data_1FQY
# 
_entry.id   1FQY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FQY         
RCSB  RCSB011836   
WWPDB D_1000011836 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FQY 
_pdbx_database_status.recvd_initial_deposition_date   2000-09-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Murata, K.'    1 
'Mitsuoka, K.'  2 
'Hirai, T.'     3 
'Walz, T.'      4 
'Agre, P.'      5 
'Heymann, J.B.' 6 
'Engel, A.'     7 
'Fujiyoshi, Y.' 8 
# 
_citation.id                        primary 
_citation.title                     'Structural determinants of water permeation through aquaporin-1.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            407 
_citation.page_first                599 
_citation.page_last                 605 
_citation.year                      2000 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11034202 
_citation.pdbx_database_id_DOI      10.1038/35036519 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Murata, K.'    1 
primary 'Mitsuoka, K.'  2 
primary 'Hirai, T.'     3 
primary 'Walz, T.'      4 
primary 'Agre, P.'      5 
primary 'Heymann, J.B.' 6 
primary 'Engel, A.'     7 
primary 'Fujiyoshi, Y.' 8 
# 
_cell.entry_id           1FQY 
_cell.length_a           96.000 
_cell.length_b           96.000 
_cell.length_c           100.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1FQY 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           AQUAPORIN-1 
_entity.formula_weight             28549.914 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AQP1 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVT
LGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRR
RRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVT
LGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRR
RRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   GLU n 
1 5   PHE n 
1 6   LYS n 
1 7   LYS n 
1 8   LYS n 
1 9   LEU n 
1 10  PHE n 
1 11  TRP n 
1 12  ARG n 
1 13  ALA n 
1 14  VAL n 
1 15  VAL n 
1 16  ALA n 
1 17  GLU n 
1 18  PHE n 
1 19  LEU n 
1 20  ALA n 
1 21  THR n 
1 22  THR n 
1 23  LEU n 
1 24  PHE n 
1 25  VAL n 
1 26  PHE n 
1 27  ILE n 
1 28  SER n 
1 29  ILE n 
1 30  GLY n 
1 31  SER n 
1 32  ALA n 
1 33  LEU n 
1 34  GLY n 
1 35  PHE n 
1 36  LYS n 
1 37  TYR n 
1 38  PRO n 
1 39  VAL n 
1 40  GLY n 
1 41  ASN n 
1 42  ASN n 
1 43  GLN n 
1 44  THR n 
1 45  ALA n 
1 46  VAL n 
1 47  GLN n 
1 48  ASP n 
1 49  ASN n 
1 50  VAL n 
1 51  LYS n 
1 52  VAL n 
1 53  SER n 
1 54  LEU n 
1 55  ALA n 
1 56  PHE n 
1 57  GLY n 
1 58  LEU n 
1 59  SER n 
1 60  ILE n 
1 61  ALA n 
1 62  THR n 
1 63  LEU n 
1 64  ALA n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  GLY n 
1 69  HIS n 
1 70  ILE n 
1 71  SER n 
1 72  GLY n 
1 73  ALA n 
1 74  HIS n 
1 75  LEU n 
1 76  ASN n 
1 77  PRO n 
1 78  ALA n 
1 79  VAL n 
1 80  THR n 
1 81  LEU n 
1 82  GLY n 
1 83  LEU n 
1 84  LEU n 
1 85  LEU n 
1 86  SER n 
1 87  CYS n 
1 88  GLN n 
1 89  ILE n 
1 90  SER n 
1 91  ILE n 
1 92  PHE n 
1 93  ARG n 
1 94  ALA n 
1 95  LEU n 
1 96  MET n 
1 97  TYR n 
1 98  ILE n 
1 99  ILE n 
1 100 ALA n 
1 101 GLN n 
1 102 CYS n 
1 103 VAL n 
1 104 GLY n 
1 105 ALA n 
1 106 ILE n 
1 107 VAL n 
1 108 ALA n 
1 109 THR n 
1 110 ALA n 
1 111 ILE n 
1 112 LEU n 
1 113 SER n 
1 114 GLY n 
1 115 ILE n 
1 116 THR n 
1 117 SER n 
1 118 SER n 
1 119 LEU n 
1 120 THR n 
1 121 GLY n 
1 122 ASN n 
1 123 SER n 
1 124 LEU n 
1 125 GLY n 
1 126 ARG n 
1 127 ASN n 
1 128 ASP n 
1 129 LEU n 
1 130 ALA n 
1 131 ASP n 
1 132 GLY n 
1 133 VAL n 
1 134 ASN n 
1 135 SER n 
1 136 GLY n 
1 137 GLN n 
1 138 GLY n 
1 139 LEU n 
1 140 GLY n 
1 141 ILE n 
1 142 GLU n 
1 143 ILE n 
1 144 ILE n 
1 145 GLY n 
1 146 THR n 
1 147 LEU n 
1 148 GLN n 
1 149 LEU n 
1 150 VAL n 
1 151 LEU n 
1 152 CYS n 
1 153 VAL n 
1 154 LEU n 
1 155 ALA n 
1 156 THR n 
1 157 THR n 
1 158 ASP n 
1 159 ARG n 
1 160 ARG n 
1 161 ARG n 
1 162 ARG n 
1 163 ASP n 
1 164 LEU n 
1 165 GLY n 
1 166 GLY n 
1 167 SER n 
1 168 ALA n 
1 169 PRO n 
1 170 LEU n 
1 171 ALA n 
1 172 ILE n 
1 173 GLY n 
1 174 LEU n 
1 175 SER n 
1 176 VAL n 
1 177 ALA n 
1 178 LEU n 
1 179 GLY n 
1 180 HIS n 
1 181 LEU n 
1 182 LEU n 
1 183 ALA n 
1 184 ILE n 
1 185 ASP n 
1 186 TYR n 
1 187 THR n 
1 188 GLY n 
1 189 CYS n 
1 190 GLY n 
1 191 ILE n 
1 192 ASN n 
1 193 PRO n 
1 194 ALA n 
1 195 ARG n 
1 196 SER n 
1 197 PHE n 
1 198 GLY n 
1 199 SER n 
1 200 ALA n 
1 201 VAL n 
1 202 ILE n 
1 203 THR n 
1 204 HIS n 
1 205 ASN n 
1 206 PHE n 
1 207 SER n 
1 208 ASN n 
1 209 HIS n 
1 210 TRP n 
1 211 ILE n 
1 212 PHE n 
1 213 TRP n 
1 214 VAL n 
1 215 GLY n 
1 216 PRO n 
1 217 PHE n 
1 218 ILE n 
1 219 GLY n 
1 220 GLY n 
1 221 ALA n 
1 222 LEU n 
1 223 ALA n 
1 224 VAL n 
1 225 LEU n 
1 226 ILE n 
1 227 TYR n 
1 228 ASP n 
1 229 PHE n 
1 230 ILE n 
1 231 LEU n 
1 232 ALA n 
1 233 PRO n 
1 234 ARG n 
1 235 SER n 
1 236 SER n 
1 237 ASP n 
1 238 LEU n 
1 239 THR n 
1 240 ASP n 
1 241 ARG n 
1 242 VAL n 
1 243 LYS n 
1 244 VAL n 
1 245 TRP n 
1 246 THR n 
1 247 SER n 
1 248 GLY n 
1 249 GLN n 
1 250 VAL n 
1 251 GLU n 
1 252 GLU n 
1 253 TYR n 
1 254 ASP n 
1 255 LEU n 
1 256 ASP n 
1 257 ALA n 
1 258 ASP n 
1 259 ASP n 
1 260 ILE n 
1 261 ASN n 
1 262 SER n 
1 263 ARG n 
1 264 VAL n 
1 265 GLU n 
1 266 MET n 
1 267 LYS n 
1 268 PRO n 
1 269 LYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                human 
_entity_src_nat.pdbx_organism_scientific   'Homo sapiens' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9606 
_entity_src_nat.genus                      Homo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ERYTHROCYTE 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_code                    AQP1_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P29972 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHISGAHLNPAVT
LGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGIEIIGTLQLVLCVLATTDRR
RRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTD
RVKVWTSGQVEEYDLDADDINSRVEMKPK
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1FQY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 269 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P29972 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  269 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       269 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FQY 
_exptl.method            'ELECTRON CRYSTALLOGRAPHY' 
_exptl.crystals_number   135 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'Dialysis with continuous flow dialysis machine' 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
;Escherichia coli lipids, magnesium chloride, sodium chloride, MES, pH 6.0, Dialysis with continuous flow dialysis machine, temperature 298K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           4.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'GATAN Model 795 MegaScan' 
_diffrn_detector.pdbx_collection_date   1996-06-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             electron 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.0197 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ELECTRON MICROSCOPE' 
_diffrn_source.type                        'JEOL 3000 SFF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             0.0197 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FQY 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             96.0 
_reflns.d_resolution_high            3.8 
_reflns.number_obs                   85254 
_reflns.number_all                   85254 
_reflns.percent_possible_obs         88.0 
_reflns.pdbx_Rmerge_I_obs            0.4950000 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        1.1 
_reflns.B_iso_Wilson_estimate        8.14 
_reflns.pdbx_redundancy              18.8 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.8 
_reflns_shell.d_res_low              3.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   86.9 
_reflns_shell.Rmerge_I_obs           0.7030000 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        13.2 
_reflns_shell.number_unique_all      4010 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1FQY 
_refine.ls_number_reflns_obs                     1846 
_refine.ls_number_reflns_all                     1846 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.pdbx_ls_sigma_F                          1.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             6.00 
_refine.ls_d_res_high                            3.80 
_refine.ls_percent_reflns_obs                    50.8 
_refine.ls_R_factor_obs                          0.4060000 
_refine.ls_R_factor_all                          0.4060000 
_refine.ls_R_factor_R_work                       0.3990000 
_refine.ls_R_factor_R_free                       0.4170000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 0.036 
_refine.ls_number_reflns_R_free                  124 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;For refinement with phase restraint, we used the structure factors merged  
from both electron diffraction patterns and images.  Thus in this file  
we included the structure factors with phases used in the refinement.  
The observed phases were labelled as calculated phases here.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'ELECTRON CRYSTALLOGRAPHY' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1FQY 
_refine_analyze.Luzzati_coordinate_error_obs    0.85 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'ELECTRON CRYSTALLOGRAPHY' 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON CRYSTALLOGRAPHY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1661 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1661 
_refine_hist.d_res_high                       3.80 
_refine_hist.d_res_low                        6.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d    0.017 ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 
x_angle_deg 2.794 ? ? ? 'ELECTRON CRYSTALLOGRAPHY' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.80 
_refine_ls_shell.d_res_low                        3.93 
_refine_ls_shell.number_reflns_R_work             ? 
_refine_ls_shell.R_factor_R_work                  0.4240000 
_refine_ls_shell.percent_reflns_obs               36.3 
_refine_ls_shell.R_factor_R_free                  0.3100000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            1.58 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'ELECTRON CRYSTALLOGRAPHY' 
# 
_struct.entry_id                  1FQY 
_struct.title                     'STRUCTURE OF AQUAPORIN-1 AT 3.8 A RESOLUTION BY ELECTRON CRYSTALLOGRAPHY' 
_struct.pdbx_descriptor           AQUAPORIN-1 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FQY 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
_struct_keywords.text            'WATER CHANNEL, TWO-DIMENSIONAL CRYSTAL, MEMBRANE PROTEIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The biological assembly is a tetramer constructed from chain A' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 8   ? TYR A 37  ? LYS A 8   TYR A 37  1 ? 30 
HELX_P HELX_P2 2 ASP A 48  ? VAL A 67  ? ASP A 48  VAL A 67  1 ? 20 
HELX_P HELX_P3 3 ASN A 76  ? LEU A 85  ? ASN A 76  LEU A 85  1 ? 10 
HELX_P HELX_P4 4 ALA A 94  ? THR A 116 ? ALA A 94  THR A 116 1 ? 23 
HELX_P HELX_P5 5 GLY A 136 ? THR A 156 ? GLY A 136 THR A 156 1 ? 21 
HELX_P HELX_P6 6 GLY A 166 ? ILE A 184 ? GLY A 166 ILE A 184 1 ? 19 
HELX_P HELX_P7 7 ASN A 192 ? VAL A 201 ? ASN A 192 VAL A 201 1 ? 10 
HELX_P HELX_P8 8 SER A 207 ? PHE A 229 ? SER A 207 PHE A 229 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1FQY 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FQY 
_atom_sites.fract_transf_matrix[1][1]   0.010417 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010417 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . LYS A 1 8   ? 56.812 30.226 17.376  1.00 10.00  ? 8   LYS A N   1 
ATOM 2    C CA  . LYS A 1 8   ? 57.972 30.061 16.444  1.00 10.00  ? 8   LYS A CA  1 
ATOM 3    C C   . LYS A 1 8   ? 57.595 28.971 15.486  1.00 10.00  ? 8   LYS A C   1 
ATOM 4    O O   . LYS A 1 8   ? 57.990 28.922 14.332  1.00 46.93  ? 8   LYS A O   1 
ATOM 5    C CB  . LYS A 1 8   ? 59.210 29.616 17.216  1.00 46.93  ? 8   LYS A CB  1 
ATOM 6    C CG  . LYS A 1 8   ? 59.575 30.484 18.403  1.00 46.93  ? 8   LYS A CG  1 
ATOM 7    C CD  . LYS A 1 8   ? 59.667 31.974 17.988  1.00 46.93  ? 8   LYS A CD  1 
ATOM 8    C CE  . LYS A 1 8   ? 59.865 32.934 19.166  1.00 46.93  ? 8   LYS A CE  1 
ATOM 9    N NZ  . LYS A 1 8   ? 59.935 34.336 18.667  1.00 46.93  ? 8   LYS A NZ  1 
ATOM 10   N N   . LEU A 1 9   ? 56.864 28.048 16.039  1.00 10.00  ? 9   LEU A N   1 
ATOM 11   C CA  . LEU A 1 9   ? 56.388 26.931 15.316  1.00 10.00  ? 9   LEU A CA  1 
ATOM 12   C C   . LEU A 1 9   ? 55.512 27.309 14.126  1.00 10.00  ? 9   LEU A C   1 
ATOM 13   O O   . LEU A 1 9   ? 55.645 26.754 13.058  1.00 76.85  ? 9   LEU A O   1 
ATOM 14   C CB  . LEU A 1 9   ? 55.620 26.132 16.327  1.00 76.85  ? 9   LEU A CB  1 
ATOM 15   C CG  . LEU A 1 9   ? 55.076 24.788 15.919  1.00 76.85  ? 9   LEU A CG  1 
ATOM 16   C CD1 . LEU A 1 9   ? 56.207 23.930 15.453  1.00 76.85  ? 9   LEU A CD1 1 
ATOM 17   C CD2 . LEU A 1 9   ? 54.358 24.152 17.099  1.00 76.85  ? 9   LEU A CD2 1 
ATOM 18   N N   . PHE A 1 10  ? 54.578 28.230 14.337  1.00 10.00  ? 10  PHE A N   1 
ATOM 19   C CA  . PHE A 1 10  ? 53.661 28.662 13.276  1.00 10.00  ? 10  PHE A CA  1 
ATOM 20   C C   . PHE A 1 10  ? 54.390 29.054 12.017  1.00 10.00  ? 10  PHE A C   1 
ATOM 21   O O   . PHE A 1 10  ? 53.834 29.017 10.918  1.00 10.00  ? 10  PHE A O   1 
ATOM 22   C CB  . PHE A 1 10  ? 52.764 29.831 13.745  1.00 10.00  ? 10  PHE A CB  1 
ATOM 23   C CG  . PHE A 1 10  ? 51.838 30.398 12.669  1.00 10.00  ? 10  PHE A CG  1 
ATOM 24   C CD1 . PHE A 1 10  ? 52.305 31.324 11.743  1.00 10.00  ? 10  PHE A CD1 1 
ATOM 25   C CD2 . PHE A 1 10  ? 50.513 30.009 12.580  1.00 10.00  ? 10  PHE A CD2 1 
ATOM 26   C CE1 . PHE A 1 10  ? 51.471 31.840 10.738  1.00 10.00  ? 10  PHE A CE1 1 
ATOM 27   C CE2 . PHE A 1 10  ? 49.675 30.531 11.567  1.00 10.00  ? 10  PHE A CE2 1 
ATOM 28   C CZ  . PHE A 1 10  ? 50.167 31.446 10.657  1.00 10.00  ? 10  PHE A CZ  1 
ATOM 29   N N   . TRP A 1 11  ? 55.651 29.393 12.159  1.00 10.00  ? 11  TRP A N   1 
ATOM 30   C CA  . TRP A 1 11  ? 56.427 29.835 11.021  1.00 10.00  ? 11  TRP A CA  1 
ATOM 31   C C   . TRP A 1 11  ? 57.131 28.662 10.324  1.00 10.00  ? 11  TRP A C   1 
ATOM 32   O O   . TRP A 1 11  ? 57.023 28.521 9.101   1.00 10.00  ? 11  TRP A O   1 
ATOM 33   C CB  . TRP A 1 11  ? 57.416 30.897 11.495  1.00 10.00  ? 11  TRP A CB  1 
ATOM 34   C CG  . TRP A 1 11  ? 56.745 31.990 12.376  1.00 10.00  ? 11  TRP A CG  1 
ATOM 35   C CD1 . TRP A 1 11  ? 56.836 32.125 13.731  1.00 10.00  ? 11  TRP A CD1 1 
ATOM 36   C CD2 . TRP A 1 11  ? 55.801 32.965 11.942  1.00 10.00  ? 11  TRP A CD2 1 
ATOM 37   N NE1 . TRP A 1 11  ? 55.976 33.104 14.174  1.00 10.00  ? 11  TRP A NE1 1 
ATOM 38   C CE2 . TRP A 1 11  ? 55.322 33.635 13.094  1.00 10.00  ? 11  TRP A CE2 1 
ATOM 39   C CE3 . TRP A 1 11  ? 55.279 33.329 10.702  1.00 10.00  ? 11  TRP A CE3 1 
ATOM 40   C CZ2 . TRP A 1 11  ? 54.369 34.640 13.031  1.00 10.00  ? 11  TRP A CZ2 1 
ATOM 41   C CZ3 . TRP A 1 11  ? 54.334 34.319 10.637  1.00 10.00  ? 11  TRP A CZ3 1 
ATOM 42   C CH2 . TRP A 1 11  ? 53.880 34.960 11.797  1.00 10.00  ? 11  TRP A CH2 1 
ATOM 43   N N   . ARG A 1 12  ? 57.880 27.819 11.040  1.00 67.44  ? 12  ARG A N   1 
ATOM 44   C CA  . ARG A 1 12  ? 58.452 26.661 10.317  1.00 67.44  ? 12  ARG A CA  1 
ATOM 45   C C   . ARG A 1 12  ? 57.229 25.981 9.683   1.00 67.44  ? 12  ARG A C   1 
ATOM 46   O O   . ARG A 1 12  ? 57.319 25.392 8.603   1.00 10.00  ? 12  ARG A O   1 
ATOM 47   C CB  . ARG A 1 12  ? 59.152 25.591 11.203  1.00 10.00  ? 12  ARG A CB  1 
ATOM 48   C CG  . ARG A 1 12  ? 59.950 26.105 12.355  1.00 10.00  ? 12  ARG A CG  1 
ATOM 49   C CD  . ARG A 1 12  ? 60.862 25.127 13.069  1.00 10.00  ? 12  ARG A CD  1 
ATOM 50   N NE  . ARG A 1 12  ? 60.962 25.621 14.457  1.00 10.00  ? 12  ARG A NE  1 
ATOM 51   C CZ  . ARG A 1 12  ? 61.696 25.093 15.433  1.00 10.00  ? 12  ARG A CZ  1 
ATOM 52   N NH1 . ARG A 1 12  ? 62.379 24.010 15.252  1.00 10.00  ? 12  ARG A NH1 1 
ATOM 53   N NH2 . ARG A 1 12  ? 61.658 25.572 16.689  1.00 10.00  ? 12  ARG A NH2 1 
ATOM 54   N N   . ALA A 1 13  ? 56.107 26.042 10.405  1.00 10.00  ? 13  ALA A N   1 
ATOM 55   C CA  . ALA A 1 13  ? 54.859 25.453 9.964   1.00 10.00  ? 13  ALA A CA  1 
ATOM 56   C C   . ALA A 1 13  ? 54.605 25.914 8.554   1.00 10.00  ? 13  ALA A C   1 
ATOM 57   O O   . ALA A 1 13  ? 54.563 25.098 7.650   1.00 10.00  ? 13  ALA A O   1 
ATOM 58   C CB  . ALA A 1 13  ? 53.708 25.850 10.874  1.00 10.00  ? 13  ALA A CB  1 
ATOM 59   N N   . VAL A 1 14  ? 54.478 27.220 8.344   1.00 10.00  ? 14  VAL A N   1 
ATOM 60   C CA  . VAL A 1 14  ? 54.214 27.677 6.984   1.00 10.00  ? 14  VAL A CA  1 
ATOM 61   C C   . VAL A 1 14  ? 55.265 27.194 6.012   1.00 10.00  ? 14  VAL A C   1 
ATOM 62   O O   . VAL A 1 14  ? 54.937 26.708 4.935   1.00 10.00  ? 14  VAL A O   1 
ATOM 63   C CB  . VAL A 1 14  ? 54.131 29.200 6.824   1.00 10.00  ? 14  VAL A CB  1 
ATOM 64   C CG1 . VAL A 1 14  ? 53.606 29.507 5.437   1.00 10.00  ? 14  VAL A CG1 1 
ATOM 65   C CG2 . VAL A 1 14  ? 53.254 29.815 7.888   1.00 10.00  ? 14  VAL A CG2 1 
ATOM 66   N N   . VAL A 1 15  ? 56.531 27.440 6.333   1.00 48.66  ? 15  VAL A N   1 
ATOM 67   C CA  . VAL A 1 15  ? 57.573 26.992 5.429   1.00 48.66  ? 15  VAL A CA  1 
ATOM 68   C C   . VAL A 1 15  ? 57.423 25.491 5.227   1.00 48.66  ? 15  VAL A C   1 
ATOM 69   O O   . VAL A 1 15  ? 57.468 25.017 4.089   1.00 10.00  ? 15  VAL A O   1 
ATOM 70   C CB  . VAL A 1 15  ? 59.005 27.353 5.894   1.00 10.00  ? 15  VAL A CB  1 
ATOM 71   C CG1 . VAL A 1 15  ? 59.310 28.815 5.558   1.00 10.00  ? 15  VAL A CG1 1 
ATOM 72   C CG2 . VAL A 1 15  ? 59.213 26.973 7.358   1.00 10.00  ? 15  VAL A CG2 1 
ATOM 73   N N   . ALA A 1 16  ? 57.156 24.771 6.320   1.00 10.00  ? 16  ALA A N   1 
ATOM 74   C CA  . ALA A 1 16  ? 56.993 23.322 6.297   1.00 10.00  ? 16  ALA A CA  1 
ATOM 75   C C   . ALA A 1 16  ? 56.075 22.978 5.159   1.00 10.00  ? 16  ALA A C   1 
ATOM 76   O O   . ALA A 1 16  ? 56.278 21.990 4.463   1.00 10.00  ? 16  ALA A O   1 
ATOM 77   C CB  . ALA A 1 16  ? 56.429 22.810 7.619   1.00 10.00  ? 16  ALA A CB  1 
ATOM 78   N N   . GLU A 1 17  ? 55.066 23.805 4.961   1.00 10.00  ? 17  GLU A N   1 
ATOM 79   C CA  . GLU A 1 17  ? 54.163 23.566 3.875   1.00 10.00  ? 17  GLU A CA  1 
ATOM 80   C C   . GLU A 1 17  ? 54.655 24.290 2.629   1.00 10.00  ? 17  GLU A C   1 
ATOM 81   O O   . GLU A 1 17  ? 54.446 23.783 1.522   1.00 36.30  ? 17  GLU A O   1 
ATOM 82   C CB  . GLU A 1 17  ? 52.751 24.021 4.231   1.00 36.30  ? 17  GLU A CB  1 
ATOM 83   C CG  . GLU A 1 17  ? 52.076 23.217 5.336   1.00 36.30  ? 17  GLU A CG  1 
ATOM 84   C CD  . GLU A 1 17  ? 50.864 23.928 5.908   1.00 36.30  ? 17  GLU A CD  1 
ATOM 85   O OE1 . GLU A 1 17  ? 50.789 25.160 5.798   1.00 36.30  ? 17  GLU A OE1 1 
ATOM 86   O OE2 . GLU A 1 17  ? 49.981 23.265 6.477   1.00 36.30  ? 17  GLU A OE2 1 
ATOM 87   N N   . PHE A 1 18  ? 55.268 25.473 2.786   1.00 11.03  ? 18  PHE A N   1 
ATOM 88   C CA  . PHE A 1 18  ? 55.758 26.233 1.627   1.00 11.03  ? 18  PHE A CA  1 
ATOM 89   C C   . PHE A 1 18  ? 56.570 25.302 0.767   1.00 11.03  ? 18  PHE A C   1 
ATOM 90   O O   . PHE A 1 18  ? 56.376 25.175 -0.438  1.00 10.00  ? 18  PHE A O   1 
ATOM 91   C CB  . PHE A 1 18  ? 56.635 27.404 2.059   1.00 10.00  ? 18  PHE A CB  1 
ATOM 92   C CG  . PHE A 1 18  ? 57.185 28.187 0.909   1.00 10.00  ? 18  PHE A CG  1 
ATOM 93   C CD1 . PHE A 1 18  ? 56.481 29.253 0.380   1.00 10.00  ? 18  PHE A CD1 1 
ATOM 94   C CD2 . PHE A 1 18  ? 58.373 27.820 0.306   1.00 10.00  ? 18  PHE A CD2 1 
ATOM 95   C CE1 . PHE A 1 18  ? 56.961 29.932 -0.741  1.00 10.00  ? 18  PHE A CE1 1 
ATOM 96   C CE2 . PHE A 1 18  ? 58.858 28.493 -0.814  1.00 10.00  ? 18  PHE A CE2 1 
ATOM 97   C CZ  . PHE A 1 18  ? 58.159 29.541 -1.340  1.00 10.00  ? 18  PHE A CZ  1 
ATOM 98   N N   . LEU A 1 19  ? 57.502 24.676 1.450   1.00 10.00  ? 19  LEU A N   1 
ATOM 99   C CA  . LEU A 1 19  ? 58.421 23.728 0.899   1.00 10.00  ? 19  LEU A CA  1 
ATOM 100  C C   . LEU A 1 19  ? 57.652 22.538 0.376   1.00 10.00  ? 19  LEU A C   1 
ATOM 101  O O   . LEU A 1 19  ? 57.475 22.395 -0.824  1.00 10.00  ? 19  LEU A O   1 
ATOM 102  C CB  . LEU A 1 19  ? 59.326 23.286 2.040   1.00 10.00  ? 19  LEU A CB  1 
ATOM 103  C CG  . LEU A 1 19  ? 60.777 22.950 1.825   1.00 10.00  ? 19  LEU A CG  1 
ATOM 104  C CD1 . LEU A 1 19  ? 61.326 23.709 0.631   1.00 10.00  ? 19  LEU A CD1 1 
ATOM 105  C CD2 . LEU A 1 19  ? 61.484 23.305 3.112   1.00 10.00  ? 19  LEU A CD2 1 
ATOM 106  N N   . ALA A 1 20  ? 57.228 21.682 1.307   1.00 10.00  ? 20  ALA A N   1 
ATOM 107  C CA  . ALA A 1 20  ? 56.490 20.447 1.026   1.00 10.00  ? 20  ALA A CA  1 
ATOM 108  C C   . ALA A 1 20  ? 55.636 20.502 -0.220  1.00 10.00  ? 20  ALA A C   1 
ATOM 109  O O   . ALA A 1 20  ? 55.905 19.808 -1.198  1.00 10.00  ? 20  ALA A O   1 
ATOM 110  C CB  . ALA A 1 20  ? 55.640 20.051 2.230   1.00 10.00  ? 20  ALA A CB  1 
ATOM 111  N N   . THR A 1 21  ? 54.586 21.306 -0.149  1.00 10.00  ? 21  THR A N   1 
ATOM 112  C CA  . THR A 1 21  ? 53.661 21.509 -1.255  1.00 10.00  ? 21  THR A CA  1 
ATOM 113  C C   . THR A 1 21  ? 54.416 21.644 -2.572  1.00 10.00  ? 21  THR A C   1 
ATOM 114  O O   . THR A 1 21  ? 54.021 21.070 -3.591  1.00 10.00  ? 21  THR A O   1 
ATOM 115  C CB  . THR A 1 21  ? 52.824 22.790 -1.016  1.00 10.00  ? 21  THR A CB  1 
ATOM 116  O OG1 . THR A 1 21  ? 51.669 22.489 -0.228  1.00 10.00  ? 21  THR A OG1 1 
