1 228 ? -68.662  44.477  -83.326  1.00 48.95  ? 228  MET B CB    1 
ATOM   5579  C  CG    . MET B  1 228 ? -69.057  44.103  -81.909  1.00 37.13  ? 228  MET B CG    1 
ATOM   5580  S  SD    . MET B  1 228 ? -70.103  45.241  -81.007  1.00 55.98  ? 228  MET B SD    1 
ATOM   5581  C  CE    . MET B  1 228 ? -71.680  44.415  -81.119  1.00 41.35  ? 228  MET B CE    1 
ATOM   5582  N  N     . THR B  1 229 ? -69.416  41.770  -84.608  1.00 44.08  ? 229  THR B N     1 
ATOM   5583  C  CA    . THR B  1 229 ? -70.068  40.472  -84.467  1.00 49.93  ? 229  THR B CA    1 
ATOM   5584  C  C     . THR B  1 229 ? -69.218  39.284  -84.904  1.00 44.12  ? 229  THR B C     1 
ATOM   5585  O  O     . THR B  1 229 ? -69.123  38.297  -84.184  1.00 45.86  ? 229  THR B O     1 
ATOM   5586  C  CB    . THR B  1 229 ? -71.463  40.455  -85.111  1.00 56.73  ? 229  THR B CB    1 
ATOM   5587  O  OG1   . THR B  1 229 ? -72.323  41.344  -84.383  1.00 54.92  ? 229  THR B OG1   1 
ATOM   5588  C  CG2   . THR B  1 229 ? -72.060  39.059  -85.069  1.00 51.47  ? 229  THR B CG2   1 
ATOM   5589  N  N     . LYS B  1 230 ? -68.564  39.385  -86.051  1.00 47.95  ? 230  LYS B N     1 
ATOM   5590  C  CA    . LYS B  1 230 ? -67.709  38.296  -86.510  1.00 46.92  ? 230  LYS B CA    1 
ATOM   5591  C  C     . LYS B  1 230 ? -66.591  38.047  -85.480  1.00 37.78  ? 230  LYS B C     1 
ATOM   5592  O  O     . LYS B  1 230 ? -66.184  36.906  -85.264  1.00 52.54  ? 230  LYS B O     1 
ATOM   5593  C  CB    . LYS B  1 230 ? -67.118  38.631  -87.881  1.00 35.77  ? 230  LYS B CB    1 
ATOM   5594  C  CG    . LYS B  1 230 ? -66.545  37.460  -88.700  0.65 39.61  ? 230  LYS B CG    1 
ATOM   5595  C  CD    . LYS B  1 230 ? -66.994  37.580  -90.175  0.65 64.52  ? 230  LYS B CD    1 
ATOM   5596  C  CE    . LYS B  1 230 ? -66.821  39.020  -90.705  0.65 85.44  ? 230  LYS B CE    1 
ATOM   5597  N  NZ    . LYS B  1 230 ? -67.628  39.350  -91.915  0.65 64.38  ? 230  LYS B NZ    1 
ATOM   5598  N  N     . LYS B  1 231 ? -66.133  39.102  -84.810  1.00 38.97  ? 231  LYS B N     1 
ATOM   5599  C  CA    . LYS B  1 231 ? -65.076  38.948  -83.820  1.00 42.04  ? 231  LYS B CA    1 
ATOM   5600  C  C     . LYS B  1 231 ? -65.525  38.151  -82.600  1.00 41.15  ? 231  LYS B C     1 
ATOM   5601  O  O     . LYS B  1 231 ? -64.811  37.250  -82.162  1.00 63.24  ? 231  LYS B O     1 
ATOM   5602  C  CB    . LYS B  1 231 ? -64.471  40.289  -83.403  1.00 28.92  ? 231  LYS B CB    1 
ATOM   5603  C  CG    . LYS B  1 231 ? -63.128  40.144  -82.668  1.00 42.75  ? 231  LYS B CG    1 
