data_1FSK
# 
_entry.id   1FSK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1FSK         
RCSB  RCSB011866   
WWPDB D_1000011866 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1FSK 
_pdbx_database_status.recvd_initial_deposition_date   2000-09-11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Mirza, O.'      1 
'Henriksen, A.'  2 
'Ipsen, H.'      3 
'Larsen, J.'     4 
'Wissenbach, M.' 5 
'Spangfort, M.'  6 
'Gajhede, M.'    7 
# 
_citation.id                        primary 
_citation.title                     
;Dominant epitopes and allergic cross-reactivity: complex formation between a Fab fragment of a monoclonal murine IgG antibody and the major allergen from birch pollen Bet v 1.
;
_citation.journal_abbrev            J.Immunol. 
_citation.journal_volume            165 
_citation.page_first                331 
_citation.page_last                 338 
_citation.year                      2000 
_citation.journal_id_ASTM           JOIMA3 
_citation.country                   US 
_citation.journal_id_ISSN           0022-1767 
_citation.journal_id_CSD            0952 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   10861069 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Mirza, O.'       1 
primary 'Henriksen, A.'   2 
primary 'Ipsen, H.'       3 
primary 'Larsen, J.N.'    4 
primary 'Wissenbach, M.'  5 
primary 'Spangfort, M.D.' 6 
primary 'Gajhede, M.'     7 
# 
_cell.entry_id           1FSK 
_cell.length_a           91.653 
_cell.length_b           99.145 
_cell.length_c           108.905 
_cell.angle_alpha        105.70 
_cell.angle_beta         98.32 
_cell.angle_gamma        97.62 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1FSK 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     triclinic 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'MAJOR POLLEN ALLERGEN BET V 1-A'  17427.576 4 ? ? ? ? 
2 polymer man 'IMMUNOGLOBULIN KAPPA LIGHT CHAIN' 23730.113 4 ? ? ? ? 
3 polymer man 'ANTIBODY HEAVY CHAIN FAB'         23836.660 4 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BET V I-A, BETVI ALLERGEN'                       
2 'BV16 FAB-FRAGMENT, KAPPA MOPC21 CODING SEQUENCE' 
3 'HEAVY CHAIN OF THE MONOCLONAL ANTIBODY MST2'     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFK
YNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
;
;GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGLPFKYVKDRVDEVDHTNFK
YNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN
;
A,D,G,J ? 
2 'polypeptide(L)' no no 
;NIVLTQSPKSMSVSVGERVTLSCKASENVDTYVFWFQQKPDQSPKLLLYGPSNRYTGVPDRFTGSGSTTDFTLTISSVQA
EDLADYHCGQSYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;NIVLTQSPKSMSVSVGERVTLSCKASENVDTYVFWFQQKPDQSPKLLLYGPSNRYTGVPDRFTGSGSTTDFTLTISSVQA
EDLADYHCGQSYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
B,E,H,K ? 
3 'polypeptide(L)' no no 
;QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTNYNQKFKDKATLTVDKSSSTAY
MQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSVAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
;
;QVQLQQPGTELVRPGASVILSCKASGYTFTSYWINWVKQRPGQGLEWVGNIFPSDSYTNYNQKFKDKATLTVDKSSSTAY
MQVNSPTSEDSAVYYCTRGARDTWFAYWGQGTLVTVSVAKTTPPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWN
SGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
;
C,F,I,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   VAL n 
1 3   PHE n 
1 4   ASN n 
1 5   TYR n 
1 6   GLU n 
1 7   THR n 
1 8   GLU n 
1 9   THR n 
1 10  THR n 
1 11  SER n 
1 12  VAL n 
1 13  ILE n 
1 14  PRO n 
1 15  ALA n 
1 16  ALA n 
1 17  ARG n 
1 18  LEU n 
1 19  PHE n 
1 20  LYS n 
1 21  ALA n 
1 22  PHE n 
1 23  ILE n 
1 24  LEU n 
1 25  ASP n 
1 26  GLY n 
1 27  ASP n 
1 28  ASN n 
1 29  LEU n 
1 30  PHE n 
1 31  PRO n 
1 32  LYS n 
1 33  VAL n 
1 34  ALA n 
1 35  PRO n 
1 36  GLN n 
1 37  ALA n 
1 38  ILE n 
1 39  SER n 
1 40  SER n 
1 41  VAL n 
1 42  GLU n 
1 43  ASN n 
1 44  ILE n 
1 45  GLU n 
1 46  GLY n 
1 47  ASN n 
1 48  GLY n 
1 49  GLY n 
1 50  PRO n 
1 51  GLY n 
1 52  THR n 
1 53  ILE n 
1 54  LYS n 
1 55  LYS n 
1 56  ILE n 
1 57  SER n 
1 58  PHE n 
1 59  PRO n 
1 60  GLU n 
1 61  GLY n 
1 62  LEU n 
1 63  PRO n 
1 64  PHE n 
1 65  LYS n 
1 66  TYR n 
1 67  VAL n 
1 68  LYS n 
1 69  ASP n 
1 70  ARG n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  VAL n 
1 75  ASP n 
1 76  HIS n 
1 77  THR n 
1 78  ASN n 
1 79  PHE n 
1 80  LYS n 
1 81  TYR n 
1 82  ASN n 
1 83  TYR n 
1 84  SER n 
1 85  VAL n 
1 86  ILE n 
1 87  GLU n 
1 88  GLY n 
1 89  GLY n 
1 90  PRO n 
1 91  ILE n 
1 92  GLY n 
1 93  ASP n 
1 94  THR n 
1 95  LEU n 
1 96  GLU n 
1 97  LYS n 
1 98  ILE n 
1 99  SER n 
1 100 ASN n 
1 101 GLU n 
1 102 ILE n 
1 103 LYS n 
1 104 ILE n 
1 105 VAL n 
1 106 ALA n 
1 107 THR n 
1 108 PRO n 
1 109 ASP n 
1 110 GLY n 
1 111 GLY n 
1 112 SER n 
1 113 ILE n 
1 114 LEU n 
1 115 LYS n 
1 116 ILE n 
1 117 SER n 
1 118 ASN n 
1 119 LYS n 
1 120 TYR n 
1 121 HIS n 
1 122 THR n 
1 123 LYS n 
1 124 GLY n 
1 125 ASP n 
1 126 HIS n 
1 127 GLU n 
1 128 VAL n 
1 129 LYS n 
1 130 ALA n 
1 131 GLU n 
1 132 GLN n 
1 133 VAL n 
1 134 LYS n 
1 135 ALA n 
1 136 SER n 
1 137 LYS n 
1 138 GLU n 
1 139 MET n 
1 140 GLY n 
1 141 GLU n 
1 142 THR n 
1 143 LEU n 
1 144 LEU n 
1 145 ARG n 
1 146 ALA n 
1 147 VAL n 
1 148 GLU n 
1 149 SER n 
1 150 TYR n 
1 151 LEU n 
1 152 LEU n 
1 153 ALA n 
1 154 HIS n 
1 155 SER n 
1 156 ASP n 
1 157 ALA n 
1 158 TYR n 
1 159 ASN n 
2 1   ASN n 
2 2   ILE n 
2 3   VAL n 
2 4   LEU n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   LYS n 
2 10  SER n 
2 11  MET n 
2 12  SER n 
2 13  VAL n 
2 14  SER n 
2 15  VAL n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  VAL n 
2 20  THR n 
2 21  LEU n 
2 22  SER n 
2 23  CYS n 
2 24  LYS n 
2 25  ALA n 
2 26  SER n 
2 27  GLU n 
2 28  ASN n 
2 29  VAL n 
2 30  ASP n 
2 31  THR n 
2 32  TYR n 
2 33  VAL n 
2 34  PHE n 
2 35  TRP n 
2 36  PHE n 
2 37  GLN n 
2 38  GLN n 
2 39  LYS n 
2 40  PRO n 
2 41  ASP n 
2 42  GLN n 
2 43  SER n 
2 44  PRO n 
2 45  LYS n 
2 46  LEU n 
2 47  LEU n 
2 48  LEU n 
2 49  TYR n 
2 50  GLY n 
2 51  PRO n 
2 52  SER n 
2 53  ASN n 
2 54  ARG n 
2 55  TYR n 
2 56  THR n 
2 57  GLY n 
2 58  VAL n 
2 59  PRO n 
2 60  ASP n 
2 61  ARG n 
2 62  PHE n 
2 63  THR n 
2 64  GLY n 
2 65  SER n 
2 66  GLY n 
2 67  SER n 
2 68  THR n 
2 69  THR n 
2 70  ASP n 
2 71  PHE n 
2 72  THR n 
2 73  LEU n 
2 74  THR n 
2 75  ILE n 
2 76  SER n 
2 77  SER n 
2 78  VAL n 
2 79  GLN n 
2 80  ALA n 
2 81  GLU n 
2 82  ASP n 
2 83  LEU n 
2 84  ALA n 
2 85  ASP n 
2 86  TYR n 
2 87  HIS n 
2 88  CYS n 
2 89  GLY n 
2 90  GLN n 
2 91  SER n 
2 92  TYR n 
2 93  SER n 
2 94  TYR n 
2 95  PRO n 
2 96  TYR n 
2 97  THR n 
2 98  PHE n 
2 99  GLY n 
2 100 GLY n 
2 101 GLY n 
2 102 THR n 
2 103 LYS n 
2 104 LEU n 
2 105 GLU n 
2 106 ILE n 
2 107 LYS n 
2 108 ARG n 
2 109 ALA n 
2 110 ASP n 
2 111 ALA n 
2 112 ALA n 
2 113 PRO n 
2 114 THR n 
2 115 VAL n 
2 116 SER n 
2 117 ILE n 
2 118 PHE n 
2 119 PRO n 
2 120 PRO n 
2 121 SER n 
2 122 SER n 
2 123 GLU n 
2 124 GLN n 
2 125 LEU n 
2 126 THR n 
2 127 SER n 
2 128 GLY n 
2 129 GLY n 
2 130 ALA n 
2 131 SER n 
2 132 VAL n 
2 133 VAL n 
2 134 CYS n 
2 135 PHE n 
2 136 LEU n 
2 137 ASN n 
2 138 ASN n 
2 139 PHE n 
2 140 TYR n 
2 141 PRO n 
2 142 LYS n 
2 143 ASP n 
2 144 ILE n 
2 145 ASN n 
2 146 VAL n 
2 147 LYS n 
2 148 TRP n 
2 149 LYS n 
2 150 ILE n 
2 151 ASP n 
2 152 GLY n 
2 153 SER n 
2 154 GLU n 
2 155 ARG n 
2 156 GLN n 
2 157 ASN n 
2 158 GLY n 
2 159 VAL n 
2 160 LEU n 
2 161 ASN n 
2 162 SER n 
2 163 TRP n 
2 164 THR n 
2 165 ASP n 
2 166 GLN n 
2 167 ASP n 
2 168 SER n 
2 169 LYS n 
2 170 ASP n 
2 171 SER n 
2 172 THR n 
2 173 TYR n 
2 174 SER n 
2 175 MET n 
2 176 SER n 
2 177 SER n 
2 178 THR n 
2 179 LEU n 
2 180 THR n 
2 181 LEU n 
2 182 THR n 
2 183 LYS n 
2 184 ASP n 
2 185 GLU n 
2 186 TYR n 
2 187 GLU n 
2 188 ARG n 
2 189 HIS n 
2 190 ASN n 
2 191 SER n 
2 192 TYR n 
2 193 THR n 
2 194 CYS n 
2 195 GLU n 
2 196 ALA n 
2 197 THR n 
2 198 HIS n 
2 199 LYS n 
2 200 THR n 
2 201 SER n 
2 202 THR n 
2 203 SER n 
2 204 PRO n 
2 205 ILE n 
2 206 VAL n 
2 207 LYS n 
2 208 SER n 
2 209 PHE n 
2 210 ASN n 
2 211 ARG n 
2 212 ASN n 
2 213 GLU n 
2 214 CYS n 
3 1   GLN n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   GLN n 
3 6   GLN n 
3 7   PRO n 
3 8   GLY n 
3 9   THR n 
3 10  GLU n 
3 11  LEU n 
3 12  VAL n 
3 13  ARG n 
3 14  PRO n 
3 15  GLY n 
3 16  ALA n 
3 17  SER n 
3 18  VAL n 
3 19  ILE n 
3 20  LEU n 
3 21  SER n 
3 22  CYS n 
3 23  LYS n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  TYR n 
3 28  THR n 
3 29  PHE n 
3 30  THR n 
3 31  SER n 
3 32  TYR n 
3 33  TRP n 
3 34  ILE n 
3 35  ASN n 
3 36  TRP n 
3 37  VAL n 
3 38  LYS n 
3 39  GLN n 
3 40  ARG n 
3 41  PRO n 
3 42  GLY n 
3 43  GLN n 
3 44  GLY n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  VAL n 
3 49  GLY n 
3 50  ASN n 
3 51  ILE n 
3 52  PHE n 
3 53  PRO n 
3 54  SER n 
3 55  ASP n 
3 56  SER n 
3 57  TYR n 
3 58  THR n 
3 59  ASN n 
3 60  TYR n 
3 61  ASN n 
3 62  GLN n 
3 63  LYS n 
3 64  PHE n 
3 65  LYS n 
3 66  ASP n 
3 67  LYS n 
3 68  ALA n 
3 69  THR n 
3 70  LEU n 
3 71  THR n 
3 72  VAL n 
3 73  ASP n 
3 74  LYS n 
3 75  SER n 
3 76  SER n 
3 77  SER n 
3 78  THR n 
3 79  ALA n 
3 80  TYR n 
3 81  MET n 
3 82  GLN n 
3 83  VAL n 
3 84  ASN n 
3 85  SER n 
3 86  PRO n 
3 87  THR n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  SER n 
3 92  ALA n 
3 93  VAL n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  THR n 
3 98  ARG n 
3 99  GLY n 
3 100 ALA n 
3 101 ARG n 
3 102 ASP n 
3 103 THR n 
3 104 TRP n 
3 105 PHE n 
3 106 ALA n 
3 107 TYR n 
3 108 TRP n 
3 109 GLY n 
3 110 GLN n 
3 111 GLY n 
3 112 THR n 
3 113 LEU n 
3 114 VAL n 
3 115 THR n 
3 116 VAL n 
3 117 SER n 
3 118 VAL n 
3 119 ALA n 
3 120 LYS n 
3 121 THR n 
3 122 THR n 
3 123 PRO n 
3 124 PRO n 
3 125 SER n 
3 126 VAL n 
3 127 PHE n 
3 128 PRO n 
3 129 LEU n 
3 130 ALA n 
3 131 PRO n 
3 132 GLY n 
3 133 SER n 
3 134 ALA n 
3 135 ALA n 
3 136 GLN n 
3 137 THR n 
3 138 ASN n 
3 139 SER n 
3 140 MET n 
3 141 VAL n 
3 142 THR n 
3 143 LEU n 
3 144 GLY n 
3 145 CYS n 
3 146 LEU n 
3 147 VAL n 
3 148 LYS n 
3 149 GLY n 
3 150 TYR n 
3 151 PHE n 
3 152 PRO n 
3 153 GLU n 
3 154 PRO n 
3 155 VAL n 
3 156 THR n 
3 157 VAL n 
3 158 THR n 
3 159 TRP n 
3 160 ASN n 
3 161 SER n 
3 162 GLY n 
3 163 SER n 
3 164 LEU n 
3 165 SER n 
3 166 SER n 
3 167 GLY n 
3 168 VAL n 
3 169 HIS n 
3 170 THR n 
3 171 PHE n 
3 172 PRO n 
3 173 ALA n 
3 174 VAL n 
3 175 LEU n 
3 176 GLN n 
3 177 SER n 
3 178 ASP n 
3 179 LEU n 
3 180 TYR n 
3 181 THR n 
3 182 LEU n 
3 183 SER n 
3 184 SER n 
3 185 SER n 
3 186 VAL n 
3 187 THR n 
3 188 VAL n 
3 189 PRO n 
3 190 SER n 
3 191 SER n 
3 192 THR n 
3 193 TRP n 
3 194 PRO n 
3 195 SER n 
3 196 GLU n 
3 197 THR n 
3 198 VAL n 
3 199 THR n 
3 200 CYS n 
3 201 ASN n 
3 202 VAL n 
3 203 ALA n 
3 204 HIS n 
3 205 PRO n 
3 206 ALA n 
3 207 SER n 
3 208 SER n 
3 209 THR n 
3 210 LYS n 
3 211 VAL n 
3 212 ASP n 
3 213 LYS n 
3 214 LYS n 
3 215 ILE n 
3 216 VAL n 
3 217 PRO n 
3 218 ARG n 
3 219 ASP n 
3 220 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'European white birch' Betula ?             ? ? ? ? ? ? 'Betula pendula' 3505  ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse'          Mus    'BALB/C MICE' ? ? ? ? ? ? 'Mus musculus'   10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? 'house mouse'          Mus    'BALB/C MICE' ? ? ? ? ? ? 'Mus musculus'   10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP BEV1A_BETVE P15494 1 1 ? ? 
2 UNP KAC_MOUSE   P01837 2 1 ? ? 
3 PDB 1FSK        1FSK   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1FSK A 1 ? 159 ? P15494 1 ? 159 ? 1 159 
2  2 1FSK B 1 ? 214 ? P01837 1 ? 106 ? 1 214 
3  1 1FSK D 1 ? 159 ? P15494 1 ? 159 ? 1 159 
4  2 1FSK E 1 ? 214 ? P01837 1 ? 106 ? 1 214 
5  1 1FSK G 1 ? 159 ? P15494 1 ? 159 ? 1 159 
6  2 1FSK H 1 ? 214 ? P01837 1 ? 106 ? 1 214 
7  1 1FSK J 1 ? 159 ? P15494 1 ? 159 ? 1 159 
8  2 1FSK K 1 ? 214 ? P01837 1 ? 106 ? 1 214 
9  3 1FSK C 1 ? 220 ? 1FSK   1 ? 220 ? 1 220 
10 3 1FSK F 1 ? 220 ? 1FSK   1 ? 220 ? 1 220 
11 3 1FSK I 1 ? 220 ? 1FSK   1 ? 220 ? 1 220 
12 3 1FSK L 1 ? 220 ? 1FSK   1 ? 220 ? 1 220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 1FSK LEU B 4   ? UNP P01837 MET 33  CONFLICT 4   1  
2 1FSK VAL B 13  ? UNP P01837 MET 42  CONFLICT 13  2  
2 1FSK SER B 22  ? UNP P01837 THR 51  CONFLICT 22  3  
2 1FSK ASP B 30  ? UNP P01837 VAL 59  CONFLICT 30  4  
2 1FSK PHE B 34  ? UNP P01837 SER 63  CONFLICT 34  5  
2 1FSK PHE B 36  ? UNP P01837 TYR 65  CONFLICT 36  6  
2 1FSK ASP B 41  ? UNP P01837 GLU 70  CONFLICT 41  7  
2 1FSK LEU B 48  ? UNP P01837 ILE 77  CONFLICT 48  8  
2 1FSK PRO B 51  ? UNP P01837 ALA 80  CONFLICT 51  9  
2 1FSK THR B 68  ? UNP P01837 ALA 97  CONFLICT 68  10 
2 1FSK SER B 91  ? UNP P01837 GLY 120 CONFLICT 91  11 
2 1FSK LYS B 149 ? UNP P01837 ASN 178 CONFLICT 149 12 
4 1FSK LEU E 4   ? UNP P01837 MET 33  CONFLICT 4   13 
4 1FSK VAL E 13  ? UNP P01837 MET 42  CONFLICT 13  14 
4 1FSK SER E 22  ? UNP P01837 THR 51  CONFLICT 22  15 
4 1FSK ASP E 30  ? UNP P01837 VAL 59  CONFLICT 30  16 
4 1FSK PHE E 34  ? UNP P01837 SER 63  CONFLICT 34  17 
4 1FSK PHE E 36  ? UNP P01837 TYR 65  CONFLICT 36  18 
4 1FSK ASP E 41  ? UNP P01837 GLU 70  CONFLICT 41  19 
4 1FSK LEU E 48  ? UNP P01837 ILE 77  CONFLICT 48  20 
4 1FSK PRO E 51  ? UNP P01837 ALA 80  CONFLICT 51  21 
4 1FSK THR E 68  ? UNP P01837 ALA 97  CONFLICT 68  22 
4 1FSK SER E 91  ? UNP P01837 GLY 120 CONFLICT 91  23 
4 1FSK LYS E 149 ? UNP P01837 ASN 178 CONFLICT 149 24 
6 1FSK LEU H 4   ? UNP P01837 MET 33  CONFLICT 4   25 
6 1FSK VAL H 13  ? UNP P01837 MET 42  CONFLICT 13  26 
6 1FSK SER H 22  ? UNP P01837 THR 51  CONFLICT 22  27 
6 1FSK ASP H 30  ? UNP P01837 VAL 59  CONFLICT 30  28 
6 1FSK PHE H 34  ? UNP P01837 SER 63  CONFLICT 34  29 
6 1FSK PHE H 36  ? UNP P01837 TYR 65  CONFLICT 36  30 
6 1FSK ASP H 41  ? UNP P01837 GLU 70  CONFLICT 41  31 
6 1FSK LEU H 48  ? UNP P01837 ILE 77  CONFLICT 48  32 
6 1FSK PRO H 51  ? UNP P01837 ALA 80  CONFLICT 51  33 
6 1FSK THR H 68  ? UNP P01837 ALA 97  CONFLICT 68  34 
6 1FSK SER H 91  ? UNP P01837 GLY 120 CONFLICT 91  35 
6 1FSK LYS H 149 ? UNP P01837 ASN 178 CONFLICT 149 36 
8 1FSK LEU K 4   ? UNP P01837 MET 33  CONFLICT 4   37 
8 1FSK VAL K 13  ? UNP P01837 MET 42  CONFLICT 13  38 
8 1FSK SER K 22  ? UNP P01837 THR 51  CONFLICT 22  39 
8 1FSK ASP K 30  ? UNP P01837 VAL 59  CONFLICT 30  40 
8 1FSK PHE K 34  ? UNP P01837 SER 63  CONFLICT 34  41 
8 1FSK PHE K 36  ? UNP P01837 TYR 65  CONFLICT 36  42 
8 1FSK ASP K 41  ? UNP P01837 GLU 70  CONFLICT 41  43 
8 1FSK LEU K 48  ? UNP P01837 ILE 77  CONFLICT 48  44 
8 1FSK PRO K 51  ? UNP P01837 ALA 80  CONFLICT 51  45 
8 1FSK THR K 68  ? UNP P01837 ALA 97  CONFLICT 68  46 
8 1FSK SER K 91  ? UNP P01837 GLY 120 CONFLICT 91  47 
8 1FSK LYS K 149 ? UNP P01837 ASN 178 CONFLICT 149 48 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1FSK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   65.49 
_exptl_crystal.density_Matthews      3.56 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.0 
_exptl_crystal_grow.temp            300 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '12% peg 6000, 0.1M sodium citrate, pH 4.0, VAPOR DIFFUSION, HANGING DROP, temperature 300K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           120 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1998-05-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.950 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I711' 
_diffrn_source.pdbx_wavelength             0.950 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I711 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1FSK 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30 
_reflns.d_resolution_high            2.9 
_reflns.number_obs                   ? 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.5 
_reflns.pdbx_Rmerge_I_obs            0.047 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.85 
_reflns.B_iso_Wilson_estimate        49.2 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.9 
_reflns_shell.d_res_low              3.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   83.8 
_reflns_shell.Rmerge_I_obs           0.37 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_all      6763 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1FSK 
_refine.ls_number_reflns_obs                     73464 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               551538.89 
_refine.pdbx_data_cutoff_low_absF                0.00 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    92.4 
_refine.ls_R_factor_obs                          0.253 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.253 
_refine.ls_R_factor_R_free                       0.285 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  3726 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               63.3 
_refine.aniso_B[1][1]                            11.20 
_refine.aniso_B[2][2]                            -4.64 
_refine.aniso_B[3][3]                            -6.56 
_refine.aniso_B[1][2]                            5.26 
_refine.aniso_B[1][3]                            1.18 
_refine.aniso_B[2][3]                            -8.71 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.314 
_refine.solvent_model_param_bsol                 38.46 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1FSK 
_refine_analyze.Luzzati_coordinate_error_obs    0.46 
_refine_analyze.Luzzati_sigma_a_obs             0.58 
_refine_analyze.Luzzati_d_res_low_obs           20.00 
_refine_analyze.Luzzati_coordinate_error_free   0.54 
_refine_analyze.Luzzati_sigma_a_free            0.66 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        18308 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               18308 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.010 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.94  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.75  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       4.66  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        3.77  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       5.80  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.08 
_refine_ls_shell.number_reflns_R_work             10014 
_refine_ls_shell.R_factor_R_work                  0.39 
_refine_ls_shell.percent_reflns_obs               79.5 
_refine_ls_shell.R_factor_R_free                  0.419 
_refine_ls_shell.R_factor_R_free_error            0.018 
_refine_ls_shell.percent_reflns_R_free            4.9 
_refine_ls_shell.number_reflns_R_free             519 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PA PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 CIS_PEPT       ?           'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  1FSK 
_struct.title                     
'COMPLEX FORMATION BETWEEN A FAB FRAGMENT OF A MONOCLONAL IGG ANTIBODY AND THE MAJOR ALLERGEN FROM BIRCH POLLEN BET V 1' 
_struct.pdbx_descriptor           'MAJOR POLLEN ALLERGEN BET V 1-A/IMMUNOGLOBULIN KAPPA LIGHT CHAIN/ANTIBODY HEAVY CHAIN FAB' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1FSK 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Bet v 1, Bv16 Fab fragment, antibody allergen complex, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 1 ? 
K N N 2 ? 
L N N 3 ? 
# 
loop_
_struct_biol.id 
1 
2 
3 
4 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 14  ? ILE A 23  ? PRO A 14  ILE A 23  1 ? 10 
HELX_P HELX_P2  2  ASP A 25  ? ALA A 34  ? ASP A 25  ALA A 34  1 ? 10 
HELX_P HELX_P3  3  LYS A 129 ? HIS A 154 ? LYS A 129 HIS A 154 1 ? 26 
HELX_P HELX_P4  4  SER B 121 ? THR B 126 ? SER B 121 THR B 126 1 ? 6  
HELX_P HELX_P5  5  LYS B 183 ? ARG B 188 ? LYS B 183 ARG B 188 1 ? 6  
HELX_P HELX_P6  6  THR C 28  ? TYR C 32  ? THR C 28  TYR C 32  5 ? 5  
HELX_P HELX_P7  7  GLN C 62  ? LYS C 65  ? GLN C 62  LYS C 65  5 ? 4  
HELX_P HELX_P8  8  LYS C 74  ? SER C 76  ? LYS C 74  SER C 76  5 ? 3  
HELX_P HELX_P9  9  THR C 87  ? SER C 91  ? THR C 87  SER C 91  5 ? 5  
HELX_P HELX_P10 10 SER C 191 ? GLU C 196 ? SER C 191 GLU C 196 1 ? 6  
HELX_P HELX_P11 11 PRO C 205 ? SER C 208 ? PRO C 205 SER C 208 5 ? 4  
HELX_P HELX_P12 12 PRO D 14  ? ILE D 23  ? PRO D 14  ILE D 23  1 ? 10 
HELX_P HELX_P13 13 ASP D 25  ? ALA D 34  ? ASP D 25  ALA D 34  1 ? 10 
HELX_P HELX_P14 14 LYS D 129 ? HIS D 154 ? LYS D 129 HIS D 154 1 ? 26 
HELX_P HELX_P15 15 SER E 121 ? THR E 126 ? SER E 121 THR E 126 1 ? 6  
HELX_P HELX_P16 16 LYS E 183 ? ARG E 188 ? LYS E 183 ARG E 188 1 ? 6  
HELX_P HELX_P17 17 THR F 28  ? TYR F 32  ? THR F 28  TYR F 32  5 ? 5  
HELX_P HELX_P18 18 GLN F 62  ? LYS F 65  ? GLN F 62  LYS F 65  5 ? 4  
HELX_P HELX_P19 19 LYS F 74  ? SER F 76  ? LYS F 74  SER F 76  5 ? 3  
HELX_P HELX_P20 20 THR F 87  ? SER F 91  ? THR F 87  SER F 91  5 ? 5  
HELX_P HELX_P21 21 SER F 191 ? GLU F 196 ? SER F 191 GLU F 196 1 ? 6  
HELX_P HELX_P22 22 PRO F 205 ? SER F 207 ? PRO F 205 SER F 207 5 ? 3  
HELX_P HELX_P23 23 PRO G 14  ? ILE G 23  ? PRO G 14  ILE G 23  1 ? 10 
HELX_P HELX_P24 24 ASP G 25  ? ALA G 34  ? ASP G 25  ALA G 34  1 ? 10 
HELX_P HELX_P25 25 LYS G 129 ? HIS G 154 ? LYS G 129 HIS G 154 1 ? 26 
HELX_P HELX_P26 26 SER H 121 ? THR H 126 ? SER H 121 THR H 126 1 ? 6  
HELX_P HELX_P27 27 LYS H 183 ? ARG H 188 ? LYS H 183 ARG H 188 1 ? 6  
HELX_P HELX_P28 28 THR I 28  ? TYR I 32  ? THR I 28  TYR I 32  5 ? 5  
HELX_P HELX_P29 29 GLN I 62  ? LYS I 65  ? GLN I 62  LYS I 65  5 ? 4  
HELX_P HELX_P30 30 LYS I 74  ? SER I 76  ? LYS I 74  SER I 76  5 ? 3  
HELX_P HELX_P31 31 THR I 87  ? SER I 91  ? THR I 87  SER I 91  5 ? 5  
HELX_P HELX_P32 32 SER I 191 ? GLU I 196 ? SER I 191 GLU I 196 1 ? 6  
HELX_P HELX_P33 33 PRO I 205 ? SER I 207 ? PRO I 205 SER I 207 5 ? 3  
HELX_P HELX_P34 34 PRO J 14  ? ILE J 23  ? PRO J 14  ILE J 23  1 ? 10 
HELX_P HELX_P35 35 ASP J 25  ? ALA J 34  ? ASP J 25  ALA J 34  1 ? 10 
HELX_P HELX_P36 36 LYS J 129 ? HIS J 154 ? LYS J 129 HIS J 154 1 ? 26 
HELX_P HELX_P37 37 SER K 121 ? THR K 126 ? SER K 121 THR K 126 1 ? 6  
HELX_P HELX_P38 38 LYS K 183 ? ARG K 188 ? LYS K 183 ARG K 188 1 ? 6  
HELX_P HELX_P39 39 THR L 28  ? TYR L 32  ? THR L 28  TYR L 32  5 ? 5  
HELX_P HELX_P40 40 GLN L 62  ? LYS L 65  ? GLN L 62  LYS L 65  5 ? 4  
HELX_P HELX_P41 41 LYS L 74  ? SER L 76  ? LYS L 74  SER L 76  5 ? 3  
HELX_P HELX_P42 42 THR L 87  ? SER L 91  ? THR L 87  SER L 91  5 ? 5  
HELX_P HELX_P43 43 SER L 191 ? GLU L 196 ? SER L 191 GLU L 196 1 ? 6  
HELX_P HELX_P44 44 PRO L 205 ? SER L 208 ? PRO L 205 SER L 208 5 ? 4  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 88  SG ? ? B CYS 23  B CYS 88  1_555 ? ? ? ? ? ? ? 2.755 ? 
disulf2  disulf ? ? B CYS 134 SG ? ? ? 1_555 B CYS 194 SG ? ? B CYS 134 B CYS 194 1_555 ? ? ? ? ? ? ? 2.697 ? 
disulf3  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? C CYS 22  C CYS 96  1_555 ? ? ? ? ? ? ? 2.370 ? 
disulf4  disulf ? ? C CYS 145 SG ? ? ? 1_555 C CYS 200 SG ? ? C CYS 145 C CYS 200 1_555 ? ? ? ? ? ? ? 2.587 ? 
disulf5  disulf ? ? E CYS 23  SG ? ? ? 1_555 E CYS 88  SG ? ? E CYS 23  E CYS 88  1_555 ? ? ? ? ? ? ? 2.762 ? 
disulf6  disulf ? ? E CYS 134 SG ? ? ? 1_555 E CYS 194 SG ? ? E CYS 134 E CYS 194 1_555 ? ? ? ? ? ? ? 2.700 ? 
disulf7  disulf ? ? F CYS 22  SG ? ? ? 1_555 F CYS 96  SG ? ? F CYS 22  F CYS 96  1_555 ? ? ? ? ? ? ? 2.353 ? 
disulf8  disulf ? ? F CYS 145 SG ? ? ? 1_555 F CYS 200 SG ? ? F CYS 145 F CYS 200 1_555 ? ? ? ? ? ? ? 2.598 ? 
disulf9  disulf ? ? H CYS 23  SG ? ? ? 1_555 H CYS 88  SG ? ? H CYS 23  H CYS 88  1_555 ? ? ? ? ? ? ? 2.780 ? 
disulf10 disulf ? ? H CYS 134 SG ? ? ? 1_555 H CYS 194 SG ? ? H CYS 134 H CYS 194 1_555 ? ? ? ? ? ? ? 2.714 ? 
disulf11 disulf ? ? I CYS 22  SG ? ? ? 1_555 I CYS 96  SG ? ? I CYS 22  I CYS 96  1_555 ? ? ? ? ? ? ? 2.372 ? 
disulf12 disulf ? ? I CYS 145 SG ? ? ? 1_555 I CYS 200 SG ? ? I CYS 145 I CYS 200 1_555 ? ? ? ? ? ? ? 2.584 ? 
disulf13 disulf ? ? K CYS 23  SG ? ? ? 1_555 K CYS 88  SG ? ? K CYS 23  K CYS 88  1_555 ? ? ? ? ? ? ? 2.764 ? 
disulf14 disulf ? ? K CYS 134 SG ? ? ? 1_555 K CYS 194 SG ? ? K CYS 134 K CYS 194 1_555 ? ? ? ? ? ? ? 2.687 ? 
disulf15 disulf ? ? L CYS 22  SG ? ? ? 1_555 L CYS 96  SG ? ? L CYS 22  L CYS 96  1_555 ? ? ? ? ? ? ? 2.367 ? 
disulf16 disulf ? ? L CYS 145 SG ? ? ? 1_555 L CYS 200 SG ? ? L CYS 145 L CYS 200 1_555 ? ? ? ? ? ? ? 2.578 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 7   B . ? SER 7   B PRO 8   B ? PRO 8   B 1 -0.46 
2  TYR 94  B . ? TYR 94  B PRO 95  B ? PRO 95  B 1 1.50  
3  TYR 140 B . ? TYR 140 B PRO 141 B ? PRO 141 B 1 0.78  
4  PHE 151 C . ? PHE 151 C PRO 152 C ? PRO 152 C 1 0.83  
5  GLU 153 C . ? GLU 153 C PRO 154 C ? PRO 154 C 1 0.66  
6  TRP 193 C . ? TRP 193 C PRO 194 C ? PRO 194 C 1 -0.24 
7  SER 7   E . ? SER 7   E PRO 8   E ? PRO 8   E 1 0.40  
8  TYR 94  E . ? TYR 94  E PRO 95  E ? PRO 95  E 1 0.60  
9  TYR 140 E . ? TYR 140 E PRO 141 E ? PRO 141 E 1 0.81  
10 PHE 151 F . ? PHE 151 F PRO 152 F ? PRO 152 F 1 0.81  
11 GLU 153 F . ? GLU 153 F PRO 154 F ? PRO 154 F 1 0.62  
12 TRP 193 F . ? TRP 193 F PRO 194 F ? PRO 194 F 1 -0.29 
13 SER 7   H . ? SER 7   H PRO 8   H ? PRO 8   H 1 0.20  
14 TYR 94  H . ? TYR 94  H PRO 95  H ? PRO 95  H 1 2.82  
15 TYR 140 H . ? TYR 140 H PRO 141 H ? PRO 141 H 1 0.77  
16 PHE 151 I . ? PHE 151 I PRO 152 I ? PRO 152 I 1 0.85  
17 GLU 153 I . ? GLU 153 I PRO 154 I ? PRO 154 I 1 0.80  
18 TRP 193 I . ? TRP 193 I PRO 194 I ? PRO 194 I 1 -0.32 
19 SER 7   K . ? SER 7   K PRO 8   K ? PRO 8   K 1 -0.56 
20 TYR 94  K . ? TYR 94  K PRO 95  K ? PRO 95  K 1 -1.38 
21 TYR 140 K . ? TYR 140 K PRO 141 K ? PRO 141 K 1 0.67  
22 PHE 151 L . ? PHE 151 L PRO 152 L ? PRO 152 L 1 0.82  
23 GLU 153 L . ? GLU 153 L PRO 154 L ? PRO 154 L 1 0.69  
24 TRP 193 L . ? TRP 193 L PRO 194 L ? PRO 194 L 1 -0.24 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 7 ? 
B  ? 7 ? 
C  ? 4 ? 
D  ? 5 ? 
E  ? 4 ? 
F  ? 4 ? 
G  ? 4 ? 
H  ? 4 ? 
I  ? 5 ? 
J  ? 4 ? 
K  ? 4 ? 
L  ? 4 ? 
M  ? 2 ? 
N  ? 3 ? 
O  ? 7 ? 
P  ? 7 ? 
Q  ? 4 ? 
R  ? 5 ? 
S  ? 4 ? 
T  ? 4 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 5 ? 
X  ? 4 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 2 ? 
AB ? 6 ? 
AC ? 7 ? 
AD ? 7 ? 
AE ? 4 ? 
AF ? 5 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 5 ? 
AL ? 4 ? 
AM ? 4 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 7 ? 
AQ ? 7 ? 
AR ? 4 ? 
AS ? 5 ? 
AT ? 4 ? 
AU ? 4 ? 
AV ? 4 ? 
AW ? 4 ? 
AX ? 5 ? 
AY ? 4 ? 
AZ ? 4 ? 
BA ? 4 ? 
BB ? 2 ? 
BC ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
A  4 5 ? anti-parallel 
A  5 6 ? anti-parallel 
A  6 7 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
B  6 7 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
D  1 2 ? parallel      
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? parallel      
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? parallel      
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
O  4 5 ? anti-parallel 
O  5 6 ? anti-parallel 
O  6 7 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
P  4 5 ? anti-parallel 
P  5 6 ? anti-parallel 
P  6 7 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? parallel      
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
R  4 5 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? parallel      
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AC 6 7 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AD 4 5 ? anti-parallel 
AD 5 6 ? anti-parallel 
AD 6 7 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? parallel      
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? parallel      
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? parallel      
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AP 5 6 ? anti-parallel 
AP 6 7 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AQ 4 5 ? anti-parallel 
AQ 5 6 ? anti-parallel 
AQ 6 7 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? anti-parallel 
AS 1 2 ? parallel      
AS 2 3 ? anti-parallel 
AS 3 4 ? anti-parallel 
AS 4 5 ? anti-parallel 
AT 1 2 ? parallel      
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? anti-parallel 
AV 1 2 ? anti-parallel 
AV 2 3 ? anti-parallel 
AV 3 4 ? anti-parallel 
AW 1 2 ? anti-parallel 
AW 2 3 ? anti-parallel 
AW 3 4 ? anti-parallel 
AX 1 2 ? anti-parallel 
AX 2 3 ? anti-parallel 
AX 3 4 ? anti-parallel 
AX 4 5 ? anti-parallel 
AY 1 2 ? anti-parallel 
AY 2 3 ? anti-parallel 
AY 3 4 ? parallel      
AZ 1 2 ? anti-parallel 
AZ 2 3 ? anti-parallel 
AZ 3 4 ? anti-parallel 
BA 1 2 ? anti-parallel 
BA 2 3 ? anti-parallel 
BA 3 4 ? anti-parallel 
BB 1 2 ? anti-parallel 
BC 1 2 ? anti-parallel 
BC 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 SER A 40  ? GLU A 45  ? SER A 40  GLU A 45  
A  2 ILE A 53  ? SER A 57  ? ILE A 53  SER A 57  
A  3 TYR A 66  ? ASP A 75  ? TYR A 66  ASP A 75  
A  4 LYS A 80  ? GLU A 87  ? LYS A 80  GLU A 87  
A  5 LEU A 95  ? ALA A 106 ? LEU A 95  ALA A 106 
A  6 SER A 112 ? SER A 117 ? SER A 112 SER A 117 
A  7 THR A 10  ? SER A 11  ? THR A 10  SER A 11  
B  1 SER A 40  ? GLU A 45  ? SER A 40  GLU A 45  
B  2 ILE A 53  ? SER A 57  ? ILE A 53  SER A 57  
B  3 TYR A 66  ? ASP A 75  ? TYR A 66  ASP A 75  
B  4 LYS A 80  ? GLU A 87  ? LYS A 80  GLU A 87  
B  5 LEU A 95  ? ALA A 106 ? LEU A 95  ALA A 106 
B  6 TYR A 120 ? THR A 122 ? TYR A 120 THR A 122 
B  7 VAL A 2   ? PHE A 3   ? VAL A 2   PHE A 3   
C  1 LEU B 4   ? SER B 7   ? LEU B 4   SER B 7   
C  2 VAL B 19  ? ALA B 25  ? VAL B 19  ALA B 25  
C  3 ASP B 70  ? ILE B 75  ? ASP B 70  ILE B 75  
C  4 PHE B 62  ? SER B 67  ? PHE B 62  SER B 67  
D  1 SER B 10  ? SER B 14  ? SER B 10  SER B 14  
D  2 THR B 102 ? LYS B 107 ? THR B 102 LYS B 107 
D  3 ALA B 84  ? GLN B 90  ? ALA B 84  GLN B 90  
D  4 VAL B 33  ? GLN B 38  ? VAL B 33  GLN B 38  
D  5 LEU B 46  ? LEU B 48  ? LEU B 46  LEU B 48  
E  1 SER B 10  ? SER B 14  ? SER B 10  SER B 14  
E  2 THR B 102 ? LYS B 107 ? THR B 102 LYS B 107 
E  3 ALA B 84  ? GLN B 90  ? ALA B 84  GLN B 90  
E  4 THR B 97  ? PHE B 98  ? THR B 97  PHE B 98  
F  1 VAL B 115 ? PHE B 118 ? VAL B 115 PHE B 118 
F  2 GLY B 129 ? PHE B 139 ? GLY B 129 PHE B 139 
F  3 TYR B 173 ? THR B 182 ? TYR B 173 THR B 182 
F  4 VAL B 159 ? LEU B 160 ? VAL B 159 LEU B 160 
G  1 SER B 153 ? ARG B 155 ? SER B 153 ARG B 155 
G  2 ASN B 145 ? ILE B 150 ? ASN B 145 ILE B 150 
G  3 SER B 191 ? THR B 197 ? SER B 191 THR B 197 
G  4 ILE B 205 ? ASN B 210 ? ILE B 205 ASN B 210 
H  1 GLN C 3   ? GLN C 5   ? GLN C 3   GLN C 5   
H  2 VAL C 18  ? SER C 25  ? VAL C 18  SER C 25  
H  3 THR C 78  ? VAL C 83  ? THR C 78  VAL C 83  
H  4 ALA C 68  ? ASP C 73  ? ALA C 68  ASP C 73  
I  1 THR C 103 ? TRP C 108 ? THR C 103 TRP C 108 
I  2 ALA C 92  ? ALA C 100 ? ALA C 92  ALA C 100 
I  3 ILE C 34  ? GLN C 39  ? ILE C 34  GLN C 39  
I  4 LEU C 45  ? PHE C 52  ? LEU C 45  PHE C 52  
I  5 TYR C 57  ? TYR C 60  ? TYR C 57  TYR C 60  
J  1 THR C 103 ? TRP C 108 ? THR C 103 TRP C 108 
J  2 ALA C 92  ? ALA C 100 ? ALA C 92  ALA C 100 
J  3 THR C 112 ? VAL C 116 ? THR C 112 VAL C 116 
J  4 THR C 9   ? VAL C 12  ? THR C 9   VAL C 12  
K  1 SER C 125 ? PRO C 128 ? SER C 125 PRO C 128 
K  2 GLY C 144 ? TYR C 150 ? GLY C 144 TYR C 150 
K  3 LEU C 179 ? SER C 185 ? LEU C 179 SER C 185 
K  4 HIS C 169 ? THR C 170 ? HIS C 169 THR C 170 
L  1 SER C 125 ? PRO C 128 ? SER C 125 PRO C 128 
L  2 GLY C 144 ? TYR C 150 ? GLY C 144 TYR C 150 
L  3 LEU C 179 ? SER C 185 ? LEU C 179 SER C 185 
L  4 VAL C 174 ? GLN C 176 ? VAL C 174 GLN C 176 
M  1 MET C 140 ? VAL C 141 ? MET C 140 VAL C 141 
M  2 VAL C 188 ? PRO C 189 ? VAL C 188 PRO C 189 
N  1 THR C 156 ? TRP C 159 ? THR C 156 TRP C 159 
N  2 VAL C 198 ? HIS C 204 ? VAL C 198 HIS C 204 
N  3 THR C 209 ? ILE C 215 ? THR C 209 ILE C 215 
O  1 SER D 40  ? GLU D 45  ? SER D 40  GLU D 45  
O  2 ILE D 53  ? SER D 57  ? ILE D 53  SER D 57  
O  3 TYR D 66  ? ASP D 75  ? TYR D 66  ASP D 75  
O  4 LYS D 80  ? GLU D 87  ? LYS D 80  GLU D 87  
O  5 LEU D 95  ? ALA D 106 ? LEU D 95  ALA D 106 
O  6 SER D 112 ? SER D 117 ? SER D 112 SER D 117 
O  7 THR D 10  ? SER D 11  ? THR D 10  SER D 11  
P  1 SER D 40  ? GLU D 45  ? SER D 40  GLU D 45  
P  2 ILE D 53  ? SER D 57  ? ILE D 53  SER D 57  
P  3 TYR D 66  ? ASP D 75  ? TYR D 66  ASP D 75  
P  4 LYS D 80  ? GLU D 87  ? LYS D 80  GLU D 87  
P  5 LEU D 95  ? ALA D 106 ? LEU D 95  ALA D 106 
P  6 TYR D 120 ? THR D 122 ? TYR D 120 THR D 122 
P  7 VAL D 2   ? PHE D 3   ? VAL D 2   PHE D 3   
Q  1 LEU E 4   ? SER E 7   ? LEU E 4   SER E 7   
Q  2 VAL E 19  ? ALA E 25  ? VAL E 19  ALA E 25  
Q  3 ASP E 70  ? ILE E 75  ? ASP E 70  ILE E 75  
Q  4 PHE E 62  ? SER E 67  ? PHE E 62  SER E 67  
R  1 SER E 10  ? SER E 14  ? SER E 10  SER E 14  
R  2 THR E 102 ? LYS E 107 ? THR E 102 LYS E 107 
R  3 ALA E 84  ? GLN E 90  ? ALA E 84  GLN E 90  
R  4 VAL E 33  ? GLN E 38  ? VAL E 33  GLN E 38  
R  5 LEU E 46  ? LEU E 48  ? LEU E 46  LEU E 48  
S  1 SER E 10  ? SER E 14  ? SER E 10  SER E 14  
S  2 THR E 102 ? LYS E 107 ? THR E 102 LYS E 107 
S  3 ALA E 84  ? GLN E 90  ? ALA E 84  GLN E 90  
S  4 THR E 97  ? PHE E 98  ? THR E 97  PHE E 98  
T  1 VAL E 115 ? PHE E 118 ? VAL E 115 PHE E 118 
T  2 GLY E 129 ? PHE E 139 ? GLY E 129 PHE E 139 
T  3 TYR E 173 ? THR E 182 ? TYR E 173 THR E 182 
T  4 VAL E 159 ? LEU E 160 ? VAL E 159 LEU E 160 
U  1 SER E 153 ? ARG E 155 ? SER E 153 ARG E 155 
U  2 ASN E 145 ? ILE E 150 ? ASN E 145 ILE E 150 
U  3 SER E 191 ? THR E 197 ? SER E 191 THR E 197 
U  4 ILE E 205 ? ASN E 210 ? ILE E 205 ASN E 210 
V  1 GLN F 3   ? GLN F 5   ? GLN F 3   GLN F 5   
V  2 VAL F 18  ? SER F 25  ? VAL F 18  SER F 25  
V  3 THR F 78  ? VAL F 83  ? THR F 78  VAL F 83  
V  4 ALA F 68  ? ASP F 73  ? ALA F 68  ASP F 73  
W  1 THR F 103 ? TRP F 108 ? THR F 103 TRP F 108 
W  2 ALA F 92  ? ALA F 100 ? ALA F 92  ALA F 100 
W  3 ILE F 34  ? GLN F 39  ? ILE F 34  GLN F 39  
W  4 LEU F 45  ? PHE F 52  ? LEU F 45  PHE F 52  
W  5 TYR F 57  ? TYR F 60  ? TYR F 57  TYR F 60  
X  1 THR F 103 ? TRP F 108 ? THR F 103 TRP F 108 
X  2 ALA F 92  ? ALA F 100 ? ALA F 92  ALA F 100 
X  3 THR F 112 ? VAL F 116 ? THR F 112 VAL F 116 
X  4 THR F 9   ? VAL F 12  ? THR F 9   VAL F 12  
Y  1 SER F 125 ? PRO F 128 ? SER F 125 PRO F 128 
Y  2 GLY F 144 ? TYR F 150 ? GLY F 144 TYR F 150 
Y  3 LEU F 179 ? SER F 185 ? LEU F 179 SER F 185 
Y  4 HIS F 169 ? THR F 170 ? HIS F 169 THR F 170 
Z  1 SER F 125 ? PRO F 128 ? SER F 125 PRO F 128 
Z  2 GLY F 144 ? TYR F 150 ? GLY F 144 TYR F 150 
Z  3 LEU F 179 ? SER F 185 ? LEU F 179 SER F 185 
Z  4 VAL F 174 ? GLN F 176 ? VAL F 174 GLN F 176 
AA 1 MET F 140 ? VAL F 141 ? MET F 140 VAL F 141 
AA 2 VAL F 188 ? PRO F 189 ? VAL F 188 PRO F 189 
AB 1 THR F 156 ? TRP F 159 ? THR F 156 TRP F 159 
AB 2 VAL F 198 ? HIS F 204 ? VAL F 198 HIS F 204 
AB 3 THR F 209 ? ILE F 215 ? THR F 209 ILE F 215 
AB 4 THR I 209 ? ILE I 215 ? THR I 209 ILE I 215 
AB 5 VAL I 198 ? HIS I 204 ? VAL I 198 HIS I 204 
AB 6 THR I 156 ? TRP I 159 ? THR I 156 TRP I 159 
AC 1 SER G 40  ? GLU G 45  ? SER G 40  GLU G 45  
AC 2 ILE G 53  ? SER G 57  ? ILE G 53  SER G 57  
AC 3 TYR G 66  ? ASP G 75  ? TYR G 66  ASP G 75  
AC 4 LYS G 80  ? GLU G 87  ? LYS G 80  GLU G 87  
AC 5 LEU G 95  ? ALA G 106 ? LEU G 95  ALA G 106 
AC 6 SER G 112 ? SER G 117 ? SER G 112 SER G 117 
AC 7 THR G 10  ? SER G 11  ? THR G 10  SER G 11  
AD 1 SER G 40  ? GLU G 45  ? SER G 40  GLU G 45  
AD 2 ILE G 53  ? SER G 57  ? ILE G 53  SER G 57  
AD 3 TYR G 66  ? ASP G 75  ? TYR G 66  ASP G 75  
AD 4 LYS G 80  ? GLU G 87  ? LYS G 80  GLU G 87  
AD 5 LEU G 95  ? ALA G 106 ? LEU G 95  ALA G 106 
AD 6 TYR G 120 ? THR G 122 ? TYR G 120 THR G 122 
AD 7 VAL G 2   ? PHE G 3   ? VAL G 2   PHE G 3   
AE 1 LEU H 4   ? SER H 7   ? LEU H 4   SER H 7   
AE 2 VAL H 19  ? ALA H 25  ? VAL H 19  ALA H 25  
AE 3 ASP H 70  ? ILE H 75  ? ASP H 70  ILE H 75  
AE 4 PHE H 62  ? SER H 67  ? PHE H 62  SER H 67  
AF 1 SER H 10  ? SER H 14  ? SER H 10  SER H 14  
AF 2 THR H 102 ? LYS H 107 ? THR H 102 LYS H 107 
AF 3 ALA H 84  ? GLN H 90  ? ALA H 84  GLN H 90  
AF 4 VAL H 33  ? GLN H 38  ? VAL H 33  GLN H 38  
AF 5 LEU H 46  ? LEU H 48  ? LEU H 46  LEU H 48  
AG 1 SER H 10  ? SER H 14  ? SER H 10  SER H 14  
AG 2 THR H 102 ? LYS H 107 ? THR H 102 LYS H 107 
AG 3 ALA H 84  ? GLN H 90  ? ALA H 84  GLN H 90  
AG 4 THR H 97  ? PHE H 98  ? THR H 97  PHE H 98  
AH 1 VAL H 115 ? PHE H 118 ? VAL H 115 PHE H 118 
AH 2 GLY H 129 ? PHE H 139 ? GLY H 129 PHE H 139 
AH 3 TYR H 173 ? THR H 182 ? TYR H 173 THR H 182 
AH 4 VAL H 159 ? LEU H 160 ? VAL H 159 LEU H 160 
AI 1 SER H 153 ? ARG H 155 ? SER H 153 ARG H 155 
AI 2 ASN H 145 ? ILE H 150 ? ASN H 145 ILE H 150 
AI 3 SER H 191 ? THR H 197 ? SER H 191 THR H 197 
AI 4 ILE H 205 ? ASN H 210 ? ILE H 205 ASN H 210 
AJ 1 GLN I 3   ? GLN I 5   ? GLN I 3   GLN I 5   
AJ 2 VAL I 18  ? SER I 25  ? VAL I 18  SER I 25  
AJ 3 THR I 78  ? VAL I 83  ? THR I 78  VAL I 83  
AJ 4 ALA I 68  ? ASP I 73  ? ALA I 68  ASP I 73  
AK 1 THR I 103 ? TRP I 108 ? THR I 103 TRP I 108 
AK 2 ALA I 92  ? ALA I 100 ? ALA I 92  ALA I 100 
AK 3 ILE I 34  ? GLN I 39  ? ILE I 34  GLN I 39  
AK 4 LEU I 45  ? PHE I 52  ? LEU I 45  PHE I 52  
AK 5 TYR I 57  ? TYR I 60  ? TYR I 57  TYR I 60  
AL 1 THR I 103 ? TRP I 108 ? THR I 103 TRP I 108 
AL 2 ALA I 92  ? ALA I 100 ? ALA I 92  ALA I 100 
AL 3 THR I 112 ? VAL I 116 ? THR I 112 VAL I 116 
AL 4 THR I 9   ? VAL I 12  ? THR I 9   VAL I 12  
AM 1 SER I 125 ? PRO I 128 ? SER I 125 PRO I 128 
AM 2 GLY I 144 ? TYR I 150 ? GLY I 144 TYR I 150 
AM 3 LEU I 179 ? SER I 185 ? LEU I 179 SER I 185 
AM 4 HIS I 169 ? THR I 170 ? HIS I 169 THR I 170 
AN 1 SER I 125 ? PRO I 128 ? SER I 125 PRO I 128 
AN 2 GLY I 144 ? TYR I 150 ? GLY I 144 TYR I 150 
AN 3 LEU I 179 ? SER I 185 ? LEU I 179 SER I 185 
AN 4 VAL I 174 ? GLN I 176 ? VAL I 174 GLN I 176 
AO 1 MET I 140 ? VAL I 141 ? MET I 140 VAL I 141 
AO 2 VAL I 188 ? PRO I 189 ? VAL I 188 PRO I 189 
AP 1 SER J 40  ? GLU J 45  ? SER J 40  GLU J 45  
AP 2 ILE J 53  ? SER J 57  ? ILE J 53  SER J 57  
AP 3 TYR J 66  ? ASP J 75  ? TYR J 66  ASP J 75  
AP 4 LYS J 80  ? GLU J 87  ? LYS J 80  GLU J 87  
AP 5 LEU J 95  ? ALA J 106 ? LEU J 95  ALA J 106 
AP 6 SER J 112 ? SER J 117 ? SER J 112 SER J 117 
AP 7 THR J 10  ? SER J 11  ? THR J 10  SER J 11  
AQ 1 SER J 40  ? GLU J 45  ? SER J 40  GLU J 45  
AQ 2 ILE J 53  ? SER J 57  ? ILE J 53  SER J 57  
AQ 3 TYR J 66  ? ASP J 75  ? TYR J 66  ASP J 75  
AQ 4 LYS J 80  ? GLU J 87  ? LYS J 80  GLU J 87  
AQ 5 LEU J 95  ? ALA J 106 ? LEU J 95  ALA J 106 
AQ 6 TYR J 120 ? THR J 122 ? TYR J 120 THR J 122 
AQ 7 VAL J 2   ? PHE J 3   ? VAL J 2   PHE J 3   
AR 1 LEU K 4   ? SER K 7   ? LEU K 4   SER K 7   
AR 2 VAL K 19  ? ALA K 25  ? VAL K 19  ALA K 25  
AR 3 ASP K 70  ? ILE K 75  ? ASP K 70  ILE K 75  
AR 4 PHE K 62  ? SER K 67  ? PHE K 62  SER K 67  
AS 1 SER K 10  ? SER K 14  ? SER K 10  SER K 14  
AS 2 THR K 102 ? LYS K 107 ? THR K 102 LYS K 107 
AS 3 ALA K 84  ? GLN K 90  ? ALA K 84  GLN K 90  
AS 4 VAL K 33  ? GLN K 38  ? VAL K 33  GLN K 38  
AS 5 LEU K 46  ? LEU K 48  ? LEU K 46  LEU K 48  
AT 1 SER K 10  ? SER K 14  ? SER K 10  SER K 14  
AT 2 THR K 102 ? LYS K 107 ? THR K 102 LYS K 107 
AT 3 ALA K 84  ? GLN K 90  ? ALA K 84  GLN K 90  
AT 4 THR K 97  ? PHE K 98  ? THR K 97  PHE K 98  
AU 1 VAL K 115 ? PHE K 118 ? VAL K 115 PHE K 118 
AU 2 GLY K 129 ? PHE K 139 ? GLY K 129 PHE K 139 
AU 3 TYR K 173 ? THR K 182 ? TYR K 173 THR K 182 
AU 4 VAL K 159 ? LEU K 160 ? VAL K 159 LEU K 160 
AV 1 SER K 153 ? ARG K 155 ? SER K 153 ARG K 155 
AV 2 ASN K 145 ? ILE K 150 ? ASN K 145 ILE K 150 
AV 3 SER K 191 ? THR K 197 ? SER K 191 THR K 197 
AV 4 ILE K 205 ? ASN K 210 ? ILE K 205 ASN K 210 
AW 1 GLN L 3   ? GLN L 5   ? GLN L 3   GLN L 5   
AW 2 VAL L 18  ? SER L 25  ? VAL L 18  SER L 25  
AW 3 THR L 78  ? VAL L 83  ? THR L 78  VAL L 83  
AW 4 ALA L 68  ? ASP L 73  ? ALA L 68  ASP L 73  
AX 1 THR L 103 ? TRP L 108 ? THR L 103 TRP L 108 
AX 2 ALA L 92  ? ALA L 100 ? ALA L 92  ALA L 100 
AX 3 ILE L 34  ? GLN L 39  ? ILE L 34  GLN L 39  
AX 4 LEU L 45  ? PHE L 52  ? LEU L 45  PHE L 52  
AX 5 TYR L 57  ? TYR L 60  ? TYR L 57  TYR L 60  
AY 1 THR L 103 ? TRP L 108 ? THR L 103 TRP L 108 
AY 2 ALA L 92  ? ALA L 100 ? ALA L 92  ALA L 100 
AY 3 THR L 112 ? VAL L 116 ? THR L 112 VAL L 116 
AY 4 THR L 9   ? VAL L 12  ? THR L 9   VAL L 12  
AZ 1 SER L 125 ? PRO L 128 ? SER L 125 PRO L 128 
AZ 2 GLY L 144 ? TYR L 150 ? GLY L 144 TYR L 150 
AZ 3 LEU L 179 ? SER L 185 ? LEU L 179 SER L 185 
AZ 4 HIS L 169 ? THR L 170 ? HIS L 169 THR L 170 
BA 1 SER L 125 ? PRO L 128 ? SER L 125 PRO L 128 
BA 2 GLY L 144 ? TYR L 150 ? GLY L 144 TYR L 150 
BA 3 LEU L 179 ? SER L 185 ? LEU L 179 SER L 185 
BA 4 VAL L 174 ? GLN L 176 ? VAL L 174 GLN L 176 
BB 1 MET L 140 ? VAL L 141 ? MET L 140 VAL L 141 
BB 2 VAL L 188 ? PRO L 189 ? VAL L 188 PRO L 189 
BC 1 THR L 156 ? TRP L 159 ? THR L 156 TRP L 159 
BC 2 VAL L 198 ? HIS L 204 ? VAL L 198 HIS L 204 
BC 3 THR L 209 ? ILE L 215 ? THR L 209 ILE L 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O GLU A 45  ? O GLU A 45  N ILE A 53  ? N ILE A 53  
A  2 3 N ILE A 56  ? N ILE A 56  O VAL A 67  ? O VAL A 67  
A  3 4 N ASP A 75  ? N ASP A 75  O LYS A 80  ? O LYS A 80  
A  4 5 N VAL A 85  ? N VAL A 85  O ILE A 98  ? O ILE A 98  
A  5 6 N VAL A 105 ? N VAL A 105 O ILE A 113 ? O ILE A 113 
A  6 7 N SER A 112 ? N SER A 112 O SER A 11  ? O SER A 11  
B  1 2 O GLU A 45  ? O GLU A 45  N ILE A 53  ? N ILE A 53  
B  2 3 N ILE A 56  ? N ILE A 56  O VAL A 67  ? O VAL A 67  
B  3 4 N ASP A 75  ? N ASP A 75  O LYS A 80  ? O LYS A 80  
B  4 5 N VAL A 85  ? N VAL A 85  O ILE A 98  ? O ILE A 98  
B  5 6 N GLU A 96  ? N GLU A 96  O HIS A 121 ? O HIS A 121 
B  6 7 N TYR A 120 ? N TYR A 120 O PHE A 3   ? O PHE A 3   
C  1 2 N SER B 7   ? N SER B 7   O SER B 22  ? O SER B 22  
C  2 3 O CYS B 23  ? O CYS B 23  N PHE B 71  ? N PHE B 71  
C  3 4 N THR B 74  ? N THR B 74  O THR B 63  ? O THR B 63  
D  1 2 N MET B 11  ? N MET B 11  O LYS B 103 ? O LYS B 103 
D  2 3 N LEU B 104 ? N LEU B 104 O ALA B 84  ? O ALA B 84  
D  3 4 N GLY B 89  ? N GLY B 89  O PHE B 34  ? O PHE B 34  
D  4 5 O TRP B 35  ? O TRP B 35  N LEU B 47  ? N LEU B 47  
E  1 2 N MET B 11  ? N MET B 11  O LYS B 103 ? O LYS B 103 
E  2 3 N LEU B 104 ? N LEU B 104 O ALA B 84  ? O ALA B 84  
E  3 4 N GLN B 90  ? N GLN B 90  O THR B 97  ? O THR B 97  
F  1 2 N PHE B 118 ? N PHE B 118 O VAL B 133 ? O VAL B 133 
F  2 3 N ASN B 138 ? N ASN B 138 O TYR B 173 ? O TYR B 173 
F  3 4 N THR B 178 ? N THR B 178 O LEU B 160 ? O LEU B 160 
G  1 2 N ARG B 155 ? N ARG B 155 O TRP B 148 ? O TRP B 148 
G  2 3 O LYS B 149 ? O LYS B 149 N THR B 193 ? N THR B 193 
G  3 4 N ALA B 196 ? N ALA B 196 O ILE B 205 ? O ILE B 205 
H  1 2 O GLN C 5   ? O GLN C 5   N LYS C 23  ? N LYS C 23  
H  2 3 O CYS C 22  ? O CYS C 22  N ALA C 79  ? N ALA C 79  
H  3 4 O GLN C 82  ? O GLN C 82  N THR C 69  ? N THR C 69  
I  1 2 N TYR C 107 ? N TYR C 107 O ARG C 98  ? O ARG C 98  
I  2 3 O THR C 97  ? O THR C 97  N ASN C 35  ? N ASN C 35  
I  3 4 N LYS C 38  ? N LYS C 38  O GLU C 46  ? O GLU C 46  
I  4 5 N PHE C 52  ? N PHE C 52  O TYR C 57  ? O TYR C 57  
J  1 2 N TYR C 107 ? N TYR C 107 O ARG C 98  ? O ARG C 98  
J  2 3 N TYR C 94  ? N TYR C 94  O THR C 112 ? O THR C 112 
J  3 4 N THR C 115 ? N THR C 115 O GLU C 10  ? O GLU C 10  
K  1 2 O PHE C 127 ? O PHE C 127 N LEU C 146 ? N LEU C 146 
K  2 3 O TYR C 150 ? O TYR C 150 N TYR C 180 ? N TYR C 180 
K  3 4 N SER C 185 ? N SER C 185 O HIS C 169 ? O HIS C 169 
L  1 2 O PHE C 127 ? O PHE C 127 N LEU C 146 ? N LEU C 146 
L  2 3 O TYR C 150 ? O TYR C 150 N TYR C 180 ? N TYR C 180 
L  3 4 O THR C 181 ? O THR C 181 N VAL C 174 ? N VAL C 174 
M  1 2 O VAL C 141 ? O VAL C 141 N VAL C 188 ? N VAL C 188 
N  1 2 O THR C 158 ? O THR C 158 N ASN C 201 ? N ASN C 201 
N  2 3 N HIS C 204 ? N HIS C 204 O THR C 209 ? O THR C 209 
O  1 2 O GLU D 45  ? O GLU D 45  N ILE D 53  ? N ILE D 53  
O  2 3 N ILE D 56  ? N ILE D 56  O VAL D 67  ? O VAL D 67  
O  3 4 N ASP D 75  ? N ASP D 75  O LYS D 80  ? O LYS D 80  
O  4 5 N VAL D 85  ? N VAL D 85  O ILE D 98  ? O ILE D 98  
O  5 6 N VAL D 105 ? N VAL D 105 O ILE D 113 ? O ILE D 113 
O  6 7 N SER D 112 ? N SER D 112 O SER D 11  ? O SER D 11  
P  1 2 O GLU D 45  ? O GLU D 45  N ILE D 53  ? N ILE D 53  
P  2 3 N ILE D 56  ? N ILE D 56  O VAL D 67  ? O VAL D 67  
P  3 4 N ASP D 75  ? N ASP D 75  O LYS D 80  ? O LYS D 80  
P  4 5 N VAL D 85  ? N VAL D 85  O ILE D 98  ? O ILE D 98  
P  5 6 N GLU D 96  ? N GLU D 96  O HIS D 121 ? O HIS D 121 
P  6 7 N TYR D 120 ? N TYR D 120 O PHE D 3   ? O PHE D 3   
Q  1 2 N SER E 7   ? N SER E 7   O SER E 22  ? O SER E 22  
Q  2 3 O CYS E 23  ? O CYS E 23  N PHE E 71  ? N PHE E 71  
Q  3 4 N THR E 74  ? N THR E 74  O THR E 63  ? O THR E 63  
R  1 2 N MET E 11  ? N MET E 11  O LYS E 103 ? O LYS E 103 
R  2 3 N LEU E 104 ? N LEU E 104 O ALA E 84  ? O ALA E 84  
R  3 4 N GLY E 89  ? N GLY E 89  O PHE E 34  ? O PHE E 34  
R  4 5 O TRP E 35  ? O TRP E 35  N LEU E 47  ? N LEU E 47  
S  1 2 N MET E 11  ? N MET E 11  O LYS E 103 ? O LYS E 103 
S  2 3 N LEU E 104 ? N LEU E 104 O ALA E 84  ? O ALA E 84  
S  3 4 N GLN E 90  ? N GLN E 90  O THR E 97  ? O THR E 97  
T  1 2 N PHE E 118 ? N PHE E 118 O VAL E 133 ? O VAL E 133 
T  2 3 N ASN E 138 ? N ASN E 138 O TYR E 173 ? O TYR E 173 
T  3 4 N THR E 178 ? N THR E 178 O LEU E 160 ? O LEU E 160 
U  1 2 N ARG E 155 ? N ARG E 155 O TRP E 148 ? O TRP E 148 
U  2 3 O LYS E 149 ? O LYS E 149 N THR E 193 ? N THR E 193 
U  3 4 N ALA E 196 ? N ALA E 196 O ILE E 205 ? O ILE E 205 
V  1 2 O GLN F 5   ? O GLN F 5   N LYS F 23  ? N LYS F 23  
V  2 3 O CYS F 22  ? O CYS F 22  N ALA F 79  ? N ALA F 79  
V  3 4 O GLN F 82  ? O GLN F 82  N THR F 69  ? N THR F 69  
W  1 2 N TYR F 107 ? N TYR F 107 O ARG F 98  ? O ARG F 98  
W  2 3 O THR F 97  ? O THR F 97  N ASN F 35  ? N ASN F 35  
W  3 4 N LYS F 38  ? N LYS F 38  O GLU F 46  ? O GLU F 46  
W  4 5 N PHE F 52  ? N PHE F 52  O TYR F 57  ? O TYR F 57  
X  1 2 N TYR F 107 ? N TYR F 107 O ARG F 98  ? O ARG F 98  
X  2 3 N TYR F 94  ? N TYR F 94  O THR F 112 ? O THR F 112 
X  3 4 N THR F 115 ? N THR F 115 O GLU F 10  ? O GLU F 10  
Y  1 2 O PHE F 127 ? O PHE F 127 N LEU F 146 ? N LEU F 146 
Y  2 3 O TYR F 150 ? O TYR F 150 N TYR F 180 ? N TYR F 180 
Y  3 4 N SER F 185 ? N SER F 185 O HIS F 169 ? O HIS F 169 
Z  1 2 O PHE F 127 ? O PHE F 127 N LEU F 146 ? N LEU F 146 
Z  2 3 O TYR F 150 ? O TYR F 150 N TYR F 180 ? N TYR F 180 
Z  3 4 O THR F 181 ? O THR F 181 N VAL F 174 ? N VAL F 174 
AA 1 2 O VAL F 141 ? O VAL F 141 N VAL F 188 ? N VAL F 188 
AB 1 2 O THR F 158 ? O THR F 158 N ASN F 201 ? N ASN F 201 
AB 2 3 N HIS F 204 ? N HIS F 204 O THR F 209 ? O THR F 209 
AB 3 4 N ASP F 212 ? N ASP F 212 O LYS I 210 ? O LYS I 210 
AB 4 5 N ILE I 215 ? N ILE I 215 O VAL I 198 ? O VAL I 198 
AB 5 6 N ALA I 203 ? N ALA I 203 O THR I 156 ? O THR I 156 
AC 1 2 O GLU G 45  ? O GLU G 45  N ILE G 53  ? N ILE G 53  
AC 2 3 N ILE G 56  ? N ILE G 56  O VAL G 67  ? O VAL G 67  
AC 3 4 N ASP G 75  ? N ASP G 75  O LYS G 80  ? O LYS G 80  
AC 4 5 N VAL G 85  ? N VAL G 85  O ILE G 98  ? O ILE G 98  
AC 5 6 N VAL G 105 ? N VAL G 105 O ILE G 113 ? O ILE G 113 
AC 6 7 N SER G 112 ? N SER G 112 O SER G 11  ? O SER G 11  
AD 1 2 O GLU G 45  ? O GLU G 45  N ILE G 53  ? N ILE G 53  
AD 2 3 N ILE G 56  ? N ILE G 56  O VAL G 67  ? O VAL G 67  
AD 3 4 N ASP G 75  ? N ASP G 75  O LYS G 80  ? O LYS G 80  
AD 4 5 N VAL G 85  ? N VAL G 85  O ILE G 98  ? O ILE G 98  
AD 5 6 N GLU G 96  ? N GLU G 96  O HIS G 121 ? O HIS G 121 
AD 6 7 N TYR G 120 ? N TYR G 120 O PHE G 3   ? O PHE G 3   
AE 1 2 N SER H 7   ? N SER H 7   O SER H 22  ? O SER H 22  
AE 2 3 O CYS H 23  ? O CYS H 23  N PHE H 71  ? N PHE H 71  
AE 3 4 N THR H 74  ? N THR H 74  O THR H 63  ? O THR H 63  
AF 1 2 N MET H 11  ? N MET H 11  O LYS H 103 ? O LYS H 103 
AF 2 3 N LEU H 104 ? N LEU H 104 O ALA H 84  ? O ALA H 84  
AF 3 4 N GLY H 89  ? N GLY H 89  O PHE H 34  ? O PHE H 34  
AF 4 5 O TRP H 35  ? O TRP H 35  N LEU H 47  ? N LEU H 47  
AG 1 2 N MET H 11  ? N MET H 11  O LYS H 103 ? O LYS H 103 
AG 2 3 N LEU H 104 ? N LEU H 104 O ALA H 84  ? O ALA H 84  
AG 3 4 N GLN H 90  ? N GLN H 90  O THR H 97  ? O THR H 97  
AH 1 2 N PHE H 118 ? N PHE H 118 O VAL H 133 ? O VAL H 133 
AH 2 3 N ASN H 138 ? N ASN H 138 O TYR H 173 ? O TYR H 173 
AH 3 4 N THR H 178 ? N THR H 178 O LEU H 160 ? O LEU H 160 
AI 1 2 N ARG H 155 ? N ARG H 155 O TRP H 148 ? O TRP H 148 
AI 2 3 O LYS H 149 ? O LYS H 149 N THR H 193 ? N THR H 193 
AI 3 4 N ALA H 196 ? N ALA H 196 O ILE H 205 ? O ILE H 205 
AJ 1 2 O GLN I 5   ? O GLN I 5   N LYS I 23  ? N LYS I 23  
AJ 2 3 O CYS I 22  ? O CYS I 22  N ALA I 79  ? N ALA I 79  
AJ 3 4 O GLN I 82  ? O GLN I 82  N THR I 69  ? N THR I 69  
AK 1 2 N TYR I 107 ? N TYR I 107 O ARG I 98  ? O ARG I 98  
AK 2 3 O THR I 97  ? O THR I 97  N ASN I 35  ? N ASN I 35  
AK 3 4 N LYS I 38  ? N LYS I 38  O GLU I 46  ? O GLU I 46  
AK 4 5 N PHE I 52  ? N PHE I 52  O TYR I 57  ? O TYR I 57  
AL 1 2 N TYR I 107 ? N TYR I 107 O ARG I 98  ? O ARG I 98  
AL 2 3 N TYR I 94  ? N TYR I 94  O THR I 112 ? O THR I 112 
AL 3 4 N THR I 115 ? N THR I 115 O GLU I 10  ? O GLU I 10  
AM 1 2 O PHE I 127 ? O PHE I 127 N LEU I 146 ? N LEU I 146 
AM 2 3 O TYR I 150 ? O TYR I 150 N TYR I 180 ? N TYR I 180 
AM 3 4 N SER I 185 ? N SER I 185 O HIS I 169 ? O HIS I 169 
AN 1 2 O PHE I 127 ? O PHE I 127 N LEU I 146 ? N LEU I 146 
AN 2 3 O TYR I 150 ? O TYR I 150 N TYR I 180 ? N TYR I 180 
AN 3 4 O THR I 181 ? O THR I 181 N VAL I 174 ? N VAL I 174 
AO 1 2 O VAL I 141 ? O VAL I 141 N VAL I 188 ? N VAL I 188 
AP 1 2 O GLU J 45  ? O GLU J 45  N ILE J 53  ? N ILE J 53  
AP 2 3 N ILE J 56  ? N ILE J 56  O VAL J 67  ? O VAL J 67  
AP 3 4 N ASP J 75  ? N ASP J 75  O LYS J 80  ? O LYS J 80  
AP 4 5 N VAL J 85  ? N VAL J 85  O ILE J 98  ? O ILE J 98  
AP 5 6 N VAL J 105 ? N VAL J 105 O ILE J 113 ? O ILE J 113 
AP 6 7 N SER J 112 ? N SER J 112 O SER J 11  ? O SER J 11  
AQ 1 2 O GLU J 45  ? O GLU J 45  N ILE J 53  ? N ILE J 53  
AQ 2 3 N ILE J 56  ? N ILE J 56  O VAL J 67  ? O VAL J 67  
AQ 3 4 N ASP J 75  ? N ASP J 75  O LYS J 80  ? O LYS J 80  
AQ 4 5 N VAL J 85  ? N VAL J 85  O ILE J 98  ? O ILE J 98  
AQ 5 6 N GLU J 96  ? N GLU J 96  O HIS J 121 ? O HIS J 121 
AQ 6 7 N TYR J 120 ? N TYR J 120 O PHE J 3   ? O PHE J 3   
AR 1 2 N SER K 7   ? N SER K 7   O SER K 22  ? O SER K 22  
AR 2 3 O CYS K 23  ? O CYS K 23  N PHE K 71  ? N PHE K 71  
AR 3 4 N THR K 74  ? N THR K 74  O THR K 63  ? O THR K 63  
AS 1 2 N MET K 11  ? N MET K 11  O LYS K 103 ? O LYS K 103 
AS 2 3 N LEU K 104 ? N LEU K 104 O ALA K 84  ? O ALA K 84  
AS 3 4 N GLY K 89  ? N GLY K 89  O PHE K 34  ? O PHE K 34  
AS 4 5 O TRP K 35  ? O TRP K 35  N LEU K 47  ? N LEU K 47  
AT 1 2 N MET K 11  ? N MET K 11  O LYS K 103 ? O LYS K 103 
AT 2 3 N LEU K 104 ? N LEU K 104 O ALA K 84  ? O ALA K 84  
AT 3 4 N GLN K 90  ? N GLN K 90  O THR K 97  ? O THR K 97  
AU 1 2 N PHE K 118 ? N PHE K 118 O VAL K 133 ? O VAL K 133 
AU 2 3 N ASN K 138 ? N ASN K 138 O TYR K 173 ? O TYR K 173 
AU 3 4 N THR K 178 ? N THR K 178 O LEU K 160 ? O LEU K 160 
AV 1 2 N ARG K 155 ? N ARG K 155 O TRP K 148 ? O TRP K 148 
AV 2 3 O LYS K 149 ? O LYS K 149 N THR K 193 ? N THR K 193 
AV 3 4 N ALA K 196 ? N ALA K 196 O ILE K 205 ? O ILE K 205 
AW 1 2 O GLN L 5   ? O GLN L 5   N LYS L 23  ? N LYS L 23  
AW 2 3 O CYS L 22  ? O CYS L 22  N ALA L 79  ? N ALA L 79  
AW 3 4 O GLN L 82  ? O GLN L 82  N THR L 69  ? N THR L 69  
AX 1 2 N TYR L 107 ? N TYR L 107 O ARG L 98  ? O ARG L 98  
AX 2 3 O THR L 97  ? O THR L 97  N ASN L 35  ? N ASN L 35  
AX 3 4 N LYS L 38  ? N LYS L 38  O GLU L 46  ? O GLU L 46  
AX 4 5 N PHE L 52  ? N PHE L 52  O TYR L 57  ? O TYR L 57  
AY 1 2 N TYR L 107 ? N TYR L 107 O ARG L 98  ? O ARG L 98  
AY 2 3 N TYR L 94  ? N TYR L 94  O THR L 112 ? O THR L 112 
AY 3 4 N THR L 115 ? N THR L 115 O GLU L 10  ? O GLU L 10  
AZ 1 2 O PHE L 127 ? O PHE L 127 N LEU L 146 ? N LEU L 146 
AZ 2 3 O TYR L 150 ? O TYR L 150 N TYR L 180 ? N TYR L 180 
AZ 3 4 N SER L 185 ? N SER L 185 O HIS L 169 ? O HIS L 169 
BA 1 2 O PHE L 127 ? O PHE L 127 N LEU L 146 ? N LEU L 146 
BA 2 3 O TYR L 150 ? O TYR L 150 N TYR L 180 ? N TYR L 180 
BA 3 4 O THR L 181 ? O THR L 181 N VAL L 174 ? N VAL L 174 
BB 1 2 O VAL L 141 ? O VAL L 141 N VAL L 188 ? N VAL L 188 
BC 1 2 O THR L 158 ? O THR L 158 N ASN L 201 ? N ASN L 201 
BC 2 3 N HIS L 204 ? N HIS L 204 O THR L 209 ? O THR L 209 
# 
_database_PDB_matrix.entry_id          1FSK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1FSK 
_atom_sites.fract_transf_matrix[1][1]   0.010911 
_atom_sites.fract_transf_matrix[1][2]   0.001461 
_atom_sites.fract_transf_matrix[1][3]   0.002123 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010176 
_atom_sites.fract_transf_matrix[2][3]   0.003148 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009714 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . GLY A 1 1   ? 3.418   69.648  -25.487 1.00 52.48  ? 1   GLY A N   1 
ATOM 2     C CA  . GLY A 1 1   ? 2.586   68.451  -25.754 1.00 53.95  ? 1   GLY A CA  1 
ATOM 3     C C   . GLY A 1 1   ? 1.359   68.452  -24.871 1.00 54.40  ? 1   GLY A C   1 
ATOM 4     O O   . GLY A 1 1   ? 1.340   69.130  -23.852 1.00 58.95  ? 1   GLY A O   1 
ATOM 5     N N   . VAL A 1 2   ? 0.336   67.700  -25.261 1.00 52.78  ? 2   VAL A N   1 
ATOM 6     C CA  . VAL A 1 2   ? -0.909  67.614  -24.500 1.00 51.46  ? 2   VAL A CA  1 
ATOM 7     C C   . VAL A 1 2   ? -1.493  66.211  -24.651 1.00 55.90  ? 2   VAL A C   1 
ATOM 8     O O   . VAL A 1 2   ? -2.419  65.990  -25.451 1.00 60.07  ? 2   VAL A O   1 
ATOM 9     C CB  . VAL A 1 2   ? -1.953  68.621  -25.018 1.00 49.67  ? 2   VAL A CB  1 
ATOM 10    C CG1 . VAL A 1 2   ? -3.202  68.574  -24.150 1.00 43.17  ? 2   VAL A CG1 1 
ATOM 11    C CG2 . VAL A 1 2   ? -1.361  70.008  -25.043 1.00 46.16  ? 2   VAL A CG2 1 
ATOM 12    N N   . PHE A 1 3   ? -0.961  65.272  -23.870 1.00 55.32  ? 3   PHE A N   1 
ATOM 13    C CA  . PHE A 1 3   ? -1.396  63.873  -23.911 1.00 56.08  ? 3   PHE A CA  1 
ATOM 14    C C   . PHE A 1 3   ? -2.426  63.476  -22.854 1.00 54.64  ? 3   PHE A C   1 
ATOM 15    O O   . PHE A 1 3   ? -2.122  63.456  -21.660 1.00 56.66  ? 3   PHE A O   1 
ATOM 16    C CB  . PHE A 1 3   ? -0.185  62.956  -23.760 1.00 59.08  ? 3   PHE A CB  1 
ATOM 17    C CG  . PHE A 1 3   ? 0.958   63.308  -24.660 1.00 65.39  ? 3   PHE A CG  1 
ATOM 18    C CD1 . PHE A 1 3   ? 0.818   63.231  -26.042 1.00 64.61  ? 3   PHE A CD1 1 
ATOM 19    C CD2 . PHE A 1 3   ? 2.179   63.717  -24.122 1.00 69.46  ? 3   PHE A CD2 1 
ATOM 20    C CE1 . PHE A 1 3   ? 1.875   63.553  -26.874 1.00 68.30  ? 3   PHE A CE1 1 
ATOM 21    C CE2 . PHE A 1 3   ? 3.248   64.043  -24.944 1.00 71.53  ? 3   PHE A CE2 1 
ATOM 22    C CZ  . PHE A 1 3   ? 3.097   63.961  -26.325 1.00 72.43  ? 3   PHE A CZ  1 
ATOM 23    N N   . ASN A 1 4   ? -3.637  63.144  -23.292 1.00 53.26  ? 4   ASN A N   1 
ATOM 24    C CA  . ASN A 1 4   ? -4.683  62.712  -22.374 1.00 55.78  ? 4   ASN A CA  1 
ATOM 25    C C   . ASN A 1 4   ? -4.429  61.263  -21.924 1.00 57.52  ? 4   ASN A C   1 
ATOM 26    O O   . ASN A 1 4   ? -3.658  60.545  -22.545 1.00 59.55  ? 4   ASN A O   1 
ATOM 27    C CB  . ASN A 1 4   ? -6.043  62.790  -23.055 1.00 57.42  ? 4   ASN A CB  1 
ATOM 28    C CG  . ASN A 1 4   ? -7.121  62.099  -22.255 1.00 63.57  ? 4   ASN A CG  1 
ATOM 29    O OD1 . ASN A 1 4   ? -7.547  62.592  -21.206 1.00 66.24  ? 4   ASN A OD1 1 
ATOM 30    N ND2 . ASN A 1 4   ? -7.552  60.932  -22.728 1.00 65.36  ? 4   ASN A ND2 1 
ATOM 31    N N   . TYR A 1 5   ? -5.075  60.833  -20.846 1.00 56.73  ? 5   TYR A N   1 
ATOM 32    C CA  . TYR A 1 5   ? -4.916  59.469  -20.351 1.00 53.03  ? 5   TYR A CA  1 
ATOM 33    C C   . TYR A 1 5   ? -6.096  59.105  -19.460 1.00 54.55  ? 5   TYR A C   1 
ATOM 34    O O   . TYR A 1 5   ? -5.931  59.008  -18.245 1.00 56.37  ? 5   TYR A O   1 
ATOM 35    C CB  . TYR A 1 5   ? -3.632  59.318  -19.526 1.00 49.71  ? 5   TYR A CB  1 
ATOM 36    C CG  . TYR A 1 5   ? -2.330  59.253  -20.297 1.00 54.77  ? 5   TYR A CG  1 
ATOM 37    C CD1 . TYR A 1 5   ? -2.140  58.338  -21.332 1.00 62.36  ? 5   TYR A CD1 1 
ATOM 38    C CD2 . TYR A 1 5   ? -1.253  60.063  -19.943 1.00 58.14  ? 5   TYR A CD2 1 
ATOM 39    C CE1 . TYR A 1 5   ? -0.894  58.228  -22.000 1.00 64.43  ? 5   TYR A CE1 1 
ATOM 40    C CE2 . TYR A 1 5   ? -0.008  59.964  -20.594 1.00 57.85  ? 5   TYR A CE2 1 
ATOM 41    C CZ  . TYR A 1 5   ? 0.169   59.047  -21.619 1.00 60.76  ? 5   TYR A CZ  1 
ATOM 42    O OH  . TYR A 1 5   ? 1.403   58.949  -22.240 1.00 54.09  ? 5   TYR A OH  1 
ATOM 43    N N   . GLU A 1 6   ? -7.277  58.901  -20.046 1.00 56.03  ? 6   GLU A N   1 
ATOM 44    C CA  . GLU A 1 6   ? -8.465  58.546  -19.260 1.00 61.05  ? 6   GLU A CA  1 
ATOM 45    C C   . GLU A 1 6   ? -8.312  57.294  -18.379 1.00 61.54  ? 6   GLU A C   1 
ATOM 46    O O   . GLU A 1 6   ? -7.323  56.563  -18.469 1.00 57.80  ? 6   GLU A O   1 
ATOM 47    C CB  . GLU A 1 6   ? -9.673  58.361  -20.167 1.00 63.56  ? 6   GLU A CB  1 
ATOM 48    C CG  . GLU A 1 6   ? -10.055 59.604  -20.924 1.00 79.05  ? 6   GLU A CG  1 
ATOM 49    C CD  . GLU A 1 6   ? -11.253 59.374  -21.832 1.00 89.47  ? 6   GLU A CD  1 
ATOM 50    O OE1 . GLU A 1 6   ? -11.162 58.519  -22.747 1.00 92.58  ? 6   GLU A OE1 1 
ATOM 51    O OE2 . GLU A 1 6   ? -12.288 60.049  -21.629 1.00 95.78  ? 6   GLU A OE2 1 
ATOM 52    N N   . THR A 1 7   ? -9.308  57.063  -17.526 1.00 64.59  ? 7   THR A N   1 
ATOM 53    C CA  . THR A 1 7   ? -9.321  55.931  -16.599 1.00 64.23  ? 7   THR A CA  1 
ATOM 54    C C   . THR A 1 7   ? -10.745 55.728  -16.101 1.00 64.02  ? 7   THR A C   1 
ATOM 55    O O   . THR A 1 7   ? -11.614 56.576  -16.308 1.00 63.11  ? 7   THR A O   1 
ATOM 56    C CB  . THR A 1 7   ? -8.403  56.189  -15.363 1.00 67.32  ? 7   THR A CB  1 
ATOM 57    O OG1 . THR A 1 7   ? -7.034  56.249  -15.781 1.00 69.53  ? 7   THR A OG1 1 
ATOM 58    C CG2 . THR A 1 7   ? -8.555  55.085  -14.330 1.00 66.62  ? 7   THR A CG2 1 
ATOM 59    N N   . GLU A 1 8   ? -10.984 54.587  -15.468 1.00 65.86  ? 8   GLU A N   1 
ATOM 60    C CA  . GLU A 1 8   ? -12.291 54.272  -14.906 1.00 66.79  ? 8   GLU A CA  1 
ATOM 61    C C   . GLU A 1 8   ? -12.188 53.289  -13.762 1.00 65.51  ? 8   GLU A C   1 
ATOM 62    O O   . GLU A 1 8   ? -11.165 52.616  -13.578 1.00 66.00  ? 8   GLU A O   1 
ATOM 63    C CB  . GLU A 1 8   ? -13.245 53.731  -15.966 1.00 67.19  ? 8   GLU A CB  1 
ATOM 64    C CG  . GLU A 1 8   ? -13.934 54.828  -16.732 1.00 71.90  ? 8   GLU A CG  1 
ATOM 65    C CD  . GLU A 1 8   ? -15.119 54.322  -17.515 1.00 77.23  ? 8   GLU A CD  1 
ATOM 66    O OE1 . GLU A 1 8   ? -15.963 53.612  -16.924 1.00 76.88  ? 8   GLU A OE1 1 
ATOM 67    O OE2 . GLU A 1 8   ? -15.211 54.643  -18.720 1.00 82.85  ? 8   GLU A OE2 1 
ATOM 68    N N   . THR A 1 9   ? -13.254 53.232  -12.980 1.00 63.56  ? 9   THR A N   1 
ATOM 69    C CA  . THR A 1 9   ? -13.296 52.346  -11.839 1.00 65.28  ? 9   THR A CA  1 
ATOM 70    C C   . THR A 1 9   ? -14.690 52.396  -11.247 1.00 63.53  ? 9   THR A C   1 
ATOM 71    O O   . THR A 1 9   ? -15.454 53.327  -11.499 1.00 60.81  ? 9   THR A O   1 
ATOM 72    C CB  . THR A 1 9   ? -12.248 52.751  -10.775 1.00 68.46  ? 9   THR A CB  1 
ATOM 73    O OG1 . THR A 1 9   ? -12.318 51.854  -9.657  1.00 71.74  ? 9   THR A OG1 1 
ATOM 74    C CG2 . THR A 1 9   ? -12.491 54.175  -10.311 1.00 68.01  ? 9   THR A CG2 1 
ATOM 75    N N   . THR A 1 10  ? -15.013 51.376  -10.463 1.00 64.38  ? 10  THR A N   1 
ATOM 76    C CA  . THR A 1 10  ? -16.328 51.271  -9.852  1.00 65.79  ? 10  THR A CA  1 
ATOM 77    C C   . THR A 1 10  ? -16.290 51.341  -8.346  1.00 65.49  ? 10  THR A C   1 
ATOM 78    O O   . THR A 1 10  ? -15.239 51.200  -7.712  1.00 65.65  ? 10  THR A O   1 
ATOM 79    C CB  . THR A 1 10  ? -17.004 49.937  -10.222 1.00 66.21  ? 10  THR A CB  1 
ATOM 80    O OG1 . THR A 1 10  ? -16.088 49.140  -10.990 1.00 65.60  ? 10  THR A OG1 1 
ATOM 81    C CG2 . THR A 1 10  ? -18.288 50.183  -11.001 1.00 65.63  ? 10  THR A CG2 1 
ATOM 82    N N   . SER A 1 11  ? -17.467 51.560  -7.785  1.00 64.14  ? 11  SER A N   1 
ATOM 83    C CA  . SER A 1 11  ? -17.617 51.620  -6.350  1.00 64.79  ? 11  SER A CA  1 
ATOM 84    C C   . SER A 1 11  ? -19.053 51.345  -5.990  1.00 64.05  ? 11  SER A C   1 
ATOM 85    O O   . SER A 1 11  ? -19.979 51.548  -6.784  1.00 66.13  ? 11  SER A O   1 
ATOM 86    C CB  . SER A 1 11  ? -17.212 52.980  -5.791  1.00 67.17  ? 11  SER A CB  1 
ATOM 87    O OG  . SER A 1 11  ? -17.413 53.002  -4.383  1.00 67.12  ? 11  SER A OG  1 
ATOM 88    N N   . VAL A 1 12  ? -19.215 50.880  -4.767  1.00 62.61  ? 12  VAL A N   1 
ATOM 89    C CA  . VAL A 1 12  ? -20.508 50.538  -4.220  1.00 63.77  ? 12  VAL A CA  1 
ATOM 90    C C   . VAL A 1 12  ? -21.286 51.800  -3.842  1.00 61.46  ? 12  VAL A C   1 
ATOM 91    O O   . VAL A 1 12  ? -22.487 51.905  -4.115  1.00 63.63  ? 12  VAL A O   1 
ATOM 92    C CB  . VAL A 1 12  ? -20.293 49.659  -2.991  1.00 67.16  ? 12  VAL A CB  1 
ATOM 93    C CG1 . VAL A 1 12  ? -19.479 48.449  -3.389  1.00 69.03  ? 12  VAL A CG1 1 
ATOM 94    C CG2 . VAL A 1 12  ? -19.519 50.428  -1.930  1.00 68.67  ? 12  VAL A CG2 1 
ATOM 95    N N   . ILE A 1 13  ? -20.578 52.750  -3.228  1.00 55.76  ? 13  ILE A N   1 
ATOM 96    C CA  . ILE A 1 13  ? -21.129 54.023  -2.771  1.00 48.91  ? 13  ILE A CA  1 
ATOM 97    C C   . ILE A 1 13  ? -21.877 54.752  -3.871  1.00 47.44  ? 13  ILE A C   1 
ATOM 98    O O   . ILE A 1 13  ? -21.321 54.978  -4.944  1.00 47.15  ? 13  ILE A O   1 
ATOM 99    C CB  . ILE A 1 13  ? -20.015 54.975  -2.326  1.00 49.08  ? 13  ILE A CB  1 
ATOM 100   C CG1 . ILE A 1 13  ? -18.678 54.221  -2.172  1.00 46.12  ? 13  ILE A CG1 1 
ATOM 101   C CG2 . ILE A 1 13  ? -20.461 55.720  -1.081  1.00 49.78  ? 13  ILE A CG2 1 
ATOM 102   C CD1 . ILE A 1 13  ? -18.456 53.483  -0.855  1.00 39.38  ? 13  ILE A CD1 1 
ATOM 103   N N   . PRO A 1 14  ? -23.136 55.154  -3.622  1.00 45.76  ? 14  PRO A N   1 
ATOM 104   C CA  . PRO A 1 14  ? -23.862 55.863  -4.682  1.00 48.69  ? 14  PRO A CA  1 
ATOM 105   C C   . PRO A 1 14  ? -23.087 57.130  -5.053  1.00 53.42  ? 14  PRO A C   1 
ATOM 106   O O   . PRO A 1 14  ? -22.518 57.793  -4.176  1.00 53.28  ? 14  PRO A O   1 
ATOM 107   C CB  . PRO A 1 14  ? -25.206 56.182  -4.035  1.00 45.72  ? 14  PRO A CB  1 
ATOM 108   C CG  . PRO A 1 14  ? -25.367 55.099  -3.027  1.00 42.05  ? 14  PRO A CG  1 
ATOM 109   C CD  . PRO A 1 14  ? -23.984 54.985  -2.434  1.00 43.05  ? 14  PRO A CD  1 
ATOM 110   N N   . ALA A 1 15  ? -23.049 57.452  -6.347  1.00 57.51  ? 15  ALA A N   1 
ATOM 111   C CA  . ALA A 1 15  ? -22.341 58.643  -6.833  1.00 56.55  ? 15  ALA A CA  1 
ATOM 112   C C   . ALA A 1 15  ? -22.534 59.817  -5.880  1.00 54.38  ? 15  ALA A C   1 
ATOM 113   O O   . ALA A 1 15  ? -21.572 60.330  -5.297  1.00 51.93  ? 15  ALA A O   1 
ATOM 114   C CB  . ALA A 1 15  ? -22.852 59.023  -8.216  1.00 56.64  ? 15  ALA A CB  1 
ATOM 115   N N   . ALA A 1 16  ? -23.792 60.230  -5.742  1.00 51.43  ? 16  ALA A N   1 
ATOM 116   C CA  . ALA A 1 16  ? -24.165 61.325  -4.864  1.00 48.31  ? 16  ALA A CA  1 
ATOM 117   C C   . ALA A 1 16  ? -23.219 61.402  -3.674  1.00 48.43  ? 16  ALA A C   1 
ATOM 118   O O   . ALA A 1 16  ? -22.333 62.256  -3.616  1.00 46.61  ? 16  ALA A O   1 
ATOM 119   C CB  . ALA A 1 16  ? -25.583 61.116  -4.384  1.00 48.91  ? 16  ALA A CB  1 
ATOM 120   N N   . ARG A 1 17  ? -23.406 60.486  -2.734  1.00 49.63  ? 17  ARG A N   1 
ATOM 121   C CA  . ARG A 1 17  ? -22.590 60.431  -1.533  1.00 48.21  ? 17  ARG A CA  1 
ATOM 122   C C   . ARG A 1 17  ? -21.083 60.395  -1.787  1.00 47.87  ? 17  ARG A C   1 
ATOM 123   O O   . ARG A 1 17  ? -20.332 61.212  -1.241  1.00 48.04  ? 17  ARG A O   1 
ATOM 124   C CB  . ARG A 1 17  ? -23.014 59.225  -0.693  1.00 50.07  ? 17  ARG A CB  1 
ATOM 125   C CG  . ARG A 1 17  ? -22.026 58.821  0.395   1.00 52.97  ? 17  ARG A CG  1 
ATOM 126   C CD  . ARG A 1 17  ? -22.740 58.158  1.586   1.00 57.12  ? 17  ARG A CD  1 
ATOM 127   N NE  . ARG A 1 17  ? -21.876 57.206  2.286   1.00 52.46  ? 17  ARG A NE  1 
ATOM 128   C CZ  . ARG A 1 17  ? -22.199 56.598  3.422   1.00 52.92  ? 17  ARG A CZ  1 
ATOM 129   N NH1 . ARG A 1 17  ? -23.375 56.854  3.997   1.00 52.65  ? 17  ARG A NH1 1 
ATOM 130   N NH2 . ARG A 1 17  ? -21.359 55.718  3.963   1.00 44.98  ? 17  ARG A NH2 1 
ATOM 131   N N   . LEU A 1 18  ? -20.633 59.451  -2.606  1.00 47.11  ? 18  LEU A N   1 
ATOM 132   C CA  . LEU A 1 18  ? -19.208 59.350  -2.883  1.00 46.86  ? 18  LEU A CA  1 
ATOM 133   C C   . LEU A 1 18  ? -18.638 60.687  -3.341  1.00 46.41  ? 18  LEU A C   1 
ATOM 134   O O   . LEU A 1 18  ? -17.500 61.027  -3.028  1.00 46.28  ? 18  LEU A O   1 
ATOM 135   C CB  . LEU A 1 18  ? -18.943 58.293  -3.951  1.00 44.83  ? 18  LEU A CB  1 
ATOM 136   C CG  . LEU A 1 18  ? -17.459 58.211  -4.326  1.00 44.25  ? 18  LEU A CG  1 
ATOM 137   C CD1 . LEU A 1 18  ? -16.655 57.709  -3.144  1.00 38.22  ? 18  LEU A CD1 1 
ATOM 138   C CD2 . LEU A 1 18  ? -17.277 57.302  -5.517  1.00 45.47  ? 18  LEU A CD2 1 
ATOM 139   N N   . PHE A 1 19  ? -19.433 61.445  -4.090  1.00 49.60  ? 19  PHE A N   1 
ATOM 140   C CA  . PHE A 1 19  ? -18.973 62.738  -4.585  1.00 51.15  ? 19  PHE A CA  1 
ATOM 141   C C   . PHE A 1 19  ? -18.679 63.660  -3.429  1.00 50.60  ? 19  PHE A C   1 
ATOM 142   O O   . PHE A 1 19  ? -17.562 64.178  -3.292  1.00 45.80  ? 19  PHE A O   1 
ATOM 143   C CB  . PHE A 1 19  ? -20.021 63.402  -5.471  1.00 56.20  ? 19  PHE A CB  1 
ATOM 144   C CG  . PHE A 1 19  ? -19.564 64.717  -6.047  1.00 57.69  ? 19  PHE A CG  1 
ATOM 145   C CD1 . PHE A 1 19  ? -18.378 64.793  -6.776  1.00 56.18  ? 19  PHE A CD1 1 
ATOM 146   C CD2 . PHE A 1 19  ? -20.303 65.881  -5.851  1.00 57.58  ? 19  PHE A CD2 1 
ATOM 147   C CE1 . PHE A 1 19  ? -17.935 66.005  -7.299  1.00 50.08  ? 19  PHE A CE1 1 
ATOM 148   C CE2 . PHE A 1 19  ? -19.865 67.102  -6.375  1.00 51.01  ? 19  PHE A CE2 1 
ATOM 149   C CZ  . PHE A 1 19  ? -18.679 67.159  -7.097  1.00 48.61  ? 19  PHE A CZ  1 
ATOM 150   N N   . LYS A 1 20  ? -19.707 63.876  -2.617  1.00 52.94  ? 20  LYS A N   1 
ATOM 151   C CA  . LYS A 1 20  ? -19.583 64.723  -1.445  1.00 55.87  ? 20  LYS A CA  1 
ATOM 152   C C   . LYS A 1 20  ? -18.332 64.284  -0.721  1.00 55.48  ? 20  LYS A C   1 
ATOM 153   O O   . LYS A 1 20  ? -17.379 65.039  -0.562  1.00 55.34  ? 20  LYS A O   1 
ATOM 154   C CB  . LYS A 1 20  ? -20.789 64.535  -0.530  1.00 57.57  ? 20  LYS A CB  1 
ATOM 155   C CG  . LYS A 1 20  ? -22.111 64.869  -1.204  1.00 67.77  ? 20  LYS A CG  1 
ATOM 156   C CD  . LYS A 1 20  ? -23.316 64.470  -0.342  1.00 72.82  ? 20  LYS A CD  1 
ATOM 157   C CE  . LYS A 1 20  ? -23.310 65.145  1.029   1.00 76.32  ? 20  LYS A CE  1 
ATOM 158   N NZ  . LYS A 1 20  ? -24.562 64.868  1.803   1.00 81.69  ? 20  LYS A NZ  1 
ATOM 159   N N   . ALA A 1 21  ? -18.335 63.029  -0.316  1.00 55.63  ? 21  ALA A N   1 
ATOM 160   C CA  . ALA A 1 21  ? -17.217 62.465  0.408   1.00 55.15  ? 21  ALA A CA  1 
ATOM 161   C C   . ALA A 1 21  ? -15.842 62.654  -0.243  1.00 53.74  ? 21  ALA A C   1 
ATOM 162   O O   . ALA A 1 21  ? -15.076 63.529  0.148   1.00 53.19  ? 21  ALA A O   1 
ATOM 163   C CB  . ALA A 1 21  ? -17.483 60.990  0.643   1.00 55.80  ? 21  ALA A CB  1 
ATOM 164   N N   . PHE A 1 22  ? -15.554 61.823  -1.240  1.00 54.15  ? 22  PHE A N   1 
ATOM 165   C CA  . PHE A 1 22  ? -14.272 61.798  -1.947  1.00 52.61  ? 22  PHE A CA  1 
ATOM 166   C C   . PHE A 1 22  ? -13.763 63.106  -2.544  1.00 54.33  ? 22  PHE A C   1 
ATOM 167   O O   . PHE A 1 22  ? -12.555 63.369  -2.558  1.00 54.55  ? 22  PHE A O   1 
ATOM 168   C CB  . PHE A 1 22  ? -14.334 60.727  -3.043  1.00 52.74  ? 22  PHE A CB  1 
ATOM 169   C CG  . PHE A 1 22  ? -13.019 60.452  -3.694  1.00 54.43  ? 22  PHE A CG  1 
ATOM 170   C CD1 . PHE A 1 22  ? -11.935 60.005  -2.944  1.00 56.81  ? 22  PHE A CD1 1 
ATOM 171   C CD2 . PHE A 1 22  ? -12.850 60.659  -5.057  1.00 55.19  ? 22  PHE A CD2 1 
ATOM 172   C CE1 . PHE A 1 22  ? -10.687 59.767  -3.550  1.00 59.51  ? 22  PHE A CE1 1 
ATOM 173   C CE2 . PHE A 1 22  ? -11.610 60.426  -5.675  1.00 52.44  ? 22  PHE A CE2 1 
ATOM 174   C CZ  . PHE A 1 22  ? -10.527 59.981  -4.920  1.00 53.88  ? 22  PHE A CZ  1 
ATOM 175   N N   . ILE A 1 23  ? -14.680 63.926  -3.038  1.00 56.40  ? 23  ILE A N   1 
ATOM 176   C CA  . ILE A 1 23  ? -14.293 65.185  -3.653  1.00 56.58  ? 23  ILE A CA  1 
ATOM 177   C C   . ILE A 1 23  ? -14.474 66.389  -2.749  1.00 55.27  ? 23  ILE A C   1 
ATOM 178   O O   . ILE A 1 23  ? -13.502 66.930  -2.212  1.00 52.22  ? 23  ILE A O   1 
ATOM 179   C CB  . ILE A 1 23  ? -15.095 65.412  -4.935  1.00 62.02  ? 23  ILE A CB  1 
ATOM 180   C CG1 . ILE A 1 23  ? -14.741 64.327  -5.951  1.00 63.73  ? 23  ILE A CG1 1 
ATOM 181   C CG2 . ILE A 1 23  ? -14.822 66.803  -5.488  1.00 58.94  ? 23  ILE A CG2 1 
ATOM 182   C CD1 . ILE A 1 23  ? -13.256 64.247  -6.244  1.00 68.00  ? 23  ILE A CD1 1 
ATOM 183   N N   . LEU A 1 24  ? -15.730 66.799  -2.591  1.00 56.38  ? 24  LEU A N   1 
ATOM 184   C CA  . LEU A 1 24  ? -16.062 67.956  -1.777  1.00 59.13  ? 24  LEU A CA  1 
ATOM 185   C C   . LEU A 1 24  ? -15.295 68.037  -0.466  1.00 62.58  ? 24  LEU A C   1 
ATOM 186   O O   . LEU A 1 24  ? -14.544 68.985  -0.262  1.00 65.77  ? 24  LEU A O   1 
ATOM 187   C CB  . LEU A 1 24  ? -17.570 68.013  -1.504  1.00 53.73  ? 24  LEU A CB  1 
ATOM 188   C CG  . LEU A 1 24  ? -18.453 67.940  -2.762  1.00 53.00  ? 24  LEU A CG  1 
ATOM 189   C CD1 . LEU A 1 24  ? -19.852 68.457  -2.455  1.00 50.69  ? 24  LEU A CD1 1 
ATOM 190   C CD2 . LEU A 1 24  ? -17.852 68.768  -3.881  1.00 50.68  ? 24  LEU A CD2 1 
ATOM 191   N N   . ASP A 1 25  ? -15.452 67.061  0.422   1.00 64.01  ? 25  ASP A N   1 
ATOM 192   C CA  . ASP A 1 25  ? -14.742 67.131  1.694   1.00 62.75  ? 25  ASP A CA  1 
ATOM 193   C C   . ASP A 1 25  ? -13.467 66.296  1.720   1.00 60.80  ? 25  ASP A C   1 
ATOM 194   O O   . ASP A 1 25  ? -12.688 66.322  2.681   1.00 58.53  ? 25  ASP A O   1 
ATOM 195   C CB  . ASP A 1 25  ? -15.636 66.684  2.833   1.00 65.23  ? 25  ASP A CB  1 
ATOM 196   C CG  . ASP A 1 25  ? -15.013 66.973  4.177   1.00 69.81  ? 25  ASP A CG  1 
ATOM 197   O OD1 . ASP A 1 25  ? -14.927 68.173  4.539   1.00 73.86  ? 25  ASP A OD1 1 
ATOM 198   O OD2 . ASP A 1 25  ? -14.586 66.018  4.862   1.00 69.21  ? 25  ASP A OD2 1 
ATOM 199   N N   . GLY A 1 26  ? -13.249 65.579  0.633   1.00 59.84  ? 26  GLY A N   1 
ATOM 200   C CA  . GLY A 1 26  ? -12.098 64.716  0.540   1.00 63.46  ? 26  GLY A CA  1 
ATOM 201   C C   . GLY A 1 26  ? -10.768 65.263  0.996   1.00 65.92  ? 26  GLY A C   1 
ATOM 202   O O   . GLY A 1 26  ? -10.009 64.578  1.666   1.00 67.81  ? 26  GLY A O   1 
ATOM 203   N N   . ASP A 1 27  ? -10.479 66.502  0.645   1.00 68.87  ? 27  ASP A N   1 
ATOM 204   C CA  . ASP A 1 27  ? -9.182  67.071  0.970   1.00 70.22  ? 27  ASP A CA  1 
ATOM 205   C C   . ASP A 1 27  ? -8.816  67.264  2.445   1.00 67.00  ? 27  ASP A C   1 
ATOM 206   O O   . ASP A 1 27  ? -7.783  67.853  2.752   1.00 65.76  ? 27  ASP A O   1 
ATOM 207   C CB  . ASP A 1 27  ? -8.986  68.371  0.173   1.00 75.94  ? 27  ASP A CB  1 
ATOM 208   C CG  . ASP A 1 27  ? -9.035  68.131  -1.357  1.00 81.09  ? 27  ASP A CG  1 
ATOM 209   O OD1 . ASP A 1 27  ? -10.154 68.052  -1.929  1.00 82.37  ? 27  ASP A OD1 1 
ATOM 210   O OD2 . ASP A 1 27  ? -7.954  68.004  -1.989  1.00 83.55  ? 27  ASP A OD2 1 
ATOM 211   N N   . ASN A 1 28  ? -9.639  66.744  3.351   1.00 62.80  ? 28  ASN A N   1 
ATOM 212   C CA  . ASN A 1 28  ? -9.355  66.835  4.790   1.00 61.64  ? 28  ASN A CA  1 
ATOM 213   C C   . ASN A 1 28  ? -9.582  65.441  5.371   1.00 58.21  ? 28  ASN A C   1 
ATOM 214   O O   . ASN A 1 28  ? -9.200  65.115  6.508   1.00 58.64  ? 28  ASN A O   1 
ATOM 215   C CB  . ASN A 1 28  ? -10.298 67.832  5.460   1.00 66.45  ? 28  ASN A CB  1 
ATOM 216   C CG  . ASN A 1 28  ? -11.708 67.287  5.631   1.00 70.45  ? 28  ASN A CG  1 
ATOM 217   O OD1 . ASN A 1 28  ? -11.936 66.279  6.315   1.00 68.24  ? 28  ASN A OD1 1 
ATOM 218   N ND2 . ASN A 1 28  ? -12.663 67.958  5.010   1.00 71.90  ? 28  ASN A ND2 1 
ATOM 219   N N   . LEU A 1 29  ? -10.229 64.634  4.542   1.00 51.56  ? 29  LEU A N   1 
ATOM 220   C CA  . LEU A 1 29  ? -10.559 63.262  4.844   1.00 41.79  ? 29  LEU A CA  1 
ATOM 221   C C   . LEU A 1 29  ? -9.343  62.400  4.540   1.00 38.83  ? 29  LEU A C   1 
ATOM 222   O O   . LEU A 1 29  ? -9.037  61.447  5.247   1.00 34.69  ? 29  LEU A O   1 
ATOM 223   C CB  . LEU A 1 29  ? -11.713 62.854  3.956   1.00 35.99  ? 29  LEU A CB  1 
ATOM 224   C CG  . LEU A 1 29  ? -12.343 61.518  4.256   1.00 40.11  ? 29  LEU A CG  1 
ATOM 225   C CD1 . LEU A 1 29  ? -12.448 61.360  5.754   1.00 43.19  ? 29  LEU A CD1 1 
ATOM 226   C CD2 . LEU A 1 29  ? -13.714 61.454  3.604   1.00 42.35  ? 29  LEU A CD2 1 
ATOM 227   N N   . PHE A 1 30  ? -8.630  62.763  3.488   1.00 37.48  ? 30  PHE A N   1 
ATOM 228   C CA  . PHE A 1 30  ? -7.464  62.013  3.082   1.00 43.42  ? 30  PHE A CA  1 
ATOM 229   C C   . PHE A 1 30  ? -6.370  61.864  4.128   1.00 46.70  ? 30  PHE A C   1 
ATOM 230   O O   . PHE A 1 30  ? -5.890  60.765  4.357   1.00 49.84  ? 30  PHE A O   1 
ATOM 231   C CB  . PHE A 1 30  ? -6.863  62.599  1.795   1.00 44.61  ? 30  PHE A CB  1 
ATOM 232   C CG  . PHE A 1 30  ? -7.792  62.542  0.603   1.00 49.34  ? 30  PHE A CG  1 
ATOM 233   C CD1 . PHE A 1 30  ? -8.663  61.473  0.429   1.00 50.71  ? 30  PHE A CD1 1 
ATOM 234   C CD2 . PHE A 1 30  ? -7.805  63.562  -0.340  1.00 50.24  ? 30  PHE A CD2 1 
ATOM 235   C CE1 . PHE A 1 30  ? -9.536  61.425  -0.665  1.00 48.32  ? 30  PHE A CE1 1 
ATOM 236   C CE2 . PHE A 1 30  ? -8.678  63.521  -1.440  1.00 46.48  ? 30  PHE A CE2 1 
ATOM 237   C CZ  . PHE A 1 30  ? -9.541  62.453  -1.598  1.00 47.29  ? 30  PHE A CZ  1 
ATOM 238   N N   . PRO A 1 31  ? -5.955  62.953  4.784   1.00 47.74  ? 31  PRO A N   1 
ATOM 239   C CA  . PRO A 1 31  ? -4.893  62.728  5.771   1.00 47.28  ? 31  PRO A CA  1 
ATOM 240   C C   . PRO A 1 31  ? -5.397  61.841  6.907   1.00 46.53  ? 31  PRO A C   1 
ATOM 241   O O   . PRO A 1 31  ? -4.614  61.269  7.672   1.00 46.12  ? 31  PRO A O   1 
ATOM 242   C CB  . PRO A 1 31  ? -4.543  64.142  6.247   1.00 46.31  ? 31  PRO A CB  1 
ATOM 243   C CG  . PRO A 1 31  ? -5.049  65.030  5.151   1.00 49.06  ? 31  PRO A CG  1 
ATOM 244   C CD  . PRO A 1 31  ? -6.343  64.367  4.747   1.00 48.08  ? 31  PRO A CD  1 
ATOM 245   N N   . LYS A 1 32  ? -6.717  61.738  7.011   1.00 47.35  ? 32  LYS A N   1 
ATOM 246   C CA  . LYS A 1 32  ? -7.335  60.924  8.050   1.00 48.35  ? 32  LYS A CA  1 
ATOM 247   C C   . LYS A 1 32  ? -7.260  59.447  7.646   1.00 47.10  ? 32  LYS A C   1 
ATOM 248   O O   . LYS A 1 32  ? -6.600  58.644  8.306   1.00 46.95  ? 32  LYS A O   1 
ATOM 249   C CB  . LYS A 1 32  ? -8.797  61.358  8.256   1.00 50.97  ? 32  LYS A CB  1 
ATOM 250   C CG  . LYS A 1 32  ? -9.585  60.524  9.274   1.00 54.30  ? 32  LYS A CG  1 
ATOM 251   C CD  . LYS A 1 32  ? -11.062 60.965  9.428   1.00 60.69  ? 32  LYS A CD  1 
ATOM 252   C CE  . LYS A 1 32  ? -11.239 62.248  10.253  1.00 62.02  ? 32  LYS A CE  1 
ATOM 253   N NZ  . LYS A 1 32  ? -10.626 63.465  9.625   1.00 64.05  ? 32  LYS A NZ  1 
ATOM 254   N N   . VAL A 1 33  ? -7.904  59.108  6.534   1.00 43.64  ? 33  VAL A N   1 
ATOM 255   C CA  . VAL A 1 33  ? -7.933  57.735  6.048   1.00 40.08  ? 33  VAL A CA  1 
ATOM 256   C C   . VAL A 1 33  ? -6.702  57.220  5.294   1.00 36.97  ? 33  VAL A C   1 
ATOM 257   O O   . VAL A 1 33  ? -6.425  56.037  5.331   1.00 37.17  ? 33  VAL A O   1 
ATOM 258   C CB  . VAL A 1 33  ? -9.156  57.517  5.148   1.00 41.45  ? 33  VAL A CB  1 
ATOM 259   C CG1 . VAL A 1 33  ? -10.423 57.956  5.874   1.00 40.81  ? 33  VAL A CG1 1 
ATOM 260   C CG2 . VAL A 1 33  ? -8.990  58.297  3.856   1.00 45.43  ? 33  VAL A CG2 1 
ATOM 261   N N   . ALA A 1 34  ? -5.955  58.079  4.614   1.00 37.21  ? 34  ALA A N   1 
ATOM 262   C CA  . ALA A 1 34  ? -4.795  57.600  3.859   1.00 38.12  ? 34  ALA A CA  1 
ATOM 263   C C   . ALA A 1 34  ? -3.450  58.247  4.225   1.00 40.13  ? 34  ALA A C   1 
ATOM 264   O O   . ALA A 1 34  ? -2.668  58.626  3.351   1.00 39.00  ? 34  ALA A O   1 
ATOM 265   C CB  . ALA A 1 34  ? -5.069  57.778  2.382   1.00 41.49  ? 34  ALA A CB  1 
ATOM 266   N N   . PRO A 1 35  ? -3.151  58.332  5.526   1.00 43.94  ? 35  PRO A N   1 
ATOM 267   C CA  . PRO A 1 35  ? -1.959  58.903  6.169   1.00 47.53  ? 35  PRO A CA  1 
ATOM 268   C C   . PRO A 1 35  ? -0.600  58.690  5.526   1.00 53.99  ? 35  PRO A C   1 
ATOM 269   O O   . PRO A 1 35  ? 0.304   59.510  5.700   1.00 54.38  ? 35  PRO A O   1 
ATOM 270   C CB  . PRO A 1 35  ? -2.001  58.295  7.559   1.00 43.64  ? 35  PRO A CB  1 
ATOM 271   C CG  . PRO A 1 35  ? -3.468  58.192  7.814   1.00 46.46  ? 35  PRO A CG  1 
ATOM 272   C CD  . PRO A 1 35  ? -3.977  57.628  6.520   1.00 45.73  ? 35  PRO A CD  1 
ATOM 273   N N   . GLN A 1 36  ? -0.443  57.585  4.804   1.00 60.02  ? 36  GLN A N   1 
ATOM 274   C CA  . GLN A 1 36  ? 0.837   57.274  4.174   1.00 64.21  ? 36  GLN A CA  1 
ATOM 275   C C   . GLN A 1 36  ? 0.968   57.896  2.792   1.00 66.08  ? 36  GLN A C   1 
ATOM 276   O O   . GLN A 1 36  ? 2.059   57.923  2.214   1.00 69.65  ? 36  GLN A O   1 
ATOM 277   C CB  . GLN A 1 36  ? 1.025   55.755  4.081   1.00 66.20  ? 36  GLN A CB  1 
ATOM 278   C CG  . GLN A 1 36  ? 0.027   55.024  3.176   1.00 69.98  ? 36  GLN A CG  1 
ATOM 279   C CD  . GLN A 1 36  ? -1.423  55.163  3.629   1.00 71.13  ? 36  GLN A CD  1 
ATOM 280   O OE1 . GLN A 1 36  ? -1.716  55.238  4.823   1.00 68.68  ? 36  GLN A OE1 1 
ATOM 281   N NE2 . GLN A 1 36  ? -2.338  55.171  2.671   1.00 74.88  ? 36  GLN A NE2 1 
ATOM 282   N N   . ALA A 1 37  ? -0.147  58.398  2.269   1.00 65.22  ? 37  ALA A N   1 
ATOM 283   C CA  . ALA A 1 37  ? -0.171  59.023  0.951   1.00 65.51  ? 37  ALA A CA  1 
ATOM 284   C C   . ALA A 1 37  ? -0.121  60.540  1.102   1.00 65.85  ? 37  ALA A C   1 
ATOM 285   O O   . ALA A 1 37  ? 0.806   61.210  0.620   1.00 63.44  ? 37  ALA A O   1 
ATOM 286   C CB  . ALA A 1 37  ? -1.447  58.612  0.213   1.00 65.00  ? 37  ALA A CB  1 
ATOM 287   N N   . ILE A 1 38  ? -1.139  61.057  1.789   1.00 65.68  ? 38  ILE A N   1 
ATOM 288   C CA  . ILE A 1 38  ? -1.298  62.482  2.039   1.00 63.48  ? 38  ILE A CA  1 
ATOM 289   C C   . ILE A 1 38  ? -1.100  62.822  3.499   1.00 62.54  ? 38  ILE A C   1 
ATOM 290   O O   . ILE A 1 38  ? -1.842  62.354  4.370   1.00 60.27  ? 38  ILE A O   1 
ATOM 291   C CB  . ILE A 1 38  ? -2.703  62.964  1.665   1.00 61.90  ? 38  ILE A CB  1 
ATOM 292   C CG1 . ILE A 1 38  ? -2.938  62.785  0.173   1.00 59.27  ? 38  ILE A CG1 1 
ATOM 293   C CG2 . ILE A 1 38  ? -2.863  64.421  2.036   1.00 60.11  ? 38  ILE A CG2 1 
ATOM 294   C CD1 . ILE A 1 38  ? -4.385  62.939  -0.222  1.00 59.46  ? 38  ILE A CD1 1 
ATOM 295   N N   . SER A 1 39  ? -0.103  63.660  3.746   1.00 59.70  ? 39  SER A N   1 
ATOM 296   C CA  . SER A 1 39  ? 0.213   64.123  5.083   1.00 55.85  ? 39  SER A CA  1 
ATOM 297   C C   . SER A 1 39  ? -0.844  65.152  5.533   1.00 54.28  ? 39  SER A C   1 
ATOM 298   O O   . SER A 1 39  ? -1.589  64.926  6.495   1.00 48.93  ? 39  SER A O   1 
ATOM 299   C CB  . SER A 1 39  ? 1.605   64.753  5.060   1.00 57.37  ? 39  SER A CB  1 
ATOM 300   O OG  . SER A 1 39  ? 1.844   65.522  6.217   1.00 58.42  ? 39  SER A OG  1 
ATOM 301   N N   . SER A 1 40  ? -0.917  66.268  4.804   1.00 55.53  ? 40  SER A N   1 
ATOM 302   C CA  . SER A 1 40  ? -1.855  67.354  5.108   1.00 52.65  ? 40  SER A CA  1 
ATOM 303   C C   . SER A 1 40  ? -2.147  68.213  3.881   1.00 51.73  ? 40  SER A C   1 
ATOM 304   O O   . SER A 1 40  ? -1.312  68.336  2.986   1.00 53.90  ? 40  SER A O   1 
ATOM 305   C CB  . SER A 1 40  ? -1.262  68.251  6.191   1.00 52.28  ? 40  SER A CB  1 
ATOM 306   O OG  . SER A 1 40  ? -0.024  68.792  5.757   1.00 51.07  ? 40  SER A OG  1 
ATOM 307   N N   . VAL A 1 41  ? -3.329  68.822  3.859   1.00 50.01  ? 41  VAL A N   1 
ATOM 308   C CA  . VAL A 1 41  ? -3.741  69.690  2.749   1.00 47.58  ? 41  VAL A CA  1 
ATOM 309   C C   . VAL A 1 41  ? -4.112  71.080  3.286   1.00 47.43  ? 41  VAL A C   1 
ATOM 310   O O   . VAL A 1 41  ? -4.815  71.184  4.295   1.00 47.09  ? 41  VAL A O   1 
ATOM 311   C CB  . VAL A 1 41  ? -4.980  69.112  2.033   1.00 42.77  ? 41  VAL A CB  1 
ATOM 312   C CG1 . VAL A 1 41  ? -5.348  69.973  0.844   1.00 41.51  ? 41  VAL A CG1 1 
ATOM 313   C CG2 . VAL A 1 41  ? -4.705  67.698  1.601   1.00 45.97  ? 41  VAL A CG2 1 
ATOM 314   N N   . GLU A 1 42  ? -3.650  72.146  2.634   1.00 44.67  ? 42  GLU A N   1 
ATOM 315   C CA  . GLU A 1 42  ? -4.004  73.484  3.105   1.00 45.43  ? 42  GLU A CA  1 
ATOM 316   C C   . GLU A 1 42  ? -4.334  74.460  1.975   1.00 42.42  ? 42  GLU A C   1 
ATOM 317   O O   . GLU A 1 42  ? -3.742  74.384  0.902   1.00 45.11  ? 42  GLU A O   1 
ATOM 318   C CB  . GLU A 1 42  ? -2.885  74.061  3.974   1.00 53.50  ? 42  GLU A CB  1 
ATOM 319   C CG  . GLU A 1 42  ? -1.651  74.479  3.210   1.00 65.04  ? 42  GLU A CG  1 
ATOM 320   C CD  . GLU A 1 42  ? -0.619  75.161  4.100   1.00 71.90  ? 42  GLU A CD  1 
ATOM 321   O OE1 . GLU A 1 42  ? 0.100   74.452  4.855   1.00 72.73  ? 42  GLU A OE1 1 
ATOM 322   O OE2 . GLU A 1 42  ? -0.537  76.414  4.043   1.00 74.07  ? 42  GLU A OE2 1 
ATOM 323   N N   . ASN A 1 43  ? -5.275  75.375  2.231   1.00 36.62  ? 43  ASN A N   1 
ATOM 324   C CA  . ASN A 1 43  ? -5.708  76.374  1.251   1.00 30.93  ? 43  ASN A CA  1 
ATOM 325   C C   . ASN A 1 43  ? -4.823  77.609  1.150   1.00 29.94  ? 43  ASN A C   1 
ATOM 326   O O   . ASN A 1 43  ? -5.089  78.614  1.790   1.00 32.20  ? 43  ASN A O   1 
ATOM 327   C CB  . ASN A 1 43  ? -7.134  76.814  1.555   1.00 29.43  ? 43  ASN A CB  1 
ATOM 328   C CG  . ASN A 1 43  ? -8.140  75.716  1.300   1.00 32.19  ? 43  ASN A CG  1 
ATOM 329   O OD1 . ASN A 1 43  ? -7.763  74.564  1.073   1.00 31.06  ? 43  ASN A OD1 1 
ATOM 330   N ND2 . ASN A 1 43  ? -9.427  76.058  1.335   1.00 33.78  ? 43  ASN A ND2 1 
ATOM 331   N N   . ILE A 1 44  ? -3.771  77.509  0.344   1.00 29.88  ? 44  ILE A N   1 
ATOM 332   C CA  . ILE A 1 44  ? -2.827  78.598  0.090   1.00 29.83  ? 44  ILE A CA  1 
ATOM 333   C C   . ILE A 1 44  ? -3.515  79.933  -0.270  1.00 30.03  ? 44  ILE A C   1 
ATOM 334   O O   . ILE A 1 44  ? -3.019  81.000  0.089   1.00 31.71  ? 44  ILE A O   1 
ATOM 335   C CB  . ILE A 1 44  ? -1.897  78.212  -1.058  1.00 31.15  ? 44  ILE A CB  1 
ATOM 336   C CG1 . ILE A 1 44  ? -1.059  77.010  -0.649  1.00 31.96  ? 44  ILE A CG1 1 
ATOM 337   C CG2 . ILE A 1 44  ? -0.989  79.369  -1.410  1.00 26.24  ? 44  ILE A CG2 1 
ATOM 338   C CD1 . ILE A 1 44  ? 0.176   77.385  0.158   1.00 40.24  ? 44  ILE A CD1 1 
ATOM 339   N N   . GLU A 1 45  ? -4.621  79.864  -1.013  1.00 25.04  ? 45  GLU A N   1 
ATOM 340   C CA  . GLU A 1 45  ? -5.417  81.032  -1.390  1.00 25.29  ? 45  GLU A CA  1 
ATOM 341   C C   . GLU A 1 45  ? -6.866  80.602  -1.619  1.00 24.70  ? 45  GLU A C   1 
ATOM 342   O O   . GLU A 1 45  ? -7.126  79.610  -2.279  1.00 31.69  ? 45  GLU A O   1 
ATOM 343   C CB  . GLU A 1 45  ? -4.890  81.730  -2.675  1.00 29.69  ? 45  GLU A CB  1 
ATOM 344   C CG  . GLU A 1 45  ? -5.985  82.617  -3.393  1.00 28.26  ? 45  GLU A CG  1 
ATOM 345   C CD  . GLU A 1 45  ? -5.460  83.666  -4.395  1.00 29.72  ? 45  GLU A CD  1 
ATOM 346   O OE1 . GLU A 1 45  ? -4.552  83.344  -5.199  1.00 31.96  ? 45  GLU A OE1 1 
ATOM 347   O OE2 . GLU A 1 45  ? -5.983  84.815  -4.400  1.00 25.26  ? 45  GLU A OE2 1 
ATOM 348   N N   . GLY A 1 46  ? -7.821  81.336  -1.076  1.00 22.82  ? 46  GLY A N   1 
ATOM 349   C CA  . GLY A 1 46  ? -9.195  80.959  -1.300  1.00 20.34  ? 46  GLY A CA  1 
ATOM 350   C C   . GLY A 1 46  ? -9.758  80.221  -0.119  1.00 22.22  ? 46  GLY A C   1 
ATOM 351   O O   . GLY A 1 46  ? -9.017  79.715  0.722   1.00 23.57  ? 46  GLY A O   1 
ATOM 352   N N   . ASN A 1 47  ? -11.079 80.141  -0.066  1.00 21.85  ? 47  ASN A N   1 
ATOM 353   C CA  . ASN A 1 47  ? -11.747 79.490  1.034   1.00 20.81  ? 47  ASN A CA  1 
ATOM 354   C C   . ASN A 1 47  ? -12.254 78.089  0.697   1.00 23.77  ? 47  ASN A C   1 
ATOM 355   O O   . ASN A 1 47  ? -13.209 77.604  1.308   1.00 20.49  ? 47  ASN A O   1 
ATOM 356   C CB  . ASN A 1 47  ? -12.904 80.368  1.488   1.00 22.81  ? 47  ASN A CB  1 
ATOM 357   C CG  . ASN A 1 47  ? -13.955 80.533  0.418   1.00 21.76  ? 47  ASN A CG  1 
ATOM 358   O OD1 . ASN A 1 47  ? -15.066 81.012  0.677   1.00 25.71  ? 47  ASN A OD1 1 
ATOM 359   N ND2 . ASN A 1 47  ? -13.614 80.137  -0.799  1.00 24.80  ? 47  ASN A ND2 1 
ATOM 360   N N   . GLY A 1 48  ? -11.640 77.436  -0.280  1.00 27.37  ? 48  GLY A N   1 
ATOM 361   C CA  . GLY A 1 48  ? -12.081 76.095  -0.611  1.00 30.66  ? 48  GLY A CA  1 
ATOM 362   C C   . GLY A 1 48  ? -13.116 75.936  -1.712  1.00 34.30  ? 48  GLY A C   1 
ATOM 363   O O   . GLY A 1 48  ? -13.382 74.815  -2.149  1.00 38.10  ? 48  GLY A O   1 
ATOM 364   N N   . GLY A 1 49  ? -13.721 77.024  -2.165  1.00 33.40  ? 49  GLY A N   1 
ATOM 365   C CA  . GLY A 1 49  ? -14.681 76.898  -3.245  1.00 31.98  ? 49  GLY A CA  1 
ATOM 366   C C   . GLY A 1 49  ? -13.919 76.965  -4.565  1.00 33.06  ? 49  GLY A C   1 
ATOM 367   O O   . GLY A 1 49  ? -12.675 76.900  -4.586  1.00 29.54  ? 49  GLY A O   1 
ATOM 368   N N   . PRO A 1 50  ? -14.634 77.100  -5.697  1.00 32.17  ? 50  PRO A N   1 
ATOM 369   C CA  . PRO A 1 50  ? -13.999 77.179  -7.022  1.00 25.44  ? 50  PRO A CA  1 
ATOM 370   C C   . PRO A 1 50  ? -12.826 78.162  -7.023  1.00 21.79  ? 50  PRO A C   1 
ATOM 371   O O   . PRO A 1 50  ? -12.899 79.233  -6.426  1.00 22.28  ? 50  PRO A O   1 
ATOM 372   C CB  . PRO A 1 50  ? -15.133 77.654  -7.917  1.00 26.40  ? 50  PRO A CB  1 
ATOM 373   C CG  . PRO A 1 50  ? -16.342 77.065  -7.278  1.00 26.28  ? 50  PRO A CG  1 
ATOM 374   C CD  . PRO A 1 50  ? -16.097 77.256  -5.794  1.00 26.59  ? 50  PRO A CD  1 
ATOM 375   N N   . GLY A 1 51  ? -11.747 77.786  -7.689  1.00 22.62  ? 51  GLY A N   1 
ATOM 376   C CA  . GLY A 1 51  ? -10.588 78.650  -7.756  1.00 19.97  ? 51  GLY A CA  1 
ATOM 377   C C   . GLY A 1 51  ? -9.590  78.401  -6.641  1.00 22.92  ? 51  GLY A C   1 
ATOM 378   O O   . GLY A 1 51  ? -8.397  78.656  -6.810  1.00 21.32  ? 51  GLY A O   1 
ATOM 379   N N   . THR A 1 52  ? -10.052 77.899  -5.499  1.00 22.36  ? 52  THR A N   1 
ATOM 380   C CA  . THR A 1 52  ? -9.142  77.658  -4.379  1.00 20.38  ? 52  THR A CA  1 
ATOM 381   C C   . THR A 1 52  ? -7.822  76.975  -4.769  1.00 24.53  ? 52  THR A C   1 
ATOM 382   O O   . THR A 1 52  ? -7.818  76.040  -5.571  1.00 27.86  ? 52  THR A O   1 
ATOM 383   C CB  . THR A 1 52  ? -9.826  76.803  -3.305  1.00 17.65  ? 52  THR A CB  1 
ATOM 384   O OG1 . THR A 1 52  ? -11.043 77.442  -2.895  1.00 22.58  ? 52  THR A OG1 1 
ATOM 385   C CG2 . THR A 1 52  ? -8.913  76.639  -2.103  1.00 20.39  ? 52  THR A CG2 1 
ATOM 386   N N   . ILE A 1 53  ? -6.705  77.452  -4.215  1.00 26.68  ? 53  ILE A N   1 
ATOM 387   C CA  . ILE A 1 53  ? -5.372  76.870  -4.462  1.00 25.26  ? 53  ILE A CA  1 
ATOM 388   C C   . ILE A 1 53  ? -4.908  76.119  -3.209  1.00 28.44  ? 53  ILE A C   1 
ATOM 389   O O   . ILE A 1 53  ? -4.704  76.728  -2.151  1.00 29.35  ? 53  ILE A O   1 
ATOM 390   C CB  . ILE A 1 53  ? -4.298  77.942  -4.788  1.00 22.68  ? 53  ILE A CB  1 
ATOM 391   C CG1 . ILE A 1 53  ? -4.295  78.262  -6.280  1.00 22.65  ? 53  ILE A CG1 1 
ATOM 392   C CG2 . ILE A 1 53  ? -2.915  77.432  -4.401  1.00 23.71  ? 53  ILE A CG2 1 
ATOM 393   C CD1 . ILE A 1 53  ? -5.631  78.650  -6.806  1.00 25.29  ? 53  ILE A CD1 1 
ATOM 394   N N   . LYS A 1 54  ? -4.716  74.802  -3.348  1.00 30.12  ? 54  LYS A N   1 
ATOM 395   C CA  . LYS A 1 54  ? -4.308  73.925  -2.243  1.00 28.66  ? 54  LYS A CA  1 
ATOM 396   C C   . LYS A 1 54  ? -2.868  73.419  -2.307  1.00 36.46  ? 54  LYS A C   1 
ATOM 397   O O   . LYS A 1 54  ? -2.338  73.116  -3.377  1.00 42.29  ? 54  LYS A O   1 
ATOM 398   C CB  . LYS A 1 54  ? -5.263  72.730  -2.163  1.00 15.48  ? 54  LYS A CB  1 
ATOM 399   C CG  . LYS A 1 54  ? -6.729  73.144  -2.302  1.00 27.02  ? 54  LYS A CG  1 