ATOM 117  C CG2 . THR A 1 21  ? 52.406 23.422 -2.314  1.00 10.00  ? 21  THR A CG2 1 
ATOM 118  N N   . THR A 1 22  ? 55.497 22.411 -2.539  1.00 10.00  ? 22  THR A N   1 
ATOM 119  C CA  . THR A 1 22  ? 56.289 22.623 -3.724  1.00 10.00  ? 22  THR A CA  1 
ATOM 120  C C   . THR A 1 22  ? 56.781 21.293 -4.207  1.00 10.00  ? 22  THR A C   1 
ATOM 121  O O   . THR A 1 22  ? 56.583 20.947 -5.368  1.00 10.00  ? 22  THR A O   1 
ATOM 122  C CB  . THR A 1 22  ? 57.472 23.519 -3.449  1.00 10.00  ? 22  THR A CB  1 
ATOM 123  O OG1 . THR A 1 22  ? 57.014 24.759 -2.910  1.00 10.00  ? 22  THR A OG1 1 
ATOM 124  C CG2 . THR A 1 22  ? 58.208 23.791 -4.731  1.00 10.00  ? 22  THR A CG2 1 
ATOM 125  N N   . LEU A 1 23  ? 57.458 20.573 -3.321  1.00 10.00  ? 23  LEU A N   1 
ATOM 126  C CA  . LEU A 1 23  ? 57.973 19.258 -3.642  1.00 10.00  ? 23  LEU A CA  1 
ATOM 127  C C   . LEU A 1 23  ? 56.840 18.436 -4.230  1.00 10.00  ? 23  LEU A C   1 
ATOM 128  O O   . LEU A 1 23  ? 57.014 17.783 -5.254  1.00 10.00  ? 23  LEU A O   1 
ATOM 129  C CB  . LEU A 1 23  ? 58.502 18.556 -2.387  1.00 10.00  ? 23  LEU A CB  1 
ATOM 130  C CG  . LEU A 1 23  ? 59.707 19.118 -1.637  1.00 10.00  ? 23  LEU A CG  1 
ATOM 131  C CD1 . LEU A 1 23  ? 60.175 18.155 -0.557  1.00 10.00  ? 23  LEU A CD1 1 
ATOM 132  C CD2 . LEU A 1 23  ? 60.811 19.359 -2.638  1.00 10.00  ? 23  LEU A CD2 1 
ATOM 133  N N   . PHE A 1 24  ? 55.692 18.471 -3.560  1.00 10.00  ? 24  PHE A N   1 
ATOM 134  C CA  . PHE A 1 24  ? 54.498 17.742 -3.983  1.00 10.00  ? 24  PHE A CA  1 
ATOM 135  C C   . PHE A 1 24  ? 54.140 18.013 -5.432  1.00 10.00  ? 24  PHE A C   1 
ATOM 136  O O   . PHE A 1 24  ? 54.187 17.125 -6.276  1.00 10.00  ? 24  PHE A O   1 
ATOM 137  C CB  . PHE A 1 24  ? 53.309 18.075 -3.047  1.00 10.00  ? 24  PHE A CB  1 
ATOM 138  C CG  . PHE A 1 24  ? 51.957 17.956 -3.693  1.00 10.00  ? 24  PHE A CG  1 
ATOM 139  C CD1 . PHE A 1 24  ? 51.503 16.754 -4.167  1.00 10.00  ? 24  PHE A CD1 1 
ATOM 140  C CD2 . PHE A 1 24  ? 51.163 19.069 -3.878  1.00 10.00  ? 24  PHE A CD2 1 
ATOM 141  C CE1 . PHE A 1 24  ? 50.272 16.664 -4.828  1.00 10.00  ? 24  PHE A CE1 1 
ATOM 142  C CE2 . PHE A 1 24  ? 49.938 18.983 -4.536  1.00 10.00  ? 24  PHE A CE2 1 
ATOM 143  C CZ  . PHE A 1 24  ? 49.495 17.778 -5.012  1.00 10.00  ? 24  PHE A CZ  1 
ATOM 144  N N   . VAL A 1 25  ? 53.806 19.259 -5.716  1.00 10.00  ? 25  VAL A N   1 
ATOM 145  C CA  . VAL A 1 25  ? 53.393 19.602 -7.053  1.00 10.00  ? 25  VAL A CA  1 
ATOM 146  C C   . VAL A 1 25  ? 54.452 19.385 -8.093  1.00 10.00  ? 25  VAL A C   1 
ATOM 147  O O   . VAL A 1 25  ? 54.153 19.310 -9.278  1.00 10.00  ? 25  VAL A O   1 
ATOM 148  C CB  . VAL A 1 25  ? 52.876 21.037 -7.157  1.00 10.00  ? 25  VAL A CB  1 
ATOM 149  C CG1 . VAL A 1 25  ? 51.725 21.102 -8.144  1.00 10.00  ? 25  VAL A CG1 1 
ATOM 150  C CG2 . VAL A 1 25  ? 52.424 21.526 -5.834  1.00 10.00  ? 25  VAL A CG2 1 
ATOM 151  N N   . PHE A 1 26  ? 55.702 19.335 -7.689  1.00 10.00  ? 26  PHE A N   1 
ATOM 152  C CA  . PHE A 1 26  ? 56.696 19.125 -8.706  1.00 10.00  ? 26  PHE A CA  1 
ATOM 153  C C   . PHE A 1 26  ? 56.629 17.687 -9.179  1.00 10.00  ? 26  PHE A C   1 
ATOM 154  O O   . PHE A 1 26  ? 56.645 17.425 -10.380 1.00 12.26  ? 26  PHE A O   1 
ATOM 155  C CB  . PHE A 1 26  ? 58.098 19.449 -8.216  1.00 12.26  ? 26  PHE A CB  1 
ATOM 156  C CG  . PHE A 1 26  ? 59.139 19.224 -9.255  1.00 12.26  ? 26  PHE A CG  1 
ATOM 157  C CD1 . PHE A 1 26  ? 58.929 19.652 -10.562 1.00 12.26  ? 26  PHE A CD1 1 
ATOM 158  C CD2 . PHE A 1 26  ? 60.299 18.540 -8.952  1.00 12.26  ? 26  PHE A CD2 1 
ATOM 159  C CE1 . PHE A 1 26  ? 59.860 19.393 -11.543 1.00 12.26  ? 26  PHE A CE1 1 
ATOM 160  C CE2 . PHE A 1 26  ? 61.230 18.281 -9.932  1.00 12.26  ? 26  PHE A CE2 1 
ATOM 161  C CZ  . PHE A 1 26  ? 61.011 18.706 -11.227 1.00 12.26  ? 26  PHE A CZ  1 
ATOM 162  N N   . ILE A 1 27  ? 56.634 16.756 -8.230  1.00 89.49  ? 27  ILE A N   1 
ATOM 163  C CA  . ILE A 1 27  ? 56.573 15.337 -8.550  1.00 89.49  ? 27  ILE A CA  1 
ATOM 164  C C   . ILE A 1 27  ? 55.356 15.132 -9.417  1.00 89.49  ? 27  ILE A C   1 
ATOM 165  O O   . ILE A 1 27  ? 55.438 14.600 -10.520 1.00 10.00  ? 27  ILE A O   1 
ATOM 166  C CB  . ILE A 1 27  ? 56.341 14.472 -7.302  1.00 10.00  ? 27  ILE A CB  1 
ATOM 167  C CG1 . ILE A 1 27  ? 57.264 14.896 -6.165  1.00 10.00  ? 27  ILE A CG1 1 
ATOM 168  C CG2 . ILE A 1 27  ? 56.559 13.000 -7.641  1.00 10.00  ? 27  ILE A CG2 1 
ATOM 169  C CD1 . ILE A 1 27  ? 56.823 14.347 -4.834  1.00 10.00  ? 27  ILE A CD1 1 
ATOM 170  N N   . SER A 1 28  ? 54.230 15.579 -8.888  1.00 10.00  ? 28  SER A N   1 
ATOM 171  C CA  . SER A 1 28  ? 52.976 15.439 -9.569  1.00 10.00  ? 28  SER A CA  1 
ATOM 172  C C   . SER A 1 28  ? 53.078 15.882 -11.009 1.00 10.00  ? 28  SER A C   1 
ATOM 173  O O   . SER A 1 28  ? 52.738 15.134 -11.926 1.00 100.00 ? 28  SER A O   1 
ATOM 174  C CB  . SER A 1 28  ? 51.885 16.222 -8.839  1.00 100.00 ? 28  SER A CB  1 
ATOM 175  O OG  . SER A 1 28  ? 52.132 17.612 -8.810  1.00 100.00 ? 28  SER A OG  1 
ATOM 176  N N   . ILE A 1 29  ? 53.501 17.119 -11.204 1.00 10.00  ? 29  ILE A N   1 
ATOM 177  C CA  . ILE A 1 29  ? 53.638 17.656 -12.538 1.00 10.00  ? 29  ILE A CA  1 
ATOM 178  C C   . ILE A 1 29  ? 54.787 16.936 -13.221 1.00 10.00  ? 29  ILE A C   1 
ATOM 179  O O   . ILE A 1 29  ? 54.924 16.986 -14.441 1.00 10.00  ? 29  ILE A O   1 
ATOM 180  C CB  . ILE A 1 29  ? 53.861 19.188 -12.492 1.00 10.00  ? 29  ILE A CB  1 
ATOM 181  C CG1 . ILE A 1 29  ? 53.384 19.817 -13.805 1.00 10.00  ? 29  ILE A CG1 1 
ATOM 182  C CG2 . ILE A 1 29  ? 55.337 19.520 -12.142 1.00 10.00  ? 29  ILE A CG2 1 
ATOM 183  C CD1 . ILE A 1 29  ? 52.591 21.101 -13.631 1.00 10.00  ? 29  ILE A CD1 1 
ATOM 184  N N   . GLY A 1 30  ? 55.599 16.270 -12.412 1.00 10.00  ? 30  GLY A N   1 
ATOM 185  C CA  . GLY A 1 30  ? 56.725 15.536 -12.922 1.00 10.00  ? 30  GLY A CA  1 
ATOM 186  C C   . GLY A 1 30  ? 56.212 14.362 -13.697 1.00 10.00  ? 30  GLY A C   1 
ATOM 187  O O   . GLY A 1 30  ? 56.235 14.383 -14.917 1.00 29.66  ? 30  GLY A O   1 
ATOM 188  N N   . SER A 1 31  ? 55.715 13.356 -12.985 1.00 73.15  ? 31  SER A N   1 
ATOM 189  C CA  . SER A 1 31  ? 55.197 12.132 -13.607 1.00 73.15  ? 31  SER A CA  1 
ATOM 190  C C   . SER A 1 31  ? 54.294 12.349 -14.818 1.00 73.15  ? 31  SER A C   1 
ATOM 191  O O   . SER A 1 31  ? 54.531 11.776 -15.877 1.00 10.00  ? 31  SER A O   1 
ATOM 192  C CB  . SER A 1 31  ? 54.503 11.232 -12.571 1.00 10.00  ? 31  SER A CB  1 
ATOM 193  O OG  . SER A 1 31  ? 53.664 11.974 -11.717 1.00 10.00  ? 31  SER A OG  1 
ATOM 194  N N   . ALA A 1 32  ? 53.250 13.150 -14.646 1.00 10.00  ? 32  ALA A N   1 
ATOM 195  C CA  . ALA A 1 32  ? 52.316 13.435 -15.716 1.00 10.00  ? 32  ALA A CA  1 
ATOM 196  C C   . ALA A 1 32  ? 53.091 13.781 -16.968 1.00 10.00  ? 32  ALA A C   1 
ATOM 197  O O   . ALA A 1 32  ? 53.045 13.057 -17.958 1.00 10.00  ? 32  ALA A O   1 
ATOM 198  C CB  . ALA A 1 32  ? 51.410 14.575 -15.314 1.00 10.00  ? 32  ALA A CB  1 
ATOM 199  N N   . LEU A 1 33  ? 53.800 14.898 -16.916 1.00 10.00  ? 33  LEU A N   1 
ATOM 200  C CA  . LEU A 1 33  ? 54.615 15.315 -18.038 1.00 10.00  ? 33  LEU A CA  1 
ATOM 201  C C   . LEU A 1 33  ? 55.599 14.213 -18.303 1.00 10.00  ? 33  LEU A C   1 
ATOM 202  O O   . LEU A 1 33  ? 56.079 14.036 -19.421 1.00 10.00  ? 33  LEU A O   1 
ATOM 203  C CB  . LEU A 1 33  ? 55.396 16.562 -17.683 1.00 10.00  ? 33  LEU A CB  1 
ATOM 204  C CG  . LEU A 1 33  ? 54.492 17.755 -17.506 1.00 10.00  ? 33  LEU A CG  1 
ATOM 205  C CD1 . LEU A 1 33  ? 55.331 19.009 -17.464 1.00 10.00  ? 33  LEU A CD1 1 
ATOM 206  C CD2 . LEU A 1 33  ? 53.514 17.791 -18.674 1.00 10.00  ? 33  LEU A CD2 1 
ATOM 207  N N   . GLY A 1 34  ? 55.925 13.507 -17.231 1.00 10.00  ? 34  GLY A N   1 
ATOM 208  C CA  . GLY A 1 34  ? 56.875 12.436 -17.335 1.00 10.00  ? 34  GLY A CA  1 
ATOM 209  C C   . GLY A 1 34  ? 56.477 11.546 -18.459 1.00 10.00  ? 34  GLY A C   1 
ATOM 210  O O   . GLY A 1 34  ? 57.275 11.313 -19.344 1.00 10.00  ? 34  GLY A O   1 
ATOM 211  N N   . PHE A 1 35  ? 55.199 11.203 -18.508 1.00 71.53  ? 35  PHE A N   1 
ATOM 212  C CA  . PHE A 1 35  ? 54.728 10.285 -19.531 1.00 71.53  ? 35  PHE A CA  1 
ATOM 213  C C   . PHE A 1 35  ? 54.541 10.685 -20.971 1.00 71.53  ? 35  PHE A C   1 
ATOM 214  O O   . PHE A 1 35  ? 54.726 9.887  -21.841 1.00 10.00  ? 35  PHE A O   1 
ATOM 215  C CB  . PHE A 1 35  ? 53.551 9.473  -19.040 1.00 10.00  ? 35  PHE A CB  1 
ATOM 216  C CG  . PHE A 1 35  ? 53.911 8.589  -17.924 1.00 10.00  ? 35  PHE A CG  1 
ATOM 217  C CD1 . PHE A 1 35  ? 54.180 9.140  -16.687 1.00 10.00  ? 35  PHE A CD1 1 
ATOM 218  C CD2 . PHE A 1 35  ? 54.102 7.238  -18.113 1.00 10.00  ? 35  PHE A CD2 1 
ATOM 219  C CE1 . PHE A 1 35  ? 54.629 8.373  -15.638 1.00 10.00  ? 35  PHE A CE1 1 
ATOM 220  C CE2 . PHE A 1 35  ? 54.557 6.451  -17.056 1.00 10.00  ? 35  PHE A CE2 1 
ATOM 221  C CZ  . PHE A 1 35  ? 54.826 7.030  -15.814 1.00 10.00  ? 35  PHE A CZ  1 
ATOM 222  N N   . LYS A 1 36  ? 54.215 11.920 -21.251 1.00 35.43  ? 36  LYS A N   1 
ATOM 223  C CA  . LYS A 1 36  ? 54.032 12.299 -22.640 1.00 35.43  ? 36  LYS A CA  1 
ATOM 224  C C   . LYS A 1 36  ? 55.295 12.498 -23.414 1.00 35.43  ? 36  LYS A C   1 
ATOM 225  O O   . LYS A 1 36  ? 55.216 12.660 -24.645 1.00 78.63  ? 36  LYS A O   1 
ATOM 226  C CB  . LYS A 1 36  ? 53.287 13.654 -22.709 1.00 78.63  ? 36  LYS A CB  1 
ATOM 227  C CG  . LYS A 1 36  ? 53.025 14.264 -24.111 1.00 78.63  ? 36  LYS A CG  1 
ATOM 228  C CD  . LYS A 1 36  ? 53.630 15.680 -24.328 1.00 78.63  ? 36  LYS A CD  1 
ATOM 229  C CE  . LYS A 1 36  ? 53.635 16.035 -25.812 1.00 78.63  ? 36  LYS A CE  1 
ATOM 230  N NZ  . LYS A 1 36  ? 52.805 17.229 -26.096 1.00 78.63  ? 36  LYS A NZ  1 
ATOM 231  N N   . TYR A 1 37  ? 56.469 12.369 -22.825 1.00 10.00  ? 37  TYR A N   1 
ATOM 232  C CA  . TYR A 1 37  ? 57.485 12.880 -23.669 1.00 10.00  ? 37  TYR A CA  1 
ATOM 233  C C   . TYR A 1 37  ? 58.413 12.386 -24.797 1.00 10.00  ? 37  TYR A C   1 
ATOM 234  O O   . TYR A 1 37  ? 58.412 13.076 -25.821 1.00 99.94  ? 37  TYR A O   1 
ATOM 235  C CB  . TYR A 1 37  ? 58.195 13.935 -22.854 1.00 99.94  ? 37  TYR A CB  1 
ATOM 236  C CG  . TYR A 1 37  ? 59.277 13.442 -22.016 1.00 99.94  ? 37  TYR A CG  1 
ATOM 237  C CD1 . TYR A 1 37  ? 59.056 13.030 -20.708 1.00 99.94  ? 37  TYR A CD1 1 
ATOM 238  C CD2 . TYR A 1 37  ? 60.558 13.446 -22.515 1.00 99.94  ? 37  TYR A CD2 1 
ATOM 239  C CE1 . TYR A 1 37  ? 60.130 12.644 -19.902 1.00 99.94  ? 37  TYR A CE1 1 
ATOM 240  C CE2 . TYR A 1 37  ? 61.621 13.067 -21.745 1.00 99.94  ? 37  TYR A CE2 1 
ATOM 241  C CZ  . TYR A 1 37  ? 61.399 12.671 -20.450 1.00 99.94  ? 37  TYR A CZ  1 
ATOM 242  O OH  . TYR A 1 37  ? 62.474 12.367 -19.711 1.00 99.94  ? 37  TYR A OH  1 
ATOM 243  N N   . PRO A 1 38  ? 59.237 11.305 -24.674 1.00 99.54  ? 38  PRO A N   1 
ATOM 244  C CA  . PRO A 1 38  ? 59.979 11.081 -25.924 1.00 99.54  ? 38  PRO A CA  1 
ATOM 245  C C   . PRO A 1 38  ? 59.105 11.091 -27.178 1.00 99.54  ? 38  PRO A C   1 
ATOM 246  O O   . PRO A 1 38  ? 57.884 10.978 -27.057 1.00 10.00  ? 38  PRO A O   1 
ATOM 247  C CB  . PRO A 1 38  ? 60.708 9.786  -25.667 1.00 10.00  ? 38  PRO A CB  1 
ATOM 248  C CG  . PRO A 1 38  ? 61.158 10.042 -24.253 1.00 10.00  ? 38  PRO A CG  1 
ATOM 249  C CD  . PRO A 1 38  ? 59.843 10.465 -23.609 1.00 10.00  ? 38  PRO A CD  1 
ATOM 250  N N   . VAL A 1 39  ? 59.720 11.321 -28.344 1.00 10.00  ? 39  VAL A N   1 
ATOM 251  C CA  . VAL A 1 39  ? 58.987 11.484 -29.611 1.00 10.00  ? 39  VAL A CA  1 
ATOM 252  C C   . VAL A 1 39  ? 57.618 10.860 -29.656 1.00 10.00  ? 39  VAL A C   1 
ATOM 253  O O   . VAL A 1 39  ? 57.437 9.653  -29.529 1.00 17.79  ? 39  VAL A O   1 
ATOM 254  C CB  . VAL A 1 39  ? 59.814 11.128 -30.885 1.00 17.79  ? 39  VAL A CB  1 
ATOM 255  C CG1 . VAL A 1 39  ? 59.180 11.765 -32.147 1.00 17.79  ? 39  VAL A CG1 1 
ATOM 256  C CG2 . VAL A 1 39  ? 61.269 11.606 -30.724 1.00 17.79  ? 39  VAL A CG2 1 
ATOM 257  N N   . GLY A 1 40  ? 56.674 11.771 -29.828 1.00 100.00 ? 40  GLY A N   1 
ATOM 258  C CA  . GLY A 1 40  ? 55.251 11.526 -29.896 1.00 100.00 ? 40  GLY A CA  1 
ATOM 259  C C   . GLY A 1 40  ? 54.569 10.183 -29.774 1.00 100.00 ? 40  GLY A C   1 
ATOM 260  O O   . GLY A 1 40  ? 54.265 9.713  -28.678 1.00 100.00 ? 40  GLY A O   1 
ATOM 261  N N   . ASN A 1 41  ? 54.282 9.613  -30.936 1.00 10.00  ? 41  ASN A N   1 
ATOM 262  C CA  . ASN A 1 41  ? 53.543 8.370  -31.082 1.00 10.00  ? 41  ASN A CA  1 
ATOM 263  C C   . ASN A 1 41  ? 54.200 7.038  -30.687 1.00 10.00  ? 41  ASN A C   1 
ATOM 264  O O   . ASN A 1 41  ? 54.474 6.223  -31.566 1.00 99.73  ? 41  ASN A O   1 
ATOM 265  C CB  . ASN A 1 41  ? 53.047 8.305  -32.538 1.00 99.73  ? 41  ASN A CB  1 
ATOM 266  C CG  . ASN A 1 41  ? 51.751 7.511  -32.702 1.00 99.73  ? 41  ASN A CG  1 
ATOM 267  O OD1 . ASN A 1 41  ? 51.078 7.611  -33.732 1.00 99.73  ? 41  ASN A OD1 1 
ATOM 268  N ND2 . ASN A 1 41  ? 51.393 6.731  -31.689 1.00 99.73  ? 41  ASN A ND2 1 
ATOM 269  N N   . ASN A 1 42  ? 54.417 6.782  -29.397 1.00 10.00  ? 42  ASN A N   1 
ATOM 270  C CA  . ASN A 1 42  ? 54.990 5.499  -29.005 1.00 10.00  ? 42  ASN A CA  1 
ATOM 271  C C   . ASN A 1 42  ? 54.379 4.762  -27.821 1.00 10.00  ? 42  ASN A C   1 
ATOM 272  O O   . ASN A 1 42  ? 54.242 3.539  -27.850 1.00 99.69  ? 42  ASN A O   1 
ATOM 273  C CB  . ASN A 1 42  ? 56.506 5.538  -28.944 1.00 99.69  ? 42  ASN A CB  1 
ATOM 274  C CG  . ASN A 1 42  ? 57.132 5.025  -30.231 1.00 99.69  ? 42  ASN A CG  1 
ATOM 275  O OD1 . ASN A 1 42  ? 56.648 4.059  -30.834 1.00 99.69  ? 42  ASN A OD1 1 
ATOM 276  N ND2 . ASN A 1 42  ? 58.211 5.663  -30.662 1.00 99.69  ? 42  ASN A ND2 1 
ATOM 277  N N   . GLN A 1 43  ? 54.057 5.484  -26.760 1.00 10.00  ? 43  GLN A N   1 
ATOM 278  C CA  . GLN A 1 43  ? 53.373 4.903  -25.601 1.00 10.00  ? 43  GLN A CA  1 
ATOM 279  C C   . GLN A 1 43  ? 52.410 5.983  -25.224 1.00 10.00  ? 43  GLN A C   1 
ATOM 280  O O   . GLN A 1 43  ? 51.211 5.750  -25.042 1.00 100.00 ? 43  GLN A O   1 
ATOM 281  C CB  . GLN A 1 43  ? 54.268 4.647  -24.381 1.00 100.00 ? 43  GLN A CB  1 
ATOM 282  C CG  . GLN A 1 43  ? 53.400 4.431  -23.128 1.00 100.00 ? 43  GLN A CG  1 
ATOM 283  C CD  . GLN A 1 43  ? 54.136 3.957  -21.892 1.00 100.00 ? 43  GLN A CD  1 
ATOM 284  O OE1 . GLN A 1 43  ? 55.368 3.900  -21.868 1.00 100.00 ? 43  GLN A OE1 1 
ATOM 285  N NE2 . GLN A 1 43  ? 53.372 3.603  -20.852 1.00 100.00 ? 43  GLN A NE2 1 
ATOM 286  N N   . THR A 1 44  ? 52.935 7.191  -25.152 1.00 10.00  ? 44  THR A N   1 
ATOM 287  C CA  . THR A 1 44  ? 52.075 8.264  -24.799 1.00 10.00  ? 44  THR A CA  1 
ATOM 288  C C   . THR A 1 44  ? 51.571 9.118  -25.947 1.00 10.00  ? 44  THR A C   1 
ATOM 289  O O   . THR A 1 44  ? 52.173 10.092 -26.386 1.00 72.85  ? 44  THR A O   1 
ATOM 290  C CB  . THR A 1 44  ? 52.611 9.053  -23.618 1.00 72.85  ? 44  THR A CB  1 
ATOM 291  O OG1 . THR A 1 44  ? 52.605 8.190  -22.476 1.00 72.85  ? 44  THR A OG1 1 
ATOM 292  C CG2 . THR A 1 44  ? 51.723 10.259 -23.334 1.00 72.85  ? 44  THR A CG2 1 
ATOM 293  N N   . ALA A 1 45  ? 50.473 8.611  -26.480 1.00 10.00  ? 45  ALA A N   1 
ATOM 294  C CA  . ALA A 1 45  ? 49.691 9.265  -27.493 1.00 10.00  ? 45  ALA A CA  1 
ATOM 295  C C   . ALA A 1 45  ? 48.806 9.975  -26.467 1.00 10.00  ? 45  ALA A C   1 
ATOM 296  O O   . ALA A 1 45  ? 48.693 11.177 -26.525 1.00 100.00 ? 45  ALA A O   1 
ATOM 297  C CB  . ALA A 1 45  ? 48.892 8.253  -28.281 1.00 100.00 ? 45  ALA A CB  1 
ATOM 298  N N   . VAL A 1 46  ? 48.295 9.218  -25.478 1.00 68.42  ? 46  VAL A N   1 
ATOM 299  C CA  . VAL A 1 46  ? 47.493 9.727  -24.342 1.00 68.42  ? 46  VAL A CA  1 
ATOM 300  C C   . VAL A 1 46  ? 47.691 8.856  -23.067 1.00 68.42  ? 46  VAL A C   1 
ATOM 301  O O   . VAL A 1 46  ? 46.922 7.982  -22.766 1.00 89.58  ? 46  VAL A O   1 
ATOM 302  C CB  . VAL A 1 46  ? 46.014 9.862  -24.670 1.00 89.58  ? 46  VAL A CB  1 
ATOM 303  C CG1 . VAL A 1 46  ? 45.273 10.573 -23.495 1.00 89.58  ? 46  VAL A CG1 1 
ATOM 304  C CG2 . VAL A 1 46  ? 45.839 10.604 -25.958 1.00 89.58  ? 46  VAL A CG2 1 
ATOM 305  N N   . GLN A 1 47  ? 48.694 9.225  -22.282 1.00 10.00  ? 47  GLN A N   1 
ATOM 306  C CA  . GLN A 1 47  ? 49.143 8.579  -21.032 1.00 10.00  ? 47  GLN A CA  1 
ATOM 307  C C   . GLN A 1 47  ? 48.194 7.817  -20.091 1.00 10.00  ? 47  GLN A C   1 
ATOM 308  O O   . GLN A 1 47  ? 47.237 8.361  -19.578 1.00 10.00  ? 47  GLN A O   1 
ATOM 309  C CB  . GLN A 1 47  ? 49.849 9.616  -20.169 1.00 10.00  ? 47  GLN A CB  1 
ATOM 310  C CG  . GLN A 1 47  ? 48.980 10.855 -19.899 1.00 10.00  ? 47  GLN A CG  1 
ATOM 311  C CD  . GLN A 1 47  ? 49.306 11.529 -18.594 1.00 10.00  ? 47  GLN A CD  1 
ATOM 312  O OE1 . GLN A 1 47  ? 49.601 10.867 -17.602 1.00 10.00  ? 47  GLN A OE1 1 
ATOM 313  N NE2 . GLN A 1 47  ? 49.217 12.850 -18.574 1.00 10.00  ? 47  GLN A NE2 1 
ATOM 314  N N   . ASP A 1 48  ? 48.554 6.580  -19.774 1.00 10.00  ? 48  ASP A N   1 
ATOM 315  C CA  . ASP A 1 48  ? 47.827 5.684  -18.853 1.00 10.00  ? 48  ASP A CA  1 
ATOM 316  C C   . ASP A 1 48  ? 47.555 6.277  -17.459 1.00 10.00  ? 48  ASP A C   1 
ATOM 317  O O   . ASP A 1 48  ? 48.252 5.991  -16.496 1.00 10.00  ? 48  ASP A O   1 
ATOM 318  C CB  . ASP A 1 48  ? 48.679 4.429  -18.674 1.00 10.00  ? 48  ASP A CB  1 
ATOM 319  C CG  . ASP A 1 48  ? 50.100 4.745  -18.251 1.00 10.00  ? 48  ASP A CG  1 
ATOM 320  O OD1 . ASP A 1 48  ? 50.459 5.921  -18.098 1.00 10.00  ? 48  ASP A OD1 1 
ATOM 321  O OD2 . ASP A 1 48  ? 50.884 3.801  -18.065 1.00 10.00  ? 48  ASP A OD2 1 
ATOM 322  N N   . ASN A 1 49  ? 46.394 6.913  -17.327 1.00 10.00  ? 49  ASN A N   1 
ATOM 323  C CA  . ASN A 1 49  ? 45.972 7.606  -16.118 1.00 10.00  ? 49  ASN A CA  1 
ATOM 324  C C   . ASN A 1 49  ? 46.203 7.232  -14.667 1.00 10.00  ? 49  ASN A C   1 
ATOM 325  O O   . ASN A 1 49  ? 46.433 8.156  -13.894 1.00 10.00  ? 49  ASN A O   1 
ATOM 326  C CB  . ASN A 1 49  ? 44.528 8.006  -16.253 1.00 10.00  ? 49  ASN A CB  1 
ATOM 327  C CG  . ASN A 1 49  ? 44.288 8.741  -17.508 1.00 10.00  ? 49  ASN A CG  1 
ATOM 328  O OD1 . ASN A 1 49  ? 44.801 9.837  -17.698 1.00 10.00  ? 49  ASN A OD1 1 
ATOM 329  N ND2 . ASN A 1 49  ? 43.605 8.097  -18.437 1.00 10.00  ? 49  ASN A ND2 1 
ATOM 330  N N   . VAL A 1 50  ? 46.230 5.983  -14.213 1.00 10.00  ? 50  VAL A N   1 
ATOM 331  C CA  . VAL A 1 50  ? 46.322 5.769  -12.756 1.00 10.00  ? 50  VAL A CA  1 
ATOM 332  C C   . VAL A 1 50  ? 47.722 6.144  -12.264 1.00 10.00  ? 50  VAL A C   1 
ATOM 333  O O   . VAL A 1 50  ? 47.832 6.612  -11.086 1.00 10.00  ? 50  VAL A O   1 
ATOM 334  C CB  . VAL A 1 50  ? 46.069 4.299  -12.402 1.00 10.00  ? 50  VAL A CB  1 
ATOM 335  C CG1 . VAL A 1 50  ? 44.691 3.804  -12.846 1.00 10.00  ? 50  VAL A CG1 1 
ATOM 336  C CG2 . VAL A 1 50  ? 47.076 3.346  -13.056 1.00 10.00  ? 50  VAL A CG2 1 
ATOM 337  N N   . LYS A 1 51  ? 48.793 5.735  -12.863 1.00 10.00  ? 51  LYS A N   1 
ATOM 338  C CA  . LYS A 1 51  ? 50.064 6.040  -12.272 1.00 10.00  ? 51  LYS A CA  1 
ATOM 339  C C   . LYS A 1 51  ? 50.085 7.501  -11.997 1.00 10.00  ? 51  LYS A C   1 
ATOM 340  O O   . LYS A 1 51  ? 50.535 7.948  -10.938 1.00 100.00 ? 51  LYS A O   1 
ATOM 341  C CB  . LYS A 1 51  ? 51.209 5.649  -13.184 1.00 100.00 ? 51  LYS A CB  1 
ATOM 342  C CG  . LYS A 1 51  ? 50.884 5.502  -14.644 1.00 100.00 ? 51  LYS A CG  1 
ATOM 343  C CD  . LYS A 1 51  ? 50.388 6.755  -15.299 1.00 100.00 ? 51  LYS A CD  1 
ATOM 344  C CE  . LYS A 1 51  ? 51.498 7.689  -15.625 1.00 100.00 ? 51  LYS A CE  1 
ATOM 345  N NZ  . LYS A 1 51  ? 51.059 8.641  -16.679 1.00 100.00 ? 51  LYS A NZ  1 
ATOM 346  N N   . VAL A 1 52  ? 49.519 8.235  -12.947 1.00 10.00  ? 52  VAL A N   1 
ATOM 347  C CA  . VAL A 1 52  ? 49.441 9.670  -12.833 1.00 10.00  ? 52  VAL A CA  1 
ATOM 348  C C   . VAL A 1 52  ? 48.703 9.908  -11.530 1.00 10.00  ? 52  VAL A C   1 
ATOM 349  O O   . VAL A 1 52  ? 49.141 10.688 -10.699 1.00 10.00  ? 52  VAL A O   1 
ATOM 350  C CB  . VAL A 1 52  ? 48.627 10.296 -13.944 1.00 10.00  ? 52  VAL A CB  1 
ATOM 351  C CG1 . VAL A 1 52  ? 48.992 11.731 -14.067 1.00 10.00  ? 52  VAL A CG1 1 
ATOM 352  C CG2 . VAL A 1 52  ? 48.817 9.596  -15.237 1.00 10.00  ? 52  VAL A CG2 1 
ATOM 353  N N   . SER A 1 53  ? 47.594 9.207  -11.343 1.00 10.00  ? 53  SER A N   1 
ATOM 354  C CA  . SER A 1 53  ? 46.842 9.345  -10.111 1.00 10.00  ? 53  SER A CA  1 
ATOM 355  C C   . SER A 1 53  ? 47.764 9.003  -8.948  1.00 10.00  ? 53  SER A C   1 
ATOM 356  O O   . SER A 1 53  ? 47.858 9.763  -7.993  1.00 10.00  ? 53  SER A O   1 
ATOM 357  C CB  . SER A 1 53  ? 45.646 8.415  -10.110 1.00 10.00  ? 53  SER A CB  1 
ATOM 358  O OG  . SER A 1 53  ? 44.669 8.862  -9.189  1.00 10.00  ? 53  SER A OG  1 
ATOM 359  N N   . LEU A 1 54  ? 48.482 7.889  -9.065  1.00 100.00 ? 54  LEU A N   1 
ATOM 360  C CA  . LEU A 1 54  ? 49.421 7.433  -8.045  1.00 100.00 ? 54  LEU A CA  1 
ATOM 361  C C   . LEU A 1 54  ? 50.382 8.516  -7.568  1.00 100.00 ? 54  LEU A C   1 
ATOM 362  O O   . LEU A 1 54  ? 50.575 8.688  -6.365  1.00 10.00  ? 54  LEU A O   1 
ATOM 363  C CB  . LEU A 1 54  ? 50.231 6.253  -8.573  1.00 10.00  ? 54  LEU A CB  1 
ATOM 364  C CG  . LEU A 1 54  ? 49.428 4.996  -8.858  1.00 10.00  ? 54  LEU A CG  1 
ATOM 365  C CD1 . LEU A 1 54  ? 50.328 3.860  -9.256  1.00 10.00  ? 54  LEU A CD1 1 
ATOM 366  C CD2 . LEU A 1 54  ? 48.650 4.628  -7.610  1.00 10.00  ? 54  LEU A CD2 1 
ATOM 367  N N   . ALA A 1 55  ? 51.038 9.181  -8.511  1.00 99.63  ? 55  ALA A N   1 
ATOM 368  C CA  . ALA A 1 55  ? 51.979 10.240 -8.184  1.00 99.63  ? 55  ALA A CA  1 
ATOM 369  C C   . ALA A 1 55  ? 51.323 11.281 -7.302  1.00 99.63  ? 55  ALA A C   1 