ATOM   5604  C  CD    . LYS B  1 231 ? -62.166  39.215  -83.441  1.00 32.75  ? 231  LYS B CD    1 
ATOM   5605  C  CE    . LYS B  1 231 ? -60.765  39.144  -82.833  1.00 50.32  ? 231  LYS B CE    1 
ATOM   5606  N  NZ    . LYS B  1 231 ? -59.870  38.258  -83.643  1.00 34.20  ? 231  LYS B NZ    1 
ATOM   5607  N  N     . ALA B  1 232 ? -66.697  38.462  -82.057  1.00 33.98  ? 232  ALA B N     1 
ATOM   5608  C  CA    . ALA B  1 232 ? -67.212  37.708  -80.907  1.00 47.94  ? 232  ALA B CA    1 
ATOM   5609  C  C     . ALA B  1 232 ? -67.374  36.220  -81.288  1.00 52.75  ? 232  ALA B C     1 
ATOM   5610  O  O     . ALA B  1 232 ? -67.273  35.334  -80.432  1.00 59.69  ? 232  ALA B O     1 
ATOM   5611  C  CB    . ALA B  1 232 ? -68.532  38.293  -80.422  1.00 37.06  ? 232  ALA B CB    1 
ATOM   5612  N  N     . ASP B  1 233 ? -67.616  35.963  -82.577  1.00 45.24  ? 233  ASP B N     1 
ATOM   5613  C  CA    . ASP B  1 233 ? -67.723  34.603  -83.102  1.00 48.73  ? 233  ASP B CA    1 
ATOM   5614  C  C     . ASP B  1 233 ? -66.334  33.985  -82.920  1.00 55.68  ? 233  ASP B C     1 
ATOM   5615  O  O     . ASP B  1 233 ? -66.159  32.943  -82.266  1.00 52.22  ? 233  ASP B O     1 
ATOM   5616  C  CB    . ASP B  1 233 ? -68.003  34.624  -84.610  1.00 64.87  ? 233  ASP B CB    1 
ATOM   5617  C  CG    . ASP B  1 233 ? -69.472  34.808  -84.954  1.00 67.38  ? 233  ASP B CG    1 
ATOM   5618  O  OD1   . ASP B  1 233 ? -70.319  34.819  -84.033  1.00 41.43  ? 233  ASP B OD1   1 
ATOM   5619  O  OD2   . ASP B  1 233 ? -69.770  34.922  -86.170  1.00 52.47  ? 233  ASP B OD2   1 
ATOM   5620  N  N     . GLU B  1 234 ? -65.354  34.659  -83.521  1.00 34.91  ? 234  GLU B N     1 
ATOM   5621  C  CA    . GLU B  1 234 ? -63.960  34.248  -83.476  1.00 41.13  ? 234  GLU B CA    1 
ATOM   5622  C  C     . GLU B  1 234 ? -63.482  34.001  -82.053  1.00 41.17  ? 234  GLU B C     1 
ATOM   5623  O  O     . GLU B  1 234 ? -62.652  33.121  -81.826  1.00 50.07  ? 234  GLU B O     1 
ATOM   5624  C  CB    . GLU B  1 234 ? -63.085  35.289  -84.165  1.00 29.37  ? 234  GLU B CB    1 
ATOM   5625  C  CG    . GLU B  1 234 ? -63.449  35.500  -85.629  1.00 38.36  ? 234  GLU B CG    1 
ATOM   5626  C  CD    . GLU B  1 234 ? -62.376  36.243  -86.416  1.00 55.50  ? 234  GLU B CD    1 
ATOM   5627  O  OE1   . GLU B  1 234 ? -61.476  36.864  -85.794  1.00 32.22  ? 234  GLU B OE1   1 
ATOM   5628  O  OE2   . GLU B  1 234 ? -62.429  36.196  -87.671  1.00 53.02  ? 234  GLU B OE2   1 
ATOM   5629  N  N     . ILE B  1 235 ? -64.018  34.757  -81.098  1.00 20.75  ? 235  ILE B N     1 