ATOM 400   C CD  . LYS A 1 54  ? -7.751  72.067  -1.906  1.00 25.36  ? 54  LYS A CD  1 
ATOM 401   C CE  . LYS A 1 54  ? -9.180  72.650  -1.929  1.00 34.70  ? 54  LYS A CE  1 
ATOM 402   N NZ  . LYS A 1 54  ? -10.285 71.771  -1.411  1.00 35.37  ? 54  LYS A NZ  1 
ATOM 403   N N   . LYS A 1 55  ? -2.226  73.352  -1.147  1.00 41.51  ? 55  LYS A N   1 
ATOM 404   C CA  . LYS A 1 55  ? -0.872  72.838  -1.059  1.00 44.48  ? 55  LYS A CA  1 
ATOM 405   C C   . LYS A 1 55  ? -1.034  71.492  -0.348  1.00 45.44  ? 55  LYS A C   1 
ATOM 406   O O   . LYS A 1 55  ? -1.331  71.434  0.853   1.00 42.63  ? 55  LYS A O   1 
ATOM 407   C CB  . LYS A 1 55  ? 0.025   73.771  -0.234  1.00 49.09  ? 55  LYS A CB  1 
ATOM 408   C CG  . LYS A 1 55  ? 1.533   73.527  -0.416  1.00 53.35  ? 55  LYS A CG  1 
ATOM 409   C CD  . LYS A 1 55  ? 2.249   73.197  0.902   1.00 55.74  ? 55  LYS A CD  1 
ATOM 410   C CE  . LYS A 1 55  ? 3.056   74.380  1.459   1.00 57.44  ? 55  LYS A CE  1 
ATOM 411   N NZ  . LYS A 1 55  ? 4.317   74.681  0.705   1.00 57.96  ? 55  LYS A NZ  1 
ATOM 412   N N   . ILE A 1 56  ? -0.877  70.416  -1.115  1.00 47.98  ? 56  ILE A N   1 
ATOM 413   C CA  . ILE A 1 56  ? -0.987  69.058  -0.601  1.00 48.92  ? 56  ILE A CA  1 
ATOM 414   C C   . ILE A 1 56  ? 0.395   68.548  -0.200  1.00 52.25  ? 56  ILE A C   1 
ATOM 415   O O   . ILE A 1 56  ? 1.302   68.468  -1.030  1.00 56.70  ? 56  ILE A O   1 
ATOM 416   C CB  . ILE A 1 56  ? -1.573  68.128  -1.659  1.00 45.92  ? 56  ILE A CB  1 
ATOM 417   C CG1 . ILE A 1 56  ? -2.959  68.630  -2.055  1.00 43.56  ? 56  ILE A CG1 1 
ATOM 418   C CG2 . ILE A 1 56  ? -1.647  66.725  -1.118  1.00 43.32  ? 56  ILE A CG2 1 
ATOM 419   C CD1 . ILE A 1 56  ? -3.746  67.674  -2.932  1.00 48.36  ? 56  ILE A CD1 1 
ATOM 420   N N   . SER A 1 57  ? 0.545   68.211  1.078   1.00 53.80  ? 57  SER A N   1 
ATOM 421   C CA  . SER A 1 57  ? 1.813   67.730  1.621   1.00 54.03  ? 57  SER A CA  1 
ATOM 422   C C   . SER A 1 57  ? 1.869   66.212  1.757   1.00 56.70  ? 57  SER A C   1 
ATOM 423   O O   . SER A 1 57  ? 0.859   65.560  2.071   1.00 54.54  ? 57  SER A O   1 
ATOM 424   C CB  . SER A 1 57  ? 2.071   68.371  2.982   1.00 55.36  ? 57  SER A CB  1 
ATOM 425   O OG  . SER A 1 57  ? 2.170   69.780  2.854   1.00 55.89  ? 57  SER A OG  1 
ATOM 426   N N   . PHE A 1 58  ? 3.068   65.667  1.532   1.00 58.53  ? 58  PHE A N   1 
ATOM 427   C CA  . PHE A 1 58  ? 3.306   64.226  1.583   1.00 57.77  ? 58  PHE A CA  1 
ATOM 428   C C   . PHE A 1 58  ? 4.184   63.776  2.742   1.00 60.58  ? 58  PHE A C   1 
ATOM 429   O O   . PHE A 1 58  ? 5.105   64.492  3.152   1.00 61.32  ? 58  PHE A O   1 
ATOM 430   C CB  . PHE A 1 58  ? 3.932   63.759  0.269   1.00 50.12  ? 58  PHE A CB  1 
ATOM 431   C CG  . PHE A 1 58  ? 3.068   64.000  -0.919  1.00 45.93  ? 58  PHE A CG  1 
ATOM 432   C CD1 . PHE A 1 58  ? 1.775   63.469  -0.970  1.00 47.49  ? 58  PHE A CD1 1 
ATOM 433   C CD2 . PHE A 1 58  ? 3.528   64.777  -1.979  1.00 44.51  ? 58  PHE A CD2 1 
ATOM 434   C CE1 . PHE A 1 58  ? 0.942   63.711  -2.065  1.00 47.41  ? 58  PHE A CE1 1 
ATOM 435   C CE2 . PHE A 1 58  ? 2.709   65.029  -3.079  1.00 48.86  ? 58  PHE A CE2 1 
ATOM 436   C CZ  . PHE A 1 58  ? 1.408   64.492  -3.124  1.00 50.36  ? 58  PHE A CZ  1 
ATOM 437   N N   . PRO A 1 59  ? 3.903   62.573  3.282   1.00 62.29  ? 59  PRO A N   1 
ATOM 438   C CA  . PRO A 1 59  ? 4.668   62.018  4.398   1.00 64.39  ? 59  PRO A CA  1 
ATOM 439   C C   . PRO A 1 59  ? 6.127   61.871  3.967   1.00 70.16  ? 59  PRO A C   1 
ATOM 440   O O   . PRO A 1 59  ? 6.425   61.434  2.848   1.00 73.47  ? 59  PRO A O   1 
ATOM 441   C CB  . PRO A 1 59  ? 3.969   60.685  4.663   1.00 61.64  ? 59  PRO A CB  1 
ATOM 442   C CG  . PRO A 1 59  ? 2.553   60.933  4.166   1.00 59.69  ? 59  PRO A CG  1 
ATOM 443   C CD  . PRO A 1 59  ? 2.795   61.677  2.897   1.00 61.02  ? 59  PRO A CD  1 
ATOM 444   N N   . GLU A 1 60  ? 7.033   62.285  4.845   1.00 75.07  ? 60  GLU A N   1 
ATOM 445   C CA  . GLU A 1 60  ? 8.458   62.214  4.557   1.00 79.65  ? 60  GLU A CA  1 
ATOM 446   C C   . GLU A 1 60  ? 8.809   60.803  4.103   1.00 80.13  ? 60  GLU A C   1 
ATOM 447   O O   . GLU A 1 60  ? 8.469   59.816  4.762   1.00 78.97  ? 60  GLU A O   1 
ATOM 448   C CB  . GLU A 1 60  ? 9.257   62.628  5.802   1.00 84.35  ? 60  GLU A CB  1 
ATOM 449   C CG  . GLU A 1 60  ? 10.726  62.232  5.806   1.00 90.87  ? 60  GLU A CG  1 
ATOM 450   C CD  . GLU A 1 60  ? 11.053  61.270  6.942   1.00 96.01  ? 60  GLU A CD  1 
ATOM 451   O OE1 . GLU A 1 60  ? 10.244  61.178  7.890   1.00 99.79  ? 60  GLU A OE1 1 
ATOM 452   O OE2 . GLU A 1 60  ? 12.119  60.619  6.899   1.00 97.62  ? 60  GLU A OE2 1 
ATOM 453   N N   . GLY A 1 61  ? 9.463   60.715  2.952   1.00 81.74  ? 61  GLY A N   1 
ATOM 454   C CA  . GLY A 1 61  ? 9.828   59.417  2.419   1.00 83.55  ? 61  GLY A CA  1 
ATOM 455   C C   . GLY A 1 61  ? 9.376   59.239  0.983   1.00 85.43  ? 61  GLY A C   1 
ATOM 456   O O   . GLY A 1 61  ? 10.151  58.790  0.136   1.00 86.58  ? 61  GLY A O   1 
ATOM 457   N N   . LEU A 1 62  ? 8.121   59.581  0.701   1.00 85.85  ? 62  LEU A N   1 
ATOM 458   C CA  . LEU A 1 62  ? 7.583   59.457  -0.655  1.00 85.19  ? 62  LEU A CA  1 
ATOM 459   C C   . LEU A 1 62  ? 8.459   60.238  -1.639  1.00 84.27  ? 62  LEU A C   1 
ATOM 460   O O   . LEU A 1 62  ? 9.389   60.951  -1.231  1.00 82.55  ? 62  LEU A O   1 
ATOM 461   C CB  . LEU A 1 62  ? 6.144   59.979  -0.712  1.00 86.03  ? 62  LEU A CB  1 
ATOM 462   C CG  . LEU A 1 62  ? 5.064   59.139  -0.022  1.00 86.68  ? 62  LEU A CG  1 
ATOM 463   C CD1 . LEU A 1 62  ? 5.332   59.101  1.482   1.00 89.23  ? 62  LEU A CD1 1 
ATOM 464   C CD2 . LEU A 1 62  ? 3.679   59.720  -0.310  1.00 85.51  ? 62  LEU A CD2 1 
ATOM 465   N N   . PRO A 1 63  ? 8.173   60.125  -2.949  1.00 84.41  ? 63  PRO A N   1 
ATOM 466   C CA  . PRO A 1 63  ? 8.981   60.843  -3.945  1.00 84.36  ? 63  PRO A CA  1 
ATOM 467   C C   . PRO A 1 63  ? 8.991   62.358  -3.809  1.00 84.00  ? 63  PRO A C   1 
ATOM 468   O O   . PRO A 1 63  ? 10.057  62.981  -3.843  1.00 84.47  ? 63  PRO A O   1 
ATOM 469   C CB  . PRO A 1 63  ? 8.369   60.409  -5.272  1.00 85.71  ? 63  PRO A CB  1 
ATOM 470   C CG  . PRO A 1 63  ? 6.934   60.158  -4.923  1.00 86.35  ? 63  PRO A CG  1 
ATOM 471   C CD  . PRO A 1 63  ? 7.039   59.433  -3.594  1.00 85.66  ? 63  PRO A CD  1 
ATOM 472   N N   . PHE A 1 64  ? 7.801   62.945  -3.672  1.00 82.27  ? 64  PHE A N   1 
ATOM 473   C CA  . PHE A 1 64  ? 7.664   64.395  -3.557  1.00 78.90  ? 64  PHE A CA  1 
ATOM 474   C C   . PHE A 1 64  ? 7.251   64.847  -2.173  1.00 79.14  ? 64  PHE A C   1 
ATOM 475   O O   . PHE A 1 64  ? 6.590   64.115  -1.430  1.00 77.46  ? 64  PHE A O   1 
ATOM 476   C CB  . PHE A 1 64  ? 6.615   64.920  -4.528  1.00 76.26  ? 64  PHE A CB  1 
ATOM 477   C CG  . PHE A 1 64  ? 6.827   64.495  -5.944  1.00 73.11  ? 64  PHE A CG  1 
ATOM 478   C CD1 . PHE A 1 64  ? 8.005   64.816  -6.616  1.00 71.07  ? 64  PHE A CD1 1 
ATOM 479   C CD2 . PHE A 1 64  ? 5.830   63.784  -6.616  1.00 70.89  ? 64  PHE A CD2 1 
ATOM 480   C CE1 . PHE A 1 64  ? 8.187   64.437  -7.940  1.00 70.11  ? 64  PHE A CE1 1 
ATOM 481   C CE2 . PHE A 1 64  ? 5.998   63.399  -7.935  1.00 71.88  ? 64  PHE A CE2 1 
ATOM 482   C CZ  . PHE A 1 64  ? 7.181   63.727  -8.604  1.00 72.17  ? 64  PHE A CZ  1 
ATOM 483   N N   . LYS A 1 65  ? 7.622   66.083  -1.852  1.00 79.75  ? 65  LYS A N   1 
ATOM 484   C CA  . LYS A 1 65  ? 7.270   66.661  -0.569  1.00 79.27  ? 65  LYS A CA  1 
ATOM 485   C C   . LYS A 1 65  ? 5.861   67.276  -0.596  1.00 77.54  ? 65  LYS A C   1 
ATOM 486   O O   . LYS A 1 65  ? 5.048   67.025  0.305   1.00 78.85  ? 65  LYS A O   1 
ATOM 487   C CB  . LYS A 1 65  ? 8.284   67.735  -0.161  1.00 81.70  ? 65  LYS A CB  1 
ATOM 488   C CG  . LYS A 1 65  ? 7.960   68.331  1.215   1.00 88.90  ? 65  LYS A CG  1 
ATOM 489   C CD  . LYS A 1 65  ? 8.865   69.505  1.613   1.00 93.62  ? 65  LYS A CD  1 
ATOM 490   C CE  . LYS A 1 65  ? 8.393   70.162  2.927   1.00 93.09  ? 65  LYS A CE  1 
ATOM 491   N NZ  . LYS A 1 65  ? 9.268   71.296  3.362   1.00 98.11  ? 65  LYS A NZ  1 
ATOM 492   N N   . TYR A 1 66  ? 5.574   68.069  -1.633  1.00 72.50  ? 66  TYR A N   1 
ATOM 493   C CA  . TYR A 1 66  ? 4.280   68.739  -1.770  1.00 63.12  ? 66  TYR A CA  1 
ATOM 494   C C   . TYR A 1 66  ? 3.868   68.891  -3.229  1.00 58.42  ? 66  TYR A C   1 
ATOM 495   O O   . TYR A 1 66  ? 4.620   68.557  -4.142  1.00 55.99  ? 66  TYR A O   1 
ATOM 496   C CB  . TYR A 1 66  ? 4.355   70.140  -1.169  1.00 60.41  ? 66  TYR A CB  1 
ATOM 497   C CG  . TYR A 1 66  ? 5.088   71.120  -2.066  1.00 59.64  ? 66  TYR A CG  1 
ATOM 498   C CD1 . TYR A 1 66  ? 6.469   71.051  -2.234  1.00 58.49  ? 66  TYR A CD1 1 
ATOM 499   C CD2 . TYR A 1 66  ? 4.386   72.089  -2.787  1.00 62.47  ? 66  TYR A CD2 1 
ATOM 500   C CE1 . TYR A 1 66  ? 7.133   71.925  -3.101  1.00 61.23  ? 66  TYR A CE1 1 
ATOM 501   C CE2 . TYR A 1 66  ? 5.038   72.967  -3.655  1.00 62.42  ? 66  TYR A CE2 1 
ATOM 502   C CZ  . TYR A 1 66  ? 6.408   72.881  -3.809  1.00 61.38  ? 66  TYR A CZ  1 
ATOM 503   O OH  . TYR A 1 66  ? 7.038   73.754  -4.673  1.00 60.41  ? 66  TYR A OH  1 
ATOM 504   N N   . VAL A 1 67  ? 2.675   69.440  -3.430  1.00 53.42  ? 67  VAL A N   1 
ATOM 505   C CA  . VAL A 1 67  ? 2.141   69.685  -4.761  1.00 52.69  ? 67  VAL A CA  1 
ATOM 506   C C   . VAL A 1 67  ? 0.959   70.640  -4.627  1.00 51.19  ? 67  VAL A C   1 
ATOM 507   O O   . VAL A 1 67  ? 0.161   70.513  -3.693  1.00 48.77  ? 67  VAL A O   1 
ATOM 508   C CB  . VAL A 1 67  ? 1.635   68.391  -5.428  1.00 53.55  ? 67  VAL A CB  1 
ATOM 509   C CG1 . VAL A 1 67  ? 0.420   67.857  -4.671  1.00 51.08  ? 67  VAL A CG1 1 
ATOM 510   C CG2 . VAL A 1 67  ? 1.283   68.667  -6.887  1.00 50.95  ? 67  VAL A CG2 1 
ATOM 511   N N   . LYS A 1 68  ? 0.837   71.588  -5.556  1.00 48.77  ? 68  LYS A N   1 
ATOM 512   C CA  . LYS A 1 68  ? -0.262  72.540  -5.500  1.00 45.07  ? 68  LYS A CA  1 
ATOM 513   C C   . LYS A 1 68  ? -1.219  72.339  -6.662  1.00 43.77  ? 68  LYS A C   1 
ATOM 514   O O   . LYS A 1 68  ? -0.818  72.388  -7.819  1.00 47.36  ? 68  LYS A O   1 
ATOM 515   C CB  . LYS A 1 68  ? 0.282   73.973  -5.506  1.00 44.66  ? 68  LYS A CB  1 
ATOM 516   C CG  . LYS A 1 68  ? 1.243   74.276  -4.360  1.00 46.57  ? 68  LYS A CG  1 
ATOM 517   C CD  . LYS A 1 68  ? 1.804   75.692  -4.435  1.00 51.91  ? 68  LYS A CD  1 
ATOM 518   C CE  . LYS A 1 68  ? 2.861   75.941  -3.352  1.00 56.47  ? 68  LYS A CE  1 
ATOM 519   N NZ  . LYS A 1 68  ? 3.518   77.287  -3.472  1.00 59.75  ? 68  LYS A NZ  1 
ATOM 520   N N   . ASP A 1 69  ? -2.483  72.087  -6.346  1.00 40.43  ? 69  ASP A N   1 
ATOM 521   C CA  . ASP A 1 69  ? -3.501  71.907  -7.368  1.00 38.07  ? 69  ASP A CA  1 
ATOM 522   C C   . ASP A 1 69  ? -4.365  73.156  -7.309  1.00 37.45  ? 69  ASP A C   1 
ATOM 523   O O   . ASP A 1 69  ? -4.216  73.975  -6.419  1.00 39.01  ? 69  ASP A O   1 
ATOM 524   C CB  . ASP A 1 69  ? -4.385  70.696  -7.078  1.00 37.60  ? 69  ASP A CB  1 
ATOM 525   C CG  . ASP A 1 69  ? -3.599  69.433  -6.823  1.00 42.09  ? 69  ASP A CG  1 
ATOM 526   O OD1 . ASP A 1 69  ? -2.343  69.445  -6.927  1.00 42.37  ? 69  ASP A OD1 1 
ATOM 527   O OD2 . ASP A 1 69  ? -4.256  68.418  -6.509  1.00 39.33  ? 69  ASP A OD2 1 
ATOM 528   N N   . ARG A 1 70  ? -5.298  73.283  -8.235  1.00 37.44  ? 70  ARG A N   1 
ATOM 529   C CA  . ARG A 1 70  ? -6.148  74.445  -8.272  1.00 36.89  ? 70  ARG A CA  1 
ATOM 530   C C   . ARG A 1 70  ? -7.556  74.087  -8.714  1.00 37.85  ? 70  ARG A C   1 
ATOM 531   O O   . ARG A 1 70  ? -7.786  73.754  -9.874  1.00 41.01  ? 70  ARG A O   1 
ATOM 532   C CB  . ARG A 1 70  ? -5.524  75.464  -9.220  1.00 35.24  ? 70  ARG A CB  1 
ATOM 533   C CG  . ARG A 1 70  ? -6.516  76.246  -10.082 1.00 33.50  ? 70  ARG A CG  1 
ATOM 534   C CD  . ARG A 1 70  ? -5.732  76.996  -11.120 1.00 36.82  ? 70  ARG A CD  1 
ATOM 535   N NE  . ARG A 1 70  ? -6.089  76.679  -12.499 1.00 41.32  ? 70  ARG A NE  1 
ATOM 536   C CZ  . ARG A 1 70  ? -5.268  76.885  -13.526 1.00 45.11  ? 70  ARG A CZ  1 
ATOM 537   N NH1 . ARG A 1 70  ? -4.061  77.387  -13.305 1.00 47.29  ? 70  ARG A NH1 1 
ATOM 538   N NH2 . ARG A 1 70  ? -5.656  76.630  -14.770 1.00 46.05  ? 70  ARG A NH2 1 
ATOM 539   N N   . VAL A 1 71  ? -8.504  74.154  -7.789  1.00 35.35  ? 71  VAL A N   1 
ATOM 540   C CA  . VAL A 1 71  ? -9.876  73.829  -8.131  1.00 32.27  ? 71  VAL A CA  1 
ATOM 541   C C   . VAL A 1 71  ? -10.228 74.702  -9.309  1.00 37.48  ? 71  VAL A C   1 
ATOM 542   O O   . VAL A 1 71  ? -10.056 75.913  -9.233  1.00 37.80  ? 71  VAL A O   1 
ATOM 543   C CB  . VAL A 1 71  ? -10.818 74.157  -6.994  1.00 28.28  ? 71  VAL A CB  1 
ATOM 544   C CG1 . VAL A 1 71  ? -12.208 73.649  -7.330  1.00 24.10  ? 71  VAL A CG1 1 
ATOM 545   C CG2 . VAL A 1 71  ? -10.301 73.548  -5.703  1.00 22.57  ? 71  VAL A CG2 1 
ATOM 546   N N   . ASP A 1 72  ? -10.708 74.104  -10.397 1.00 38.80  ? 72  ASP A N   1 
ATOM 547   C CA  . ASP A 1 72  ? -11.044 74.880  -11.581 1.00 37.73  ? 72  ASP A CA  1 
ATOM 548   C C   . ASP A 1 72  ? -12.513 75.022  -11.839 1.00 40.38  ? 72  ASP A C   1 
ATOM 549   O O   . ASP A 1 72  ? -12.983 76.075  -12.273 1.00 46.19  ? 72  ASP A O   1 
ATOM 550   C CB  . ASP A 1 72  ? -10.393 74.268  -12.795 1.00 34.59  ? 72  ASP A CB  1 
ATOM 551   C CG  . ASP A 1 72  ? -8.911  74.472  -12.794 1.00 40.25  ? 72  ASP A CG  1 
ATOM 552   O OD1 . ASP A 1 72  ? -8.485  75.650  -12.630 1.00 41.20  ? 72  ASP A OD1 1 
ATOM 553   O OD2 . ASP A 1 72  ? -8.177  73.465  -12.954 1.00 37.77  ? 72  ASP A OD2 1 
ATOM 554   N N   . GLU A 1 73  ? -13.250 73.954  -11.602 1.00 38.22  ? 73  GLU A N   1 
ATOM 555   C CA  . GLU A 1 73  ? -14.671 74.023  -11.818 1.00 41.45  ? 73  GLU A CA  1 
ATOM 556   C C   . GLU A 1 73  ? -15.283 72.935  -10.960 1.00 39.76  ? 73  GLU A C   1 
ATOM 557   O O   . GLU A 1 73  ? -14.652 71.900  -10.722 1.00 40.72  ? 73  GLU A O   1 
ATOM 558   C CB  . GLU A 1 73  ? -14.975 73.822  -13.307 1.00 51.24  ? 73  GLU A CB  1 
ATOM 559   C CG  . GLU A 1 73  ? -16.423 74.156  -13.712 1.00 73.13  ? 73  GLU A CG  1 
ATOM 560   C CD  . GLU A 1 73  ? -17.401 72.953  -13.644 1.00 82.98  ? 73  GLU A CD  1 
ATOM 561   O OE1 . GLU A 1 73  ? -18.640 73.190  -13.675 1.00 82.41  ? 73  GLU A OE1 1 
ATOM 562   O OE2 . GLU A 1 73  ? -16.940 71.782  -13.575 1.00 89.03  ? 73  GLU A OE2 1 
ATOM 563   N N   . VAL A 1 74  ? -16.498 73.176  -10.480 1.00 32.49  ? 74  VAL A N   1 
ATOM 564   C CA  . VAL A 1 74  ? -17.164 72.205  -9.645  1.00 31.31  ? 74  VAL A CA  1 
ATOM 565   C C   . VAL A 1 74  ? -18.654 72.125  -9.914  1.00 41.04  ? 74  VAL A C   1 
ATOM 566   O O   . VAL A 1 74  ? -19.415 72.923  -9.382  1.00 43.32  ? 74  VAL A O   1 
ATOM 567   C CB  . VAL A 1 74  ? -16.976 72.544  -8.182  1.00 22.78  ? 74  VAL A CB  1 
ATOM 568   C CG1 . VAL A 1 74  ? -17.766 71.573  -7.318  1.00 21.90  ? 74  VAL A CG1 1 
ATOM 569   C CG2 . VAL A 1 74  ? -15.502 72.535  -7.846  1.00 11.49  ? 74  VAL A CG2 1 
ATOM 570   N N   . ASP A 1 75  ? -19.086 71.169  -10.739 1.00 49.89  ? 75  ASP A N   1 
ATOM 571   C CA  . ASP A 1 75  ? -20.513 71.043  -10.984 1.00 53.24  ? 75  ASP A CA  1 
ATOM 572   C C   . ASP A 1 75  ? -21.072 70.206  -9.870  1.00 53.10  ? 75  ASP A C   1 
ATOM 573   O O   . ASP A 1 75  ? -20.696 69.046  -9.709  1.00 52.18  ? 75  ASP A O   1 
ATOM 574   C CB  . ASP A 1 75  ? -20.842 70.347  -12.292 1.00 56.03  ? 75  ASP A CB  1 
ATOM 575   C CG  . ASP A 1 75  ? -22.340 70.369  -12.574 1.00 60.18  ? 75  ASP A CG  1 
ATOM 576   O OD1 . ASP A 1 75  ? -23.131 70.022  -11.652 1.00 55.64  ? 75  ASP A OD1 1 
ATOM 577   O OD2 . ASP A 1 75  ? -22.725 70.749  -13.705 1.00 60.48  ? 75  ASP A OD2 1 
ATOM 578   N N   . HIS A 1 76  ? -21.982 70.791  -9.111  1.00 52.66  ? 76  HIS A N   1 
ATOM 579   C CA  . HIS A 1 76  ? -22.557 70.082  -7.997  1.00 54.76  ? 76  HIS A CA  1 
ATOM 580   C C   . HIS A 1 76  ? -23.590 69.053  -8.402  1.00 55.09  ? 76  HIS A C   1 
ATOM 581   O O   . HIS A 1 76  ? -23.506 67.897  -7.990  1.00 57.53  ? 76  HIS A O   1 
ATOM 582   C CB  . HIS A 1 76  ? -23.126 71.089  -6.995  1.00 53.96  ? 76  HIS A CB  1 
ATOM 583   C CG  . HIS A 1 76  ? -22.066 71.819  -6.233  1.00 54.46  ? 76  HIS A CG  1 
ATOM 584   N ND1 . HIS A 1 76  ? -21.247 71.195  -5.319  1.00 54.24  ? 76  HIS A ND1 1 
ATOM 585   C CD2 . HIS A 1 76  ? -21.640 73.102  -6.300  1.00 58.49  ? 76  HIS A CD2 1 
ATOM 586   C CE1 . HIS A 1 76  ? -20.361 72.058  -4.859  1.00 53.14  ? 76  HIS A CE1 1 
ATOM 587   N NE2 . HIS A 1 76  ? -20.577 73.223  -5.439  1.00 55.16  ? 76  HIS A NE2 1 
ATOM 588   N N   . THR A 1 77  ? -24.549 69.451  -9.222  1.00 54.83  ? 77  THR A N   1 
ATOM 589   C CA  . THR A 1 77  ? -25.586 68.519  -9.636  1.00 56.47  ? 77  THR A CA  1 
ATOM 590   C C   . THR A 1 77  ? -25.058 67.284  -10.387 1.00 59.34  ? 77  THR A C   1 
ATOM 591   O O   . THR A 1 77  ? -25.487 66.161  -10.122 1.00 60.56  ? 77  THR A O   1 
ATOM 592   C CB  . THR A 1 77  ? -26.634 69.230  -10.501 1.00 53.19  ? 77  THR A CB  1 
ATOM 593   O OG1 . THR A 1 77  ? -25.997 69.783  -11.660 1.00 49.78  ? 77  THR A OG1 1 
ATOM 594   C CG2 . THR A 1 77  ? -27.301 70.349  -9.703  1.00 53.71  ? 77  THR A CG2 1 
ATOM 595   N N   . ASN A 1 78  ? -24.114 67.484  -11.300 1.00 61.21  ? 78  ASN A N   1 
ATOM 596   C CA  . ASN A 1 78  ? -23.572 66.375  -12.083 1.00 60.14  ? 78  ASN A CA  1 
ATOM 597   C C   . ASN A 1 78  ? -22.327 65.698  -11.539 1.00 59.11  ? 78  ASN A C   1 
ATOM 598   O O   . ASN A 1 78  ? -21.772 64.823  -12.187 1.00 60.78  ? 78  ASN A O   1 
ATOM 599   C CB  . ASN A 1 78  ? -23.303 66.847  -13.505 1.00 59.90  ? 78  ASN A CB  1 
ATOM 600   C CG  . ASN A 1 78  ? -24.573 67.192  -14.231 1.00 61.65  ? 78  ASN A CG  1 
ATOM 601   O OD1 . ASN A 1 78  ? -25.349 66.308  -14.586 1.00 66.75  ? 78  ASN A OD1 1 
ATOM 602   N ND2 . ASN A 1 78  ? -24.812 68.480  -14.436 1.00 61.03  ? 78  ASN A ND2 1 
ATOM 603   N N   . PHE A 1 79  ? -21.881 66.100  -10.360 1.00 56.16  ? 79  PHE A N   1 
ATOM 604   C CA  . PHE A 1 79  ? -20.702 65.495  -9.756  1.00 51.17  ? 79  PHE A CA  1 
ATOM 605   C C   . PHE A 1 79  ? -19.456 65.558  -10.629 1.00 50.57  ? 79  PHE A C   1 
ATOM 606   O O   . PHE A 1 79  ? -18.632 64.642  -10.603 1.00 47.58  ? 79  PHE A O   1 
ATOM 607   C CB  . PHE A 1 79  ? -20.989 64.044  -9.412  1.00 48.36  ? 79  PHE A CB  1 
ATOM 608   C CG  . PHE A 1 79  ? -22.309 63.838  -8.741  1.00 52.38  ? 79  PHE A CG  1 
ATOM 609   C CD1 . PHE A 1 79  ? -22.645 64.561  -7.602  1.00 55.36  ? 79  PHE A CD1 1 
ATOM 610   C CD2 . PHE A 1 79  ? -23.216 62.906  -9.234  1.00 51.60  ? 79  PHE A CD2 1 
ATOM 611   C CE1 . PHE A 1 79  ? -23.864 64.361  -6.960  1.00 54.01  ? 79  PHE A CE1 1 
ATOM 612   C CE2 . PHE A 1 79  ? -24.439 62.695  -8.599  1.00 51.67  ? 79  PHE A CE2 1 
ATOM 613   C CZ  . PHE A 1 79  ? -24.764 63.426  -7.459  1.00 51.80  ? 79  PHE A CZ  1 
ATOM 614   N N   . LYS A 1 80  ? -19.323 66.623  -11.416 1.00 51.95  ? 80  LYS A N   1 
ATOM 615   C CA  . LYS A 1 80  ? -18.137 66.795  -12.253 1.00 50.65  ? 80  LYS A CA  1 
ATOM 616   C C   . LYS A 1 80  ? -17.221 67.758  -11.502 1.00 45.95  ? 80  LYS A C   1 
ATOM 617   O O   . LYS A 1 80  ? -17.674 68.754  -10.948 1.00 42.71  ? 80  LYS A O   1 
ATOM 618   C CB  . LYS A 1 80  ? -18.513 67.369  -13.618 1.00 53.01  ? 80  LYS A CB  1 
ATOM 619   C CG  . LYS A 1 80  ? -17.323 67.524  -14.571 1.00 59.05  ? 80  LYS A CG  1 
ATOM 620   C CD  . LYS A 1 80  ? -17.767 68.013  -15.966 1.00 63.65  ? 80  LYS A CD  1 
ATOM 621   C CE  . LYS A 1 80  ? -16.572 68.342  -16.874 1.00 62.50  ? 80  LYS A CE  1 
ATOM 622   N NZ  . LYS A 1 80  ? -16.949 68.554  -18.309 1.00 67.43  ? 80  LYS A NZ  1 
ATOM 623   N N   . TYR A 1 81  ? -15.936 67.457  -11.482 1.00 40.93  ? 81  TYR A N   1 
ATOM 624   C CA  . TYR A 1 81  ? -15.007 68.292  -10.759 1.00 40.06  ? 81  TYR A CA  1 
ATOM 625   C C   . TYR A 1 81  ? -13.658 68.334  -11.462 1.00 39.79  ? 81  TYR A C   1 
ATOM 626   O O   . TYR A 1 81  ? -13.013 67.307  -11.658 1.00 37.58  ? 81  TYR A O   1 
ATOM 627   C CB  . TYR A 1 81  ? -14.866 67.734  -9.357  1.00 40.92  ? 81  TYR A CB  1 
ATOM 628   C CG  . TYR A 1 81  ? -13.651 68.201  -8.606  1.00 42.52  ? 81  TYR A CG  1 
ATOM 629   C CD1 . TYR A 1 81  ? -13.723 69.266  -7.714  1.00 38.86  ? 81  TYR A CD1 1 
ATOM 630   C CD2 . TYR A 1 81  ? -12.433 67.546  -8.746  1.00 45.38  ? 81  TYR A CD2 1 
ATOM 631   C CE1 . TYR A 1 81  ? -12.604 69.665  -6.966  1.00 39.92  ? 81  TYR A CE1 1 
ATOM 632   C CE2 . TYR A 1 81  ? -11.310 67.938  -8.006  1.00 47.10  ? 81  TYR A CE2 1 
ATOM 633   C CZ  . TYR A 1 81  ? -11.401 68.997  -7.110  1.00 42.43  ? 81  TYR A CZ  1 
ATOM 634   O OH  . TYR A 1 81  ? -10.306 69.349  -6.331  1.00 42.10  ? 81  TYR A OH  1 
ATOM 635   N N   . ASN A 1 82  ? -13.223 69.533  -11.822 1.00 40.50  ? 82  ASN A N   1 
ATOM 636   C CA  . ASN A 1 82  ? -11.960 69.687  -12.519 1.00 43.04  ? 82  ASN A CA  1 
ATOM 637   C C   . ASN A 1 82  ? -10.979 70.445  -11.670 1.00 40.92  ? 82  ASN A C   1 
ATOM 638   O O   . ASN A 1 82  ? -11.380 71.246  -10.839 1.00 40.51  ? 82  ASN A O   1 
ATOM 639   C CB  . ASN A 1 82  ? -12.189 70.449  -13.805 1.00 46.83  ? 82  ASN A CB  1 
ATOM 640   C CG  . ASN A 1 82  ? -13.457 70.022  -14.495 1.00 53.69  ? 82  ASN A CG  1 
ATOM 641   O OD1 . ASN A 1 82  ? -14.555 70.116  -13.930 1.00 61.16  ? 82  ASN A OD1 1 
ATOM 642   N ND2 . ASN A 1 82  ? -13.324 69.542  -15.721 1.00 54.29  ? 82  ASN A ND2 1 
ATOM 643   N N   . TYR A 1 83  ? -9.695  70.185  -11.881 1.00 37.67  ? 83  TYR A N   1 
ATOM 644   C CA  . TYR A 1 83  ? -8.654  70.871  -11.146 1.00 38.73  ? 83  TYR A CA  1 
ATOM 645   C C   . TYR A 1 83  ? -7.331  70.700  -11.873 1.00 41.05  ? 83  TYR A C   1 
ATOM 646   O O   . TYR A 1 83  ? -7.244  69.922  -12.815 1.00 45.47  ? 83  TYR A O   1 
ATOM 647   C CB  . TYR A 1 83  ? -8.558  70.340  -9.726  1.00 38.80  ? 83  TYR A CB  1 
ATOM 648   C CG  . TYR A 1 83  ? -7.960  68.967  -9.624  1.00 35.68  ? 83  TYR A CG  1 
ATOM 649   C CD1 . TYR A 1 83  ? -8.711  67.830  -9.935  1.00 29.35  ? 83  TYR A CD1 1 
ATOM 650   C CD2 . TYR A 1 83  ? -6.638  68.809  -9.209  1.00 32.09  ? 83  TYR A CD2 1 
ATOM 651   C CE1 . TYR A 1 83  ? -8.159  66.559  -9.830  1.00 31.24  ? 83  TYR A CE1 1 
ATOM 652   C CE2 . TYR A 1 83  ? -6.070  67.558  -9.103  1.00 36.24  ? 83  TYR A CE2 1 
ATOM 653   C CZ  . TYR A 1 83  ? -6.828  66.420  -9.415  1.00 38.25  ? 83  TYR A CZ  1 
ATOM 654   O OH  . TYR A 1 83  ? -6.237  65.154  -9.319  1.00 39.51  ? 83  TYR A OH  1 
ATOM 655   N N   . SER A 1 84  ? -6.298  71.407  -11.430 1.00 40.92  ? 84  SER A N   1 
ATOM 656   C CA  . SER A 1 84  ? -5.013  71.360  -12.124 1.00 39.94  ? 84  SER A CA  1 
ATOM 657   C C   . SER A 1 84  ? -3.801  71.300  -11.220 1.00 39.90  ? 84  SER A C   1 
ATOM 658   O O   . SER A 1 84  ? -3.671  72.073  -10.277 1.00 43.25  ? 84  SER A O   1 
ATOM 659   C CB  . SER A 1 84  ? -4.851  72.605  -13.013 1.00 37.97  ? 84  SER A CB  1 
ATOM 660   O OG  . SER A 1 84  ? -6.041  72.901  -13.728 1.00 29.91  ? 84  SER A OG  1 
ATOM 661   N N   . VAL A 1 85  ? -2.897  70.383  -11.506 1.00 40.61  ? 85  VAL A N   1 
ATOM 662   C CA  . VAL A 1 85  ? -1.681  70.321  -10.720 1.00 38.91  ? 85  VAL A CA  1 
ATOM 663   C C   . VAL A 1 85  ? -0.867  71.443  -11.332 1.00 38.03  ? 85  VAL A C   1 
ATOM 664   O O   . VAL A 1 85  ? -0.771  71.529  -12.548 1.00 37.47  ? 85  VAL A O   1 
ATOM 665   C CB  . VAL A 1 85  ? -0.961  69.009  -10.919 1.00 34.92  ? 85  VAL A CB  1 
ATOM 666   C CG1 . VAL A 1 85  ? 0.309   69.003  -10.072 1.00 38.25  ? 85  VAL A CG1 1 
ATOM 667   C CG2 . VAL A 1 85  ? -1.894  67.875  -10.554 1.00 25.32  ? 85  VAL A CG2 1 
ATOM 668   N N   . ILE A 1 86  ? -0.274  72.303  -10.513 1.00 38.15  ? 86  ILE A N   1 
ATOM 669   C CA  . ILE A 1 86  ? 0.449   73.428  -11.089 1.00 35.60  ? 86  ILE A CA  1 
ATOM 670   C C   . ILE A 1 86  ? 1.810   73.738  -10.512 1.00 36.08  ? 86  ILE A C   1 
ATOM 671   O O   . ILE A 1 86  ? 2.530   74.559  -11.055 1.00 31.98  ? 86  ILE A O   1 
ATOM 672   C CB  . ILE A 1 86  ? -0.410  74.686  -11.013 1.00 30.49  ? 86  ILE A CB  1 
ATOM 673   C CG1 . ILE A 1 86  ? -0.558  75.115  -9.552  1.00 30.34  ? 86  ILE A CG1 1 
ATOM 674   C CG2 . ILE A 1 86  ? -1.807  74.391  -11.600 1.00 28.49  ? 86  ILE A CG2 1 
ATOM 675   C CD1 . ILE A 1 86  ? -1.677  76.109  -9.319  1.00 35.69  ? 86  ILE A CD1 1 
ATOM 676   N N   . GLU A 1 87  ? 2.175   73.106  -9.409  1.00 41.70  ? 87  GLU A N   1 
ATOM 677   C CA  . GLU A 1 87  ? 3.490   73.375  -8.860  1.00 48.07  ? 87  GLU A CA  1 
ATOM 678   C C   . GLU A 1 87  ? 3.931   72.223  -7.977  1.00 51.93  ? 87  GLU A C   1 
ATOM 679   O O   . GLU A 1 87  ? 3.097   71.570  -7.338  1.00 50.67  ? 87  GLU A O   1 
ATOM 680   C CB  . GLU A 1 87  ? 3.489   74.678  -8.066  1.00 50.57  ? 87  GLU A CB  1 
ATOM 681   C CG  . GLU A 1 87  ? 4.877   75.276  -7.886  1.00 60.31  ? 87  GLU A CG  1 
ATOM 682   C CD  . GLU A 1 87  ? 4.931   76.352  -6.799  1.00 70.87  ? 87  GLU A CD  1 
ATOM 683   O OE1 . GLU A 1 87  ? 4.236   77.396  -6.922  1.00 71.75  ? 87  GLU A OE1 1 
ATOM 684   O OE2 . GLU A 1 87  ? 5.678   76.150  -5.812  1.00 75.03  ? 87  GLU A OE2 1 
ATOM 685   N N   . GLY A 1 88  ? 5.244   71.982  -7.966  1.00 55.48  ? 88  GLY A N   1 
ATOM 686   C CA  . GLY A 1 88  ? 5.824   70.919  -7.169  1.00 58.89  ? 88  GLY A CA  1 
ATOM 687   C C   . GLY A 1 88  ? 5.428   69.519  -7.611  1.00 63.27  ? 88  GLY A C   1 
ATOM 688   O O   . GLY A 1 88  ? 4.315   69.303  -8.115  1.00 65.80  ? 88  GLY A O   1 
ATOM 689   N N   . GLY A 1 89  ? 6.337   68.561  -7.421  1.00 63.42  ? 89  GLY A N   1 
ATOM 690   C CA  . GLY A 1 89  ? 6.057   67.187  -7.802  1.00 61.77  ? 89  GLY A CA  1 
ATOM 691   C C   . GLY A 1 89  ? 6.338   66.895  -9.264  1.00 62.14  ? 89  GLY A C   1 
ATOM 692   O O   . GLY A 1 89  ? 7.399   67.260  -9.779  1.00 64.56  ? 89  GLY A O   1 
ATOM 693   N N   . PRO A 1 90  ? 5.398   66.237  -9.965  1.00 61.49  ? 90  PRO A N   1 
ATOM 694   C CA  . PRO A 1 90  ? 5.549   65.897  -11.382 1.00 63.15  ? 90  PRO A CA  1 
ATOM 695   C C   . PRO A 1 90  ? 5.810   67.128  -12.242 1.00 66.27  ? 90  PRO A C   1 
ATOM 696   O O   . PRO A 1 90  ? 6.322   67.033  -13.362 1.00 70.17  ? 90  PRO A O   1 
ATOM 697   C CB  . PRO A 1 90  ? 4.214   65.233  -11.722 1.00 59.40  ? 90  PRO A CB  1 
ATOM 698   C CG  . PRO A 1 90  ? 3.266   65.902  -10.804 1.00 58.67  ? 90  PRO A CG  1 
ATOM 699   C CD  . PRO A 1 90  ? 4.037   65.913  -9.506  1.00 60.87  ? 90  PRO A CD  1 
ATOM 700   N N   . ILE A 1 91  ? 5.453   68.288  -11.707 1.00 66.52  ? 91  ILE A N   1 
ATOM 701   C CA  . ILE A 1 91  ? 5.630   69.534  -12.425 1.00 65.14  ? 91  ILE A CA  1 
ATOM 702   C C   . ILE A 1 91  ? 7.089   69.969  -12.475 1.00 68.08  ? 91  ILE A C   1 
ATOM 703   O O   . ILE A 1 91  ? 7.816   69.875  -11.486 1.00 70.54  ? 91  ILE A O   1 
ATOM 704   C CB  . ILE A 1 91  ? 4.790   70.642  -11.789 1.00 59.93  ? 91  ILE A CB  1 
ATOM 705   C CG1 . ILE A 1 91  ? 3.324   70.200  -11.711 1.00 55.63  ? 91  ILE A CG1 1 
ATOM 706   C CG2 . ILE A 1 91  ? 4.923   71.901  -12.600 1.00 56.09  ? 91  ILE A CG2 1 
ATOM 707   C CD1 . ILE A 1 91  ? 2.711   69.849  -13.052 1.00 53.05  ? 91  ILE A CD1 1 
ATOM 708   N N   . GLY A 1 92  ? 7.513   70.432  -13.645 1.00 71.13  ? 92  GLY A N   1 
ATOM 709   C CA  . GLY A 1 92  ? 8.879   70.889  -13.812 1.00 73.70  ? 92  GLY A CA  1 
ATOM 710   C C   . GLY A 1 92  ? 9.560   70.337  -15.048 1.00 76.20  ? 92  GLY A C   1 
ATOM 711   O O   . GLY A 1 92  ? 9.416   69.150  -15.365 1.00 76.63  ? 92  GLY A O   1 
ATOM 712   N N   . ASP A 1 93  ? 10.296  71.206  -15.743 1.00 77.81  ? 93  ASP A N   1 
ATOM 713   C CA  . ASP A 1 93  ? 11.039  70.835  -16.951 1.00 81.72  ? 93  ASP A CA  1 
ATOM 714   C C   . ASP A 1 93  ? 10.152  70.215  -18.019 1.00 81.89  ? 93  ASP A C   1 
ATOM 715   O O   . ASP A 1 93  ? 9.557   70.906  -18.846 1.00 84.50  ? 93  ASP A O   1 
ATOM 716   C CB  . ASP A 1 93  ? 12.144  69.838  -16.596 1.00 86.46  ? 93  ASP A CB  1 
ATOM 717   C CG  . ASP A 1 93  ? 13.040  70.339  -15.481 1.00 92.33  ? 93  ASP A CG  1 
ATOM 718   O OD1 . ASP A 1 93  ? 13.832  71.270  -15.739 1.00 96.30  ? 93  ASP A OD1 1 
ATOM 719   O OD2 . ASP A 1 93  ? 12.945  69.809  -14.348 1.00 92.48  ? 93  ASP A OD2 1 
ATOM 720   N N   . THR A 1 94  ? 10.081  68.892  -17.984 1.00 80.33  ? 94  THR A N   1 
ATOM 721   C CA  . THR A 1 94  ? 9.288   68.116  -18.920 1.00 79.07  ? 94  THR A CA  1 
ATOM 722   C C   . THR A 1 94  ? 7.784   68.422  -18.839 1.00 78.00  ? 94  THR A C   1 
ATOM 723   O O   . THR A 1 94  ? 7.101   68.523  -19.863 1.00 78.45  ? 94  THR A O   1 
ATOM 724   C CB  . THR A 1 94  ? 9.528   66.619  -18.656 1.00 78.25  ? 94  THR A CB  1 
ATOM 725   O OG1 . THR A 1 94  ? 9.190   66.319  -17.296 1.00 80.88  ? 94  THR A OG1 1 
ATOM 726   C CG2 . THR A 1 94  ? 11.005  66.272  -18.871 1.00 79.45  ? 94  THR A CG2 1 
ATOM 727   N N   . LEU A 1 95  ? 7.277   68.576  -17.618 1.00 76.49  ? 95  LEU A N   1 
ATOM 728   C CA  . LEU A 1 95  ? 5.861   68.849  -17.397 1.00 73.75  ? 95  LEU A CA  1 
ATOM 729   C C   . LEU A 1 95  ? 5.592   70.289  -16.981 1.00 74.55  ? 95  LEU A C   1 
ATOM 730   O O   . LEU A 1 95  ? 6.303   70.843  -16.139 1.00 75.25  ? 95  LEU A O   1 
ATOM 731   C CB  . LEU A 1 95  ? 5.312   67.924  -16.312 1.00 70.53  ? 95  LEU A CB  1 
ATOM 732   C CG  . LEU A 1 95  ? 4.137   67.019  -16.682 1.00 72.37  ? 95  LEU A CG  1 
ATOM 733   C CD1 . LEU A 1 95  ? 3.578   66.411  -15.398 1.00 71.94  ? 95  LEU A CD1 1 
ATOM 734   C CD2 . LEU A 1 95  ? 3.056   67.799  -17.430 1.00 68.06  ? 95  LEU A CD2 1 
ATOM 735   N N   . GLU A 1 96  ? 4.555   70.881  -17.574 1.00 76.04  ? 96  GLU A N   1 
ATOM 736   C CA  . GLU A 1 96  ? 4.136   72.257  -17.270 1.00 75.34  ? 96  GLU A CA  1 
ATOM 737   C C   . GLU A 1 96  ? 3.053   72.228  -16.194 1.00 69.81  ? 96  GLU A C   1 
ATOM 738   O O   . GLU A 1 96  ? 3.241   72.747  -15.094 1.00 69.68  ? 96  GLU A O   1 
ATOM 739   C CB  . GLU A 1 96  ? 3.552   72.951  -18.513 1.00 82.16  ? 96  GLU A CB  1 
ATOM 740   C CG  . GLU A 1 96  ? 4.565   73.497  -19.523 1.00 89.24  ? 96  GLU A CG  1 
ATOM 741   C CD  . GLU A 1 96  ? 3.891   74.206  -20.703 1.00 96.16  ? 96  GLU A CD  1 
ATOM 742   O OE1 . GLU A 1 96  ? 4.622   74.723  -21.584 1.00 100.62 ? 96  GLU A OE1 1 
ATOM 743   O OE2 . GLU A 1 96  ? 2.633   74.243  -20.749 1.00 100.13 ? 96  GLU A OE2 1 
ATOM 744   N N   . LYS A 1 97  ? 1.917   71.622  -16.533 1.00 62.14  ? 97  LYS A N   1 
ATOM 745   C CA  . LYS A 1 97  ? 0.794   71.509  -15.611 1.00 56.22  ? 97  LYS A CA  1 
ATOM 746   C C   . LYS A 1 97  ? -0.081  70.343  -16.039 1.00 51.43  ? 97  LYS A C   1 
ATOM 747   O O   . LYS A 1 97  ? -0.125  70.016  -17.213 1.00 53.71  ? 97  LYS A O   1 
ATOM 748   C CB  . LYS A 1 97  ? -0.036  72.810  -15.617 1.00 55.93  ? 97  LYS A CB  1 
ATOM 749   C CG  . LYS A 1 97  ? -1.231  72.844  -16.590 1.00 50.53  ? 97  LYS A CG  1 
ATOM 750   C CD  . LYS A 1 97  ? -1.747  74.270  -16.764 1.00 46.80  ? 97  LYS A CD  1 
ATOM 751   C CE  . LYS A 1 97  ? -2.981  74.340  -17.645 1.00 42.67  ? 97  LYS A CE  1 
ATOM 752   N NZ  . LYS A 1 97  ? -4.180  73.877  -16.904 1.00 43.90  ? 97  LYS A NZ  1 
ATOM 753   N N   . ILE A 1 98  ? -0.781  69.729  -15.090 1.00 47.75  ? 98  ILE A N   1 
ATOM 754   C CA  . ILE A 1 98  ? -1.675  68.613  -15.395 1.00 40.88  ? 98  ILE A CA  1 
ATOM 755   C C   . ILE A 1 98  ? -3.115  68.995  -15.117 1.00 36.67  ? 98  ILE A C   1 
ATOM 756   O O   . ILE A 1 98  ? -3.470  69.346  -13.997 1.00 36.76  ? 98  ILE A O   1 
ATOM 757   C CB  . ILE A 1 98  ? -1.359  67.377  -14.541 1.00 39.08  ? 98  ILE A CB  1 
ATOM 758   C CG1 . ILE A 1 98  ? 0.137   67.058  -14.636 1.00 41.94  ? 98  ILE A CG1 1 
ATOM 759   C CG2 . ILE A 1 98  ? -2.205  66.206  -15.006 1.00 28.58  ? 98  ILE A CG2 1 
ATOM 760   C CD1 . ILE A 1 98  ? 0.627   66.073  -13.589 1.00 35.22  ? 98  ILE A CD1 1 
ATOM 761   N N   . SER A 1 99  ? -3.945  68.936  -16.141 1.00 34.74  ? 99  SER A N   1 
ATOM 762   C CA  . SER A 1 99  ? -5.341  69.254  -15.955 1.00 39.18  ? 99  SER A CA  1 
ATOM 763   C C   . SER A 1 99  ? -5.979  67.930  -15.653 1.00 40.85  ? 99  SER A C   1 
ATOM 764   O O   . SER A 1 99  ? -5.569  66.912  -16.194 1.00 41.04  ? 99  SER A O   1 
ATOM 765   C CB  . SER A 1 99  ? -5.946  69.801  -17.231 1.00 44.75  ? 99  SER A CB  1 
ATOM 766   O OG  . SER A 1 99  ? -4.983  70.555  -17.934 1.00 55.89  ? 99  SER A OG  1 
ATOM 767   N N   . ASN A 1 100 ? -6.986  67.932  -14.794 1.00 43.79  ? 100 ASN A N   1 
ATOM 768   C CA  . ASN A 1 100 ? -7.657  66.698  -14.450 1.00 43.72  ? 100 ASN A CA  1 
ATOM 769   C C   . ASN A 1 100 ? -9.134  66.922  -14.371 1.00 47.24  ? 100 ASN A C   1 
ATOM 770   O O   . ASN A 1 100 ? -9.598  68.030  -14.103 1.00 54.17  ? 100 ASN A O   1 
ATOM 771   C CB  . ASN A 1 100 ? -7.153  66.193  -13.117 1.00 40.79  ? 100 ASN A CB  1 
ATOM 772   C CG  . ASN A 1 100 ? -5.658  66.121  -13.073 1.00 43.46  ? 100 ASN A CG  1 
ATOM 773   O OD1 . ASN A 1 100 ? -5.036  65.563  -13.971 1.00 48.96  ? 100 ASN A OD1 1 
ATOM 774   N ND2 . ASN A 1 100 ? -5.063  66.686  -12.031 1.00 49.95  ? 100 ASN A ND2 1 
ATOM 775   N N   . GLU A 1 101 ? -9.879  65.866  -14.624 1.00 48.86  ? 101 GLU A N   1 
ATOM 776   C CA  . GLU A 1 101 ? -11.315 65.954  -14.545 1.00 54.28  ? 101 GLU A CA  1 
ATOM 777   C C   . GLU A 1 101 ? -11.852 64.646  -13.997 1.00 55.36  ? 101 GLU A C   1 
ATOM 778   O O   . GLU A 1 101 ? -11.513 63.570  -14.486 1.00 56.34  ? 101 GLU A O   1 
ATOM 779   C CB  . GLU A 1 101 ? -11.930 66.217  -15.904 1.00 56.15  ? 101 GLU A CB  1 
ATOM 780   C CG  . GLU A 1 101 ? -13.424 66.339  -15.788 1.00 65.53  ? 101 GLU A CG  1 
ATOM 781   C CD  . GLU A 1 101 ? -14.099 66.545  -17.117 1.00 71.44  ? 101 GLU A CD  1 
ATOM 782   O OE1 . GLU A 1 101 ? -13.601 67.376  -17.918 1.00 69.37  ? 101 GLU A OE1 1 
ATOM 783   O OE2 . GLU A 1 101 ? -15.139 65.883  -17.350 1.00 75.62  ? 101 GLU A OE2 1 
ATOM 784   N N   . ILE A 1 102 ? -12.687 64.745  -12.974 1.00 55.53  ? 102 ILE A N   1 
ATOM 785   C CA  . ILE A 1 102 ? -13.263 63.571  -12.360 1.00 52.70  ? 102 ILE A CA  1 
ATOM 786   C C   . ILE A 1 102 ? -14.772 63.688  -12.389 1.00 53.97  ? 102 ILE A C   1 
ATOM 787   O O   . ILE A 1 102 ? -15.359 64.636  -11.870 1.00 52.30  ? 102 ILE A O   1 
ATOM 788   C CB  . ILE A 1 102 ? -12.796 63.419  -10.913 1.00 50.52  ? 102 ILE A CB  1 
ATOM 789   C CG1 . ILE A 1 102 ? -11.270 63.339  -10.875 1.00 46.85  ? 102 ILE A CG1 1 
ATOM 790   C CG2 . ILE A 1 102 ? -13.417 62.181  -10.302 1.00 51.73  ? 102 ILE A CG2 1 
ATOM 791   C CD1 . ILE A 1 102 ? -10.691 63.208  -9.488  1.00 44.15  ? 102 ILE A CD1 1 
ATOM 792   N N   . LYS A 1 103 ? -15.403 62.714  -13.015 1.00 53.95  ? 103 LYS A N   1 
ATOM 793   C CA  . LYS A 1 103 ? -16.839 62.716  -13.110 1.00 52.36  ? 103 LYS A CA  1 
ATOM 794   C C   . LYS A 1 103 ? -17.330 61.429  -12.442 1.00 50.08  ? 103 LYS A C   1 
ATOM 795   O O   . LYS A 1 103 ? -16.716 60.369  -12.606 1.00 52.40  ? 103 LYS A O   1 
ATOM 796   C CB  . LYS A 1 103 ? -17.222 62.769  -14.585 1.00 55.94  ? 103 LYS A CB  1 
ATOM 797   C CG  . LYS A 1 103 ? -18.629 63.233  -14.845 1.00 62.02  ? 103 LYS A CG  1 
ATOM 798   C CD  . LYS A 1 103 ? -19.665 62.239  -14.331 1.00 68.82  ? 103 LYS A CD  1 
ATOM 799   C CE  . LYS A 1 103 ? -21.083 62.764  -14.561 1.00 71.32  ? 103 LYS A CE  1 
ATOM 800   N NZ  . LYS A 1 103 ? -21.312 63.190  -15.990 1.00 73.76  ? 103 LYS A NZ  1 
ATOM 801   N N   . ILE A 1 104 ? -18.414 61.524  -11.675 1.00 44.93  ? 104 ILE A N   1 
ATOM 802   C CA  . ILE A 1 104 ? -18.965 60.363  -10.990 1.00 45.11  ? 104 ILE A CA  1 
ATOM 803   C C   . ILE A 1 104 ? -20.404 60.109  -11.421 1.00 48.55  ? 104 ILE A C   1 
ATOM 804   O O   . ILE A 1 104 ? -21.288 60.958  -11.254 1.00 44.35  ? 104 ILE A O   1 
ATOM 805   C CB  . ILE A 1 104 ? -18.877 60.531  -9.458  1.00 44.82  ? 104 ILE A CB  1 
ATOM 806   C CG1 . ILE A 1 104 ? -17.404 60.562  -9.037  1.00 45.06  ? 104 ILE A CG1 1 
ATOM 807   C CG2 . ILE A 1 104 ? -19.578 59.387  -8.761  1.00 42.01  ? 104 ILE A CG2 1 
ATOM 808   C CD1 . ILE A 1 104 ? -17.177 60.742  -7.561  1.00 46.28  ? 104 ILE A CD1 1 
ATOM 809   N N   . VAL A 1 105 ? -20.610 58.918  -11.985 1.00 55.82  ? 105 VAL A N   1 
ATOM 810   C CA  . VAL A 1 105 ? -21.906 58.461  -12.507 1.00 57.96  ? 105 VAL A CA  1 
ATOM 811   C C   . VAL A 1 105 ? -22.545 57.335  -11.700 1.00 58.91  ? 105 VAL A C   1 
ATOM 812   O O   . VAL A 1 105 ? -21.898 56.328  -11.383 1.00 60.01  ? 105 VAL A O   1 
ATOM 813   C CB  . VAL A 1 105 ? -21.760 57.954  -13.945 1.00 58.19  ? 105 VAL A CB  1 
ATOM 814   C CG1 . VAL A 1 105 ? -21.479 59.119  -14.888 1.00 54.01  ? 105 VAL A CG1 1 
ATOM 815   C CG2 . VAL A 1 105 ? -20.624 56.916  -14.003 1.00 59.49  ? 105 VAL A CG2 1 
ATOM 816   N N   . ALA A 1 106 ? -23.830 57.499  -11.403 1.00 59.13  ? 106 ALA A N   1 
ATOM 817   C CA  . ALA A 1 106 ? -24.559 56.512  -10.621 1.00 65.06  ? 106 ALA A CA  1 
ATOM 818   C C   . ALA A 1 106 ? -25.084 55.359  -11.474 1.00 69.95  ? 106 ALA A C   1 
ATOM 819   O O   . ALA A 1 106 ? -25.971 55.548  -12.316 1.00 74.68  ? 106 ALA A O   1 
ATOM 820   C CB  . ALA A 1 106 ? -25.716 57.187  -9.874  1.00 59.85  ? 106 ALA A CB  1 
ATOM 821   N N   . THR A 1 107 ? -24.526 54.168  -11.253 1.00 74.26  ? 107 THR A N   1 
ATOM 822   C CA  . THR A 1 107 ? -24.944 52.967  -11.970 1.00 76.01  ? 107 THR A CA  1 
ATOM 823   C C   . THR A 1 107 ? -26.294 52.501  -11.411 1.00 79.36  ? 107 THR A C   1 
ATOM 824   O O   . THR A 1 107 ? -26.594 52.718  -10.238 1.00 78.68  ? 107 THR A O   1 
ATOM 825   C CB  . THR A 1 107 ? -23.895 51.854  -11.826 1.00 73.34  ? 107 THR A CB  1 
ATOM 826   O OG1 . THR A 1 107 ? -23.443 51.793  -10.471 1.00 70.76  ? 107 THR A OG1 1 
ATOM 827   C CG2 . THR A 1 107 ? -22.714 52.133  -12.722 1.00 72.35  ? 107 THR A CG2 1 
ATOM 828   N N   . PRO A 1 108 ? -27.126 51.860  -12.251 1.00 82.84  ? 108 PRO A N   1 
ATOM 829   C CA  . PRO A 1 108 ? -28.462 51.352  -11.901 1.00 84.94  ? 108 PRO A CA  1 
ATOM 830   C C   . PRO A 1 108 ? -28.536 50.485  -10.642 1.00 85.49  ? 108 PRO A C   1 
ATOM 831   O O   . PRO A 1 108 ? -29.550 50.478  -9.934  1.00 85.29  ? 108 PRO A O   1 
ATOM 832   C CB  . PRO A 1 108 ? -28.871 50.577  -13.154 1.00 85.72  ? 108 PRO A CB  1 
ATOM 833   C CG  . PRO A 1 108 ? -28.166 51.310  -14.244 1.00 85.80  ? 108 PRO A CG  1 
ATOM 834   C CD  . PRO A 1 108 ? -26.796 51.509  -13.642 1.00 84.29  ? 108 PRO A CD  1 
ATOM 835   N N   . ASP A 1 109 ? -27.460 49.752  -10.377 1.00 84.16  ? 109 ASP A N   1 
ATOM 836   C CA  . ASP A 1 109 ? -27.387 48.878  -9.216  1.00 84.03  ? 109 ASP A CA  1 
ATOM 837   C C   . ASP A 1 109 ? -27.168 49.642  -7.912  1.00 84.05  ? 109 ASP A C   1 
ATOM 838   O O   . ASP A 1 109 ? -27.038 49.029  -6.853  1.00 83.50  ? 109 ASP A O   1 
ATOM 839   C CB  . ASP A 1 109 ? -26.254 47.874  -9.403  1.00 86.82  ? 109 ASP A CB  1 
ATOM 840   C CG  . ASP A 1 109 ? -24.970 48.534  -9.858  1.00 92.17  ? 109 ASP A CG  1 
ATOM 841   O OD1 . ASP A 1 109 ? -24.959 49.068  -10.993 1.00 95.17  ? 109 ASP A OD1 1 
ATOM 842   O OD2 . ASP A 1 109 ? -23.983 48.526  -9.083  1.00 94.66  ? 109 ASP A OD2 1 
ATOM 843   N N   . GLY A 1 110 ? -27.123 50.971  -7.989  1.00 84.58  ? 110 GLY A N   1 
ATOM 844   C CA  . GLY A 1 110 ? -26.908 51.780  -6.798  1.00 82.86  ? 110 GLY A CA  1 
ATOM 845   C C   . GLY A 1 110 ? -25.476 52.285  -6.649  1.00 81.65  ? 110 GLY A C   1 
ATOM 846   O O   . GLY A 1 110 ? -25.257 53.407  -6.180  1.00 82.47  ? 110 GLY A O   1 
ATOM 847   N N   . GLY A 1 111 ? -24.503 51.461  -7.046  1.00 78.70  ? 111 GLY A N   1 
ATOM 848   C CA  . GLY A 1 111 ? -23.100 51.840  -6.955  1.00 72.09  ? 111 GLY A CA  1 
ATOM 849   C C   . GLY A 1 111 ? -22.722 53.030  -7.825  1.00 67.57  ? 111 GLY A C   1 
ATOM 850   O O   . GLY A 1 111 ? -23.528 53.941  -8.035  1.00 65.48  ? 111 GLY A O   1 
ATOM 851   N N   . SER A 1 112 ? -21.500 53.034  -8.346  1.00 64.42  ? 112 SER A N   1 
ATOM 852   C CA  . SER A 1 112 ? -21.071 54.152  -9.171  1.00 61.67  ? 112 SER A CA  1 
ATOM 853   C C   . SER A 1 112 ? -19.759 53.924  -9.914  1.00 61.19  ? 112 SER A C   1 
ATOM 854   O O   . SER A 1 112 ? -19.043 52.939  -9.669  1.00 58.33  ? 112 SER A O   1 
ATOM 855   C CB  . SER A 1 112 ? -20.956 55.415  -8.305  1.00 63.31  ? 112 SER A CB  1 
ATOM 856   O OG  . SER A 1 112 ? -20.030 55.237  -7.239  1.00 61.58  ? 112 SER A OG  1 
ATOM 857   N N   . ILE A 1 113 ? -19.454 54.860  -10.817 1.00 60.95  ? 113 ILE A N   1 
ATOM 858   C CA  . ILE A 1 113 ? -18.239 54.816  -11.633 1.00 60.45  ? 113 ILE A CA  1 
ATOM 859   C C   . ILE A 1 113 ? -17.523 56.173  -11.669 1.00 58.32  ? 113 ILE A C   1 
ATOM 860   O O   . ILE A 1 113 ? -18.159 57.223  -11.775 1.00 55.95  ? 113 ILE A O   1 
ATOM 861   C CB  . ILE A 1 113 ? -18.549 54.442  -13.095 1.00 61.07  ? 113 ILE A CB  1 
ATOM 862   C CG1 . ILE A 1 113 ? -19.735 53.481  -13.159 1.00 57.81  ? 113 ILE A CG1 1 
ATOM 863   C CG2 . ILE A 1 113 ? -17.319 53.801  -13.728 1.00 63.92  ? 113 ILE A CG2 1 
ATOM 864   C CD1 . ILE A 1 113 ? -20.319 53.338  -14.543 1.00 52.96  ? 113 ILE A CD1 1 
ATOM 865   N N   . LEU A 1 114 ? -16.196 56.131  -11.611 1.00 55.95  ? 114 LEU A N   1 
ATOM 866   C CA  . LEU A 1 114 ? -15.386 57.336  -11.630 1.00 56.16  ? 114 LEU A CA  1 
ATOM 867   C C   . LEU A 1 114 ? -14.525 57.454  -12.859 1.00 56.83  ? 114 LEU A C   1 
ATOM 868   O O   . LEU A 1 114 ? -13.482 56.815  -12.930 1.00 58.12  ? 114 LEU A O   1 
ATOM 869   C CB  . LEU A 1 114 ? -14.431 57.376  -10.446 1.00 60.24  ? 114 LEU A CB  1 
ATOM 870   C CG  . LEU A 1 114 ? -14.979 57.389  -9.036  1.00 63.33  ? 114 LEU A CG  1 
ATOM 871   C CD1 . LEU A 1 114 ? -15.482 56.002  -8.664  1.00 63.91  ? 114 LEU A CD1 1 
ATOM 872   C CD2 . LEU A 1 114 ? -13.860 57.821  -8.106  1.00 64.75  ? 114 LEU A CD2 1 
ATOM 873   N N   . LYS A 1 115 ? -14.927 58.285  -13.812 1.00 56.84  ? 115 LYS A N   1 
ATOM 874   C CA  . LYS A 1 115 ? -14.118 58.488  -15.006 1.00 58.08  ? 115 LYS A CA  1 
ATOM 875   C C   . LYS A 1 115 ? -13.025 59.508  -14.623 1.00 58.16  ? 115 LYS A C   1 
ATOM 876   O O   . LYS A 1 115 ? -13.248 60.339  -13.752 1.00 60.61  ? 115 LYS A O   1 
ATOM 877   C CB  . LYS A 1 115 ? -15.017 58.993  -16.121 1.00 61.94  ? 115 LYS A CB  1 
ATOM 878   C CG  . LYS A 1 115 ? -16.282 58.159  -16.253 1.00 68.37  ? 115 LYS A CG  1 
ATOM 879   C CD  . LYS A 1 115 ? -17.108 58.585  -17.454 1.00 72.70  ? 115 LYS A CD  1 
ATOM 880   C CE  . LYS A 1 115 ? -18.381 57.751  -17.597 1.00 75.67  ? 115 LYS A CE  1 
ATOM 881   N NZ  . LYS A 1 115 ? -19.277 58.240  -18.708 1.00 77.20  ? 115 LYS A NZ  1 
ATOM 882   N N   . ILE A 1 116 ? -11.856 59.464  -15.263 1.00 57.41  ? 116 ILE A N   1 
ATOM 883   C CA  . ILE A 1 116 ? -10.755 60.363  -14.883 1.00 57.84  ? 116 ILE A CA  1 
ATOM 884   C C   . ILE A 1 116 ? -9.733  60.773  -15.967 1.00 56.48  ? 116 ILE A C   1 
ATOM 885   O O   . ILE A 1 116 ? -8.848  59.981  -16.307 1.00 54.18  ? 116 ILE A O   1 
ATOM 886   C CB  . ILE A 1 116 ? -9.947  59.716  -13.725 1.00 62.87  ? 116 ILE A CB  1 
ATOM 887   C CG1 . ILE A 1 116 ? -10.787 59.672  -12.452 1.00 64.67  ? 116 ILE A CG1 1 
ATOM 888   C CG2 . ILE A 1 116 ? -8.651  60.478  -13.482 1.00 69.11  ? 116 ILE A CG2 1 
ATOM 889   C CD1 . ILE A 1 116 ? -10.089 58.953  -11.312 1.00 64.20  ? 116 ILE A CD1 1 
ATOM 890   N N   . SER A 1 117 ? -9.809  62.012  -16.462 1.00 55.06  ? 117 SER A N   1 
ATOM 891   C CA  . SER A 1 117 ? -8.868  62.482  -17.490 1.00 54.21  ? 117 SER A CA  1 
ATOM 892   C C   . SER A 1 117 ? -7.544  62.913  -16.890 1.00 51.67  ? 117 SER A C   1 
ATOM 893   O O   . SER A 1 117 ? -7.413  63.003  -15.677 1.00 52.28  ? 117 SER A O   1 
ATOM 894   C CB  . SER A 1 117 ? -9.459  63.654  -18.259 1.00 57.95  ? 117 SER A CB  1 
ATOM 895   O OG  . SER A 1 117 ? -10.742 63.312  -18.745 1.00 63.43  ? 117 SER A OG  1 
ATOM 896   N N   . ASN A 1 118 ? -6.568  63.198  -17.740 1.00 50.12  ? 118 ASN A N   1 
ATOM 897   C CA  . ASN A 1 118 ? -5.257  63.600  -17.248 1.00 50.14  ? 118 ASN A CA  1 
ATOM 898   C C   . ASN A 1 118 ? -4.372  64.267  -18.301 1.00 49.89  ? 118 ASN A C   1 
ATOM 899   O O   . ASN A 1 118 ? -3.249  63.813  -18.548 1.00 45.16  ? 118 ASN A O   1 
ATOM 900   C CB  . ASN A 1 118 ? -4.515  62.384  -16.698 1.00 55.33  ? 118 ASN A CB  1 
ATOM 901   C CG  . ASN A 1 118 ? -4.962  62.004  -15.305 1.00 64.05  ? 118 ASN A CG  1 
ATOM 902   O OD1 . ASN A 1 118 ? -4.611  62.668  -14.325 1.00 68.09  ? 118 ASN A OD1 1 
ATOM 903   N ND2 . ASN A 1 118 ? -5.747  60.928  -15.204 1.00 64.82  ? 118 ASN A ND2 1 
ATOM 904   N N   . LYS A 1 119 ? -4.854  65.345  -18.914 1.00 47.57  ? 119 LYS A N   1 
ATOM 905   C CA  . LYS A 1 119 ? -4.056  66.009  -19.929 1.00 45.68  ? 119 LYS A CA  1 
ATOM 906   C C   . LYS A 1 119 ? -2.757  66.508  -19.315 1.00 45.14  ? 119 LYS A C   1 
ATOM 907   O O   . LYS A 1 119 ? -2.769  67.364  -18.440 1.00 44.95  ? 119 LYS A O   1 
ATOM 908   C CB  . LYS A 1 119 ? -4.839  67.163  -20.555 1.00 46.22  ? 119 LYS A CB  1 
ATOM 909   C CG  . LYS A 1 119 ? -6.215  66.769  -21.101 1.00 55.77  ? 119 LYS A CG  1 
ATOM 910   C CD  . LYS A 1 119 ? -7.165  66.302  -19.975 1.00 64.44  ? 119 LYS A CD  1 
ATOM 911   C CE  . LYS A 1 119 ? -7.368  67.397  -18.893 1.00 68.00  ? 119 LYS A CE  1 
ATOM 912   N NZ  . LYS A 1 119 ? -8.223  67.025  -17.713 1.00 65.20  ? 119 LYS A NZ  1 
ATOM 913   N N   . TYR A 1 120 ? -1.640  65.932  -19.741 1.00 45.16  ? 120 TYR A N   1 
ATOM 914   C CA  . TYR A 1 120 ? -0.347  66.362  -19.242 1.00 52.48  ? 120 TYR A CA  1 
ATOM 915   C C   . TYR A 1 120 ? 0.240   67.370  -20.224 1.00 56.15  ? 120 TYR A C   1 
ATOM 916   O O   . TYR A 1 120 ? 0.738   66.998  -21.286 1.00 59.58  ? 120 TYR A O   1 
ATOM 917   C CB  . TYR A 1 120 ? 0.639   65.197  -19.125 1.00 53.05  ? 120 TYR A CB  1 
ATOM 918   C CG  . TYR A 1 120 ? 0.411   64.228  -17.987 1.00 54.34  ? 120 TYR A CG  1 
ATOM 919   C CD1 . TYR A 1 120 ? -0.772  63.491  -17.902 1.00 56.37  ? 120 TYR A CD1 1 
ATOM 920   C CD2 . TYR A 1 120 ? 1.414   63.995  -17.025 1.00 51.74  ? 120 TYR A CD2 1 
ATOM 921   C CE1 . TYR A 1 120 ? -0.965  62.527  -16.886 1.00 56.86  ? 120 TYR A CE1 1 
ATOM 922   C CE2 . TYR A 1 120 ? 1.241   63.036  -16.003 1.00 51.52  ? 120 TYR A CE2 1 
ATOM 923   C CZ  . TYR A 1 120 ? 0.043   62.303  -15.943 1.00 55.26  ? 120 TYR A CZ  1 
ATOM 924   O OH  . TYR A 1 120 ? -0.156  61.345  -14.963 1.00 55.90  ? 120 TYR A OH  1 
ATOM 925   N N   . HIS A 1 121 ? 0.165   68.648  -19.882 1.00 60.20  ? 121 HIS A N   1 
ATOM 926   C CA  . HIS A 1 121 ? 0.729   69.692  -20.726 1.00 59.97  ? 121 HIS A CA  1 
ATOM 927   C C   . HIS A 1 121 ? 2.247   69.593  -20.574 1.00 62.18  ? 121 HIS A C   1 
ATOM 928   O O   . HIS A 1 121 ? 2.813   69.915  -19.528 1.00 65.40  ? 121 HIS A O   1 
ATOM 929   C CB  . HIS A 1 121 ? 0.192   71.060  -20.288 1.00 51.97  ? 121 HIS A CB  1 
ATOM 930   C CG  . HIS A 1 121 ? -1.288  71.192  -20.461 1.00 47.98  ? 121 HIS A CG  1 
ATOM 931   N ND1 . HIS A 1 121 ? -2.189  70.355  -19.832 1.00 45.21  ? 121 HIS A ND1 1 
ATOM 932   C CD2 . HIS A 1 121 ? -2.026  72.017  -21.241 1.00 49.54  ? 121 HIS A CD2 1 
ATOM 933   C CE1 . HIS A 1 121 ? -3.415  70.655  -20.221 1.00 43.90  ? 121 HIS A CE1 1 
ATOM 934   N NE2 . HIS A 1 121 ? -3.346  71.660  -21.076 1.00 50.42  ? 121 HIS A NE2 1 
ATOM 935   N N   . THR A 1 122 ? 2.893   69.096  -21.620 1.00 62.80  ? 122 THR A N   1 
ATOM 936   C CA  . THR A 1 122 ? 4.332   68.923  -21.613 1.00 65.19  ? 122 THR A CA  1 
ATOM 937   C C   . THR A 1 122 ? 5.020   70.048  -22.351 1.00 67.50  ? 122 THR A C   1 
ATOM 938   O O   . THR A 1 122 ? 4.404   70.754  -23.160 1.00 60.82  ? 122 THR A O   1 
ATOM 939   C CB  . THR A 1 122 ? 4.724   67.602  -22.267 1.00 64.95  ? 122 THR A CB  1 
ATOM 940   O OG1 . THR A 1 122 ? 4.120   67.513  -23.564 1.00 67.25  ? 122 THR A OG1 1 
ATOM 941   C CG2 . THR A 1 122 ? 4.258   66.442  -21.414 1.00 63.91  ? 122 THR A CG2 1 
ATOM 942   N N   . LYS A 1 123 ? 6.307   70.208  -22.057 1.00 75.42  ? 123 LYS A N   1 
ATOM 943   C CA  . LYS A 1 123 ? 7.104   71.247  -22.681 1.00 83.31  ? 123 LYS A CA  1 
ATOM 944   C C   . LYS A 1 123 ? 7.390   70.907  -24.137 1.00 87.72  ? 123 LYS A C   1 
ATOM 945   O O   . LYS A 1 123 ? 8.123   69.953  -24.438 1.00 88.48  ? 123 LYS A O   1 
ATOM 946   C CB  . LYS A 1 123 ? 8.414   71.443  -21.914 1.00 85.13  ? 123 LYS A CB  1 
ATOM 947   C CG  . LYS A 1 123 ? 8.541   72.793  -21.188 1.00 90.43  ? 123 LYS A CG  1 
ATOM 948   C CD  . LYS A 1 123 ? 8.781   73.985  -22.144 1.00 94.86  ? 123 LYS A CD  1 
ATOM 949   C CE  . LYS A 1 123 ? 7.506   74.466  -22.848 1.00 97.90  ? 123 LYS A CE  1 
ATOM 950   N NZ  . LYS A 1 123 ? 7.746   75.622  -23.768 1.00 96.96  ? 123 LYS A NZ  1 
ATOM 951   N N   . GLY A 1 124 ? 6.795   71.699  -25.031 1.00 92.02  ? 124 GLY A N   1 
ATOM 952   C CA  . GLY A 1 124 ? 6.975   71.499  -26.456 1.00 97.21  ? 124 GLY A CA  1 
ATOM 953   C C   . GLY A 1 124 ? 6.458   70.142  -26.863 1.00 100.86 ? 124 GLY A C   1 
ATOM 954   O O   . GLY A 1 124 ? 5.343   70.027  -27.382 1.00 102.37 ? 124 GLY A O   1 
ATOM 955   N N   . ASP A 1 125 ? 7.266   69.110  -26.628 1.00 104.26 ? 125 ASP A N   1 
ATOM 956   C CA  . ASP A 1 125 ? 6.854   67.763  -26.968 1.00 108.40 ? 125 ASP A CA  1 
ATOM 957   C C   . ASP A 1 125 ? 7.624   66.633  -26.299 1.00 109.79 ? 125 ASP A C   1 
ATOM 958   O O   . ASP A 1 125 ? 7.664   65.529  -26.836 1.00 109.18 ? 125 ASP A O   1 
ATOM 959   C CB  . ASP A 1 125 ? 6.889   67.573  -28.485 1.00 110.04 ? 125 ASP A CB  1 
ATOM 960   C CG  . ASP A 1 125 ? 5.596   66.985  -29.021 1.00 111.16 ? 125 ASP A CG  1 
ATOM 961   O OD1 . ASP A 1 125 ? 4.549   67.671  -28.950 1.00 110.52 ? 125 ASP A OD1 1 
ATOM 962   O OD2 . ASP A 1 125 ? 5.627   65.833  -29.504 1.00 110.84 ? 125 ASP A OD2 1 
ATOM 963   N N   . HIS A 1 126 ? 8.243   66.885  -25.146 1.00 111.59 ? 126 HIS A N   1 
ATOM 964   C CA  . HIS A 1 126 ? 8.943   65.798  -24.470 1.00 113.03 ? 126 HIS A CA  1 
ATOM 965   C C   . HIS A 1 126 ? 7.817   64.810  -24.112 1.00 114.28 ? 126 HIS A C   1 
ATOM 966   O O   . HIS A 1 126 ? 6.635   65.164  -24.189 1.00 112.92 ? 126 HIS A O   1 
ATOM 967   C CB  . HIS A 1 126 ? 9.670   66.298  -23.212 1.00 111.76 ? 126 HIS A CB  1 
ATOM 968   C CG  . HIS A 1 126 ? 10.681  65.329  -22.668 1.00 112.97 ? 126 HIS A CG  1 
ATOM 969   N ND1 . HIS A 1 126 ? 10.346  64.054  -22.251 1.00 114.12 ? 126 HIS A ND1 1 
ATOM 970   C CD2 . HIS A 1 126 ? 12.016  65.446  -22.474 1.00 112.26 ? 126 HIS A CD2 1 
ATOM 971   C CE1 . HIS A 1 126 ? 11.432  63.432  -21.825 1.00 112.85 ? 126 HIS A CE1 1 
ATOM 972   N NE2 . HIS A 1 126 ? 12.458  64.252  -21.949 1.00 113.18 ? 126 HIS A NE2 1 
ATOM 973   N N   . GLU A 1 127 ? 8.165   63.580  -23.739 1.00 116.97 ? 127 GLU A N   1 
ATOM 974   C CA  . GLU A 1 127 ? 7.148   62.570  -23.420 1.00 118.56 ? 127 GLU A CA  1 
ATOM 975   C C   . GLU A 1 127 ? 6.763   62.383  -21.953 1.00 115.36 ? 127 GLU A C   1 
ATOM 976   O O   . GLU A 1 127 ? 7.487   62.780  -21.035 1.00 114.34 ? 127 GLU A O   1 
ATOM 977   C CB  . GLU A 1 127 ? 7.558   61.196  -23.986 1.00 124.86 ? 127 GLU A CB  1 
ATOM 978   C CG  . GLU A 1 127 ? 7.217   60.945  -25.463 1.00 129.97 ? 127 GLU A CG  1 
ATOM 979   C CD  . GLU A 1 127 ? 5.727   60.688  -25.724 1.00 131.78 ? 127 GLU A CD  1 
ATOM 980   O OE1 . GLU A 1 127 ? 5.385   60.290  -26.862 1.00 131.85 ? 127 GLU A OE1 1 
ATOM 981   O OE2 . GLU A 1 127 ? 4.899   60.886  -24.807 1.00 131.80 ? 127 GLU A OE2 1 
ATOM 982   N N   . VAL A 1 128 ? 5.606   61.745  -21.775 1.00 111.17 ? 128 VAL A N   1 
ATOM 983   C CA  . VAL A 1 128 ? 5.033   61.425  -20.475 1.00 107.33 ? 128 VAL A CA  1 
ATOM 984   C C   . VAL A 1 128 ? 5.644   60.130  -19.962 1.00 105.25 ? 128 VAL A C   1 
ATOM 985   O O   . VAL A 1 128 ? 5.204   59.040  -20.343 1.00 104.67 ? 128 VAL A O   1 
ATOM 986   C CB  . VAL A 1 128 ? 3.522   61.187  -20.586 1.00 106.83 ? 128 VAL A CB  1 
ATOM 987   C CG1 . VAL A 1 128 ? 2.953   60.905  -19.219 1.00 107.00 ? 128 VAL A CG1 1 
ATOM 988   C CG2 . VAL A 1 128 ? 2.851   62.373  -21.229 1.00 106.15 ? 128 VAL A CG2 1 
ATOM 989   N N   . LYS A 1 129 ? 6.653   60.233  -19.108 1.00 102.21 ? 129 LYS A N   1 
ATOM 990   C CA  . LYS A 1 129 ? 7.281   59.035  -18.577 1.00 100.31 ? 129 LYS A CA  1 
ATOM 991   C C   . LYS A 1 129 ? 6.225   58.126  -17.957 1.00 98.68  ? 129 LYS A C   1 
ATOM 992   O O   . LYS A 1 129 ? 5.610   58.484  -16.954 1.00 100.06 ? 129 LYS A O   1 
ATOM 993   C CB  . LYS A 1 129 ? 8.343   59.413  -17.542 1.00 101.66 ? 129 LYS A CB  1 
ATOM 994   C CG  . LYS A 1 129 ? 9.784   59.271  -18.041 1.00 102.59 ? 129 LYS A CG  1 
ATOM 995   C CD  . LYS A 1 129 ? 10.053  60.005  -19.365 1.00 102.97 ? 129 LYS A CD  1 
ATOM 996   C CE  . LYS A 1 129 ? 9.689   59.165  -20.597 1.00 100.57 ? 129 LYS A CE  1 
ATOM 997   N NZ  . LYS A 1 129 ? 10.036  59.846  -21.880 1.00 93.80  ? 129 LYS A NZ  1 
ATOM 998   N N   . ALA A 1 130 ? 6.005   56.962  -18.570 1.00 96.05  ? 130 ALA A N   1 
ATOM 999   C CA  . ALA A 1 130 ? 5.019   55.993  -18.090 1.00 94.84  ? 130 ALA A CA  1 
ATOM 1000  C C   . ALA A 1 130 ? 5.066   55.888  -16.575 1.00 94.21  ? 130 ALA A C   1 
ATOM 1001  O O   . ALA A 1 130 ? 4.146   55.372  -15.940 1.00 92.03  ? 130 ALA A O   1 
ATOM 1002  C CB  . ALA A 1 130 ? 5.278   54.647  -18.706 1.00 95.03  ? 130 ALA A CB  1 
ATOM 1003  N N   . GLU A 1 131 ? 6.164   56.379  -16.015 1.00 95.08  ? 131 GLU A N   1 
ATOM 1004  C CA  . GLU A 1 131 ? 6.374   56.411  -14.578 1.00 95.97  ? 131 GLU A CA  1 
ATOM 1005  C C   . GLU A 1 131 ? 5.174   57.057  -13.928 1.00 91.90  ? 131 GLU A C   1 
ATOM 1006  O O   . GLU A 1 131 ? 4.461   56.443  -13.138 1.00 93.09  ? 131 GLU A O   1 
ATOM 1007  C CB  . GLU A 1 131 ? 7.602   57.256  -14.250 1.00 101.43 ? 131 GLU A CB  1 
ATOM 1008  C CG  . GLU A 1 131 ? 8.540   56.569  -13.316 1.00 109.28 ? 131 GLU A CG  1 
ATOM 1009  C CD  . GLU A 1 131 ? 8.909   55.197  -13.841 1.00 114.30 ? 131 GLU A CD  1 
ATOM 1010  O OE1 . GLU A 1 131 ? 8.016   54.319  -13.906 1.00 115.76 ? 131 GLU A OE1 1 
ATOM 1011  O OE2 . GLU A 1 131 ? 10.088  55.003  -14.200 1.00 116.80 ? 131 GLU A OE2 1 
ATOM 1012  N N   . GLN A 1 132 ? 4.972   58.319  -14.280 1.00 85.59  ? 132 GLN A N   1 
ATOM 1013  C CA  . GLN A 1 132 ? 3.876   59.098  -13.757 1.00 80.93  ? 132 GLN A CA  1 
ATOM 1014  C C   . GLN A 1 132 ? 2.525   58.474  -14.006 1.00 75.55  ? 132 GLN A C   1 
ATOM 1015  O O   . GLN A 1 132 ? 1.804   58.175  -13.061 1.00 77.02  ? 132 GLN A O   1 
ATOM 1016  C CB  . GLN A 1 132 ? 3.912   60.505  -14.347 1.00 83.31  ? 132 GLN A CB  1 
ATOM 1017  C CG  . GLN A 1 132 ? 4.944   61.368  -13.685 1.00 89.21  ? 132 GLN A CG  1 
ATOM 1018  C CD  . GLN A 1 132 ? 4.634   61.559  -12.214 1.00 95.94  ? 132 GLN A CD  1 
ATOM 1019  O OE1 . GLN A 1 132 ? 5.540   61.703  -11.385 1.00 99.03  ? 132 GLN A OE1 1 
ATOM 1020  N NE2 . GLN A 1 132 ? 3.342   61.569  -11.879 1.00 97.46  ? 132 GLN A NE2 1 
ATOM 1021  N N   . VAL A 1 133 ? 2.178   58.264  -15.268 1.00 68.71  ? 133 VAL A N   1 
ATOM 1022  C CA  . VAL A 1 133 ? 0.875   57.702  -15.579 1.00 65.66  ? 133 VAL A CA  1 
ATOM 1023  C C   . VAL A 1 133 ? 0.579   56.515  -14.675 1.00 68.84  ? 133 VAL A C   1 
ATOM 1024  O O   . VAL A 1 133 ? -0.586  56.188  -14.424 1.00 67.63  ? 133 VAL A O   1 
ATOM 1025  C CB  . VAL A 1 133 ? 0.793   57.249  -17.034 1.00 62.07  ? 133 VAL A CB  1 
ATOM 1026  C CG1 . VAL A 1 133 ? -0.669  57.181  -17.467 1.00 58.01  ? 133 VAL A CG1 1 
ATOM 1027  C CG2 . VAL A 1 133 ? 1.587   58.192  -17.909 1.00 58.73  ? 133 VAL A CG2 1 
ATOM 1028  N N   . LYS A 1 134 ? 1.651   55.890  -14.186 1.00 71.39  ? 134 LYS A N   1 
ATOM 1029  C CA  . LYS A 1 134 ? 1.570   54.733  -13.292 1.00 72.55  ? 134 LYS A CA  1 
ATOM 1030  C C   . LYS A 1 134 ? 1.152   55.155  -11.880 1.00 72.92  ? 134 LYS A C   1 
ATOM 1031  O O   . LYS A 1 134 ? 0.120   54.711  -11.371 1.00 75.10  ? 134 LYS A O   1 
ATOM 1032  C CB  . LYS A 1 134 ? 2.931   54.024  -13.235 1.00 72.26  ? 134 LYS A CB  1 
ATOM 1033  C CG  . LYS A 1 134 ? 2.938   52.680  -12.505 1.00 71.53  ? 134 LYS A CG  1 
ATOM 1034  C CD  . LYS A 1 134 ? 4.323   52.037  -12.583 1.00 75.45  ? 134 LYS A CD  1 
ATOM 1035  C CE  . LYS A 1 134 ? 4.304   50.556  -12.199 1.00 76.10  ? 134 LYS A CE  1 
ATOM 1036  N NZ  . LYS A 1 134 ? 3.955   50.314  -10.771 1.00 79.71  ? 134 LYS A NZ  1 
ATOM 1037  N N   . ALA A 1 135 ? 1.959   56.013  -11.257 1.00 69.33  ? 135 ALA A N   1 
ATOM 1038  C CA  . ALA A 1 135 ? 1.684   56.504  -9.913  1.00 65.53  ? 135 ALA A CA  1 
ATOM 1039  C C   . ALA A 1 135 ? 0.309   57.168  -9.818  1.00 64.41  ? 135 ALA A C   1 
ATOM 1040  O O   . ALA A 1 135 ? -0.496  56.830  -8.952  1.00 65.39  ? 135 ALA A O   1 
ATOM 1041  C CB  . ALA A 1 135 ? 2.762   57.483  -9.498  1.00 65.20  ? 135 ALA A CB  1 
ATOM 1042  N N   . SER A 1 136 ? 0.048   58.113  -10.713 1.00 62.03  ? 136 SER A N   1 
ATOM 1043  C CA  . SER A 1 136 ? -1.226  58.827  -10.739 1.00 64.99  ? 136 SER A CA  1 
ATOM 1044  C C   . SER A 1 136 ? -2.408  57.878  -10.624 1.00 65.94  ? 136 SER A C   1 
ATOM 1045  O O   . SER A 1 136 ? -3.442  58.226  -10.051 1.00 65.37  ? 136 SER A O   1 
ATOM 1046  C CB  . SER A 1 136 ? -1.359  59.629  -12.038 1.00 67.36  ? 136 SER A CB  1 
ATOM 1047  O OG  . SER A 1 136 ? -0.292  60.550  -12.186 1.00 67.22  ? 136 SER A OG  1 
ATOM 1048  N N   . LYS A 1 137 ? -2.246  56.682  -11.180 1.00 67.72  ? 137 LYS A N   1 
ATOM 1049  C CA  . LYS A 1 137 ? -3.287  55.664  -11.164 1.00 69.80  ? 137 LYS A CA  1 
ATOM 1050  C C   . LYS A 1 137 ? -3.424  54.974  -9.811  1.00 68.38  ? 137 LYS A C   1 
ATOM 1051  O O   . LYS A 1 137 ? -4.536  54.701  -9.353  1.00 67.93  ? 137 LYS A O   1 
ATOM 1052  C CB  . LYS A 1 137 ? -2.992  54.622  -12.246 1.00 75.45  ? 137 LYS A CB  1 
ATOM 1053  C CG  . LYS A 1 137 ? -3.809  54.787  -13.532 1.00 82.06  ? 137 LYS A CG  1 
ATOM 1054  C CD  . LYS A 1 137 ? -5.172  54.086  -13.430 1.00 86.42  ? 137 LYS A CD  1 
ATOM 1055  C CE  . LYS A 1 137 ? -5.010  52.566  -13.274 1.00 84.79  ? 137 LYS A CE  1 
ATOM 1056  N NZ  . LYS A 1 137 ? -6.313  51.849  -13.137 1.00 85.40  ? 137 LYS A NZ  1 
ATOM 1057  N N   . GLU A 1 138 ? -2.283  54.696  -9.187  1.00 67.70  ? 138 GLU A N   1 
ATOM 1058  C CA  . GLU A 1 138 ? -2.227  54.034  -7.884  1.00 69.58  ? 138 GLU A CA  1 
ATOM 1059  C C   . GLU A 1 138 ? -2.546  55.028  -6.775  1.00 67.23  ? 138 GLU A C   1 
ATOM 1060  O O   . GLU A 1 138 ? -3.281  54.716  -5.831  1.00 66.80  ? 138 GLU A O   1 
ATOM 1061  C CB  . GLU A 1 138 ? -0.834  53.436  -7.675  1.00 74.97  ? 138 GLU A CB  1 
ATOM 1062  C CG  . GLU A 1 138 ? -0.482  52.358  -8.712  1.00 84.84  ? 138 GLU A CG  1 
ATOM 1063  C CD  . GLU A 1 138 ? 0.986   51.920  -8.683  1.00 87.88  ? 138 GLU A CD  1 
ATOM 1064  O OE1 . GLU A 1 138 ? 1.355   51.013  -9.469  1.00 88.26  ? 138 GLU A OE1 1 
ATOM 1065  O OE2 . GLU A 1 138 ? 1.769   52.480  -7.882  1.00 89.98  ? 138 GLU A OE2 1 
ATOM 1066  N N   . MET A 1 139 ? -1.974  56.223  -6.896  1.00 63.77  ? 139 MET A N   1 
ATOM 1067  C CA  . MET A 1 139 ? -2.208  57.297  -5.943  1.00 59.96  ? 139 MET A CA  1 
ATOM 1068  C C   . MET A 1 139 ? -3.725  57.394  -5.802  1.00 56.53  ? 139 MET A C   1 
ATOM 1069  O O   . MET A 1 139 ? -4.291  57.032  -4.776  1.00 55.29  ? 139 MET A O   1 
ATOM 1070  C CB  . MET A 1 139 ? -1.629  58.604  -6.497  1.00 59.93  ? 139 MET A CB  1 
ATOM 1071  C CG  . MET A 1 139 ? -1.776  59.842  -5.609  1.00 65.10  ? 139 MET A CG  1 
ATOM 1072  S SD  . MET A 1 139 ? -1.033  59.668  -3.963  1.00 72.08  ? 139 MET A SD  1 
ATOM 1073  C CE  . MET A 1 139 ? 0.725   60.052  -4.247  1.00 68.62  ? 139 MET A CE  1 
ATOM 1074  N N   . GLY A 1 140 ? -4.380  57.853  -6.859  1.00 53.96  ? 140 GLY A N   1 
ATOM 1075  C CA  . GLY A 1 140 ? -5.824  57.977  -6.825  1.00 54.56  ? 140 GLY A CA  1 
ATOM 1076  C C   . GLY A 1 140 ? -6.538  56.665  -6.570  1.00 54.06  ? 140 GLY A C   1 
ATOM 1077  O O   . GLY A 1 140 ? -7.697  56.648  -6.157  1.00 53.06  ? 140 GLY A O   1 
ATOM 1078  N N   . GLU A 1 141 ? -5.852  55.559  -6.810  1.00 56.88  ? 141 GLU A N   1 
ATOM 1079  C CA  . GLU A 1 141 ? -6.458  54.252  -6.603  1.00 62.14  ? 141 GLU A CA  1 
ATOM 1080  C C   . GLU A 1 141 ? -6.691  53.993  -5.119  1.00 60.96  ? 141 GLU A C   1 
ATOM 1081  O O   . GLU A 1 141 ? -7.831  53.841  -4.659  1.00 61.82  ? 141 GLU A O   1 
ATOM 1082  C CB  . GLU A 1 141 ? -5.559  53.146  -7.171  1.00 69.39  ? 141 GLU A CB  1 
ATOM 1083  C CG  . GLU A 1 141 ? -6.246  51.781  -7.279  1.00 81.09  ? 141 GLU A CG  1 
ATOM 1084  C CD  . GLU A 1 141 ? -7.393  51.776  -8.302  1.00 88.90  ? 141 GLU A CD  1 
ATOM 1085  O OE1 . GLU A 1 141 ? -7.103  51.843  -9.525  1.00 94.97  ? 141 GLU A OE1 1 
ATOM 1086  O OE2 . GLU A 1 141 ? -8.578  51.715  -7.883  1.00 87.61  ? 141 GLU A OE2 1 
ATOM 1087  N N   . THR A 1 142 ? -5.594  53.943  -4.376  1.00 57.70  ? 142 THR A N   1 
ATOM 1088  C CA  . THR A 1 142 ? -5.663  53.694  -2.951  1.00 55.56  ? 142 THR A CA  1 
ATOM 1089  C C   . THR A 1 142 ? -6.683  54.635  -2.312  1.00 52.45  ? 142 THR A C   1 
ATOM 1090  O O   . THR A 1 142 ? -7.574  54.189  -1.586  1.00 52.93  ? 142 THR A O   1 
ATOM 1091  C CB  . THR A 1 142 ? -4.293  53.912  -2.297  1.00 57.04  ? 142 THR A CB  1 
ATOM 1092  O OG1 . THR A 1 142 ? -4.142  55.293  -1.969  1.00 56.86  ? 142 THR A OG1 1 
ATOM 1093  C CG2 . THR A 1 142 ? -3.173  53.514  -3.254  1.00 54.15  ? 142 THR A CG2 1 
ATOM 1094  N N   . LEU A 1 143 ? -6.560  55.930  -2.609  1.00 47.69  ? 143 LEU A N   1 
ATOM 1095  C CA  . LEU A 1 143 ? -7.455  56.949  -2.060  1.00 42.93  ? 143 LEU A CA  1 
ATOM 1096  C C   . LEU A 1 143 ? -8.911  56.589  -2.226  1.00 41.41  ? 143 LEU A C   1 
ATOM 1097  O O   . LEU A 1 143 ? -9.642  56.562  -1.247  1.00 41.20  ? 143 LEU A O   1 
ATOM 1098  C CB  . LEU A 1 143 ? -7.212  58.318  -2.699  1.00 46.09  ? 143 LEU A CB  1 
ATOM 1099  C CG  . LEU A 1 143 ? -5.825  58.981  -2.596  1.00 51.68  ? 143 LEU A CG  1 
ATOM 1100  C CD1 . LEU A 1 143 ? -5.950  60.438  -3.011  1.00 45.31  ? 143 LEU A CD1 1 
ATOM 1101  C CD2 . LEU A 1 143 ? -5.275  58.903  -1.183  1.00 52.17  ? 143 LEU A CD2 1 
ATOM 1102  N N   . LEU A 1 144 ? -9.351  56.324  -3.450  1.00 40.43  ? 144 LEU A N   1 
ATOM 1103  C CA  . LEU A 1 144 ? -10.744 55.956  -3.620  1.00 44.50  ? 144 LEU A CA  1 
ATOM 1104  C C   . LEU A 1 144 ? -11.037 54.776  -2.708  1.00 48.21  ? 144 LEU A C   1 
ATOM 1105  O O   . LEU A 1 144 ? -12.108 54.688  -2.108  1.00 47.36  ? 144 LEU A O   1 
ATOM 1106  C CB  . LEU A 1 144 ? -11.062 55.559  -5.058  1.00 46.81  ? 144 LEU A CB  1 
ATOM 1107  C CG  . LEU A 1 144 ? -12.441 54.876  -5.197  1.00 52.98  ? 144 LEU A CG  1 
ATOM 1108  C CD1 . LEU A 1 144 ? -13.531 55.707  -4.541  1.00 58.75  ? 144 LEU A CD1 1 
ATOM 1109  C CD2 . LEU A 1 144 ? -12.776 54.674  -6.657  1.00 55.69  ? 144 LEU A CD2 1 
ATOM 1110  N N   . ARG A 1 145 ? -10.080 53.863  -2.602  1.00 50.67  ? 145 ARG A N   1 
ATOM 1111  C CA  . ARG A 1 145 ? -10.270 52.701  -1.750  1.00 54.01  ? 145 ARG A CA  1 
ATOM 1112  C C   . ARG A 1 145 ? -10.397 53.101  -0.273  1.00 55.07  ? 145 ARG A C   1 
ATOM 1113  O O   . ARG A 1 145 ? -11.414 52.805  0.365   1.00 54.98  ? 145 ARG A O   1 
ATOM 1114  C CB  . ARG A 1 145 ? -9.116  51.716  -1.959  1.00 55.96  ? 145 ARG A CB  1 
ATOM 1115  C CG  . ARG A 1 145 ? -9.412  50.602  -2.975  1.00 60.31  ? 145 ARG A CG  1 
ATOM 1116  C CD  . ARG A 1 145 ? -9.857  51.089  -4.382  1.00 59.25  ? 145 ARG A CD  1 
ATOM 1117  N NE  . ARG A 1 145 ? -11.308 50.982  -4.623  1.00 59.41  ? 145 ARG A NE  1 
ATOM 1118  C CZ  . ARG A 1 145 ? -11.883 50.816  -5.824  1.00 55.80  ? 145 ARG A CZ  1 
ATOM 1119  N NH1 . ARG A 1 145 ? -11.144 50.729  -6.930  1.00 50.65  ? 145 ARG A NH1 1 
ATOM 1120  N NH2 . ARG A 1 145 ? -13.207 50.740  -5.927  1.00 45.56  ? 145 ARG A NH2 1 
ATOM 1121  N N   . ALA A 1 146 ? -9.380  53.785  0.256   1.00 54.34  ? 146 ALA A N   1 
ATOM 1122  C CA  . ALA A 1 146 ? -9.376  54.228  1.653   1.00 52.01  ? 146 ALA A CA  1 
ATOM 1123  C C   . ALA A 1 146 ? -10.687 54.914  2.042   1.00 51.80  ? 146 ALA A C   1 
ATOM 1124  O O   . ALA A 1 146 ? -11.148 54.804  3.175   1.00 52.49  ? 146 ALA A O   1 
ATOM 1125  C CB  . ALA A 1 146 ? -8.208  55.170  1.899   1.00 46.44  ? 146 ALA A CB  1 
ATOM 1126  N N   . VAL A 1 147 ? -11.291 55.624  1.100   1.00 51.07  ? 147 VAL A N   1 
ATOM 1127  C CA  . VAL A 1 147 ? -12.545 56.313  1.371   1.00 48.17  ? 147 VAL A CA  1 
ATOM 1128  C C   . VAL A 1 147 ? -13.725 55.342  1.314   1.00 50.61  ? 147 VAL A C   1 
ATOM 1129  O O   . VAL A 1 147 ? -14.648 55.430  2.129   1.00 49.91  ? 147 VAL A O   1 
ATOM 1130  C CB  . VAL A 1 147 ? -12.763 57.488  0.366   1.00 45.62  ? 147 VAL A CB  1 
ATOM 1131  C CG1 . VAL A 1 147 ? -14.205 57.975  0.413   1.00 35.74  ? 147 VAL A CG1 1 
ATOM 1132  C CG2 . VAL A 1 147 ? -11.804 58.633  0.696   1.00 39.14  ? 147 VAL A CG2 1 
ATOM 1133  N N   . GLU A 1 148 ? -13.699 54.416  0.358   1.00 51.21  ? 148 GLU A N   1 
ATOM 1134  C CA  . GLU A 1 148 ? -14.779 53.441  0.234   1.00 51.38  ? 148 GLU A CA  1 
ATOM 1135  C C   . GLU A 1 148 ? -14.942 52.709  1.558   1.00 51.87  ? 148 GLU A C   1 
ATOM 1136  O O   . GLU A 1 148 ? -16.054 52.585  2.094   1.00 51.42  ? 148 GLU A O   1 
ATOM 1137  C CB  . GLU A 1 148 ? -14.464 52.421  -0.851  1.00 52.24  ? 148 GLU A CB  1 
ATOM 1138  C CG  . GLU A 1 148 ? -14.855 52.825  -2.245  1.00 55.05  ? 148 GLU A CG  1 
ATOM 1139  C CD  . GLU A 1 148 ? -14.618 51.691  -3.216  1.00 60.32  ? 148 GLU A CD  1 
ATOM 1140  O OE1 . GLU A 1 148 ? -13.469 51.202  -3.253  1.00 60.77  ? 148 GLU A OE1 1 
ATOM 1141  O OE2 . GLU A 1 148 ? -15.568 51.282  -3.926  1.00 61.17  ? 148 GLU A OE2 1 
ATOM 1142  N N   . SER A 1 149 ? -13.818 52.219  2.071   1.00 51.54  ? 149 SER A N   1 
ATOM 1143  C CA  . SER A 1 149 ? -13.801 51.500  3.332   1.00 52.97  ? 149 SER A CA  1 
ATOM 1144  C C   . SER A 1 149 ? -14.417 52.378  4.417   1.00 53.57  ? 149 SER A C   1 
ATOM 1145  O O   . SER A 1 149 ? -15.470 52.048  4.969   1.00 53.84  ? 149 SER A O   1 
ATOM 1146  C CB  . SER A 1 149 ? -12.365 51.149  3.703   1.00 54.96  ? 149 SER A CB  1 
ATOM 1147  O OG  . SER A 1 149 ? -11.589 52.324  3.844   1.00 55.80  ? 149 SER A OG  1 
ATOM 1148  N N   . TYR A 1 150 ? -13.757 53.500  4.707   1.00 54.03  ? 150 TYR A N   1 
ATOM 1149  C CA  . TYR A 1 150 ? -14.233 54.438  5.717   1.00 53.56  ? 150 TYR A CA  1 
ATOM 1150  C C   . TYR A 1 150 ? -15.717 54.698  5.538   1.00 50.44  ? 150 TYR A C   1 
ATOM 1151  O O   . TYR A 1 150 ? -16.505 54.532  6.466   1.00 47.90  ? 150 TYR A O   1 
ATOM 1152  C CB  . TYR A 1 150 ? -13.491 55.771  5.617   1.00 58.42  ? 150 TYR A CB  1 
ATOM 1153  C CG  . TYR A 1 150 ? -13.939 56.779  6.658   1.00 68.10  ? 150 TYR A CG  1 
ATOM 1154  C CD1 . TYR A 1 150 ? -13.122 57.095  7.745   1.00 70.98  ? 150 TYR A CD1 1 
ATOM 1155  C CD2 . TYR A 1 150 ? -15.205 57.381  6.588   1.00 69.08  ? 150 TYR A CD2 1 
ATOM 1156  C CE1 . TYR A 1 150 ? -13.549 57.980  8.742   1.00 71.18  ? 150 TYR A CE1 1 
ATOM 1157  C CE2 . TYR A 1 150 ? -15.644 58.264  7.582   1.00 70.75  ? 150 TYR A CE2 1 
ATOM 1158  C CZ  . TYR A 1 150 ? -14.808 58.555  8.656   1.00 72.12  ? 150 TYR A CZ  1 
ATOM 1159  O OH  . TYR A 1 150 ? -15.224 59.400  9.658   1.00 76.67  ? 150 TYR A OH  1 
ATOM 1160  N N   . LEU A 1 151 ? -16.095 55.128  4.344   1.00 49.05  ? 151 LEU A N   1 
ATOM 1161  C CA  . LEU A 1 151 ? -17.493 55.405  4.068   1.00 49.85  ? 151 LEU A CA  1 
ATOM 1162  C C   . LEU A 1 151 ? -18.386 54.259  4.489   1.00 47.98  ? 151 LEU A C   1 
ATOM 1163  O O   . LEU A 1 151 ? -19.482 54.469  5.003   1.00 45.40  ? 151 LEU A O   1 
ATOM 1164  C CB  . LEU A 1 151 ? -17.691 55.676  2.584   1.00 51.88  ? 151 LEU A CB  1 
ATOM 1165  C CG  . LEU A 1 151 ? -17.534 57.151  2.221   1.00 53.93  ? 151 LEU A CG  1 
ATOM 1166  C CD1 . LEU A 1 151 ? -17.702 57.356  0.713   1.00 53.29  ? 151 LEU A CD1 1 
ATOM 1167  C CD2 . LEU A 1 151 ? -18.571 57.948  3.005   1.00 53.90  ? 151 LEU A CD2 1 
ATOM 1168  N N   . LEU A 1 152 ? -17.905 53.044  4.261   1.00 48.27  ? 152 LEU A N   1 
ATOM 1169  C CA  . LEU A 1 152 ? -18.655 51.843  4.604   1.00 51.82  ? 152 LEU A CA  1 
ATOM 1170  C C   . LEU A 1 152 ? -18.813 51.649  6.101   1.00 53.71  ? 152 LEU A C   1 
ATOM 1171  O O   . LEU A 1 152 ? -19.931 51.475  6.606   1.00 58.59  ? 152 LEU A O   1 
ATOM 1172  C CB  . LEU A 1 152 ? -17.970 50.623  3.999   1.00 51.14  ? 152 LEU A CB  1 
ATOM 1173  C CG  . LEU A 1 152 ? -18.314 50.454  2.522   1.00 54.72  ? 152 LEU A CG  1 
ATOM 1174  C CD1 . LEU A 1 152 ? -17.467 49.351  1.913   1.00 52.53  ? 152 LEU A CD1 1 
ATOM 1175  C CD2 . LEU A 1 152 ? -19.821 50.153  2.396   1.00 56.41  ? 152 LEU A CD2 1 
ATOM 1176  N N   . ALA A 1 153 ? -17.680 51.681  6.797   1.00 52.70  ? 153 ALA A N   1 
ATOM 1177  C CA  . ALA A 1 153 ? -17.637 51.513  8.242   1.00 54.21  ? 153 ALA A CA  1 
ATOM 1178  C C   . ALA A 1 153 ? -18.416 52.591  9.003   1.00 58.46  ? 153 ALA A C   1 
ATOM 1179  O O   . ALA A 1 153 ? -18.811 52.377  10.152  1.00 60.80  ? 153 ALA A O   1 
ATOM 1180  C CB  . ALA A 1 153 ? -16.183 51.491  8.712   1.00 50.42  ? 153 ALA A CB  1 
ATOM 1181  N N   . HIS A 1 154 ? -18.645 53.741  8.370   1.00 62.02  ? 154 HIS A N   1 
ATOM 1182  C CA  . HIS A 1 154 ? -19.358 54.831  9.023   1.00 64.39  ? 154 HIS A CA  1 
ATOM 1183  C C   . HIS A 1 154 ? -20.590 55.253  8.246   1.00 64.59  ? 154 HIS A C   1 
ATOM 1184  O O   . HIS A 1 154 ? -20.741 56.403  7.849   1.00 62.16  ? 154 HIS A O   1 
ATOM 1185  C CB  . HIS A 1 154 ? -18.408 56.001  9.210   1.00 66.64  ? 154 HIS A CB  1 
ATOM 1186  C CG  . HIS A 1 154 ? -17.146 55.626  9.917   1.00 70.19  ? 154 HIS A CG  1 
ATOM 1187  N ND1 . HIS A 1 154 ? -16.294 54.655  9.440   1.00 71.57  ? 154 HIS A ND1 1 
ATOM 1188  C CD2 . HIS A 1 154 ? -16.592 56.083  11.064  1.00 72.90  ? 154 HIS A CD2 1 
ATOM 1189  C CE1 . HIS A 1 154 ? -15.266 54.530  10.263  1.00 73.99  ? 154 HIS A CE1 1 
ATOM 1190  N NE2 . HIS A 1 154 ? -15.422 55.386  11.256  1.00 74.39  ? 154 HIS A NE2 1 
ATOM 1191  N N   . SER A 1 155 ? -21.469 54.283  8.057   1.00 66.93  ? 155 SER A N   1 
ATOM 1192  C CA  . SER A 1 155 ? -22.724 54.426  7.336   1.00 70.73  ? 155 SER A CA  1 
ATOM 1193  C C   . SER A 1 155 ? -23.575 55.692  7.527   1.00 70.96  ? 155 SER A C   1 
ATOM 1194  O O   . SER A 1 155 ? -24.364 56.041  6.645   1.00 71.74  ? 155 SER A O   1 
ATOM 1195  C CB  . SER A 1 155 ? -23.566 53.200  7.649   1.00 73.56  ? 155 SER A CB  1 
ATOM 1196  O OG  . SER A 1 155 ? -23.451 52.885  9.030   1.00 76.88  ? 155 SER A OG  1 
ATOM 1197  N N   . ASP A 1 156 ? -23.437 56.373  8.664   1.00 72.07  ? 156 ASP A N   1 
ATOM 1198  C CA  . ASP A 1 156 ? -24.225 57.590  8.933   1.00 73.34  ? 156 ASP A CA  1 
ATOM 1199  C C   . ASP A 1 156 ? -23.569 58.870  8.413   1.00 71.40  ? 156 ASP A C   1 
ATOM 1200  O O   . ASP A 1 156 ? -24.183 59.947  8.405   1.00 66.31  ? 156 ASP A O   1 
ATOM 1201  C CB  . ASP A 1 156 ? -24.486 57.741  10.437  1.00 76.17  ? 156 ASP A CB  1 
ATOM 1202  C CG  . ASP A 1 156 ? -23.213 57.672  11.261  1.00 77.45  ? 156 ASP A CG  1 
ATOM 1203  O OD1 . ASP A 1 156 ? -22.281 58.448  10.979  1.00 74.23  ? 156 ASP A OD1 1 
ATOM 1204  O OD2 . ASP A 1 156 ? -23.144 56.839  12.192  1.00 81.58  ? 156 ASP A OD2 1 
ATOM 1205  N N   . ALA A 1 157 ? -22.319 58.728  7.979   1.00 72.00  ? 157 ALA A N   1 
ATOM 1206  C CA  . ALA A 1 157 ? -21.525 59.829  7.450   1.00 71.41  ? 157 ALA A CA  1 
ATOM 1207  C C   . ALA A 1 157 ? -22.045 60.351  6.116   1.00 73.28  ? 157 ALA A C   1 
ATOM 1208  O O   . ALA A 1 157 ? -22.921 59.750  5.485   1.00 76.95  ? 157 ALA A O   1 
ATOM 1209  C CB  . ALA A 1 157 ? -20.079 59.384  7.295   1.00 68.08  ? 157 ALA A CB  1 
ATOM 1210  N N   . TYR A 1 158 ? -21.486 61.485  5.709   1.00 71.96  ? 158 TYR A N   1 
ATOM 1211  C CA  . TYR A 1 158 ? -21.815 62.160  4.455   1.00 71.35  ? 158 TYR A CA  1 
ATOM 1212  C C   . TYR A 1 158 ? -23.204 61.871  3.913   1.00 73.03  ? 158 TYR A C   1 
ATOM 1213  O O   . TYR A 1 158 ? -23.356 61.416  2.777   1.00 71.71  ? 158 TYR A O   1 
ATOM 1214  C CB  . TYR A 1 158 ? -20.743 61.819  3.422   1.00 65.88  ? 158 TYR A CB  1 
ATOM 1215  C CG  . TYR A 1 158 ? -19.367 62.168  3.939   1.00 59.42  ? 158 TYR A CG  1 
ATOM 1216  C CD1 . TYR A 1 158 ? -18.780 63.396  3.657   1.00 57.30  ? 158 TYR A CD1 1 
ATOM 1217  C CD2 . TYR A 1 158 ? -18.687 61.301  4.783   1.00 58.75  ? 158 TYR A CD2 1 
ATOM 1218  C CE1 . TYR A 1 158 ? -17.553 63.748  4.207   1.00 53.85  ? 158 TYR A CE1 1 
ATOM 1219  C CE2 . TYR A 1 158 ? -17.462 61.646  5.338   1.00 55.42  ? 158 TYR A CE2 1 
ATOM 1220  C CZ  . TYR A 1 158 ? -16.900 62.866  5.048   1.00 53.27  ? 158 TYR A CZ  1 
ATOM 1221  O OH  . TYR A 1 158 ? -15.682 63.197  5.600   1.00 56.31  ? 158 TYR A OH  1 
ATOM 1222  N N   . ASN A 1 159 ? -24.207 62.162  4.744   1.00 77.37  ? 159 ASN A N   1 
ATOM 1223  C CA  . ASN A 1 159 ? -25.606 61.952  4.405   1.00 82.24  ? 159 ASN A CA  1 
ATOM 1224  C C   . ASN A 1 159 ? -25.998 60.522  4.799   1.00 83.03  ? 159 ASN A C   1 
ATOM 1225  O O   . ASN A 1 159 ? -26.294 59.697  3.903   1.00 84.63  ? 159 ASN A O   1 
ATOM 1226  C CB  . ASN A 1 159 ? -25.811 62.187  2.904   1.00 89.30  ? 159 ASN A CB  1 
ATOM 1227  C CG  . ASN A 1 159 ? -27.184 62.715  2.577   1.00 93.86  ? 159 ASN A CG  1 
ATOM 1228  O OD1 . ASN A 1 159 ? -28.185 62.006  2.716   1.00 97.18  ? 159 ASN A OD1 1 
ATOM 1229  N ND2 . ASN A 1 159 ? -27.246 63.972  2.139   1.00 95.75  ? 159 ASN A ND2 1 
ATOM 1230  O OXT . ASN A 1 159 ? -25.985 60.241  6.018   1.00 81.36  ? 159 ASN A OXT 1 
ATOM 1231  N N   . ASN B 2 1   ? -25.354 81.106  -10.531 1.00 60.75  ? 1   ASN B N   1 
ATOM 1232  C CA  . ASN B 2 1   ? -25.530 82.529  -10.115 1.00 59.23  ? 1   ASN B CA  1 
ATOM 1233  C C   . ASN B 2 1   ? -26.398 82.658  -8.849  1.00 57.34  ? 1   ASN B C   1 
ATOM 1234  O O   . ASN B 2 1   ? -27.625 82.604  -8.916  1.00 57.75  ? 1   ASN B O   1 
ATOM 1235  C CB  . ASN B 2 1   ? -26.169 83.325  -11.259 1.00 61.59  ? 1   ASN B CB  1 
ATOM 1236  C CG  . ASN B 2 1   ? -25.864 84.819  -11.179 1.00 66.39  ? 1   ASN B CG  1 
ATOM 1237  O OD1 . ASN B 2 1   ? -24.865 85.288  -11.742 1.00 67.62  ? 1   ASN B OD1 1 
ATOM 1238  N ND2 . ASN B 2 1   ? -26.713 85.570  -10.466 1.00 63.09  ? 1   ASN B ND2 1 
ATOM 1239  N N   . ILE B 2 2   ? -25.752 82.838  -7.700  1.00 57.11  ? 2   ILE B N   1 
ATOM 1240  C CA  . ILE B 2 2   ? -26.452 82.976  -6.423  1.00 56.66  ? 2   ILE B CA  1 
ATOM 1241  C C   . ILE B 2 2   ? -26.794 84.424  -6.086  1.00 55.92  ? 2   ILE B C   1 
ATOM 1242  O O   . ILE B 2 2   ? -26.275 85.352  -6.708  1.00 58.67  ? 2   ILE B O   1 
ATOM 1243  C CB  . ILE B 2 2   ? -25.592 82.408  -5.293  1.00 57.40  ? 2   ILE B CB  1 
ATOM 1244  C CG1 . ILE B 2 2   ? -25.546 80.887  -5.412  1.00 61.17  ? 2   ILE B CG1 1 
ATOM 1245  C CG2 . ILE B 2 2   ? -26.131 82.835  -3.941  1.00 58.07  ? 2   ILE B CG2 1 
ATOM 1246  C CD1 . ILE B 2 2   ? -24.726 80.207  -4.335  1.00 69.84  ? 2   ILE B CD1 1 
ATOM 1247  N N   . VAL B 2 3   ? -27.671 84.619  -5.106  1.00 56.38  ? 3   VAL B N   1 
ATOM 1248  C CA  . VAL B 2 3   ? -28.048 85.968  -4.692  1.00 58.86  ? 3   VAL B CA  1 
ATOM 1249  C C   . VAL B 2 3   ? -27.988 86.138  -3.179  1.00 58.00  ? 3   VAL B C   1 
ATOM 1250  O O   . VAL B 2 3   ? -28.749 85.518  -2.440  1.00 61.59  ? 3   VAL B O   1 
ATOM 1251  C CB  . VAL B 2 3   ? -29.471 86.347  -5.178  1.00 58.25  ? 3   VAL B CB  1 
ATOM 1252  C CG1 . VAL B 2 3   ? -29.603 86.043  -6.660  1.00 57.28  ? 3   VAL B CG1 1 
ATOM 1253  C CG2 . VAL B 2 3   ? -30.527 85.606  -4.380  1.00 60.45  ? 3   VAL B CG2 1 
ATOM 1254  N N   . LEU B 2 4   ? -27.071 86.982  -2.725  1.00 56.47  ? 4   LEU B N   1 
ATOM 1255  C CA  . LEU B 2 4   ? -26.906 87.242  -1.302  1.00 57.52  ? 4   LEU B CA  1 
ATOM 1256  C C   . LEU B 2 4   ? -27.786 88.417  -0.936  1.00 58.86  ? 4   LEU B C   1 
ATOM 1257  O O   . LEU B 2 4   ? -27.610 89.519  -1.461  1.00 61.92  ? 4   LEU B O   1 
ATOM 1258  C CB  . LEU B 2 4   ? -25.448 87.574  -0.990  1.00 57.74  ? 4   LEU B CB  1 
ATOM 1259  C CG  . LEU B 2 4   ? -24.499 86.526  -1.570  1.00 60.11  ? 4   LEU B CG  1 
ATOM 1260  C CD1 . LEU B 2 4   ? -23.038 86.926  -1.374  1.00 61.81  ? 4   LEU B CD1 1 
ATOM 1261  C CD2 . LEU B 2 4   ? -24.802 85.200  -0.899  1.00 57.89  ? 4   LEU B CD2 1 
ATOM 1262  N N   . THR B 2 5   ? -28.736 88.187  -0.036  1.00 59.62  ? 5   THR B N   1 
ATOM 1263  C CA  . THR B 2 5   ? -29.639 89.255  0.366   1.00 57.04  ? 5   THR B CA  1 
ATOM 1264  C C   . THR B 2 5   ? -29.380 89.787  1.776   1.00 58.63  ? 5   THR B C   1 
ATOM 1265  O O   . THR B 2 5   ? -29.461 89.051  2.771   1.00 58.24  ? 5   THR B O   1 
ATOM 1266  C CB  . THR B 2 5   ? -31.098 88.806  0.231   1.00 53.69  ? 5   THR B CB  1 
ATOM 1267  O OG1 . THR B 2 5   ? -31.363 88.476  -1.138  1.00 50.01  ? 5   THR B OG1 1 
ATOM 1268  C CG2 . THR B 2 5   ? -32.036 89.917  0.655   1.00 50.89  ? 5   THR B CG2 1 
ATOM 1269  N N   . GLN B 2 6   ? -29.077 91.083  1.843   1.00 57.41  ? 6   GLN B N   1 
ATOM 1270  C CA  . GLN B 2 6   ? -28.790 91.749  3.098   1.00 56.60  ? 6   GLN B CA  1 
ATOM 1271  C C   . GLN B 2 6   ? -29.951 92.590  3.591   1.00 61.64  ? 6   GLN B C   1 
ATOM 1272  O O   . GLN B 2 6   ? -30.638 93.266  2.809   1.00 60.25  ? 6   GLN B O   1 
ATOM 1273  C CB  . GLN B 2 6   ? -27.573 92.638  2.947   1.00 48.06  ? 6   GLN B CB  1 
ATOM 1274  C CG  . GLN B 2 6   ? -26.376 91.919  2.409   1.00 48.88  ? 6   GLN B CG  1 
ATOM 1275  C CD  . GLN B 2 6   ? -25.098 92.497  2.981   1.00 51.67  ? 6   GLN B CD  1 
ATOM 1276  O OE1 . GLN B 2 6   ? -24.955 92.614  4.213   1.00 56.99  ? 6   GLN B OE1 1 
ATOM 1277  N NE2 . GLN B 2 6   ? -24.156 92.860  2.104   1.00 47.55  ? 6   GLN B NE2 1 
ATOM 1278  N N   . SER B 2 7   ? -30.170 92.541  4.903   1.00 67.43  ? 7   SER B N   1 
ATOM 1279  C CA  . SER B 2 7   ? -31.251 93.298  5.535   1.00 67.87  ? 7   SER B CA  1 
ATOM 1280  C C   . SER B 2 7   ? -30.960 93.619  6.986   1.00 68.13  ? 7   SER B C   1 
ATOM 1281  O O   . SER B 2 7   ? -30.387 92.803  7.716   1.00 68.01  ? 7   SER B O   1 
ATOM 1282  C CB  . SER B 2 7   ? -32.535 92.503  5.464   1.00 69.05  ? 7   SER B CB  1 
ATOM 1283  O OG  . SER B 2 7   ? -32.282 91.200  5.934   1.00 75.64  ? 7   SER B OG  1 
ATOM 1284  N N   . PRO B 2 8   ? -31.381 94.811  7.436   1.00 67.88  ? 8   PRO B N   1 
ATOM 1285  C CA  . PRO B 2 8   ? -32.087 95.843  6.667   1.00 66.41  ? 8   PRO B CA  1 
ATOM 1286  C C   . PRO B 2 8   ? -31.187 96.627  5.726   1.00 65.86  ? 8   PRO B C   1 
ATOM 1287  O O   . PRO B 2 8   ? -29.978 96.404  5.673   1.00 67.29  ? 8   PRO B O   1 
ATOM 1288  C CB  . PRO B 2 8   ? -32.653 96.711  7.760   1.00 63.95  ? 8   PRO B CB  1 
ATOM 1289  C CG  . PRO B 2 8   ? -31.540 96.706  8.763   1.00 64.55  ? 8   PRO B CG  1 
ATOM 1290  C CD  . PRO B 2 8   ? -31.070 95.265  8.799   1.00 65.66  ? 8   PRO B CD  1 
ATOM 1291  N N   . LYS B 2 9   ? -31.751 97.566  4.995   1.00 63.98  ? 9   LYS B N   1 
ATOM 1292  C CA  . LYS B 2 9   ? -30.928 98.333  4.101   1.00 61.60  ? 9   LYS B CA  1 
ATOM 1293  C C   . LYS B 2 9   ? -29.960 99.166  4.933   1.00 62.06  ? 9   LYS B C   1 
ATOM 1294  O O   . LYS B 2 9   ? -28.864 99.467  4.473   1.00 59.93  ? 9   LYS B O   1 
ATOM 1295  C CB  . LYS B 2 9   ? -31.812 99.212  3.234   1.00 61.62  ? 9   LYS B CB  1 
ATOM 1296  C CG  . LYS B 2 9   ? -31.184 99.600  1.914   1.00 64.20  ? 9   LYS B CG  1 
ATOM 1297  C CD  . LYS B 2 9   ? -31.013 98.390  1.012   1.00 64.62  ? 9   LYS B CD  1 
ATOM 1298  C CE  . LYS B 2 9   ? -30.482 98.790  -0.382  1.00 66.43  ? 9   LYS B CE  1 
ATOM 1299  N NZ  . LYS B 2 9   ? -30.258 97.569  -1.231  1.00 64.62  ? 9   LYS B NZ  1 
ATOM 1300  N N   . SER B 2 10  ? -30.358 99.510  6.162   1.00 62.04  ? 10  SER B N   1 
ATOM 1301  C CA  . SER B 2 10  ? -29.510 100.301 7.065   1.00 63.98  ? 10  SER B CA  1 
ATOM 1302  C C   . SER B 2 10  ? -29.888 100.119 8.539   1.00 63.44  ? 10  SER B C   1 
ATOM 1303  O O   . SER B 2 10  ? -31.004 99.733  8.865   1.00 61.67  ? 10  SER B O   1 
ATOM 1304  C CB  . SER B 2 10  ? -29.600 101.783 6.725   1.00 65.73  ? 10  SER B CB  1 
ATOM 1305  O OG  . SER B 2 10  ? -30.772 102.329 7.295   1.00 73.88  ? 10  SER B OG  1 
ATOM 1306  N N   . MET B 2 11  ? -28.946 100.411 9.426   1.00 65.90  ? 11  MET B N   1 
ATOM 1307  C CA  . MET B 2 11  ? -29.158 100.276 10.857  1.00 68.60  ? 11  MET B CA  1 
ATOM 1308  C C   . MET B 2 11  ? -28.624 101.477 11.601  1.00 69.33  ? 11  MET B C   1 
ATOM 1309  O O   . MET B 2 11  ? -27.562 102.005 11.261  1.00 72.06  ? 11  MET B O   1 
ATOM 1310  C CB  . MET B 2 11  ? -28.452 99.035  11.389  1.00 74.30  ? 11  MET B CB  1 
ATOM 1311  C CG  . MET B 2 11  ? -29.191 97.747  11.158  1.00 82.86  ? 11  MET B CG  1 
ATOM 1312  S SD  . MET B 2 11  ? -28.491 96.475  12.211  1.00 100.22 ? 11  MET B SD  1 
ATOM 1313  C CE  . MET B 2 11  ? -29.431 96.722  13.761  1.00 98.38  ? 11  MET B CE  1 
ATOM 1314  N N   . SER B 2 12  ? -29.358 101.893 12.630  1.00 67.92  ? 12  SER B N   1 
ATOM 1315  C CA  . SER B 2 12  ? -28.956 103.029 13.450  1.00 65.08  ? 12  SER B CA  1 
ATOM 1316  C C   . SER B 2 12  ? -28.957 102.636 14.911  1.00 60.43  ? 12  SER B C   1 
ATOM 1317  O O   . SER B 2 12  ? -29.987 102.283 15.473  1.00 58.70  ? 12  SER B O   1 
ATOM 1318  C CB  . SER B 2 12  ? -29.891 104.213 13.216  1.00 67.29  ? 12  SER B CB  1 
ATOM 1319  O OG  . SER B 2 12  ? -29.717 104.724 11.899  1.00 74.60  ? 12  SER B OG  1 
ATOM 1320  N N   . VAL B 2 13  ? -27.783 102.681 15.519  1.00 58.52  ? 13  VAL B N   1 
ATOM 1321  C CA  . VAL B 2 13  ? -27.648 102.316 16.917  1.00 56.42  ? 13  VAL B CA  1 
ATOM 1322  C C   . VAL B 2 13  ? -26.671 103.257 17.578  1.00 55.22  ? 13  VAL B C   1 
ATOM 1323  O O   . VAL B 2 13  ? -25.925 103.963 16.913  1.00 57.38  ? 13  VAL B O   1 
ATOM 1324  C CB  . VAL B 2 13  ? -27.144 100.871 17.083  1.00 56.21  ? 13  VAL B CB  1 
ATOM 1325  C CG1 . VAL B 2 13  ? -28.034 99.935  16.274  1.00 55.95  ? 13  VAL B CG1 1 
ATOM 1326  C CG2 . VAL B 2 13  ? -25.675 100.764 16.663  1.00 52.49  ? 13  VAL B CG2 1 
ATOM 1327  N N   . SER B 2 14  ? -26.666 103.252 18.897  1.00 52.53  ? 14  SER B N   1 
ATOM 1328  C CA  . SER B 2 14  ? -25.800 104.148 19.632  1.00 49.13  ? 14  SER B CA  1 
ATOM 1329  C C   . SER B 2 14  ? -24.512 103.493 19.984  1.00 43.68  ? 14  SER B C   1 
ATOM 1330  O O   . SER B 2 14  ? -24.451 102.292 20.185  1.00 44.61  ? 14  SER B O   1 
ATOM 1331  C CB  . SER B 2 14  ? -26.510 104.607 20.890  1.00 52.57  ? 14  SER B CB  1 
ATOM 1332  O OG  . SER B 2 14  ? -27.865 104.901 20.581  1.00 56.45  ? 14  SER B OG  1 
ATOM 1333  N N   . VAL B 2 15  ? -23.475 104.296 20.077  1.00 41.14  ? 15  VAL B N   1 
ATOM 1334  C CA  . VAL B 2 15  ? -22.173 103.751 20.391  1.00 42.15  ? 15  VAL B CA  1 
ATOM 1335  C C   . VAL B 2 15  ? -22.115 103.074 21.765  1.00 43.38  ? 15  VAL B C   1 
ATOM 1336  O O   . VAL B 2 15  ? -22.272 103.709 22.809  1.00 45.07  ? 15  VAL B O   1 
ATOM 1337  C CB  . VAL B 2 15  ? -21.089 104.839 20.256  1.00 39.08  ? 15  VAL B CB  1 
ATOM 1338  C CG1 . VAL B 2 15  ? -21.734 106.219 20.354  1.00 44.47  ? 15  VAL B CG1 1 
ATOM 1339  C CG2 . VAL B 2 15  ? -19.998 104.640 21.306  1.00 40.84  ? 15  VAL B CG2 1 
ATOM 1340  N N   . GLY B 2 16  ? -21.889 101.761 21.724  1.00 46.67  ? 16  GLY B N   1 
ATOM 1341  C CA  . GLY B 2 16  ? -21.802 100.919 22.905  1.00 43.02  ? 16  GLY B CA  1 
ATOM 1342  C C   . GLY B 2 16  ? -22.764 99.768  22.677  1.00 44.68  ? 16  GLY B C   1 
ATOM 1343  O O   . GLY B 2 16  ? -22.561 98.655  23.165  1.00 45.11  ? 16  GLY B O   1 
ATOM 1344  N N   . GLU B 2 17  ? -23.814 100.063 21.909  1.00 47.18  ? 17  GLU B N   1 
ATOM 1345  C CA  . GLU B 2 17  ? -24.868 99.114  21.562  1.00 51.16  ? 17  GLU B CA  1 
ATOM 1346  C C   . GLU B 2 17  ? -24.385 97.838  20.899  1.00 51.95  ? 17  GLU B C   1 
ATOM 1347  O O   . GLU B 2 17  ? -23.216 97.697  20.544  1.00 54.06  ? 17  GLU B O   1 
ATOM 1348  C CB  . GLU B 2 17  ? -25.865 99.757  20.605  1.00 55.69  ? 17  GLU B CB  1 
ATOM 1349  C CG  . GLU B 2 17  ? -26.916 100.614 21.251  1.00 67.47  ? 17  GLU B CG  1 
ATOM 1350  C CD  . GLU B 2 17  ? -28.247 100.515 20.514  1.00 76.05  ? 17  GLU B CD  1 
ATOM 1351  O OE1 . GLU B 2 17  ? -29.178 101.289 20.844  1.00 80.57  ? 17  GLU B OE1 1 
ATOM 1352  O OE2 . GLU B 2 17  ? -28.364 99.649  19.609  1.00 77.95  ? 17  GLU B OE2 1 
ATOM 1353  N N   . ARG B 2 18  ? -25.315 96.915  20.701  1.00 48.54  ? 18  ARG B N   1 
ATOM 1354  C CA  . ARG B 2 18  ? -24.997 95.661  20.051  1.00 44.73  ? 18  ARG B CA  1 
ATOM 1355  C C   . ARG B 2 18  ? -25.816 95.568  18.779  1.00 42.73  ? 18  ARG B C   1 
ATOM 1356  O O   . ARG B 2 18  ? -26.978 95.978  18.739  1.00 39.04  ? 18  ARG B O   1 
ATOM 1357  C CB  . ARG B 2 18  ? -25.325 94.492  20.961  1.00 43.81  ? 18  ARG B CB  1 
ATOM 1358  C CG  . ARG B 2 18  ? -25.158 93.156  20.304  1.00 42.95  ? 18  ARG B CG  1 
ATOM 1359  C CD  . ARG B 2 18  ? -26.384 92.302  20.541  1.00 44.65  ? 18  ARG B CD  1 
ATOM 1360  N NE  . ARG B 2 18  ? -26.077 90.877  20.469  1.00 49.59  ? 18  ARG B NE  1 
ATOM 1361  C CZ  . ARG B 2 18  ? -25.103 90.288  21.157  1.00 48.73  ? 18  ARG B CZ  1 
ATOM 1362  N NH1 . ARG B 2 18  ? -24.327 90.998  21.974  1.00 48.87  ? 18  ARG B NH1 1 
ATOM 1363  N NH2 . ARG B 2 18  ? -24.910 88.982  21.036  1.00 51.51  ? 18  ARG B NH2 1 
ATOM 1364  N N   . VAL B 2 19  ? -25.208 95.024  17.736  1.00 42.82  ? 19  VAL B N   1 
ATOM 1365  C CA  . VAL B 2 19  ? -25.889 94.922  16.465  1.00 42.71  ? 19  VAL B CA  1 
ATOM 1366  C C   . VAL B 2 19  ? -25.561 93.623  15.781  1.00 41.47  ? 19  VAL B C   1 
ATOM 1367  O O   . VAL B 2 19  ? -24.510 93.020  16.023  1.00 41.39  ? 19  VAL B O   1 
ATOM 1368  C CB  . VAL B 2 19  ? -25.481 96.084  15.506  1.00 44.76  ? 19  VAL B CB  1 
ATOM 1369  C CG1 . VAL B 2 19  ? -26.198 95.952  14.185  1.00 46.78  ? 19  VAL B CG1 1 
ATOM 1370  C CG2 . VAL B 2 19  ? -25.825 97.413  16.119  1.00 47.30  ? 19  VAL B CG2 1 
ATOM 1371  N N   . THR B 2 20  ? -26.485 93.206  14.923  1.00 41.53  ? 20  THR B N   1 
ATOM 1372  C CA  . THR B 2 20  ? -26.329 92.006  14.143  1.00 42.03  ? 20  THR B CA  1 
ATOM 1373  C C   . THR B 2 20  ? -26.904 92.232  12.757  1.00 45.69  ? 20  THR B C   1 
ATOM 1374  O O   . THR B 2 20  ? -28.070 92.621  12.607  1.00 43.15  ? 20  THR B O   1 
ATOM 1375  C CB  . THR B 2 20  ? -27.038 90.820  14.782  1.00 42.58  ? 20  THR B CB  1 
ATOM 1376  O OG1 . THR B 2 20  ? -26.361 90.454  15.992  1.00 43.42  ? 20  THR B OG1 1 
ATOM 1377  C CG2 . THR B 2 20  ? -27.034 89.644  13.826  1.00 45.87  ? 20  THR B CG2 1 
ATOM 1378  N N   . LEU B 2 21  ? -26.061 91.983  11.753  1.00 48.28  ? 21  LEU B N   1 
ATOM 1379  C CA  . LEU B 2 21  ? -26.415 92.126  10.342  1.00 44.98  ? 21  LEU B CA  1 
ATOM 1380  C C   . LEU B 2 21  ? -26.720 90.744  9.795   1.00 45.76  ? 21  LEU B C   1 
ATOM 1381  O O   . LEU B 2 21  ? -26.189 89.744  10.290  1.00 41.99  ? 21  LEU B O   1 
ATOM 1382  C CB  . LEU B 2 21  ? -25.245 92.716  9.547   1.00 46.89  ? 21  LEU B CB  1 
ATOM 1383  C CG  . LEU B 2 21  ? -24.714 94.122  9.842   1.00 46.39  ? 21  LEU B CG  1 
ATOM 1384  C CD1 . LEU B 2 21  ? -25.792 95.127  9.537   1.00 50.98  ? 21  LEU B CD1 1 
ATOM 1385  C CD2 . LEU B 2 21  ? -24.275 94.235  11.277  1.00 43.97  ? 21  LEU B CD2 1 
ATOM 1386  N N   . SER B 2 22  ? -27.552 90.697  8.758   1.00 45.78  ? 22  SER B N   1 
ATOM 1387  C CA  . SER B 2 22  ? -27.934 89.432  8.148   1.00 48.04  ? 22  SER B CA  1 
ATOM 1388  C C   . SER B 2 22  ? -27.628 89.335  6.660   1.00 50.93  ? 22  SER B C   1 
ATOM 1389  O O   . SER B 2 22  ? -27.736 90.321  5.923   1.00 51.81  ? 22  SER B O   1 
ATOM 1390  C CB  . SER B 2 22  ? -29.432 89.187  8.322   1.00 47.13  ? 22  SER B CB  1 
ATOM 1391  O OG  . SER B 2 22  ? -30.113 89.319  7.074   1.00 46.08  ? 22  SER B OG  1 
ATOM 1392  N N   . CYS B 2 23  ? -27.253 88.131  6.232   1.00 53.00  ? 23  CYS B N   1 
ATOM 1393  C CA  . CYS B 2 23  ? -26.997 87.847  4.829   1.00 52.48  ? 23  CYS B CA  1 
ATOM 1394  C C   . CYS B 2 23  ? -27.670 86.523  4.567   1.00 53.82  ? 23  CYS B C   1 
ATOM 1395  O O   . CYS B 2 23  ? -27.378 85.540  5.251   1.00 53.10  ? 23  CYS B O   1 
ATOM 1396  C CB  . CYS B 2 23  ? -25.506 87.710  4.521   1.00 52.46  ? 23  CYS B CB  1 