ATOM 370  O O   . ALA A 1 55  ? 51.764 11.520 -6.189  1.00 47.73  ? 55  ALA A O   1 
ATOM 371  C CB  . ALA A 1 55  ? 52.527 10.872 -9.446  1.00 47.73  ? 55  ALA A CB  1 
ATOM 372  N N   . PHE A 1 56  ? 50.277 11.922 -7.793  1.00 10.00  ? 56  PHE A N   1 
ATOM 373  C CA  . PHE A 1 56  ? 49.628 12.905 -6.962  1.00 10.00  ? 56  PHE A CA  1 
ATOM 374  C C   . PHE A 1 56  ? 49.190 12.179 -5.705  1.00 10.00  ? 56  PHE A C   1 
ATOM 375  O O   . PHE A 1 56  ? 49.383 12.660 -4.594  1.00 10.00  ? 56  PHE A O   1 
ATOM 376  C CB  . PHE A 1 56  ? 48.378 13.467 -7.639  1.00 10.00  ? 56  PHE A CB  1 
ATOM 377  C CG  . PHE A 1 56  ? 48.605 14.042 -9.017  1.00 10.00  ? 56  PHE A CG  1 
ATOM 378  C CD1 . PHE A 1 56  ? 48.685 13.227 -10.135 1.00 10.00  ? 56  PHE A CD1 1 
ATOM 379  C CD2 . PHE A 1 56  ? 48.657 15.414 -9.203  1.00 10.00  ? 56  PHE A CD2 1 
ATOM 380  C CE1 . PHE A 1 56  ? 48.813 13.769 -11.413 1.00 10.00  ? 56  PHE A CE1 1 
ATOM 381  C CE2 . PHE A 1 56  ? 48.785 15.953 -10.480 1.00 10.00  ? 56  PHE A CE2 1 
ATOM 382  C CZ  . PHE A 1 56  ? 48.859 15.126 -11.579 1.00 10.00  ? 56  PHE A CZ  1 
ATOM 383  N N   . GLY A 1 57  ? 48.585 11.017 -5.927  1.00 57.87  ? 57  GLY A N   1 
ATOM 384  C CA  . GLY A 1 57  ? 48.040 10.168 -4.879  1.00 57.87  ? 57  GLY A CA  1 
ATOM 385  C C   . GLY A 1 57  ? 48.913 9.796  -3.709  1.00 57.87  ? 57  GLY A C   1 
ATOM 386  O O   . GLY A 1 57  ? 48.658 10.205 -2.581  1.00 100.00 ? 57  GLY A O   1 
ATOM 387  N N   . LEU A 1 58  ? 49.896 8.953  -3.957  1.00 10.00  ? 58  LEU A N   1 
ATOM 388  C CA  . LEU A 1 58  ? 50.801 8.525  -2.911  1.00 10.00  ? 58  LEU A CA  1 
ATOM 389  C C   . LEU A 1 58  ? 51.540 9.713  -2.292  1.00 10.00  ? 58  LEU A C   1 
ATOM 390  O O   . LEU A 1 58  ? 51.579 9.865  -1.072  1.00 10.00  ? 58  LEU A O   1 
ATOM 391  C CB  . LEU A 1 58  ? 51.776 7.507  -3.494  1.00 10.00  ? 58  LEU A CB  1 
ATOM 392  C CG  . LEU A 1 58  ? 51.033 6.394  -4.229  1.00 10.00  ? 58  LEU A CG  1 
ATOM 393  C CD1 . LEU A 1 58  ? 51.945 5.574  -5.084  1.00 10.00  ? 58  LEU A CD1 1 
ATOM 394  C CD2 . LEU A 1 58  ? 50.346 5.523  -3.215  1.00 10.00  ? 58  LEU A CD2 1 
ATOM 395  N N   . SER A 1 59  ? 52.047 10.584 -3.157  1.00 29.18  ? 59  SER A N   1 
ATOM 396  C CA  . SER A 1 59  ? 52.803 11.759 -2.755  1.00 29.18  ? 59  SER A CA  1 
ATOM 397  C C   . SER A 1 59  ? 52.376 12.400 -1.462  1.00 29.18  ? 59  SER A C   1 
ATOM 398  O O   . SER A 1 59  ? 53.146 12.464 -0.501  1.00 97.77  ? 59  SER A O   1 
ATOM 399  C CB  . SER A 1 59  ? 52.779 12.826 -3.854  1.00 97.77  ? 59  SER A CB  1 
ATOM 400  O OG  . SER A 1 59  ? 53.755 12.587 -4.856  1.00 97.77  ? 59  SER A OG  1 
ATOM 401  N N   . ILE A 1 60  ? 51.159 12.917 -1.463  1.00 10.00  ? 60  ILE A N   1 
ATOM 402  C CA  . ILE A 1 60  ? 50.619 13.616 -0.315  1.00 10.00  ? 60  ILE A CA  1 
ATOM 403  C C   . ILE A 1 60  ? 50.744 12.872 0.998   1.00 10.00  ? 60  ILE A C   1 
ATOM 404  O O   . ILE A 1 60  ? 51.097 13.478 2.007   1.00 10.00  ? 60  ILE A O   1 
ATOM 405  C CB  . ILE A 1 60  ? 49.176 14.012 -0.571  1.00 10.00  ? 60  ILE A CB  1 
ATOM 406  C CG1 . ILE A 1 60  ? 49.085 14.668 -1.945  1.00 10.00  ? 60  ILE A CG1 1 
ATOM 407  C CG2 . ILE A 1 60  ? 48.707 14.994 0.478   1.00 10.00  ? 60  ILE A CG2 1 
ATOM 408  C CD1 . ILE A 1 60  ? 47.696 14.913 -2.445  1.00 10.00  ? 60  ILE A CD1 1 
ATOM 409  N N   . ALA A 1 61  ? 50.467 11.571 0.985   1.00 67.20  ? 61  ALA A N   1 
ATOM 410  C CA  . ALA A 1 61  ? 50.551 10.749 2.196   1.00 67.20  ? 61  ALA A CA  1 
ATOM 411  C C   . ALA A 1 61  ? 51.973 10.669 2.775   1.00 67.20  ? 61  ALA A C   1 
ATOM 412  O O   . ALA A 1 61  ? 52.153 10.562 3.993   1.00 10.00  ? 61  ALA A O   1 
ATOM 413  C CB  . ALA A 1 61  ? 50.016 9.363  1.928   1.00 10.00  ? 61  ALA A CB  1 
ATOM 414  N N   . THR A 1 62  ? 52.968 10.625 1.897   1.00 10.00  ? 62  THR A N   1 
ATOM 415  C CA  . THR A 1 62  ? 54.351 10.587 2.321   1.00 10.00  ? 62  THR A CA  1 
ATOM 416  C C   . THR A 1 62  ? 54.633 11.913 2.977   1.00 10.00  ? 62  THR A C   1 
ATOM 417  O O   . THR A 1 62  ? 54.911 11.972 4.165   1.00 10.00  ? 62  THR A O   1 
ATOM 418  C CB  . THR A 1 62  ? 55.267 10.511 1.141   1.00 10.00  ? 62  THR A CB  1 
ATOM 419  O OG1 . THR A 1 62  ? 54.911 9.402  0.317   1.00 10.00  ? 62  THR A OG1 1 
ATOM 420  C CG2 . THR A 1 62  ? 56.655 10.364 1.612   1.00 10.00  ? 62  THR A CG2 1 
ATOM 421  N N   . LEU A 1 63  ? 54.539 12.969 2.167   1.00 24.85  ? 63  LEU A N   1 
ATOM 422  C CA  . LEU A 1 63  ? 54.777 14.359 2.552   1.00 24.85  ? 63  LEU A CA  1 
ATOM 423  C C   . LEU A 1 63  ? 53.992 14.788 3.774   1.00 24.85  ? 63  LEU A C   1 
ATOM 424  O O   . LEU A 1 63  ? 54.352 15.754 4.444   1.00 10.00  ? 63  LEU A O   1 
ATOM 425  C CB  . LEU A 1 63  ? 54.447 15.261 1.366   1.00 10.00  ? 63  LEU A CB  1 
ATOM 426  C CG  . LEU A 1 63  ? 55.385 15.086 0.174   1.00 10.00  ? 63  LEU A CG  1 
ATOM 427  C CD1 . LEU A 1 63  ? 54.792 15.569 -1.107  1.00 10.00  ? 63  LEU A CD1 1 
ATOM 428  C CD2 . LEU A 1 63  ? 56.635 15.827 0.459   1.00 10.00  ? 63  LEU A CD2 1 
ATOM 429  N N   . ALA A 1 64  ? 52.894 14.093 4.025   1.00 10.00  ? 64  ALA A N   1 
ATOM 430  C CA  . ALA A 1 64  ? 52.078 14.398 5.170   1.00 10.00  ? 64  ALA A CA  1 
ATOM 431  C C   . ALA A 1 64  ? 52.609 13.648 6.375   1.00 10.00  ? 64  ALA A C   1 
ATOM 432  O O   . ALA A 1 64  ? 52.531 14.147 7.490   1.00 48.07  ? 64  ALA A O   1 
ATOM 433  C CB  . ALA A 1 64  ? 50.646 14.008 4.907   1.00 48.07  ? 64  ALA A CB  1 
ATOM 434  N N   . GLN A 1 65  ? 53.127 12.440 6.151   1.00 10.00  ? 65  GLN A N   1 
ATOM 435  C CA  . GLN A 1 65  ? 53.653 11.599 7.230   1.00 10.00  ? 65  GLN A CA  1 
ATOM 436  C C   . GLN A 1 65  ? 54.954 12.156 7.779   1.00 10.00  ? 65  GLN A C   1 
ATOM 437  O O   . GLN A 1 65  ? 55.406 11.804 8.876   1.00 10.00  ? 65  GLN A O   1 
ATOM 438  C CB  . GLN A 1 65  ? 53.913 10.189 6.725   1.00 10.00  ? 65  GLN A CB  1 
ATOM 439  C CG  . GLN A 1 65  ? 54.254 9.243  7.840   1.00 10.00  ? 65  GLN A CG  1 
ATOM 440  C CD  . GLN A 1 65  ? 55.150 8.127  7.399   1.00 10.00  ? 65  GLN A CD  1 
ATOM 441  O OE1 . GLN A 1 65  ? 55.494 7.236  8.174   1.00 10.00  ? 65  GLN A OE1 1 
ATOM 442  N NE2 . GLN A 1 65  ? 55.556 8.173  6.147   1.00 10.00  ? 65  GLN A NE2 1 
ATOM 443  N N   . SER A 1 66  ? 55.563 13.022 6.990   1.00 10.00  ? 66  SER A N   1 
ATOM 444  C CA  . SER A 1 66  ? 56.817 13.624 7.358   1.00 10.00  ? 66  SER A CA  1 
ATOM 445  C C   . SER A 1 66  ? 56.756 15.015 7.974   1.00 10.00  ? 66  SER A C   1 
ATOM 446  O O   . SER A 1 66  ? 57.420 15.297 8.966   1.00 10.00  ? 66  SER A O   1 
ATOM 447  C CB  . SER A 1 66  ? 57.726 13.626 6.141   1.00 10.00  ? 66  SER A CB  1 
ATOM 448  O OG  . SER A 1 66  ? 57.021 13.815 4.924   1.00 10.00  ? 66  SER A OG  1 
ATOM 449  N N   . VAL A 1 67  ? 55.944 15.889 7.405   1.00 10.00  ? 67  VAL A N   1 
ATOM 450  C CA  . VAL A 1 67  ? 55.880 17.246 7.913   1.00 10.00  ? 67  VAL A CA  1 
ATOM 451  C C   . VAL A 1 67  ? 55.166 17.421 9.243   1.00 10.00  ? 67  VAL A C   1 
ATOM 452  O O   . VAL A 1 67  ? 54.743 16.439 9.865   1.00 10.00  ? 67  VAL A O   1 
ATOM 453  C CB  . VAL A 1 67  ? 55.180 18.174 6.933   1.00 10.00  ? 67  VAL A CB  1 
ATOM 454  C CG1 . VAL A 1 67  ? 56.090 18.479 5.788   1.00 10.00  ? 67  VAL A CG1 1 
ATOM 455  C CG2 . VAL A 1 67  ? 53.829 17.573 6.472   1.00 10.00  ? 67  VAL A CG2 1 
ATOM 456  N N   . GLY A 1 68  ? 55.150 18.686 9.698   1.00 52.25  ? 68  GLY A N   1 
ATOM 457  C CA  . GLY A 1 68  ? 54.471 19.099 10.918  1.00 52.25  ? 68  GLY A CA  1 
ATOM 458  C C   . GLY A 1 68  ? 53.306 18.155 11.114  1.00 52.25  ? 68  GLY A C   1 
ATOM 459  O O   . GLY A 1 68  ? 52.681 17.724 10.133  1.00 57.08  ? 68  GLY A O   1 
ATOM 460  N N   . HIS A 1 69  ? 52.964 17.868 12.364  1.00 43.65  ? 69  HIS A N   1 
ATOM 461  C CA  . HIS A 1 69  ? 51.927 16.887 12.600  1.00 43.65  ? 69  HIS A CA  1 
ATOM 462  C C   . HIS A 1 69  ? 50.508 17.324 12.995  1.00 43.65  ? 69  HIS A C   1 
ATOM 463  O O   . HIS A 1 69  ? 49.550 17.063 12.252  1.00 99.91  ? 69  HIS A O   1 
ATOM 464  C CB  . HIS A 1 69  ? 52.453 15.865 13.600  1.00 99.91  ? 69  HIS A CB  1 
ATOM 465  C CG  . HIS A 1 69  ? 52.627 16.404 15.002  1.00 99.91  ? 69  HIS A CG  1 
ATOM 466  N ND1 . HIS A 1 69  ? 53.738 17.115 15.401  1.00 99.91  ? 69  HIS A ND1 1 
ATOM 467  C CD2 . HIS A 1 69  ? 51.840 16.278 16.095  1.00 99.91  ? 69  HIS A CD2 1 
ATOM 468  C CE1 . HIS A 1 69  ? 53.629 17.400 16.685  1.00 99.91  ? 69  HIS A CE1 1 
ATOM 469  N NE2 . HIS A 1 69  ? 52.497 16.912 17.140  1.00 99.91  ? 69  HIS A NE2 1 
ATOM 470  N N   . ILE A 1 70  ? 50.348 17.873 14.198  1.00 10.45  ? 70  ILE A N   1 
ATOM 471  C CA  . ILE A 1 70  ? 49.007 18.270 14.638  1.00 10.45  ? 70  ILE A CA  1 
ATOM 472  C C   . ILE A 1 70  ? 48.608 19.488 13.829  1.00 10.45  ? 70  ILE A C   1 
ATOM 473  O O   . ILE A 1 70  ? 47.428 19.840 13.646  1.00 100.00 ? 70  ILE A O   1 
ATOM 474  C CB  . ILE A 1 70  ? 49.043 18.641 16.124  1.00 100.00 ? 70  ILE A CB  1 
ATOM 475  C CG1 . ILE A 1 70  ? 47.809 18.111 16.866  1.00 100.00 ? 70  ILE A CG1 1 
ATOM 476  C CG2 . ILE A 1 70  ? 49.251 20.158 16.286  1.00 100.00 ? 70  ILE A CG2 1 
ATOM 477  C CD1 . ILE A 1 70  ? 47.933 18.202 18.321  1.00 100.00 ? 70  ILE A CD1 1 
ATOM 478  N N   . SER A 1 71  ? 49.677 20.150 13.463  1.00 10.00  ? 71  SER A N   1 
ATOM 479  C CA  . SER A 1 71  ? 49.643 21.412 12.718  1.00 10.00  ? 71  SER A CA  1 
ATOM 480  C C   . SER A 1 71  ? 49.896 21.099 11.248  1.00 10.00  ? 71  SER A C   1 
ATOM 481  O O   . SER A 1 71  ? 49.741 19.985 10.790  1.00 10.00  ? 71  SER A O   1 
ATOM 482  C CB  . SER A 1 71  ? 50.724 22.359 13.244  1.00 10.00  ? 71  SER A CB  1 
ATOM 483  O OG  . SER A 1 71  ? 50.685 23.587 12.531  1.00 10.00  ? 71  SER A OG  1 
ATOM 484  N N   . GLY A 1 72  ? 50.187 22.157 10.515  1.00 10.00  ? 72  GLY A N   1 
ATOM 485  C CA  . GLY A 1 72  ? 50.409 22.053 9.096   1.00 10.00  ? 72  GLY A CA  1 
ATOM 486  C C   . GLY A 1 72  ? 51.084 20.827 8.541   1.00 10.00  ? 72  GLY A C   1 
ATOM 487  O O   . GLY A 1 72  ? 52.281 20.598 8.751   1.00 24.95  ? 72  GLY A O   1 
ATOM 488  N N   . ALA A 1 73  ? 50.286 20.069 7.801   1.00 10.00  ? 73  ALA A N   1 
ATOM 489  C CA  . ALA A 1 73  ? 50.711 18.859 7.125   1.00 10.00  ? 73  ALA A CA  1 
ATOM 490  C C   . ALA A 1 73  ? 50.139 18.932 5.710   1.00 10.00  ? 73  ALA A C   1 
ATOM 491  O O   . ALA A 1 73  ? 50.823 18.681 4.726   1.00 44.82  ? 73  ALA A O   1 
ATOM 492  C CB  . ALA A 1 73  ? 50.182 17.633 7.861   1.00 44.82  ? 73  ALA A CB  1 
ATOM 493  N N   . HIS A 1 74  ? 48.866 19.292 5.637   1.00 10.00  ? 74  HIS A N   1 
ATOM 494  C CA  . HIS A 1 74  ? 48.149 19.418 4.392   1.00 10.00  ? 74  HIS A CA  1 
ATOM 495  C C   . HIS A 1 74  ? 48.803 20.294 3.375   1.00 10.00  ? 74  HIS A C   1 
ATOM 496  O O   . HIS A 1 74  ? 49.855 20.894 3.636   1.00 10.00  ? 74  HIS A O   1 
ATOM 497  C CB  . HIS A 1 74  ? 46.782 19.993 4.671   1.00 10.00  ? 74  HIS A CB  1 
ATOM 498  C CG  . HIS A 1 74  ? 46.821 21.364 5.271   1.00 10.00  ? 74  HIS A CG  1 
ATOM 499  N ND1 . HIS A 1 74  ? 47.155 21.575 6.586   1.00 10.00  ? 74  HIS A ND1 1 
ATOM 500  C CD2 . HIS A 1 74  ? 46.593 22.575 4.731   1.00 10.00  ? 74  HIS A CD2 1 
ATOM 501  C CE1 . HIS A 1 74  ? 47.131 22.883 6.837   1.00 10.00  ? 74  HIS A CE1 1 
ATOM 502  N NE2 . HIS A 1 74  ? 46.792 23.504 5.723   1.00 10.00  ? 74  HIS A NE2 1 
ATOM 503  N N   . LEU A 1 75  ? 48.106 20.452 2.240   1.00 10.00  ? 75  LEU A N   1 
ATOM 504  C CA  . LEU A 1 75  ? 48.639 21.231 1.120   1.00 10.00  ? 75  LEU A CA  1 
ATOM 505  C C   . LEU A 1 75  ? 47.574 21.995 0.303   1.00 10.00  ? 75  LEU A C   1 
ATOM 506  O O   . LEU A 1 75  ? 47.845 22.415 -0.844  1.00 10.00  ? 75  LEU A O   1 
ATOM 507  C CB  . LEU A 1 75  ? 49.402 20.246 0.243   1.00 10.00  ? 75  LEU A CB  1 
ATOM 508  C CG  . LEU A 1 75  ? 50.040 18.995 0.895   1.00 10.00  ? 75  LEU A CG  1 
ATOM 509  C CD1 . LEU A 1 75  ? 50.339 17.932 -0.164  1.00 10.00  ? 75  LEU A CD1 1 
ATOM 510  C CD2 . LEU A 1 75  ? 51.317 19.362 1.663   1.00 10.00  ? 75  LEU A CD2 1 
ATOM 511  N N   . ASN A 1 76  ? 46.363 22.237 0.823   1.00 30.73  ? 76  ASN A N   1 
ATOM 512  C CA  . ASN A 1 76  ? 45.314 22.996 0.107   1.00 30.73  ? 76  ASN A CA  1 
ATOM 513  C C   . ASN A 1 76  ? 44.427 23.829 1.017   1.00 30.73  ? 76  ASN A C   1 
ATOM 514  O O   . ASN A 1 76  ? 44.284 23.553 2.198   1.00 10.00  ? 76  ASN A O   1 
ATOM 515  C CB  . ASN A 1 76  ? 44.434 22.078 -0.700  1.00 10.00  ? 76  ASN A CB  1 
ATOM 516  C CG  . ASN A 1 76  ? 43.557 21.200 0.114   1.00 10.00  ? 76  ASN A CG  1 
ATOM 517  O OD1 . ASN A 1 76  ? 42.531 21.668 0.638   1.00 10.00  ? 76  ASN A OD1 1 
ATOM 518  N ND2 . ASN A 1 76  ? 43.887 19.938 0.221   1.00 10.00  ? 76  ASN A ND2 1 
ATOM 519  N N   . PRO A 1 77  ? 43.821 24.879 0.477   1.00 10.00  ? 77  PRO A N   1 
ATOM 520  C CA  . PRO A 1 77  ? 42.930 25.842 1.142   1.00 10.00  ? 77  PRO A CA  1 
ATOM 521  C C   . PRO A 1 77  ? 41.597 25.326 1.640   1.00 10.00  ? 77  PRO A C   1 
ATOM 522  O O   . PRO A 1 77  ? 41.095 25.785 2.657   1.00 14.46  ? 77  PRO A O   1 
ATOM 523  C CB  . PRO A 1 77  ? 42.725 26.910 0.040   1.00 14.46  ? 77  PRO A CB  1 
ATOM 524  C CG  . PRO A 1 77  ? 44.030 26.847 -0.685  1.00 14.46  ? 77  PRO A CG  1 
ATOM 525  C CD  . PRO A 1 77  ? 44.280 25.386 -0.821  1.00 14.46  ? 77  PRO A CD  1 
ATOM 526  N N   . ALA A 1 78  ? 41.004 24.388 0.919   1.00 11.24  ? 78  ALA A N   1 
ATOM 527  C CA  . ALA A 1 78  ? 39.727 23.832 1.310   1.00 11.24  ? 78  ALA A CA  1 
ATOM 528  C C   . ALA A 1 78  ? 39.808 23.185 2.676   1.00 11.24  ? 78  ALA A C   1 
ATOM 529  O O   . ALA A 1 78  ? 38.927 23.396 3.501   1.00 10.00  ? 78  ALA A O   1 
ATOM 530  C CB  . ALA A 1 78  ? 39.254 22.838 0.274   1.00 10.00  ? 78  ALA A CB  1 
ATOM 531  N N   . VAL A 1 79  ? 40.836 22.376 2.915   1.00 10.00  ? 79  VAL A N   1 
ATOM 532  C CA  . VAL A 1 79  ? 40.970 21.707 4.201   1.00 10.00  ? 79  VAL A CA  1 
ATOM 533  C C   . VAL A 1 79  ? 40.970 22.654 5.374   1.00 10.00  ? 79  VAL A C   1 
ATOM 534  O O   . VAL A 1 79  ? 40.270 22.413 6.365   1.00 15.21  ? 79  VAL A O   1 
ATOM 535  C CB  . VAL A 1 79  ? 42.213 20.830 4.259   1.00 15.21  ? 79  VAL A CB  1 
ATOM 536  C CG1 . VAL A 1 79  ? 42.098 19.734 3.236   1.00 15.21  ? 79  VAL A CG1 1 
ATOM 537  C CG2 . VAL A 1 79  ? 43.464 21.646 4.002   1.00 15.21  ? 79  VAL A CG2 1 
ATOM 538  N N   . THR A 1 80  ? 41.702 23.747 5.245   1.00 46.18  ? 80  THR A N   1 
ATOM 539  C CA  . THR A 1 80  ? 41.922 24.752 6.296   1.00 46.18  ? 80  THR A CA  1 
ATOM 540  C C   . THR A 1 80  ? 40.576 25.362 6.676   1.00 46.18  ? 80  THR A C   1 
ATOM 541  O O   . THR A 1 80  ? 40.297 25.477 7.906   1.00 10.00  ? 80  THR A O   1 
ATOM 542  C CB  . THR A 1 80  ? 42.859 25.849 5.789   1.00 10.00  ? 80  THR A CB  1 
ATOM 543  O OG1 . THR A 1 80  ? 44.114 25.288 5.432   1.00 10.00  ? 80  THR A OG1 1 
ATOM 544  C CG2 . THR A 1 80  ? 43.124 26.937 6.830   1.00 10.00  ? 80  THR A CG2 1 
ATOM 545  N N   . LEU A 1 81  ? 39.806 25.871 5.754   1.00 10.00  ? 81  LEU A N   1 
ATOM 546  C CA  . LEU A 1 81  ? 38.609 26.535 6.166   1.00 10.00  ? 81  LEU A CA  1 
ATOM 547  C C   . LEU A 1 81  ? 37.708 25.553 6.834   1.00 10.00  ? 81  LEU A C   1 
ATOM 548  O O   . LEU A 1 81  ? 37.162 25.845 7.884   1.00 10.00  ? 81  LEU A O   1 
ATOM 549  C CB  . LEU A 1 81  ? 37.970 27.229 5.000   1.00 10.00  ? 81  LEU A CB  1 
ATOM 550  C CG  . LEU A 1 81  ? 38.810 28.489 4.765   1.00 10.00  ? 81  LEU A CG  1 
ATOM 551  C CD1 . LEU A 1 81  ? 38.538 29.072 3.405   1.00 10.00  ? 81  LEU A CD1 1 
ATOM 552  C CD2 . LEU A 1 81  ? 38.611 29.537 5.893   1.00 10.00  ? 81  LEU A CD2 1 
ATOM 553  N N   . GLY A 1 82  ? 37.627 24.349 6.281   1.00 10.00  ? 82  GLY A N   1 
ATOM 554  C CA  . GLY A 1 82  ? 36.788 23.323 6.884   1.00 10.00  ? 82  GLY A CA  1 
ATOM 555  C C   . GLY A 1 82  ? 37.056 23.277 8.375   1.00 10.00  ? 82  GLY A C   1 
ATOM 556  O O   . GLY A 1 82  ? 36.177 23.011 9.194   1.00 10.00  ? 82  GLY A O   1 
ATOM 557  N N   . LEU A 1 83  ? 38.327 23.500 8.682   1.00 48.46  ? 83  LEU A N   1 
ATOM 558  C CA  . LEU A 1 83  ? 38.856 23.586 10.032  1.00 48.46  ? 83  LEU A CA  1 
ATOM 559  C C   . LEU A 1 83  ? 38.325 24.831 10.749  1.00 48.46  ? 83  LEU A C   1 
ATOM 560  O O   . LEU A 1 83  ? 37.702 24.726 11.798  1.00 59.92  ? 83  LEU A O   1 
ATOM 561  C CB  . LEU A 1 83  ? 40.389 23.635 9.992   1.00 59.92  ? 83  LEU A CB  1 
ATOM 562  C CG  . LEU A 1 83  ? 41.049 24.766 10.792  1.00 59.92  ? 83  LEU A CG  1 
ATOM 563  C CD1 . LEU A 1 83  ? 41.580 24.253 12.116  1.00 59.92  ? 83  LEU A CD1 1 
ATOM 564  C CD2 . LEU A 1 83  ? 42.145 25.429 9.977   1.00 59.92  ? 83  LEU A CD2 1 
ATOM 565  N N   . LEU A 1 84  ? 38.589 26.006 10.201  1.00 10.00  ? 84  LEU A N   1 
ATOM 566  C CA  . LEU A 1 84  ? 38.115 27.241 10.832  1.00 10.00  ? 84  LEU A CA  1 
ATOM 567  C C   . LEU A 1 84  ? 36.733 27.162 11.412  1.00 10.00  ? 84  LEU A C   1 
ATOM 568  O O   . LEU A 1 84  ? 36.464 27.470 12.550  1.00 97.71  ? 84  LEU A O   1 
ATOM 569  C CB  . LEU A 1 84  ? 38.157 28.410 9.825   1.00 97.71  ? 84  LEU A CB  1 
ATOM 570  C CG  . LEU A 1 84  ? 37.306 29.658 10.210  1.00 97.71  ? 84  LEU A CG  1 
ATOM 571  C CD1 . LEU A 1 84  ? 37.843 30.381 11.440  1.00 97.71  ? 84  LEU A CD1 1 
ATOM 572  C CD2 . LEU A 1 84  ? 37.153 30.634 9.044   1.00 97.71  ? 84  LEU A CD2 1 
ATOM 573  N N   . LEU A 1 85  ? 35.909 26.577 10.608  1.00 10.00  ? 85  LEU A N   1 
ATOM 574  C CA  . LEU A 1 85  ? 34.535 26.474 10.913  1.00 10.00  ? 85  LEU A CA  1 
ATOM 575  C C   . LEU A 1 85  ? 34.361 25.912 12.300  1.00 10.00  ? 85  LEU A C   1 
ATOM 576  O O   . LEU A 1 85  ? 34.389 24.707 12.533  1.00 10.00  ? 85  LEU A O   1 
ATOM 577  C CB  . LEU A 1 85  ? 33.875 25.699 9.792   1.00 10.00  ? 85  LEU A CB  1 
ATOM 578  C CG  . LEU A 1 85  ? 34.379 26.346 8.490   1.00 10.00  ? 85  LEU A CG  1 
ATOM 579  C CD1 . LEU A 1 85  ? 33.507 26.019 7.259   1.00 10.00  ? 85  LEU A CD1 1 
ATOM 580  C CD2 . LEU A 1 85  ? 34.412 27.821 8.679   1.00 10.00  ? 85  LEU A CD2 1 
ATOM 581  N N   . SER A 1 86  ? 34.095 26.875 13.179  1.00 10.00  ? 86  SER A N   1 
ATOM 582  C CA  . SER A 1 86  ? 33.924 26.736 14.602  1.00 10.00  ? 86  SER A CA  1 
ATOM 583  C C   . SER A 1 86  ? 33.748 28.192 15.014  1.00 10.00  ? 86  SER A C   1 
ATOM 584  O O   . SER A 1 86  ? 33.566 29.060 14.162  1.00 52.53  ? 86  SER A O   1 
ATOM 585  C CB  . SER A 1 86  ? 35.222 26.184 15.173  1.00 52.53  ? 86  SER A CB  1 
ATOM 586  O OG  . SER A 1 86  ? 35.415 26.613 16.508  1.00 52.53  ? 86  SER A OG  1 
ATOM 587  N N   . CYS A 1 87  ? 33.923 28.464 16.297  1.00 10.00  ? 87  CYS A N   1 
ATOM 588  C CA  . CYS A 1 87  ? 33.771 29.785 16.907  1.00 10.00  ? 87  CYS A CA  1 
ATOM 589  C C   . CYS A 1 87  ? 34.900 30.875 16.878  1.00 10.00  ? 87  CYS A C   1 
ATOM 590  O O   . CYS A 1 87  ? 34.596 32.038 17.190  1.00 10.00  ? 87  CYS A O   1 
ATOM 591  C CB  . CYS A 1 87  ? 33.371 29.537 18.360  1.00 10.00  ? 87  CYS A CB  1 
ATOM 592  S SG  . CYS A 1 87  ? 34.071 27.972 18.988  1.00 10.00  ? 87  CYS A SG  1 
ATOM 593  N N   . GLN A 1 88  ? 36.136 30.576 16.437  1.00 18.78  ? 88  GLN A N   1 
ATOM 594  C CA  . GLN A 1 88  ? 37.220 31.590 16.512  1.00 18.78  ? 88  GLN A CA  1 
ATOM 595  C C   . GLN A 1 88  ? 38.331 31.785 15.470  1.00 18.78  ? 88  GLN A C   1 
ATOM 596  O O   . GLN A 1 88  ? 39.098 30.871 15.164  1.00 10.12  ? 88  GLN A O   1 
ATOM 597  C CB  . GLN A 1 88  ? 37.896 31.500 17.892  1.00 10.12  ? 88  GLN A CB  1 
ATOM 598  C CG  . GLN A 1 88  ? 37.054 32.102 19.038  1.00 10.12  ? 88  GLN A CG  1 
ATOM 599  C CD  . GLN A 1 88  ? 37.214 31.364 20.354  1.00 10.12  ? 88  GLN A CD  1 
ATOM 600  O OE1 . GLN A 1 88  ? 38.085 30.505 20.488  1.00 10.12  ? 88  GLN A OE1 1 
ATOM 601  N NE2 . GLN A 1 88  ? 36.375 31.702 21.333  1.00 10.12  ? 88  GLN A NE2 1 
ATOM 602  N N   . ILE A 1 89  ? 38.493 33.049 15.070  1.00 10.00  ? 89  ILE A N   1 
ATOM 603  C CA  . ILE A 1 89  ? 39.532 33.480 14.133  1.00 10.00  ? 89  ILE A CA  1 
ATOM 604  C C   . ILE A 1 89  ? 40.527 34.355 14.916  1.00 10.00  ? 89  ILE A C   1 
ATOM 605  O O   . ILE A 1 89  ? 41.331 35.072 14.333  1.00 10.00  ? 89  ILE A O   1 
ATOM 606  C CB  . ILE A 1 89  ? 38.947 34.318 12.958  1.00 10.00  ? 89  ILE A CB  1 
ATOM 607  C CG1 . ILE A 1 89  ? 39.945 34.367 11.800  1.00 10.00  ? 89  ILE A CG1 1 
ATOM 608  C CG2 . ILE A 1 89  ? 38.582 35.709 13.418  1.00 10.00  ? 89  ILE A CG2 1 
ATOM 609  C CD1 . ILE A 1 89  ? 39.374 34.831 10.475  1.00 10.00  ? 89  ILE A CD1 1 
ATOM 610  N N   . SER A 1 90  ? 40.434 34.308 16.241  1.00 10.00  ? 90  SER A N   1 
ATOM 611  C CA  . SER A 1 90  ? 41.322 35.080 17.105  1.00 10.00  ? 90  SER A CA  1 
ATOM 612  C C   . SER A 1 90  ? 42.746 34.591 16.829  1.00 10.00  ? 90  SER A C   1 
ATOM 613  O O   . SER A 1 90  ? 43.696 35.415 16.851  1.00 10.00  ? 90  SER A O   1 
ATOM 614  C CB  . SER A 1 90  ? 40.956 34.888 18.580  1.00 10.00  ? 90  SER A CB  1 
ATOM 615  O OG  . SER A 1 90  ? 42.045 35.158 19.459  1.00 10.00  ? 90  SER A OG  1 
ATOM 616  N N   . ILE A 1 91  ? 42.915 33.257 16.613  1.00 10.09  ? 91  ILE A N   1 
ATOM 617  C CA  . ILE A 1 91  ? 44.229 32.691 16.258  1.00 10.09  ? 91  ILE A CA  1 
ATOM 618  C C   . ILE A 1 91  ? 44.233 32.193 14.816  1.00 10.09  ? 91  ILE A C   1 
ATOM 619  O O   . ILE A 1 91  ? 45.295 31.891 14.283  1.00 10.00  ? 91  ILE A O   1 
ATOM 620  C CB  . ILE A 1 91  ? 44.674 31.554 17.157  1.00 10.00  ? 91  ILE A CB  1 
ATOM 621  C CG1 . ILE A 1 91  ? 46.029 31.033 16.691  1.00 10.00  ? 91  ILE A CG1 1 
ATOM 622  C CG2 . ILE A 1 91  ? 43.617 30.469 17.182  1.00 10.00  ? 91  ILE A CG2 1 
ATOM 623  C CD1 . ILE A 1 91  ? 46.580 29.948 17.565  1.00 10.00  ? 91  ILE A CD1 1 