ATOM   5630  C  CA    . ILE B  1 235 ? -63.648  34.575  -79.698  1.00 25.84  ? 235  ILE B CA    1 
ATOM   5631  C  C     . ILE B  1 235 ? -64.058  33.189  -79.246  1.00 40.12  ? 235  ILE B C     1 
ATOM   5632  O  O     . ILE B  1 235 ? -63.262  32.449  -78.656  1.00 43.57  ? 235  ILE B O     1 
ATOM   5633  C  CB    . ILE B  1 235 ? -64.308  35.624  -78.793  1.00 25.40  ? 235  ILE B CB    1 
ATOM   5634  C  CG1   . ILE B  1 235 ? -63.550  36.935  -78.911  1.00 38.62  ? 235  ILE B CG1   1 
ATOM   5635  C  CG2   . ILE B  1 235 ? -64.333  35.179  -77.365  1.00 22.03  ? 235  ILE B CG2   1 
ATOM   5636  C  CD1   . ILE B  1 235 ? -62.062  36.790  -78.767  1.00 25.70  ? 235  ILE B CD1   1 
ATOM   5637  N  N     . GLN B  1 236 ? -65.302  32.837  -79.536  1.00 33.53  ? 236  GLN B N     1 
ATOM   5638  C  CA    . GLN B  1 236 ? -65.796  31.524  -79.171  1.00 40.09  ? 236  GLN B CA    1 
ATOM   5639  C  C     . GLN B  1 236 ? -64.929  30.446  -79.823  1.00 48.92  ? 236  GLN B C     1 
ATOM   5640  O  O     . GLN B  1 236 ? -64.564  29.462  -79.172  1.00 65.86  ? 236  GLN B O     1 
ATOM   5641  C  CB    . GLN B  1 236 ? -67.248  31.364  -79.604  1.00 25.12  ? 236  GLN B CB    1 
ATOM   5642  C  CG    . GLN B  1 236 ? -68.190  32.361  -78.988  1.00 18.85  ? 236  GLN B CG    1 
ATOM   5643  C  CD    . GLN B  1 236 ? -68.352  32.206  -77.487  1.00 48.92  ? 236  GLN B CD    1 
ATOM   5644  O  OE1   . GLN B  1 236 ? -67.457  32.554  -76.692  1.00 55.42  ? 236  GLN B OE1   1 
ATOM   5645  N  NE2   . GLN B  1 236 ? -69.522  31.720  -77.082  1.00 33.81  ? 236  GLN B NE2   1 
ATOM   5646  N  N     . ILE B  1 237 ? -64.564  30.647  -81.089  1.00 29.21  ? 237  ILE B N     1 
ATOM   5647  C  CA    . ILE B  1 237 ? -63.725  29.669  -81.789  1.00 37.60  ? 237  ILE B CA    1 
ATOM   5648  C  C     . ILE B  1 237 ? -62.370  29.575  -81.099  1.00 37.61  ? 237  ILE B C     1 
ATOM   5649  O  O     . ILE B  1 237 ? -61.860  28.484  -80.840  1.00 37.27  ? 237  ILE B O     1 
ATOM   5650  C  CB    . ILE B  1 237 ? -63.536  30.053  -83.267  1.00 35.53  ? 237  ILE B CB    1 
ATOM   5651  C  CG1   . ILE B  1 237 ? -64.867  29.874  -84.008  1.00 33.69  ? 237  ILE B CG1   1 
ATOM   5652  C  CG2   . ILE B  1 237 ? -62.421  29.228  -83.899  1.00 34.13  ? 237  ILE B CG2   1 
ATOM   5653  C  CD1   . ILE B  1 237 ? -64.921  30.496  -85.394  1.00 71.82  ? 237  ILE B CD1   1 
ATOM   5654  N  N     . TYR B  1 238 ? -61.839  30.748  -80.792  1.00 27.34  ? 238  TYR B N     1 
ATOM   5655  C  CA    . TYR B  1 238 ? -60.584  30.903  -80.066  1.00 31.11  ? 238  TYR B CA    1 