ATOM 1397  S SG  . CYS B 2 23  ? -25.137 87.847  2.719   1.00 48.75  ? 23  CYS B SG  1 
ATOM 1398  N N   . LYS B 2 24  ? -28.580 86.509  3.593   1.00 56.22  ? 24  LYS B N   1 
ATOM 1399  C CA  . LYS B 2 24  ? -29.315 85.295  3.226   1.00 58.60  ? 24  LYS B CA  1 
ATOM 1400  C C   . LYS B 2 24  ? -29.133 84.995  1.739   1.00 56.34  ? 24  LYS B C   1 
ATOM 1401  O O   . LYS B 2 24  ? -29.463 85.823  0.888   1.00 57.20  ? 24  LYS B O   1 
ATOM 1402  C CB  . LYS B 2 24  ? -30.813 85.452  3.510   1.00 61.00  ? 24  LYS B CB  1 
ATOM 1403  C CG  . LYS B 2 24  ? -31.160 86.102  4.841   1.00 69.41  ? 24  LYS B CG  1 
ATOM 1404  C CD  . LYS B 2 24  ? -30.655 85.304  6.029   1.00 74.09  ? 24  LYS B CD  1 
ATOM 1405  C CE  . LYS B 2 24  ? -31.284 85.828  7.306   1.00 76.17  ? 24  LYS B CE  1 
ATOM 1406  N NZ  . LYS B 2 24  ? -32.779 85.790  7.194   1.00 73.98  ? 24  LYS B NZ  1 
ATOM 1407  N N   . ALA B 2 25  ? -28.631 83.800  1.439   1.00 54.71  ? 25  ALA B N   1 
ATOM 1408  C CA  . ALA B 2 25  ? -28.388 83.384  0.063   1.00 53.42  ? 25  ALA B CA  1 
ATOM 1409  C C   . ALA B 2 25  ? -29.552 82.587  -0.515  1.00 52.05  ? 25  ALA B C   1 
ATOM 1410  O O   . ALA B 2 25  ? -30.308 81.955  0.221   1.00 52.47  ? 25  ALA B O   1 
ATOM 1411  C CB  . ALA B 2 25  ? -27.112 82.560  -0.007  1.00 54.37  ? 25  ALA B CB  1 
ATOM 1412  N N   . SER B 2 26  ? -29.678 82.615  -1.838  1.00 47.72  ? 26  SER B N   1 
ATOM 1413  C CA  . SER B 2 26  ? -30.745 81.905  -2.521  1.00 49.69  ? 26  SER B CA  1 
ATOM 1414  C C   . SER B 2 26  ? -30.548 80.387  -2.566  1.00 53.69  ? 26  SER B C   1 
ATOM 1415  O O   . SER B 2 26  ? -31.390 79.665  -3.095  1.00 56.58  ? 26  SER B O   1 
ATOM 1416  C CB  . SER B 2 26  ? -30.902 82.444  -3.943  1.00 48.05  ? 26  SER B CB  1 
ATOM 1417  O OG  . SER B 2 26  ? -29.708 82.312  -4.694  1.00 47.59  ? 26  SER B OG  1 
ATOM 1418  N N   . GLU B 2 27  ? -29.441 79.901  -2.017  1.00 55.71  ? 27  GLU B N   1 
ATOM 1419  C CA  . GLU B 2 27  ? -29.160 78.470  -1.998  1.00 56.57  ? 27  GLU B CA  1 
ATOM 1420  C C   . GLU B 2 27  ? -28.192 78.171  -0.888  1.00 55.39  ? 27  GLU B C   1 
ATOM 1421  O O   . GLU B 2 27  ? -27.870 79.032  -0.077  1.00 57.64  ? 27  GLU B O   1 
ATOM 1422  C CB  . GLU B 2 27  ? -28.506 78.031  -3.290  1.00 63.18  ? 27  GLU B CB  1 
ATOM 1423  C CG  . GLU B 2 27  ? -29.343 78.229  -4.517  1.00 75.34  ? 27  GLU B CG  1 
ATOM 1424  C CD  . GLU B 2 27  ? -28.494 78.224  -5.771  1.00 83.43  ? 27  GLU B CD  1 
ATOM 1425  O OE1 . GLU B 2 27  ? -27.625 77.324  -5.889  1.00 87.25  ? 27  GLU B OE1 1 
ATOM 1426  O OE2 . GLU B 2 27  ? -28.694 79.117  -6.633  1.00 88.26  ? 27  GLU B OE2 1 
ATOM 1427  N N   . ASN B 2 28  ? -27.724 76.936  -0.850  1.00 53.98  ? 28  ASN B N   1 
ATOM 1428  C CA  . ASN B 2 28  ? -26.759 76.570  0.158   1.00 53.93  ? 28  ASN B CA  1 
ATOM 1429  C C   . ASN B 2 28  ? -25.426 77.002  -0.424  1.00 54.57  ? 28  ASN B C   1 
ATOM 1430  O O   . ASN B 2 28  ? -25.197 76.893  -1.635  1.00 55.35  ? 28  ASN B O   1 
ATOM 1431  C CB  . ASN B 2 28  ? -26.784 75.055  0.428   1.00 51.97  ? 28  ASN B CB  1 
ATOM 1432  C CG  . ASN B 2 28  ? -25.575 74.574  1.228   1.00 52.79  ? 28  ASN B CG  1 
ATOM 1433  O OD1 . ASN B 2 28  ? -24.487 74.430  0.676   1.00 53.30  ? 28  ASN B OD1 1 
ATOM 1434  N ND2 . ASN B 2 28  ? -25.761 74.331  2.529   1.00 48.78  ? 28  ASN B ND2 1 
ATOM 1435  N N   . VAL B 2 29  ? -24.567 77.535  0.434   1.00 53.17  ? 29  VAL B N   1 
ATOM 1436  C CA  . VAL B 2 29  ? -23.251 77.970  0.010   1.00 51.33  ? 29  VAL B CA  1 
ATOM 1437  C C   . VAL B 2 29  ? -22.292 77.409  1.032   1.00 49.61  ? 29  VAL B C   1 
ATOM 1438  O O   . VAL B 2 29  ? -21.098 77.696  1.020   1.00 48.31  ? 29  VAL B O   1 
ATOM 1439  C CB  . VAL B 2 29  ? -23.151 79.504  -0.026  1.00 53.06  ? 29  VAL B CB  1 
ATOM 1440  C CG1 . VAL B 2 29  ? -24.151 80.060  -1.028  1.00 55.99  ? 29  VAL B CG1 1 
ATOM 1441  C CG2 . VAL B 2 29  ? -23.419 80.073  1.347   1.00 52.07  ? 29  VAL B CG2 1 
ATOM 1442  N N   . ASP B 2 30  ? -22.843 76.609  1.933   1.00 47.64  ? 30  ASP B N   1 
ATOM 1443  C CA  . ASP B 2 30  ? -22.048 75.968  2.955   1.00 49.47  ? 30  ASP B CA  1 
ATOM 1444  C C   . ASP B 2 30  ? -21.338 76.942  3.864   1.00 49.42  ? 30  ASP B C   1 
ATOM 1445  O O   . ASP B 2 30  ? -21.932 77.440  4.815   1.00 48.27  ? 30  ASP B O   1 
ATOM 1446  C CB  . ASP B 2 30  ? -21.033 75.038  2.306   1.00 53.19  ? 30  ASP B CB  1 
ATOM 1447  C CG  . ASP B 2 30  ? -21.698 74.012  1.416   1.00 58.98  ? 30  ASP B CG  1 
ATOM 1448  O OD1 . ASP B 2 30  ? -22.676 73.379  1.884   1.00 62.24  ? 30  ASP B OD1 1 
ATOM 1449  O OD2 . ASP B 2 30  ? -21.249 73.839  0.258   1.00 60.74  ? 30  ASP B OD2 1 
ATOM 1450  N N   . THR B 2 31  ? -20.069 77.212  3.590   1.00 47.46  ? 31  THR B N   1 
ATOM 1451  C CA  . THR B 2 31  ? -19.332 78.134  4.440   1.00 46.02  ? 31  THR B CA  1 
ATOM 1452  C C   . THR B 2 31  ? -18.470 79.101  3.643   1.00 45.13  ? 31  THR B C   1 
ATOM 1453  O O   . THR B 2 31  ? -17.607 79.805  4.190   1.00 47.48  ? 31  THR B O   1 
ATOM 1454  C CB  . THR B 2 31  ? -18.464 77.349  5.429   1.00 44.94  ? 31  THR B CB  1 
ATOM 1455  O OG1 . THR B 2 31  ? -17.762 76.318  4.730   1.00 45.78  ? 31  THR B OG1 1 
ATOM 1456  C CG2 . THR B 2 31  ? -19.332 76.714  6.497   1.00 42.51  ? 31  THR B CG2 1 
ATOM 1457  N N   . TYR B 2 32  ? -18.732 79.137  2.344   1.00 43.07  ? 32  TYR B N   1 
ATOM 1458  C CA  . TYR B 2 32  ? -17.991 79.983  1.425   1.00 43.24  ? 32  TYR B CA  1 
ATOM 1459  C C   . TYR B 2 32  ? -18.513 81.410  1.433   1.00 41.49  ? 32  TYR B C   1 
ATOM 1460  O O   . TYR B 2 32  ? -18.754 82.027  0.392   1.00 40.22  ? 32  TYR B O   1 
ATOM 1461  C CB  . TYR B 2 32  ? -18.056 79.351  0.037   1.00 45.80  ? 32  TYR B CB  1 
ATOM 1462  C CG  . TYR B 2 32  ? -17.517 77.937  0.076   1.00 46.24  ? 32  TYR B CG  1 
ATOM 1463  C CD1 . TYR B 2 32  ? -18.269 76.858  -0.380  1.00 46.19  ? 32  TYR B CD1 1 
ATOM 1464  C CD2 . TYR B 2 32  ? -16.261 77.678  0.629   1.00 47.33  ? 32  TYR B CD2 1 
ATOM 1465  C CE1 . TYR B 2 32  ? -17.781 75.563  -0.279  1.00 42.00  ? 32  TYR B CE1 1 
ATOM 1466  C CE2 . TYR B 2 32  ? -15.770 76.397  0.731   1.00 45.98  ? 32  TYR B CE2 1 
ATOM 1467  C CZ  . TYR B 2 32  ? -16.528 75.346  0.281   1.00 44.59  ? 32  TYR B CZ  1 
ATOM 1468  O OH  . TYR B 2 32  ? -16.016 74.075  0.410   1.00 51.34  ? 32  TYR B OH  1 
ATOM 1469  N N   . VAL B 2 33  ? -18.676 81.923  2.642   1.00 37.62  ? 33  VAL B N   1 
ATOM 1470  C CA  . VAL B 2 33  ? -19.164 83.262  2.838   1.00 35.08  ? 33  VAL B CA  1 
ATOM 1471  C C   . VAL B 2 33  ? -18.137 84.058  3.622   1.00 35.36  ? 33  VAL B C   1 
ATOM 1472  O O   . VAL B 2 33  ? -17.343 83.484  4.366   1.00 34.02  ? 33  VAL B O   1 
ATOM 1473  C CB  . VAL B 2 33  ? -20.479 83.219  3.566   1.00 30.93  ? 33  VAL B CB  1 
ATOM 1474  C CG1 . VAL B 2 33  ? -20.933 84.601  3.895   1.00 27.65  ? 33  VAL B CG1 1 
ATOM 1475  C CG2 . VAL B 2 33  ? -21.493 82.544  2.682   1.00 32.26  ? 33  VAL B CG2 1 
ATOM 1476  N N   . PHE B 2 34  ? -18.146 85.377  3.423   1.00 33.51  ? 34  PHE B N   1 
ATOM 1477  C CA  . PHE B 2 34  ? -17.205 86.283  4.071   1.00 28.31  ? 34  PHE B CA  1 
ATOM 1478  C C   . PHE B 2 34  ? -17.749 87.709  4.094   1.00 31.33  ? 34  PHE B C   1 
ATOM 1479  O O   . PHE B 2 34  ? -18.584 88.086  3.258   1.00 30.39  ? 34  PHE B O   1 
ATOM 1480  C CB  . PHE B 2 34  ? -15.878 86.234  3.327   1.00 24.04  ? 34  PHE B CB  1 
ATOM 1481  C CG  . PHE B 2 34  ? -16.033 86.243  1.839   1.00 22.46  ? 34  PHE B CG  1 
ATOM 1482  C CD1 . PHE B 2 34  ? -16.034 87.438  1.132   1.00 20.80  ? 34  PHE B CD1 1 
ATOM 1483  C CD2 . PHE B 2 34  ? -16.238 85.055  1.146   1.00 25.85  ? 34  PHE B CD2 1 
ATOM 1484  C CE1 . PHE B 2 34  ? -16.238 87.455  -0.237  1.00 17.41  ? 34  PHE B CE1 1 
ATOM 1485  C CE2 . PHE B 2 34  ? -16.448 85.060  -0.229  1.00 28.14  ? 34  PHE B CE2 1 
ATOM 1486  C CZ  . PHE B 2 34  ? -16.447 86.268  -0.919  1.00 27.57  ? 34  PHE B CZ  1 
ATOM 1487  N N   . TRP B 2 35  ? -17.256 88.501  5.049   1.00 34.14  ? 35  TRP B N   1 
ATOM 1488  C CA  . TRP B 2 35  ? -17.713 89.873  5.228   1.00 32.32  ? 35  TRP B CA  1 
ATOM 1489  C C   . TRP B 2 35  ? -16.687 90.956  5.010   1.00 31.14  ? 35  TRP B C   1 
ATOM 1490  O O   . TRP B 2 35  ? -15.516 90.807  5.367   1.00 28.11  ? 35  TRP B O   1 
ATOM 1491  C CB  . TRP B 2 35  ? -18.278 90.064  6.632   1.00 33.40  ? 35  TRP B CB  1 
ATOM 1492  C CG  . TRP B 2 35  ? -19.449 89.188  6.959   1.00 37.95  ? 35  TRP B CG  1 
ATOM 1493  C CD1 . TRP B 2 35  ? -19.408 87.897  7.403   1.00 37.14  ? 35  TRP B CD1 1 
ATOM 1494  C CD2 . TRP B 2 35  ? -20.841 89.547  6.895   1.00 38.03  ? 35  TRP B CD2 1 
ATOM 1495  N NE1 . TRP B 2 35  ? -20.688 87.429  7.623   1.00 36.23  ? 35  TRP B NE1 1 
ATOM 1496  C CE2 . TRP B 2 35  ? -21.587 88.420  7.318   1.00 38.95  ? 35  TRP B CE2 1 
ATOM 1497  C CE3 . TRP B 2 35  ? -21.529 90.710  6.523   1.00 34.70  ? 35  TRP B CE3 1 
ATOM 1498  C CZ2 . TRP B 2 35  ? -22.992 88.421  7.381   1.00 40.63  ? 35  TRP B CZ2 1 
ATOM 1499  C CZ3 . TRP B 2 35  ? -22.929 90.713  6.586   1.00 38.31  ? 35  TRP B CZ3 1 
ATOM 1500  C CH2 . TRP B 2 35  ? -23.643 89.571  7.011   1.00 39.19  ? 35  TRP B CH2 1 
ATOM 1501  N N   . PHE B 2 36  ? -17.165 92.066  4.452   1.00 29.82  ? 36  PHE B N   1 
ATOM 1502  C CA  . PHE B 2 36  ? -16.334 93.235  4.188   1.00 29.83  ? 36  PHE B CA  1 
ATOM 1503  C C   . PHE B 2 36  ? -16.845 94.434  4.963   1.00 29.96  ? 36  PHE B C   1 
ATOM 1504  O O   . PHE B 2 36  ? -18.054 94.572  5.189   1.00 28.64  ? 36  PHE B O   1 
ATOM 1505  C CB  . PHE B 2 36  ? -16.360 93.610  2.706   1.00 31.09  ? 36  PHE B CB  1 
ATOM 1506  C CG  . PHE B 2 36  ? -15.766 92.577  1.799   1.00 38.29  ? 36  PHE B CG  1 
ATOM 1507  C CD1 . PHE B 2 36  ? -16.558 91.919  0.860   1.00 42.92  ? 36  PHE B CD1 1 
ATOM 1508  C CD2 . PHE B 2 36  ? -14.413 92.268  1.865   1.00 38.16  ? 36  PHE B CD2 1 
ATOM 1509  C CE1 . PHE B 2 36  ? -16.008 90.976  0.004   1.00 45.06  ? 36  PHE B CE1 1 
ATOM 1510  C CE2 . PHE B 2 36  ? -13.855 91.323  1.013   1.00 38.65  ? 36  PHE B CE2 1 
ATOM 1511  C CZ  . PHE B 2 36  ? -14.650 90.679  0.084   1.00 41.14  ? 36  PHE B CZ  1 
ATOM 1512  N N   . GLN B 2 37  ? -15.921 95.299  5.370   1.00 30.54  ? 37  GLN B N   1 
ATOM 1513  C CA  . GLN B 2 37  ? -16.278 96.531  6.072   1.00 35.37  ? 37  GLN B CA  1 
ATOM 1514  C C   . GLN B 2 37  ? -15.736 97.691  5.250   1.00 37.72  ? 37  GLN B C   1 
ATOM 1515  O O   . GLN B 2 37  ? -14.526 97.906  5.203   1.00 39.22  ? 37  GLN B O   1 
ATOM 1516  C CB  . GLN B 2 37  ? -15.647 96.602  7.458   1.00 34.47  ? 37  GLN B CB  1 
ATOM 1517  C CG  . GLN B 2 37  ? -15.864 97.953  8.124   1.00 32.92  ? 37  GLN B CG  1 
ATOM 1518  C CD  . GLN B 2 37  ? -14.808 98.281  9.161   1.00 32.11  ? 37  GLN B CD  1 
ATOM 1519  O OE1 . GLN B 2 37  ? -13.625 98.405  8.832   1.00 36.08  ? 37  GLN B OE1 1 
ATOM 1520  N NE2 . GLN B 2 37  ? -15.227 98.427  10.421  1.00 28.45  ? 37  GLN B NE2 1 
ATOM 1521  N N   . GLN B 2 38  ? -16.619 98.440  4.598   1.00 39.13  ? 38  GLN B N   1 
ATOM 1522  C CA  . GLN B 2 38  ? -16.160 99.554  3.789   1.00 40.31  ? 38  GLN B CA  1 
ATOM 1523  C C   . GLN B 2 38  ? -16.554 100.915 4.363   1.00 46.69  ? 38  GLN B C   1 
ATOM 1524  O O   . GLN B 2 38  ? -17.718 101.324 4.291   1.00 50.56  ? 38  GLN B O   1 
ATOM 1525  C CB  . GLN B 2 38  ? -16.697 99.423  2.373   1.00 37.18  ? 38  GLN B CB  1 
ATOM 1526  C CG  . GLN B 2 38  ? -16.252 100.557 1.464   1.00 38.28  ? 38  GLN B CG  1 
ATOM 1527  C CD  . GLN B 2 38  ? -16.693 100.377 0.012   1.00 40.15  ? 38  GLN B CD  1 
ATOM 1528  O OE1 . GLN B 2 38  ? -17.823 99.956  -0.256  1.00 42.21  ? 38  GLN B OE1 1 
ATOM 1529  N NE2 . GLN B 2 38  ? -15.805 100.704 -0.930  1.00 36.88  ? 38  GLN B NE2 1 
ATOM 1530  N N   . LYS B 2 39  ? -15.571 101.608 4.934   1.00 49.06  ? 39  LYS B N   1 
ATOM 1531  C CA  . LYS B 2 39  ? -15.773 102.931 5.520   1.00 51.72  ? 39  LYS B CA  1 
ATOM 1532  C C   . LYS B 2 39  ? -15.866 103.944 4.384   1.00 55.43  ? 39  LYS B C   1 
ATOM 1533  O O   . LYS B 2 39  ? -15.525 103.627 3.247   1.00 57.69  ? 39  LYS B O   1 
ATOM 1534  C CB  . LYS B 2 39  ? -14.601 103.281 6.445   1.00 51.22  ? 39  LYS B CB  1 
ATOM 1535  C CG  . LYS B 2 39  ? -14.646 102.578 7.800   1.00 49.91  ? 39  LYS B CG  1 
ATOM 1536  C CD  . LYS B 2 39  ? -13.352 102.793 8.583   1.00 48.62  ? 39  LYS B CD  1 
ATOM 1537  C CE  . LYS B 2 39  ? -13.450 102.273 10.021  1.00 48.73  ? 39  LYS B CE  1 
ATOM 1538  N NZ  . LYS B 2 39  ? -12.165 102.404 10.797  1.00 50.33  ? 39  LYS B NZ  1 
ATOM 1539  N N   . PRO B 2 40  ? -16.333 105.174 4.671   1.00 57.24  ? 40  PRO B N   1 
ATOM 1540  C CA  . PRO B 2 40  ? -16.449 106.199 3.626   1.00 56.69  ? 40  PRO B CA  1 
ATOM 1541  C C   . PRO B 2 40  ? -15.086 106.568 3.029   1.00 57.52  ? 40  PRO B C   1 
ATOM 1542  O O   . PRO B 2 40  ? -14.135 106.870 3.762   1.00 49.82  ? 40  PRO B O   1 
ATOM 1543  C CB  . PRO B 2 40  ? -17.093 107.359 4.366   1.00 57.52  ? 40  PRO B CB  1 
ATOM 1544  C CG  . PRO B 2 40  ? -16.503 107.218 5.753   1.00 60.09  ? 40  PRO B CG  1 
ATOM 1545  C CD  . PRO B 2 40  ? -16.660 105.738 5.994   1.00 57.08  ? 40  PRO B CD  1 
ATOM 1546  N N   . ASP B 2 41  ? -15.013 106.528 1.696   1.00 61.99  ? 41  ASP B N   1 
ATOM 1547  C CA  . ASP B 2 41  ? -13.793 106.830 0.937   1.00 65.77  ? 41  ASP B CA  1 
ATOM 1548  C C   . ASP B 2 41  ? -12.658 105.857 1.195   1.00 63.95  ? 41  ASP B C   1 
ATOM 1549  O O   . ASP B 2 41  ? -11.527 106.275 1.456   1.00 66.05  ? 41  ASP B O   1 
ATOM 1550  C CB  . ASP B 2 41  ? -13.276 108.241 1.230   1.00 75.61  ? 41  ASP B CB  1 
ATOM 1551  C CG  . ASP B 2 41  ? -14.197 109.325 0.708   1.00 85.27  ? 41  ASP B CG  1 
ATOM 1552  O OD1 . ASP B 2 41  ? -14.738 109.161 -0.413  1.00 88.76  ? 41  ASP B OD1 1 
ATOM 1553  O OD2 . ASP B 2 41  ? -14.367 110.346 1.416   1.00 88.11  ? 41  ASP B OD2 1 
ATOM 1554  N N   . GLN B 2 42  ? -12.961 104.564 1.116   1.00 61.77  ? 42  GLN B N   1 
ATOM 1555  C CA  . GLN B 2 42  ? -11.970 103.516 1.332   1.00 55.49  ? 42  GLN B CA  1 
ATOM 1556  C C   . GLN B 2 42  ? -12.352 102.260 0.576   1.00 52.12  ? 42  GLN B C   1 
ATOM 1557  O O   . GLN B 2 42  ? -13.532 101.929 0.460   1.00 52.65  ? 42  GLN B O   1 
ATOM 1558  C CB  . GLN B 2 42  ? -11.882 103.158 2.805   1.00 54.12  ? 42  GLN B CB  1 
ATOM 1559  C CG  . GLN B 2 42  ? -11.453 104.275 3.697   1.00 57.94  ? 42  GLN B CG  1 
ATOM 1560  C CD  . GLN B 2 42  ? -10.950 103.744 5.009   1.00 61.37  ? 42  GLN B CD  1 
ATOM 1561  O OE1 . GLN B 2 42  ? -11.658 103.018 5.708   1.00 64.48  ? 42  GLN B OE1 1 
ATOM 1562  N NE2 . GLN B 2 42  ? -9.714  104.086 5.352   1.00 61.81  ? 42  GLN B NE2 1 
ATOM 1563  N N   . SER B 2 43  ? -11.364 101.550 0.061   1.00 47.82  ? 43  SER B N   1 
ATOM 1564  C CA  . SER B 2 43  ? -11.665 100.316 -0.642  1.00 46.22  ? 43  SER B CA  1 
ATOM 1565  C C   . SER B 2 43  ? -12.191 99.359  0.428   1.00 41.02  ? 43  SER B C   1 
ATOM 1566  O O   . SER B 2 43  ? -11.881 99.521  1.601   1.00 40.90  ? 43  SER B O   1 
ATOM 1567  C CB  . SER B 2 43  ? -10.392 99.764  -1.272  1.00 47.34  ? 43  SER B CB  1 
ATOM 1568  O OG  . SER B 2 43  ? -9.386  99.609  -0.290  1.00 47.53  ? 43  SER B OG  1 
ATOM 1569  N N   . PRO B 2 44  ? -13.009 98.363  0.048   1.00 38.03  ? 44  PRO B N   1 
ATOM 1570  C CA  . PRO B 2 44  ? -13.505 97.449  1.081   1.00 33.80  ? 44  PRO B CA  1 
ATOM 1571  C C   . PRO B 2 44  ? -12.348 96.800  1.822   1.00 31.61  ? 44  PRO B C   1 
ATOM 1572  O O   . PRO B 2 44  ? -11.225 96.752  1.324   1.00 35.76  ? 44  PRO B O   1 
ATOM 1573  C CB  . PRO B 2 44  ? -14.309 96.425  0.289   1.00 31.01  ? 44  PRO B CB  1 
ATOM 1574  C CG  . PRO B 2 44  ? -14.817 97.209  -0.859  1.00 30.51  ? 44  PRO B CG  1 
ATOM 1575  C CD  . PRO B 2 44  ? -13.616 98.055  -1.259  1.00 36.45  ? 44  PRO B CD  1 
ATOM 1576  N N   . LYS B 2 45  ? -12.624 96.324  3.024   1.00 27.84  ? 45  LYS B N   1 
ATOM 1577  C CA  . LYS B 2 45  ? -11.614 95.659  3.827   1.00 29.53  ? 45  LYS B CA  1 
ATOM 1578  C C   . LYS B 2 45  ? -12.209 94.333  4.250   1.00 29.34  ? 45  LYS B C   1 
ATOM 1579  O O   . LYS B 2 45  ? -13.404 94.237  4.570   1.00 26.80  ? 45  LYS B O   1 
ATOM 1580  C CB  . LYS B 2 45  ? -11.255 96.485  5.063   1.00 33.91  ? 45  LYS B CB  1 
ATOM 1581  C CG  . LYS B 2 45  ? -10.475 97.759  4.753   1.00 43.70  ? 45  LYS B CG  1 
ATOM 1582  C CD  . LYS B 2 45  ? -10.632 98.844  5.872   1.00 53.26  ? 45  LYS B CD  1 
ATOM 1583  C CE  . LYS B 2 45  ? -12.059 99.496  5.964   1.00 48.64  ? 45  LYS B CE  1 
ATOM 1584  N NZ  . LYS B 2 45  ? -12.490 100.354 4.784   1.00 43.17  ? 45  LYS B NZ  1 
ATOM 1585  N N   . LEU B 2 46  ? -11.373 93.302  4.234   1.00 30.82  ? 46  LEU B N   1 
ATOM 1586  C CA  . LEU B 2 46  ? -11.823 91.974  4.612   1.00 27.01  ? 46  LEU B CA  1 
ATOM 1587  C C   . LEU B 2 46  ? -12.039 91.940  6.114   1.00 28.72  ? 46  LEU B C   1 
ATOM 1588  O O   . LEU B 2 46  ? -11.093 92.051  6.901   1.00 26.69  ? 46  LEU B O   1 
ATOM 1589  C CB  . LEU B 2 46  ? -10.787 90.941  4.203   1.00 24.82  ? 46  LEU B CB  1 
ATOM 1590  C CG  . LEU B 2 46  ? -11.202 89.491  4.396   1.00 18.97  ? 46  LEU B CG  1 
ATOM 1591  C CD1 . LEU B 2 46  ? -12.452 89.180  3.578   1.00 26.13  ? 46  LEU B CD1 1 
ATOM 1592  C CD2 . LEU B 2 46  ? -10.044 88.620  3.977   1.00 26.35  ? 46  LEU B CD2 1 
ATOM 1593  N N   . LEU B 2 47  ? -13.295 91.795  6.507   1.00 29.22  ? 47  LEU B N   1 
ATOM 1594  C CA  . LEU B 2 47  ? -13.645 91.775  7.917   1.00 28.59  ? 47  LEU B CA  1 
ATOM 1595  C C   . LEU B 2 47  ? -13.625 90.345  8.444   1.00 31.33  ? 47  LEU B C   1 
ATOM 1596  O O   . LEU B 2 47  ? -12.729 89.939  9.185   1.00 29.62  ? 47  LEU B O   1 
ATOM 1597  C CB  . LEU B 2 47  ? -15.035 92.380  8.087   1.00 24.33  ? 47  LEU B CB  1 
ATOM 1598  C CG  . LEU B 2 47  ? -15.420 92.772  9.504   1.00 24.25  ? 47  LEU B CG  1 
ATOM 1599  C CD1 . LEU B 2 47  ? -14.468 93.862  9.971   1.00 21.80  ? 47  LEU B CD1 1 
ATOM 1600  C CD2 . LEU B 2 47  ? -16.879 93.221  9.548   1.00 22.80  ? 47  LEU B CD2 1 
ATOM 1601  N N   . LEU B 2 48  ? -14.638 89.591  8.049   1.00 35.02  ? 48  LEU B N   1 
ATOM 1602  C CA  . LEU B 2 48  ? -14.762 88.201  8.434   1.00 37.38  ? 48  LEU B CA  1 
ATOM 1603  C C   . LEU B 2 48  ? -14.542 87.344  7.187   1.00 39.14  ? 48  LEU B C   1 
ATOM 1604  O O   . LEU B 2 48  ? -15.368 87.345  6.268   1.00 39.72  ? 48  LEU B O   1 
ATOM 1605  C CB  . LEU B 2 48  ? -16.161 87.961  9.006   1.00 41.51  ? 48  LEU B CB  1 
ATOM 1606  C CG  . LEU B 2 48  ? -16.259 87.545  10.477  1.00 42.18  ? 48  LEU B CG  1 
ATOM 1607  C CD1 . LEU B 2 48  ? -15.205 88.262  11.318  1.00 42.23  ? 48  LEU B CD1 1 
ATOM 1608  C CD2 . LEU B 2 48  ? -17.662 87.847  10.978  1.00 40.52  ? 48  LEU B CD2 1 
ATOM 1609  N N   . TYR B 2 49  ? -13.408 86.652  7.135   1.00 42.04  ? 49  TYR B N   1 
ATOM 1610  C CA  . TYR B 2 49  ? -13.101 85.765  6.006   1.00 47.99  ? 49  TYR B CA  1 
ATOM 1611  C C   . TYR B 2 49  ? -13.747 84.457  6.449   1.00 48.32  ? 49  TYR B C   1 
ATOM 1612  O O   . TYR B 2 49  ? -13.446 83.976  7.530   1.00 51.92  ? 49  TYR B O   1 
ATOM 1613  C CB  . TYR B 2 49  ? -11.586 85.631  5.861   1.00 48.41  ? 49  TYR B CB  1 
ATOM 1614  C CG  . TYR B 2 49  ? -10.930 84.774  6.905   1.00 47.99  ? 49  TYR B CG  1 
ATOM 1615  C CD1 . TYR B 2 49  ? -10.958 83.389  6.805   1.00 47.12  ? 49  TYR B CD1 1 
ATOM 1616  C CD2 . TYR B 2 49  ? -10.309 85.343  8.014   1.00 49.44  ? 49  TYR B CD2 1 
ATOM 1617  C CE1 . TYR B 2 49  ? -10.391 82.586  7.786   1.00 45.11  ? 49  TYR B CE1 1 
ATOM 1618  C CE2 . TYR B 2 49  ? -9.737  84.544  9.000   1.00 48.01  ? 49  TYR B CE2 1 
ATOM 1619  C CZ  . TYR B 2 49  ? -9.787  83.168  8.873   1.00 44.97  ? 49  TYR B CZ  1 
ATOM 1620  O OH  . TYR B 2 49  ? -9.246  82.358  9.829   1.00 53.32  ? 49  TYR B OH  1 
ATOM 1621  N N   . GLY B 2 50  ? -14.642 83.880  5.655   1.00 50.12  ? 50  GLY B N   1 
ATOM 1622  C CA  . GLY B 2 50  ? -15.321 82.682  6.139   1.00 55.11  ? 50  GLY B CA  1 
ATOM 1623  C C   . GLY B 2 50  ? -16.180 83.082  7.351   1.00 55.71  ? 50  GLY B C   1 
ATOM 1624  O O   . GLY B 2 50  ? -15.691 83.811  8.225   1.00 54.38  ? 50  GLY B O   1 
ATOM 1625  N N   . PRO B 2 51  ? -17.453 82.624  7.458   1.00 57.88  ? 51  PRO B N   1 
ATOM 1626  C CA  . PRO B 2 51  ? -18.262 83.033  8.624   1.00 56.05  ? 51  PRO B CA  1 
ATOM 1627  C C   . PRO B 2 51  ? -17.554 82.838  9.958   1.00 55.05  ? 51  PRO B C   1 
ATOM 1628  O O   . PRO B 2 51  ? -16.628 82.032  10.073  1.00 58.60  ? 51  PRO B O   1 
ATOM 1629  C CB  . PRO B 2 51  ? -19.525 82.180  8.492   1.00 53.42  ? 51  PRO B CB  1 
ATOM 1630  C CG  . PRO B 2 51  ? -19.030 80.945  7.791   1.00 50.25  ? 51  PRO B CG  1 
ATOM 1631  C CD  . PRO B 2 51  ? -18.102 81.508  6.738   1.00 54.51  ? 51  PRO B CD  1 
ATOM 1632  N N   . SER B 2 52  ? -17.971 83.598  10.957  1.00 52.18  ? 52  SER B N   1 
ATOM 1633  C CA  . SER B 2 52  ? -17.374 83.496  12.289  1.00 52.35  ? 52  SER B CA  1 
ATOM 1634  C C   . SER B 2 52  ? -15.840 83.440  12.353  1.00 47.82  ? 52  SER B C   1 
ATOM 1635  O O   . SER B 2 52  ? -15.297 82.724  13.189  1.00 44.64  ? 52  SER B O   1 
ATOM 1636  C CB  . SER B 2 52  ? -17.896 82.257  12.995  1.00 54.43  ? 52  SER B CB  1 
ATOM 1637  O OG  . SER B 2 52  ? -17.121 81.137  12.617  1.00 50.82  ? 52  SER B OG  1 
ATOM 1638  N N   . ASN B 2 53  ? -15.143 84.186  11.500  1.00 44.77  ? 53  ASN B N   1 
ATOM 1639  C CA  . ASN B 2 53  ? -13.682 84.181  11.526  1.00 45.95  ? 53  ASN B CA  1 
ATOM 1640  C C   . ASN B 2 53  ? -13.041 85.538  11.292  1.00 49.48  ? 53  ASN B C   1 
ATOM 1641  O O   . ASN B 2 53  ? -12.974 86.010  10.157  1.00 58.05  ? 53  ASN B O   1 
ATOM 1642  C CB  . ASN B 2 53  ? -13.165 83.202  10.493  1.00 46.84  ? 53  ASN B CB  1 
ATOM 1643  C CG  . ASN B 2 53  ? -13.180 81.799  10.999  1.00 48.56  ? 53  ASN B CG  1 
ATOM 1644  O OD1 . ASN B 2 53  ? -12.358 81.446  11.844  1.00 51.59  ? 53  ASN B OD1 1 
ATOM 1645  N ND2 . ASN B 2 53  ? -14.125 80.984  10.512  1.00 47.29  ? 53  ASN B ND2 1 
ATOM 1646  N N   . ARG B 2 54  ? -12.544 86.161  12.352  1.00 44.75  ? 54  ARG B N   1 
ATOM 1647  C CA  . ARG B 2 54  ? -11.944 87.481  12.207  1.00 40.97  ? 54  ARG B CA  1 
ATOM 1648  C C   . ARG B 2 54  ? -10.627 87.483  11.453  1.00 36.31  ? 54  ARG B C   1 
ATOM 1649  O O   . ARG B 2 54  ? -9.669  86.836  11.857  1.00 33.20  ? 54  ARG B O   1 
ATOM 1650  C CB  . ARG B 2 54  ? -11.771 88.141  13.583  1.00 44.25  ? 54  ARG B CB  1 
ATOM 1651  C CG  . ARG B 2 54  ? -13.094 88.650  14.167  1.00 48.32  ? 54  ARG B CG  1 
ATOM 1652  C CD  . ARG B 2 54  ? -12.968 89.279  15.555  1.00 52.30  ? 54  ARG B CD  1 
ATOM 1653  N NE  . ARG B 2 54  ? -12.899 88.292  16.632  1.00 56.59  ? 54  ARG B NE  1 
ATOM 1654  C CZ  . ARG B 2 54  ? -11.768 87.873  17.195  1.00 62.04  ? 54  ARG B CZ  1 
ATOM 1655  N NH1 . ARG B 2 54  ? -10.593 88.354  16.789  1.00 62.66  ? 54  ARG B NH1 1 
ATOM 1656  N NH2 . ARG B 2 54  ? -11.812 86.974  18.172  1.00 64.11  ? 54  ARG B NH2 1 
ATOM 1657  N N   . TYR B 2 55  ? -10.590 88.219  10.345  1.00 33.36  ? 55  TYR B N   1 
ATOM 1658  C CA  . TYR B 2 55  ? -9.378  88.313  9.547   1.00 32.40  ? 55  TYR B CA  1 
ATOM 1659  C C   . TYR B 2 55  ? -8.331  89.087  10.349  1.00 34.70  ? 55  TYR B C   1 
ATOM 1660  O O   . TYR B 2 55  ? -8.658  89.751  11.321  1.00 36.10  ? 55  TYR B O   1 
ATOM 1661  C CB  . TYR B 2 55  ? -9.663  89.027  8.216   1.00 26.50  ? 55  TYR B CB  1 
ATOM 1662  C CG  . TYR B 2 55  ? -8.456  89.140  7.287   1.00 18.96  ? 55  TYR B CG  1 
ATOM 1663  C CD1 . TYR B 2 55  ? -8.131  90.341  6.673   1.00 12.71  ? 55  TYR B CD1 1 
ATOM 1664  C CD2 . TYR B 2 55  ? -7.627  88.046  7.053   1.00 20.05  ? 55  TYR B CD2 1 
ATOM 1665  C CE1 . TYR B 2 55  ? -7.008  90.452  5.857   1.00 21.60  ? 55  TYR B CE1 1 
ATOM 1666  C CE2 . TYR B 2 55  ? -6.498  88.146  6.236   1.00 17.60  ? 55  TYR B CE2 1 
ATOM 1667  C CZ  . TYR B 2 55  ? -6.192  89.350  5.644   1.00 20.17  ? 55  TYR B CZ  1 
ATOM 1668  O OH  . TYR B 2 55  ? -5.059  89.454  4.860   1.00 22.59  ? 55  TYR B OH  1 
ATOM 1669  N N   . THR B 2 56  ? -7.073  88.986  9.947   1.00 36.89  ? 56  THR B N   1 
ATOM 1670  C CA  . THR B 2 56  ? -5.994  89.680  10.618  1.00 40.79  ? 56  THR B CA  1 
ATOM 1671  C C   . THR B 2 56  ? -6.376  91.107  10.963  1.00 47.42  ? 56  THR B C   1 
ATOM 1672  O O   . THR B 2 56  ? -6.751  91.887  10.075  1.00 47.42  ? 56  THR B O   1 
ATOM 1673  C CB  . THR B 2 56  ? -4.754  89.732  9.732   1.00 41.46  ? 56  THR B CB  1 
ATOM 1674  O OG1 . THR B 2 56  ? -4.203  88.417  9.631   1.00 42.52  ? 56  THR B OG1 1 
ATOM 1675  C CG2 . THR B 2 56  ? -3.716  90.692  10.305  1.00 41.44  ? 56  THR B CG2 1 
ATOM 1676  N N   . GLY B 2 57  ? -6.257  91.449  12.250  1.00 49.82  ? 57  GLY B N   1 
ATOM 1677  C CA  . GLY B 2 57  ? -6.588  92.796  12.706  1.00 46.78  ? 57  GLY B CA  1 
ATOM 1678  C C   . GLY B 2 57  ? -7.901  92.837  13.461  1.00 43.87  ? 57  GLY B C   1 
ATOM 1679  O O   . GLY B 2 57  ? -7.917  92.832  14.690  1.00 45.09  ? 57  GLY B O   1 
ATOM 1680  N N   . VAL B 2 58  ? -8.999  92.861  12.714  1.00 39.91  ? 58  VAL B N   1 
ATOM 1681  C CA  . VAL B 2 58  ? -10.353 92.892  13.263  1.00 40.52  ? 58  VAL B CA  1 
ATOM 1682  C C   . VAL B 2 58  ? -10.485 92.593  14.770  1.00 42.62  ? 58  VAL B C   1 
ATOM 1683  O O   . VAL B 2 58  ? -10.159 91.491  15.233  1.00 41.56  ? 58  VAL B O   1 
ATOM 1684  C CB  . VAL B 2 58  ? -11.264 91.905  12.503  1.00 36.98  ? 58  VAL B CB  1 
ATOM 1685  C CG1 . VAL B 2 58  ? -12.723 92.227  12.776  1.00 39.05  ? 58  VAL B CG1 1 
ATOM 1686  C CG2 . VAL B 2 58  ? -10.977 91.963  11.024  1.00 36.98  ? 58  VAL B CG2 1 
ATOM 1687  N N   . PRO B 2 59  ? -10.974 93.578  15.550  1.00 43.96  ? 59  PRO B N   1 
ATOM 1688  C CA  . PRO B 2 59  ? -11.166 93.456  17.003  1.00 42.35  ? 59  PRO B CA  1 
ATOM 1689  C C   . PRO B 2 59  ? -12.277 92.470  17.381  1.00 39.80  ? 59  PRO B C   1 
ATOM 1690  O O   . PRO B 2 59  ? -13.287 92.343  16.672  1.00 38.67  ? 59  PRO B O   1 
ATOM 1691  C CB  . PRO B 2 59  ? -11.484 94.888  17.420  1.00 45.69  ? 59  PRO B CB  1 
ATOM 1692  C CG  . PRO B 2 59  ? -12.205 95.432  16.188  1.00 41.95  ? 59  PRO B CG  1 
ATOM 1693  C CD  . PRO B 2 59  ? -11.311 94.941  15.090  1.00 41.59  ? 59  PRO B CD  1 
ATOM 1694  N N   . ASP B 2 60  ? -12.090 91.799  18.516  1.00 37.84  ? 60  ASP B N   1 
ATOM 1695  C CA  . ASP B 2 60  ? -13.035 90.786  18.985  1.00 38.44  ? 60  ASP B CA  1 
ATOM 1696  C C   . ASP B 2 60  ? -14.464 91.244  19.176  1.00 36.29  ? 60  ASP B C   1 
ATOM 1697  O O   . ASP B 2 60  ? -15.317 90.469  19.589  1.00 33.08  ? 60  ASP B O   1 
ATOM 1698  C CB  . ASP B 2 60  ? -12.528 90.140  20.274  1.00 45.07  ? 60  ASP B CB  1 
ATOM 1699  C CG  . ASP B 2 60  ? -11.393 90.921  20.911  1.00 56.97  ? 60  ASP B CG  1 
ATOM 1700  O OD1 . ASP B 2 60  ? -10.322 91.060  20.271  1.00 61.66  ? 60  ASP B OD1 1 
ATOM 1701  O OD2 . ASP B 2 60  ? -11.572 91.395  22.057  1.00 60.19  ? 60  ASP B OD2 1 
ATOM 1702  N N   . ARG B 2 61  ? -14.728 92.500  18.858  1.00 35.43  ? 61  ARG B N   1 
ATOM 1703  C CA  . ARG B 2 61  ? -16.068 93.060  18.988  1.00 37.78  ? 61  ARG B CA  1 
ATOM 1704  C C   . ARG B 2 61  ? -16.879 92.497  17.818  1.00 40.17  ? 61  ARG B C   1 
ATOM 1705  O O   . ARG B 2 61  ? -18.127 92.474  17.824  1.00 39.43  ? 61  ARG B O   1 
ATOM 1706  C CB  . ARG B 2 61  ? -15.941 94.584  18.922  1.00 34.95  ? 61  ARG B CB  1 
ATOM 1707  C CG  . ARG B 2 61  ? -14.493 94.981  19.243  1.00 41.76  ? 61  ARG B CG  1 
ATOM 1708  C CD  . ARG B 2 61  ? -14.281 96.409  19.716  1.00 44.90  ? 61  ARG B CD  1 
ATOM 1709  N NE  . ARG B 2 61  ? -14.000 97.369  18.649  1.00 41.64  ? 61  ARG B NE  1 
ATOM 1710  C CZ  . ARG B 2 61  ? -14.859 97.684  17.688  1.00 40.12  ? 61  ARG B CZ  1 
ATOM 1711  N NH1 . ARG B 2 61  ? -16.062 97.095  17.657  1.00 30.13  ? 61  ARG B NH1 1 
ATOM 1712  N NH2 . ARG B 2 61  ? -14.523 98.613  16.792  1.00 30.85  ? 61  ARG B NH2 1 
ATOM 1713  N N   . PHE B 2 62  ? -16.130 92.013  16.826  1.00 40.09  ? 62  PHE B N   1 
ATOM 1714  C CA  . PHE B 2 62  ? -16.683 91.438  15.600  1.00 38.63  ? 62  PHE B CA  1 
ATOM 1715  C C   . PHE B 2 62  ? -16.739 89.901  15.639  1.00 39.40  ? 62  PHE B C   1 
ATOM 1716  O O   . PHE B 2 62  ? -15.785 89.229  16.054  1.00 35.01  ? 62  PHE B O   1 
ATOM 1717  C CB  . PHE B 2 62  ? -15.838 91.881  14.398  1.00 32.10  ? 62  PHE B CB  1 
ATOM 1718  C CG  . PHE B 2 62  ? -15.921 93.353  14.094  1.00 31.04  ? 62  PHE B CG  1 
ATOM 1719  C CD1 . PHE B 2 62  ? -17.004 93.871  13.376  1.00 31.38  ? 62  PHE B CD1 1 
ATOM 1720  C CD2 . PHE B 2 62  ? -14.902 94.223  14.498  1.00 29.34  ? 62  PHE B CD2 1 
ATOM 1721  C CE1 . PHE B 2 62  ? -17.075 95.235  13.056  1.00 25.43  ? 62  PHE B CE1 1 
ATOM 1722  C CE2 . PHE B 2 62  ? -14.956 95.579  14.190  1.00 25.86  ? 62  PHE B CE2 1 
ATOM 1723  C CZ  . PHE B 2 62  ? -16.050 96.089  13.463  1.00 27.24  ? 62  PHE B CZ  1 
ATOM 1724  N N   . THR B 2 63  ? -17.860 89.350  15.192  1.00 38.82  ? 63  THR B N   1 
ATOM 1725  C CA  . THR B 2 63  ? -18.034 87.908  15.170  1.00 36.78  ? 63  THR B CA  1 
ATOM 1726  C C   . THR B 2 63  ? -19.174 87.607  14.221  1.00 41.24  ? 63  THR B C   1 
ATOM 1727  O O   . THR B 2 63  ? -19.938 88.505  13.845  1.00 42.27  ? 63  THR B O   1 
ATOM 1728  C CB  . THR B 2 63  ? -18.410 87.345  16.566  1.00 33.25  ? 63  THR B CB  1 
ATOM 1729  O OG1 . THR B 2 63  ? -19.648 87.927  16.998  1.00 19.80  ? 63  THR B OG1 1 
ATOM 1730  C CG2 . THR B 2 63  ? -17.316 87.644  17.598  1.00 22.69  ? 63  THR B CG2 1 
ATOM 1731  N N   . GLY B 2 64  ? -19.299 86.343  13.837  1.00 40.30  ? 64  GLY B N   1 
ATOM 1732  C CA  . GLY B 2 64  ? -20.365 85.989  12.931  1.00 40.74  ? 64  GLY B CA  1 
ATOM 1733  C C   . GLY B 2 64  ? -20.655 84.514  12.957  1.00 42.69  ? 64  GLY B C   1 
ATOM 1734  O O   . GLY B 2 64  ? -20.022 83.765  13.696  1.00 39.36  ? 64  GLY B O   1 
ATOM 1735  N N   . SER B 2 65  ? -21.619 84.093  12.149  1.00 48.08  ? 65  SER B N   1 
ATOM 1736  C CA  . SER B 2 65  ? -21.976 82.686  12.108  1.00 51.54  ? 65  SER B CA  1 
ATOM 1737  C C   . SER B 2 65  ? -23.010 82.320  11.041  1.00 52.60  ? 65  SER B C   1 
ATOM 1738  O O   . SER B 2 65  ? -23.705 83.173  10.461  1.00 50.97  ? 65  SER B O   1 
ATOM 1739  C CB  . SER B 2 65  ? -22.516 82.241  13.464  1.00 50.57  ? 65  SER B CB  1 
ATOM 1740  O OG  . SER B 2 65  ? -23.889 82.590  13.580  1.00 52.84  ? 65  SER B OG  1 
ATOM 1741  N N   . GLY B 2 66  ? -23.107 81.015  10.817  1.00 52.59  ? 66  GLY B N   1 
ATOM 1742  C CA  . GLY B 2 66  ? -24.037 80.503  9.847   1.00 50.65  ? 66  GLY B CA  1 
ATOM 1743  C C   . GLY B 2 66  ? -23.388 79.485  8.945   1.00 49.44  ? 66  GLY B C   1 
ATOM 1744  O O   . GLY B 2 66  ? -22.202 79.151  9.053   1.00 45.19  ? 66  GLY B O   1 
ATOM 1745  N N   . SER B 2 67  ? -24.213 78.986  8.045   1.00 50.10  ? 67  SER B N   1 
ATOM 1746  C CA  . SER B 2 67  ? -23.809 78.007  7.066   1.00 54.54  ? 67  SER B CA  1 
ATOM 1747  C C   . SER B 2 67  ? -25.106 77.704  6.352   1.00 55.27  ? 67  SER B C   1 
ATOM 1748  O O   . SER B 2 67  ? -26.174 78.173  6.767   1.00 55.41  ? 67  SER B O   1 
ATOM 1749  C CB  . SER B 2 67  ? -23.272 76.739  7.733   1.00 55.93  ? 67  SER B CB  1 
ATOM 1750  O OG  . SER B 2 67  ? -24.328 75.989  8.300   1.00 55.06  ? 67  SER B OG  1 
ATOM 1751  N N   . THR B 2 68  ? -25.019 76.936  5.277   1.00 56.63  ? 68  THR B N   1 
ATOM 1752  C CA  . THR B 2 68  ? -26.209 76.594  4.528   1.00 57.75  ? 68  THR B CA  1 
ATOM 1753  C C   . THR B 2 68  ? -26.756 77.797  3.785   1.00 54.36  ? 68  THR B C   1 
ATOM 1754  O O   . THR B 2 68  ? -26.401 78.036  2.632   1.00 53.64  ? 68  THR B O   1 
ATOM 1755  C CB  . THR B 2 68  ? -27.296 76.039  5.467   1.00 61.32  ? 68  THR B CB  1 
ATOM 1756  O OG1 . THR B 2 68  ? -26.868 74.764  5.964   1.00 67.18  ? 68  THR B OG1 1 
ATOM 1757  C CG2 . THR B 2 68  ? -28.639 75.910  4.746   1.00 65.46  ? 68  THR B CG2 1 
ATOM 1758  N N   . THR B 2 69  ? -27.597 78.576  4.447   1.00 52.57  ? 69  THR B N   1 
ATOM 1759  C CA  . THR B 2 69  ? -28.186 79.708  3.762   1.00 54.12  ? 69  THR B CA  1 
ATOM 1760  C C   . THR B 2 69  ? -28.295 81.033  4.534   1.00 55.80  ? 69  THR B C   1 
ATOM 1761  O O   . THR B 2 69  ? -28.378 82.095  3.912   1.00 55.85  ? 69  THR B O   1 
ATOM 1762  C CB  . THR B 2 69  ? -29.574 79.303  3.226   1.00 53.35  ? 69  THR B CB  1 
ATOM 1763  O OG1 . THR B 2 69  ? -30.129 80.374  2.458   1.00 53.48  ? 69  THR B OG1 1 
ATOM 1764  C CG2 . THR B 2 69  ? -30.507 78.956  4.380   1.00 56.08  ? 69  THR B CG2 1 
ATOM 1765  N N   . ASP B 2 70  ? -28.284 80.991  5.868   1.00 56.58  ? 70  ASP B N   1 
ATOM 1766  C CA  . ASP B 2 70  ? -28.402 82.221  6.656   1.00 53.04  ? 70  ASP B CA  1 
ATOM 1767  C C   . ASP B 2 70  ? -27.153 82.524  7.486   1.00 50.35  ? 70  ASP B C   1 
ATOM 1768  O O   . ASP B 2 70  ? -26.660 81.669  8.218   1.00 48.62  ? 70  ASP B O   1 
ATOM 1769  C CB  . ASP B 2 70  ? -29.646 82.146  7.557   1.00 57.46  ? 70  ASP B CB  1 
ATOM 1770  C CG  . ASP B 2 70  ? -30.945 81.889  6.765   1.00 64.33  ? 70  ASP B CG  1 
ATOM 1771  O OD1 . ASP B 2 70  ? -30.930 81.966  5.515   1.00 68.34  ? 70  ASP B OD1 1 
ATOM 1772  O OD2 . ASP B 2 70  ? -31.994 81.616  7.390   1.00 69.66  ? 70  ASP B OD2 1 
ATOM 1773  N N   . PHE B 2 71  ? -26.646 83.752  7.360   1.00 49.96  ? 71  PHE B N   1 
ATOM 1774  C CA  . PHE B 2 71  ? -25.436 84.179  8.076   1.00 50.95  ? 71  PHE B CA  1 
ATOM 1775  C C   . PHE B 2 71  ? -25.597 85.536  8.735   1.00 48.08  ? 71  PHE B C   1 
ATOM 1776  O O   . PHE B 2 71  ? -26.450 86.332  8.337   1.00 47.36  ? 71  PHE B O   1 
ATOM 1777  C CB  . PHE B 2 71  ? -24.246 84.268  7.122   1.00 50.48  ? 71  PHE B CB  1 
ATOM 1778  C CG  . PHE B 2 71  ? -24.063 83.055  6.271   1.00 51.29  ? 71  PHE B CG  1 
ATOM 1779  C CD1 . PHE B 2 71  ? -22.925 82.266  6.405   1.00 52.88  ? 71  PHE B CD1 1 
ATOM 1780  C CD2 . PHE B 2 71  ? -25.028 82.701  5.328   1.00 47.09  ? 71  PHE B CD2 1 
ATOM 1781  C CE1 . PHE B 2 71  ? -22.747 81.139  5.612   1.00 52.38  ? 71  PHE B CE1 1 
ATOM 1782  C CE2 . PHE B 2 71  ? -24.866 81.585  4.533   1.00 47.78  ? 71  PHE B CE2 1 
ATOM 1783  C CZ  . PHE B 2 71  ? -23.723 80.797  4.671   1.00 52.00  ? 71  PHE B CZ  1 
ATOM 1784  N N   . THR B 2 72  ? -24.740 85.806  9.717   1.00 47.33  ? 72  THR B N   1 
ATOM 1785  C CA  . THR B 2 72  ? -24.809 87.066  10.442  1.00 51.01  ? 72  THR B CA  1 
ATOM 1786  C C   . THR B 2 72  ? -23.510 87.587  11.020  1.00 52.04  ? 72  THR B C   1 
ATOM 1787  O O   . THR B 2 72  ? -22.715 86.838  11.604  1.00 53.27  ? 72  THR B O   1 
ATOM 1788  C CB  . THR B 2 72  ? -25.732 86.977  11.652  1.00 54.00  ? 72  THR B CB  1 
ATOM 1789  O OG1 . THR B 2 72  ? -25.072 86.229  12.689  1.00 48.20  ? 72  THR B OG1 1 
ATOM 1790  C CG2 . THR B 2 72  ? -27.051 86.318  11.274  1.00 58.06  ? 72  THR B CG2 1 
ATOM 1791  N N   . LEU B 2 73  ? -23.341 88.899  10.892  1.00 50.14  ? 73  LEU B N   1 
ATOM 1792  C CA  . LEU B 2 73  ? -22.187 89.591  11.442  1.00 46.20  ? 73  LEU B CA  1 
ATOM 1793  C C   . LEU B 2 73  ? -22.736 90.301  12.659  1.00 44.73  ? 73  LEU B C   1 
ATOM 1794  O O   . LEU B 2 73  ? -23.836 90.856  12.606  1.00 45.06  ? 73  LEU B O   1 
ATOM 1795  C CB  . LEU B 2 73  ? -21.657 90.629  10.462  1.00 45.93  ? 73  LEU B CB  1 
ATOM 1796  C CG  . LEU B 2 73  ? -20.587 91.564  11.034  1.00 47.03  ? 73  LEU B CG  1 
ATOM 1797  C CD1 . LEU B 2 73  ? -19.456 90.774  11.717  1.00 46.96  ? 73  LEU B CD1 1 
ATOM 1798  C CD2 . LEU B 2 73  ? -20.058 92.425  9.904   1.00 46.66  ? 73  LEU B CD2 1 
ATOM 1799  N N   . THR B 2 74  ? -22.000 90.276  13.759  1.00 42.43  ? 74  THR B N   1 
ATOM 1800  C CA  . THR B 2 74  ? -22.484 90.952  14.947  1.00 44.42  ? 74  THR B CA  1 
ATOM 1801  C C   . THR B 2 74  ? -21.389 91.714  15.678  1.00 44.01  ? 74  THR B C   1 
ATOM 1802  O O   . THR B 2 74  ? -20.248 91.246  15.839  1.00 42.12  ? 74  THR B O   1 
ATOM 1803  C CB  . THR B 2 74  ? -23.136 89.964  15.944  1.00 48.01  ? 74  THR B CB  1 
ATOM 1804  O OG1 . THR B 2 74  ? -22.114 89.258  16.657  1.00 55.74  ? 74  THR B OG1 1 
ATOM 1805  C CG2 . THR B 2 74  ? -24.005 88.951  15.207  1.00 49.80  ? 74  THR B CG2 1 
ATOM 1806  N N   . ILE B 2 75  ? -21.732 92.919  16.099  1.00 43.81  ? 75  ILE B N   1 
ATOM 1807  C CA  . ILE B 2 75  ? -20.780 93.704  16.846  1.00 44.72  ? 75  ILE B CA  1 
ATOM 1808  C C   . ILE B 2 75  ? -21.406 93.791  18.227  1.00 46.19  ? 75  ILE B C   1 
ATOM 1809  O O   . ILE B 2 75  ? -22.559 94.214  18.389  1.00 41.11  ? 75  ILE B O   1 
ATOM 1810  C CB  . ILE B 2 75  ? -20.574 95.109  16.252  1.00 43.03  ? 75  ILE B CB  1 
ATOM 1811  C CG1 . ILE B 2 75  ? -20.631 95.034  14.726  1.00 40.74  ? 75  ILE B CG1 1 
ATOM 1812  C CG2 . ILE B 2 75  ? -19.209 95.657  16.700  1.00 42.05  ? 75  ILE B CG2 1 
ATOM 1813  C CD1 . ILE B 2 75  ? -20.301 96.324  14.040  1.00 41.88  ? 75  ILE B CD1 1 
ATOM 1814  N N   . SER B 2 76  ? -20.638 93.330  19.206  1.00 48.12  ? 76  SER B N   1 
ATOM 1815  C CA  . SER B 2 76  ? -21.059 93.314  20.593  1.00 46.48  ? 76  SER B CA  1 
ATOM 1816  C C   . SER B 2 76  ? -21.448 94.715  21.030  1.00 48.57  ? 76  SER B C   1 
ATOM 1817  O O   . SER B 2 76  ? -22.583 94.952  21.458  1.00 49.56  ? 76  SER B O   1 
ATOM 1818  C CB  . SER B 2 76  ? -19.914 92.791  21.462  1.00 45.05  ? 76  SER B CB  1 
ATOM 1819  O OG  . SER B 2 76  ? -18.733 93.546  21.256  1.00 44.80  ? 76  SER B OG  1 
ATOM 1820  N N   . SER B 2 77  ? -20.490 95.637  20.922  1.00 48.55  ? 77  SER B N   1 
ATOM 1821  C CA  . SER B 2 77  ? -20.705 97.032  21.298  1.00 46.42  ? 77  SER B CA  1 
ATOM 1822  C C   . SER B 2 77  ? -20.080 98.011  20.286  1.00 44.42  ? 77  SER B C   1 
ATOM 1823  O O   . SER B 2 77  ? -18.904 98.381  20.390  1.00 41.11  ? 77  SER B O   1 
ATOM 1824  C CB  . SER B 2 77  ? -20.172 97.284  22.720  1.00 44.63  ? 77  SER B CB  1 
ATOM 1825  O OG  . SER B 2 77  ? -18.806 96.937  22.839  1.00 43.61  ? 77  SER B OG  1 
ATOM 1826  N N   . VAL B 2 78  ? -20.898 98.412  19.311  1.00 42.59  ? 78  VAL B N   1 
ATOM 1827  C CA  . VAL B 2 78  ? -20.521 99.337  18.243  1.00 43.56  ? 78  VAL B CA  1 
ATOM 1828  C C   . VAL B 2 78  ? -19.685 100.538 18.705  1.00 45.51  ? 78  VAL B C   1 
ATOM 1829  O O   . VAL B 2 78  ? -19.898 101.059 19.785  1.00 48.73  ? 78  VAL B O   1 
ATOM 1830  C CB  . VAL B 2 78  ? -21.788 99.871  17.562  1.00 43.69  ? 78  VAL B CB  1 
ATOM 1831  C CG1 . VAL B 2 78  ? -21.423 100.718 16.359  1.00 46.55  ? 78  VAL B CG1 1 
ATOM 1832  C CG2 . VAL B 2 78  ? -22.688 98.713  17.168  1.00 47.13  ? 78  VAL B CG2 1 
ATOM 1833  N N   . GLN B 2 79  ? -18.728 100.975 17.894  1.00 47.77  ? 79  GLN B N   1 
ATOM 1834  C CA  . GLN B 2 79  ? -17.906 102.138 18.243  1.00 50.90  ? 79  GLN B CA  1 
ATOM 1835  C C   . GLN B 2 79  ? -18.216 103.209 17.225  1.00 52.00  ? 79  GLN B C   1 
ATOM 1836  O O   . GLN B 2 79  ? -18.981 102.973 16.287  1.00 49.24  ? 79  GLN B O   1 
ATOM 1837  C CB  . GLN B 2 79  ? -16.418 101.830 18.153  1.00 51.33  ? 79  GLN B CB  1 
ATOM 1838  C CG  . GLN B 2 79  ? -15.944 100.741 19.064  1.00 51.70  ? 79  GLN B CG  1 
ATOM 1839  C CD  . GLN B 2 79  ? -16.394 100.953 20.484  1.00 53.95  ? 79  GLN B CD  1 
ATOM 1840  O OE1 . GLN B 2 79  ? -17.522 100.626 20.843  1.00 52.54  ? 79  GLN B OE1 1 
ATOM 1841  N NE2 . GLN B 2 79  ? -15.514 101.515 21.303  1.00 59.36  ? 79  GLN B NE2 1 
ATOM 1842  N N   . ALA B 2 80  ? -17.618 104.382 17.385  1.00 53.31  ? 80  ALA B N   1 
ATOM 1843  C CA  . ALA B 2 80  ? -17.883 105.445 16.428  1.00 58.21  ? 80  ALA B CA  1 
ATOM 1844  C C   . ALA B 2 80  ? -17.157 105.192 15.105  1.00 59.00  ? 80  ALA B C   1 
ATOM 1845  O O   . ALA B 2 80  ? -17.517 105.766 14.075  1.00 61.97  ? 80  ALA B O   1 
ATOM 1846  C CB  . ALA B 2 80  ? -17.477 106.795 17.008  1.00 58.63  ? 80  ALA B CB  1 
ATOM 1847  N N   . GLU B 2 81  ? -16.147 104.321 15.151  1.00 56.61  ? 81  GLU B N   1 
ATOM 1848  C CA  . GLU B 2 81  ? -15.324 103.976 13.990  1.00 56.15  ? 81  GLU B CA  1 
ATOM 1849  C C   . GLU B 2 81  ? -16.077 103.012 13.107  1.00 53.16  ? 81  GLU B C   1 
ATOM 1850  O O   . GLU B 2 81  ? -16.134 103.180 11.893  1.00 55.85  ? 81  GLU B O   1 
ATOM 1851  C CB  . GLU B 2 81  ? -14.026 103.289 14.423  1.00 61.04  ? 81  GLU B CB  1 
ATOM 1852  C CG  . GLU B 2 81  ? -13.209 104.005 15.488  1.00 74.87  ? 81  GLU B CG  1 
ATOM 1853  C CD  . GLU B 2 81  ? -14.019 104.359 16.743  1.00 84.06  ? 81  GLU B CD  1 
ATOM 1854  O OE1 . GLU B 2 81  ? -14.733 105.387 16.725  1.00 88.37  ? 81  GLU B OE1 1 
ATOM 1855  O OE2 . GLU B 2 81  ? -13.950 103.612 17.747  1.00 91.69  ? 81  GLU B OE2 1 
ATOM 1856  N N   . ASP B 2 82  ? -16.643 102.000 13.750  1.00 47.08  ? 82  ASP B N   1 
ATOM 1857  C CA  . ASP B 2 82  ? -17.390 100.944 13.101  1.00 44.60  ? 82  ASP B CA  1 
ATOM 1858  C C   . ASP B 2 82  ? -18.489 101.444 12.196  1.00 43.19  ? 82  ASP B C   1 
ATOM 1859  O O   . ASP B 2 82  ? -19.275 100.678 11.637  1.00 44.40  ? 82  ASP B O   1 
ATOM 1860  C CB  . ASP B 2 82  ? -17.933 100.016 14.165  1.00 46.76  ? 82  ASP B CB  1 
ATOM 1861  C CG  . ASP B 2 82  ? -16.853 99.581  15.119  1.00 46.36  ? 82  ASP B CG  1 
ATOM 1862  O OD1 . ASP B 2 82  ? -15.667 99.725  14.753  1.00 47.75  ? 82  ASP B OD1 1 
ATOM 1863  O OD2 . ASP B 2 82  ? -17.174 99.099  16.220  1.00 45.14  ? 82  ASP B OD2 1 
ATOM 1864  N N   . LEU B 2 83  ? -18.544 102.752 12.058  1.00 39.75  ? 83  LEU B N   1 
ATOM 1865  C CA  . LEU B 2 83  ? -19.501 103.354 11.168  1.00 37.47  ? 83  LEU B CA  1 
ATOM 1866  C C   . LEU B 2 83  ? -19.000 102.950 9.785   1.00 37.08  ? 83  LEU B C   1 
ATOM 1867  O O   . LEU B 2 83  ? -17.875 103.298 9.405   1.00 35.80  ? 83  LEU B O   1 
ATOM 1868  C CB  . LEU B 2 83  ? -19.438 104.861 11.351  1.00 40.48  ? 83  LEU B CB  1 
ATOM 1869  C CG  . LEU B 2 83  ? -20.112 105.804 10.371  1.00 39.83  ? 83  LEU B CG  1 
ATOM 1870  C CD1 . LEU B 2 83  ? -21.476 105.283 9.915   1.00 49.38  ? 83  LEU B CD1 1 
ATOM 1871  C CD2 . LEU B 2 83  ? -20.230 107.136 11.084  1.00 45.69  ? 83  LEU B CD2 1 
ATOM 1872  N N   . ALA B 2 84  ? -19.806 102.201 9.038   1.00 36.86  ? 84  ALA B N   1 
ATOM 1873  C CA  . ALA B 2 84  ? -19.378 101.773 7.713   1.00 32.07  ? 84  ALA B CA  1 
ATOM 1874  C C   . ALA B 2 84  ? -20.476 101.092 6.941   1.00 33.84  ? 84  ALA B C   1 
ATOM 1875  O O   . ALA B 2 84  ? -21.614 100.997 7.398   1.00 33.34  ? 84  ALA B O   1 
ATOM 1876  C CB  . ALA B 2 84  ? -18.212 100.826 7.835   1.00 29.05  ? 84  ALA B CB  1 
ATOM 1877  N N   . ASP B 2 85  ? -20.132 100.642 5.741   1.00 37.54  ? 85  ASP B N   1 
ATOM 1878  C CA  . ASP B 2 85  ? -21.076 99.898  4.930   1.00 40.03  ? 85  ASP B CA  1 
ATOM 1879  C C   . ASP B 2 85  ? -20.520 98.477  4.964   1.00 42.09  ? 85  ASP B C   1 
ATOM 1880  O O   . ASP B 2 85  ? -19.376 98.230  4.553   1.00 41.96  ? 85  ASP B O   1 
ATOM 1881  C CB  . ASP B 2 85  ? -21.134 100.405 3.494   1.00 42.57  ? 85  ASP B CB  1 
ATOM 1882  C CG  . ASP B 2 85  ? -22.199 99.682  2.683   1.00 49.45  ? 85  ASP B CG  1 
ATOM 1883  O OD1 . ASP B 2 85  ? -22.978 98.934  3.314   1.00 51.85  ? 85  ASP B OD1 1 
ATOM 1884  O OD2 . ASP B 2 85  ? -22.273 99.848  1.440   1.00 53.37  ? 85  ASP B OD2 1 
ATOM 1885  N N   . TYR B 2 86  ? -21.326 97.555  5.482   1.00 42.07  ? 86  TYR B N   1 
ATOM 1886  C CA  . TYR B 2 86  ? -20.913 96.169  5.623   1.00 41.67  ? 86  TYR B CA  1 
ATOM 1887  C C   . TYR B 2 86  ? -21.411 95.264  4.497   1.00 44.41  ? 86  TYR B C   1 
ATOM 1888  O O   . TYR B 2 86  ? -22.597 95.268  4.147   1.00 44.22  ? 86  TYR B O   1 
ATOM 1889  C CB  . TYR B 2 86  ? -21.350 95.686  6.998   1.00 38.61  ? 86  TYR B CB  1 
ATOM 1890  C CG  . TYR B 2 86  ? -20.574 96.380  8.104   1.00 38.75  ? 86  TYR B CG  1 
ATOM 1891  C CD1 . TYR B 2 86  ? -20.969 97.626  8.619   1.00 35.84  ? 86  TYR B CD1 1 
ATOM 1892  C CD2 . TYR B 2 86  ? -19.402 95.807  8.606   1.00 38.70  ? 86  TYR B CD2 1 
ATOM 1893  C CE1 . TYR B 2 86  ? -20.201 98.283  9.614   1.00 30.40  ? 86  TYR B CE1 1 
ATOM 1894  C CE2 . TYR B 2 86  ? -18.634 96.441  9.585   1.00 36.91  ? 86  TYR B CE2 1 
ATOM 1895  C CZ  . TYR B 2 86  ? -19.030 97.672  10.086  1.00 36.74  ? 86  TYR B CZ  1 
ATOM 1896  O OH  . TYR B 2 86  ? -18.217 98.256  11.042  1.00 31.18  ? 86  TYR B OH  1 
ATOM 1897  N N   . HIS B 2 87  ? -20.486 94.480  3.942   1.00 46.52  ? 87  HIS B N   1 
ATOM 1898  C CA  . HIS B 2 87  ? -20.776 93.618  2.798   1.00 45.66  ? 87  HIS B CA  1 
ATOM 1899  C C   . HIS B 2 87  ? -20.656 92.107  2.926   1.00 46.68  ? 87  HIS B C   1 
ATOM 1900  O O   . HIS B 2 87  ? -19.937 91.568  3.775   1.00 46.71  ? 87  HIS B O   1 
ATOM 1901  C CB  . HIS B 2 87  ? -19.900 94.035  1.624   1.00 48.46  ? 87  HIS B CB  1 
ATOM 1902  C CG  . HIS B 2 87  ? -20.156 95.424  1.124   1.00 56.06  ? 87  HIS B CG  1 
ATOM 1903  N ND1 . HIS B 2 87  ? -21.319 95.780  0.474   1.00 60.53  ? 87  HIS B ND1 1 
ATOM 1904  C CD2 . HIS B 2 87  ? -19.381 96.538  1.150   1.00 56.15  ? 87  HIS B CD2 1 
ATOM 1905  C CE1 . HIS B 2 87  ? -21.248 97.052  0.119   1.00 60.91  ? 87  HIS B CE1 1 
ATOM 1906  N NE2 . HIS B 2 87  ? -20.083 97.534  0.516   1.00 57.65  ? 87  HIS B NE2 1 
ATOM 1907  N N   . CYS B 2 88  ? -21.341 91.444  1.997   1.00 48.09  ? 88  CYS B N   1 
ATOM 1908  C CA  . CYS B 2 88  ? -21.382 89.992  1.898   1.00 46.57  ? 88  CYS B CA  1 
ATOM 1909  C C   . CYS B 2 88  ? -20.960 89.399  0.568   1.00 43.68  ? 88  CYS B C   1 
ATOM 1910  O O   . CYS B 2 88  ? -21.323 89.901  -0.508  1.00 39.96  ? 88  CYS B O   1 
ATOM 1911  C CB  . CYS B 2 88  ? -22.772 89.498  2.196   1.00 41.05  ? 88  CYS B CB  1 
ATOM 1912  S SG  . CYS B 2 88  ? -22.726 88.702  3.743   1.00 62.98  ? 88  CYS B SG  1 
ATOM 1913  N N   . GLY B 2 89  ? -20.215 88.302  0.656   1.00 39.10  ? 89  GLY B N   1 
ATOM 1914  C CA  . GLY B 2 89  ? -19.764 87.638  -0.547  1.00 35.44  ? 89  GLY B CA  1 
ATOM 1915  C C   . GLY B 2 89  ? -19.653 86.140  -0.389  1.00 32.00  ? 89  GLY B C   1 
ATOM 1916  O O   . GLY B 2 89  ? -19.334 85.649  0.691   1.00 28.77  ? 89  GLY B O   1 
ATOM 1917  N N   . GLN B 2 90  ? -19.926 85.425  -1.478  1.00 32.64  ? 90  GLN B N   1 
ATOM 1918  C CA  . GLN B 2 90  ? -19.845 83.974  -1.510  1.00 33.25  ? 90  GLN B CA  1 
ATOM 1919  C C   . GLN B 2 90  ? -18.958 83.558  -2.665  1.00 38.85  ? 90  GLN B C   1 
ATOM 1920  O O   . GLN B 2 90  ? -18.869 84.250  -3.677  1.00 42.06  ? 90  GLN B O   1 
ATOM 1921  C CB  . GLN B 2 90  ? -21.228 83.350  -1.687  1.00 28.26  ? 90  GLN B CB  1 
ATOM 1922  C CG  . GLN B 2 90  ? -21.957 83.667  -3.000  1.00 29.22  ? 90  GLN B CG  1 
ATOM 1923  C CD  . GLN B 2 90  ? -21.478 82.837  -4.199  1.00 33.62  ? 90  GLN B CD  1 
ATOM 1924  O OE1 . GLN B 2 90  ? -21.100 81.667  -4.059  1.00 32.61  ? 90  GLN B OE1 1 
ATOM 1925  N NE2 . GLN B 2 90  ? -21.524 83.436  -5.387  1.00 29.17  ? 90  GLN B NE2 1 
ATOM 1926  N N   . SER B 2 91  ? -18.287 82.428  -2.506  1.00 42.02  ? 91  SER B N   1 
ATOM 1927  C CA  . SER B 2 91  ? -17.420 81.913  -3.548  1.00 41.08  ? 91  SER B CA  1 
ATOM 1928  C C   . SER B 2 91  ? -17.684 80.421  -3.605  1.00 40.61  ? 91  SER B C   1 
ATOM 1929  O O   . SER B 2 91  ? -16.785 79.595  -3.770  1.00 44.13  ? 91  SER B O   1 
ATOM 1930  C CB  . SER B 2 91  ? -15.956 82.200  -3.218  1.00 44.98  ? 91  SER B CB  1 
ATOM 1931  O OG  . SER B 2 91  ? -15.637 81.793  -1.902  1.00 46.61  ? 91  SER B OG  1 
ATOM 1932  N N   . TYR B 2 92  ? -18.951 80.092  -3.448  1.00 39.27  ? 92  TYR B N   1 
ATOM 1933  C CA  . TYR B 2 92  ? -19.400 78.726  -3.503  1.00 42.11  ? 92  TYR B CA  1 
ATOM 1934  C C   . TYR B 2 92  ? -19.449 78.407  -4.983  1.00 44.59  ? 92  TYR B C   1 
ATOM 1935  O O   . TYR B 2 92  ? -18.749 77.523  -5.472  1.00 46.24  ? 92  TYR B O   1 
ATOM 1936  C CB  . TYR B 2 92  ? -20.793 78.629  -2.891  1.00 42.50  ? 92  TYR B CB  1 
ATOM 1937  C CG  . TYR B 2 92  ? -21.492 77.309  -3.120  1.00 47.95  ? 92  TYR B CG  1 
ATOM 1938  C CD1 . TYR B 2 92  ? -20.995 76.119  -2.583  1.00 47.00  ? 92  TYR B CD1 1 
ATOM 1939  C CD2 . TYR B 2 92  ? -22.672 77.256  -3.858  1.00 52.04  ? 92  TYR B CD2 1 
ATOM 1940  C CE1 . TYR B 2 92  ? -21.665 74.915  -2.777  1.00 50.51  ? 92  TYR B CE1 1 
ATOM 1941  C CE2 . TYR B 2 92  ? -23.350 76.063  -4.058  1.00 54.62  ? 92  TYR B CE2 1 
ATOM 1942  C CZ  . TYR B 2 92  ? -22.847 74.897  -3.518  1.00 53.34  ? 92  TYR B CZ  1 
ATOM 1943  O OH  . TYR B 2 92  ? -23.537 73.724  -3.719  1.00 55.11  ? 92  TYR B OH  1 
ATOM 1944  N N   . SER B 2 93  ? -20.282 79.134  -5.712  1.00 45.89  ? 93  SER B N   1 
ATOM 1945  C CA  . SER B 2 93  ? -20.402 78.927  -7.156  1.00 43.74  ? 93  SER B CA  1 
ATOM 1946  C C   . SER B 2 93  ? -19.761 80.117  -7.868  1.00 40.17  ? 93  SER B C   1 
ATOM 1947  O O   . SER B 2 93  ? -19.532 81.130  -7.256  1.00 42.88  ? 93  SER B O   1 
ATOM 1948  C CB  . SER B 2 93  ? -21.887 78.883  -7.546  1.00 43.00  ? 93  SER B CB  1 
ATOM 1949  O OG  . SER B 2 93  ? -22.459 80.201  -7.532  1.00 56.47  ? 93  SER B OG  1 
ATOM 1950  N N   . TYR B 2 94  ? -19.413 79.972  -9.140  1.00 39.66  ? 94  TYR B N   1 
ATOM 1951  C CA  . TYR B 2 94  ? -18.926 81.120  -9.905  1.00 40.82  ? 94  TYR B CA  1 
ATOM 1952  C C   . TYR B 2 94  ? -20.290 81.449  -10.549 1.00 44.99  ? 94  TYR B C   1 
ATOM 1953  O O   . TYR B 2 94  ? -21.055 80.536  -10.875 1.00 54.41  ? 94  TYR B O   1 
ATOM 1954  C CB  . TYR B 2 94  ? -17.965 80.701  -10.999 1.00 35.98  ? 94  TYR B CB  1 
ATOM 1955  C CG  . TYR B 2 94  ? -16.496 80.592  -10.675 1.00 41.46  ? 94  TYR B CG  1 
ATOM 1956  C CD1 . TYR B 2 94  ? -15.774 81.644  -10.124 1.00 41.86  ? 94  TYR B CD1 1 
ATOM 1957  C CD2 . TYR B 2 94  ? -15.797 79.457  -11.044 1.00 49.06  ? 94  TYR B CD2 1 
ATOM 1958  C CE1 . TYR B 2 94  ? -14.355 81.570  -9.954  1.00 42.52  ? 94  TYR B CE1 1 
ATOM 1959  C CE2 . TYR B 2 94  ? -14.395 79.354  -10.891 1.00 46.61  ? 94  TYR B CE2 1 
ATOM 1960  C CZ  . TYR B 2 94  ? -13.688 80.400  -10.358 1.00 45.02  ? 94  TYR B CZ  1 
ATOM 1961  O OH  . TYR B 2 94  ? -12.334 80.260  -10.296 1.00 51.14  ? 94  TYR B OH  1 
ATOM 1962  N N   . PRO B 2 95  ? -20.630 82.720  -10.721 1.00 42.15  ? 95  PRO B N   1 
ATOM 1963  C CA  . PRO B 2 95  ? -19.868 83.902  -10.407 1.00 36.25  ? 95  PRO B CA  1 
ATOM 1964  C C   . PRO B 2 95  ? -20.022 84.182  -8.944  1.00 33.13  ? 95  PRO B C   1 
ATOM 1965  O O   . PRO B 2 95  ? -21.076 83.943  -8.323  1.00 38.26  ? 95  PRO B O   1 
ATOM 1966  C CB  . PRO B 2 95  ? -20.536 84.966  -11.241 1.00 34.87  ? 95  PRO B CB  1 
ATOM 1967  C CG  . PRO B 2 95  ? -21.963 84.342  -11.620 1.00 34.40  ? 95  PRO B CG  1 
ATOM 1968  C CD  . PRO B 2 95  ? -22.052 83.078  -10.845 1.00 42.55  ? 95  PRO B CD  1 
ATOM 1969  N N   . TYR B 2 96  ? -18.938 84.681  -8.410  1.00 28.47  ? 96  TYR B N   1 
ATOM 1970  C CA  . TYR B 2 96  ? -18.918 85.098  -7.042  1.00 25.31  ? 96  TYR B CA  1 
ATOM 1971  C C   . TYR B 2 96  ? -19.894 86.267  -7.031  1.00 25.03  ? 96  TYR B C   1 
ATOM 1972  O O   . TYR B 2 96  ? -19.904 87.098  -7.944  1.00 29.65  ? 96  TYR B O   1 
ATOM 1973  C CB  . TYR B 2 96  ? -17.550 85.627  -6.669  1.00 19.40  ? 96  TYR B CB  1 
ATOM 1974  C CG  . TYR B 2 96  ? -16.410 84.643  -6.777  1.00 19.09  ? 96  TYR B CG  1 
ATOM 1975  C CD1 . TYR B 2 96  ? -16.602 83.280  -6.581  1.00 15.34  ? 96  TYR B CD1 1 
ATOM 1976  C CD2 . TYR B 2 96  ? -15.101 85.106  -6.978  1.00 11.54  ? 96  TYR B CD2 1 
ATOM 1977  C CE1 . TYR B 2 96  ? -15.516 82.396  -6.574  1.00 17.90  ? 96  TYR B CE1 1 
ATOM 1978  C CE2 . TYR B 2 96  ? -14.021 84.240  -6.973  1.00 7.28   ? 96  TYR B CE2 1 
ATOM 1979  C CZ  . TYR B 2 96  ? -14.227 82.894  -6.770  1.00 14.06  ? 96  TYR B CZ  1 
ATOM 1980  O OH  . TYR B 2 96  ? -13.138 82.067  -6.773  1.00 17.35  ? 96  TYR B OH  1 
ATOM 1981  N N   . THR B 2 97  ? -20.709 86.354  -6.000  1.00 23.13  ? 97  THR B N   1 
ATOM 1982  C CA  . THR B 2 97  ? -21.652 87.445  -5.925  1.00 26.00  ? 97  THR B CA  1 
ATOM 1983  C C   . THR B 2 97  ? -21.574 88.112  -4.552  1.00 30.32  ? 97  THR B C   1 
ATOM 1984  O O   . THR B 2 97  ? -20.944 87.571  -3.634  1.00 27.26  ? 97  THR B O   1 
ATOM 1985  C CB  . THR B 2 97  ? -23.087 86.939  -6.219  1.00 26.24  ? 97  THR B CB  1 
ATOM 1986  O OG1 . THR B 2 97  ? -23.503 86.012  -5.209  1.00 28.97  ? 97  THR B OG1 1 
ATOM 1987  C CG2 . THR B 2 97  ? -23.125 86.248  -7.574  1.00 22.62  ? 97  THR B CG2 1 
ATOM 1988  N N   . PHE B 2 98  ? -22.190 89.294  -4.420  1.00 33.73  ? 98  PHE B N   1 
ATOM 1989  C CA  . PHE B 2 98  ? -22.177 90.017  -3.146  1.00 31.74  ? 98  PHE B CA  1 
ATOM 1990  C C   . PHE B 2 98  ? -23.550 90.440  -2.622  1.00 34.67  ? 98  PHE B C   1 
ATOM 1991  O O   . PHE B 2 98  ? -24.532 90.511  -3.364  1.00 29.91  ? 98  PHE B O   1 
ATOM 1992  C CB  . PHE B 2 98  ? -21.337 91.282  -3.249  1.00 24.90  ? 98  PHE B CB  1 
ATOM 1993  C CG  . PHE B 2 98  ? -19.939 91.057  -3.707  1.00 26.38  ? 98  PHE B CG  1 
ATOM 1994  C CD1 . PHE B 2 98  ? -19.627 91.092  -5.055  1.00 25.82  ? 98  PHE B CD1 1 
ATOM 1995  C CD2 . PHE B 2 98  ? -18.916 90.851  -2.787  1.00 28.77  ? 98  PHE B CD2 1 
ATOM 1996  C CE1 . PHE B 2 98  ? -18.309 90.928  -5.483  1.00 23.25  ? 98  PHE B CE1 1 
ATOM 1997  C CE2 . PHE B 2 98  ? -17.599 90.684  -3.204  1.00 22.37  ? 98  PHE B CE2 1 
ATOM 1998  C CZ  . PHE B 2 98  ? -17.296 90.725  -4.554  1.00 14.26  ? 98  PHE B CZ  1 
ATOM 1999  N N   . GLY B 2 99  ? -23.607 90.714  -1.322  1.00 41.32  ? 99  GLY B N   1 
ATOM 2000  C CA  . GLY B 2 99  ? -24.841 91.198  -0.732  1.00 44.42  ? 99  GLY B CA  1 
ATOM 2001  C C   . GLY B 2 99  ? -24.952 92.668  -1.145  1.00 44.92  ? 99  GLY B C   1 
ATOM 2002  O O   . GLY B 2 99  ? -23.957 93.321  -1.502  1.00 42.59  ? 99  GLY B O   1 
ATOM 2003  N N   . GLY B 2 100 ? -26.155 93.215  -1.112  1.00 46.38  ? 100 GLY B N   1 
ATOM 2004  C CA  . GLY B 2 100 ? -26.298 94.604  -1.504  1.00 49.12  ? 100 GLY B CA  1 
ATOM 2005  C C   . GLY B 2 100 ? -25.622 95.580  -0.555  1.00 49.59  ? 100 GLY B C   1 
ATOM 2006  O O   . GLY B 2 100 ? -25.425 96.745  -0.890  1.00 52.29  ? 100 GLY B O   1 
ATOM 2007  N N   . GLY B 2 101 ? -25.251 95.102  0.627   1.00 49.79  ? 101 GLY B N   1 
ATOM 2008  C CA  . GLY B 2 101 ? -24.626 95.966  1.609   1.00 47.76  ? 101 GLY B CA  1 
ATOM 2009  C C   . GLY B 2 101 ? -25.686 96.486  2.567   1.00 49.33  ? 101 GLY B C   1 
ATOM 2010  O O   . GLY B 2 101 ? -26.859 96.618  2.199   1.00 51.73  ? 101 GLY B O   1 
ATOM 2011  N N   . THR B 2 102 ? -25.283 96.762  3.803   1.00 46.46  ? 102 THR B N   1 
ATOM 2012  C CA  . THR B 2 102 ? -26.195 97.277  4.815   1.00 42.88  ? 102 THR B CA  1 
ATOM 2013  C C   . THR B 2 102 ? -25.408 98.318  5.628   1.00 42.95  ? 102 THR B C   1 
ATOM 2014  O O   . THR B 2 102 ? -24.478 97.990  6.365   1.00 38.15  ? 102 THR B O   1 
ATOM 2015  C CB  . THR B 2 102 ? -26.742 96.111  5.690   1.00 42.34  ? 102 THR B CB  1 
ATOM 2016  O OG1 . THR B 2 102 ? -27.537 96.629  6.760   1.00 40.16  ? 102 THR B OG1 1 
ATOM 2017  C CG2 . THR B 2 102 ? -25.610 95.276  6.252   1.00 49.89  ? 102 THR B CG2 1 
ATOM 2018  N N   . LYS B 2 103 ? -25.785 99.585  5.459   1.00 45.78  ? 103 LYS B N   1 
ATOM 2019  C CA  . LYS B 2 103 ? -25.103 100.696 6.104   1.00 46.98  ? 103 LYS B CA  1 
ATOM 2020  C C   . LYS B 2 103 ? -25.341 100.847 7.596   1.00 45.79  ? 103 LYS B C   1 
ATOM 2021  O O   . LYS B 2 103 ? -26.473 100.966 8.044   1.00 47.00  ? 103 LYS B O   1 
ATOM 2022  C CB  . LYS B 2 103 ? -25.479 102.007 5.406   1.00 51.60  ? 103 LYS B CB  1 
ATOM 2023  C CG  . LYS B 2 103 ? -24.458 103.132 5.641   1.00 67.68  ? 103 LYS B CG  1 
ATOM 2024  C CD  . LYS B 2 103 ? -25.095 104.524 5.773   1.00 77.25  ? 103 LYS B CD  1 
ATOM 2025  C CE  . LYS B 2 103 ? -25.765 105.007 4.478   1.00 83.13  ? 103 LYS B CE  1 
ATOM 2026  N NZ  . LYS B 2 103 ? -26.503 106.307 4.658   1.00 84.71  ? 103 LYS B NZ  1 
ATOM 2027  N N   . LEU B 2 104 ? -24.260 100.863 8.363   1.00 45.72  ? 104 LEU B N   1 
ATOM 2028  C CA  . LEU B 2 104 ? -24.345 101.028 9.812   1.00 46.00  ? 104 LEU B CA  1 
ATOM 2029  C C   . LEU B 2 104 ? -24.207 102.515 10.148  1.00 49.31  ? 104 LEU B C   1 
ATOM 2030  O O   . LEU B 2 104 ? -23.195 103.134 9.804   1.00 48.99  ? 104 LEU B O   1 
ATOM 2031  C CB  . LEU B 2 104 ? -23.224 100.250 10.491  1.00 40.94  ? 104 LEU B CB  1 
ATOM 2032  C CG  . LEU B 2 104 ? -23.302 100.254 12.010  1.00 40.07  ? 104 LEU B CG  1 
ATOM 2033  C CD1 . LEU B 2 104 ? -24.577 99.540  12.424  1.00 43.01  ? 104 LEU B CD1 1 
ATOM 2034  C CD2 . LEU B 2 104 ? -22.079 99.576  12.611  1.00 38.83  ? 104 LEU B CD2 1 
ATOM 2035  N N   . GLU B 2 105 ? -25.216 103.078 10.820  1.00 52.59  ? 105 GLU B N   1 
ATOM 2036  C CA  . GLU B 2 105 ? -25.229 104.500 11.195  1.00 52.64  ? 105 GLU B CA  1 
ATOM 2037  C C   . GLU B 2 105 ? -25.372 104.710 12.695  1.00 51.42  ? 105 GLU B C   1 
ATOM 2038  O O   . GLU B 2 105 ? -26.308 104.203 13.306  1.00 51.80  ? 105 GLU B O   1 
ATOM 2039  C CB  . GLU B 2 105 ? -26.382 105.216 10.498  1.00 51.88  ? 105 GLU B CB  1 
ATOM 2040  C CG  . GLU B 2 105 ? -26.468 104.892 9.031   1.00 62.90  ? 105 GLU B CG  1 
ATOM 2041  C CD  . GLU B 2 105 ? -27.491 105.732 8.304   1.00 68.34  ? 105 GLU B CD  1 
ATOM 2042  O OE1 . GLU B 2 105 ? -27.314 106.968 8.252   1.00 72.72  ? 105 GLU B OE1 1 
ATOM 2043  O OE2 . GLU B 2 105 ? -28.469 105.157 7.782   1.00 72.35  ? 105 GLU B OE2 1 
ATOM 2044  N N   . ILE B 2 106 ? -24.454 105.476 13.281  1.00 49.38  ? 106 ILE B N   1 
ATOM 2045  C CA  . ILE B 2 106 ? -24.487 105.760 14.718  1.00 49.36  ? 106 ILE B CA  1 
ATOM 2046  C C   . ILE B 2 106 ? -25.434 106.900 15.155  1.00 50.51  ? 106 ILE B C   1 
ATOM 2047  O O   . ILE B 2 106 ? -25.532 107.941 14.501  1.00 47.65  ? 106 ILE B O   1 
ATOM 2048  C CB  . ILE B 2 106 ? -23.088 106.103 15.231  1.00 47.19  ? 106 ILE B CB  1 
ATOM 2049  C CG1 . ILE B 2 106 ? -22.139 104.968 14.888  1.00 46.83  ? 106 ILE B CG1 1 
ATOM 2050  C CG2 . ILE B 2 106 ? -23.116 106.335 16.739  1.00 42.11  ? 106 ILE B CG2 1 
ATOM 2051  C CD1 . ILE B 2 106 ? -20.701 105.308 15.164  1.00 51.76  ? 106 ILE B CD1 1 
ATOM 2052  N N   . LYS B 2 107 ? -26.126 106.681 16.272  1.00 50.20  ? 107 LYS B N   1 
ATOM 2053  C CA  . LYS B 2 107 ? -27.042 107.660 16.835  1.00 51.14  ? 107 LYS B CA  1 
ATOM 2054  C C   . LYS B 2 107 ? -26.366 108.292 18.061  1.00 52.06  ? 107 LYS B C   1 
ATOM 2055  O O   . LYS B 2 107 ? -25.703 107.601 18.852  1.00 52.15  ? 107 LYS B O   1 
ATOM 2056  C CB  . LYS B 2 107 ? -28.347 106.983 17.245  1.00 53.63  ? 107 LYS B CB  1 
ATOM 2057  C CG  . LYS B 2 107 ? -29.304 107.925 17.930  1.00 63.07  ? 107 LYS B CG  1 
ATOM 2058  C CD  . LYS B 2 107 ? -30.364 107.181 18.721  1.00 72.97  ? 107 LYS B CD  1 
ATOM 2059  C CE  . LYS B 2 107 ? -31.172 108.140 19.598  1.00 76.85  ? 107 LYS B CE  1 
ATOM 2060  N NZ  . LYS B 2 107 ? -32.184 107.405 20.421  1.00 81.92  ? 107 LYS B NZ  1 
ATOM 2061  N N   . ARG B 2 108 ? -26.526 109.608 18.213  1.00 50.20  ? 108 ARG B N   1 
ATOM 2062  C CA  . ARG B 2 108 ? -25.913 110.335 19.328  1.00 49.71  ? 108 ARG B CA  1 
ATOM 2063  C C   . ARG B 2 108 ? -26.769 111.503 19.840  1.00 50.13  ? 108 ARG B C   1 
ATOM 2064  O O   . ARG B 2 108 ? -27.906 111.716 19.387  1.00 47.32  ? 108 ARG B O   1 
ATOM 2065  C CB  . ARG B 2 108 ? -24.530 110.855 18.908  1.00 47.05  ? 108 ARG B CB  1 
ATOM 2066  C CG  . ARG B 2 108 ? -24.557 111.750 17.664  1.00 41.22  ? 108 ARG B CG  1 
ATOM 2067  C CD  . ARG B 2 108 ? -24.287 113.195 18.022  1.00 43.53  ? 108 ARG B CD  1 
ATOM 2068  N NE  . ARG B 2 108 ? -22.914 113.369 18.484  1.00 46.28  ? 108 ARG B NE  1 
ATOM 2069  C CZ  . ARG B 2 108 ? -22.533 114.216 19.436  1.00 48.73  ? 108 ARG B CZ  1 
ATOM 2070  N NH1 . ARG B 2 108 ? -23.433 114.975 20.049  1.00 48.41  ? 108 ARG B NH1 1 
ATOM 2071  N NH2 . ARG B 2 108 ? -21.245 114.316 19.768  1.00 49.33  ? 108 ARG B NH2 1 
ATOM 2072  N N   . ALA B 2 109 ? -26.214 112.247 20.800  1.00 49.80  ? 109 ALA B N   1 
ATOM 2073  C CA  . ALA B 2 109 ? -26.899 113.401 21.380  1.00 51.43  ? 109 ALA B CA  1 
ATOM 2074  C C   . ALA B 2 109 ? -26.953 114.515 20.340  1.00 51.12  ? 109 ALA B C   1 
ATOM 2075  O O   . ALA B 2 109 ? -25.975 114.735 19.632  1.00 51.36  ? 109 ALA B O   1 
ATOM 2076  C CB  . ALA B 2 109 ? -26.142 113.878 22.618  1.00 49.67  ? 109 ALA B CB  1 
ATOM 2077  N N   . ASP B 2 110 ? -28.078 115.217 20.230  1.00 52.07  ? 110 ASP B N   1 
ATOM 2078  C CA  . ASP B 2 110 ? -28.154 116.306 19.255  1.00 55.24  ? 110 ASP B CA  1 
ATOM 2079  C C   . ASP B 2 110 ? -27.074 117.369 19.509  1.00 54.08  ? 110 ASP B C   1 
ATOM 2080  O O   . ASP B 2 110 ? -26.541 117.493 20.616  1.00 53.21  ? 110 ASP B O   1 
ATOM 2081  C CB  . ASP B 2 110 ? -29.537 116.974 19.279  1.00 57.17  ? 110 ASP B CB  1 
ATOM 2082  C CG  . ASP B 2 110 ? -30.610 116.122 18.632  1.00 60.46  ? 110 ASP B CG  1 
ATOM 2083  O OD1 . ASP B 2 110 ? -31.743 116.622 18.451  1.00 61.61  ? 110 ASP B OD1 1 
ATOM 2084  O OD2 . ASP B 2 110 ? -30.322 114.949 18.307  1.00 62.78  ? 110 ASP B OD2 1 
ATOM 2085  N N   . ALA B 2 111 ? -26.740 118.117 18.465  1.00 53.37  ? 111 ALA B N   1 
ATOM 2086  C CA  . ALA B 2 111 ? -25.749 119.182 18.566  1.00 54.81  ? 111 ALA B CA  1 
ATOM 2087  C C   . ALA B 2 111 ? -26.092 120.199 17.494  1.00 57.67  ? 111 ALA B C   1 
ATOM 2088  O O   . ALA B 2 111 ? -26.617 119.847 16.429  1.00 59.54  ? 111 ALA B O   1 
ATOM 2089  C CB  . ALA B 2 111 ? -24.349 118.645 18.347  1.00 52.18  ? 111 ALA B CB  1 
ATOM 2090  N N   . ALA B 2 112 ? -25.825 121.466 17.785  1.00 58.75  ? 112 ALA B N   1 
ATOM 2091  C CA  . ALA B 2 112 ? -26.115 122.514 16.829  1.00 56.76  ? 112 ALA B CA  1 
ATOM 2092  C C   . ALA B 2 112 ? -24.851 122.802 16.026  1.00 57.37  ? 112 ALA B C   1 
ATOM 2093  O O   . ALA B 2 112 ? -23.715 122.691 16.530  1.00 56.19  ? 112 ALA B O   1 
ATOM 2094  C CB  . ALA B 2 112 ? -26.605 123.760 17.548  1.00 55.59  ? 112 ALA B CB  1 
ATOM 2095  N N   . PRO B 2 113 ? -25.030 123.161 14.751  1.00 56.47  ? 113 PRO B N   1 
ATOM 2096  C CA  . PRO B 2 113 ? -23.901 123.460 13.869  1.00 55.97  ? 113 PRO B CA  1 
ATOM 2097  C C   . PRO B 2 113 ? -22.971 124.518 14.422  1.00 55.24  ? 113 PRO B C   1 
ATOM 2098  O O   . PRO B 2 113 ? -23.235 125.129 15.456  1.00 58.11  ? 113 PRO B O   1 
ATOM 2099  C CB  . PRO B 2 113 ? -24.580 123.915 12.573  1.00 54.95  ? 113 PRO B CB  1 
ATOM 2100  C CG  . PRO B 2 113 ? -25.894 124.459 13.048  1.00 55.51  ? 113 PRO B CG  1 
ATOM 2101  C CD  . PRO B 2 113 ? -26.311 123.442 14.083  1.00 54.83  ? 113 PRO B CD  1 
ATOM 2102  N N   . THR B 2 114 ? -21.868 124.720 13.719  1.00 51.40  ? 114 THR B N   1 
ATOM 2103  C CA  . THR B 2 114 ? -20.899 125.725 14.091  1.00 45.62  ? 114 THR B CA  1 
ATOM 2104  C C   . THR B 2 114 ? -20.652 126.407 12.767  1.00 46.71  ? 114 THR B C   1 
ATOM 2105  O O   . THR B 2 114 ? -19.853 125.948 11.947  1.00 47.33  ? 114 THR B O   1 
ATOM 2106  C CB  . THR B 2 114 ? -19.640 125.081 14.635  1.00 41.31  ? 114 THR B CB  1 
ATOM 2107  O OG1 . THR B 2 114 ? -19.984 124.314 15.796  1.00 49.42  ? 114 THR B OG1 1 
ATOM 2108  C CG2 . THR B 2 114 ? -18.615 126.132 14.999  1.00 32.31  ? 114 THR B CG2 1 
ATOM 2109  N N   . VAL B 2 115 ? -21.389 127.496 12.560  1.00 46.62  ? 115 VAL B N   1 
ATOM 2110  C CA  . VAL B 2 115 ? -21.338 128.268 11.328  1.00 44.04  ? 115 VAL B CA  1 
ATOM 2111  C C   . VAL B 2 115 ? -20.164 129.203 11.171  1.00 42.24  ? 115 VAL B C   1 
ATOM 2112  O O   . VAL B 2 115 ? -19.638 129.744 12.141  1.00 41.88  ? 115 VAL B O   1 
ATOM 2113  C CB  . VAL B 2 115 ? -22.601 129.091 11.152  1.00 42.92  ? 115 VAL B CB  1 
ATOM 2114  C CG1 . VAL B 2 115 ? -22.732 129.516 9.696   1.00 45.71  ? 115 VAL B CG1 1 
ATOM 2115  C CG2 . VAL B 2 115 ? -23.805 128.281 11.610  1.00 39.42  ? 115 VAL B CG2 1 
ATOM 2116  N N   . SER B 2 116 ? -19.775 129.396 9.920   1.00 41.11  ? 116 SER B N   1 
ATOM 2117  C CA  . SER B 2 116 ? -18.659 130.254 9.592   1.00 42.00  ? 116 SER B CA  1 
ATOM 2118  C C   . SER B 2 116 ? -18.874 130.678 8.162   1.00 41.13  ? 116 SER B C   1 
ATOM 2119  O O   . SER B 2 116 ? -19.024 129.843 7.266   1.00 41.86  ? 116 SER B O   1 
ATOM 2120  C CB  . SER B 2 116 ? -17.355 129.477 9.719   1.00 41.17  ? 116 SER B CB  1 
ATOM 2121  O OG  . SER B 2 116 ? -17.294 128.813 10.970  1.00 49.49  ? 116 SER B OG  1 
ATOM 2122  N N   . ILE B 2 117 ? -18.913 131.982 7.942   1.00 40.13  ? 117 ILE B N   1 
ATOM 2123  C CA  . ILE B 2 117 ? -19.124 132.475 6.597   1.00 38.75  ? 117 ILE B CA  1 
ATOM 2124  C C   . ILE B 2 117 ? -17.815 133.054 6.109   1.00 36.29  ? 117 ILE B C   1 
ATOM 2125  O O   . ILE B 2 117 ? -17.030 133.564 6.904   1.00 32.51  ? 117 ILE B O   1 
ATOM 2126  C CB  . ILE B 2 117 ? -20.285 133.516 6.559   1.00 39.54  ? 117 ILE B CB  1 
ATOM 2127  C CG1 . ILE B 2 117 ? -20.505 134.011 5.128   1.00 37.20  ? 117 ILE B CG1 1 
ATOM 2128  C CG2 . ILE B 2 117 ? -20.007 134.648 7.526   1.00 37.63  ? 117 ILE B CG2 1 
ATOM 2129  C CD1 . ILE B 2 117 ? -21.869 134.633 4.932   1.00 33.15  ? 117 ILE B CD1 1 
ATOM 2130  N N   . PHE B 2 118 ? -17.571 132.913 4.808   1.00 38.32  ? 118 PHE B N   1 
ATOM 2131  C CA  . PHE B 2 118 ? -16.351 133.397 4.192   1.00 40.34  ? 118 PHE B CA  1 
ATOM 2132  C C   . PHE B 2 118 ? -16.626 134.178 2.919   1.00 44.16  ? 118 PHE B C   1 
ATOM 2133  O O   . PHE B 2 118 ? -17.302 133.701 2.001   1.00 46.41  ? 118 PHE B O   1 
ATOM 2134  C CB  . PHE B 2 118 ? -15.411 132.240 3.856   1.00 41.04  ? 118 PHE B CB  1 
ATOM 2135  C CG  . PHE B 2 118 ? -14.880 131.519 5.055   1.00 45.26  ? 118 PHE B CG  1 
ATOM 2136  C CD1 . PHE B 2 118 ? -15.685 130.635 5.767   1.00 43.76  ? 118 PHE B CD1 1 
ATOM 2137  C CD2 . PHE B 2 118 ? -13.573 131.749 5.497   1.00 43.68  ? 118 PHE B CD2 1 
ATOM 2138  C CE1 . PHE B 2 118 ? -15.189 129.986 6.922   1.00 48.01  ? 118 PHE B CE1 1 
ATOM 2139  C CE2 . PHE B 2 118 ? -13.067 131.102 6.651   1.00 44.64  ? 118 PHE B CE2 1 
ATOM 2140  C CZ  . PHE B 2 118 ? -13.875 130.223 7.365   1.00 42.68  ? 118 PHE B CZ  1 
ATOM 2141  N N   . PRO B 2 119 ? -16.105 135.410 2.858   1.00 46.27  ? 119 PRO B N   1 
ATOM 2142  C CA  . PRO B 2 119 ? -16.255 136.306 1.712   1.00 42.35  ? 119 PRO B CA  1 
ATOM 2143  C C   . PRO B 2 119 ? -15.234 135.925 0.646   1.00 42.02  ? 119 PRO B C   1 
ATOM 2144  O O   . PRO B 2 119 ? -14.104 135.550 0.967   1.00 45.09  ? 119 PRO B O   1 
ATOM 2145  C CB  . PRO B 2 119 ? -15.969 137.664 2.321   1.00 42.67  ? 119 PRO B CB  1 
ATOM 2146  C CG  . PRO B 2 119 ? -14.927 137.339 3.365   1.00 40.18  ? 119 PRO B CG  1 
ATOM 2147  C CD  . PRO B 2 119 ? -15.503 136.118 4.007   1.00 44.60  ? 119 PRO B CD  1 
ATOM 2148  N N   . PRO B 2 120 ? -15.614 136.027 -0.634  1.00 40.51  ? 120 PRO B N   1 
ATOM 2149  C CA  . PRO B 2 120 ? -14.729 135.688 -1.754  1.00 42.73  ? 120 PRO B CA  1 
ATOM 2150  C C   . PRO B 2 120 ? -13.289 136.097 -1.477  1.00 44.85  ? 120 PRO B C   1 
ATOM 2151  O O   . PRO B 2 120 ? -13.044 137.188 -0.983  1.00 43.57  ? 120 PRO B O   1 
ATOM 2152  C CB  . PRO B 2 120 ? -15.326 136.478 -2.916  1.00 37.54  ? 120 PRO B CB  1 
ATOM 2153  C CG  . PRO B 2 120 ? -16.769 136.461 -2.610  1.00 36.37  ? 120 PRO B CG  1 
ATOM 2154  C CD  . PRO B 2 120 ? -16.825 136.710 -1.114  1.00 35.71  ? 120 PRO B CD  1 
ATOM 2155  N N   . SER B 2 121 ? -12.334 135.228 -1.781  1.00 46.68  ? 121 SER B N   1 
ATOM 2156  C CA  . SER B 2 121 ? -10.949 135.594 -1.547  1.00 49.21  ? 121 SER B CA  1 
ATOM 2157  C C   . SER B 2 121 ? -10.519 136.538 -2.652  1.00 49.33  ? 121 SER B C   1 
ATOM 2158  O O   . SER B 2 121 ? -10.995 136.456 -3.789  1.00 46.99  ? 121 SER B O   1 
ATOM 2159  C CB  . SER B 2 121 ? -10.043 134.368 -1.561  1.00 48.58  ? 121 SER B CB  1 
ATOM 2160  O OG  . SER B 2 121 ? -9.934  133.868 -2.876  1.00 46.46  ? 121 SER B OG  1 
ATOM 2161  N N   . SER B 2 122 ? -9.617  137.441 -2.297  1.00 55.08  ? 122 SER B N   1 
ATOM 2162  C CA  . SER B 2 122 ? -9.087  138.414 -3.237  1.00 56.97  ? 122 SER B CA  1 
ATOM 2163  C C   . SER B 2 122 ? -8.773  137.739 -4.564  1.00 56.39  ? 122 SER B C   1 
ATOM 2164  O O   . SER B 2 122 ? -9.249  138.165 -5.620  1.00 55.58  ? 122 SER B O   1 
ATOM 2165  C CB  . SER B 2 122 ? -7.824  139.045 -2.652  1.00 58.62  ? 122 SER B CB  1 
ATOM 2166  O OG  . SER B 2 122 ? -7.195  138.144 -1.750  1.00 61.23  ? 122 SER B OG  1 
ATOM 2167  N N   . GLU B 2 123 ? -7.979  136.674 -4.495  1.00 55.03  ? 123 GLU B N   1 
ATOM 2168  C CA  . GLU B 2 123 ? -7.596  135.935 -5.685  1.00 52.56  ? 123 GLU B CA  1 
ATOM 2169  C C   . GLU B 2 123 ? -8.781  135.653 -6.586  1.00 50.45  ? 123 GLU B C   1 
ATOM 2170  O O   . GLU B 2 123 ? -8.813  136.082 -7.734  1.00 50.67  ? 123 GLU B O   1 
ATOM 2171  C CB  . GLU B 2 123 ? -6.951  134.593 -5.323  1.00 56.02  ? 123 GLU B CB  1 
ATOM 2172  C CG  . GLU B 2 123 ? -5.549  134.655 -4.737  1.00 62.10  ? 123 GLU B CG  1 
ATOM 2173  C CD  . GLU B 2 123 ? -5.556  134.718 -3.224  1.00 67.33  ? 123 GLU B CD  1 
ATOM 2174  O OE1 . GLU B 2 123 ? -4.501  134.413 -2.617  1.00 68.31  ? 123 GLU B OE1 1 
ATOM 2175  O OE2 . GLU B 2 123 ? -6.617  135.075 -2.648  1.00 71.11  ? 123 GLU B OE2 1 
ATOM 2176  N N   . GLN B 2 124 ? -9.760  134.928 -6.064  1.00 47.45  ? 124 GLN B N   1 
ATOM 2177  C CA  . GLN B 2 124 ? -10.914 134.573 -6.869  1.00 44.09  ? 124 GLN B CA  1 
ATOM 2178  C C   . GLN B 2 124 ? -11.475 135.766 -7.624  1.00 44.93  ? 124 GLN B C   1 
ATOM 2179  O O   . GLN B 2 124 ? -11.941 135.633 -8.762  1.00 42.59  ? 124 GLN B O   1 
ATOM 2180  C CB  . GLN B 2 124 ? -12.013 133.963 -6.004  1.00 43.60  ? 124 GLN B CB  1 
ATOM 2181  C CG  . GLN B 2 124 ? -13.245 133.607 -6.818  1.00 44.71  ? 124 GLN B CG  1 
ATOM 2182  C CD  . GLN B 2 124 ? -14.428 133.210 -5.965  1.00 44.85  ? 124 GLN B CD  1 
ATOM 2183  O OE1 . GLN B 2 124 ? -14.499 133.538 -4.769  1.00 46.11  ? 124 GLN B OE1 1 
ATOM 2184  N NE2 . GLN B 2 124 ? -15.379 132.516 -6.578  1.00 37.52  ? 124 GLN B NE2 1 
ATOM 2185  N N   . LEU B 2 125 ? -11.424 136.931 -6.982  1.00 45.97  ? 125 LEU B N   1 
ATOM 2186  C CA  . LEU B 2 125 ? -11.946 138.168 -7.560  1.00 48.55  ? 125 LEU B CA  1 
ATOM 2187  C C   . LEU B 2 125 ? -11.154 138.651 -8.771  1.00 49.25  ? 125 LEU B C   1 
ATOM 2188  O O   . LEU B 2 125 ? -11.706 139.150 -9.753  1.00 48.79  ? 125 LEU B O   1 
ATOM 2189  C CB  . LEU B 2 125 ? -11.960 139.240 -6.481  1.00 48.10  ? 125 LEU B CB  1 
ATOM 2190  C CG  . LEU B 2 125 ? -12.831 138.818 -5.298  1.00 47.52  ? 125 LEU B CG  1 
ATOM 2191  C CD1 . LEU B 2 125 ? -12.485 139.616 -4.051  1.00 52.39  ? 125 LEU B CD1 1 
ATOM 2192  C CD2 . LEU B 2 125 ? -14.283 138.998 -5.683  1.00 47.42  ? 125 LEU B CD2 1 
ATOM 2193  N N   . THR B 2 126 ? -9.848  138.488 -8.686  1.00 52.83  ? 126 THR B N   1 
ATOM 2194  C CA  . THR B 2 126 ? -8.962  138.896 -9.753  1.00 57.64  ? 126 THR B CA  1 
ATOM 2195  C C   . THR B 2 126 ? -9.272  138.148 -11.049 1.00 57.16  ? 126 THR B C   1 
ATOM 2196  O O   . THR B 2 126 ? -8.641  138.390 -12.074 1.00 59.37  ? 126 THR B O   1 
ATOM 2197  C CB  . THR B 2 126 ? -7.503  138.628 -9.352  1.00 62.37  ? 126 THR B CB  1 
ATOM 2198  O OG1 . THR B 2 126 ? -7.201  137.237 -9.524  1.00 65.13  ? 126 THR B OG1 1 
ATOM 2199  C CG2 . THR B 2 126 ? -7.293  138.985 -7.879  1.00 66.35  ? 126 THR B CG2 1 
ATOM 2200  N N   . SER B 2 127 ? -10.233 137.234 -11.011 1.00 56.05  ? 127 SER B N   1 
ATOM 2201  C CA  . SER B 2 127 ? -10.578 136.475 -12.208 1.00 55.81  ? 127 SER B CA  1 
ATOM 2202  C C   . SER B 2 127 ? -12.035 136.701 -12.582 1.00 53.70  ? 127 SER B C   1 
ATOM 2203  O O   . SER B 2 127 ? -12.583 136.028 -13.460 1.00 53.56  ? 127 SER B O   1 
ATOM 2204  C CB  . SER B 2 127 ? -10.314 134.984 -11.981 1.00 58.38  ? 127 SER B CB  1 
ATOM 2205  O OG  . SER B 2 127 ? -10.939 134.526 -10.792 1.00 60.18  ? 127 SER B OG  1 
ATOM 2206  N N   . GLY B 2 128 ? -12.653 137.662 -11.907 1.00 51.40  ? 128 GLY B N   1 
ATOM 2207  C CA  . GLY B 2 128 ? -14.039 137.977 -12.177 1.00 47.42  ? 128 GLY B CA  1 
ATOM 2208  C C   . GLY B 2 128 ? -14.977 137.027 -11.469 1.00 48.05  ? 128 GLY B C   1 
ATOM 2209  O O   . GLY B 2 128 ? -16.186 137.056 -11.704 1.00 47.42  ? 128 GLY B O   1 
ATOM 2210  N N   . GLY B 2 129 ? -14.426 136.184 -10.600 1.00 47.71  ? 129 GLY B N   1 
ATOM 2211  C CA  . GLY B 2 129 ? -15.259 135.237 -9.881  1.00 45.42  ? 129 GLY B CA  1 
ATOM 2212  C C   . GLY B 2 129 ? -15.602 135.722 -8.490  1.00 44.81  ? 129 GLY B C   1 
ATOM 2213  O O   . GLY B 2 129 ? -14.876 136.546 -7.942  1.00 46.41  ? 129 GLY B O   1 
ATOM 2214  N N   . ALA B 2 130 ? -16.696 135.218 -7.916  1.00 43.85  ? 130 ALA B N   1 
ATOM 2215  C CA  . ALA B 2 130 ? -17.113 135.611 -6.569  1.00 44.65  ? 130 ALA B CA  1 
ATOM 2216  C C   . ALA B 2 130 ? -17.867 134.525 -5.784  1.00 44.79  ? 130 ALA B C   1 
ATOM 2217  O O   . ALA B 2 130 ? -19.070 134.320 -5.976  1.00 46.77  ? 130 ALA B O   1 
ATOM 2218  C CB  . ALA B 2 130 ? -17.965 136.863 -6.647  1.00 48.48  ? 130 ALA B CB  1 
ATOM 2219  N N   . SER B 2 131 ? -17.173 133.845 -4.878  1.00 40.87  ? 131 SER B N   1 
ATOM 2220  C CA  . SER B 2 131 ? -17.821 132.805 -4.096  1.00 36.67  ? 131 SER B CA  1 
ATOM 2221  C C   . SER B 2 131 ? -17.793 133.021 -2.591  1.00 35.78  ? 131 SER B C   1 
ATOM 2222  O O   . SER B 2 131 ? -16.734 133.227 -1.975  1.00 31.88  ? 131 SER B O   1 
ATOM 2223  C CB  . SER B 2 131 ? -17.205 131.443 -4.413  1.00 37.47  ? 131 SER B CB  1 
ATOM 2224  O OG  . SER B 2 131 ? -17.559 131.014 -5.709  1.00 36.09  ? 131 SER B OG  1 
ATOM 2225  N N   . VAL B 2 132 ? -18.976 132.959 -2.002  1.00 33.71  ? 132 VAL B N   1 
ATOM 2226  C CA  . VAL B 2 132 ? -19.114 133.118 -0.571  1.00 36.28  ? 132 VAL B CA  1 
ATOM 2227  C C   . VAL B 2 132 ? -19.494 131.749 -0.059  1.00 37.29  ? 132 VAL B C   1 
ATOM 2228  O O   . VAL B 2 132 ? -20.496 131.179 -0.481  1.00 35.65  ? 132 VAL B O   1 
ATOM 2229  C CB  . VAL B 2 132 ? -20.241 134.096 -0.210  1.00 38.70  ? 132 VAL B CB  1 
ATOM 2230  C CG1 . VAL B 2 132 ? -20.216 134.383 1.293   1.00 37.69  ? 132 VAL B CG1 1 
ATOM 2231  C CG2 . VAL B 2 132 ? -20.104 135.371 -1.026  1.00 35.65  ? 132 VAL B CG2 1 
ATOM 2232  N N   . VAL B 2 133 ? -18.697 131.217 0.852   1.00 39.60  ? 133 VAL B N   1 
ATOM 2233  C CA  . VAL B 2 133 ? -18.973 129.901 1.381   1.00 38.95  ? 133 VAL B CA  1 
ATOM 2234  C C   . VAL B 2 133 ? -19.392 130.012 2.820   1.00 42.89  ? 133 VAL B C   1 
ATOM 2235  O O   . VAL B 2 133 ? -19.222 131.051 3.449   1.00 46.27  ? 133 VAL B O   1 
ATOM 2236  C CB  . VAL B 2 133 ? -17.729 129.000 1.315   1.00 36.21  ? 133 VAL B CB  1 
ATOM 2237  C CG1 . VAL B 2 133 ? -17.106 129.089 -0.058  1.00 33.04  ? 133 VAL B CG1 1 
ATOM 2238  C CG2 . VAL B 2 133 ? -16.729 129.406 2.386   1.00 39.73  ? 133 VAL B CG2 1 
ATOM 2239  N N   . CYS B 2 134 ? -19.942 128.929 3.339   1.00 43.03  ? 134 CYS B N   1 
ATOM 2240  C CA  . CYS B 2 134 ? -20.348 128.906 4.721   1.00 46.26  ? 134 CYS B CA  1 
ATOM 2241  C C   . CYS B 2 134 ? -20.394 127.466 5.195   1.00 47.01  ? 134 CYS B C   1 
ATOM 2242  O O   . CYS B 2 134 ? -21.013 126.614 4.554   1.00 49.02  ? 134 CYS B O   1 
ATOM 2243  C CB  . CYS B 2 134 ? -21.710 129.557 4.889   1.00 44.87  ? 134 CYS B CB  1 
ATOM 2244  S SG  . CYS B 2 134 ? -22.166 129.674 6.632   1.00 56.82  ? 134 CYS B SG  1 
ATOM 2245  N N   . PHE B 2 135 ? -19.721 127.200 6.311   1.00 46.05  ? 135 PHE B N   1 
ATOM 2246  C CA  . PHE B 2 135 ? -19.678 125.863 6.875   1.00 46.46  ? 135 PHE B CA  1 
ATOM 2247  C C   . PHE B 2 135 ? -20.536 125.754 8.122   1.00 48.74  ? 135 PHE B C   1 
ATOM 2248  O O   . PHE B 2 135 ? -20.429 126.564 9.040   1.00 50.64  ? 135 PHE B O   1 
ATOM 2249  C CB  . PHE B 2 135 ? -18.259 125.464 7.284   1.00 46.75  ? 135 PHE B CB  1 
ATOM 2250  C CG  . PHE B 2 135 ? -17.219 125.633 6.208   1.00 49.96  ? 135 PHE B CG  1 
ATOM 2251  C CD1 . PHE B 2 135 ? -17.396 125.097 4.934   1.00 49.45  ? 135 PHE B CD1 1 
ATOM 2252  C CD2 . PHE B 2 135 ? -16.024 126.290 6.491   1.00 46.34  ? 135 PHE B CD2 1 
ATOM 2253  C CE1 . PHE B 2 135 ? -16.391 125.216 3.967   1.00 44.00  ? 135 PHE B CE1 1 
ATOM 2254  C CE2 . PHE B 2 135 ? -15.024 126.409 5.529   1.00 39.64  ? 135 PHE B CE2 1 
ATOM 2255  C CZ  . PHE B 2 135 ? -15.208 125.873 4.271   1.00 37.83  ? 135 PHE B CZ  1 
ATOM 2256  N N   . LEU B 2 136 ? -21.379 124.733 8.147   1.00 50.85  ? 136 LEU B N   1 
ATOM 2257  C CA  . LEU B 2 136 ? -22.227 124.445 9.294   1.00 50.15  ? 136 LEU B CA  1 
ATOM 2258  C C   . LEU B 2 136 ? -21.632 123.113 9.691   1.00 46.82  ? 136 LEU B C   1 
ATOM 2259  O O   . LEU B 2 136 ? -21.941 122.083 9.091   1.00 43.84  ? 136 LEU B O   1 
ATOM 2260  C CB  . LEU B 2 136 ? -23.678 124.269 8.864   1.00 51.53  ? 136 LEU B CB  1 
ATOM 2261  C CG  . LEU B 2 136 ? -24.196 125.398 7.975   1.00 50.79  ? 136 LEU B CG  1 
ATOM 2262  C CD1 . LEU B 2 136 ? -23.570 125.302 6.588   1.00 48.23  ? 136 LEU B CD1 1 
ATOM 2263  C CD2 . LEU B 2 136 ? -25.702 125.296 7.885   1.00 48.01  ? 136 LEU B CD2 1 
ATOM 2264  N N   . ASN B 2 137 ? -20.766 123.144 10.693  1.00 41.97  ? 137 ASN B N   1 
ATOM 2265  C CA  . ASN B 2 137 ? -20.078 121.941 11.089  1.00 41.33  ? 137 ASN B CA  1 
ATOM 2266  C C   . ASN B 2 137 ? -20.413 121.283 12.396  1.00 40.53  ? 137 ASN B C   1 
ATOM 2267  O O   . ASN B 2 137 ? -20.683 121.932 13.398  1.00 39.27  ? 137 ASN B O   1 
ATOM 2268  C CB  . ASN B 2 137 ? -18.583 122.198 11.055  1.00 39.61  ? 137 ASN B CB  1 
ATOM 2269  C CG  . ASN B 2 137 ? -18.107 122.585 9.688   1.00 42.19  ? 137 ASN B CG  1 
ATOM 2270  O OD1 . ASN B 2 137 ? -18.860 122.487 8.706   1.00 42.22  ? 137 ASN B OD1 1 
ATOM 2271  N ND2 . ASN B 2 137 ? -16.850 123.019 9.598   1.00 39.95  ? 137 ASN B ND2 1 
ATOM 2272  N N   . ASN B 2 138 ? -20.386 119.962 12.356  1.00 42.77  ? 138 ASN B N   1 
ATOM 2273  C CA  . ASN B 2 138 ? -20.615 119.151 13.526  1.00 47.85  ? 138 ASN B CA  1 
ATOM 2274  C C   . ASN B 2 138 ? -21.969 119.248 14.184  1.00 49.22  ? 138 ASN B C   1 
ATOM 2275  O O   . ASN B 2 138 ? -22.064 119.569 15.372  1.00 51.05  ? 138 ASN B O   1 
ATOM 2276  C CB  . ASN B 2 138 ? -19.533 119.465 14.537  1.00 50.78  ? 138 ASN B CB  1 
ATOM 2277  C CG  . ASN B 2 138 ? -18.161 119.399 13.924  1.00 53.17  ? 138 ASN B CG  1 
ATOM 2278  O OD1 . ASN B 2 138 ? -17.528 118.343 13.891  1.00 49.35  ? 138 ASN B OD1 1 
ATOM 2279  N ND2 . ASN B 2 138 ? -17.701 120.527 13.401  1.00 59.09  ? 138 ASN B ND2 1 
ATOM 2280  N N   . PHE B 2 139 ? -23.021 118.974 13.425  1.00 49.18  ? 139 PHE B N   1 
ATOM 2281  C CA  . PHE B 2 139 ? -24.336 118.995 14.023  1.00 50.52  ? 139 PHE B CA  1 
ATOM 2282  C C   . PHE B 2 139 ? -24.875 117.585 14.197  1.00 56.23  ? 139 PHE B C   1 
ATOM 2283  O O   . PHE B 2 139 ? -24.105 116.627 14.231  1.00 57.41  ? 139 PHE B O   1 
ATOM 2284  C CB  . PHE B 2 139 ? -25.308 119.830 13.205  1.00 44.15  ? 139 PHE B CB  1 
ATOM 2285  C CG  . PHE B 2 139 ? -25.225 119.622 11.730  1.00 44.03  ? 139 PHE B CG  1 
ATOM 2286  C CD1 . PHE B 2 139 ? -24.160 120.139 10.995  1.00 46.45  ? 139 PHE B CD1 1 
ATOM 2287  C CD2 . PHE B 2 139 ? -26.294 119.041 11.047  1.00 42.88  ? 139 PHE B CD2 1 
ATOM 2288  C CE1 . PHE B 2 139 ? -24.175 120.094 9.589   1.00 47.93  ? 139 PHE B CE1 1 
ATOM 2289  C CE2 . PHE B 2 139 ? -26.325 118.985 9.646   1.00 41.87  ? 139 PHE B CE2 1 
ATOM 2290  C CZ  . PHE B 2 139 ? -25.269 119.515 8.912   1.00 44.12  ? 139 PHE B CZ  1 
ATOM 2291  N N   . TYR B 2 140 ? -26.196 117.478 14.338  1.00 61.60  ? 140 TYR B N   1 
ATOM 2292  C CA  . TYR B 2 140 ? -26.917 116.210 14.507  1.00 65.06  ? 140 TYR B CA  1 
ATOM 2293  C C   . TYR B 2 140 ? -28.300 116.525 15.049  1.00 66.93  ? 140 TYR B C   1 
ATOM 2294  O O   . TYR B 2 140 ? -28.432 117.175 16.094  1.00 66.21  ? 140 TYR B O   1 
ATOM 2295  C CB  . TYR B 2 140 ? -26.210 115.270 15.495  1.00 70.02  ? 140 TYR B CB  1 
ATOM 2296  C CG  . TYR B 2 140 ? -26.817 113.877 15.521  1.00 74.62  ? 140 TYR B CG  1 
ATOM 2297  C CD1 . TYR B 2 140 ? -26.987 113.147 14.341  1.00 73.44  ? 140 TYR B CD1 1 
ATOM 2298  C CD2 . TYR B 2 140 ? -27.215 113.284 16.716  1.00 77.46  ? 140 TYR B CD2 1 
ATOM 2299  C CE1 . TYR B 2 140 ? -27.532 111.869 14.351  1.00 71.98  ? 140 TYR B CE1 1 
ATOM 2300  C CE2 . TYR B 2 140 ? -27.761 111.998 16.733  1.00 77.53  ? 140 TYR B CE2 1 
ATOM 2301  C CZ  . TYR B 2 140 ? -27.913 111.298 15.550  1.00 74.19  ? 140 TYR B CZ  1 
ATOM 2302  O OH  . TYR B 2 140 ? -28.417 110.017 15.576  1.00 77.26  ? 140 TYR B OH  1 
ATOM 2303  N N   . PRO B 2 141 ? -29.357 116.051 14.371  1.00 67.88  ? 141 PRO B N   1 
ATOM 2304  C CA  . PRO B 2 141 ? -29.474 115.235 13.156  1.00 67.51  ? 141 PRO B CA  1 
ATOM 2305  C C   . PRO B 2 141 ? -28.839 115.777 11.889  1.00 67.59  ? 141 PRO B C   1 
ATOM 2306  O O   . PRO B 2 141 ? -28.348 116.899 11.845  1.00 69.47  ? 141 PRO B O   1 
ATOM 2307  C CB  . PRO B 2 141 ? -30.983 115.087 12.983  1.00 69.37  ? 141 PRO B CB  1 
ATOM 2308  C CG  . PRO B 2 141 ? -31.489 115.138 14.394  1.00 70.80  ? 141 PRO B CG  1 
ATOM 2309  C CD  . PRO B 2 141 ? -30.690 116.287 14.954  1.00 71.22  ? 141 PRO B CD  1 
ATOM 2310  N N   . LYS B 2 142 ? -28.883 114.951 10.849  1.00 68.75  ? 142 LYS B N   1 
ATOM 2311  C CA  . LYS B 2 142 ? -28.334 115.281 9.540   1.00 68.78  ? 142 LYS B CA  1 
ATOM 2312  C C   . LYS B 2 142 ? -29.166 116.380 8.903   1.00 68.12  ? 142 LYS B C   1 
ATOM 2313  O O   . LYS B 2 142 ? -28.663 117.189 8.118   1.00 65.49  ? 142 LYS B O   1 
ATOM 2314  C CB  . LYS B 2 142 ? -28.339 114.026 8.647   1.00 70.97  ? 142 LYS B CB  1 
ATOM 2315  C CG  . LYS B 2 142 ? -27.865 114.221 7.197   1.00 76.03  ? 142 LYS B CG  1 
ATOM 2316  C CD  . LYS B 2 142 ? -28.960 114.778 6.279   1.00 80.33  ? 142 LYS B CD  1 
ATOM 2317  C CE  . LYS B 2 142 ? -28.445 114.977 4.853   1.00 83.93  ? 142 LYS B CE  1 
ATOM 2318  N NZ  . LYS B 2 142 ? -27.813 113.728 4.316   1.00 82.76  ? 142 LYS B NZ  1 
ATOM 2319  N N   . ASP B 2 143 ? -30.445 116.408 9.248   1.00 69.99  ? 143 ASP B N   1 
ATOM 2320  C CA  . ASP B 2 143 ? -31.334 117.405 8.685   1.00 74.45  ? 143 ASP B CA  1 
ATOM 2321  C C   . ASP B 2 143 ? -31.072 118.831 9.172   1.00 75.07  ? 143 ASP B C   1 
ATOM 2322  O O   . ASP B 2 143 ? -31.116 119.127 10.375  1.00 77.05  ? 143 ASP B O   1 
ATOM 2323  C CB  . ASP B 2 143 ? -32.794 117.009 8.938   1.00 79.30  ? 143 ASP B CB  1 
ATOM 2324  C CG  . ASP B 2 143 ? -33.358 116.122 7.832   1.00 82.73  ? 143 ASP B CG  1 
ATOM 2325  O OD1 . ASP B 2 143 ? -32.757 115.062 7.548   1.00 83.05  ? 143 ASP B OD1 1 
ATOM 2326  O OD2 . ASP B 2 143 ? -34.402 116.489 7.245   1.00 84.64  ? 143 ASP B OD2 1 
ATOM 2327  N N   . ILE B 2 144 ? -30.785 119.706 8.212   1.00 70.96  ? 144 ILE B N   1 
ATOM 2328  C CA  . ILE B 2 144 ? -30.532 121.103 8.488   1.00 68.81  ? 144 ILE B CA  1 
ATOM 2329  C C   . ILE B 2 144 ? -30.797 121.881 7.222   1.00 72.52  ? 144 ILE B C   1 
ATOM 2330  O O   . ILE B 2 144 ? -30.674 121.348 6.113   1.00 74.42  ? 144 ILE B O   1 
ATOM 2331  C CB  . ILE B 2 144 ? -29.088 121.354 8.910   1.00 65.05  ? 144 ILE B CB  1 
ATOM 2332  C CG1 . ILE B 2 144 ? -28.980 122.742 9.536   1.00 64.21  ? 144 ILE B CG1 1 
ATOM 2333  C CG2 . ILE B 2 144 ? -28.169 121.270 7.703   1.00 63.46  ? 144 ILE B CG2 1 
ATOM 2334  C CD1 . ILE B 2 144 ? -27.638 123.026 10.162  1.00 65.74  ? 144 ILE B CD1 1 
ATOM 2335  N N   . ASN B 2 145 ? -31.160 123.148 7.398   1.00 75.90  ? 145 ASN B N   1 
ATOM 2336  C CA  . ASN B 2 145 ? -31.458 124.028 6.274   1.00 78.22  ? 145 ASN B CA  1 
ATOM 2337  C C   . ASN B 2 145 ? -30.629 125.303 6.271   1.00 74.79  ? 145 ASN B C   1 
ATOM 2338  O O   . ASN B 2 145 ? -30.295 125.865 7.319   1.00 71.61  ? 145 ASN B O   1 
ATOM 2339  C CB  . ASN B 2 145 ? -32.950 124.384 6.254   1.00 85.00  ? 145 ASN B CB  1 
ATOM 2340  C CG  . ASN B 2 145 ? -33.827 123.191 5.910   1.00 91.29  ? 145 ASN B CG  1 
ATOM 2341  O OD1 . ASN B 2 145 ? -33.635 122.542 4.872   1.00 92.84  ? 145 ASN B OD1 1 
ATOM 2342  N ND2 . ASN B 2 145 ? -34.795 122.892 6.778   1.00 93.66  ? 145 ASN B ND2 1 
ATOM 2343  N N   . VAL B 2 146 ? -30.317 125.753 5.064   1.00 72.67  ? 146 VAL B N   1 
ATOM 2344  C CA  . VAL B 2 146 ? -29.518 126.943 4.864   1.00 71.05  ? 146 VAL B CA  1 
ATOM 2345  C C   . VAL B 2 146 ? -30.220 127.943 3.972   1.00 69.19  ? 146 VAL B C   1 
ATOM 2346  O O   . VAL B 2 146 ? -30.755 127.589 2.923   1.00 68.58  ? 146 VAL B O   1 
ATOM 2347  C CB  . VAL B 2 146 ? -28.169 126.583 4.222   1.00 70.87  ? 146 VAL B CB  1 
ATOM 2348  C CG1 . VAL B 2 146 ? -27.527 127.810 3.605   1.00 72.89  ? 146 VAL B CG1 1 
ATOM 2349  C CG2 . VAL B 2 146 ? -27.261 125.993 5.266   1.00 71.75  ? 146 VAL B CG2 1 
ATOM 2350  N N   . LYS B 2 147 ? -30.199 129.198 4.394   1.00 67.48  ? 147 LYS B N   1 
ATOM 2351  C CA  . LYS B 2 147 ? -30.811 130.269 3.632   1.00 66.66  ? 147 LYS B CA  1 
ATOM 2352  C C   . LYS B 2 147 ? -29.775 131.374 3.470   1.00 65.27  ? 147 LYS B C   1 
ATOM 2353  O O   . LYS B 2 147 ? -28.974 131.632 4.375   1.00 61.32  ? 147 LYS B O   1 
ATOM 2354  C CB  . LYS B 2 147 ? -32.051 130.789 4.373   1.00 70.26  ? 147 LYS B CB  1 
ATOM 2355  C CG  . LYS B 2 147 ? -32.709 132.026 3.768   1.00 73.27  ? 147 LYS B CG  1 
ATOM 2356  C CD  . LYS B 2 147 ? -33.975 132.441 4.538   1.00 73.79  ? 147 LYS B CD  1 
ATOM 2357  C CE  . LYS B 2 147 ? -35.164 131.521 4.241   1.00 74.01  ? 147 LYS B CE  1 
ATOM 2358  N NZ  . LYS B 2 147 ? -36.428 131.955 4.923   1.00 78.92  ? 147 LYS B NZ  1 
ATOM 2359  N N   . TRP B 2 148 ? -29.760 131.999 2.303   1.00 64.46  ? 148 TRP B N   1 
ATOM 2360  C CA  . TRP B 2 148 ? -28.830 133.087 2.085   1.00 69.25  ? 148 TRP B CA  1 
ATOM 2361  C C   . TRP B 2 148 ? -29.622 134.373 1.865   1.00 73.27  ? 148 TRP B C   1 
ATOM 2362  O O   . TRP B 2 148 ? -30.693 134.359 1.244   1.00 72.69  ? 148 TRP B O   1 
ATOM 2363  C CB  . TRP B 2 148 ? -27.931 132.829 0.869   1.00 68.44  ? 148 TRP B CB  1 
ATOM 2364  C CG  . TRP B 2 148 ? -26.838 131.809 1.068   1.00 68.03  ? 148 TRP B CG  1 
ATOM 2365  C CD1 . TRP B 2 148 ? -26.946 130.458 0.920   1.00 67.94  ? 148 TRP B CD1 1 
ATOM 2366  C CD2 . TRP B 2 148 ? -25.463 132.064 1.424   1.00 68.99  ? 148 TRP B CD2 1 
ATOM 2367  N NE1 . TRP B 2 148 ? -25.733 129.855 1.155   1.00 69.50  ? 148 TRP B NE1 1 
ATOM 2368  C CE2 . TRP B 2 148 ? -24.806 130.816 1.468   1.00 69.66  ? 148 TRP B CE2 1 
ATOM 2369  C CE3 . TRP B 2 148 ? -24.728 133.222 1.710   1.00 67.22  ? 148 TRP B CE3 1 
ATOM 2370  C CZ2 . TRP B 2 148 ? -23.442 130.694 1.784   1.00 69.13  ? 148 TRP B CZ2 1 
ATOM 2371  C CZ3 . TRP B 2 148 ? -23.372 133.096 2.023   1.00 67.18  ? 148 TRP B CZ3 1 
ATOM 2372  C CH2 . TRP B 2 148 ? -22.748 131.841 2.057   1.00 65.47  ? 148 TRP B CH2 1 
ATOM 2373  N N   . LYS B 2 149 ? -29.089 135.477 2.390   1.00 75.55  ? 149 LYS B N   1 
ATOM 2374  C CA  . LYS B 2 149 ? -29.712 136.788 2.252   1.00 73.90  ? 149 LYS B CA  1 
ATOM 2375  C C   . LYS B 2 149 ? -28.695 137.864 1.870   1.00 73.91  ? 149 LYS B C   1 
ATOM 2376  O O   . LYS B 2 149 ? -27.806 138.214 2.654   1.00 73.40  ? 149 LYS B O   1 
ATOM 2377  C CB  . LYS B 2 149 ? -30.420 137.179 3.555   1.00 72.75  ? 149 LYS B CB  1 
ATOM 2378  C CG  . LYS B 2 149 ? -31.729 136.451 3.792   1.00 72.57  ? 149 LYS B CG  1 
ATOM 2379  C CD  . LYS B 2 149 ? -31.866 136.021 5.245   1.00 76.19  ? 149 LYS B CD  1 
ATOM 2380  C CE  . LYS B 2 149 ? -31.915 137.200 6.203   1.00 76.11  ? 149 LYS B CE  1 
ATOM 2381  N NZ  . LYS B 2 149 ? -33.171 137.983 6.056   1.00 76.96  ? 149 LYS B NZ  1 
ATOM 2382  N N   . ILE B 2 150 ? -28.821 138.360 0.645   1.00 73.86  ? 150 ILE B N   1 
ATOM 2383  C CA  . ILE B 2 150 ? -27.960 139.426 0.144   1.00 75.96  ? 150 ILE B CA  1 
ATOM 2384  C C   . ILE B 2 150 ? -28.702 140.727 0.462   1.00 75.79  ? 150 ILE B C   1 
ATOM 2385  O O   . ILE B 2 150 ? -29.575 141.156 -0.296  1.00 78.98  ? 150 ILE B O   1 
ATOM 2386  C CB  . ILE B 2 150 ? -27.756 139.301 -1.379  1.00 76.20  ? 150 ILE B CB  1 
ATOM 2387  C CG1 . ILE B 2 150 ? -29.094 138.964 -2.058  1.00 79.05  ? 150 ILE B CG1 1 
ATOM 2388  C CG2 . ILE B 2 150 ? -26.743 138.231 -1.668  1.00 75.12  ? 150 ILE B CG2 1 
ATOM 2389  C CD1 . ILE B 2 150 ? -29.041 138.845 -3.578  1.00 79.73  ? 150 ILE B CD1 1 
ATOM 2390  N N   . ASP B 2 151 ? -28.363 141.343 1.591   1.00 72.40  ? 151 ASP B N   1 
ATOM 2391  C CA  . ASP B 2 151 ? -29.029 142.567 2.016   1.00 70.21  ? 151 ASP B CA  1 
ATOM 2392  C C   . ASP B 2 151 ? -30.464 142.236 2.408   1.00 71.34  ? 151 ASP B C   1 
ATOM 2393  O O   . ASP B 2 151 ? -31.410 142.757 1.820   1.00 70.25  ? 151 ASP B O   1 
ATOM 2394  C CB  . ASP B 2 151 ? -29.047 143.620 0.900   1.00 65.17  ? 151 ASP B CB  1 