ATOM 624  N N   . PHE A 1 92  ? 43.066 32.183 14.174  1.00 10.00  ? 92  PHE A N   1 
ATOM 625  C CA  . PHE A 1 92  ? 42.972 31.699 12.804  1.00 10.00  ? 92  PHE A CA  1 
ATOM 626  C C   . PHE A 1 92  ? 43.329 32.603 11.632  1.00 10.00  ? 92  PHE A C   1 
ATOM 627  O O   . PHE A 1 92  ? 42.484 32.996 10.815  1.00 10.00  ? 92  PHE A O   1 
ATOM 628  C CB  . PHE A 1 92  ? 41.668 30.934 12.558  1.00 10.00  ? 92  PHE A CB  1 
ATOM 629  C CG  . PHE A 1 92  ? 41.793 29.477 12.844  1.00 10.00  ? 92  PHE A CG  1 
ATOM 630  C CD1 . PHE A 1 92  ? 42.490 28.653 11.971  1.00 10.00  ? 92  PHE A CD1 1 
ATOM 631  C CD2 . PHE A 1 92  ? 41.374 28.951 14.061  1.00 10.00  ? 92  PHE A CD2 1 
ATOM 632  C CE1 . PHE A 1 92  ? 42.782 27.342 12.316  1.00 10.00  ? 92  PHE A CE1 1 
ATOM 633  C CE2 . PHE A 1 92  ? 41.670 27.627 14.399  1.00 10.00  ? 92  PHE A CE2 1 
ATOM 634  C CZ  . PHE A 1 92  ? 42.375 26.840 13.534  1.00 10.00  ? 92  PHE A CZ  1 
ATOM 635  N N   . ARG A 1 93  ? 44.630 32.851 11.541  1.00 10.00  ? 93  ARG A N   1 
ATOM 636  C CA  . ARG A 1 93  ? 45.226 33.616 10.468  1.00 10.00  ? 93  ARG A CA  1 
ATOM 637  C C   . ARG A 1 93  ? 45.794 32.517 9.561   1.00 10.00  ? 93  ARG A C   1 
ATOM 638  O O   . ARG A 1 93  ? 47.003 32.413 9.358   1.00 10.17  ? 93  ARG A O   1 
ATOM 639  C CB  . ARG A 1 93  ? 46.378 34.488 10.968  1.00 10.17  ? 93  ARG A CB  1 
ATOM 640  C CG  . ARG A 1 93  ? 46.391 34.818 12.442  1.00 10.17  ? 93  ARG A CG  1 
ATOM 641  C CD  . ARG A 1 93  ? 47.842 34.765 12.901  1.00 10.17  ? 93  ARG A CD  1 
ATOM 642  N NE  . ARG A 1 93  ? 48.084 35.415 14.184  1.00 10.17  ? 93  ARG A NE  1 
ATOM 643  C CZ  . ARG A 1 93  ? 49.168 35.204 14.927  1.00 10.17  ? 93  ARG A CZ  1 
ATOM 644  N NH1 . ARG A 1 93  ? 50.099 34.349 14.511  1.00 10.17  ? 93  ARG A NH1 1 
ATOM 645  N NH2 . ARG A 1 93  ? 49.347 35.892 16.050  1.00 10.17  ? 93  ARG A NH2 1 
ATOM 646  N N   . ALA A 1 94  ? 44.907 31.654 9.081   1.00 10.88  ? 94  ALA A N   1 
ATOM 647  C CA  . ALA A 1 94  ? 45.273 30.565 8.194   1.00 10.88  ? 94  ALA A CA  1 
ATOM 648  C C   . ALA A 1 94  ? 45.371 31.059 6.776   1.00 10.88  ? 94  ALA A C   1 
ATOM 649  O O   . ALA A 1 94  ? 45.614 30.278 5.870   1.00 10.00  ? 94  ALA A O   1 
ATOM 650  C CB  . ALA A 1 94  ? 44.256 29.483 8.258   1.00 10.00  ? 94  ALA A CB  1 
ATOM 651  N N   . LEU A 1 95  ? 45.099 32.348 6.579   1.00 10.00  ? 95  LEU A N   1 
ATOM 652  C CA  . LEU A 1 95  ? 45.158 32.965 5.258   1.00 10.00  ? 95  LEU A CA  1 
ATOM 653  C C   . LEU A 1 95  ? 46.602 32.967 4.764   1.00 10.00  ? 95  LEU A C   1 
ATOM 654  O O   . LEU A 1 95  ? 46.854 33.095 3.568   1.00 10.00  ? 95  LEU A O   1 
ATOM 655  C CB  . LEU A 1 95  ? 44.591 34.387 5.305   1.00 10.00  ? 95  LEU A CB  1 
ATOM 656  C CG  . LEU A 1 95  ? 43.123 34.525 5.747   1.00 10.00  ? 95  LEU A CG  1 
ATOM 657  C CD1 . LEU A 1 95  ? 42.798 35.962 6.077   1.00 10.00  ? 95  LEU A CD1 1 
ATOM 658  C CD2 . LEU A 1 95  ? 42.169 34.027 4.677   1.00 10.00  ? 95  LEU A CD2 1 
ATOM 659  N N   . MET A 1 96  ? 47.541 32.853 5.701   1.00 10.00  ? 96  MET A N   1 
ATOM 660  C CA  . MET A 1 96  ? 48.964 32.801 5.390   1.00 10.00  ? 96  MET A CA  1 
ATOM 661  C C   . MET A 1 96  ? 49.212 31.520 4.656   1.00 10.00  ? 96  MET A C   1 
ATOM 662  O O   . MET A 1 96  ? 49.922 31.479 3.663   1.00 10.00  ? 96  MET A O   1 
ATOM 663  C CB  . MET A 1 96  ? 49.782 32.729 6.672   1.00 10.00  ? 96  MET A CB  1 
ATOM 664  C CG  . MET A 1 96  ? 49.768 33.976 7.454   1.00 10.00  ? 96  MET A CG  1 
ATOM 665  S SD  . MET A 1 96  ? 50.165 35.227 6.309   1.00 10.00  ? 96  MET A SD  1 
ATOM 666  C CE  . MET A 1 96  ? 51.748 34.669 5.746   1.00 10.00  ? 96  MET A CE  1 
ATOM 667  N N   . TYR A 1 97  ? 48.690 30.469 5.264   1.00 10.00  ? 97  TYR A N   1 
ATOM 668  C CA  . TYR A 1 97  ? 48.832 29.116 4.707   1.00 10.00  ? 97  TYR A CA  1 
ATOM 669  C C   . TYR A 1 97  ? 48.492 29.125 3.215   1.00 10.00  ? 97  TYR A C   1 
ATOM 670  O O   . TYR A 1 97  ? 49.215 28.561 2.441   1.00 10.00  ? 97  TYR A O   1 
ATOM 671  C CB  . TYR A 1 97  ? 47.887 28.155 5.423   1.00 10.00  ? 97  TYR A CB  1 
ATOM 672  C CG  . TYR A 1 97  ? 48.502 27.568 6.689   1.00 10.00  ? 97  TYR A CG  1 
ATOM 673  C CD1 . TYR A 1 97  ? 48.338 28.227 7.911   1.00 10.00  ? 97  TYR A CD1 1 
ATOM 674  C CD2 . TYR A 1 97  ? 49.230 26.376 6.623   1.00 10.00  ? 97  TYR A CD2 1 
ATOM 675  C CE1 . TYR A 1 97  ? 48.905 27.695 9.072   1.00 10.00  ? 97  TYR A CE1 1 
ATOM 676  C CE2 . TYR A 1 97  ? 49.798 25.843 7.785   1.00 10.00  ? 97  TYR A CE2 1 
ATOM 677  C CZ  . TYR A 1 97  ? 49.636 26.503 9.009   1.00 10.00  ? 97  TYR A CZ  1 
ATOM 678  O OH  . TYR A 1 97  ? 50.189 25.985 10.138  1.00 10.00  ? 97  TYR A OH  1 
ATOM 679  N N   . ILE A 1 98  ? 47.457 29.879 2.859   1.00 10.00  ? 98  ILE A N   1 
ATOM 680  C CA  . ILE A 1 98  ? 47.069 29.929 1.461   1.00 10.00  ? 98  ILE A CA  1 
ATOM 681  C C   . ILE A 1 98  ? 48.119 30.615 0.614   1.00 10.00  ? 98  ILE A C   1 
ATOM 682  O O   . ILE A 1 98  ? 48.458 30.132 -0.466  1.00 10.00  ? 98  ILE A O   1 
ATOM 683  C CB  . ILE A 1 98  ? 45.728 30.669 1.240   1.00 10.00  ? 98  ILE A CB  1 
ATOM 684  C CG1 . ILE A 1 98  ? 44.601 30.025 2.054   1.00 10.00  ? 98  ILE A CG1 1 
ATOM 685  C CG2 . ILE A 1 98  ? 45.353 30.660 -0.245  1.00 10.00  ? 98  ILE A CG2 1 
ATOM 686  C CD1 . ILE A 1 98  ? 43.237 30.717 1.907   1.00 10.00  ? 98  ILE A CD1 1 
ATOM 687  N N   . ILE A 1 99  ? 48.578 31.781 1.055   1.00 52.67  ? 99  ILE A N   1 
ATOM 688  C CA  . ILE A 1 99  ? 49.570 32.508 0.281   1.00 52.67  ? 99  ILE A CA  1 
ATOM 689  C C   . ILE A 1 99  ? 50.807 31.625 0.105   1.00 52.67  ? 99  ILE A C   1 
ATOM 690  O O   . ILE A 1 99  ? 51.434 31.646 -0.950  1.00 10.00  ? 99  ILE A O   1 
ATOM 691  C CB  . ILE A 1 99  ? 49.863 33.915 0.902   1.00 10.00  ? 99  ILE A CB  1 
ATOM 692  C CG1 . ILE A 1 99  ? 50.354 34.883 -0.184  1.00 10.00  ? 99  ILE A CG1 1 
ATOM 693  C CG2 . ILE A 1 99  ? 50.803 33.798 2.090   1.00 10.00  ? 99  ILE A CG2 1 
ATOM 694  C CD1 . ILE A 1 99  ? 50.173 36.366 0.172   1.00 10.00  ? 99  ILE A CD1 1 
ATOM 695  N N   . ALA A 1 100 ? 51.091 30.796 1.112   1.00 10.00  ? 100 ALA A N   1 
ATOM 696  C CA  . ALA A 1 100 ? 52.226 29.869 1.094   1.00 10.00  ? 100 ALA A CA  1 
ATOM 697  C C   . ALA A 1 100 ? 51.976 28.864 0.003   1.00 10.00  ? 100 ALA A C   1 
ATOM 698  O O   . ALA A 1 100 ? 52.746 28.728 -0.945  1.00 10.00  ? 100 ALA A O   1 
ATOM 699  C CB  . ALA A 1 100 ? 52.328 29.143 2.416   1.00 10.00  ? 100 ALA A CB  1 
ATOM 700  N N   . GLN A 1 101 ? 50.884 28.143 0.178   1.00 10.00  ? 101 GLN A N   1 
ATOM 701  C CA  . GLN A 1 101 ? 50.450 27.139 -0.762  1.00 10.00  ? 101 GLN A CA  1 
ATOM 702  C C   . GLN A 1 101 ? 50.454 27.664 -2.183  1.00 10.00  ? 101 GLN A C   1 
ATOM 703  O O   . GLN A 1 101 ? 50.491 26.889 -3.130  1.00 10.00  ? 101 GLN A O   1 
ATOM 704  C CB  . GLN A 1 101 ? 49.045 26.687 -0.397  1.00 10.00  ? 101 GLN A CB  1 
ATOM 705  C CG  . GLN A 1 101 ? 48.956 26.227 1.051   1.00 10.00  ? 101 GLN A CG  1 
ATOM 706  C CD  . GLN A 1 101 ? 47.545 26.095 1.546   1.00 10.00  ? 101 GLN A CD  1 
ATOM 707  O OE1 . GLN A 1 101 ? 46.602 25.968 0.765   1.00 10.00  ? 101 GLN A OE1 1 
ATOM 708  N NE2 . GLN A 1 101 ? 47.387 26.090 2.859   1.00 10.00  ? 101 GLN A NE2 1 
ATOM 709  N N   . CYS A 1 102 ? 50.361 28.978 -2.328  1.00 10.80  ? 102 CYS A N   1 
ATOM 710  C CA  . CYS A 1 102 ? 50.341 29.610 -3.641  1.00 10.80  ? 102 CYS A CA  1 
ATOM 711  C C   . CYS A 1 102 ? 51.715 29.935 -4.149  1.00 10.80  ? 102 CYS A C   1 
ATOM 712  O O   . CYS A 1 102 ? 51.995 29.767 -5.333  1.00 10.00  ? 102 CYS A O   1 
ATOM 713  C CB  . CYS A 1 102 ? 49.532 30.891 -3.605  1.00 10.00  ? 102 CYS A CB  1 
ATOM 714  S SG  . CYS A 1 102 ? 47.797 30.610 -3.363  1.00 10.00  ? 102 CYS A SG  1 
ATOM 715  N N   . VAL A 1 103 ? 52.530 30.512 -3.279  1.00 10.00  ? 103 VAL A N   1 
ATOM 716  C CA  . VAL A 1 103 ? 53.884 30.869 -3.654  1.00 10.00  ? 103 VAL A CA  1 
ATOM 717  C C   . VAL A 1 103 ? 54.727 29.637 -3.943  1.00 10.00  ? 103 VAL A C   1 
ATOM 718  O O   . VAL A 1 103 ? 55.505 29.631 -4.898  1.00 10.00  ? 103 VAL A O   1 
ATOM 719  C CB  . VAL A 1 103 ? 54.565 31.745 -2.593  1.00 10.00  ? 103 VAL A CB  1 
ATOM 720  C CG1 . VAL A 1 103 ? 54.205 33.192 -2.813  1.00 10.00  ? 103 VAL A CG1 1 
ATOM 721  C CG2 . VAL A 1 103 ? 54.149 31.323 -1.203  1.00 10.00  ? 103 VAL A CG2 1 
ATOM 722  N N   . GLY A 1 104 ? 54.542 28.598 -3.131  1.00 10.00  ? 104 GLY A N   1 
ATOM 723  C CA  . GLY A 1 104 ? 55.270 27.357 -3.310  1.00 10.00  ? 104 GLY A CA  1 
ATOM 724  C C   . GLY A 1 104 ? 54.980 26.792 -4.678  1.00 10.00  ? 104 GLY A C   1 
ATOM 725  O O   . GLY A 1 104 ? 55.873 26.353 -5.395  1.00 48.76  ? 104 GLY A O   1 
ATOM 726  N N   . ALA A 1 105 ? 53.716 26.841 -5.058  1.00 10.00  ? 105 ALA A N   1 
ATOM 727  C CA  . ALA A 1 105 ? 53.306 26.337 -6.345  1.00 10.00  ? 105 ALA A CA  1 
ATOM 728  C C   . ALA A 1 105 ? 54.036 26.987 -7.496  1.00 10.00  ? 105 ALA A C   1 
ATOM 729  O O   . ALA A 1 105 ? 54.372 26.318 -8.470  1.00 10.00  ? 105 ALA A O   1 
ATOM 730  C CB  . ALA A 1 105 ? 51.838 26.521 -6.518  1.00 10.00  ? 105 ALA A CB  1 
ATOM 731  N N   . ILE A 1 106 ? 54.304 28.284 -7.390  1.00 10.00  ? 106 ILE A N   1 
ATOM 732  C CA  . ILE A 1 106 ? 54.964 28.956 -8.495  1.00 10.00  ? 106 ILE A CA  1 
ATOM 733  C C   . ILE A 1 106 ? 56.405 28.589 -8.720  1.00 10.00  ? 106 ILE A C   1 
ATOM 734  O O   . ILE A 1 106 ? 56.843 28.604 -9.867  1.00 10.37  ? 106 ILE A O   1 
ATOM 735  C CB  . ILE A 1 106 ? 54.864 30.458 -8.462  1.00 10.37  ? 106 ILE A CB  1 
ATOM 736  C CG1 . ILE A 1 106 ? 53.553 30.910 -7.816  1.00 10.37  ? 106 ILE A CG1 1 
ATOM 737  C CG2 . ILE A 1 106 ? 54.936 30.942 -9.887  1.00 10.37  ? 106 ILE A CG2 1 
ATOM 738  C CD1 . ILE A 1 106 ? 52.297 30.523 -8.571  1.00 10.37  ? 106 ILE A CD1 1 
ATOM 739  N N   . VAL A 1 107 ? 57.169 28.383 -7.644  1.00 10.15  ? 107 VAL A N   1 
ATOM 740  C CA  . VAL A 1 107 ? 58.566 27.955 -7.785  1.00 10.15  ? 107 VAL A CA  1 
ATOM 741  C C   . VAL A 1 107 ? 58.539 26.471 -8.073  1.00 10.15  ? 107 VAL A C   1 
ATOM 742  O O   . VAL A 1 107 ? 59.556 25.870 -8.406  1.00 10.66  ? 107 VAL A O   1 
ATOM 743  C CB  . VAL A 1 107 ? 59.450 28.204 -6.536  1.00 10.66  ? 107 VAL A CB  1 
ATOM 744  C CG1 . VAL A 1 107 ? 60.163 29.543 -6.665  1.00 10.66  ? 107 VAL A CG1 1 
ATOM 745  C CG2 . VAL A 1 107 ? 58.645 28.124 -5.254  1.00 10.66  ? 107 VAL A CG2 1 
ATOM 746  N N   . ALA A 1 108 ? 57.357 25.890 -7.904  1.00 10.00  ? 108 ALA A N   1 
ATOM 747  C CA  . ALA A 1 108 ? 57.137 24.492 -8.168  1.00 10.00  ? 108 ALA A CA  1 
ATOM 748  C C   . ALA A 1 108 ? 57.044 24.343 -9.665  1.00 10.00  ? 108 ALA A C   1 
ATOM 749  O O   . ALA A 1 108 ? 57.766 23.545 -10.248 1.00 10.00  ? 108 ALA A O   1 
ATOM 750  C CB  . ALA A 1 108 ? 55.884 24.046 -7.531  1.00 10.00  ? 108 ALA A CB  1 
ATOM 751  N N   . THR A 1 109 ? 56.172 25.114 -10.293 1.00 10.00  ? 109 THR A N   1 
ATOM 752  C CA  . THR A 1 109 ? 56.031 25.021 -11.755 1.00 10.00  ? 109 THR A CA  1 
ATOM 753  C C   . THR A 1 109 ? 57.267 25.637 -12.403 1.00 10.00  ? 109 THR A C   1 
ATOM 754  O O   . THR A 1 109 ? 57.688 25.193 -13.464 1.00 10.00  ? 109 THR A O   1 
ATOM 755  C CB  . THR A 1 109 ? 54.781 25.772 -12.213 1.00 10.00  ? 109 THR A CB  1 
ATOM 756  O OG1 . THR A 1 109 ? 53.626 25.204 -11.612 1.00 10.00  ? 109 THR A OG1 1 
ATOM 757  C CG2 . THR A 1 109 ? 54.577 25.726 -13.728 1.00 10.00  ? 109 THR A CG2 1 
ATOM 758  N N   . ALA A 1 110 ? 57.795 26.664 -11.776 1.00 10.00  ? 110 ALA A N   1 
ATOM 759  C CA  . ALA A 1 110 ? 58.949 27.342 -12.309 1.00 10.00  ? 110 ALA A CA  1 
ATOM 760  C C   . ALA A 1 110 ? 60.132 26.421 -12.443 1.00 10.00  ? 110 ALA A C   1 
ATOM 761  O O   . ALA A 1 110 ? 60.700 26.313 -13.525 1.00 10.00  ? 110 ALA A O   1 
ATOM 762  C CB  . ALA A 1 110 ? 59.302 28.490 -11.439 1.00 10.00  ? 110 ALA A CB  1 
ATOM 763  N N   . ILE A 1 111 ? 60.520 25.787 -11.335 1.00 10.00  ? 111 ILE A N   1 
ATOM 764  C CA  . ILE A 1 111 ? 61.659 24.864 -11.312 1.00 10.00  ? 111 ILE A CA  1 
ATOM 765  C C   . ILE A 1 111 ? 61.499 23.764 -12.357 1.00 10.00  ? 111 ILE A C   1 
ATOM 766  O O   . ILE A 1 111 ? 62.473 23.137 -12.765 1.00 10.00  ? 111 ILE A O   1 
ATOM 767  C CB  . ILE A 1 111 ? 61.863 24.239 -9.916  1.00 10.00  ? 111 ILE A CB  1 
ATOM 768  C CG1 . ILE A 1 111 ? 62.401 25.269 -8.929  1.00 10.00  ? 111 ILE A CG1 1 
ATOM 769  C CG2 . ILE A 1 111 ? 62.886 23.144 -9.987  1.00 10.00  ? 111 ILE A CG2 1 
ATOM 770  C CD1 . ILE A 1 111 ? 63.859 25.569 -9.115  1.00 10.00  ? 111 ILE A CD1 1 
ATOM 771  N N   . LEU A 1 112 ? 60.268 23.547 -12.795 1.00 10.00  ? 112 LEU A N   1 
ATOM 772  C CA  . LEU A 1 112 ? 59.978 22.549 -13.797 1.00 10.00  ? 112 LEU A CA  1 
ATOM 773  C C   . LEU A 1 112 ? 60.460 23.014 -15.159 1.00 10.00  ? 112 LEU A C   1 
ATOM 774  O O   . LEU A 1 112 ? 61.354 22.419 -15.738 1.00 10.00  ? 112 LEU A O   1 
ATOM 775  C CB  . LEU A 1 112 ? 58.484 22.278 -13.841 1.00 10.00  ? 112 LEU A CB  1 
ATOM 776  C CG  . LEU A 1 112 ? 58.103 21.229 -14.867 1.00 10.00  ? 112 LEU A CG  1 
ATOM 777  C CD1 . LEU A 1 112 ? 58.566 19.869 -14.386 1.00 10.00  ? 112 LEU A CD1 1 
ATOM 778  C CD2 . LEU A 1 112 ? 56.625 21.238 -15.084 1.00 10.00  ? 112 LEU A CD2 1 
ATOM 779  N N   . SER A 1 113 ? 59.853 24.070 -15.673 1.00 10.00  ? 113 SER A N   1 
ATOM 780  C CA  . SER A 1 113 ? 60.228 24.617 -16.961 1.00 10.00  ? 113 SER A CA  1 
ATOM 781  C C   . SER A 1 113 ? 61.752 24.645 -17.106 1.00 10.00  ? 113 SER A C   1 
ATOM 782  O O   . SER A 1 113 ? 62.282 24.491 -18.200 1.00 10.57  ? 113 SER A O   1 
ATOM 783  C CB  . SER A 1 113 ? 59.661 26.040 -17.085 1.00 10.57  ? 113 SER A CB  1 
ATOM 784  O OG  . SER A 1 113 ? 59.729 26.553 -18.411 1.00 10.57  ? 113 SER A OG  1 
ATOM 785  N N   . GLY A 1 114 ? 62.450 24.843 -15.989 1.00 64.81  ? 114 GLY A N   1 
ATOM 786  C CA  . GLY A 1 114 ? 63.909 24.917 -15.984 1.00 64.81  ? 114 GLY A CA  1 
ATOM 787  C C   . GLY A 1 114 ? 64.590 23.662 -16.483 1.00 64.81  ? 114 GLY A C   1 
ATOM 788  O O   . GLY A 1 114 ? 65.534 23.723 -17.279 1.00 13.45  ? 114 GLY A O   1 
ATOM 789  N N   . ILE A 1 115 ? 64.193 22.538 -15.900 1.00 10.00  ? 115 ILE A N   1 
ATOM 790  C CA  . ILE A 1 115 ? 64.702 21.247 -16.302 1.00 10.00  ? 115 ILE A CA  1 
ATOM 791  C C   . ILE A 1 115 ? 63.933 20.873 -17.550 1.00 10.00  ? 115 ILE A C   1 
ATOM 792  O O   . ILE A 1 115 ? 64.424 20.989 -18.652 1.00 10.00  ? 115 ILE A O   1 
ATOM 793  C CB  . ILE A 1 115 ? 64.465 20.177 -15.212 1.00 10.00  ? 115 ILE A CB  1 
ATOM 794  C CG1 . ILE A 1 115 ? 63.079 20.309 -14.603 1.00 10.00  ? 115 ILE A CG1 1 
ATOM 795  C CG2 . ILE A 1 115 ? 65.480 20.305 -14.109 1.00 10.00  ? 115 ILE A CG2 1 
ATOM 796  C CD1 . ILE A 1 115 ? 62.673 19.126 -13.849 1.00 10.00  ? 115 ILE A CD1 1 
ATOM 797  N N   . THR A 1 116 ? 62.695 20.464 -17.342 1.00 10.00  ? 116 THR A N   1 
ATOM 798  C CA  . THR A 1 116 ? 61.797 20.094 -18.407 1.00 10.00  ? 116 THR A CA  1 
ATOM 799  C C   . THR A 1 116 ? 61.754 21.346 -19.279 1.00 10.00  ? 116 THR A C   1 
ATOM 800  O O   . THR A 1 116 ? 61.125 22.352 -18.917 1.00 10.00  ? 116 THR A O   1 
ATOM 801  C CB  . THR A 1 116 ? 60.398 19.762 -17.804 1.00 10.00  ? 116 THR A CB  1 
ATOM 802  O OG1 . THR A 1 116 ? 60.558 19.131 -16.524 1.00 10.00  ? 116 THR A OG1 1 
ATOM 803  C CG2 . THR A 1 116 ? 59.688 18.802 -18.635 1.00 10.00  ? 116 THR A CG2 1 
ATOM 804  N N   . SER A 1 117 ? 62.494 21.293 -20.381 1.00 32.04  ? 117 SER A N   1 
ATOM 805  C CA  . SER A 1 117 ? 62.596 22.424 -21.276 1.00 32.04  ? 117 SER A CA  1 
ATOM 806  C C   . SER A 1 117 ? 62.745 22.006 -22.734 1.00 32.04  ? 117 SER A C   1 
ATOM 807  O O   . SER A 1 117 ? 63.101 22.822 -23.584 1.00 10.00  ? 117 SER A O   1 
ATOM 808  C CB  . SER A 1 117 ? 63.772 23.319 -20.853 1.00 10.00  ? 117 SER A CB  1 
ATOM 809  O OG  . SER A 1 117 ? 65.034 22.662 -20.992 1.00 10.00  ? 117 SER A OG  1 
ATOM 810  N N   . SER A 1 118 ? 62.452 20.746 -23.030 1.00 10.00  ? 118 SER A N   1 
ATOM 811  C CA  . SER A 1 118 ? 62.547 20.244 -24.390 1.00 10.00  ? 118 SER A CA  1 
ATOM 812  C C   . SER A 1 118 ? 61.236 19.563 -24.767 1.00 10.00  ? 118 SER A C   1 
ATOM 813  O O   . SER A 1 118 ? 61.112 18.972 -25.834 1.00 10.00  ? 118 SER A O   1 
ATOM 814  C CB  . SER A 1 118 ? 63.706 19.273 -24.513 1.00 10.00  ? 118 SER A CB  1 
ATOM 815  O OG  . SER A 1 118 ? 63.629 18.285 -23.503 1.00 10.00  ? 118 SER A OG  1 
ATOM 816  N N   . LEU A 1 119 ? 60.271 19.602 -23.852 1.00 10.00  ? 119 LEU A N   1 
ATOM 817  C CA  . LEU A 1 119 ? 58.957 18.996 -24.071 1.00 10.00  ? 119 LEU A CA  1 
ATOM 818  C C   . LEU A 1 119 ? 58.164 19.864 -25.052 1.00 10.00  ? 119 LEU A C   1 
ATOM 819  O O   . LEU A 1 119 ? 57.059 20.291 -24.712 1.00 18.54  ? 119 LEU A O   1 
ATOM 820  C CB  . LEU A 1 119 ? 58.188 19.007 -22.767 1.00 18.54  ? 119 LEU A CB  1 
ATOM 821  C CG  . LEU A 1 119 ? 58.752 18.172 -21.635 1.00 18.54  ? 119 LEU A CG  1 
ATOM 822  C CD1 . LEU A 1 119 ? 57.617 17.862 -20.679 1.00 18.54  ? 119 LEU A CD1 1 
ATOM 823  C CD2 . LEU A 1 119 ? 59.316 16.898 -22.184 1.00 18.54  ? 119 LEU A CD2 1 
ATOM 824  N N   . THR A 1 120 ? 58.646 20.066 -26.284 1.00 53.56  ? 120 THR A N   1 
ATOM 825  C CA  . THR A 1 120 ? 57.971 20.999 -27.195 1.00 53.56  ? 120 THR A CA  1 
ATOM 826  C C   . THR A 1 120 ? 57.388 20.644 -28.596 1.00 53.56  ? 120 THR A C   1 
ATOM 827  O O   . THR A 1 120 ? 58.087 20.779 -29.612 1.00 99.91  ? 120 THR A O   1 
ATOM 828  C CB  . THR A 1 120 ? 58.841 22.299 -27.338 1.00 99.91  ? 120 THR A CB  1 
ATOM 829  O OG1 . THR A 1 120 ? 60.117 21.961 -27.891 1.00 99.91  ? 120 THR A OG1 1 
ATOM 830  C CG2 . THR A 1 120 ? 59.107 22.939 -25.975 1.00 99.91  ? 120 THR A CG2 1 
ATOM 831  N N   . GLY A 1 121 ? 56.188 20.068 -28.609 1.00 10.00  ? 121 GLY A N   1 
ATOM 832  C CA  . GLY A 1 121 ? 55.483 19.792 -29.845 1.00 10.00  ? 121 GLY A CA  1 
ATOM 833  C C   . GLY A 1 121 ? 54.700 21.084 -29.873 1.00 10.00  ? 121 GLY A C   1 
ATOM 834  O O   . GLY A 1 121 ? 55.317 22.128 -30.004 1.00 10.00  ? 121 GLY A O   1 
ATOM 835  N N   . ASN A 1 122 ? 53.374 21.068 -29.778 1.00 99.98  ? 122 ASN A N   1 
ATOM 836  C CA  . ASN A 1 122 ? 52.724 22.369 -29.635 1.00 99.98  ? 122 ASN A CA  1 
ATOM 837  C C   . ASN A 1 122 ? 52.642 22.488 -28.110 1.00 99.98  ? 122 ASN A C   1 
ATOM 838  O O   . ASN A 1 122 ? 51.602 22.343 -27.472 1.00 10.00  ? 122 ASN A O   1 
ATOM 839  C CB  . ASN A 1 122 ? 51.397 22.515 -30.371 1.00 10.00  ? 122 ASN A CB  1 
ATOM 840  C CG  . ASN A 1 122 ? 51.419 23.707 -31.324 1.00 10.00  ? 122 ASN A CG  1 
ATOM 841  O OD1 . ASN A 1 122 ? 51.097 23.591 -32.503 1.00 10.00  ? 122 ASN A OD1 1 
ATOM 842  N ND2 . ASN A 1 122 ? 51.900 24.842 -30.830 1.00 10.00  ? 122 ASN A ND2 1 
ATOM 843  N N   . SER A 1 123 ? 53.879 22.374 -27.640 1.00 100.00 ? 123 SER A N   1 
ATOM 844  C CA  . SER A 1 123 ? 54.485 22.370 -26.319 1.00 100.00 ? 123 SER A CA  1 
ATOM 845  C C   . SER A 1 123 ? 53.883 23.014 -25.114 1.00 100.00 ? 123 SER A C   1 
ATOM 846  O O   . SER A 1 123 ? 53.629 24.230 -25.122 1.00 100.00 ? 123 SER A O   1 
ATOM 847  C CB  . SER A 1 123 ? 55.833 22.992 -26.509 1.00 100.00 ? 123 SER A CB  1 
ATOM 848  O OG  . SER A 1 123 ? 55.700 24.149 -27.295 1.00 100.00 ? 123 SER A OG  1 
ATOM 849  N N   . LEU A 1 124 ? 53.768 22.272 -24.019 1.00 10.00  ? 124 LEU A N   1 
ATOM 850  C CA  . LEU A 1 124 ? 53.244 22.989 -22.914 1.00 10.00  ? 124 LEU A CA  1 
ATOM 851  C C   . LEU A 1 124 ? 53.444 22.600 -21.494 1.00 10.00  ? 124 LEU A C   1 
ATOM 852  O O   . LEU A 1 124 ? 54.049 23.362 -20.739 1.00 100.00 ? 124 LEU A O   1 
ATOM 853  C CB  . LEU A 1 124 ? 51.781 23.329 -23.163 1.00 100.00 ? 124 LEU A CB  1 
ATOM 854  C CG  . LEU A 1 124 ? 51.206 24.420 -22.263 1.00 100.00 ? 124 LEU A CG  1 
ATOM 855  C CD1 . LEU A 1 124 ? 52.024 25.728 -22.271 1.00 100.00 ? 124 LEU A CD1 1 
ATOM 856  C CD2 . LEU A 1 124 ? 49.811 24.659 -22.762 1.00 100.00 ? 124 LEU A CD2 1 
ATOM 857  N N   . GLY A 1 125 ? 53.030 21.407 -21.118 1.00 10.00  ? 125 GLY A N   1 
ATOM 858  C CA  . GLY A 1 125 ? 53.088 21.120 -19.700 1.00 10.00  ? 125 GLY A CA  1 
ATOM 859  C C   . GLY A 1 125 ? 51.837 21.848 -19.220 1.00 10.00  ? 125 GLY A C   1 
ATOM 860  O O   . GLY A 1 125 ? 51.768 22.417 -18.137 1.00 10.00  ? 125 GLY A O   1 
ATOM 861  N N   . ARG A 1 126 ? 50.852 21.800 -20.122 1.00 52.38  ? 126 ARG A N   1 
ATOM 862  C CA  . ARG A 1 126 ? 49.499 22.388 -20.094 1.00 52.38  ? 126 ARG A CA  1 
ATOM 863  C C   . ARG A 1 126 ? 48.763 22.615 -18.784 1.00 52.38  ? 126 ARG A C   1 
ATOM 864  O O   . ARG A 1 126 ? 49.096 22.014 -17.757 1.00 10.00  ? 126 ARG A O   1 
ATOM 865  C CB  . ARG A 1 126 ? 48.605 21.561 -21.030 1.00 10.00  ? 126 ARG A CB  1 
ATOM 866  C CG  . ARG A 1 126 ? 47.370 22.239 -21.563 1.00 10.00  ? 126 ARG A CG  1 
ATOM 867  C CD  . ARG A 1 126 ? 46.617 21.300 -22.481 1.00 10.00  ? 126 ARG A CD  1 
ATOM 868  N NE  . ARG A 1 126 ? 47.099 21.320 -23.856 1.00 10.00  ? 126 ARG A NE  1 
ATOM 869  C CZ  . ARG A 1 126 ? 46.611 20.531 -24.805 1.00 10.00  ? 126 ARG A CZ  1 
ATOM 870  N NH1 . ARG A 1 126 ? 45.658 19.670 -24.507 1.00 10.00  ? 126 ARG A NH1 1 
ATOM 871  N NH2 . ARG A 1 126 ? 47.014 20.647 -26.059 1.00 10.00  ? 126 ARG A NH2 1 
ATOM 872  N N   . ASN A 1 127 ? 47.768 23.503 -18.861 1.00 10.00  ? 127 ASN A N   1 
ATOM 873  C CA  . ASN A 1 127 ? 46.896 23.863 -17.751 1.00 10.00  ? 127 ASN A CA  1 
ATOM 874  C C   . ASN A 1 127 ? 46.538 22.485 -17.274 1.00 10.00  ? 127 ASN A C   1 
ATOM 875  O O   . ASN A 1 127 ? 45.769 21.794 -17.940 1.00 10.00  ? 127 ASN A O   1 
ATOM 876  C CB  . ASN A 1 127 ? 45.624 24.563 -18.276 1.00 10.00  ? 127 ASN A CB  1 
ATOM 877  C CG  . ASN A 1 127 ? 45.785 25.113 -19.685 1.00 10.00  ? 127 ASN A CG  1 