ATOM   5656  C  C     . TYR B  1 238 ? -60.559  30.010  -78.833  1.00 32.78  ? 238  TYR B C     1 
ATOM   5657  O  O     . TYR B  1 238 ? -59.739  29.095  -78.719  1.00 43.90  ? 238  TYR B O     1 
ATOM   5658  C  CB    . TYR B  1 238 ? -60.363  32.363  -79.700  1.00 24.08  ? 238  TYR B CB    1 
ATOM   5659  C  CG    . TYR B  1 238 ? -59.081  32.764  -79.003  1.00 30.18  ? 238  TYR B CG    1 
ATOM   5660  C  CD1   . TYR B  1 238 ? -58.012  33.281  -79.720  1.00 17.80  ? 238  TYR B CD1   1 
ATOM   5661  C  CD2   . TYR B  1 238 ? -58.941  32.625  -77.628  1.00 32.82  ? 238  TYR B CD2   1 
ATOM   5662  C  CE1   . TYR B  1 238 ? -56.840  33.651  -79.089  1.00 26.50  ? 238  TYR B CE1   1 
ATOM   5663  C  CE2   . TYR B  1 238 ? -57.773  32.992  -76.988  1.00 31.53  ? 238  TYR B CE2   1 
ATOM   5664  C  CZ    . TYR B  1 238 ? -56.725  33.504  -77.723  1.00 28.85  ? 238  TYR B CZ    1 
ATOM   5665  O  OH    . TYR B  1 238 ? -55.560  33.872  -77.090  1.00 27.28  ? 238  TYR B OH    1 
ATOM   5666  N  N     . LYS B  1 239 ? -61.513  30.286  -77.950  1.00 23.92  ? 239  LYS B N     1 
ATOM   5667  C  CA    . LYS B  1 239 ? -61.635  29.546  -76.695  1.00 46.39  ? 239  LYS B CA    1 
ATOM   5668  C  C     . LYS B  1 239 ? -61.764  28.055  -76.931  1.00 33.22  ? 239  LYS B C     1 
ATOM   5669  O  O     . LYS B  1 239 ? -61.200  27.242  -76.198  1.00 36.31  ? 239  LYS B O     1 
ATOM   5670  C  CB    . LYS B  1 239 ? -62.835  30.060  -75.885  1.00 17.03  ? 239  LYS B CB    1 
ATOM   5671  C  CG    . LYS B  1 239 ? -62.694  31.525  -75.520  1.00 35.70  ? 239  LYS B CG    1 
ATOM   5672  C  CD    . LYS B  1 239 ? -63.977  32.126  -75.030  1.00 34.00  ? 239  LYS B CD    1 
ATOM   5673  C  CE    . LYS B  1 239 ? -63.985  32.293  -73.530  1.00 46.25  ? 239  LYS B CE    1 
ATOM   5674  N  NZ    . LYS B  1 239 ? -65.246  32.970  -73.129  1.00 57.02  ? 239  LYS B NZ    1 
ATOM   5675  N  N     . TYR B  1 240 ? -62.496  27.701  -77.974  1.00 37.16  ? 240  TYR B N     1 
ATOM   5676  C  CA    . TYR B  1 240 ? -62.688  26.305  -78.280  1.00 31.38  ? 240  TYR B CA    1 
ATOM   5677  C  C     . TYR B  1 240 ? -61.334  25.719  -78.632  1.00 37.27  ? 240  TYR B C     1 
ATOM   5678  O  O     . TYR B  1 240 ? -60.852  24.821  -77.944  1.00 38.74  ? 240  TYR B O     1 
ATOM   5679  C  CB    . TYR B  1 240 ? -63.657  26.164  -79.435  1.00 28.64  ? 240  TYR B CB    1 
ATOM   5680  C  CG    . TYR B  1 240 ? -63.967  24.740  -79.802  1.00 41.73  ? 240  TYR B CG    1 
ATOM   5681  C  CD1   . TYR B  1 240 ? -64.634  23.893  -78.903  1.00 37.07  ? 240  TYR B CD1   1 