ATOM 2395  C CG  . ASP B 2 151 ? -27.684 144.207 0.630   1.00 64.88  ? 151 ASP B CG  1 
ATOM 2396  O OD1 . ASP B 2 151 ? -26.982 144.513 1.617   1.00 63.79  ? 151 ASP B OD1 1 
ATOM 2397  O OD2 . ASP B 2 151 ? -27.319 144.376 -0.559  1.00 66.36  ? 151 ASP B OD2 1 
ATOM 2398  N N   . GLY B 2 152 ? -30.619 141.346 3.385   1.00 72.75  ? 152 GLY B N   1 
ATOM 2399  C CA  . GLY B 2 152 ? -31.944 140.983 3.862   1.00 76.18  ? 152 GLY B CA  1 
ATOM 2400  C C   . GLY B 2 152 ? -32.945 140.302 2.935   1.00 78.58  ? 152 GLY B C   1 
ATOM 2401  O O   . GLY B 2 152 ? -34.017 139.909 3.390   1.00 79.63  ? 152 GLY B O   1 
ATOM 2402  N N   . SER B 2 153 ? -32.632 140.160 1.651   1.00 80.09  ? 153 SER B N   1 
ATOM 2403  C CA  . SER B 2 153 ? -33.558 139.497 0.737   1.00 81.78  ? 153 SER B CA  1 
ATOM 2404  C C   . SER B 2 153 ? -33.047 138.094 0.420   1.00 82.85  ? 153 SER B C   1 
ATOM 2405  O O   . SER B 2 153 ? -31.838 137.868 0.348   1.00 83.77  ? 153 SER B O   1 
ATOM 2406  C CB  . SER B 2 153 ? -33.698 140.292 -0.559  1.00 84.03  ? 153 SER B CB  1 
ATOM 2407  O OG  . SER B 2 153 ? -32.514 140.207 -1.338  1.00 85.54  ? 153 SER B OG  1 
ATOM 2408  N N   . GLU B 2 154 ? -33.967 137.155 0.225   1.00 83.39  ? 154 GLU B N   1 
ATOM 2409  C CA  . GLU B 2 154 ? -33.590 135.779 -0.077  1.00 84.61  ? 154 GLU B CA  1 
ATOM 2410  C C   . GLU B 2 154 ? -32.764 135.632 -1.337  1.00 84.70  ? 154 GLU B C   1 
ATOM 2411  O O   . GLU B 2 154 ? -32.712 136.523 -2.190  1.00 84.31  ? 154 GLU B O   1 
ATOM 2412  C CB  . GLU B 2 154 ? -34.828 134.889 -0.208  1.00 88.46  ? 154 GLU B CB  1 
ATOM 2413  C CG  . GLU B 2 154 ? -34.983 133.882 0.921   1.00 96.87  ? 154 GLU B CG  1 
ATOM 2414  C CD  . GLU B 2 154 ? -35.140 134.551 2.283   1.00 103.21 ? 154 GLU B CD  1 
ATOM 2415  O OE1 . GLU B 2 154 ? -34.251 135.351 2.664   1.00 105.53 ? 154 GLU B OE1 1 
ATOM 2416  O OE2 . GLU B 2 154 ? -36.150 134.274 2.975   1.00 104.23 ? 154 GLU B OE2 1 
ATOM 2417  N N   . ARG B 2 155 ? -32.114 134.484 -1.439  1.00 84.72  ? 155 ARG B N   1 
ATOM 2418  C CA  . ARG B 2 155 ? -31.296 134.170 -2.589  1.00 85.83  ? 155 ARG B CA  1 
ATOM 2419  C C   . ARG B 2 155 ? -31.267 132.655 -2.742  1.00 86.75  ? 155 ARG B C   1 
ATOM 2420  O O   . ARG B 2 155 ? -30.808 131.937 -1.848  1.00 86.45  ? 155 ARG B O   1 
ATOM 2421  C CB  . ARG B 2 155 ? -29.886 134.722 -2.404  1.00 82.81  ? 155 ARG B CB  1 
ATOM 2422  C CG  . ARG B 2 155 ? -29.002 134.488 -3.603  1.00 83.12  ? 155 ARG B CG  1 
ATOM 2423  C CD  . ARG B 2 155 ? -29.464 135.262 -4.833  1.00 83.56  ? 155 ARG B CD  1 
ATOM 2424  N NE  . ARG B 2 155 ? -28.708 134.855 -6.019  1.00 84.74  ? 155 ARG B NE  1 
ATOM 2425  C CZ  . ARG B 2 155 ? -28.523 135.609 -7.102  1.00 85.82  ? 155 ARG B CZ  1 
ATOM 2426  N NH1 . ARG B 2 155 ? -29.040 136.831 -7.163  1.00 86.12  ? 155 ARG B NH1 1 
ATOM 2427  N NH2 . ARG B 2 155 ? -27.817 135.138 -8.126  1.00 84.64  ? 155 ARG B NH2 1 
ATOM 2428  N N   . GLN B 2 156 ? -31.787 132.184 -3.873  1.00 88.23  ? 156 GLN B N   1 
ATOM 2429  C CA  . GLN B 2 156 ? -31.857 130.758 -4.186  1.00 89.42  ? 156 GLN B CA  1 
ATOM 2430  C C   . GLN B 2 156 ? -30.905 130.388 -5.312  1.00 88.21  ? 156 GLN B C   1 
ATOM 2431  O O   . GLN B 2 156 ? -30.516 129.233 -5.465  1.00 86.80  ? 156 GLN B O   1 
ATOM 2432  C CB  . GLN B 2 156 ? -33.280 130.378 -4.614  1.00 92.19  ? 156 GLN B CB  1 
ATOM 2433  C CG  . GLN B 2 156 ? -34.160 129.802 -3.514  1.00 97.12  ? 156 GLN B CG  1 
ATOM 2434  C CD  . GLN B 2 156 ? -34.599 130.835 -2.496  1.00 101.32 ? 156 GLN B CD  1 
ATOM 2435  O OE1 . GLN B 2 156 ? -35.237 131.830 -2.842  1.00 106.24 ? 156 GLN B OE1 1 
ATOM 2436  N NE2 . GLN B 2 156 ? -34.266 130.601 -1.229  1.00 101.75 ? 156 GLN B NE2 1 
ATOM 2437  N N   . ASN B 2 157 ? -30.528 131.384 -6.095  1.00 87.45  ? 157 ASN B N   1 
ATOM 2438  C CA  . ASN B 2 157 ? -29.660 131.180 -7.241  1.00 88.42  ? 157 ASN B CA  1 
ATOM 2439  C C   . ASN B 2 157 ? -28.172 131.090 -6.899  1.00 86.99  ? 157 ASN B C   1 
ATOM 2440  O O   . ASN B 2 157 ? -27.709 131.718 -5.948  1.00 87.36  ? 157 ASN B O   1 
ATOM 2441  C CB  . ASN B 2 157 ? -29.912 132.325 -8.215  1.00 93.21  ? 157 ASN B CB  1 
ATOM 2442  C CG  . ASN B 2 157 ? -31.366 132.777 -8.200  1.00 98.25  ? 157 ASN B CG  1 
ATOM 2443  O OD1 . ASN B 2 157 ? -32.254 132.045 -8.637  1.00 102.38 ? 157 ASN B OD1 1 
ATOM 2444  N ND2 . ASN B 2 157 ? -31.618 133.975 -7.672  1.00 101.18 ? 157 ASN B ND2 1 
ATOM 2445  N N   . GLY B 2 158 ? -27.436 130.292 -7.675  1.00 84.03  ? 158 GLY B N   1 
ATOM 2446  C CA  . GLY B 2 158 ? -25.997 130.144 -7.482  1.00 79.02  ? 158 GLY B CA  1 
ATOM 2447  C C   . GLY B 2 158 ? -25.477 129.549 -6.183  1.00 74.47  ? 158 GLY B C   1 
ATOM 2448  O O   . GLY B 2 158 ? -24.266 129.588 -5.921  1.00 76.13  ? 158 GLY B O   1 
ATOM 2449  N N   . VAL B 2 159 ? -26.377 129.001 -5.371  1.00 68.86  ? 159 VAL B N   1 
ATOM 2450  C CA  . VAL B 2 159 ? -25.995 128.396 -4.096  1.00 63.42  ? 159 VAL B CA  1 
ATOM 2451  C C   . VAL B 2 159 ? -25.926 126.882 -4.245  1.00 62.53  ? 159 VAL B C   1 
ATOM 2452  O O   . VAL B 2 159 ? -26.807 126.270 -4.861  1.00 60.71  ? 159 VAL B O   1 
ATOM 2453  C CB  . VAL B 2 159 ? -27.006 128.747 -2.977  1.00 60.79  ? 159 VAL B CB  1 
ATOM 2454  C CG1 . VAL B 2 159 ? -28.405 128.346 -3.400  1.00 58.28  ? 159 VAL B CG1 1 
ATOM 2455  C CG2 . VAL B 2 159 ? -26.619 128.045 -1.682  1.00 56.21  ? 159 VAL B CG2 1 
ATOM 2456  N N   . LEU B 2 160 ? -24.874 126.287 -3.684  1.00 61.01  ? 160 LEU B N   1 
ATOM 2457  C CA  . LEU B 2 160 ? -24.681 124.844 -3.759  1.00 58.03  ? 160 LEU B CA  1 
ATOM 2458  C C   . LEU B 2 160 ? -24.246 124.262 -2.434  1.00 55.13  ? 160 LEU B C   1 
ATOM 2459  O O   . LEU B 2 160 ? -23.397 124.824 -1.734  1.00 52.69  ? 160 LEU B O   1 
ATOM 2460  C CB  . LEU B 2 160 ? -23.655 124.505 -4.832  1.00 59.21  ? 160 LEU B CB  1 
ATOM 2461  C CG  . LEU B 2 160 ? -24.136 124.889 -6.226  1.00 63.50  ? 160 LEU B CG  1 
ATOM 2462  C CD1 . LEU B 2 160 ? -23.088 124.527 -7.252  1.00 64.42  ? 160 LEU B CD1 1 
ATOM 2463  C CD2 . LEU B 2 160 ? -25.440 124.171 -6.522  1.00 67.61  ? 160 LEU B CD2 1 
ATOM 2464  N N   . ASN B 2 161 ? -24.824 123.111 -2.112  1.00 52.00  ? 161 ASN B N   1 
ATOM 2465  C CA  . ASN B 2 161 ? -24.543 122.430 -0.856  1.00 52.98  ? 161 ASN B CA  1 
ATOM 2466  C C   . ASN B 2 161 ? -24.001 121.015 -0.984  1.00 54.00  ? 161 ASN B C   1 
ATOM 2467  O O   . ASN B 2 161 ? -23.952 120.437 -2.073  1.00 54.83  ? 161 ASN B O   1 
ATOM 2468  C CB  . ASN B 2 161 ? -25.818 122.369 -0.028  1.00 54.40  ? 161 ASN B CB  1 
ATOM 2469  C CG  . ASN B 2 161 ? -26.356 123.726 0.287   1.00 54.24  ? 161 ASN B CG  1 
ATOM 2470  O OD1 . ASN B 2 161 ? -26.374 124.613 -0.571  1.00 60.93  ? 161 ASN B OD1 1 
ATOM 2471  N ND2 . ASN B 2 161 ? -26.806 123.907 1.520   1.00 49.02  ? 161 ASN B ND2 1 
ATOM 2472  N N   . SER B 2 162 ? -23.603 120.466 0.158   1.00 51.56  ? 162 SER B N   1 
ATOM 2473  C CA  . SER B 2 162 ? -23.098 119.108 0.221   1.00 52.12  ? 162 SER B CA  1 
ATOM 2474  C C   . SER B 2 162 ? -22.722 118.799 1.662   1.00 53.16  ? 162 SER B C   1 
ATOM 2475  O O   . SER B 2 162 ? -22.122 119.641 2.348   1.00 48.53  ? 162 SER B O   1 
ATOM 2476  C CB  . SER B 2 162 ? -21.882 118.934 -0.700  1.00 49.59  ? 162 SER B CB  1 
ATOM 2477  O OG  . SER B 2 162 ? -20.678 119.140 0.002   1.00 38.85  ? 162 SER B OG  1 
ATOM 2478  N N   . TRP B 2 163 ? -23.114 117.602 2.116   1.00 54.93  ? 163 TRP B N   1 
ATOM 2479  C CA  . TRP B 2 163 ? -22.816 117.142 3.472   1.00 54.21  ? 163 TRP B CA  1 
ATOM 2480  C C   . TRP B 2 163 ? -21.729 116.087 3.414   1.00 50.91  ? 163 TRP B C   1 
ATOM 2481  O O   . TRP B 2 163 ? -21.478 115.498 2.367   1.00 49.98  ? 163 TRP B O   1 
ATOM 2482  C CB  . TRP B 2 163 ? -24.017 116.469 4.139   1.00 56.49  ? 163 TRP B CB  1 
ATOM 2483  C CG  . TRP B 2 163 ? -25.251 117.272 4.259   1.00 60.73  ? 163 TRP B CG  1 
ATOM 2484  C CD1 . TRP B 2 163 ? -25.908 117.595 5.417   1.00 59.20  ? 163 TRP B CD1 1 
ATOM 2485  C CD2 . TRP B 2 163 ? -26.061 117.753 3.181   1.00 63.13  ? 163 TRP B CD2 1 
ATOM 2486  N NE1 . TRP B 2 163 ? -27.088 118.243 5.120   1.00 60.83  ? 163 TRP B NE1 1 
ATOM 2487  C CE2 . TRP B 2 163 ? -27.206 118.352 3.757   1.00 63.58  ? 163 TRP B CE2 1 
ATOM 2488  C CE3 . TRP B 2 163 ? -25.933 117.733 1.783   1.00 65.15  ? 163 TRP B CE3 1 
ATOM 2489  C CZ2 . TRP B 2 163 ? -28.221 118.924 2.984   1.00 67.41  ? 163 TRP B CZ2 1 
ATOM 2490  C CZ3 . TRP B 2 163 ? -26.939 118.304 1.012   1.00 68.04  ? 163 TRP B CZ3 1 
ATOM 2491  C CH2 . TRP B 2 163 ? -28.072 118.893 1.618   1.00 70.08  ? 163 TRP B CH2 1 
ATOM 2492  N N   . THR B 2 164 ? -21.097 115.848 4.556   1.00 45.69  ? 164 THR B N   1 
ATOM 2493  C CA  . THR B 2 164 ? -20.072 114.832 4.649   1.00 39.39  ? 164 THR B CA  1 
ATOM 2494  C C   . THR B 2 164 ? -20.823 113.584 5.097   1.00 38.49  ? 164 THR B C   1 
ATOM 2495  O O   . THR B 2 164 ? -22.025 113.456 4.852   1.00 40.96  ? 164 THR B O   1 
ATOM 2496  C CB  . THR B 2 164 ? -19.004 115.210 5.701   1.00 38.52  ? 164 THR B CB  1 
ATOM 2497  O OG1 . THR B 2 164 ? -19.588 115.199 7.009   1.00 39.29  ? 164 THR B OG1 1 
ATOM 2498  C CG2 . THR B 2 164 ? -18.445 116.594 5.416   1.00 26.73  ? 164 THR B CG2 1 
ATOM 2499  N N   . ASP B 2 165 ? -20.119 112.662 5.738   1.00 37.24  ? 165 ASP B N   1 
ATOM 2500  C CA  . ASP B 2 165 ? -20.750 111.455 6.250   1.00 39.93  ? 165 ASP B CA  1 
ATOM 2501  C C   . ASP B 2 165 ? -20.443 111.476 7.710   1.00 40.86  ? 165 ASP B C   1 
ATOM 2502  O O   . ASP B 2 165 ? -19.360 111.883 8.113   1.00 43.78  ? 165 ASP B O   1 
ATOM 2503  C CB  . ASP B 2 165 ? -20.148 110.187 5.661   1.00 44.68  ? 165 ASP B CB  1 
ATOM 2504  C CG  . ASP B 2 165 ? -19.712 110.363 4.236   1.00 55.45  ? 165 ASP B CG  1 
ATOM 2505  O OD1 . ASP B 2 165 ? -18.678 111.043 4.024   1.00 64.06  ? 165 ASP B OD1 1 
ATOM 2506  O OD2 . ASP B 2 165 ? -20.401 109.834 3.331   1.00 59.28  ? 165 ASP B OD2 1 
ATOM 2507  N N   . GLN B 2 166 ? -21.414 111.072 8.505   1.00 42.86  ? 166 GLN B N   1 
ATOM 2508  C CA  . GLN B 2 166 ? -21.258 111.010 9.952   1.00 44.52  ? 166 GLN B CA  1 
ATOM 2509  C C   . GLN B 2 166 ? -19.791 110.668 10.154  1.00 42.08  ? 166 GLN B C   1 
ATOM 2510  O O   . GLN B 2 166 ? -19.349 109.634 9.678   1.00 41.64  ? 166 GLN B O   1 
ATOM 2511  C CB  . GLN B 2 166 ? -22.170 109.889 10.446  1.00 47.83  ? 166 GLN B CB  1 
ATOM 2512  C CG  . GLN B 2 166 ? -22.535 109.877 11.900  1.00 48.36  ? 166 GLN B CG  1 
ATOM 2513  C CD  . GLN B 2 166 ? -23.774 109.033 12.122  1.00 54.18  ? 166 GLN B CD  1 
ATOM 2514  O OE1 . GLN B 2 166 ? -23.930 107.965 11.514  1.00 58.90  ? 166 GLN B OE1 1 
ATOM 2515  N NE2 . GLN B 2 166 ? -24.664 109.502 12.985  1.00 52.53  ? 166 GLN B NE2 1 
ATOM 2516  N N   . ASP B 2 167 ? -19.010 111.519 10.810  1.00 44.63  ? 167 ASP B N   1 
ATOM 2517  C CA  . ASP B 2 167 ? -17.605 111.155 10.944  1.00 50.63  ? 167 ASP B CA  1 
ATOM 2518  C C   . ASP B 2 167 ? -17.374 110.124 12.045  1.00 52.44  ? 167 ASP B C   1 
ATOM 2519  O O   . ASP B 2 167 ? -18.276 109.787 12.808  1.00 56.81  ? 167 ASP B O   1 
ATOM 2520  C CB  . ASP B 2 167 ? -16.710 112.392 11.122  1.00 53.09  ? 167 ASP B CB  1 
ATOM 2521  C CG  . ASP B 2 167 ? -16.534 112.783 12.564  1.00 53.17  ? 167 ASP B CG  1 
ATOM 2522  O OD1 . ASP B 2 167 ? -15.577 113.528 12.868  1.00 51.65  ? 167 ASP B OD1 1 
ATOM 2523  O OD2 . ASP B 2 167 ? -17.358 112.349 13.395  1.00 55.70  ? 167 ASP B OD2 1 
ATOM 2524  N N   . SER B 2 168 ? -16.153 109.627 12.124  1.00 52.96  ? 168 SER B N   1 
ATOM 2525  C CA  . SER B 2 168 ? -15.832 108.574 13.064  1.00 54.10  ? 168 SER B CA  1 
ATOM 2526  C C   . SER B 2 168 ? -15.442 108.951 14.460  1.00 55.70  ? 168 SER B C   1 
ATOM 2527  O O   . SER B 2 168 ? -15.276 108.071 15.298  1.00 55.03  ? 168 SER B O   1 
ATOM 2528  C CB  . SER B 2 168 ? -14.711 107.735 12.497  1.00 58.07  ? 168 SER B CB  1 
ATOM 2529  O OG  . SER B 2 168 ? -13.508 108.485 12.520  1.00 63.66  ? 168 SER B OG  1 
ATOM 2530  N N   . LYS B 2 169 ? -15.255 110.232 14.724  1.00 58.77  ? 169 LYS B N   1 
ATOM 2531  C CA  . LYS B 2 169 ? -14.852 110.624 16.062  1.00 63.10  ? 169 LYS B CA  1 
ATOM 2532  C C   . LYS B 2 169 ? -15.993 111.051 16.959  1.00 62.26  ? 169 LYS B C   1 
ATOM 2533  O O   . LYS B 2 169 ? -15.927 110.861 18.171  1.00 63.26  ? 169 LYS B O   1 
ATOM 2534  C CB  . LYS B 2 169 ? -13.813 111.741 15.994  1.00 69.69  ? 169 LYS B CB  1 
ATOM 2535  C CG  . LYS B 2 169 ? -12.411 111.261 15.675  1.00 80.48  ? 169 LYS B CG  1 
ATOM 2536  C CD  . LYS B 2 169 ? -11.815 110.435 16.810  1.00 88.71  ? 169 LYS B CD  1 
ATOM 2537  C CE  . LYS B 2 169 ? -10.369 110.026 16.506  1.00 92.13  ? 169 LYS B CE  1 
ATOM 2538  N NZ  . LYS B 2 169 ? -10.259 109.181 15.271  1.00 95.82  ? 169 LYS B NZ  1 
ATOM 2539  N N   . ASP B 2 170 ? -17.036 111.621 16.367  1.00 61.61  ? 170 ASP B N   1 
ATOM 2540  C CA  . ASP B 2 170 ? -18.156 112.096 17.156  1.00 62.55  ? 170 ASP B CA  1 
ATOM 2541  C C   . ASP B 2 170 ? -19.490 111.839 16.498  1.00 61.40  ? 170 ASP B C   1 
ATOM 2542  O O   . ASP B 2 170 ? -20.517 112.310 16.964  1.00 65.17  ? 170 ASP B O   1 
ATOM 2543  C CB  . ASP B 2 170 ? -17.996 113.596 17.447  1.00 66.79  ? 170 ASP B CB  1 
ATOM 2544  C CG  . ASP B 2 170 ? -18.243 114.476 16.222  1.00 71.92  ? 170 ASP B CG  1 
ATOM 2545  O OD1 . ASP B 2 170 ? -17.860 115.669 16.254  1.00 72.20  ? 170 ASP B OD1 1 
ATOM 2546  O OD2 . ASP B 2 170 ? -18.834 113.990 15.230  1.00 75.19  ? 170 ASP B OD2 1 
ATOM 2547  N N   . SER B 2 171 ? -19.477 111.097 15.406  1.00 57.56  ? 171 SER B N   1 
ATOM 2548  C CA  . SER B 2 171 ? -20.713 110.782 14.712  1.00 56.19  ? 171 SER B CA  1 
ATOM 2549  C C   . SER B 2 171 ? -21.553 111.994 14.292  1.00 54.60  ? 171 SER B C   1 
ATOM 2550  O O   . SER B 2 171 ? -22.753 111.856 14.061  1.00 56.81  ? 171 SER B O   1 
ATOM 2551  C CB  . SER B 2 171 ? -21.556 109.846 15.581  1.00 58.38  ? 171 SER B CB  1 
ATOM 2552  O OG  . SER B 2 171 ? -20.777 108.749 16.041  1.00 64.74  ? 171 SER B OG  1 
ATOM 2553  N N   . THR B 2 172 ? -20.945 113.177 14.187  1.00 52.62  ? 172 THR B N   1 
ATOM 2554  C CA  . THR B 2 172 ? -21.695 114.370 13.760  1.00 50.97  ? 172 THR B CA  1 
ATOM 2555  C C   . THR B 2 172 ? -21.618 114.501 12.249  1.00 51.52  ? 172 THR B C   1 
ATOM 2556  O O   . THR B 2 172 ? -20.948 113.713 11.584  1.00 51.30  ? 172 THR B O   1 
ATOM 2557  C CB  . THR B 2 172 ? -21.112 115.690 14.303  1.00 47.94  ? 172 THR B CB  1 
ATOM 2558  O OG1 . THR B 2 172 ? -19.803 115.887 13.754  1.00 45.90  ? 172 THR B OG1 1 
ATOM 2559  C CG2 . THR B 2 172 ? -21.050 115.684 15.805  1.00 44.94  ? 172 THR B CG2 1 
ATOM 2560  N N   . TYR B 2 173 ? -22.298 115.506 11.711  1.00 51.28  ? 173 TYR B N   1 
ATOM 2561  C CA  . TYR B 2 173 ? -22.260 115.755 10.279  1.00 53.40  ? 173 TYR B CA  1 
ATOM 2562  C C   . TYR B 2 173 ? -21.728 117.160 10.049  1.00 52.60  ? 173 TYR B C   1 
ATOM 2563  O O   . TYR B 2 173 ? -21.388 117.881 10.993  1.00 51.02  ? 173 TYR B O   1 
ATOM 2564  C CB  . TYR B 2 173 ? -23.649 115.648 9.653   1.00 58.77  ? 173 TYR B CB  1 
ATOM 2565  C CG  . TYR B 2 173 ? -24.240 114.266 9.689   1.00 66.52  ? 173 TYR B CG  1 
ATOM 2566  C CD1 . TYR B 2 173 ? -24.656 113.638 8.519   1.00 70.38  ? 173 TYR B CD1 1 
ATOM 2567  C CD2 . TYR B 2 173 ? -24.403 113.585 10.895  1.00 72.96  ? 173 TYR B CD2 1 
ATOM 2568  C CE1 . TYR B 2 173 ? -25.229 112.353 8.543   1.00 75.16  ? 173 TYR B CE1 1 
ATOM 2569  C CE2 . TYR B 2 173 ? -24.972 112.302 10.937  1.00 77.08  ? 173 TYR B CE2 1 
ATOM 2570  C CZ  . TYR B 2 173 ? -25.385 111.688 9.754   1.00 77.00  ? 173 TYR B CZ  1 
ATOM 2571  O OH  . TYR B 2 173 ? -25.942 110.417 9.781   1.00 78.40  ? 173 TYR B OH  1 
ATOM 2572  N N   . SER B 2 174 ? -21.656 117.543 8.784   1.00 48.80  ? 174 SER B N   1 
ATOM 2573  C CA  . SER B 2 174 ? -21.190 118.862 8.425   1.00 46.42  ? 174 SER B CA  1 
ATOM 2574  C C   . SER B 2 174 ? -21.691 119.107 7.032   1.00 48.26  ? 174 SER B C   1 
ATOM 2575  O O   . SER B 2 174 ? -21.853 118.177 6.243   1.00 49.12  ? 174 SER B O   1 
ATOM 2576  C CB  . SER B 2 174 ? -19.671 118.932 8.482   1.00 40.13  ? 174 SER B CB  1 
ATOM 2577  O OG  . SER B 2 174 ? -19.241 118.622 9.795   1.00 38.16  ? 174 SER B OG  1 
ATOM 2578  N N   . MET B 2 175 ? -21.977 120.364 6.743   1.00 51.21  ? 175 MET B N   1 
ATOM 2579  C CA  . MET B 2 175 ? -22.477 120.718 5.438   1.00 52.18  ? 175 MET B CA  1 
ATOM 2580  C C   . MET B 2 175 ? -21.844 122.012 5.019   1.00 50.91  ? 175 MET B C   1 
ATOM 2581  O O   . MET B 2 175 ? -21.376 122.788 5.859   1.00 51.00  ? 175 MET B O   1 
ATOM 2582  C CB  . MET B 2 175 ? -23.983 120.899 5.475   1.00 55.23  ? 175 MET B CB  1 
ATOM 2583  C CG  . MET B 2 175 ? -24.545 121.133 4.107   1.00 59.04  ? 175 MET B CG  1 
ATOM 2584  S SD  . MET B 2 175 ? -25.732 122.444 4.131   1.00 64.84  ? 175 MET B SD  1 
ATOM 2585  C CE  . MET B 2 175 ? -27.242 121.578 4.592   1.00 63.32  ? 175 MET B CE  1 
ATOM 2586  N N   . SER B 2 176 ? -21.824 122.246 3.717   1.00 47.83  ? 176 SER B N   1 
ATOM 2587  C CA  . SER B 2 176 ? -21.245 123.467 3.225   1.00 47.52  ? 176 SER B CA  1 
ATOM 2588  C C   . SER B 2 176 ? -22.017 123.948 2.031   1.00 49.95  ? 176 SER B C   1 
ATOM 2589  O O   . SER B 2 176 ? -22.088 123.277 0.994   1.00 52.67  ? 176 SER B O   1 
ATOM 2590  C CB  . SER B 2 176 ? -19.792 123.263 2.828   1.00 45.29  ? 176 SER B CB  1 
ATOM 2591  O OG  . SER B 2 176 ? -19.636 123.418 1.425   1.00 48.23  ? 176 SER B OG  1 
ATOM 2592  N N   . SER B 2 177 ? -22.624 125.114 2.196   1.00 50.92  ? 177 SER B N   1 
ATOM 2593  C CA  . SER B 2 177 ? -23.361 125.733 1.111   1.00 48.76  ? 177 SER B CA  1 
ATOM 2594  C C   . SER B 2 177 ? -22.444 126.860 0.705   1.00 46.02  ? 177 SER B C   1 
ATOM 2595  O O   . SER B 2 177 ? -21.769 127.474 1.543   1.00 44.47  ? 177 SER B O   1 
ATOM 2596  C CB  . SER B 2 177 ? -24.700 126.288 1.584   1.00 46.36  ? 177 SER B CB  1 
ATOM 2597  O OG  . SER B 2 177 ? -24.495 127.298 2.538   1.00 50.29  ? 177 SER B OG  1 
ATOM 2598  N N   . THR B 2 178 ? -22.396 127.114 -0.584  1.00 41.47  ? 178 THR B N   1 
ATOM 2599  C CA  . THR B 2 178 ? -21.527 128.146 -1.049  1.00 42.12  ? 178 THR B CA  1 
ATOM 2600  C C   . THR B 2 178 ? -22.222 128.918 -2.145  1.00 45.71  ? 178 THR B C   1 
ATOM 2601  O O   . THR B 2 178 ? -22.704 128.339 -3.124  1.00 45.26  ? 178 THR B O   1 
ATOM 2602  C CB  . THR B 2 178 ? -20.202 127.541 -1.532  1.00 38.16  ? 178 THR B CB  1 
ATOM 2603  O OG1 . THR B 2 178 ? -19.889 128.051 -2.832  1.00 39.08  ? 178 THR B OG1 1 
ATOM 2604  C CG2 . THR B 2 178 ? -20.294 126.011 -1.565  1.00 32.93  ? 178 THR B CG2 1 
ATOM 2605  N N   . LEU B 2 179 ? -22.282 130.235 -1.936  1.00 47.14  ? 179 LEU B N   1 
ATOM 2606  C CA  . LEU B 2 179 ? -22.904 131.179 -2.850  1.00 45.13  ? 179 LEU B CA  1 
ATOM 2607  C C   . LEU B 2 179 ? -21.880 131.675 -3.847  1.00 47.69  ? 179 LEU B C   1 
ATOM 2608  O O   . LEU B 2 179 ? -20.844 132.241 -3.476  1.00 48.87  ? 179 LEU B O   1 
ATOM 2609  C CB  . LEU B 2 179 ? -23.457 132.371 -2.078  1.00 48.44  ? 179 LEU B CB  1 
ATOM 2610  C CG  . LEU B 2 179 ? -24.632 133.097 -2.744  1.00 50.25  ? 179 LEU B CG  1 
ATOM 2611  C CD1 . LEU B 2 179 ? -24.309 133.426 -4.200  1.00 49.43  ? 179 LEU B CD1 1 
ATOM 2612  C CD2 . LEU B 2 179 ? -25.868 132.205 -2.667  1.00 51.52  ? 179 LEU B CD2 1 
ATOM 2613  N N   . THR B 2 180 ? -22.181 131.476 -5.121  1.00 47.67  ? 180 THR B N   1 
ATOM 2614  C CA  . THR B 2 180 ? -21.275 131.894 -6.170  1.00 49.45  ? 180 THR B CA  1 
ATOM 2615  C C   . THR B 2 180 ? -21.969 132.803 -7.159  1.00 53.13  ? 180 THR B C   1 
ATOM 2616  O O   . THR B 2 180 ? -23.097 132.519 -7.575  1.00 55.72  ? 180 THR B O   1 
ATOM 2617  C CB  . THR B 2 180 ? -20.741 130.688 -6.931  1.00 46.83  ? 180 THR B CB  1 
ATOM 2618  O OG1 . THR B 2 180 ? -20.122 129.783 -6.007  1.00 54.00  ? 180 THR B OG1 1 
ATOM 2619  C CG2 . THR B 2 180 ? -19.730 131.127 -7.979  1.00 44.23  ? 180 THR B CG2 1 
ATOM 2620  N N   . LEU B 2 181 ? -21.290 133.890 -7.533  1.00 55.34  ? 181 LEU B N   1 
ATOM 2621  C CA  . LEU B 2 181 ? -21.821 134.854 -8.499  1.00 57.14  ? 181 LEU B CA  1 
ATOM 2622  C C   . LEU B 2 181 ? -20.764 135.748 -9.161  1.00 58.13  ? 181 LEU B C   1 
ATOM 2623  O O   . LEU B 2 181 ? -19.563 135.599 -8.903  1.00 56.39  ? 181 LEU B O   1 
ATOM 2624  C CB  . LEU B 2 181 ? -22.919 135.710 -7.849  1.00 57.17  ? 181 LEU B CB  1 
ATOM 2625  C CG  . LEU B 2 181 ? -22.823 136.060 -6.367  1.00 55.02  ? 181 LEU B CG  1 
ATOM 2626  C CD1 . LEU B 2 181 ? -21.779 137.135 -6.133  1.00 56.78  ? 181 LEU B CD1 1 
ATOM 2627  C CD2 . LEU B 2 181 ? -24.179 136.537 -5.904  1.00 53.14  ? 181 LEU B CD2 1 
ATOM 2628  N N   . THR B 2 182 ? -21.221 136.655 -10.032 1.00 60.08  ? 182 THR B N   1 
ATOM 2629  C CA  . THR B 2 182 ? -20.334 137.570 -10.761 1.00 62.89  ? 182 THR B CA  1 
ATOM 2630  C C   . THR B 2 182 ? -19.754 138.644 -9.876  1.00 63.78  ? 182 THR B C   1 
ATOM 2631  O O   . THR B 2 182 ? -20.462 139.242 -9.070  1.00 66.23  ? 182 THR B O   1 
ATOM 2632  C CB  . THR B 2 182 ? -21.056 138.290 -11.923 1.00 63.51  ? 182 THR B CB  1 
ATOM 2633  O OG1 . THR B 2 182 ? -22.399 138.611 -11.533 1.00 66.39  ? 182 THR B OG1 1 
ATOM 2634  C CG2 . THR B 2 182 ? -21.056 137.423 -13.174 1.00 61.84  ? 182 THR B CG2 1 
ATOM 2635  N N   . LYS B 2 183 ? -18.462 138.893 -10.043 1.00 63.10  ? 183 LYS B N   1 
ATOM 2636  C CA  . LYS B 2 183 ? -17.773 139.910 -9.268  1.00 65.79  ? 183 LYS B CA  1 
ATOM 2637  C C   . LYS B 2 183 ? -18.641 141.159 -9.184  1.00 67.09  ? 183 LYS B C   1 
ATOM 2638  O O   . LYS B 2 183 ? -18.886 141.696 -8.096  1.00 66.80  ? 183 LYS B O   1 
ATOM 2639  C CB  . LYS B 2 183 ? -16.451 140.243 -9.944  1.00 68.58  ? 183 LYS B CB  1 
ATOM 2640  C CG  . LYS B 2 183 ? -15.599 141.268 -9.226  1.00 72.19  ? 183 LYS B CG  1 
ATOM 2641  C CD  . LYS B 2 183 ? -14.241 141.364 -9.899  1.00 76.46  ? 183 LYS B CD  1 
ATOM 2642  C CE  . LYS B 2 183 ? -13.336 142.362 -9.211  1.00 82.26  ? 183 LYS B CE  1 
ATOM 2643  N NZ  . LYS B 2 183 ? -12.018 142.427 -9.901  1.00 86.74  ? 183 LYS B NZ  1 
ATOM 2644  N N   . ASP B 2 184 ? -19.114 141.605 -10.345 1.00 69.07  ? 184 ASP B N   1 
ATOM 2645  C CA  . ASP B 2 184 ? -19.958 142.791 -10.428 1.00 71.76  ? 184 ASP B CA  1 
ATOM 2646  C C   . ASP B 2 184 ? -21.165 142.631 -9.519  1.00 70.31  ? 184 ASP B C   1 
ATOM 2647  O O   . ASP B 2 184 ? -21.395 143.459 -8.641  1.00 74.15  ? 184 ASP B O   1 
ATOM 2648  C CB  . ASP B 2 184 ? -20.430 143.019 -11.868 1.00 76.83  ? 184 ASP B CB  1 
ATOM 2649  C CG  . ASP B 2 184 ? -19.286 142.994 -12.877 1.00 84.36  ? 184 ASP B CG  1 
ATOM 2650  O OD1 . ASP B 2 184 ? -18.241 143.651 -12.641 1.00 85.21  ? 184 ASP B OD1 1 
ATOM 2651  O OD2 . ASP B 2 184 ? -19.438 142.316 -13.919 1.00 90.44  ? 184 ASP B OD2 1 
ATOM 2652  N N   . GLU B 2 185 ? -21.927 141.563 -9.735  1.00 67.85  ? 185 GLU B N   1 
ATOM 2653  C CA  . GLU B 2 185 ? -23.115 141.289 -8.933  1.00 68.11  ? 185 GLU B CA  1 
ATOM 2654  C C   . GLU B 2 185 ? -22.747 141.211 -7.456  1.00 65.49  ? 185 GLU B C   1 
ATOM 2655  O O   . GLU B 2 185 ? -23.535 141.563 -6.573  1.00 63.56  ? 185 GLU B O   1 
ATOM 2656  C CB  . GLU B 2 185 ? -23.752 139.968 -9.370  1.00 74.17  ? 185 GLU B CB  1 
ATOM 2657  C CG  . GLU B 2 185 ? -25.224 140.084 -9.766  1.00 85.88  ? 185 GLU B CG  1 
ATOM 2658  C CD  . GLU B 2 185 ? -26.138 140.515 -8.612  1.00 92.53  ? 185 GLU B CD  1 
ATOM 2659  O OE1 . GLU B 2 185 ? -26.197 139.795 -7.589  1.00 94.00  ? 185 GLU B OE1 1 
ATOM 2660  O OE2 . GLU B 2 185 ? -26.809 141.566 -8.734  1.00 97.99  ? 185 GLU B OE2 1 
ATOM 2661  N N   . TYR B 2 186 ? -21.536 140.753 -7.186  1.00 63.26  ? 186 TYR B N   1 
ATOM 2662  C CA  . TYR B 2 186 ? -21.094 140.636 -5.814  1.00 63.14  ? 186 TYR B CA  1 
ATOM 2663  C C   . TYR B 2 186 ? -21.040 142.014 -5.164  1.00 64.83  ? 186 TYR B C   1 
ATOM 2664  O O   . TYR B 2 186 ? -21.539 142.217 -4.052  1.00 65.56  ? 186 TYR B O   1 
ATOM 2665  C CB  . TYR B 2 186 ? -19.712 139.971 -5.746  1.00 63.16  ? 186 TYR B CB  1 
ATOM 2666  C CG  . TYR B 2 186 ? -19.113 139.984 -4.346  1.00 61.24  ? 186 TYR B CG  1 
ATOM 2667  C CD1 . TYR B 2 186 ? -19.861 139.555 -3.251  1.00 56.98  ? 186 TYR B CD1 1 
ATOM 2668  C CD2 . TYR B 2 186 ? -17.826 140.475 -4.111  1.00 56.11  ? 186 TYR B CD2 1 
ATOM 2669  C CE1 . TYR B 2 186 ? -19.346 139.623 -1.953  1.00 52.34  ? 186 TYR B CE1 1 
ATOM 2670  C CE2 . TYR B 2 186 ? -17.307 140.545 -2.810  1.00 54.33  ? 186 TYR B CE2 1 
ATOM 2671  C CZ  . TYR B 2 186 ? -18.080 140.121 -1.735  1.00 54.60  ? 186 TYR B CZ  1 
ATOM 2672  O OH  . TYR B 2 186 ? -17.619 140.228 -0.435  1.00 56.85  ? 186 TYR B OH  1 
ATOM 2673  N N   . GLU B 2 187 ? -20.442 142.968 -5.868  1.00 65.04  ? 187 GLU B N   1 
ATOM 2674  C CA  . GLU B 2 187 ? -20.313 144.314 -5.337  1.00 64.58  ? 187 GLU B CA  1 
ATOM 2675  C C   . GLU B 2 187 ? -21.587 145.153 -5.393  1.00 64.74  ? 187 GLU B C   1 
ATOM 2676  O O   . GLU B 2 187 ? -21.697 146.144 -4.684  1.00 67.29  ? 187 GLU B O   1 
ATOM 2677  C CB  . GLU B 2 187 ? -19.165 145.014 -6.046  1.00 60.24  ? 187 GLU B CB  1 
ATOM 2678  C CG  . GLU B 2 187 ? -17.848 144.351 -5.722  1.00 61.26  ? 187 GLU B CG  1 
ATOM 2679  C CD  . GLU B 2 187 ? -16.859 144.431 -6.856  1.00 66.47  ? 187 GLU B CD  1 
ATOM 2680  O OE1 . GLU B 2 187 ? -17.276 144.215 -8.015  1.00 69.52  ? 187 GLU B OE1 1 
ATOM 2681  O OE2 . GLU B 2 187 ? -15.663 144.688 -6.589  1.00 69.00  ? 187 GLU B OE2 1 
ATOM 2682  N N   . ARG B 2 188 ? -22.555 144.772 -6.220  1.00 65.20  ? 188 ARG B N   1 
ATOM 2683  C CA  . ARG B 2 188 ? -23.793 145.538 -6.281  1.00 64.79  ? 188 ARG B CA  1 
ATOM 2684  C C   . ARG B 2 188 ? -24.529 145.358 -4.964  1.00 61.42  ? 188 ARG B C   1 
ATOM 2685  O O   . ARG B 2 188 ? -25.649 145.828 -4.805  1.00 59.34  ? 188 ARG B O   1 
ATOM 2686  C CB  . ARG B 2 188 ? -24.672 145.064 -7.438  1.00 68.39  ? 188 ARG B CB  1 
ATOM 2687  C CG  . ARG B 2 188 ? -24.105 145.390 -8.797  1.00 78.59  ? 188 ARG B CG  1 
ATOM 2688  C CD  . ARG B 2 188 ? -24.956 144.805 -9.914  1.00 86.71  ? 188 ARG B CD  1 
ATOM 2689  N NE  . ARG B 2 188 ? -24.168 144.656 -11.139 1.00 96.69  ? 188 ARG B NE  1 
ATOM 2690  C CZ  . ARG B 2 188 ? -24.591 144.052 -12.249 1.00 103.08 ? 188 ARG B CZ  1 
ATOM 2691  N NH1 . ARG B 2 188 ? -25.816 143.533 -12.297 1.00 105.72 ? 188 ARG B NH1 1 
ATOM 2692  N NH2 . ARG B 2 188 ? -23.781 143.957 -13.307 1.00 104.86 ? 188 ARG B NH2 1 
ATOM 2693  N N   . HIS B 2 189 ? -23.892 144.674 -4.020  1.00 60.11  ? 189 HIS B N   1 
ATOM 2694  C CA  . HIS B 2 189 ? -24.507 144.445 -2.729  1.00 60.46  ? 189 HIS B CA  1 
ATOM 2695  C C   . HIS B 2 189 ? -23.570 144.592 -1.547  1.00 58.31  ? 189 HIS B C   1 
ATOM 2696  O O   . HIS B 2 189 ? -22.346 144.501 -1.677  1.00 55.87  ? 189 HIS B O   1 
ATOM 2697  C CB  . HIS B 2 189 ? -25.205 143.095 -2.726  1.00 67.61  ? 189 HIS B CB  1 
ATOM 2698  C CG  . HIS B 2 189 ? -26.343 143.033 -3.693  1.00 77.32  ? 189 HIS B CG  1 
ATOM 2699  N ND1 . HIS B 2 189 ? -26.153 142.941 -5.056  1.00 81.78  ? 189 HIS B ND1 1 
ATOM 2700  C CD2 . HIS B 2 189 ? -27.679 143.137 -3.504  1.00 81.35  ? 189 HIS B CD2 1 
ATOM 2701  C CE1 . HIS B 2 189 ? -27.325 142.994 -5.665  1.00 84.66  ? 189 HIS B CE1 1 
ATOM 2702  N NE2 . HIS B 2 189 ? -28.265 143.114 -4.748  1.00 85.30  ? 189 HIS B NE2 1 
ATOM 2703  N N   . ASN B 2 190 ? -24.181 144.809 -0.388  1.00 56.33  ? 190 ASN B N   1 
ATOM 2704  C CA  . ASN B 2 190 ? -23.477 145.081 0.857   1.00 57.65  ? 190 ASN B CA  1 
ATOM 2705  C C   . ASN B 2 190 ? -23.256 143.958 1.839   1.00 56.36  ? 190 ASN B C   1 
ATOM 2706  O O   . ASN B 2 190 ? -22.151 143.438 1.962   1.00 53.41  ? 190 ASN B O   1 
ATOM 2707  C CB  . ASN B 2 190 ? -24.216 146.211 1.580   1.00 65.52  ? 190 ASN B CB  1 
ATOM 2708  C CG  . ASN B 2 190 ? -24.574 147.380 0.645   1.00 71.30  ? 190 ASN B CG  1 
ATOM 2709  O OD1 . ASN B 2 190 ? -23.693 148.152 0.218   1.00 73.62  ? 190 ASN B OD1 1 
ATOM 2710  N ND2 . ASN B 2 190 ? -25.871 147.505 0.314   1.00 73.21  ? 190 ASN B ND2 1 
ATOM 2711  N N   . SER B 2 191 ? -24.307 143.636 2.583   1.00 57.22  ? 191 SER B N   1 
ATOM 2712  C CA  . SER B 2 191 ? -24.237 142.598 3.599   1.00 59.44  ? 191 SER B CA  1 
ATOM 2713  C C   . SER B 2 191 ? -24.630 141.209 3.096   1.00 60.97  ? 191 SER B C   1 
ATOM 2714  O O   . SER B 2 191 ? -25.690 141.017 2.489   1.00 62.50  ? 191 SER B O   1 
ATOM 2715  C CB  . SER B 2 191 ? -25.120 142.960 4.796   1.00 57.12  ? 191 SER B CB  1 
ATOM 2716  O OG  . SER B 2 191 ? -26.497 142.785 4.497   1.00 55.70  ? 191 SER B OG  1 
ATOM 2717  N N   . TYR B 2 192 ? -23.757 140.246 3.367   1.00 59.42  ? 192 TYR B N   1 
ATOM 2718  C CA  . TYR B 2 192 ? -23.976 138.867 2.989   1.00 54.06  ? 192 TYR B CA  1 
ATOM 2719  C C   . TYR B 2 192 ? -24.188 138.115 4.270   1.00 53.55  ? 192 TYR B C   1 
ATOM 2720  O O   . TYR B 2 192 ? -23.379 138.207 5.184   1.00 52.52  ? 192 TYR B O   1 
ATOM 2721  C CB  . TYR B 2 192 ? -22.761 138.339 2.249   1.00 50.56  ? 192 TYR B CB  1 
ATOM 2722  C CG  . TYR B 2 192 ? -22.712 138.877 0.857   1.00 52.80  ? 192 TYR B CG  1 
ATOM 2723  C CD1 . TYR B 2 192 ? -23.597 138.416 -0.111  1.00 54.99  ? 192 TYR B CD1 1 
ATOM 2724  C CD2 . TYR B 2 192 ? -21.836 139.897 0.515   1.00 55.85  ? 192 TYR B CD2 1 
ATOM 2725  C CE1 . TYR B 2 192 ? -23.611 138.953 -1.390  1.00 57.90  ? 192 TYR B CE1 1 
ATOM 2726  C CE2 . TYR B 2 192 ? -21.848 140.451 -0.761  1.00 56.31  ? 192 TYR B CE2 1 
ATOM 2727  C CZ  . TYR B 2 192 ? -22.734 139.972 -1.711  1.00 59.19  ? 192 TYR B CZ  1 
ATOM 2728  O OH  . TYR B 2 192 ? -22.732 140.498 -2.984  1.00 65.36  ? 192 TYR B OH  1 
ATOM 2729  N N   . THR B 2 193 ? -25.288 137.382 4.339   1.00 55.60  ? 193 THR B N   1 
ATOM 2730  C CA  . THR B 2 193 ? -25.594 136.631 5.536   1.00 58.44  ? 193 THR B CA  1 
ATOM 2731  C C   . THR B 2 193 ? -25.917 135.146 5.302   1.00 58.43  ? 193 THR B C   1 
ATOM 2732  O O   . THR B 2 193 ? -26.405 134.758 4.239   1.00 56.12  ? 193 THR B O   1 
ATOM 2733  C CB  . THR B 2 193 ? -26.726 137.340 6.293   1.00 61.01  ? 193 THR B CB  1 
ATOM 2734  O OG1 . THR B 2 193 ? -27.243 136.474 7.307   1.00 64.44  ? 193 THR B OG1 1 
ATOM 2735  C CG2 . THR B 2 193 ? -27.819 137.756 5.340   1.00 61.94  ? 193 THR B CG2 1 
ATOM 2736  N N   . CYS B 2 194 ? -25.625 134.319 6.306   1.00 60.52  ? 194 CYS B N   1 
ATOM 2737  C CA  . CYS B 2 194 ? -25.853 132.877 6.223   1.00 62.60  ? 194 CYS B CA  1 
ATOM 2738  C C   . CYS B 2 194 ? -26.842 132.379 7.278   1.00 64.32  ? 194 CYS B C   1 
ATOM 2739  O O   . CYS B 2 194 ? -26.590 132.483 8.481   1.00 62.04  ? 194 CYS B O   1 
ATOM 2740  C CB  . CYS B 2 194 ? -24.527 132.148 6.380   1.00 66.22  ? 194 CYS B CB  1 
ATOM 2741  S SG  . CYS B 2 194 ? -24.536 130.511 5.655   1.00 75.11  ? 194 CYS B SG  1 
ATOM 2742  N N   . GLU B 2 195 ? -27.947 131.801 6.807   1.00 67.00  ? 195 GLU B N   1 
ATOM 2743  C CA  . GLU B 2 195 ? -29.036 131.317 7.663   1.00 69.68  ? 195 GLU B CA  1 
ATOM 2744  C C   . GLU B 2 195 ? -29.052 129.811 7.962   1.00 70.20  ? 195 GLU B C   1 
ATOM 2745  O O   . GLU B 2 195 ? -29.274 128.994 7.063   1.00 68.18  ? 195 GLU B O   1 
ATOM 2746  C CB  . GLU B 2 195 ? -30.368 131.702 7.012   1.00 76.49  ? 195 GLU B CB  1 
ATOM 2747  C CG  . GLU B 2 195 ? -31.495 131.996 7.985   1.00 83.10  ? 195 GLU B CG  1 
ATOM 2748  C CD  . GLU B 2 195 ? -31.180 133.194 8.846   1.00 85.52  ? 195 GLU B CD  1 
ATOM 2749  O OE1 . GLU B 2 195 ? -31.103 134.319 8.292   1.00 88.21  ? 195 GLU B OE1 1 
ATOM 2750  O OE2 . GLU B 2 195 ? -30.998 133.001 10.069  1.00 86.80  ? 195 GLU B OE2 1 
ATOM 2751  N N   . ALA B 2 196 ? -28.871 129.450 9.232   1.00 72.29  ? 196 ALA B N   1 
ATOM 2752  C CA  . ALA B 2 196 ? -28.850 128.042 9.624   1.00 75.41  ? 196 ALA B CA  1 
ATOM 2753  C C   . ALA B 2 196 ? -29.997 127.615 10.520  1.00 78.36  ? 196 ALA B C   1 
ATOM 2754  O O   . ALA B 2 196 ? -29.928 127.752 11.741  1.00 78.10  ? 196 ALA B O   1 
ATOM 2755  C CB  . ALA B 2 196 ? -27.544 127.722 10.308  1.00 75.22  ? 196 ALA B CB  1 
ATOM 2756  N N   . THR B 2 197 ? -31.039 127.066 9.912   1.00 82.74  ? 197 THR B N   1 
ATOM 2757  C CA  . THR B 2 197 ? -32.202 126.613 10.663  1.00 89.16  ? 197 THR B CA  1 
ATOM 2758  C C   . THR B 2 197 ? -32.115 125.120 10.927  1.00 93.87  ? 197 THR B C   1 
ATOM 2759  O O   . THR B 2 197 ? -32.484 124.303 10.080  1.00 96.10  ? 197 THR B O   1 
ATOM 2760  C CB  . THR B 2 197 ? -33.484 126.881 9.892   1.00 89.48  ? 197 THR B CB  1 
ATOM 2761  O OG1 . THR B 2 197 ? -33.494 128.248 9.464   1.00 89.82  ? 197 THR B OG1 1 
ATOM 2762  C CG2 . THR B 2 197 ? -34.692 126.608 10.771  1.00 88.20  ? 197 THR B CG2 1 
ATOM 2763  N N   . HIS B 2 198 ? -31.638 124.759 12.111  1.00 97.85  ? 198 HIS B N   1 
ATOM 2764  C CA  . HIS B 2 198 ? -31.498 123.352 12.443  1.00 100.12 ? 198 HIS B CA  1 
ATOM 2765  C C   . HIS B 2 198 ? -32.760 122.782 13.095  1.00 98.97  ? 198 HIS B C   1 
ATOM 2766  O O   . HIS B 2 198 ? -33.863 122.885 12.548  1.00 98.26  ? 198 HIS B O   1 
ATOM 2767  C CB  . HIS B 2 198 ? -30.260 123.152 13.343  1.00 103.38 ? 198 HIS B CB  1 
ATOM 2768  C CG  . HIS B 2 198 ? -29.836 121.719 13.502  1.00 106.34 ? 198 HIS B CG  1 
ATOM 2769  N ND1 . HIS B 2 198 ? -29.860 120.812 12.459  1.00 107.18 ? 198 HIS B ND1 1 
ATOM 2770  C CD2 . HIS B 2 198 ? -29.376 121.039 14.579  1.00 104.79 ? 198 HIS B CD2 1 
ATOM 2771  C CE1 . HIS B 2 198 ? -29.438 119.637 12.892  1.00 103.55 ? 198 HIS B CE1 1 
ATOM 2772  N NE2 . HIS B 2 198 ? -29.139 119.747 14.172  1.00 102.58 ? 198 HIS B NE2 1 
ATOM 2773  N N   . LYS B 2 199 ? -32.586 122.180 14.264  1.00 97.90  ? 199 LYS B N   1 
ATOM 2774  C CA  . LYS B 2 199 ? -33.676 121.554 14.988  1.00 95.60  ? 199 LYS B CA  1 
ATOM 2775  C C   . LYS B 2 199 ? -33.336 121.565 16.475  1.00 93.24  ? 199 LYS B C   1 
ATOM 2776  O O   . LYS B 2 199 ? -34.021 120.941 17.276  1.00 91.72  ? 199 LYS B O   1 
ATOM 2777  C CB  . LYS B 2 199 ? -33.845 120.115 14.489  1.00 97.89  ? 199 LYS B CB  1 
ATOM 2778  C CG  . LYS B 2 199 ? -33.945 120.018 12.957  1.00 101.00 ? 199 LYS B CG  1 
ATOM 2779  C CD  . LYS B 2 199 ? -33.699 118.610 12.425  1.00 102.87 ? 199 LYS B CD  1 
ATOM 2780  C CE  . LYS B 2 199 ? -34.758 117.621 12.909  1.00 106.36 ? 199 LYS B CE  1 
ATOM 2781  N NZ  . LYS B 2 199 ? -34.621 116.274 12.270  1.00 105.42 ? 199 LYS B NZ  1 
ATOM 2782  N N   . THR B 2 200 ? -32.264 122.271 16.829  1.00 93.29  ? 200 THR B N   1 
ATOM 2783  C CA  . THR B 2 200 ? -31.835 122.387 18.223  1.00 92.60  ? 200 THR B CA  1 
ATOM 2784  C C   . THR B 2 200 ? -32.186 123.767 18.818  1.00 94.54  ? 200 THR B C   1 
ATOM 2785  O O   . THR B 2 200 ? -31.836 124.071 19.965  1.00 94.11  ? 200 THR B O   1 
ATOM 2786  C CB  . THR B 2 200 ? -30.304 122.104 18.385  1.00 90.37  ? 200 THR B CB  1 
ATOM 2787  O OG1 . THR B 2 200 ? -29.566 122.735 17.330  1.00 88.40  ? 200 THR B OG1 1 
ATOM 2788  C CG2 . THR B 2 200 ? -30.037 120.608 18.365  1.00 88.71  ? 200 THR B CG2 1 
ATOM 2789  N N   . SER B 2 201 ? -32.878 124.589 18.025  1.00 96.55  ? 201 SER B N   1 
ATOM 2790  C CA  . SER B 2 201 ? -33.335 125.925 18.437  1.00 97.12  ? 201 SER B CA  1 
ATOM 2791  C C   . SER B 2 201 ? -34.311 126.481 17.390  1.00 100.02 ? 201 SER B C   1 
ATOM 2792  O O   . SER B 2 201 ? -34.038 126.419 16.186  1.00 101.69 ? 201 SER B O   1 
ATOM 2793  C CB  . SER B 2 201 ? -32.153 126.896 18.613  1.00 93.04  ? 201 SER B CB  1 
ATOM 2794  O OG  . SER B 2 201 ? -31.585 127.273 17.370  1.00 91.50  ? 201 SER B OG  1 
ATOM 2795  N N   . THR B 2 202 ? -35.452 127.006 17.841  1.00 100.79 ? 202 THR B N   1 
ATOM 2796  C CA  . THR B 2 202 ? -36.442 127.570 16.920  1.00 100.22 ? 202 THR B CA  1 
ATOM 2797  C C   . THR B 2 202 ? -35.884 128.879 16.389  1.00 99.44  ? 202 THR B C   1 
ATOM 2798  O O   . THR B 2 202 ? -36.370 129.445 15.405  1.00 98.09  ? 202 THR B O   1 
ATOM 2799  C CB  . THR B 2 202 ? -37.768 127.852 17.633  1.00 100.83 ? 202 THR B CB  1 
ATOM 2800  O OG1 . THR B 2 202 ? -37.934 126.924 18.712  1.00 99.61  ? 202 THR B OG1 1 
ATOM 2801  C CG2 . THR B 2 202 ? -38.933 127.702 16.659  1.00 99.74  ? 202 THR B CG2 1 
ATOM 2802  N N   . SER B 2 203 ? -34.843 129.340 17.072  1.00 99.13  ? 203 SER B N   1 
ATOM 2803  C CA  . SER B 2 203 ? -34.130 130.566 16.743  1.00 95.74  ? 203 SER B CA  1 
ATOM 2804  C C   . SER B 2 203 ? -32.828 130.212 16.016  1.00 90.54  ? 203 SER B C   1 
ATOM 2805  O O   . SER B 2 203 ? -31.820 129.879 16.649  1.00 88.64  ? 203 SER B O   1 
ATOM 2806  C CB  . SER B 2 203 ? -33.811 131.338 18.025  1.00 98.16  ? 203 SER B CB  1 
ATOM 2807  O OG  . SER B 2 203 ? -33.211 130.481 18.991  1.00 103.34 ? 203 SER B OG  1 
ATOM 2808  N N   . PRO B 2 204 ? -32.840 130.286 14.679  1.00 85.83  ? 204 PRO B N   1 
ATOM 2809  C CA  . PRO B 2 204 ? -31.714 129.990 13.785  1.00 81.99  ? 204 PRO B CA  1 
ATOM 2810  C C   . PRO B 2 204 ? -30.398 130.672 14.072  1.00 78.23  ? 204 PRO B C   1 
ATOM 2811  O O   . PRO B 2 204 ? -30.355 131.826 14.498  1.00 78.97  ? 204 PRO B O   1 
ATOM 2812  C CB  . PRO B 2 204 ? -32.234 130.405 12.422  1.00 81.63  ? 204 PRO B CB  1 
ATOM 2813  C CG  . PRO B 2 204 ? -33.222 131.454 12.752  1.00 84.37  ? 204 PRO B CG  1 
ATOM 2814  C CD  . PRO B 2 204 ? -33.960 130.849 13.910  1.00 84.58  ? 204 PRO B CD  1 
ATOM 2815  N N   . ILE B 2 205 ? -29.325 129.943 13.780  1.00 74.78  ? 205 ILE B N   1 
ATOM 2816  C CA  . ILE B 2 205 ? -27.972 130.445 13.949  1.00 68.13  ? 205 ILE B CA  1 
ATOM 2817  C C   . ILE B 2 205 ? -27.662 131.240 12.690  1.00 65.48  ? 205 ILE B C   1 
ATOM 2818  O O   . ILE B 2 205 ? -27.873 130.769 11.568  1.00 65.33  ? 205 ILE B O   1 
ATOM 2819  C CB  . ILE B 2 205 ? -26.918 129.312 14.083  1.00 65.91  ? 205 ILE B CB  1 
ATOM 2820  C CG1 . ILE B 2 205 ? -27.226 128.415 15.288  1.00 64.28  ? 205 ILE B CG1 1 
ATOM 2821  C CG2 . ILE B 2 205 ? -25.547 129.918 14.291  1.00 61.71  ? 205 ILE B CG2 1 
ATOM 2822  C CD1 . ILE B 2 205 ? -28.410 127.472 15.113  1.00 66.26  ? 205 ILE B CD1 1 
ATOM 2823  N N   . VAL B 2 206 ? -27.162 132.453 12.885  1.00 61.29  ? 206 VAL B N   1 
ATOM 2824  C CA  . VAL B 2 206 ? -26.838 133.322 11.765  1.00 56.57  ? 206 VAL B CA  1 
ATOM 2825  C C   . VAL B 2 206 ? -25.400 133.837 11.807  1.00 57.53  ? 206 VAL B C   1 
ATOM 2826  O O   . VAL B 2 206 ? -24.830 134.064 12.884  1.00 59.47  ? 206 VAL B O   1 
ATOM 2827  C CB  . VAL B 2 206 ? -27.775 134.535 11.725  1.00 49.64  ? 206 VAL B CB  1 
ATOM 2828  C CG1 . VAL B 2 206 ? -27.625 135.248 10.408  1.00 47.94  ? 206 VAL B CG1 1 
ATOM 2829  C CG2 . VAL B 2 206 ? -29.198 134.092 11.945  1.00 45.50  ? 206 VAL B CG2 1 
ATOM 2830  N N   . LYS B 2 207 ? -24.817 133.999 10.622  1.00 54.91  ? 207 LYS B N   1 
ATOM 2831  C CA  . LYS B 2 207 ? -23.470 134.518 10.483  1.00 51.92  ? 207 LYS B CA  1 
ATOM 2832  C C   . LYS B 2 207 ? -23.428 135.307 9.199   1.00 54.01  ? 207 LYS B C   1 
ATOM 2833  O O   . LYS B 2 207 ? -23.971 134.878 8.180   1.00 53.63  ? 207 LYS B O   1 
ATOM 2834  C CB  . LYS B 2 207 ? -22.433 133.398 10.438  1.00 47.35  ? 207 LYS B CB  1 
ATOM 2835  C CG  . LYS B 2 207 ? -22.180 132.756 11.781  1.00 47.71  ? 207 LYS B CG  1 
ATOM 2836  C CD  . LYS B 2 207 ? -22.041 133.811 12.854  1.00 49.33  ? 207 LYS B CD  1 
ATOM 2837  C CE  . LYS B 2 207 ? -21.640 133.206 14.177  1.00 53.75  ? 207 LYS B CE  1 
ATOM 2838  N NZ  . LYS B 2 207 ? -20.219 132.761 14.109  1.00 56.71  ? 207 LYS B NZ  1 
ATOM 2839  N N   . SER B 2 208 ? -22.801 136.475 9.253   1.00 54.64  ? 208 SER B N   1 
ATOM 2840  C CA  . SER B 2 208 ? -22.698 137.311 8.070   1.00 55.49  ? 208 SER B CA  1 
ATOM 2841  C C   . SER B 2 208 ? -21.617 138.370 8.174   1.00 53.53  ? 208 SER B C   1 
ATOM 2842  O O   . SER B 2 208 ? -21.074 138.627 9.246   1.00 51.03  ? 208 SER B O   1 
ATOM 2843  C CB  . SER B 2 208 ? -24.040 137.986 7.779   1.00 56.50  ? 208 SER B CB  1 
ATOM 2844  O OG  . SER B 2 208 ? -24.358 138.974 8.735   1.00 58.09  ? 208 SER B OG  1 
ATOM 2845  N N   . PHE B 2 209 ? -21.299 138.965 7.035   1.00 53.86  ? 209 PHE B N   1 
ATOM 2846  C CA  . PHE B 2 209 ? -20.303 140.006 6.981   1.00 59.26  ? 209 PHE B CA  1 
ATOM 2847  C C   . PHE B 2 209 ? -20.867 141.110 6.110   1.00 63.50  ? 209 PHE B C   1 
ATOM 2848  O O   . PHE B 2 209 ? -21.868 140.909 5.421   1.00 61.29  ? 209 PHE B O   1 
ATOM 2849  C CB  . PHE B 2 209 ? -18.985 139.489 6.392   1.00 57.56  ? 209 PHE B CB  1 
ATOM 2850  C CG  . PHE B 2 209 ? -19.084 139.045 4.961   1.00 55.91  ? 209 PHE B CG  1 
ATOM 2851  C CD1 . PHE B 2 209 ? -19.586 137.794 4.639   1.00 55.41  ? 209 PHE B CD1 1 
ATOM 2852  C CD2 . PHE B 2 209 ? -18.673 139.885 3.933   1.00 60.00  ? 209 PHE B CD2 1 
ATOM 2853  C CE1 . PHE B 2 209 ? -19.677 137.385 3.310   1.00 58.06  ? 209 PHE B CE1 1 
ATOM 2854  C CE2 . PHE B 2 209 ? -18.760 139.490 2.595   1.00 60.73  ? 209 PHE B CE2 1 
ATOM 2855  C CZ  . PHE B 2 209 ? -19.263 138.238 2.285   1.00 62.89  ? 209 PHE B CZ  1 
ATOM 2856  N N   . ASN B 2 210 ? -20.223 142.275 6.158   1.00 70.55  ? 210 ASN B N   1 
ATOM 2857  C CA  . ASN B 2 210 ? -20.644 143.435 5.382   1.00 74.96  ? 210 ASN B CA  1 
ATOM 2858  C C   . ASN B 2 210 ? -19.523 143.793 4.410   1.00 78.08  ? 210 ASN B C   1 
ATOM 2859  O O   . ASN B 2 210 ? -18.475 144.296 4.818   1.00 78.31  ? 210 ASN B O   1 
ATOM 2860  C CB  . ASN B 2 210 ? -20.931 144.607 6.321   1.00 77.70  ? 210 ASN B CB  1 
ATOM 2861  C CG  . ASN B 2 210 ? -21.853 145.639 5.696   1.00 81.38  ? 210 ASN B CG  1 
ATOM 2862  O OD1 . ASN B 2 210 ? -21.463 146.393 4.795   1.00 81.36  ? 210 ASN B OD1 1 
ATOM 2863  N ND2 . ASN B 2 210 ? -23.097 145.670 6.165   1.00 82.98  ? 210 ASN B ND2 1 
ATOM 2864  N N   . ARG B 2 211 ? -19.754 143.516 3.129   1.00 79.75  ? 211 ARG B N   1 
ATOM 2865  C CA  . ARG B 2 211 ? -18.774 143.767 2.073   1.00 81.29  ? 211 ARG B CA  1 
ATOM 2866  C C   . ARG B 2 211 ? -18.116 145.126 2.205   1.00 87.00  ? 211 ARG B C   1 
ATOM 2867  O O   . ARG B 2 211 ? -16.940 145.301 1.879   1.00 84.95  ? 211 ARG B O   1 
ATOM 2868  C CB  . ARG B 2 211 ? -19.447 143.688 0.712   1.00 78.45  ? 211 ARG B CB  1 
ATOM 2869  C CG  . ARG B 2 211 ? -18.494 143.434 -0.422  1.00 73.90  ? 211 ARG B CG  1 
ATOM 2870  C CD  . ARG B 2 211 ? -19.215 143.567 -1.732  1.00 71.75  ? 211 ARG B CD  1 
ATOM 2871  N NE  . ARG B 2 211 ? -19.517 144.962 -1.997  1.00 72.63  ? 211 ARG B NE  1 
ATOM 2872  C CZ  . ARG B 2 211 ? -18.590 145.884 -2.208  1.00 73.56  ? 211 ARG B CZ  1 
ATOM 2873  N NH1 . ARG B 2 211 ? -17.308 145.536 -2.190  1.00 73.00  ? 211 ARG B NH1 1 
ATOM 2874  N NH2 . ARG B 2 211 ? -18.945 147.146 -2.422  1.00 71.90  ? 211 ARG B NH2 1 
ATOM 2875  N N   . ASN B 2 212 ? -18.898 146.085 2.682   1.00 96.35  ? 212 ASN B N   1 
ATOM 2876  C CA  . ASN B 2 212 ? -18.454 147.465 2.847   1.00 104.63 ? 212 ASN B CA  1 
ATOM 2877  C C   . ASN B 2 212 ? -17.591 147.687 4.077   1.00 111.74 ? 212 ASN B C   1 
ATOM 2878  O O   . ASN B 2 212 ? -16.608 148.426 4.028   1.00 112.08 ? 212 ASN B O   1 
ATOM 2879  C CB  . ASN B 2 212 ? -19.678 148.385 2.918   1.00 102.71 ? 212 ASN B CB  1 
ATOM 2880  C CG  . ASN B 2 212 ? -20.679 148.110 1.805   1.00 100.67 ? 212 ASN B CG  1 
ATOM 2881  O OD1 . ASN B 2 212 ? -20.453 148.453 0.636   1.00 99.43  ? 212 ASN B OD1 1 
ATOM 2882  N ND2 . ASN B 2 212 ? -21.787 147.467 2.163   1.00 98.90  ? 212 ASN B ND2 1 
ATOM 2883  N N   . GLU B 2 213 ? -17.974 147.046 5.176   1.00 120.51 ? 213 GLU B N   1 
ATOM 2884  C CA  . GLU B 2 213 ? -17.267 147.162 6.446   1.00 128.45 ? 213 GLU B CA  1 
ATOM 2885  C C   . GLU B 2 213 ? -15.881 146.524 6.399   1.00 130.59 ? 213 GLU B C   1 
ATOM 2886  O O   . GLU B 2 213 ? -15.161 146.487 7.399   1.00 129.55 ? 213 GLU B O   1 
ATOM 2887  C CB  . GLU B 2 213 ? -18.096 146.512 7.543   1.00 133.56 ? 213 GLU B CB  1 
ATOM 2888  C CG  . GLU B 2 213 ? -17.541 146.671 8.932   1.00 141.31 ? 213 GLU B CG  1 
ATOM 2889  C CD  . GLU B 2 213 ? -18.455 146.044 9.956   1.00 146.38 ? 213 GLU B CD  1 
ATOM 2890  O OE1 . GLU B 2 213 ? -19.465 145.433 9.537   1.00 147.97 ? 213 GLU B OE1 1 
ATOM 2891  O OE2 . GLU B 2 213 ? -18.168 146.156 11.168  1.00 149.66 ? 213 GLU B OE2 1 
ATOM 2892  N N   . CYS B 2 214 ? -15.523 146.029 5.218   1.00 133.61 ? 214 CYS B N   1 
ATOM 2893  C CA  . CYS B 2 214 ? -14.226 145.385 4.999   1.00 136.65 ? 214 CYS B CA  1 
ATOM 2894  C C   . CYS B 2 214 ? -13.036 146.132 5.583   1.00 139.12 ? 214 CYS B C   1 
ATOM 2895  O O   . CYS B 2 214 ? -12.621 147.143 4.970   1.00 141.74 ? 214 CYS B O   1 
ATOM 2896  C CB  . CYS B 2 214 ? -13.992 145.166 3.513   1.00 135.32 ? 214 CYS B CB  1 
ATOM 2897  S SG  . CYS B 2 214 ? -14.332 143.483 3.027   1.00 134.30 ? 214 CYS B SG  1 
ATOM 2898  O OXT . CYS B 2 214 ? -12.535 145.698 6.646   1.00 140.42 ? 214 CYS B OXT 1 
ATOM 2899  N N   . GLN C 3 1   ? 5.349   93.545  3.070   1.00 47.03  ? 1   GLN C N   1 
ATOM 2900  C CA  . GLN C 3 1   ? 4.790   93.968  1.771   1.00 50.78  ? 1   GLN C CA  1 
ATOM 2901  C C   . GLN C 3 1   ? 4.148   92.875  0.959   1.00 52.91  ? 1   GLN C C   1 
ATOM 2902  O O   . GLN C 3 1   ? 4.579   91.725  0.979   1.00 56.05  ? 1   GLN C O   1 
ATOM 2903  C CB  . GLN C 3 1   ? 5.860   94.558  0.864   1.00 54.38  ? 1   GLN C CB  1 
ATOM 2904  C CG  . GLN C 3 1   ? 5.498   94.371  -0.637  1.00 56.14  ? 1   GLN C CG  1 
ATOM 2905  C CD  . GLN C 3 1   ? 6.596   94.808  -1.598  1.00 59.30  ? 1   GLN C CD  1 
ATOM 2906  O OE1 . GLN C 3 1   ? 7.783   94.545  -1.368  1.00 60.46  ? 1   GLN C OE1 1 
ATOM 2907  N NE2 . GLN C 3 1   ? 6.206   95.465  -2.689  1.00 57.34  ? 1   GLN C NE2 1 
ATOM 2908  N N   . VAL C 3 2   ? 3.156   93.296  0.190   1.00 48.81  ? 2   VAL C N   1 
ATOM 2909  C CA  . VAL C 3 2   ? 2.403   92.484  -0.754  1.00 45.06  ? 2   VAL C CA  1 
ATOM 2910  C C   . VAL C 3 2   ? 1.416   93.543  -1.172  1.00 43.34  ? 2   VAL C C   1 
ATOM 2911  O O   . VAL C 3 2   ? 0.485   93.856  -0.431  1.00 40.65  ? 2   VAL C O   1 
ATOM 2912  C CB  . VAL C 3 2   ? 1.680   91.264  -0.116  1.00 44.47  ? 2   VAL C CB  1 
ATOM 2913  C CG1 . VAL C 3 2   ? 1.495   91.473  1.383   1.00 45.91  ? 2   VAL C CG1 1 
ATOM 2914  C CG2 . VAL C 3 2   ? 0.352   91.003  -0.842  1.00 33.70  ? 2   VAL C CG2 1 
ATOM 2915  N N   . GLN C 3 3   ? 1.649   94.117  -2.353  1.00 43.39  ? 3   GLN C N   1 
ATOM 2916  C CA  . GLN C 3 3   ? 0.828   95.213  -2.842  1.00 41.32  ? 3   GLN C CA  1 
ATOM 2917  C C   . GLN C 3 3   ? 0.310   95.152  -4.275  1.00 37.11  ? 3   GLN C C   1 
ATOM 2918  O O   . GLN C 3 3   ? 0.926   94.552  -5.149  1.00 39.32  ? 3   GLN C O   1 
ATOM 2919  C CB  . GLN C 3 3   ? 1.614   96.495  -2.616  1.00 41.81  ? 3   GLN C CB  1 
ATOM 2920  C CG  . GLN C 3 3   ? 2.114   96.578  -1.190  1.00 53.72  ? 3   GLN C CG  1 
ATOM 2921  C CD  . GLN C 3 3   ? 3.251   97.568  -1.005  1.00 60.38  ? 3   GLN C CD  1 
ATOM 2922  O OE1 . GLN C 3 3   ? 4.317   97.433  -1.618  1.00 67.77  ? 3   GLN C OE1 1 
ATOM 2923  N NE2 . GLN C 3 3   ? 3.035   98.567  -0.149  1.00 65.00  ? 3   GLN C NE2 1 
ATOM 2924  N N   . LEU C 3 4   ? -0.845  95.781  -4.483  1.00 29.81  ? 4   LEU C N   1 
ATOM 2925  C CA  . LEU C 3 4   ? -1.479  95.845  -5.783  1.00 25.30  ? 4   LEU C CA  1 
ATOM 2926  C C   . LEU C 3 4   ? -1.583  97.306  -6.181  1.00 27.40  ? 4   LEU C C   1 
ATOM 2927  O O   . LEU C 3 4   ? -2.508  98.024  -5.761  1.00 28.18  ? 4   LEU C O   1 
ATOM 2928  C CB  . LEU C 3 4   ? -2.870  95.226  -5.724  1.00 21.59  ? 4   LEU C CB  1 
ATOM 2929  C CG  . LEU C 3 4   ? -2.859  93.790  -5.196  1.00 15.52  ? 4   LEU C CG  1 
ATOM 2930  C CD1 . LEU C 3 4   ? -4.267  93.176  -5.288  1.00 23.49  ? 4   LEU C CD1 1 
ATOM 2931  C CD2 . LEU C 3 4   ? -1.852  92.966  -5.986  1.00 15.95  ? 4   LEU C CD2 1 
ATOM 2932  N N   . GLN C 3 5   ? -0.635  97.745  -6.996  1.00 26.94  ? 5   GLN C N   1 
ATOM 2933  C CA  . GLN C 3 5   ? -0.603  99.129  -7.432  1.00 32.31  ? 5   GLN C CA  1 
ATOM 2934  C C   . GLN C 3 5   ? -1.404  99.459  -8.696  1.00 36.43  ? 5   GLN C C   1 
ATOM 2935  O O   . GLN C 3 5   ? -1.203  98.862  -9.767  1.00 39.99  ? 5   GLN C O   1 
ATOM 2936  C CB  . GLN C 3 5   ? 0.844   99.556  -7.650  1.00 35.08  ? 5   GLN C CB  1 
ATOM 2937  C CG  . GLN C 3 5   ? 1.073   101.029 -7.423  1.00 49.15  ? 5   GLN C CG  1 
ATOM 2938  C CD  . GLN C 3 5   ? 2.088   101.609 -8.383  1.00 58.12  ? 5   GLN C CD  1 
ATOM 2939  O OE1 . GLN C 3 5   ? 3.189   101.060 -8.569  1.00 62.31  ? 5   GLN C OE1 1 
ATOM 2940  N NE2 . GLN C 3 5   ? 1.729   102.736 -9.005  1.00 63.97  ? 5   GLN C NE2 1 
ATOM 2941  N N   . GLN C 3 6   ? -2.315  100.418 -8.576  1.00 37.41  ? 6   GLN C N   1 
ATOM 2942  C CA  . GLN C 3 6   ? -3.095  100.838 -9.732  1.00 38.22  ? 6   GLN C CA  1 
ATOM 2943  C C   . GLN C 3 6   ? -3.450  102.341 -9.781  1.00 37.10  ? 6   GLN C C   1 
ATOM 2944  O O   . GLN C 3 6   ? -3.812  102.954 -8.778  1.00 41.95  ? 6   GLN C O   1 
ATOM 2945  C CB  . GLN C 3 6   ? -4.359  99.965  -9.881  1.00 37.56  ? 6   GLN C CB  1 
ATOM 2946  C CG  . GLN C 3 6   ? -5.076  99.547  -8.609  1.00 36.67  ? 6   GLN C CG  1 
ATOM 2947  C CD  . GLN C 3 6   ? -6.409  98.873  -8.925  1.00 38.51  ? 6   GLN C CD  1 
ATOM 2948  O OE1 . GLN C 3 6   ? -7.095  98.341  -8.039  1.00 32.91  ? 6   GLN C OE1 1 
ATOM 2949  N NE2 . GLN C 3 6   ? -6.787  98.903  -10.205 1.00 40.22  ? 6   GLN C NE2 1 
ATOM 2950  N N   . PRO C 3 7   ? -3.315  102.956 -10.959 1.00 33.12  ? 7   PRO C N   1 
ATOM 2951  C CA  . PRO C 3 7   ? -3.605  104.365 -11.194 1.00 32.35  ? 7   PRO C CA  1 
ATOM 2952  C C   . PRO C 3 7   ? -4.857  104.820 -10.490 1.00 35.29  ? 7   PRO C C   1 
ATOM 2953  O O   . PRO C 3 7   ? -5.814  104.061 -10.365 1.00 42.08  ? 7   PRO C O   1 
ATOM 2954  C CB  . PRO C 3 7   ? -3.751  104.415 -12.695 1.00 33.97  ? 7   PRO C CB  1 
ATOM 2955  C CG  . PRO C 3 7   ? -2.664  103.514 -13.120 1.00 38.38  ? 7   PRO C CG  1 
ATOM 2956  C CD  . PRO C 3 7   ? -2.805  102.329 -12.188 1.00 34.78  ? 7   PRO C CD  1 
ATOM 2957  N N   . GLY C 3 8   ? -4.864  106.068 -10.048 1.00 36.23  ? 8   GLY C N   1 
ATOM 2958  C CA  . GLY C 3 8   ? -6.032  106.576 -9.355  1.00 34.47  ? 8   GLY C CA  1 
ATOM 2959  C C   . GLY C 3 8   ? -7.179  106.940 -10.273 1.00 35.63  ? 8   GLY C C   1 
ATOM 2960  O O   . GLY C 3 8   ? -8.347  106.763 -9.912  1.00 35.33  ? 8   GLY C O   1 
ATOM 2961  N N   . THR C 3 9   ? -6.856  107.444 -11.464 1.00 39.62  ? 9   THR C N   1 
ATOM 2962  C CA  . THR C 3 9   ? -7.900  107.852 -12.395 1.00 43.39  ? 9   THR C CA  1 
ATOM 2963  C C   . THR C 3 9   ? -7.630  107.528 -13.844 1.00 43.21  ? 9   THR C C   1 
ATOM 2964  O O   . THR C 3 9   ? -6.489  107.373 -14.258 1.00 43.24  ? 9   THR C O   1 
ATOM 2965  C CB  . THR C 3 9   ? -8.148  109.375 -12.344 1.00 42.05  ? 9   THR C CB  1 
ATOM 2966  O OG1 . THR C 3 9   ? -7.462  109.938 -11.220 1.00 46.59  ? 9   THR C OG1 1 
ATOM 2967  C CG2 . THR C 3 9   ? -9.662  109.674 -12.245 1.00 48.20  ? 9   THR C CG2 1 
ATOM 2968  N N   . GLU C 3 10  ? -8.712  107.446 -14.609 1.00 45.34  ? 10  GLU C N   1 
ATOM 2969  C CA  . GLU C 3 10  ? -8.659  107.192 -16.042 1.00 46.37  ? 10  GLU C CA  1 
ATOM 2970  C C   . GLU C 3 10  ? -9.834  107.929 -16.661 1.00 44.40  ? 10  GLU C C   1 
ATOM 2971  O O   . GLU C 3 10  ? -10.982 107.753 -16.237 1.00 43.88  ? 10  GLU C O   1 
ATOM 2972  C CB  . GLU C 3 10  ? -8.783  105.704 -16.344 1.00 48.77  ? 10  GLU C CB  1 
ATOM 2973  C CG  . GLU C 3 10  ? -7.570  104.907 -15.956 1.00 58.34  ? 10  GLU C CG  1 
ATOM 2974  C CD  . GLU C 3 10  ? -6.626  104.699 -17.111 1.00 62.11  ? 10  GLU C CD  1 
ATOM 2975  O OE1 . GLU C 3 10  ? -5.410  104.999 -16.956 1.00 64.25  ? 10  GLU C OE1 1 
ATOM 2976  O OE2 . GLU C 3 10  ? -7.116  104.225 -18.167 1.00 65.74  ? 10  GLU C OE2 1 
ATOM 2977  N N   . LEU C 3 11  ? -9.546  108.784 -17.637 1.00 43.51  ? 11  LEU C N   1 
ATOM 2978  C CA  . LEU C 3 11  ? -10.603 109.520 -18.318 1.00 43.28  ? 11  LEU C CA  1 
ATOM 2979  C C   . LEU C 3 11  ? -10.615 108.965 -19.718 1.00 45.33  ? 11  LEU C C   1 
ATOM 2980  O O   . LEU C 3 11  ? -9.560  108.767 -20.325 1.00 42.81  ? 11  LEU C O   1 
ATOM 2981  C CB  . LEU C 3 11  ? -10.316 111.029 -18.356 1.00 40.78  ? 11  LEU C CB  1 
ATOM 2982  C CG  . LEU C 3 11  ? -11.296 111.950 -19.108 1.00 39.51  ? 11  LEU C CG  1 
ATOM 2983  C CD1 . LEU C 3 11  ? -12.721 111.762 -18.595 1.00 43.45  ? 11  LEU C CD1 1 
ATOM 2984  C CD2 . LEU C 3 11  ? -10.869 113.397 -18.931 1.00 44.04  ? 11  LEU C CD2 1 
ATOM 2985  N N   . VAL C 3 12  ? -11.803 108.692 -20.236 1.00 48.73  ? 12  VAL C N   1 
ATOM 2986  C CA  . VAL C 3 12  ? -11.862 108.148 -21.570 1.00 49.70  ? 12  VAL C CA  1 
ATOM 2987  C C   . VAL C 3 12  ? -13.096 108.605 -22.334 1.00 51.15  ? 12  VAL C C   1 
ATOM 2988  O O   . VAL C 3 12  ? -14.197 108.730 -21.779 1.00 48.71  ? 12  VAL C O   1 
ATOM 2989  C CB  . VAL C 3 12  ? -11.772 106.601 -21.511 1.00 48.78  ? 12  VAL C CB  1 
ATOM 2990  C CG1 . VAL C 3 12  ? -13.137 105.994 -21.191 1.00 46.57  ? 12  VAL C CG1 1 
ATOM 2991  C CG2 . VAL C 3 12  ? -11.183 106.074 -22.801 1.00 52.78  ? 12  VAL C CG2 1 
ATOM 2992  N N   . ARG C 3 13  ? -12.888 108.880 -23.614 1.00 54.86  ? 13  ARG C N   1 
ATOM 2993  C CA  . ARG C 3 13  ? -13.966 109.319 -24.472 1.00 60.64  ? 13  ARG C CA  1 
ATOM 2994  C C   . ARG C 3 13  ? -14.885 108.130 -24.697 1.00 61.08  ? 13  ARG C C   1 
ATOM 2995  O O   . ARG C 3 13  ? -14.414 107.018 -24.952 1.00 64.58  ? 13  ARG C O   1 
ATOM 2996  C CB  . ARG C 3 13  ? -13.390 109.799 -25.801 1.00 63.79  ? 13  ARG C CB  1 
ATOM 2997  C CG  . ARG C 3 13  ? -12.457 110.978 -25.655 1.00 75.83  ? 13  ARG C CG  1 
ATOM 2998  C CD  . ARG C 3 13  ? -13.075 112.233 -26.246 1.00 88.73  ? 13  ARG C CD  1 
ATOM 2999  N NE  . ARG C 3 13  ? -13.388 112.015 -27.656 1.00 97.33  ? 13  ARG C NE  1 
ATOM 3000  C CZ  . ARG C 3 13  ? -13.702 112.977 -28.522 1.00 100.50 ? 13  ARG C CZ  1 
ATOM 3001  N NH1 . ARG C 3 13  ? -13.748 114.246 -28.124 1.00 101.54 ? 13  ARG C NH1 1 
ATOM 3002  N NH2 . ARG C 3 13  ? -13.961 112.665 -29.791 1.00 101.74 ? 13  ARG C NH2 1 
ATOM 3003  N N   . PRO C 3 14  ? -16.206 108.331 -24.563 1.00 59.52  ? 14  PRO C N   1 
ATOM 3004  C CA  . PRO C 3 14  ? -17.101 107.198 -24.788 1.00 59.27  ? 14  PRO C CA  1 
ATOM 3005  C C   . PRO C 3 14  ? -16.689 106.426 -26.040 1.00 60.98  ? 14  PRO C C   1 
ATOM 3006  O O   . PRO C 3 14  ? -16.307 107.013 -27.053 1.00 61.15  ? 14  PRO C O   1 
ATOM 3007  C CB  . PRO C 3 14  ? -18.486 107.855 -24.903 1.00 54.82  ? 14  PRO C CB  1 
ATOM 3008  C CG  . PRO C 3 14  ? -18.219 109.376 -24.814 1.00 56.84  ? 14  PRO C CG  1 
ATOM 3009  C CD  . PRO C 3 14  ? -16.952 109.477 -24.030 1.00 59.02  ? 14  PRO C CD  1 
ATOM 3010  N N   . GLY C 3 15  ? -16.733 105.105 -25.940 1.00 62.04  ? 15  GLY C N   1 
ATOM 3011  C CA  . GLY C 3 15  ? -16.355 104.278 -27.064 1.00 67.40  ? 15  GLY C CA  1 
ATOM 3012  C C   . GLY C 3 15  ? -14.865 104.277 -27.349 1.00 69.49  ? 15  GLY C C   1 
ATOM 3013  O O   . GLY C 3 15  ? -14.444 104.180 -28.499 1.00 73.48  ? 15  GLY C O   1 
ATOM 3014  N N   . ALA C 3 16  ? -14.058 104.399 -26.306 1.00 69.57  ? 16  ALA C N   1 
ATOM 3015  C CA  . ALA C 3 16  ? -12.614 104.371 -26.475 1.00 68.12  ? 16  ALA C CA  1 
ATOM 3016  C C   . ALA C 3 16  ? -12.153 103.187 -25.637 1.00 68.44  ? 16  ALA C C   1 
ATOM 3017  O O   . ALA C 3 16  ? -12.835 102.783 -24.695 1.00 68.45  ? 16  ALA C O   1 
ATOM 3018  C CB  . ALA C 3 16  ? -12.002 105.655 -25.971 1.00 67.02  ? 16  ALA C CB  1 
ATOM 3019  N N   . SER C 3 17  ? -11.011 102.606 -25.970 1.00 66.56  ? 17  SER C N   1 
ATOM 3020  C CA  . SER C 3 17  ? -10.572 101.463 -25.188 1.00 62.82  ? 17  SER C CA  1 
ATOM 3021  C C   . SER C 3 17  ? -9.924  101.931 -23.895 1.00 61.73  ? 17  SER C C   1 
ATOM 3022  O O   . SER C 3 17  ? -9.094  102.841 -23.885 1.00 59.97  ? 17  SER C O   1 
ATOM 3023  C CB  . SER C 3 17  ? -9.597  100.592 -25.976 1.00 62.17  ? 17  SER C CB  1 
ATOM 3024  O OG  . SER C 3 17  ? -9.523  99.303  -25.395 1.00 61.04  ? 17  SER C OG  1 
ATOM 3025  N N   . VAL C 3 18  ? -10.321 101.292 -22.804 1.00 60.46  ? 18  VAL C N   1 
ATOM 3026  C CA  . VAL C 3 18  ? -9.815  101.615 -21.482 1.00 58.83  ? 18  VAL C CA  1 
ATOM 3027  C C   . VAL C 3 18  ? -8.983  100.496 -20.919 1.00 56.00  ? 18  VAL C C   1 
ATOM 3028  O O   . VAL C 3 18  ? -9.458  99.369  -20.829 1.00 57.72  ? 18  VAL C O   1 
ATOM 3029  C CB  . VAL C 3 18  ? -10.957 101.842 -20.499 1.00 60.16  ? 18  VAL C CB  1 
ATOM 3030  C CG1 . VAL C 3 18  ? -10.425 101.798 -19.082 1.00 62.44  ? 18  VAL C CG1 1 
ATOM 3031  C CG2 . VAL C 3 18  ? -11.611 103.169 -20.774 1.00 63.11  ? 18  VAL C CG2 1 
ATOM 3032  N N   . ILE C 3 19  ? -7.755  100.797 -20.522 1.00 52.20  ? 19  ILE C N   1 
ATOM 3033  C CA  . ILE C 3 19  ? -6.925  99.762  -19.943 1.00 49.69  ? 19  ILE C CA  1 
ATOM 3034  C C   . ILE C 3 19  ? -6.621  100.010 -18.482 1.00 48.21  ? 19  ILE C C   1 
ATOM 3035  O O   . ILE C 3 19  ? -6.105  101.064 -18.096 1.00 47.84  ? 19  ILE C O   1 
ATOM 3036  C CB  . ILE C 3 19  ? -5.615  99.606  -20.686 1.00 51.22  ? 19  ILE C CB  1 
ATOM 3037  C CG1 . ILE C 3 19  ? -5.848  98.760  -21.936 1.00 51.52  ? 19  ILE C CG1 1 
ATOM 3038  C CG2 . ILE C 3 19  ? -4.567  98.982  -19.765 1.00 56.54  ? 19  ILE C CG2 1 
ATOM 3039  C CD1 . ILE C 3 19  ? -6.827  99.377  -22.898 1.00 50.09  ? 19  ILE C CD1 1 
ATOM 3040  N N   . LEU C 3 20  ? -6.940  99.019  -17.666 1.00 43.91  ? 20  LEU C N   1 
ATOM 3041  C CA  . LEU C 3 20  ? -6.694  99.131  -16.253 1.00 41.14  ? 20  LEU C CA  1 
ATOM 3042  C C   . LEU C 3 20  ? -5.511  98.256  -15.918 1.00 42.27  ? 20  LEU C C   1 
ATOM 3043  O O   . LEU C 3 20  ? -5.550  97.043  -16.111 1.00 43.39  ? 20  LEU C O   1 
ATOM 3044  C CB  . LEU C 3 20  ? -7.931  98.689  -15.482 1.00 36.58  ? 20  LEU C CB  1 
ATOM 3045  C CG  . LEU C 3 20  ? -9.189  99.422  -15.943 1.00 35.44  ? 20  LEU C CG  1 
ATOM 3046  C CD1 . LEU C 3 20  ? -10.347 99.027  -15.084 1.00 31.43  ? 20  LEU C CD1 1 
ATOM 3047  C CD2 . LEU C 3 20  ? -8.977  100.921 -15.858 1.00 36.04  ? 20  LEU C CD2 1 
ATOM 3048  N N   . SER C 3 21  ? -4.442  98.878  -15.443 1.00 43.97  ? 21  SER C N   1 
ATOM 3049  C CA  . SER C 3 21  ? -3.257  98.126  -15.076 1.00 46.27  ? 21  SER C CA  1 
ATOM 3050  C C   . SER C 3 21  ? -3.264  97.930  -13.572 1.00 43.04  ? 21  SER C C   1 
ATOM 3051  O O   . SER C 3 21  ? -3.805  98.756  -12.829 1.00 40.20  ? 21  SER C O   1 
ATOM 3052  C CB  . SER C 3 21  ? -2.003  98.888  -15.472 1.00 48.28  ? 21  SER C CB  1 
ATOM 3053  O OG  . SER C 3 21  ? -1.842  100.022 -14.637 1.00 57.42  ? 21  SER C OG  1 
ATOM 3054  N N   . CYS C 3 22  ? -2.675  96.824  -13.136 1.00 39.84  ? 22  CYS C N   1 
ATOM 3055  C CA  . CYS C 3 22  ? -2.580  96.501  -11.723 1.00 41.47  ? 22  CYS C CA  1 
ATOM 3056  C C   . CYS C 3 22  ? -1.255  95.803  -11.575 1.00 41.97  ? 22  CYS C C   1 
ATOM 3057  O O   . CYS C 3 22  ? -1.095  94.707  -12.088 1.00 48.92  ? 22  CYS C O   1 
ATOM 3058  C CB  . CYS C 3 22  ? -3.697  95.549  -11.302 1.00 38.44  ? 22  CYS C CB  1 
ATOM 3059  S SG  . CYS C 3 22  ? -3.383  94.784  -9.684  1.00 23.19  ? 22  CYS C SG  1 
ATOM 3060  N N   . LYS C 3 23  ? -0.306  96.420  -10.881 1.00 39.47  ? 23  LYS C N   1 
ATOM 3061  C CA  . LYS C 3 23  ? 1.011   95.815  -10.738 1.00 37.95  ? 23  LYS C CA  1 
ATOM 3062  C C   . LYS C 3 23  ? 1.279   95.220  -9.372  1.00 36.66  ? 23  LYS C C   1 
ATOM 3063  O O   . LYS C 3 23  ? 1.276   95.928  -8.363  1.00 34.47  ? 23  LYS C O   1 
ATOM 3064  C CB  . LYS C 3 23  ? 2.095   96.838  -11.074 1.00 37.12  ? 23  LYS C CB  1 
ATOM 3065  C CG  . LYS C 3 23  ? 3.509   96.306  -10.886 1.00 42.50  ? 23  LYS C CG  1 
ATOM 3066  C CD  . LYS C 3 23  ? 4.560   97.355  -11.242 1.00 48.50  ? 23  LYS C CD  1 
ATOM 3067  C CE  . LYS C 3 23  ? 5.961   96.870  -10.881 1.00 54.24  ? 23  LYS C CE  1 
ATOM 3068  N NZ  . LYS C 3 23  ? 6.265   95.533  -11.486 1.00 59.32  ? 23  LYS C NZ  1 
ATOM 3069  N N   . ALA C 3 24  ? 1.534   93.911  -9.361  1.00 39.65  ? 24  ALA C N   1 
ATOM 3070  C CA  . ALA C 3 24  ? 1.808   93.168  -8.132  1.00 43.66  ? 24  ALA C CA  1 
ATOM 3071  C C   . ALA C 3 24  ? 3.223   93.408  -7.631  1.00 47.18  ? 24  ALA C C   1 
ATOM 3072  O O   . ALA C 3 24  ? 4.060   93.954  -8.352  1.00 53.19  ? 24  ALA C O   1 
ATOM 3073  C CB  . ALA C 3 24  ? 1.601   91.686  -8.360  1.00 38.34  ? 24  ALA C CB  1 
ATOM 3074  N N   . SER C 3 25  ? 3.471   92.999  -6.389  1.00 46.44  ? 25  SER C N   1 
ATOM 3075  C CA  . SER C 3 25  ? 4.771   93.131  -5.740  1.00 42.95  ? 25  SER C CA  1 
ATOM 3076  C C   . SER C 3 25  ? 4.656   92.522  -4.356  1.00 38.97  ? 25  SER C C   1 
ATOM 3077  O O   . SER C 3 25  ? 3.571   92.473  -3.788  1.00 35.04  ? 25  SER C O   1 
ATOM 3078  C CB  . SER C 3 25  ? 5.180   94.604  -5.624  1.00 44.41  ? 25  SER C CB  1 
ATOM 3079  O OG  . SER C 3 25  ? 4.162   95.384  -5.022  1.00 43.03  ? 25  SER C OG  1 
ATOM 3080  N N   . GLY C 3 26  ? 5.769   92.034  -3.825  1.00 38.89  ? 26  GLY C N   1 
ATOM 3081  C CA  . GLY C 3 26  ? 5.745   91.459  -2.493  1.00 36.83  ? 26  GLY C CA  1 
ATOM 3082  C C   . GLY C 3 26  ? 5.377   89.994  -2.428  1.00 33.90  ? 26  GLY C C   1 
ATOM 3083  O O   . GLY C 3 26  ? 5.400   89.407  -1.350  1.00 30.13  ? 26  GLY C O   1 
ATOM 3084  N N   . TYR C 3 27  ? 5.028   89.402  -3.564  1.00 36.63  ? 27  TYR C N   1 
ATOM 3085  C CA  . TYR C 3 27  ? 4.668   87.984  -3.593  1.00 42.22  ? 27  TYR C CA  1 
ATOM 3086  C C   . TYR C 3 27  ? 4.945   87.397  -4.976  1.00 46.19  ? 27  TYR C C   1 
ATOM 3087  O O   . TYR C 3 27  ? 5.240   88.142  -5.928  1.00 50.81  ? 27  TYR C O   1 
ATOM 3088  C CB  . TYR C 3 27  ? 3.186   87.789  -3.227  1.00 42.89  ? 27  TYR C CB  1 
ATOM 3089  C CG  . TYR C 3 27  ? 2.193   88.060  -4.342  1.00 48.53  ? 27  TYR C CG  1 
ATOM 3090  C CD1 . TYR C 3 27  ? 1.905   89.359  -4.767  1.00 51.32  ? 27  TYR C CD1 1 
ATOM 3091  C CD2 . TYR C 3 27  ? 1.548   87.007  -4.982  1.00 50.53  ? 27  TYR C CD2 1 
ATOM 3092  C CE1 . TYR C 3 27  ? 0.989   89.598  -5.815  1.00 50.98  ? 27  TYR C CE1 1 
ATOM 3093  C CE2 . TYR C 3 27  ? 0.636   87.230  -6.020  1.00 53.16  ? 27  TYR C CE2 1 
ATOM 3094  C CZ  . TYR C 3 27  ? 0.360   88.525  -6.434  1.00 54.32  ? 27  TYR C CZ  1 
ATOM 3095  O OH  . TYR C 3 27  ? -0.538  88.719  -7.469  1.00 55.77  ? 27  TYR C OH  1 
ATOM 3096  N N   . THR C 3 28  ? 4.862   86.074  -5.098  1.00 43.23  ? 28  THR C N   1 
ATOM 3097  C CA  . THR C 3 28  ? 5.104   85.452  -6.395  1.00 42.82  ? 28  THR C CA  1 
ATOM 3098  C C   . THR C 3 28  ? 3.866   85.548  -7.281  1.00 42.15  ? 28  THR C C   1 
ATOM 3099  O O   . THR C 3 28  ? 2.936   84.740  -7.183  1.00 35.79  ? 28  THR C O   1 
ATOM 3100  C CB  . THR C 3 28  ? 5.523   83.999  -6.233  1.00 45.47  ? 28  THR C CB  1 
ATOM 3101  O OG1 . THR C 3 28  ? 6.849   83.958  -5.694  1.00 43.39  ? 28  THR C OG1 1 
ATOM 3102  C CG2 . THR C 3 28  ? 5.495   83.284  -7.579  1.00 47.67  ? 28  THR C CG2 1 
ATOM 3103  N N   . PHE C 3 29  ? 3.888   86.556  -8.149  1.00 43.56  ? 29  PHE C N   1 
ATOM 3104  C CA  . PHE C 3 29  ? 2.799   86.874  -9.067  1.00 42.53  ? 29  PHE C CA  1 
ATOM 3105  C C   . PHE C 3 29  ? 2.017   85.706  -9.668  1.00 41.44  ? 29  PHE C C   1 
ATOM 3106  O O   . PHE C 3 29  ? 0.785   85.686  -9.632  1.00 38.14  ? 29  PHE C O   1 
ATOM 3107  C CB  . PHE C 3 29  ? 3.350   87.749  -10.191 1.00 45.04  ? 29  PHE C CB  1 
ATOM 3108  C CG  . PHE C 3 29  ? 2.297   88.267  -11.125 1.00 43.73  ? 29  PHE C CG  1 
ATOM 3109  C CD1 . PHE C 3 29  ? 1.294   89.102  -10.667 1.00 39.59  ? 29  PHE C CD1 1 
ATOM 3110  C CD2 . PHE C 3 29  ? 2.307   87.915  -12.466 1.00 44.69  ? 29  PHE C CD2 1 
ATOM 3111  C CE1 . PHE C 3 29  ? 0.314   89.580  -11.535 1.00 38.63  ? 29  PHE C CE1 1 
ATOM 3112  C CE2 . PHE C 3 29  ? 1.324   88.391  -13.342 1.00 41.70  ? 29  PHE C CE2 1 
ATOM 3113  C CZ  . PHE C 3 29  ? 0.330   89.222  -12.874 1.00 37.93  ? 29  PHE C CZ  1 
ATOM 3114  N N   . THR C 3 30  ? 2.742   84.740  -10.215 1.00 42.18  ? 30  THR C N   1 
ATOM 3115  C CA  . THR C 3 30  ? 2.153   83.571  -10.865 1.00 44.07  ? 30  THR C CA  1 
ATOM 3116  C C   . THR C 3 30  ? 1.576   82.512  -9.957  1.00 45.28  ? 30  THR C C   1 
ATOM 3117  O O   . THR C 3 30  ? 1.044   81.503  -10.439 1.00 45.11  ? 30  THR C O   1 
ATOM 3118  C CB  . THR C 3 30  ? 3.176   82.855  -11.708 1.00 45.25  ? 30  THR C CB  1 
ATOM 3119  O OG1 . THR C 3 30  ? 4.358   82.640  -10.916 1.00 46.13  ? 30  THR C OG1 1 
ATOM 3120  C CG2 . THR C 3 30  ? 3.488   83.665  -12.941 1.00 46.05  ? 30  THR C CG2 1 
ATOM 3121  N N   . SER C 3 31  ? 1.701   82.709  -8.652  1.00 43.03  ? 31  SER C N   1 
ATOM 3122  C CA  . SER C 3 31  ? 1.175   81.730  -7.718  1.00 36.74  ? 31  SER C CA  1 
ATOM 3123  C C   . SER C 3 31  ? -0.202  82.127  -7.213  1.00 35.23  ? 31  SER C C   1 
ATOM 3124  O O   . SER C 3 31  ? -0.845  81.347  -6.534  1.00 32.21  ? 31  SER C O   1 
ATOM 3125  C CB  . SER C 3 31  ? 2.132   81.571  -6.538  1.00 32.40  ? 31  SER C CB  1 
ATOM 3126  O OG  . SER C 3 31  ? 3.435   81.213  -6.978  1.00 38.61  ? 31  SER C OG  1 
ATOM 3127  N N   . TYR C 3 32  ? -0.671  83.322  -7.566  1.00 34.36  ? 32  TYR C N   1 
ATOM 3128  C CA  . TYR C 3 32  ? -1.960  83.785  -7.070  1.00 34.52  ? 32  TYR C CA  1 
ATOM 3129  C C   . TYR C 3 32  ? -2.931  84.359  -8.073  1.00 36.97  ? 32  TYR C C   1 
ATOM 3130  O O   . TYR C 3 32  ? -2.531  84.987  -9.048  1.00 38.79  ? 32  TYR C O   1 
ATOM 3131  C CB  . TYR C 3 32  ? -1.736  84.850  -6.003  1.00 34.92  ? 32  TYR C CB  1 
ATOM 3132  C CG  . TYR C 3 32  ? -1.215  84.313  -4.705  1.00 31.48  ? 32  TYR C CG  1 
ATOM 3133  C CD1 . TYR C 3 32  ? -2.090  83.869  -3.713  1.00 28.85  ? 32  TYR C CD1 1 
ATOM 3134  C CD2 . TYR C 3 32  ? 0.159   84.244  -4.461  1.00 32.41  ? 32  TYR C CD2 1 
ATOM 3135  C CE1 . TYR C 3 32  ? -1.613  83.375  -2.517  1.00 31.28  ? 32  TYR C CE1 1 
ATOM 3136  C CE2 . TYR C 3 32  ? 0.648   83.753  -3.262  1.00 29.49  ? 32  TYR C CE2 1 
ATOM 3137  C CZ  . TYR C 3 32  ? -0.240  83.322  -2.298  1.00 33.73  ? 32  TYR C CZ  1 
ATOM 3138  O OH  . TYR C 3 32  ? 0.236   82.838  -1.102  1.00 41.44  ? 32  TYR C OH  1 
ATOM 3139  N N   . TRP C 3 33  ? -4.216  84.170  -7.787  1.00 35.87  ? 33  TRP C N   1 
ATOM 3140  C CA  . TRP C 3 33  ? -5.286  84.708  -8.611  1.00 36.96  ? 33  TRP C CA  1 
ATOM 3141  C C   . TRP C 3 33  ? -5.367  86.222  -8.447  1.00 38.60  ? 33  TRP C C   1 
ATOM 3142  O O   . TRP C 3 33  ? -4.817  86.786  -7.497  1.00 37.15  ? 33  TRP C O   1 
ATOM 3143  C CB  . TRP C 3 33  ? -6.631  84.178  -8.150  1.00 38.50  ? 33  TRP C CB  1 
ATOM 3144  C CG  . TRP C 3 33  ? -7.004  82.881  -8.680  1.00 39.20  ? 33  TRP C CG  1 
ATOM 3145  C CD1 . TRP C 3 33  ? -6.858  81.675  -8.071  1.00 42.62  ? 33  TRP C CD1 1 
ATOM 3146  C CD2 . TRP C 3 33  ? -7.649  82.631  -9.929  1.00 38.86  ? 33  TRP C CD2 1 
ATOM 3147  N NE1 . TRP C 3 33  ? -7.384  80.680  -8.865  1.00 39.28  ? 33  TRP C NE1 1 
ATOM 3148  C CE2 . TRP C 3 33  ? -7.873  81.244  -10.013 1.00 34.87  ? 33  TRP C CE2 1 
ATOM 3149  C CE3 . TRP C 3 33  ? -8.059  83.449  -10.988 1.00 40.43  ? 33  TRP C CE3 1 
ATOM 3150  C CZ2 . TRP C 3 33  ? -8.493  80.655  -11.106 1.00 33.74  ? 33  TRP C CZ2 1 
ATOM 3151  C CZ3 . TRP C 3 33  ? -8.673  82.863  -12.072 1.00 39.64  ? 33  TRP C CZ3 1 
ATOM 3152  C CH2 . TRP C 3 33  ? -8.886  81.477  -12.122 1.00 37.30  ? 33  TRP C CH2 1 
ATOM 3153  N N   . ILE C 3 34  ? -6.085  86.857  -9.373  1.00 39.53  ? 34  ILE C N   1 
ATOM 3154  C CA  . ILE C 3 34  ? -6.346  88.299  -9.343  1.00 37.51  ? 34  ILE C CA  1 
ATOM 3155  C C   . ILE C 3 34  ? -7.834  88.444  -9.621  1.00 35.03  ? 34  ILE C C   1 
ATOM 3156  O O   . ILE C 3 34  ? -8.317  88.067  -10.688 1.00 36.39  ? 34  ILE C O   1 
ATOM 3157  C CB  . ILE C 3 34  ? -5.573  89.079  -10.422 1.00 34.46  ? 34  ILE C CB  1 
ATOM 3158  C CG1 . ILE C 3 34  ? -4.078  89.045  -10.122 1.00 36.08  ? 34  ILE C CG1 1 
ATOM 3159  C CG2 . ILE C 3 34  ? -6.043  90.519  -10.455 1.00 26.84  ? 34  ILE C CG2 1 
ATOM 3160  C CD1 . ILE C 3 34  ? -3.685  89.662  -8.792  1.00 37.16  ? 34  ILE C CD1 1 
ATOM 3161  N N   . ASN C 3 35  ? -8.566  88.966  -8.654  1.00 32.94  ? 35  ASN C N   1 
ATOM 3162  C CA  . ASN C 3 35  ? -9.991  89.119  -8.833  1.00 32.19  ? 35  ASN C CA  1 
ATOM 3163  C C   . ASN C 3 35  ? -10.338 90.554  -8.999  1.00 34.31  ? 35  ASN C C   1 
ATOM 3164  O O   . ASN C 3 35  ? -9.977  91.385  -8.172  1.00 41.98  ? 35  ASN C O   1 
ATOM 3165  C CB  . ASN C 3 35  ? -10.733 88.552  -7.646  1.00 32.42  ? 35  ASN C CB  1 
ATOM 3166  C CG  . ASN C 3 35  ? -10.815 87.054  -7.702  1.00 34.47  ? 35  ASN C CG  1 
ATOM 3167  O OD1 . ASN C 3 35  ? -11.842 86.490  -8.120  1.00 31.75  ? 35  ASN C OD1 1 
ATOM 3168  N ND2 . ASN C 3 35  ? -9.722  86.386  -7.307  1.00 30.35  ? 35  ASN C ND2 1 
ATOM 3169  N N   . TRP C 3 36  ? -11.047 90.844  -10.079 1.00 31.08  ? 36  TRP C N   1 
ATOM 3170  C CA  . TRP C 3 36  ? -11.437 92.201  -10.363 1.00 23.59  ? 36  TRP C CA  1 
ATOM 3171  C C   . TRP C 3 36  ? -12.872 92.455  -9.967  1.00 23.66  ? 36  TRP C C   1 
ATOM 3172  O O   . TRP C 3 36  ? -13.780 91.736  -10.375 1.00 25.52  ? 36  TRP C O   1 
ATOM 3173  C CB  . TRP C 3 36  ? -11.242 92.511  -11.845 1.00 17.26  ? 36  TRP C CB  1 
ATOM 3174  C CG  . TRP C 3 36  ? -9.789  92.521  -12.283 1.00 18.54  ? 36  TRP C CG  1 
ATOM 3175  C CD1 . TRP C 3 36  ? -9.007  91.433  -12.526 1.00 11.16  ? 36  TRP C CD1 1 
ATOM 3176  C CD2 . TRP C 3 36  ? -8.956  93.680  -12.543 1.00 17.52  ? 36  TRP C CD2 1 
ATOM 3177  N NE1 . TRP C 3 36  ? -7.745  91.829  -12.923 1.00 21.12  ? 36  TRP C NE1 1 
ATOM 3178  C CE2 . TRP C 3 36  ? -7.684  93.200  -12.941 1.00 16.92  ? 36  TRP C CE2 1 
ATOM 3179  C CE3 . TRP C 3 36  ? -9.162  95.066  -12.479 1.00 7.87   ? 36  TRP C CE3 1 
ATOM 3180  C CZ2 . TRP C 3 36  ? -6.615  94.060  -13.277 1.00 15.23  ? 36  TRP C CZ2 1 
ATOM 3181  C CZ3 . TRP C 3 36  ? -8.100  95.918  -12.814 1.00 9.48   ? 36  TRP C CZ3 1 
ATOM 3182  C CH2 . TRP C 3 36  ? -6.843  95.407  -13.206 1.00 11.91  ? 36  TRP C CH2 1 
ATOM 3183  N N   . VAL C 3 37  ? -13.068 93.471  -9.142  1.00 20.68  ? 37  VAL C N   1 
ATOM 3184  C CA  . VAL C 3 37  ? -14.400 93.840  -8.741  1.00 25.74  ? 37  VAL C CA  1 
ATOM 3185  C C   . VAL C 3 37  ? -14.587 95.318  -9.068  1.00 27.57  ? 37  VAL C C   1 
ATOM 3186  O O   . VAL C 3 37  ? -13.687 96.140  -8.867  1.00 26.72  ? 37  VAL C O   1 
ATOM 3187  C CB  . VAL C 3 37  ? -14.642 93.562  -7.251  1.00 24.57  ? 37  VAL C CB  1 
ATOM 3188  C CG1 . VAL C 3 37  ? -13.450 93.952  -6.463  1.00 25.63  ? 37  VAL C CG1 1 
ATOM 3189  C CG2 . VAL C 3 37  ? -15.855 94.328  -6.772  1.00 23.42  ? 37  VAL C CG2 1 
ATOM 3190  N N   . LYS C 3 38  ? -15.757 95.624  -9.619  1.00 31.57  ? 38  LYS C N   1 
ATOM 3191  C CA  . LYS C 3 38  ? -16.126 96.971  -10.028 1.00 36.18  ? 38  LYS C CA  1 
ATOM 3192  C C   . LYS C 3 38  ? -17.191 97.521  -9.097  1.00 36.49  ? 38  LYS C C   1 
ATOM 3193  O O   . LYS C 3 38  ? -18.055 96.784  -8.629  1.00 38.29  ? 38  LYS C O   1 
ATOM 3194  C CB  . LYS C 3 38  ? -16.644 96.947  -11.480 1.00 36.64  ? 38  LYS C CB  1 
ATOM 3195  C CG  . LYS C 3 38  ? -17.840 97.852  -11.758 1.00 38.56  ? 38  LYS C CG  1 
ATOM 3196  C CD  . LYS C 3 38  ? -18.126 97.980  -13.252 1.00 38.87  ? 38  LYS C CD  1 
ATOM 3197  C CE  . LYS C 3 38  ? -19.494 98.628  -13.508 1.00 40.30  ? 38  LYS C CE  1 
ATOM 3198  N NZ  . LYS C 3 38  ? -19.797 98.731  -14.967 1.00 44.46  ? 38  LYS C NZ  1 
ATOM 3199  N N   . GLN C 3 39  ? -17.135 98.821  -8.836  1.00 37.96  ? 39  GLN C N   1 
ATOM 3200  C CA  . GLN C 3 39  ? -18.107 99.440  -7.949  1.00 41.70  ? 39  GLN C CA  1 
ATOM 3201  C C   . GLN C 3 39  ? -18.444 100.858 -8.388  1.00 46.99  ? 39  GLN C C   1 
ATOM 3202  O O   . GLN C 3 39  ? -17.556 101.700 -8.584  1.00 45.07  ? 39  GLN C O   1 
ATOM 3203  C CB  . GLN C 3 39  ? -17.573 99.443  -6.517  1.00 36.05  ? 39  GLN C CB  1 
ATOM 3204  C CG  . GLN C 3 39  ? -18.401 100.248 -5.540  1.00 36.73  ? 39  GLN C CG  1 
ATOM 3205  C CD  . GLN C 3 39  ? -17.833 100.216 -4.120  1.00 39.09  ? 39  GLN C CD  1 
ATOM 3206  O OE1 . GLN C 3 39  ? -16.623 100.391 -3.902  1.00 37.61  ? 39  GLN C OE1 1 
ATOM 3207  N NE2 . GLN C 3 39  ? -18.712 100.005 -3.145  1.00 38.23  ? 39  GLN C NE2 1 
ATOM 3208  N N   . ARG C 3 40  ? -19.738 101.109 -8.548  1.00 52.43  ? 40  ARG C N   1 
ATOM 3209  C CA  . ARG C 3 40  ? -20.209 102.417 -8.967  1.00 58.76  ? 40  ARG C CA  1 
ATOM 3210  C C   . ARG C 3 40  ? -20.535 103.254 -7.747  1.00 62.04  ? 40  ARG C C   1 
ATOM 3211  O O   . ARG C 3 40  ? -20.910 102.713 -6.714  1.00 61.65  ? 40  ARG C O   1 
ATOM 3212  C CB  . ARG C 3 40  ? -21.428 102.270 -9.887  1.00 59.53  ? 40  ARG C CB  1 
ATOM 3213  C CG  . ARG C 3 40  ? -21.049 102.326 -11.374 1.00 66.85  ? 40  ARG C CG  1 
ATOM 3214  C CD  . ARG C 3 40  ? -22.049 101.624 -12.259 1.00 72.14  ? 40  ARG C CD  1 
ATOM 3215  N NE  . ARG C 3 40  ? -23.410 101.951 -11.869 1.00 83.92  ? 40  ARG C NE  1 
ATOM 3216  C CZ  . ARG C 3 40  ? -24.490 101.415 -12.426 1.00 91.06  ? 40  ARG C CZ  1 
ATOM 3217  N NH1 . ARG C 3 40  ? -24.353 100.526 -13.405 1.00 95.71  ? 40  ARG C NH1 1 
ATOM 3218  N NH2 . ARG C 3 40  ? -25.703 101.761 -11.999 1.00 95.14  ? 40  ARG C NH2 1 
ATOM 3219  N N   . PRO C 3 41  ? -20.376 104.590 -7.849  1.00 67.63  ? 41  PRO C N   1 
ATOM 3220  C CA  . PRO C 3 41  ? -20.649 105.525 -6.748  1.00 69.62  ? 41  PRO C CA  1 
ATOM 3221  C C   . PRO C 3 41  ? -21.842 105.113 -5.886  1.00 72.13  ? 41  PRO C C   1 
ATOM 3222  O O   . PRO C 3 41  ? -22.975 105.023 -6.377  1.00 74.25  ? 41  PRO C O   1 
ATOM 3223  C CB  . PRO C 3 41  ? -20.870 106.846 -7.478  1.00 66.14  ? 41  PRO C CB  1 
ATOM 3224  C CG  . PRO C 3 41  ? -19.863 106.757 -8.592  1.00 64.84  ? 41  PRO C CG  1 
ATOM 3225  C CD  . PRO C 3 41  ? -20.053 105.332 -9.088  1.00 67.33  ? 41  PRO C CD  1 
ATOM 3226  N N   . GLY C 3 42  ? -21.572 104.857 -4.605  1.00 74.40  ? 42  GLY C N   1 
ATOM 3227  C CA  . GLY C 3 42  ? -22.620 104.447 -3.680  1.00 76.19  ? 42  GLY C CA  1 
ATOM 3228  C C   . GLY C 3 42  ? -23.439 103.298 -4.242  1.00 76.68  ? 42  GLY C C   1 
ATOM 3229  O O   . GLY C 3 42  ? -24.644 103.419 -4.474  1.00 74.81  ? 42  GLY C O   1 
ATOM 3230  N N   . GLN C 3 43  ? -22.773 102.173 -4.466  1.00 76.82  ? 43  GLN C N   1 
ATOM 3231  C CA  . GLN C 3 43  ? -23.426 101.004 -5.028  1.00 77.27  ? 43  GLN C CA  1 
ATOM 3232  C C   . GLN C 3 43  ? -22.750 99.754  -4.492  1.00 75.50  ? 43  GLN C C   1 
ATOM 3233  O O   . GLN C 3 43  ? -21.646 99.816  -3.939  1.00 74.14  ? 43  GLN C O   1 
ATOM 3234  C CB  . GLN C 3 43  ? -23.310 101.027 -6.558  1.00 79.59  ? 43  GLN C CB  1 
ATOM 3235  C CG  . GLN C 3 43  ? -23.973 102.224 -7.233  1.00 80.74  ? 43  GLN C CG  1 
ATOM 3236  C CD  . GLN C 3 43  ? -25.448 101.999 -7.485  1.00 82.75  ? 43  GLN C CD  1 
ATOM 3237  O OE1 . GLN C 3 43  ? -25.832 101.287 -8.419  1.00 83.29  ? 43  GLN C OE1 1 
ATOM 3238  N NE2 . GLN C 3 43  ? -26.287 102.592 -6.644  1.00 81.04  ? 43  GLN C NE2 1 
ATOM 3239  N N   . GLY C 3 44  ? -23.426 98.620  -4.659  1.00 73.20  ? 44  GLY C N   1 
ATOM 3240  C CA  . GLY C 3 44  ? -22.871 97.361  -4.211  1.00 65.81  ? 44  GLY C CA  1 
ATOM 3241  C C   . GLY C 3 44  ? -21.684 97.002  -5.083  1.00 59.87  ? 44  GLY C C   1 
ATOM 3242  O O   . GLY C 3 44  ? -21.439 97.619  -6.131  1.00 59.86  ? 44  GLY C O   1 
ATOM 3243  N N   . LEU C 3 45  ? -20.938 95.999  -4.646  1.00 53.17  ? 45  LEU C N   1 
ATOM 3244  C CA  . LEU C 3 45  ? -19.772 95.548  -5.377  1.00 42.19  ? 45  LEU C CA  1 
ATOM 3245  C C   . LEU C 3 45  ? -20.219 94.586  -6.467  1.00 37.36  ? 45  LEU C C   1 
ATOM 3246  O O   . LEU C 3 45  ? -21.316 94.046  -6.419  1.00 34.70  ? 45  LEU C O   1 
ATOM 3247  C CB  . LEU C 3 45  ? -18.825 94.853  -4.412  1.00 42.02  ? 45  LEU C CB  1 
ATOM 3248  C CG  . LEU C 3 45  ? -18.504 95.694  -3.177  1.00 34.17  ? 45  LEU C CG  1 
ATOM 3249  C CD1 . LEU C 3 45  ? -17.797 94.866  -2.124  1.00 37.83  ? 45  LEU C CD1 1 
ATOM 3250  C CD2 . LEU C 3 45  ? -17.648 96.836  -3.601  1.00 34.20  ? 45  LEU C CD2 1 
ATOM 3251  N N   . GLU C 3 46  ? -19.368 94.374  -7.452  1.00 35.79  ? 46  GLU C N   1 
ATOM 3252  C CA  . GLU C 3 46  ? -19.706 93.474  -8.533  1.00 38.87  ? 46  GLU C CA  1 
ATOM 3253  C C   . GLU C 3 46  ? -18.501 92.662  -8.948  1.00 34.90  ? 46  GLU C C   1 
ATOM 3254  O O   . GLU C 3 46  ? -17.524 93.230  -9.423  1.00 36.69  ? 46  GLU C O   1 
ATOM 3255  C CB  . GLU C 3 46  ? -20.194 94.257  -9.738  1.00 42.46  ? 46  GLU C CB  1 
ATOM 3256  C CG  . GLU C 3 46  ? -21.602 94.775  -9.620  1.00 56.73  ? 46  GLU C CG  1 
ATOM 3257  C CD  . GLU C 3 46  ? -22.169 95.217  -10.967 1.00 66.39  ? 46  GLU C CD  1 
ATOM 3258  O OE1 . GLU C 3 46  ? -23.346 95.636  -11.012 1.00 76.77  ? 46  GLU C OE1 1 
ATOM 3259  O OE2 . GLU C 3 46  ? -21.441 95.147  -11.985 1.00 69.98  ? 46  GLU C OE2 1 
ATOM 3260  N N   . TRP C 3 47  ? -18.556 91.340  -8.785  1.00 28.21  ? 47  TRP C N   1 
ATOM 3261  C CA  . TRP C 3 47  ? -17.417 90.537  -9.189  1.00 27.16  ? 47  TRP C CA  1 
ATOM 3262  C C   . TRP C 3 47  ? -17.325 90.619  -10.699 1.00 28.20  ? 47  TRP C C   1 
ATOM 3263  O O   . TRP C 3 47  ? -18.292 90.364  -11.408 1.00 31.50  ? 47  TRP C O   1 
ATOM 3264  C CB  . TRP C 3 47  ? -17.573 89.080  -8.753  1.00 27.59  ? 47  TRP C CB  1 
ATOM 3265  C CG  . TRP C 3 47  ? -16.338 88.274  -9.037  1.00 28.45  ? 47  TRP C CG  1 
ATOM 3266  C CD1 . TRP C 3 47  ? -15.102 88.428  -8.473  1.00 25.42  ? 47  TRP C CD1 1 
ATOM 3267  C CD2 . TRP C 3 47  ? -16.214 87.215  -9.988  1.00 31.86  ? 47  TRP C CD2 1 
ATOM 3268  N NE1 . TRP C 3 47  ? -14.211 87.527  -9.016  1.00 26.93  ? 47  TRP C NE1 1 
ATOM 3269  C CE2 . TRP C 3 47  ? -14.868 86.772  -9.950  1.00 28.93  ? 47  TRP C CE2 1 
ATOM 3270  C CE3 . TRP C 3 47  ? -17.109 86.596  -10.872 1.00 28.13  ? 47  TRP C CE3 1 
ATOM 3271  C CZ2 . TRP C 3 47  ? -14.400 85.741  -10.759 1.00 25.78  ? 47  TRP C CZ2 1 
ATOM 3272  C CZ3 . TRP C 3 47  ? -16.644 85.574  -11.674 1.00 27.31  ? 47  TRP C CZ3 1 
ATOM 3273  C CH2 . TRP C 3 47  ? -15.300 85.154  -11.614 1.00 28.90  ? 47  TRP C CH2 1 
ATOM 3274  N N   . VAL C 3 48  ? -16.166 90.997  -11.198 1.00 28.84  ? 48  VAL C N   1 
ATOM 3275  C CA  . VAL C 3 48  ? -16.009 91.101  -12.636 1.00 30.16  ? 48  VAL C CA  1 
ATOM 3276  C C   . VAL C 3 48  ? -15.575 89.764  -13.226 1.00 33.58  ? 48  VAL C C   1 
ATOM 3277  O O   . VAL C 3 48  ? -16.216 89.240  -14.131 1.00 36.77  ? 48  VAL C O   1 
ATOM 3278  C CB  . VAL C 3 48  ? -14.981 92.188  -13.002 1.00 29.17  ? 48  VAL C CB  1 
ATOM 3279  C CG1 . VAL C 3 48  ? -14.717 92.175  -14.481 1.00 25.43  ? 48  VAL C CG1 1 
ATOM 3280  C CG2 . VAL C 3 48  ? -15.511 93.555  -12.590 1.00 23.95  ? 48  VAL C CG2 1 
ATOM 3281  N N   . GLY C 3 49  ? -14.493 89.206  -12.702 1.00 33.41  ? 49  GLY C N   1 
ATOM 3282  C CA  . GLY C 3 49  ? -13.994 87.943  -13.199 1.00 30.25  ? 49  GLY C CA  1 
ATOM 3283  C C   . GLY C 3 49  ? -12.632 87.764  -12.581 1.00 31.17  ? 49  GLY C C   1 
ATOM 3284  O O   . GLY C 3 49  ? -12.145 88.667  -11.915 1.00 35.64  ? 49  GLY C O   1 
ATOM 3285  N N   . ASN C 3 50  ? -12.005 86.616  -12.779 1.00 31.05  ? 50  ASN C N   1 
ATOM 3286  C CA  . ASN C 3 50  ? -10.692 86.387  -12.196 1.00 27.24  ? 50  ASN C CA  1 
ATOM 3287  C C   . ASN C 3 50  ? -9.731  85.858  -13.233 1.00 24.45  ? 50  ASN C C   1 
ATOM 3288  O O   . ASN C 3 50  ? -10.120 85.496  -14.341 1.00 20.49  ? 50  ASN C O   1 
ATOM 3289  C CB  . ASN C 3 50  ? -10.780 85.391  -11.049 1.00 28.76  ? 50  ASN C CB  1 
ATOM 3290  C CG  . ASN C 3 50  ? -11.328 84.048  -11.487 1.00 29.31  ? 50  ASN C CG  1 
ATOM 3291  O OD1 . ASN C 3 50  ? -11.294 83.070  -10.735 1.00 32.06  ? 50  ASN C OD1 1 
ATOM 3292  N ND2 . ASN C 3 50  ? -11.839 83.992  -12.709 1.00 26.55  ? 50  ASN C ND2 1 
ATOM 3293  N N   . ILE C 3 51  ? -8.463  85.816  -12.877 1.00 23.76  ? 51  ILE C N   1 
ATOM 3294  C CA  . ILE C 3 51  ? -7.484  85.327  -13.817 1.00 26.83  ? 51  ILE C CA  1 
ATOM 3295  C C   . ILE C 3 51  ? -6.264  84.911  -13.052 1.00 28.18  ? 51  ILE C C   1 
ATOM 3296  O O   . ILE C 3 51  ? -5.730  85.667  -12.251 1.00 28.38  ? 51  ILE C O   1 
ATOM 3297  C CB  . ILE C 3 51  ? -7.103  86.405  -14.883 1.00 22.45  ? 51  ILE C CB  1 
ATOM 3298  C CG1 . ILE C 3 51  ? -6.034  85.861  -15.839 1.00 15.72  ? 51  ILE C CG1 1 
ATOM 3299  C CG2 . ILE C 3 51  ? -6.559  87.642  -14.204 1.00 19.72  ? 51  ILE C CG2 1 
ATOM 3300  C CD1 . ILE C 3 51  ? -5.929  86.639  -17.147 1.00 14.02  ? 51  ILE C CD1 1 
ATOM 3301  N N   . PHE C 3 52  ? -5.859  83.672  -13.275 1.00 32.16  ? 52  PHE C N   1 
ATOM 3302  C CA  . PHE C 3 52  ? -4.688  83.137  -12.623 1.00 36.93  ? 52  PHE C CA  1 
ATOM 3303  C C   . PHE C 3 52  ? -3.582  83.408  -13.600 1.00 39.80  ? 52  PHE C C   1 
ATOM 3304  O O   . PHE C 3 52  ? -3.695  83.030  -14.755 1.00 43.06  ? 52  PHE C O   1 
ATOM 3305  C CB  . PHE C 3 52  ? -4.819  81.626  -12.431 1.00 32.95  ? 52  PHE C CB  1 
ATOM 3306  C CG  . PHE C 3 52  ? -3.860  81.076  -11.438 1.00 32.26  ? 52  PHE C CG  1 
ATOM 3307  C CD1 . PHE C 3 52  ? -4.124  81.183  -10.076 1.00 29.73  ? 52  PHE C CD1 1 
ATOM 3308  C CD2 . PHE C 3 52  ? -2.647  80.545  -11.845 1.00 37.69  ? 52  PHE C CD2 1 
ATOM 3309  C CE1 . PHE C 3 52  ? -3.190  80.779  -9.123  1.00 29.82  ? 52  PHE C CE1 1 
ATOM 3310  C CE2 . PHE C 3 52  ? -1.694  80.135  -10.902 1.00 39.17  ? 52  PHE C CE2 1 
ATOM 3311  C CZ  . PHE C 3 52  ? -1.970  80.256  -9.533  1.00 32.43  ? 52  PHE C CZ  1 
ATOM 3312  N N   . PRO C 3 53  ? -2.516  84.104  -13.179 1.00 44.14  ? 53  PRO C N   1 
ATOM 3313  C CA  . PRO C 3 53  ? -1.431  84.353  -14.140 1.00 45.87  ? 53  PRO C CA  1 
ATOM 3314  C C   . PRO C 3 53  ? -0.802  82.996  -14.443 1.00 43.87  ? 53  PRO C C   1 
ATOM 3315  O O   . PRO C 3 53  ? -1.448  81.979  -14.242 1.00 47.44  ? 53  PRO C O   1 
ATOM 3316  C CB  . PRO C 3 53  ? -0.502  85.300  -13.377 1.00 48.16  ? 53  PRO C CB  1 
ATOM 3317  C CG  . PRO C 3 53  ? -0.756  84.957  -11.934 1.00 49.44  ? 53  PRO C CG  1 
ATOM 3318  C CD  . PRO C 3 53  ? -2.261  84.786  -11.901 1.00 45.98  ? 53  PRO C CD  1 
ATOM 3319  N N   . SER C 3 54  ? 0.438   82.951  -14.908 1.00 43.51  ? 54  SER C N   1 
ATOM 3320  C CA  . SER C 3 54  ? 1.079   81.655  -15.209 1.00 44.51  ? 54  SER C CA  1 
ATOM 3321  C C   . SER C 3 54  ? 0.447   80.976  -16.431 1.00 45.77  ? 54  SER C C   1 
ATOM 3322  O O   . SER C 3 54  ? 1.065   80.918  -17.495 1.00 51.48  ? 54  SER C O   1 
ATOM 3323  C CB  . SER C 3 54  ? 1.032   80.694  -13.989 1.00 40.69  ? 54  SER C CB  1 
ATOM 3324  O OG  . SER C 3 54  ? -0.027  79.747  -14.056 1.00 23.14  ? 54  SER C OG  1 
ATOM 3325  N N   . ASP C 3 55  ? -0.776  80.471  -16.300 1.00 43.41  ? 55  ASP C N   1 
ATOM 3326  C CA  . ASP C 3 55  ? -1.420  79.822  -17.432 1.00 40.46  ? 55  ASP C CA  1 
ATOM 3327  C C   . ASP C 3 55  ? -2.584  80.680  -17.919 1.00 38.82  ? 55  ASP C C   1 
ATOM 3328  O O   . ASP C 3 55  ? -3.391  80.263  -18.747 1.00 40.90  ? 55  ASP C O   1 
ATOM 3329  C CB  . ASP C 3 55  ? -1.903  78.428  -17.034 1.00 37.71  ? 55  ASP C CB  1 
ATOM 3330  C CG  . ASP C 3 55  ? -3.289  78.442  -16.461 1.00 42.21  ? 55  ASP C CG  1 
ATOM 3331  O OD1 . ASP C 3 55  ? -3.545  79.259  -15.560 1.00 46.22  ? 55  ASP C OD1 1 
ATOM 3332  O OD2 . ASP C 3 55  ? -4.130  77.639  -16.912 1.00 51.71  ? 55  ASP C OD2 1 
ATOM 3333  N N   . SER C 3 56  ? -2.648  81.894  -17.398 1.00 36.47  ? 56  SER C N   1 
ATOM 3334  C CA  . SER C 3 56  ? -3.697  82.846  -17.748 1.00 38.80  ? 56  SER C CA  1 
ATOM 3335  C C   . SER C 3 56  ? -5.131  82.292  -17.818 1.00 37.52  ? 56  SER C C   1 
ATOM 3336  O O   . SER C 3 56  ? -5.933  82.723  -18.648 1.00 34.63  ? 56  SER C O   1 
ATOM 3337  C CB  . SER C 3 56  ? -3.334  83.559  -19.051 1.00 33.43  ? 56  SER C CB  1 
ATOM 3338  O OG  . SER C 3 56  ? -2.083  84.214  -18.903 1.00 39.76  ? 56  SER C OG  1 
ATOM 3339  N N   . TYR C 3 57  ? -5.447  81.350  -16.931 1.00 37.55  ? 57  TYR C N   1 
ATOM 3340  C CA  . TYR C 3 57  ? -6.792  80.763  -16.865 1.00 37.10  ? 57  TYR C CA  1 
ATOM 3341  C C   . TYR C 3 57  ? -7.741  81.871  -16.363 1.00 35.86  ? 57  TYR C C   1 
ATOM 3342  O O   . TYR C 3 57  ? -7.371  82.658  -15.490 1.00 37.29  ? 57  TYR C O   1 
ATOM 3343  C CB  . TYR C 3 57  ? -6.794  79.538  -15.913 1.00 34.63  ? 57  TYR C CB  1 
ATOM 3344  C CG  . TYR C 3 57  ? -8.112  78.774  -15.841 1.00 32.90  ? 57  TYR C CG  1 
ATOM 3345  C CD1 . TYR C 3 57  ? -8.171  77.409  -16.120 1.00 32.78  ? 57  TYR C CD1 1 
ATOM 3346  C CD2 . TYR C 3 57  ? -9.299  79.419  -15.501 1.00 32.67  ? 57  TYR C CD2 1 
ATOM 3347  C CE1 . TYR C 3 57  ? -9.394  76.704  -16.065 1.00 34.13  ? 57  TYR C CE1 1 
ATOM 3348  C CE2 . TYR C 3 57  ? -10.520 78.727  -15.439 1.00 38.53  ? 57  TYR C CE2 1 
ATOM 3349  C CZ  . TYR C 3 57  ? -10.564 77.371  -15.724 1.00 38.21  ? 57  TYR C CZ  1 
ATOM 3350  O OH  . TYR C 3 57  ? -11.783 76.709  -15.673 1.00 39.62  ? 57  TYR C OH  1 
ATOM 3351  N N   . THR C 3 58  ? -8.957  81.940  -16.897 1.00 35.96  ? 58  THR C N   1 
ATOM 3352  C CA  . THR C 3 58  ? -9.865  83.007  -16.481 1.00 36.13  ? 58  THR C CA  1 
ATOM 3353  C C   . THR C 3 58  ? -11.329 82.603  -16.377 1.00 34.87  ? 58  THR C C   1 
ATOM 3354  O O   . THR C 3 58  ? -11.765 81.672  -17.042 1.00 38.28  ? 58  THR C O   1 
ATOM 3355  C CB  . THR C 3 58  ? -9.829  84.175  -17.475 1.00 34.83  ? 58  THR C CB  1 
ATOM 3356  O OG1 . THR C 3 58  ? -10.820 83.951  -18.486 1.00 36.41  ? 58  THR C OG1 1 
ATOM 3357  C CG2 . THR C 3 58  ? -8.470  84.270  -18.149 1.00 36.40  ? 58  THR C CG2 1 
ATOM 3358  N N   . ASN C 3 59  ? -12.081 83.335  -15.558 1.00 32.12  ? 59  ASN C N   1 
ATOM 3359  C CA  . ASN C 3 59  ? -13.508 83.110  -15.379 1.00 30.57  ? 59  ASN C CA  1 
ATOM 3360  C C   . ASN C 3 59  ? -14.144 84.480  -15.419 1.00 29.07  ? 59  ASN C C   1 
ATOM 3361  O O   . ASN C 3 59  ? -13.701 85.369  -14.710 1.00 30.38  ? 59  ASN C O   1 
ATOM 3362  C CB  . ASN C 3 59  ? -13.818 82.479  -14.020 1.00 33.60  ? 59  ASN C CB  1 
ATOM 3363  C CG  . ASN C 3 59  ? -13.395 81.028  -13.924 1.00 38.62  ? 59  ASN C CG  1 
ATOM 3364  O OD1 . ASN C 3 59  ? -12.302 80.706  -13.436 1.00 46.49  ? 59  ASN C OD1 1 
ATOM 3365  N ND2 . ASN C 3 59  ? -14.265 80.136  -14.385 1.00 38.47  ? 59  ASN C ND2 1 
ATOM 3366  N N   . TYR C 3 60  ? -15.178 84.660  -16.230 1.00 28.53  ? 60  TYR C N   1 
ATOM 3367  C CA  . TYR C 3 60  ? -15.832 85.963  -16.313 1.00 30.28  ? 60  TYR C CA  1 
ATOM 3368  C C   . TYR C 3 60  ? -17.240 85.917  -15.776 1.00 33.95  ? 60  TYR C C   1 
ATOM 3369  O O   . TYR C 3 60  ? -17.945 84.925  -15.942 1.00 39.22  ? 60  TYR C O   1 
ATOM 3370  C CB  . TYR C 3 60  ? -15.912 86.467  -17.763 1.00 29.36  ? 60  TYR C CB  1 
ATOM 3371  C CG  . TYR C 3 60  ? -14.594 86.882  -18.398 1.00 27.07  ? 60  TYR C CG  1 
ATOM 3372  C CD1 . TYR C 3 60  ? -14.400 88.185  -18.863 1.00 23.38  ? 60  TYR C CD1 1 
ATOM 3373  C CD2 . TYR C 3 60  ? -13.549 85.971  -18.545 1.00 24.60  ? 60  TYR C CD2 1 
ATOM 3374  C CE1 . TYR C 3 60  ? -13.188 88.575  -19.460 1.00 25.25  ? 60  TYR C CE1 1 
ATOM 3375  C CE2 . TYR C 3 60  ? -12.337 86.348  -19.139 1.00 27.32  ? 60  TYR C CE2 1 
ATOM 3376  C CZ  . TYR C 3 60  ? -12.156 87.649  -19.593 1.00 26.67  ? 60  TYR C CZ  1 
ATOM 3377  O OH  . TYR C 3 60  ? -10.939 88.014  -20.153 1.00 27.11  ? 60  TYR C OH  1 
ATOM 3378  N N   . ASN C 3 61  ? -17.643 86.996  -15.115 1.00 37.52  ? 61  ASN C N   1 
ATOM 3379  C CA  . ASN C 3 61  ? -19.002 87.108  -14.611 1.00 39.57  ? 61  ASN C CA  1 
ATOM 3380  C C   . ASN C 3 61  ? -19.733 87.294  -15.926 1.00 43.65  ? 61  ASN C C   1 
ATOM 3381  O O   . ASN C 3 61  ? -19.194 87.900  -16.845 1.00 40.79  ? 61  ASN C O   1 
ATOM 3382  C CB  . ASN C 3 61  ? -19.154 88.360  -13.754 1.00 38.66  ? 61  ASN C CB  1 
ATOM 3383  C CG  . ASN C 3 61  ? -20.589 88.622  -13.368 1.00 42.47  ? 61  ASN C CG  1 
ATOM 3384  O OD1 . ASN C 3 61  ? -21.492 88.472  -14.193 1.00 41.40  ? 61  ASN C OD1 1 
ATOM 3385  N ND2 . ASN C 3 61  ? -20.814 89.028  -12.112 1.00 46.07  ? 61  ASN C ND2 1 
ATOM 3386  N N   . GLN C 3 62  ? -20.943 86.781  -16.042 1.00 49.19  ? 62  GLN C N   1 
ATOM 3387  C CA  . GLN C 3 62  ? -21.653 86.917  -17.302 1.00 54.12  ? 62  GLN C CA  1 
ATOM 3388  C C   . GLN C 3 62  ? -21.768 88.362  -17.800 1.00 52.90  ? 62  GLN C C   1 
ATOM 3389  O O   . GLN C 3 62  ? -21.379 88.667  -18.932 1.00 50.26  ? 62  GLN C O   1 
ATOM 3390  C CB  . GLN C 3 62  ? -23.046 86.293  -17.185 1.00 62.42  ? 62  GLN C CB  1 
ATOM 3391  C CG  . GLN C 3 62  ? -23.599 85.846  -18.523 1.00 73.07  ? 62  GLN C CG  1 
ATOM 3392  C CD  . GLN C 3 62  ? -22.588 85.005  -19.303 1.00 83.85  ? 62  GLN C CD  1 