ATOM 878  O OD1 . ASN A 1 127 ? 45.080 24.709 -20.607 1.00 10.00  ? 127 ASN A OD1 1 
ATOM 879  N ND2 . ASN A 1 127 ? 46.720 26.036 -19.857 1.00 10.00  ? 127 ASN A ND2 1 
ATOM 880  N N   . ASP A 1 128 ? 47.122 22.048 -16.165 1.00 10.00  ? 128 ASP A N   1 
ATOM 881  C CA  . ASP A 1 128 ? 46.824 20.705 -15.754 1.00 10.00  ? 128 ASP A CA  1 
ATOM 882  C C   . ASP A 1 128 ? 45.356 20.425 -15.694 1.00 10.00  ? 128 ASP A C   1 
ATOM 883  O O   . ASP A 1 128 ? 44.957 19.268 -15.920 1.00 10.00  ? 128 ASP A O   1 
ATOM 884  C CB  . ASP A 1 128 ? 47.652 20.171 -14.522 1.00 10.00  ? 128 ASP A CB  1 
ATOM 885  C CG  . ASP A 1 128 ? 47.465 20.956 -13.198 1.00 10.00  ? 128 ASP A CG  1 
ATOM 886  O OD1 . ASP A 1 128 ? 47.335 22.182 -13.202 1.00 10.00  ? 128 ASP A OD1 1 
ATOM 887  O OD2 . ASP A 1 128 ? 47.539 20.329 -12.116 1.00 10.00  ? 128 ASP A OD2 1 
ATOM 888  N N   . LEU A 1 129 ? 44.549 21.481 -15.743 1.00 10.00  ? 129 LEU A N   1 
ATOM 889  C CA  . LEU A 1 129 ? 43.150 21.222 -15.578 1.00 10.00  ? 129 LEU A CA  1 
ATOM 890  C C   . LEU A 1 129 ? 42.080 21.785 -16.537 1.00 10.00  ? 129 LEU A C   1 
ATOM 891  O O   . LEU A 1 129 ? 41.589 21.086 -17.448 1.00 10.00  ? 129 LEU A O   1 
ATOM 892  C CB  . LEU A 1 129 ? 42.799 21.555 -14.147 1.00 10.00  ? 129 LEU A CB  1 
ATOM 893  C CG  . LEU A 1 129 ? 43.547 21.083 -12.883 1.00 10.00  ? 129 LEU A CG  1 
ATOM 894  C CD1 . LEU A 1 129 ? 42.469 20.817 -11.963 1.00 10.00  ? 129 LEU A CD1 1 
ATOM 895  C CD2 . LEU A 1 129 ? 44.423 19.830 -12.932 1.00 10.00  ? 129 LEU A CD2 1 
ATOM 896  N N   . ALA A 1 130 ? 41.555 22.957 -16.208 1.00 10.00  ? 130 ALA A N   1 
ATOM 897  C CA  . ALA A 1 130 ? 40.557 23.529 -17.063 1.00 10.00  ? 130 ALA A CA  1 
ATOM 898  C C   . ALA A 1 130 ? 41.046 23.500 -18.493 1.00 10.00  ? 130 ALA A C   1 
ATOM 899  O O   . ALA A 1 130 ? 41.871 24.313 -18.863 1.00 70.94  ? 130 ALA A O   1 
ATOM 900  C CB  . ALA A 1 130 ? 40.240 24.964 -16.630 1.00 70.94  ? 130 ALA A CB  1 
ATOM 901  N N   . ASP A 1 131 ? 40.631 22.497 -19.255 1.00 10.00  ? 131 ASP A N   1 
ATOM 902  C CA  . ASP A 1 131 ? 40.948 22.438 -20.681 1.00 10.00  ? 131 ASP A CA  1 
ATOM 903  C C   . ASP A 1 131 ? 39.541 22.327 -21.249 1.00 10.00  ? 131 ASP A C   1 
ATOM 904  O O   . ASP A 1 131 ? 39.031 23.261 -21.848 1.00 10.00  ? 131 ASP A O   1 
ATOM 905  C CB  . ASP A 1 131 ? 41.842 21.256 -21.059 1.00 10.00  ? 131 ASP A CB  1 
ATOM 906  C CG  . ASP A 1 131 ? 41.798 20.950 -22.541 1.00 10.00  ? 131 ASP A CG  1 
ATOM 907  O OD1 . ASP A 1 131 ? 42.090 21.831 -23.382 1.00 10.00  ? 131 ASP A OD1 1 
ATOM 908  O OD2 . ASP A 1 131 ? 41.425 19.807 -22.864 1.00 10.00  ? 131 ASP A OD2 1 
ATOM 909  N N   . GLY A 1 132 ? 38.883 21.225 -20.920 1.00 10.00  ? 132 GLY A N   1 
ATOM 910  C CA  . GLY A 1 132 ? 37.495 20.973 -21.288 1.00 10.00  ? 132 GLY A CA  1 
ATOM 911  C C   . GLY A 1 132 ? 36.928 20.832 -22.698 1.00 10.00  ? 132 GLY A C   1 
ATOM 912  O O   . GLY A 1 132 ? 37.006 21.756 -23.508 1.00 10.00  ? 132 GLY A O   1 
ATOM 913  N N   . VAL A 1 133 ? 36.409 19.633 -23.008 1.00 25.95  ? 133 VAL A N   1 
ATOM 914  C CA  . VAL A 1 133 ? 35.696 19.344 -24.271 1.00 25.95  ? 133 VAL A CA  1 
ATOM 915  C C   . VAL A 1 133 ? 34.310 19.117 -23.689 1.00 25.95  ? 133 VAL A C   1 
ATOM 916  O O   . VAL A 1 133 ? 33.534 18.283 -24.142 1.00 10.00  ? 133 VAL A O   1 
ATOM 917  C CB  . VAL A 1 133 ? 36.117 18.033 -24.987 1.00 10.00  ? 133 VAL A CB  1 
ATOM 918  C CG1 . VAL A 1 133 ? 35.509 18.004 -26.384 1.00 10.00  ? 133 VAL A CG1 1 
ATOM 919  C CG2 . VAL A 1 133 ? 37.602 17.935 -25.122 1.00 10.00  ? 133 VAL A CG2 1 
ATOM 920  N N   . ASN A 1 134 ? 34.012 19.956 -22.712 1.00 14.95  ? 134 ASN A N   1 
ATOM 921  C CA  . ASN A 1 134 ? 32.811 19.916 -21.916 1.00 14.95  ? 134 ASN A CA  1 
ATOM 922  C C   . ASN A 1 134 ? 32.404 21.391 -21.710 1.00 14.95  ? 134 ASN A C   1 
ATOM 923  O O   . ASN A 1 134 ? 33.040 22.279 -22.287 1.00 10.00  ? 134 ASN A O   1 
ATOM 924  C CB  . ASN A 1 134 ? 33.268 19.229 -20.628 1.00 10.00  ? 134 ASN A CB  1 
ATOM 925  C CG  . ASN A 1 134 ? 32.272 19.302 -19.519 1.00 10.00  ? 134 ASN A CG  1 
ATOM 926  O OD1 . ASN A 1 134 ? 31.122 19.655 -19.745 1.00 10.00  ? 134 ASN A OD1 1 
ATOM 927  N ND2 . ASN A 1 134 ? 32.692 18.972 -18.315 1.00 10.00  ? 134 ASN A ND2 1 
ATOM 928  N N   . SER A 1 135 ? 31.339 21.657 -20.953 1.00 10.00  ? 135 SER A N   1 
ATOM 929  C CA  . SER A 1 135 ? 30.876 23.017 -20.670 1.00 10.00  ? 135 SER A CA  1 
ATOM 930  C C   . SER A 1 135 ? 30.714 23.367 -19.177 1.00 10.00  ? 135 SER A C   1 
ATOM 931  O O   . SER A 1 135 ? 31.548 24.081 -18.607 1.00 86.47  ? 135 SER A O   1 
ATOM 932  C CB  . SER A 1 135 ? 29.555 23.309 -21.402 1.00 86.47  ? 135 SER A CB  1 
ATOM 933  O OG  . SER A 1 135 ? 29.674 23.200 -22.818 1.00 86.47  ? 135 SER A OG  1 
ATOM 934  N N   . GLY A 1 136 ? 29.607 22.946 -18.572 1.00 10.00  ? 136 GLY A N   1 
ATOM 935  C CA  . GLY A 1 136 ? 29.369 23.257 -17.178 1.00 10.00  ? 136 GLY A CA  1 
ATOM 936  C C   . GLY A 1 136 ? 29.527 22.030 -16.297 1.00 10.00  ? 136 GLY A C   1 
ATOM 937  O O   . GLY A 1 136 ? 29.508 22.142 -15.064 1.00 21.24  ? 136 GLY A O   1 
ATOM 938  N N   . GLN A 1 137 ? 29.637 20.849 -16.916 1.00 10.00  ? 137 GLN A N   1 
ATOM 939  C CA  . GLN A 1 137 ? 29.792 19.601 -16.185 1.00 10.00  ? 137 GLN A CA  1 
ATOM 940  C C   . GLN A 1 137 ? 31.045 19.715 -15.327 1.00 10.00  ? 137 GLN A C   1 
ATOM 941  O O   . GLN A 1 137 ? 31.046 19.301 -14.169 1.00 100.00 ? 137 GLN A O   1 
ATOM 942  C CB  . GLN A 1 137 ? 29.986 18.429 -17.161 1.00 100.00 ? 137 GLN A CB  1 
ATOM 943  C CG  . GLN A 1 137 ? 29.099 18.404 -18.411 1.00 100.00 ? 137 GLN A CG  1 
ATOM 944  C CD  . GLN A 1 137 ? 29.612 17.417 -19.461 1.00 100.00 ? 137 GLN A CD  1 
ATOM 945  O OE1 . GLN A 1 137 ? 28.996 17.260 -20.524 1.00 100.00 ? 137 GLN A OE1 1 
ATOM 946  N NE2 . GLN A 1 137 ? 30.732 16.747 -19.170 1.00 100.00 ? 137 GLN A NE2 1 
ATOM 947  N N   . GLY A 1 138 ? 32.115 20.228 -15.926 1.00 10.00  ? 138 GLY A N   1 
ATOM 948  C CA  . GLY A 1 138 ? 33.374 20.346 -15.220 1.00 10.00  ? 138 GLY A CA  1 
ATOM 949  C C   . GLY A 1 138 ? 33.256 20.851 -13.805 1.00 10.00  ? 138 GLY A C   1 
ATOM 950  O O   . GLY A 1 138 ? 33.996 20.451 -12.911 1.00 10.00  ? 138 GLY A O   1 
ATOM 951  N N   . LEU A 1 139 ? 32.303 21.744 -13.614 1.00 14.49  ? 139 LEU A N   1 
ATOM 952  C CA  . LEU A 1 139 ? 32.074 22.366 -12.334 1.00 14.49  ? 139 LEU A CA  1 
ATOM 953  C C   . LEU A 1 139 ? 31.809 21.395 -11.203 1.00 14.49  ? 139 LEU A C   1 
ATOM 954  O O   . LEU A 1 139 ? 32.632 21.243 -10.317 1.00 10.00  ? 139 LEU A O   1 
ATOM 955  C CB  . LEU A 1 139 ? 30.934 23.386 -12.447 1.00 10.00  ? 139 LEU A CB  1 
ATOM 956  C CG  . LEU A 1 139 ? 31.077 24.523 -13.472 1.00 10.00  ? 139 LEU A CG  1 
ATOM 957  C CD1 . LEU A 1 139 ? 29.914 25.476 -13.259 1.00 10.00  ? 139 LEU A CD1 1 
ATOM 958  C CD2 . LEU A 1 139 ? 32.415 25.269 -13.340 1.00 10.00  ? 139 LEU A CD2 1 
ATOM 959  N N   . GLY A 1 140 ? 30.658 20.741 -11.224 1.00 10.00  ? 140 GLY A N   1 
ATOM 960  C CA  . GLY A 1 140 ? 30.335 19.839 -10.142 1.00 10.00  ? 140 GLY A CA  1 
ATOM 961  C C   . GLY A 1 140 ? 31.328 18.739 -9.808  1.00 10.00  ? 140 GLY A C   1 
ATOM 962  O O   . GLY A 1 140 ? 31.712 18.596 -8.649  1.00 10.00  ? 140 GLY A O   1 
ATOM 963  N N   . ILE A 1 141 ? 31.747 17.971 -10.810 1.00 10.00  ? 141 ILE A N   1 
ATOM 964  C CA  . ILE A 1 141 ? 32.647 16.839 -10.614 1.00 10.00  ? 141 ILE A CA  1 
ATOM 965  C C   . ILE A 1 141 ? 33.667 16.961 -9.485  1.00 10.00  ? 141 ILE A C   1 
ATOM 966  O O   . ILE A 1 141 ? 33.783 16.069 -8.649  1.00 10.00  ? 141 ILE A O   1 
ATOM 967  C CB  . ILE A 1 141 ? 33.376 16.450 -11.922 1.00 10.00  ? 141 ILE A CB  1 
ATOM 968  C CG1 . ILE A 1 141 ? 34.573 17.360 -12.174 1.00 10.00  ? 141 ILE A CG1 1 
ATOM 969  C CG2 . ILE A 1 141 ? 32.428 16.504 -13.081 1.00 10.00  ? 141 ILE A CG2 1 
ATOM 970  C CD1 . ILE A 1 141 ? 35.443 16.934 -13.330 1.00 10.00  ? 141 ILE A CD1 1 
ATOM 971  N N   . GLU A 1 142 ? 34.435 18.037 -9.477  1.00 10.00  ? 142 GLU A N   1 
ATOM 972  C CA  . GLU A 1 142 ? 35.446 18.224 -8.458  1.00 10.00  ? 142 GLU A CA  1 
ATOM 973  C C   . GLU A 1 142 ? 34.821 18.570 -7.117  1.00 10.00  ? 142 GLU A C   1 
ATOM 974  O O   . GLU A 1 142 ? 35.321 18.155 -6.063  1.00 72.54  ? 142 GLU A O   1 
ATOM 975  C CB  . GLU A 1 142 ? 36.379 19.329 -8.902  1.00 72.54  ? 142 GLU A CB  1 
ATOM 976  C CG  . GLU A 1 142 ? 36.656 20.358 -7.860  1.00 72.54  ? 142 GLU A CG  1 
ATOM 977  C CD  . GLU A 1 142 ? 36.892 21.706 -8.482  1.00 72.54  ? 142 GLU A CD  1 
ATOM 978  O OE1 . GLU A 1 142 ? 35.917 22.312 -8.972  1.00 72.54  ? 142 GLU A OE1 1 
ATOM 979  O OE2 . GLU A 1 142 ? 38.054 22.162 -8.489  1.00 72.54  ? 142 GLU A OE2 1 
ATOM 980  N N   . ILE A 1 143 ? 33.726 19.324 -7.148  1.00 10.00  ? 143 ILE A N   1 
ATOM 981  C CA  . ILE A 1 143 ? 33.076 19.728 -5.910  1.00 10.00  ? 143 ILE A CA  1 
ATOM 982  C C   . ILE A 1 143 ? 32.545 18.580 -5.073  1.00 10.00  ? 143 ILE A C   1 
ATOM 983  O O   . ILE A 1 143 ? 32.293 18.755 -3.878  1.00 10.00  ? 143 ILE A O   1 
ATOM 984  C CB  . ILE A 1 143 ? 31.946 20.752 -6.124  1.00 10.00  ? 143 ILE A CB  1 
ATOM 985  C CG1 . ILE A 1 143 ? 30.592 20.074 -6.262  1.00 10.00  ? 143 ILE A CG1 1 
ATOM 986  C CG2 . ILE A 1 143 ? 32.196 21.570 -7.365  1.00 10.00  ? 143 ILE A CG2 1 
ATOM 987  C CD1 . ILE A 1 143 ? 29.452 21.056 -6.361  1.00 10.00  ? 143 ILE A CD1 1 
ATOM 988  N N   . ILE A 1 144 ? 32.287 17.435 -5.710  1.00 12.35  ? 144 ILE A N   1 
ATOM 989  C CA  . ILE A 1 144 ? 31.796 16.236 -5.009  1.00 12.35  ? 144 ILE A CA  1 
ATOM 990  C C   . ILE A 1 144 ? 32.993 15.460 -4.447  1.00 12.35  ? 144 ILE A C   1 
ATOM 991  O O   . ILE A 1 144 ? 32.888 14.835 -3.393  1.00 10.00  ? 144 ILE A O   1 
ATOM 992  C CB  . ILE A 1 144 ? 30.977 15.294 -5.961  1.00 10.00  ? 144 ILE A CB  1 
ATOM 993  C CG1 . ILE A 1 144 ? 29.697 15.987 -6.412  1.00 10.00  ? 144 ILE A CG1 1 
ATOM 994  C CG2 . ILE A 1 144 ? 30.507 14.061 -5.231  1.00 10.00  ? 144 ILE A CG2 1 
ATOM 995  C CD1 . ILE A 1 144 ? 29.215 15.601 -7.792  1.00 10.00  ? 144 ILE A CD1 1 
ATOM 996  N N   . GLY A 1 145 ? 34.119 15.525 -5.163  1.00 10.00  ? 145 GLY A N   1 
ATOM 997  C CA  . GLY A 1 145 ? 35.332 14.824 -4.788  1.00 10.00  ? 145 GLY A CA  1 
ATOM 998  C C   . GLY A 1 145 ? 36.022 15.333 -3.551  1.00 10.00  ? 145 GLY A C   1 
ATOM 999  O O   . GLY A 1 145 ? 36.408 14.564 -2.680  1.00 19.78  ? 145 GLY A O   1 
ATOM 1000 N N   . THR A 1 146 ? 36.178 16.634 -3.451  1.00 10.00  ? 146 THR A N   1 
ATOM 1001 C CA  . THR A 1 146 ? 36.839 17.174 -2.284  1.00 10.00  ? 146 THR A CA  1 
ATOM 1002 C C   . THR A 1 146 ? 35.975 16.952 -1.062  1.00 10.00  ? 146 THR A C   1 
ATOM 1003 O O   . THR A 1 146 ? 36.438 17.006 0.077   1.00 10.00  ? 146 THR A O   1 
ATOM 1004 C CB  . THR A 1 146 ? 37.052 18.645 -2.443  1.00 10.00  ? 146 THR A CB  1 
ATOM 1005 O OG1 . THR A 1 146 ? 38.263 18.865 -3.172  1.00 10.00  ? 146 THR A OG1 1 
ATOM 1006 C CG2 . THR A 1 146 ? 37.139 19.305 -1.092  1.00 10.00  ? 146 THR A CG2 1 
ATOM 1007 N N   . LEU A 1 147 ? 34.702 16.725 -1.322  1.00 10.00  ? 147 LEU A N   1 
ATOM 1008 C CA  . LEU A 1 147 ? 33.722 16.527 -0.284  1.00 10.00  ? 147 LEU A CA  1 
ATOM 1009 C C   . LEU A 1 147 ? 34.122 15.416 0.646   1.00 10.00  ? 147 LEU A C   1 
ATOM 1010 O O   . LEU A 1 147 ? 33.946 15.516 1.849   1.00 10.00  ? 147 LEU A O   1 
ATOM 1011 C CB  . LEU A 1 147 ? 32.367 16.244 -0.916  1.00 10.00  ? 147 LEU A CB  1 
ATOM 1012 C CG  . LEU A 1 147 ? 31.114 16.305 -0.052  1.00 10.00  ? 147 LEU A CG  1 
ATOM 1013 C CD1 . LEU A 1 147 ? 31.318 17.174 1.153   1.00 10.00  ? 147 LEU A CD1 1 
ATOM 1014 C CD2 . LEU A 1 147 ? 29.961 16.814 -0.894  1.00 10.00  ? 147 LEU A CD2 1 
ATOM 1015 N N   . GLN A 1 148 ? 34.660 14.352 0.080   1.00 28.04  ? 148 GLN A N   1 
ATOM 1016 C CA  . GLN A 1 148 ? 35.087 13.230 0.881   1.00 28.04  ? 148 GLN A CA  1 
ATOM 1017 C C   . GLN A 1 148 ? 36.482 13.489 1.396   1.00 28.04  ? 148 GLN A C   1 
ATOM 1018 O O   . GLN A 1 148 ? 36.793 13.127 2.516   1.00 10.00  ? 148 GLN A O   1 
ATOM 1019 C CB  . GLN A 1 148 ? 35.058 11.961 0.056   1.00 10.00  ? 148 GLN A CB  1 
ATOM 1020 C CG  . GLN A 1 148 ? 35.918 12.046 -1.181  1.00 10.00  ? 148 GLN A CG  1 
ATOM 1021 C CD  . GLN A 1 148 ? 35.589 10.954 -2.146  1.00 10.00  ? 148 GLN A CD  1 
ATOM 1022 O OE1 . GLN A 1 148 ? 35.937 9.792  -1.922  1.00 10.00  ? 148 GLN A OE1 1 
ATOM 1023 N NE2 . GLN A 1 148 ? 34.862 11.297 -3.201  1.00 10.00  ? 148 GLN A NE2 1 
ATOM 1024 N N   . LEU A 1 149 ? 37.339 14.069 0.567   1.00 10.08  ? 149 LEU A N   1 
ATOM 1025 C CA  . LEU A 1 149 ? 38.678 14.377 1.017   1.00 10.08  ? 149 LEU A CA  1 
ATOM 1026 C C   . LEU A 1 149 ? 38.592 15.135 2.342   1.00 10.08  ? 149 LEU A C   1 
ATOM 1027 O O   . LEU A 1 149 ? 39.175 14.710 3.326   1.00 10.00  ? 149 LEU A O   1 
ATOM 1028 C CB  . LEU A 1 149 ? 39.385 15.260 0.005   1.00 10.00  ? 149 LEU A CB  1 
ATOM 1029 C CG  . LEU A 1 149 ? 40.396 16.155 0.708   1.00 10.00  ? 149 LEU A CG  1 
ATOM 1030 C CD1 . LEU A 1 149 ? 41.558 15.321 1.035   1.00 10.00  ? 149 LEU A CD1 1 
ATOM 1031 C CD2 . LEU A 1 149 ? 40.767 17.370 -0.089  1.00 10.00  ? 149 LEU A CD2 1 
ATOM 1032 N N   . VAL A 1 150 ? 37.928 16.299 2.327   1.00 10.00  ? 150 VAL A N   1 
ATOM 1033 C CA  . VAL A 1 150 ? 37.776 17.152 3.513   1.00 10.00  ? 150 VAL A CA  1 
ATOM 1034 C C   . VAL A 1 150 ? 37.097 16.409 4.611   1.00 10.00  ? 150 VAL A C   1 
ATOM 1035 O O   . VAL A 1 150 ? 37.283 16.699 5.796   1.00 10.00  ? 150 VAL A O   1 
ATOM 1036 C CB  . VAL A 1 150 ? 36.894 18.342 3.248   1.00 10.00  ? 150 VAL A CB  1 
ATOM 1037 C CG1 . VAL A 1 150 ? 36.708 19.147 4.513   1.00 10.00  ? 150 VAL A CG1 1 
ATOM 1038 C CG2 . VAL A 1 150 ? 37.469 19.177 2.166   1.00 10.00  ? 150 VAL A CG2 1 
ATOM 1039 N N   . LEU A 1 151 ? 36.180 15.559 4.173   1.00 10.00  ? 151 LEU A N   1 
ATOM 1040 C CA  . LEU A 1 151 ? 35.402 14.713 5.048   1.00 10.00  ? 151 LEU A CA  1 
ATOM 1041 C C   . LEU A 1 151 ? 36.355 13.828 5.834   1.00 10.00  ? 151 LEU A C   1 
ATOM 1042 O O   . LEU A 1 151 ? 36.434 13.910 7.054   1.00 10.00  ? 151 LEU A O   1 
ATOM 1043 C CB  . LEU A 1 151 ? 34.433 13.876 4.215   1.00 10.00  ? 151 LEU A CB  1 
ATOM 1044 C CG  . LEU A 1 151 ? 33.113 13.479 4.872   1.00 10.00  ? 151 LEU A CG  1 
ATOM 1045 C CD1 . LEU A 1 151 ? 32.516 14.645 5.648   1.00 10.00  ? 151 LEU A CD1 1 
ATOM 1046 C CD2 . LEU A 1 151 ? 32.169 12.879 3.806   1.00 10.00  ? 151 LEU A CD2 1 
ATOM 1047 N N   . CYS A 1 152 ? 37.066 12.969 5.125   1.00 10.00  ? 152 CYS A N   1 
ATOM 1048 C CA  . CYS A 1 152 ? 38.020 12.097 5.758   1.00 10.00  ? 152 CYS A CA  1 
ATOM 1049 C C   . CYS A 1 152 ? 39.055 12.908 6.525   1.00 10.00  ? 152 CYS A C   1 
ATOM 1050 O O   . CYS A 1 152 ? 39.435 12.528 7.624   1.00 10.25  ? 152 CYS A O   1 
ATOM 1051 C CB  . CYS A 1 152 ? 38.698 11.220 4.716   1.00 10.25  ? 152 CYS A CB  1 
ATOM 1052 S SG  . CYS A 1 152 ? 39.494 12.096 3.360   1.00 10.25  ? 152 CYS A SG  1 
ATOM 1053 N N   . VAL A 1 153 ? 39.485 14.042 5.970   1.00 10.00  ? 153 VAL A N   1 
ATOM 1054 C CA  . VAL A 1 153 ? 40.489 14.876 6.624   1.00 10.00  ? 153 VAL A CA  1 
ATOM 1055 C C   . VAL A 1 153 ? 40.105 15.288 8.019   1.00 10.00  ? 153 VAL A C   1 
ATOM 1056 O O   . VAL A 1 153 ? 40.964 15.485 8.872   1.00 10.00  ? 153 VAL A O   1 
ATOM 1057 C CB  . VAL A 1 153 ? 40.757 16.143 5.867   1.00 10.00  ? 153 VAL A CB  1 
ATOM 1058 C CG1 . VAL A 1 153 ? 41.810 16.921 6.564   1.00 10.00  ? 153 VAL A CG1 1 
ATOM 1059 C CG2 . VAL A 1 153 ? 41.220 15.848 4.511   1.00 10.00  ? 153 VAL A CG2 1 
ATOM 1060 N N   . LEU A 1 154 ? 38.819 15.510 8.226   1.00 10.00  ? 154 LEU A N   1 
ATOM 1061 C CA  . LEU A 1 154 ? 38.344 15.901 9.527   1.00 10.00  ? 154 LEU A CA  1 
ATOM 1062 C C   . LEU A 1 154 ? 37.910 14.682 10.340  1.00 10.00  ? 154 LEU A C   1 
ATOM 1063 O O   . LEU A 1 154 ? 38.070 14.666 11.559  1.00 10.00  ? 154 LEU A O   1 
ATOM 1064 C CB  . LEU A 1 154 ? 37.211 16.912 9.371   1.00 10.00  ? 154 LEU A CB  1 
ATOM 1065 C CG  . LEU A 1 154 ? 36.555 17.436 10.646  1.00 10.00  ? 154 LEU A CG  1 
ATOM 1066 C CD1 . LEU A 1 154 ? 37.542 18.113 11.551  1.00 10.00  ? 154 LEU A CD1 1 
ATOM 1067 C CD2 . LEU A 1 154 ? 35.481 18.401 10.268  1.00 10.00  ? 154 LEU A CD2 1 
ATOM 1068 N N   . ALA A 1 155 ? 37.390 13.661 9.653   1.00 10.00  ? 155 ALA A N   1 
ATOM 1069 C CA  . ALA A 1 155 ? 36.926 12.446 10.306  1.00 10.00  ? 155 ALA A CA  1 
ATOM 1070 C C   . ALA A 1 155 ? 38.071 11.944 11.119  1.00 10.00  ? 155 ALA A C   1 
ATOM 1071 O O   . ALA A 1 155 ? 37.972 11.714 12.327  1.00 10.00  ? 155 ALA A O   1 
ATOM 1072 C CB  . ALA A 1 155 ? 36.563 11.398 9.281   1.00 10.00  ? 155 ALA A CB  1 
ATOM 1073 N N   . THR A 1 156 ? 39.158 11.730 10.394  1.00 10.00  ? 156 THR A N   1 
ATOM 1074 C CA  . THR A 1 156 ? 40.394 11.227 10.918  1.00 10.00  ? 156 THR A CA  1 
ATOM 1075 C C   . THR A 1 156 ? 40.826 11.916 12.187  1.00 10.00  ? 156 THR A C   1 
ATOM 1076 O O   . THR A 1 156 ? 41.465 11.290 13.063  1.00 10.00  ? 156 THR A O   1 
ATOM 1077 C CB  . THR A 1 156 ? 41.471 11.424 9.900   1.00 10.00  ? 156 THR A CB  1 
ATOM 1078 O OG1 . THR A 1 156 ? 41.040 10.935 8.626   1.00 10.00  ? 156 THR A OG1 1 
ATOM 1079 C CG2 . THR A 1 156 ? 42.616 10.641 10.296  1.00 10.00  ? 156 THR A CG2 1 
ATOM 1080 N N   . THR A 1 157 ? 40.407 13.170 12.327  1.00 10.00  ? 157 THR A N   1 
ATOM 1081 C CA  . THR A 1 157 ? 40.830 13.993 13.460  1.00 10.00  ? 157 THR A CA  1 
ATOM 1082 C C   . THR A 1 157 ? 40.062 14.095 14.791  1.00 10.00  ? 157 THR A C   1 
ATOM 1083 O O   . THR A 1 157 ? 40.648 14.398 15.829  1.00 10.00  ? 157 THR A O   1 
ATOM 1084 C CB  . THR A 1 157 ? 41.045 15.425 12.981  1.00 10.00  ? 157 THR A CB  1 
ATOM 1085 O OG1 . THR A 1 157 ? 39.796 15.969 12.599  1.00 10.00  ? 157 THR A OG1 1 
ATOM 1086 C CG2 . THR A 1 157 ? 41.959 15.418 11.773  1.00 10.00  ? 157 THR A CG2 1 
ATOM 1087 N N   . ASP A 1 158 ? 38.756 13.919 14.743  1.00 10.00  ? 158 ASP A N   1 
ATOM 1088 C CA  . ASP A 1 158 ? 37.885 14.026 15.903  1.00 10.00  ? 158 ASP A CA  1 
ATOM 1089 C C   . ASP A 1 158 ? 38.497 13.899 17.310  1.00 10.00  ? 158 ASP A C   1 
ATOM 1090 O O   . ASP A 1 158 ? 39.000 14.904 17.870  1.00 10.00  ? 158 ASP A O   1 
ATOM 1091 C CB  . ASP A 1 158 ? 36.662 13.131 15.677  1.00 10.00  ? 158 ASP A CB  1 
ATOM 1092 C CG  . ASP A 1 158 ? 35.784 13.657 14.538  1.00 10.00  ? 158 ASP A CG  1 
ATOM 1093 O OD1 . ASP A 1 158 ? 36.285 14.452 13.727  1.00 10.00  ? 158 ASP A OD1 1 
ATOM 1094 O OD2 . ASP A 1 158 ? 34.577 13.376 14.479  1.00 10.00  ? 158 ASP A OD2 1 
ATOM 1095 N N   . ARG A 1 159 ? 38.428 12.715 17.909  1.00 10.00  ? 159 ARG A N   1 
ATOM 1096 C CA  . ARG A 1 159 ? 38.971 12.566 19.248  1.00 10.00  ? 159 ARG A CA  1 
ATOM 1097 C C   . ARG A 1 159 ? 40.497 12.619 19.356  1.00 10.00  ? 159 ARG A C   1 
ATOM 1098 O O   . ARG A 1 159 ? 41.053 13.402 20.138  1.00 10.00  ? 159 ARG A O   1 
ATOM 1099 C CB  . ARG A 1 159 ? 38.522 11.248 19.861  1.00 10.00  ? 159 ARG A CB  1 
ATOM 1100 C CG  . ARG A 1 159 ? 37.055 11.027 19.956  1.00 10.00  ? 159 ARG A CG  1 
ATOM 1101 C CD  . ARG A 1 159 ? 36.738 9.564  19.713  1.00 10.00  ? 159 ARG A CD  1 
ATOM 1102 N NE  . ARG A 1 159 ? 36.767 9.255  18.288  1.00 10.00  ? 159 ARG A NE  1 
ATOM 1103 C CZ  . ARG A 1 159 ? 37.288 8.148  17.775  1.00 10.00  ? 159 ARG A CZ  1 
ATOM 1104 N NH1 . ARG A 1 159 ? 37.833 7.251  18.578  1.00 10.00  ? 159 ARG A NH1 1 
ATOM 1105 N NH2 . ARG A 1 159 ? 37.210 7.910  16.473  1.00 10.00  ? 159 ARG A NH2 1 
ATOM 1106 N N   . ARG A 1 160 ? 41.158 11.688 18.669  1.00 100.00 ? 160 ARG A N   1 
ATOM 1107 C CA  . ARG A 1 160 ? 42.616 11.540 18.706  1.00 100.00 ? 160 ARG A CA  1 
ATOM 1108 C C   . ARG A 1 160 ? 43.440 12.226 17.608  1.00 100.00 ? 160 ARG A C   1 
ATOM 1109 O O   . ARG A 1 160 ? 43.103 12.173 16.414  1.00 21.68  ? 160 ARG A O   1 
ATOM 1110 C CB  . ARG A 1 160 ? 42.977 10.046 18.781  1.00 21.68  ? 160 ARG A CB  1 
ATOM 1111 C CG  . ARG A 1 160 ? 44.461 9.809  19.001  1.00 21.68  ? 160 ARG A CG  1 
ATOM 1112 C CD  . ARG A 1 160 ? 44.769 8.377  19.339  1.00 21.68  ? 160 ARG A CD  1 
ATOM 1113 N NE  . ARG A 1 160 ? 46.164 8.231  19.739  1.00 21.68  ? 160 ARG A NE  1 
ATOM 1114 C CZ  . ARG A 1 160 ? 46.785 7.066  19.839  1.00 21.68  ? 160 ARG A CZ  1 
ATOM 1115 N NH1 . ARG A 1 160 ? 46.138 5.948  19.563  1.00 21.68  ? 160 ARG A NH1 1 
ATOM 1116 N NH2 . ARG A 1 160 ? 48.035 7.011  20.262  1.00 21.68  ? 160 ARG A NH2 1 
ATOM 1117 N N   . ARG A 1 161 ? 44.567 12.805 18.031  1.00 100.00 ? 161 ARG A N   1 
ATOM 1118 C CA  . ARG A 1 161 ? 45.470 13.511 17.120  1.00 100.00 ? 161 ARG A CA  1 
ATOM 1119 C C   . ARG A 1 161 ? 46.450 12.658 16.248  1.00 100.00 ? 161 ARG A C   1 
ATOM 1120 O O   . ARG A 1 161 ? 46.008 11.696 15.591  1.00 10.93  ? 161 ARG A O   1 
ATOM 1121 C CB  . ARG A 1 161 ? 46.182 14.669 17.835  1.00 10.93  ? 161 ARG A CB  1 
ATOM 1122 C CG  . ARG A 1 161 ? 45.228 15.739 18.353  1.00 10.93  ? 161 ARG A CG  1 
ATOM 1123 C CD  . ARG A 1 161 ? 45.829 16.448 19.554  1.00 10.93  ? 161 ARG A CD  1 
ATOM 1124 N NE  . ARG A 1 161 ? 45.301 17.808 19.680  1.00 10.93  ? 161 ARG A NE  1 
ATOM 1125 C CZ  . ARG A 1 161 ? 45.915 18.819 20.299  1.00 10.93  ? 161 ARG A CZ  1 
ATOM 1126 N NH1 . ARG A 1 161 ? 47.088 18.628 20.892  1.00 10.93  ? 161 ARG A NH1 1 
ATOM 1127 N NH2 . ARG A 1 161 ? 45.397 20.049 20.257  1.00 10.93  ? 161 ARG A NH2 1 
ATOM 1128 N N   . ARG A 1 162 ? 47.766 12.902 16.321  1.00 100.00 ? 162 ARG A N   1 
ATOM 1129 C CA  . ARG A 1 162 ? 48.694 12.219 15.396  1.00 100.00 ? 162 ARG A CA  1 
ATOM 1130 C C   . ARG A 1 162 ? 49.467 10.926 15.704  1.00 100.00 ? 162 ARG A C   1 
ATOM 1131 O O   . ARG A 1 162 ? 49.998 10.701 16.780  1.00 10.00  ? 162 ARG A O   1 