ATOM   5682  C  CD2   . TYR B  1 240 ? -63.617  24.239  -81.060  1.00 35.32  ? 240  TYR B CD2   1 
ATOM   5683  C  CE1   . TYR B  1 240 ? -64.946  22.570  -79.253  1.00 33.74  ? 240  TYR B CE1   1 
ATOM   5684  C  CE2   . TYR B  1 240 ? -63.918  22.931  -81.424  1.00 26.79  ? 240  TYR B CE2   1 
ATOM   5685  C  CZ    . TYR B  1 240 ? -64.579  22.093  -80.525  1.00 42.75  ? 240  TYR B CZ    1 
ATOM   5686  O  OH    . TYR B  1 240 ? -64.829  20.780  -80.902  1.00 42.43  ? 240  TYR B OH    1 
ATOM   5687  N  N     . VAL B  1 241 ? -60.702  26.270  -79.664  1.00 35.38  ? 241  VAL B N     1 
ATOM   5688  C  CA    . VAL B  1 241 ? -59.390  25.804  -80.092  1.00 26.81  ? 241  VAL B CA    1 
ATOM   5689  C  C     . VAL B  1 241 ? -58.442  25.721  -78.912  1.00 26.97  ? 241  VAL B C     1 
ATOM   5690  O  O     . VAL B  1 241 ? -57.803  24.696  -78.711  1.00 29.45  ? 241  VAL B O     1 
ATOM   5691  C  CB    . VAL B  1 241 ? -58.787  26.709  -81.155  1.00 27.66  ? 241  VAL B CB    1 
ATOM   5692  C  CG1   . VAL B  1 241 ? -57.395  26.267  -81.468  1.00 26.63  ? 241  VAL B CG1   1 
ATOM   5693  C  CG2   . VAL B  1 241 ? -59.624  26.638  -82.411  1.00 51.02  ? 241  VAL B CG2   1 
ATOM   5694  N  N     . VAL B  1 242 ? -58.407  26.770  -78.095  1.00 21.37  ? 242  VAL B N     1 
ATOM   5695  C  CA    . VAL B  1 242 ? -57.535  26.794  -76.914  1.00 28.39  ? 242  VAL B CA    1 
ATOM   5696  C  C     . VAL B  1 242 ? -57.881  25.641  -75.984  1.00 21.43  ? 242  VAL B C     1 
ATOM   5697  O  O     . VAL B  1 242 ? -57.075  24.749  -75.766  1.00 26.81  ? 242  VAL B O     1 
ATOM   5698  C  CB    . VAL B  1 242 ? -57.650  28.136  -76.113  1.00 30.31  ? 242  VAL B CB    1 
ATOM   5699  C  CG1   . VAL B  1 242 ? -56.976  28.011  -74.755  1.00 17.27  ? 242  VAL B CG1   1 
ATOM   5700  C  CG2   . VAL B  1 242 ? -57.007  29.284  -76.881  1.00 40.52  ? 242  VAL B CG2   1 
ATOM   5701  N  N     . HIS B  1 243 ? -59.102  25.647  -75.471  1.00 33.91  ? 243  HIS B N     1 
ATOM   5702  C  CA    . HIS B  1 243 ? -59.563  24.607  -74.558  1.00 40.01  ? 243  HIS B CA    1 
ATOM   5703  C  C     . HIS B  1 243 ? -59.254  23.188  -74.998  1.00 32.25  ? 243  HIS B C     1 
ATOM   5704  O  O     . HIS B  1 243 ? -58.802  22.372  -74.194  1.00 38.11  ? 243  HIS B O     1 
ATOM   5705  C  CB    . HIS B  1 243 ? -61.069  24.721  -74.357  1.00 14.55  ? 243  HIS B CB    1 
ATOM   5706  C  CG    . HIS B  1 243 ? -61.459  25.659  -73.260  1.00 23.97  ? 243  HIS B CG    1 
ATOM   5707  N  ND1   . HIS B  1 243 ? -62.489  26.5