ATOM 3393  O OE1 . GLN C 3 62  ? -22.199 83.916  -18.869 1.00 89.87  ? 62  GLN C OE1 1 
ATOM 3394  N NE2 . GLN C 3 62  ? -22.152 85.515  -20.455 1.00 88.46  ? 62  GLN C NE2 1 
ATOM 3395  N N   . LYS C 3 63  ? -22.299 89.240  -16.947 1.00 51.14  ? 63  LYS C N   1 
ATOM 3396  C CA  . LYS C 3 63  ? -22.504 90.653  -17.273 1.00 49.89  ? 63  LYS C CA  1 
ATOM 3397  C C   . LYS C 3 63  ? -21.393 91.309  -18.070 1.00 50.52  ? 63  LYS C C   1 
ATOM 3398  O O   . LYS C 3 63  ? -21.645 92.246  -18.818 1.00 50.09  ? 63  LYS C O   1 
ATOM 3399  C CB  . LYS C 3 63  ? -22.723 91.476  -15.995 1.00 53.42  ? 63  LYS C CB  1 
ATOM 3400  C CG  . LYS C 3 63  ? -24.183 91.650  -15.550 1.00 62.73  ? 63  LYS C CG  1 
ATOM 3401  C CD  . LYS C 3 63  ? -24.896 90.313  -15.273 1.00 72.15  ? 63  LYS C CD  1 
ATOM 3402  C CE  . LYS C 3 63  ? -24.308 89.556  -14.069 1.00 78.59  ? 63  LYS C CE  1 
ATOM 3403  N NZ  . LYS C 3 63  ? -24.859 88.165  -13.901 1.00 81.09  ? 63  LYS C NZ  1 
ATOM 3404  N N   . PHE C 3 64  ? -20.166 90.820  -17.923 1.00 52.59  ? 64  PHE C N   1 
ATOM 3405  C CA  . PHE C 3 64  ? -19.033 91.424  -18.612 1.00 52.20  ? 64  PHE C CA  1 
ATOM 3406  C C   . PHE C 3 64  ? -18.451 90.569  -19.705 1.00 56.40  ? 64  PHE C C   1 
ATOM 3407  O O   . PHE C 3 64  ? -17.583 91.017  -20.444 1.00 57.10  ? 64  PHE C O   1 
ATOM 3408  C CB  . PHE C 3 64  ? -17.937 91.760  -17.598 1.00 48.51  ? 64  PHE C CB  1 
ATOM 3409  C CG  . PHE C 3 64  ? -18.437 92.543  -16.418 1.00 45.41  ? 64  PHE C CG  1 
ATOM 3410  C CD1 . PHE C 3 64  ? -19.087 91.903  -15.368 1.00 45.72  ? 64  PHE C CD1 1 
ATOM 3411  C CD2 . PHE C 3 64  ? -18.347 93.929  -16.398 1.00 43.22  ? 64  PHE C CD2 1 
ATOM 3412  C CE1 . PHE C 3 64  ? -19.645 92.632  -14.319 1.00 44.10  ? 64  PHE C CE1 1 
ATOM 3413  C CE2 . PHE C 3 64  ? -18.905 94.664  -15.353 1.00 42.92  ? 64  PHE C CE2 1 
ATOM 3414  C CZ  . PHE C 3 64  ? -19.557 94.013  -14.310 1.00 40.71  ? 64  PHE C CZ  1 
ATOM 3415  N N   . LYS C 3 65  ? -18.937 89.340  -19.800 1.00 62.25  ? 65  LYS C N   1 
ATOM 3416  C CA  . LYS C 3 65  ? -18.455 88.386  -20.788 1.00 66.98  ? 65  LYS C CA  1 
ATOM 3417  C C   . LYS C 3 65  ? -17.702 89.026  -21.954 1.00 68.44  ? 65  LYS C C   1 
ATOM 3418  O O   . LYS C 3 65  ? -16.486 88.818  -22.132 1.00 65.45  ? 65  LYS C O   1 
ATOM 3419  C CB  . LYS C 3 65  ? -19.633 87.577  -21.345 1.00 70.77  ? 65  LYS C CB  1 
ATOM 3420  C CG  . LYS C 3 65  ? -19.204 86.312  -22.099 1.00 75.53  ? 65  LYS C CG  1 
ATOM 3421  C CD  . LYS C 3 65  ? -19.948 86.131  -23.421 1.00 79.24  ? 65  LYS C CD  1 
ATOM 3422  C CE  . LYS C 3 65  ? -21.454 86.041  -23.217 1.00 80.38  ? 65  LYS C CE  1 
ATOM 3423  N NZ  . LYS C 3 65  ? -22.183 85.944  -24.515 1.00 80.03  ? 65  LYS C NZ  1 
ATOM 3424  N N   . ASP C 3 66  ? -18.431 89.826  -22.730 1.00 70.14  ? 66  ASP C N   1 
ATOM 3425  C CA  . ASP C 3 66  ? -17.861 90.455  -23.911 1.00 71.12  ? 66  ASP C CA  1 
ATOM 3426  C C   . ASP C 3 66  ? -17.489 91.937  -23.810 1.00 69.58  ? 66  ASP C C   1 
ATOM 3427  O O   . ASP C 3 66  ? -17.035 92.535  -24.786 1.00 66.80  ? 66  ASP C O   1 
ATOM 3428  C CB  . ASP C 3 66  ? -18.791 90.189  -25.101 1.00 75.29  ? 66  ASP C CB  1 
ATOM 3429  C CG  . ASP C 3 66  ? -18.718 88.724  -25.576 1.00 81.06  ? 66  ASP C CG  1 
ATOM 3430  O OD1 . ASP C 3 66  ? -19.662 88.268  -26.262 1.00 84.40  ? 66  ASP C OD1 1 
ATOM 3431  O OD2 . ASP C 3 66  ? -17.705 88.029  -25.279 1.00 80.84  ? 66  ASP C OD2 1 
ATOM 3432  N N   . LYS C 3 67  ? -17.661 92.537  -22.637 1.00 68.88  ? 67  LYS C N   1 
ATOM 3433  C CA  . LYS C 3 67  ? -17.265 93.933  -22.457 1.00 67.25  ? 67  LYS C CA  1 
ATOM 3434  C C   . LYS C 3 67  ? -15.798 93.987  -22.043 1.00 64.00  ? 67  LYS C C   1 
ATOM 3435  O O   . LYS C 3 67  ? -14.976 94.668  -22.662 1.00 60.18  ? 67  LYS C O   1 
ATOM 3436  C CB  . LYS C 3 67  ? -18.081 94.594  -21.350 1.00 71.97  ? 67  LYS C CB  1 
ATOM 3437  C CG  . LYS C 3 67  ? -19.451 95.067  -21.752 1.00 77.12  ? 67  LYS C CG  1 
ATOM 3438  C CD  . LYS C 3 67  ? -19.868 96.265  -20.905 1.00 79.62  ? 67  LYS C CD  1 
ATOM 3439  C CE  . LYS C 3 67  ? -18.857 97.410  -21.042 1.00 82.00  ? 67  LYS C CE  1 
ATOM 3440  N NZ  . LYS C 3 67  ? -18.651 97.866  -22.455 1.00 81.84  ? 67  LYS C NZ  1 
ATOM 3441  N N   . ALA C 3 68  ? -15.505 93.233  -20.983 1.00 59.21  ? 68  ALA C N   1 
ATOM 3442  C CA  . ALA C 3 68  ? -14.186 93.165  -20.373 1.00 54.23  ? 68  ALA C CA  1 
ATOM 3443  C C   . ALA C 3 68  ? -13.265 92.065  -20.871 1.00 52.26  ? 68  ALA C C   1 
ATOM 3444  O O   . ALA C 3 68  ? -13.708 91.077  -21.454 1.00 52.45  ? 68  ALA C O   1 
ATOM 3445  C CB  . ALA C 3 68  ? -14.347 93.040  -18.875 1.00 56.55  ? 68  ALA C CB  1 
ATOM 3446  N N   . THR C 3 69  ? -11.975 92.239  -20.595 1.00 50.73  ? 69  THR C N   1 
ATOM 3447  C CA  . THR C 3 69  ? -10.956 91.288  -21.004 1.00 50.88  ? 69  THR C CA  1 
ATOM 3448  C C   . THR C 3 69  ? -9.712  91.342  -20.119 1.00 48.08  ? 69  THR C C   1 
ATOM 3449  O O   . THR C 3 69  ? -8.861  92.243  -20.245 1.00 45.33  ? 69  THR C O   1 
ATOM 3450  C CB  . THR C 3 69  ? -10.534 91.540  -22.457 1.00 53.74  ? 69  THR C CB  1 
ATOM 3451  O OG1 . THR C 3 69  ? -11.607 91.178  -23.329 1.00 62.34  ? 69  THR C OG1 1 
ATOM 3452  C CG2 . THR C 3 69  ? -9.301  90.721  -22.813 1.00 54.75  ? 69  THR C CG2 1 
ATOM 3453  N N   . LEU C 3 70  ? -9.603  90.350  -19.243 1.00 41.63  ? 70  LEU C N   1 
ATOM 3454  C CA  . LEU C 3 70  ? -8.482  90.257  -18.325 1.00 38.43  ? 70  LEU C CA  1 
ATOM 3455  C C   . LEU C 3 70  ? -7.311  89.613  -19.021 1.00 36.37  ? 70  LEU C C   1 
ATOM 3456  O O   . LEU C 3 70  ? -7.496  88.763  -19.874 1.00 34.49  ? 70  LEU C O   1 
ATOM 3457  C CB  . LEU C 3 70  ? -8.859  89.403  -17.122 1.00 35.84  ? 70  LEU C CB  1 
ATOM 3458  C CG  . LEU C 3 70  ? -10.295 89.589  -16.635 1.00 27.79  ? 70  LEU C CG  1 
ATOM 3459  C CD1 . LEU C 3 70  ? -10.530 88.716  -15.411 1.00 20.38  ? 70  LEU C CD1 1 
ATOM 3460  C CD2 . LEU C 3 70  ? -10.543 91.056  -16.317 1.00 21.88  ? 70  LEU C CD2 1 
ATOM 3461  N N   . THR C 3 71  ? -6.107  90.015  -18.637 1.00 38.63  ? 71  THR C N   1 
ATOM 3462  C CA  . THR C 3 71  ? -4.885  89.472  -19.213 1.00 36.27  ? 71  THR C CA  1 
ATOM 3463  C C   . THR C 3 71  ? -3.774  89.831  -18.249 1.00 35.61  ? 71  THR C C   1 
ATOM 3464  O O   . THR C 3 71  ? -3.996  90.594  -17.304 1.00 35.00  ? 71  THR C O   1 
ATOM 3465  C CB  . THR C 3 71  ? -4.569  90.112  -20.565 1.00 35.19  ? 71  THR C CB  1 
ATOM 3466  O OG1 . THR C 3 71  ? -4.381  91.520  -20.386 1.00 36.38  ? 71  THR C OG1 1 
ATOM 3467  C CG2 . THR C 3 71  ? -5.707  89.891  -21.542 1.00 28.67  ? 71  THR C CG2 1 
ATOM 3468  N N   . VAL C 3 72  ? -2.584  89.294  -18.482 1.00 36.50  ? 72  VAL C N   1 
ATOM 3469  C CA  . VAL C 3 72  ? -1.463  89.573  -17.596 1.00 40.30  ? 72  VAL C CA  1 
ATOM 3470  C C   . VAL C 3 72  ? -0.153  89.581  -18.346 1.00 42.95  ? 72  VAL C C   1 
ATOM 3471  O O   . VAL C 3 72  ? -0.064  89.069  -19.447 1.00 45.80  ? 72  VAL C O   1 
ATOM 3472  C CB  . VAL C 3 72  ? -1.330  88.504  -16.479 1.00 41.30  ? 72  VAL C CB  1 
ATOM 3473  C CG1 . VAL C 3 72  ? -2.693  87.939  -16.129 1.00 41.18  ? 72  VAL C CG1 1 
ATOM 3474  C CG2 . VAL C 3 72  ? -0.388  87.386  -16.916 1.00 36.88  ? 72  VAL C CG2 1 
ATOM 3475  N N   . ASP C 3 73  ? 0.873   90.157  -17.742 1.00 46.90  ? 73  ASP C N   1 
ATOM 3476  C CA  . ASP C 3 73  ? 2.178   90.172  -18.372 1.00 46.88  ? 73  ASP C CA  1 
ATOM 3477  C C   . ASP C 3 73  ? 3.184   89.671  -17.364 1.00 46.10  ? 73  ASP C C   1 
ATOM 3478  O O   . ASP C 3 73  ? 3.837   90.452  -16.668 1.00 46.32  ? 73  ASP C O   1 
ATOM 3479  C CB  . ASP C 3 73  ? 2.569   91.568  -18.830 1.00 48.41  ? 73  ASP C CB  1 
ATOM 3480  C CG  . ASP C 3 73  ? 4.047   91.668  -19.137 1.00 51.31  ? 73  ASP C CG  1 
ATOM 3481  O OD1 . ASP C 3 73  ? 4.659   90.632  -19.482 1.00 57.06  ? 73  ASP C OD1 1 
ATOM 3482  O OD2 . ASP C 3 73  ? 4.601   92.775  -19.040 1.00 55.94  ? 73  ASP C OD2 1 
ATOM 3483  N N   . LYS C 3 74  ? 3.302   88.354  -17.305 1.00 44.12  ? 74  LYS C N   1 
ATOM 3484  C CA  . LYS C 3 74  ? 4.194   87.699  -16.372 1.00 43.34  ? 74  LYS C CA  1 
ATOM 3485  C C   . LYS C 3 74  ? 5.537   88.405  -16.170 1.00 45.81  ? 74  LYS C C   1 
ATOM 3486  O O   . LYS C 3 74  ? 5.988   88.557  -15.027 1.00 48.80  ? 74  LYS C O   1 
ATOM 3487  C CB  . LYS C 3 74  ? 4.385   86.239  -16.804 1.00 43.08  ? 74  LYS C CB  1 
ATOM 3488  C CG  . LYS C 3 74  ? 3.063   85.431  -16.767 1.00 47.79  ? 74  LYS C CG  1 
ATOM 3489  C CD  . LYS C 3 74  ? 3.067   84.133  -17.606 1.00 46.94  ? 74  LYS C CD  1 
ATOM 3490  C CE  . LYS C 3 74  ? 3.923   83.031  -16.987 1.00 44.47  ? 74  LYS C CE  1 
ATOM 3491  N NZ  . LYS C 3 74  ? 3.882   81.757  -17.764 1.00 40.54  ? 74  LYS C NZ  1 
ATOM 3492  N N   . SER C 3 75  ? 6.163   88.867  -17.249 1.00 44.26  ? 75  SER C N   1 
ATOM 3493  C CA  . SER C 3 75  ? 7.465   89.524  -17.117 1.00 46.64  ? 75  SER C CA  1 
ATOM 3494  C C   . SER C 3 75  ? 7.458   90.670  -16.112 1.00 47.53  ? 75  SER C C   1 
ATOM 3495  O O   . SER C 3 75  ? 8.199   90.641  -15.127 1.00 48.73  ? 75  SER C O   1 
ATOM 3496  C CB  . SER C 3 75  ? 7.951   90.028  -18.476 1.00 48.09  ? 75  SER C CB  1 
ATOM 3497  O OG  . SER C 3 75  ? 6.975   90.838  -19.106 1.00 49.21  ? 75  SER C OG  1 
ATOM 3498  N N   . SER C 3 76  ? 6.610   91.667  -16.359 1.00 48.01  ? 76  SER C N   1 
ATOM 3499  C CA  . SER C 3 76  ? 6.495   92.837  -15.482 1.00 48.85  ? 76  SER C CA  1 
ATOM 3500  C C   . SER C 3 76  ? 5.513   92.561  -14.347 1.00 47.04  ? 76  SER C C   1 
ATOM 3501  O O   . SER C 3 76  ? 5.069   93.477  -13.646 1.00 47.17  ? 76  SER C O   1 
ATOM 3502  C CB  . SER C 3 76  ? 5.995   94.040  -16.268 1.00 47.32  ? 76  SER C CB  1 
ATOM 3503  O OG  . SER C 3 76  ? 4.632   93.857  -16.592 1.00 53.99  ? 76  SER C OG  1 
ATOM 3504  N N   . SER C 3 77  ? 5.176   91.291  -14.186 1.00 44.94  ? 77  SER C N   1 
ATOM 3505  C CA  . SER C 3 77  ? 4.264   90.861  -13.142 1.00 45.52  ? 77  SER C CA  1 
ATOM 3506  C C   . SER C 3 77  ? 3.141   91.846  -12.852 1.00 44.29  ? 77  SER C C   1 
ATOM 3507  O O   . SER C 3 77  ? 3.054   92.393  -11.764 1.00 44.07  ? 77  SER C O   1 
ATOM 3508  C CB  . SER C 3 77  ? 5.047   90.565  -11.860 1.00 44.87  ? 77  SER C CB  1 
ATOM 3509  O OG  . SER C 3 77  ? 5.985   91.595  -11.590 1.00 46.33  ? 77  SER C OG  1 
ATOM 3510  N N   . THR C 3 78  ? 2.289   92.083  -13.837 1.00 43.05  ? 78  THR C N   1 
ATOM 3511  C CA  . THR C 3 78  ? 1.157   92.964  -13.636 1.00 40.36  ? 78  THR C CA  1 
ATOM 3512  C C   . THR C 3 78  ? -0.021  92.466  -14.480 1.00 41.39  ? 78  THR C C   1 
ATOM 3513  O O   . THR C 3 78  ? 0.177   91.841  -15.523 1.00 43.42  ? 78  THR C O   1 
ATOM 3514  C CB  . THR C 3 78  ? 1.511   94.433  -13.983 1.00 36.43  ? 78  THR C CB  1 
ATOM 3515  O OG1 . THR C 3 78  ? 0.519   94.975  -14.863 1.00 40.02  ? 78  THR C OG1 1 
ATOM 3516  C CG2 . THR C 3 78  ? 2.863   94.522  -14.620 1.00 29.04  ? 78  THR C CG2 1 
ATOM 3517  N N   . ALA C 3 79  ? -1.240  92.726  -14.016 1.00 39.06  ? 79  ALA C N   1 
ATOM 3518  C CA  . ALA C 3 79  ? -2.437  92.282  -14.714 1.00 38.20  ? 79  ALA C CA  1 
ATOM 3519  C C   . ALA C 3 79  ? -3.234  93.446  -15.238 1.00 39.21  ? 79  ALA C C   1 
ATOM 3520  O O   . ALA C 3 79  ? -3.231  94.537  -14.650 1.00 36.63  ? 79  ALA C O   1 
ATOM 3521  C CB  . ALA C 3 79  ? -3.298  91.474  -13.792 1.00 38.94  ? 79  ALA C CB  1 
ATOM 3522  N N   . TYR C 3 80  ? -3.954  93.198  -16.327 1.00 36.70  ? 80  TYR C N   1 
ATOM 3523  C CA  . TYR C 3 80  ? -4.737  94.250  -16.930 1.00 34.43  ? 80  TYR C CA  1 
ATOM 3524  C C   . TYR C 3 80  ? -6.156  93.854  -17.203 1.00 34.92  ? 80  TYR C C   1 
ATOM 3525  O O   . TYR C 3 80  ? -6.415  92.759  -17.692 1.00 38.30  ? 80  TYR C O   1 
ATOM 3526  C CB  . TYR C 3 80  ? -4.133  94.678  -18.262 1.00 29.89  ? 80  TYR C CB  1 
ATOM 3527  C CG  . TYR C 3 80  ? -2.668  95.062  -18.234 1.00 28.92  ? 80  TYR C CG  1 
ATOM 3528  C CD1 . TYR C 3 80  ? -1.664  94.085  -18.121 1.00 32.54  ? 80  TYR C CD1 1 
ATOM 3529  C CD2 . TYR C 3 80  ? -2.276  96.400  -18.355 1.00 25.84  ? 80  TYR C CD2 1 
ATOM 3530  C CE1 . TYR C 3 80  ? -0.298  94.435  -18.131 1.00 31.64  ? 80  TYR C CE1 1 
ATOM 3531  C CE2 . TYR C 3 80  ? -0.918  96.763  -18.366 1.00 30.79  ? 80  TYR C CE2 1 
ATOM 3532  C CZ  . TYR C 3 80  ? 0.066   95.779  -18.252 1.00 34.42  ? 80  TYR C CZ  1 
ATOM 3533  O OH  . TYR C 3 80  ? 1.401   96.145  -18.238 1.00 33.58  ? 80  TYR C OH  1 
ATOM 3534  N N   . MET C 3 81  ? -7.071  94.756  -16.879 1.00 34.53  ? 81  MET C N   1 
ATOM 3535  C CA  . MET C 3 81  ? -8.473  94.548  -17.174 1.00 36.17  ? 81  MET C CA  1 
ATOM 3536  C C   . MET C 3 81  ? -8.742  95.565  -18.258 1.00 40.69  ? 81  MET C C   1 
ATOM 3537  O O   . MET C 3 81  ? -8.442  96.752  -18.095 1.00 36.82  ? 81  MET C O   1 
ATOM 3538  C CB  . MET C 3 81  ? -9.375  94.863  -16.008 1.00 34.90  ? 81  MET C CB  1 
ATOM 3539  C CG  . MET C 3 81  ? -10.809 94.955  -16.466 1.00 36.48  ? 81  MET C CG  1 
ATOM 3540  S SD  . MET C 3 81  ? -11.935 95.023  -15.082 1.00 42.61  ? 81  MET C SD  1 
ATOM 3541  C CE  . MET C 3 81  ? -13.537 95.037  -15.925 1.00 48.29  ? 81  MET C CE  1 
ATOM 3542  N N   . GLN C 3 82  ? -9.314  95.104  -19.363 1.00 45.77  ? 82  GLN C N   1 
ATOM 3543  C CA  . GLN C 3 82  ? -9.577  95.980  -20.486 1.00 45.28  ? 82  GLN C CA  1 
ATOM 3544  C C   . GLN C 3 82  ? -11.051 96.107  -20.759 1.00 47.37  ? 82  GLN C C   1 
ATOM 3545  O O   . GLN C 3 82  ? -11.752 95.107  -20.882 1.00 46.43  ? 82  GLN C O   1 
ATOM 3546  C CB  . GLN C 3 82  ? -8.886  95.432  -21.716 1.00 45.05  ? 82  GLN C CB  1 
ATOM 3547  C CG  . GLN C 3 82  ? -8.456  96.487  -22.685 1.00 47.17  ? 82  GLN C CG  1 
ATOM 3548  C CD  . GLN C 3 82  ? -8.978  96.225  -24.065 1.00 53.07  ? 82  GLN C CD  1 
ATOM 3549  O OE1 . GLN C 3 82  ? -10.156 96.444  -24.331 1.00 60.55  ? 82  GLN C OE1 1 
ATOM 3550  N NE2 . GLN C 3 82  ? -8.114  95.734  -24.955 1.00 49.85  ? 82  GLN C NE2 1 
ATOM 3551  N N   . VAL C 3 83  ? -11.534 97.337  -20.837 1.00 49.56  ? 83  VAL C N   1 
ATOM 3552  C CA  . VAL C 3 83  ? -12.940 97.532  -21.118 1.00 53.48  ? 83  VAL C CA  1 
ATOM 3553  C C   . VAL C 3 83  ? -13.091 98.047  -22.526 1.00 59.97  ? 83  VAL C C   1 
ATOM 3554  O O   . VAL C 3 83  ? -12.329 98.908  -22.986 1.00 61.23  ? 83  VAL C O   1 
ATOM 3555  C CB  . VAL C 3 83  ? -13.576 98.523  -20.193 1.00 50.11  ? 83  VAL C CB  1 
ATOM 3556  C CG1 . VAL C 3 83  ? -15.079 98.557  -20.449 1.00 49.74  ? 83  VAL C CG1 1 
ATOM 3557  C CG2 . VAL C 3 83  ? -13.265 98.147  -18.780 1.00 48.57  ? 83  VAL C CG2 1 
ATOM 3558  N N   . ASN C 3 84  ? -14.093 97.518  -23.211 1.00 63.40  ? 84  ASN C N   1 
ATOM 3559  C CA  . ASN C 3 84  ? -14.324 97.894  -24.586 1.00 63.37  ? 84  ASN C CA  1 
ATOM 3560  C C   . ASN C 3 84  ? -15.595 98.701  -24.722 1.00 63.56  ? 84  ASN C C   1 
ATOM 3561  O O   . ASN C 3 84  ? -16.592 98.440  -24.031 1.00 62.11  ? 84  ASN C O   1 
ATOM 3562  C CB  . ASN C 3 84  ? -14.387 96.629  -25.433 1.00 67.31  ? 84  ASN C CB  1 
ATOM 3563  C CG  . ASN C 3 84  ? -13.125 95.791  -25.307 1.00 70.42  ? 84  ASN C CG  1 
ATOM 3564  O OD1 . ASN C 3 84  ? -12.071 96.166  -25.832 1.00 74.67  ? 84  ASN C OD1 1 
ATOM 3565  N ND2 . ASN C 3 84  ? -13.220 94.661  -24.595 1.00 66.10  ? 84  ASN C ND2 1 
ATOM 3566  N N   . SER C 3 85  ? -15.537 99.689  -25.614 1.00 60.52  ? 85  SER C N   1 
ATOM 3567  C CA  . SER C 3 85  ? -16.661 100.576 -25.886 1.00 58.79  ? 85  SER C CA  1 
ATOM 3568  C C   . SER C 3 85  ? -17.368 101.051 -24.626 1.00 57.65  ? 85  SER C C   1 
ATOM 3569  O O   . SER C 3 85  ? -18.530 100.721 -24.371 1.00 58.38  ? 85  SER C O   1 
ATOM 3570  C CB  . SER C 3 85  ? -17.647 99.896  -26.818 1.00 57.12  ? 85  SER C CB  1 
ATOM 3571  O OG  . SER C 3 85  ? -17.010 99.636  -28.056 1.00 64.23  ? 85  SER C OG  1 
ATOM 3572  N N   . PRO C 3 86  ? -16.653 101.838 -23.818 1.00 54.72  ? 86  PRO C N   1 
ATOM 3573  C CA  . PRO C 3 86  ? -17.090 102.429 -22.558 1.00 52.99  ? 86  PRO C CA  1 
ATOM 3574  C C   . PRO C 3 86  ? -18.329 103.297 -22.728 1.00 50.68  ? 86  PRO C C   1 
ATOM 3575  O O   . PRO C 3 86  ? -18.644 103.735 -23.831 1.00 51.82  ? 86  PRO C O   1 
ATOM 3576  C CB  . PRO C 3 86  ? -15.876 103.243 -22.142 1.00 56.92  ? 86  PRO C CB  1 
ATOM 3577  C CG  . PRO C 3 86  ? -14.737 102.418 -22.681 1.00 55.16  ? 86  PRO C CG  1 
ATOM 3578  C CD  . PRO C 3 86  ? -15.220 102.092 -24.046 1.00 52.40  ? 86  PRO C CD  1 
ATOM 3579  N N   . THR C 3 87  ? -19.026 103.534 -21.626 1.00 48.17  ? 87  THR C N   1 
ATOM 3580  C CA  . THR C 3 87  ? -20.223 104.359 -21.611 1.00 51.40  ? 87  THR C CA  1 
ATOM 3581  C C   . THR C 3 87  ? -20.400 104.770 -20.154 1.00 56.86  ? 87  THR C C   1 
ATOM 3582  O O   . THR C 3 87  ? -19.742 104.214 -19.277 1.00 59.88  ? 87  THR C O   1 
ATOM 3583  C CB  . THR C 3 87  ? -21.467 103.571 -22.056 1.00 49.63  ? 87  THR C CB  1 
ATOM 3584  O OG1 . THR C 3 87  ? -21.981 102.808 -20.952 1.00 53.31  ? 87  THR C OG1 1 
ATOM 3585  C CG2 . THR C 3 87  ? -21.113 102.623 -23.185 1.00 44.74  ? 87  THR C CG2 1 
ATOM 3586  N N   . SER C 3 88  ? -21.278 105.730 -19.883 1.00 57.83  ? 88  SER C N   1 
ATOM 3587  C CA  . SER C 3 88  ? -21.488 106.178 -18.511 1.00 61.39  ? 88  SER C CA  1 
ATOM 3588  C C   . SER C 3 88  ? -21.747 105.017 -17.545 1.00 62.56  ? 88  SER C C   1 
ATOM 3589  O O   . SER C 3 88  ? -21.396 105.099 -16.363 1.00 63.22  ? 88  SER C O   1 
ATOM 3590  C CB  . SER C 3 88  ? -22.657 107.162 -18.450 1.00 65.33  ? 88  SER C CB  1 
ATOM 3591  O OG  . SER C 3 88  ? -23.860 106.545 -18.878 1.00 73.10  ? 88  SER C OG  1 
ATOM 3592  N N   . GLU C 3 89  ? -22.361 103.941 -18.042 1.00 62.06  ? 89  GLU C N   1 
ATOM 3593  C CA  . GLU C 3 89  ? -22.657 102.773 -17.209 1.00 60.90  ? 89  GLU C CA  1 
ATOM 3594  C C   . GLU C 3 89  ? -21.319 102.202 -16.736 1.00 55.62  ? 89  GLU C C   1 
ATOM 3595  O O   . GLU C 3 89  ? -21.255 101.499 -15.731 1.00 56.26  ? 89  GLU C O   1 
ATOM 3596  C CB  . GLU C 3 89  ? -23.445 101.718 -18.014 1.00 64.49  ? 89  GLU C CB  1 
ATOM 3597  C CG  . GLU C 3 89  ? -24.408 100.816 -17.189 1.00 75.64  ? 89  GLU C CG  1 
ATOM 3598  C CD  . GLU C 3 89  ? -23.844 99.412  -16.834 1.00 86.75  ? 89  GLU C CD  1 
ATOM 3599  O OE1 . GLU C 3 89  ? -23.414 98.659  -17.750 1.00 91.59  ? 89  GLU C OE1 1 
ATOM 3600  O OE2 . GLU C 3 89  ? -23.849 99.052  -15.630 1.00 91.26  ? 89  GLU C OE2 1 
ATOM 3601  N N   . ASP C 3 90  ? -20.249 102.539 -17.452 1.00 49.02  ? 90  ASP C N   1 
ATOM 3602  C CA  . ASP C 3 90  ? -18.917 102.057 -17.114 1.00 46.33  ? 90  ASP C CA  1 
ATOM 3603  C C   . ASP C 3 90  ? -18.103 102.943 -16.185 1.00 45.16  ? 90  ASP C C   1 
ATOM 3604  O O   . ASP C 3 90  ? -17.158 102.472 -15.557 1.00 43.18  ? 90  ASP C O   1 
ATOM 3605  C CB  . ASP C 3 90  ? -18.113 101.794 -18.375 1.00 47.35  ? 90  ASP C CB  1 
ATOM 3606  C CG  . ASP C 3 90  ? -18.694 100.679 -19.195 1.00 48.43  ? 90  ASP C CG  1 
ATOM 3607  O OD1 . ASP C 3 90  ? -19.258 99.740  -18.583 1.00 49.09  ? 90  ASP C OD1 1 
ATOM 3608  O OD2 . ASP C 3 90  ? -18.578 100.734 -20.438 1.00 49.86  ? 90  ASP C OD2 1 
ATOM 3609  N N   . SER C 3 91  ? -18.429 104.224 -16.104 1.00 43.58  ? 91  SER C N   1 
ATOM 3610  C CA  . SER C 3 91  ? -17.692 105.073 -15.184 1.00 41.21  ? 91  SER C CA  1 
ATOM 3611  C C   . SER C 3 91  ? -17.917 104.479 -13.801 1.00 40.37  ? 91  SER C C   1 
ATOM 3612  O O   . SER C 3 91  ? -19.056 104.328 -13.354 1.00 36.86  ? 91  SER C O   1 
ATOM 3613  C CB  . SER C 3 91  ? -18.204 106.513 -15.214 1.00 42.42  ? 91  SER C CB  1 
ATOM 3614  O OG  . SER C 3 91  ? -17.604 107.246 -16.269 1.00 47.01  ? 91  SER C OG  1 
ATOM 3615  N N   . ALA C 3 92  ? -16.816 104.119 -13.147 1.00 41.21  ? 92  ALA C N   1 
ATOM 3616  C CA  . ALA C 3 92  ? -16.842 103.540 -11.811 1.00 39.25  ? 92  ALA C CA  1 
ATOM 3617  C C   . ALA C 3 92  ? -15.406 103.314 -11.342 1.00 40.20  ? 92  ALA C C   1 
ATOM 3618  O O   . ALA C 3 92  ? -14.440 103.699 -12.019 1.00 39.58  ? 92  ALA C O   1 
ATOM 3619  C CB  . ALA C 3 92  ? -17.601 102.225 -11.833 1.00 38.51  ? 92  ALA C CB  1 
ATOM 3620  N N   . VAL C 3 93  ? -15.263 102.704 -10.173 1.00 39.62  ? 93  VAL C N   1 
ATOM 3621  C CA  . VAL C 3 93  ? -13.936 102.414 -9.658  1.00 35.89  ? 93  VAL C CA  1 
ATOM 3622  C C   . VAL C 3 93  ? -13.715 100.901 -9.740  1.00 33.15  ? 93  VAL C C   1 
ATOM 3623  O O   . VAL C 3 93  ? -14.604 100.109 -9.442  1.00 30.47  ? 93  VAL C O   1 
ATOM 3624  C CB  . VAL C 3 93  ? -13.773 102.929 -8.216  1.00 33.56  ? 93  VAL C CB  1 
ATOM 3625  C CG1 . VAL C 3 93  ? -14.966 102.532 -7.383  1.00 35.35  ? 93  VAL C CG1 1 
ATOM 3626  C CG2 . VAL C 3 93  ? -12.488 102.389 -7.613  1.00 28.83  ? 93  VAL C CG2 1 
ATOM 3627  N N   . TYR C 3 94  ? -12.522 100.521 -10.165 1.00 31.80  ? 94  TYR C N   1 
ATOM 3628  C CA  . TYR C 3 94  ? -12.155 99.132  -10.359 1.00 31.85  ? 94  TYR C CA  1 
ATOM 3629  C C   . TYR C 3 94  ? -10.989 98.674  -9.491  1.00 34.15  ? 94  TYR C C   1 
ATOM 3630  O O   . TYR C 3 94  ? -9.857  99.169  -9.619  1.00 32.10  ? 94  TYR C O   1 
ATOM 3631  C CB  . TYR C 3 94  ? -11.788 98.937  -11.825 1.00 32.84  ? 94  TYR C CB  1 
ATOM 3632  C CG  . TYR C 3 94  ? -12.941 99.178  -12.765 1.00 40.12  ? 94  TYR C CG  1 
ATOM 3633  C CD1 . TYR C 3 94  ? -13.749 98.122  -13.178 1.00 41.59  ? 94  TYR C CD1 1 
ATOM 3634  C CD2 . TYR C 3 94  ? -13.257 100.465 -13.194 1.00 38.68  ? 94  TYR C CD2 1 
ATOM 3635  C CE1 . TYR C 3 94  ? -14.850 98.339  -13.993 1.00 45.98  ? 94  TYR C CE1 1 
ATOM 3636  C CE2 . TYR C 3 94  ? -14.357 100.697 -14.013 1.00 42.72  ? 94  TYR C CE2 1 
ATOM 3637  C CZ  . TYR C 3 94  ? -15.155 99.630  -14.408 1.00 48.18  ? 94  TYR C CZ  1 
ATOM 3638  O OH  . TYR C 3 94  ? -16.268 99.843  -15.200 1.00 50.98  ? 94  TYR C OH  1 
ATOM 3639  N N   . TYR C 3 95  ? -11.260 97.710  -8.617  1.00 32.11  ? 95  TYR C N   1 
ATOM 3640  C CA  . TYR C 3 95  ? -10.210 97.185  -7.766  1.00 30.26  ? 95  TYR C CA  1 
ATOM 3641  C C   . TYR C 3 95  ? -9.739  95.841  -8.247  1.00 29.59  ? 95  TYR C C   1 
ATOM 3642  O O   . TYR C 3 95  ? -10.543 95.002  -8.663  1.00 30.72  ? 95  TYR C O   1 
ATOM 3643  C CB  . TYR C 3 95  ? -10.688 96.971  -6.346  1.00 33.49  ? 95  TYR C CB  1 
ATOM 3644  C CG  . TYR C 3 95  ? -11.347 98.142  -5.717  1.00 35.85  ? 95  TYR C CG  1 
ATOM 3645  C CD1 . TYR C 3 95  ? -12.715 98.315  -5.825  1.00 39.29  ? 95  TYR C CD1 1 
ATOM 3646  C CD2 . TYR C 3 95  ? -10.617 99.049  -4.949  1.00 36.90  ? 95  TYR C CD2 1 
ATOM 3647  C CE1 . TYR C 3 95  ? -13.361 99.360  -5.172  1.00 42.37  ? 95  TYR C CE1 1 
ATOM 3648  C CE2 . TYR C 3 95  ? -11.250 100.103 -4.292  1.00 37.75  ? 95  TYR C CE2 1 
ATOM 3649  C CZ  . TYR C 3 95  ? -12.627 100.247 -4.404  1.00 40.69  ? 95  TYR C CZ  1 
ATOM 3650  O OH  . TYR C 3 95  ? -13.293 101.242 -3.729  1.00 38.16  ? 95  TYR C OH  1 
ATOM 3651  N N   . CYS C 3 96  ? -8.433  95.638  -8.189  1.00 21.65  ? 96  CYS C N   1 
ATOM 3652  C CA  . CYS C 3 96  ? -7.891  94.352  -8.538  1.00 20.46  ? 96  CYS C CA  1 
ATOM 3653  C C   . CYS C 3 96  ? -7.581  93.832  -7.136  1.00 22.05  ? 96  CYS C C   1 
ATOM 3654  O O   . CYS C 3 96  ? -7.181  94.600  -6.274  1.00 24.83  ? 96  CYS C O   1 
ATOM 3655  C CB  . CYS C 3 96  ? -6.634  94.509  -9.372  1.00 20.42  ? 96  CYS C CB  1 
ATOM 3656  S SG  . CYS C 3 96  ? -5.360  95.312  -8.489  1.00 33.04  ? 96  CYS C SG  1 
ATOM 3657  N N   . THR C 3 97  ? -7.791  92.548  -6.887  1.00 21.80  ? 97  THR C N   1 
ATOM 3658  C CA  . THR C 3 97  ? -7.564  92.013  -5.558  1.00 20.65  ? 97  THR C CA  1 
ATOM 3659  C C   . THR C 3 97  ? -6.854  90.697  -5.595  1.00 21.59  ? 97  THR C C   1 
ATOM 3660  O O   . THR C 3 97  ? -6.815  90.032  -6.619  1.00 22.99  ? 97  THR C O   1 
ATOM 3661  C CB  . THR C 3 97  ? -8.880  91.743  -4.824  1.00 24.13  ? 97  THR C CB  1 
ATOM 3662  O OG1 . THR C 3 97  ? -9.455  90.514  -5.311  1.00 19.53  ? 97  THR C OG1 1 
ATOM 3663  C CG2 . THR C 3 97  ? -9.842  92.890  -5.040  1.00 15.54  ? 97  THR C CG2 1 
ATOM 3664  N N   . ARG C 3 98  ? -6.339  90.313  -4.437  1.00 23.22  ? 98  ARG C N   1 
ATOM 3665  C CA  . ARG C 3 98  ? -5.617  89.069  -4.268  1.00 25.73  ? 98  ARG C CA  1 
ATOM 3666  C C   . ARG C 3 98  ? -6.075  88.525  -2.940  1.00 26.55  ? 98  ARG C C   1 
ATOM 3667  O O   . ARG C 3 98  ? -6.242  89.281  -1.986  1.00 30.85  ? 98  ARG C O   1 
ATOM 3668  C CB  . ARG C 3 98  ? -4.111  89.344  -4.232  1.00 27.13  ? 98  ARG C CB  1 
ATOM 3669  C CG  . ARG C 3 98  ? -3.234  88.109  -4.400  1.00 31.41  ? 98  ARG C CG  1 
ATOM 3670  C CD  . ARG C 3 98  ? -2.880  87.480  -3.078  1.00 33.98  ? 98  ARG C CD  1 
ATOM 3671  N NE  . ARG C 3 98  ? -1.449  87.589  -2.784  1.00 36.31  ? 98  ARG C NE  1 
ATOM 3672  C CZ  . ARG C 3 98  ? -0.870  87.100  -1.688  1.00 34.12  ? 98  ARG C CZ  1 
ATOM 3673  N NH1 . ARG C 3 98  ? -1.604  86.463  -0.772  1.00 30.12  ? 98  ARG C NH1 1 
ATOM 3674  N NH2 . ARG C 3 98  ? 0.439   87.247  -1.514  1.00 34.84  ? 98  ARG C NH2 1 
ATOM 3675  N N   . GLY C 3 99  ? -6.284  87.219  -2.867  1.00 29.84  ? 99  GLY C N   1 
ATOM 3676  C CA  . GLY C 3 99  ? -6.735  86.638  -1.620  1.00 25.73  ? 99  GLY C CA  1 
ATOM 3677  C C   . GLY C 3 99  ? -5.553  86.206  -0.792  1.00 27.30  ? 99  GLY C C   1 
ATOM 3678  O O   . GLY C 3 99  ? -4.463  86.776  -0.874  1.00 28.92  ? 99  GLY C O   1 
ATOM 3679  N N   . ALA C 3 100 ? -5.775  85.190  0.025   1.00 27.45  ? 100 ALA C N   1 
ATOM 3680  C CA  . ALA C 3 100 ? -4.724  84.657  0.871   1.00 27.50  ? 100 ALA C CA  1 
ATOM 3681  C C   . ALA C 3 100 ? -5.240  83.450  1.633   1.00 28.57  ? 100 ALA C C   1 
ATOM 3682  O O   . ALA C 3 100 ? -6.406  83.076  1.505   1.00 27.90  ? 100 ALA C O   1 
ATOM 3683  C CB  . ALA C 3 100 ? -4.232  85.716  1.838   1.00 26.23  ? 100 ALA C CB  1 
ATOM 3684  N N   . ARG C 3 101 ? -4.348  82.862  2.423   1.00 31.75  ? 101 ARG C N   1 
ATOM 3685  C CA  . ARG C 3 101 ? -4.625  81.684  3.233   1.00 36.24  ? 101 ARG C CA  1 
ATOM 3686  C C   . ARG C 3 101 ? -6.045  81.596  3.751   1.00 33.38  ? 101 ARG C C   1 
ATOM 3687  O O   . ARG C 3 101 ? -6.365  82.190  4.776   1.00 36.55  ? 101 ARG C O   1 
ATOM 3688  C CB  . ARG C 3 101 ? -3.660  81.649  4.415   1.00 44.52  ? 101 ARG C CB  1 
ATOM 3689  C CG  . ARG C 3 101 ? -3.877  80.494  5.370   1.00 51.63  ? 101 ARG C CG  1 
ATOM 3690  C CD  . ARG C 3 101 ? -3.410  79.166  4.800   1.00 63.25  ? 101 ARG C CD  1 
ATOM 3691  N NE  . ARG C 3 101 ? -3.086  78.228  5.879   1.00 81.59  ? 101 ARG C NE  1 
ATOM 3692  C CZ  . ARG C 3 101 ? -2.015  78.331  6.668   1.00 88.91  ? 101 ARG C CZ  1 
ATOM 3693  N NH1 . ARG C 3 101 ? -1.152  79.333  6.492   1.00 89.65  ? 101 ARG C NH1 1 
ATOM 3694  N NH2 . ARG C 3 101 ? -1.818  77.447  7.644   1.00 91.10  ? 101 ARG C NH2 1 
ATOM 3695  N N   . ASP C 3 102 ? -6.887  80.863  3.035   1.00 29.47  ? 102 ASP C N   1 
ATOM 3696  C CA  . ASP C 3 102 ? -8.275  80.645  3.414   1.00 30.82  ? 102 ASP C CA  1 
ATOM 3697  C C   . ASP C 3 102 ? -9.348  81.623  3.004   1.00 30.45  ? 102 ASP C C   1 
ATOM 3698  O O   . ASP C 3 102 ? -10.463 81.541  3.528   1.00 26.30  ? 102 ASP C O   1 
ATOM 3699  C CB  . ASP C 3 102 ? -8.399  80.426  4.904   1.00 34.99  ? 102 ASP C CB  1 
ATOM 3700  C CG  . ASP C 3 102 ? -7.798  79.131  5.330   1.00 42.48  ? 102 ASP C CG  1 
ATOM 3701  O OD1 . ASP C 3 102 ? -6.608  79.117  5.749   1.00 50.21  ? 102 ASP C OD1 1 
ATOM 3702  O OD2 . ASP C 3 102 ? -8.527  78.122  5.218   1.00 44.85  ? 102 ASP C OD2 1 
ATOM 3703  N N   . THR C 3 103 ? -9.021  82.544  2.096   1.00 30.69  ? 103 THR C N   1 
ATOM 3704  C CA  . THR C 3 103 ? -9.998  83.499  1.559   1.00 29.69  ? 103 THR C CA  1 
ATOM 3705  C C   . THR C 3 103 ? -9.570  84.163  0.322   1.00 30.32  ? 103 THR C C   1 
ATOM 3706  O O   . THR C 3 103 ? -8.464  83.988  -0.184  1.00 31.25  ? 103 THR C O   1 
ATOM 3707  C CB  . THR C 3 103 ? -10.289 84.710  2.394   1.00 27.42  ? 103 THR C CB  1 
ATOM 3708  O OG1 . THR C 3 103 ? -9.111  85.068  3.116   1.00 34.21  ? 103 THR C OG1 1 
ATOM 3709  C CG2 . THR C 3 103 ? -11.516 84.496  3.228   1.00 29.75  ? 103 THR C CG2 1 
ATOM 3710  N N   . TRP C 3 104 ? -10.481 85.021  -0.090  1.00 29.20  ? 104 TRP C N   1 
ATOM 3711  C CA  . TRP C 3 104 ? -10.314 85.824  -1.261  1.00 30.02  ? 104 TRP C CA  1 
ATOM 3712  C C   . TRP C 3 104 ? -10.391 87.255  -0.764  1.00 29.84  ? 104 TRP C C   1 
ATOM 3713  O O   . TRP C 3 104 ? -10.808 87.492  0.363   1.00 28.84  ? 104 TRP C O   1 
ATOM 3714  C CB  . TRP C 3 104 ? -11.471 85.541  -2.211  1.00 26.28  ? 104 TRP C CB  1 
ATOM 3715  C CG  . TRP C 3 104 ? -11.583 84.123  -2.606  1.00 14.91  ? 104 TRP C CG  1 
ATOM 3716  C CD1 . TRP C 3 104 ? -12.582 83.265  -2.284  1.00 19.81  ? 104 TRP C CD1 1 
ATOM 3717  C CD2 . TRP C 3 104 ? -10.696 83.408  -3.464  1.00 13.39  ? 104 TRP C CD2 1 
ATOM 3718  N NE1 . TRP C 3 104 ? -12.381 82.050  -2.900  1.00 24.13  ? 104 TRP C NE1 1 
ATOM 3719  C CE2 . TRP C 3 104 ? -11.223 82.115  -3.627  1.00 17.65  ? 104 TRP C CE2 1 
ATOM 3720  C CE3 . TRP C 3 104 ? -9.502  83.736  -4.114  1.00 16.15  ? 104 TRP C CE3 1 
ATOM 3721  C CZ2 . TRP C 3 104 ? -10.602 81.150  -4.420  1.00 18.23  ? 104 TRP C CZ2 1 
ATOM 3722  C CZ3 . TRP C 3 104 ? -8.884  82.776  -4.905  1.00 18.96  ? 104 TRP C CZ3 1 
ATOM 3723  C CH2 . TRP C 3 104 ? -9.434  81.499  -5.048  1.00 19.27  ? 104 TRP C CH2 1 
ATOM 3724  N N   . PHE C 3 105 ? -9.953  88.204  -1.579  1.00 30.84  ? 105 PHE C N   1 
ATOM 3725  C CA  . PHE C 3 105 ? -10.088 89.598  -1.195  1.00 29.63  ? 105 PHE C CA  1 
ATOM 3726  C C   . PHE C 3 105 ? -9.419  90.005  0.100   1.00 27.03  ? 105 PHE C C   1 
ATOM 3727  O O   . PHE C 3 105 ? -9.959  90.799  0.865   1.00 21.26  ? 105 PHE C O   1 
ATOM 3728  C CB  . PHE C 3 105 ? -11.567 89.903  -1.115  1.00 30.46  ? 105 PHE C CB  1 
ATOM 3729  C CG  . PHE C 3 105 ? -12.321 89.468  -2.336  1.00 31.99  ? 105 PHE C CG  1 
ATOM 3730  C CD1 . PHE C 3 105 ? -13.438 88.643  -2.228  1.00 27.68  ? 105 PHE C CD1 1 
ATOM 3731  C CD2 . PHE C 3 105 ? -11.941 89.930  -3.603  1.00 30.58  ? 105 PHE C CD2 1 
ATOM 3732  C CE1 . PHE C 3 105 ? -14.178 88.290  -3.357  1.00 21.26  ? 105 PHE C CE1 1 
ATOM 3733  C CE2 . PHE C 3 105 ? -12.674 89.583  -4.737  1.00 22.63  ? 105 PHE C CE2 1 
ATOM 3734  C CZ  . PHE C 3 105 ? -13.798 88.761  -4.613  1.00 20.12  ? 105 PHE C CZ  1 
ATOM 3735  N N   . ALA C 3 106 ? -8.244  89.455  0.349   1.00 25.76  ? 106 ALA C N   1 
ATOM 3736  C CA  . ALA C 3 106 ? -7.521  89.811  1.538   1.00 21.21  ? 106 ALA C CA  1 
ATOM 3737  C C   . ALA C 3 106 ? -6.777  91.098  1.229   1.00 21.45  ? 106 ALA C C   1 
ATOM 3738  O O   . ALA C 3 106 ? -6.602  91.944  2.094   1.00 24.62  ? 106 ALA C O   1 
ATOM 3739  C CB  . ALA C 3 106 ? -6.552  88.730  1.899   1.00 19.70  ? 106 ALA C CB  1 
ATOM 3740  N N   . TYR C 3 107 ? -6.346  91.259  -0.009  1.00 15.23  ? 107 TYR C N   1 
ATOM 3741  C CA  . TYR C 3 107 ? -5.620  92.458  -0.370  1.00 18.65  ? 107 TYR C CA  1 
ATOM 3742  C C   . TYR C 3 107 ? -6.320  93.196  -1.479  1.00 22.84  ? 107 TYR C C   1 
ATOM 3743  O O   . TYR C 3 107 ? -6.829  92.575  -2.414  1.00 29.09  ? 107 TYR C O   1 
ATOM 3744  C CB  . TYR C 3 107 ? -4.226  92.092  -0.821  1.00 19.05  ? 107 TYR C CB  1 
ATOM 3745  C CG  . TYR C 3 107 ? -3.380  91.476  0.268   1.00 29.95  ? 107 TYR C CG  1 
ATOM 3746  C CD1 . TYR C 3 107 ? -2.415  92.229  0.932   1.00 31.29  ? 107 TYR C CD1 1 
ATOM 3747  C CD2 . TYR C 3 107 ? -3.526  90.136  0.621   1.00 30.55  ? 107 TYR C CD2 1 
ATOM 3748  C CE1 . TYR C 3 107 ? -1.615  91.670  1.910   1.00 37.25  ? 107 TYR C CE1 1 
ATOM 3749  C CE2 . TYR C 3 107 ? -2.723  89.565  1.600   1.00 33.59  ? 107 TYR C CE2 1 
ATOM 3750  C CZ  . TYR C 3 107 ? -1.769  90.338  2.239   1.00 37.12  ? 107 TYR C CZ  1 
ATOM 3751  O OH  . TYR C 3 107 ? -0.946  89.781  3.194   1.00 39.20  ? 107 TYR C OH  1 
ATOM 3752  N N   . TRP C 3 108 ? -6.342  94.523  -1.392  1.00 22.59  ? 108 TRP C N   1 
ATOM 3753  C CA  . TRP C 3 108 ? -7.007  95.319  -2.411  1.00 21.45  ? 108 TRP C CA  1 
ATOM 3754  C C   . TRP C 3 108 ? -6.138  96.364  -3.049  1.00 23.02  ? 108 TRP C C   1 
ATOM 3755  O O   . TRP C 3 108 ? -5.303  96.965  -2.391  1.00 29.36  ? 108 TRP C O   1 
ATOM 3756  C CB  . TRP C 3 108 ? -8.221  96.015  -1.832  1.00 21.29  ? 108 TRP C CB  1 
ATOM 3757  C CG  . TRP C 3 108 ? -9.305  95.086  -1.446  1.00 20.97  ? 108 TRP C CG  1 
ATOM 3758  C CD1 . TRP C 3 108 ? -9.281  94.162  -0.437  1.00 20.24  ? 108 TRP C CD1 1 
ATOM 3759  C CD2 . TRP C 3 108 ? -10.605 95.021  -2.020  1.00 22.12  ? 108 TRP C CD2 1 
ATOM 3760  N NE1 . TRP C 3 108 ? -10.491 93.532  -0.341  1.00 15.63  ? 108 TRP C NE1 1 
ATOM 3761  C CE2 . TRP C 3 108 ? -11.326 94.037  -1.306  1.00 20.83  ? 108 TRP C CE2 1 
ATOM 3762  C CE3 . TRP C 3 108 ? -11.235 95.697  -3.073  1.00 25.06  ? 108 TRP C CE3 1 
ATOM 3763  C CZ2 . TRP C 3 108 ? -12.655 93.716  -1.604  1.00 21.05  ? 108 TRP C CZ2 1 
ATOM 3764  C CZ3 . TRP C 3 108 ? -12.559 95.380  -3.370  1.00 29.59  ? 108 TRP C CZ3 1 
ATOM 3765  C CH2 . TRP C 3 108 ? -13.255 94.392  -2.635  1.00 25.98  ? 108 TRP C CH2 1 
ATOM 3766  N N   . GLY C 3 109 ? -6.326  96.571  -4.347  1.00 27.65  ? 109 GLY C N   1 
ATOM 3767  C CA  . GLY C 3 109 ? -5.570  97.596  -5.028  1.00 24.18  ? 109 GLY C CA  1 
ATOM 3768  C C   . GLY C 3 109 ? -6.208  98.898  -4.571  1.00 26.51  ? 109 GLY C C   1 
ATOM 3769  O O   . GLY C 3 109 ? -7.285  98.923  -3.948  1.00 18.66  ? 109 GLY C O   1 
ATOM 3770  N N   . GLN C 3 110 ? -5.539  99.998  -4.866  1.00 32.99  ? 110 GLN C N   1 
ATOM 3771  C CA  . GLN C 3 110 ? -6.053  101.303 -4.484  1.00 40.29  ? 110 GLN C CA  1 
ATOM 3772  C C   . GLN C 3 110 ? -7.457  101.565 -5.070  1.00 39.74  ? 110 GLN C C   1 
ATOM 3773  O O   . GLN C 3 110 ? -8.325  102.140 -4.408  1.00 38.25  ? 110 GLN C O   1 
ATOM 3774  C CB  . GLN C 3 110 ? -5.061  102.360 -4.967  1.00 46.47  ? 110 GLN C CB  1 
ATOM 3775  C CG  . GLN C 3 110 ? -5.560  103.786 -4.867  1.00 54.29  ? 110 GLN C CG  1 
ATOM 3776  C CD  . GLN C 3 110 ? -4.737  104.735 -5.719  1.00 59.57  ? 110 GLN C CD  1 
ATOM 3777  O OE1 . GLN C 3 110 ? -5.030  105.930 -5.799  1.00 66.74  ? 110 GLN C OE1 1 
ATOM 3778  N NE2 . GLN C 3 110 ? -3.699  104.203 -6.365  1.00 59.98  ? 110 GLN C NE2 1 
ATOM 3779  N N   . GLY C 3 111 ? -7.659  101.116 -6.309  1.00 39.90  ? 111 GLY C N   1 
ATOM 3780  C CA  . GLY C 3 111 ? -8.912  101.317 -7.017  1.00 37.02  ? 111 GLY C CA  1 
ATOM 3781  C C   . GLY C 3 111 ? -8.680  102.395 -8.067  1.00 36.07  ? 111 GLY C C   1 
ATOM 3782  O O   . GLY C 3 111 ? -8.030  103.394 -7.781  1.00 38.25  ? 111 GLY C O   1 
ATOM 3783  N N   . THR C 3 112 ? -9.162  102.204 -9.288  1.00 33.46  ? 112 THR C N   1 
ATOM 3784  C CA  . THR C 3 112 ? -8.977  103.222 -10.308 1.00 30.39  ? 112 THR C CA  1 
ATOM 3785  C C   . THR C 3 112 ? -10.325 103.822 -10.662 1.00 33.81  ? 112 THR C C   1 
ATOM 3786  O O   . THR C 3 112 ? -11.314 103.118 -10.846 1.00 30.98  ? 112 THR C O   1 
ATOM 3787  C CB  . THR C 3 112 ? -8.348  102.669 -11.597 1.00 29.65  ? 112 THR C CB  1 
ATOM 3788  O OG1 . THR C 3 112 ? -6.983  102.305 -11.365 1.00 28.01  ? 112 THR C OG1 1 
ATOM 3789  C CG2 . THR C 3 112 ? -8.397  103.721 -12.683 1.00 28.90  ? 112 THR C CG2 1 
ATOM 3790  N N   . LEU C 3 113 ? -10.368 105.139 -10.759 1.00 37.12  ? 113 LEU C N   1 
ATOM 3791  C CA  . LEU C 3 113 ? -11.618 105.780 -11.084 1.00 40.03  ? 113 LEU C CA  1 
ATOM 3792  C C   . LEU C 3 113 ? -11.665 106.094 -12.556 1.00 41.03  ? 113 LEU C C   1 
ATOM 3793  O O   . LEU C 3 113 ? -10.907 106.938 -13.039 1.00 44.04  ? 113 LEU C O   1 
ATOM 3794  C CB  . LEU C 3 113 ? -11.797 107.068 -10.290 1.00 38.09  ? 113 LEU C CB  1 
ATOM 3795  C CG  . LEU C 3 113 ? -13.095 107.815 -10.607 1.00 40.43  ? 113 LEU C CG  1 
ATOM 3796  C CD1 . LEU C 3 113 ? -14.292 106.889 -10.470 1.00 41.95  ? 113 LEU C CD1 1 
ATOM 3797  C CD2 . LEU C 3 113 ? -13.231 108.979 -9.657  1.00 40.62  ? 113 LEU C CD2 1 
ATOM 3798  N N   . VAL C 3 114 ? -12.537 105.395 -13.275 1.00 36.67  ? 114 VAL C N   1 
ATOM 3799  C CA  . VAL C 3 114 ? -12.671 105.663 -14.686 1.00 32.90  ? 114 VAL C CA  1 
ATOM 3800  C C   . VAL C 3 114 ? -13.839 106.594 -14.840 1.00 33.10  ? 114 VAL C C   1 
ATOM 3801  O O   . VAL C 3 114 ? -14.886 106.438 -14.196 1.00 27.94  ? 114 VAL C O   1 
ATOM 3802  C CB  . VAL C 3 114 ? -12.950 104.423 -15.516 1.00 30.83  ? 114 VAL C CB  1 
ATOM 3803  C CG1 . VAL C 3 114 ? -11.849 103.419 -15.319 1.00 36.66  ? 114 VAL C CG1 1 
ATOM 3804  C CG2 . VAL C 3 114 ? -14.291 103.854 -15.142 1.00 39.95  ? 114 VAL C CG2 1 
ATOM 3805  N N   . THR C 3 115 ? -13.618 107.584 -15.691 1.00 36.59  ? 115 THR C N   1 
ATOM 3806  C CA  . THR C 3 115 ? -14.605 108.588 -16.001 1.00 42.72  ? 115 THR C CA  1 
ATOM 3807  C C   . THR C 3 115 ? -14.665 108.517 -17.529 1.00 45.98  ? 115 THR C C   1 
ATOM 3808  O O   . THR C 3 115 ? -13.633 108.648 -18.202 1.00 41.98  ? 115 THR C O   1 
ATOM 3809  C CB  . THR C 3 115 ? -14.134 110.009 -15.514 1.00 42.19  ? 115 THR C CB  1 
ATOM 3810  O OG1 . THR C 3 115 ? -13.718 109.949 -14.136 1.00 42.86  ? 115 THR C OG1 1 
ATOM 3811  C CG2 . THR C 3 115 ? -15.262 111.023 -15.633 1.00 42.42  ? 115 THR C CG2 1 
ATOM 3812  N N   . VAL C 3 116 ? -15.855 108.228 -18.062 1.00 49.19  ? 116 VAL C N   1 
ATOM 3813  C CA  . VAL C 3 116 ? -16.066 108.168 -19.511 1.00 49.98  ? 116 VAL C CA  1 
ATOM 3814  C C   . VAL C 3 116 ? -16.768 109.469 -19.867 1.00 50.85  ? 116 VAL C C   1 
ATOM 3815  O O   . VAL C 3 116 ? -17.918 109.683 -19.469 1.00 48.21  ? 116 VAL C O   1 
ATOM 3816  C CB  . VAL C 3 116 ? -16.985 106.997 -19.933 1.00 49.21  ? 116 VAL C CB  1 
ATOM 3817  C CG1 . VAL C 3 116 ? -16.233 105.697 -19.887 1.00 49.38  ? 116 VAL C CG1 1 
ATOM 3818  C CG2 . VAL C 3 116 ? -18.195 106.937 -19.019 1.00 50.55  ? 116 VAL C CG2 1 
ATOM 3819  N N   . SER C 3 117 ? -16.071 110.342 -20.590 1.00 50.59  ? 117 SER C N   1 
ATOM 3820  C CA  . SER C 3 117 ? -16.640 111.622 -20.963 1.00 52.52  ? 117 SER C CA  1 
ATOM 3821  C C   . SER C 3 117 ? -15.855 112.319 -22.048 1.00 53.61  ? 117 SER C C   1 
ATOM 3822  O O   . SER C 3 117 ? -14.668 112.061 -22.268 1.00 51.54  ? 117 SER C O   1 
ATOM 3823  C CB  . SER C 3 117 ? -16.730 112.552 -19.748 1.00 54.45  ? 117 SER C CB  1 
ATOM 3824  O OG  . SER C 3 117 ? -17.477 113.722 -20.058 1.00 59.72  ? 117 SER C OG  1 
ATOM 3825  N N   . VAL C 3 118 ? -16.551 113.221 -22.726 1.00 57.77  ? 118 VAL C N   1 
ATOM 3826  C CA  . VAL C 3 118 ? -15.973 114.008 -23.802 1.00 56.98  ? 118 VAL C CA  1 
ATOM 3827  C C   . VAL C 3 118 ? -15.299 115.215 -23.165 1.00 56.53  ? 118 VAL C C   1 
ATOM 3828  O O   . VAL C 3 118 ? -14.353 115.789 -23.731 1.00 57.07  ? 118 VAL C O   1 
ATOM 3829  C CB  . VAL C 3 118 ? -17.075 114.466 -24.775 1.00 56.81  ? 118 VAL C CB  1 
ATOM 3830  C CG1 . VAL C 3 118 ? -17.257 113.419 -25.872 1.00 51.39  ? 118 VAL C CG1 1 
ATOM 3831  C CG2 . VAL C 3 118 ? -18.395 114.677 -23.994 1.00 52.33  ? 118 VAL C CG2 1 
ATOM 3832  N N   . ALA C 3 119 ? -15.797 115.571 -21.976 1.00 51.76  ? 119 ALA C N   1 
ATOM 3833  C CA  . ALA C 3 119 ? -15.278 116.685 -21.195 1.00 48.43  ? 119 ALA C CA  1 
ATOM 3834  C C   . ALA C 3 119 ? -13.757 116.650 -21.149 1.00 48.21  ? 119 ALA C C   1 
ATOM 3835  O O   . ALA C 3 119 ? -13.133 115.583 -21.075 1.00 50.47  ? 119 ALA C O   1 
ATOM 3836  C CB  . ALA C 3 119 ? -15.842 116.640 -19.788 1.00 46.25  ? 119 ALA C CB  1 
ATOM 3837  N N   . LYS C 3 120 ? -13.157 117.828 -21.202 1.00 48.55  ? 120 LYS C N   1 
ATOM 3838  C CA  . LYS C 3 120 ? -11.711 117.925 -21.189 1.00 49.06  ? 120 LYS C CA  1 
ATOM 3839  C C   . LYS C 3 120 ? -11.181 118.084 -19.778 1.00 47.94  ? 120 LYS C C   1 
ATOM 3840  O O   . LYS C 3 120 ? -11.756 118.788 -18.943 1.00 48.23  ? 120 LYS C O   1 
ATOM 3841  C CB  . LYS C 3 120 ? -11.258 119.103 -22.056 1.00 54.10  ? 120 LYS C CB  1 
ATOM 3842  C CG  . LYS C 3 120 ? -11.582 118.965 -23.547 1.00 56.53  ? 120 LYS C CG  1 
ATOM 3843  C CD  . LYS C 3 120 ? -10.732 117.885 -24.202 1.00 59.50  ? 120 LYS C CD  1 
ATOM 3844  C CE  . LYS C 3 120 ? -11.035 117.751 -25.688 1.00 59.82  ? 120 LYS C CE  1 
ATOM 3845  N NZ  . LYS C 3 120 ? -10.233 116.664 -26.324 1.00 64.06  ? 120 LYS C NZ  1 
ATOM 3846  N N   . THR C 3 121 ? -10.081 117.408 -19.508 1.00 48.30  ? 121 THR C N   1 
ATOM 3847  C CA  . THR C 3 121 ? -9.478  117.490 -18.195 1.00 51.16  ? 121 THR C CA  1 
ATOM 3848  C C   . THR C 3 121 ? -8.929  118.912 -17.944 1.00 49.94  ? 121 THR C C   1 
ATOM 3849  O O   . THR C 3 121 ? -8.174  119.461 -18.751 1.00 46.14  ? 121 THR C O   1 
ATOM 3850  C CB  . THR C 3 121 ? -8.358  116.414 -18.044 1.00 51.69  ? 121 THR C CB  1 
ATOM 3851  O OG1 . THR C 3 121 ? -7.293  116.945 -17.245 1.00 51.62  ? 121 THR C OG1 1 
ATOM 3852  C CG2 . THR C 3 121 ? -7.836  115.958 -19.424 1.00 51.06  ? 121 THR C CG2 1 
ATOM 3853  N N   . THR C 3 122 ? -9.344  119.513 -16.833 1.00 48.07  ? 122 THR C N   1 
ATOM 3854  C CA  . THR C 3 122 ? -8.889  120.852 -16.485 1.00 48.74  ? 122 THR C CA  1 
ATOM 3855  C C   . THR C 3 122 ? -8.466  120.898 -15.020 1.00 45.72  ? 122 THR C C   1 
ATOM 3856  O O   . THR C 3 122 ? -9.152  120.361 -14.145 1.00 47.14  ? 122 THR C O   1 
ATOM 3857  C CB  . THR C 3 122 ? -9.989  121.902 -16.721 1.00 51.10  ? 122 THR C CB  1 
ATOM 3858  O OG1 . THR C 3 122 ? -10.995 121.782 -15.711 1.00 57.38  ? 122 THR C OG1 1 
ATOM 3859  C CG2 . THR C 3 122 ? -10.630 121.695 -18.080 1.00 53.01  ? 122 THR C CG2 1 
ATOM 3860  N N   . PRO C 3 123 ? -7.321  121.541 -14.735 1.00 41.73  ? 123 PRO C N   1 
ATOM 3861  C CA  . PRO C 3 123 ? -6.826  121.637 -13.363 1.00 39.74  ? 123 PRO C CA  1 
ATOM 3862  C C   . PRO C 3 123 ? -7.684  122.547 -12.509 1.00 39.32  ? 123 PRO C C   1 
ATOM 3863  O O   . PRO C 3 123 ? -8.412  123.393 -13.015 1.00 38.49  ? 123 PRO C O   1 
ATOM 3864  C CB  . PRO C 3 123 ? -5.408  122.158 -13.544 1.00 38.16  ? 123 PRO C CB  1 
ATOM 3865  C CG  . PRO C 3 123 ? -5.530  123.018 -14.743 1.00 36.19  ? 123 PRO C CG  1 
ATOM 3866  C CD  . PRO C 3 123 ? -6.400  122.207 -15.672 1.00 38.62  ? 123 PRO C CD  1 
ATOM 3867  N N   . PRO C 3 124 ? -7.598  122.386 -11.189 1.00 38.50  ? 124 PRO C N   1 
ATOM 3868  C CA  . PRO C 3 124 ? -8.366  123.180 -10.236 1.00 36.06  ? 124 PRO C CA  1 
ATOM 3869  C C   . PRO C 3 124 ? -7.744  124.541 -9.950  1.00 37.46  ? 124 PRO C C   1 
ATOM 3870  O O   . PRO C 3 124 ? -6.559  124.772 -10.212 1.00 41.96  ? 124 PRO C O   1 
ATOM 3871  C CB  . PRO C 3 124 ? -8.339  122.309 -9.000  1.00 31.16  ? 124 PRO C CB  1 
ATOM 3872  C CG  . PRO C 3 124 ? -6.915  121.854 -9.009  1.00 32.34  ? 124 PRO C CG  1 
ATOM 3873  C CD  . PRO C 3 124 ? -6.665  121.490 -10.478 1.00 37.11  ? 124 PRO C CD  1 
ATOM 3874  N N   . SER C 3 125 ? -8.563  125.437 -9.412  1.00 38.58  ? 125 SER C N   1 
ATOM 3875  C CA  . SER C 3 125 ? -8.119  126.764 -9.004  1.00 37.12  ? 125 SER C CA  1 
ATOM 3876  C C   . SER C 3 125 ? -8.409  126.735 -7.530  1.00 34.61  ? 125 SER C C   1 
ATOM 3877  O O   . SER C 3 125 ? -9.551  126.520 -7.122  1.00 33.14  ? 125 SER C O   1 
ATOM 3878  C CB  . SER C 3 125 ? -8.936  127.868 -9.670  1.00 37.62  ? 125 SER C CB  1 
ATOM 3879  O OG  . SER C 3 125 ? -8.588  127.968 -11.037 1.00 42.45  ? 125 SER C OG  1 
ATOM 3880  N N   . VAL C 3 126 ? -7.382  126.914 -6.721  1.00 32.06  ? 126 VAL C N   1 
ATOM 3881  C CA  . VAL C 3 126 ? -7.608  126.865 -5.298  1.00 34.73  ? 126 VAL C CA  1 
ATOM 3882  C C   . VAL C 3 126 ? -7.483  128.243 -4.641  1.00 35.96  ? 126 VAL C C   1 
ATOM 3883  O O   . VAL C 3 126 ? -6.434  128.894 -4.672  1.00 39.48  ? 126 VAL C O   1 
ATOM 3884  C CB  . VAL C 3 126 ? -6.692  125.768 -4.654  1.00 33.40  ? 126 VAL C CB  1 
ATOM 3885  C CG1 . VAL C 3 126 ? -5.480  125.524 -5.531  1.00 29.46  ? 126 VAL C CG1 1 
ATOM 3886  C CG2 . VAL C 3 126 ? -6.283  126.155 -3.242  1.00 36.06  ? 126 VAL C CG2 1 
ATOM 3887  N N   . PHE C 3 127 ? -8.595  128.684 -4.069  1.00 33.93  ? 127 PHE C N   1 
ATOM 3888  C CA  . PHE C 3 127 ? -8.673  129.975 -3.422  1.00 34.78  ? 127 PHE C CA  1 
ATOM 3889  C C   . PHE C 3 127 ? -8.758  129.761 -1.912  1.00 34.55  ? 127 PHE C C   1 
ATOM 3890  O O   . PHE C 3 127 ? -9.631  129.040 -1.428  1.00 31.88  ? 127 PHE C O   1 
ATOM 3891  C CB  . PHE C 3 127 ? -9.902  130.714 -3.943  1.00 30.49  ? 127 PHE C CB  1 
ATOM 3892  C CG  . PHE C 3 127 ? -9.954  130.824 -5.448  1.00 33.20  ? 127 PHE C CG  1 
ATOM 3893  C CD1 . PHE C 3 127 ? -8.863  131.332 -6.171  1.00 36.87  ? 127 PHE C CD1 1 
ATOM 3894  C CD2 . PHE C 3 127 ? -11.107 130.463 -6.151  1.00 34.60  ? 127 PHE C CD2 1 
ATOM 3895  C CE1 . PHE C 3 127 ? -8.930  131.483 -7.594  1.00 43.42  ? 127 PHE C CE1 1 
ATOM 3896  C CE2 . PHE C 3 127 ? -11.183 130.609 -7.571  1.00 41.65  ? 127 PHE C CE2 1 
ATOM 3897  C CZ  . PHE C 3 127 ? -10.097 131.119 -8.291  1.00 40.85  ? 127 PHE C CZ  1 
ATOM 3898  N N   . PRO C 3 128 ? -7.847  130.389 -1.147  1.00 35.00  ? 128 PRO C N   1 
ATOM 3899  C CA  . PRO C 3 128 ? -7.821  130.253 0.310   1.00 36.03  ? 128 PRO C CA  1 
ATOM 3900  C C   . PRO C 3 128 ? -8.981  130.976 0.963   1.00 38.81  ? 128 PRO C C   1 
ATOM 3901  O O   . PRO C 3 128 ? -9.453  131.988 0.448   1.00 39.90  ? 128 PRO C O   1 
ATOM 3902  C CB  . PRO C 3 128 ? -6.482  130.874 0.681   1.00 34.82  ? 128 PRO C CB  1 
ATOM 3903  C CG  . PRO C 3 128 ? -6.403  132.006 -0.269  1.00 33.71  ? 128 PRO C CG  1 
ATOM 3904  C CD  . PRO C 3 128 ? -6.853  131.386 -1.587  1.00 35.80  ? 128 PRO C CD  1 
ATOM 3905  N N   . LEU C 3 129 ? -9.440  130.457 2.099   1.00 38.80  ? 129 LEU C N   1 
ATOM 3906  C CA  . LEU C 3 129 ? -10.540 131.077 2.820   1.00 36.66  ? 129 LEU C CA  1 
ATOM 3907  C C   . LEU C 3 129 ? -10.140 131.367 4.258   1.00 39.50  ? 129 LEU C C   1 
ATOM 3908  O O   . LEU C 3 129 ? -10.099 130.463 5.098   1.00 36.61  ? 129 LEU C O   1 
ATOM 3909  C CB  . LEU C 3 129 ? -11.769 130.174 2.810   1.00 32.65  ? 129 LEU C CB  1 
ATOM 3910  C CG  . LEU C 3 129 ? -12.185 129.610 1.456   1.00 36.16  ? 129 LEU C CG  1 
ATOM 3911  C CD1 . LEU C 3 129 ? -13.489 128.860 1.641   1.00 37.30  ? 129 LEU C CD1 1 
ATOM 3912  C CD2 . LEU C 3 129 ? -12.338 130.725 0.412   1.00 37.48  ? 129 LEU C CD2 1 
ATOM 3913  N N   . ALA C 3 130 ? -9.830  132.633 4.525   1.00 45.86  ? 130 ALA C N   1 
ATOM 3914  C CA  . ALA C 3 130 ? -9.452  133.090 5.861   1.00 54.07  ? 130 ALA C CA  1 
ATOM 3915  C C   . ALA C 3 130 ? -10.643 133.863 6.439   1.00 57.48  ? 130 ALA C C   1 
ATOM 3916  O O   . ALA C 3 130 ? -11.525 134.306 5.698   1.00 55.75  ? 130 ALA C O   1 
ATOM 3917  C CB  . ALA C 3 130 ? -8.215  133.987 5.786   1.00 56.84  ? 130 ALA C CB  1 
ATOM 3918  N N   . PRO C 3 131 ? -10.695 134.027 7.768   1.00 60.36  ? 131 PRO C N   1 
ATOM 3919  C CA  . PRO C 3 131 ? -11.827 134.759 8.339   1.00 64.71  ? 131 PRO C CA  1 
ATOM 3920  C C   . PRO C 3 131 ? -11.685 136.223 7.958   1.00 72.56  ? 131 PRO C C   1 
ATOM 3921  O O   . PRO C 3 131 ? -10.567 136.753 7.941   1.00 75.04  ? 131 PRO C O   1 
ATOM 3922  C CB  . PRO C 3 131 ? -11.658 134.543 9.841   1.00 61.71  ? 131 PRO C CB  1 
ATOM 3923  C CG  . PRO C 3 131 ? -10.739 133.339 9.939   1.00 60.65  ? 131 PRO C CG  1 
ATOM 3924  C CD  . PRO C 3 131 ? -9.782  133.573 8.823   1.00 58.36  ? 131 PRO C CD  1 
ATOM 3925  N N   . GLY C 3 132 ? -12.796 136.883 7.648   1.00 78.55  ? 132 GLY C N   1 
ATOM 3926  C CA  . GLY C 3 132 ? -12.714 138.286 7.279   1.00 87.33  ? 132 GLY C CA  1 
ATOM 3927  C C   . GLY C 3 132 ? -12.152 139.195 8.372   1.00 94.09  ? 132 GLY C C   1 
ATOM 3928  O O   . GLY C 3 132 ? -12.107 138.818 9.553   1.00 95.30  ? 132 GLY C O   1 
ATOM 3929  N N   . SER C 3 133 ? -11.712 140.396 7.984   1.00 99.27  ? 133 SER C N   1 
ATOM 3930  C CA  . SER C 3 133 ? -11.179 141.357 8.958   1.00 103.70 ? 133 SER C CA  1 
ATOM 3931  C C   . SER C 3 133 ? -12.357 141.647 9.873   1.00 106.84 ? 133 SER C C   1 
ATOM 3932  O O   . SER C 3 133 ? -12.230 141.712 11.104  1.00 105.77 ? 133 SER C O   1 
ATOM 3933  C CB  . SER C 3 133 ? -10.730 142.653 8.261   1.00 102.81 ? 133 SER C CB  1 
ATOM 3934  O OG  . SER C 3 133 ? -11.783 143.218 7.490   1.00 100.81 ? 133 SER C OG  1 
ATOM 3935  N N   . ALA C 3 134 ? -13.513 141.800 9.231   1.00 111.36 ? 134 ALA C N   1 
ATOM 3936  C CA  . ALA C 3 134 ? -14.776 142.050 9.907   1.00 115.56 ? 134 ALA C CA  1 
ATOM 3937  C C   . ALA C 3 134 ? -15.189 140.753 10.626  1.00 118.26 ? 134 ALA C C   1 
ATOM 3938  O O   . ALA C 3 134 ? -16.335 140.312 10.513  1.00 120.02 ? 134 ALA C O   1 
ATOM 3939  C CB  . ALA C 3 134 ? -15.844 142.462 8.872   1.00 114.75 ? 134 ALA C CB  1 
ATOM 3940  N N   . ALA C 3 135 ? -14.245 140.149 11.352  1.00 119.16 ? 135 ALA C N   1 
ATOM 3941  C CA  . ALA C 3 135 ? -14.486 138.909 12.093  1.00 118.42 ? 135 ALA C CA  1 
ATOM 3942  C C   . ALA C 3 135 ? -14.056 139.027 13.554  1.00 118.21 ? 135 ALA C C   1 
ATOM 3943  O O   . ALA C 3 135 ? -13.092 139.733 13.878  1.00 116.05 ? 135 ALA C O   1 
ATOM 3944  C CB  . ALA C 3 135 ? -13.750 137.749 11.433  1.00 118.48 ? 135 ALA C CB  1 
ATOM 3945  N N   . GLN C 3 136 ? -14.761 138.314 14.430  1.00 118.69 ? 136 GLN C N   1 
ATOM 3946  C CA  . GLN C 3 136 ? -14.451 138.360 15.849  1.00 118.15 ? 136 GLN C CA  1 
ATOM 3947  C C   . GLN C 3 136 ? -14.008 137.064 16.496  1.00 115.71 ? 136 GLN C C   1 
ATOM 3948  O O   . GLN C 3 136 ? -14.444 135.968 16.138  1.00 114.21 ? 136 GLN C O   1 
ATOM 3949  C CB  . GLN C 3 136 ? -15.627 138.938 16.641  1.00 121.70 ? 136 GLN C CB  1 
ATOM 3950  C CG  . GLN C 3 136 ? -15.814 140.437 16.434  1.00 128.27 ? 136 GLN C CG  1 
ATOM 3951  C CD  . GLN C 3 136 ? -16.162 141.181 17.719  1.00 130.81 ? 136 GLN C CD  1 
ATOM 3952  O OE1 . GLN C 3 136 ? -17.127 140.837 18.404  1.00 131.85 ? 136 GLN C OE1 1 
ATOM 3953  N NE2 . GLN C 3 136 ? -15.377 142.210 18.048  1.00 131.22 ? 136 GLN C NE2 1 
ATOM 3954  N N   . THR C 3 137 ? -13.131 137.242 17.475  1.00 114.20 ? 137 THR C N   1 
ATOM 3955  C CA  . THR C 3 137 ? -12.543 136.169 18.265  1.00 112.79 ? 137 THR C CA  1 
ATOM 3956  C C   . THR C 3 137 ? -13.525 135.118 18.792  1.00 111.61 ? 137 THR C C   1 
ATOM 3957  O O   . THR C 3 137 ? -14.679 135.427 19.110  1.00 112.60 ? 137 THR C O   1 
ATOM 3958  C CB  . THR C 3 137 ? -11.803 136.764 19.484  1.00 112.13 ? 137 THR C CB  1 
ATOM 3959  O OG1 . THR C 3 137 ? -11.624 138.170 19.288  1.00 112.31 ? 137 THR C OG1 1 
ATOM 3960  C CG2 . THR C 3 137 ? -10.451 136.111 19.661  1.00 112.01 ? 137 THR C CG2 1 
ATOM 3961  N N   . ASN C 3 138 ? -13.041 133.876 18.876  1.00 108.95 ? 138 ASN C N   1 
ATOM 3962  C CA  . ASN C 3 138 ? -13.783 132.724 19.417  1.00 103.87 ? 138 ASN C CA  1 
ATOM 3963  C C   . ASN C 3 138 ? -12.754 131.910 20.187  1.00 98.61  ? 138 ASN C C   1 
ATOM 3964  O O   . ASN C 3 138 ? -11.584 132.291 20.272  1.00 98.53  ? 138 ASN C O   1 
ATOM 3965  C CB  . ASN C 3 138 ? -14.383 131.839 18.318  1.00 105.20 ? 138 ASN C CB  1 
ATOM 3966  C CG  . ASN C 3 138 ? -15.616 132.442 17.688  1.00 105.41 ? 138 ASN C CG  1 
ATOM 3967  O OD1 . ASN C 3 138 ? -16.535 132.869 18.390  1.00 105.95 ? 138 ASN C OD1 1 
ATOM 3968  N ND2 . ASN C 3 138 ? -15.651 132.476 16.360  1.00 105.38 ? 138 ASN C ND2 1 
ATOM 3969  N N   . SER C 3 139 ? -13.169 130.791 20.754  1.00 91.84  ? 139 SER C N   1 
ATOM 3970  C CA  . SER C 3 139 ? -12.219 129.969 21.483  1.00 85.72  ? 139 SER C CA  1 
ATOM 3971  C C   . SER C 3 139 ? -11.356 129.235 20.460  1.00 82.57  ? 139 SER C C   1 
ATOM 3972  O O   . SER C 3 139 ? -10.150 129.029 20.644  1.00 81.87  ? 139 SER C O   1 
ATOM 3973  C CB  . SER C 3 139 ? -12.965 128.965 22.350  1.00 83.70  ? 139 SER C CB  1 
ATOM 3974  O OG  . SER C 3 139 ? -12.112 127.911 22.754  1.00 77.70  ? 139 SER C OG  1 
ATOM 3975  N N   . MET C 3 140 ? -12.014 128.860 19.370  1.00 77.36  ? 140 MET C N   1 
ATOM 3976  C CA  . MET C 3 140 ? -11.396 128.142 18.278  1.00 67.95  ? 140 MET C CA  1 
ATOM 3977  C C   . MET C 3 140 ? -11.451 129.017 17.044  1.00 64.91  ? 140 MET C C   1 
ATOM 3978  O O   . MET C 3 140 ? -12.129 130.049 17.021  1.00 66.06  ? 140 MET C O   1 
ATOM 3979  C CB  . MET C 3 140 ? -12.182 126.869 18.006  1.00 65.97  ? 140 MET C CB  1 
ATOM 3980  C CG  . MET C 3 140 ? -11.323 125.707 17.641  1.00 64.17  ? 140 MET C CG  1 
ATOM 3981  S SD  . MET C 3 140 ? -10.551 125.083 19.109  1.00 62.61  ? 140 MET C SD  1 
ATOM 3982  C CE  . MET C 3 140 ? -11.895 124.054 19.728  1.00 57.76  ? 140 MET C CE  1 
ATOM 3983  N N   . VAL C 3 141 ? -10.749 128.589 16.008  1.00 59.25  ? 141 VAL C N   1 
ATOM 3984  C CA  . VAL C 3 141 ? -10.731 129.322 14.756  1.00 53.47  ? 141 VAL C CA  1 
ATOM 3985  C C   . VAL C 3 141 ? -10.817 128.343 13.606  1.00 53.21  ? 141 VAL C C   1 
ATOM 3986  O O   . VAL C 3 141 ? -10.173 127.297 13.627  1.00 55.49  ? 141 VAL C O   1 
ATOM 3987  C CB  . VAL C 3 141 ? -9.450  130.151 14.626  1.00 49.93  ? 141 VAL C CB  1 
ATOM 3988  C CG1 . VAL C 3 141 ? -8.241  129.286 14.915  1.00 51.07  ? 141 VAL C CG1 1 
ATOM 3989  C CG2 . VAL C 3 141 ? -9.368  130.758 13.247  1.00 48.72  ? 141 VAL C CG2 1 
ATOM 3990  N N   . THR C 3 142 ? -11.625 128.661 12.604  1.00 53.14  ? 142 THR C N   1 
ATOM 3991  C CA  . THR C 3 142 ? -11.736 127.756 11.473  1.00 52.79  ? 142 THR C CA  1 
ATOM 3992  C C   . THR C 3 142 ? -11.396 128.435 10.150  1.00 51.59  ? 142 THR C C   1 
ATOM 3993  O O   . THR C 3 142 ? -11.862 129.540 9.845   1.00 48.40  ? 142 THR C O   1 
ATOM 3994  C CB  . THR C 3 142 ? -13.148 127.126 11.373  1.00 52.83  ? 142 THR C CB  1 
ATOM 3995  O OG1 . THR C 3 142 ? -14.023 128.019 10.679  1.00 59.54  ? 142 THR C OG1 1 
ATOM 3996  C CG2 . THR C 3 142 ? -13.708 126.836 12.761  1.00 49.17  ? 142 THR C CG2 1 
ATOM 3997  N N   . LEU C 3 143 ? -10.563 127.752 9.372   1.00 50.24  ? 143 LEU C N   1 
ATOM 3998  C CA  . LEU C 3 143 ? -10.137 128.238 8.071   1.00 51.29  ? 143 LEU C CA  1 
ATOM 3999  C C   . LEU C 3 143 ? -10.658 127.287 7.013   1.00 52.99  ? 143 LEU C C   1 
ATOM 4000  O O   . LEU C 3 143 ? -11.739 126.724 7.136   1.00 55.29  ? 143 LEU C O   1 
ATOM 4001  C CB  . LEU C 3 143 ? -8.620  128.271 7.999   1.00 47.10  ? 143 LEU C CB  1 
ATOM 4002  C CG  . LEU C 3 143 ? -7.977  128.914 9.215   1.00 43.24  ? 143 LEU C CG  1 
ATOM 4003  C CD1 . LEU C 3 143 ? -6.470  128.749 9.157   1.00 44.90  ? 143 LEU C CD1 1 
ATOM 4004  C CD2 . LEU C 3 143 ? -8.374  130.373 9.250   1.00 47.40  ? 143 LEU C CD2 1 
ATOM 4005  N N   . GLY C 3 144 ? -9.867  127.094 5.973   1.00 55.34  ? 144 GLY C N   1 
ATOM 4006  C CA  . GLY C 3 144 ? -10.280 126.203 4.912   1.00 53.78  ? 144 GLY C CA  1 
ATOM 4007  C C   . GLY C 3 144 ? -10.120 126.934 3.608   1.00 48.22  ? 144 GLY C C   1 
ATOM 4008  O O   . GLY C 3 144 ? -10.043 128.158 3.592   1.00 48.30  ? 144 GLY C O   1 
ATOM 4009  N N   . CYS C 3 145 ? -10.047 126.193 2.519   1.00 42.01  ? 145 CYS C N   1 
ATOM 4010  C CA  . CYS C 3 145 ? -9.920  126.823 1.224   1.00 41.50  ? 145 CYS C CA  1 
ATOM 4011  C C   . CYS C 3 145 ? -10.821 126.068 0.273   1.00 39.08  ? 145 CYS C C   1 
ATOM 4012  O O   . CYS C 3 145 ? -11.310 124.994 0.606   1.00 37.68  ? 145 CYS C O   1 
ATOM 4013  C CB  . CYS C 3 145 ? -8.479  126.761 0.756   1.00 41.17  ? 145 CYS C CB  1 
ATOM 4014  S SG  . CYS C 3 145 ? -7.910  125.089 0.647   1.00 35.54  ? 145 CYS C SG  1 
ATOM 4015  N N   . LEU C 3 146 ? -11.055 126.622 -0.907  1.00 38.65  ? 146 LEU C N   1 
ATOM 4016  C CA  . LEU C 3 146 ? -11.927 125.936 -1.833  1.00 40.77  ? 146 LEU C CA  1 
ATOM 4017  C C   . LEU C 3 146 ? -11.283 125.658 -3.182  1.00 39.82  ? 146 LEU C C   1 
ATOM 4018  O O   . LEU C 3 146 ? -10.598 126.508 -3.749  1.00 39.23  ? 146 LEU C O   1 
ATOM 4019  C CB  . LEU C 3 146 ? -13.230 126.725 -2.023  1.00 39.48  ? 146 LEU C CB  1 
ATOM 4020  C CG  . LEU C 3 146 ? -13.347 127.536 -3.315  1.00 40.32  ? 146 LEU C CG  1 
ATOM 4021  C CD1 . LEU C 3 146 ? -14.777 127.998 -3.529  1.00 35.40  ? 146 LEU C CD1 1 
ATOM 4022  C CD2 . LEU C 3 146 ? -12.388 128.713 -3.260  1.00 42.81  ? 146 LEU C CD2 1 
ATOM 4023  N N   . VAL C 3 147 ? -11.513 124.445 -3.676  1.00 39.83  ? 147 VAL C N   1 
ATOM 4024  C CA  . VAL C 3 147 ? -10.996 123.996 -4.960  1.00 40.94  ? 147 VAL C CA  1 
ATOM 4025  C C   . VAL C 3 147 ? -12.112 124.105 -5.973  1.00 40.34  ? 147 VAL C C   1 
ATOM 4026  O O   . VAL C 3 147 ? -13.148 123.439 -5.847  1.00 39.00  ? 147 VAL C O   1 
ATOM 4027  C CB  . VAL C 3 147 ? -10.554 122.543 -4.895  1.00 42.35  ? 147 VAL C CB  1 
ATOM 4028  C CG1 . VAL C 3 147 ? -10.045 122.104 -6.255  1.00 39.61  ? 147 VAL C CG1 1 
ATOM 4029  C CG2 . VAL C 3 147 ? -9.481  122.387 -3.833  1.00 48.69  ? 147 VAL C CG2 1 
ATOM 4030  N N   . LYS C 3 148 ? -11.890 124.920 -6.995  1.00 38.34  ? 148 LYS C N   1 
ATOM 4031  C CA  . LYS C 3 148 ? -12.930 125.132 -7.980  1.00 36.48  ? 148 LYS C CA  1 
ATOM 4032  C C   . LYS C 3 148 ? -12.576 124.852 -9.438  1.00 32.20  ? 148 LYS C C   1 
ATOM 4033  O O   . LYS C 3 148 ? -11.416 124.939 -9.837  1.00 25.93  ? 148 LYS C O   1 
ATOM 4034  C CB  . LYS C 3 148 ? -13.435 126.570 -7.839  1.00 39.81  ? 148 LYS C CB  1 
ATOM 4035  C CG  . LYS C 3 148 ? -14.690 126.877 -8.637  1.00 41.00  ? 148 LYS C CG  1 
ATOM 4036  C CD  . LYS C 3 148 ? -15.170 128.295 -8.399  1.00 39.82  ? 148 LYS C CD  1 
ATOM 4037  C CE  . LYS C 3 148 ? -16.590 128.465 -8.907  1.00 43.10  ? 148 LYS C CE  1 
ATOM 4038  N NZ  . LYS C 3 148 ? -17.542 127.549 -8.204  1.00 47.35  ? 148 LYS C NZ  1 
ATOM 4039  N N   . GLY C 3 149 ? -13.614 124.504 -10.206 1.00 33.65  ? 149 GLY C N   1 
ATOM 4040  C CA  . GLY C 3 149 ? -13.511 124.243 -11.639 1.00 35.91  ? 149 GLY C CA  1 
ATOM 4041  C C   . GLY C 3 149 ? -12.466 123.309 -12.228 1.00 35.72  ? 149 GLY C C   1 
ATOM 4042  O O   . GLY C 3 149 ? -11.729 123.691 -13.146 1.00 37.15  ? 149 GLY C O   1 
ATOM 4043  N N   . TYR C 3 150 ? -12.405 122.079 -11.731 1.00 33.64  ? 150 TYR C N   1 
ATOM 4044  C CA  . TYR C 3 150 ? -11.443 121.115 -12.247 1.00 29.52  ? 150 TYR C CA  1 
ATOM 4045  C C   . TYR C 3 150 ? -12.168 119.891 -12.789 1.00 28.86  ? 150 TYR C C   1 
ATOM 4046  O O   . TYR C 3 150 ? -13.369 119.673 -12.548 1.00 20.16  ? 150 TYR C O   1 
ATOM 4047  C CB  . TYR C 3 150 ? -10.493 120.652 -11.156 1.00 26.85  ? 150 TYR C CB  1 
ATOM 4048  C CG  . TYR C 3 150 ? -11.222 119.886 -10.076 1.00 30.94  ? 150 TYR C CG  1 
ATOM 4049  C CD1 . TYR C 3 150 ? -11.978 120.552 -9.112  1.00 32.61  ? 150 TYR C CD1 1 
ATOM 4050  C CD2 . TYR C 3 150 ? -11.162 118.496 -10.017 1.00 35.21  ? 150 TYR C CD2 1 
ATOM 4051  C CE1 . TYR C 3 150 ? -12.644 119.855 -8.113  1.00 34.93  ? 150 TYR C CE1 1 
ATOM 4052  C CE2 . TYR C 3 150 ? -11.830 117.789 -9.022  1.00 36.20  ? 150 TYR C CE2 1 
ATOM 4053  C CZ  . TYR C 3 150 ? -12.563 118.473 -8.072  1.00 33.46  ? 150 TYR C CZ  1 
ATOM 4054  O OH  . TYR C 3 150 ? -13.201 117.782 -7.065  1.00 31.67  ? 150 TYR C OH  1 
ATOM 4055  N N   . PHE C 3 151 ? -11.405 119.081 -13.508 1.00 29.02  ? 151 PHE C N   1 
ATOM 4056  C CA  . PHE C 3 151 ? -11.939 117.877 -14.093 1.00 30.10  ? 151 PHE C CA  1 
ATOM 4057  C C   . PHE C 3 151 ? -10.789 116.991 -14.580 1.00 29.89  ? 151 PHE C C   1 
ATOM 4058  O O   . PHE C 3 151 ? -9.799  117.477 -15.140 1.00 26.78  ? 151 PHE C O   1 
ATOM 4059  C CB  . PHE C 3 151 ? -12.856 118.249 -15.248 1.00 30.97  ? 151 PHE C CB  1 
ATOM 4060  C CG  . PHE C 3 151 ? -13.609 117.096 -15.808 1.00 31.50  ? 151 PHE C CG  1 
ATOM 4061  C CD1 . PHE C 3 151 ? -14.824 116.717 -15.258 1.00 30.46  ? 151 PHE C CD1 1 
ATOM 4062  C CD2 . PHE C 3 151 ? -13.099 116.384 -16.893 1.00 34.14  ? 151 PHE C CD2 1 
ATOM 4063  C CE1 . PHE C 3 151 ? -15.533 115.648 -15.778 1.00 34.59  ? 151 PHE C CE1 1 
ATOM 4064  C CE2 . PHE C 3 151 ? -13.796 115.311 -17.426 1.00 35.98  ? 151 PHE C CE2 1 
ATOM 4065  C CZ  . PHE C 3 151 ? -15.022 114.939 -16.867 1.00 36.87  ? 151 PHE C CZ  1 
ATOM 4066  N N   . PRO C 3 152 ? -10.916 115.672 -14.384 1.00 29.74  ? 152 PRO C N   1 
ATOM 4067  C CA  . PRO C 3 152 ? -12.064 115.010 -13.762 1.00 31.54  ? 152 PRO C CA  1 
ATOM 4068  C C   . PRO C 3 152 ? -11.824 114.758 -12.293 1.00 33.94  ? 152 PRO C C   1 
ATOM 4069  O O   . PRO C 3 152 ? -10.879 115.277 -11.709 1.00 33.02  ? 152 PRO C O   1 
ATOM 4070  C CB  . PRO C 3 152 ? -12.112 113.703 -14.501 1.00 34.29  ? 152 PRO C CB  1 
ATOM 4071  C CG  . PRO C 3 152 ? -10.628 113.359 -14.521 1.00 25.14  ? 152 PRO C CG  1 
ATOM 4072  C CD  . PRO C 3 152 ? -9.979  114.672 -14.928 1.00 26.02  ? 152 PRO C CD  1 
ATOM 4073  N N   . GLU C 3 153 ? -12.698 113.948 -11.708 1.00 35.00  ? 153 GLU C N   1 
ATOM 4074  C CA  . GLU C 3 153 ? -12.541 113.551 -10.328 1.00 36.36  ? 153 GLU C CA  1 
ATOM 4075  C C   . GLU C 3 153 ? -11.335 112.595 -10.364 1.00 41.08  ? 153 GLU C C   1 
ATOM 4076  O O   . GLU C 3 153 ? -11.071 111.959 -11.384 1.00 46.68  ? 153 GLU C O   1 
ATOM 4077  C CB  . GLU C 3 153 ? -13.784 112.798 -9.887  1.00 39.78  ? 153 GLU C CB  1 
ATOM 4078  C CG  . GLU C 3 153 ? -14.885 113.659 -9.337  1.00 41.31  ? 153 GLU C CG  1 
ATOM 4079  C CD  . GLU C 3 153 ? -14.591 114.123 -7.922  1.00 38.88  ? 153 GLU C CD  1 
ATOM 4080  O OE1 . GLU C 3 153 ? -15.558 114.207 -7.136  1.00 37.76  ? 153 GLU C OE1 1 
ATOM 4081  O OE2 . GLU C 3 153 ? -13.405 114.402 -7.596  1.00 40.33  ? 153 GLU C OE2 1 
ATOM 4082  N N   . PRO C 3 154 ? -10.605 112.450 -9.254  1.00 44.94  ? 154 PRO C N   1 
ATOM 4083  C CA  . PRO C 3 154 ? -10.800 113.083 -7.954  1.00 46.89  ? 154 PRO C CA  1 
ATOM 4084  C C   . PRO C 3 154 ? -9.689  114.066 -7.654  1.00 46.65  ? 154 PRO C C   1 
ATOM 4085  O O   . PRO C 3 154 ? -8.759  114.271 -8.457  1.00 47.15  ? 154 PRO C O   1 
ATOM 4086  C CB  . PRO C 3 154 ? -10.699 111.908 -7.014  1.00 45.29  ? 154 PRO C CB  1 
ATOM 4087  C CG  . PRO C 3 154 ? -9.461  111.226 -7.595  1.00 45.05  ? 154 PRO C CG  1 
ATOM 4088  C CD  . PRO C 3 154 ? -9.664  111.320 -9.123  1.00 43.12  ? 154 PRO C CD  1 
ATOM 4089  N N   . VAL C 3 155 ? -9.789  114.626 -6.455  1.00 45.35  ? 155 VAL C N   1 
ATOM 4090  C CA  . VAL C 3 155 ? -8.813  115.563 -5.946  1.00 42.15  ? 155 VAL C CA  1 
ATOM 4091  C C   . VAL C 3 155 ? -8.616  115.252 -4.473  1.00 40.20  ? 155 VAL C C   1 
ATOM 4092  O O   . VAL C 3 155 ? -9.567  114.947 -3.742  1.00 33.98  ? 155 VAL C O   1 
ATOM 4093  C CB  . VAL C 3 155 ? -9.289  117.019 -6.123  1.00 41.85  ? 155 VAL C CB  1 
ATOM 4094  C CG1 . VAL C 3 155 ? -9.333  117.735 -4.791  1.00 39.71  ? 155 VAL C CG1 1 
ATOM 4095  C CG2 . VAL C 3 155 ? -8.352  117.740 -7.070  1.00 42.80  ? 155 VAL C CG2 1 
ATOM 4096  N N   . THR C 3 156 ? -7.371  115.323 -4.039  1.00 40.70  ? 156 THR C N   1 
ATOM 4097  C CA  . THR C 3 156 ? -7.070  115.038 -2.655  1.00 41.86  ? 156 THR C CA  1 
ATOM 4098  C C   . THR C 3 156 ? -6.514  116.299 -2.030  1.00 38.86  ? 156 THR C C   1 
ATOM 4099  O O   . THR C 3 156 ? -5.708  117.015 -2.634  1.00 34.90  ? 156 THR C O   1 
ATOM 4100  C CB  . THR C 3 156 ? -6.009  113.960 -2.537  1.00 41.39  ? 156 THR C CB  1 
ATOM 4101  O OG1 . THR C 3 156 ? -4.725  114.590 -2.483  1.00 50.43  ? 156 THR C OG1 1 
ATOM 4102  C CG2 . THR C 3 156 ? -6.052  113.039 -3.756  1.00 40.05  ? 156 THR C CG2 1 
ATOM 4103  N N   . VAL C 3 157 ? -6.936  116.557 -0.806  1.00 38.49  ? 157 VAL C N   1 
ATOM 4104  C CA  . VAL C 3 157 ? -6.466  117.734 -0.111  1.00 39.32  ? 157 VAL C CA  1 
ATOM 4105  C C   . VAL C 3 157 ? -6.073  117.387 1.322   1.00 39.82  ? 157 VAL C C   1 
ATOM 4106  O O   . VAL C 3 157 ? -6.697  116.546 1.981   1.00 33.91  ? 157 VAL C O   1 
ATOM 4107  C CB  . VAL C 3 157 ? -7.557  118.827 -0.099  1.00 40.16  ? 157 VAL C CB  1 
ATOM 4108  C CG1 . VAL C 3 157 ? -8.409  118.714 -1.352  1.00 41.78  ? 157 VAL C CG1 1 
ATOM 4109  C CG2 . VAL C 3 157 ? -8.424  118.702 1.126   1.00 38.32  ? 157 VAL C CG2 1 
ATOM 4110  N N   . THR C 3 158 ? -5.018  118.031 1.794   1.00 40.17  ? 158 THR C N   1 
ATOM 4111  C CA  . THR C 3 158 ? -4.555  117.811 3.143   1.00 40.12  ? 158 THR C CA  1 
ATOM 4112  C C   . THR C 3 158 ? -4.066  119.126 3.693   1.00 43.55  ? 158 THR C C   1 
ATOM 4113  O O   . THR C 3 158 ? -3.728  120.038 2.935   1.00 43.34  ? 158 THR C O   1 
ATOM 4114  C CB  . THR C 3 158 ? -3.407  116.815 3.189   1.00 37.55  ? 158 THR C CB  1 
ATOM 4115  O OG1 . THR C 3 158 ? -2.379  117.232 2.284   1.00 32.71  ? 158 THR C OG1 1 
ATOM 4116  C CG2 . THR C 3 158 ? -3.906  115.438 2.818   1.00 40.80  ? 158 THR C CG2 1 
ATOM 4117  N N   . TRP C 3 159 ? -4.029  119.225 5.016   1.00 45.08  ? 159 TRP C N   1 
ATOM 4118  C CA  . TRP C 3 159 ? -3.571  120.442 5.647   1.00 41.24  ? 159 TRP C CA  1 
ATOM 4119  C C   . TRP C 3 159 ? -2.217  120.263 6.298   1.00 41.71  ? 159 TRP C C   1 
ATOM 4120  O O   . TRP C 3 159 ? -1.998  119.331 7.069   1.00 40.42  ? 159 TRP C O   1 
ATOM 4121  C CB  . TRP C 3 159 ? -4.595  120.915 6.662   1.00 38.55  ? 159 TRP C CB  1 
ATOM 4122  C CG  . TRP C 3 159 ? -5.862  121.348 6.019   1.00 32.47  ? 159 TRP C CG  1 
ATOM 4123  C CD1 . TRP C 3 159 ? -6.932  120.566 5.691   1.00 26.69  ? 159 TRP C CD1 1 
ATOM 4124  C CD2 . TRP C 3 159 ? -6.193  122.679 5.614   1.00 34.79  ? 159 TRP C CD2 1 
ATOM 4125  N NE1 . TRP C 3 159 ? -7.921  121.332 5.108   1.00 30.17  ? 159 TRP C NE1 1 
ATOM 4126  C CE2 . TRP C 3 159 ? -7.493  122.633 5.048   1.00 34.30  ? 159 TRP C CE2 1 
ATOM 4127  C CE3 . TRP C 3 159 ? -5.520  123.908 5.676   1.00 37.65  ? 159 TRP C CE3 1 
ATOM 4128  C CZ2 . TRP C 3 159 ? -8.132  123.772 4.548   1.00 31.02  ? 159 TRP C CZ2 1 
ATOM 4129  C CZ3 . TRP C 3 159 ? -6.152  125.037 5.180   1.00 37.02  ? 159 TRP C CZ3 1 
ATOM 4130  C CH2 . TRP C 3 159 ? -7.450  124.961 4.623   1.00 34.41  ? 159 TRP C CH2 1 
ATOM 4131  N N   . ASN C 3 160 ? -1.315  121.184 5.980   1.00 42.26  ? 160 ASN C N   1 
ATOM 4132  C CA  . ASN C 3 160 ? 0.038   121.148 6.497   1.00 40.26  ? 160 ASN C CA  1 
ATOM 4133  C C   . ASN C 3 160 ? 0.592   119.786 6.183   1.00 38.70  ? 160 ASN C C   1 
ATOM 4134  O O   . ASN C 3 160 ? 1.068   119.071 7.064   1.00 33.03  ? 160 ASN C O   1 
ATOM 4135  C CB  . ASN C 3 160 ? 0.066   121.389 8.003   1.00 42.12  ? 160 ASN C CB  1 
ATOM 4136  C CG  . ASN C 3 160 ? -0.122  122.851 8.353   1.00 45.66  ? 160 ASN C CG  1 
ATOM 4137  O OD1 . ASN C 3 160 ? 0.135   123.739 7.532   1.00 41.88  ? 160 ASN C OD1 1 
ATOM 4138  N ND2 . ASN C 3 160 ? -0.558  123.113 9.582   1.00 47.76  ? 160 ASN C ND2 1 
ATOM 4139  N N   . SER C 3 161 ? 0.485   119.421 4.912   1.00 39.25  ? 161 SER C N   1 
ATOM 4140  C CA  . SER C 3 161 ? 0.988   118.145 4.429   1.00 38.82  ? 161 SER C CA  1 
ATOM 4141  C C   . SER C 3 161 ? 0.548   116.949 5.268   1.00 38.49  ? 161 SER C C   1 
ATOM 4142  O O   . SER C 3 161 ? 1.337   116.046 5.500   1.00 38.56  ? 161 SER C O   1 
ATOM 4143  C CB  . SER C 3 161 ? 2.510   118.195 4.387   1.00 36.21  ? 161 SER C CB  1 
ATOM 4144  O OG  . SER C 3 161 ? 2.941   119.489 3.994   1.00 50.42  ? 161 SER C OG  1 
ATOM 4145  N N   . GLY C 3 162 ? -0.696  116.938 5.735   1.00 38.42  ? 162 GLY C N   1 
ATOM 4146  C CA  . GLY C 3 162 ? -1.156  115.801 6.515   1.00 36.83  ? 162 GLY C CA  1 
ATOM 4147  C C   . GLY C 3 162 ? -1.014  115.888 8.024   1.00 38.98  ? 162 GLY C C   1 
ATOM 4148  O O   . GLY C 3 162 ? -1.663  115.120 8.740   1.00 37.90  ? 162 GLY C O   1 
ATOM 4149  N N   . SER C 3 163 ? -0.174  116.799 8.519   1.00 41.29  ? 163 SER C N   1 
ATOM 4150  C CA  . SER C 3 163 ? 0.012   116.964 9.965   1.00 43.13  ? 163 SER C CA  1 
ATOM 4151  C C   . SER C 3 163 ? -1.345  117.185 10.625  1.00 44.93  ? 163 SER C C   1 
ATOM 4152  O O   . SER C 3 163 ? -1.678  116.558 11.635  1.00 49.26  ? 163 SER C O   1 
ATOM 4153  C CB  . SER C 3 163 ? 0.913   118.158 10.245  1.00 43.14  ? 163 SER C CB  1 
ATOM 4154  O OG  . SER C 3 163 ? 2.183   117.937 9.669   1.00 49.28  ? 163 SER C OG  1 
ATOM 4155  N N   . LEU C 3 164 ? -2.123  118.086 10.039  1.00 43.73  ? 164 LEU C N   1 
ATOM 4156  C CA  . LEU C 3 164 ? -3.453  118.376 10.532  1.00 45.39  ? 164 LEU C CA  1 
ATOM 4157  C C   . LEU C 3 164 ? -4.458  117.402 9.961   1.00 48.99  ? 164 LEU C C   1 
ATOM 4158  O O   . LEU C 3 164 ? -4.758  117.449 8.763   1.00 52.47  ? 164 LEU C O   1 
ATOM 4159  C CB  . LEU C 3 164 ? -3.885  119.769 10.125  1.00 48.29  ? 164 LEU C CB  1 
ATOM 4160  C CG  . LEU C 3 164 ? -3.199  120.892 10.869  1.00 48.51  ? 164 LEU C CG  1 
ATOM 4161  C CD1 . LEU C 3 164 ? -3.960  122.168 10.588  1.00 51.89  ? 164 LEU C CD1 1 
ATOM 4162  C CD2 . LEU C 3 164 ? -3.203  120.584 12.364  1.00 48.63  ? 164 LEU C CD2 1 
ATOM 4163  N N   . SER C 3 165 ? -4.993  116.536 10.814  1.00 48.04  ? 165 SER C N   1 
ATOM 4164  C CA  . SER C 3 165 ? -5.971  115.554 10.370  1.00 50.71  ? 165 SER C CA  1 
ATOM 4165  C C   . SER C 3 165 ? -7.247  115.649 11.194  1.00 53.57  ? 165 SER C C   1 
ATOM 4166  O O   . SER C 3 165 ? -8.341  115.312 10.720  1.00 57.72  ? 165 SER C O   1 
ATOM 4167  C CB  . SER C 3 165 ? -5.380  114.152 10.477  1.00 52.22  ? 165 SER C CB  1 
ATOM 4168  O OG  . SER C 3 165 ? -4.741  113.983 11.726  1.00 58.80  ? 165 SER C OG  1 
ATOM 4169  N N   . SER C 3 166 ? -7.099  116.109 12.432  1.00 53.14  ? 166 SER C N   1 
ATOM 4170  C CA  . SER C 3 166 ? -8.232  116.263 13.335  1.00 52.01  ? 166 SER C CA  1 
ATOM 4171  C C   . SER C 3 166 ? -8.815  117.654 13.144  1.00 52.70  ? 166 SER C C   1 
ATOM 4172  O O   . SER C 3 166 ? -8.085  118.653 13.187  1.00 50.92  ? 166 SER C O   1 
ATOM 4173  C CB  . SER C 3 166 ? -7.765  116.097 14.775  1.00 52.15  ? 166 SER C CB  1 
ATOM 4174  O OG  . SER C 3 166 ? -6.603  116.878 14.995  1.00 58.96  ? 166 SER C OG  1 
ATOM 4175  N N   . GLY C 3 167 ? -10.124 117.717 12.919  1.00 52.77  ? 167 GLY C N   1 
ATOM 4176  C CA  . GLY C 3 167 ? -10.775 119.003 12.743  1.00 54.19  ? 167 GLY C CA  1 
ATOM 4177  C C   . GLY C 3 167 ? -10.886 119.467 11.306  1.00 55.49  ? 167 GLY C C   1 
ATOM 4178  O O   . GLY C 3 167 ? -11.261 120.616 11.034  1.00 59.39  ? 167 GLY C O   1 
ATOM 4179  N N   . VAL C 3 168 ? -10.559 118.579 10.376  1.00 54.09  ? 168 VAL C N   1 
ATOM 4180  C CA  . VAL C 3 168 ? -10.638 118.908 8.962   1.00 49.13  ? 168 VAL C CA  1 
ATOM 4181  C C   . VAL C 3 168 ? -11.892 118.273 8.421   1.00 47.95  ? 168 VAL C C   1 
ATOM 4182  O O   . VAL C 3 168 ? -12.245 117.162 8.811   1.00 51.97  ? 168 VAL C O   1 
ATOM 4183  C CB  . VAL C 3 168 ? -9.467  118.324 8.196   1.00 44.27  ? 168 VAL C CB  1 
ATOM 4184  C CG1 . VAL C 3 168 ? -8.163  118.879 8.728   1.00 45.02  ? 168 VAL C CG1 1 
ATOM 4185  C CG2 . VAL C 3 168 ? -9.478  116.821 8.351   1.00 51.36  ? 168 VAL C CG2 1 
ATOM 4186  N N   . HIS C 3 169 ? -12.580 118.982 7.543   1.00 46.19  ? 169 HIS C N   1 
ATOM 4187  C CA  . HIS C 3 169 ? -13.782 118.449 6.922   1.00 47.36  ? 169 HIS C CA  1 
ATOM 4188  C C   . HIS C 3 169 ? -13.666 118.790 5.463   1.00 48.15  ? 169 HIS C C   1 
ATOM 4189  O O   . HIS C 3 169 ? -13.656 119.968 5.105   1.00 52.66  ? 169 HIS C O   1 
ATOM 4190  C CB  . HIS C 3 169 ? -15.055 119.106 7.451   1.00 49.23  ? 169 HIS C CB  1 
ATOM 4191  C CG  . HIS C 3 169 ? -15.389 118.747 8.862   1.00 50.49  ? 169 HIS C CG  1 
ATOM 4192  N ND1 . HIS C 3 169 ? -16.581 119.105 9.455   1.00 50.15  ? 169 HIS C ND1 1 
ATOM 4193  C CD2 . HIS C 3 169 ? -14.680 118.091 9.810   1.00 52.55  ? 169 HIS C CD2 1 
ATOM 4194  C CE1 . HIS C 3 169 ? -16.591 118.690 10.708  1.00 50.41  ? 169 HIS C CE1 1 
ATOM 4195  N NE2 . HIS C 3 169 ? -15.449 118.072 10.949  1.00 57.29  ? 169 HIS C NE2 1 
ATOM 4196  N N   . THR C 3 170 ? -13.548 117.774 4.619   1.00 45.27  ? 170 THR C N   1 
ATOM 4197  C CA  . THR C 3 170 ? -13.468 118.016 3.185   1.00 41.21  ? 170 THR C CA  1 
ATOM 4198  C C   . THR C 3 170 ? -14.802 117.582 2.614   1.00 41.43  ? 170 THR C C   1 
ATOM 4199  O O   . THR C 3 170 ? -15.285 116.483 2.886   1.00 45.51  ? 170 THR C O   1 
ATOM 4200  C CB  . THR C 3 170 ? -12.354 117.223 2.538   1.00 37.68  ? 170 THR C CB  1 
ATOM 4201  O OG1 . THR C 3 170 ? -11.100 117.643 3.085   1.00 28.69  ? 170 THR C OG1 1 
ATOM 4202  C CG2 . THR C 3 170 ? -12.367 117.452 1.036   1.00 39.78  ? 170 THR C CG2 1 
ATOM 4203  N N   . PHE C 3 171 ? -15.403 118.440 1.812   1.00 35.94  ? 171 PHE C N   1 
ATOM 4204  C CA  . PHE C 3 171 ? -16.703 118.113 1.302   1.00 33.59  ? 171 PHE C CA  1 
ATOM 4205  C C   . PHE C 3 171 ? -16.719 117.476 -0.060  1.00 36.51  ? 171 PHE C C   1 
ATOM 4206  O O   . PHE C 3 171 ? -15.870 117.746 -0.913  1.00 37.88  ? 171 PHE C O   1 
ATOM 4207  C CB  . PHE C 3 171 ? -17.572 119.366 1.320   1.00 34.86  ? 171 PHE C CB  1 
ATOM 4208  C CG  . PHE C 3 171 ? -17.814 119.911 2.704   1.00 33.27  ? 171 PHE C CG  1 
ATOM 4209  C CD1 . PHE C 3 171 ? -19.084 119.875 3.272   1.00 37.16  ? 171 PHE C CD1 1 
ATOM 4210  C CD2 . PHE C 3 171 ? -16.759 120.398 3.467   1.00 35.93  ? 171 PHE C CD2 1 
ATOM 4211  C CE1 . PHE C 3 171 ? -19.292 120.311 4.585   1.00 40.74  ? 171 PHE C CE1 1 
ATOM 4212  C CE2 . PHE C 3 171 ? -16.954 120.832 4.776   1.00 33.33  ? 171 PHE C CE2 1 
ATOM 4213  C CZ  . PHE C 3 171 ? -18.219 120.787 5.338   1.00 36.52  ? 171 PHE C CZ  1 
ATOM 4214  N N   . PRO C 3 172 ? -17.688 116.584 -0.272  1.00 39.28  ? 172 PRO C N   1 
ATOM 4215  C CA  . PRO C 3 172 ? -17.839 115.892 -1.548  1.00 42.24  ? 172 PRO C CA  1 
ATOM 4216  C C   . PRO C 3 172 ? -18.044 116.914 -2.657  1.00 42.94  ? 172 PRO C C   1 
ATOM 4217  O O   . PRO C 3 172 ? -18.845 117.846 -2.519  1.00 45.07  ? 172 PRO C O   1 
ATOM 4218  C CB  . PRO C 3 172 ? -19.065 115.003 -1.315  1.00 41.89  ? 172 PRO C CB  1 
ATOM 4219  C CG  . PRO C 3 172 ? -19.821 115.711 -0.225  1.00 43.29  ? 172 PRO C CG  1 
ATOM 4220  C CD  . PRO C 3 172 ? -18.705 116.135 0.690   1.00 40.07  ? 172 PRO C CD  1 
ATOM 4221  N N   . ALA C 3 173 ? -17.310 116.740 -3.749  1.00 42.12  ? 173 ALA C N   1 
ATOM 4222  C CA  . ALA C 3 173 ? -17.403 117.662 -4.868  1.00 43.35  ? 173 ALA C CA  1 
ATOM 4223  C C   . ALA C 3 173 ? -18.786 117.683 -5.506  1.00 42.40  ? 173 ALA C C   1 
ATOM 4224  O O   . ALA C 3 173 ? -19.607 116.789 -5.281  1.00 35.30  ? 173 ALA C O   1 
ATOM 4225  C CB  . ALA C 3 173 ? -16.359 117.315 -5.919  1.00 42.06  ? 173 ALA C CB  1 
ATOM 4226  N N   . VAL C 3 174 ? -19.023 118.736 -6.290  1.00 42.86  ? 174 VAL C N   1 
ATOM 4227  C CA  . VAL C 3 174 ? -20.267 118.929 -7.021  1.00 46.30  ? 174 VAL C CA  1 
ATOM 4228  C C   . VAL C 3 174 ? -19.892 119.233 -8.461  1.00 49.55  ? 174 VAL C C   1 
ATOM 4229  O O   . VAL C 3 174 ? -18.917 119.945 -8.734  1.00 49.21  ? 174 VAL C O   1 
ATOM 4230  C CB  . VAL C 3 174 ? -21.097 120.091 -6.461  1.00 45.88  ? 174 VAL C CB  1 
ATOM 4231  C CG1 . VAL C 3 174 ? -21.487 119.802 -5.027  1.00 48.57  ? 174 VAL C CG1 1 
ATOM 4232  C CG2 . VAL C 3 174 ? -20.306 121.377 -6.541  1.00 51.58  ? 174 VAL C CG2 1 
ATOM 4233  N N   . LEU C 3 175 ? -20.668 118.681 -9.384  1.00 55.19  ? 175 LEU C N   1 
ATOM 4234  C CA  . LEU C 3 175 ? -20.385 118.867 -10.788 1.00 62.04  ? 175 LEU C CA  1 
ATOM 4235  C C   . LEU C 3 175 ? -21.160 120.028 -11.378 1.00 67.58  ? 175 LEU C C   1 
ATOM 4236  O O   . LEU C 3 175 ? -22.379 119.960 -11.522 1.00 71.17  ? 175 LEU C O   1 
ATOM 4237  C CB  . LEU C 3 175 ? -20.685 117.570 -11.553 1.00 61.33  ? 175 LEU C CB  1 
ATOM 4238  C CG  . LEU C 3 175 ? -20.272 117.461 -13.026 1.00 63.92  ? 175 LEU C CG  1 
ATOM 4239  C CD1 . LEU C 3 175 ? -21.239 118.239 -13.918 1.00 68.28  ? 175 LEU C CD1 1 
ATOM 4240  C CD2 . LEU C 3 175 ? -18.856 117.976 -13.184 1.00 61.76  ? 175 LEU C CD2 1 
ATOM 4241  N N   . GLN C 3 176 ? -20.438 121.095 -11.711 1.00 72.20  ? 176 GLN C N   1 
ATOM 4242  C CA  . GLN C 3 176 ? -21.031 122.282 -12.317 1.00 76.51  ? 176 GLN C CA  1 
ATOM 4243  C C   . GLN C 3 176 ? -20.682 122.238 -13.803 1.00 78.71  ? 176 GLN C C   1 
ATOM 4244  O O   . GLN C 3 176 ? -19.515 122.357 -14.186 1.00 80.45  ? 176 GLN C O   1 
ATOM 4245  C CB  . GLN C 3 176 ? -20.468 123.554 -11.667 1.00 78.60  ? 176 GLN C CB  1 
ATOM 4246  C CG  . GLN C 3 176 ? -21.143 124.853 -12.124 1.00 88.95  ? 176 GLN C CG  1 
ATOM 4247  C CD  . GLN C 3 176 ? -22.668 124.707 -12.302 1.00 94.76  ? 176 GLN C CD  1 
ATOM 4248  O OE1 . GLN C 3 176 ? -23.396 124.325 -11.374 1.00 98.43  ? 176 GLN C OE1 1 
ATOM 4249  N NE2 . GLN C 3 176 ? -23.148 125.009 -13.507 1.00 97.60  ? 176 GLN C NE2 1 
ATOM 4250  N N   . SER C 3 177 ? -21.699 122.033 -14.629 1.00 78.95  ? 177 SER C N   1 
ATOM 4251  C CA  . SER C 3 177 ? -21.510 121.957 -16.061 1.00 78.11  ? 177 SER C CA  1 
ATOM 4252  C C   . SER C 3 177 ? -20.108 121.503 -16.436 1.00 75.45  ? 177 SER C C   1 
ATOM 4253  O O   . SER C 3 177 ? -19.283 122.306 -16.862 1.00 73.63  ? 177 SER C O   1 
ATOM 4254  C CB  . SER C 3 177 ? -21.789 123.311 -16.708 1.00 82.09  ? 177 SER C CB  1 
ATOM 4255  O OG  . SER C 3 177 ? -21.759 123.191 -18.121 1.00 86.95  ? 177 SER C OG  1 
ATOM 4256  N N   . ASP C 3 178 ? -19.842 120.216 -16.250 1.00 72.83  ? 178 ASP C N   1 
ATOM 4257  C CA  . ASP C 3 178 ? -18.552 119.620 -16.593 1.00 71.18  ? 178 ASP C CA  1 
ATOM 4258  C C   . ASP C 3 178 ? -17.339 120.096 -15.825 1.00 67.78  ? 178 ASP C C   1 
ATOM 4259  O O   . ASP C 3 178 ? -16.214 119.974 -16.319 1.00 70.32  ? 178 ASP C O   1 
ATOM 4260  C CB  . ASP C 3 178 ? -18.268 119.788 -18.080 1.00 76.29  ? 178 ASP C CB  1 
ATOM 4261  C CG  . ASP C 3 178 ? -19.180 118.949 -18.926 1.00 82.18  ? 178 ASP C CG  1 
ATOM 4262  O OD1 . ASP C 3 178 ? -19.038 118.990 -20.165 1.00 83.21  ? 178 ASP C OD1 1 
ATOM 4263  O OD2 . ASP C 3 178 ? -20.044 118.243 -18.347 1.00 85.76  ? 178 ASP C OD2 1 
ATOM 4264  N N   . LEU C 3 179 ? -17.552 120.633 -14.630 1.00 61.11  ? 179 LEU C N   1 
ATOM 4265  C CA  . LEU C 3 179 ? -16.438 121.078 -13.803 1.00 57.19  ? 179 LEU C CA  1 
ATOM 4266  C C   . LEU C 3 179 ? -16.754 120.904 -12.345 1.00 55.59  ? 179 LEU C C   1 
ATOM 4267  O O   . LEU C 3 179 ? -17.697 121.499 -11.830 1.00 59.83  ? 179 LEU C O   1 
ATOM 4268  C CB  . LEU C 3 179 ? -16.081 122.536 -14.067 1.00 55.09  ? 179 LEU C CB  1 
ATOM 4269  C CG  . LEU C 3 179 ? -15.265 122.809 -15.338 1.00 52.67  ? 179 LEU C CG  1 
ATOM 4270  C CD1 . LEU C 3 179 ? -14.534 124.126 -15.171 1.00 52.57  ? 179 LEU C CD1 1 
ATOM 4271  C CD2 . LEU C 3 179 ? -14.243 121.708 -15.585 1.00 56.61  ? 179 LEU C CD2 1 
ATOM 4272  N N   . TYR C 3 180 ? -15.953 120.087 -11.678 1.00 51.66  ? 180 TYR C N   1 
ATOM 4273  C CA  . TYR C 3 180 ? -16.172 119.844 -10.268 1.00 48.27  ? 180 TYR C CA  1 
ATOM 4274  C C   . TYR C 3 180 ? -15.630 120.966 -9.432  1.00 44.64  ? 180 TYR C C   1 
ATOM 4275  O O   . TYR C 3 180 ? -14.808 121.773 -9.877  1.00 44.36  ? 180 TYR C O   1 
ATOM 4276  C CB  . TYR C 3 180 ? -15.509 118.547 -9.818  1.00 53.27  ? 180 TYR C CB  1 
ATOM 4277  C CG  . TYR C 3 180 ? -16.108 117.306 -10.425 1.00 56.74  ? 180 TYR C CG  1 
ATOM 4278  C CD1 . TYR C 3 180 ? -15.638 116.800 -11.637 1.00 57.59  ? 180 TYR C CD1 1 
ATOM 4279  C CD2 . TYR C 3 180 ? -17.139 116.637 -9.782  1.00 57.08  ? 180 TYR C CD2 1 
ATOM 4280  C CE1 . TYR C 3 180 ? -16.182 115.650 -12.188 1.00 61.82  ? 180 TYR C CE1 1 
ATOM 4281  C CE2 . TYR C 3 180 ? -17.692 115.484 -10.327 1.00 61.58  ? 180 TYR C CE2 1 
ATOM 4282  C CZ  . TYR C 3 180 ? -17.209 114.994 -11.526 1.00 61.97  ? 180 TYR C CZ  1 
ATOM 4283  O OH  . TYR C 3 180 ? -17.737 113.830 -12.042 1.00 65.06  ? 180 TYR C OH  1 
ATOM 4284  N N   . THR C 3 181 ? -16.103 121.012 -8.201  1.00 41.61  ? 181 THR C N   1 
ATOM 4285  C CA  . THR C 3 181 ? -15.658 122.026 -7.280  1.00 40.70  ? 181 THR C CA  1 
ATOM 4286  C C   . THR C 3 181 ? -16.015 121.576 -5.870  1.00 39.81  ? 181 THR C C   1 
ATOM 4287  O O   . THR C 3 181 ? -17.147 121.166 -5.598  1.00 34.34  ? 181 THR C O   1 
ATOM 4288  C CB  . THR C 3 181 ? -16.279 123.418 -7.638  1.00 40.70  ? 181 THR C CB  1 
ATOM 4289  O OG1 . THR C 3 181 ? -16.635 124.102 -6.439  1.00 35.44  ? 181 THR C OG1 1 
ATOM 4290  C CG2 . THR C 3 181 ? -17.516 123.277 -8.534  1.00 38.45  ? 181 THR C CG2 1 
ATOM 4291  N N   . LEU C 3 182 ? -15.023 121.597 -4.986  1.00 42.53  ? 182 LEU C N   1 
ATOM 4292  C CA  . LEU C 3 182 ? -15.249 121.192 -3.605  1.00 46.81  ? 182 LEU C CA  1 
ATOM 4293  C C   . LEU C 3 182 ? -14.481 122.108 -2.678  1.00 46.86  ? 182 LEU C C   1 
ATOM 4294  O O   . LEU C 3 182 ? -13.632 122.883 -3.115  1.00 47.14  ? 182 LEU C O   1 
ATOM 4295  C CB  . LEU C 3 182 ? -14.810 119.742 -3.369  1.00 45.82  ? 182 LEU C CB  1 
ATOM 4296  C CG  . LEU C 3 182 ? -13.317 119.411 -3.243  1.00 42.72  ? 182 LEU C CG  1 
ATOM 4297  C CD1 . LEU C 3 182 ? -12.699 119.950 -1.954  1.00 37.70  ? 182 LEU C CD1 1 
ATOM 4298  C CD2 . LEU C 3 182 ? -13.198 117.919 -3.254  1.00 36.08  ? 182 LEU C CD2 1 
ATOM 4299  N N   . SER C 3 183 ? -14.748 121.960 -1.388  1.00 48.51  ? 183 SER C N   1 
ATOM 4300  C CA  . SER C 3 183 ? -14.138 122.799 -0.375  1.00 48.36  ? 183 SER C CA  1 
ATOM 4301  C C   . SER C 3 183 ? -13.781 122.015 0.874   1.00 47.76  ? 183 SER C C   1 
ATOM 4302  O O   . SER C 3 183 ? -14.470 121.063 1.232   1.00 46.34  ? 183 SER C O   1 
ATOM 4303  C CB  . SER C 3 183 ? -15.149 123.859 -0.002  1.00 51.08  ? 183 SER C CB  1 
ATOM 4304  O OG  . SER C 3 183 ? -16.408 123.212 0.211   1.00 56.40  ? 183 SER C OG  1 
ATOM 4305  N N   . SER C 3 184 ? -12.719 122.429 1.550   1.00 44.76  ? 184 SER C N   1 
ATOM 4306  C CA  . SER C 3 184 ? -12.318 121.768 2.780   1.00 41.94  ? 184 SER C CA  1 
ATOM 4307  C C   . SER C 3 184 ? -12.023 122.807 3.846   1.00 41.35  ? 184 SER C C   1 
ATOM 4308  O O   . SER C 3 184 ? -11.400 123.833 3.562   1.00 44.50  ? 184 SER C O   1 
ATOM 4309  C CB  . SER C 3 184 ? -11.078 120.913 2.556   1.00 40.68  ? 184 SER C CB  1 
ATOM 4310  O OG  . SER C 3 184 ? -10.613 120.369 3.783   1.00 39.07  ? 184 SER C OG  1 
ATOM 4311  N N   . SER C 3 185 ? -12.454 122.531 5.073   1.00 37.56  ? 185 SER C N   1 
ATOM 4312  C CA  . SER C 3 185 ? -12.249 123.445 6.184   1.00 36.60  ? 185 SER C CA  1 
ATOM 4313  C C   . SER C 3 185 ? -11.422 122.822 7.283   1.00 39.55  ? 185 SER C C   1 
ATOM 4314  O O   . SER C 3 185 ? -11.293 121.608 7.360   1.00 44.01  ? 185 SER C O   1 
ATOM 4315  C CB  . SER C 3 185 ? -13.593 123.842 6.787   1.00 37.32  ? 185 SER C CB  1 
ATOM 4316  O OG  . SER C 3 185 ? -14.108 122.825 7.634   1.00 33.98  ? 185 SER C OG  1 
ATOM 4317  N N   . VAL C 3 186 ? -10.869 123.659 8.147   1.00 38.99  ? 186 VAL C N   1 
ATOM 4318  C CA  . VAL C 3 186 ? -10.094 123.169 9.278   1.00 38.37  ? 186 VAL C CA  1 
ATOM 4319  C C   . VAL C 3 186 ? -10.581 123.944 10.482  1.00 45.01  ? 186 VAL C C   1 
ATOM 4320  O O   . VAL C 3 186 ? -11.457 124.793 10.364  1.00 49.58  ? 186 VAL C O   1 
ATOM 4321  C CB  . VAL C 3 186 ? -8.616  123.471 9.156   1.00 33.65  ? 186 VAL C CB  1 
ATOM 4322  C CG1 . VAL C 3 186 ? -7.819  122.281 9.638   1.00 36.08  ? 186 VAL C CG1 1 
ATOM 4323  C CG2 . VAL C 3 186 ? -8.283  123.859 7.750   1.00 31.77  ? 186 VAL C CG2 1 
ATOM 4324  N N   . THR C 3 187 ? -10.002 123.666 11.642  1.00 45.24  ? 187 THR C N   1 
ATOM 4325  C CA  . THR C 3 187 ? -10.381 124.359 12.858  1.00 41.95  ? 187 THR C CA  1 
ATOM 4326  C C   . THR C 3 187 ? -9.288  124.090 13.846  1.00 41.27  ? 187 THR C C   1 
ATOM 4327  O O   . THR C 3 187 ? -8.853  122.950 13.974  1.00 36.33  ? 187 THR C O   1 
ATOM 4328  C CB  . THR C 3 187 ? -11.679 123.828 13.434  1.00 43.70  ? 187 THR C CB  1 
ATOM 4329  O OG1 . THR C 3 187 ? -12.704 123.861 12.428  1.00 49.36  ? 187 THR C OG1 1 
ATOM 4330  C CG2 . THR C 3 187 ? -12.099 124.681 14.611  1.00 42.02  ? 187 THR C CG2 1 
ATOM 4331  N N   . VAL C 3 188 ? -8.848  125.138 14.543  1.00 44.99  ? 188 VAL C N   1 
ATOM 4332  C CA  . VAL C 3 188 ? -7.757  125.036 15.519  1.00 45.67  ? 188 VAL C CA  1 
ATOM 4333  C C   . VAL C 3 188 ? -7.829  126.057 16.654  1.00 50.15  ? 188 VAL C C   1 
ATOM 4334  O O   . VAL C 3 188 ? -8.666  126.963 16.652  1.00 51.38  ? 188 VAL C O   1 
ATOM 4335  C CB  . VAL C 3 188 ? -6.380  125.257 14.845  1.00 44.00  ? 188 VAL C CB  1 
ATOM 4336  C CG1 . VAL C 3 188 ? -6.210  124.328 13.657  1.00 38.59  ? 188 VAL C CG1 1 
ATOM 4337  C CG2 . VAL C 3 188 ? -6.247  126.712 14.421  1.00 37.72  ? 188 VAL C CG2 1 
ATOM 4338  N N   . PRO C 3 189 ? -6.937  125.914 17.645  1.00 54.27  ? 189 PRO C N   1 
ATOM 4339  C CA  . PRO C 3 189 ? -6.895  126.837 18.777  1.00 56.96  ? 189 PRO C CA  1 
ATOM 4340  C C   . PRO C 3 189 ? -6.583  128.237 18.246  1.00 58.25  ? 189 PRO C C   1 
ATOM 4341  O O   . PRO C 3 189 ? -5.617  128.427 17.499  1.00 56.14  ? 189 PRO C O   1 
ATOM 4342  C CB  . PRO C 3 189 ? -5.759  126.278 19.619  1.00 58.18  ? 189 PRO C CB  1 
ATOM 4343  C CG  . PRO C 3 189 ? -5.889  124.809 19.385  1.00 57.74  ? 189 PRO C CG  1 
ATOM 4344  C CD  . PRO C 3 189 ? -6.067  124.754 17.898  1.00 55.09  ? 189 PRO C CD  1 
ATOM 4345  N N   . SER C 3 190 ? -7.410  129.206 18.622  1.00 58.43  ? 190 SER C N   1 
ATOM 4346  C CA  . SER C 3 190 ? -7.223  130.576 18.174  1.00 60.98  ? 190 SER C CA  1 
ATOM 4347  C C   . SER C 3 190 ? -5.784  130.992 18.427  1.00 62.30  ? 190 SER C C   1 
ATOM 4348  O O   . SER C 3 190 ? -5.246  131.866 17.747  1.00 64.74  ? 190 SER C O   1 
ATOM 4349  C CB  . SER C 3 190 ? -8.180  131.487 18.928  1.00 66.30  ? 190 SER C CB  1 
ATOM 4350  O OG  . SER C 3 190 ? -9.493  130.945 18.903  1.00 70.10  ? 190 SER C OG  1 
ATOM 4351  N N   . SER C 3 191 ? -5.174  130.349 19.418  1.00 59.99  ? 191 SER C N   1 
ATOM 4352  C CA  . SER C 3 191 ? -3.788  130.599 19.777  1.00 57.04  ? 191 SER C CA  1 
ATOM 4353  C C   . SER C 3 191 ? -2.892  130.284 18.580  1.00 58.05  ? 191 SER C C   1 
ATOM 4354  O O   . SER C 3 191 ? -2.267  131.173 17.999  1.00 53.72  ? 191 SER C O   1 
ATOM 4355  C CB  . SER C 3 191 ? -3.392  129.707 20.956  1.00 56.60  ? 191 SER C CB  1 
ATOM 4356  O OG  . SER C 3 191 ? -3.546  128.329 20.647  1.00 52.40  ? 191 SER C OG  1 
ATOM 4357  N N   . THR C 3 192 ? -2.868  129.002 18.222  1.00 60.31  ? 192 THR C N   1 
ATOM 4358  C CA  . THR C 3 192 ? -2.078  128.446 17.119  1.00 62.23  ? 192 THR C CA  1 
ATOM 4359  C C   . THR C 3 192 ? -2.062  129.211 15.786  1.00 63.46  ? 192 THR C C   1 
ATOM 4360  O O   . THR C 3 192 ? -1.117  129.075 15.006  1.00 60.56  ? 192 THR C O   1 
ATOM 4361  C CB  . THR C 3 192 ? -2.534  127.012 16.818  1.00 60.76  ? 192 THR C CB  1 
ATOM 4362  O OG1 . THR C 3 192 ? -3.849  127.048 16.255  1.00 67.08  ? 192 THR C OG1 1 
ATOM 4363  C CG2 . THR C 3 192 ? -2.582  126.187 18.098  1.00 61.35  ? 192 THR C CG2 1 
ATOM 4364  N N   . TRP C 3 193 ? -3.100  129.992 15.508  1.00 64.12  ? 193 TRP C N   1 
ATOM 4365  C CA  . TRP C 3 193 ? -3.135  130.743 14.259  1.00 63.82  ? 193 TRP C CA  1 
ATOM 4366  C C   . TRP C 3 193 ? -3.477  132.204 14.508  1.00 64.34  ? 193 TRP C C   1 
ATOM 4367  O O   . TRP C 3 193 ? -4.319  132.518 15.346  1.00 66.20  ? 193 TRP C O   1 
ATOM 4368  C CB  . TRP C 3 193 ? -4.167  130.144 13.306  1.00 63.72  ? 193 TRP C CB  1 
ATOM 4369  C CG  . TRP C 3 193 ? -4.090  130.698 11.901  1.00 63.78  ? 193 TRP C CG  1 
ATOM 4370  C CD1 . TRP C 3 193 ? -3.160  130.391 10.942  1.00 64.87  ? 193 TRP C CD1 1 
ATOM 4371  C CD2 . TRP C 3 193 ? -4.953  131.681 11.316  1.00 59.64  ? 193 TRP C CD2 1 
ATOM 4372  N NE1 . TRP C 3 193 ? -3.393  131.124 9.799   1.00 59.78  ? 193 TRP C NE1 1 
ATOM 4373  C CE2 . TRP C 3 193 ? -4.487  131.923 10.003  1.00 57.66  ? 193 TRP C CE2 1 
ATOM 4374  C CE3 . TRP C 3 193 ? -6.073  132.381 11.773  1.00 57.85  ? 193 TRP C CE3 1 
ATOM 4375  C CZ2 . TRP C 3 193 ? -5.104  132.836 9.147   1.00 54.64  ? 193 TRP C CZ2 1 
ATOM 4376  C CZ3 . TRP C 3 193 ? -6.687  133.291 10.916  1.00 55.30  ? 193 TRP C CZ3 1 
ATOM 4377  C CH2 . TRP C 3 193 ? -6.199  133.508 9.619   1.00 51.37  ? 193 TRP C CH2 1 
ATOM 4378  N N   . PRO C 3 194 ? -2.836  133.118 13.771  1.00 61.71  ? 194 PRO C N   1 
ATOM 4379  C CA  . PRO C 3 194 ? -1.831  132.831 12.750  1.00 59.79  ? 194 PRO C CA  1 
ATOM 4380  C C   . PRO C 3 194 ? -0.442  132.847 13.344  1.00 59.49  ? 194 PRO C C   1 
ATOM 4381  O O   . PRO C 3 194 ? 0.547   133.031 12.633  1.00 56.70  ? 194 PRO C O   1 
ATOM 4382  C CB  . PRO C 3 194 ? -2.039  133.953 11.753  1.00 59.29  ? 194 PRO C CB  1 
ATOM 4383  C CG  . PRO C 3 194 ? -2.294  135.094 12.657  1.00 60.57  ? 194 PRO C CG  1 
ATOM 4384  C CD  . PRO C 3 194 ? -3.264  134.522 13.683  1.00 59.78  ? 194 PRO C CD  1 
ATOM 4385  N N   . SER C 3 195 ? -0.367  132.680 14.657  1.00 59.86  ? 195 SER C N   1 
ATOM 4386  C CA  . SER C 3 195 ? 0.929   132.652 15.310  1.00 62.95  ? 195 SER C CA  1 
ATOM 4387  C C   . SER C 3 195 ? 1.741   131.573 14.591  1.00 64.47  ? 195 SER C C   1 
ATOM 4388  O O   . SER C 3 195 ? 2.894   131.779 14.213  1.00 63.46  ? 195 SER C O   1 
ATOM 4389  C CB  . SER C 3 195 ? 0.763   132.318 16.792  1.00 61.91  ? 195 SER C CB  1 