ATOM 1132 C CB  . ARG A 1 162 ? 49.539 13.273 14.694  1.00 10.00  ? 162 ARG A CB  1 
ATOM 1133 C CG  . ARG A 1 162 ? 48.672 14.053 13.687  1.00 10.00  ? 162 ARG A CG  1 
ATOM 1134 C CD  . ARG A 1 162 ? 49.126 13.814 12.274  1.00 10.00  ? 162 ARG A CD  1 
ATOM 1135 N NE  . ARG A 1 162 ? 48.088 14.118 11.298  1.00 10.00  ? 162 ARG A NE  1 
ATOM 1136 C CZ  . ARG A 1 162 ? 48.323 14.334 10.013  1.00 10.00  ? 162 ARG A CZ  1 
ATOM 1137 N NH1 . ARG A 1 162 ? 49.563 14.291 9.565   1.00 10.00  ? 162 ARG A NH1 1 
ATOM 1138 N NH2 . ARG A 1 162 ? 47.317 14.519 9.168   1.00 10.00  ? 162 ARG A NH2 1 
ATOM 1139 N N   . ASP A 1 163 ? 49.599 10.183 14.611  1.00 10.00  ? 163 ASP A N   1 
ATOM 1140 C CA  . ASP A 1 163 ? 50.142 8.834  14.447  1.00 10.00  ? 163 ASP A CA  1 
ATOM 1141 C C   . ASP A 1 163 ? 51.463 8.293  14.893  1.00 10.00  ? 163 ASP A C   1 
ATOM 1142 O O   . ASP A 1 163 ? 52.492 8.920  14.846  1.00 14.55  ? 163 ASP A O   1 
ATOM 1143 C CB  . ASP A 1 163 ? 49.880 8.354  12.996  1.00 14.55  ? 163 ASP A CB  1 
ATOM 1144 C CG  . ASP A 1 163 ? 50.731 9.109  11.924  1.00 14.55  ? 163 ASP A CG  1 
ATOM 1145 O OD1 . ASP A 1 163 ? 51.646 9.875  12.262  1.00 14.55  ? 163 ASP A OD1 1 
ATOM 1146 O OD2 . ASP A 1 163 ? 50.511 8.899  10.718  1.00 14.55  ? 163 ASP A OD2 1 
ATOM 1147 N N   . LEU A 1 164 ? 51.377 7.030  15.249  1.00 16.61  ? 164 LEU A N   1 
ATOM 1148 C CA  . LEU A 1 164 ? 52.470 6.208  15.708  1.00 16.61  ? 164 LEU A CA  1 
ATOM 1149 C C   . LEU A 1 164 ? 52.280 4.876  15.004  1.00 16.61  ? 164 LEU A C   1 
ATOM 1150 O O   . LEU A 1 164 ? 53.082 3.974  15.156  1.00 99.93  ? 164 LEU A O   1 
ATOM 1151 C CB  . LEU A 1 164 ? 52.375 6.010  17.221  1.00 99.93  ? 164 LEU A CB  1 
ATOM 1152 C CG  . LEU A 1 164 ? 52.677 7.248  18.049  1.00 99.93  ? 164 LEU A CG  1 
ATOM 1153 C CD1 . LEU A 1 164 ? 52.455 6.897  19.494  1.00 99.93  ? 164 LEU A CD1 1 
ATOM 1154 C CD2 . LEU A 1 164 ? 54.110 7.672  17.814  1.00 99.93  ? 164 LEU A CD2 1 
ATOM 1155 N N   . GLY A 1 165 ? 51.118 4.762  14.360  1.00 10.00  ? 165 GLY A N   1 
ATOM 1156 C CA  . GLY A 1 165 ? 50.729 3.603  13.563  1.00 10.00  ? 165 GLY A CA  1 
ATOM 1157 C C   . GLY A 1 165 ? 50.550 4.019  12.117  1.00 10.00  ? 165 GLY A C   1 
ATOM 1158 O O   . GLY A 1 165 ? 50.363 3.204  11.253  1.00 23.67  ? 165 GLY A O   1 
ATOM 1159 N N   . GLY A 1 166 ? 50.635 5.327  11.907  1.00 10.00  ? 166 GLY A N   1 
ATOM 1160 C CA  . GLY A 1 166 ? 50.592 6.013  10.647  1.00 10.00  ? 166 GLY A CA  1 
ATOM 1161 C C   . GLY A 1 166 ? 49.489 5.776  9.642   1.00 10.00  ? 166 GLY A C   1 
ATOM 1162 O O   . GLY A 1 166 ? 49.698 6.014  8.450   1.00 87.80  ? 166 GLY A O   1 
ATOM 1163 N N   . SER A 1 167 ? 48.340 5.294  10.115  1.00 10.00  ? 167 SER A N   1 
ATOM 1164 C CA  . SER A 1 167 ? 47.187 4.992  9.212   1.00 10.00  ? 167 SER A CA  1 
ATOM 1165 C C   . SER A 1 167 ? 46.651 6.196  8.467   1.00 10.00  ? 167 SER A C   1 
ATOM 1166 O O   . SER A 1 167 ? 46.764 6.236  7.235   1.00 10.00  ? 167 SER A O   1 
ATOM 1167 C CB  . SER A 1 167 ? 46.123 4.350  10.016  1.00 10.00  ? 167 SER A CB  1 
ATOM 1168 O OG  . SER A 1 167 ? 45.809 5.103  11.210  1.00 10.00  ? 167 SER A OG  1 
ATOM 1169 N N   . ALA A 1 168 ? 46.168 7.193  9.227   1.00 10.00  ? 168 ALA A N   1 
ATOM 1170 C CA  . ALA A 1 168 ? 45.589 8.378  8.643   1.00 10.00  ? 168 ALA A CA  1 
ATOM 1171 C C   . ALA A 1 168 ? 46.324 8.867  7.418   1.00 10.00  ? 168 ALA A C   1 
ATOM 1172 O O   . ALA A 1 168 ? 45.736 8.919  6.350   1.00 10.00  ? 168 ALA A O   1 
ATOM 1173 C CB  . ALA A 1 168 ? 45.430 9.477  9.660   1.00 10.00  ? 168 ALA A CB  1 
ATOM 1174 N N   . PRO A 1 169 ? 47.599 9.248  7.557   1.00 10.00  ? 169 PRO A N   1 
ATOM 1175 C CA  . PRO A 1 169 ? 48.282 9.716  6.373   1.00 10.00  ? 169 PRO A CA  1 
ATOM 1176 C C   . PRO A 1 169 ? 48.268 8.774  5.218   1.00 10.00  ? 169 PRO A C   1 
ATOM 1177 O O   . PRO A 1 169 ? 48.144 9.202  4.081   1.00 10.00  ? 169 PRO A O   1 
ATOM 1178 C CB  . PRO A 1 169 ? 49.673 9.957  6.885   1.00 10.00  ? 169 PRO A CB  1 
ATOM 1179 C CG  . PRO A 1 169 ? 49.394 10.588 8.130   1.00 10.00  ? 169 PRO A CG  1 
ATOM 1180 C CD  . PRO A 1 169 ? 48.406 9.593  8.733   1.00 10.00  ? 169 PRO A CD  1 
ATOM 1181 N N   . LEU A 1 170 ? 48.480 7.503  5.482   1.00 10.00  ? 170 LEU A N   1 
ATOM 1182 C CA  . LEU A 1 170 ? 48.430 6.584  4.380   1.00 10.00  ? 170 LEU A CA  1 
ATOM 1183 C C   . LEU A 1 170 ? 47.016 6.704  3.861   1.00 10.00  ? 170 LEU A C   1 
ATOM 1184 O O   . LEU A 1 170 ? 46.789 6.783  2.659   1.00 10.00  ? 170 LEU A O   1 
ATOM 1185 C CB  . LEU A 1 170 ? 48.719 5.153  4.813   1.00 10.00  ? 170 LEU A CB  1 
ATOM 1186 C CG  . LEU A 1 170 ? 47.977 4.363  5.871   1.00 10.00  ? 170 LEU A CG  1 
ATOM 1187 C CD1 . LEU A 1 170 ? 47.065 3.369  5.209   1.00 10.00  ? 170 LEU A CD1 1 
ATOM 1188 C CD2 . LEU A 1 170 ? 49.017 3.737  6.838   1.00 10.00  ? 170 LEU A CD2 1 
ATOM 1189 N N   . ALA A 1 171 ? 46.070 6.733  4.787   1.00 10.00  ? 171 ALA A N   1 
ATOM 1190 C CA  . ALA A 1 171 ? 44.679 6.830  4.417   1.00 10.00  ? 171 ALA A CA  1 
ATOM 1191 C C   . ALA A 1 171 ? 44.500 8.028  3.534   1.00 10.00  ? 171 ALA A C   1 
ATOM 1192 O O   . ALA A 1 171 ? 44.406 7.894  2.318   1.00 10.00  ? 171 ALA A O   1 
ATOM 1193 C CB  . ALA A 1 171 ? 43.801 6.947  5.640   1.00 10.00  ? 171 ALA A CB  1 
ATOM 1194 N N   . ILE A 1 172 ? 44.488 9.203  4.149   1.00 91.00  ? 172 ILE A N   1 
ATOM 1195 C CA  . ILE A 1 172 ? 44.271 10.443 3.432   1.00 91.00  ? 172 ILE A CA  1 
ATOM 1196 C C   . ILE A 1 172 ? 44.899 10.456 2.055   1.00 91.00  ? 172 ILE A C   1 
ATOM 1197 O O   . ILE A 1 172 ? 44.230 10.761 1.079   1.00 10.00  ? 172 ILE A O   1 
ATOM 1198 C CB  . ILE A 1 172 ? 44.772 11.661 4.234   1.00 10.00  ? 172 ILE A CB  1 
ATOM 1199 C CG1 . ILE A 1 172 ? 44.147 11.683 5.621   1.00 10.00  ? 172 ILE A CG1 1 
ATOM 1200 C CG2 . ILE A 1 172 ? 44.409 12.935 3.528   1.00 10.00  ? 172 ILE A CG2 1 
ATOM 1201 C CD1 . ILE A 1 172 ? 44.707 12.749 6.483   1.00 10.00  ? 172 ILE A CD1 1 
ATOM 1202 N N   . GLY A 1 173 ? 46.167 10.084 1.973   1.00 10.00  ? 173 GLY A N   1 
ATOM 1203 C CA  . GLY A 1 173 ? 46.838 10.108 0.694   1.00 10.00  ? 173 GLY A CA  1 
ATOM 1204 C C   . GLY A 1 173 ? 46.109 9.379  -0.405  1.00 10.00  ? 173 GLY A C   1 
ATOM 1205 O O   . GLY A 1 173 ? 45.872 9.918  -1.488  1.00 10.00  ? 173 GLY A O   1 
ATOM 1206 N N   . LEU A 1 174 ? 45.804 8.122  -0.142  1.00 10.00  ? 174 LEU A N   1 
ATOM 1207 C CA  . LEU A 1 174 ? 45.121 7.291  -1.114  1.00 10.00  ? 174 LEU A CA  1 
ATOM 1208 C C   . LEU A 1 174 ? 43.690 7.782  -1.298  1.00 10.00  ? 174 LEU A C   1 
ATOM 1209 O O   . LEU A 1 174 ? 43.091 7.558  -2.346  1.00 10.00  ? 174 LEU A O   1 
ATOM 1210 C CB  . LEU A 1 174 ? 45.164 5.841  -0.655  1.00 10.00  ? 174 LEU A CB  1 
ATOM 1211 C CG  . LEU A 1 174 ? 46.458 5.491  0.082   1.00 10.00  ? 174 LEU A CG  1 
ATOM 1212 C CD1 . LEU A 1 174 ? 46.303 4.206  0.843   1.00 10.00  ? 174 LEU A CD1 1 
ATOM 1213 C CD2 . LEU A 1 174 ? 47.615 5.440  -0.863  1.00 10.00  ? 174 LEU A CD2 1 
ATOM 1214 N N   . SER A 1 175 ? 43.135 8.406  -0.259  1.00 10.00  ? 175 SER A N   1 
ATOM 1215 C CA  . SER A 1 175 ? 41.788 8.963  -0.307  1.00 10.00  ? 175 SER A CA  1 
ATOM 1216 C C   . SER A 1 175 ? 41.831 10.001 -1.404  1.00 10.00  ? 175 SER A C   1 
ATOM 1217 O O   . SER A 1 175 ? 41.086 9.942  -2.373  1.00 10.00  ? 175 SER A O   1 
ATOM 1218 C CB  . SER A 1 175 ? 41.453 9.625  1.030   1.00 10.00  ? 175 SER A CB  1 
ATOM 1219 O OG  . SER A 1 175 ? 40.496 10.652 0.893   1.00 10.00  ? 175 SER A OG  1 
ATOM 1220 N N   . VAL A 1 176 ? 42.776 10.916 -1.264  1.00 10.00  ? 176 VAL A N   1 
ATOM 1221 C CA  . VAL A 1 176 ? 42.994 11.988 -2.218  1.00 10.00  ? 176 VAL A CA  1 
ATOM 1222 C C   . VAL A 1 176 ? 43.234 11.388 -3.582  1.00 10.00  ? 176 VAL A C   1 
ATOM 1223 O O   . VAL A 1 176 ? 42.881 11.975 -4.596  1.00 10.00  ? 176 VAL A O   1 
ATOM 1224 C CB  . VAL A 1 176 ? 44.232 12.793 -1.858  1.00 10.00  ? 176 VAL A CB  1 
ATOM 1225 C CG1 . VAL A 1 176 ? 44.367 13.938 -2.778  1.00 10.00  ? 176 VAL A CG1 1 
ATOM 1226 C CG2 . VAL A 1 176 ? 44.157 13.273 -0.437  1.00 10.00  ? 176 VAL A CG2 1 
ATOM 1227 N N   . ALA A 1 177 ? 43.874 10.231 -3.601  1.00 10.00  ? 177 ALA A N   1 
ATOM 1228 C CA  . ALA A 1 177 ? 44.155 9.566  -4.848  1.00 10.00  ? 177 ALA A CA  1 
ATOM 1229 C C   . ALA A 1 177 ? 42.857 9.311  -5.565  1.00 10.00  ? 177 ALA A C   1 
ATOM 1230 O O   . ALA A 1 177 ? 42.739 9.516  -6.765  1.00 10.00  ? 177 ALA A O   1 
ATOM 1231 C CB  . ALA A 1 177 ? 44.887 8.268  -4.600  1.00 10.00  ? 177 ALA A CB  1 
ATOM 1232 N N   . LEU A 1 178 ? 41.864 8.889  -4.809  1.00 10.00  ? 178 LEU A N   1 
ATOM 1233 C CA  . LEU A 1 178 ? 40.570 8.593  -5.389  1.00 10.00  ? 178 LEU A CA  1 
ATOM 1234 C C   . LEU A 1 178 ? 40.067 9.752  -6.200  1.00 10.00  ? 178 LEU A C   1 
ATOM 1235 O O   . LEU A 1 178 ? 39.521 9.573  -7.284  1.00 10.00  ? 178 LEU A O   1 
ATOM 1236 C CB  . LEU A 1 178 ? 39.565 8.284  -4.300  1.00 10.00  ? 178 LEU A CB  1 
ATOM 1237 C CG  . LEU A 1 178 ? 38.159 7.942  -4.743  1.00 10.00  ? 178 LEU A CG  1 
ATOM 1238 C CD1 . LEU A 1 178 ? 38.147 6.814  -5.741  1.00 10.00  ? 178 LEU A CD1 1 
ATOM 1239 C CD2 . LEU A 1 178 ? 37.410 7.592  -3.510  1.00 10.00  ? 178 LEU A CD2 1 
ATOM 1240 N N   . GLY A 1 179 ? 40.206 10.936 -5.633  1.00 10.00  ? 179 GLY A N   1 
ATOM 1241 C CA  . GLY A 1 179 ? 39.748 12.113 -6.318  1.00 10.00  ? 179 GLY A CA  1 
ATOM 1242 C C   . GLY A 1 179 ? 40.271 12.091 -7.729  1.00 10.00  ? 179 GLY A C   1 
ATOM 1243 O O   . GLY A 1 179 ? 39.489 12.084 -8.672  1.00 52.70  ? 179 GLY A O   1 
ATOM 1244 N N   . HIS A 1 180 ? 41.575 11.917 -7.866  1.00 10.00  ? 180 HIS A N   1 
ATOM 1245 C CA  . HIS A 1 180 ? 42.195 11.944 -9.173  1.00 10.00  ? 180 HIS A CA  1 
ATOM 1246 C C   . HIS A 1 180 ? 41.829 10.907 -10.213 1.00 10.00  ? 180 HIS A C   1 
ATOM 1247 O O   . HIS A 1 180 ? 41.750 11.244 -11.388 1.00 10.00  ? 180 HIS A O   1 
ATOM 1248 C CB  . HIS A 1 180 ? 43.707 11.956 -9.050  1.00 10.00  ? 180 HIS A CB  1 
ATOM 1249 C CG  . HIS A 1 180 ? 44.232 12.834 -7.955  1.00 10.00  ? 180 HIS A CG  1 
ATOM 1250 N ND1 . HIS A 1 180 ? 44.269 12.410 -6.649  1.00 10.00  ? 180 HIS A ND1 1 
ATOM 1251 C CD2 . HIS A 1 180 ? 44.840 14.025 -7.999  1.00 10.00  ? 180 HIS A CD2 1 
ATOM 1252 C CE1 . HIS A 1 180 ? 44.906 13.317 -5.926  1.00 10.00  ? 180 HIS A CE1 1 
ATOM 1253 N NE2 . HIS A 1 180 ? 45.265 14.308 -6.712  1.00 10.00  ? 180 HIS A NE2 1 
ATOM 1254 N N   . LEU A 1 181 ? 41.739 9.646  -9.824  1.00 10.00  ? 181 LEU A N   1 
ATOM 1255 C CA  . LEU A 1 181 ? 41.428 8.610  -10.797 1.00 10.00  ? 181 LEU A CA  1 
ATOM 1256 C C   . LEU A 1 181 ? 40.338 9.137  -11.711 1.00 10.00  ? 181 LEU A C   1 
ATOM 1257 O O   . LEU A 1 181 ? 40.431 9.064  -12.936 1.00 10.00  ? 181 LEU A O   1 
ATOM 1258 C CB  . LEU A 1 181 ? 40.890 7.365  -10.105 1.00 10.00  ? 181 LEU A CB  1 
ATOM 1259 C CG  . LEU A 1 181 ? 41.225 7.149  -8.636  1.00 10.00  ? 181 LEU A CG  1 
ATOM 1260 C CD1 . LEU A 1 181 ? 40.468 5.946  -8.127  1.00 10.00  ? 181 LEU A CD1 1 
ATOM 1261 C CD2 . LEU A 1 181 ? 42.686 6.947  -8.450  1.00 10.00  ? 181 LEU A CD2 1 
ATOM 1262 N N   . LEU A 1 182 ? 39.325 9.719  -11.064 1.00 34.54  ? 182 LEU A N   1 
ATOM 1263 C CA  . LEU A 1 182 ? 38.146 10.310 -11.680 1.00 34.54  ? 182 LEU A CA  1 
ATOM 1264 C C   . LEU A 1 182 ? 38.412 11.751 -12.117 1.00 34.54  ? 182 LEU A C   1 
ATOM 1265 O O   . LEU A 1 182 ? 38.329 12.066 -13.324 1.00 22.12  ? 182 LEU A O   1 
ATOM 1266 C CB  . LEU A 1 182 ? 37.011 10.367 -10.667 1.00 22.12  ? 182 LEU A CB  1 
ATOM 1267 C CG  . LEU A 1 182 ? 35.854 11.210 -11.193 1.00 22.12  ? 182 LEU A CG  1 
ATOM 1268 C CD1 . LEU A 1 182 ? 35.363 10.677 -12.541 1.00 22.12  ? 182 LEU A CD1 1 
ATOM 1269 C CD2 . LEU A 1 182 ? 34.752 11.360 -10.179 1.00 22.12  ? 182 LEU A CD2 1 
ATOM 1270 N N   . ALA A 1 183 ? 38.652 12.632 -11.129 1.00 10.00  ? 183 ALA A N   1 
ATOM 1271 C CA  . ALA A 1 183 ? 38.956 14.017 -11.373 1.00 10.00  ? 183 ALA A CA  1 
ATOM 1272 C C   . ALA A 1 183 ? 39.625 14.257 -12.680 1.00 10.00  ? 183 ALA A C   1 
ATOM 1273 O O   . ALA A 1 183 ? 39.275 15.148 -13.397 1.00 10.00  ? 183 ALA A O   1 
ATOM 1274 C CB  . ALA A 1 183 ? 39.827 14.526 -10.208 1.00 10.00  ? 183 ALA A CB  1 
ATOM 1275 N N   . ILE A 1 184 ? 40.617 13.438 -12.935 1.00 10.00  ? 184 ILE A N   1 
ATOM 1276 C CA  . ILE A 1 184 ? 41.434 13.517 -14.125 1.00 10.00  ? 184 ILE A CA  1 
ATOM 1277 C C   . ILE A 1 184 ? 40.839 13.720 -15.557 1.00 10.00  ? 184 ILE A C   1 
ATOM 1278 O O   . ILE A 1 184 ? 40.940 14.792 -16.114 1.00 10.00  ? 184 ILE A O   1 
ATOM 1279 C CB  . ILE A 1 184 ? 42.633 12.377 -14.092 1.00 10.00  ? 184 ILE A CB  1 
ATOM 1280 C CG1 . ILE A 1 184 ? 43.979 13.042 -14.333 1.00 10.00  ? 184 ILE A CG1 1 
ATOM 1281 C CG2 . ILE A 1 184 ? 42.423 11.251 -15.090 1.00 10.00  ? 184 ILE A CG2 1 
ATOM 1282 C CD1 . ILE A 1 184 ? 44.334 14.048 -13.337 1.00 10.00  ? 184 ILE A CD1 1 
ATOM 1283 N N   . ASP A 1 185 ? 40.246 12.708 -16.156 1.00 10.00  ? 185 ASP A N   1 
ATOM 1284 C CA  . ASP A 1 185 ? 39.829 12.887 -17.529 1.00 10.00  ? 185 ASP A CA  1 
ATOM 1285 C C   . ASP A 1 185 ? 39.126 14.149 -17.982 1.00 10.00  ? 185 ASP A C   1 
ATOM 1286 O O   . ASP A 1 185 ? 39.662 14.870 -18.849 1.00 29.46  ? 185 ASP A O   1 
ATOM 1287 C CB  . ASP A 1 185 ? 39.084 11.690 -18.088 1.00 29.46  ? 185 ASP A CB  1 
ATOM 1288 C CG  . ASP A 1 185 ? 39.077 11.699 -19.627 1.00 29.46  ? 185 ASP A CG  1 
ATOM 1289 O OD1 . ASP A 1 185 ? 39.734 12.556 -20.271 1.00 29.46  ? 185 ASP A OD1 1 
ATOM 1290 O OD2 . ASP A 1 185 ? 38.444 10.832 -20.237 1.00 29.46  ? 185 ASP A OD2 1 
ATOM 1291 N N   . TYR A 1 186 ? 37.900 14.380 -17.514 1.00 79.30  ? 186 TYR A N   1 
ATOM 1292 C CA  . TYR A 1 186 ? 37.138 15.543 -17.970 1.00 79.30  ? 186 TYR A CA  1 
ATOM 1293 C C   . TYR A 1 186 ? 37.929 16.842 -18.113 1.00 79.30  ? 186 TYR A C   1 
ATOM 1294 O O   . TYR A 1 186 ? 37.989 17.452 -19.184 1.00 99.78  ? 186 TYR A O   1 
ATOM 1295 C CB  . TYR A 1 186 ? 35.928 15.741 -17.085 1.00 99.78  ? 186 TYR A CB  1 
ATOM 1296 C CG  . TYR A 1 186 ? 35.096 14.511 -16.946 1.00 99.78  ? 186 TYR A CG  1 
ATOM 1297 C CD1 . TYR A 1 186 ? 35.473 13.493 -16.085 1.00 99.78  ? 186 TYR A CD1 1 
ATOM 1298 C CD2 . TYR A 1 186 ? 33.929 14.352 -17.677 1.00 99.78  ? 186 TYR A CD2 1 
ATOM 1299 C CE1 . TYR A 1 186 ? 34.697 12.351 -15.933 1.00 99.78  ? 186 TYR A CE1 1 
ATOM 1300 C CE2 . TYR A 1 186 ? 33.139 13.212 -17.528 1.00 99.78  ? 186 TYR A CE2 1 
ATOM 1301 C CZ  . TYR A 1 186 ? 33.534 12.211 -16.658 1.00 99.78  ? 186 TYR A CZ  1 
ATOM 1302 O OH  . TYR A 1 186 ? 32.732 11.110 -16.470 1.00 99.78  ? 186 TYR A OH  1 
ATOM 1303 N N   . THR A 1 187 ? 38.489 17.271 -17.003 1.00 83.78  ? 187 THR A N   1 
ATOM 1304 C CA  . THR A 1 187 ? 39.325 18.435 -16.910 1.00 83.78  ? 187 THR A CA  1 
ATOM 1305 C C   . THR A 1 187 ? 40.266 17.956 -15.784 1.00 83.78  ? 187 THR A C   1 
ATOM 1306 O O   . THR A 1 187 ? 39.754 17.535 -14.756 1.00 100.00 ? 187 THR A O   1 
ATOM 1307 C CB  . THR A 1 187 ? 38.487 19.694 -16.436 1.00 100.00 ? 187 THR A CB  1 
ATOM 1308 O OG1 . THR A 1 187 ? 37.720 19.405 -15.260 1.00 100.00 ? 187 THR A OG1 1 
ATOM 1309 C CG2 . THR A 1 187 ? 37.547 20.220 -17.523 1.00 100.00 ? 187 THR A CG2 1 
ATOM 1310 N N   . GLY A 1 188 ? 41.581 17.889 -16.025 1.00 10.00  ? 188 GLY A N   1 
ATOM 1311 C CA  . GLY A 1 188 ? 42.525 17.466 -14.992 1.00 10.00  ? 188 GLY A CA  1 
ATOM 1312 C C   . GLY A 1 188 ? 42.121 17.612 -13.519 1.00 10.00  ? 188 GLY A C   1 
ATOM 1313 O O   . GLY A 1 188 ? 41.268 18.386 -13.162 1.00 30.53  ? 188 GLY A O   1 
ATOM 1314 N N   . CYS A 1 189 ? 42.740 16.786 -12.678 1.00 22.65  ? 189 CYS A N   1 
ATOM 1315 C CA  . CYS A 1 189 ? 42.505 16.653 -11.231 1.00 22.65  ? 189 CYS A CA  1 
ATOM 1316 C C   . CYS A 1 189 ? 42.333 17.998 -10.525 1.00 22.65  ? 189 CYS A C   1 
ATOM 1317 O O   . CYS A 1 189 ? 43.259 18.852 -10.553 1.00 35.11  ? 189 CYS A O   1 
ATOM 1318 C CB  . CYS A 1 189 ? 43.699 15.934 -10.581 1.00 35.11  ? 189 CYS A CB  1 
ATOM 1319 S SG  . CYS A 1 189 ? 45.022 16.972 -10.082 1.00 35.11  ? 189 CYS A SG  1 
ATOM 1320 N N   . GLY A 1 190 ? 41.227 18.136 -9.806  1.00 10.00  ? 190 GLY A N   1 
ATOM 1321 C CA  . GLY A 1 190 ? 41.017 19.383 -9.112  1.00 10.00  ? 190 GLY A CA  1 
ATOM 1322 C C   . GLY A 1 190 ? 40.455 19.210 -7.709  1.00 10.00  ? 190 GLY A C   1 
ATOM 1323 O O   . GLY A 1 190 ? 39.302 19.212 -7.527  1.00 10.00  ? 190 GLY A O   1 
ATOM 1324 N N   . ILE A 1 191 ? 41.320 19.259 -6.713  1.00 100.00 ? 191 ILE A N   1 
ATOM 1325 C CA  . ILE A 1 191 ? 40.978 19.112 -5.290  1.00 100.00 ? 191 ILE A CA  1 
ATOM 1326 C C   . ILE A 1 191 ? 41.855 20.135 -4.532  1.00 100.00 ? 191 ILE A C   1 
ATOM 1327 O O   . ILE A 1 191 ? 41.825 20.211 -3.298  1.00 10.00  ? 191 ILE A O   1 
ATOM 1328 C CB  . ILE A 1 191 ? 41.310 17.607 -4.887  1.00 10.00  ? 191 ILE A CB  1 
ATOM 1329 C CG1 . ILE A 1 191 ? 40.993 17.306 -3.416  1.00 10.00  ? 191 ILE A CG1 1 
ATOM 1330 C CG2 . ILE A 1 191 ? 42.784 17.286 -5.267  1.00 10.00  ? 191 ILE A CG2 1 
ATOM 1331 C CD1 . ILE A 1 191 ? 41.526 15.987 -2.889  1.00 10.00  ? 191 ILE A CD1 1 
ATOM 1332 N N   . ASN A 1 192 ? 42.543 20.984 -5.293  1.00 34.80  ? 192 ASN A N   1 
ATOM 1333 C CA  . ASN A 1 192 ? 43.493 21.870 -4.648  1.00 34.80  ? 192 ASN A CA  1 
ATOM 1334 C C   . ASN A 1 192 ? 43.730 23.157 -5.405  1.00 34.80  ? 192 ASN A C   1 
ATOM 1335 O O   . ASN A 1 192 ? 43.898 23.162 -6.611  1.00 50.30  ? 192 ASN A O   1 
ATOM 1336 C CB  . ASN A 1 192 ? 44.784 21.057 -4.581  1.00 50.30  ? 192 ASN A CB  1 
ATOM 1337 C CG  . ASN A 1 192 ? 45.776 21.597 -3.608  1.00 50.30  ? 192 ASN A CG  1 
ATOM 1338 O OD1 . ASN A 1 192 ? 46.293 22.712 -3.755  1.00 50.30  ? 192 ASN A OD1 1 
ATOM 1339 N ND2 . ASN A 1 192 ? 46.059 20.792 -2.606  1.00 50.30  ? 192 ASN A ND2 1 
ATOM 1340 N N   . PRO A 1 193 ? 43.583 24.297 -4.728  1.00 10.00  ? 193 PRO A N   1 
ATOM 1341 C CA  . PRO A 1 193 ? 43.783 25.619 -5.275  1.00 10.00  ? 193 PRO A CA  1 
ATOM 1342 C C   . PRO A 1 193 ? 45.164 25.864 -5.844  1.00 10.00  ? 193 PRO A C   1 
ATOM 1343 O O   . PRO A 1 193 ? 45.295 26.232 -7.007  1.00 10.00  ? 193 PRO A O   1 
ATOM 1344 C CB  . PRO A 1 193 ? 43.529 26.502 -4.066  1.00 10.00  ? 193 PRO A CB  1 
ATOM 1345 C CG  . PRO A 1 193 ? 42.419 25.784 -3.457  1.00 10.00  ? 193 PRO A CG  1 
ATOM 1346 C CD  . PRO A 1 193 ? 42.959 24.404 -3.419  1.00 10.00  ? 193 PRO A CD  1 
ATOM 1347 N N   . ALA A 1 194 ? 46.190 25.644 -5.028  1.00 10.00  ? 194 ALA A N   1 
ATOM 1348 C CA  . ALA A 1 194 ? 47.559 25.832 -5.453  1.00 10.00  ? 194 ALA A CA  1 
ATOM 1349 C C   . ALA A 1 194 ? 47.830 25.205 -6.812  1.00 10.00  ? 194 ALA A C   1 
ATOM 1350 O O   . ALA A 1 194 ? 48.308 25.886 -7.725  1.00 10.00  ? 194 ALA A O   1 
ATOM 1351 C CB  . ALA A 1 194 ? 48.514 25.286 -4.414  1.00 10.00  ? 194 ALA A CB  1 
ATOM 1352 N N   . ARG A 1 195 ? 47.543 23.912 -6.945  1.00 10.00  ? 195 ARG A N   1 
ATOM 1353 C CA  . ARG A 1 195 ? 47.788 23.214 -8.197  1.00 10.00  ? 195 ARG A CA  1 
ATOM 1354 C C   . ARG A 1 195 ? 47.403 24.053 -9.416  1.00 10.00  ? 195 ARG A C   1 
ATOM 1355 O O   . ARG A 1 195 ? 48.083 23.996 -10.435 1.00 99.82  ? 195 ARG A O   1 
ATOM 1356 C CB  . ARG A 1 195 ? 47.131 21.817 -8.202  1.00 99.82  ? 195 ARG A CB  1 
ATOM 1357 C CG  . ARG A 1 195 ? 46.114 21.515 -9.320  1.00 99.82  ? 195 ARG A CG  1 
ATOM 1358 C CD  . ARG A 1 195 ? 44.796 22.189 -8.970  1.00 99.82  ? 195 ARG A CD  1 
ATOM 1359 N NE  . ARG A 1 195 ? 43.528 21.601 -9.502  1.00 99.82  ? 195 ARG A NE  1 
ATOM 1360 C CZ  . ARG A 1 195 ? 42.329 22.119 -9.180  1.00 99.82  ? 195 ARG A CZ  1 
ATOM 1361 N NH1 . ARG A 1 195 ? 42.324 23.164 -8.370  1.00 99.82  ? 195 ARG A NH1 1 
ATOM 1362 N NH2 . ARG A 1 195 ? 41.209 21.676 -9.632  1.00 99.82  ? 195 ARG A NH2 1 
ATOM 1363 N N   . SER A 1 196 ? 46.412 24.927 -9.282  1.00 10.00  ? 196 SER A N   1 
ATOM 1364 C CA  . SER A 1 196 ? 45.949 25.728 -10.408 1.00 10.00  ? 196 SER A CA  1 
ATOM 1365 C C   . SER A 1 196 ? 46.931 26.850 -10.724 1.00 10.00  ? 196 SER A C   1 
ATOM 1366 O O   . SER A 1 196 ? 47.465 26.890 -11.848 1.00 98.25  ? 196 SER A O   1 
ATOM 1367 C CB  . SER A 1 196 ? 44.558 26.299 -10.123 1.00 98.25  ? 196 SER A CB  1 
ATOM 1368 O OG  . SER A 1 196 ? 43.601 25.263 -9.981  1.00 98.25  ? 196 SER A OG  1 
ATOM 1369 N N   . PHE A 1 197 ? 47.151 27.833 -9.847  1.00 10.00  ? 197 PHE A N   1 
ATOM 1370 C CA  . PHE A 1 197 ? 48.044 28.953 -10.165 1.00 10.00  ? 197 PHE A CA  1 
ATOM 1371 C C   . PHE A 1 197 ? 49.277 28.521 -10.938 1.00 10.00  ? 197 PHE A C   1 
ATOM 1372 O O   . PHE A 1 197 ? 49.494 28.968 -12.062 1.00 10.00  ? 197 PHE A O   1 
ATOM 1373 C CB  . PHE A 1 197 ? 48.476 29.715 -8.904  1.00 10.00  ? 197 PHE A CB  1 
ATOM 1374 C CG  . PHE A 1 197 ? 48.085 31.178 -8.918  1.00 10.00  ? 197 PHE A CG  1 
ATOM 1375 C CD1 . PHE A 1 197 ? 48.885 32.125 -9.547  1.00 10.00  ? 197 PHE A CD1 1 
ATOM 1376 C CD2 . PHE A 1 197 ? 46.877 31.599 -8.355  1.00 10.00  ? 197 PHE A CD2 1 
ATOM 1377 C CE1 . PHE A 1 197 ? 48.480 33.462 -9.606  1.00 10.00  ? 197 PHE A CE1 1 
ATOM 1378 C CE2 . PHE A 1 197 ? 46.476 32.930 -8.416  1.00 10.00  ? 197 PHE A CE2 1 
ATOM 1379 C CZ  . PHE A 1 197 ? 47.273 33.853 -9.044  1.00 10.00  ? 197 PHE A CZ  1 
ATOM 1380 N N   . GLY A 1 198 ? 50.085 27.672 -10.311 1.00 10.00  ? 198 GLY A N   1 
ATOM 1381 C CA  . GLY A 1 198 ? 51.307 27.185 -10.928 1.00 10.00  ? 198 GLY A CA  1 
ATOM 1382 C C   . GLY A 1 198 ? 51.148 26.810 -12.388 1.00 10.00  ? 198 GLY A C   1 
ATOM 1383 O O   . GLY A 1 198 ? 52.018 27.077 -13.226 1.00 10.00  ? 198 GLY A O   1 
ATOM 1384 N N   . SER A 1 199 ? 50.026 26.201 -12.712 1.00 10.00  ? 199 SER A N   1 
ATOM 1385 C CA  . SER A 1 199 ? 49.809 25.806 -14.079 1.00 10.00  ? 199 SER A CA  1 
ATOM 1386 C C   . SER A 1 199 ? 49.475 27.004 -14.933 1.00 10.00  ? 199 SER A C   1 
ATOM 1387 O O   . SER A 1 199 ? 49.988 27.159 -16.054 1.00 10.00  ? 199 SER A O   1 
ATOM 1388 C CB  . SER A 1 199 ? 48.713 24.741 -14.150 1.00 10.00  ? 199 SER A CB  1 
ATOM 1389 O OG  . SER A 1 199 ? 47.507 25.163 -13.532 1.00 10.00  ? 199 SER A OG  1 
ATOM 1390 N N   . ALA A 1 200 ? 48.653 27.878 -14.373 1.00 10.00  ? 200 ALA A N   1 
ATOM 1391 C CA  . ALA A 1 200 ? 48.165 29.055 -15.055 1.00 10.00  ? 200 ALA A CA  1 
ATOM 1392 C C   . ALA A 1 200 ? 49.204 30.125 -15.316 1.00 10.00  ? 200 ALA A C   1 
ATOM 1393 O O   . ALA A 1 200 ? 49.059 30.935 -16.237 1.00 67.42  ? 200 ALA A O   1 
ATOM 1394 C CB  . ALA A 1 200 ? 47.036 29.671 -14.241 1.00 67.42  ? 200 ALA A CB  1 
ATOM 1395 N N   . VAL A 1 201 ? 50.143 30.242 -14.384 1.00 10.00  ? 201 VAL A N   1 
ATOM 1396 C CA  . VAL A 1 201 ? 51.214 31.223 -14.424 1.00 10.00  ? 201 VAL A CA  1 
ATOM 1397 C C   . VAL A 1 201 ? 51.708 31.541 -15.825 1.00 10.00  ? 201 VAL A C   1 
ATOM 1398 O O   . VAL A 1 201 ? 52.231 32.624 -16.053 1.00 10.00  ? 201 VAL A O   1 
ATOM 1399 C CB  . VAL A 1 201 ? 52.343 30.851 -13.433 1.00 10.00  ? 201 VAL A CB  1 
ATOM 1400 C CG1 . VAL A 1 201 ? 53.537 31.781 -13.556 1.00 10.00  ? 201 VAL A CG1 1 
ATOM 1401 C CG2 . VAL A 1 201 ? 51.785 30.954 -12.028 1.00 10.00  ? 201 VAL A CG2 1 
ATOM 1402 N N   . ILE A 1 202 ? 51.494 30.652 -16.780 1.00 10.00  ? 202 ILE A N   1 
ATOM 1403 C CA  . ILE A 1 202 ? 51.882 30.951 -18.140 1.00 10.00  ? 202 ILE A CA  1 
ATOM 1404 C C   . ILE A 1 202 ? 50.780 31.641 -18.953 1.00 10.00  ? 202 ILE A C   1 
ATOM 1405 O O   . ILE A 1 202 ? 50.886 32.841 -19.252 1.00 10.00  ? 202 ILE A O   1 
ATOM 1406 C CB  . ILE A 1 202 ? 52.297 29.716 -18.792 1.00 10.00  ? 202 ILE A CB  1 
ATOM 1407 C CG1 . ILE A 1 202 ? 53.496 29.147 -18.043 1.00 10.00  ? 202 ILE A CG1 1 
ATOM 1408 C CG2 . ILE A 1 202 ? 52.610 29.998 -20.205 1.00 10.00  ? 202 ILE A CG2 1 
ATOM 1409 C CD1 . ILE A 1 202 ? 54.824 29.865 -18.262 1.00 10.00  ? 202 ILE A CD1 1 
ATOM 1410 N N   . THR A 1 203 ? 49.783 30.865 -19.402 1.00 60.83  ? 203 THR A N   1 
ATOM 1411 C CA  . THR A 1 203 ? 48.617 31.365 -20.182 1.00 60.83  ? 203 THR A CA  1 
ATOM 1412 C C   . THR A 1 203 ? 47.334 30.617 -19.754 1.00 60.83  ? 203 THR A C   1 
ATOM 1413 O O   . THR A 1 203 ? 47.075 29.493 -20.193 1.00 10.00  ? 203 THR A O   1 
ATOM 1414 C CB  . THR A 1 203 ? 48.794 31.217 -21.740 1.00 10.00  ? 203 THR A CB  1 
ATOM 1415 O OG1 . THR A 1 203 ? 49.598 30.071 -22.034 1.00 10.00  ? 203 THR A OG1 1 
ATOM 1416 C CG2 . THR A 1 203 ? 49.445 32.425 -22.330 1.00 10.00  ? 203 THR A CG2 1 
ATOM 1417 N N   . HIS A 1 204 ? 46.555 31.238 -18.874 1.00 10.00  ? 204 HIS A N   1 
ATOM 1418 C CA  . HIS A 1 204 ? 45.338 30.631 -18.352 1.00 10.00  ? 204 HIS A CA  1 
ATOM 1419 C C   . HIS A 1 204 ? 44.030 31.156 -18.909 1.00 10.00  ? 204 HIS A C   1 
ATOM 1420 O O   . HIS A 1 204 ? 43.483 32.124 -18.401 1.00 10.06  ? 204 HIS A O   1 
ATOM 1421 C CB  . HIS A 1 204 ? 45.308 30.762 -16.830 1.00 10.06  ? 204 HIS A CB  1 
ATOM 1422 C CG  . HIS A 1 204 ? 45.653 32.139 -16.300 1.00 10.06  ? 204 HIS A CG  1 
ATOM 1423 N ND1 . HIS A 1 204 ? 44.757 33.178 -16.334 1.00 10.06  ? 204 HIS A ND1 1 
ATOM 1424 C CD2 . HIS A 1 204 ? 46.817 32.648 -15.851 1.00 10.06  ? 204 HIS A CD2 1 
ATOM 1425 C CE1 . HIS A 1 204 ? 45.363 34.291 -15.934 1.00 10.06  ? 204 HIS A CE1 1 
ATOM 1426 N NE2 . HIS A 1 204 ? 46.610 33.996 -15.636 1.00 10.06  ? 204 HIS A NE2 1 
ATOM 1427 N N   . ASN A 1 205 ? 43.466 30.440 -19.866 1.00 10.00  ? 205 ASN A N   1 
ATOM 1428 C CA  . ASN A 1 205 ? 42.233 30.866 -20.502 1.00 10.00  ? 205 ASN A CA  1 
ATOM 1429 C C   . ASN A 1 205 ? 40.853 30.611 -19.902 1.00 10.00  ? 205 ASN A C   1 
ATOM 1430 O O   . ASN A 1 205 ? 39.865 31.144 -20.422 1.00 10.00  ? 205 ASN A O   1 
ATOM 1431 C CB  . ASN A 1 205 ? 42.216 30.390 -21.942 1.00 10.00  ? 205 ASN A CB  1 
ATOM 1432 C CG  . ASN A 1 205 ? 42.854 31.370 -22.867 1.00 10.00  ? 205 ASN A CG  1 
ATOM 1433 O OD1 . ASN A 1 205 ? 43.361 32.409 -22.439 1.00 10.00  ? 205 ASN A OD1 1 
ATOM 1434 N ND2 . ASN A 1 205 ? 42.821 31.066 -24.156 1.00 10.00  ? 205 ASN A ND2 1 
ATOM 1435 N N   . PHE A 1 206 ? 40.732 29.849 -18.824 1.00 10.00  ? 206 PHE A N   1 
ATOM 1436 C CA  . PHE A 1 206 ? 39.386 29.610 -18.337 1.00 10.00  ? 206 PHE A CA  1 
ATOM 1437 C C   . PHE A 1 206 ? 38.940 30.252 -17.058 1.00 10.00  ? 206 PHE A C   1 
ATOM 1438 O O   . PHE A 1 206 ? 39.634 30.211 -16.045 1.00 10.00  ? 206 PHE A O   1 
ATOM 1439 C CB  . PHE A 1 206 ? 39.052 28.116 -18.325 1.00 10.00  ? 206 PHE A CB  1 
ATOM 1440 C CG  . PHE A 1 206 ? 38.369 27.641 -19.580 1.00 10.00  ? 206 PHE A CG  1 
ATOM 1441 C CD1 . PHE A 1 206 ? 37.034 27.946 -19.831 1.00 10.00  ? 206 PHE A CD1 1 
ATOM 1442 C CD2 . PHE A 1 206 ? 39.073 26.912 -20.530 1.00 10.00  ? 206 PHE A CD2 1 
ATOM 1443 C CE1 . PHE A 1 206 ? 36.415 27.531 -21.020 1.00 10.00  ? 206 PHE A CE1 1 
ATOM 1444 C CE2 . PHE A 1 206 ? 38.461 26.494 -21.722 1.00 10.00  ? 206 PHE A CE2 1 
ATOM 1445 C CZ  . PHE A 1 206 ? 37.133 26.805 -21.966 1.00 10.00  ? 206 PHE A CZ  1 
ATOM 1446 N N   . SER A 1 207 ? 37.755 30.858 -17.132 1.00 10.00  ? 207 SER A N   1 
ATOM 1447 C CA  . SER A 1 207 ? 37.086 31.476 -15.990 1.00 10.00  ? 207 SER A CA  1 
ATOM 1448 C C   . SER A 1 207 ? 36.905 30.353 -14.969 1.00 10.00  ? 207 SER A C   1 
ATOM 1449 O O   . SER A 1 207 ? 36.442 30.579 -13.858 1.00 10.00  ? 207 SER A O   1 
ATOM 1450 C CB  . SER A 1 207 ? 35.674 31.885 -16.405 1.00 10.00  ? 207 SER A CB  1 
ATOM 1451 O OG  . SER A 1 207 ? 34.953 30.707 -16.735 1.00 10.00  ? 207 SER A OG  1 
ATOM 1452 N N   . ASN A 1 208 ? 37.158 29.141 -15.462 1.00 38.34  ? 208 ASN A N   1 
ATOM 1453 C CA  . ASN A 1 208 ? 37.045 27.856 -14.800 1.00 38.34  ? 208 ASN A CA  1 
ATOM 1454 C C   . ASN A 1 208 ? 37.958 27.545 -13.619 1.00 38.34  ? 208 ASN A C   1 
ATOM 1455 O O   . ASN A 1 208 ? 37.494 27.376 -12.493 1.00 10.00  ? 208 ASN A O   1 
ATOM 1456 C CB  . ASN A 1 208 ? 37.235 26.773 -15.870 1.00 10.00  ? 208 ASN A CB  1 
ATOM 1457 C CG  . ASN A 1 208 ? 36.412 25.545 -15.593 1.00 10.00  ? 208 ASN A CG  1 
ATOM 1458 O OD1 . ASN A 1 208 ? 36.443 24.576 -16.337 1.00 10.00  ? 208 ASN A OD1 1 
ATOM 1459 N ND2 . ASN A 1 208 ? 35.655 25.580 -14.514 1.00 10.00  ? 208 ASN A ND2 1 
ATOM 1460 N N   . HIS A 1 209 ? 39.250 27.386 -13.881 1.00 54.90  ? 209 HIS A N   1 
ATOM 1461 C CA  . HIS A 1 209 ? 40.153 27.000 -12.821 1.00 54.90  ? 209 HIS A CA  1 
ATOM 1462 C C   . HIS A 1 209 ? 39.936 27.618 -11.437 1.00 54.90  ? 209 HIS A C   1 
ATOM 1463 O O   . HIS A 1 209 ? 40.553 27.166 -10.472 1.00 10.00  ? 209 HIS A O   1 
ATOM 1464 C CB  . HIS A 1 209 ? 41.612 27.046 -13.293 1.00 10.00  ? 209 HIS A CB  1 
ATOM 1465 C CG  . HIS A 1 209 ? 42.112 28.419 -13.598 1.00 10.00  ? 209 HIS A CG  1 
ATOM 1466 N ND1 . HIS A 1 209 ? 41.769 29.112 -14.727 1.00 10.00  ? 209 HIS A ND1 1 
ATOM 1467 C CD2 . HIS A 1 209 ? 42.959 29.221 -12.897 1.00 10.00  ? 209 HIS A CD2 1 
ATOM 1468 C CE1 . HIS A 1 209 ? 42.381 30.290 -14.722 1.00 10.00  ? 209 HIS A CE1 1 
ATOM 1469 N NE2 . HIS A 1 209 ? 43.100 30.372 -13.629 1.00 10.00  ? 209 HIS A NE2 1 
ATOM 1470 N N   . TRP A 1 210 ? 39.087 28.643 -11.326 1.00 10.00  ? 210 TRP A N   1 
ATOM 1471 C CA  . TRP A 1 210 ? 38.784 29.222 -10.021 1.00 10.00  ? 210 TRP A CA  1 
ATOM 1472 C C   . TRP A 1 210 ? 37.335 29.010 -9.676  1.00 10.00  ? 210 TRP A C   1 
ATOM 1473 O O   . TRP A 1 210 ? 36.942 29.057 -8.511  1.00 10.00  ? 210 TRP A O   1 
ATOM 1474 C CB  . TRP A 1 210 ? 39.176 30.688 -9.928  1.00 10.00  ? 210 TRP A CB  1 
ATOM 1475 C CG  . TRP A 1 210 ? 40.621 30.796 -9.753  1.00 10.00  ? 210 TRP A CG  1 
ATOM 1476 C CD1 . TRP A 1 210 ? 41.538 30.673 -10.727 1.00 10.00  ? 210 TRP A CD1 1 
ATOM 1477 C CD2 . TRP A 1 210 ? 41.355 30.786 -8.511  1.00 10.00  ? 210 TRP A CD2 1 
ATOM 1478 N NE1 . TRP A 1 210 ? 42.789 30.541 -10.188 1.00 10.00  ? 210 TRP A NE1 1 
ATOM 1479 C CE2 . TRP A 1 210 ? 42.704 30.607 -8.815  1.00 10.00  ? 210 TRP A CE2 1 
ATOM 1480 C CE3 . TRP A 1 210 ? 40.990 30.889 -7.161  1.00 10.00  ? 210 TRP A CE3 1 
ATOM 1481 C CZ2 . TRP A 1 210 ? 43.709 30.528 -7.837  1.00 10.00  ? 210 TRP A CZ2 1 
ATOM 1482 C CZ3 . TRP A 1 210 ? 41.999 30.802 -6.187  1.00 10.00  ? 210 TRP A CZ3 1 
ATOM 1483 C CH2 . TRP A 1 210 ? 43.327 30.624 -6.532  1.00 10.00  ? 210 TRP A CH2 1 
ATOM 1484 N N   . ILE A 1 211 ? 36.491 28.856 -10.688 1.00 10.12  ? 211 ILE A N   1 
ATOM 1485 C CA  . ILE A 1 211 ? 35.146 28.467 -10.349 1.00 10.12  ? 211 ILE A CA  1 
ATOM 1486 C C   . ILE A 1 211 ? 35.524 27.101 -9.701  1.00 10.12  ? 211 ILE A C   1 
ATOM 1487 O O   . ILE A 1 211 ? 34.732 26.506 -8.979  1.00 10.00  ? 211 ILE A O   1 
ATOM 1488 C CB  . ILE A 1 211 ? 34.204 28.313 -11.596 1.00 10.00  ? 211 ILE A CB  1 
ATOM 1489 C CG1 . ILE A 1 211 ? 33.891 29.679 -12.220 1.00 10.00  ? 211 ILE A CG1 1 
ATOM 1490 C CG2 . ILE A 1 211 ? 32.875 27.689 -11.179 1.00 10.00  ? 211 ILE A CG2 1 
ATOM 1491 C CD1 . ILE A 1 211 ? 33.070 29.588 -13.526 1.00 10.00  ? 211 ILE A CD1 1 
ATOM 1492 N N   . PHE A 1 212 ? 36.758 26.638 -9.976  1.00 23.93  ? 212 PHE A N   1 
ATOM 1493 C CA  . PHE A 1 212 ? 37.300 25.417 -9.408  1.00 23.93  ? 212 PHE A CA  1 
ATOM 1494 C C   . PHE A 1 212 ? 37.453 25.685 -7.922  1.00 23.93  ? 212 PHE A C   1 
ATOM 1495 O O   . PHE A 1 212 ? 36.945 24.939 -7.132  1.00 10.00  ? 212 PHE A O   1 
ATOM 1496 C CB  . PHE A 1 212 ? 38.699 25.112 -9.931  1.00 10.00  ? 212 PHE A CB  1 
ATOM 1497 C CG  . PHE A 1 212 ? 38.756 24.534 -11.314 1.00 10.00  ? 212 PHE A CG  1 
ATOM 1498 C CD1 . PHE A 1 212 ? 37.641 24.407 -12.123 1.00 10.00  ? 212 PHE A CD1 1 
ATOM 1499 C CD2 . PHE A 1 212 ? 39.970 24.166 -11.831 1.00 10.00  ? 212 PHE A CD2 1 
ATOM 1500 C CE1 . PHE A 1 212 ? 37.767 23.920 -13.437 1.00 10.00  ? 212 PHE A CE1 1 
ATOM 1501 C CE2 . PHE A 1 212 ? 40.090 23.693 -13.125 1.00 10.00  ? 212 PHE A CE2 1 
ATOM 1502 C CZ  . PHE A 1 212 ? 39.000 23.571 -13.926 1.00 10.00  ? 212 PHE A CZ  1 
ATOM 1503 N N   . TRP A 1 213 ? 38.147 26.767 -7.557  1.00 100.00 ? 213 TRP A N   1 
ATOM 1504 C CA  . TRP A 1 213 ? 38.339 27.093 -6.136  1.00 100.00 ? 213 TRP A CA  1 
ATOM 1505 C C   . TRP A 1 213 ? 37.015 27.126 -5.415  1.00 100.00 ? 213 TRP A C   1 
ATOM 1506 O O   . TRP A 1 213 ? 36.764 26.158 -4.715  1.00 10.43  ? 213 TRP A O   1 
ATOM 1507 C CB  . TRP A 1 213 ? 39.112 28.378 -5.878  1.00 10.43  ? 213 TRP A CB  1 
ATOM 1508 C CG  . TRP A 1 213 ? 39.430 28.785 -4.359  1.00 10.43  ? 213 TRP A CG  1 
ATOM 1509 C CD1 . TRP A 1 213 ? 40.113 29.892 -4.015  1.00 10.43  ? 213 TRP A CD1 1 
ATOM 1510 C CD2 . TRP A 1 213 ? 39.076 28.154 -3.090  1.00 10.43  ? 213 TRP A CD2 1 
ATOM 1511 N NE1 . TRP A 1 213 ? 40.215 30.023 -2.661  1.00 10.43  ? 213 TRP A NE1 1 
ATOM 1512 C CE2 . TRP A 1 213 ? 39.569 28.971 -2.065  1.00 10.43  ? 213 TRP A CE2 1 
ATOM 1513 C CE3 . TRP A 1 213 ? 38.373 26.983 -2.721  1.00 10.43  ? 213 TRP A CE3 1 
ATOM 1514 C CZ2 . TRP A 1 213 ? 39.442 28.672 -0.684  1.00 10.43  ? 213 TRP A CZ2 1 
ATOM 1515 C CZ3 . TRP A 1 213 ? 38.231 26.695 -1.343  1.00 10.43  ? 213 TRP A CZ3 1 
ATOM 1516 C CH2 . TRP A 1 213 ? 38.751 27.543 -0.350  1.00 10.43  ? 213 TRP A CH2 1 
ATOM 1517 N N   . VAL A 1 214 ? 36.173 28.153 -5.620  1.00 10.00  ? 214 VAL A N   1 
ATOM 1518 C CA  . VAL A 1 214 ? 34.856 28.224 -4.955  1.00 10.00  ? 214 VAL A CA  1 
ATOM 1519 C C   . VAL A 1 214 ? 34.202 26.829 -4.846  1.00 10.00  ? 214 VAL A C   1 
ATOM 1520 O O   . VAL A 1 214 ? 33.507 26.526 -3.870  1.00 43.30  ? 214 VAL A O   1 
ATOM 1521 C CB  . VAL A 1 214 ? 33.928 29.297 -5.672  1.00 43.30  ? 214 VAL A CB  1 
ATOM 1522 C CG1 . VAL A 1 214 ? 34.390 30.745 -5.306  1.00 43.30  ? 214 VAL A CG1 1 
ATOM 1523 C CG2 . VAL A 1 214 ? 34.017 29.135 -7.203  1.00 43.30  ? 214 VAL A CG2 1 
ATOM 1524 N N   . GLY A 1 215 ? 34.495 25.982 -5.831  1.00 95.36  ? 215 GLY A N   1 
ATOM 1525 C CA  . GLY A 1 215 ? 34.008 24.606 -5.836  1.00 95.36  ? 215 GLY A CA  1 
ATOM 1526 C C   . GLY A 1 215 ? 34.534 23.925 -4.575  1.00 95.36  ? 215 GLY A C   1 
ATOM 1527 O O   . GLY A 1 215 ? 33.733 23.669 -3.689  1.00 40.22  ? 215 GLY A O   1 
ATOM 1528 N N   . PRO A 1 216 ? 35.827 23.523 -4.501  1.00 11.68  ? 216 PRO A N   1 
ATOM 1529 C CA  . PRO A 1 216 ? 36.387 22.888 -3.311  1.00 11.68  ? 216 PRO A CA  1 
ATOM 1530 C C   . PRO A 1 216 ? 35.862 23.478 -2.020  1.00 11.68  ? 216 PRO A C   1 
ATOM 1531 O O   . PRO A 1 216 ? 35.489 22.742 -1.097  1.00 10.00  ? 216 PRO A O   1 
ATOM 1532 C CB  . PRO A 1 216 ? 37.869 23.148 -3.502  1.00 10.00  ? 216 PRO A CB  1 
ATOM 1533 C CG  . PRO A 1 216 ? 38.034 23.026 -5.029  1.00 10.00  ? 216 PRO A CG  1 
ATOM 1534 C CD  . PRO A 1 216 ? 36.633 23.070 -5.617  1.00 10.00  ? 216 PRO A CD  1 
ATOM 1535 N N   . PHE A 1 217 ? 35.819 24.808 -1.961  1.00 100.00 ? 217 PHE A N   1 
ATOM 1536 C CA  . PHE A 1 217 ? 35.304 25.476 -0.776  1.00 100.00 ? 217 PHE A CA  1 
ATOM 1537 C C   . PHE A 1 217 ? 33.915 24.972 -0.524  1.00 100.00 ? 217 PHE A C   1 
ATOM 1538 O O   . PHE A 1 217 ? 33.650 24.410 0.518   1.00 10.00  ? 217 PHE A O   1 
ATOM 1539 C CB  . PHE A 1 217 ? 35.188 27.006 -0.918  1.00 10.00  ? 217 PHE A CB  1 
ATOM 1540 C CG  . PHE A 1 217 ? 34.654 27.710 0.341   1.00 10.00  ? 217 PHE A CG  1 
ATOM 1541 C CD1 . PHE A 1 217 ? 35.507 27.970 1.409   1.00 10.00  ? 217 PHE A CD1 1 
ATOM 1542 C CD2 . PHE A 1 217 ? 33.300 28.069 0.478   1.00 10.00  ? 217 PHE A CD2 1 
ATOM 1543 C CE1 . PHE A 1 217 ? 35.031 28.557 2.607   1.00 10.00  ? 217 PHE A CE1 1 
ATOM 1544 C CE2 . PHE A 1 217 ? 32.821 28.661 1.686   1.00 10.00  ? 217 PHE A CE2 1 
ATOM 1545 C CZ  . PHE A 1 217 ? 33.692 28.898 2.742   1.00 10.00  ? 217 PHE A CZ  1 
ATOM 1546 N N   . ILE A 1 218 ? 33.022 25.241 -1.466  1.00 10.00  ? 218 ILE A N   1 
ATOM 1547 C CA  . ILE A 1 218 ? 31.650 24.829 -1.324  1.00 10.00  ? 218 ILE A CA  1 
ATOM 1548 C C   . ILE A 1 218 ? 31.491 23.313 -1.120  1.00 10.00  ? 218 ILE A C   1 
ATOM 1549 O O   . ILE A 1 218 ? 30.641 22.890 -0.344  1.00 27.34  ? 218 ILE A O   1 
ATOM 1550 C CB  . ILE A 1 218 ? 30.776 25.411 -2.456  1.00 27.34  ? 218 ILE A CB  1 
ATOM 1551 C CG1 . ILE A 1 218 ? 31.292 24.987 -3.830  1.00 27.34  ? 218 ILE A CG1 1 
ATOM 1552 C CG2 . ILE A 1 218 ? 30.795 26.953 -2.400  1.00 27.34  ? 218 ILE A CG2 1 
ATOM 1553 C CD1 . ILE A 1 218 ? 30.873 25.929 -4.958  1.00 27.34  ? 218 ILE A CD1 1 
ATOM 1554 N N   . GLY A 1 219 ? 32.316 22.507 -1.790  1.00 10.00  ? 219 GLY A N   1 
ATOM 1555 C CA  . GLY A 1 219 ? 32.267 21.062 -1.607  1.00 10.00  ? 219 GLY A CA  1 
ATOM 1556 C C   . GLY A 1 219 ? 32.594 20.827 -0.147  1.00 10.00  ? 219 GLY A C   1 
ATOM 1557 O O   . GLY A 1 219 ? 31.918 20.088 0.569   1.00 10.00  ? 219 GLY A O   1 
ATOM 1558 N N   . GLY A 1 220 ? 33.641 21.514 0.293   1.00 100.00 ? 220 GLY A N   1 
ATOM 1559 C CA  . GLY A 1 220 ? 34.077 21.444 1.668   1.00 100.00 ? 220 GLY A CA  1 
ATOM 1560 C C   . GLY A 1 220 ? 33.131 22.225 2.574   1.00 100.00 ? 220 GLY A C   1 
ATOM 1561 O O   . GLY A 1 220 ? 33.061 21.930 3.772   1.00 100.00 ? 220 GLY A O   1 
ATOM 1562 N N   . ALA A 1 221 ? 32.379 23.183 2.020   1.00 80.42  ? 221 ALA A N   1 
ATOM 1563 C CA  . ALA A 1 221 ? 31.448 23.998 2.798   1.00 80.42  ? 221 ALA A CA  1 
ATOM 1564 C C   . ALA A 1 221 ? 30.361 23.121 3.361   1.00 80.42  ? 221 ALA A C   1 
ATOM 1565 O O   . ALA A 1 221 ? 30.101 23.139 4.562   1.00 32.06  ? 221 ALA A O   1 
ATOM 1566 C CB  . ALA A 1 221 ? 30.840 25.094 1.939   1.00 32.06  ? 221 ALA A CB  1 
ATOM 1567 N N   . LEU A 1 222 ? 29.688 22.391 2.479   1.00 10.00  ? 222 LEU A N   1 
ATOM 1568 C CA  . LEU A 1 222 ? 28.639 21.506 2.913   1.00 10.00  ? 222 LEU A CA  1 
ATOM 1569 C C   . LEU A 1 222 ? 29.326 20.333 3.559   1.00 10.00  ? 222 LEU A C   1 
ATOM 1570 O O   . LEU A 1 222 ? 28.696 19.571 4.268   1.00 10.00  ? 222 LEU A O   1 
ATOM 1571 C CB  . LEU A 1 222 ? 27.790 21.050 1.725   1.00 10.00  ? 222 LEU A CB  1 
ATOM 1572 C CG  . LEU A 1 222 ? 26.822 22.065 1.100   1.00 10.00  ? 222 LEU A CG  1 
ATOM 1573 C CD1 . LEU A 1 222 ? 26.845 21.965 -0.418  1.00 10.00  ? 222 LEU A CD1 1 
ATOM 1574 C CD2 . LEU A 1 222 ? 25.404 21.854 1.641   1.00 10.00  ? 222 LEU A CD2 1 
ATOM 1575 N N   . ALA A 1 223 ? 30.624 20.195 3.329   1.00 10.00  ? 223 ALA A N   1 
ATOM 1576 C CA  . ALA A 1 223 ? 31.357 19.083 3.894   1.00 10.00  ? 223 ALA A CA  1 
ATOM 1577 C C   . ALA A 1 223 ? 31.455 19.098 5.398   1.00 10.00  ? 223 ALA A C   1 
ATOM 1578 O O   . ALA A 1 223 ? 31.330 18.051 6.029   1.00 10.00  ? 223 ALA A O   1 
ATOM 1579 C CB  . ALA A 1 223 ? 32.688 19.010 3.316   1.00 10.00  ? 223 ALA A CB  1 
ATOM 1580 N N   . VAL A 1 224 ? 31.740 20.263 5.976   1.00 10.00  ? 224 VAL A N   1 
ATOM 1581 C CA  . VAL A 1 224 ? 31.840 20.362 7.431   1.00 10.00  ? 224 VAL A CA  1 
ATOM 1582 C C   . VAL A 1 224 ? 30.463 20.574 8.005   1.00 10.00  ? 224 VAL A C   1 
ATOM 1583 O O   . VAL A 1 224 ? 30.227 20.273 9.174   1.00 10.00  ? 224 VAL A O   1 
ATOM 1584 C CB  . VAL A 1 224 ? 32.710 21.513 7.921   1.00 10.00  ? 224 VAL A CB  1 
ATOM 1585 C CG1 . VAL A 1 224 ? 32.880 21.426 9.441   1.00 10.00  ? 224 VAL A CG1 1 
ATOM 1586 C CG2 . VAL A 1 224 ? 34.064 21.477 7.248   1.00 10.00  ? 224 VAL A CG2 1 
ATOM 1587 N N   . LEU A 1 225 ? 29.560 21.120 7.188   1.00 100.00 ? 225 LEU A N   1 
ATOM 1588 C CA  . LEU A 1 225 ? 28.187 21.339 7.613   1.00 100.00 ? 225 LEU A CA  1 
ATOM 1589 C C   . LEU A 1 225 ? 27.543 19.983 7.800   1.00 100.00 ? 225 LEU A C   1 
ATOM 1590 O O   . LEU A 1 225 ? 26.688 19.823 8.673   1.00 10.00  ? 225 LEU A O   1 
ATOM 1591 C CB  . LEU A 1 225 ? 27.390 22.110 6.572   1.00 10.00  ? 225 LEU A CB  1 
ATOM 1592 C CG  . LEU A 1 225 ? 25.917 21.970 6.910   1.00 10.00  ? 225 LEU A CG  1 
ATOM 1593 C CD1 . LEU A 1 225 ? 25.632 22.816 8.147   1.00 10.00  ? 225 LEU A CD1 1 
ATOM 1594 C CD2 . LEU A 1 225 ? 25.055 22.335 5.713   1.00 10.00  ? 225 LEU A CD2 1 
ATOM 1595 N N   . ILE A 1 226 ? 27.874 19.039 6.916   1.00 10.33  ? 226 ILE A N   1 
ATOM 1596 C CA  . ILE A 1 226 ? 27.324 17.693 7.029   1.00 10.33  ? 226 ILE A CA  1 
ATOM 1597 C C   . ILE A 1 226 ? 28.104 16.858 8.005   1.00 10.33  ? 226 ILE A C   1 
ATOM 1598 O O   . ILE A 1 226 ? 27.634 15.819 8.467   1.00 10.00  ? 226 ILE A O   1 
ATOM 1599 C CB  . ILE A 1 226 ? 27.133 16.940 5.669   1.00 10.00  ? 226 ILE A CB  1 
ATOM 1600 C CG1 . ILE A 1 226 ? 28.449 16.556 5.006   1.00 10.00  ? 226 ILE A CG1 1 
ATOM 1601 C CG2 . ILE A 1 226 ? 26.310 17.795 4.712   1.00 10.00  ? 226 ILE A CG2 1 
ATOM 1602 C CD1 . ILE A 1 226 ? 28.230 16.060 3.545   1.00 10.00  ? 226 ILE A CD1 1 
ATOM 1603 N N   . TYR A 1 227 ? 29.341 17.244 8.240   1.00 10.00  ? 227 TYR A N   1 
ATOM 1604 C CA  . TYR A 1 227 ? 30.087 16.520 9.221   1.00 10.00  ? 227 TYR A CA  1 
ATOM 1605 C C   . TYR A 1 227 ? 29.730 17.067 10.606  1.00 10.00  ? 227 TYR A C   1 
ATOM 1606 O O   . TYR A 1 227 ? 29.929 16.366 11.593  1.00 10.00  ? 227 TYR A O   1 
ATOM 1607 C CB  . TYR A 1 227 ? 31.592 16.610 8.994   1.00 10.00  ? 227 TYR A CB  1 
ATOM 1608 C CG  . TYR A 1 227 ? 32.261 15.339 9.427   1.00 10.00  ? 227 TYR A CG  1 
ATOM 1609 C CD1 . TYR A 1 227 ? 32.382 14.288 8.554   1.00 10.00  ? 227 TYR A CD1 1 
ATOM 1610 C CD2 . TYR A 1 227 ? 32.704 15.157 10.726  1.00 10.00  ? 227 TYR A CD2 1 
ATOM 1611 C CE1 . TYR A 1 227 ? 32.885 13.074 8.944   1.00 10.00  ? 227 TYR A CE1 1 
ATOM 1612 C CE2 . TYR A 1 227 ? 33.218 13.930 11.141  1.00 10.00  ? 227 TYR A CE2 1 
ATOM 1613 C CZ  . TYR A 1 227 ? 33.325 12.900 10.234  1.00 10.00  ? 227 TYR A CZ  1 
ATOM 1614 O OH  . TYR A 1 227 ? 33.901 11.711 10.592  1.00 10.00  ? 227 TYR A OH  1 
ATOM 1615 N N   . ASP A 1 228 ? 29.216 18.299 10.707  1.00 10.00  ? 228 ASP A N   1 
ATOM 1616 C CA  . ASP A 1 228 ? 28.858 18.846 12.030  1.00 10.00  ? 228 ASP A CA  1 
ATOM 1617 C C   . ASP A 1 228 ? 27.578 18.204 12.546  1.00 10.00  ? 228 ASP A C   1 
ATOM 1618 O O   . ASP A 1 228 ? 27.561 17.594 13.616  1.00 10.00  ? 228 ASP A O   1 
ATOM 1619 C CB  . ASP A 1 228 ? 28.720 20.376 12.010  1.00 10.00  ? 228 ASP A CB  1 
ATOM 1620 C CG  . ASP A 1 228 ? 28.717 20.999 13.421  1.00 10.00  ? 228 ASP A CG  1 
ATOM 1621 O OD1 . ASP A 1 228 ? 28.867 20.277 14.426  1.00 10.00  ? 228 ASP A OD1 1 
ATOM 1622 O OD2 . ASP A 1 228 ? 28.596 22.240 13.530  1.00 10.00  ? 228 ASP A OD2 1 
ATOM 1623 N N   . PHE A 1 229 ? 26.487 18.345 11.812  1.00 10.00  ? 229 PHE A N   1 
ATOM 1624 C CA  . PHE A 1 229 ? 25.282 17.706 12.267  1.00 10.00  ? 229 PHE A CA  1 
ATOM 1625 C C   . PHE A 1 229 ? 25.502 16.198 12.482  1.00 10.00  ? 229 PHE A C   1 
ATOM 1626 O O   . PHE A 1 229 ? 24.670 15.582 13.120  1.00 10.00  ? 229 PHE A O   1 
ATOM 1627 C CB  . PHE A 1 229 ? 24.109 17.992 11.321  1.00 10.00  ? 229 PHE A CB  1 
ATOM 1628 C CG  . PHE A 1 229 ? 24.074 17.121 10.076  1.00 10.00  ? 229 PHE A CG  1 
ATOM 1629 C CD1 . PHE A 1 229 ? 23.774 15.770 10.160  1.00 10.00  ? 229 PHE A CD1 1 
ATOM 1630 C CD2 . PHE A 1 229 ? 24.294 17.661 8.816   1.00 10.00  ? 229 PHE A CD2 1 
ATOM 1631 C CE1 . PHE A 1 229 ? 23.712 14.992 9.037   1.00 10.00  ? 229 PHE A CE1 1 
ATOM 1632 C CE2 . PHE A 1 229 ? 24.226 16.864 7.677   1.00 10.00  ? 229 PHE A CE2 1 
ATOM 1633 C CZ  . PHE A 1 229 ? 23.932 15.543 7.796   1.00 10.00  ? 229 PHE A CZ  1 
ATOM 1634 N N   . ILE A 1 230 ? 26.577 15.576 11.976  1.00 10.00  ? 230 ILE A N   1 
ATOM 1635 C CA  . ILE A 1 230 ? 26.786 14.130 12.199  1.00 10.00  ? 230 ILE A CA  1 
ATOM 1636 C C   . ILE A 1 230 ? 26.561 13.786 13.668  1.00 10.00  ? 230 ILE A C   1 
ATOM 1637 O O   . ILE A 1 230 ? 25.966 12.772 13.971  1.00 10.00  ? 230 ILE A O   1 
ATOM 1638 C CB  . ILE A 1 230 ? 28.162 13.676 11.651  1.00 10.00  ? 230 ILE A CB  1 
ATOM 1639 C CG1 . ILE A 1 230 ? 28.099 13.438 10.147  1.00 10.00  ? 230 ILE A CG1 1 