ATOM 4390  O OG  . SER C 3 195 ? -0.104  131.214 16.967  1.00 62.18  ? 195 SER C OG  1 
ATOM 4391  N N   . GLU C 3 196 ? 1.123   130.415 14.404  1.00 65.40  ? 196 GLU C N   1 
ATOM 4392  C CA  . GLU C 3 196 ? 1.772   129.336 13.691  1.00 66.18  ? 196 GLU C CA  1 
ATOM 4393  C C   . GLU C 3 196 ? 1.222   129.409 12.284  1.00 63.83  ? 196 GLU C C   1 
ATOM 4394  O O   . GLU C 3 196 ? 0.311   130.188 12.007  1.00 63.60  ? 196 GLU C O   1 
ATOM 4395  C CB  . GLU C 3 196 ? 1.433   127.993 14.310  1.00 72.70  ? 196 GLU C CB  1 
ATOM 4396  C CG  . GLU C 3 196 ? 2.026   127.795 15.677  1.00 82.77  ? 196 GLU C CG  1 
ATOM 4397  C CD  . GLU C 3 196 ? 1.582   126.484 16.296  1.00 90.72  ? 196 GLU C CD  1 
ATOM 4398  O OE1 . GLU C 3 196 ? 1.867   125.411 15.708  1.00 90.79  ? 196 GLU C OE1 1 
ATOM 4399  O OE2 . GLU C 3 196 ? 0.938   126.527 17.368  1.00 95.00  ? 196 GLU C OE2 1 
ATOM 4400  N N   . THR C 3 197 ? 1.761   128.594 11.392  1.00 62.49  ? 197 THR C N   1 
ATOM 4401  C CA  . THR C 3 197 ? 1.315   128.627 10.013  1.00 60.41  ? 197 THR C CA  1 
ATOM 4402  C C   . THR C 3 197 ? 0.469   127.441 9.583   1.00 59.64  ? 197 THR C C   1 
ATOM 4403  O O   . THR C 3 197 ? 0.718   126.305 9.971   1.00 60.12  ? 197 THR C O   1 
ATOM 4404  C CB  . THR C 3 197 ? 2.518   128.764 9.065   1.00 60.91  ? 197 THR C CB  1 
ATOM 4405  O OG1 . THR C 3 197 ? 2.148   128.302 7.764   1.00 59.77  ? 197 THR C OG1 1 
ATOM 4406  C CG2 . THR C 3 197 ? 3.717   127.975 9.591   1.00 57.86  ? 197 THR C CG2 1 
ATOM 4407  N N   . VAL C 3 198 ? -0.543  127.732 8.775   1.00 58.44  ? 198 VAL C N   1 
ATOM 4408  C CA  . VAL C 3 198 ? -1.448  126.715 8.253   1.00 53.73  ? 198 VAL C CA  1 
ATOM 4409  C C   . VAL C 3 198 ? -1.545  126.832 6.744   1.00 53.57  ? 198 VAL C C   1 
ATOM 4410  O O   . VAL C 3 198 ? -1.596  127.934 6.186   1.00 54.12  ? 198 VAL C O   1 
ATOM 4411  C CB  . VAL C 3 198 ? -2.843  126.868 8.835   1.00 49.80  ? 198 VAL C CB  1 
ATOM 4412  C CG1 . VAL C 3 198 ? -3.858  126.151 7.968   1.00 43.42  ? 198 VAL C CG1 1 
ATOM 4413  C CG2 . VAL C 3 198 ? -2.847  126.320 10.234  1.00 52.18  ? 198 VAL C CG2 1 
ATOM 4414  N N   . THR C 3 199 ? -1.594  125.687 6.083   1.00 51.89  ? 199 THR C N   1 
ATOM 4415  C CA  . THR C 3 199 ? -1.662  125.685 4.640   1.00 50.75  ? 199 THR C CA  1 
ATOM 4416  C C   . THR C 3 199 ? -2.279  124.395 4.100   1.00 50.73  ? 199 THR C C   1 
ATOM 4417  O O   . THR C 3 199 ? -1.988  123.305 4.595   1.00 51.08  ? 199 THR C O   1 
ATOM 4418  C CB  . THR C 3 199 ? -0.253  125.891 4.074   1.00 49.31  ? 199 THR C CB  1 
ATOM 4419  O OG1 . THR C 3 199 ? -0.224  125.497 2.702   1.00 52.72  ? 199 THR C OG1 1 
ATOM 4420  C CG2 . THR C 3 199 ? 0.752   125.080 4.868   1.00 47.21  ? 199 THR C CG2 1 
ATOM 4421  N N   . CYS C 3 200 ? -3.146  124.520 3.096   1.00 49.85  ? 200 CYS C N   1 
ATOM 4422  C CA  . CYS C 3 200 ? -3.785  123.343 2.506   1.00 48.02  ? 200 CYS C CA  1 
ATOM 4423  C C   . CYS C 3 200 ? -3.016  122.905 1.275   1.00 45.16  ? 200 CYS C C   1 
ATOM 4424  O O   . CYS C 3 200 ? -2.609  123.731 0.446   1.00 41.09  ? 200 CYS C O   1 
ATOM 4425  C CB  . CYS C 3 200 ? -5.231  123.639 2.111   1.00 48.83  ? 200 CYS C CB  1 
ATOM 4426  S SG  . CYS C 3 200 ? -5.339  124.860 0.819   1.00 47.51  ? 200 CYS C SG  1 
ATOM 4427  N N   . ASN C 3 201 ? -2.818  121.596 1.170   1.00 42.88  ? 201 ASN C N   1 
ATOM 4428  C CA  . ASN C 3 201 ? -2.096  121.012 0.056   1.00 40.92  ? 201 ASN C CA  1 
ATOM 4429  C C   . ASN C 3 201 ? -3.107  120.260 -0.780  1.00 41.21  ? 201 ASN C C   1 
ATOM 4430  O O   . ASN C 3 201 ? -3.562  119.167 -0.414  1.00 43.95  ? 201 ASN C O   1 
ATOM 4431  C CB  . ASN C 3 201 ? -1.041  120.044 0.568   1.00 38.59  ? 201 ASN C CB  1 
ATOM 4432  C CG  . ASN C 3 201 ? -0.610  120.355 1.978   1.00 36.59  ? 201 ASN C CG  1 
ATOM 4433  O OD1 . ASN C 3 201 ? 0.109   121.322 2.215   1.00 36.66  ? 201 ASN C OD1 1 
ATOM 4434  N ND2 . ASN C 3 201 ? -1.063  119.541 2.932   1.00 40.71  ? 201 ASN C ND2 1 
ATOM 4435  N N   . VAL C 3 202 ? -3.467  120.851 -1.905  1.00 39.47  ? 202 VAL C N   1 
ATOM 4436  C CA  . VAL C 3 202 ? -4.431  120.219 -2.776  1.00 43.01  ? 202 VAL C CA  1 
ATOM 4437  C C   . VAL C 3 202 ? -3.721  119.577 -3.961  1.00 44.04  ? 202 VAL C C   1 
ATOM 4438  O O   . VAL C 3 202 ? -2.856  120.196 -4.591  1.00 46.46  ? 202 VAL C O   1 
ATOM 4439  C CB  . VAL C 3 202 ? -5.452  121.241 -3.274  1.00 40.34  ? 202 VAL C CB  1 
ATOM 4440  C CG1 . VAL C 3 202 ? -4.727  122.420 -3.861  1.00 39.11  ? 202 VAL C CG1 1 
ATOM 4441  C CG2 . VAL C 3 202 ? -6.365  120.605 -4.307  1.00 41.58  ? 202 VAL C CG2 1 
ATOM 4442  N N   . ALA C 3 203 ? -4.083  118.329 -4.247  1.00 42.66  ? 203 ALA C N   1 
ATOM 4443  C CA  . ALA C 3 203 ? -3.483  117.595 -5.350  1.00 40.03  ? 203 ALA C CA  1 
ATOM 4444  C C   . ALA C 3 203 ? -4.533  117.033 -6.287  1.00 39.96  ? 203 ALA C C   1 
ATOM 4445  O O   . ALA C 3 203 ? -5.546  116.463 -5.843  1.00 37.46  ? 203 ALA C O   1 
ATOM 4446  C CB  . ALA C 3 203 ? -2.633  116.474 -4.822  1.00 44.44  ? 203 ALA C CB  1 
ATOM 4447  N N   . HIS C 3 204 ? -4.273  117.216 -7.583  1.00 38.02  ? 204 HIS C N   1 
ATOM 4448  C CA  . HIS C 3 204 ? -5.129  116.743 -8.673  1.00 33.62  ? 204 HIS C CA  1 
ATOM 4449  C C   . HIS C 3 204 ? -4.200  116.010 -9.625  1.00 33.05  ? 204 HIS C C   1 
ATOM 4450  O O   . HIS C 3 204 ? -3.721  116.582 -10.609 1.00 25.05  ? 204 HIS C O   1 
ATOM 4451  C CB  . HIS C 3 204 ? -5.772  117.904 -9.407  1.00 30.23  ? 204 HIS C CB  1 
ATOM 4452  C CG  . HIS C 3 204 ? -6.731  117.489 -10.482 1.00 38.20  ? 204 HIS C CG  1 
ATOM 4453  N ND1 . HIS C 3 204 ? -6.518  117.769 -11.815 1.00 40.53  ? 204 HIS C ND1 1 
ATOM 4454  C CD2 . HIS C 3 204 ? -7.947  116.890 -10.415 1.00 34.63  ? 204 HIS C CD2 1 
ATOM 4455  C CE1 . HIS C 3 204 ? -7.562  117.370 -12.520 1.00 39.52  ? 204 HIS C CE1 1 
ATOM 4456  N NE2 . HIS C 3 204 ? -8.444  116.834 -11.693 1.00 34.73  ? 204 HIS C NE2 1 
ATOM 4457  N N   . PRO C 3 205 ? -3.959  114.716 -9.347  1.00 36.68  ? 205 PRO C N   1 
ATOM 4458  C CA  . PRO C 3 205 ? -3.086  113.841 -10.130 1.00 36.44  ? 205 PRO C CA  1 
ATOM 4459  C C   . PRO C 3 205 ? -3.498  113.909 -11.590 1.00 39.70  ? 205 PRO C C   1 
ATOM 4460  O O   . PRO C 3 205 ? -2.663  114.072 -12.485 1.00 37.26  ? 205 PRO C O   1 
ATOM 4461  C CB  . PRO C 3 205 ? -3.356  112.483 -9.520  1.00 31.70  ? 205 PRO C CB  1 
ATOM 4462  C CG  . PRO C 3 205 ? -4.849  112.561 -9.282  1.00 36.38  ? 205 PRO C CG  1 
ATOM 4463  C CD  . PRO C 3 205 ? -4.972  113.912 -8.628  1.00 36.08  ? 205 PRO C CD  1 
ATOM 4464  N N   . ALA C 3 206 ? -4.810  113.798 -11.804 1.00 44.01  ? 206 ALA C N   1 
ATOM 4465  C CA  . ALA C 3 206 ? -5.399  113.843 -13.133 1.00 42.09  ? 206 ALA C CA  1 
ATOM 4466  C C   . ALA C 3 206 ? -4.732  114.893 -14.046 1.00 40.80  ? 206 ALA C C   1 
ATOM 4467  O O   . ALA C 3 206 ? -4.390  114.595 -15.184 1.00 39.27  ? 206 ALA C O   1 
ATOM 4468  C CB  . ALA C 3 206 ? -6.907  114.099 -13.010 1.00 43.10  ? 206 ALA C CB  1 
ATOM 4469  N N   . SER C 3 207 ? -4.532  116.112 -13.548 1.00 42.32  ? 207 SER C N   1 
ATOM 4470  C CA  . SER C 3 207 ? -3.908  117.165 -14.347 1.00 43.09  ? 207 SER C CA  1 
ATOM 4471  C C   . SER C 3 207 ? -2.436  117.339 -13.977 1.00 45.12  ? 207 SER C C   1 
ATOM 4472  O O   . SER C 3 207 ? -1.794  118.322 -14.366 1.00 42.64  ? 207 SER C O   1 
ATOM 4473  C CB  . SER C 3 207 ? -4.643  118.494 -14.159 1.00 38.86  ? 207 SER C CB  1 
ATOM 4474  O OG  . SER C 3 207 ? -4.460  119.013 -12.850 1.00 45.24  ? 207 SER C OG  1 
ATOM 4475  N N   . SER C 3 208 ? -1.908  116.380 -13.222 1.00 47.30  ? 208 SER C N   1 
ATOM 4476  C CA  . SER C 3 208 ? -0.510  116.420 -12.811 1.00 50.64  ? 208 SER C CA  1 
ATOM 4477  C C   . SER C 3 208 ? -0.195  117.768 -12.172 1.00 49.39  ? 208 SER C C   1 
ATOM 4478  O O   . SER C 3 208 ? 0.827   118.390 -12.466 1.00 48.12  ? 208 SER C O   1 
ATOM 4479  C CB  . SER C 3 208 ? 0.377   116.201 -14.031 1.00 50.67  ? 208 SER C CB  1 
ATOM 4480  O OG  . SER C 3 208 ? -0.117  115.108 -14.784 1.00 54.28  ? 208 SER C OG  1 
ATOM 4481  N N   . THR C 3 209 ? -1.092  118.205 -11.298 1.00 48.48  ? 209 THR C N   1 
ATOM 4482  C CA  . THR C 3 209 ? -0.946  119.476 -10.612 1.00 46.40  ? 209 THR C CA  1 
ATOM 4483  C C   . THR C 3 209 ? -1.029  119.307 -9.110  1.00 46.33  ? 209 THR C C   1 
ATOM 4484  O O   . THR C 3 209 ? -1.729  118.427 -8.603  1.00 50.83  ? 209 THR C O   1 
ATOM 4485  C CB  . THR C 3 209 ? -2.058  120.453 -11.006 1.00 45.89  ? 209 THR C CB  1 
ATOM 4486  O OG1 . THR C 3 209 ? -2.138  120.542 -12.433 1.00 47.01  ? 209 THR C OG1 1 
ATOM 4487  C CG2 . THR C 3 209 ? -1.772  121.822 -10.432 1.00 44.69  ? 209 THR C CG2 1 
ATOM 4488  N N   . LYS C 3 210 ? -0.305  120.160 -8.402  1.00 47.83  ? 210 LYS C N   1 
ATOM 4489  C CA  . LYS C 3 210 ? -0.308  120.152 -6.948  1.00 47.64  ? 210 LYS C CA  1 
ATOM 4490  C C   . LYS C 3 210 ? -0.169  121.601 -6.541  1.00 44.11  ? 210 LYS C C   1 
ATOM 4491  O O   . LYS C 3 210 ? 0.699   122.327 -7.041  1.00 40.60  ? 210 LYS C O   1 
ATOM 4492  C CB  . LYS C 3 210 ? 0.853   119.337 -6.395  1.00 51.46  ? 210 LYS C CB  1 
ATOM 4493  C CG  . LYS C 3 210 ? 0.507   118.587 -5.124  1.00 63.76  ? 210 LYS C CG  1 
ATOM 4494  C CD  . LYS C 3 210 ? 1.311   117.275 -5.054  1.00 75.60  ? 210 LYS C CD  1 
ATOM 4495  C CE  . LYS C 3 210 ? 0.829   116.339 -3.925  1.00 82.42  ? 210 LYS C CE  1 
ATOM 4496  N NZ  . LYS C 3 210 ? 1.572   115.030 -3.862  1.00 79.36  ? 210 LYS C NZ  1 
ATOM 4497  N N   . VAL C 3 211 ? -1.049  122.027 -5.648  1.00 42.64  ? 211 VAL C N   1 
ATOM 4498  C CA  . VAL C 3 211 ? -1.035  123.399 -5.188  1.00 40.91  ? 211 VAL C CA  1 
ATOM 4499  C C   . VAL C 3 211 ? -1.088  123.515 -3.677  1.00 45.82  ? 211 VAL C C   1 
ATOM 4500  O O   . VAL C 3 211 ? -1.747  122.717 -2.983  1.00 46.87  ? 211 VAL C O   1 
ATOM 4501  C CB  . VAL C 3 211 ? -2.212  124.176 -5.761  1.00 35.08  ? 211 VAL C CB  1 
ATOM 4502  C CG1 . VAL C 3 211 ? -2.205  125.578 -5.226  1.00 29.66  ? 211 VAL C CG1 1 
ATOM 4503  C CG2 . VAL C 3 211 ? -2.131  124.180 -7.258  1.00 32.47  ? 211 VAL C CG2 1 
ATOM 4504  N N   . ASP C 3 212 ? -0.380  124.520 -3.177  1.00 46.78  ? 212 ASP C N   1 
ATOM 4505  C CA  . ASP C 3 212 ? -0.345  124.793 -1.755  1.00 44.96  ? 212 ASP C CA  1 
ATOM 4506  C C   . ASP C 3 212 ? -0.687  126.250 -1.533  1.00 43.97  ? 212 ASP C C   1 
ATOM 4507  O O   . ASP C 3 212 ? -0.055  127.146 -2.096  1.00 44.91  ? 212 ASP C O   1 
ATOM 4508  C CB  . ASP C 3 212 ? 1.036   124.497 -1.206  1.00 47.52  ? 212 ASP C CB  1 
ATOM 4509  C CG  . ASP C 3 212 ? 1.448   123.079 -1.450  1.00 51.48  ? 212 ASP C CG  1 
ATOM 4510  O OD1 . ASP C 3 212 ? 0.747   122.166 -0.953  1.00 56.37  ? 212 ASP C OD1 1 
ATOM 4511  O OD2 . ASP C 3 212 ? 2.465   122.880 -2.148  1.00 50.26  ? 212 ASP C OD2 1 
ATOM 4512  N N   . LYS C 3 213 ? -1.715  126.478 -0.732  1.00 44.18  ? 213 LYS C N   1 
ATOM 4513  C CA  . LYS C 3 213 ? -2.143  127.822 -0.400  1.00 47.04  ? 213 LYS C CA  1 
ATOM 4514  C C   . LYS C 3 213 ? -1.956  128.003 1.087   1.00 51.02  ? 213 LYS C C   1 
ATOM 4515  O O   . LYS C 3 213 ? -2.452  127.209 1.881   1.00 53.80  ? 213 LYS C O   1 
ATOM 4516  C CB  . LYS C 3 213 ? -3.614  128.024 -0.740  1.00 45.14  ? 213 LYS C CB  1 
ATOM 4517  C CG  . LYS C 3 213 ? -3.854  128.487 -2.146  1.00 50.49  ? 213 LYS C CG  1 
ATOM 4518  C CD  . LYS C 3 213 ? -3.347  129.895 -2.336  1.00 55.08  ? 213 LYS C CD  1 
ATOM 4519  C CE  . LYS C 3 213 ? -3.627  130.386 -3.745  1.00 60.10  ? 213 LYS C CE  1 
ATOM 4520  N NZ  . LYS C 3 213 ? -3.270  131.826 -3.902  1.00 65.24  ? 213 LYS C NZ  1 
ATOM 4521  N N   . LYS C 3 214 ? -1.213  129.029 1.469   1.00 54.44  ? 214 LYS C N   1 
ATOM 4522  C CA  . LYS C 3 214 ? -1.018  129.297 2.880   1.00 57.36  ? 214 LYS C CA  1 
ATOM 4523  C C   . LYS C 3 214 ? -2.166  130.198 3.280   1.00 55.85  ? 214 LYS C C   1 
ATOM 4524  O O   . LYS C 3 214 ? -2.398  131.240 2.660   1.00 52.98  ? 214 LYS C O   1 
ATOM 4525  C CB  . LYS C 3 214 ? 0.300   130.021 3.117   1.00 61.66  ? 214 LYS C CB  1 
ATOM 4526  C CG  . LYS C 3 214 ? 0.519   130.496 4.549   1.00 64.99  ? 214 LYS C CG  1 
ATOM 4527  C CD  . LYS C 3 214 ? 1.937   131.063 4.707   1.00 64.63  ? 214 LYS C CD  1 
ATOM 4528  C CE  . LYS C 3 214 ? 2.230   131.530 6.129   1.00 66.70  ? 214 LYS C CE  1 
ATOM 4529  N NZ  . LYS C 3 214 ? 3.672   131.870 6.295   1.00 65.91  ? 214 LYS C NZ  1 
ATOM 4530  N N   . ILE C 3 215 ? -2.914  129.784 4.289   1.00 54.68  ? 215 ILE C N   1 
ATOM 4531  C CA  . ILE C 3 215 ? -4.011  130.609 4.728   1.00 53.17  ? 215 ILE C CA  1 
ATOM 4532  C C   . ILE C 3 215 ? -3.402  131.681 5.606   1.00 53.97  ? 215 ILE C C   1 
ATOM 4533  O O   . ILE C 3 215 ? -2.832  131.405 6.670   1.00 54.22  ? 215 ILE C O   1 
ATOM 4534  C CB  . ILE C 3 215 ? -5.045  129.807 5.515   1.00 51.29  ? 215 ILE C CB  1 
ATOM 4535  C CG1 . ILE C 3 215 ? -5.597  128.682 4.635   1.00 50.48  ? 215 ILE C CG1 1 
ATOM 4536  C CG2 . ILE C 3 215 ? -6.178  130.726 5.962   1.00 46.28  ? 215 ILE C CG2 1 
ATOM 4537  C CD1 . ILE C 3 215 ? -6.359  129.167 3.412   1.00 44.45  ? 215 ILE C CD1 1 
ATOM 4538  N N   . VAL C 3 216 ? -3.494  132.911 5.125   1.00 55.01  ? 216 VAL C N   1 
ATOM 4539  C CA  . VAL C 3 216 ? -2.957  134.041 5.851   1.00 54.85  ? 216 VAL C CA  1 
ATOM 4540  C C   . VAL C 3 216 ? -4.070  135.016 6.136   1.00 59.20  ? 216 VAL C C   1 
ATOM 4541  O O   . VAL C 3 216 ? -4.913  135.276 5.270   1.00 55.51  ? 216 VAL C O   1 
ATOM 4542  C CB  . VAL C 3 216 ? -1.888  134.745 5.047   1.00 47.30  ? 216 VAL C CB  1 
ATOM 4543  C CG1 . VAL C 3 216 ? -0.658  133.854 4.961   1.00 46.75  ? 216 VAL C CG1 1 
ATOM 4544  C CG2 . VAL C 3 216 ? -2.431  135.077 3.665   1.00 43.43  ? 216 VAL C CG2 1 
ATOM 4545  N N   . PRO C 3 217 ? -4.082  135.572 7.362   1.00 64.12  ? 217 PRO C N   1 
ATOM 4546  C CA  . PRO C 3 217 ? -5.087  136.534 7.816   1.00 66.83  ? 217 PRO C CA  1 
ATOM 4547  C C   . PRO C 3 217 ? -5.293  137.618 6.786   1.00 71.60  ? 217 PRO C C   1 
ATOM 4548  O O   . PRO C 3 217 ? -4.365  138.359 6.458   1.00 68.93  ? 217 PRO C O   1 
ATOM 4549  C CB  . PRO C 3 217 ? -4.496  137.058 9.121   1.00 65.18  ? 217 PRO C CB  1 
ATOM 4550  C CG  . PRO C 3 217 ? -3.017  136.870 8.930   1.00 63.02  ? 217 PRO C CG  1 
ATOM 4551  C CD  . PRO C 3 217 ? -2.958  135.513 8.314   1.00 62.86  ? 217 PRO C CD  1 
ATOM 4552  N N   . ARG C 3 218 ? -6.514  137.690 6.265   1.00 79.17  ? 218 ARG C N   1 
ATOM 4553  C CA  . ARG C 3 218 ? -6.837  138.681 5.251   1.00 87.69  ? 218 ARG C CA  1 
ATOM 4554  C C   . ARG C 3 218 ? -6.818  140.066 5.884   1.00 91.76  ? 218 ARG C C   1 
ATOM 4555  O O   . ARG C 3 218 ? -7.450  140.296 6.920   1.00 91.78  ? 218 ARG C O   1 
ATOM 4556  C CB  . ARG C 3 218 ? -8.200  138.363 4.588   1.00 88.53  ? 218 ARG C CB  1 
ATOM 4557  C CG  . ARG C 3 218 ? -9.443  138.420 5.477   1.00 88.10  ? 218 ARG C CG  1 
ATOM 4558  C CD  . ARG C 3 218 ? -10.526 137.401 5.038   1.00 90.57  ? 218 ARG C CD  1 
ATOM 4559  N NE  . ARG C 3 218 ? -10.836 137.401 3.604   1.00 93.04  ? 218 ARG C NE  1 
ATOM 4560  C CZ  . ARG C 3 218 ? -11.651 136.530 2.999   1.00 94.01  ? 218 ARG C CZ  1 
ATOM 4561  N NH1 . ARG C 3 218 ? -12.260 135.571 3.689   1.00 93.67  ? 218 ARG C NH1 1 
ATOM 4562  N NH2 . ARG C 3 218 ? -11.852 136.606 1.689   1.00 93.90  ? 218 ARG C NH2 1 
ATOM 4563  N N   . ASP C 3 219 ? -6.057  140.971 5.270   1.00 97.86  ? 219 ASP C N   1 
ATOM 4564  C CA  . ASP C 3 219 ? -5.916  142.338 5.762   1.00 104.39 ? 219 ASP C CA  1 
ATOM 4565  C C   . ASP C 3 219 ? -6.474  143.363 4.778   1.00 108.36 ? 219 ASP C C   1 
ATOM 4566  O O   . ASP C 3 219 ? -6.488  143.134 3.566   1.00 109.19 ? 219 ASP C O   1 
ATOM 4567  C CB  . ASP C 3 219 ? -4.440  142.648 6.040   1.00 105.31 ? 219 ASP C CB  1 
ATOM 4568  C CG  . ASP C 3 219 ? -4.188  143.044 7.487   1.00 106.63 ? 219 ASP C CG  1 
ATOM 4569  O OD1 . ASP C 3 219 ? -4.376  142.189 8.383   1.00 104.32 ? 219 ASP C OD1 1 
ATOM 4570  O OD2 . ASP C 3 219 ? -3.808  144.214 7.725   1.00 106.40 ? 219 ASP C OD2 1 
ATOM 4571  N N   . CYS C 3 220 ? -6.933  144.493 5.314   1.00 112.49 ? 220 CYS C N   1 
ATOM 4572  C CA  . CYS C 3 220 ? -7.495  145.571 4.503   1.00 115.83 ? 220 CYS C CA  1 
ATOM 4573  C C   . CYS C 3 220 ? -6.952  146.921 4.987   1.00 116.58 ? 220 CYS C C   1 
ATOM 4574  O O   . CYS C 3 220 ? -6.215  146.927 6.000   1.00 116.92 ? 220 CYS C O   1 
ATOM 4575  C CB  . CYS C 3 220 ? -9.029  145.553 4.595   1.00 117.11 ? 220 CYS C CB  1 
ATOM 4576  S SG  . CYS C 3 220 ? -9.894  146.523 3.322   1.00 117.22 ? 220 CYS C SG  1 
ATOM 4577  O OXT . CYS C 3 220 ? -7.265  147.954 4.353   1.00 117.24 ? 220 CYS C OXT 1 
ATOM 4578  N N   . GLY D 1 1   ? -0.541  6.586   23.768  1.00 43.69  ? 1   GLY D N   1 
ATOM 4579  C CA  . GLY D 1 1   ? -1.376  5.387   23.536  1.00 46.39  ? 1   GLY D CA  1 
ATOM 4580  C C   . GLY D 1 1   ? -2.490  5.314   24.552  1.00 50.27  ? 1   GLY D C   1 
ATOM 4581  O O   . GLY D 1 1   ? -2.402  5.937   25.600  1.00 53.10  ? 1   GLY D O   1 
ATOM 4582  N N   . VAL D 1 2   ? -3.539  4.559   24.241  1.00 54.70  ? 2   VAL D N   1 
ATOM 4583  C CA  . VAL D 1 2   ? -4.687  4.402   25.132  1.00 59.05  ? 2   VAL D CA  1 
ATOM 4584  C C   . VAL D 1 2   ? -5.260  2.992   24.976  1.00 61.41  ? 2   VAL D C   1 
ATOM 4585  O O   . VAL D 1 2   ? -6.269  2.790   24.277  1.00 60.46  ? 2   VAL D O   1 
ATOM 4586  C CB  . VAL D 1 2   ? -5.806  5.412   24.794  1.00 56.72  ? 2   VAL D CB  1 
ATOM 4587  C CG1 . VAL D 1 2   ? -6.945  5.290   25.798  1.00 56.36  ? 2   VAL D CG1 1 
ATOM 4588  C CG2 . VAL D 1 2   ? -5.247  6.809   24.779  1.00 56.74  ? 2   VAL D CG2 1 
ATOM 4589  N N   . PHE D 1 3   ? -4.622  2.028   25.639  1.00 62.81  ? 3   PHE D N   1 
ATOM 4590  C CA  . PHE D 1 3   ? -5.033  0.625   25.577  1.00 64.19  ? 3   PHE D CA  1 
ATOM 4591  C C   . PHE D 1 3   ? -5.926  0.148   26.725  1.00 61.43  ? 3   PHE D C   1 
ATOM 4592  O O   . PHE D 1 3   ? -5.483  0.072   27.871  1.00 59.78  ? 3   PHE D O   1 
ATOM 4593  C CB  . PHE D 1 3   ? -3.795  -0.268  25.539  1.00 69.86  ? 3   PHE D CB  1 
ATOM 4594  C CG  . PHE D 1 3   ? -2.774  0.158   24.532  1.00 77.30  ? 3   PHE D CG  1 
ATOM 4595  C CD1 . PHE D 1 3   ? -3.072  0.148   23.172  1.00 79.27  ? 3   PHE D CD1 1 
ATOM 4596  C CD2 . PHE D 1 3   ? -1.507  0.568   24.946  1.00 80.18  ? 3   PHE D CD2 1 
ATOM 4597  C CE1 . PHE D 1 3   ? -2.126  0.538   22.241  1.00 81.16  ? 3   PHE D CE1 1 
ATOM 4598  C CE2 . PHE D 1 3   ? -0.546  0.962   24.022  1.00 82.28  ? 3   PHE D CE2 1 
ATOM 4599  C CZ  . PHE D 1 3   ? -0.855  0.948   22.665  1.00 82.46  ? 3   PHE D CZ  1 
ATOM 4600  N N   . ASN D 1 4   ? -7.173  -0.191  26.413  1.00 60.78  ? 4   ASN D N   1 
ATOM 4601  C CA  . ASN D 1 4   ? -8.097  -0.694  27.420  1.00 60.51  ? 4   ASN D CA  1 
ATOM 4602  C C   . ASN D 1 4   ? -7.766  -2.156  27.758  1.00 58.54  ? 4   ASN D C   1 
ATOM 4603  O O   . ASN D 1 4   ? -7.059  -2.820  27.016  1.00 61.43  ? 4   ASN D O   1 
ATOM 4604  C CB  . ASN D 1 4   ? -9.528  -0.614  26.905  1.00 65.24  ? 4   ASN D CB  1 
ATOM 4605  C CG  . ASN D 1 4   ? -10.493 -1.372  27.785  1.00 75.38  ? 4   ASN D CG  1 
ATOM 4606  O OD1 . ASN D 1 4   ? -10.804 -0.944  28.902  1.00 84.42  ? 4   ASN D OD1 1 
ATOM 4607  N ND2 . ASN D 1 4   ? -10.955 -2.521  27.304  1.00 79.21  ? 4   ASN D ND2 1 
ATOM 4608  N N   . TYR D 1 5   ? -8.273  -2.657  28.878  1.00 57.21  ? 5   TYR D N   1 
ATOM 4609  C CA  . TYR D 1 5   ? -8.033  -4.041  29.277  1.00 55.44  ? 5   TYR D CA  1 
ATOM 4610  C C   . TYR D 1 5   ? -9.092  -4.479  30.278  1.00 55.75  ? 5   TYR D C   1 
ATOM 4611  O O   . TYR D 1 5   ? -8.783  -4.633  31.457  1.00 54.73  ? 5   TYR D O   1 
ATOM 4612  C CB  . TYR D 1 5   ? -6.658  -4.205  29.938  1.00 54.39  ? 5   TYR D CB  1 
ATOM 4613  C CG  . TYR D 1 5   ? -5.451  -4.199  29.018  1.00 57.29  ? 5   TYR D CG  1 
ATOM 4614  C CD1 . TYR D 1 5   ? -5.369  -5.054  27.920  1.00 59.92  ? 5   TYR D CD1 1 
ATOM 4615  C CD2 . TYR D 1 5   ? -4.357  -3.381  29.288  1.00 59.46  ? 5   TYR D CD2 1 
ATOM 4616  C CE1 . TYR D 1 5   ? -4.209  -5.098  27.109  1.00 62.52  ? 5   TYR D CE1 1 
ATOM 4617  C CE2 . TYR D 1 5   ? -3.198  -3.416  28.493  1.00 61.66  ? 5   TYR D CE2 1 
ATOM 4618  C CZ  . TYR D 1 5   ? -3.126  -4.275  27.408  1.00 64.63  ? 5   TYR D CZ  1 
ATOM 4619  O OH  . TYR D 1 5   ? -1.970  -4.311  26.643  1.00 68.93  ? 5   TYR D OH  1 
ATOM 4620  N N   . GLU D 1 6   ? -10.330 -4.681  29.824  1.00 58.44  ? 6   GLU D N   1 
ATOM 4621  C CA  . GLU D 1 6   ? -11.412 -5.105  30.722  1.00 62.92  ? 6   GLU D CA  1 
ATOM 4622  C C   . GLU D 1 6   ? -11.134 -6.395  31.509  1.00 64.24  ? 6   GLU D C   1 
ATOM 4623  O O   . GLU D 1 6   ? -10.148 -7.096  31.265  1.00 67.20  ? 6   GLU D O   1 
ATOM 4624  C CB  . GLU D 1 6   ? -12.715 -5.274  29.950  1.00 65.09  ? 6   GLU D CB  1 
ATOM 4625  C CG  . GLU D 1 6   ? -13.206 -4.001  29.310  1.00 74.61  ? 6   GLU D CG  1 
ATOM 4626  C CD  . GLU D 1 6   ? -14.496 -4.212  28.535  1.00 81.37  ? 6   GLU D CD  1 
ATOM 4627  O OE1 . GLU D 1 6   ? -14.496 -5.014  27.570  1.00 84.20  ? 6   GLU D OE1 1 
ATOM 4628  O OE2 . GLU D 1 6   ? -15.512 -3.576  28.893  1.00 84.88  ? 6   GLU D OE2 1 
ATOM 4629  N N   . THR D 1 7   ? -12.020 -6.694  32.458  1.00 64.34  ? 7   THR D N   1 
ATOM 4630  C CA  . THR D 1 7   ? -11.903 -7.873  33.319  1.00 62.86  ? 7   THR D CA  1 
ATOM 4631  C C   . THR D 1 7   ? -13.255 -8.136  33.968  1.00 62.23  ? 7   THR D C   1 
ATOM 4632  O O   . THR D 1 7   ? -14.156 -7.301  33.908  1.00 61.30  ? 7   THR D O   1 
ATOM 4633  C CB  . THR D 1 7   ? -10.852 -7.656  34.454  1.00 61.64  ? 7   THR D CB  1 
ATOM 4634  O OG1 . THR D 1 7   ? -9.540  -7.543  33.885  1.00 65.68  ? 7   THR D OG1 1 
ATOM 4635  C CG2 . THR D 1 7   ? -10.862 -8.816  35.437  1.00 55.61  ? 7   THR D CG2 1 
ATOM 4636  N N   . GLU D 1 8   ? -13.396 -9.315  34.562  1.00 62.34  ? 8   GLU D N   1 
ATOM 4637  C CA  . GLU D 1 8   ? -14.623 -9.689  35.252  1.00 60.44  ? 8   GLU D CA  1 
ATOM 4638  C C   . GLU D 1 8   ? -14.367 -10.726 36.321  1.00 59.07  ? 8   GLU D C   1 
ATOM 4639  O O   . GLU D 1 8   ? -13.315 -11.380 36.349  1.00 59.29  ? 8   GLU D O   1 
ATOM 4640  C CB  . GLU D 1 8   ? -15.686 -10.199 34.281  1.00 58.74  ? 8   GLU D CB  1 
ATOM 4641  C CG  . GLU D 1 8   ? -16.479 -9.083  33.660  1.00 61.59  ? 8   GLU D CG  1 
ATOM 4642  C CD  . GLU D 1 8   ? -17.737 -9.576  32.992  1.00 64.70  ? 8   GLU D CD  1 
ATOM 4643  O OE1 . GLU D 1 8   ? -18.492 -10.336 33.641  1.00 68.16  ? 8   GLU D OE1 1 
ATOM 4644  O OE2 . GLU D 1 8   ? -17.974 -9.195  31.824  1.00 63.84  ? 8   GLU D OE2 1 
ATOM 4645  N N   . THR D 1 9   ? -15.333 -10.848 37.218  1.00 57.13  ? 9   THR D N   1 
ATOM 4646  C CA  . THR D 1 9   ? -15.224 -11.794 38.308  1.00 59.60  ? 9   THR D CA  1 
ATOM 4647  C C   . THR D 1 9   ? -16.539 -11.810 39.060  1.00 59.34  ? 9   THR D C   1 
ATOM 4648  O O   . THR D 1 9   ? -17.345 -10.883 38.948  1.00 60.38  ? 9   THR D O   1 
ATOM 4649  C CB  . THR D 1 9   ? -14.068 -11.420 39.262  1.00 60.40  ? 9   THR D CB  1 
ATOM 4650  O OG1 . THR D 1 9   ? -13.993 -12.372 40.332  1.00 63.55  ? 9   THR D OG1 1 
ATOM 4651  C CG2 . THR D 1 9   ? -14.282 -10.032 39.827  1.00 62.22  ? 9   THR D CG2 1 
ATOM 4652  N N   . THR D 1 10  ? -16.750 -12.877 39.820  1.00 58.23  ? 10  THR D N   1 
ATOM 4653  C CA  . THR D 1 10  ? -17.984 -13.047 40.572  1.00 56.12  ? 10  THR D CA  1 
ATOM 4654  C C   . THR D 1 10  ? -17.772 -13.052 42.062  1.00 54.61  ? 10  THR D C   1 
ATOM 4655  O O   . THR D 1 10  ? -16.652 -13.196 42.558  1.00 53.50  ? 10  THR D O   1 
ATOM 4656  C CB  . THR D 1 10  ? -18.676 -14.377 40.209  1.00 54.26  ? 10  THR D CB  1 
ATOM 4657  O OG1 . THR D 1 10  ? -17.840 -15.111 39.298  1.00 56.45  ? 10  THR D OG1 1 
ATOM 4658  C CG2 . THR D 1 10  ? -20.049 -14.120 39.599  1.00 47.84  ? 10  THR D CG2 1 
ATOM 4659  N N   . SER D 1 11  ? -18.880 -12.890 42.767  1.00 53.90  ? 11  SER D N   1 
ATOM 4660  C CA  . SER D 1 11  ? -18.863 -12.909 44.208  1.00 55.58  ? 11  SER D CA  1 
ATOM 4661  C C   . SER D 1 11  ? -20.242 -13.238 44.719  1.00 54.61  ? 11  SER D C   1 
ATOM 4662  O O   . SER D 1 11  ? -21.256 -13.014 44.048  1.00 52.60  ? 11  SER D O   1 
ATOM 4663  C CB  . SER D 1 11  ? -18.420 -11.573 44.790  1.00 59.55  ? 11  SER D CB  1 
ATOM 4664  O OG  . SER D 1 11  ? -18.452 -11.630 46.214  1.00 60.48  ? 11  SER D OG  1 
ATOM 4665  N N   . VAL D 1 12  ? -20.250 -13.771 45.927  1.00 52.12  ? 12  VAL D N   1 
ATOM 4666  C CA  . VAL D 1 12  ? -21.462 -14.172 46.600  1.00 53.74  ? 12  VAL D CA  1 
ATOM 4667  C C   . VAL D 1 12  ? -22.212 -12.953 47.134  1.00 54.80  ? 12  VAL D C   1 
ATOM 4668  O O   . VAL D 1 12  ? -23.439 -12.863 47.010  1.00 61.27  ? 12  VAL D O   1 
ATOM 4669  C CB  . VAL D 1 12  ? -21.088 -15.106 47.743  1.00 56.67  ? 12  VAL D CB  1 
ATOM 4670  C CG1 . VAL D 1 12  ? -20.305 -16.272 47.189  1.00 61.58  ? 12  VAL D CG1 1 
ATOM 4671  C CG2 . VAL D 1 12  ? -20.209 -14.376 48.746  1.00 59.03  ? 12  VAL D CG2 1 
ATOM 4672  N N   . ILE D 1 13  ? -21.455 -12.021 47.713  1.00 51.79  ? 13  ILE D N   1 
ATOM 4673  C CA  . ILE D 1 13  ? -21.973 -10.784 48.299  1.00 48.35  ? 13  ILE D CA  1 
ATOM 4674  C C   . ILE D 1 13  ? -22.860 -10.015 47.332  1.00 46.53  ? 13  ILE D C   1 
ATOM 4675  O O   . ILE D 1 13  ? -22.440 -9.719  46.215  1.00 43.57  ? 13  ILE D O   1 
ATOM 4676  C CB  . ILE D 1 13  ? -20.831 -9.828  48.662  1.00 48.28  ? 13  ILE D CB  1 
ATOM 4677  C CG1 . ILE D 1 13  ? -19.472 -10.556 48.621  1.00 47.27  ? 13  ILE D CG1 1 
ATOM 4678  C CG2 . ILE D 1 13  ? -21.140 -9.160  49.988  1.00 49.74  ? 13  ILE D CG2 1 
ATOM 4679  C CD1 . ILE D 1 13  ? -19.086 -11.354 49.858  1.00 38.94  ? 13  ILE D CD1 1 
ATOM 4680  N N   . PRO D 1 14  ? -24.087 -9.660  47.747  1.00 45.69  ? 14  PRO D N   1 
ATOM 4681  C CA  . PRO D 1 14  ? -24.943 -8.914  46.817  1.00 49.07  ? 14  PRO D CA  1 
ATOM 4682  C C   . PRO D 1 14  ? -24.242 -7.610  46.428  1.00 51.83  ? 14  PRO D C   1 
ATOM 4683  O O   . PRO D 1 14  ? -23.588 -6.978  47.269  1.00 52.29  ? 14  PRO D O   1 
ATOM 4684  C CB  . PRO D 1 14  ? -26.209 -8.660  47.635  1.00 49.00  ? 14  PRO D CB  1 
ATOM 4685  C CG  . PRO D 1 14  ? -26.231 -9.798  48.595  1.00 47.90  ? 14  PRO D CG  1 
ATOM 4686  C CD  . PRO D 1 14  ? -24.785 -9.910  49.014  1.00 44.49  ? 14  PRO D CD  1 
ATOM 4687  N N   . ALA D 1 15  ? -24.362 -7.221  45.159  1.00 53.47  ? 15  ALA D N   1 
ATOM 4688  C CA  . ALA D 1 15  ? -23.737 -5.991  44.659  1.00 54.39  ? 15  ALA D CA  1 
ATOM 4689  C C   . ALA D 1 15  ? -23.840 -4.875  45.690  1.00 54.40  ? 15  ALA D C   1 
ATOM 4690  O O   . ALA D 1 15  ? -22.825 -4.369  46.183  1.00 56.28  ? 15  ALA D O   1 
ATOM 4691  C CB  . ALA D 1 15  ? -24.409 -5.551  43.369  1.00 53.68  ? 15  ALA D CB  1 
ATOM 4692  N N   . ALA D 1 16  ? -25.079 -4.501  45.995  1.00 54.80  ? 16  ALA D N   1 
ATOM 4693  C CA  . ALA D 1 16  ? -25.368 -3.461  46.969  1.00 55.11  ? 16  ALA D CA  1 
ATOM 4694  C C   . ALA D 1 16  ? -24.289 -3.422  48.046  1.00 53.44  ? 16  ALA D C   1 
ATOM 4695  O O   . ALA D 1 16  ? -23.418 -2.550  48.048  1.00 55.50  ? 16  ALA D O   1 
ATOM 4696  C CB  . ALA D 1 16  ? -26.717 -3.727  47.596  1.00 58.00  ? 16  ALA D CB  1 
ATOM 4697  N N   . ARG D 1 17  ? -24.349 -4.389  48.951  1.00 49.88  ? 17  ARG D N   1 
ATOM 4698  C CA  . ARG D 1 17  ? -23.399 -4.484  50.042  1.00 48.61  ? 17  ARG D CA  1 
ATOM 4699  C C   . ARG D 1 17  ? -21.929 -4.470  49.612  1.00 50.16  ? 17  ARG D C   1 
ATOM 4700  O O   . ARG D 1 17  ? -21.132 -3.664  50.110  1.00 50.38  ? 17  ARG D O   1 
ATOM 4701  C CB  . ARG D 1 17  ? -23.699 -5.741  50.859  1.00 46.73  ? 17  ARG D CB  1 
ATOM 4702  C CG  . ARG D 1 17  ? -22.583 -6.178  51.802  1.00 48.34  ? 17  ARG D CG  1 
ATOM 4703  C CD  . ARG D 1 17  ? -23.140 -6.919  53.028  1.00 49.23  ? 17  ARG D CD  1 
ATOM 4704  N NE  . ARG D 1 17  ? -22.187 -7.887  53.568  1.00 52.78  ? 17  ARG D NE  1 
ATOM 4705  C CZ  . ARG D 1 17  ? -22.362 -8.562  54.698  1.00 54.74  ? 17  ARG D CZ  1 
ATOM 4706  N NH1 . ARG D 1 17  ? -23.462 -8.365  55.419  1.00 61.44  ? 17  ARG D NH1 1 
ATOM 4707  N NH2 . ARG D 1 17  ? -21.450 -9.446  55.092  1.00 54.41  ? 17  ARG D NH2 1 
ATOM 4708  N N   . LEU D 1 18  ? -21.560 -5.360  48.697  1.00 47.46  ? 18  LEU D N   1 
ATOM 4709  C CA  . LEU D 1 18  ? -20.174 -5.412  48.252  1.00 42.05  ? 18  LEU D CA  1 
ATOM 4710  C C   . LEU D 1 18  ? -19.687 -4.037  47.802  1.00 41.74  ? 18  LEU D C   1 
ATOM 4711  O O   . LEU D 1 18  ? -18.528 -3.683  47.996  1.00 41.23  ? 18  LEU D O   1 
ATOM 4712  C CB  . LEU D 1 18  ? -20.015 -6.405  47.105  1.00 35.84  ? 18  LEU D CB  1 
ATOM 4713  C CG  . LEU D 1 18  ? -18.588 -6.433  46.555  1.00 30.35  ? 18  LEU D CG  1 
ATOM 4714  C CD1 . LEU D 1 18  ? -17.643 -6.975  47.603  1.00 33.86  ? 18  LEU D CD1 1 
ATOM 4715  C CD2 . LEU D 1 18  ? -18.530 -7.274  45.308  1.00 29.75  ? 18  LEU D CD2 1 
ATOM 4716  N N   . PHE D 1 19  ? -20.577 -3.262  47.193  1.00 45.90  ? 19  PHE D N   1 
ATOM 4717  C CA  . PHE D 1 19  ? -20.204 -1.936  46.720  1.00 49.83  ? 19  PHE D CA  1 
ATOM 4718  C C   . PHE D 1 19  ? -19.794 -1.069  47.883  1.00 51.24  ? 19  PHE D C   1 
ATOM 4719  O O   . PHE D 1 19  ? -18.679 -0.532  47.919  1.00 52.45  ? 19  PHE D O   1 
ATOM 4720  C CB  . PHE D 1 19  ? -21.360 -1.252  45.997  1.00 48.13  ? 19  PHE D CB  1 
ATOM 4721  C CG  . PHE D 1 19  ? -20.999 0.100   45.444  1.00 48.73  ? 19  PHE D CG  1 
ATOM 4722  C CD1 . PHE D 1 19  ? -19.910 0.242   44.587  1.00 48.86  ? 19  PHE D CD1 1 
ATOM 4723  C CD2 . PHE D 1 19  ? -21.729 1.233   45.788  1.00 50.76  ? 19  PHE D CD2 1 
ATOM 4724  C CE1 . PHE D 1 19  ? -19.552 1.490   44.081  1.00 48.54  ? 19  PHE D CE1 1 
ATOM 4725  C CE2 . PHE D 1 19  ? -21.378 2.490   45.285  1.00 49.40  ? 19  PHE D CE2 1 
ATOM 4726  C CZ  . PHE D 1 19  ? -20.287 2.615   44.432  1.00 47.33  ? 19  PHE D CZ  1 
ATOM 4727  N N   . LYS D 1 20  ? -20.723 -0.920  48.819  1.00 52.72  ? 20  LYS D N   1 
ATOM 4728  C CA  . LYS D 1 20  ? -20.478 -0.132  50.010  1.00 56.40  ? 20  LYS D CA  1 
ATOM 4729  C C   . LYS D 1 20  ? -19.142 -0.577  50.561  1.00 54.30  ? 20  LYS D C   1 
ATOM 4730  O O   . LYS D 1 20  ? -18.192 0.194   50.650  1.00 58.73  ? 20  LYS D O   1 
ATOM 4731  C CB  . LYS D 1 20  ? -21.566 -0.395  51.047  1.00 61.33  ? 20  LYS D CB  1 
ATOM 4732  C CG  . LYS D 1 20  ? -22.963 -0.059  50.550  1.00 68.02  ? 20  LYS D CG  1 
ATOM 4733  C CD  . LYS D 1 20  ? -24.051 -0.532  51.525  1.00 74.61  ? 20  LYS D CD  1 
ATOM 4734  C CE  . LYS D 1 20  ? -23.896 0.070   52.923  1.00 76.91  ? 20  LYS D CE  1 
ATOM 4735  N NZ  . LYS D 1 20  ? -25.044 -0.275  53.822  1.00 78.70  ? 20  LYS D NZ  1 
ATOM 4736  N N   . ALA D 1 21  ? -19.073 -1.851  50.895  1.00 50.86  ? 21  ALA D N   1 
ATOM 4737  C CA  . ALA D 1 21  ? -17.870 -2.424  51.453  1.00 47.58  ? 21  ALA D CA  1 
ATOM 4738  C C   . ALA D 1 21  ? -16.584 -2.168  50.660  1.00 46.49  ? 21  ALA D C   1 
ATOM 4739  O O   . ALA D 1 21  ? -15.793 -1.295  51.002  1.00 46.18  ? 21  ALA D O   1 
ATOM 4740  C CB  . ALA D 1 21  ? -18.079 -3.912  51.636  1.00 50.94  ? 21  ALA D CB  1 
ATOM 4741  N N   . PHE D 1 22  ? -16.399 -2.938  49.595  1.00 48.54  ? 22  PHE D N   1 
ATOM 4742  C CA  . PHE D 1 22  ? -15.209 -2.894  48.741  1.00 47.31  ? 22  PHE D CA  1 
ATOM 4743  C C   . PHE D 1 22  ? -14.796 -1.545  48.161  1.00 47.31  ? 22  PHE D C   1 
ATOM 4744  O O   . PHE D 1 22  ? -13.602 -1.253  48.022  1.00 42.96  ? 22  PHE D O   1 
ATOM 4745  C CB  . PHE D 1 22  ? -15.380 -3.909  47.600  1.00 45.43  ? 22  PHE D CB  1 
ATOM 4746  C CG  . PHE D 1 22  ? -14.144 -4.118  46.789  1.00 40.85  ? 22  PHE D CG  1 
ATOM 4747  C CD1 . PHE D 1 22  ? -12.974 -4.578  47.382  1.00 38.09  ? 22  PHE D CD1 1 
ATOM 4748  C CD2 . PHE D 1 22  ? -14.142 -3.836  45.429  1.00 41.91  ? 22  PHE D CD2 1 
ATOM 4749  C CE1 . PHE D 1 22  ? -11.803 -4.753  46.624  1.00 42.78  ? 22  PHE D CE1 1 
ATOM 4750  C CE2 . PHE D 1 22  ? -12.979 -4.007  44.660  1.00 44.06  ? 22  PHE D CE2 1 
ATOM 4751  C CZ  . PHE D 1 22  ? -11.806 -4.465  45.261  1.00 41.26  ? 22  PHE D CZ  1 
ATOM 4752  N N   . ILE D 1 23  ? -15.779 -0.724  47.821  1.00 48.62  ? 23  ILE D N   1 
ATOM 4753  C CA  . ILE D 1 23  ? -15.491 0.571   47.235  1.00 50.40  ? 23  ILE D CA  1 
ATOM 4754  C C   . ILE D 1 23  ? -15.589 1.723   48.220  1.00 55.04  ? 23  ILE D C   1 
ATOM 4755  O O   . ILE D 1 23  ? -14.569 2.258   48.671  1.00 56.48  ? 23  ILE D O   1 
ATOM 4756  C CB  . ILE D 1 23  ? -16.444 0.846   46.067  1.00 48.27  ? 23  ILE D CB  1 
ATOM 4757  C CG1 . ILE D 1 23  ? -16.192 -0.176  44.961  1.00 46.72  ? 23  ILE D CG1 1 
ATOM 4758  C CG2 . ILE D 1 23  ? -16.263 2.271   45.563  1.00 44.02  ? 23  ILE D CG2 1 
ATOM 4759  C CD1 . ILE D 1 23  ? -14.752 -0.205  44.492  1.00 48.42  ? 23  ILE D CD1 1 
ATOM 4760  N N   . LEU D 1 24  ? -16.825 2.095   48.544  1.00 56.81  ? 24  LEU D N   1 
ATOM 4761  C CA  . LEU D 1 24  ? -17.080 3.198   49.451  1.00 58.10  ? 24  LEU D CA  1 
ATOM 4762  C C   . LEU D 1 24  ? -16.166 3.230   50.665  1.00 60.95  ? 24  LEU D C   1 
ATOM 4763  O O   . LEU D 1 24  ? -15.414 4.185   50.834  1.00 66.34  ? 24  LEU D O   1 
ATOM 4764  C CB  . LEU D 1 24  ? -18.544 3.202   49.900  1.00 54.78  ? 24  LEU D CB  1 
ATOM 4765  C CG  . LEU D 1 24  ? -19.565 3.173   48.749  1.00 57.95  ? 24  LEU D CG  1 
ATOM 4766  C CD1 . LEU D 1 24  ? -20.931 3.639   49.245  1.00 64.10  ? 24  LEU D CD1 1 
ATOM 4767  C CD2 . LEU D 1 24  ? -19.115 4.072   47.613  1.00 56.61  ? 24  LEU D CD2 1 
ATOM 4768  N N   . ASP D 1 25  ? -16.200 2.205   51.509  1.00 61.29  ? 25  ASP D N   1 
ATOM 4769  C CA  . ASP D 1 25  ? -15.347 2.230   52.694  1.00 60.66  ? 25  ASP D CA  1 
ATOM 4770  C C   . ASP D 1 25  ? -14.062 1.426   52.525  1.00 57.72  ? 25  ASP D C   1 
ATOM 4771  O O   . ASP D 1 25  ? -13.174 1.421   53.388  1.00 56.16  ? 25  ASP D O   1 
ATOM 4772  C CB  . ASP D 1 25  ? -16.093 1.703   53.904  1.00 62.46  ? 25  ASP D CB  1 
ATOM 4773  C CG  . ASP D 1 25  ? -15.322 1.937   55.181  1.00 66.75  ? 25  ASP D CG  1 
ATOM 4774  O OD1 . ASP D 1 25  ? -15.218 3.118   55.593  1.00 66.76  ? 25  ASP D OD1 1 
ATOM 4775  O OD2 . ASP D 1 25  ? -14.801 0.957   55.760  1.00 64.41  ? 25  ASP D OD2 1 
ATOM 4776  N N   . GLY D 1 26  ? -13.962 0.771   51.384  1.00 55.43  ? 26  GLY D N   1 
ATOM 4777  C CA  . GLY D 1 26  ? -12.811 -0.058  51.112  1.00 54.36  ? 26  GLY D CA  1 
ATOM 4778  C C   . GLY D 1 26  ? -11.450 0.497   51.440  1.00 54.99  ? 26  GLY D C   1 
ATOM 4779  O O   . GLY D 1 26  ? -10.607 -0.202  51.978  1.00 53.32  ? 26  GLY D O   1 
ATOM 4780  N N   . ASP D 1 27  ? -11.227 1.760   51.128  1.00 60.51  ? 27  ASP D N   1 
ATOM 4781  C CA  . ASP D 1 27  ? -9.914  2.343   51.328  1.00 67.05  ? 27  ASP D CA  1 
ATOM 4782  C C   . ASP D 1 27  ? -9.379  2.466   52.760  1.00 67.12  ? 27  ASP D C   1 
ATOM 4783  O O   . ASP D 1 27  ? -8.326  3.062   52.980  1.00 69.56  ? 27  ASP D O   1 
ATOM 4784  C CB  . ASP D 1 27  ? -9.834  3.685   50.584  1.00 71.33  ? 27  ASP D CB  1 
ATOM 4785  C CG  . ASP D 1 27  ? -10.055 3.524   49.061  1.00 76.84  ? 27  ASP D CG  1 
ATOM 4786  O OD1 . ASP D 1 27  ? -11.234 3.449   48.619  1.00 78.27  ? 27  ASP D OD1 1 
ATOM 4787  O OD2 . ASP D 1 27  ? -9.053  3.456   48.302  1.00 76.78  ? 27  ASP D OD2 1 
ATOM 4788  N N   . ASN D 1 28  ? -10.079 1.880   53.724  1.00 66.18  ? 28  ASN D N   1 
ATOM 4789  C CA  . ASN D 1 28  ? -9.629  1.904   55.126  1.00 66.47  ? 28  ASN D CA  1 
ATOM 4790  C C   . ASN D 1 28  ? -9.763  0.477   55.653  1.00 62.25  ? 28  ASN D C   1 
ATOM 4791  O O   . ASN D 1 28  ? -9.247  0.104   56.717  1.00 60.68  ? 28  ASN D O   1 
ATOM 4792  C CB  . ASN D 1 28  ? -10.504 2.841   55.956  1.00 74.02  ? 28  ASN D CB  1 
ATOM 4793  C CG  . ASN D 1 28  ? -11.876 2.254   56.257  1.00 79.64  ? 28  ASN D CG  1 
ATOM 4794  O OD1 . ASN D 1 28  ? -12.004 1.207   56.906  1.00 77.39  ? 28  ASN D OD1 1 
ATOM 4795  N ND2 . ASN D 1 28  ? -12.910 2.933   55.787  1.00 83.59  ? 28  ASN D ND2 1 
ATOM 4796  N N   . LEU D 1 29  ? -10.486 -0.302  54.863  1.00 55.70  ? 29  LEU D N   1 
ATOM 4797  C CA  . LEU D 1 29  ? -10.753 -1.695  55.128  1.00 44.05  ? 29  LEU D CA  1 
ATOM 4798  C C   . LEU D 1 29  ? -9.567  -2.508  54.640  1.00 40.98  ? 29  LEU D C   1 
ATOM 4799  O O   . LEU D 1 29  ? -9.164  -3.484  55.254  1.00 40.35  ? 29  LEU D O   1 
ATOM 4800  C CB  . LEU D 1 29  ? -11.997 -2.086  54.358  1.00 42.27  ? 29  LEU D CB  1 
ATOM 4801  C CG  . LEU D 1 29  ? -12.565 -3.449  54.652  1.00 39.40  ? 29  LEU D CG  1 
ATOM 4802  C CD1 . LEU D 1 29  ? -12.489 -3.686  56.141  1.00 45.99  ? 29  LEU D CD1 1 
ATOM 4803  C CD2 . LEU D 1 29  ? -13.997 -3.514  54.161  1.00 38.11  ? 29  LEU D CD2 1 
ATOM 4804  N N   . PHE D 1 30  ? -8.989  -2.076  53.531  1.00 39.67  ? 30  PHE D N   1 
ATOM 4805  C CA  . PHE D 1 30  ? -7.865  -2.777  52.950  1.00 39.60  ? 30  PHE D CA  1 
ATOM 4806  C C   . PHE D 1 30  ? -6.653  -2.951  53.854  1.00 39.66  ? 30  PHE D C   1 
ATOM 4807  O O   . PHE D 1 30  ? -6.128  -4.046  53.965  1.00 44.81  ? 30  PHE D O   1 
ATOM 4808  C CB  . PHE D 1 30  ? -7.431  -2.111  51.631  1.00 35.96  ? 30  PHE D CB  1 
ATOM 4809  C CG  . PHE D 1 30  ? -8.490  -2.128  50.554  1.00 31.96  ? 30  PHE D CG  1 
ATOM 4810  C CD1 . PHE D 1 30  ? -9.353  -3.205  50.424  1.00 32.24  ? 30  PHE D CD1 1 
ATOM 4811  C CD2 . PHE D 1 30  ? -8.633  -1.061  49.679  1.00 31.41  ? 30  PHE D CD2 1 
ATOM 4812  C CE1 . PHE D 1 30  ? -10.346 -3.216  49.442  1.00 33.75  ? 30  PHE D CE1 1 
ATOM 4813  C CE2 . PHE D 1 30  ? -9.625  -1.065  48.691  1.00 32.62  ? 30  PHE D CE2 1 
ATOM 4814  C CZ  . PHE D 1 30  ? -10.482 -2.144  48.576  1.00 33.95  ? 30  PHE D CZ  1 
ATOM 4815  N N   . PRO D 1 31  ? -6.183  -1.887  54.513  1.00 38.75  ? 31  PRO D N   1 
ATOM 4816  C CA  . PRO D 1 31  ? -5.007  -2.136  55.356  1.00 39.41  ? 31  PRO D CA  1 
ATOM 4817  C C   . PRO D 1 31  ? -5.360  -3.093  56.497  1.00 42.80  ? 31  PRO D C   1 
ATOM 4818  O O   . PRO D 1 31  ? -4.482  -3.684  57.137  1.00 38.53  ? 31  PRO D O   1 
ATOM 4819  C CB  . PRO D 1 31  ? -4.631  -0.742  55.865  1.00 36.63  ? 31  PRO D CB  1 
ATOM 4820  C CG  . PRO D 1 31  ? -5.280  0.188   54.883  1.00 35.53  ? 31  PRO D CG  1 
ATOM 4821  C CD  . PRO D 1 31  ? -6.597  -0.482  54.598  1.00 35.83  ? 31  PRO D CD  1 
ATOM 4822  N N   . LYS D 1 32  ? -6.659  -3.234  56.750  1.00 44.64  ? 32  LYS D N   1 
ATOM 4823  C CA  . LYS D 1 32  ? -7.135  -4.115  57.805  1.00 43.79  ? 32  LYS D CA  1 
ATOM 4824  C C   . LYS D 1 32  ? -7.081  -5.565  57.315  1.00 44.34  ? 32  LYS D C   1 
ATOM 4825  O O   . LYS D 1 32  ? -6.333  -6.384  57.845  1.00 45.36  ? 32  LYS D O   1 
ATOM 4826  C CB  . LYS D 1 32  ? -8.567  -3.727  58.197  1.00 51.16  ? 32  LYS D CB  1 
ATOM 4827  C CG  . LYS D 1 32  ? -9.218  -4.633  59.253  1.00 64.34  ? 32  LYS D CG  1 
ATOM 4828  C CD  . LYS D 1 32  ? -10.676 -4.235  59.607  1.00 71.49  ? 32  LYS D CD  1 
ATOM 4829  C CE  . LYS D 1 32  ? -10.776 -3.000  60.518  1.00 69.93  ? 32  LYS D CE  1 
ATOM 4830  N NZ  . LYS D 1 32  ? -10.263 -1.739  59.894  1.00 74.93  ? 32  LYS D NZ  1 
ATOM 4831  N N   . VAL D 1 33  ? -7.845  -5.864  56.271  1.00 43.35  ? 33  VAL D N   1 
ATOM 4832  C CA  . VAL D 1 33  ? -7.905  -7.209  55.716  1.00 40.37  ? 33  VAL D CA  1 
ATOM 4833  C C   . VAL D 1 33  ? -6.762  -7.655  54.796  1.00 42.17  ? 33  VAL D C   1 
ATOM 4834  O O   . VAL D 1 33  ? -6.460  -8.834  54.737  1.00 48.80  ? 33  VAL D O   1 
ATOM 4835  C CB  . VAL D 1 33  ? -9.222  -7.410  54.953  1.00 36.61  ? 33  VAL D CB  1 
ATOM 4836  C CG1 . VAL D 1 33  ? -10.400 -7.040  55.842  1.00 33.60  ? 33  VAL D CG1 1 
ATOM 4837  C CG2 . VAL D 1 33  ? -9.223  -6.562  53.694  1.00 35.95  ? 33  VAL D CG2 1 
ATOM 4838  N N   . ALA D 1 34  ? -6.116  -6.745  54.079  1.00 40.86  ? 34  ALA D N   1 
ATOM 4839  C CA  . ALA D 1 34  ? -5.044  -7.156  53.170  1.00 41.25  ? 34  ALA D CA  1 
ATOM 4840  C C   . ALA D 1 34  ? -3.675  -6.494  53.414  1.00 42.04  ? 34  ALA D C   1 
ATOM 4841  O O   . ALA D 1 34  ? -3.008  -6.050  52.478  1.00 42.47  ? 34  ALA D O   1 
ATOM 4842  C CB  . ALA D 1 34  ? -5.494  -6.909  51.746  1.00 36.76  ? 34  ALA D CB  1 
ATOM 4843  N N   . PRO D 1 35  ? -3.228  -6.469  54.675  1.00 42.14  ? 35  PRO D N   1 
ATOM 4844  C CA  . PRO D 1 35  ? -1.980  -5.904  55.205  1.00 42.29  ? 35  PRO D CA  1 
ATOM 4845  C C   . PRO D 1 35  ? -0.703  -6.052  54.396  1.00 46.78  ? 35  PRO D C   1 
ATOM 4846  O O   . PRO D 1 35  ? 0.200   -5.222  54.507  1.00 50.89  ? 35  PRO D O   1 
ATOM 4847  C CB  . PRO D 1 35  ? -1.850  -6.581  56.552  1.00 39.74  ? 35  PRO D CB  1 
ATOM 4848  C CG  . PRO D 1 35  ? -3.274  -6.731  56.972  1.00 45.62  ? 35  PRO D CG  1 
ATOM 4849  C CD  . PRO D 1 35  ? -3.919  -7.244  55.717  1.00 45.20  ? 35  PRO D CD  1 
ATOM 4850  N N   . GLN D 1 36  ? -0.610  -7.112  53.604  1.00 50.92  ? 36  GLN D N   1 
ATOM 4851  C CA  . GLN D 1 36  ? 0.593   -7.361  52.813  1.00 52.27  ? 36  GLN D CA  1 
ATOM 4852  C C   . GLN D 1 36  ? 0.549   -6.666  51.459  1.00 53.37  ? 36  GLN D C   1 
ATOM 4853  O O   . GLN D 1 36  ? 1.563   -6.585  50.757  1.00 58.32  ? 36  GLN D O   1 
ATOM 4854  C CB  . GLN D 1 36  ? 0.799   -8.867  52.615  1.00 51.57  ? 36  GLN D CB  1 
ATOM 4855  C CG  . GLN D 1 36  ? -0.288  -9.575  51.796  1.00 56.90  ? 36  GLN D CG  1 
ATOM 4856  C CD  . GLN D 1 36  ? -1.679  -9.494  52.419  1.00 58.70  ? 36  GLN D CD  1 
ATOM 4857  O OE1 . GLN D 1 36  ? -1.832  -9.486  53.641  1.00 64.26  ? 36  GLN D OE1 1 
ATOM 4858  N NE2 . GLN D 1 36  ? -2.699  -9.456  51.577  1.00 60.42  ? 36  GLN D NE2 1 
ATOM 4859  N N   . ALA D 1 37  ? -0.628  -6.163  51.098  1.00 50.61  ? 37  ALA D N   1 
ATOM 4860  C CA  . ALA D 1 37  ? -0.818  -5.472  49.826  1.00 46.39  ? 37  ALA D CA  1 
ATOM 4861  C C   . ALA D 1 37  ? -0.780  -3.963  50.052  1.00 45.97  ? 37  ALA D C   1 
ATOM 4862  O O   . ALA D 1 37  ? 0.067   -3.248  49.501  1.00 43.37  ? 37  ALA D O   1 
ATOM 4863  C CB  . ALA D 1 37  ? -2.163  -5.874  49.223  1.00 44.41  ? 37  ALA D CB  1 
ATOM 4864  N N   . ILE D 1 38  ? -1.719  -3.507  50.879  1.00 46.82  ? 38  ILE D N   1 
ATOM 4865  C CA  . ILE D 1 38  ? -1.872  -2.103  51.223  1.00 45.15  ? 38  ILE D CA  1 
ATOM 4866  C C   . ILE D 1 38  ? -1.511  -1.834  52.667  1.00 43.81  ? 38  ILE D C   1 
ATOM 4867  O O   . ILE D 1 38  ? -2.140  -2.363  53.590  1.00 44.46  ? 38  ILE D O   1 
ATOM 4868  C CB  . ILE D 1 38  ? -3.317  -1.637  51.042  1.00 45.77  ? 38  ILE D CB  1 
ATOM 4869  C CG1 . ILE D 1 38  ? -3.721  -1.746  49.580  1.00 46.69  ? 38  ILE D CG1 1 
ATOM 4870  C CG2 . ILE D 1 38  ? -3.461  -0.207  51.509  1.00 46.61  ? 38  ILE D CG2 1 
ATOM 4871  C CD1 . ILE D 1 38  ? -5.211  -1.606  49.364  1.00 51.63  ? 38  ILE D CD1 1 
ATOM 4872  N N   . SER D 1 39  ? -0.507  -0.988  52.843  1.00 41.63  ? 39  SER D N   1 
ATOM 4873  C CA  . SER D 1 39  ? -0.045  -0.585  54.155  1.00 42.83  ? 39  SER D CA  1 
ATOM 4874  C C   . SER D 1 39  ? -1.061  0.395   54.782  1.00 43.87  ? 39  SER D C   1 
ATOM 4875  O O   . SER D 1 39  ? -1.686  0.101   55.814  1.00 41.27  ? 39  SER D O   1 
ATOM 4876  C CB  . SER D 1 39  ? 1.323   0.079   54.006  1.00 41.16  ? 39  SER D CB  1 
ATOM 4877  O OG  . SER D 1 39  ? 1.680   0.798   55.166  1.00 50.77  ? 39  SER D OG  1 
ATOM 4878  N N   . SER D 1 40  ? -1.238  1.546   54.129  1.00 44.00  ? 40  SER D N   1 
ATOM 4879  C CA  . SER D 1 40  ? -2.153  2.589   54.597  1.00 43.04  ? 40  SER D CA  1 
ATOM 4880  C C   . SER D 1 40  ? -2.604  3.503   53.458  1.00 42.30  ? 40  SER D C   1 
ATOM 4881  O O   . SER D 1 40  ? -1.883  3.693   52.481  1.00 41.66  ? 40  SER D O   1 
ATOM 4882  C CB  . SER D 1 40  ? -1.455  3.442   55.651  1.00 42.78  ? 40  SER D CB  1 
ATOM 4883  O OG  . SER D 1 40  ? -0.286  4.032   55.102  1.00 45.12  ? 40  SER D OG  1 
ATOM 4884  N N   . VAL D 1 41  ? -3.791  4.083   53.604  1.00 42.50  ? 41  VAL D N   1 
ATOM 4885  C CA  . VAL D 1 41  ? -4.344  4.998   52.603  1.00 42.10  ? 41  VAL D CA  1 
ATOM 4886  C C   . VAL D 1 41  ? -4.676  6.349   53.255  1.00 42.22  ? 41  VAL D C   1 
ATOM 4887  O O   . VAL D 1 41  ? -5.260  6.384   54.340  1.00 41.98  ? 41  VAL D O   1 
ATOM 4888  C CB  . VAL D 1 41  ? -5.647  4.427   52.003  1.00 42.00  ? 41  VAL D CB  1 
ATOM 4889  C CG1 . VAL D 1 41  ? -6.169  5.337   50.916  1.00 34.68  ? 41  VAL D CG1 1 
ATOM 4890  C CG2 . VAL D 1 41  ? -5.399  3.044   51.467  1.00 42.85  ? 41  VAL D CG2 1 
ATOM 4891  N N   . GLU D 1 42  ? -4.313  7.457   52.616  1.00 42.95  ? 42  GLU D N   1 
ATOM 4892  C CA  . GLU D 1 42  ? -4.636  8.760   53.195  1.00 45.34  ? 42  GLU D CA  1 
ATOM 4893  C C   . GLU D 1 42  ? -5.115  9.785   52.161  1.00 44.07  ? 42  GLU D C   1 
ATOM 4894  O O   . GLU D 1 42  ? -4.653  9.783   51.024  1.00 44.13  ? 42  GLU D O   1 
ATOM 4895  C CB  . GLU D 1 42  ? -3.431  9.318   53.957  1.00 50.57  ? 42  GLU D CB  1 
ATOM 4896  C CG  . GLU D 1 42  ? -2.303  9.804   53.080  1.00 63.46  ? 42  GLU D CG  1 
ATOM 4897  C CD  . GLU D 1 42  ? -1.189  10.467  53.878  1.00 70.78  ? 42  GLU D CD  1 
ATOM 4898  O OE1 . GLU D 1 42  ? -0.376  9.735   54.504  1.00 76.27  ? 42  GLU D OE1 1 
ATOM 4899  O OE2 . GLU D 1 42  ? -1.137  11.724  53.880  1.00 72.21  ? 42  GLU D OE2 1 
ATOM 4900  N N   . ASN D 1 43  ? -6.036  10.660  52.574  1.00 42.70  ? 43  ASN D N   1 
ATOM 4901  C CA  . ASN D 1 43  ? -6.596  11.699  51.706  1.00 38.05  ? 43  ASN D CA  1 
ATOM 4902  C C   . ASN D 1 43  ? -5.750  12.960  51.571  1.00 35.00  ? 43  ASN D C   1 
ATOM 4903  O O   . ASN D 1 43  ? -5.958  13.927  52.295  1.00 37.24  ? 43  ASN D O   1 
ATOM 4904  C CB  . ASN D 1 43  ? -7.986  12.089  52.201  1.00 35.44  ? 43  ASN D CB  1 
ATOM 4905  C CG  . ASN D 1 43  ? -8.993  10.981  52.006  1.00 38.87  ? 43  ASN D CG  1 
ATOM 4906  O OD1 . ASN D 1 43  ? -8.622  9.853   51.679  1.00 40.88  ? 43  ASN D OD1 1 
ATOM 4907  N ND2 . ASN D 1 43  ? -10.273 11.287  52.206  1.00 39.75  ? 43  ASN D ND2 1 
ATOM 4908  N N   . ILE D 1 44  ? -4.799  12.927  50.644  1.00 29.44  ? 44  ILE D N   1 
ATOM 4909  C CA  . ILE D 1 44  ? -3.915  14.047  50.342  1.00 30.82  ? 44  ILE D CA  1 
ATOM 4910  C C   . ILE D 1 44  ? -4.663  15.383  50.139  1.00 32.57  ? 44  ILE D C   1 
ATOM 4911  O O   . ILE D 1 44  ? -4.150  16.445  50.500  1.00 38.47  ? 44  ILE D O   1 
ATOM 4912  C CB  . ILE D 1 44  ? -3.120  13.746  49.076  1.00 30.96  ? 44  ILE D CB  1 
ATOM 4913  C CG1 . ILE D 1 44  ? -2.216  12.548  49.323  1.00 32.15  ? 44  ILE D CG1 1 
ATOM 4914  C CG2 . ILE D 1 44  ? -2.276  14.941  48.683  1.00 31.28  ? 44  ILE D CG2 1 
ATOM 4915  C CD1 . ILE D 1 44  ? -0.903  12.907  49.997  1.00 41.13  ? 44  ILE D CD1 1 
ATOM 4916  N N   . GLU D 1 45  ? -5.845  15.324  49.525  1.00 30.78  ? 45  GLU D N   1 
ATOM 4917  C CA  . GLU D 1 45  ? -6.702  16.497  49.308  1.00 27.80  ? 45  GLU D CA  1 
ATOM 4918  C C   . GLU D 1 45  ? -8.157  16.040  49.227  1.00 23.66  ? 45  GLU D C   1 
ATOM 4919  O O   . GLU D 1 45  ? -8.472  15.073  48.551  1.00 26.00  ? 45  GLU D O   1 
ATOM 4920  C CB  . GLU D 1 45  ? -6.341  17.274  48.012  1.00 27.97  ? 45  GLU D CB  1 
ATOM 4921  C CG  . GLU D 1 45  ? -7.530  18.165  47.473  1.00 33.03  ? 45  GLU D CG  1 
ATOM 4922  C CD  . GLU D 1 45  ? -7.145  19.277  46.471  1.00 40.24  ? 45  GLU D CD  1 
ATOM 4923  O OE1 . GLU D 1 45  ? -6.328  19.020  45.550  1.00 36.65  ? 45  GLU D OE1 1 
ATOM 4924  O OE2 . GLU D 1 45  ? -7.691  20.414  46.589  1.00 42.11  ? 45  GLU D OE2 1 
ATOM 4925  N N   . GLY D 1 46  ? -9.054  16.726  49.913  1.00 22.91  ? 46  GLY D N   1 
ATOM 4926  C CA  . GLY D 1 46  ? -10.444 16.326  49.832  1.00 26.27  ? 46  GLY D CA  1 
ATOM 4927  C C   . GLY D 1 46  ? -10.851 15.512  51.030  1.00 24.61  ? 46  GLY D C   1 
ATOM 4928  O O   . GLY D 1 46  ? -10.008 14.984  51.754  1.00 25.28  ? 46  GLY D O   1 
ATOM 4929  N N   . ASN D 1 47  ? -12.153 15.393  51.224  1.00 22.29  ? 47  ASN D N   1 
ATOM 4930  C CA  . ASN D 1 47  ? -12.676 14.673  52.360  1.00 24.49  ? 47  ASN D CA  1 
ATOM 4931  C C   . ASN D 1 47  ? -13.194 13.285  52.009  1.00 30.03  ? 47  ASN D C   1 
ATOM 4932  O O   . ASN D 1 47  ? -14.063 12.747  52.700  1.00 31.93  ? 47  ASN D O   1 
ATOM 4933  C CB  . ASN D 1 47  ? -13.792 15.493  52.996  1.00 22.15  ? 47  ASN D CB  1 
ATOM 4934  C CG  . ASN D 1 47  ? -14.958 15.689  52.065  1.00 17.33  ? 47  ASN D CG  1 
ATOM 4935  O OD1 . ASN D 1 47  ? -16.039 16.131  52.475  1.00 28.30  ? 47  ASN D OD1 1 
ATOM 4936  N ND2 . ASN D 1 47  ? -14.754 15.366  50.798  1.00 24.90  ? 47  ASN D ND2 1 
ATOM 4937  N N   . GLY D 1 48  ? -12.684 12.698  50.932  1.00 33.89  ? 48  GLY D N   1 
ATOM 4938  C CA  . GLY D 1 48  ? -13.138 11.363  50.583  1.00 36.50  ? 48  GLY D CA  1 
ATOM 4939  C C   . GLY D 1 48  ? -14.292 11.236  49.603  1.00 35.27  ? 48  GLY D C   1 
ATOM 4940  O O   . GLY D 1 48  ? -14.588 10.136  49.145  1.00 37.70  ? 48  GLY D O   1 
ATOM 4941  N N   . GLY D 1 49  ? -14.966 12.330  49.284  1.00 34.73  ? 49  GLY D N   1 
ATOM 4942  C CA  . GLY D 1 49  ? -16.044 12.235  48.316  1.00 30.83  ? 49  GLY D CA  1 
ATOM 4943  C C   . GLY D 1 49  ? -15.444 12.389  46.926  1.00 27.50  ? 49  GLY D C   1 
ATOM 4944  O O   . GLY D 1 49  ? -14.208 12.354  46.759  1.00 26.96  ? 49  GLY D O   1 
ATOM 4945  N N   . PRO D 1 50  ? -16.287 12.564  45.895  1.00 25.39  ? 50  PRO D N   1 
ATOM 4946  C CA  . PRO D 1 50  ? -15.816 12.730  44.508  1.00 20.89  ? 50  PRO D CA  1 
ATOM 4947  C C   . PRO D 1 50  ? -14.667 13.744  44.420  1.00 20.54  ? 50  PRO D C   1 
ATOM 4948  O O   . PRO D 1 50  ? -14.689 14.783  45.079  1.00 20.12  ? 50  PRO D O   1 
ATOM 4949  C CB  . PRO D 1 50  ? -17.054 13.224  43.776  1.00 12.37  ? 50  PRO D CB  1 
ATOM 4950  C CG  . PRO D 1 50  ? -18.167 12.572  44.517  1.00 15.39  ? 50  PRO D CG  1 
ATOM 4951  C CD  . PRO D 1 50  ? -17.750 12.687  45.976  1.00 21.27  ? 50  PRO D CD  1 
ATOM 4952  N N   . GLY D 1 51  ? -13.666 13.427  43.614  1.00 18.38  ? 51  GLY D N   1 
ATOM 4953  C CA  . GLY D 1 51  ? -12.540 14.319  43.463  1.00 16.09  ? 51  GLY D CA  1 
ATOM 4954  C C   . GLY D 1 51  ? -11.413 14.038  44.442  1.00 20.87  ? 51  GLY D C   1 
ATOM 4955  O O   . GLY D 1 51  ? -10.252 14.333  44.152  1.00 16.79  ? 51  GLY D O   1 
ATOM 4956  N N   . THR D 1 52  ? -11.729 13.462  45.601  1.00 19.35  ? 52  THR D N   1 
ATOM 4957  C CA  . THR D 1 52  ? -10.691 13.189  46.592  1.00 19.78  ? 52  THR D CA  1 
ATOM 4958  C C   . THR D 1 52  ? -9.410  12.559  46.014  1.00 24.17  ? 52  THR D C   1 
ATOM 4959  O O   . THR D 1 52  ? -9.482  11.670  45.168  1.00 27.25  ? 52  THR D O   1 
ATOM 4960  C CB  . THR D 1 52  ? -11.229 12.265  47.693  1.00 17.30  ? 52  THR D CB  1 
ATOM 4961  O OG1 . THR D 1 52  ? -12.395 12.851  48.276  1.00 17.80  ? 52  THR D OG1 1 
ATOM 4962  C CG2 . THR D 1 52  ? -10.181 12.059  48.772  1.00 10.62  ? 52  THR D CG2 1 
ATOM 4963  N N   . ILE D 1 53  ? -8.246  13.034  46.461  1.00 28.29  ? 53  ILE D N   1 
ATOM 4964  C CA  . ILE D 1 53  ? -6.941  12.498  46.030  1.00 27.03  ? 53  ILE D CA  1 
ATOM 4965  C C   . ILE D 1 53  ? -6.319  11.696  47.179  1.00 30.08  ? 53  ILE D C   1 
ATOM 4966  O O   . ILE D 1 53  ? -6.002  12.257  48.238  1.00 31.02  ? 53  ILE D O   1 
ATOM 4967  C CB  . ILE D 1 53  ? -5.933  13.612  45.640  1.00 22.99  ? 53  ILE D CB  1 
ATOM 4968  C CG1 . ILE D 1 53  ? -6.112  14.011  44.180  1.00 14.78  ? 53  ILE D CG1 1 
ATOM 4969  C CG2 . ILE D 1 53  ? -4.505  13.114  45.840  1.00 20.09  ? 53  ILE D CG2 1 
ATOM 4970  C CD1 . ILE D 1 53  ? -7.503  14.388  43.837  1.00 22.89  ? 53  ILE D CD1 1 
ATOM 4971  N N   . LYS D 1 54  ? -6.124  10.394  46.947  1.00 33.91  ? 54  LYS D N   1 
ATOM 4972  C CA  . LYS D 1 54  ? -5.572  9.472   47.946  1.00 31.36  ? 54  LYS D CA  1 
ATOM 4973  C C   . LYS D 1 54  ? -4.138  9.005   47.689  1.00 32.55  ? 54  LYS D C   1 
ATOM 4974  O O   . LYS D 1 54  ? -3.735  8.771   46.550  1.00 33.56  ? 54  LYS D O   1 
ATOM 4975  C CB  . LYS D 1 54  ? -6.492  8.253   48.067  1.00 24.55  ? 54  LYS D CB  1 
ATOM 4976  C CG  . LYS D 1 54  ? -7.970  8.639   48.122  1.00 30.77  ? 54  LYS D CG  1 
ATOM 4977  C CD  . LYS D 1 54  ? -8.919  7.515   48.578  1.00 33.90  ? 54  LYS D CD  1 
ATOM 4978  C CE  . LYS D 1 54  ? -10.350 8.064   48.755  1.00 36.11  ? 54  LYS D CE  1 
ATOM 4979  N NZ  . LYS D 1 54  ? -11.368 7.129   49.347  1.00 40.89  ? 54  LYS D NZ  1 
ATOM 4980  N N   . LYS D 1 55  ? -3.363  8.895   48.762  1.00 33.83  ? 55  LYS D N   1 
ATOM 4981  C CA  . LYS D 1 55  ? -1.999  8.408   48.666  1.00 36.75  ? 55  LYS D CA  1 
ATOM 4982  C C   . LYS D 1 55  ? -2.050  7.023   49.315  1.00 41.10  ? 55  LYS D C   1 
ATOM 4983  O O   . LYS D 1 55  ? -2.203  6.895   50.538  1.00 43.02  ? 55  LYS D O   1 
ATOM 4984  C CB  . LYS D 1 55  ? -1.031  9.317   49.430  1.00 37.50  ? 55  LYS D CB  1 
ATOM 4985  C CG  . LYS D 1 55  ? 0.447   9.119   49.062  1.00 42.88  ? 55  LYS D CG  1 
ATOM 4986  C CD  . LYS D 1 55  ? 1.320   8.739   50.268  1.00 49.35  ? 55  LYS D CD  1 
ATOM 4987  C CE  . LYS D 1 55  ? 2.166   9.911   50.794  1.00 54.84  ? 55  LYS D CE  1 
ATOM 4988  N NZ  . LYS D 1 55  ? 3.328   10.282  49.916  1.00 57.35  ? 55  LYS D NZ  1 
ATOM 4989  N N   . ILE D 1 56  ? -1.965  5.992   48.478  1.00 44.52  ? 56  ILE D N   1 
ATOM 4990  C CA  . ILE D 1 56  ? -1.989  4.607   48.928  1.00 45.92  ? 56  ILE D CA  1 
ATOM 4991  C C   . ILE D 1 56  ? -0.563  4.111   49.136  1.00 44.89  ? 56  ILE D C   1 
ATOM 4992  O O   . ILE D 1 56  ? 0.243   4.095   48.205  1.00 40.09  ? 56  ILE D O   1 
ATOM 4993  C CB  . ILE D 1 56  ? -2.680  3.720   47.898  1.00 51.02  ? 56  ILE D CB  1 
ATOM 4994  C CG1 . ILE D 1 56  ? -4.112  4.211   47.690  1.00 53.78  ? 56  ILE D CG1 1 
ATOM 4995  C CG2 . ILE D 1 56  ? -2.666  2.287   48.366  1.00 49.13  ? 56  ILE D CG2 1 
ATOM 4996  C CD1 . ILE D 1 56  ? -4.980  3.280   46.856  1.00 65.47  ? 56  ILE D CD1 1 
ATOM 4997  N N   . SER D 1 57  ? -0.261  3.709   50.367  1.00 47.97  ? 57  SER D N   1 
ATOM 4998  C CA  . SER D 1 57  ? 1.071   3.233   50.730  1.00 48.60  ? 57  SER D CA  1 
ATOM 4999  C C   . SER D 1 57  ? 1.169   1.712   50.774  1.00 46.61  ? 57  SER D C   1 
ATOM 5000  O O   . SER D 1 57  ? 0.215   1.021   51.164  1.00 37.55  ? 57  SER D O   1 
ATOM 5001  C CB  . SER D 1 57  ? 1.476   3.813   52.089  1.00 52.98  ? 57  SER D CB  1 
ATOM 5002  O OG  . SER D 1 57  ? 1.535   5.226   52.027  1.00 54.13  ? 57  SER D OG  1 
ATOM 5003  N N   . PHE D 1 58  ? 2.343   1.209   50.384  1.00 49.43  ? 58  PHE D N   1 
ATOM 5004  C CA  . PHE D 1 58  ? 2.613   -0.225  50.333  1.00 54.82  ? 58  PHE D CA  1 
ATOM 5005  C C   . PHE D 1 58  ? 3.628   -0.714  51.355  1.00 60.93  ? 58  PHE D C   1 
ATOM 5006  O O   . PHE D 1 58  ? 4.579   0.002   51.691  1.00 65.81  ? 58  PHE D O   1 
ATOM 5007  C CB  . PHE D 1 58  ? 3.091   -0.608  48.935  1.00 51.43  ? 58  PHE D CB  1 
ATOM 5008  C CG  . PHE D 1 58  ? 2.088   -0.329  47.868  1.00 48.57  ? 58  PHE D CG  1 
ATOM 5009  C CD1 . PHE D 1 58  ? 0.809   -0.889  47.938  1.00 47.84  ? 58  PHE D CD1 1 
ATOM 5010  C CD2 . PHE D 1 58  ? 2.405   0.513   46.804  1.00 45.18  ? 58  PHE D CD2 1 
ATOM 5011  C CE1 . PHE D 1 58  ? -0.150  -0.608  46.960  1.00 45.90  ? 58  PHE D CE1 1 
ATOM 5012  C CE2 . PHE D 1 58  ? 1.456   0.802   45.822  1.00 40.14  ? 58  PHE D CE2 1 
ATOM 5013  C CZ  . PHE D 1 58  ? 0.173   0.241   45.899  1.00 41.40  ? 58  PHE D CZ  1 
ATOM 5014  N N   . PRO D 1 59  ? 3.433   -1.950  51.857  1.00 64.49  ? 59  PRO D N   1 
ATOM 5015  C CA  . PRO D 1 59  ? 4.335   -2.543  52.846  1.00 69.15  ? 59  PRO D CA  1 
ATOM 5016  C C   . PRO D 1 59  ? 5.738   -2.631  52.241  1.00 74.25  ? 59  PRO D C   1 
ATOM 5017  O O   . PRO D 1 59  ? 5.911   -3.002  51.071  1.00 70.88  ? 59  PRO D O   1 
ATOM 5018  C CB  . PRO D 1 59  ? 3.696   -3.905  53.117  1.00 67.83  ? 59  PRO D CB  1 
ATOM 5019  C CG  . PRO D 1 59  ? 2.229   -3.663  52.804  1.00 64.62  ? 59  PRO D CG  1 
ATOM 5020  C CD  . PRO D 1 59  ? 2.308   -2.852  51.558  1.00 62.74  ? 59  PRO D CD  1 
ATOM 5021  N N   . GLU D 1 60  ? 6.731   -2.240  53.032  1.00 80.92  ? 60  GLU D N   1 
ATOM 5022  C CA  . GLU D 1 60  ? 8.112   -2.260  52.577  1.00 88.66  ? 60  GLU D CA  1 
ATOM 5023  C C   . GLU D 1 60  ? 8.433   -3.638  52.008  1.00 89.28  ? 60  GLU D C   1 
ATOM 5024  O O   . GLU D 1 60  ? 8.191   -4.667  52.649  1.00 92.18  ? 60  GLU D O   1 
ATOM 5025  C CB  . GLU D 1 60  ? 9.045   -1.891  53.743  1.00 94.54  ? 60  GLU D CB  1 
ATOM 5026  C CG  . GLU D 1 60  ? 10.513  -2.251  53.554  1.00 104.76 ? 60  GLU D CG  1 
ATOM 5027  C CD  . GLU D 1 60  ? 10.987  -3.262  54.591  1.00 112.87 ? 60  GLU D CD  1 
ATOM 5028  O OE1 . GLU D 1 60  ? 10.294  -3.426  55.622  1.00 115.26 ? 60  GLU D OE1 1 
ATOM 5029  O OE2 . GLU D 1 60  ? 12.052  -3.879  54.387  1.00 118.37 ? 60  GLU D OE2 1 
ATOM 5030  N N   . GLY D 1 61  ? 8.948   -3.652  50.786  1.00 87.49  ? 61  GLY D N   1 
ATOM 5031  C CA  . GLY D 1 61  ? 9.273   -4.911  50.146  1.00 85.17  ? 61  GLY D CA  1 
ATOM 5032  C C   . GLY D 1 61  ? 8.661   -5.027  48.766  1.00 84.16  ? 61  GLY D C   1 
ATOM 5033  O O   . GLY D 1 61  ? 9.339   -5.413  47.811  1.00 84.07  ? 61  GLY D O   1 
ATOM 5034  N N   . LEU D 1 62  ? 7.375   -4.703  48.653  1.00 83.32  ? 62  LEU D N   1 
ATOM 5035  C CA  . LEU D 1 62  ? 6.684   -4.768  47.361  1.00 80.88  ? 62  LEU D CA  1 
ATOM 5036  C C   . LEU D 1 62  ? 7.426   -3.915  46.323  1.00 77.90  ? 62  LEU D C   1 
ATOM 5037  O O   . LEU D 1 62  ? 8.386   -3.201  46.656  1.00 77.14  ? 62  LEU D O   1 
ATOM 5038  C CB  . LEU D 1 62  ? 5.239   -4.279  47.498  1.00 80.28  ? 62  LEU D CB  1 
ATOM 5039  C CG  . LEU D 1 62  ? 4.263   -5.180  48.262  1.00 81.42  ? 62  LEU D CG  1 
ATOM 5040  C CD1 . LEU D 1 62  ? 4.706   -5.287  49.722  1.00 86.63  ? 62  LEU D CD1 1 
ATOM 5041  C CD2 . LEU D 1 62  ? 2.844   -4.619  48.172  1.00 80.30  ? 62  LEU D CD2 1 
ATOM 5042  N N   . PRO D 1 63  ? 6.991   -3.968  45.050  1.00 74.08  ? 63  PRO D N   1 
ATOM 5043  C CA  . PRO D 1 63  ? 7.663   -3.181  44.008  1.00 74.01  ? 63  PRO D CA  1 
ATOM 5044  C C   . PRO D 1 63  ? 7.661   -1.673  44.224  1.00 76.51  ? 63  PRO D C   1 
ATOM 5045  O O   . PRO D 1 63  ? 8.705   -1.023  44.100  1.00 80.25  ? 63  PRO D O   1 
ATOM 5046  C CB  . PRO D 1 63  ? 6.907   -3.559  42.740  1.00 68.58  ? 63  PRO D CB  1 
ATOM 5047  C CG  . PRO D 1 63  ? 5.533   -3.862  43.240  1.00 68.36  ? 63  PRO D CG  1 
ATOM 5048  C CD  . PRO D 1 63  ? 5.803   -4.653  44.505  1.00 70.67  ? 63  PRO D CD  1 
ATOM 5049  N N   . PHE D 1 64  ? 6.485   -1.122  44.529  1.00 75.19  ? 64  PHE D N   1 
ATOM 5050  C CA  . PHE D 1 64  ? 6.337   0.317   44.741  1.00 70.82  ? 64  PHE D CA  1 
ATOM 5051  C C   . PHE D 1 64  ? 6.081   0.687   46.185  1.00 68.95  ? 64  PHE D C   1 
ATOM 5052  O O   . PHE D 1 64  ? 5.525   -0.098  46.959  1.00 69.86  ? 64  PHE D O   1 
ATOM 5053  C CB  . PHE D 1 64  ? 5.172   0.865   43.928  1.00 73.05  ? 64  PHE D CB  1 
ATOM 5054  C CG  . PHE D 1 64  ? 5.225   0.517   42.476  1.00 75.55  ? 64  PHE D CG  1 
ATOM 5055  C CD1 . PHE D 1 64  ? 6.311   0.900   41.691  1.00 75.58  ? 64  PHE D CD1 1 
ATOM 5056  C CD2 . PHE D 1 64  ? 4.167   -0.181  41.885  1.00 74.58  ? 64  PHE D CD2 1 
ATOM 5057  C CE1 . PHE D 1 64  ? 6.342   0.593   40.336  1.00 76.04  ? 64  PHE D CE1 1 
ATOM 5058  C CE2 . PHE D 1 64  ? 4.185   -0.493  40.534  1.00 73.12  ? 64  PHE D CE2 1 
ATOM 5059  C CZ  . PHE D 1 64  ? 5.276   -0.105  39.753  1.00 74.49  ? 64  PHE D CZ  1 
ATOM 5060  N N   . LYS D 1 65  ? 6.464   1.912   46.526  1.00 67.14  ? 65  LYS D N   1 
ATOM 5061  C CA  . LYS D 1 65  ? 6.254   2.415   47.870  1.00 68.14  ? 65  LYS D CA  1 
ATOM 5062  C C   . LYS D 1 65  ? 4.838   2.995   48.040  1.00 66.56  ? 65  LYS D C   1 
ATOM 5063  O O   . LYS D 1 65  ? 4.138   2.678   49.013  1.00 65.90  ? 65  LYS D O   1 
ATOM 5064  C CB  . LYS D 1 65  ? 7.288   3.490   48.215  1.00 71.32  ? 65  LYS D CB  1 
ATOM 5065  C CG  . LYS D 1 65  ? 7.117   4.008   49.651  1.00 82.43  ? 65  LYS D CG  1 
ATOM 5066  C CD  . LYS D 1 65  ? 8.039   5.180   50.005  1.00 89.47  ? 65  LYS D CD  1 
ATOM 5067  C CE  . LYS D 1 65  ? 7.714   5.755   51.399  1.00 93.10  ? 65  LYS D CE  1 
ATOM 5068  N NZ  . LYS D 1 65  ? 8.614   6.887   51.791  1.00 96.74  ? 65  LYS D NZ  1 
ATOM 5069  N N   . TYR D 1 66  ? 4.419   3.835   47.090  1.00 62.61  ? 66  TYR D N   1 
ATOM 5070  C CA  . TYR D 1 66  ? 3.106   4.476   47.141  1.00 57.99  ? 66  TYR D CA  1 
ATOM 5071  C C   . TYR D 1 66  ? 2.525   4.694   45.751  1.00 58.06  ? 66  TYR D C   1 
ATOM 5072  O O   . TYR D 1 66  ? 3.171   4.424   44.739  1.00 58.73  ? 66  TYR D O   1 
ATOM 5073  C CB  . TYR D 1 66  ? 3.226   5.845   47.803  1.00 60.57  ? 66  TYR D CB  1 
ATOM 5074  C CG  . TYR D 1 66  ? 3.831   6.888   46.880  1.00 59.63  ? 66  TYR D CG  1 
ATOM 5075  C CD1 . TYR D 1 66  ? 5.185   6.862   46.550  1.00 58.40  ? 66  TYR D CD1 1 
ATOM 5076  C CD2 . TYR D 1 66  ? 3.032   7.875   46.298  1.00 59.76  ? 66  TYR D CD2 1 
ATOM 5077  C CE1 . TYR D 1 66  ? 5.725   7.794   45.662  1.00 61.13  ? 66  TYR D CE1 1 
ATOM 5078  C CE2 . TYR D 1 66  ? 3.561   8.811   45.409  1.00 59.58  ? 66  TYR D CE2 1 
ATOM 5079  C CZ  . TYR D 1 66  ? 4.904   8.767   45.094  1.00 60.72  ? 66  TYR D CZ  1 
ATOM 5080  O OH  . TYR D 1 66  ? 5.409   9.702   44.214  1.00 63.92  ? 66  TYR D OH  1 
ATOM 5081  N N   . VAL D 1 67  ? 1.307   5.224   45.717  1.00 55.85  ? 67  VAL D N   1 
ATOM 5082  C CA  . VAL D 1 67  ? 0.615   5.525   44.468  1.00 51.64  ? 67  VAL D CA  1 
ATOM 5083  C C   . VAL D 1 67  ? -0.559  6.443   44.792  1.00 50.51  ? 67  VAL D C   1 
ATOM 5084  O O   . VAL D 1 67  ? -1.240  6.249   45.806  1.00 51.69  ? 67  VAL D O   1 
ATOM 5085  C CB  . VAL D 1 67  ? 0.059   4.256   43.797  1.00 48.79  ? 67  VAL D CB  1 
ATOM 5086  C CG1 . VAL D 1 67  ? -1.049  3.651   44.659  1.00 51.16  ? 67  VAL D CG1 1 
ATOM 5087  C CG2 . VAL D 1 67  ? -0.465  4.598   42.411  1.00 48.28  ? 67  VAL D CG2 1 
ATOM 5088  N N   . LYS D 1 68  ? -0.804  7.433   43.937  1.00 46.97  ? 68  LYS D N   1 
ATOM 5089  C CA  . LYS D 1 68  ? -1.910  8.355   44.173  1.00 43.70  ? 68  LYS D CA  1 
ATOM 5090  C C   . LYS D 1 68  ? -2.994  8.192   43.119  1.00 39.74  ? 68  LYS D C   1 
ATOM 5091  O O   . LYS D 1 68  ? -2.734  8.309   41.928  1.00 37.43  ? 68  LYS D O   1 
ATOM 5092  C CB  . LYS D 1 68  ? -1.400  9.799   44.183  1.00 47.45  ? 68  LYS D CB  1 
ATOM 5093  C CG  . LYS D 1 68  ? -0.314  10.066  45.224  1.00 52.95  ? 68  LYS D CG  1 
ATOM 5094  C CD  . LYS D 1 68  ? 0.208   11.499  45.161  1.00 57.30  ? 68  LYS D CD  1 
ATOM 5095  C CE  . LYS D 1 68  ? 1.380   11.716  46.125  1.00 62.86  ? 68  LYS D CE  1 
ATOM 5096  N NZ  . LYS D 1 68  ? 1.994   13.081  46.003  1.00 65.90  ? 68  LYS D NZ  1 
ATOM 5097  N N   . ASP D 1 69  ? -4.206  7.893   43.567  1.00 36.99  ? 69  ASP D N   1 
ATOM 5098  C CA  . ASP D 1 69  ? -5.332  7.740   42.663  1.00 36.86  ? 69  ASP D CA  1 
ATOM 5099  C C   . ASP D 1 69  ? -6.208  8.964   42.888  1.00 36.92  ? 69  ASP D C   1 
ATOM 5100  O O   . ASP D 1 69  ? -5.969  9.741   43.799  1.00 41.62  ? 69  ASP D O   1 
ATOM 5101  C CB  . ASP D 1 69  ? -6.154  6.495   42.988  1.00 35.49  ? 69  ASP D CB  1 
ATOM 5102  C CG  . ASP D 1 69  ? -5.323  5.240   43.081  1.00 40.00  ? 69  ASP D CG  1 
ATOM 5103  O OD1 . ASP D 1 69  ? -4.089  5.291   42.833  1.00 44.24  ? 69  ASP D OD1 1 
ATOM 5104  O OD2 . ASP D 1 69  ? -5.918  4.194   43.414  1.00 40.31  ? 69  ASP D OD2 1 
ATOM 5105  N N   . ARG D 1 70  ? -7.246  9.114   42.085  1.00 32.42  ? 70  ARG D N   1 
ATOM 5106  C CA  . ARG D 1 70  ? -8.115  10.255  42.213  1.00 26.28  ? 70  ARG D CA  1 
ATOM 5107  C C   . ARG D 1 70  ? -9.556  9.886   41.916  1.00 24.67  ? 70  ARG D C   1 
ATOM 5108  O O   . ARG D 1 70  ? -9.915  9.609   40.775  1.00 24.99  ? 70  ARG D O   1 
ATOM 5109  C CB  . ARG D 1 70  ? -7.625  11.338  41.257  1.00 25.31  ? 70  ARG D CB  1 
ATOM 5110  C CG  . ARG D 1 70  ? -8.725  12.143  40.558  1.00 14.86  ? 70  ARG D CG  1 
ATOM 5111  C CD  . ARG D 1 70  ? -8.079  12.958  39.476  1.00 19.29  ? 70  ARG D CD  1 
ATOM 5112  N NE  . ARG D 1 70  ? -8.585  12.702  38.132  1.00 28.73  ? 70  ARG D NE  1 
ATOM 5113  C CZ  . ARG D 1 70  ? -7.895  12.983  37.031  1.00 34.65  ? 70  ARG D CZ  1 
ATOM 5114  N NH1 . ARG D 1 70  ? -6.683  13.505  37.139  1.00 36.12  ? 70  ARG D NH1 1 
ATOM 5115  N NH2 . ARG D 1 70  ? -8.422  12.784  35.829  1.00 40.84  ? 70  ARG D NH2 1 
ATOM 5116  N N   . VAL D 1 71  ? -10.389 9.886   42.944  1.00 25.04  ? 71  VAL D N   1 
ATOM 5117  C CA  . VAL D 1 71  ? -11.789 9.544   42.747  1.00 26.26  ? 71  VAL D CA  1 
ATOM 5118  C C   . VAL D 1 71  ? -12.292 10.467  41.668  1.00 28.43  ? 71  VAL D C   1 
ATOM 5119  O O   . VAL D 1 71  ? -12.134 11.673  41.789  1.00 28.24  ? 71  VAL D O   1 
ATOM 5120  C CB  . VAL D 1 71  ? -12.597 9.789   44.005  1.00 26.00  ? 71  VAL D CB  1 
ATOM 5121  C CG1 . VAL D 1 71  ? -14.003 9.265   43.804  1.00 30.68  ? 71  VAL D CG1 1 
ATOM 5122  C CG2 . VAL D 1 71  ? -11.921 9.124   45.194  1.00 15.65  ? 71  VAL D CG2 1 
ATOM 5123  N N   . ASP D 1 72  ? -12.885 9.917   40.615  1.00 30.64  ? 72  ASP D N   1 
ATOM 5124  C CA  . ASP D 1 72  ? -13.371 10.743  39.520  1.00 29.40  ? 72  ASP D CA  1 
ATOM 5125  C C   . ASP D 1 72  ? -14.860 10.861  39.444  1.00 34.06  ? 72  ASP D C   1 
ATOM 5126  O O   . ASP D 1 72  ? -15.397 11.923  39.122  1.00 40.60  ? 72  ASP D O   1 
ATOM 5127  C CB  . ASP D 1 72  ? -12.856 10.209  38.206  1.00 23.67  ? 72  ASP D CB  1 
ATOM 5128  C CG  . ASP D 1 72  ? -11.389 10.448  38.045  1.00 26.81  ? 72  ASP D CG  1 
ATOM 5129  O OD1 . ASP D 1 72  ? -10.972 11.625  38.220  1.00 27.59  ? 72  ASP D OD1 1 
ATOM 5130  O OD2 . ASP D 1 72  ? -10.660 9.473   37.747  1.00 26.94  ? 72  ASP D OD2 1 
ATOM 5131  N N   . GLU D 1 73  ? -15.544 9.766   39.708  1.00 37.84  ? 73  GLU D N   1 
ATOM 5132  C CA  . GLU D 1 73  ? -16.987 9.810   39.663  1.00 42.52  ? 73  GLU D CA  1 
ATOM 5133  C C   . GLU D 1 73  ? -17.472 8.666   40.525  1.00 37.61  ? 73  GLU D C   1 
ATOM 5134  O O   . GLU D 1 73  ? -16.802 7.638   40.632  1.00 38.10  ? 73  GLU D O   1 
ATOM 5135  C CB  . GLU D 1 73  ? -17.459 9.678   38.207  1.00 55.89  ? 73  GLU D CB  1 
ATOM 5136  C CG  . GLU D 1 73  ? -18.948 9.997   37.991  1.00 75.13  ? 73  GLU D CG  1 
ATOM 5137  C CD  . GLU D 1 73  ? -19.889 8.768   38.106  1.00 84.63  ? 73  GLU D CD  1 
ATOM 5138  O OE1 . GLU D 1 73  ? -21.127 8.976   38.231  1.00 88.94  ? 73  GLU D OE1 1 
ATOM 5139  O OE2 . GLU D 1 73  ? -19.402 7.606   38.057  1.00 85.60  ? 73  GLU D OE2 1 
ATOM 5140  N N   . VAL D 1 74  ? -18.623 8.852   41.153  1.00 32.94  ? 74  VAL D N   1 
ATOM 5141  C CA  . VAL D 1 74  ? -19.171 7.821   42.005  1.00 34.05  ? 74  VAL D CA  1 
ATOM 5142  C C   . VAL D 1 74  ? -20.683 7.718   41.907  1.00 40.59  ? 74  VAL D C   1 
ATOM 5143  O O   . VAL D 1 74  ? -21.389 8.469   42.564  1.00 45.82  ? 74  VAL D O   1 
ATOM 5144  C CB  . VAL D 1 74  ? -18.822 8.087   43.454  1.00 27.35  ? 74  VAL D CB  1 
ATOM 5145  C CG1 . VAL D 1 74  ? -19.487 7.054   44.347  1.00 18.63  ? 74  VAL D CG1 1 
ATOM 5146  C CG2 . VAL D 1 74  ? -17.319 8.095   43.616  1.00 25.62  ? 74  VAL D CG2 1 
ATOM 5147  N N   . ASP D 1 75  ? -21.192 6.799   41.087  1.00 46.29  ? 75  ASP D N   1 
ATOM 5148  C CA  . ASP D 1 75  ? -22.634 6.650   41.001  1.00 46.49  ? 75  ASP D CA  1 
ATOM 5149  C C   . ASP D 1 75  ? -23.042 5.742   42.127  1.00 47.62  ? 75  ASP D C   1 
ATOM 5150  O O   . ASP D 1 75  ? -22.628 4.586   42.183  1.00 44.08  ? 75  ASP D O   1 
ATOM 5151  C CB  . ASP D 1 75  ? -23.100 6.013   39.705  1.00 48.71  ? 75  ASP D CB  1 
ATOM 5152  C CG  . ASP D 1 75  ? -24.619 6.011   39.600  1.00 55.03  ? 75  ASP D CG  1 
ATOM 5153  O OD1 . ASP D 1 75  ? -25.290 5.597   40.584  1.00 54.62  ? 75  ASP D OD1 1 
ATOM 5154  O OD2 . ASP D 1 75  ? -25.140 6.436   38.545  1.00 59.43  ? 75  ASP D OD2 1 
ATOM 5155  N N   . HIS D 1 76  ? -23.869 6.263   43.018  1.00 49.64  ? 76  HIS D N   1 
ATOM 5156  C CA  . HIS D 1 76  ? -24.294 5.483   44.152  1.00 52.42  ? 76  HIS D CA  1 
ATOM 5157  C C   . HIS D 1 76  ? -25.348 4.452   43.816  1.00 53.45  ? 76  HIS D C   1 
ATOM 5158  O O   . HIS D 1 76  ? -25.197 3.281   44.157  1.00 52.27  ? 76  HIS D O   1 
ATOM 5159  C CB  . HIS D 1 76  ? -24.761 6.423   45.264  1.00 55.40  ? 76  HIS D CB  1 
ATOM 5160  C CG  . HIS D 1 76  ? -23.634 7.140   45.937  1.00 54.97  ? 76  HIS D CG  1 
ATOM 5161  N ND1 . HIS D 1 76  ? -22.703 6.488   46.714  1.00 56.85  ? 76  HIS D ND1 1 
ATOM 5162  C CD2 . HIS D 1 76  ? -23.244 8.436   45.888  1.00 55.05  ? 76  HIS D CD2 1 
ATOM 5163  C CE1 . HIS D 1 76  ? -21.783 7.349   47.114  1.00 58.24  ? 76  HIS D CE1 1 
ATOM 5164  N NE2 . HIS D 1 76  ? -22.088 8.537   46.625  1.00 57.88  ? 76  HIS D NE2 1 
ATOM 5165  N N   . THR D 1 77  ? -26.403 4.868   43.133  1.00 56.35  ? 77  THR D N   1 
ATOM 5166  C CA  . THR D 1 77  ? -27.467 3.934   42.791  1.00 58.85  ? 77  THR D CA  1 
ATOM 5167  C C   . THR D 1 77  ? -27.010 2.753   41.916  1.00 58.87  ? 77  THR D C   1 
ATOM 5168  O O   . THR D 1 77  ? -27.388 1.607   42.168  1.00 57.20  ? 77  THR D O   1 
ATOM 5169  C CB  . THR D 1 77  ? -28.624 4.665   42.092  1.00 58.49  ? 77  THR D CB  1 
ATOM 5170  O OG1 . THR D 1 77  ? -28.138 5.294   40.899  1.00 56.79  ? 77  THR D OG1 1 
ATOM 5171  C CG2 . THR D 1 77  ? -29.215 5.723   43.023  1.00 56.01  ? 77  THR D CG2 1 
ATOM 5172  N N   . ASN D 1 78  ? -26.182 3.024   40.911  1.00 57.26  ? 78  ASN D N   1 
ATOM 5173  C CA  . ASN D 1 78  ? -25.714 1.972   40.013  1.00 58.22  ? 78  ASN D CA  1 
ATOM 5174  C C   . ASN D 1 78  ? -24.403 1.298   40.369  1.00 59.22  ? 78  ASN D C   1 
ATOM 5175  O O   . ASN D 1 78  ? -23.911 0.471   39.615  1.00 60.04  ? 78  ASN D O   1 
ATOM 5176  C CB  . ASN D 1 78  ? -25.621 2.522   38.598  1.00 61.19  ? 78  ASN D CB  1 
ATOM 5177  C CG  . ASN D 1 78  ? -26.972 2.872   38.043  1.00 66.66  ? 78  ASN D CG  1 
ATOM 5178  O OD1 . ASN D 1 78  ? -27.768 1.988   37.732  1.00 72.75  ? 78  ASN D OD1 1 
ATOM 5179  N ND2 . ASN D 1 78  ? -27.258 4.163   37.936  1.00 67.92  ? 78  ASN D ND2 1 
ATOM 5180  N N   . PHE D 1 79  ? -23.829 1.649   41.510  1.00 60.86  ? 79  PHE D N   1 
ATOM 5181  C CA  . PHE D 1 79  ? -22.575 1.043   41.943  1.00 57.02  ? 79  PHE D CA  1 
ATOM 5182  C C   . PHE D 1 79  ? -21.440 1.182   40.934  1.00 54.58  ? 79  PHE D C   1 
ATOM 5183  O O   . PHE D 1 79  ? -20.604 0.288   40.815  1.00 55.21  ? 79  PHE D O   1 
ATOM 5184  C CB  . PHE D 1 79  ? -22.794 -0.431  42.239  1.00 54.40  ? 79  PHE D CB  1 
ATOM 5185  C CG  . PHE D 1 79  ? -24.022 -0.703  43.046  1.00 56.28  ? 79  PHE D CG  1 
ATOM 5186  C CD1 . PHE D 1 79  ? -24.234 -0.047  44.254  1.00 54.78  ? 79  PHE D CD1 1 
ATOM 5187  C CD2 . PHE D 1 79  ? -24.963 -1.630  42.610  1.00 56.45  ? 79  PHE D CD2 1 
ATOM 5188  C CE1 . PHE D 1 79  ? -25.364 -0.310  45.020  1.00 59.58  ? 79  PHE D CE1 1 
ATOM 5189  C CE2 . PHE D 1 79  ? -26.100 -1.904  43.371  1.00 60.42  ? 79  PHE D CE2 1 
ATOM 5190  C CZ  . PHE D 1 79  ? -26.303 -1.242  44.578  1.00 61.55  ? 79  PHE D CZ  1 
ATOM 5191  N N   . LYS D 1 80  ? -21.419 2.287   40.194  1.00 49.42  ? 80  LYS D N   1 
ATOM 5192  C CA  . LYS D 1 80  ? -20.346 2.529   39.239  1.00 46.22  ? 80  LYS D CA  1 
ATOM 5193  C C   . LYS D 1 80  ? -19.366 3.473   39.930  1.00 44.00  ? 80  LYS D C   1 
ATOM 5194  O O   . LYS D 1 80  ? -19.765 4.426   40.589  1.00 47.76  ? 80  LYS D O   1 
ATOM 5195  C CB  . LYS D 1 80  ? -20.886 3.165   37.959  1.00 52.45  ? 80  LYS D CB  1 
ATOM 5196  C CG  . LYS D 1 80  ? -19.821 3.399   36.884  1.00 56.48  ? 80  LYS D CG  1 
ATOM 5197  C CD  . LYS D 1 80  ? -20.436 3.950   35.579  1.00 64.41  ? 80  LYS D CD  1 
ATOM 5198  C CE  . LYS D 1 80  ? -19.364 4.354   34.556  1.00 68.06  ? 80  LYS D CE  1 
ATOM 5199  N NZ  . LYS D 1 80  ? -19.907 4.631   33.189  1.00 72.39  ? 80  LYS D NZ  1 
ATOM 5200  N N   . TYR D 1 81  ? -18.082 3.208   39.784  1.00 39.89  ? 81  TYR D N   1 
ATOM 5201  C CA  . TYR D 1 81  ? -17.089 4.026   40.441  1.00 34.63  ? 81  TYR D CA  1 
ATOM 5202  C C   . TYR D 1 81  ? -15.832 4.135   39.589  1.00 36.33  ? 81  TYR D C   1 
ATOM 5203  O O   . TYR D 1 81  ? -15.199 3.133   39.262  1.00 33.60  ? 81  TYR D O   1 
ATOM 5204  C CB  . TYR D 1 81  ? -16.775 3.401   41.784  1.00 28.39  ? 81  TYR D CB  1 
ATOM 5205  C CG  . TYR D 1 81  ? -15.492 3.854   42.410  1.00 30.01  ? 81  TYR D CG  1 
ATOM 5206  C CD1 . TYR D 1 81  ? -15.478 4.868   43.360  1.00 36.52  ? 81  TYR D CD1 1 
ATOM 5207  C CD2 . TYR D 1 81  ? -14.285 3.239   42.093  1.00 34.50  ? 81  TYR D CD2 1 
ATOM 5208  C CE1 . TYR D 1 81  ? -14.284 5.259   43.998  1.00 40.45  ? 81  TYR D CE1 1 
ATOM 5209  C CE2 . TYR D 1 81  ? -13.089 3.618   42.718  1.00 39.33  ? 81  TYR D CE2 1 
ATOM 5210  C CZ  . TYR D 1 81  ? -13.093 4.627   43.677  1.00 40.99  ? 81  TYR D CZ  1 
ATOM 5211  O OH  . TYR D 1 81  ? -11.922 4.962   44.343  1.00 39.97  ? 81  TYR D OH  1 
ATOM 5212  N N   . ASN D 1 82  ? -15.460 5.364   39.244  1.00 36.05  ? 82  ASN D N   1 
ATOM 5213  C CA  . ASN D 1 82  ? -14.293 5.584   38.415  1.00 36.01  ? 82  ASN D CA  1 
ATOM 5214  C C   . ASN D 1 82  ? -13.237 6.317   39.183  1.00 35.76  ? 82  ASN D C   1 
ATOM 5215  O O   . ASN D 1 82  ? -13.552 7.061   40.098  1.00 39.95  ? 82  ASN D O   1 
ATOM 5216  C CB  . ASN D 1 82  ? -14.686 6.407   37.210  1.00 40.81  ? 82  ASN D CB  1 
ATOM 5217  C CG  . ASN D 1 82  ? -16.020 5.987   36.648  1.00 48.22  ? 82  ASN D CG  1 
ATOM 5218  O OD1 . ASN D 1 82  ? -17.046 6.026   37.340  1.00 53.00  ? 82  ASN D OD1 1 
ATOM 5219  N ND2 . ASN D 1 82  ? -16.022 5.573   35.389  1.00 51.99  ? 82  ASN D ND2 1 
ATOM 5220  N N   . TYR D 1 83  ? -11.981 6.100   38.808  1.00 33.08  ? 83  TYR D N   1 
ATOM 5221  C CA  . TYR D 1 83  ? -10.873 6.773   39.455  1.00 31.62  ? 83  TYR D CA  1 
ATOM 5222  C C   . TYR D 1 83  ? -9.643  6.672   38.571  1.00 30.15  ? 83  TYR D C   1 
ATOM 5223  O O   . TYR D 1 83  ? -9.653  5.945   37.584  1.00 23.88  ? 83  TYR D O   1 
ATOM 5224  C CB  . TYR D 1 83  ? -10.603 6.171   40.827  1.00 37.27  ? 83  TYR D CB  1 
ATOM 5225  C CG  . TYR D 1 83  ? -9.973  4.812   40.789  1.00 38.31  ? 83  TYR D CG  1 
ATOM 5226  C CD1 . TYR D 1 83  ? -10.732 3.676   40.505  1.00 38.96  ? 83  TYR D CD1 1 
ATOM 5227  C CD2 . TYR D 1 83  ? -8.608  4.664   41.037  1.00 38.31  ? 83  TYR D CD2 1 
ATOM 5228  C CE1 . TYR D 1 83  ? -10.147 2.412   40.473  1.00 41.14  ? 83  TYR D CE1 1 
ATOM 5229  C CE2 . TYR D 1 83  ? -8.009  3.423   41.005  1.00 41.02  ? 83  TYR D CE2 1 
ATOM 5230  C CZ  . TYR D 1 83  ? -8.777  2.287   40.721  1.00 42.66  ? 83  TYR D CZ  1 
ATOM 5231  O OH  . TYR D 1 83  ? -8.160  1.038   40.675  1.00 42.65  ? 83  TYR D OH  1 
ATOM 5232  N N   . SER D 1 84  ? -8.577  7.381   38.931  1.00 33.28  ? 84  SER D N   1 
ATOM 5233  C CA  . SER D 1 84  ? -7.382  7.401   38.090  1.00 36.28  ? 84  SER D CA  1 
ATOM 5234  C C   . SER D 1 84  ? -6.072  7.325   38.842  1.00 38.92  ? 84  SER D C   1 
ATOM 5235  O O   . SER D 1 84  ? -5.849  8.055   39.808  1.00 44.23  ? 84  SER D O   1 
ATOM 5236  C CB  . SER D 1 84  ? -7.348  8.696   37.258  1.00 37.03  ? 84  SER D CB  1 
ATOM 5237  O OG  . SER D 1 84  ? -8.616  9.008   36.704  1.00 29.39  ? 84  SER D OG  1 
ATOM 5238  N N   . VAL D 1 85  ? -5.189  6.445   38.401  1.00 36.43  ? 85  VAL D N   1 
ATOM 5239  C CA  . VAL D 1 85  ? -3.888  6.373   39.041  1.00 31.63  ? 85  VAL D CA  1 
ATOM 5240  C C   . VAL D 1 85  ? -3.172  7.545   38.401  1.00 32.31  ? 85  VAL D C   1 
ATOM 5241  O O   . VAL D 1 85  ? -3.223  7.696   37.186  1.00 32.22  ? 85  VAL D O   1 
ATOM 5242  C CB  . VAL D 1 85  ? -3.174  5.094   38.692  1.00 26.48  ? 85  VAL D CB  1 
ATOM 5243  C CG1 . VAL D 1 85  ? -1.815  5.075   39.385  1.00 25.29  ? 85  VAL D CG1 1 
ATOM 5244  C CG2 . VAL D 1 85  ? -4.036  3.919   39.096  1.00 22.58  ? 85  VAL D CG2 1 
ATOM 5245  N N   . ILE D 1 86  ? -2.504  8.376   39.190  1.00 32.95  ? 86  ILE D N   1 
ATOM 5246  C CA  . ILE D 1 86  ? -1.874  9.546   38.595  1.00 31.36  ? 86  ILE D CA  1 
ATOM 5247  C C   . ILE D 1 86  ? -0.463  9.859   39.028  1.00 33.42  ? 86  ILE D C   1 
ATOM 5248  O O   . ILE D 1 86  ? 0.174   10.727  38.451  1.00 33.05  ? 86  ILE D O   1 
ATOM 5249  C CB  . ILE D 1 86  ? -2.738  10.780  38.838  1.00 30.16  ? 86  ILE D CB  1 
ATOM 5250  C CG1 . ILE D 1 86  ? -2.722  11.131  40.327  1.00 31.95  ? 86  ILE D CG1 1 
ATOM 5251  C CG2 . ILE D 1 86  ? -4.194  10.483  38.403  1.00 29.15  ? 86  ILE D CG2 1 
ATOM 5252  C CD1 . ILE D 1 86  ? -3.827  12.085  40.738  1.00 25.87  ? 86  ILE D CD1 1 
ATOM 5253  N N   . GLU D 1 87  ? 0.041   9.181   40.045  1.00 35.96  ? 87  GLU D N   1 
ATOM 5254  C CA  . GLU D 1 87  ? 1.407   9.452   40.450  1.00 39.78  ? 87  GLU D CA  1 
ATOM 5255  C C   . GLU D 1 87  ? 1.970   8.266   41.212  1.00 43.28  ? 87  GLU D C   1 
ATOM 5256  O O   . GLU D 1 87  ? 1.227   7.558   41.907  1.00 43.64  ? 87  GLU D O   1 
ATOM 5257  C CB  . GLU D 1 87  ? 1.475   10.716  41.308  1.00 41.55  ? 87  GLU D CB  1 
ATOM 5258  C CG  . GLU D 1 87  ? 2.864   11.337  41.360  1.00 47.43  ? 87  GLU D CG  1 
ATOM 5259  C CD  . GLU D 1 87  ? 3.025   12.353  42.490  1.00 55.08  ? 87  GLU D CD  1 
ATOM 5260  O OE1 . GLU D 1 87  ? 2.301   13.383  42.504  1.00 59.23  ? 87  GLU D OE1 1 
ATOM 5261  O OE2 . GLU D 1 87  ? 3.887   12.116  43.370  1.00 56.69  ? 87  GLU D OE2 1 
ATOM 5262  N N   . GLY D 1 88  ? 3.279   8.059   41.061  1.00 41.97  ? 88  GLY D N   1 
ATOM 5263  C CA  . GLY D 1 88  ? 3.965   6.972   41.726  1.00 48.38  ? 88  GLY D CA  1 
ATOM 5264  C C   . GLY D 1 88  ? 3.545   5.587   41.257  1.00 56.15  ? 88  GLY D C   1 
ATOM 5265  O O   . GLY D 1 88  ? 2.385   5.371   40.874  1.00 60.53  ? 88  GLY D O   1 
ATOM 5266  N N   . GLY D 1 89  ? 4.487   4.642   41.288  1.00 59.28  ? 89  GLY D N   1 
ATOM 5267  C CA  . GLY D 1 89  ? 4.189   3.282   40.868  1.00 53.20  ? 89  GLY D CA  1 
ATOM 5268  C C   . GLY D 1 89  ? 4.305   3.075   39.370  1.00 51.91  ? 89  GLY D C   1 
ATOM 5269  O O   . GLY D 1 89  ? 5.294   3.493   38.755  1.00 50.28  ? 89  GLY D O   1 
ATOM 5270  N N   . PRO D 1 90  ? 3.302   2.432   38.749  1.00 52.50  ? 90  PRO D N   1 
ATOM 5271  C CA  . PRO D 1 90  ? 3.293   2.169   37.307  1.00 55.40  ? 90  PRO D CA  1 
ATOM 5272  C C   . PRO D 1 90  ? 3.429   3.447   36.491  1.00 59.45  ? 90  PRO D C   1 
ATOM 5273  O O   . PRO D 1 90  ? 3.807   3.422   35.315  1.00 62.45  ? 90  PRO D O   1 
ATOM 5274  C CB  . PRO D 1 90  ? 1.937   1.492   37.088  1.00 53.03  ? 90  PRO D CB  1 
ATOM 5275  C CG  . PRO D 1 90  ? 1.092   2.088   38.144  1.00 51.41  ? 90  PRO D CG  1 
ATOM 5276  C CD  . PRO D 1 90  ? 2.011   2.050   39.344  1.00 53.33  ? 90  PRO D CD  1 
ATOM 5277  N N   . ILE D 1 91  ? 3.117   4.569   37.127  1.00 62.35  ? 91  ILE D N   1 
ATOM 5278  C CA  . ILE D 1 91  ? 3.186   5.855   36.462  1.00 62.43  ? 91  ILE D CA  1 
ATOM 5279  C C   . ILE D 1 91  ? 4.620   6.327   36.266  1.00 65.11  ? 91  ILE D C   1 
ATOM 5280  O O   . ILE D 1 91  ? 5.457   6.201   37.159  1.00 64.65  ? 91  ILE D O   1 
ATOM 5281  C CB  . ILE D 1 91  ? 2.406   6.908   37.250  1.00 58.73  ? 91  ILE D CB  1 
ATOM 5282  C CG1 . ILE D 1 91  ? 0.967   6.429   37.473  1.00 59.45  ? 91  ILE D CG1 1 
ATOM 5283  C CG2 . ILE D 1 91  ? 2.418   8.210   36.497  1.00 56.04  ? 91  ILE D CG2 1 
ATOM 5284  C CD1 . ILE D 1 91  ? 0.204   6.134   36.191  1.00 57.12  ? 91  ILE D CD1 1 
ATOM 5285  N N   . GLY D 1 92  ? 4.895   6.859   35.078  1.00 69.32  ? 92  GLY D N   1 
ATOM 5286  C CA  . GLY D 1 92  ? 6.223   7.357   34.780  1.00 74.48  ? 92  GLY D CA  1 
ATOM 5287  C C   . GLY D 1 92  ? 6.763   6.886   33.447  1.00 78.85  ? 92  GLY D C   1 
ATOM 5288  O O   . GLY D 1 92  ? 6.603   5.715   33.085  1.00 80.29  ? 92  GLY D O   1 
ATOM 5289  N N   . ASP D 1 93  ? 7.398   7.807   32.720  1.00 82.80  ? 93  ASP D N   1 
ATOM 5290  C CA  . ASP D 1 93  ? 8.002   7.520   31.414  1.00 84.84  ? 93  ASP D CA  1 
ATOM 5291  C C   . ASP D 1 93  ? 7.004   6.935   30.422  1.00 82.04  ? 93  ASP D C   1 
ATOM 5292  O O   . ASP D 1 93  ? 6.306   7.653   29.706  1.00 79.41  ? 93  ASP D O   1 
ATOM 5293  C CB  . ASP D 1 93  ? 9.160   6.532   31.584  1.00 92.12  ? 93  ASP D CB  1 
ATOM 5294  C CG  . ASP D 1 93  ? 10.171  6.996   32.614  1.00 98.90  ? 93  ASP D CG  1 
ATOM 5295  O OD1 . ASP D 1 93  ? 10.910  7.959   32.317  1.00 104.87 ? 93  ASP D OD1 1 
ATOM 5296  O OD2 . ASP D 1 93  ? 10.219  6.408   33.721  1.00 100.79 ? 93  ASP D OD2 1 
ATOM 5297  N N   . THR D 1 94  ? 6.960   5.610   30.398  1.00 79.12  ? 94  THR D N   1 
ATOM 5298  C CA  . THR D 1 94  ? 6.080   4.865   29.519  1.00 77.48  ? 94  THR D CA  1 
ATOM 5299  C C   . THR D 1 94  ? 4.592   5.129   29.789  1.00 72.74  ? 94  THR D C   1 
ATOM 5300  O O   . THR D 1 94  ? 3.792   5.268   28.857  1.00 72.11  ? 94  THR D O   1 
ATOM 5301  C CB  . THR D 1 94  ? 6.378   3.362   29.673  1.00 81.50  ? 94  THR D CB  1 
ATOM 5302  O OG1 . THR D 1 94  ? 6.205   2.986   31.046  1.00 82.30  ? 94  THR D OG1 1 
ATOM 5303  C CG2 . THR D 1 94  ? 7.827   3.060   29.266  1.00 80.35  ? 94  THR D CG2 1 
ATOM 5304  N N   . LEU D 1 95  ? 4.231   5.205   31.066  1.00 68.62  ? 95  LEU D N   1 
ATOM 5305  C CA  . LEU D 1 95  ? 2.846   5.433   31.464  1.00 66.07  ? 95  LEU D CA  1 
ATOM 5306  C C   . LEU D 1 95  ? 2.599   6.844   31.986  1.00 65.87  ? 95  LEU D C   1 
ATOM 5307  O O   . LEU D 1 95  ? 3.395   7.371   32.772  1.00 65.78  ? 95  LEU D O   1 
ATOM 5308  C CB  . LEU D 1 95  ? 2.443   4.437   32.554  1.00 60.55  ? 95  LEU D CB  1 
ATOM 5309  C CG  . LEU D 1 95  ? 1.250   3.524   32.274  1.00 58.83  ? 95  LEU D CG  1 
ATOM 5310  C CD1 . LEU D 1 95  ? 0.858   2.838   33.578  1.00 56.50  ? 95  LEU D CD1 1 
ATOM 5311  C CD2 . LEU D 1 95  ? 0.075   4.317   31.698  1.00 57.99  ? 95  LEU D CD2 1 
ATOM 5312  N N   . GLU D 1 96  ? 1.489   7.441   31.549  1.00 63.38  ? 96  GLU D N   1 
ATOM 5313  C CA  . GLU D 1 96  ? 1.084   8.789   31.974  1.00 60.93  ? 96  GLU D CA  1 
ATOM 5314  C C   . GLU D 1 96  ? 0.135   8.677   33.165  1.00 58.09  ? 96  GLU D C   1 
ATOM 5315  O O   . GLU D 1 96  ? 0.440   9.140   34.262  1.00 60.38  ? 96  GLU D O   1 
ATOM 5316  C CB  . GLU D 1 96  ? 0.348   9.532   30.850  1.00 64.34  ? 96  GLU D CB  1 
ATOM 5317  C CG  . GLU D 1 96  ? 1.223   10.153  29.762  1.00 73.39  ? 96  GLU D CG  1 
ATOM 5318  C CD  . GLU D 1 96  ? 0.403   10.906  28.705  1.00 81.09  ? 96  GLU D CD  1 
ATOM 5319  O OE1 . GLU D 1 96  ? 1.016   11.486  27.774  1.00 83.38  ? 96  GLU D OE1 1 
ATOM 5320  O OE2 . GLU D 1 96  ? -0.852  10.916  28.806  1.00 82.85  ? 96  GLU D OE2 1 
ATOM 5321  N N   . LYS D 1 97  ? -1.021  8.062   32.930  1.00 54.40  ? 97  LYS D N   1 
ATOM 5322  C CA  . LYS D 1 97  ? -2.026  7.874   33.967  1.00 51.68  ? 97  LYS D CA  1 
ATOM 5323  C C   . LYS D 1 97  ? -2.925  6.711   33.581  1.00 48.08  ? 97  LYS D C   1 
ATOM 5324  O O   . LYS D 1 97  ? -3.101  6.443   32.402  1.00 48.47  ? 97  LYS D O   1 
ATOM 5325  C CB  . LYS D 1 97  ? -2.873  9.153   34.126  1.00 52.25  ? 97  LYS D CB  1 
ATOM 5326  C CG  . LYS D 1 97  ? -4.175  9.208   33.301  1.00 47.38  ? 97  LYS D CG  1 
ATOM 5327  C CD  . LYS D 1 97  ? -4.734  10.625  33.264  1.00 41.76  ? 97  LYS D CD  1 
ATOM 5328  C CE  . LYS D 1 97  ? -6.063  10.712  32.541  1.00 38.58  ? 97  LYS D CE  1 
ATOM 5329  N NZ  . LYS D 1 97  ? -7.159  10.184  33.392  1.00 38.45  ? 97  LYS D NZ  1 
ATOM 5330  N N   . ILE D 1 98  ? -3.499  6.034   34.571  1.00 44.79  ? 98  ILE D N   1 
ATOM 5331  C CA  . ILE D 1 98  ? -4.401  4.911   34.309  1.00 40.42  ? 98  ILE D CA  1 
ATOM 5332  C C   . ILE D 1 98  ? -5.803  5.244   34.774  1.00 38.87  ? 98  ILE D C   1 
ATOM 5333  O O   . ILE D 1 98  ? -6.030  5.532   35.950  1.00 38.78  ? 98  ILE D O   1 
ATOM 5334  C CB  . ILE D 1 98  ? -3.963  3.639   35.051  1.00 37.51  ? 98  ILE D CB  1 
ATOM 5335  C CG1 . ILE D 1 98  ? -2.484  3.363   34.768  1.00 36.52  ? 98  ILE D CG1 1 
ATOM 5336  C CG2 . ILE D 1 98  ? -4.838  2.476   34.624  1.00 30.67  ? 98  ILE D CG2 1 
ATOM 5337  C CD1 . ILE D 1 98  ? -1.856  2.340   35.698  1.00 37.94  ? 98  ILE D CD1 1 
ATOM 5338  N N   . SER D 1 99  ? -6.746  5.217   33.851  1.00 36.77  ? 99  SER D N   1 
ATOM 5339  C CA  . SER D 1 99  ? -8.119  5.491   34.216  1.00 40.26  ? 99  SER D CA  1 
ATOM 5340  C C   . SER D 1 99  ? -8.694  4.138   34.519  1.00 41.90  ? 99  SER D C   1 
ATOM 5341  O O   . SER D 1 99  ? -8.329  3.159   33.880  1.00 45.57  ? 99  SER D O   1 
ATOM 5342  C CB  . SER D 1 99  ? -8.881  6.089   33.052  1.00 39.11  ? 99  SER D CB  1 
ATOM 5343  O OG  . SER D 1 99  ? -8.022  6.901   32.286  1.00 48.91  ? 99  SER D OG  1 
ATOM 5344  N N   . ASN D 1 100 ? -9.593  4.073   35.487  1.00 41.64  ? 100 ASN D N   1 
ATOM 5345  C CA  . ASN D 1 100 ? -10.196 2.807   35.838  1.00 41.38  ? 100 ASN D CA  1 
ATOM 5346  C C   . ASN D 1 100 ? -11.656 2.990   36.099  1.00 39.97  ? 100 ASN D C   1 
ATOM 5347  O O   . ASN D 1 100 ? -12.104 4.070   36.479  1.00 42.07  ? 100 ASN D O   1 
ATOM 5348  C CB  . ASN D 1 100 ? -9.529  2.242   37.074  1.00 41.14  ? 100 ASN D CB  1 
ATOM 5349  C CG  . ASN D 1 100 ? -8.036  2.205   36.940  1.00 46.61  ? 100 ASN D CG  1 
ATOM 5350  O OD1 . ASN D 1 100 ? -7.513  1.711   35.946  1.00 49.92  ? 100 ASN D OD1 1 
ATOM 5351  N ND2 . ASN D 1 100 ? -7.333  2.729   37.937  1.00 53.49  ? 100 ASN D ND2 1 
ATOM 5352  N N   . GLU D 1 101 ? -12.406 1.929   35.879  1.00 39.50  ? 101 GLU D N   1 
ATOM 5353  C CA  . GLU D 1 101 ? -13.823 1.976   36.129  1.00 43.69  ? 101 GLU D CA  1 
ATOM 5354  C C   . GLU D 1 101 ? -14.269 0.629   36.666  1.00 44.15  ? 101 GLU D C   1 
ATOM 5355  O O   . GLU D 1 101 ? -13.971 -0.413  36.083  1.00 48.71  ? 101 GLU D O   1 
ATOM 5356  C CB  . GLU D 1 101 ? -14.598 2.295   34.864  1.00 45.21  ? 101 GLU D CB  1 
ATOM 5357  C CG  . GLU D 1 101 ? -16.070 2.372   35.159  1.00 57.21  ? 101 GLU D CG  1 
ATOM 5358  C CD  . GLU D 1 101 ? -16.900 2.630   33.930  1.00 62.43  ? 101 GLU D CD  1 
ATOM 5359  O OE1 . GLU D 1 101 ? -16.514 3.510   33.123  1.00 66.41  ? 101 GLU D OE1 1 
ATOM 5360  O OE2 . GLU D 1 101 ? -17.949 1.959   33.783  1.00 64.50  ? 101 GLU D OE2 1 
ATOM 5361  N N   . ILE D 1 102 ? -14.982 0.653   37.782  1.00 40.70  ? 102 ILE D N   1 
ATOM 5362  C CA  . ILE D 1 102 ? -15.460 -0.563  38.392  1.00 36.32  ? 102 ILE D CA  1 
ATOM 5363  C C   . ILE D 1 102 ? -16.958 -0.483  38.544  1.00 40.21  ? 102 ILE D C   1 
ATOM 5364  O O   . ILE D 1 102 ? -17.494 0.419   39.178  1.00 42.07  ? 102 ILE D O   1 
ATOM 5365  C CB  . ILE D 1 102 ? -14.825 -0.776  39.762  1.00 33.02  ? 102 ILE D CB  1 
ATOM 5366  C CG1 . ILE D 1 102 ? -13.305 -0.820  39.620  1.00 30.50  ? 102 ILE D CG1 1 
ATOM 5367  C CG2 . ILE D 1 102 ? -15.346 -2.061  40.373  1.00 33.43  ? 102 ILE D CG2 1 
ATOM 5368  C CD1 . ILE D 1 102 ? -12.565 -1.008  40.922  1.00 30.05  ? 102 ILE D CD1 1 
ATOM 5369  N N   . LYS D 1 103 ? -17.641 -1.437  37.943  1.00 45.29  ? 103 LYS D N   1 
ATOM 5370  C CA  . LYS D 1 103 ? -19.079 -1.466  38.017  1.00 50.11  ? 103 LYS D CA  1 
ATOM 5371  C C   . LYS D 1 103 ? -19.465 -2.797  38.668  1.00 52.47  ? 103 LYS D C   1 
ATOM 5372  O O   . LYS D 1 103 ? -18.857 -3.833  38.379  1.00 52.97  ? 103 LYS D O   1 
ATOM 5373  C CB  . LYS D 1 103 ? -19.635 -1.346  36.600  1.00 52.03  ? 103 LYS D CB  1 
ATOM 5374  C CG  . LYS D 1 103 ? -21.072 -0.903  36.529  1.00 60.54  ? 103 LYS D CG  1 
ATOM 5375  C CD  . LYS D 1 103 ? -22.024 -1.947  37.106  1.00 69.14  ? 103 LYS D CD  1 
ATOM 5376  C CE  . LYS D 1 103 ? -23.470 -1.447  37.072  1.00 74.64  ? 103 LYS D CE  1 
ATOM 5377  N NZ  . LYS D 1 103 ? -23.871 -0.954  35.704  1.00 80.25  ? 103 LYS D NZ  1 
ATOM 5378  N N   . ILE D 1 104 ? -20.453 -2.768  39.559  1.00 55.65  ? 104 ILE D N   1 
ATOM 5379  C CA  . ILE D 1 104 ? -20.901 -3.978  40.240  1.00 57.29  ? 104 ILE D CA  1 
ATOM 5380  C C   . ILE D 1 104 ? -22.376 -4.245  39.966  1.00 61.64  ? 104 ILE D C   1 
ATOM 5381  O O   . ILE D 1 104 ? -23.248 -3.425  40.282  1.00 60.72  ? 104 ILE D O   1 
ATOM 5382  C CB  . ILE D 1 104 ? -20.639 -3.886  41.757  1.00 54.62  ? 104 ILE D CB  1 
ATOM 5383  C CG1 . ILE D 1 104 ? -19.129 -3.839  42.002  1.00 53.70  ? 104 ILE D CG1 1 
ATOM 5384  C CG2 . ILE D 1 104 ? -21.233 -5.080  42.468  1.00 50.35  ? 104 ILE D CG2 1 
ATOM 5385  C CD1 . ILE D 1 104 ? -18.734 -3.728  43.450  1.00 57.86  ? 104 ILE D CD1 1 
ATOM 5386  N N   . VAL D 1 105 ? -22.625 -5.409  39.365  1.00 68.46  ? 105 VAL D N   1 
ATOM 5387  C CA  . VAL D 1 105 ? -23.965 -5.869  38.972  1.00 73.17  ? 105 VAL D CA  1 