ATOM 1640 C CG2 . ILE A 1 230 ? 28.578 12.418 12.224  1.00 10.00  ? 230 ILE A CG2 1 
ATOM 1641 C CD1 . ILE A 1 230 ? 27.057 12.514 9.735   1.00 10.00  ? 230 ILE A CD1 1 
ATOM 1642 N N   . LEU A 1 231 ? 27.167 14.540 14.560  1.00 10.00  ? 231 LEU A N   1 
ATOM 1643 C CA  . LEU A 1 231 ? 26.970 14.450 15.981  1.00 10.00  ? 231 LEU A CA  1 
ATOM 1644 C C   . LEU A 1 231 ? 27.664 15.587 16.648  1.00 10.00  ? 231 LEU A C   1 
ATOM 1645 O O   . LEU A 1 231 ? 28.894 15.723 16.697  1.00 100.00 ? 231 LEU A O   1 
ATOM 1646 C CB  . LEU A 1 231 ? 27.253 13.111 16.672  1.00 100.00 ? 231 LEU A CB  1 
ATOM 1647 C CG  . LEU A 1 231 ? 26.718 13.408 18.100  1.00 100.00 ? 231 LEU A CG  1 
ATOM 1648 C CD1 . LEU A 1 231 ? 25.296 13.997 18.031  1.00 100.00 ? 231 LEU A CD1 1 
ATOM 1649 C CD2 . LEU A 1 231 ? 26.764 12.259 19.092  1.00 100.00 ? 231 LEU A CD2 1 
ATOM 1650 N N   . ALA A 1 232 ? 26.778 16.375 17.207  1.00 10.00  ? 232 ALA A N   1 
ATOM 1651 C CA  . ALA A 1 232 ? 27.029 17.639 17.852  1.00 10.00  ? 232 ALA A CA  1 
ATOM 1652 C C   . ALA A 1 232 ? 28.176 18.032 18.804  1.00 10.00  ? 232 ALA A C   1 
ATOM 1653 O O   . ALA A 1 232 ? 28.188 17.650 19.978  1.00 10.35  ? 232 ALA A O   1 
ATOM 1654 C CB  . ALA A 1 232 ? 25.712 18.108 18.434  1.00 10.35  ? 232 ALA A CB  1 
ATOM 1655 N N   . PRO A 1 233 ? 29.147 18.840 18.287  1.00 10.58  ? 233 PRO A N   1 
ATOM 1656 C CA  . PRO A 1 233 ? 30.299 19.355 19.026  1.00 10.58  ? 233 PRO A CA  1 
ATOM 1657 C C   . PRO A 1 233 ? 29.817 20.338 20.092  1.00 10.58  ? 233 PRO A C   1 
ATOM 1658 O O   . PRO A 1 233 ? 28.689 20.861 19.913  1.00 10.00  ? 233 PRO A O   1 
ATOM 1659 C CB  . PRO A 1 233 ? 31.081 20.097 17.943  1.00 10.00  ? 233 PRO A CB  1 
ATOM 1660 C CG  . PRO A 1 233 ? 31.004 19.199 16.858  1.00 10.00  ? 233 PRO A CG  1 
ATOM 1661 C CD  . PRO A 1 233 ? 29.490 18.864 16.848  1.00 10.00  ? 233 PRO A CD  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   GLU 4   4   ?   ?   ?   A . n 
A 1 5   PHE 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   ?   ?   ?   A . n 
A 1 7   LYS 7   7   ?   ?   ?   A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   LEU 9   9   9   LEU LEU A . n 
A 1 10  PHE 10  10  10  PHE PHE A . n 
A 1 11  TRP 11  11  11  TRP TRP A . n 
A 1 12  ARG 12  12  12  ARG ARG A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  VAL 14  14  14  VAL VAL A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  GLU 17  17  17  GLU GLU A . n 
A 1 18  PHE 18  18  18  PHE PHE A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  ALA 20  20  20  ALA ALA A . n 
A 1 21  THR 21  21  21  THR THR A . n 
A 1 22  THR 22  22  22  THR THR A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  PHE 24  24  24  PHE PHE A . n 
A 1 25  VAL 25  25  25  VAL VAL A . n 
A 1 26  PHE 26  26  26  PHE PHE A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  GLY 30  30  30  GLY GLY A . n 
A 1 31  SER 31  31  31  SER SER A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  TYR 37  37  37  TYR TYR A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  THR 44  44  44  THR THR A . n 
A 1 45  ALA 45  45  45  ALA ALA A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  GLN 47  47  47  GLN GLN A . n 
A 1 48  ASP 48  48  48  ASP ASP A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  VAL 50  50  50  VAL VAL A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  VAL 52  52  52  VAL VAL A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  PHE 56  56  56  PHE PHE A . n 
A 1 57  GLY 57  57  57  GLY GLY A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  SER 66  66  66  SER SER A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  GLY 68  68  68  GLY GLY A . n 
A 1 69  HIS 69  69  69  HIS HIS A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  HIS 74  74  74  HIS HIS A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  ALA 78  78  78  ALA ALA A . n 
A 1 79  VAL 79  79  79  VAL VAL A . n 
A 1 80  THR 80  80  80  THR THR A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LEU 83  83  83  LEU LEU A . n 
A 1 84  LEU 84  84  84  LEU LEU A . n 
A 1 85  LEU 85  85  85  LEU LEU A . n 
A 1 86  SER 86  86  86  SER SER A . n 
A 1 87  CYS 87  87  87  CYS CYS A . n 
A 1 88  GLN 88  88  88  GLN GLN A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  SER 90  90  90  SER SER A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  PHE 92  92  92  PHE PHE A . n 
A 1 93  ARG 93  93  93  ARG ARG A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  MET 96  96  96  MET MET A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 GLN 101 101 101 GLN GLN A . n 
A 1 102 CYS 102 102 102 CYS CYS A . n 
A 1 103 VAL 103 103 103 VAL VAL A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ILE 106 106 106 ILE ILE A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ILE 111 111 111 ILE ILE A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 SER 118 118 118 SER SER A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 GLY 121 121 121 GLY GLY A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 SER 123 123 123 SER SER A . n 
A 1 124 LEU 124 124 124 LEU LEU A . n 
A 1 125 GLY 125 125 125 GLY GLY A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 SER 135 135 135 SER SER A . n 
A 1 136 GLY 136 136 136 GLY GLY A . n 
A 1 137 GLN 137 137 137 GLN GLN A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 LEU 139 139 139 LEU LEU A . n 
A 1 140 GLY 140 140 140 GLY GLY A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 GLU 142 142 142 GLU GLU A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 THR 146 146 146 THR THR A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 VAL 153 153 153 VAL VAL A . n 
A 1 154 LEU 154 154 154 LEU LEU A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ARG 161 161 161 ARG ARG A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 SER 167 167 167 SER SER A . n 
A 1 168 ALA 168 168 168 ALA ALA A . n 
A 1 169 PRO 169 169 169 PRO PRO A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 GLY 173 173 173 GLY GLY A . n 
A 1 174 LEU 174 174 174 LEU LEU A . n 
A 1 175 SER 175 175 175 SER SER A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 HIS 180 180 180 HIS HIS A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ALA 183 183 183 ALA ALA A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 ASP 185 185 185 ASP ASP A . n 
A 1 186 TYR 186 186 186 TYR TYR A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 CYS 189 189 189 CYS CYS A . n 
A 1 190 GLY 190 190 190 GLY GLY A . n 
A 1 191 ILE 191 191 191 ILE ILE A . n 
A 1 192 ASN 192 192 192 ASN ASN A . n 
A 1 193 PRO 193 193 193 PRO PRO A . n 
A 1 194 ALA 194 194 194 ALA ALA A . n 
A 1 195 ARG 195 195 195 ARG ARG A . n 
A 1 196 SER 196 196 196 SER SER A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ILE 202 202 202 ILE ILE A . n 
A 1 203 THR 203 203 203 THR THR A . n 
A 1 204 HIS 204 204 204 HIS HIS A . n 
A 1 205 ASN 205 205 205 ASN ASN A . n 
A 1 206 PHE 206 206 206 PHE PHE A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASN 208 208 208 ASN ASN A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 TRP 213 213 213 TRP TRP A . n 
A 1 214 VAL 214 214 214 VAL VAL A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 PHE 217 217 217 PHE PHE A . n 
A 1 218 ILE 218 218 218 ILE ILE A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 ILE 226 226 226 ILE ILE A . n 
A 1 227 TYR 227 227 227 TYR TYR A . n 
A 1 228 ASP 228 228 228 ASP ASP A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 ILE 230 230 230 ILE ILE A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 PRO 233 233 233 PRO PRO A . n 
A 1 234 ARG 234 234 ?   ?   ?   A . n 
A 1 235 SER 235 235 ?   ?   ?   A . n 
A 1 236 SER 236 236 ?   ?   ?   A . n 
A 1 237 ASP 237 237 ?   ?   ?   A . n 
A 1 238 LEU 238 238 ?   ?   ?   A . n 
A 1 239 THR 239 239 ?   ?   ?   A . n 
A 1 240 ASP 240 240 ?   ?   ?   A . n 
A 1 241 ARG 241 241 ?   ?   ?   A . n 
A 1 242 VAL 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 VAL 244 244 ?   ?   ?   A . n 
A 1 245 TRP 245 245 ?   ?   ?   A . n 
A 1 246 THR 246 246 ?   ?   ?   A . n 
A 1 247 SER 247 247 ?   ?   ?   A . n 
A 1 248 GLY 248 248 ?   ?   ?   A . n 
A 1 249 GLN 249 249 ?   ?   ?   A . n 
A 1 250 VAL 250 250 ?   ?   ?   A . n 
A 1 251 GLU 251 251 ?   ?   ?   A . n 
A 1 252 GLU 252 252 ?   ?   ?   A . n 
A 1 253 TYR 253 253 ?   ?   ?   A . n 
A 1 254 ASP 254 254 ?   ?   ?   A . n 
A 1 255 LEU 255 255 ?   ?   ?   A . n 
A 1 256 ASP 256 256 ?   ?   ?   A . n 
A 1 257 ALA 257 257 ?   ?   ?   A . n 
A 1 258 ASP 258 258 ?   ?   ?   A . n 
A 1 259 ASP 259 259 ?   ?   ?   A . n 
A 1 260 ILE 260 260 ?   ?   ?   A . n 
A 1 261 ASN 261 261 ?   ?   ?   A . n 
A 1 262 SER 262 262 ?   ?   ?   A . n 
A 1 263 ARG 263 263 ?   ?   ?   A . n 
A 1 264 VAL 264 264 ?   ?   ?   A . n 
A 1 265 GLU 265 265 ?   ?   ?   A . n 
A 1 266 MET 266 266 ?   ?   ?   A . n 
A 1 267 LYS 267 267 ?   ?   ?   A . n 
A 1 268 PRO 268 268 ?   ?   ?   A . n 
A 1 269 LYS 269 269 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 12140 ? 
1 MORE         -96   ? 
1 'SSA (A^2)'  38710 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -x+1,-y,z      -1.0000000000 0.0000000000  0.0000000000 96.0000000000 0.0000000000  
-1.0000000000 0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_545 -y+1/2,x-1/2,z 0.0000000000  -1.0000000000 0.0000000000 48.0000000000 1.0000000000  
0.0000000000  0.0000000000 -48.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_555 y+1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 48.0000000000 -1.0000000000 
0.0000000000  0.0000000000 48.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2000-10-18 
2 'Structure model' 1 1 2008-04-27 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
LATLINE 'model building' .            ? 1 
X-PLOR  refinement       3.851        ? 2 
CCP4    'data scaling'   '(TRUNCATE)' ? 3 
LATLINE phasing          .            ? 4 
# 
_em_3d_reconstruction.entry_id                    1FQY 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_particles               . 
_em_3d_reconstruction.symmetry_type               . 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.resolution                  3.8 
_em_3d_reconstruction.resolution_method           'DIFFRACTION PATTERN/LAYERLINES' 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.name                 aquaporin 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.source               . 
_em_entity_assembly.type                 COMPLEX 
_em_entity_assembly.details              ? 
_em_entity_assembly.entity_id_list       ? 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                1FQY 
_em_image_scans.id                      1 
_em_image_scans.image_recording_id      1 
_em_image_scans.scanner_model           OTHER 
_em_image_scans.dimension_height        ? 
_em_image_scans.dimension_width         ? 
_em_image_scans.frames_per_image        ? 
_em_image_scans.sampling_size           ? 
_em_image_scans.citation_id             ? 
_em_image_scans.number_digital_images   ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.details                 ? 
# 
_em_imaging.entry_id                        1FQY 
_em_imaging.id                              1 
_em_imaging.specimen_id                     1 
_em_imaging.accelerating_voltage            300 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.mode                            DIFFRACTION 
_em_imaging.microscope_model                'JEOL 3000SFF' 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         HELIUM 
_em_imaging.details                         'diffraction patterns and images collected' 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.grid_material    MOLYBDENUM 
_em_sample_support.grid_mesh_size   ? 
_em_sample_support.grid_type        ? 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
# 
_em_experiment.entry_id                1FQY 
_em_experiment.id                      1 
_em_experiment.entity_assembly_id      1 
_em_experiment.aggregation_state       '2D ARRAY' 
_em_experiment.reconstruction_method   CRYSTALLOGRAPHY 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    17 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   CD2 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   TYR 
_pdbx_validate_close_contact.auth_seq_id_2    97 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.14 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A TYR 37  ? ? CA A TYR 37  ? ? C   A TYR 37  ? ? 138.77 111.00 27.77  2.70 N 
2 1 N  A ALA 45  ? ? CA A ALA 45  ? ? C   A ALA 45  ? ? 93.05  111.00 -17.95 2.70 N 
3 1 N  A ASN 49  ? ? CA A ASN 49  ? ? C   A ASN 49  ? ? 129.28 111.00 18.28  2.70 N 
4 1 N  A GLY 121 ? ? CA A GLY 121 ? ? C   A GLY 121 ? ? 96.03  113.10 -17.07 2.50 N 
5 1 N  A ASP 163 ? ? CA A ASP 163 ? ? C   A ASP 163 ? ? 128.89 111.00 17.89  2.70 N 
6 1 NE A ARG 195 ? ? CZ A ARG 195 ? ? NH1 A ARG 195 ? ? 117.02 120.30 -3.28  0.50 N 
7 1 NE A ARG 195 ? ? CZ A ARG 195 ? ? NH2 A ARG 195 ? ? 124.01 120.30 3.71   0.50 N 
8 1 CA A LEU 231 ? ? CB A LEU 231 ? ? CG  A LEU 231 ? ? 100.59 115.30 -14.71 2.30 N 
9 1 N  A ALA 232 ? ? CA A ALA 232 ? ? C   A ALA 232 ? ? 129.02 111.00 18.02  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 19  ? ? -62.90  -77.32  
2  1 ALA A 20  ? ? -29.63  -68.82  
3  1 PRO A 38  ? ? -48.55  159.31  
4  1 VAL A 39  ? ? -23.37  117.27  
5  1 ASN A 42  ? ? -135.46 -42.31  
6  1 GLN A 43  ? ? -140.60 -47.88  
7  1 GLN A 47  ? ? -29.92  126.93  
8  1 ASP A 48  ? ? -54.05  91.56   
9  1 ASN A 49  ? ? -36.80  -34.91  
10 1 HIS A 69  ? ? -103.13 -68.37  
11 1 ALA A 73  ? ? -134.46 -46.12  
12 1 HIS A 74  ? ? -53.08  -177.39 
13 1 LEU A 75  ? ? -146.51 18.96   
14 1 LEU A 85  ? ? -50.94  100.66  
15 1 SER A 86  ? ? 176.16  -162.40 
16 1 ARG A 93  ? ? -100.77 59.84   
17 1 ILE A 115 ? ? -79.80  -75.91  
18 1 THR A 116 ? ? -57.05  101.70  
19 1 SER A 117 ? ? -146.72 15.31   
20 1 ASN A 122 ? ? -92.59  56.88   
21 1 SER A 123 ? ? -24.78  128.43  
22 1 LEU A 124 ? ? -157.42 -58.44  
23 1 ARG A 126 ? ? -29.18  160.32  
24 1 ASN A 127 ? ? -48.41  104.47  
25 1 LEU A 129 ? ? -130.85 -91.25  
26 1 ALA A 130 ? ? -49.34  97.35   
27 1 ASP A 131 ? ? -124.17 -64.24  
28 1 SER A 135 ? ? -125.91 -79.99  
29 1 ASP A 158 ? ? -19.90  -97.40  
30 1 ARG A 161 ? ? -79.62  -123.97 
31 1 ALA A 171 ? ? -54.52  -77.12  
32 1 ALA A 183 ? ? -28.50  -46.82  
33 1 ILE A 184 ? ? -45.07  -75.07  
34 1 VAL A 201 ? ? -34.00  -22.19  
35 1 ILE A 202 ? ? -89.88  -76.98  
36 1 HIS A 209 ? ? -39.16  -11.40  
37 1 TRP A 213 ? ? -52.67  -73.30  
38 1 VAL A 214 ? ? -37.40  -31.50  
39 1 LEU A 231 ? ? -171.65 114.29  
40 1 ALA A 232 ? ? -41.64  106.08  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A GLU 4   ? A GLU 4   
5  1 Y 1 A PHE 5   ? A PHE 5   
6  1 Y 1 A LYS 6   ? A LYS 6   
7  1 Y 1 A LYS 7   ? A LYS 7   
8  1 Y 1 A ARG 234 ? A ARG 234 
9  1 Y 1 A SER 235 ? A SER 235 
10 1 Y 1 A SER 236 ? A SER 236 
11 1 Y 1 A ASP 237 ? A ASP 237 
12 1 Y 1 A LEU 238 ? A LEU 238 
13 1 Y 1 A THR 239 ? A THR 239 
14 1 Y 1 A ASP 240 ? A ASP 240 
15 1 Y 1 A ARG 241 ? A ARG 241 
16 1 Y 1 A VAL 242 ? A VAL 242 
17 1 Y 1 A LYS 243 ? A LYS 243 
18 1 Y 1 A VAL 244 ? A VAL 244 
19 1 Y 1 A TRP 245 ? A TRP 245 
20 1 Y 1 A THR 246 ? A THR 246 
21 1 Y 1 A SER 247 ? A SER 247 
22 1 Y 1 A GLY 248 ? A GLY 248 
23 1 Y 1 A GLN 249 ? A GLN 249 
24 1 Y 1 A VAL 250 ? A VAL 250 
25 1 Y 1 A GLU 251 ? A GLU 251 
26 1 Y 1 A GLU 252 ? A GLU 252 
27 1 Y 1 A TYR 253 ? A TYR 253 
28 1 Y 1 A ASP 254 ? A ASP 254 
29 1 Y 1 A LEU 255 ? A LEU 255 
30 1 Y 1 A ASP 256 ? A ASP 256 
31 1 Y 1 A ALA 257 ? A ALA 257 
32 1 Y 1 A ASP 258 ? A ASP 258 
33 1 Y 1 A ASP 259 ? A ASP 259 
34 1 Y 1 A ILE 260 ? A ILE 260 
35 1 Y 1 A ASN 261 ? A ASN 261 
36 1 Y 1 A SER 262 ? A SER 262 
37 1 Y 1 A ARG 263 ? A ARG 263 
38 1 Y 1 A VAL 264 ? A VAL 264 
39 1 Y 1 A GLU 265 ? A GLU 265 
40 1 Y 1 A MET 266 ? A MET 266 
41 1 Y 1 A LYS 267 ? A LYS 267 
42 1 Y 1 A PRO 268 ? A PRO 268 
43 1 Y 1 A LYS 269 ? A LYS 269 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
MET N    N 
MET CA   C 
MET C    C 
MET O    O 
MET CB   C 
MET CG   C 
MET SD   S 
MET CE   C 
MET OXT  O 
MET H    H 
MET HN2  H 
MET HA   H 
MET 1HB  H 
MET 2HB  H 
MET 1HG  H 
MET 2HG  H 
MET 1HE  H 
MET 2HE  H 
MET 3HE  H 
MET HXT  H 
ALA N    N 
ALA CA   C 
ALA C    C 
ALA O    O 
ALA CB   C 
ALA OXT  O 
ALA H    H 
ALA HN2  H 
ALA HA   H 
ALA 1HB  H 
ALA 2HB  H 
ALA 3HB  H 
ALA HXT  H 
SER N    N 
SER CA   C 
SER C    C 
SER O    O 
SER CB   C 
SER OG   O 
SER OXT  O 
SER H    H 
SER HN2  H 
SER HA   H 
SER 1HB  H 
SER 2HB  H 
SER HG   H 
SER HXT  H 
GLU N    N 
GLU CA   C 
GLU C    C 
GLU O    O 
GLU CB   C 
GLU CG   C 
GLU CD   C 
GLU OE1  O 
GLU OE2  O 
GLU OXT  O 
GLU H    H 
GLU HN2  H 
GLU HA   H 
GLU 1HB  H 
GLU 2HB  H 
GLU 1HG  H 
GLU 2HG  H 
GLU HE2  H 
GLU HXT  H 
PHE N    N 
PHE CA   C 
PHE C    C 
PHE O    O 
PHE CB   C 
PHE CG   C 
PHE CD1  C 
PHE CD2  C 
PHE CE1  C 
PHE CE2  C 
PHE CZ   C 
PHE OXT  O 
PHE H    H 
PHE HN2  H 
PHE HA   H 
PHE 1HB  H 
PHE 2HB  H 
PHE HD1  H 
PHE HD2  H 
PHE HE1  H 
PHE HE2  H 
PHE HZ   H 
PHE HXT  H 
LYS N    N 
LYS CA   C 
LYS C    C 
LYS O    O 
LYS CB   C 
LYS CG   C 
LYS CD   C 
LYS CE   C 
LYS NZ   N 
LYS OXT  O 
LYS H    H 
LYS HN2  H 
LYS HA   H 
LYS 1HB  H 
LYS 2HB  H 
LYS 1HG  H 
LYS 2HG  H 
LYS 1HD  H 
LYS 2HD  H 
LYS 1HE  H 
LYS 2HE  H 
LYS 1HZ  H 
LYS 2HZ  H 
LYS 3HZ  H 
LYS HXT  H 
LEU N    N 
LEU CA   C 
LEU C    C 
LEU O    O 
LEU CB   C 
LEU CG   C 
LEU CD1  C 
LEU CD2  C 
LEU OXT  O 
LEU H    H 
LEU HN2  H 
LEU HA   H 
LEU 1HB  H 
LEU 2HB  H 
LEU HG   H 
LEU 1HD1 H 
LEU 2HD1 H 
LEU 3HD1 H 
LEU 1HD2 H 
LEU 2HD2 H 
LEU 3HD2 H 
LEU HXT  H 
TRP N    N 
TRP CA   C 
TRP C    C 
TRP O    O 
TRP CB   C 
TRP CG   C 
TRP CD1  C 
TRP CD2  C 
TRP NE1  N 
TRP CE2  C 
TRP CE3  C 
TRP CZ2  C 
TRP CZ3  C 
TRP CH2  C 
TRP OXT  O 
TRP H    H 
TRP HN2  H 
TRP HA   H 
TRP 1HB  H 
TRP 2HB  H 
TRP HD1  H 
TRP HE1  H 
TRP HE3  H 
TRP HZ2  H 
TRP HZ3  H 
TRP HH2  H 
TRP HXT  H 
ARG N    N 
ARG CA   C 
ARG C    C 
ARG O    O 
ARG CB   C 
ARG CG   C 
ARG CD   C 
ARG NE   N 
ARG CZ   C 
ARG NH1  N 
ARG NH2  N 
ARG OXT  O 
ARG H    H 
ARG HN2  H 
ARG HA   H 
ARG 1HB  H 
ARG 2HB  H 
ARG 1HG  H 
ARG 2HG  H 
ARG 1HD  H 
ARG 2HD  H 
ARG HE   H 
ARG 1HH1 H 
ARG 2HH1 H 
ARG 1HH2 H 
ARG 2HH2 H 
ARG HXT  H 
VAL N    N 
VAL CA   C 
VAL C    C 
VAL O    O 
VAL CB   C 
VAL CG1  C 
VAL CG2  C 
VAL OXT  O 
VAL H    H 
VAL HN2  H 
VAL HA   H 
VAL HB   H 
VAL 1HG1 H 
VAL 2HG1 H 
VAL 3HG1 H 
VAL 1HG2 H 
VAL 2HG2 H 
VAL 3HG2 H 
VAL HXT  H 
THR N    N 
THR CA   C 
THR C    C 
THR O    O 
THR CB   C 
THR OG1  O 
THR CG2  C 
THR OXT  O 
THR H    H 
THR HN2  H 
THR HA   H 
THR HB   H 
THR HG1  H 
THR 1HG2 H 
THR 2HG2 H 
THR 3HG2 H 
THR HXT  H 
ILE N    N 
ILE CA   C 
ILE C    C 
ILE O    O 
ILE CB   C 
ILE CG1  C 
ILE CG2  C 
ILE CD1  C 
ILE OXT  O 
ILE H    H 
ILE HN2  H 
ILE HA   H 
ILE HB   H 
ILE 1HG1 H 
ILE 2HG1 H 
ILE 1HG2 H 
ILE 2HG2 H 
ILE 3HG2 H 
ILE 1HD1 H 
ILE 2HD1 H 
ILE 3HD1 H 
ILE HXT  H 
GLY N    N 
GLY CA   C 
GLY C    C 
GLY O    O 
GLY OXT  O 
GLY H    H 
GLY HN2  H 
GLY 1HA  H 
GLY 2HA  H 
GLY HXT  H 
TYR N    N 
TYR CA   C 
TYR C    C 
TYR O    O 
TYR CB   C 
TYR CG   C 
TYR CD1  C 
TYR CD2  C 
TYR CE1  C 
TYR CE2  C 
TYR CZ   C 
TYR OH   O 
TYR OXT  O 
TYR H    H 
TYR HN2  H 
TYR HA   H 
TYR 1HB  H 
TYR 2HB  H 
TYR HD1  H 
TYR HD2  H 
TYR HE1  H 
TYR HE2  H 
TYR HH   H 
TYR HXT  H 
PRO N    N 
PRO CA   C 
PRO C    C 
PRO O    O 
PRO CB   C 
PRO CG   C 
PRO CD   C 
PRO OXT  O 
PRO HT1  H 
PRO HT2  H 
PRO HA   H 
PRO 1HB  H 
PRO 2HB  H 
PRO 1HG  H 
PRO 2HG  H 
PRO 1HD  H 
PRO 2HD  H 
PRO HXT  H 
ASN N    N 
ASN CA   C 
ASN C    C 
ASN O    O 
ASN CB   C 
ASN CG   C 
ASN OD1  O 
ASN ND2  N 
ASN OXT  O 
ASN H    H 
ASN HN2  H 
ASN HA   H 
ASN 1HB  H 
ASN 2HB  H 
ASN 1HD2 H 
ASN 2HD2 H 
ASN HXT  H 
GLN N    N 
GLN CA   C 
GLN C    C 
GLN O    O 
GLN CB   C 
GLN CG   C 
GLN CD   C 
GLN OE1  O 
GLN NE2  N 
GLN OXT  O 
GLN H    H 
GLN HN2  H 
GLN HA   H 
GLN 1HB  H 
GLN 2HB  H 
GLN 1HG  H 
GLN 2HG  H 
GLN 1HE2 H 
GLN 2HE2 H 
GLN HXT  H 
ASP N    N 
ASP CA   C 
ASP C    C 
ASP O    O 
ASP CB   C 
ASP CG   C 
ASP OD1  O 
ASP OD2  O 
ASP OXT  O 
ASP H    H 
ASP HN2  H 
ASP HA   H 
ASP 1HB  H 
ASP 2HB  H 
ASP HD2  H 
ASP HXT  H 
HIS N    N 
HIS CA   C 
HIS C    C 
HIS O    O 
HIS CB   C 
HIS CG   C 
HIS ND1  N 
HIS CD2  C 
HIS CE1  C 
HIS NE2  N 
HIS OXT  O 
HIS H    H 
HIS HN2  H 
HIS HA   H 
HIS 1HB  H 
HIS 2HB  H 
HIS HD1  H 
HIS HD2  H 
HIS HE1  H 
HIS HE2  H 
HIS HXT  H 
CYS N    N 
CYS CA   C 
CYS C    C 
CYS O    O 
CYS CB   C 
CYS SG   S 
CYS OXT  O 
CYS H    H 
CYS HN2  H 
CYS HA   H 
CYS 1HB  H 
CYS 2HB  H 
CYS HG   H 
CYS HXT  H 
# 
_em_embedding.details       3% 
_em_embedding.id            1 
_em_embedding.material      trehalose 
_em_embedding.specimen_id   1 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.film_or_detector_model        'GENERIC FILM' 
_em_image_recording.avg_electron_dose_per_image   20 
_em_image_recording.average_exposure_time         ? 
_em_image_recording.details                       'digitized using LeafScan45 scanner (Scitex)' 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_real_images               ? 
_em_image_recording.detector_mode                 ? 
# 
_em_specimen.experiment_id           1 
_em_specimen.id                      1 
_em_specimen.embedding_applied       YES 
_em_specimen.shadowing_applied       NO 
_em_specimen.staining_applied        NO 
_em_specimen.vitrification_applied   YES 
_em_specimen.concentration           ? 
_em_specimen.details                 ? 
#