ATOM 5388  C C   . VAL D 1 105 ? -24.484 -7.051  39.785  1.00 75.43  ? 105 VAL D C   1 
ATOM 5389  O O   . VAL D 1 105 ? -23.785 -8.056  39.970  1.00 74.41  ? 105 VAL D O   1 
ATOM 5390  C CB  . VAL D 1 105 ? -23.979 -6.298  37.499  1.00 73.94  ? 105 VAL D CB  1 
ATOM 5391  C CG1 . VAL D 1 105 ? -23.833 -5.079  36.595  1.00 72.12  ? 105 VAL D CG1 1 
ATOM 5392  C CG2 . VAL D 1 105 ? -22.842 -7.301  37.252  1.00 73.61  ? 105 VAL D CG2 1 
ATOM 5393  N N   . ALA D 1 106 ? -25.727 -6.933  40.237  1.00 78.97  ? 106 ALA D N   1 
ATOM 5394  C CA  . ALA D 1 106 ? -26.341 -7.978  41.044  1.00 85.17  ? 106 ALA D CA  1 
ATOM 5395  C C   . ALA D 1 106 ? -26.942 -9.097  40.195  1.00 88.52  ? 106 ALA D C   1 
ATOM 5396  O O   . ALA D 1 106 ? -27.924 -8.887  39.471  1.00 91.45  ? 106 ALA D O   1 
ATOM 5397  C CB  . ALA D 1 106 ? -27.417 -7.371  41.957  1.00 86.27  ? 106 ALA D CB  1 
ATOM 5398  N N   . THR D 1 107 ? -26.341 -10.283 40.285  1.00 89.56  ? 107 THR D N   1 
ATOM 5399  C CA  . THR D 1 107 ? -26.819 -11.453 39.557  1.00 89.15  ? 107 THR D CA  1 
ATOM 5400  C C   . THR D 1 107 ? -28.086 -11.980 40.243  1.00 91.27  ? 107 THR D C   1 
ATOM 5401  O O   . THR D 1 107 ? -28.249 -11.831 41.456  1.00 91.60  ? 107 THR D O   1 
ATOM 5402  C CB  . THR D 1 107 ? -25.741 -12.545 39.519  1.00 87.96  ? 107 THR D CB  1 
ATOM 5403  O OG1 . THR D 1 107 ? -25.133 -12.664 40.810  1.00 88.63  ? 107 THR D OG1 1 
ATOM 5404  C CG2 . THR D 1 107 ? -24.678 -12.193 38.508  1.00 84.71  ? 107 THR D CG2 1 
ATOM 5405  N N   . PRO D 1 108 ? -29.000 -12.598 39.472  1.00 91.79  ? 108 PRO D N   1 
ATOM 5406  C CA  . PRO D 1 108 ? -30.275 -13.158 39.947  1.00 90.30  ? 108 PRO D CA  1 
ATOM 5407  C C   . PRO D 1 108 ? -30.186 -14.089 41.156  1.00 88.22  ? 108 PRO D C   1 
ATOM 5408  O O   . PRO D 1 108 ? -31.111 -14.156 41.974  1.00 85.37  ? 108 PRO D O   1 
ATOM 5409  C CB  . PRO D 1 108 ? -30.814 -13.875 38.712  1.00 91.94  ? 108 PRO D CB  1 
ATOM 5410  C CG  . PRO D 1 108 ? -30.254 -13.068 37.585  1.00 91.37  ? 108 PRO D CG  1 
ATOM 5411  C CD  . PRO D 1 108 ? -28.828 -12.868 38.034  1.00 90.97  ? 108 PRO D CD  1 
ATOM 5412  N N   . ASP D 1 109 ? -29.075 -14.810 41.253  1.00 86.73  ? 109 ASP D N   1 
ATOM 5413  C CA  . ASP D 1 109 ? -28.848 -15.739 42.351  1.00 86.76  ? 109 ASP D CA  1 
ATOM 5414  C C   . ASP D 1 109 ? -28.492 -15.039 43.662  1.00 87.23  ? 109 ASP D C   1 
ATOM 5415  O O   . ASP D 1 109 ? -28.229 -15.703 44.664  1.00 87.43  ? 109 ASP D O   1 
ATOM 5416  C CB  . ASP D 1 109 ? -27.727 -16.704 41.979  1.00 86.22  ? 109 ASP D CB  1 
ATOM 5417  C CG  . ASP D 1 109 ? -26.517 -15.991 41.413  1.00 87.10  ? 109 ASP D CG  1 
ATOM 5418  O OD1 . ASP D 1 109 ? -26.650 -15.402 40.315  1.00 85.86  ? 109 ASP D OD1 1 
ATOM 5419  O OD2 . ASP D 1 109 ? -25.445 -16.016 42.066  1.00 87.33  ? 109 ASP D OD2 1 
ATOM 5420  N N   . GLY D 1 110 ? -28.480 -13.706 43.653  1.00 87.82  ? 110 GLY D N   1 
ATOM 5421  C CA  . GLY D 1 110 ? -28.143 -12.954 44.853  1.00 85.41  ? 110 GLY D CA  1 
ATOM 5422  C C   . GLY D 1 110 ? -26.712 -12.423 44.859  1.00 83.75  ? 110 GLY D C   1 
ATOM 5423  O O   . GLY D 1 110 ? -26.460 -11.324 45.360  1.00 87.74  ? 110 GLY D O   1 
ATOM 5424  N N   . GLY D 1 111 ? -25.778 -13.199 44.307  1.00 79.20  ? 111 GLY D N   1 
ATOM 5425  C CA  . GLY D 1 111 ? -24.380 -12.794 44.255  1.00 71.80  ? 111 GLY D CA  1 
ATOM 5426  C C   . GLY D 1 111 ? -24.129 -11.553 43.414  1.00 68.24  ? 111 GLY D C   1 
ATOM 5427  O O   . GLY D 1 111 ? -24.972 -10.653 43.346  1.00 68.57  ? 111 GLY D O   1 
ATOM 5428  N N   . SER D 1 112 ? -22.974 -11.491 42.759  1.00 64.64  ? 112 SER D N   1 
ATOM 5429  C CA  . SER D 1 112 ? -22.666 -10.320 41.952  1.00 63.19  ? 112 SER D CA  1 
ATOM 5430  C C   . SER D 1 112 ? -21.446 -10.475 41.052  1.00 64.19  ? 112 SER D C   1 
ATOM 5431  O O   . SER D 1 112 ? -20.690 -11.454 41.161  1.00 64.72  ? 112 SER D O   1 
ATOM 5432  C CB  . SER D 1 112 ? -22.473 -9.104  42.862  1.00 64.29  ? 112 SER D CB  1 
ATOM 5433  O OG  . SER D 1 112 ? -21.426 -9.315  43.800  1.00 62.37  ? 112 SER D OG  1 
ATOM 5434  N N   . ILE D 1 113 ? -21.269 -9.488  40.170  1.00 63.91  ? 113 ILE D N   1 
ATOM 5435  C CA  . ILE D 1 113 ? -20.156 -9.463  39.216  1.00 66.00  ? 113 ILE D CA  1 
ATOM 5436  C C   . ILE D 1 113 ? -19.474 -8.090  39.171  1.00 65.61  ? 113 ILE D C   1 
ATOM 5437  O O   . ILE D 1 113 ? -20.138 -7.049  39.198  1.00 67.83  ? 113 ILE D O   1 
ATOM 5438  C CB  . ILE D 1 113 ? -20.626 -9.768  37.781  1.00 68.43  ? 113 ILE D CB  1 
ATOM 5439  C CG1 . ILE D 1 113 ? -21.795 -10.753 37.804  1.00 72.96  ? 113 ILE D CG1 1 
ATOM 5440  C CG2 . ILE D 1 113 ? -19.470 -10.345 36.975  1.00 65.34  ? 113 ILE D CG2 1 
ATOM 5441  C CD1 . ILE D 1 113 ? -22.536 -10.838 36.488  1.00 77.79  ? 113 ILE D CD1 1 
ATOM 5442  N N   . LEU D 1 114 ? -18.147 -8.102  39.073  1.00 61.51  ? 114 LEU D N   1 
ATOM 5443  C CA  . LEU D 1 114 ? -17.365 -6.878  39.026  1.00 56.10  ? 114 LEU D CA  1 
ATOM 5444  C C   . LEU D 1 114 ? -16.658 -6.674  37.713  1.00 55.12  ? 114 LEU D C   1 
ATOM 5445  O O   . LEU D 1 114 ? -15.619 -7.283  37.487  1.00 56.65  ? 114 LEU D O   1 
ATOM 5446  C CB  . LEU D 1 114 ? -16.279 -6.879  40.092  1.00 49.51  ? 114 LEU D CB  1 
ATOM 5447  C CG  . LEU D 1 114 ? -16.661 -6.950  41.552  1.00 47.45  ? 114 LEU D CG  1 
ATOM 5448  C CD1 . LEU D 1 114 ? -17.092 -8.363  41.901  1.00 48.66  ? 114 LEU D CD1 1 
ATOM 5449  C CD2 . LEU D 1 114 ? -15.449 -6.537  42.367  1.00 45.16  ? 114 LEU D CD2 1 
ATOM 5450  N N   . LYS D 1 115 ? -17.186 -5.806  36.861  1.00 53.88  ? 115 LYS D N   1 
ATOM 5451  C CA  . LYS D 1 115 ? -16.526 -5.521  35.593  1.00 52.86  ? 115 LYS D CA  1 
ATOM 5452  C C   . LYS D 1 115 ? -15.412 -4.494  35.903  1.00 49.53  ? 115 LYS D C   1 
ATOM 5453  O O   . LYS D 1 115 ? -15.544 -3.717  36.838  1.00 49.20  ? 115 LYS D O   1 
ATOM 5454  C CB  . LYS D 1 115 ? -17.560 -4.983  34.618  1.00 55.93  ? 115 LYS D CB  1 
ATOM 5455  C CG  . LYS D 1 115 ? -18.815 -5.840  34.589  1.00 59.91  ? 115 LYS D CG  1 
ATOM 5456  C CD  . LYS D 1 115 ? -19.781 -5.373  33.514  1.00 69.10  ? 115 LYS D CD  1 
ATOM 5457  C CE  . LYS D 1 115 ? -21.049 -6.229  33.477  1.00 73.99  ? 115 LYS D CE  1 
ATOM 5458  N NZ  . LYS D 1 115 ? -22.078 -5.706  32.506  1.00 77.04  ? 115 LYS D NZ  1 
ATOM 5459  N N   . ILE D 1 116 ? -14.325 -4.476  35.131  1.00 45.51  ? 116 ILE D N   1 
ATOM 5460  C CA  . ILE D 1 116 ? -13.206 -3.572  35.430  1.00 43.18  ? 116 ILE D CA  1 
ATOM 5461  C C   . ILE D 1 116 ? -12.326 -3.081  34.258  1.00 46.69  ? 116 ILE D C   1 
ATOM 5462  O O   . ILE D 1 116 ? -11.471 -3.834  33.774  1.00 51.88  ? 116 ILE D O   1 
ATOM 5463  C CB  . ILE D 1 116 ? -12.256 -4.257  36.446  1.00 41.98  ? 116 ILE D CB  1 
ATOM 5464  C CG1 . ILE D 1 116 ? -12.939 -4.387  37.801  1.00 41.84  ? 116 ILE D CG1 1 
ATOM 5465  C CG2 . ILE D 1 116 ? -10.956 -3.479  36.578  1.00 40.13  ? 116 ILE D CG2 1 
ATOM 5466  C CD1 . ILE D 1 116 ? -12.099 -5.145  38.813  1.00 42.21  ? 116 ILE D CD1 1 
ATOM 5467  N N   . SER D 1 117 ? -12.483 -1.821  33.841  1.00 43.99  ? 117 SER D N   1 
ATOM 5468  C CA  . SER D 1 117 ? -11.677 -1.277  32.736  1.00 44.52  ? 117 SER D CA  1 
ATOM 5469  C C   . SER D 1 117 ? -10.298 -0.844  33.201  1.00 43.09  ? 117 SER D C   1 
ATOM 5470  O O   . SER D 1 117 ? -10.028 -0.811  34.395  1.00 40.45  ? 117 SER D O   1 
ATOM 5471  C CB  . SER D 1 117 ? -12.373 -0.083  32.102  1.00 44.05  ? 117 SER D CB  1 
ATOM 5472  O OG  . SER D 1 117 ? -13.696 -0.432  31.752  1.00 55.85  ? 117 SER D OG  1 
ATOM 5473  N N   . ASN D 1 118 ? -9.433  -0.495  32.259  1.00 41.70  ? 118 ASN D N   1 
ATOM 5474  C CA  . ASN D 1 118 ? -8.085  -0.086  32.619  1.00 49.10  ? 118 ASN D CA  1 
ATOM 5475  C C   . ASN D 1 118 ? -7.340  0.659   31.509  1.00 52.93  ? 118 ASN D C   1 
ATOM 5476  O O   . ASN D 1 118 ? -6.242  0.248   31.114  1.00 55.46  ? 118 ASN D O   1 
ATOM 5477  C CB  . ASN D 1 118 ? -7.259  -1.311  33.013  1.00 54.42  ? 118 ASN D CB  1 
ATOM 5478  C CG  . ASN D 1 118 ? -7.531  -1.773  34.424  1.00 60.57  ? 118 ASN D CG  1 
ATOM 5479  O OD1 . ASN D 1 118 ? -7.081  -1.152  35.389  1.00 62.26  ? 118 ASN D OD1 1 
ATOM 5480  N ND2 . ASN D 1 118 ? -8.279  -2.871  34.557  1.00 66.39  ? 118 ASN D ND2 1 
ATOM 5481  N N   . LYS D 1 119 ? -7.911  1.751   31.012  1.00 48.80  ? 119 LYS D N   1 
ATOM 5482  C CA  . LYS D 1 119 ? -7.248  2.487   29.949  1.00 47.16  ? 119 LYS D CA  1 
ATOM 5483  C C   . LYS D 1 119 ? -5.895  2.986   30.436  1.00 45.76  ? 119 LYS D C   1 
ATOM 5484  O O   . LYS D 1 119 ? -5.819  3.792   31.353  1.00 47.03  ? 119 LYS D O   1 
ATOM 5485  C CB  . LYS D 1 119 ? -8.121  3.652   29.480  1.00 46.18  ? 119 LYS D CB  1 
ATOM 5486  C CG  . LYS D 1 119 ? -9.542  3.253   29.077  1.00 51.07  ? 119 LYS D CG  1 
ATOM 5487  C CD  . LYS D 1 119 ? -10.345 2.706   30.280  1.00 60.21  ? 119 LYS D CD  1 
ATOM 5488  C CE  . LYS D 1 119 ? -10.442 3.739   31.437  1.00 63.34  ? 119 LYS D CE  1 
ATOM 5489  N NZ  . LYS D 1 119 ? -11.145 3.289   32.686  1.00 59.43  ? 119 LYS D NZ  1 
ATOM 5490  N N   . TYR D 1 120 ? -4.825  2.461   29.853  1.00 45.48  ? 120 TYR D N   1 
ATOM 5491  C CA  . TYR D 1 120 ? -3.488  2.895   30.222  1.00 45.87  ? 120 TYR D CA  1 
ATOM 5492  C C   . TYR D 1 120 ? -3.042  3.965   29.235  1.00 49.46  ? 120 TYR D C   1 
ATOM 5493  O O   . TYR D 1 120 ? -2.665  3.659   28.103  1.00 53.17  ? 120 TYR D O   1 
ATOM 5494  C CB  . TYR D 1 120 ? -2.477  1.751   30.161  1.00 40.97  ? 120 TYR D CB  1 
ATOM 5495  C CG  . TYR D 1 120 ? -2.555  0.721   31.263  1.00 40.17  ? 120 TYR D CG  1 
ATOM 5496  C CD1 . TYR D 1 120 ? -3.706  -0.049  31.444  1.00 40.23  ? 120 TYR D CD1 1 
ATOM 5497  C CD2 . TYR D 1 120 ? -1.444  0.463   32.087  1.00 39.71  ? 120 TYR D CD2 1 
ATOM 5498  C CE1 . TYR D 1 120 ? -3.762  -1.068  32.419  1.00 42.69  ? 120 TYR D CE1 1 
ATOM 5499  C CE2 . TYR D 1 120 ? -1.476  -0.554  33.068  1.00 41.80  ? 120 TYR D CE2 1 
ATOM 5500  C CZ  . TYR D 1 120 ? -2.644  -1.318  33.225  1.00 45.79  ? 120 TYR D CZ  1 
ATOM 5501  O OH  . TYR D 1 120 ? -2.708  -2.330  34.169  1.00 46.90  ? 120 TYR D OH  1 
ATOM 5502  N N   . HIS D 1 121 ? -3.101  5.223   29.651  1.00 53.12  ? 121 HIS D N   1 
ATOM 5503  C CA  . HIS D 1 121 ? -2.657  6.322   28.805  1.00 53.17  ? 121 HIS D CA  1 
ATOM 5504  C C   . HIS D 1 121 ? -1.128  6.253   28.775  1.00 57.12  ? 121 HIS D C   1 
ATOM 5505  O O   . HIS D 1 121 ? -0.448  6.534   29.761  1.00 55.90  ? 121 HIS D O   1 
ATOM 5506  C CB  . HIS D 1 121 ? -3.163  7.651   29.374  1.00 47.06  ? 121 HIS D CB  1 
ATOM 5507  C CG  . HIS D 1 121 ? -4.657  7.757   29.379  1.00 44.08  ? 121 HIS D CG  1 
ATOM 5508  N ND1 . HIS D 1 121 ? -5.461  6.868   30.062  1.00 42.99  ? 121 HIS D ND1 1 
ATOM 5509  C CD2 . HIS D 1 121 ? -5.497  8.604   28.735  1.00 41.32  ? 121 HIS D CD2 1 
ATOM 5510  C CE1 . HIS D 1 121 ? -6.731  7.160   29.834  1.00 42.44  ? 121 HIS D CE1 1 
ATOM 5511  N NE2 . HIS D 1 121 ? -6.781  8.209   29.032  1.00 41.13  ? 121 HIS D NE2 1 
ATOM 5512  N N   . THR D 1 122 ? -0.600  5.826   27.636  1.00 61.80  ? 122 THR D N   1 
ATOM 5513  C CA  . THR D 1 122 ? 0.833   5.687   27.466  1.00 64.43  ? 122 THR D CA  1 
ATOM 5514  C C   . THR D 1 122 ? 1.409   6.865   26.716  1.00 71.09  ? 122 THR D C   1 
ATOM 5515  O O   . THR D 1 122 ? 0.689   7.598   26.022  1.00 71.97  ? 122 THR D O   1 
ATOM 5516  C CB  . THR D 1 122 ? 1.168   4.415   26.699  1.00 62.34  ? 122 THR D CB  1 
ATOM 5517  O OG1 . THR D 1 122 ? 0.415   4.380   25.477  1.00 58.31  ? 122 THR D OG1 1 
ATOM 5518  C CG2 . THR D 1 122 ? 0.826   3.201   27.538  1.00 61.15  ? 122 THR D CG2 1 
ATOM 5519  N N   . LYS D 1 123 ? 2.718   7.039   26.866  1.00 77.18  ? 123 LYS D N   1 
ATOM 5520  C CA  . LYS D 1 123 ? 3.417   8.129   26.211  1.00 84.03  ? 123 LYS D CA  1 
ATOM 5521  C C   . LYS D 1 123 ? 3.536   7.872   24.713  1.00 88.92  ? 123 LYS D C   1 
ATOM 5522  O O   . LYS D 1 123 ? 4.246   6.952   24.277  1.00 87.64  ? 123 LYS D O   1 
ATOM 5523  C CB  . LYS D 1 123 ? 4.804   8.318   26.830  1.00 84.46  ? 123 LYS D CB  1 
ATOM 5524  C CG  . LYS D 1 123 ? 4.991   9.633   27.607  1.00 87.93  ? 123 LYS D CG  1 
ATOM 5525  C CD  . LYS D 1 123 ? 5.095   10.878  26.696  1.00 88.83  ? 123 LYS D CD  1 
ATOM 5526  C CE  . LYS D 1 123 ? 3.736   11.363  26.173  1.00 90.16  ? 123 LYS D CE  1 
ATOM 5527  N NZ  . LYS D 1 123 ? 3.848   12.569  25.296  1.00 89.92  ? 123 LYS D NZ  1 
ATOM 5528  N N   . GLY D 1 124 ? 2.825   8.695   23.939  1.00 92.87  ? 124 GLY D N   1 
ATOM 5529  C CA  . GLY D 1 124 ? 2.841   8.574   22.494  1.00 95.87  ? 124 GLY D CA  1 
ATOM 5530  C C   . GLY D 1 124 ? 2.305   7.227   22.079  1.00 97.93  ? 124 GLY D C   1 
ATOM 5531  O O   . GLY D 1 124 ? 1.140   7.112   21.690  1.00 98.75  ? 124 GLY D O   1 
ATOM 5532  N N   . ASP D 1 125 ? 3.154   6.205   22.163  1.00 99.25  ? 125 ASP D N   1 
ATOM 5533  C CA  . ASP D 1 125 ? 2.729   4.869   21.800  1.00 103.13 ? 125 ASP D CA  1 
ATOM 5534  C C   . ASP D 1 125 ? 3.593   3.726   22.313  1.00 103.96 ? 125 ASP D C   1 
ATOM 5535  O O   . ASP D 1 125 ? 3.590   2.652   21.716  1.00 106.12 ? 125 ASP D O   1 
ATOM 5536  C CB  . ASP D 1 125 ? 2.590   4.757   20.281  1.00 106.07 ? 125 ASP D CB  1 
ATOM 5537  C CG  . ASP D 1 125 ? 1.254   4.166   19.867  1.00 108.98 ? 125 ASP D CG  1 
ATOM 5538  O OD1 . ASP D 1 125 ? 0.212   4.820   20.098  1.00 110.31 ? 125 ASP D OD1 1 
ATOM 5539  O OD2 . ASP D 1 125 ? 1.248   3.043   19.319  1.00 111.45 ? 125 ASP D OD2 1 
ATOM 5540  N N   . HIS D 1 126 ? 4.338   3.933   23.397  1.00 103.60 ? 126 HIS D N   1 
ATOM 5541  C CA  . HIS D 1 126 ? 5.131   2.828   23.927  1.00 103.56 ? 126 HIS D CA  1 
ATOM 5542  C C   . HIS D 1 126 ? 4.074   1.796   24.360  1.00 101.04 ? 126 HIS D C   1 
ATOM 5543  O O   . HIS D 1 126 ? 2.886   2.125   24.441  1.00 98.58  ? 126 HIS D O   1 
ATOM 5544  C CB  . HIS D 1 126 ? 5.991   3.280   25.117  1.00 107.46 ? 126 HIS D CB  1 
ATOM 5545  C CG  . HIS D 1 126 ? 7.076   2.308   25.488  1.00 112.78 ? 126 HIS D CG  1 
ATOM 5546  N ND1 . HIS D 1 126 ? 6.816   1.007   25.871  1.00 114.96 ? 126 HIS D ND1 1 
ATOM 5547  C CD2 . HIS D 1 126 ? 8.424   2.448   25.532  1.00 114.34 ? 126 HIS D CD2 1 
ATOM 5548  C CE1 . HIS D 1 126 ? 7.956   0.389   26.134  1.00 114.76 ? 126 HIS D CE1 1 
ATOM 5549  N NE2 . HIS D 1 126 ? 8.944   1.240   25.936  1.00 116.48 ? 126 HIS D NE2 1 
ATOM 5550  N N   . GLU D 1 127 ? 4.485   0.558   24.623  1.00 100.43 ? 127 GLU D N   1 
ATOM 5551  C CA  . GLU D 1 127 ? 3.532   -0.493  25.002  1.00 98.65  ? 127 GLU D CA  1 
ATOM 5552  C C   . GLU D 1 127 ? 3.325   -0.765  26.492  1.00 95.42  ? 127 GLU D C   1 
ATOM 5553  O O   . GLU D 1 127 ? 4.144   -0.399  27.341  1.00 93.03  ? 127 GLU D O   1 
ATOM 5554  C CB  . GLU D 1 127 ? 3.897   -1.826  24.318  1.00 101.39 ? 127 GLU D CB  1 
ATOM 5555  C CG  . GLU D 1 127 ? 3.390   -2.008  22.880  1.00 101.88 ? 127 GLU D CG  1 
ATOM 5556  C CD  . GLU D 1 127 ? 1.885   -2.289  22.779  1.00 103.44 ? 127 GLU D CD  1 
ATOM 5557  O OE1 . GLU D 1 127 ? 1.419   -2.635  21.669  1.00 103.13 ? 127 GLU D OE1 1 
ATOM 5558  O OE2 . GLU D 1 127 ? 1.167   -2.160  23.796  1.00 103.60 ? 127 GLU D OE2 1 
ATOM 5559  N N   . VAL D 1 128 ? 2.209   -1.438  26.770  1.00 92.36  ? 128 VAL D N   1 
ATOM 5560  C CA  . VAL D 1 128 ? 1.798   -1.837  28.109  1.00 87.88  ? 128 VAL D CA  1 
ATOM 5561  C C   . VAL D 1 128 ? 2.488   -3.142  28.476  1.00 88.70  ? 128 VAL D C   1 
ATOM 5562  O O   . VAL D 1 128 ? 2.026   -4.222  28.090  1.00 90.31  ? 128 VAL D O   1 
ATOM 5563  C CB  . VAL D 1 128 ? 0.288   -2.107  28.160  1.00 85.52  ? 128 VAL D CB  1 
ATOM 5564  C CG1 . VAL D 1 128 ? -0.111  -2.472  29.564  1.00 84.77  ? 128 VAL D CG1 1 
ATOM 5565  C CG2 . VAL D 1 128 ? -0.475  -0.908  27.665  1.00 83.57  ? 128 VAL D CG2 1 
ATOM 5566  N N   . LYS D 1 129 ? 3.587   -3.058  29.211  1.00 87.74  ? 129 LYS D N   1 
ATOM 5567  C CA  . LYS D 1 129 ? 4.295   -4.268  29.600  1.00 89.71  ? 129 LYS D CA  1 
ATOM 5568  C C   . LYS D 1 129 ? 3.335   -5.234  30.287  1.00 90.53  ? 129 LYS D C   1 
ATOM 5569  O O   . LYS D 1 129 ? 2.836   -4.944  31.371  1.00 92.80  ? 129 LYS D O   1 
ATOM 5570  C CB  . LYS D 1 129 ? 5.464   -3.918  30.524  1.00 88.73  ? 129 LYS D CB  1 
ATOM 5571  C CG  . LYS D 1 129 ? 6.839   -3.999  29.854  1.00 90.17  ? 129 LYS D CG  1 
ATOM 5572  C CD  . LYS D 1 129 ? 6.939   -3.192  28.548  1.00 89.55  ? 129 LYS D CD  1 
ATOM 5573  C CE  . LYS D 1 129 ? 6.449   -3.977  27.323  1.00 86.03  ? 129 LYS D CE  1 
ATOM 5574  N NZ  . LYS D 1 129 ? 6.628   -3.221  26.049  1.00 83.42  ? 129 LYS D NZ  1 
ATOM 5575  N N   . ALA D 1 130 ? 3.065   -6.370  29.642  1.00 91.84  ? 130 ALA D N   1 
ATOM 5576  C CA  . ALA D 1 130 ? 2.159   -7.386  30.179  1.00 92.28  ? 130 ALA D CA  1 
ATOM 5577  C C   . ALA D 1 130 ? 2.387   -7.568  31.671  1.00 93.57  ? 130 ALA D C   1 
ATOM 5578  O O   . ALA D 1 130 ? 1.556   -8.138  32.380  1.00 91.72  ? 130 ALA D O   1 
ATOM 5579  C CB  . ALA D 1 130 ? 2.370   -8.690  29.464  1.00 93.10  ? 130 ALA D CB  1 
ATOM 5580  N N   . GLU D 1 131 ? 3.536   -7.081  32.125  1.00 95.31  ? 131 GLU D N   1 
ATOM 5581  C CA  . GLU D 1 131 ? 3.912   -7.119  33.527  1.00 97.65  ? 131 GLU D CA  1 
ATOM 5582  C C   . GLU D 1 131 ? 2.782   -6.536  34.346  1.00 95.82  ? 131 GLU D C   1 
ATOM 5583  O O   . GLU D 1 131 ? 2.177   -7.207  35.178  1.00 96.44  ? 131 GLU D O   1 
ATOM 5584  C CB  . GLU D 1 131 ? 5.154   -6.262  33.756  1.00 100.71 ? 131 GLU D CB  1 
ATOM 5585  C CG  . GLU D 1 131 ? 6.205   -6.972  34.535  1.00 106.84 ? 131 GLU D CG  1 
ATOM 5586  C CD  . GLU D 1 131 ? 6.534   -8.304  33.899  1.00 111.87 ? 131 GLU D CD  1 
ATOM 5587  O OE1 . GLU D 1 131 ? 5.656   -9.198  33.890  1.00 112.86 ? 131 GLU D OE1 1 
ATOM 5588  O OE2 . GLU D 1 131 ? 7.666   -8.450  33.395  1.00 116.05 ? 131 GLU D OE2 1 
ATOM 5589  N N   . GLN D 1 132 ? 2.517   -5.264  34.090  1.00 92.43  ? 132 GLN D N   1 
ATOM 5590  C CA  . GLN D 1 132 ? 1.477   -4.539  34.778  1.00 87.50  ? 132 GLN D CA  1 
ATOM 5591  C C   . GLN D 1 132 ? 0.120   -5.183  34.654  1.00 82.47  ? 132 GLN D C   1 
ATOM 5592  O O   . GLN D 1 132 ? -0.478  -5.550  35.658  1.00 81.72  ? 132 GLN D O   1 
ATOM 5593  C CB  . GLN D 1 132 ? 1.417   -3.103  34.264  1.00 91.34  ? 132 GLN D CB  1 
ATOM 5594  C CG  . GLN D 1 132 ? 2.505   -2.250  34.848  1.00 98.53  ? 132 GLN D CG  1 
ATOM 5595  C CD  . GLN D 1 132 ? 2.365   -2.144  36.353  1.00 105.39 ? 132 GLN D CD  1 
ATOM 5596  O OE1 . GLN D 1 132 ? 3.359   -2.020  37.078  1.00 109.55 ? 132 GLN D OE1 1 
ATOM 5597  N NE2 . GLN D 1 132 ? 1.121   -2.182  36.835  1.00 106.20 ? 132 GLN D NE2 1 
ATOM 5598  N N   . VAL D 1 133 ? -0.367  -5.337  33.431  1.00 77.64  ? 133 VAL D N   1 
ATOM 5599  C CA  . VAL D 1 133 ? -1.688  -5.916  33.242  1.00 75.72  ? 133 VAL D CA  1 
ATOM 5600  C C   . VAL D 1 133 ? -1.855  -7.154  34.108  1.00 73.55  ? 133 VAL D C   1 
ATOM 5601  O O   . VAL D 1 133 ? -2.978  -7.522  34.474  1.00 71.87  ? 133 VAL D O   1 
ATOM 5602  C CB  . VAL D 1 133 ? -1.933  -6.294  31.783  1.00 75.65  ? 133 VAL D CB  1 
ATOM 5603  C CG1 . VAL D 1 133 ? -3.438  -6.375  31.519  1.00 71.27  ? 133 VAL D CG1 1 
ATOM 5604  C CG2 . VAL D 1 133 ? -1.265  -5.285  30.873  1.00 75.42  ? 133 VAL D CG2 1 
ATOM 5605  N N   . LYS D 1 134 ? -0.723  -7.774  34.435  1.00 71.62  ? 134 LYS D N   1 
ATOM 5606  C CA  . LYS D 1 134 ? -0.679  -8.975  35.269  1.00 72.13  ? 134 LYS D CA  1 
ATOM 5607  C C   . LYS D 1 134 ? -0.938  -8.638  36.740  1.00 69.67  ? 134 LYS D C   1 
ATOM 5608  O O   . LYS D 1 134 ? -1.891  -9.134  37.341  1.00 68.40  ? 134 LYS D O   1 
ATOM 5609  C CB  . LYS D 1 134 ? 0.690   -9.653  35.127  1.00 74.19  ? 134 LYS D CB  1 
ATOM 5610  C CG  . LYS D 1 134 ? 0.807   -11.034 35.778  1.00 76.69  ? 134 LYS D CG  1 
ATOM 5611  C CD  . LYS D 1 134 ? 2.186   -11.639 35.508  1.00 79.14  ? 134 LYS D CD  1 
ATOM 5612  C CE  . LYS D 1 134 ? 2.241   -13.137 35.811  1.00 78.39  ? 134 LYS D CE  1 
ATOM 5613  N NZ  . LYS D 1 134 ? 2.066   -13.460 37.253  1.00 75.44  ? 134 LYS D NZ  1 
ATOM 5614  N N   . ALA D 1 135 ? -0.081  -7.795  37.310  1.00 66.84  ? 135 ALA D N   1 
ATOM 5615  C CA  . ALA D 1 135 ? -0.205  -7.381  38.703  1.00 63.81  ? 135 ALA D CA  1 
ATOM 5616  C C   . ALA D 1 135 ? -1.570  -6.756  38.993  1.00 63.72  ? 135 ALA D C   1 
ATOM 5617  O O   . ALA D 1 135 ? -2.260  -7.156  39.925  1.00 62.37  ? 135 ALA D O   1 
ATOM 5618  C CB  . ALA D 1 135 ? 0.897   -6.397  39.043  1.00 63.47  ? 135 ALA D CB  1 
ATOM 5619  N N   . SER D 1 136 ? -1.951  -5.773  38.188  1.00 65.03  ? 136 SER D N   1 
ATOM 5620  C CA  . SER D 1 136 ? -3.231  -5.089  38.349  1.00 68.02  ? 136 SER D CA  1 
ATOM 5621  C C   . SER D 1 136 ? -4.373  -6.072  38.547  1.00 69.36  ? 136 SER D C   1 
ATOM 5622  O O   . SER D 1 136 ? -5.338  -5.779  39.252  1.00 72.29  ? 136 SER D O   1 
ATOM 5623  C CB  . SER D 1 136 ? -3.532  -4.223  37.120  1.00 69.32  ? 136 SER D CB  1 
ATOM 5624  O OG  . SER D 1 136 ? -2.508  -3.269  36.900  1.00 72.58  ? 136 SER D OG  1 
ATOM 5625  N N   . LYS D 1 137 ? -4.257  -7.233  37.911  1.00 69.97  ? 137 LYS D N   1 
ATOM 5626  C CA  . LYS D 1 137 ? -5.272  -8.276  37.992  1.00 70.80  ? 137 LYS D CA  1 
ATOM 5627  C C   . LYS D 1 137 ? -5.236  -9.037  39.313  1.00 68.91  ? 137 LYS D C   1 
ATOM 5628  O O   . LYS D 1 137 ? -6.280  -9.359  39.881  1.00 65.64  ? 137 LYS D O   1 
ATOM 5629  C CB  . LYS D 1 137 ? -5.087  -9.253  36.830  1.00 76.61  ? 137 LYS D CB  1 
ATOM 5630  C CG  . LYS D 1 137 ? -6.050  -9.039  35.661  1.00 86.71  ? 137 LYS D CG  1 
ATOM 5631  C CD  . LYS D 1 137 ? -7.376  -9.778  35.881  1.00 92.88  ? 137 LYS D CD  1 
ATOM 5632  C CE  . LYS D 1 137 ? -7.170  -11.300 35.933  1.00 93.88  ? 137 LYS D CE  1 
ATOM 5633  N NZ  . LYS D 1 137 ? -8.435  -12.057 36.179  1.00 95.74  ? 137 LYS D NZ  1 
ATOM 5634  N N   . GLU D 1 138 ? -4.026  -9.320  39.786  1.00 69.33  ? 138 GLU D N   1 
ATOM 5635  C CA  . GLU D 1 138 ? -3.805  -10.047 41.035  1.00 69.64  ? 138 GLU D CA  1 
ATOM 5636  C C   . GLU D 1 138 ? -4.010  -9.120  42.225  1.00 68.21  ? 138 GLU D C   1 
ATOM 5637  O O   . GLU D 1 138 ? -4.623  -9.497  43.227  1.00 66.24  ? 138 GLU D O   1 
ATOM 5638  C CB  . GLU D 1 138 ? -2.386  -10.622 41.048  1.00 76.05  ? 138 GLU D CB  1 
ATOM 5639  C CG  . GLU D 1 138 ? -2.137  -11.635 39.920  1.00 86.61  ? 138 GLU D CG  1 
ATOM 5640  C CD  . GLU D 1 138 ? -0.669  -12.037 39.756  1.00 93.20  ? 138 GLU D CD  1 
ATOM 5641  O OE1 . GLU D 1 138 ? -0.379  -12.892 38.884  1.00 96.19  ? 138 GLU D OE1 1 
ATOM 5642  O OE2 . GLU D 1 138 ? 0.192   -11.500 40.491  1.00 97.37  ? 138 GLU D OE2 1 
ATOM 5643  N N   . MET D 1 139 ? -3.477  -7.907  42.105  1.00 67.55  ? 139 MET D N   1 
ATOM 5644  C CA  . MET D 1 139 ? -3.617  -6.890  43.137  1.00 62.58  ? 139 MET D CA  1 
ATOM 5645  C C   . MET D 1 139 ? -5.106  -6.837  43.456  1.00 58.20  ? 139 MET D C   1 
ATOM 5646  O O   . MET D 1 139 ? -5.540  -7.265  44.518  1.00 57.57  ? 139 MET D O   1 
ATOM 5647  C CB  . MET D 1 139 ? -3.129  -5.541  42.591  1.00 68.43  ? 139 MET D CB  1 
ATOM 5648  C CG  . MET D 1 139 ? -3.195  -4.352  43.555  1.00 73.02  ? 139 MET D CG  1 
ATOM 5649  S SD  . MET D 1 139 ? -2.270  -4.588  45.088  1.00 86.92  ? 139 MET D SD  1 
ATOM 5650  C CE  . MET D 1 139 ? -0.557  -4.152  44.624  1.00 82.62  ? 139 MET D CE  1 
ATOM 5651  N N   . GLY D 1 140 ? -5.891  -6.340  42.510  1.00 55.03  ? 140 GLY D N   1 
ATOM 5652  C CA  . GLY D 1 140 ? -7.323  -6.252  42.718  1.00 49.79  ? 140 GLY D CA  1 
ATOM 5653  C C   . GLY D 1 140 ? -7.979  -7.596  42.983  1.00 45.14  ? 140 GLY D C   1 
ATOM 5654  O O   . GLY D 1 140 ? -9.080  -7.667  43.523  1.00 38.90  ? 140 GLY D O   1 
ATOM 5655  N N   . GLU D 1 141 ? -7.306  -8.669  42.604  1.00 47.05  ? 141 GLU D N   1 
ATOM 5656  C CA  . GLU D 1 141 ? -7.863  -9.997  42.809  1.00 52.22  ? 141 GLU D CA  1 
ATOM 5657  C C   . GLU D 1 141 ? -7.915  -10.338 44.293  1.00 49.35  ? 141 GLU D C   1 
ATOM 5658  O O   . GLU D 1 141 ? -8.986  -10.544 44.871  1.00 44.56  ? 141 GLU D O   1 
ATOM 5659  C CB  . GLU D 1 141 ? -7.015  -11.049 42.080  1.00 64.46  ? 141 GLU D CB  1 
ATOM 5660  C CG  . GLU D 1 141 ? -7.685  -12.425 41.979  1.00 75.09  ? 141 GLU D CG  1 
ATOM 5661  C CD  . GLU D 1 141 ? -8.940  -12.403 41.096  1.00 81.23  ? 141 GLU D CD  1 
ATOM 5662  O OE1 . GLU D 1 141 ? -8.797  -12.267 39.852  1.00 80.35  ? 141 GLU D OE1 1 
ATOM 5663  O OE2 . GLU D 1 141 ? -10.066 -12.514 41.647  1.00 81.48  ? 141 GLU D OE2 1 
ATOM 5664  N N   . THR D 1 142 ? -6.738  -10.401 44.900  1.00 49.31  ? 142 THR D N   1 
ATOM 5665  C CA  . THR D 1 142 ? -6.633  -10.725 46.307  1.00 49.95  ? 142 THR D CA  1 
ATOM 5666  C C   . THR D 1 142 ? -7.587  -9.844  47.111  1.00 49.83  ? 142 THR D C   1 
ATOM 5667  O O   . THR D 1 142 ? -8.376  -10.349 47.910  1.00 50.54  ? 142 THR D O   1 
ATOM 5668  C CB  . THR D 1 142 ? -5.199  -10.508 46.809  1.00 50.66  ? 142 THR D CB  1 
ATOM 5669  O OG1 . THR D 1 142 ? -5.036  -9.143  47.195  1.00 54.26  ? 142 THR D OG1 1 
ATOM 5670  C CG2 . THR D 1 142 ? -4.192  -10.830 45.708  1.00 47.16  ? 142 THR D CG2 1 
ATOM 5671  N N   . LEU D 1 143 ? -7.525  -8.533  46.871  1.00 49.03  ? 143 LEU D N   1 
ATOM 5672  C CA  . LEU D 1 143 ? -8.366  -7.565  47.575  1.00 45.87  ? 143 LEU D CA  1 
ATOM 5673  C C   . LEU D 1 143 ? -9.823  -7.952  47.562  1.00 47.05  ? 143 LEU D C   1 
ATOM 5674  O O   . LEU D 1 143 ? -10.435 -8.048  48.617  1.00 47.72  ? 143 LEU D O   1 
ATOM 5675  C CB  . LEU D 1 143 ? -8.222  -6.156  46.988  1.00 42.86  ? 143 LEU D CB  1 
ATOM 5676  C CG  . LEU D 1 143 ? -6.846  -5.469  46.966  1.00 41.74  ? 143 LEU D CG  1 
ATOM 5677  C CD1 . LEU D 1 143 ? -7.046  -3.998  46.651  1.00 44.24  ? 143 LEU D CD1 1 
ATOM 5678  C CD2 . LEU D 1 143 ? -6.132  -5.604  48.295  1.00 42.08  ? 143 LEU D CD2 1 
ATOM 5679  N N   . LEU D 1 144 ? -10.399 -8.167  46.384  1.00 48.32  ? 144 LEU D N   1 
ATOM 5680  C CA  . LEU D 1 144 ? -11.797 -8.558  46.358  1.00 48.94  ? 144 LEU D CA  1 
ATOM 5681  C C   . LEU D 1 144 ? -11.959 -9.788  47.231  1.00 49.54  ? 144 LEU D C   1 
ATOM 5682  O O   . LEU D 1 144 ? -12.950 -9.931  47.945  1.00 49.82  ? 144 LEU D O   1 
ATOM 5683  C CB  . LEU D 1 144 ? -12.275 -8.887  44.947  1.00 48.63  ? 144 LEU D CB  1 
ATOM 5684  C CG  . LEU D 1 144 ? -13.649 -9.593  44.932  1.00 48.39  ? 144 LEU D CG  1 
ATOM 5685  C CD1 . LEU D 1 144 ? -14.667 -8.825  45.754  1.00 46.50  ? 144 LEU D CD1 1 
ATOM 5686  C CD2 . LEU D 1 144 ? -14.149 -9.729  43.509  1.00 52.14  ? 144 LEU D CD2 1 
ATOM 5687  N N   . ARG D 1 145 ? -10.980 -10.682 47.176  1.00 52.02  ? 145 ARG D N   1 
ATOM 5688  C CA  . ARG D 1 145 ? -11.047 -11.893 47.980  1.00 55.68  ? 145 ARG D CA  1 
ATOM 5689  C C   . ARG D 1 145 ? -11.006 -11.574 49.479  1.00 54.79  ? 145 ARG D C   1 
ATOM 5690  O O   . ARG D 1 145 ? -11.932 -11.931 50.214  1.00 58.01  ? 145 ARG D O   1 
ATOM 5691  C CB  . ARG D 1 145 ? -9.909  -12.837 47.587  1.00 64.52  ? 145 ARG D CB  1 
ATOM 5692  C CG  . ARG D 1 145 ? -10.299 -13.904 46.552  1.00 77.44  ? 145 ARG D CG  1 
ATOM 5693  C CD  . ARG D 1 145 ? -10.914 -13.355 45.234  1.00 89.75  ? 145 ARG D CD  1 
ATOM 5694  N NE  . ARG D 1 145 ? -12.382 -13.485 45.158  1.00 97.85  ? 145 ARG D NE  1 
ATOM 5695  C CZ  . ARG D 1 145 ? -13.090 -13.600 44.024  1.00 98.98  ? 145 ARG D CZ  1 
ATOM 5696  N NH1 . ARG D 1 145 ? -12.484 -13.610 42.838  1.00 100.37 ? 145 ARG D NH1 1 
ATOM 5697  N NH2 . ARG D 1 145 ? -14.416 -13.703 44.071  1.00 99.23  ? 145 ARG D NH2 1 
ATOM 5698  N N   . ALA D 1 146 ? -9.948  -10.894 49.925  1.00 51.93  ? 146 ALA D N   1 
ATOM 5699  C CA  . ALA D 1 146 ? -9.789  -10.522 51.335  1.00 46.09  ? 146 ALA D CA  1 
ATOM 5700  C C   . ALA D 1 146 ? -11.058 -9.885  51.909  1.00 43.84  ? 146 ALA D C   1 
ATOM 5701  O O   . ALA D 1 146 ? -11.380 -10.061 53.079  1.00 41.84  ? 146 ALA D O   1 
ATOM 5702  C CB  . ALA D 1 146 ? -8.618  -9.566  51.495  1.00 45.48  ? 146 ALA D CB  1 
ATOM 5703  N N   . VAL D 1 147 ? -11.780 -9.142  51.085  1.00 43.62  ? 147 VAL D N   1 
ATOM 5704  C CA  . VAL D 1 147 ? -13.006 -8.499  51.536  1.00 41.77  ? 147 VAL D CA  1 
ATOM 5705  C C   . VAL D 1 147 ? -14.168 -9.495  51.562  1.00 45.86  ? 147 VAL D C   1 
ATOM 5706  O O   . VAL D 1 147 ? -14.991 -9.470  52.479  1.00 43.86  ? 147 VAL D O   1 
ATOM 5707  C CB  . VAL D 1 147 ? -13.361 -7.282  50.627  1.00 40.42  ? 147 VAL D CB  1 
ATOM 5708  C CG1 . VAL D 1 147 ? -14.796 -6.833  50.867  1.00 35.33  ? 147 VAL D CG1 1 
ATOM 5709  C CG2 . VAL D 1 147 ? -12.393 -6.134  50.904  1.00 35.96  ? 147 VAL D CG2 1 
ATOM 5710  N N   . GLU D 1 148 ? -14.238 -10.369 50.560  1.00 49.93  ? 148 GLU D N   1 
ATOM 5711  C CA  . GLU D 1 148 ? -15.305 -11.363 50.509  1.00 56.86  ? 148 GLU D CA  1 
ATOM 5712  C C   . GLU D 1 148 ? -15.298 -12.167 51.803  1.00 58.86  ? 148 GLU D C   1 
ATOM 5713  O O   . GLU D 1 148 ? -16.334 -12.344 52.458  1.00 58.03  ? 148 GLU D O   1 
ATOM 5714  C CB  . GLU D 1 148 ? -15.100 -12.320 49.340  1.00 58.48  ? 148 GLU D CB  1 
ATOM 5715  C CG  . GLU D 1 148 ? -15.660 -11.856 48.027  1.00 67.62  ? 148 GLU D CG  1 
ATOM 5716  C CD  . GLU D 1 148 ? -15.518 -12.930 46.978  1.00 71.89  ? 148 GLU D CD  1 
ATOM 5717  O OE1 . GLU D 1 148 ? -14.373 -13.388 46.781  1.00 74.28  ? 148 GLU D OE1 1 
ATOM 5718  O OE2 . GLU D 1 148 ? -16.538 -13.324 46.365  1.00 76.55  ? 148 GLU D OE2 1 
ATOM 5719  N N   . SER D 1 149 ? -14.113 -12.656 52.155  1.00 59.41  ? 149 SER D N   1 
ATOM 5720  C CA  . SER D 1 149 ? -13.936 -13.437 53.364  1.00 62.75  ? 149 SER D CA  1 
ATOM 5721  C C   . SER D 1 149 ? -14.437 -12.633 54.559  1.00 63.77  ? 149 SER D C   1 
ATOM 5722  O O   . SER D 1 149 ? -15.410 -13.018 55.211  1.00 66.28  ? 149 SER D O   1 
ATOM 5723  C CB  . SER D 1 149 ? -12.461 -13.772 53.546  1.00 64.08  ? 149 SER D CB  1 
ATOM 5724  O OG  . SER D 1 149 ? -11.696 -12.589 53.663  1.00 67.34  ? 149 SER D OG  1 
ATOM 5725  N N   . TYR D 1 150 ? -13.767 -11.514 54.833  1.00 63.28  ? 150 TYR D N   1 
ATOM 5726  C CA  . TYR D 1 150 ? -14.139 -10.641 55.941  1.00 61.14  ? 150 TYR D CA  1 
ATOM 5727  C C   . TYR D 1 150 ? -15.640 -10.407 55.948  1.00 59.44  ? 150 TYR D C   1 
ATOM 5728  O O   . TYR D 1 150 ? -16.311 -10.640 56.946  1.00 58.95  ? 150 TYR D O   1 
ATOM 5729  C CB  . TYR D 1 150 ? -13.439 -9.284  55.828  1.00 63.11  ? 150 TYR D CB  1 
ATOM 5730  C CG  . TYR D 1 150 ? -13.780 -8.341  56.964  1.00 63.73  ? 150 TYR D CG  1 
ATOM 5731  C CD1 . TYR D 1 150 ? -12.850 -8.064  57.962  1.00 68.03  ? 150 TYR D CD1 1 
ATOM 5732  C CD2 . TYR D 1 150 ? -15.055 -7.769  57.074  1.00 64.14  ? 150 TYR D CD2 1 
ATOM 5733  C CE1 . TYR D 1 150 ? -13.173 -7.244  59.049  1.00 71.67  ? 150 TYR D CE1 1 
ATOM 5734  C CE2 . TYR D 1 150 ? -15.392 -6.949  58.158  1.00 67.35  ? 150 TYR D CE2 1 
ATOM 5735  C CZ  . TYR D 1 150 ? -14.444 -6.694  59.142  1.00 70.87  ? 150 TYR D CZ  1 
ATOM 5736  O OH  . TYR D 1 150 ? -14.757 -5.912  60.231  1.00 71.56  ? 150 TYR D OH  1 
ATOM 5737  N N   . LEU D 1 151 ? -16.165 -9.923  54.832  1.00 57.19  ? 151 LEU D N   1 
ATOM 5738  C CA  . LEU D 1 151 ? -17.587 -9.666  54.736  1.00 53.86  ? 151 LEU D CA  1 
ATOM 5739  C C   . LEU D 1 151 ? -18.401 -10.853 55.196  1.00 52.45  ? 151 LEU D C   1 
ATOM 5740  O O   . LEU D 1 151 ? -19.429 -10.696 55.847  1.00 51.58  ? 151 LEU D O   1 
ATOM 5741  C CB  . LEU D 1 151 ? -17.961 -9.324  53.299  1.00 53.74  ? 151 LEU D CB  1 
ATOM 5742  C CG  . LEU D 1 151 ? -17.876 -7.830  53.001  1.00 52.14  ? 151 LEU D CG  1 
ATOM 5743  C CD1 . LEU D 1 151 ? -18.225 -7.553  51.537  1.00 54.94  ? 151 LEU D CD1 1 
ATOM 5744  C CD2 . LEU D 1 151 ? -18.827 -7.099  53.941  1.00 46.44  ? 151 LEU D CD2 1 
ATOM 5745  N N   . LEU D 1 152 ? -17.930 -12.044 54.848  1.00 53.57  ? 152 LEU D N   1 
ATOM 5746  C CA  . LEU D 1 152 ? -18.615 -13.280 55.208  1.00 56.09  ? 152 LEU D CA  1 
ATOM 5747  C C   . LEU D 1 152 ? -18.595 -13.554 56.700  1.00 59.08  ? 152 LEU D C   1 
ATOM 5748  O O   . LEU D 1 152 ? -19.646 -13.782 57.321  1.00 56.51  ? 152 LEU D O   1 
ATOM 5749  C CB  . LEU D 1 152 ? -17.982 -14.452 54.461  1.00 51.24  ? 152 LEU D CB  1 
ATOM 5750  C CG  . LEU D 1 152 ? -18.498 -14.554 53.028  1.00 50.78  ? 152 LEU D CG  1 
ATOM 5751  C CD1 . LEU D 1 152 ? -17.708 -15.602 52.265  1.00 48.82  ? 152 LEU D CD1 1 
ATOM 5752  C CD2 . LEU D 1 152 ? -20.001 -14.884 53.062  1.00 37.97  ? 152 LEU D CD2 1 
ATOM 5753  N N   . ALA D 1 153 ? -17.387 -13.530 57.260  1.00 61.58  ? 153 ALA D N   1 
ATOM 5754  C CA  . ALA D 1 153 ? -17.169 -13.770 58.680  1.00 63.30  ? 153 ALA D CA  1 
ATOM 5755  C C   . ALA D 1 153 ? -17.873 -12.751 59.583  1.00 65.02  ? 153 ALA D C   1 
ATOM 5756  O O   . ALA D 1 153 ? -18.124 -13.033 60.756  1.00 70.76  ? 153 ALA D O   1 
ATOM 5757  C CB  . ALA D 1 153 ? -15.671 -13.779 58.977  1.00 61.22  ? 153 ALA D CB  1 
ATOM 5758  N N   . HIS D 1 154 ? -18.198 -11.578 59.045  1.00 63.50  ? 154 HIS D N   1 
ATOM 5759  C CA  . HIS D 1 154 ? -18.849 -10.542 59.835  1.00 60.74  ? 154 HIS D CA  1 
ATOM 5760  C C   . HIS D 1 154 ? -20.169 -10.111 59.228  1.00 61.25  ? 154 HIS D C   1 
ATOM 5761  O O   . HIS D 1 154 ? -20.385 -8.946  58.913  1.00 60.96  ? 154 HIS D O   1 
ATOM 5762  C CB  . HIS D 1 154 ? -17.907 -9.360  59.975  1.00 61.63  ? 154 HIS D CB  1 
ATOM 5763  C CG  . HIS D 1 154 ? -16.563 -9.741  60.508  1.00 65.00  ? 154 HIS D CG  1 
ATOM 5764  N ND1 . HIS D 1 154 ? -15.755 -10.667 59.884  1.00 69.37  ? 154 HIS D ND1 1 
ATOM 5765  C CD2 . HIS D 1 154 ? -15.886 -9.329  61.605  1.00 66.91  ? 154 HIS D CD2 1 
ATOM 5766  C CE1 . HIS D 1 154 ? -14.636 -10.808 60.573  1.00 71.28  ? 154 HIS D CE1 1 
ATOM 5767  N NE2 . HIS D 1 154 ? -14.689 -10.007 61.623  1.00 69.19  ? 154 HIS D NE2 1 
ATOM 5768  N N   . SER D 1 155 ? -21.047 -11.092 59.088  1.00 62.58  ? 155 SER D N   1 
ATOM 5769  C CA  . SER D 1 155 ? -22.382 -10.943 58.526  1.00 63.64  ? 155 SER D CA  1 
ATOM 5770  C C   . SER D 1 155 ? -23.228 -9.709  58.884  1.00 65.89  ? 155 SER D C   1 
ATOM 5771  O O   . SER D 1 155 ? -24.122 -9.334  58.121  1.00 66.78  ? 155 SER D O   1 
ATOM 5772  C CB  . SER D 1 155 ? -23.160 -12.203 58.869  1.00 62.13  ? 155 SER D CB  1 
ATOM 5773  O OG  . SER D 1 155 ? -22.879 -12.588 60.207  1.00 62.94  ? 155 SER D OG  1 
ATOM 5774  N N   . ASP D 1 156 ? -22.970 -9.083  60.032  1.00 68.57  ? 156 ASP D N   1 
ATOM 5775  C CA  . ASP D 1 156 ? -23.745 -7.901  60.456  1.00 69.33  ? 156 ASP D CA  1 
ATOM 5776  C C   . ASP D 1 156 ? -23.177 -6.582  59.932  1.00 68.54  ? 156 ASP D C   1 
ATOM 5777  O O   . ASP D 1 156 ? -23.806 -5.523  60.055  1.00 66.21  ? 156 ASP D O   1 
ATOM 5778  C CB  . ASP D 1 156 ? -23.830 -7.834  61.988  1.00 72.92  ? 156 ASP D CB  1 
ATOM 5779  C CG  . ASP D 1 156 ? -22.470 -7.915  62.654  1.00 76.99  ? 156 ASP D CG  1 
ATOM 5780  O OD1 . ASP D 1 156 ? -21.590 -7.103  62.310  1.00 82.55  ? 156 ASP D OD1 1 
ATOM 5781  O OD2 . ASP D 1 156 ? -22.277 -8.793  63.521  1.00 79.39  ? 156 ASP D OD2 1 
ATOM 5782  N N   . ALA D 1 157 ? -21.985 -6.671  59.346  1.00 69.83  ? 157 ALA D N   1 
ATOM 5783  C CA  . ALA D 1 157 ? -21.277 -5.526  58.792  1.00 72.02  ? 157 ALA D CA  1 
ATOM 5784  C C   . ALA D 1 157 ? -21.957 -4.947  57.560  1.00 73.76  ? 157 ALA D C   1 
ATOM 5785  O O   . ALA D 1 157 ? -22.886 -5.535  57.007  1.00 75.88  ? 157 ALA D O   1 
ATOM 5786  C CB  . ALA D 1 157 ? -19.849 -5.927  58.448  1.00 69.14  ? 157 ALA D CB  1 
ATOM 5787  N N   . TYR D 1 158 ? -21.472 -3.778  57.152  1.00 76.11  ? 158 TYR D N   1 
ATOM 5788  C CA  . TYR D 1 158 ? -21.956 -3.047  55.983  1.00 78.34  ? 158 TYR D CA  1 
ATOM 5789  C C   . TYR D 1 158 ? -23.392 -3.342  55.589  1.00 81.97  ? 158 TYR D C   1 
ATOM 5790  O O   . TYR D 1 158 ? -23.668 -3.742  54.453  1.00 78.30  ? 158 TYR D O   1 
ATOM 5791  C CB  . TYR D 1 158 ? -21.008 -3.309  54.817  1.00 76.25  ? 158 TYR D CB  1 
ATOM 5792  C CG  . TYR D 1 158 ? -19.588 -2.954  55.188  1.00 74.93  ? 158 TYR D CG  1 
ATOM 5793  C CD1 . TYR D 1 158 ? -19.062 -1.698  54.907  1.00 72.31  ? 158 TYR D CD1 1 
ATOM 5794  C CD2 . TYR D 1 158 ? -18.797 -3.849  55.900  1.00 75.21  ? 158 TYR D CD2 1 
ATOM 5795  C CE1 . TYR D 1 158 ? -17.783 -1.344  55.330  1.00 71.16  ? 158 TYR D CE1 1 
ATOM 5796  C CE2 . TYR D 1 158 ? -17.521 -3.504  56.328  1.00 72.30  ? 158 TYR D CE2 1 
ATOM 5797  C CZ  . TYR D 1 158 ? -17.019 -2.254  56.041  1.00 71.98  ? 158 TYR D CZ  1 
ATOM 5798  O OH  . TYR D 1 158 ? -15.751 -1.921  56.465  1.00 74.11  ? 158 TYR D OH  1 
ATOM 5799  N N   . ASN D 1 159 ? -24.297 -3.118  56.545  1.00 88.57  ? 159 ASN D N   1 
ATOM 5800  C CA  . ASN D 1 159 ? -25.725 -3.345  56.361  1.00 90.29  ? 159 ASN D CA  1 
ATOM 5801  C C   . ASN D 1 159 ? -26.043 -4.804  56.720  1.00 89.28  ? 159 ASN D C   1 
ATOM 5802  O O   . ASN D 1 159 ? -26.426 -5.587  55.821  1.00 86.67  ? 159 ASN D O   1 
ATOM 5803  C CB  . ASN D 1 159 ? -26.107 -3.040  54.910  1.00 93.95  ? 159 ASN D CB  1 
ATOM 5804  C CG  . ASN D 1 159 ? -27.516 -2.530  54.774  1.00 98.11  ? 159 ASN D CG  1 
ATOM 5805  O OD1 . ASN D 1 159 ? -28.479 -3.269  54.987  1.00 103.50 ? 159 ASN D OD1 1 
ATOM 5806  N ND2 . ASN D 1 159 ? -27.652 -1.252  54.416  1.00 99.20  ? 159 ASN D ND2 1 
ATOM 5807  O OXT . ASN D 1 159 ? -25.883 -5.148  57.913  1.00 88.91  ? 159 ASN D OXT 1 
ATOM 5808  N N   . ASN E 2 1   ? -27.487 16.731  42.334  1.00 74.42  ? 1   ASN E N   1 
ATOM 5809  C CA  . ASN E 2 1   ? -27.642 18.122  42.857  1.00 75.21  ? 1   ASN E CA  1 
ATOM 5810  C C   . ASN E 2 1   ? -28.387 18.151  44.206  1.00 71.24  ? 1   ASN E C   1 
ATOM 5811  O O   . ASN E 2 1   ? -29.616 18.074  44.252  1.00 74.94  ? 1   ASN E O   1 
ATOM 5812  C CB  . ASN E 2 1   ? -28.401 18.976  41.832  1.00 79.75  ? 1   ASN E CB  1 
ATOM 5813  C CG  . ASN E 2 1   ? -28.112 20.467  41.980  1.00 85.60  ? 1   ASN E CG  1 
ATOM 5814  O OD1 . ASN E 2 1   ? -27.180 20.992  41.357  1.00 88.01  ? 1   ASN E OD1 1 
ATOM 5815  N ND2 . ASN E 2 1   ? -28.900 21.153  42.817  1.00 86.07  ? 1   ASN E ND2 1 
ATOM 5816  N N   . ILE E 2 2   ? -27.639 18.271  45.299  1.00 62.98  ? 2   ILE E N   1 
ATOM 5817  C CA  . ILE E 2 2   ? -28.217 18.309  46.640  1.00 57.28  ? 2   ILE E CA  1 
ATOM 5818  C C   . ILE E 2 2   ? -28.548 19.726  47.100  1.00 59.99  ? 2   ILE E C   1 
ATOM 5819  O O   . ILE E 2 2   ? -28.103 20.704  46.495  1.00 61.34  ? 2   ILE E O   1 
ATOM 5820  C CB  . ILE E 2 2   ? -27.243 17.688  47.645  1.00 54.07  ? 2   ILE E CB  1 
ATOM 5821  C CG1 . ILE E 2 2   ? -27.185 16.182  47.424  1.00 53.46  ? 2   ILE E CG1 1 
ATOM 5822  C CG2 . ILE E 2 2   ? -27.655 18.013  49.066  1.00 55.97  ? 2   ILE E CG2 1 
ATOM 5823  C CD1 . ILE E 2 2   ? -26.256 15.455  48.369  1.00 58.88  ? 2   ILE E CD1 1 
ATOM 5824  N N   . VAL E 2 3   ? -29.331 19.841  48.170  1.00 60.90  ? 3   VAL E N   1 
ATOM 5825  C CA  . VAL E 2 3   ? -29.685 21.151  48.706  1.00 62.05  ? 3   VAL E CA  1 
ATOM 5826  C C   . VAL E 2 3   ? -29.482 21.223  50.216  1.00 62.39  ? 3   VAL E C   1 
ATOM 5827  O O   . VAL E 2 3   ? -30.159 20.541  50.985  1.00 60.45  ? 3   VAL E O   1 
ATOM 5828  C CB  . VAL E 2 3   ? -31.152 21.528  48.384  1.00 63.53  ? 3   VAL E CB  1 
ATOM 5829  C CG1 . VAL E 2 3   ? -31.420 21.317  46.907  1.00 67.71  ? 3   VAL E CG1 1 
ATOM 5830  C CG2 . VAL E 2 3   ? -32.115 20.715  49.225  1.00 64.80  ? 3   VAL E CG2 1 
ATOM 5831  N N   . LEU E 2 4   ? -28.538 22.056  50.637  1.00 63.00  ? 4   LEU E N   1 
ATOM 5832  C CA  . LEU E 2 4   ? -28.242 22.229  52.055  1.00 61.49  ? 4   LEU E CA  1 
ATOM 5833  C C   . LEU E 2 4   ? -29.102 23.359  52.578  1.00 60.59  ? 4   LEU E C   1 
ATOM 5834  O O   . LEU E 2 4   ? -28.994 24.497  52.110  1.00 62.84  ? 4   LEU E O   1 
ATOM 5835  C CB  . LEU E 2 4   ? -26.765 22.572  52.245  1.00 61.75  ? 4   LEU E CB  1 
ATOM 5836  C CG  . LEU E 2 4   ? -25.860 21.587  51.511  1.00 59.48  ? 4   LEU E CG  1 
ATOM 5837  C CD1 . LEU E 2 4   ? -24.397 22.004  51.595  1.00 57.98  ? 4   LEU E CD1 1 
ATOM 5838  C CD2 . LEU E 2 4   ? -26.079 20.216  52.118  1.00 62.38  ? 4   LEU E CD2 1 
ATOM 5839  N N   . THR E 2 5   ? -29.956 23.050  53.549  1.00 56.21  ? 5   THR E N   1 
ATOM 5840  C CA  . THR E 2 5   ? -30.831 24.070  54.101  1.00 53.32  ? 5   THR E CA  1 
ATOM 5841  C C   . THR E 2 5   ? -30.448 24.516  55.510  1.00 53.07  ? 5   THR E C   1 
ATOM 5842  O O   . THR E 2 5   ? -30.422 23.717  56.455  1.00 48.93  ? 5   THR E O   1 
ATOM 5843  C CB  . THR E 2 5   ? -32.292 23.601  54.072  1.00 54.29  ? 5   THR E CB  1 
ATOM 5844  O OG1 . THR E 2 5   ? -32.683 23.352  52.716  1.00 53.40  ? 5   THR E OG1 1 
ATOM 5845  C CG2 . THR E 2 5   ? -33.205 24.665  54.654  1.00 51.79  ? 5   THR E CG2 1 
ATOM 5846  N N   . GLN E 2 6   ? -30.161 25.812  55.633  1.00 55.24  ? 6   GLN E N   1 
ATOM 5847  C CA  . GLN E 2 6   ? -29.767 26.403  56.898  1.00 55.02  ? 6   GLN E CA  1 
ATOM 5848  C C   . GLN E 2 6   ? -30.887 27.186  57.553  1.00 58.24  ? 6   GLN E C   1 
ATOM 5849  O O   . GLN E 2 6   ? -31.654 27.896  56.884  1.00 60.09  ? 6   GLN E O   1 
ATOM 5850  C CB  . GLN E 2 6   ? -28.584 27.325  56.690  1.00 49.73  ? 6   GLN E CB  1 
ATOM 5851  C CG  . GLN E 2 6   ? -27.430 26.666  55.997  1.00 39.13  ? 6   GLN E CG  1 
ATOM 5852  C CD  . GLN E 2 6   ? -26.115 27.236  56.482  1.00 36.67  ? 6   GLN E CD  1 
ATOM 5853  O OE1 . GLN E 2 6   ? -25.858 27.279  57.700  1.00 29.06  ? 6   GLN E OE1 1 
ATOM 5854  N NE2 . GLN E 2 6   ? -25.268 27.677  55.544  1.00 33.97  ? 6   GLN E NE2 1 
ATOM 5855  N N   . SER E 2 7   ? -30.977 27.048  58.872  1.00 61.89  ? 7   SER E N   1 
ATOM 5856  C CA  . SER E 2 7   ? -32.002 27.741  59.652  1.00 65.56  ? 7   SER E CA  1 
ATOM 5857  C C   . SER E 2 7   ? -31.586 27.972  61.087  1.00 65.87  ? 7   SER E C   1 
ATOM 5858  O O   . SER E 2 7   ? -30.929 27.127  61.703  1.00 65.53  ? 7   SER E O   1 
ATOM 5859  C CB  . SER E 2 7   ? -33.280 26.924  59.650  1.00 65.37  ? 7   SER E CB  1 
ATOM 5860  O OG  . SER E 2 7   ? -32.964 25.600  60.007  1.00 70.36  ? 7   SER E OG  1 
ATOM 5861  N N   . PRO E 2 8   ? -31.976 29.127  61.650  1.00 66.75  ? 8   PRO E N   1 
ATOM 5862  C CA  . PRO E 2 8   ? -32.772 30.189  61.023  1.00 66.16  ? 8   PRO E CA  1 
ATOM 5863  C C   . PRO E 2 8   ? -31.976 31.053  60.053  1.00 65.29  ? 8   PRO E C   1 
ATOM 5864  O O   . PRO E 2 8   ? -30.776 30.859  59.869  1.00 66.55  ? 8   PRO E O   1 
ATOM 5865  C CB  . PRO E 2 8   ? -33.242 30.973  62.216  1.00 65.79  ? 8   PRO E CB  1 
ATOM 5866  C CG  . PRO E 2 8   ? -32.037 30.928  63.107  1.00 66.74  ? 8   PRO E CG  1 
ATOM 5867  C CD  . PRO E 2 8   ? -31.545 29.498  63.005  1.00 66.89  ? 8   PRO E CD  1 
ATOM 5868  N N   . LYS E 2 9   ? -32.624 32.025  59.444  1.00 62.65  ? 9   LYS E N   1 
ATOM 5869  C CA  . LYS E 2 9   ? -31.902 32.862  58.530  1.00 63.22  ? 9   LYS E CA  1 
ATOM 5870  C C   . LYS E 2 9   ? -30.870 33.661  59.317  1.00 62.40  ? 9   LYS E C   1 
ATOM 5871  O O   . LYS E 2 9   ? -29.830 34.014  58.777  1.00 59.99  ? 9   LYS E O   1 
ATOM 5872  C CB  . LYS E 2 9   ? -32.878 33.776  57.810  1.00 67.80  ? 9   LYS E CB  1 
ATOM 5873  C CG  . LYS E 2 9   ? -32.385 34.264  56.461  1.00 73.98  ? 9   LYS E CG  1 
ATOM 5874  C CD  . LYS E 2 9   ? -32.280 33.117  55.469  1.00 80.31  ? 9   LYS E CD  1 
ATOM 5875  C CE  . LYS E 2 9   ? -31.892 33.616  54.061  1.00 80.25  ? 9   LYS E CE  1 
ATOM 5876  N NZ  . LYS E 2 9   ? -31.732 32.457  53.118  1.00 79.85  ? 9   LYS E NZ  1 
ATOM 5877  N N   . SER E 2 10  ? -31.153 33.918  60.598  1.00 62.77  ? 10  SER E N   1 
ATOM 5878  C CA  . SER E 2 10  ? -30.235 34.667  61.468  1.00 61.01  ? 10  SER E CA  1 
ATOM 5879  C C   . SER E 2 10  ? -30.466 34.385  62.955  1.00 58.11  ? 10  SER E C   1 
ATOM 5880  O O   . SER E 2 10  ? -31.538 33.956  63.360  1.00 57.69  ? 10  SER E O   1 
ATOM 5881  C CB  . SER E 2 10  ? -30.382 36.165  61.237  1.00 62.78  ? 10  SER E CB  1 
ATOM 5882  O OG  . SER E 2 10  ? -31.501 36.646  61.951  1.00 68.87  ? 10  SER E OG  1 
ATOM 5883  N N   . MET E 2 11  ? -29.450 34.640  63.763  1.00 58.89  ? 11  MET E N   1 
ATOM 5884  C CA  . MET E 2 11  ? -29.523 34.408  65.196  1.00 63.96  ? 11  MET E CA  1 
ATOM 5885  C C   . MET E 2 11  ? -28.938 35.571  65.965  1.00 64.59  ? 11  MET E C   1 
ATOM 5886  O O   . MET E 2 11  ? -27.923 36.144  65.561  1.00 66.53  ? 11  MET E O   1 
ATOM 5887  C CB  . MET E 2 11  ? -28.749 33.151  65.577  1.00 68.78  ? 11  MET E CB  1 
ATOM 5888  C CG  . MET E 2 11  ? -29.486 31.865  65.333  1.00 77.00  ? 11  MET E CG  1 
ATOM 5889  S SD  . MET E 2 11  ? -28.673 30.542  66.231  1.00 91.59  ? 11  MET E SD  1 
ATOM 5890  C CE  . MET E 2 11  ? -29.461 30.670  67.875  1.00 85.38  ? 11  MET E CE  1 
ATOM 5891  N N   . SER E 2 12  ? -29.577 35.905  67.084  1.00 63.02  ? 12  SER E N   1 
ATOM 5892  C CA  . SER E 2 12  ? -29.116 36.995  67.935  1.00 58.77  ? 12  SER E CA  1 
ATOM 5893  C C   . SER E 2 12  ? -28.971 36.509  69.363  1.00 55.97  ? 12  SER E C   1 
ATOM 5894  O O   . SER E 2 12  ? -29.938 36.101  69.996  1.00 55.50  ? 12  SER E O   1 
ATOM 5895  C CB  . SER E 2 12  ? -30.090 38.172  67.870  1.00 55.48  ? 12  SER E CB  1 
ATOM 5896  O OG  . SER E 2 12  ? -30.051 38.771  66.583  1.00 56.39  ? 12  SER E OG  1 
ATOM 5897  N N   . VAL E 2 13  ? -27.744 36.540  69.858  1.00 52.93  ? 13  VAL E N   1 
ATOM 5898  C CA  . VAL E 2 13  ? -27.471 36.092  71.209  1.00 53.61  ? 13  VAL E CA  1 
ATOM 5899  C C   . VAL E 2 13  ? -26.451 37.007  71.835  1.00 52.86  ? 13  VAL E C   1 
ATOM 5900  O O   . VAL E 2 13  ? -25.785 37.769  71.152  1.00 54.24  ? 13  VAL E O   1 
ATOM 5901  C CB  . VAL E 2 13  ? -26.931 34.649  71.232  1.00 55.87  ? 13  VAL E CB  1 
ATOM 5902  C CG1 . VAL E 2 13  ? -27.881 33.745  70.450  1.00 56.78  ? 13  VAL E CG1 1 
ATOM 5903  C CG2 . VAL E 2 13  ? -25.507 34.600  70.672  1.00 54.31  ? 13  VAL E CG2 1 
ATOM 5904  N N   . SER E 2 14  ? -26.319 36.918  73.144  1.00 53.51  ? 14  SER E N   1 
ATOM 5905  C CA  . SER E 2 14  ? -25.403 37.783  73.852  1.00 55.13  ? 14  SER E CA  1 
ATOM 5906  C C   . SER E 2 14  ? -24.075 37.135  74.036  1.00 52.31  ? 14  SER E C   1 
ATOM 5907  O O   . SER E 2 14  ? -23.976 35.921  74.148  1.00 53.54  ? 14  SER E O   1 
ATOM 5908  C CB  . SER E 2 14  ? -25.995 38.147  75.201  1.00 58.46  ? 14  SER E CB  1 
ATOM 5909  O OG  . SER E 2 14  ? -27.376 38.429  75.043  1.00 66.02  ? 14  SER E OG  1 
ATOM 5910  N N   . VAL E 2 15  ? -23.045 37.955  74.083  1.00 48.87  ? 15  VAL E N   1 
ATOM 5911  C CA  . VAL E 2 15  ? -21.713 37.418  74.236  1.00 48.74  ? 15  VAL E CA  1 
ATOM 5912  C C   . VAL E 2 15  ? -21.513 36.654  75.552  1.00 50.75  ? 15  VAL E C   1 
ATOM 5913  O O   . VAL E 2 15  ? -21.581 37.218  76.648  1.00 53.51  ? 15  VAL E O   1 
ATOM 5914  C CB  . VAL E 2 15  ? -20.665 38.536  74.073  1.00 46.62  ? 15  VAL E CB  1 
ATOM 5915  C CG1 . VAL E 2 15  ? -21.320 39.893  74.320  1.00 48.97  ? 15  VAL E CG1 1 
ATOM 5916  C CG2 . VAL E 2 15  ? -19.474 38.296  75.001  1.00 40.44  ? 15  VAL E CG2 1 
ATOM 5917  N N   . GLY E 2 16  ? -21.273 35.351  75.402  1.00 50.48  ? 16  GLY E N   1 
ATOM 5918  C CA  . GLY E 2 16  ? -21.060 34.439  76.514  1.00 47.49  ? 16  GLY E CA  1 
ATOM 5919  C C   . GLY E 2 16  ? -22.023 33.286  76.304  1.00 47.92  ? 16  GLY E C   1 
ATOM 5920  O O   . GLY E 2 16  ? -21.758 32.149  76.696  1.00 49.62  ? 16  GLY E O   1 
ATOM 5921  N N   . GLU E 2 17  ? -23.142 33.605  75.657  1.00 49.25  ? 17  GLU E N   1 
ATOM 5922  C CA  . GLU E 2 17  ? -24.210 32.656  75.349  1.00 54.43  ? 17  GLU E CA  1 
ATOM 5923  C C   . GLU E 2 17  ? -23.775 31.436  74.563  1.00 54.21  ? 17  GLU E C   1 
ATOM 5924  O O   . GLU E 2 17  ? -22.646 31.341  74.093  1.00 56.39  ? 17  GLU E O   1 
ATOM 5925  C CB  . GLU E 2 17  ? -25.305 33.337  74.534  1.00 60.07  ? 17  GLU E CB  1 
ATOM 5926  C CG  . GLU E 2 17  ? -26.304 34.129  75.333  1.00 70.69  ? 17  GLU E CG  1 
ATOM 5927  C CD  . GLU E 2 17  ? -27.696 34.048  74.722  1.00 76.82  ? 17  GLU E CD  1 
ATOM 5928  O OE1 . GLU E 2 17  ? -28.602 34.779  75.189  1.00 81.64  ? 17  GLU E OE1 1 
ATOM 5929  O OE2 . GLU E 2 17  ? -27.884 33.239  73.779  1.00 78.84  ? 17  GLU E OE2 1 
ATOM 5930  N N   . ARG E 2 18  ? -24.704 30.510  74.393  1.00 52.10  ? 18  ARG E N   1 
ATOM 5931  C CA  . ARG E 2 18  ? -24.430 29.308  73.637  1.00 52.72  ? 18  ARG E CA  1 
ATOM 5932  C C   . ARG E 2 18  ? -25.365 29.277  72.444  1.00 51.41  ? 18  ARG E C   1 
ATOM 5933  O O   . ARG E 2 18  ? -26.532 29.662  72.543  1.00 50.77  ? 18  ARG E O   1 
ATOM 5934  C CB  . ARG E 2 18  ? -24.653 28.078  74.494  1.00 55.40  ? 18  ARG E CB  1 
ATOM 5935  C CG  . ARG E 2 18  ? -24.527 26.788  73.736  1.00 59.08  ? 18  ARG E CG  1 
ATOM 5936  C CD  . ARG E 2 18  ? -25.711 25.894  74.032  1.00 64.57  ? 18  ARG E CD  1 
ATOM 5937  N NE  . ARG E 2 18  ? -25.390 24.482  73.837  1.00 66.35  ? 18  ARG E NE  1 
ATOM 5938  C CZ  . ARG E 2 18  ? -24.346 23.871  74.391  1.00 65.49  ? 18  ARG E CZ  1 
ATOM 5939  N NH1 . ARG E 2 18  ? -23.506 24.545  75.176  1.00 63.25  ? 18  ARG E NH1 1 
ATOM 5940  N NH2 . ARG E 2 18  ? -24.146 22.581  74.164  1.00 63.16  ? 18  ARG E NH2 1 
ATOM 5941  N N   . VAL E 2 19  ? -24.851 28.812  71.313  1.00 49.05  ? 19  VAL E N   1 
ATOM 5942  C CA  . VAL E 2 19  ? -25.650 28.777  70.109  1.00 47.53  ? 19  VAL E CA  1 
ATOM 5943  C C   . VAL E 2 19  ? -25.368 27.534  69.315  1.00 44.17  ? 19  VAL E C   1 
ATOM 5944  O O   . VAL E 2 19  ? -24.286 26.941  69.417  1.00 38.19  ? 19  VAL E O   1 
ATOM 5945  C CB  . VAL E 2 19  ? -25.355 30.008  69.193  1.00 52.76  ? 19  VAL E CB  1 
ATOM 5946  C CG1 . VAL E 2 19  ? -26.193 29.946  67.942  1.00 55.53  ? 19  VAL E CG1 1 
ATOM 5947  C CG2 . VAL E 2 19  ? -25.660 31.289  69.921  1.00 57.49  ? 19  VAL E CG2 1 
ATOM 5948  N N   . THR E 2 20  ? -26.366 27.154  68.523  1.00 41.69  ? 20  THR E N   1 
ATOM 5949  C CA  . THR E 2 20  ? -26.267 26.008  67.653  1.00 43.37  ? 20  THR E CA  1 
ATOM 5950  C C   . THR E 2 20  ? -26.971 26.309  66.344  1.00 44.37  ? 20  THR E C   1 
ATOM 5951  O O   . THR E 2 20  ? -28.150 26.685  66.332  1.00 41.52  ? 20  THR E O   1 
ATOM 5952  C CB  . THR E 2 20  ? -26.892 24.765  68.276  1.00 42.72  ? 20  THR E CB  1 
ATOM 5953  O OG1 . THR E 2 20  ? -26.095 24.336  69.388  1.00 41.47  ? 20  THR E OG1 1 
ATOM 5954  C CG2 . THR E 2 20  ? -26.960 23.654  67.252  1.00 43.62  ? 20  THR E CG2 1 
ATOM 5955  N N   . LEU E 2 21  ? -26.223 26.143  65.252  1.00 45.73  ? 21  LEU E N   1 
ATOM 5956  C CA  . LEU E 2 21  ? -26.712 26.368  63.894  1.00 50.98  ? 21  LEU E CA  1 
ATOM 5957  C C   . LEU E 2 21  ? -27.049 25.017  63.286  1.00 51.91  ? 21  LEU E C   1 
ATOM 5958  O O   . LEU E 2 21  ? -26.461 24.000  63.662  1.00 50.37  ? 21  LEU E O   1 
ATOM 5959  C CB  . LEU E 2 21  ? -25.635 27.034  63.031  1.00 53.44  ? 21  LEU E CB  1 
ATOM 5960  C CG  . LEU E 2 21  ? -25.103 28.431  63.365  1.00 51.44  ? 21  LEU E CG  1 
ATOM 5961  C CD1 . LEU E 2 21  ? -26.220 29.429  63.228  1.00 53.21  ? 21  LEU E CD1 1 
ATOM 5962  C CD2 . LEU E 2 21  ? -24.531 28.459  64.760  1.00 49.51  ? 21  LEU E CD2 1 
ATOM 5963  N N   . SER E 2 22  ? -27.975 25.020  62.330  1.00 52.21  ? 22  SER E N   1 
ATOM 5964  C CA  . SER E 2 22  ? -28.394 23.789  61.679  1.00 54.53  ? 22  SER E CA  1 
ATOM 5965  C C   . SER E 2 22  ? -28.232 23.796  60.165  1.00 56.04  ? 22  SER E C   1 
ATOM 5966  O O   . SER E 2 22  ? -28.429 24.825  59.509  1.00 56.19  ? 22  SER E O   1 
ATOM 5967  C CB  . SER E 2 22  ? -29.867 23.501  61.977  1.00 53.21  ? 22  SER E CB  1 
ATOM 5968  O OG  . SER E 2 22  ? -30.664 23.697  60.811  1.00 51.65  ? 22  SER E OG  1 
ATOM 5969  N N   . CYS E 2 23  ? -27.879 22.629  59.627  1.00 55.39  ? 23  CYS E N   1 
ATOM 5970  C CA  . CYS E 2 23  ? -27.755 22.440  58.190  1.00 51.48  ? 23  CYS E CA  1 
ATOM 5971  C C   . CYS E 2 23  ? -28.433 21.121  57.905  1.00 52.16  ? 23  CYS E C   1 
ATOM 5972  O O   . CYS E 2 23  ? -28.064 20.103  58.492  1.00 51.62  ? 23  CYS E O   1 
ATOM 5973  C CB  . CYS E 2 23  ? -26.299 22.356  57.735  1.00 47.65  ? 23  CYS E CB  1 
ATOM 5974  S SG  . CYS E 2 23  ? -26.103 22.615  55.919  1.00 40.47  ? 23  CYS E SG  1 
ATOM 5975  N N   . LYS E 2 24  ? -29.431 21.148  57.023  1.00 53.84  ? 24  LYS E N   1 
ATOM 5976  C CA  . LYS E 2 24  ? -30.175 19.945  56.650  1.00 58.30  ? 24  LYS E CA  1 
ATOM 5977  C C   . LYS E 2 24  ? -30.130 19.747  55.138  1.00 60.40  ? 24  LYS E C   1 
ATOM 5978  O O   . LYS E 2 24  ? -30.553 20.624  54.373  1.00 59.89  ? 24  LYS E O   1 
ATOM 5979  C CB  . LYS E 2 24  ? -31.640 20.052  57.085  1.00 63.20  ? 24  LYS E CB  1 
ATOM 5980  C CG  . LYS E 2 24  ? -31.870 20.609  58.481  1.00 69.86  ? 24  LYS E CG  1 
ATOM 5981  C CD  . LYS E 2 24  ? -31.242 19.747  59.560  1.00 75.41  ? 24  LYS E CD  1 
ATOM 5982  C CE  . LYS E 2 24  ? -31.754 20.174  60.920  1.00 78.50  ? 24  LYS E CE  1 
ATOM 5983  N NZ  . LYS E 2 24  ? -33.250 20.114  60.946  1.00 81.73  ? 24  LYS E NZ  1 
ATOM 5984  N N   . ALA E 2 25  ? -29.640 18.583  54.715  1.00 61.59  ? 25  ALA E N   1 
ATOM 5985  C CA  . ALA E 2 25  ? -29.525 18.260  53.294  1.00 62.19  ? 25  ALA E CA  1 
ATOM 5986  C C   . ALA E 2 25  ? -30.726 17.475  52.779  1.00 61.79  ? 25  ALA E C   1 
ATOM 5987  O O   . ALA E 2 25  ? -31.399 16.779  53.540  1.00 61.02  ? 25  ALA E O   1 
ATOM 5988  C CB  . ALA E 2 25  ? -28.252 17.472  53.049  1.00 60.36  ? 25  ALA E CB  1 
ATOM 5989  N N   . SER E 2 26  ? -30.979 17.586  51.478  1.00 60.74  ? 26  SER E N   1 
ATOM 5990  C CA  . SER E 2 26  ? -32.097 16.897  50.852  1.00 59.63  ? 26  SER E CA  1 
ATOM 5991  C C   . SER E 2 26  ? -31.882 15.391  50.691  1.00 60.52  ? 26  SER E C   1 
ATOM 5992  O O   . SER E 2 26  ? -32.759 14.688  50.197  1.00 63.44  ? 26  SER E O   1 
ATOM 5993  C CB  . SER E 2 26  ? -32.397 17.522  49.486  1.00 58.30  ? 26  SER E CB  1 
ATOM 5994  O OG  . SER E 2 26  ? -31.278 17.464  48.619  1.00 58.11  ? 26  SER E OG  1 
ATOM 5995  N N   . GLU E 2 27  ? -30.722 14.895  51.104  1.00 60.90  ? 27  GLU E N   1 
ATOM 5996  C CA  . GLU E 2 27  ? -30.419 13.471  51.000  1.00 61.08  ? 27  GLU E CA  1 
ATOM 5997  C C   . GLU E 2 27  ? -29.346 13.124  51.991  1.00 59.27  ? 27  GLU E C   1 
ATOM 5998  O O   . GLU E 2 27  ? -28.961 13.939  52.824  1.00 60.75  ? 27  GLU E O   1 
ATOM 5999  C CB  . GLU E 2 27  ? -29.882 13.130  49.623  1.00 67.66  ? 27  GLU E CB  1 
ATOM 6000  C CG  . GLU E 2 27  ? -30.837 13.389  48.494  1.00 76.99  ? 27  GLU E CG  1 
ATOM 6001  C CD  . GLU E 2 27  ? -30.111 13.485  47.167  1.00 82.25  ? 27  GLU E CD  1 
ATOM 6002  O OE1 . GLU E 2 27  ? -29.242 12.611  46.910  1.00 85.33  ? 27  GLU E OE1 1 
ATOM 6003  O OE2 . GLU E 2 27  ? -30.408 14.428  46.391  1.00 81.04  ? 27  GLU E OE2 1 
ATOM 6004  N N   . ASN E 2 28  ? -28.857 11.900  51.901  1.00 57.14  ? 28  ASN E N   1 
ATOM 6005  C CA  . ASN E 2 28  ? -27.791 11.492  52.787  1.00 56.88  ? 28  ASN E CA  1 
ATOM 6006  C C   . ASN E 2 28  ? -26.526 11.990  52.112  1.00 56.10  ? 28  ASN E C   1 
ATOM 6007  O O   . ASN E 2 28  ? -26.413 11.961  50.878  1.00 55.61  ? 28  ASN E O   1 
ATOM 6008  C CB  . ASN E 2 28  ? -27.767 9.963   52.958  1.00 57.38  ? 28  ASN E CB  1 
ATOM 6009  C CG  . ASN E 2 28  ? -26.480 9.459   53.606  1.00 59.76  ? 28  ASN E CG  1 
ATOM 6010  O OD1 . ASN E 2 28  ? -25.450 9.372   52.947  1.00 67.37  ? 28  ASN E OD1 1 
ATOM 6011  N ND2 . ASN E 2 28  ? -26.535 9.129   54.900  1.00 60.44  ? 28  ASN E ND2 1 
ATOM 6012  N N   . VAL E 2 29  ? -25.599 12.488  52.920  1.00 51.91  ? 29  VAL E N   1 
ATOM 6013  C CA  . VAL E 2 29  ? -24.337 12.978  52.402  1.00 50.09  ? 29  VAL E CA  1 
ATOM 6014  C C   . VAL E 2 29  ? -23.275 12.373  53.290  1.00 50.02  ? 29  VAL E C   1 
ATOM 6015  O O   . VAL E 2 29  ? -22.091 12.683  53.184  1.00 51.49  ? 29  VAL E O   1 
ATOM 6016  C CB  . VAL E 2 29  ? -24.266 14.511  52.456  1.00 48.17  ? 29  VAL E CB  1 
ATOM 6017  C CG1 . VAL E 2 29  ? -25.364 15.107  51.593  1.00 46.25  ? 29  VAL E CG1 1 
ATOM 6018  C CG2 . VAL E 2 29  ? -24.408 14.985  53.882  1.00 50.09  ? 29  VAL E CG2 1 
ATOM 6019  N N   . ASP E 2 30  ? -23.725 11.506  54.185  1.00 48.62  ? 30  ASP E N   1 
ATOM 6020  C CA  . ASP E 2 30  ? -22.823 10.815  55.082  1.00 51.01  ? 30  ASP E CA  1 
ATOM 6021  C C   . ASP E 2 30  ? -22.045 11.742  55.980  1.00 50.79  ? 30  ASP E C   1 
ATOM 6022  O O   . ASP E 2 30  ? -22.550 12.163  57.014  1.00 55.09  ? 30  ASP E O   1 
ATOM 6023  C CB  . ASP E 2 30  ? -21.861 9.950   54.279  1.00 51.62  ? 30  ASP E CB  1 
ATOM 6024  C CG  . ASP E 2 30  ? -22.591 8.968   53.392  1.00 56.64  ? 30  ASP E CG  1 
ATOM 6025  O OD1 . ASP E 2 30  ? -23.509 8.285   53.908  1.00 59.06  ? 30  ASP E OD1 1 
ATOM 6026  O OD2 . ASP E 2 30  ? -22.253 8.880   52.188  1.00 60.14  ? 30  ASP E OD2 1 
ATOM 6027  N N   . THR E 2 31  ? -20.813 12.056  55.607  1.00 48.04  ? 31  THR E N   1 
ATOM 6028  C CA  . THR E 2 31  ? -20.013 12.938  56.442  1.00 48.00  ? 31  THR E CA  1 
ATOM 6029  C C   . THR E 2 31  ? -19.244 13.974  55.631  1.00 47.00  ? 31  THR E C   1 
ATOM 6030  O O   . THR E 2 31  ? -18.344 14.662  56.140  1.00 45.22  ? 31  THR E O   1 
ATOM 6031  C CB  . THR E 2 31  ? -19.045 12.113  57.289  1.00 47.27  ? 31  THR E CB  1 
ATOM 6032  O OG1 . THR E 2 31  ? -18.396 11.148  56.460  1.00 52.76  ? 31  THR E OG1 1 
ATOM 6033  C CG2 . THR E 2 31  ? -19.796 11.395  58.390  1.00 46.42  ? 31  THR E CG2 1 
ATOM 6034  N N   . TYR E 2 32  ? -19.632 14.090  54.368  1.00 45.45  ? 32  TYR E N   1 
ATOM 6035  C CA  . TYR E 2 32  ? -18.997 15.009  53.441  1.00 43.83  ? 32  TYR E CA  1 
ATOM 6036  C C   . TYR E 2 32  ? -19.538 16.417  53.590  1.00 39.87  ? 32  TYR E C   1 
ATOM 6037  O O   . TYR E 2 32  ? -19.884 17.091  52.619  1.00 37.58  ? 32  TYR E O   1 
ATOM 6038  C CB  . TYR E 2 32  ? -19.183 14.465  52.026  1.00 49.34  ? 32  TYR E CB  1 
ATOM 6039  C CG  . TYR E 2 32  ? -18.622 13.063  51.920  1.00 53.21  ? 32  TYR E CG  1 
ATOM 6040  C CD1 . TYR E 2 32  ? -19.398 12.000  51.467  1.00 51.50  ? 32  TYR E CD1 1 
ATOM 6041  C CD2 . TYR E 2 32  ? -17.315 12.796  52.333  1.00 57.51  ? 32  TYR E CD2 1 
ATOM 6042  C CE1 . TYR E 2 32  ? -18.882 10.712  51.437  1.00 54.40  ? 32  TYR E CE1 1 
ATOM 6043  C CE2 . TYR E 2 32  ? -16.796 11.522  52.305  1.00 57.73  ? 32  TYR E CE2 1 
ATOM 6044  C CZ  . TYR E 2 32  ? -17.577 10.485  51.860  1.00 55.82  ? 32  TYR E CZ  1 
ATOM 6045  O OH  . TYR E 2 32  ? -17.037 9.220   51.856  1.00 61.20  ? 32  TYR E OH  1 
ATOM 6046  N N   . VAL E 2 33  ? -19.593 16.850  54.840  1.00 36.67  ? 33  VAL E N   1 
ATOM 6047  C CA  . VAL E 2 33  ? -20.080 18.165  55.170  1.00 30.85  ? 33  VAL E CA  1 
ATOM 6048  C C   . VAL E 2 33  ? -18.992 18.932  55.905  1.00 30.47  ? 33  VAL E C   1 
ATOM 6049  O O   . VAL E 2 33  ? -18.122 18.331  56.532  1.00 30.38  ? 33  VAL E O   1 
ATOM 6050  C CB  . VAL E 2 33  ? -21.320 18.047  56.014  1.00 23.99  ? 33  VAL E CB  1 
ATOM 6051  C CG1 . VAL E 2 33  ? -21.762 19.389  56.474  1.00 24.45  ? 33  VAL E CG1 1 
ATOM 6052  C CG2 . VAL E 2 33  ? -22.402 17.411  55.188  1.00 25.89  ? 33  VAL E CG2 1 
ATOM 6053  N N   . PHE E 2 34  ? -19.039 20.258  55.795  1.00 29.48  ? 34  PHE E N   1 
ATOM 6054  C CA  . PHE E 2 34  ? -18.057 21.139  56.411  1.00 29.46  ? 34  PHE E CA  1 
ATOM 6055  C C   . PHE E 2 34  ? -18.618 22.549  56.581  1.00 32.28  ? 34  PHE E C   1 
ATOM 6056  O O   . PHE E 2 34  ? -19.535 22.961  55.857  1.00 35.19  ? 34  PHE E O   1 
ATOM 6057  C CB  . PHE E 2 34  ? -16.809 21.167  55.545  1.00 31.21  ? 34  PHE E CB  1 
ATOM 6058  C CG  . PHE E 2 34  ? -17.107 21.268  54.080  1.00 33.58  ? 34  PHE E CG  1 
ATOM 6059  C CD1 . PHE E 2 34  ? -17.194 22.504  53.457  1.00 34.92  ? 34  PHE E CD1 1 
ATOM 6060  C CD2 . PHE E 2 34  ? -17.359 20.125  53.333  1.00 34.21  ? 34  PHE E CD2 1 
ATOM 6061  C CE1 . PHE E 2 34  ? -17.527 22.602  52.114  1.00 31.55  ? 34  PHE E CE1 1 
ATOM 6062  C CE2 . PHE E 2 34  ? -17.698 20.216  51.986  1.00 32.36  ? 34  PHE E CE2 1 
ATOM 6063  C CZ  . PHE E 2 34  ? -17.780 21.460  51.378  1.00 26.10  ? 34  PHE E CZ  1 
ATOM 6064  N N   . TRP E 2 35  ? -18.048 23.289  57.531  1.00 31.10  ? 35  TRP E N   1 
ATOM 6065  C CA  . TRP E 2 35  ? -18.507 24.636  57.841  1.00 28.78  ? 35  TRP E CA  1 
ATOM 6066  C C   . TRP E 2 35  ? -17.526 25.754  57.602  1.00 25.90  ? 35  TRP E C   1 
ATOM 6067  O O   . TRP E 2 35  ? -16.325 25.610  57.837  1.00 21.57  ? 35  TRP E O   1 
ATOM 6068  C CB  . TRP E 2 35  ? -18.938 24.723  59.301  1.00 32.35  ? 35  TRP E CB  1 
ATOM 6069  C CG  . TRP E 2 35  ? -20.062 23.803  59.681  1.00 35.52  ? 35  TRP E CG  1 
ATOM 6070  C CD1 . TRP E 2 35  ? -19.958 22.492  60.033  1.00 36.54  ? 35  TRP E CD1 1 
ATOM 6071  C CD2 . TRP E 2 35  ? -21.459 24.136  59.772  1.00 36.24  ? 35  TRP E CD2 1 
ATOM 6072  N NE1 . TRP E 2 35  ? -21.204 21.982  60.341  1.00 38.48  ? 35  TRP E NE1 1 
ATOM 6073  C CE2 . TRP E 2 35  ? -22.142 22.971  60.187  1.00 37.07  ? 35  TRP E CE2 1 
ATOM 6074  C CE3 . TRP E 2 35  ? -22.198 25.305  59.544  1.00 34.88  ? 35  TRP E CE3 1 
ATOM 6075  C CZ2 . TRP E 2 35  ? -23.535 22.938  60.383  1.00 39.63  ? 35  TRP E CZ2 1 
ATOM 6076  C CZ3 . TRP E 2 35  ? -23.584 25.274  59.740  1.00 36.74  ? 35  TRP E CZ3 1 
ATOM 6077  C CH2 . TRP E 2 35  ? -24.235 24.094  60.153  1.00 36.78  ? 35  TRP E CH2 1 
ATOM 6078  N N   . PHE E 2 36  ? -18.072 26.887  57.167  1.00 28.37  ? 36  PHE E N   1 
ATOM 6079  C CA  . PHE E 2 36  ? -17.287 28.088  56.902  1.00 27.96  ? 36  PHE E CA  1 
ATOM 6080  C C   . PHE E 2 36  ? -17.741 29.221  57.795  1.00 28.88  ? 36  PHE E C   1 
ATOM 6081  O O   . PHE E 2 36  ? -18.927 29.316  58.136  1.00 27.06  ? 36  PHE E O   1 
ATOM 6082  C CB  . PHE E 2 36  ? -17.460 28.557  55.457  1.00 33.16  ? 36  PHE E CB  1 
ATOM 6083  C CG  . PHE E 2 36  ? -16.939 27.597  54.429  1.00 37.31  ? 36  PHE E CG  1 
ATOM 6084  C CD1 . PHE E 2 36  ? -17.809 26.983  53.528  1.00 39.24  ? 36  PHE E CD1 1 
ATOM 6085  C CD2 . PHE E 2 36  ? -15.583 27.317  54.348  1.00 36.46  ? 36  PHE E CD2 1 
ATOM 6086  C CE1 . PHE E 2 36  ? -17.330 26.109  52.566  1.00 38.55  ? 36  PHE E CE1 1 
ATOM 6087  C CE2 . PHE E 2 36  ? -15.094 26.440  53.385  1.00 38.56  ? 36  PHE E CE2 1 
ATOM 6088  C CZ  . PHE E 2 36  ? -15.965 25.838  52.497  1.00 38.01  ? 36  PHE E CZ  1 
ATOM 6089  N N   . GLN E 2 37  ? -16.793 30.079  58.171  1.00 30.28  ? 37  GLN E N   1 
ATOM 6090  C CA  . GLN E 2 37  ? -17.102 31.259  58.984  1.00 32.53  ? 37  GLN E CA  1 
ATOM 6091  C C   . GLN E 2 37  ? -16.661 32.478  58.192  1.00 33.14  ? 37  GLN E C   1 
ATOM 6092  O O   . GLN E 2 37  ? -15.461 32.721  58.044  1.00 35.66  ? 37  GLN E O   1 
ATOM 6093  C CB  . GLN E 2 37  ? -16.342 31.253  60.305  1.00 30.82  ? 37  GLN E CB  1 
ATOM 6094  C CG  . GLN E 2 37  ? -16.518 32.554  61.077  1.00 27.88  ? 37  GLN E CG  1 
ATOM 6095  C CD  . GLN E 2 37  ? -15.372 32.837  62.027  1.00 27.81  ? 37  GLN E CD  1 
ATOM 6096  O OE1 . GLN E 2 37  ? -14.226 33.006  61.597  1.00 30.98  ? 37  GLN E OE1 1 
ATOM 6097  N NE2 . GLN E 2 37  ? -15.671 32.896  63.329  1.00 28.94  ? 37  GLN E NE2 1 
ATOM 6098  N N   . GLN E 2 38  ? -17.613 33.246  57.679  1.00 32.81  ? 38  GLN E N   1 
ATOM 6099  C CA  . GLN E 2 38  ? -17.251 34.423  56.903  1.00 33.80  ? 38  GLN E CA  1 
ATOM 6100  C C   . GLN E 2 38  ? -17.609 35.737  57.600  1.00 36.26  ? 38  GLN E C   1 
ATOM 6101  O O   . GLN E 2 38  ? -18.782 36.124  57.668  1.00 37.84  ? 38  GLN E O   1 
ATOM 6102  C CB  . GLN E 2 38  ? -17.920 34.369  55.536  1.00 31.58  ? 38  GLN E CB  1 
ATOM 6103  C CG  . GLN E 2 38  ? -17.582 35.569  54.667  1.00 29.87  ? 38  GLN E CG  1 
ATOM 6104  C CD  . GLN E 2 38  ? -18.155 35.469  53.254  1.00 30.10  ? 38  GLN E CD  1 
ATOM 6105  O OE1 . GLN E 2 38  ? -19.299 35.039  53.068  1.00 24.58  ? 38  GLN E OE1 1 
ATOM 6106  N NE2 . GLN E 2 38  ? -17.365 35.878  52.254  1.00 25.32  ? 38  GLN E NE2 1 
ATOM 6107  N N   . LYS E 2 39  ? -16.587 36.411  58.119  1.00 38.92  ? 39  LYS E N   1 
ATOM 6108  C CA  . LYS E 2 39  ? -16.751 37.689  58.807  1.00 41.27  ? 39  LYS E CA  1 
ATOM 6109  C C   . LYS E 2 39  ? -16.968 38.772  57.754  1.00 44.24  ? 39  LYS E C   1 
ATOM 6110  O O   . LYS E 2 39  ? -16.733 38.537  56.571  1.00 45.57  ? 39  LYS E O   1 
ATOM 6111  C CB  . LYS E 2 39  ? -15.502 38.003  59.637  1.00 36.26  ? 39  LYS E CB  1 
ATOM 6112  C CG  . LYS E 2 39  ? -15.410 37.214  60.943  1.00 35.85  ? 39  LYS E CG  1 
ATOM 6113  C CD  . LYS E 2 39  ? -14.051 37.406  61.612  1.00 42.90  ? 39  LYS E CD  1 
ATOM 6114  C CE  . LYS E 2 39  ? -14.003 36.794  63.017  1.00 43.32  ? 39  LYS E CE  1 
ATOM 6115  N NZ  . LYS E 2 39  ? -12.650 36.905  63.674  1.00 49.91  ? 39  LYS E NZ  1 
ATOM 6116  N N   . PRO E 2 40  ? -17.427 39.971  58.163  1.00 46.45  ? 40  PRO E N   1 
ATOM 6117  C CA  . PRO E 2 40  ? -17.659 41.058  57.203  1.00 43.88  ? 40  PRO E CA  1 
ATOM 6118  C C   . PRO E 2 40  ? -16.368 41.493  56.507  1.00 43.59  ? 40  PRO E C   1 
ATOM 6119  O O   . PRO E 2 40  ? -15.356 41.768  57.165  1.00 42.25  ? 40  PRO E O   1 
ATOM 6120  C CB  . PRO E 2 40  ? -18.245 42.154  58.076  1.00 45.05  ? 40  PRO E CB  1 
ATOM 6121  C CG  . PRO E 2 40  ? -17.525 41.937  59.390  1.00 47.19  ? 40  PRO E CG  1 
ATOM 6122  C CD  . PRO E 2 40  ? -17.636 40.442  59.546  1.00 44.67  ? 40  PRO E CD  1 
ATOM 6123  N N   . ASP E 2 41  ? -16.422 41.542  55.175  1.00 46.19  ? 41  ASP E N   1 
ATOM 6124  C CA  . ASP E 2 41  ? -15.282 41.918  54.325  1.00 50.80  ? 41  ASP E CA  1 
ATOM 6125  C C   . ASP E 2 41  ? -14.111 40.954  54.410  1.00 51.89  ? 41  ASP E C   1 
ATOM 6126  O O   . ASP E 2 41  ? -12.965 41.381  54.589  1.00 51.42  ? 41  ASP E O   1 
ATOM 6127  C CB  . ASP E 2 41  ? -14.760 43.318  54.660  1.00 55.37  ? 41  ASP E CB  1 
ATOM 6128  C CG  . ASP E 2 41  ? -15.744 44.411  54.299  1.00 62.76  ? 41  ASP E CG  1 
ATOM 6129  O OD1 . ASP E 2 41  ? -16.390 44.309  53.228  1.00 67.26  ? 41  ASP E OD1 1 
ATOM 6130  O OD2 . ASP E 2 41  ? -15.859 45.379  55.083  1.00 64.28  ? 41  ASP E OD2 1 
ATOM 6131  N N   . GLN E 2 42  ? -14.400 39.661  54.275  1.00 49.95  ? 42  GLN E N   1 
ATOM 6132  C CA  . GLN E 2 42  ? -13.377 38.624  54.326  1.00 41.57  ? 42  GLN E CA  1 
ATOM 6133  C C   . GLN E 2 42  ? -13.811 37.412  53.527  1.00 38.82  ? 42  GLN E C   1 
ATOM 6134  O O   . GLN E 2 42  ? -14.990 37.064  53.501  1.00 40.41  ? 42  GLN E O   1 
ATOM 6135  C CB  . GLN E 2 42  ? -13.143 38.176  55.758  1.00 37.00  ? 42  GLN E CB  1 
ATOM 6136  C CG  . GLN E 2 42  ? -12.649 39.240  56.675  1.00 36.68  ? 42  GLN E CG  1 
ATOM 6137  C CD  . GLN E 2 42  ? -12.014 38.636  57.895  1.00 40.12  ? 42  GLN E CD  1 
ATOM 6138  O OE1 . GLN E 2 42  ? -12.641 37.853  58.608  1.00 44.65  ? 42  GLN E OE1 1 
ATOM 6139  N NE2 . GLN E 2 42  ? -10.759 38.981  58.140  1.00 41.62  ? 42  GLN E NE2 1 
ATOM 6140  N N   . SER E 2 43  ? -12.867 36.756  52.872  1.00 34.33  ? 43  SER E N   1 
ATOM 6141  C CA  . SER E 2 43  ? -13.215 35.562  52.123  1.00 30.67  ? 43  SER E CA  1 
ATOM 6142  C C   . SER E 2 43  ? -13.620 34.528  53.172  1.00 28.36  ? 43  SER E C   1 
ATOM 6143  O O   . SER E 2 43  ? -13.201 34.621  54.320  1.00 30.11  ? 43  SER E O   1 
ATOM 6144  C CB  . SER E 2 43  ? -12.001 35.081  51.343  1.00 32.74  ? 43  SER E CB  1 
ATOM 6145  O OG  . SER E 2 43  ? -10.904 34.885  52.213  1.00 41.25  ? 43  SER E OG  1 
ATOM 6146  N N   . PRO E 2 44  ? -14.452 33.542  52.808  1.00 26.52  ? 44  PRO E N   1 
ATOM 6147  C CA  . PRO E 2 44  ? -14.834 32.553  53.822  1.00 23.20  ? 44  PRO E CA  1 
ATOM 6148  C C   . PRO E 2 44  ? -13.603 31.884  54.402  1.00 23.08  ? 44  PRO E C   1 
ATOM 6149  O O   . PRO E 2 44  ? -12.535 31.893  53.794  1.00 21.47  ? 44  PRO E O   1 
ATOM 6150  C CB  . PRO E 2 44  ? -15.693 31.566  53.046  1.00 22.68  ? 44  PRO E CB  1 
ATOM 6151  C CG  . PRO E 2 44  ? -16.321 32.410  52.004  1.00 27.68  ? 44  PRO E CG  1 
ATOM 6152  C CD  . PRO E 2 44  ? -15.176 33.307  51.548  1.00 28.31  ? 44  PRO E CD  1 
ATOM 6153  N N   . LYS E 2 45  ? -13.754 31.324  55.595  1.00 25.44  ? 45  LYS E N   1 
ATOM 6154  C CA  . LYS E 2 45  ? -12.660 30.629  56.255  1.00 23.46  ? 45  LYS E CA  1 
ATOM 6155  C C   . LYS E 2 45  ? -13.192 29.269  56.643  1.00 22.68  ? 45  LYS E C   1 
ATOM 6156  O O   . LYS E 2 45  ? -14.353 29.127  57.069  1.00 21.76  ? 45  LYS E O   1 
ATOM 6157  C CB  . LYS E 2 45  ? -12.199 31.383  57.504  1.00 28.41  ? 45  LYS E CB  1 
ATOM 6158  C CG  . LYS E 2 45  ? -11.471 32.693  57.207  1.00 42.62  ? 45  LYS E CG  1 
ATOM 6159  C CD  . LYS E 2 45  ? -11.537 33.701  58.403  1.00 54.30  ? 45  LYS E CD  1 
ATOM 6160  C CE  . LYS E 2 45  ? -12.963 34.313  58.671  1.00 54.21  ? 45  LYS E CE  1 
ATOM 6161  N NZ  . LYS E 2 45  ? -13.522 35.236  57.596  1.00 47.18  ? 45  LYS E NZ  1 
ATOM 6162  N N   . LEU E 2 46  ? -12.345 28.262  56.479  1.00 21.84  ? 46  LEU E N   1 
ATOM 6163  C CA  . LEU E 2 46  ? -12.736 26.904  56.813  1.00 23.35  ? 46  LEU E CA  1 
ATOM 6164  C C   . LEU E 2 46  ? -12.810 26.765  58.323  1.00 20.68  ? 46  LEU E C   1 
ATOM 6165  O O   . LEU E 2 46  ? -11.798 26.843  59.021  1.00 20.67  ? 46  LEU E O   1 
ATOM 6166  C CB  . LEU E 2 46  ? -11.725 25.919  56.240  1.00 22.33  ? 46  LEU E CB  1 
ATOM 6167  C CG  . LEU E 2 46  ? -12.099 24.452  56.375  1.00 17.12  ? 46  LEU E CG  1 
ATOM 6168  C CD1 . LEU E 2 46  ? -13.425 24.161  55.658  1.00 11.49  ? 46  LEU E CD1 1 
ATOM 6169  C CD2 . LEU E 2 46  ? -10.971 23.640  55.794  1.00 17.18  ? 46  LEU E CD2 1 
ATOM 6170  N N   . LEU E 2 47  ? -14.018 26.565  58.821  1.00 19.19  ? 47  LEU E N   1 
ATOM 6171  C CA  . LEU E 2 47  ? -14.230 26.448  60.253  1.00 25.83  ? 47  LEU E CA  1 
ATOM 6172  C C   . LEU E 2 47  ? -14.140 24.993  60.682  1.00 28.61  ? 47  LEU E C   1 
ATOM 6173  O O   . LEU E 2 47  ? -13.174 24.558  61.306  1.00 29.26  ? 47  LEU E O   1 
ATOM 6174  C CB  . LEU E 2 47  ? -15.609 27.010  60.595  1.00 31.77  ? 47  LEU E CB  1 
ATOM 6175  C CG  . LEU E 2 47  ? -15.863 27.307  62.067  1.00 31.12  ? 47  LEU E CG  1 
ATOM 6176  C CD1 . LEU E 2 47  ? -14.889 28.386  62.512  1.00 28.13  ? 47  LEU E CD1 1 
ATOM 6177  C CD2 . LEU E 2 47  ? -17.319 27.721  62.277  1.00 25.91  ? 47  LEU E CD2 1 
ATOM 6178  N N   . LEU E 2 48  ? -15.173 24.246  60.336  1.00 34.20  ? 48  LEU E N   1 
ATOM 6179  C CA  . LEU E 2 48  ? -15.239 22.830  60.639  1.00 40.23  ? 48  LEU E CA  1 
ATOM 6180  C C   . LEU E 2 48  ? -15.127 22.055  59.320  1.00 43.58  ? 48  LEU E C   1 
ATOM 6181  O O   . LEU E 2 48  ? -16.040 22.093  58.483  1.00 46.30  ? 48  LEU E O   1 
ATOM 6182  C CB  . LEU E 2 48  ? -16.575 22.520  61.323  1.00 40.44  ? 48  LEU E CB  1 
ATOM 6183  C CG  . LEU E 2 48  ? -16.523 22.010  62.765  1.00 36.55  ? 48  LEU E CG  1 
ATOM 6184  C CD1 . LEU E 2 48  ? -15.401 22.694  63.549  1.00 33.57  ? 48  LEU E CD1 1 
ATOM 6185  C CD2 . LEU E 2 48  ? -17.876 22.250  63.414  1.00 31.62  ? 48  LEU E CD2 1 
ATOM 6186  N N   . TYR E 2 49  ? -13.992 21.394  59.114  1.00 43.43  ? 49  TYR E N   1 
ATOM 6187  C CA  . TYR E 2 49  ? -13.781 20.589  57.907  1.00 43.07  ? 49  TYR E CA  1 
ATOM 6188  C C   . TYR E 2 49  ? -14.358 19.242  58.323  1.00 43.99  ? 49  TYR E C   1 
ATOM 6189  O O   . TYR E 2 49  ? -13.944 18.699  59.337  1.00 43.34  ? 49  TYR E O   1 
ATOM 6190  C CB  . TYR E 2 49  ? -12.285 20.496  57.613  1.00 44.26  ? 49  TYR E CB  1 
ATOM 6191  C CG  . TYR E 2 49  ? -11.520 19.590  58.533  1.00 45.92  ? 49  TYR E CG  1 
ATOM 6192  C CD1 . TYR E 2 49  ? -11.536 18.215  58.345  1.00 45.11  ? 49  TYR E CD1 1 
ATOM 6193  C CD2 . TYR E 2 49  ? -10.805 20.101  59.614  1.00 47.48  ? 49  TYR E CD2 1 
ATOM 6194  C CE1 . TYR E 2 49  ? -10.863 17.363  59.210  1.00 44.82  ? 49  TYR E CE1 1 
ATOM 6195  C CE2 . TYR E 2 49  ? -10.127 19.256  60.486  1.00 46.85  ? 49  TYR E CE2 1 
ATOM 6196  C CZ  . TYR E 2 49  ? -10.165 17.887  60.272  1.00 46.49  ? 49  TYR E CZ  1 
ATOM 6197  O OH  . TYR E 2 49  ? -9.522  17.027  61.120  1.00 49.25  ? 49  TYR E OH  1 
ATOM 6198  N N   . GLY E 2 50  ? -15.317 18.698  57.582  1.00 46.87  ? 50  GLY E N   1 
ATOM 6199  C CA  . GLY E 2 50  ? -15.931 17.455  58.047  1.00 49.83  ? 50  GLY E CA  1 
ATOM 6200  C C   . GLY E 2 50  ? -16.678 17.760  59.360  1.00 48.05  ? 50  GLY E C   1 
ATOM 6201  O O   . GLY E 2 50  ? -16.120 18.444  60.231  1.00 46.23  ? 50  GLY E O   1 
ATOM 6202  N N   . PRO E 2 51  ? -17.924 17.270  59.557  1.00 48.74  ? 51  PRO E N   1 
ATOM 6203  C CA  . PRO E 2 51  ? -18.625 17.585  60.817  1.00 47.61  ? 51  PRO E CA  1 
ATOM 6204  C C   . PRO E 2 51  ? -17.791 17.320  62.063  1.00 48.91  ? 51  PRO E C   1 
ATOM 6205  O O   . PRO E 2 51  ? -16.844 16.529  62.037  1.00 53.58  ? 51  PRO E O   1 
ATOM 6206  C CB  . PRO E 2 51  ? -19.880 16.715  60.750  1.00 43.44  ? 51  PRO E CB  1 
ATOM 6207  C CG  . PRO E 2 51  ? -19.435 15.538  59.928  1.00 44.50  ? 51  PRO E CG  1 
ATOM 6208  C CD  . PRO E 2 51  ? -18.619 16.188  58.831  1.00 46.53  ? 51  PRO E CD  1 
ATOM 6209  N N   . SER E 2 52  ? -18.123 18.004  63.145  1.00 46.24  ? 52  SER E N   1 
ATOM 6210  C CA  . SER E 2 52  ? -17.398 17.830  64.406  1.00 47.87  ? 52  SER E CA  1 
ATOM 6211  C C   . SER E 2 52  ? -15.864 17.804  64.321  1.00 45.00  ? 52  SER E C   1 
ATOM 6212  O O   . SER E 2 52  ? -15.235 17.048  65.052  1.00 42.50  ? 52  SER E O   1 
ATOM 6213  C CB  . SER E 2 52  ? -17.829 16.540  65.074  1.00 49.11  ? 52  SER E CB  1 
ATOM 6214  O OG  . SER E 2 52  ? -17.072 15.465  64.554  1.00 53.23  ? 52  SER E OG  1 
ATOM 6215  N N   . ASN E 2 53  ? -15.264 18.619  63.457  1.00 46.14  ? 53  ASN E N   1 
ATOM 6216  C CA  . ASN E 2 53  ? -13.806 18.646  63.343  1.00 48.30  ? 53  ASN E CA  1 
ATOM 6217  C C   . ASN E 2 53  ? -13.211 20.029  63.138  1.00 47.54  ? 53  ASN E C   1 
ATOM 6218  O O   . ASN E 2 53  ? -13.260 20.572  62.037  1.00 49.54  ? 53  ASN E O   1 
ATOM 6219  C CB  . ASN E 2 53  ? -13.376 17.744  62.202  1.00 53.72  ? 53  ASN E CB  1 
ATOM 6220  C CG  . ASN E 2 53  ? -13.320 16.309  62.615  1.00 55.21  ? 53  ASN E CG  1 
ATOM 6221  O OD1 . ASN E 2 53  ? -12.414 15.921  63.352  1.00 60.93  ? 53  ASN E OD1 1 
ATOM 6222  N ND2 . ASN E 2 53  ? -14.295 15.506  62.169  1.00 46.88  ? 53  ASN E ND2 1 
ATOM 6223  N N   . ARG E 2 54  ? -12.626 20.593  64.184  1.00 45.14  ? 54  ARG E N   1 
ATOM 6224  C CA  . ARG E 2 54  ? -12.064 21.931  64.072  1.00 45.10  ? 54  ARG E CA  1 
ATOM 6225  C C   . ARG E 2 54  ? -10.824 22.010  63.199  1.00 41.20  ? 54  ARG E C   1 
ATOM 6226  O O   . ARG E 2 54  ? -9.819  21.358  63.469  1.00 40.68  ? 54  ARG E O   1 
ATOM 6227  C CB  . ARG E 2 54  ? -11.768 22.504  65.466  1.00 51.10  ? 54  ARG E CB  1 
ATOM 6228  C CG  . ARG E 2 54  ? -13.037 22.946  66.204  1.00 57.93  ? 54  ARG E CG  1 
ATOM 6229  C CD  . ARG E 2 54  ? -12.788 23.486  67.613  1.00 63.04  ? 54  ARG E CD  1 
ATOM 6230  N NE  . ARG E 2 54  ? -12.602 22.433  68.611  1.00 63.52  ? 54  ARG E NE  1 
ATOM 6231  C CZ  . ARG E 2 54  ? -11.416 22.006  69.036  1.00 67.71  ? 54  ARG E CZ  1 
ATOM 6232  N NH1 . ARG E 2 54  ? -10.293 22.538  68.555  1.00 69.55  ? 54  ARG E NH1 1 
ATOM 6233  N NH2 . ARG E 2 54  ? -11.353 21.046  69.952  1.00 67.92  ? 54  ARG E NH2 1 
ATOM 6234  N N   . TYR E 2 55  ? -10.903 22.813  62.142  1.00 35.90  ? 55  TYR E N   1 
ATOM 6235  C CA  . TYR E 2 55  ? -9.774  22.983  61.240  1.00 28.79  ? 55  TYR E CA  1 
ATOM 6236  C C   . TYR E 2 55  ? -8.669  23.731  61.990  1.00 30.41  ? 55  TYR E C   1 
ATOM 6237  O O   . TYR E 2 55  ? -8.910  24.327  63.031  1.00 28.41  ? 55  TYR E O   1 
ATOM 6238  C CB  . TYR E 2 55  ? -10.199 23.774  59.993  1.00 24.76  ? 55  TYR E CB  1 
ATOM 6239  C CG  . TYR E 2 55  ? -9.088  23.970  58.966  1.00 20.74  ? 55  TYR E CG  1 
ATOM 6240  C CD1 . TYR E 2 55  ? -8.840  25.219  58.401  1.00 19.73  ? 55  TYR E CD1 1 
ATOM 6241  C CD2 . TYR E 2 55  ? -8.269  22.914  58.586  1.00 17.22  ? 55  TYR E CD2 1 
ATOM 6242  C CE1 . TYR E 2 55  ? -7.801  25.408  57.492  1.00 19.97  ? 55  TYR E CE1 1 
ATOM 6243  C CE2 . TYR E 2 55  ? -7.226  23.091  57.672  1.00 21.08  ? 55  TYR E CE2 1 
ATOM 6244  C CZ  . TYR E 2 55  ? -6.995  24.342  57.130  1.00 21.67  ? 55  TYR E CZ  1 
ATOM 6245  O OH  . TYR E 2 55  ? -5.945  24.523  56.247  1.00 18.96  ? 55  TYR E OH  1 
ATOM 6246  N N   . THR E 2 56  ? -7.456  23.683  61.464  1.00 33.36  ? 56  THR E N   1 
ATOM 6247  C CA  . THR E 2 56  ? -6.328  24.358  62.076  1.00 39.10  ? 56  THR E CA  1 
ATOM 6248  C C   . THR E 2 56  ? -6.697  25.749  62.550  1.00 44.23  ? 56  THR E C   1 
ATOM 6249  O O   . THR E 2 56  ? -7.168  26.574  61.757  1.00 43.12  ? 56  THR E O   1 
ATOM 6250  C CB  . THR E 2 56  ? -5.179  24.492  61.082  1.00 40.18  ? 56  THR E CB  1 
ATOM 6251  O OG1 . THR E 2 56  ? -4.620  23.196  60.841  1.00 44.64  ? 56  THR E OG1 1 
ATOM 6252  C CG2 . THR E 2 56  ? -4.105  25.435  61.619  1.00 44.72  ? 56  THR E CG2 1 
ATOM 6253  N N   . GLY E 2 57  ? -6.461  26.009  63.838  1.00 49.52  ? 57  GLY E N   1 
ATOM 6254  C CA  . GLY E 2 57  ? -6.768  27.314  64.410  1.00 51.54  ? 57  GLY E CA  1 
ATOM 6255  C C   . GLY E 2 57  ? -8.002  27.278  65.289  1.00 52.41  ? 57  GLY E C   1 
ATOM 6256  O O   . GLY E 2 57  ? -7.902  27.196  66.511  1.00 56.27  ? 57  GLY E O   1 
ATOM 6257  N N   . VAL E 2 58  ? -9.167  27.326  64.654  1.00 53.20  ? 58  VAL E N   1 
ATOM 6258  C CA  . VAL E 2 58  ? -10.462 27.296  65.329  1.00 51.42  ? 58  VAL E CA  1 
ATOM 6259  C C   . VAL E 2 58  ? -10.444 26.898  66.818  1.00 51.48  ? 58  VAL E C   1 
ATOM 6260  O O   . VAL E 2 58  ? -10.058 25.779  67.176  1.00 50.33  ? 58  VAL E O   1 
ATOM 6261  C CB  . VAL E 2 58  ? -11.425 26.342  64.595  1.00 50.87  ? 58  VAL E CB  1 
ATOM 6262  C CG1 . VAL E 2 58  ? -12.855 26.614  65.025  1.00 51.91  ? 58  VAL E CG1 1 
ATOM 6263  C CG2 . VAL E 2 58  ? -11.281 26.502  63.099  1.00 50.29  ? 58  VAL E CG2 1 
ATOM 6264  N N   . PRO E 2 59  ? -10.869 27.819  67.703  1.00 52.23  ? 59  PRO E N   1 
ATOM 6265  C CA  . PRO E 2 59  ? -10.921 27.602  69.155  1.00 50.75  ? 59  PRO E CA  1 
ATOM 6266  C C   . PRO E 2 59  ? -11.977 26.569  69.571  1.00 49.58  ? 59  PRO E C   1 
ATOM 6267  O O   . PRO E 2 59  ? -13.050 26.462  68.956  1.00 46.40  ? 59  PRO E O   1 
ATOM 6268  C CB  . PRO E 2 59  ? -11.222 28.997  69.694  1.00 52.66  ? 59  PRO E CB  1 
ATOM 6269  C CG  . PRO E 2 59  ? -12.063 29.604  68.578  1.00 54.75  ? 59  PRO E CG  1 
ATOM 6270  C CD  . PRO E 2 59  ? -11.269 29.202  67.367  1.00 53.03  ? 59  PRO E CD  1 
ATOM 6271  N N   . ASP E 2 60  ? -11.672 25.830  70.634  1.00 50.32  ? 60  ASP E N   1 
ATOM 6272  C CA  . ASP E 2 60  ? -12.551 24.771  71.124  1.00 52.15  ? 60  ASP E CA  1 
ATOM 6273  C C   . ASP E 2 60  ? -13.962 25.186  71.480  1.00 50.65  ? 60  ASP E C   1 
ATOM 6274  O O   . ASP E 2 60  ? -14.761 24.366  71.923  1.00 51.13  ? 60  ASP E O   1 
ATOM 6275  C CB  . ASP E 2 60  ? -11.912 24.055  72.316  1.00 60.41  ? 60  ASP E CB  1 
ATOM 6276  C CG  . ASP E 2 60  ? -10.733 24.817  72.893  1.00 71.91  ? 60  ASP E CG  1 
ATOM 6277  O OD1 . ASP E 2 60  ? -9.729  25.019  72.165  1.00 73.85  ? 60  ASP E OD1 1 
ATOM 6278  O OD2 . ASP E 2 60  ? -10.810 25.211  74.078  1.00 77.69  ? 60  ASP E OD2 1 
ATOM 6279  N N   . ARG E 2 61  ? -14.275 26.453  71.272  1.00 47.96  ? 61  ARG E N   1 
ATOM 6280  C CA  . ARG E 2 61  ? -15.605 26.973  71.564  1.00 45.61  ? 61  ARG E CA  1 
ATOM 6281  C C   . ARG E 2 61  ? -16.516 26.467  70.442  1.00 45.46  ? 61  ARG E C   1 
ATOM 6282  O O   . ARG E 2 61  ? -17.755 26.416  70.566  1.00 42.52  ? 61  ARG E O   1 
ATOM 6283  C CB  . ARG E 2 61  ? -15.507 28.501  71.586  1.00 43.93  ? 61  ARG E CB  1 
ATOM 6284  C CG  . ARG E 2 61  ? -14.041 28.909  71.793  1.00 45.20  ? 61  ARG E CG  1 
ATOM 6285  C CD  . ARG E 2 61  ? -13.807 30.309  72.339  1.00 44.86  ? 61  ARG E CD  1 
ATOM 6286  N NE  . ARG E 2 61  ? -13.643 31.339  71.316  1.00 35.65  ? 61  ARG E NE  1 
ATOM 6287  C CZ  . ARG E 2 61  ? -14.596 31.695  70.464  1.00 35.88  ? 61  ARG E CZ  1 
ATOM 6288  N NH1 . ARG E 2 61  ? -15.788 31.085  70.510  1.00 28.86  ? 61  ARG E NH1 1 
ATOM 6289  N NH2 . ARG E 2 61  ? -14.362 32.686  69.603  1.00 29.18  ? 61  ARG E NH2 1 
ATOM 6290  N N   . PHE E 2 62  ? -15.857 26.065  69.354  1.00 44.47  ? 62  PHE E N   1 
ATOM 6291  C CA  . PHE E 2 62  ? -16.515 25.558  68.151  1.00 42.37  ? 62  PHE E CA  1 
ATOM 6292  C C   . PHE E 2 62  ? -16.545 24.023  68.092  1.00 42.13  ? 62  PHE E C   1 
ATOM 6293  O O   . PHE E 2 62  ? -15.544 23.347  68.367  1.00 42.64  ? 62  PHE E O   1 
ATOM 6294  C CB  . PHE E 2 62  ? -15.796 26.096  66.908  1.00 38.62  ? 62  PHE E CB  1 
ATOM 6295  C CG  . PHE E 2 62  ? -15.934 27.581  66.708  1.00 36.19  ? 62  PHE E CG  1 
ATOM 6296  C CD1 . PHE E 2 62  ? -17.085 28.118  66.130  1.00 35.12  ? 62  PHE E CD1 1 
ATOM 6297  C CD2 . PHE E 2 62  ? -14.896 28.446  67.073  1.00 38.83  ? 62  PHE E CD2 1 
ATOM 6298  C CE1 . PHE E 2 62  ? -17.207 29.500  65.911  1.00 37.97  ? 62  PHE E CE1 1 
ATOM 6299  C CE2 . PHE E 2 62  ? -14.998 29.821  66.861  1.00 34.56  ? 62  PHE E CE2 1 
ATOM 6300  C CZ  . PHE E 2 62  ? -16.162 30.352  66.275  1.00 37.06  ? 62  PHE E CZ  1 
ATOM 6301  N N   . THR E 2 63  ? -17.695 23.477  67.721  1.00 40.65  ? 63  THR E N   1 
ATOM 6302  C CA  . THR E 2 63  ? -17.849 22.034  67.620  1.00 43.55  ? 63  THR E CA  1 
ATOM 6303  C C   . THR E 2 63  ? -19.068 21.770  66.768  1.00 46.26  ? 63  THR E C   1 
ATOM 6304  O O   . THR E 2 63  ? -19.880 22.673  66.527  1.00 47.61  ? 63  THR E O   1 
ATOM 6305  C CB  . THR E 2 63  ? -18.080 21.374  69.001  1.00 44.43  ? 63  THR E CB  1 
ATOM 6306  O OG1 . THR E 2 63  ? -19.281 21.897  69.582  1.00 41.13  ? 63  THR E OG1 1 
ATOM 6307  C CG2 . THR E 2 63  ? -16.896 21.630  69.943  1.00 47.80  ? 63  THR E CG2 1 
ATOM 6308  N N   . GLY E 2 64  ? -19.207 20.533  66.316  1.00 46.97  ? 64  GLY E N   1 
ATOM 6309  C CA  . GLY E 2 64  ? -20.353 20.214  65.491  1.00 53.53  ? 64  GLY E CA  1 
ATOM 6310  C C   . GLY E 2 64  ? -20.618 18.731  65.444  1.00 53.91  ? 64  GLY E C   1 
ATOM 6311  O O   . GLY E 2 64  ? -19.903 17.948  66.067  1.00 52.24  ? 64  GLY E O   1 
ATOM 6312  N N   . SER E 2 65  ? -21.648 18.342  64.706  1.00 54.53  ? 65  SER E N   1 
ATOM 6313  C CA  . SER E 2 65  ? -21.983 16.935  64.606  1.00 55.78  ? 65  SER E CA  1 
ATOM 6314  C C   . SER E 2 65  ? -23.108 16.614  63.620  1.00 55.79  ? 65  SER E C   1 
ATOM 6315  O O   . SER E 2 65  ? -23.869 17.485  63.165  1.00 55.74  ? 65  SER E O   1 
ATOM 6316  C CB  . SER E 2 65  ? -22.384 16.395  65.974  1.00 57.91  ? 65  SER E CB  1 
ATOM 6317  O OG  . SER E 2 65  ? -23.745 16.709  66.242  1.00 62.29  ? 65  SER E OG  1 
ATOM 6318  N N   . GLY E 2 66  ? -23.205 15.327  63.320  1.00 53.57  ? 66  GLY E N   1 
ATOM 6319  C CA  . GLY E 2 66  ? -24.217 14.859  62.413  1.00 53.87  ? 66  GLY E CA  1 
ATOM 6320  C C   . GLY E 2 66  ? -23.642 13.913  61.389  1.00 55.69  ? 66  GLY E C   1 
ATOM 6321  O O   . GLY E 2 66  ? -22.443 13.599  61.363  1.00 54.13  ? 66  GLY E O   1 
ATOM 6322  N N   . SER E 2 67  ? -24.542 13.451  60.541  1.00 55.84  ? 67  SER E N   1 
ATOM 6323  C CA  . SER E 2 67  ? -24.217 12.546  59.466  1.00 57.74  ? 67  SER E CA  1 
ATOM 6324  C C   . SER E 2 67  ? -25.572 12.264  58.860  1.00 58.96  ? 67  SER E C   1 
ATOM 6325  O O   . SER E 2 67  ? -26.602 12.682  59.405  1.00 57.62  ? 67  SER E O   1 
ATOM 6326  C CB  . SER E 2 67  ? -23.597 11.252  59.992  1.00 55.71  ? 67  SER E CB  1 
ATOM 6327  O OG  . SER E 2 67  ? -24.584 10.449  60.603  1.00 52.95  ? 67  SER E OG  1 
ATOM 6328  N N   . THR E 2 68  ? -25.577 11.569  57.731  1.00 60.96  ? 68  THR E N   1 
ATOM 6329  C CA  . THR E 2 68  ? -26.826 11.248  57.076  1.00 58.80  ? 68  THR E CA  1 
ATOM 6330  C C   . THR E 2 68  ? -27.459 12.484  56.470  1.00 58.11  ? 68  THR E C   1 
ATOM 6331  O O   . THR E 2 68  ? -27.218 12.803  55.305  1.00 59.79  ? 68  THR E O   1 
ATOM 6332  C CB  . THR E 2 68  ? -27.810 10.610  58.076  1.00 59.70  ? 68  THR E CB  1 
ATOM 6333  O OG1 . THR E 2 68  ? -27.317 9.315   58.447  1.00 54.74  ? 68  THR E OG1 1 
ATOM 6334  C CG2 . THR E 2 68  ? -29.215 10.499  57.477  1.00 57.43  ? 68  THR E CG2 1 
ATOM 6335  N N   . THR E 2 69  ? -28.244 13.202  57.260  1.00 56.57  ? 69  THR E N   1 
ATOM 6336  C CA  . THR E 2 69  ? -28.914 14.362  56.709  1.00 59.16  ? 69  THR E CA  1 
ATOM 6337  C C   . THR E 2 69  ? -28.969 15.634  57.572  1.00 61.96  ? 69  THR E C   1 
ATOM 6338  O O   . THR E 2 69  ? -29.129 16.734  57.031  1.00 61.41  ? 69  THR E O   1 
ATOM 6339  C CB  . THR E 2 69  ? -30.345 13.961  56.279  1.00 55.59  ? 69  THR E CB  1 
ATOM 6340  O OG1 . THR E 2 69  ? -30.987 15.065  55.636  1.00 52.95  ? 69  THR E OG1 1 
ATOM 6341  C CG2 . THR E 2 69  ? -31.156 13.519  57.490  1.00 55.07  ? 69  THR E CG2 1 
ATOM 6342  N N   . ASP E 2 70  ? -28.830 15.504  58.892  1.00 64.03  ? 70  ASP E N   1 
ATOM 6343  C CA  . ASP E 2 70  ? -28.891 16.678  59.767  1.00 64.77  ? 70  ASP E CA  1 
ATOM 6344  C C   . ASP E 2 70  ? -27.574 16.954  60.494  1.00 62.34  ? 70  ASP E C   1 
ATOM 6345  O O   . ASP E 2 70  ? -26.999 16.064  61.121  1.00 59.42  ? 70  ASP E O   1 
ATOM 6346  C CB  . ASP E 2 70  ? -30.042 16.519  60.776  1.00 72.97  ? 70  ASP E CB  1 
ATOM 6347  C CG  . ASP E 2 70  ? -31.407 16.287  60.094  1.00 82.34  ? 70  ASP E CG  1 
ATOM 6348  O OD1 . ASP E 2 70  ? -31.513 16.446  58.855  1.00 86.85  ? 70  ASP E OD1 1 
ATOM 6349  O OD2 . ASP E 2 70  ? -32.388 15.952  60.797  1.00 87.61  ? 70  ASP E OD2 1 
ATOM 6350  N N   . PHE E 2 71  ? -27.100 18.197  60.401  1.00 62.74  ? 71  PHE E N   1 
ATOM 6351  C CA  . PHE E 2 71  ? -25.833 18.603  61.029  1.00 61.80  ? 71  PHE E CA  1 
ATOM 6352  C C   . PHE E 2 71  ? -25.953 19.916  61.789  1.00 59.91  ? 71  PHE E C   1 
ATOM 6353  O O   . PHE E 2 71  ? -26.854 20.722  61.527  1.00 57.01  ? 71  PHE E O   1 
ATOM 6354  C CB  . PHE E 2 71  ? -24.742 18.779  59.974  1.00 59.98  ? 71  PHE E CB  1 
ATOM 6355  C CG  . PHE E 2 71  ? -24.625 17.629  59.031  1.00 56.73  ? 71  PHE E CG  1 
ATOM 6356  C CD1 . PHE E 2 71  ? -23.467 16.857  59.005  1.00 57.19  ? 71  PHE E CD1 1 
ATOM 6357  C CD2 . PHE E 2 71  ? -25.670 17.316  58.160  1.00 50.83  ? 71  PHE E CD2 1 
ATOM 6358  C CE1 . PHE E 2 71  ? -23.349 15.787  58.125  1.00 52.54  ? 71  PHE E CE1 1 
ATOM 6359  C CE2 . PHE E 2 71  ? -25.568 16.255  57.280  1.00 46.70  ? 71  PHE E CE2 1 
ATOM 6360  C CZ  . PHE E 2 71  ? -24.406 15.486  57.259  1.00 47.08  ? 71  PHE E CZ  1 
ATOM 6361  N N   . THR E 2 72  ? -25.011 20.142  62.701  1.00 57.78  ? 72  THR E N   1 
ATOM 6362  C CA  . THR E 2 72  ? -25.030 21.350  63.509  1.00 55.95  ? 72  THR E CA  1 
ATOM 6363  C C   . THR E 2 72  ? -23.689 21.859  63.993  1.00 54.98  ? 72  THR E C   1 
ATOM 6364  O O   . THR E 2 72  ? -22.829 21.092  64.447  1.00 52.78  ? 72  THR E O   1 
ATOM 6365  C CB  . THR E 2 72  ? -25.832 21.163  64.790  1.00 56.83  ? 72  THR E CB  1 
ATOM 6366  O OG1 . THR E 2 72  ? -25.064 20.362  65.707  1.00 56.86  ? 72  THR E OG1 1 
ATOM 6367  C CG2 . THR E 2 72  ? -27.168 20.505  64.497  1.00 57.73  ? 72  THR E CG2 1 
ATOM 6368  N N   . LEU E 2 73  ? -23.553 23.179  63.937  1.00 53.97  ? 73  LEU E N   1 
ATOM 6369  C CA  . LEU E 2 73  ? -22.362 23.861  64.418  1.00 51.51  ? 73  LEU E CA  1 
ATOM 6370  C C   . LEU E 2 73  ? -22.805 24.478  65.726  1.00 53.42  ? 73  LEU E C   1 
ATOM 6371  O O   . LEU E 2 73  ? -23.917 25.013  65.812  1.00 55.65  ? 73  LEU E O   1 
ATOM 6372  C CB  . LEU E 2 73  ? -21.945 24.973  63.462  1.00 43.89  ? 73  LEU E CB  1 
ATOM 6373  C CG  . LEU E 2 73  ? -20.841 25.892  63.991  1.00 39.72  ? 73  LEU E CG  1 
ATOM 6374  C CD1 . LEU E 2 73  ? -19.638 25.084  64.511  1.00 34.07  ? 73  LEU E CD1 1 
ATOM 6375  C CD2 . LEU E 2 73  ? -20.435 26.835  62.879  1.00 35.34  ? 73  LEU E CD2 1 
ATOM 6376  N N   . THR E 2 74  ? -21.964 24.399  66.750  1.00 51.08  ? 74  THR E N   1 
ATOM 6377  C CA  . THR E 2 74  ? -22.344 24.988  68.021  1.00 48.90  ? 74  THR E CA  1 
ATOM 6378  C C   . THR E 2 74  ? -21.198 25.726  68.690  1.00 50.37  ? 74  THR E C   1 
ATOM 6379  O O   . THR E 2 74  ? -20.040 25.273  68.709  1.00 50.27  ? 74  THR E O   1 
ATOM 6380  C CB  . THR E 2 74  ? -22.882 23.926  69.007  1.00 46.84  ? 74  THR E CB  1 
ATOM 6381  O OG1 . THR E 2 74  ? -21.787 23.200  69.567  1.00 44.90  ? 74  THR E OG1 1 
ATOM 6382  C CG2 . THR E 2 74  ? -23.803 22.943  68.290  1.00 48.65  ? 74  THR E CG2 1 
ATOM 6383  N N   . ILE E 2 75  ? -21.519 26.895  69.219  1.00 51.93  ? 75  ILE E N   1 
ATOM 6384  C CA  . ILE E 2 75  ? -20.510 27.652  69.926  1.00 50.62  ? 75  ILE E CA  1 
ATOM 6385  C C   . ILE E 2 75  ? -21.000 27.636  71.361  1.00 49.91  ? 75  ILE E C   1 
ATOM 6386  O O   . ILE E 2 75  ? -22.140 28.022  71.657  1.00 49.00  ? 75  ILE E O   1 
ATOM 6387  C CB  . ILE E 2 75  ? -20.383 29.095  69.408  1.00 47.63  ? 75  ILE E CB  1 
ATOM 6388  C CG1 . ILE E 2 75  ? -20.585 29.116  67.893  1.00 44.83  ? 75  ILE E CG1 1 
ATOM 6389  C CG2 . ILE E 2 75  ? -18.989 29.641  69.758  1.00 43.10  ? 75  ILE E CG2 1 
ATOM 6390  C CD1 . ILE E 2 75  ? -20.342 30.457  67.262  1.00 39.22  ? 75  ILE E CD1 1 
ATOM 6391  N N   . SER E 2 76  ? -20.137 27.126  72.230  1.00 48.38  ? 76  SER E N   1 
ATOM 6392  C CA  . SER E 2 76  ? -20.421 27.015  73.646  1.00 47.63  ? 76  SER E CA  1 
ATOM 6393  C C   . SER E 2 76  ? -20.790 28.378  74.212  1.00 49.03  ? 76  SER E C   1 
ATOM 6394  O O   . SER E 2 76  ? -21.883 28.564  74.759  1.00 47.65  ? 76  SER E O   1 
ATOM 6395  C CB  . SER E 2 76  ? -19.191 26.463  74.368  1.00 45.26  ? 76  SER E CB  1 
ATOM 6396  O OG  . SER E 2 76  ? -18.048 27.256  74.105  1.00 42.50  ? 76  SER E OG  1 
ATOM 6397  N N   . SER E 2 77  ? -19.861 29.324  74.076  1.00 49.31  ? 77  SER E N   1 
ATOM 6398  C CA  . SER E 2 77  ? -20.061 30.687  74.559  1.00 48.21  ? 77  SER E CA  1 
ATOM 6399  C C   . SER E 2 77  ? -19.552 31.744  73.559  1.00 47.29  ? 77  SER E C   1 
ATOM 6400  O O   . SER E 2 77  ? -18.378 32.136  73.576  1.00 49.20  ? 77  SER E O   1 
ATOM 6401  C CB  . SER E 2 77  ? -19.398 30.858  75.939  1.00 44.34  ? 77  SER E CB  1 
ATOM 6402  O OG  . SER E 2 77  ? -18.022 30.533  75.909  1.00 42.56  ? 77  SER E OG  1 
ATOM 6403  N N   . VAL E 2 78  ? -20.464 32.185  72.693  1.00 44.75  ? 78  VAL E N   1 
ATOM 6404  C CA  . VAL E 2 78  ? -20.207 33.186  71.658  1.00 46.37  ? 78  VAL E CA  1 
ATOM 6405  C C   . VAL E 2 78  ? -19.348 34.375  72.119  1.00 49.59  ? 78  VAL E C   1 
ATOM 6406  O O   . VAL E 2 78  ? -19.466 34.820  73.245  1.00 54.42  ? 78  VAL E O   1 
ATOM 6407  C CB  . VAL E 2 78  ? -21.544 33.737  71.136  1.00 42.28  ? 78  VAL E CB  1 
ATOM 6408  C CG1 . VAL E 2 78  ? -21.309 34.665  69.964  1.00 44.32  ? 78  VAL E CG1 1 
ATOM 6409  C CG2 . VAL E 2 78  ? -22.457 32.590  70.753  1.00 45.52  ? 78  VAL E CG2 1 
ATOM 6410  N N   . GLN E 2 79  ? -18.478 34.887  71.252  1.00 50.82  ? 79  GLN E N   1 
ATOM 6411  C CA  . GLN E 2 79  ? -17.646 36.040  71.597  1.00 50.74  ? 79  GLN E CA  1 
ATOM 6412  C C   . GLN E 2 79  ? -18.067 37.165  70.686  1.00 54.76  ? 79  GLN E C   1 
ATOM 6413  O O   . GLN E 2 79  ? -18.913 36.970  69.809  1.00 57.83  ? 79  GLN E O   1 
ATOM 6414  C CB  . GLN E 2 79  ? -16.172 35.772  71.345  1.00 54.81  ? 79  GLN E CB  1 
ATOM 6415  C CG  . GLN E 2 79  ? -15.593 34.636  72.135  1.00 58.88  ? 79  GLN E CG  1 
ATOM 6416  C CD  . GLN E 2 79  ? -15.907 34.745  73.603  1.00 56.73  ? 79  GLN E CD  1 
ATOM 6417  O OE1 . GLN E 2 79  ? -16.991 34.369  74.044  1.00 54.28  ? 79  GLN E OE1 1 
ATOM 6418  N NE2 . GLN E 2 79  ? -14.963 35.272  74.371  1.00 52.78  ? 79  GLN E NE2 1 
ATOM 6419  N N   . ALA E 2 80  ? -17.477 38.340  70.866  1.00 55.05  ? 80  ALA E N   1 
ATOM 6420  C CA  . ALA E 2 80  ? -17.849 39.456  70.008  1.00 58.23  ? 80  ALA E CA  1 
ATOM 6421  C C   . ALA E 2 80  ? -17.249 39.305  68.610  1.00 60.45  ? 80  ALA E C   1 
ATOM 6422  O O   . ALA E 2 80  ? -17.716 39.936  67.658  1.00 61.97  ? 80  ALA E O   1 
ATOM 6423  C CB  . ALA E 2 80  ? -17.410 40.771  70.634  1.00 58.68  ? 80  ALA E CB  1 
ATOM 6424  N N   . GLU E 2 81  ? -16.226 38.453  68.502  1.00 61.50  ? 81  GLU E N   1 
ATOM 6425  C CA  . GLU E 2 81  ? -15.512 38.198  67.248  1.00 61.05  ? 81  GLU E CA  1 
ATOM 6426  C C   . GLU E 2 81  ? -16.330 37.276  66.377  1.00 55.23  ? 81  GLU E C   1 
ATOM 6427  O O   . GLU E 2 81  ? -16.504 37.518  65.187  1.00 56.85  ? 81  GLU E O   1 
ATOM 6428  C CB  . GLU E 2 81  ? -14.167 37.512  67.510  1.00 66.55  ? 81  GLU E CB  1 
ATOM 6429  C CG  . GLU E 2 81  ? -13.263 38.178  68.537  1.00 80.94  ? 81  GLU E CG  1 
ATOM 6430  C CD  . GLU E 2 81  ? -13.956 38.434  69.884  1.00 90.62  ? 81  GLU E CD  1 
ATOM 6431  O OE1 . GLU E 2 81  ? -14.685 39.448  70.001  1.00 96.26  ? 81  GLU E OE1 1 
ATOM 6432  O OE2 . GLU E 2 81  ? -13.779 37.623  70.828  1.00 93.29  ? 81  GLU E OE2 1 
ATOM 6433  N N   . ASP E 2 82  ? -16.817 36.213  67.003  1.00 48.02  ? 82  ASP E N   1 
ATOM 6434  C CA  . ASP E 2 82  ? -17.605 35.186  66.359  1.00 43.86  ? 82  ASP E CA  1 
ATOM 6435  C C   . ASP E 2 82  ? -18.793 35.720  65.599  1.00 45.05  ? 82  ASP E C   1 
ATOM 6436  O O   . ASP E 2 82  ? -19.616 34.975  65.065  1.00 48.01  ? 82  ASP E O   1 
ATOM 6437  C CB  . ASP E 2 82  ? -18.029 34.181  67.405  1.00 42.89  ? 82  ASP E CB  1 
ATOM 6438  C CG  . ASP E 2 82  ? -16.858 33.708  68.221  1.00 42.85  ? 82  ASP E CG  1 
ATOM 6439  O OD1 . ASP E 2 82  ? -15.714 33.903  67.752  1.00 42.80  ? 82  ASP E OD1 1 
ATOM 6440  O OD2 . ASP E 2 82  ? -17.065 33.148  69.313  1.00 42.90  ? 82  ASP E OD2 1 
ATOM 6441  N N   . LEU E 2 83  ? -18.883 37.032  65.556  1.00 44.15  ? 83  LEU E N   1 
ATOM 6442  C CA  . LEU E 2 83  ? -19.931 37.669  64.800  1.00 43.53  ? 83  LEU E CA  1 
ATOM 6443  C C   . LEU E 2 83  ? -19.559 37.364  63.348  1.00 42.74  ? 83  LEU E C   1 
ATOM 6444  O O   . LEU E 2 83  ? -18.479 37.760  62.883  1.00 42.82  ? 83  LEU E O   1 
ATOM 6445  C CB  . LEU E 2 83  ? -19.874 39.163  65.078  1.00 47.17  ? 83  LEU E CB  1 
ATOM 6446  C CG  . LEU E 2 83  ? -20.656 40.152  64.229  1.00 52.16  ? 83  LEU E CG  1 
ATOM 6447  C CD1 . LEU E 2 83  ? -22.051 39.631  63.867  1.00 55.18  ? 83  LEU E CD1 1 
ATOM 6448  C CD2 . LEU E 2 83  ? -20.725 41.434  65.036  1.00 50.35  ? 83  LEU E CD2 1 
ATOM 6449  N N   . ALA E 2 84  ? -20.421 36.648  62.634  1.00 38.76  ? 84  ALA E N   1 
ATOM 6450  C CA  . ALA E 2 84  ? -20.114 36.317  61.250  1.00 34.03  ? 84  ALA E CA  1 
ATOM 6451  C C   . ALA E 2 84  ? -21.271 35.663  60.541  1.00 34.52  ? 84  ALA E C   1 
ATOM 6452  O O   . ALA E 2 84  ? -22.360 35.512  61.095  1.00 33.20  ? 84  ALA E O   1 
ATOM 6453  C CB  . ALA E 2 84  ? -18.925 35.391  61.201  1.00 32.43  ? 84  ALA E CB  1 
ATOM 6454  N N   . ASP E 2 85  ? -21.037 35.302  59.287  1.00 35.47  ? 85  ASP E N   1 
ATOM 6455  C CA  . ASP E 2 85  ? -22.039 34.588  58.523  1.00 39.05  ? 85  ASP E CA  1 
ATOM 6456  C C   . ASP E 2 85  ? -21.461 33.176  58.410  1.00 40.12  ? 85  ASP E C   1 
ATOM 6457  O O   . ASP E 2 85  ? -20.360 32.978  57.879  1.00 36.18  ? 85  ASP E O   1 
ATOM 6458  C CB  . ASP E 2 85  ? -22.241 35.184  57.135  1.00 43.47  ? 85  ASP E CB  1 
ATOM 6459  C CG  . ASP E 2 85  ? -23.371 34.489  56.380  1.00 51.01  ? 85  ASP E CG  1 
ATOM 6460  O OD1 . ASP E 2 85  ? -24.076 33.685  57.030  1.00 58.20  ? 85  ASP E OD1 1 
ATOM 6461  O OD2 . ASP E 2 85  ? -23.569 34.731  55.164  1.00 46.51  ? 85  ASP E OD2 1 
ATOM 6462  N N   . TYR E 2 86  ? -22.200 32.206  58.938  1.00 41.01  ? 86  TYR E N   1 
ATOM 6463  C CA  . TYR E 2 86  ? -21.755 30.826  58.949  1.00 41.93  ? 86  TYR E CA  1 
ATOM 6464  C C   . TYR E 2 86  ? -22.343 29.983  57.818  1.00 44.89  ? 86  TYR E C   1 
ATOM 6465  O O   . TYR E 2 86  ? -23.558 29.983  57.585  1.00 46.96  ? 86  TYR E O   1 
ATOM 6466  C CB  . TYR E 2 86  ? -22.049 30.245  60.326  1.00 39.80  ? 86  TYR E CB  1 
ATOM 6467  C CG  . TYR E 2 86  ? -21.180 30.884  61.398  1.00 38.54  ? 86  TYR E CG  1 
ATOM 6468  C CD1 . TYR E 2 86  ? -21.547 32.086  62.028  1.00 35.64  ? 86  TYR E CD1 1 
ATOM 6469  C CD2 . TYR E 2 86  ? -19.957 30.308  61.747  1.00 36.34  ? 86  TYR E CD2 1 
ATOM 6470  C CE1 . TYR E 2 86  ? -20.696 32.693  62.985  1.00 36.23  ? 86  TYR E CE1 1 
ATOM 6471  C CE2 . TYR E 2 86  ? -19.112 30.894  62.688  1.00 32.83  ? 86  TYR E CE2 1 
ATOM 6472  C CZ  . TYR E 2 86  ? -19.474 32.078  63.303  1.00 36.09  ? 86  TYR E CZ  1 
ATOM 6473  O OH  . TYR E 2 86  ? -18.584 32.615  64.214  1.00 37.77  ? 86  TYR E OH  1 
ATOM 6474  N N   . HIS E 2 87  ? -21.462 29.256  57.128  1.00 44.48  ? 87  HIS E N   1 
ATOM 6475  C CA  . HIS E 2 87  ? -21.846 28.463  55.966  1.00 42.17  ? 87  HIS E CA  1 
ATOM 6476  C C   . HIS E 2 87  ? -21.692 26.949  55.981  1.00 41.49  ? 87  HIS E C   1 
ATOM 6477  O O   . HIS E 2 87  ? -20.888 26.372  56.718  1.00 41.41  ? 87  HIS E O   1 
ATOM 6478  C CB  . HIS E 2 87  ? -21.093 28.973  54.744  1.00 46.61  ? 87  HIS E CB  1 
ATOM 6479  C CG  . HIS E 2 87  ? -21.419 30.385  54.362  1.00 52.63  ? 87  HIS E CG  1 
ATOM 6480  N ND1 . HIS E 2 87  ? -22.644 30.754  53.848  1.00 57.10  ? 87  HIS E ND1 1 
ATOM 6481  C CD2 . HIS E 2 87  ? -20.663 31.510  54.388  1.00 50.53  ? 87  HIS E CD2 1 
ATOM 6482  C CE1 . HIS E 2 87  ? -22.627 32.048  53.574  1.00 59.55  ? 87  HIS E CE1 1 
ATOM 6483  N NE2 . HIS E 2 87  ? -21.437 32.529  53.891  1.00 53.54  ? 87  HIS E NE2 1 
ATOM 6484  N N   . CYS E 2 88  ? -22.452 26.331  55.080  1.00 41.15  ? 88  CYS E N   1 
ATOM 6485  C CA  . CYS E 2 88  ? -22.480 24.891  54.890  1.00 38.52  ? 88  CYS E CA  1 
ATOM 6486  C C   . CYS E 2 88  ? -22.180 24.395  53.490  1.00 37.87  ? 88  CYS E C   1 
ATOM 6487  O O   . CYS E 2 88  ? -22.652 24.954  52.489  1.00 33.40  ? 88  CYS E O   1 
ATOM 6488  C CB  . CYS E 2 88  ? -23.825 24.350  55.285  1.00 37.93  ? 88  CYS E CB  1 
ATOM 6489  S SG  . CYS E 2 88  ? -23.615 23.461  56.769  1.00 60.40  ? 88  CYS E SG  1 
ATOM 6490  N N   . GLY E 2 89  ? -21.415 23.308  53.433  1.00 37.18  ? 89  GLY E N   1 
ATOM 6491  C CA  . GLY E 2 89  ? -21.069 22.733  52.153  1.00 33.17  ? 89  GLY E CA  1 
ATOM 6492  C C   . GLY E 2 89  ? -20.918 21.232  52.202  1.00 29.34  ? 89  GLY E C   1 
ATOM 6493  O O   . GLY E 2 89  ? -20.486 20.684  53.216  1.00 23.06  ? 89  GLY E O   1 
ATOM 6494  N N   . GLN E 2 90  ? -21.285 20.582  51.096  1.00 28.24  ? 90  GLN E N   1 
ATOM 6495  C CA  . GLN E 2 90  ? -21.184 19.136  50.958  1.00 26.37  ? 90  GLN E CA  1 
ATOM 6496  C C   . GLN E 2 90  ? -20.404 18.813  49.703  1.00 25.62  ? 90  GLN E C   1 
ATOM 6497  O O   . GLN E 2 90  ? -20.422 19.572  48.737  1.00 23.94  ? 90  GLN E O   1 
ATOM 6498  C CB  . GLN E 2 90  ? -22.569 18.491  50.875  1.00 25.38  ? 90  GLN E CB  1 
ATOM 6499  C CG  . GLN E 2 90  ? -23.424 18.874  49.661  1.00 30.18  ? 90  GLN E CG  1 
ATOM 6500  C CD  . GLN E 2 90  ? -23.052 18.135  48.374  1.00 32.25  ? 90  GLN E CD  1 
ATOM 6501  O OE1 . GLN E 2 90  ? -22.645 16.968  48.404  1.00 31.45  ? 90  GLN E OE1 1 
ATOM 6502  N NE2 . GLN E 2 90  ? -23.217 18.808  47.234  1.00 30.13  ? 90  GLN E NE2 1 
ATOM 6503  N N   . SER E 2 91  ? -19.705 17.691  49.726  1.00 26.70  ? 91  SER E N   1 
ATOM 6504  C CA  . SER E 2 91  ? -18.933 17.264  48.576  1.00 29.83  ? 91  SER E CA  1 
ATOM 6505  C C   . SER E 2 91  ? -19.179 15.773  48.444  1.00 31.77  ? 91  SER E C   1 
ATOM 6506  O O   . SER E 2 91  ? -18.285 14.979  48.142  1.00 34.88  ? 91  SER E O   1 
ATOM 6507  C CB  . SER E 2 91  ? -17.448 17.562  48.783  1.00 29.48  ? 91  SER E CB  1 
ATOM 6508  O OG  . SER E 2 91  ? -17.000 17.078  50.031  1.00 30.33  ? 91  SER E OG  1 
ATOM 6509  N N   . TYR E 2 92  ? -20.422 15.407  48.697  1.00 31.52  ? 92  TYR E N   1 
ATOM 6510  C CA  . TYR E 2 92  ? -20.853 14.036  48.593  1.00 33.69  ? 92  TYR E CA  1 
ATOM 6511  C C   . TYR E 2 92  ? -21.040 13.812  47.112  1.00 36.54  ? 92  TYR E C   1 
ATOM 6512  O O   . TYR E 2 92  ? -20.381 12.976  46.502  1.00 40.74  ? 92  TYR E O   1 
ATOM 6513  C CB  . TYR E 2 92  ? -22.174 13.870  49.325  1.00 39.20  ? 92  TYR E CB  1 
ATOM 6514  C CG  . TYR E 2 92  ? -22.871 12.552  49.079  1.00 48.64  ? 92  TYR E CG  1 
ATOM 6515  C CD1 . TYR E 2 92  ? -22.309 11.345  49.490  1.00 50.39  ? 92  TYR E CD1 1 
ATOM 6516  C CD2 . TYR E 2 92  ? -24.116 12.521  48.455  1.00 55.52  ? 92  TYR E CD2 1 
ATOM 6517  C CE1 . TYR E 2 92  ? -22.977 10.141  49.283  1.00 56.00  ? 92  TYR E CE1 1 
ATOM 6518  C CE2 . TYR E 2 92  ? -24.793 11.332  48.244  1.00 60.24  ? 92  TYR E CE2 1 
ATOM 6519  C CZ  . TYR E 2 92  ? -24.223 10.145  48.659  1.00 59.94  ? 92  TYR E CZ  1 
ATOM 6520  O OH  . TYR E 2 92  ? -24.913 8.971   48.444  1.00 64.68  ? 92  TYR E OH  1 
ATOM 6521  N N   . SER E 2 93  ? -21.948 14.566  46.514  1.00 39.48  ? 93  SER E N   1 
ATOM 6522  C CA  . SER E 2 93  ? -22.201 14.451  45.078  1.00 41.54  ? 93  SER E CA  1 
ATOM 6523  C C   . SER E 2 93  ? -21.651 15.698  44.388  1.00 38.65  ? 93  SER E C   1 
ATOM 6524  O O   . SER E 2 93  ? -21.382 16.676  45.041  1.00 40.59  ? 93  SER E O   1 
ATOM 6525  C CB  . SER E 2 93  ? -23.713 14.401  44.828  1.00 45.93  ? 93  SER E CB  1 
ATOM 6526  O OG  . SER E 2 93  ? -24.300 15.703  44.982  1.00 54.12  ? 93  SER E OG  1 
ATOM 6527  N N   . TYR E 2 94  ? -21.424 15.641  43.081  1.00 39.50  ? 94  TYR E N   1 
ATOM 6528  C CA  . TYR E 2 94  ? -21.027 16.846  42.348  1.00 43.85  ? 94  TYR E CA  1 
ATOM 6529  C C   . TYR E 2 94  ? -22.454 17.185  41.862  1.00 49.81  ? 94  TYR E C   1 
ATOM 6530  O O   . TYR E 2 94  ? -23.233 16.278  41.546  1.00 56.64  ? 94  TYR E O   1 
ATOM 6531  C CB  . TYR E 2 94  ? -20.168 16.517  41.145  1.00 37.53  ? 94  TYR E CB  1 
ATOM 6532  C CG  . TYR E 2 94  ? -18.676 16.419  41.322  1.00 37.87  ? 94  TYR E CG  1 
ATOM 6533  C CD1 . TYR E 2 94  ? -17.921 17.450  41.869  1.00 37.01  ? 94  TYR E CD1 1 
ATOM 6534  C CD2 . TYR E 2 94  ? -17.999 15.325  40.813  1.00 40.23  ? 94  TYR E CD2 1 
ATOM 6535  C CE1 . TYR E 2 94  ? -16.489 17.398  41.899  1.00 36.90  ? 94  TYR E CE1 1 
ATOM 6536  C CE2 . TYR E 2 94  ? -16.587 15.245  40.826  1.00 39.31  ? 94  TYR E CE2 1 
ATOM 6537  C CZ  . TYR E 2 94  ? -15.846 16.270  41.358  1.00 39.12  ? 94  TYR E CZ  1 
ATOM 6538  O OH  . TYR E 2 94  ? -14.489 16.157  41.283  1.00 42.84  ? 94  TYR E OH  1 
ATOM 6539  N N   . PRO E 2 95  ? -22.829 18.458  41.799  1.00 48.19  ? 95  PRO E N   1 
ATOM 6540  C CA  . PRO E 2 95  ? -22.056 19.634  42.124  1.00 44.23  ? 95  PRO E CA  1 
ATOM 6541  C C   . PRO E 2 95  ? -22.078 19.814  43.608  1.00 44.83  ? 95  PRO E C   1 
ATOM 6542  O O   . PRO E 2 95  ? -23.060 19.513  44.309  1.00 46.67  ? 95  PRO E O   1 
ATOM 6543  C CB  . PRO E 2 95  ? -22.819 20.734  41.427  1.00 41.75  ? 95  PRO E CB  1 
ATOM 6544  C CG  . PRO E 2 95  ? -24.267 20.104  41.147  1.00 42.27  ? 95  PRO E CG  1 
ATOM 6545  C CD  . PRO E 2 95  ? -24.261 18.792  41.840  1.00 44.46  ? 95  PRO E CD  1 
ATOM 6546  N N   . TYR E 2 96  ? -20.950 20.304  44.074  1.00 42.65  ? 96  TYR E N   1 
ATOM 6547  C CA  . TYR E 2 96  ? -20.807 20.633  45.455  1.00 35.79  ? 96  TYR E CA  1 
ATOM 6548  C C   . TYR E 2 96  ? -21.791 21.776  45.633  1.00 35.45  ? 96  TYR E C   1 
ATOM 6549  O O   . TYR E 2 96  ? -21.902 22.663  44.779  1.00 36.73  ? 96  TYR E O   1 
ATOM 6550  C CB  . TYR E 2 96  ? -19.421 21.165  45.730  1.00 33.73  ? 96  TYR E CB  1 
ATOM 6551  C CG  . TYR E 2 96  ? -18.281 20.217  45.447  1.00 36.03  ? 96  TYR E CG  1 
ATOM 6552  C CD1 . TYR E 2 96  ? -18.431 18.839  45.572  1.00 35.37  ? 96  TYR E CD1 1 
ATOM 6553  C CD2 . TYR E 2 96  ? -17.007 20.722  45.154  1.00 33.49  ? 96  TYR E CD2 1 
ATOM 6554  C CE1 . TYR E 2 96  ? -17.333 17.979  45.419  1.00 32.85  ? 96  TYR E CE1 1 
ATOM 6555  C CE2 . TYR E 2 96  ? -15.914 19.876  45.004  1.00 33.79  ? 96  TYR E CE2 1 
ATOM 6556  C CZ  . TYR E 2 96  ? -16.079 18.515  45.138  1.00 31.31  ? 96  TYR E CZ  1 
ATOM 6557  O OH  . TYR E 2 96  ? -14.983 17.710  44.977  1.00 31.79  ? 96  TYR E OH  1 
ATOM 6558  N N   . THR E 2 97  ? -22.506 21.778  46.741  1.00 35.66  ? 97  THR E N   1 
ATOM 6559  C CA  . THR E 2 97  ? -23.458 22.844  46.977  1.00 35.08  ? 97  THR E CA  1 
ATOM 6560  C C   . THR E 2 97  ? -23.257 23.425  48.375  1.00 36.00  ? 97  THR E C   1 
ATOM 6561  O O   . THR E 2 97  ? -22.528 22.840  49.187  1.00 30.87  ? 97  THR E O   1 
ATOM 6562  C CB  . THR E 2 97  ? -24.909 22.327  46.785  1.00 32.17  ? 97  THR E CB  1 
ATOM 6563  O OG1 . THR E 2 97  ? -25.213 21.330  47.769  1.00 31.54  ? 97  THR E OG1 1 
ATOM 6564  C CG2 . THR E 2 97  ? -25.067 21.728  45.391  1.00 19.51  ? 97  THR E CG2 1 
ATOM 6565  N N   . PHE E 2 98  ? -23.878 24.581  48.641  1.00 37.20  ? 98  PHE E N   1 
ATOM 6566  C CA  . PHE E 2 98  ? -23.755 25.219  49.954  1.00 35.50  ? 98  PHE E CA  1 
ATOM 6567  C C   . PHE E 2 98  ? -25.078 25.578  50.635  1.00 38.12  ? 98  PHE E C   1 
ATOM 6568  O O   . PHE E 2 98  ? -26.129 25.676  49.992  1.00 39.39  ? 98  PHE E O   1 
ATOM 6569  C CB  . PHE E 2 98  ? -22.947 26.503  49.855  1.00 28.14  ? 98  PHE E CB  1 
ATOM 6570  C CG  . PHE E 2 98  ? -21.597 26.338  49.253  1.00 29.34  ? 98  PHE E CG  1 
ATOM 6571  C CD1 . PHE E 2 98  ? -21.416 26.465  47.887  1.00 32.45  ? 98  PHE E CD1 1 
ATOM 6572  C CD2 . PHE E 2 98  ? -20.489 26.095  50.058  1.00 29.95  ? 98  PHE E CD2 1 
ATOM 6573  C CE1 . PHE E 2 98  ? -20.145 26.359  47.325  1.00 29.63  ? 98  PHE E CE1 1 
ATOM 6574  C CE2 . PHE E 2 98  ? -19.217 25.986  49.510  1.00 28.92  ? 98  PHE E CE2 1 
ATOM 6575  C CZ  . PHE E 2 98  ? -19.044 26.118  48.139  1.00 28.00  ? 98  PHE E CZ  1 
ATOM 6576  N N   . GLY E 2 99  ? -25.014 25.768  51.950  1.00 39.00  ? 99  GLY E N   1 
ATOM 6577  C CA  . GLY E 2 99  ? -26.189 26.185  52.684  1.00 42.00  ? 99  GLY E CA  1 
ATOM 6578  C C   . GLY E 2 99  ? -26.364 27.674  52.380  1.00 46.41  ? 99  GLY E C   1 
ATOM 6579  O O   . GLY E 2 99  ? -25.418 28.368  51.971  1.00 43.73  ? 99  GLY E O   1 
ATOM 6580  N N   . GLY E 2 100 ? -27.570 28.192  52.563  1.00 52.82  ? 100 GLY E N   1 
ATOM 6581  C CA  . GLY E 2 100 ? -27.773 29.603  52.278  1.00 56.64  ? 100 GLY E CA  1 
ATOM 6582  C C   . GLY E 2 100 ? -27.025 30.532  53.221  1.00 57.21  ? 100 GLY E C   1 
ATOM 6583  O O   . GLY E 2 100 ? -26.881 31.724  52.946  1.00 57.98  ? 100 GLY E O   1 
ATOM 6584  N N   . GLY E 2 101 ? -26.534 29.987  54.330  1.00 56.91  ? 101 GLY E N   1 
ATOM 6585  C CA  . GLY E 2 101 ? -25.829 30.798  55.304  1.00 50.95  ? 101 GLY E CA  1 
ATOM 6586  C C   . GLY E 2 101 ? -26.799 31.234  56.387  1.00 50.94  ? 101 GLY E C   1 
ATOM 6587  O O   . GLY E 2 101 ? -28.006 31.363  56.140  1.00 53.83  ? 101 GLY E O   1 
ATOM 6588  N N   . THR E 2 102 ? -26.284 31.438  57.593  1.00 50.44  ? 102 THR E N   1 
ATOM 6589  C CA  . THR E 2 102 ? -27.104 31.866  58.719  1.00 52.57  ? 102 THR E CA  1 
ATOM 6590  C C   . THR E 2 102 ? -26.261 32.869  59.522  1.00 52.66  ? 102 THR E C   1 
ATOM 6591  O O   . THR E 2 102 ? -25.261 32.510  60.146  1.00 50.29  ? 102 THR E O   1 
ATOM 6592  C CB  . THR E 2 102 ? -27.545 30.633  59.566  1.00 53.96  ? 102 THR E CB  1 
ATOM 6593  O OG1 . THR E 2 102 ? -28.243 31.064  60.740  1.00 60.39  ? 102 THR E OG1 1 
ATOM 6594  C CG2 . THR E 2 102 ? -26.350 29.792  59.962  1.00 55.57  ? 102 THR E CG2 1 
ATOM 6595  N N   . LYS E 2 103 ? -26.672 34.137  59.474  1.00 53.48  ? 103 LYS E N   1 
ATOM 6596  C CA  . LYS E 2 103 ? -25.949 35.221  60.124  1.00 52.14  ? 103 LYS E CA  1 
ATOM 6597  C C   . LYS E 2 103 ? -26.047 35.269  61.638  1.00 49.47  ? 103 LYS E C   1 
ATOM 6598  O O   . LYS E 2 103 ? -27.130 35.334  62.198  1.00 48.39  ? 103 LYS E O   1 
ATOM 6599  C CB  . LYS E 2 103 ? -26.409 36.565  59.553  1.00 56.17  ? 103 LYS E CB  1 
ATOM 6600  C CG  . LYS E 2 103 ? -25.388 37.694  59.763  1.00 67.82  ? 103 LYS E CG  1 
ATOM 6601  C CD  . LYS E 2 103 ? -26.031 39.059  60.044  1.00 74.46  ? 103 LYS E CD  1 
ATOM 6602  C CE  . LYS E 2 103 ? -26.829 39.609  58.855  1.00 80.37  ? 103 LYS E CE  1 
ATOM 6603  N NZ  . LYS E 2 103 ? -27.569 40.878  59.188  1.00 81.91  ? 103 LYS E NZ  1 
ATOM 6604  N N   . LEU E 2 104 ? -24.897 35.260  62.298  1.00 50.35  ? 104 LEU E N   1 
ATOM 6605  C CA  . LEU E 2 104 ? -24.846 35.328  63.753  1.00 51.16  ? 104 LEU E CA  1 
ATOM 6606  C C   . LEU E 2 104 ? -24.699 36.797  64.173  1.00 54.30  ? 104 LEU E C   1 
ATOM 6607  O O   . LEU E 2 104 ? -23.733 37.459  63.774  1.00 52.53  ? 104 LEU E O   1 
ATOM 6608  C CB  . LEU E 2 104 ? -23.653 34.530  64.271  1.00 43.60  ? 104 LEU E CB  1 
ATOM 6609  C CG  . LEU E 2 104 ? -23.586 34.435  65.789  1.00 35.47  ? 104 LEU E CG  1 
ATOM 6610  C CD1 . LEU E 2 104 ? -24.800 33.669  66.272  1.00 33.53  ? 104 LEU E CD1 1 
ATOM 6611  C CD2 . LEU E 2 104 ? -22.303 33.750  66.226  1.00 35.79  ? 104 LEU E CD2 1 
ATOM 6612  N N   . GLU E 2 105 ? -25.649 37.293  64.973  1.00 56.92  ? 105 GLU E N   1 
ATOM 6613  C CA  . GLU E 2 105 ? -25.647 38.687  65.441  1.00 58.24  ? 105 GLU E CA  1 
ATOM 6614  C C   . GLU E 2 105 ? -25.649 38.797  66.959  1.00 56.44  ? 105 GLU E C   1 
ATOM 6615  O O   . GLU E 2 105 ? -26.515 38.231  67.621  1.00 56.55  ? 105 GLU E O   1 
ATOM 6616  C CB  . GLU E 2 105 ? -26.871 39.420  64.904  1.00 57.55  ? 105 GLU E CB  1 
ATOM 6617  C CG  . GLU E 2 105 ? -27.092 39.189  63.434  1.00 69.89  ? 105 GLU E CG  1 
ATOM 6618  C CD  . GLU E 2 105 ? -28.194 40.051  62.863  1.00 76.05  ? 105 GLU E CD  1 
ATOM 6619  O OE1 . GLU E 2 105 ? -28.042 41.291  62.878  1.00 82.01  ? 105 GLU E OE1 1 
ATOM 6620  O OE2 . GLU E 2 105 ? -29.209 39.491  62.397  1.00 78.92  ? 105 GLU E OE2 1 
ATOM 6621  N N   . ILE E 2 106 ? -24.692 39.544  67.505  1.00 54.05  ? 106 ILE E N   1 
ATOM 6622  C CA  . ILE E 2 106 ? -24.591 39.733  68.954  1.00 52.60  ? 106 ILE E CA  1 
ATOM 6623  C C   . ILE E 2 106 ? -25.509 40.823  69.551  1.00 55.59  ? 106 ILE E C   1 
ATOM 6624  O O   . ILE E 2 106 ? -25.687 41.903  68.980  1.00 52.57  ? 106 ILE E O   1 
ATOM 6625  C CB  . ILE E 2 106 ? -23.155 40.071  69.354  1.00 49.43  ? 106 ILE E CB  1 
ATOM 6626  C CG1 . ILE E 2 106 ? -22.225 38.982  68.850  1.00 45.45  ? 106 ILE E CG1 1 
ATOM 6627  C CG2 . ILE E 2 106 ? -23.043 40.208  70.870  1.00 46.82  ? 106 ILE E CG2 1 
ATOM 6628  C CD1 . ILE E 2 106 ? -20.773 39.337  69.007  1.00 49.55  ? 106 ILE E CD1 1 
ATOM 6629  N N   . LYS E 2 107 ? -26.086 40.519  70.713  1.00 56.10  ? 107 LYS E N   1 
ATOM 6630  C CA  . LYS E 2 107 ? -26.961 41.441  71.422  1.00 54.99  ? 107 LYS E CA  1 
ATOM 6631  C C   . LYS E 2 107 ? -26.180 42.007  72.617  1.00 53.82  ? 107 LYS E C   1 
ATOM 6632  O O   . LYS E 2 107 ? -25.435 41.281  73.294  1.00 52.98  ? 107 LYS E O   1 
ATOM 6633  C CB  . LYS E 2 107 ? -28.210 40.708  71.908  1.00 54.59  ? 107 LYS E CB  1 
ATOM 6634  C CG  . LYS E 2 107 ? -29.111 41.584  72.742  1.00 61.75  ? 107 LYS E CG  1 
ATOM 6635  C CD  . LYS E 2 107 ? -30.079 40.770  73.579  1.00 68.22  ? 107 LYS E CD  1 
ATOM 6636  C CE  . LYS E 2 107 ? -30.815 41.652  74.589  1.00 67.90  ? 107 LYS E CE  1 
ATOM 6637  N NZ  . LYS E 2 107 ? -31.732 40.845  75.452  1.00 73.09  ? 107 LYS E NZ  1 
ATOM 6638  N N   . ARG E 2 108 ? -26.343 43.305  72.870  1.00 52.94  ? 108 ARG E N   1 
ATOM 6639  C CA  . ARG E 2 108 ? -25.640 43.972  73.969  1.00 53.36  ? 108 ARG E CA  1 
ATOM 6640  C C   . ARG E 2 108 ? -26.461 45.087  74.635  1.00 55.69  ? 108 ARG E C   1 
ATOM 6641  O O   . ARG E 2 108 ? -27.638 45.307  74.306  1.00 55.69  ? 108 ARG E O   1 
ATOM 6642  C CB  . ARG E 2 108 ? -24.312 44.548  73.456  1.00 52.71  ? 108 ARG E CB  1 
ATOM 6643  C CG  . ARG E 2 108 ? -24.470 45.521  72.280  1.00 52.81  ? 108 ARG E CG  1 
ATOM 6644  C CD  . ARG E 2 108 ? -24.190 46.947  72.704  1.00 50.02  ? 108 ARG E CD  1 
ATOM 6645  N NE  . ARG E 2 108 ? -22.784 47.122  73.043  1.00 51.77  ? 108 ARG E NE  1 
ATOM 6646  C CZ  . ARG E 2 108 ? -22.328 47.913  74.009  1.00 55.55  ? 108 ARG E CZ  1 
ATOM 6647  N NH1 . ARG E 2 108 ? -23.177 48.613  74.752  1.00 52.96  ? 108 ARG E NH1 1 
ATOM 6648  N NH2 . ARG E 2 108 ? -21.016 48.017  74.226  1.00 61.84  ? 108 ARG E NH2 1 
ATOM 6649  N N   . ALA E 2 109 ? -25.833 45.778  75.586  1.00 57.66  ? 109 ALA E N   1 
ATOM 6650  C CA  . ALA E 2 109 ? -26.475 46.878  76.304  1.00 57.24  ? 109 ALA E CA  1 
ATOM 6651  C C   . ALA E 2 109 ? -26.645 48.057  75.347  1.00 59.69  ? 109 ALA E C   1 
ATOM 6652  O O   . ALA E 2 109 ? -25.742 48.345  74.563  1.00 64.28  ? 109 ALA E O   1 
ATOM 6653  C CB  . ALA E 2 109 ? -25.609 47.292  77.492  1.00 52.45  ? 109 ALA E CB  1 
ATOM 6654  N N   . ASP E 2 110 ? -27.785 48.741  75.389  1.00 59.67  ? 110 ASP E N   1 
ATOM 6655  C CA  . ASP E 2 110 ? -27.972 49.888  74.499  1.00 60.17  ? 110 ASP E CA  1 
ATOM 6656  C C   . ASP E 2 110 ? -26.889 50.952  74.721  1.00 60.29  ? 110 ASP E C   1 
ATOM 6657  O O   . ASP E 2 110 ? -26.255 51.018  75.780  1.00 58.24  ? 110 ASP E O   1 
ATOM 6658  C CB  . ASP E 2 110 ? -29.353 50.522  74.698  1.00 63.38  ? 110 ASP E CB  1 
ATOM 6659  C CG  . ASP E 2 110 ? -30.469 49.691  74.101  1.00 71.23  ? 110 ASP E CG  1 
ATOM 6660  O OD1 . ASP E 2 110 ? -31.622 50.173  74.062  1.00 75.51  ? 110 ASP E OD1 1 
ATOM 6661  O OD2 . ASP E 2 110 ? -30.195 48.549  73.672  1.00 79.37  ? 110 ASP E OD2 1 
ATOM 6662  N N   . ALA E 2 111 ? -26.666 51.772  73.701  1.00 60.71  ? 111 ALA E N   1 
ATOM 6663  C CA  . ALA E 2 111 ? -25.686 52.852  73.776  1.00 57.02  ? 111 ALA E CA  1 
ATOM 6664  C C   . ALA E 2 111 ? -26.147 53.929  72.811  1.00 56.69  ? 111 ALA E C   1 
ATOM 6665  O O   . ALA E 2 111 ? -26.767 53.636  71.779  1.00 54.43  ? 111 ALA E O   1 
ATOM 6666  C CB  . ALA E 2 111 ? -24.307 52.360  73.391  1.00 52.87  ? 111 ALA E CB  1 
ATOM 6667  N N   . ALA E 2 112 ? -25.872 55.180  73.158  1.00 55.14  ? 112 ALA E N   1 
ATOM 6668  C CA  . ALA E 2 112 ? -26.267 56.278  72.306  1.00 54.21  ? 112 ALA E CA  1 
ATOM 6669  C C   . ALA E 2 112 ? -25.091 56.646  71.407  1.00 53.09  ? 112 ALA E C   1 
ATOM 6670  O O   . ALA E 2 112 ? -23.915 56.529  71.792  1.00 55.31  ? 112 ALA E O   1 
ATOM 6671  C CB  . ALA E 2 112 ? -26.706 57.464  73.148  1.00 56.04  ? 112 ALA E CB  1 
ATOM 6672  N N   . PRO E 2 113 ? -25.396 57.080  70.181  1.00 51.12  ? 113 PRO E N   1 
ATOM 6673  C CA  . PRO E 2 113 ? -24.362 57.461  69.220  1.00 49.65  ? 113 PRO E CA  1 
ATOM 6674  C C   . PRO E 2 113 ? -23.401 58.501  69.750  1.00 49.37  ? 113 PRO E C   1 
ATOM 6675  O O   . PRO E 2 113 ? -23.572 59.037  70.840  1.00 52.46  ? 113 PRO E O   1 
ATOM 6676  C CB  . PRO E 2 113 ? -25.169 57.984  68.027  1.00 50.85  ? 113 PRO E CB  1 
ATOM 6677  C CG  . PRO E 2 113 ? -26.444 58.468  68.657  1.00 48.80  ? 113 PRO E CG  1 
ATOM 6678  C CD  . PRO E 2 113 ? -26.741 57.378  69.655  1.00 49.92  ? 113 PRO E CD  1 
ATOM 6679  N N   . THR E 2 114 ? -22.377 58.771  68.961  1.00 48.99  ? 114 THR E N   1 
ATOM 6680  C CA  . THR E 2 114 ? -21.392 59.771  69.303  1.00 47.26  ? 114 THR E CA  1 
ATOM 6681  C C   . THR E 2 114 ? -21.281 60.543  68.009  1.00 47.69  ? 114 THR E C   1 
ATOM 6682  O O   . THR E 2 114 ? -20.554 60.156  67.091  1.00 45.94  ? 114 THR E O   1 
ATOM 6683  C CB  . THR E 2 114 ? -20.075 59.120  69.684  1.00 46.29  ? 114 THR E CB  1 
ATOM 6684  O OG1 . THR E 2 114 ? -20.295 58.271  70.822  1.00 47.35  ? 114 THR E OG1 1 
ATOM 6685  C CG2 . THR E 2 114 ? -19.034 60.169  70.015  1.00 41.60  ? 114 THR E CG2 1 
ATOM 6686  N N   . VAL E 2 115 ? -22.053 61.625  67.944  1.00 48.55  ? 115 VAL E N   1 
ATOM 6687  C CA  . VAL E 2 115 ? -22.128 62.475  66.765  1.00 47.40  ? 115 VAL E CA  1 
ATOM 6688  C C   . VAL E 2 115 ? -20.988 63.444  66.560  1.00 43.86  ? 115 VAL E C   1 
ATOM 6689  O O   . VAL E 2 115 ? -20.376 63.934  67.505  1.00 45.89  ? 115 VAL E O   1 
ATOM 6690  C CB  . VAL E 2 115 ? -23.417 63.282  66.766  1.00 50.21  ? 115 VAL E CB  1 
ATOM 6691  C CG1 . VAL E 2 115 ? -23.697 63.796  65.358  1.00 49.09  ? 115 VAL E CG1 1 
ATOM 6692  C CG2 . VAL E 2 115 ? -24.559 62.420  67.285  1.00 53.73  ? 115 VAL E CG2 1 
ATOM 6693  N N   . SER E 2 116 ? -20.724 63.725  65.296  1.00 41.90  ? 116 SER E N   1 
ATOM 6694  C CA  . SER E 2 116 ? -19.661 64.626  64.923  1.00 42.71  ? 116 SER E CA  1 
ATOM 6695  C C   . SER E 2 116 ? -20.018 65.136  63.549  1.00 46.42  ? 116 SER E C   1 
ATOM 6696  O O   . SER E 2 116 ? -20.241 64.359  62.617  1.00 48.12  ? 116 SER E O   1 
ATOM 6697  C CB  . SER E 2 116 ? -18.341 63.873  64.876  1.00 43.09  ? 116 SER E CB  1 
ATOM 6698  O OG  . SER E 2 116 ? -18.151 63.131  66.071  1.00 37.82  ? 116 SER E OG  1 
ATOM 6699  N N   . ILE E 2 117 ? -20.098 66.449  63.419  1.00 51.61  ? 117 ILE E N   1 
ATOM 6700  C CA  . ILE E 2 117 ? -20.446 67.023  62.133  1.00 53.14  ? 117 ILE E CA  1 
ATOM 6701  C C   . ILE E 2 117 ? -19.197 67.663  61.563  1.00 51.75  ? 117 ILE E C   1 
ATOM 6702  O O   . ILE E 2 117 ? -18.346 68.144  62.311  1.00 48.33  ? 117 ILE E O   1 
ATOM 6703  C CB  . ILE E 2 117 ? -21.621 68.039  62.274  1.00 55.84  ? 117 ILE E CB  1 
ATOM 6704  C CG1 . ILE E 2 117 ? -21.983 68.621  60.908  1.00 56.21  ? 117 ILE E CG1 1 
ATOM 6705  C CG2 . ILE E 2 117 ? -21.270 69.114  63.283  1.00 53.11  ? 117 ILE E CG2 1 
ATOM 6706  C CD1 . ILE E 2 117 ? -23.367 69.229  60.882  1.00 61.57  ? 117 ILE E CD1 1 
ATOM 6707  N N   . PHE E 2 118 ? -19.078 67.611  60.241  1.00 50.92  ? 118 PHE E N   1 
ATOM 6708  C CA  . PHE E 2 118 ? -17.932 68.159  59.547  1.00 53.16  ? 118 PHE E CA  1 
ATOM 6709  C C   . PHE E 2 118 ? -18.340 69.015  58.361  1.00 57.12  ? 118 PHE E C   1 
ATOM 6710  O O   . PHE E 2 118 ? -19.092 68.579  57.478  1.00 62.92  ? 118 PHE E O   1 
ATOM 6711  C CB  . PHE E 2 118 ? -17.007 67.044  59.046  1.00 49.28  ? 118 PHE E CB  1 
ATOM 6712  C CG  . PHE E 2 118 ? -16.353 66.260  60.140  1.00 45.35  ? 118 PHE E CG  1 
ATOM 6713  C CD1 . PHE E 2 118 ? -17.072 65.317  60.868  1.00 39.61  ? 118 PHE E CD1 1 
ATOM 6714  C CD2 . PHE E 2 118 ? -15.016 66.486  60.470  1.00 43.37  ? 118 PHE E CD2 1 
ATOM 6715  C CE1 . PHE E 2 118 ? -16.461 64.608  61.923  1.00 42.61  ? 118 PHE E CE1 1 
ATOM 6716  C CE2 . PHE E 2 118 ? -14.393 65.780  61.525  1.00 41.93  ? 118 PHE E CE2 1 
ATOM 6717  C CZ  . PHE E 2 118 ? -15.116 64.843  62.252  1.00 42.17  ? 118 PHE E CZ  1 
ATOM 6718  N N   . PRO E 2 119 ? -17.848 70.259  58.331  1.00 55.44  ? 119 PRO E N   1 
ATOM 6719  C CA  . PRO E 2 119 ? -18.118 71.222  57.266  1.00 50.23  ? 119 PRO E CA  1 
ATOM 6720  C C   . PRO E 2 119 ? -17.196 70.932  56.082  1.00 47.20  ? 119 PRO E C   1 
ATOM 6721  O O   . PRO E 2 119 ? -16.036 70.565  56.270  1.00 46.39  ? 119 PRO E O   1 
ATOM 6722  C CB  . PRO E 2 119 ? -17.799 72.541  57.934  1.00 53.46  ? 119 PRO E CB  1 
ATOM 6723  C CG  . PRO E 2 119 ? -16.656 72.174  58.847  1.00 52.32  ? 119 PRO E CG  1 
ATOM 6724  C CD  . PRO E 2 119 ? -17.151 70.904  59.461  1.00 56.33  ? 119 PRO E CD  1 
ATOM 6725  N N   . PRO E 2 120 ? -17.698 71.106  54.853  1.00 45.89  ? 120 PRO E N   1 
ATOM 6726  C CA  . PRO E 2 120 ? -16.919 70.859  53.635  1.00 49.92  ? 120 PRO E CA  1 
ATOM 6727  C C   . PRO E 2 120 ? -15.466 71.284  53.800  1.00 52.96  ? 120 PRO E C   1 
ATOM 6728  O O   . PRO E 2 120 ? -15.192 72.343  54.339  1.00 53.79  ? 120 PRO E O   1 
ATOM 6729  C CB  . PRO E 2 120 ? -17.637 71.705  52.587  1.00 46.81  ? 120 PRO E CB  1 
ATOM 6730  C CG  . PRO E 2 120 ? -19.048 71.638  53.028  1.00 42.19  ? 120 PRO E CG  1 
ATOM 6731  C CD  . PRO E 2 120 ? -18.961 71.794  54.535  1.00 42.91  ? 120 PRO E CD  1 
ATOM 6732  N N   . SER E 2 121 ? -14.529 70.459  53.352  1.00 55.08  ? 121 SER E N   1 
ATOM 6733  C CA  . SER E 2 121 ? -13.135 70.836  53.481  1.00 53.64  ? 121 SER E CA  1 
ATOM 6734  C C   . SER E 2 121 ? -12.830 71.857  52.403  1.00 56.01  ? 121 SER E C   1 
ATOM 6735  O O   . SER E 2 121 ? -13.414 71.837  51.309  1.00 51.45  ? 121 SER E O   1 
ATOM 6736  C CB  . SER E 2 121 ? -12.218 69.633  53.301  1.00 55.33  ? 121 SER E CB  1 
ATOM 6737  O OG  . SER E 2 121 ? -12.228 69.217  51.949  1.00 64.11  ? 121 SER E OG  1 
ATOM 6738  N N   . SER E 2 122 ? -11.911 72.755  52.730  1.00 59.77  ? 122 SER E N   1 
ATOM 6739  C CA  . SER E 2 122 ? -11.489 73.797  51.809  1.00 60.70  ? 122 SER E CA  1 
ATOM 6740  C C   . SER E 2 122 ? -11.293 73.215  50.417  1.00 61.22  ? 122 SER E C   1 
ATOM 6741  O O   . SER E 2 122 ? -11.873 73.695  49.442  1.00 61.15  ? 122 SER E O   1 
ATOM 6742  C CB  . SER E 2 122 ? -10.186 74.416  52.314  1.00 60.25  ? 122 SER E CB  1 
ATOM 6743  O OG  . SER E 2 122 ? -9.461  73.474  53.092  1.00 61.94  ? 122 SER E OG  1 
ATOM 6744  N N   . GLU E 2 123 ? -10.479 72.167  50.341  1.00 62.94  ? 123 GLU E N   1 
ATOM 6745  C CA  . GLU E 2 123 ? -10.200 71.513  49.073  1.00 62.88  ? 123 GLU E CA  1 
ATOM 6746  C C   . GLU E 2 123 ? -11.464 71.265  48.271  1.00 57.05  ? 123 GLU E C   1 
ATOM 6747  O O   . GLU E 2 123 ? -11.610 71.762  47.163  1.00 52.14  ? 123 GLU E O   1 
ATOM 6748  C CB  . GLU E 2 123 ? -9.501  70.164  49.283  1.00 69.23  ? 123 GLU E CB  1 
ATOM 6749  C CG  . GLU E 2 123 ? -8.053  70.218  49.737  1.00 77.00  ? 123 GLU E CG  1 
ATOM 6750  C CD  . GLU E 2 123 ? -7.916  70.186  51.245  1.00 85.13  ? 123 GLU E CD  1 
ATOM 6751  O OE1 . GLU E 2 123 ? -6.801  69.865  51.731  1.00 89.57  ? 123 GLU E OE1 1 
ATOM 6752  O OE2 . GLU E 2 123 ? -8.921  70.482  51.941  1.00 88.91  ? 123 GLU E OE2 1 
ATOM 6753  N N   . GLN E 2 124 ? -12.377 70.489  48.837  1.00 54.91  ? 124 GLN E N   1 
ATOM 6754  C CA  . GLN E 2 124 ? -13.596 70.161  48.123  1.00 56.80  ? 124 GLN E CA  1 
ATOM 6755  C C   . GLN E 2 124 ? -14.245 71.384  47.504  1.00 59.27  ? 124 GLN E C   1 
ATOM 6756  O O   . GLN E 2 124 ? -14.814 71.314  46.410  1.00 60.53  ? 124 GLN E O   1 
ATOM 6757  C CB  . GLN E 2 124 ? -14.601 69.475  49.047  1.00 53.37  ? 124 GLN E CB  1 
ATOM 6758  C CG  . GLN E 2 124 ? -15.898 69.144  48.329  1.00 40.51  ? 124 GLN E CG  1 
ATOM 6759  C CD  . GLN E 2 124 ? -16.984 68.667  49.263  1.00 42.58  ? 124 GLN E CD  1 
ATOM 6760  O OE1 . GLN E 2 124 ? -16.946 68.917  50.478  1.00 41.36  ? 124 GLN E OE1 1 
ATOM 6761  N NE2 . GLN E 2 124 ? -17.980 67.990  48.697  1.00 36.51  ? 124 GLN E NE2 1 
ATOM 6762  N N   . LEU E 2 125 ? -14.151 72.504  48.212  1.00 62.54  ? 125 LEU E N   1 
ATOM 6763  C CA  . LEU E 2 125 ? -14.746 73.767  47.767  1.00 62.93  ? 125 LEU E CA  1 
ATOM 6764  C C   . LEU E 2 125 ? -14.080 74.345  46.520  1.00 60.89  ? 125 LEU E C   1 
ATOM 6765  O O   . LEU E 2 125 ? -14.731 74.895  45.629  1.00 54.13  ? 125 LEU E O   1 
ATOM 6766  C CB  . LEU E 2 125 ? -14.671 74.768  48.912  1.00 62.05  ? 125 LEU E CB  1 
ATOM 6767  C CG  . LEU E 2 125 ? -15.418 74.250  50.141  1.00 65.07  ? 125 LEU E CG  1 
ATOM 6768  C CD1 . LEU E 2 125 ? -14.965 74.972  51.400  1.00 67.10  ? 125 LEU E CD1 1 
ATOM 6769  C CD2 . LEU E 2 125 ? -16.905 74.420  49.906  1.00 62.85  ? 125 LEU E CD2 1 
ATOM 6770  N N   . THR E 2 126 ? -12.769 74.205  46.471  1.00 63.16  ? 126 THR E N   1 
ATOM 6771  C CA  . THR E 2 126 ? -11.996 74.699  45.356  1.00 65.24  ? 126 THR E CA  1 
ATOM 6772  C C   . THR E 2 126 ? -12.416 74.028  44.049  1.00 67.28  ? 126 THR E C   1 
ATOM 6773  O O   . THR E 2 126 ? -11.890 74.348  42.986  1.00 68.95  ? 126 THR E O   1 
ATOM 6774  C CB  . THR E 2 126 ? -10.500 74.437  45.599  1.00 65.58  ? 126 THR E CB  1 
ATOM 6775  O OG1 . THR E 2 126 ? -10.195 73.067  45.309  1.00 69.57  ? 126 THR E OG1 1 
ATOM 6776  C CG2 . THR E 2 126 ? -10.157 74.705  47.066  1.00 65.81  ? 126 THR E CG2 1 
ATOM 6777  N N   . SER E 2 127 ? -13.355 73.092  44.117  1.00 67.29  ? 127 SER E N   1 
ATOM 6778  C CA  . SER E 2 127 ? -13.800 72.403  42.910  1.00 66.70  ? 127 SER E CA  1 
ATOM 6779  C C   . SER E 2 127 ? -15.289 72.622  42.691  1.00 65.52  ? 127 SER E C   1 
ATOM 6780  O O   . SER E 2 127 ? -15.909 71.994  41.827  1.00 64.82  ? 127 SER E O   1 
ATOM 6781  C CB  . SER E 2 127 ? -13.492 70.907  43.014  1.00 66.27  ? 127 SER E CB  1 
ATOM 6782  O OG  . SER E 2 127 ? -13.992 70.362  44.225  1.00 66.19  ? 127 SER E OG  1 
ATOM 6783  N N   . GLY E 2 128 ? -15.854 73.524  43.485  1.00 63.36  ? 128 GLY E N   1 
ATOM 6784  C CA  . GLY E 2 128 ? -17.264 73.824  43.370  1.00 63.44  ? 128 GLY E CA  1 
ATOM 6785  C C   . GLY E 2 128 ? -18.116 72.812  44.098  1.00 64.94  ? 128 GLY E C   1 
ATOM 6786  O O   . GLY E 2 128 ? -19.344 72.829  43.980  1.00 67.86  ? 128 GLY E O   1 
ATOM 6787  N N   . GLY E 2 129 ? -17.473 71.927  44.854  1.00 64.55  ? 129 GLY E N   1 
ATOM 6788  C CA  . GLY E 2 129 ? -18.217 70.918  45.583  1.00 61.63  ? 129 GLY E CA  1 
ATOM 6789  C C   . GLY E 2 129 ? -18.433 71.309  47.028  1.00 59.92  ? 129 GLY E C   1 
ATOM 6790  O O   . GLY E 2 129 ? -17.669 72.114  47.558  1.00 57.92  ? 129 GLY E O   1 
ATOM 6791  N N   . ALA E 2 130 ? -19.460 70.743  47.669  1.00 59.37  ? 130 ALA E N   1 
ATOM 6792  C CA  . ALA E 2 130 ? -19.754 71.040  49.077  1.00 55.74  ? 130 ALA E CA  1 
ATOM 6793  C C   . ALA E 2 130 ? -20.411 69.891  49.857  1.00 53.28  ? 130 ALA E C   1 
ATOM 6794  O O   . ALA E 2 130 ? -21.624 69.674  49.767  1.00 53.68  ? 130 ALA E O   1 
ATOM 6795  C CB  . ALA E 2 130 ? -20.628 72.273  49.162  1.00 54.77  ? 130 ALA E CB  1 
ATOM 6796  N N   . SER E 2 131 ? -19.620 69.171  50.646  1.00 47.89  ? 131 SER E N   1 
ATOM 6797  C CA  . SER E 2 131 ? -20.173 68.070  51.414  1.00 46.76  ? 131 SER E CA  1 
ATOM 6798  C C   . SER E 2 131 ? -20.008 68.190  52.917  1.00 44.12  ? 131 SER E C   1 
ATOM 6799  O O   . SER E 2 131 ? -18.899 68.381  53.441  1.00 44.60  ? 131 SER E O   1 
ATOM 6800  C CB  . SER E 2 131 ? -19.569 66.745  50.950  1.00 48.70  ? 131 SER E CB  1 
ATOM 6801  O OG  . SER E 2 131 ? -20.040 66.392  49.664  1.00 57.37  ? 131 SER E OG  1 
ATOM 6802  N N   . VAL E 2 132 ? -21.129 68.065  53.610  1.00 41.05  ? 132 VAL E N   1 
ATOM 6803  C CA  . VAL E 2 132 ? -21.131 68.127  55.056  1.00 42.46  ? 132 VAL E CA  1 
ATOM 6804  C C   . VAL E 2 132 ? -21.439 66.720  55.513  1.00 45.83  ? 132 VAL E C   1 
ATOM 6805  O O   . VAL E 2 132 ? -22.470 66.154  55.148  1.00 47.69  ? 132 VAL E O   1 
ATOM 6806  C CB  . VAL E 2 132 ? -22.234 69.053  55.584  1.00 41.99  ? 132 VAL E CB  1 
ATOM 6807  C CG1 . VAL E 2 132 ? -22.071 69.245  57.092  1.00 43.54  ? 132 VAL E CG1 1 
ATOM 6808  C CG2 . VAL E 2 132 ? -22.194 70.379  54.846  1.00 41.66  ? 132 VAL E CG2 1 
ATOM 6809  N N   . VAL E 2 133 ? -20.550 66.151  56.310  1.00 46.47  ? 133 VAL E N   1 
ATOM 6810  C CA  . VAL E 2 133 ? -20.753 64.796  56.776  1.00 47.14  ? 133 VAL E CA  1 
ATOM 6811  C C   . VAL E 2 133 ? -21.034 64.805  58.250  1.00 46.77  ? 133 VAL E C   1 
ATOM 6812  O O   . VAL E 2 133 ? -20.822 65.801  58.925  1.00 47.85  ? 133 VAL E O   1 
ATOM 6813  C CB  . VAL E 2 133 ? -19.507 63.927  56.531  1.00 46.87  ? 133 VAL E CB  1 
ATOM 6814  C CG1 . VAL E 2 133 ? -19.018 64.114  55.106  1.00 42.90  ? 133 VAL E CG1 1 
ATOM 6815  C CG2 . VAL E 2 133 ? -18.418 64.288  57.527  1.00 48.77  ? 133 VAL E CG2 1 
ATOM 6816  N N   . CYS E 2 134 ? -21.512 63.679  58.746  1.00 48.17  ? 134 CYS E N   1 
ATOM 6817  C CA  . CYS E 2 134 ? -21.784 63.559  60.154  1.00 50.04  ? 134 CYS E CA  1 
ATOM 6818  C C   . CYS E 2 134 ? -21.763 62.090  60.533  1.00 50.58  ? 134 CYS E C   1 
ATOM 6819  O O   . CYS E 2 134 ? -22.429 61.265  59.898  1.00 55.20  ? 134 CYS E O   1 
ATOM 6820  C CB  . CYS E 2 134 ? -23.135 64.170  60.493  1.00 50.85  ? 134 CYS E CB  1 
ATOM 6821  S SG  . CYS E 2 134 ? -23.422 64.162  62.274  1.00 64.92  ? 134 CYS E SG  1 
ATOM 6822  N N   . PHE E 2 135 ? -20.982 61.768  61.559  1.00 46.67  ? 135 PHE E N   1 
ATOM 6823  C CA  . PHE E 2 135 ? -20.866 60.399  62.029  1.00 42.58  ? 135 PHE E CA  1 
ATOM 6824  C C   . PHE E 2 135 ? -21.601 60.191  63.345  1.00 42.08  ? 135 PHE E C   1 
ATOM 6825  O O   . PHE E 2 135 ? -21.420 60.942  64.301  1.00 34.97  ? 135 PHE E O   1 
ATOM 6826  C CB  . PHE E 2 135 ? -19.407 60.007  62.273  1.00 39.88  ? 135 PHE E CB  1 
ATOM 6827  C CG  . PHE E 2 135 ? -18.482 60.267  61.120  1.00 39.03  ? 135 PHE E CG  1 
ATOM 6828  C CD1 . PHE E 2 135 ? -18.771 59.809  59.836  1.00 42.33  ? 135 PHE E CD1 1 
ATOM 6829  C CD2 . PHE E 2 135 ? -17.277 60.929  61.332  1.00 37.41  ? 135 PHE E CD2 1 
ATOM 6830  C CE1 . PHE E 2 135 ? -17.866 60.011  58.784  1.00 34.91  ? 135 PHE E CE1 1 
ATOM 6831  C CE2 . PHE E 2 135 ? -16.373 61.131  60.287  1.00 35.24  ? 135 PHE E CE2 1 
ATOM 6832  C CZ  . PHE E 2 135 ? -16.669 60.672  59.019  1.00 34.24  ? 135 PHE E CZ  1 
ATOM 6833  N N   . LEU E 2 136 ? -22.421 59.152  63.381  1.00 44.73  ? 136 LEU E N   1 
ATOM 6834  C CA  . LEU E 2 136 ? -23.150 58.776  64.582  1.00 46.38  ? 136 LEU E CA  1 
ATOM 6835  C C   . LEU E 2 136 ? -22.500 57.433  64.829  1.00 45.99  ? 136 LEU E C   1 
ATOM 6836  O O   . LEU E 2 136 ? -22.845 56.437  64.193  1.00 43.57  ? 136 LEU E O   1 
ATOM 6837  C CB  . LEU E 2 136 ? -24.632 58.596  64.281  1.00 47.75  ? 136 LEU E CB  1 
ATOM 6838  C CG  . LEU E 2 136 ? -25.250 59.767  63.519  1.00 46.07  ? 136 LEU E CG  1 
ATOM 6839  C CD1 . LEU E 2 136 ? -24.760 59.772  62.073  1.00 46.56  ? 136 LEU E CD1 1 
ATOM 6840  C CD2 . LEU E 2 136 ? -26.758 59.637  63.564  1.00 42.71  ? 136 LEU E CD2 1 
ATOM 6841  N N   . ASN E 2 137 ? -21.544 57.417  65.744  1.00 45.41  ? 137 ASN E N   1 
ATOM 6842  C CA  . ASN E 2 137 ? -20.802 56.205  65.993  1.00 45.73  ? 137 ASN E CA  1 
ATOM 6843  C C   . ASN E 2 137 ? -21.001 55.459  67.281  1.00 46.74  ? 137 ASN E C   1 
ATOM 6844  O O   . ASN E 2 137 ? -21.187 56.039  68.346  1.00 49.40  ? 137 ASN E O   1 
ATOM 6845  C CB  . ASN E 2 137 ? -19.319 56.495  65.835  1.00 43.31  ? 137 ASN E CB  1 
ATOM 6846  C CG  . ASN E 2 137 ? -18.982 56.979  64.457  1.00 43.06  ? 137 ASN E CG  1 
ATOM 6847  O OD1 . ASN E 2 137 ? -19.824 56.927  63.549  1.00 41.64  ? 137 ASN E OD1 1 
ATOM 6848  N ND2 . ASN E 2 137 ? -17.746 57.449  64.276  1.00 39.57  ? 137 ASN E ND2 1 
ATOM 6849  N N   . ASN E 2 138 ? -20.954 54.142  67.152  1.00 48.04  ? 138 ASN E N   1 
ATOM 6850  C CA  . ASN E 2 138 ? -21.057 53.252  68.285  1.00 49.02  ? 138 ASN E CA  1 
ATOM 6851  C C   . ASN E 2 138 ? -22.344 53.278  69.071  1.00 51.87  ? 138 ASN E C   1 
ATOM 6852  O O   . ASN E 2 138 ? -22.331 53.520  70.281  1.00 54.36  ? 138 ASN E O   1 
ATOM 6853  C CB  . ASN E 2 138 ? -19.889 53.526  69.207  1.00 45.29  ? 138 ASN E CB  1 
ATOM 6854  C CG  . ASN E 2 138 ? -18.584 53.532  68.465  1.00 51.19  ? 138 ASN E CG  1 
ATOM 6855  O OD1 . ASN E 2 138 ? -17.941 52.494  68.301  1.00 56.37  ? 138 ASN E OD1 1 
ATOM 6856  N ND2 . ASN E 2 138 ? -18.194 54.702  67.977  1.00 55.10  ? 138 ASN E ND2 1 
ATOM 6857  N N   . PHE E 2 139 ? -23.461 53.031  68.399  1.00 52.29  ? 139 PHE E N   1 
ATOM 6858  C CA  . PHE E 2 139 ? -24.713 52.986  69.119  1.00 52.79  ? 139 PHE E CA  1 
ATOM 6859  C C   . PHE E 2 139 ? -25.211 51.557  69.252  1.00 56.88  ? 139 PHE E C   1 
ATOM 6860  O O   . PHE E 2 139 ? -24.428 50.617  69.151  1.00 57.62  ? 139 PHE E O   1 
ATOM 6861  C CB  . PHE E 2 139 ? -25.770 53.852  68.453  1.00 47.61  ? 139 PHE E CB  1 
ATOM 6862  C CG  . PHE E 2 139 ? -25.825 53.738  66.966  1.00 44.55  ? 139 PHE E CG  1 
ATOM 6863  C CD1 . PHE E 2 139 ? -24.843 54.322  66.169  1.00 48.58  ? 139 PHE E CD1 1 
ATOM 6864  C CD2 . PHE E 2 139 ? -26.946 53.181  66.351  1.00 45.07  ? 139 PHE E CD2 1 
ATOM 6865  C CE1 . PHE E 2 139 ? -24.992 54.367  64.769  1.00 49.82  ? 139 PHE E CE1 1 
ATOM 6866  C CE2 . PHE E 2 139 ? -27.109 53.215  64.956  1.00 43.55  ? 139 PHE E CE2 1 
ATOM 6867  C CZ  . PHE E 2 139 ? -26.136 53.812  64.161  1.00 43.99  ? 139 PHE E CZ  1 
ATOM 6868  N N   . TYR E 2 140 ? -26.509 51.413  69.510  1.00 62.60  ? 140 TYR E N   1 
ATOM 6869  C CA  . TYR E 2 140 ? -27.191 50.121  69.662  1.00 66.84  ? 140 TYR E CA  1 
ATOM 6870  C C   . TYR E 2 140 ? -28.521 50.370  70.350  1.00 70.05  ? 140 TYR E C   1 
ATOM 6871  O O   . TYR E 2 140 ? -28.560 50.946  71.444  1.00 69.09  ? 140 TYR E O   1 
ATOM 6872  C CB  . TYR E 2 140 ? -26.379 49.135  70.515  1.00 67.15  ? 140 TYR E CB  1 
ATOM 6873  C CG  . TYR E 2 140 ? -26.960 47.731  70.506  1.00 68.90  ? 140 TYR E CG  1 
ATOM 6874  C CD1 . TYR E 2 140 ? -27.228 47.076  69.302  1.00 69.75  ? 140 TYR E CD1 1 
ATOM 6875  C CD2 . TYR E 2 140 ? -27.232 47.055  71.690  1.00 69.96  ? 140 TYR E CD2 1 
ATOM 6876  C CE1 . TYR E 2 140 ? -27.750 45.787  69.280  1.00 70.53  ? 140 TYR E CE1 1 
ATOM 6877  C CE2 . TYR E 2 140 ? -27.753 45.760  71.676  1.00 71.35  ? 140 TYR E CE2 1 
ATOM 6878  C CZ  . TYR E 2 140 ? -28.006 45.132  70.470  1.00 71.02  ? 140 TYR E CZ  1 
ATOM 6879  O OH  . TYR E 2 140 ? -28.484 43.838  70.457  1.00 71.94  ? 140 TYR E OH  1 
ATOM 6880  N N   . PRO E 2 141 ? -29.631 49.918  69.745  1.00 73.37  ? 141 PRO E N   1 
ATOM 6881  C CA  . PRO E 2 141 ? -29.851 49.179  68.496  1.00 75.46  ? 141 PRO E CA  1 
ATOM 6882  C C   . PRO E 2 141 ? -29.347 49.814  67.212  1.00 76.76  ? 141 PRO E C   1 
ATOM 6883  O O   . PRO E 2 141 ? -28.882 50.948  67.197  1.00 75.77  ? 141 PRO E O   1 
ATOM 6884  C CB  . PRO E 2 141 ? -31.367 49.011  68.457  1.00 77.91  ? 141 PRO E CB  1 
ATOM 6885  C CG  . PRO E 2 141 ? -31.737 48.961  69.909  1.00 79.19  ? 141 PRO E CG  1 
ATOM 6886  C CD  . PRO E 2 141 ? -30.906 50.089  70.464  1.00 77.58  ? 141 PRO E CD  1 
ATOM 6887  N N   . LYS E 2 142 ? -29.477 49.055  66.130  1.00 78.72  ? 142 LYS E N   1 
ATOM 6888  C CA  . LYS E 2 142 ? -29.062 49.480  64.800  1.00 82.14  ? 142 LYS E CA  1 
ATOM 6889  C C   . LYS E 2 142 ? -29.969 50.599  64.317  1.00 82.15  ? 142 LYS E C   1 
ATOM 6890  O O   . LYS E 2 142 ? -29.558 51.468  63.541  1.00 81.49  ? 142 LYS E O   1 
ATOM 6891  C CB  . LYS E 2 142 ? -29.133 48.286  63.831  1.00 86.59  ? 142 LYS E CB  1 
ATOM 6892  C CG  . LYS E 2 142 ? -28.802 48.583  62.357  1.00 91.61  ? 142 LYS E CG  1 
ATOM 6893  C CD  . LYS E 2 142 ? -29.990 49.174  61.585  1.00 97.94  ? 142 LYS E CD  1 
ATOM 6894  C CE  . LYS E 2 142 ? -29.617 49.475  60.133  1.00 99.42  ? 142 LYS E CE  1 
ATOM 6895  N NZ  . LYS E 2 142 ? -29.023 48.277  59.459  1.00 101.10 ? 142 LYS E NZ  1 
ATOM 6896  N N   . ASP E 2 143 ? -31.209 50.577  64.784  1.00 81.95  ? 143 ASP E N   1 
ATOM 6897  C CA  . ASP E 2 143 ? -32.163 51.589  64.374  1.00 84.49  ? 143 ASP E CA  1 
ATOM 6898  C C   . ASP E 2 143 ? -31.877 52.988  64.928  1.00 81.76  ? 143 ASP E C   1 
ATOM 6899  O O   . ASP E 2 143 ? -31.811 53.205  66.146  1.00 79.47  ? 143 ASP E O   1 
ATOM 6900  C CB  . ASP E 2 143 ? -33.586 51.146  64.736  1.00 90.32  ? 143 ASP E CB  1 
ATOM 6901  C CG  . ASP E 2 143 ? -34.239 50.321  63.632  1.00 94.39  ? 143 ASP E CG  1 
ATOM 6902  O OD1 . ASP E 2 143 ? -33.651 49.295  63.225  1.00 97.77  ? 143 ASP E OD1 1 
ATOM 6903  O OD2 . ASP E 2 143 ? -35.340 50.701  63.170  1.00 96.48  ? 143 ASP E OD2 1 
ATOM 6904  N N   . ILE E 2 144 ? -31.697 53.927  64.004  1.00 78.51  ? 144 ILE E N   1 
ATOM 6905  C CA  . ILE E 2 144 ? -31.442 55.310  64.344  1.00 75.75  ? 144 ILE E CA  1 
ATOM 6906  C C   . ILE E 2 144 ? -31.839 56.162  63.160  1.00 75.06  ? 144 ILE E C   1 
ATOM 6907  O O   . ILE E 2 144 ? -31.813 55.705  62.013  1.00 70.97  ? 144 ILE E O   1 
ATOM 6908  C CB  . ILE E 2 144 ? -29.967 55.566  64.643  1.00 75.89  ? 144 ILE E CB  1 
ATOM 6909  C CG1 . ILE E 2 144 ? -29.821 56.914  65.345  1.00 75.76  ? 144 ILE E CG1 1 
ATOM 6910  C CG2 . ILE E 2 144 ? -29.165 55.579  63.350  1.00 74.20  ? 144 ILE E CG2 1 
ATOM 6911  C CD1 . ILE E 2 144 ? -28.430 57.188  65.858  1.00 74.89  ? 144 ILE E CD1 1 
ATOM 6912  N N   . ASN E 2 145 ? -32.204 57.406  63.452  1.00 76.71  ? 145 ASN E N   1 
ATOM 6913  C CA  . ASN E 2 145 ? -32.621 58.348  62.424  1.00 78.79  ? 145 ASN E CA  1 
ATOM 6914  C C   . ASN E 2 145 ? -31.816 59.638  62.425  1.00 77.51  ? 145 ASN E C   1 
ATOM 6915  O O   . ASN E 2 145 ? -31.392 60.140  63.471  1.00 78.87  ? 145 ASN E O   1 
ATOM 6916  C CB  . ASN E 2 145 ? -34.112 58.671  62.569  1.00 83.73  ? 145 ASN E CB  1 
ATOM 6917  C CG  . ASN E 2 145 ? -35.000 57.486  62.232  1.00 88.24  ? 145 ASN E CG  1 
ATOM 6918  O OD1 . ASN E 2 145 ? -34.899 56.912  61.140  1.00 92.37  ? 145 ASN E OD1 1 
ATOM 6919  N ND2 . ASN E 2 145 ? -35.876 57.113  63.166  1.00 88.24  ? 145 ASN E ND2 1 
ATOM 6920  N N   . VAL E 2 146 ? -31.628 60.172  61.226  1.00 75.78  ? 146 VAL E N   1 
ATOM 6921  C CA  . VAL E 2 146 ? -30.870 61.389  61.031  1.00 75.02  ? 146 VAL E CA  1 
ATOM 6922  C C   . VAL E 2 146 ? -31.668 62.427  60.277  1.00 77.78  ? 146 VAL E C   1 
ATOM 6923  O O   . VAL E 2 146 ? -32.295 62.129  59.265  1.00 77.33  ? 146 VAL E O   1 
ATOM 6924  C CB  . VAL E 2 146 ? -29.583 61.101  60.242  1.00 71.66  ? 146 VAL E CB  1 
ATOM 6925  C CG1 . VAL E 2 146 ? -29.023 62.378  59.650  1.00 67.86  ? 146 VAL E CG1 1 
ATOM 6926  C CG2 . VAL E 2 146 ? -28.567 60.464  61.154  1.00 70.35  ? 146 VAL E CG2 1 
ATOM 6927  N N   . LYS E 2 147 ? -31.627 63.654  60.777  1.00 82.62  ? 147 LYS E N   1 
ATOM 6928  C CA  . LYS E 2 147 ? -32.326 64.759  60.148  1.00 85.45  ? 147 LYS E CA  1 
ATOM 6929  C C   . LYS E 2 147 ? -31.329 65.895  59.963  1.00 86.26  ? 147 LYS E C   1 
ATOM 6930  O O   . LYS E 2 147 ? -30.448 66.112  60.803  1.00 84.84  ? 147 LYS E O   1 
ATOM 6931  C CB  . LYS E 2 147 ? -33.497 65.204  61.036  1.00 89.03  ? 147 LYS E CB  1 
ATOM 6932  C CG  . LYS E 2 147 ? -34.228 66.464  60.577  1.00 90.84  ? 147 LYS E CG  1 
ATOM 6933  C CD  . LYS E 2 147 ? -35.422 66.801  61.489  1.00 92.83  ? 147 LYS E CD  1 
ATOM 6934  C CE  . LYS E 2 147 ? -36.622 65.875  61.247  1.00 89.52  ? 147 LYS E CE  1 
ATOM 6935  N NZ  . LYS E 2 147 ? -37.818 66.238  62.073  1.00 89.68  ? 147 LYS E NZ  1 
ATOM 6936  N N   . TRP E 2 148 ? -31.435 66.594  58.843  1.00 87.13  ? 148 TRP E N   1 
ATOM 6937  C CA  . TRP E 2 148 ? -30.546 67.715  58.609  1.00 88.23  ? 148 TRP E CA  1 
ATOM 6938  C C   . TRP E 2 148 ? -31.374 68.993  58.551  1.00 87.78  ? 148 TRP E C   1 
ATOM 6939  O O   . TRP E 2 148 ? -32.499 68.996  58.033  1.00 85.40  ? 148 TRP E O   1 
ATOM 6940  C CB  . TRP E 2 148 ? -29.765 67.555  57.299  1.00 89.11  ? 148 TRP E CB  1 
ATOM 6941  C CG  . TRP E 2 148 ? -28.641 66.545  57.326  1.00 90.85  ? 148 TRP E CG  1 
ATOM 6942  C CD1 . TRP E 2 148 ? -28.742 65.205  57.101  1.00 89.54  ? 148 TRP E CD1 1 
ATOM 6943  C CD2 . TRP E 2 148 ? -27.242 66.806  57.568  1.00 91.70  ? 148 TRP E CD2 1 
ATOM 6944  N NE1 . TRP E 2 148 ? -27.502 64.615  57.181  1.00 92.04  ? 148 TRP E NE1 1 
ATOM 6945  C CE2 . TRP E 2 148 ? -26.564 65.574  57.466  1.00 91.04  ? 148 TRP E CE2 1 
ATOM 6946  C CE3 . TRP E 2 148 ? -26.500 67.961  57.856  1.00 91.14  ? 148 TRP E CE3 1 
ATOM 6947  C CZ2 . TRP E 2 148 ? -25.175 65.460  57.644  1.00 89.70  ? 148 TRP E CZ2 1 
ATOM 6948  C CZ3 . TRP E 2 148 ? -25.120 67.845  58.033  1.00 90.50  ? 148 TRP E CZ3 1 
ATOM 6949  C CH2 . TRP E 2 148 ? -24.476 66.602  57.924  1.00 90.11  ? 148 TRP E CH2 1 
ATOM 6950  N N   . LYS E 2 149 ? -30.812 70.071  59.093  1.00 88.51  ? 149 LYS E N   1 
ATOM 6951  C CA  . LYS E 2 149 ? -31.465 71.375  59.102  1.00 87.55  ? 149 LYS E CA  1 
ATOM 6952  C C   . LYS E 2 149 ? -30.508 72.496  58.698  1.00 85.14  ? 149 LYS E C   1 
ATOM 6953  O O   . LYS E 2 149 ? -29.555 72.815  59.415  1.00 84.90  ? 149 LYS E O   1 
ATOM 6954  C CB  . LYS E 2 149 ? -32.051 71.668  60.490  1.00 89.20  ? 149 LYS E CB  1 
ATOM 6955  C CG  . LYS E 2 149 ? -33.321 70.896  60.802  1.00 89.17  ? 149 LYS E CG  1 
ATOM 6956  C CD  . LYS E 2 149 ? -33.313 70.370  62.230  1.00 92.16  ? 149 LYS E CD  1 
ATOM 6957  C CE  . LYS E 2 149 ? -33.287 71.484  63.263  1.00 94.96  ? 149 LYS E CE  1 
ATOM 6958  N NZ  . LYS E 2 149 ? -34.563 72.248  63.286  1.00 99.67  ? 149 LYS E NZ  1 
ATOM 6959  N N   . ILE E 2 150 ? -30.760 73.067  57.526  1.00 82.67  ? 150 ILE E N   1 
ATOM 6960  C CA  . ILE E 2 150 ? -29.967 74.180  57.016  1.00 83.65  ? 150 ILE E CA  1 
ATOM 6961  C C   . ILE E 2 150 ? -30.695 75.443  57.487  1.00 83.28  ? 150 ILE E C   1 
ATOM 6962  O O   . ILE E 2 150 ? -31.641 75.904  56.846  1.00 82.05  ? 150 ILE E O   1 
ATOM 6963  C CB  . ILE E 2 150 ? -29.907 74.157  55.475  1.00 83.50  ? 150 ILE E CB  1 
ATOM 6964  C CG1 . ILE E 2 150 ? -31.297 73.834  54.908  1.00 88.19  ? 150 ILE E CG1 1 
ATOM 6965  C CG2 . ILE E 2 150 ? -28.909 73.131  55.021  1.00 82.32  ? 150 ILE E CG2 1 
ATOM 6966  C CD1 . ILE E 2 150 ? -31.387 73.814  53.385  1.00 94.80  ? 150 ILE E CD1 1 
ATOM 6967  N N   . ASP E 2 151 ? -30.260 75.993  58.616  1.00 82.58  ? 151 ASP E N   1 
ATOM 6968  C CA  . ASP E 2 151 ? -30.900 77.171  59.182  1.00 80.52  ? 151 ASP E CA  1 
ATOM 6969  C C   . ASP E 2 151 ? -32.284 76.784  59.686  1.00 81.20  ? 151 ASP E C   1 
ATOM 6970  O O   . ASP E 2 151 ? -33.290 77.319  59.222  1.00 82.14  ? 151 ASP E O   1 
ATOM 6971  C CB  . ASP E 2 151 ? -31.041 78.289  58.141  1.00 77.50  ? 151 ASP E CB  1 
ATOM 6972  C CG  . ASP E 2 151 ? -29.717 78.923  57.784  1.00 76.33  ? 151 ASP E CG  1 
ATOM 6973  O OD1 . ASP E 2 151 ? -28.929 79.183  58.718  1.00 80.80  ? 151 ASP E OD1 1 
ATOM 6974  O OD2 . ASP E 2 151 ? -29.471 79.174  56.580  1.00 69.54  ? 151 ASP E OD2 1 
ATOM 6975  N N   . GLY E 2 152 ? -32.332 75.830  60.613  1.00 80.68  ? 152 GLY E N   1 
ATOM 6976  C CA  . GLY E 2 152 ? -33.599 75.407  61.189  1.00 81.24  ? 152 GLY E CA  1 
ATOM 6977  C C   . GLY E 2 152 ? -34.671 74.767  60.318  1.00 82.48  ? 152 GLY E C   1 
ATOM 6978  O O   . GLY E 2 152 ? -35.689 74.323  60.848  1.00 81.99  ? 152 GLY E O   1 
ATOM 6979  N N   . SER E 2 153 ? -34.480 74.716  59.003  1.00 84.58  ? 153 SER E N   1 
ATOM 6980  C CA  . SER E 2 153 ? -35.480 74.093  58.137  1.00 87.61  ? 153 SER E CA  1 
ATOM 6981  C C   . SER E 2 153 ? -34.981 72.726  57.680  1.00 91.32  ? 153 SER E C   1 
ATOM 6982  O O   . SER E 2 153 ? -33.779 72.531  57.479  1.00 92.31  ? 153 SER E O   1 
ATOM 6983  C CB  . SER E 2 153 ? -35.757 74.965  56.916  1.00 85.34  ? 153 SER E CB  1 
ATOM 6984  O OG  . SER E 2 153 ? -34.655 74.955  56.028  1.00 89.11  ? 153 SER E OG  1 
ATOM 6985  N N   . GLU E 2 154 ? -35.903 71.781  57.511  1.00 94.61  ? 154 GLU E N   1 
ATOM 6986  C CA  . GLU E 2 154 ? -35.535 70.434  57.087  1.00 97.35  ? 154 GLU E CA  1 
ATOM 6987  C C   . GLU E 2 154 ? -34.829 70.385  55.749  1.00 96.63  ? 154 GLU E C   1 
ATOM 6988  O O   . GLU E 2 154 ? -34.871 71.331  54.958  1.00 98.12  ? 154 GLU E O   1 
ATOM 6989  C CB  . GLU E 2 154 ? -36.766 69.526  57.017  1.00 99.62  ? 154 GLU E CB  1 
ATOM 6990  C CG  . GLU E 2 154 ? -36.796 68.446  58.087  1.00 105.67 ? 154 GLU E CG  1 
ATOM 6991  C CD  . GLU E 2 154 ? -36.831 69.022  59.500  1.00 109.72 ? 154 GLU E CD  1 
ATOM 6992  O OE1 . GLU E 2 154 ? -35.923 69.814  59.848  1.00 111.05 ? 154 GLU E OE1 1 
ATOM 6993  O OE2 . GLU E 2 154 ? -37.766 68.680  60.263  1.00 110.65 ? 154 GLU E OE2 1 
ATOM 6994  N N   . ARG E 2 155 ? -34.173 69.260  55.510  1.00 94.68  ? 155 ARG E N   1 
ATOM 6995  C CA  . ARG E 2 155 ? -33.465 69.039  54.270  1.00 92.51  ? 155 ARG E CA  1 
ATOM 6996  C C   . ARG E 2 155 ? -33.428 67.538  54.017  1.00 93.81  ? 155 ARG E C   1 
ATOM 6997  O O   . ARG E 2 155 ? -32.874 66.775  54.816  1.00 95.33  ? 155 ARG E O   1 
ATOM 6998  C CB  . ARG E 2 155 ? -32.054 69.608  54.357  1.00 88.70  ? 155 ARG E CB  1 
ATOM 6999  C CG  . ARG E 2 155 ? -31.285 69.471  53.067  1.00 85.64  ? 155 ARG E CG  1 
ATOM 7000  C CD  . ARG E 2 155 ? -31.873 70.311  51.941  1.00 83.88  ? 155 ARG E CD  1 
ATOM 7001  N NE  . ARG E 2 155 ? -31.228 69.998  50.665  1.00 86.42  ? 155 ARG E NE  1 
ATOM 7002  C CZ  . ARG E 2 155 ? -31.159 70.822  49.621  1.00 88.40  ? 155 ARG E CZ  1 
ATOM 7003  N NH1 . ARG E 2 155 ? -31.699 72.034  49.691  1.00 89.77  ? 155 ARG E NH1 1 
ATOM 7004  N NH2 . ARG E 2 155 ? -30.547 70.433  48.505  1.00 86.60  ? 155 ARG E NH2 1 
ATOM 7005  N N   . GLN E 2 156 ? -34.047 67.130  52.910  1.00 93.16  ? 156 GLN E N   1 
ATOM 7006  C CA  . GLN E 2 156 ? -34.125 65.726  52.512  1.00 93.52  ? 156 GLN E CA  1 
ATOM 7007  C C   . GLN E 2 156 ? -33.279 65.449  51.279  1.00 93.51  ? 156 GLN E C   1 
ATOM 7008  O O   . GLN E 2 156 ? -32.888 64.315  51.014  1.00 95.76  ? 156 GLN E O   1 
ATOM 7009  C CB  . GLN E 2 156 ? -35.575 65.342  52.196  1.00 91.02  ? 156 GLN E CB  1 
ATOM 7010  C CG  . GLN E 2 156 ? -36.337 64.678  53.335  1.00 92.94  ? 156 GLN E CG  1 
ATOM 7011  C CD  . GLN E 2 156 ? -36.693 65.634  54.457  1.00 93.05  ? 156 GLN E CD  1 
ATOM 7012  O OE1 . GLN E 2 156 ? -37.376 66.635  54.239  1.00 94.01  ? 156 GLN E OE1 1 
ATOM 7013  N NE2 . GLN E 2 156 ? -36.236 65.328  55.668  1.00 92.51  ? 156 GLN E NE2 1 
ATOM 7014  N N   . ASN E 2 157 ? -32.994 66.500  50.533  1.00 93.35  ? 157 ASN E N   1 
ATOM 7015  C CA  . ASN E 2 157 ? -32.236 66.388  49.298  1.00 94.82  ? 157 ASN E CA  1 
ATOM 7016  C C   . ASN E 2 157 ? -30.720 66.308  49.491  1.00 93.47  ? 157 ASN E C   1 
ATOM 7017  O O   . ASN E 2 157 ? -30.178 66.883  50.435  1.00 94.87  ? 157 ASN E O   1 
ATOM 7018  C CB  . ASN E 2 157 ? -32.597 67.587  48.429  1.00 98.54  ? 157 ASN E CB  1 
ATOM 7019  C CG  . ASN E 2 157 ? -34.051 68.005  48.612  1.00 103.16 ? 157 ASN E CG  1 
ATOM 7020  O OD1 . ASN E 2 157 ? -34.966 67.284  48.213  1.00 105.40 ? 157 ASN E OD1 1 
ATOM 7021  N ND2 . ASN E 2 157 ? -34.270 69.161  49.241  1.00 104.55 ? 157 ASN E ND2 1 
ATOM 7022  N N   . GLY E 2 158 ? -30.048 65.580  48.597  1.00 90.25  ? 158 GLY E N   1 
ATOM 7023  C CA  . GLY E 2 158 ? -28.595 65.451  48.645  1.00 82.70  ? 158 GLY E CA  1 
ATOM 7024  C C   . GLY E 2 158 ? -27.944 64.784  49.848  1.00 78.35  ? 158 GLY E C   1 
ATOM 7025  O O   . GLY E 2 158 ? -26.715 64.831  49.996  1.00 76.61  ? 158 GLY E O   1 
ATOM 7026  N N   . VAL E 2 159 ? -28.753 64.165  50.704  1.00 74.38  ? 159 VAL E N   1 
ATOM 7027  C CA  . VAL E 2 159 ? -28.242 63.490  51.892  1.00 71.67  ? 159 VAL E CA  1 
ATOM 7028  C C   . VAL E 2 159 ? -28.164 61.989  51.638  1.00 70.10  ? 159 VAL E C   1 
ATOM 7029  O O   . VAL E 2 159 ? -29.089 61.399  51.069  1.00 70.67  ? 159 VAL E O   1 
ATOM 7030  C CB  . VAL E 2 159 ? -29.147 63.747  53.122  1.00 71.54  ? 159 VAL E CB  1 
ATOM 7031  C CG1 . VAL E 2 159 ? -30.572 63.342  52.809  1.00 70.32  ? 159 VAL E CG1 1 
ATOM 7032  C CG2 . VAL E 2 159 ? -28.627 62.972  54.327  1.00 72.71  ? 159 VAL E CG2 1 
ATOM 7033  N N   . LEU E 2 160 ? -27.054 61.382  52.054  1.00 67.39  ? 160 LEU E N   1 
ATOM 7034  C CA  . LEU E 2 160 ? -26.848 59.952  51.869  1.00 61.86  ? 160 LEU E CA  1 
ATOM 7035  C C   . LEU E 2 160 ? -26.278 59.295  53.105  1.00 60.09  ? 160 LEU E C   1 
ATOM 7036  O O   . LEU E 2 160 ? -25.377 59.827  53.756  1.00 60.25  ? 160 LEU E O   1 
ATOM 7037  C CB  . LEU E 2 160 ? -25.924 59.707  50.687  1.00 60.89  ? 160 LEU E CB  1 
ATOM 7038  C CG  . LEU E 2 160 ? -26.544 60.169  49.374  1.00 61.99  ? 160 LEU E CG  1 
ATOM 7039  C CD1 . LEU E 2 160 ? -25.594 59.897  48.232  1.00 64.22  ? 160 LEU E CD1 1 
ATOM 7040  C CD2 . LEU E 2 160 ? -27.858 59.442  49.155  1.00 65.66  ? 160 LEU E CD2 1 
ATOM 7041  N N   . ASN E 2 161 ? -26.804 58.114  53.404  1.00 60.42  ? 161 ASN E N   1 
ATOM 7042  C CA  . ASN E 2 161 ? -26.395 57.358  54.581  1.00 59.38  ? 161 ASN E CA  1 
ATOM 7043  C C   . ASN E 2 161 ? -25.846 55.967  54.309  1.00 55.50  ? 161 ASN E C   1 
ATOM 7044  O O   . ASN E 2 161 ? -25.893 55.462  53.188  1.00 51.70  ? 161 ASN E O   1 
ATOM 7045  C CB  . ASN E 2 161 ? -27.585 57.218  55.521  1.00 63.29  ? 161 ASN E CB  1 
ATOM 7046  C CG  . ASN E 2 161 ? -28.112 58.544  55.974  1.00 63.76  ? 161 ASN E CG  1 
ATOM 7047  O OD1 . ASN E 2 161 ? -28.226 59.485  55.184  1.00 67.28  ? 161 ASN E OD1 1 
ATOM 7048  N ND2 . ASN E 2 161 ? -28.444 58.636  57.252  1.00 66.02  ? 161 ASN E ND2 1 
ATOM 7049  N N   . SER E 2 162 ? -25.332 55.356  55.370  1.00 54.02  ? 162 SER E N   1 
ATOM 7050  C CA  . SER E 2 162 ? -24.801 54.009  55.297  1.00 52.04  ? 162 SER E CA  1 
ATOM 7051  C C   . SER E 2 162 ? -24.285 53.616  56.674  1.00 52.20  ? 162 SER E C   1 
ATOM 7052  O O   . SER E 2 162 ? -23.635 54.426  57.356  1.00 49.72  ? 162 SER E O   1 
ATOM 7053  C CB  . SER E 2 162 ? -23.680 53.922  54.255  1.00 46.18  ? 162 SER E CB  1 
ATOM 7054  O OG  . SER E 2 162 ? -22.419 54.110  54.854  1.00 45.46  ? 162 SER E OG  1 
ATOM 7055  N N   . TRP E 2 163 ? -24.613 52.387  57.083  1.00 52.86  ? 163 TRP E N   1 
ATOM 7056  C CA  . TRP E 2 163 ? -24.179 51.846  58.371  1.00 51.78  ? 163 TRP E CA  1 
ATOM 7057  C C   . TRP E 2 163 ? -23.085 50.822  58.143  1.00 47.14  ? 163 TRP E C   1 
ATOM 7058  O O   . TRP E 2 163 ? -22.924 50.308  57.042  1.00 46.12  ? 163 TRP E O   1 
ATOM 7059  C CB  . TRP E 2 163 ? -25.301 51.107  59.101  1.00 56.97  ? 163 TRP E CB  1 
ATOM 7060  C CG  . TRP E 2 163 ? -26.530 51.872  59.391  1.00 63.29  ? 163 TRP E CG  1 
ATOM 7061  C CD1 . TRP E 2 163 ? -27.079 52.106  60.626  1.00 63.69  ? 163 TRP E CD1 1 
ATOM 7062  C CD2 . TRP E 2 163 ? -27.447 52.403  58.428  1.00 66.20  ? 163 TRP E CD2 1 
ATOM 7063  N NE1 . TRP E 2 163 ? -28.292 52.745  60.486  1.00 67.45  ? 163 TRP E NE1 1 
ATOM 7064  C CE2 . TRP E 2 163 ? -28.541 52.940  59.148  1.00 69.03  ? 163 TRP E CE2 1 
ATOM 7065  C CE3 . TRP E 2 163 ? -27.452 52.478  57.025  1.00 64.80  ? 163 TRP E CE3 1 
ATOM 7066  C CZ2 . TRP E 2 163 ? -29.635 53.539  58.513  1.00 71.43  ? 163 TRP E CZ2 1 
ATOM 7067  C CZ3 . TRP E 2 163 ? -28.537 53.074  56.392  1.00 65.78  ? 163 TRP E CZ3 1 
ATOM 7068  C CH2 . TRP E 2 163 ? -29.616 53.599  57.139  1.00 70.13  ? 163 TRP E CH2 1 
ATOM 7069  N N   . THR E 2 164 ? -22.345 50.523  59.201  1.00 43.02  ? 164 THR E N   1 
ATOM 7070  C CA  . THR E 2 164 ? -21.301 49.525  59.129  1.00 40.86  ? 164 THR E CA  1 
ATOM 7071  C C   . THR E 2 164 ? -21.987 48.236  59.565  1.00 42.05  ? 164 THR E C   1 
ATOM 7072  O O   . THR E 2 164 ? -23.204 48.094  59.428  1.00 43.24  ? 164 THR E O   1 
ATOM 7073  C CB  . THR E 2 164 ? -20.143 49.858  60.098  1.00 40.96  ? 164 THR E CB  1 
ATOM 7074  O OG1 . THR E 2 164 ? -20.599 49.751  61.452  1.00 43.59  ? 164 THR E OG1 1 
ATOM 7075  C CG2 . THR E 2 164 ? -19.633 51.267  59.853  1.00 34.84  ? 164 THR E CG2 1 
ATOM 7076  N N   . ASP E 2 165 ? -21.210 47.291  60.073  1.00 44.70  ? 165 ASP E N   1 
ATOM 7077  C CA  . ASP E 2 165 ? -21.770 46.041  60.562  1.00 49.92  ? 165 ASP E CA  1 
ATOM 7078  C C   . ASP E 2 165 ? -21.323 45.973  61.987  1.00 50.74  ? 165 ASP E C   1 
ATOM 7079  O O   . ASP E 2 165 ? -20.211 46.374  62.311  1.00 51.87  ? 165 ASP E O   1 
ATOM 7080  C CB  . ASP E 2 165 ? -21.206 44.825  59.836  1.00 55.27  ? 165 ASP E CB  1 
ATOM 7081  C CG  . ASP E 2 165 ? -20.911 45.101  58.391  1.00 61.67  ? 165 ASP E CG  1 
ATOM 7082  O OD1 . ASP E 2 165 ? -19.913 45.814  58.126  1.00 67.68  ? 165 ASP E OD1 1 
ATOM 7083  O OD2 . ASP E 2 165 ? -21.675 44.617  57.523  1.00 64.82  ? 165 ASP E OD2 1 
ATOM 7084  N N   . GLN E 2 166 ? -22.209 45.499  62.844  1.00 53.25  ? 166 GLN E N   1 
ATOM 7085  C CA  . GLN E 2 166 ? -21.915 45.346  64.259  1.00 55.26  ? 166 GLN E CA  1 
ATOM 7086  C C   . GLN E 2 166 ? -20.427 45.025  64.299  1.00 53.96  ? 166 GLN E C   1 
ATOM 7087  O O   . GLN E 2 166 ? -20.017 44.036  63.718  1.00 55.51  ? 166 GLN E O   1 
ATOM 7088  C CB  . GLN E 2 166 ? -22.757 44.177  64.761  1.00 57.70  ? 166 GLN E CB  1 
ATOM 7089  C CG  . GLN E 2 166 ? -22.980 44.061  66.238  1.00 62.94  ? 166 GLN E CG  1 
ATOM 7090  C CD  . GLN E 2 166 ? -24.181 43.178  66.521  1.00 65.45  ? 166 GLN E CD  1 
ATOM 7091  O OE1 . GLN E 2 166 ? -24.378 42.149  65.863  1.00 68.48  ? 166 GLN E OE1 1 
ATOM 7092  N NE2 . GLN E 2 166 ? -24.991 43.572  67.492  1.00 63.74  ? 166 GLN E NE2 1 
ATOM 7093  N N   . ASP E 2 167 ? -19.600 45.847  64.931  1.00 54.92  ? 167 ASP E N   1 
ATOM 7094  C CA  . ASP E 2 167 ? -18.187 45.507  64.907  1.00 58.70  ? 167 ASP E CA  1 
ATOM 7095  C C   . ASP E 2 167 ? -17.836 44.414  65.914  1.00 58.00  ? 167 ASP E C   1 
ATOM 7096  O O   . ASP E 2 167 ? -18.657 44.011  66.734  1.00 58.14  ? 167 ASP E O   1 
ATOM 7097  C CB  . ASP E 2 167 ? -17.297 46.749  65.081  1.00 63.11  ? 167 ASP E CB  1 
ATOM 7098  C CG  . ASP E 2 167 ? -16.987 47.048  66.524  1.00 63.01  ? 167 ASP E CG  1 
ATOM 7099  O OD1 . ASP E 2 167 ? -16.019 47.794  66.784  1.00 60.04  ? 167 ASP E OD1 1 
ATOM 7100  O OD2 . ASP E 2 167 ? -17.720 46.542  67.401  1.00 65.27  ? 167 ASP E OD2 1 
ATOM 7101  N N   . SER E 2 168 ? -16.605 43.940  65.844  1.00 57.54  ? 168 SER E N   1 
ATOM 7102  C CA  . SER E 2 168 ? -16.179 42.836  66.678  1.00 58.98  ? 168 SER E CA  1 
ATOM 7103  C C   . SER E 2 168 ? -15.663 43.129  68.053  1.00 59.59  ? 168 SER E C   1 
ATOM 7104  O O   . SER E 2 168 ? -15.403 42.197  68.812  1.00 54.84  ? 168 SER E O   1 
ATOM 7105  C CB  . SER E 2 168 ? -15.103 42.059  65.954  1.00 63.68  ? 168 SER E CB  1 
ATOM 7106  O OG  . SER E 2 168 ? -13.914 42.829  65.913  1.00 68.91  ? 168 SER E OG  1 
ATOM 7107  N N   . LYS E 2 169 ? -15.473 44.397  68.382  1.00 61.51  ? 169 LYS E N   1 
ATOM 7108  C CA  . LYS E 2 169 ? -14.947 44.712  69.699  1.00 63.07  ? 169 LYS E CA  1 
ATOM 7109  C C   . LYS E 2 169 ? -16.004 45.057  70.726  1.00 62.54  ? 169 LYS E C   1 
ATOM 7110  O O   . LYS E 2 169 ? -15.819 44.789  71.915  1.00 62.45  ? 169 LYS E O   1 
ATOM 7111  C CB  . LYS E 2 169 ? -13.938 45.852  69.608  1.00 64.71  ? 169 LYS E CB  1 
ATOM 7112  C CG  . LYS E 2 169 ? -12.564 45.423  69.126  1.00 69.53  ? 169 LYS E CG  1 
ATOM 7113  C CD  . LYS E 2 169 ? -11.852 44.541  70.141  1.00 75.02  ? 169 LYS E CD  1 
ATOM 7114  C CE  . LYS E 2 169 ? -10.435 44.185  69.675  1.00 79.57  ? 169 LYS E CE  1 
ATOM 7115  N NZ  . LYS E 2 169 ? -10.431 43.423  68.383  1.00 84.30  ? 169 LYS E NZ  1 
ATOM 7116  N N   . ASP E 2 170 ? -17.108 45.640  70.272  1.00 60.23  ? 170 ASP E N   1 
ATOM 7117  C CA  . ASP E 2 170 ? -18.156 46.038  71.194  1.00 58.54  ? 170 ASP E CA  1 
ATOM 7118  C C   . ASP E 2 170 ? -19.541 45.795  70.651  1.00 55.79  ? 170 ASP E C   1 
ATOM 7119  O O   . ASP E 2 170 ? -20.524 46.212  71.242  1.00 56.48  ? 170 ASP E O   1 
ATOM 7120  C CB  . ASP E 2 170 ? -17.990 47.517  71.566  1.00 63.86  ? 170 ASP E CB  1 
ATOM 7121  C CG  . ASP E 2 170 ? -18.366 48.469  70.430  1.00 67.73  ? 170 ASP E CG  1 
ATOM 7122  O OD1 . ASP E 2 170 ? -17.999 49.664  70.501  1.00 66.77  ? 170 ASP E OD1 1 
ATOM 7123  O OD2 . ASP E 2 170 ? -19.043 48.036  69.471  1.00 72.89  ? 170 ASP E OD2 1 
ATOM 7124  N N   . SER E 2 171 ? -19.621 45.123  69.516  1.00 53.42  ? 171 SER E N   1 
ATOM 7125  C CA  . SER E 2 171 ? -20.913 44.826  68.922  1.00 50.36  ? 171 SER E CA  1 
ATOM 7126  C C   . SER E 2 171 ? -21.809 46.046  68.664  1.00 47.55  ? 171 SER E C   1 
ATOM 7127  O O   . SER E 2 171 ? -23.022 45.897  68.542  1.00 46.33  ? 171 SER E O   1 
ATOM 7128  C CB  . SER E 2 171 ? -21.655 43.822  69.806  1.00 47.30  ? 171 SER E CB  1 
ATOM 7129  O OG  . SER E 2 171 ? -20.816 42.719  70.115  1.00 52.74  ? 171 SER E OG  1 
ATOM 7130  N N   . THR E 2 172 ? -21.232 47.245  68.578  1.00 45.47  ? 172 THR E N   1 
ATOM 7131  C CA  . THR E 2 172 ? -22.036 48.447  68.304  1.00 44.94  ? 172 THR E CA  1 
ATOM 7132  C C   . THR E 2 172 ? -22.107 48.675  66.806  1.00 50.48  ? 172 THR E C   1 
ATOM 7133  O O   . THR E 2 172 ? -21.493 47.944  66.033  1.00 55.43  ? 172 THR E O   1 
ATOM 7134  C CB  . THR E 2 172 ? -21.425 49.741  68.873  1.00 37.31  ? 172 THR E CB  1 
ATOM 7135  O OG1 . THR E 2 172 ? -20.179 50.003  68.218  1.00 32.75  ? 172 THR E OG1 1 
ATOM 7136  C CG2 . THR E 2 172 ? -21.220 49.638  70.359  1.00 34.83  ? 172 THR E CG2 1 
ATOM 7137  N N   . TYR E 2 173 ? -22.849 49.697  66.400  1.00 53.61  ? 173 TYR E N   1 
ATOM 7138  C CA  . TYR E 2 173 ? -22.953 50.038  64.988  1.00 55.76  ? 173 TYR E CA  1 
ATOM 7139  C C   . TYR E 2 173 ? -22.467 51.468  64.804  1.00 57.08  ? 173 TYR E C   1 
ATOM 7140  O O   . TYR E 2 173 ? -22.049 52.133  65.756  1.00 58.68  ? 173 TYR E O   1 
ATOM 7141  C CB  . TYR E 2 173 ? -24.394 49.940  64.492  1.00 56.16  ? 173 TYR E CB  1 
ATOM 7142  C CG  . TYR E 2 173 ? -24.957 48.546  64.494  1.00 57.74  ? 173 TYR E CG  1 
ATOM 7143  C CD1 . TYR E 2 173 ? -25.474 47.986  63.329  1.00 61.32  ? 173 TYR E CD1 1 
ATOM 7144  C CD2 . TYR E 2 173 ? -24.994 47.786  65.662  1.00 59.16  ? 173 TYR E CD2 1 
ATOM 7145  C CE1 . TYR E 2 173 ? -26.020 46.691  63.323  1.00 61.85  ? 173 TYR E CE1 1 
ATOM 7146  C CE2 . TYR E 2 173 ? -25.536 46.493  65.672  1.00 60.46  ? 173 TYR E CE2 1 
ATOM 7147  C CZ  . TYR E 2 173 ? -26.048 45.947  64.498  1.00 61.33  ? 173 TYR E CZ  1 
ATOM 7148  O OH  . TYR E 2 173 ? -26.578 44.664  64.496  1.00 62.30  ? 173 TYR E OH  1 
ATOM 7149  N N   . SER E 2 174 ? -22.523 51.933  63.566  1.00 54.16  ? 174 SER E N   1 
ATOM 7150  C CA  . SER E 2 174 ? -22.114 53.281  63.252  1.00 50.44  ? 174 SER E CA  1 
ATOM 7151  C C   . SER E 2 174 ? -22.750 53.604  61.931  1.00 52.10  ? 174 SER E C   1 
ATOM 7152  O O   . SER E 2 174 ? -22.971 52.723  61.100  1.00 52.33  ? 174 SER E O   1 
ATOM 7153  C CB  . SER E 2 174 ? -20.600 53.379  63.169  1.00 45.58  ? 174 SER E CB  1 
ATOM 7154  O OG  . SER E 2 174 ? -20.042 52.994  64.412  1.00 50.82  ? 174 SER E OG  1 
ATOM 7155  N N   . MET E 2 175 ? -23.082 54.871  61.753  1.00 53.98  ? 175 MET E N   1 
ATOM 7156  C CA  . MET E 2 175 ? -23.710 55.296  60.528  1.00 53.65  ? 175 MET E CA  1 
ATOM 7157  C C   . MET E 2 175 ? -23.141 56.628  60.137  1.00 52.26  ? 175 MET E C   1 
ATOM 7158  O O   . MET E 2 175 ? -22.608 57.359  60.978  1.00 50.71  ? 175 MET E O   1 
ATOM 7159  C CB  . MET E 2 175 ? -25.208 55.442  60.721  1.00 56.65  ? 175 MET E CB  1 
ATOM 7160  C CG  . MET E 2 175 ? -25.903 55.751  59.428  1.00 61.25  ? 175 MET E CG  1 
ATOM 7161  S SD  . MET E 2 175 ? -27.102 57.032  59.655  1.00 65.51  ? 175 MET E SD  1 
ATOM 7162  C CE  . MET E 2 175 ? -28.547 56.106  60.193  1.00 60.22  ? 175 MET E CE  1 
ATOM 7163  N N   . SER E 2 176 ? -23.249 56.944  58.857  1.00 48.85  ? 176 SER E N   1 
ATOM 7164  C CA  . SER E 2 176 ? -22.740 58.206  58.393  1.00 46.76  ? 176 SER E CA  1 
ATOM 7165  C C   . SER E 2 176 ? -23.628 58.746  57.313  1.00 48.60  ? 176 SER E C   1 
ATOM 7166  O O   . SER E 2 176 ? -23.785 58.140  56.246  1.00 44.52  ? 176 SER E O   1 
ATOM 7167  C CB  . SER E 2 176 ? -21.329 58.057  57.848  1.00 44.98  ? 176 SER E CB  1 
ATOM 7168  O OG  . SER E 2 176 ? -21.310 58.307  56.452  1.00 45.23  ? 176 SER E OG  1 
ATOM 7169  N N   . SER E 2 177 ? -24.234 59.887  57.611  1.00 51.01  ? 177 SER E N   1 
ATOM 7170  C CA  . SER E 2 177 ? -25.082 60.557  56.645  1.00 52.80  ? 177 SER E CA  1 
ATOM 7171  C C   . SER E 2 177 ? -24.226 61.728  56.231  1.00 50.79  ? 177 SER E C   1 
ATOM 7172  O O   . SER E 2 177 ? -23.485 62.299  57.038  1.00 43.44  ? 177 SER E O   1 
ATOM 7173  C CB  . SER E 2 177 ? -26.376 61.049  57.275  1.00 53.35  ? 177 SER E CB  1 
ATOM 7174  O OG  . SER E 2 177 ? -26.094 62.000  58.271  1.00 63.13  ? 177 SER E OG  1 
ATOM 7175  N N   . THR E 2 178 ? -24.305 62.067  54.962  1.00 51.66  ? 178 THR E N   1 
ATOM 7176  C CA  . THR E 2 178 ? -23.501 63.144  54.484  1.00 53.20  ? 178 THR E CA  1 
ATOM 7177  C C   . THR E 2 178 ? -24.307 63.967  53.510  1.00 58.19  ? 178 THR E C   1 
ATOM 7178  O O   . THR E 2 178 ? -24.875 63.441  52.544  1.00 57.17  ? 178 THR E O   1 
ATOM 7179  C CB  . THR E 2 178 ? -22.221 62.601  53.837  1.00 51.90  ? 178 THR E CB  1 
ATOM 7180  O OG1 . THR E 2 178 ? -22.042 63.202  52.550  1.00 49.94  ? 178 THR E OG1 1 
ATOM 7181  C CG2 . THR E 2 178 ? -22.291 61.071  53.712  1.00 47.61  ? 178 THR E CG2 1 
ATOM 7182  N N   . LEU E 2 179 ? -24.364 65.266  53.811  1.00 63.04  ? 179 LEU E N   1 
ATOM 7183  C CA  . LEU E 2 179 ? -25.086 66.255  53.024  1.00 63.67  ? 179 LEU E CA  1 
ATOM 7184  C C   . LEU E 2 179 ? -24.170 66.837  51.967  1.00 62.12  ? 179 LEU E C   1 
ATOM 7185  O O   . LEU E 2 179 ? -23.117 67.399  52.274  1.00 56.21  ? 179 LEU E O   1 
ATOM 7186  C CB  . LEU E 2 179 ? -25.584 67.384  53.922  1.00 65.47  ? 179 LEU E CB  1 
ATOM 7187  C CG  . LEU E 2 179 ? -26.830 68.123  53.418  1.00 67.69  ? 179 LEU E CG  1 
ATOM 7188  C CD1 . LEU E 2 179 ? -26.653 68.551  51.961  1.00 63.31  ? 179 LEU E CD1 1 
ATOM 7189  C CD2 . LEU E 2 179 ? -28.040 67.200  53.554  1.00 69.80  ? 179 LEU E CD2 1 
ATOM 7190  N N   . THR E 2 180 ? -24.590 66.712  50.718  1.00 64.97  ? 180 THR E N   1 
ATOM 7191  C CA  . THR E 2 180 ? -23.796 67.215  49.619  1.00 70.57  ? 180 THR E CA  1 
ATOM 7192  C C   . THR E 2 180 ? -24.597 68.168  48.759  1.00 74.68  ? 180 THR E C   1 
ATOM 7193  O O   . THR E 2 180 ? -25.755 67.886  48.432  1.00 77.04  ? 180 THR E O   1 
ATOM 7194  C CB  . THR E 2 180 ? -23.320 66.071  48.733  1.00 71.52  ? 180 THR E CB  1 
ATOM 7195  O OG1 . THR E 2 180 ? -22.604 65.122  49.532  1.00 77.19  ? 180 THR E OG1 1 
ATOM 7196  C CG2 . THR E 2 180 ? -22.419 66.598  47.624  1.00 69.68  ? 180 THR E CG2 1 
ATOM 7197  N N   . LEU E 2 181 ? -23.974 69.291  48.394  1.00 76.53  ? 181 LEU E N   1 
ATOM 7198  C CA  . LEU E 2 181 ? -24.611 70.304  47.549  1.00 78.90  ? 181 LEU E CA  1 
ATOM 7199  C C   . LEU E 2 181 ? -23.635 71.261  46.850  1.00 82.17  ? 181 LEU E C   1 
ATOM 7200  O O   . LEU E 2 181 ? -22.413 71.123  46.983  1.00 83.11  ? 181 LEU E O   1 
ATOM 7201  C CB  . LEU E 2 181 ? -25.655 71.094  48.356  1.00 74.16  ? 181 LEU E CB  1 
ATOM 7202  C CG  . LEU E 2 181 ? -25.424 71.353  49.842  1.00 68.76  ? 181 LEU E CG  1 
ATOM 7203  C CD1 . LEU E 2 181 ? -24.378 72.429  50.046  1.00 67.51  ? 181 LEU E CD1 1 
ATOM 7204  C CD2 . LEU E 2 181 ? -26.737 71.768  50.462  1.00 61.49  ? 181 LEU E CD2 1 
ATOM 7205  N N   . THR E 2 182 ? -24.186 72.213  46.089  1.00 85.67  ? 182 THR E N   1 
ATOM 7206  C CA  . THR E 2 182 ? -23.387 73.191  45.342  1.00 86.93  ? 182 THR E CA  1 
ATOM 7207  C C   . THR E 2 182 ? -22.745 74.217  46.236  1.00 86.82  ? 182 THR E C   1 
ATOM 7208  O O   . THR E 2 182 ? -23.383 74.743  47.145  1.00 89.64  ? 182 THR E O   1 
ATOM 7209  C CB  . THR E 2 182 ? -24.229 73.969  44.302  1.00 88.03  ? 182 THR E CB  1 
ATOM 7210  O OG1 . THR E 2 182 ? -25.535 74.235  44.837  1.00 88.75  ? 182 THR E OG1 1 
ATOM 7211  C CG2 . THR E 2 182 ? -24.338 73.182  43.001  1.00 87.20  ? 182 THR E CG2 1 
ATOM 7212  N N   . LYS E 2 183 ? -21.479 74.504  45.964  1.00 85.09  ? 183 LYS E N   1 
ATOM 7213  C CA  . LYS E 2 183 ? -20.732 75.486  46.739  1.00 84.97  ? 183 LYS E CA  1 
ATOM 7214  C C   . LYS E 2 183 ? -21.607 76.709  46.986  1.00 85.47  ? 183 LYS E C   1 
ATOM 7215  O O   . LYS E 2 183 ? -21.754 77.168  48.125  1.00 83.45  ? 183 LYS E O   1 
ATOM 7216  C CB  . LYS E 2 183 ? -19.485 75.890  45.964  1.00 85.12  ? 183 LYS E CB  1 
ATOM 7217  C CG  . LYS E 2 183 ? -18.587 76.885  46.664  1.00 83.30  ? 183 LYS E CG  1 
ATOM 7218  C CD  . LYS E 2 183 ? -17.301 77.053  45.874  1.00 83.76  ? 183 LYS E CD  1 
ATOM 7219  C CE  . LYS E 2 183 ? -16.350 78.024  46.535  1.00 84.65  ? 183 LYS E CE  1 
ATOM 7220  N NZ  . LYS E 2 183 ? -15.104 78.161  45.729  1.00 83.17  ? 183 LYS E NZ  1 
ATOM 7221  N N   . ASP E 2 184 ? -22.196 77.219  45.905  1.00 86.11  ? 184 ASP E N   1 
ATOM 7222  C CA  . ASP E 2 184 ? -23.066 78.388  45.980  1.00 85.24  ? 184 ASP E CA  1 
ATOM 7223  C C   . ASP E 2 184 ? -24.178 78.146  46.988  1.00 83.32  ? 184 ASP E C   1 
ATOM 7224  O O   . ASP E 2 184 ? -24.337 78.909  47.938  1.00 81.01  ? 184 ASP E O   1 
ATOM 7225  C CB  . ASP E 2 184 ? -23.676 78.699  44.608  1.00 87.87  ? 184 ASP E CB  1 
ATOM 7226  C CG  . ASP E 2 184 ? -22.633 78.761  43.496  1.00 91.35  ? 184 ASP E CG  1 
ATOM 7227  O OD1 . ASP E 2 184 ? -21.583 79.424  43.675  1.00 93.82  ? 184 ASP E OD1 1 
ATOM 7228  O OD2 . ASP E 2 184 ? -22.872 78.147  42.432  1.00 94.64  ? 184 ASP E OD2 1 
ATOM 7229  N N   . GLU E 2 185 ? -24.939 77.077  46.775  1.00 83.47  ? 185 GLU E N   1 
ATOM 7230  C CA  . GLU E 2 185 ? -26.040 76.724  47.667  1.00 83.21  ? 185 GLU E CA  1 
ATOM 7231  C C   . GLU E 2 185 ? -25.533 76.561  49.092  1.00 80.31  ? 185 GLU E C   1 
ATOM 7232  O O   . GLU E 2 185 ? -26.240 76.838  50.066  1.00 79.09  ? 185 GLU E O   1 
ATOM 7233  C CB  . GLU E 2 185 ? -26.697 75.419  47.205  1.00 86.16  ? 185 GLU E CB  1 
ATOM 7234  C CG  . GLU E 2 185 ? -28.201 75.528  46.959  1.00 90.59  ? 185 GLU E CG  1 
ATOM 7235  C CD  . GLU E 2 185 ? -29.005 75.867  48.219  1.00 92.84  ? 185 GLU E CD  1 
ATOM 7236  O OE1 . GLU E 2 185 ? -28.952 75.084  49.192  1.00 92.54  ? 185 GLU E OE1 1 
ATOM 7237  O OE2 . GLU E 2 185 ? -29.701 76.910  48.232  1.00 96.11  ? 185 GLU E OE2 1 
ATOM 7238  N N   . TYR E 2 186 ? -24.294 76.113  49.216  1.00 78.94  ? 186 TYR E N   1 
ATOM 7239  C CA  . TYR E 2 186 ? -23.718 75.918  50.530  1.00 79.45  ? 186 TYR E CA  1 
ATOM 7240  C C   . TYR E 2 186 ? -23.626 77.253  51.261  1.00 80.25  ? 186 TYR E C   1 
ATOM 7241  O O   . TYR E 2 186 ? -24.020 77.372  52.427  1.00 78.04  ? 186 TYR E O   1 
ATOM 7242  C CB  . TYR E 2 186 ? -22.325 75.280  50.423  1.00 75.74  ? 186 TYR E CB  1 
ATOM 7243  C CG  . TYR E 2 186 ? -21.600 75.217  51.755  1.00 73.58  ? 186 TYR E CG  1 
ATOM 7244  C CD1 . TYR E 2 186 ? -22.233 74.705  52.886  1.00 74.19  ? 186 TYR E CD1 1 
ATOM 7245  C CD2 . TYR E 2 186 ? -20.304 75.718  51.901  1.00 72.17  ? 186 TYR E CD2 1 
ATOM 7246  C CE1 . TYR E 2 186 ? -21.596 74.699  54.135  1.00 70.28  ? 186 TYR E CE1 1 
ATOM 7247  C CE2 . TYR E 2 186 ? -19.661 75.717  53.152  1.00 68.00  ? 186 TYR E CE2 1 
ATOM 7248  C CZ  . TYR E 2 186 ? -20.320 75.209  54.265  1.00 67.20  ? 186 TYR E CZ  1 
ATOM 7249  O OH  . TYR E 2 186 ? -19.742 75.242  55.518  1.00 62.97  ? 186 TYR E OH  1 
ATOM 7250  N N   . GLU E 2 187 ? -23.116 78.262  50.567  1.00 80.37  ? 187 GLU E N   1 
ATOM 7251  C CA  . GLU E 2 187 ? -22.956 79.573  51.173  1.00 81.25  ? 187 GLU E CA  1 
ATOM 7252  C C   . GLU E 2 187 ? -24.242 80.386  51.293  1.00 84.08  ? 187 GLU E C   1 
ATOM 7253  O O   . GLU E 2 187 ? -24.300 81.329  52.073  1.00 84.70  ? 187 GLU E O   1 
ATOM 7254  C CB  . GLU E 2 187 ? -21.890 80.343  50.406  1.00 78.19  ? 187 GLU E CB  1 
ATOM 7255  C CG  . GLU E 2 187 ? -20.537 79.691  50.559  1.00 75.03  ? 187 GLU E CG  1 
ATOM 7256  C CD  . GLU E 2 187 ? -19.662 79.864  49.344  1.00 76.16  ? 187 GLU E CD  1 
ATOM 7257  O OE1 . GLU E 2 187 ? -20.183 79.710  48.217  1.00 77.90  ? 187 GLU E OE1 1 
ATOM 7258  O OE2 . GLU E 2 187 ? -18.451 80.129  49.512  1.00 76.77  ? 187 GLU E OE2 1 
ATOM 7259  N N   . ARG E 2 188 ? -25.277 80.037  50.537  1.00 87.45  ? 188 ARG E N   1 
ATOM 7260  C CA  . ARG E 2 188 ? -26.527 80.780  50.642  1.00 89.23  ? 188 ARG E CA  1 
ATOM 7261  C C   . ARG E 2 188 ? -27.130 80.502  52.008  1.00 88.63  ? 188 ARG E C   1 
ATOM 7262  O O   . ARG E 2 188 ? -28.237 80.935  52.303  1.00 91.03  ? 188 ARG E O   1 
ATOM 7263  C CB  . ARG E 2 188 ? -27.506 80.361  49.544  1.00 92.23  ? 188 ARG E CB  1 
ATOM 7264  C CG  . ARG E 2 188 ? -27.077 80.785  48.161  1.00 99.12  ? 188 ARG E CG  1 
ATOM 7265  C CD  . ARG E 2 188 ? -28.019 80.254  47.094  1.00 105.93 ? 188 ARG E CD  1 
ATOM 7266  N NE  . ARG E 2 188 ? -27.351 80.201  45.794  1.00 112.75 ? 188 ARG E NE  1 
ATOM 7267  C CZ  . ARG E 2 188 ? -27.869 79.662  44.692  1.00 117.56 ? 188 ARG E CZ  1 
ATOM 7268  N NH1 . ARG E 2 188 ? -29.085 79.120  44.725  1.00 118.79 ? 188 ARG E NH1 1 
ATOM 7269  N NH2 . ARG E 2 188 ? -27.163 79.652  43.559  1.00 119.18 ? 188 ARG E NH2 1 
ATOM 7270  N N   . HIS E 2 189 ? -26.395 79.772  52.840  1.00 87.73  ? 189 HIS E N   1 
ATOM 7271  C CA  . HIS E 2 189 ? -26.881 79.447  54.167  1.00 86.40  ? 189 HIS E CA  1 
ATOM 7272  C C   . HIS E 2 189 ? -25.837 79.538  55.263  1.00 86.01  ? 189 HIS E C   1 
ATOM 7273  O O   . HIS E 2 189 ? -24.630 79.480  55.014  1.00 86.68  ? 189 HIS E O   1 
ATOM 7274  C CB  . HIS E 2 189 ? -27.556 78.085  54.146  1.00 84.44  ? 189 HIS E CB  1 
ATOM 7275  C CG  . HIS E 2 189 ? -28.779 78.062  53.290  1.00 82.11  ? 189 HIS E CG  1 
ATOM 7276  N ND1 . HIS E 2 189 ? -28.719 78.061  51.910  1.00 81.74  ? 189 HIS E ND1 1 
ATOM 7277  C CD2 . HIS E 2 189 ? -30.092 78.126  53.610  1.00 80.33  ? 189 HIS E CD2 1 
ATOM 7278  C CE1 . HIS E 2 189 ? -29.943 78.128  51.420  1.00 83.32  ? 189 HIS E CE1 1 
ATOM 7279  N NE2 . HIS E 2 189 ? -30.794 78.170  52.430  1.00 82.22  ? 189 HIS E NE2 1 
ATOM 7280  N N   . ASN E 2 190 ? -26.337 79.666  56.485  1.00 84.91  ? 190 ASN E N   1 
ATOM 7281  C CA  . ASN E 2 190 ? -25.521 79.873  57.674  1.00 84.47  ? 190 ASN E CA  1 
ATOM 7282  C C   . ASN E 2 190 ? -25.191 78.695  58.554  1.00 80.44  ? 190 ASN E C   1 
ATOM 7283  O O   . ASN E 2 190 ? -24.073 78.193  58.537  1.00 81.24  ? 190 ASN E O   1 
ATOM 7284  C CB  . ASN E 2 190 ? -26.203 80.940  58.540  1.00 91.56  ? 190 ASN E CB  1 
ATOM 7285  C CG  . ASN E 2 190 ? -26.668 82.158  57.720  1.00 100.84 ? 190 ASN E CG  1 
ATOM 7286  O OD1 . ASN E 2 190 ? -25.845 82.977  57.261  1.00 104.56 ? 190 ASN E OD1 1 
ATOM 7287  N ND2 . ASN E 2 190 ? -27.996 82.274  57.518  1.00 104.96 ? 190 ASN E ND2 1 
ATOM 7288  N N   . SER E 2 191 ? -26.162 78.303  59.371  1.00 76.23  ? 191 SER E N   1 
ATOM 7289  C CA  . SER E 2 191 ? -25.978 77.203  60.305  1.00 73.73  ? 191 SER E CA  1 
ATOM 7290  C C   . SER E 2 191 ? -26.395 75.844  59.751  1.00 72.78  ? 191 SER E C   1 
ATOM 7291  O O   . SER E 2 191 ? -27.503 75.667  59.236  1.00 73.28  ? 191 SER E O   1 
ATOM 7292  C CB  . SER E 2 191 ? -26.747 77.470  61.603  1.00 71.96  ? 191 SER E CB  1 
ATOM 7293  O OG  . SER E 2 191 ? -28.141 77.281  61.426  1.00 72.56  ? 191 SER E OG  1 
ATOM 7294  N N   . TYR E 2 192 ? -25.484 74.885  59.871  1.00 71.23  ? 192 TYR E N   1 
ATOM 7295  C CA  . TYR E 2 192 ? -25.717 73.529  59.429  1.00 68.39  ? 192 TYR E CA  1 
ATOM 7296  C C   . TYR E 2 192 ? -25.794 72.689  60.674  1.00 68.47  ? 192 TYR E C   1 
ATOM 7297  O O   . TYR E 2 192 ? -24.903 72.735  61.512  1.00 64.49  ? 192 TYR E O   1 
ATOM 7298  C CB  . TYR E 2 192 ? -24.571 73.080  58.546  1.00 65.74  ? 192 TYR E CB  1 
ATOM 7299  C CG  . TYR E 2 192 ? -24.666 73.706  57.195  1.00 63.13  ? 192 TYR E CG  1 
ATOM 7300  C CD1 . TYR E 2 192 ? -25.632 73.287  56.287  1.00 64.72  ? 192 TYR E CD1 1 
ATOM 7301  C CD2 . TYR E 2 192 ? -23.842 74.758  56.839  1.00 63.18  ? 192 TYR E CD2 1 
ATOM 7302  C CE1 . TYR E 2 192 ? -25.776 73.901  55.051  1.00 65.85  ? 192 TYR E CE1 1 
ATOM 7303  C CE2 . TYR E 2 192 ? -23.983 75.390  55.607  1.00 64.99  ? 192 TYR E CE2 1 
ATOM 7304  C CZ  . TYR E 2 192 ? -24.949 74.956  54.715  1.00 66.22  ? 192 TYR E CZ  1 
ATOM 7305  O OH  . TYR E 2 192 ? -25.076 75.565  53.483  1.00 63.29  ? 192 TYR E OH  1 
ATOM 7306  N N   . THR E 2 193 ? -26.871 71.931  60.799  1.00 70.42  ? 193 THR E N   1 
ATOM 7307  C CA  . THR E 2 193 ? -27.049 71.100  61.966  1.00 75.69  ? 193 THR E CA  1 
ATOM 7308  C C   . THR E 2 193 ? -27.371 69.623  61.665  1.00 78.79  ? 193 THR E C   1 
ATOM 7309  O O   . THR E 2 193 ? -27.953 69.292  60.629  1.00 76.65  ? 193 THR E O   1 
ATOM 7310  C CB  . THR E 2 193 ? -28.117 71.734  62.873  1.00 75.53  ? 193 THR E CB  1 
ATOM 7311  O OG1 . THR E 2 193 ? -28.524 70.795  63.872  1.00 76.65  ? 193 THR E OG1 1 
ATOM 7312  C CG2 . THR E 2 193 ? -29.304 72.184  62.057  1.00 74.96  ? 193 THR E CG2 1 
ATOM 7313  N N   . CYS E 2 194 ? -26.972 68.741  62.582  1.00 81.16  ? 194 CYS E N   1 
ATOM 7314  C CA  . CYS E 2 194 ? -27.185 67.302  62.427  1.00 81.44  ? 194 CYS E CA  1 
ATOM 7315  C C   . CYS E 2 194 ? -28.061 66.718  63.536  1.00 79.79  ? 194 CYS E C   1 
ATOM 7316  O O   . CYS E 2 194 ? -27.699 66.752  64.714  1.00 77.08  ? 194 CYS E O   1 
ATOM 7317  C CB  . CYS E 2 194 ? -25.837 66.593  62.410  1.00 84.06  ? 194 CYS E CB  1 
ATOM 7318  S SG  . CYS E 2 194 ? -25.891 65.007  61.583  1.00 90.08  ? 194 CYS E SG  1 
ATOM 7319  N N   . GLU E 2 195 ? -29.195 66.149  63.133  1.00 81.68  ? 195 GLU E N   1 
ATOM 7320  C CA  . GLU E 2 195 ? -30.191 65.587  64.055  1.00 86.12  ? 195 GLU E CA  1 
ATOM 7321  C C   . GLU E 2 195 ? -30.156 64.063  64.256  1.00 85.87  ? 195 GLU E C   1 
ATOM 7322  O O   . GLU E 2 195 ? -30.452 63.299  63.331  1.00 85.65  ? 195 GLU E O   1 
ATOM 7323  C CB  . GLU E 2 195 ? -31.585 65.982  63.559  1.00 91.80  ? 195 GLU E CB  1 
ATOM 7324  C CG  . GLU E 2 195 ? -32.617 66.189  64.651  1.00 97.11  ? 195 GLU E CG  1 
ATOM 7325  C CD  . GLU E 2 195 ? -32.240 67.336  65.556  1.00 100.16 ? 195 GLU E CD  1 
ATOM 7326  O OE1 . GLU E 2 195 ? -32.235 68.496  65.071  1.00 102.89 ? 195 GLU E OE1 1 
ATOM 7327  O OE2 . GLU E 2 195 ? -31.936 67.069  66.741  1.00 101.60 ? 195 GLU E OE2 1 
ATOM 7328  N N   . ALA E 2 196 ? -29.849 63.626  65.477  1.00 83.70  ? 196 ALA E N   1 
ATOM 7329  C CA  . ALA E 2 196 ? -29.767 62.196  65.770  1.00 81.60  ? 196 ALA E CA  1 
ATOM 7330  C C   . ALA E 2 196 ? -30.815 61.690  66.739  1.00 81.85  ? 196 ALA E C   1 
ATOM 7331  O O   . ALA E 2 196 ? -30.630 61.752  67.955  1.00 80.76  ? 196 ALA E O   1 
ATOM 7332  C CB  . ALA E 2 196 ? -28.398 61.861  66.306  1.00 83.13  ? 196 ALA E CB  1 
ATOM 7333  N N   . THR E 2 197 ? -31.902 61.157  66.198  1.00 83.10  ? 197 THR E N   1 
ATOM 7334  C CA  . THR E 2 197 ? -32.981 60.630  67.024  1.00 85.28  ? 197 THR E CA  1 
ATOM 7335  C C   . THR E 2 197 ? -32.845 59.125  67.181  1.00 86.81  ? 197 THR E C   1 
ATOM 7336  O O   . THR E 2 197 ? -33.280 58.357  66.321  1.00 87.01  ? 197 THR E O   1 
ATOM 7337  C CB  . THR E 2 197 ? -34.334 60.919  66.396  1.00 85.26  ? 197 THR E CB  1 
ATOM 7338  O OG1 . THR E 2 197 ? -34.408 62.309  66.061  1.00 89.07  ? 197 THR E OG1 1 
ATOM 7339  C CG2 . THR E 2 197 ? -35.448 60.566  67.365  1.00 87.50  ? 197 THR E CG2 1 
ATOM 7340  N N   . HIS E 2 198 ? -32.253 58.699  68.288  1.00 89.76  ? 198 HIS E N   1 
ATOM 7341  C CA  . HIS E 2 198 ? -32.060 57.279  68.512  1.00 92.79  ? 198 HIS E CA  1 
ATOM 7342  C C   . HIS E 2 198 ? -33.242 56.641  69.240  1.00 93.30  ? 198 HIS E C   1 
ATOM 7343  O O   . HIS E 2 198 ? -34.393 56.754  68.809  1.00 93.98  ? 198 HIS E O   1 
ATOM 7344  C CB  . HIS E 2 198 ? -30.740 57.050  69.275  1.00 97.50  ? 198 HIS E CB  1 
ATOM 7345  C CG  . HIS E 2 198 ? -30.282 55.619  69.298  1.00 105.08 ? 198 HIS E CG  1 
ATOM 7346  N ND1 . HIS E 2 198 ? -30.392 54.781  68.206  1.00 107.31 ? 198 HIS E ND1 1 
ATOM 7347  C CD2 . HIS E 2 198 ? -29.708 54.882  70.281  1.00 106.67 ? 198 HIS E CD2 1 
ATOM 7348  C CE1 . HIS E 2 198 ? -29.911 53.588  68.518  1.00 108.08 ? 198 HIS E CE1 1 
ATOM 7349  N NE2 . HIS E 2 198 ? -29.490 53.624  69.769  1.00 108.37 ? 198 HIS E NE2 1 
ATOM 7350  N N   . LYS E 2 199 ? -32.948 55.970  70.345  1.00 93.89  ? 199 LYS E N   1 
ATOM 7351  C CA  . LYS E 2 199 ? -33.956 55.276  71.125  1.00 94.20  ? 199 LYS E CA  1 
ATOM 7352  C C   . LYS E 2 199 ? -33.476 55.199  72.571  1.00 95.64  ? 199 LYS E C   1 
ATOM 7353  O O   . LYS E 2 199 ? -34.073 54.508  73.392  1.00 95.84  ? 199 LYS E O   1 
ATOM 7354  C CB  . LYS E 2 199 ? -34.149 53.867  70.552  1.00 93.17  ? 199 LYS E CB  1 
ATOM 7355  C CG  . LYS E 2 199 ? -34.393 53.867  69.034  1.00 94.25  ? 199 LYS E CG  1 
ATOM 7356  C CD  . LYS E 2 199 ? -34.178 52.502  68.392  1.00 96.60  ? 199 LYS E CD  1 
ATOM 7357  C CE  . LYS E 2 199 ? -35.171 51.462  68.907  1.00 100.02 ? 199 LYS E CE  1 
ATOM 7358  N NZ  . LYS E 2 199 ? -35.074 50.160  68.170  1.00 101.14 ? 199 LYS E NZ  1 
ATOM 7359  N N   . THR E 2 200 ? -32.385 55.906  72.868  1.00 97.67  ? 200 THR E N   1 
ATOM 7360  C CA  . THR E 2 200 ? -31.826 55.941  74.220  1.00 97.72  ? 200 THR E CA  1 
ATOM 7361  C C   . THR E 2 200 ? -32.140 57.272  74.935  1.00 98.77  ? 200 THR E C   1 
ATOM 7362  O O   . THR E 2 200 ? -31.686 57.508  76.064  1.00 100.32 ? 200 THR E O   1 
ATOM 7363  C CB  . THR E 2 200 ? -30.282 55.681  74.218  1.00 95.45  ? 200 THR E CB  1 
ATOM 7364  O OG1 . THR E 2 200 ? -29.659 56.395  73.142  1.00 90.10  ? 200 THR E OG1 1 
ATOM 7365  C CG2 . THR E 2 200 ? -29.995 54.194  74.077  1.00 93.06  ? 200 THR E CG2 1 
ATOM 7366  N N   . SER E 2 201 ? -32.919 58.128  74.265  1.00 97.64  ? 201 SER E N   1 
ATOM 7367  C CA  . SER E 2 201 ? -33.357 59.423  74.805  1.00 96.36  ? 201 SER E CA  1 
ATOM 7368  C C   . SER E 2 201 ? -34.436 60.024  73.897  1.00 94.17  ? 201 SER E C   1 
ATOM 7369  O O   . SER E 2 201 ? -34.277 60.046  72.674  1.00 95.07  ? 201 SER E O   1 
ATOM 7370  C CB  . SER E 2 201 ? -32.177 60.407  74.932  1.00 97.27  ? 201 SER E CB  1 
ATOM 7371  O OG  . SER E 2 201 ? -31.737 60.876  73.669  1.00 95.57  ? 201 SER E OG  1 
ATOM 7372  N N   . THR E 2 202 ? -35.535 60.494  74.487  1.00 91.79  ? 202 THR E N   1 
ATOM 7373  C CA  . THR E 2 202 ? -36.617 61.094  73.704  1.00 92.29  ? 202 THR E CA  1 
ATOM 7374  C C   . THR E 2 202 ? -36.133 62.446  73.211  1.00 92.06  ? 202 THR E C   1 
ATOM 7375  O O   . THR E 2 202 ? -36.721 63.065  72.316  1.00 94.23  ? 202 THR E O   1 
ATOM 7376  C CB  . THR E 2 202 ? -37.872 61.302  74.556  1.00 92.14  ? 202 THR E CB  1 
ATOM 7377  O OG1 . THR E 2 202 ? -37.920 60.304  75.582  1.00 93.05  ? 202 THR E OG1 1 
ATOM 7378  C CG2 . THR E 2 202 ? -39.122 61.190  73.689  1.00 93.70  ? 202 THR E CG2 1 
ATOM 7379  N N   . SER E 2 203 ? -35.037 62.884  73.820  1.00 89.22  ? 203 SER E N   1 
ATOM 7380  C CA  . SER E 2 203 ? -34.380 64.144  73.505  1.00 84.75  ? 203 SER E CA  1 
ATOM 7381  C C   . SER E 2 203 ? -33.150 63.865  72.638  1.00 79.92  ? 203 SER E C   1 
ATOM 7382  O O   . SER E 2 203 ? -32.081 63.514  73.149  1.00 79.87  ? 203 SER E O   1 
ATOM 7383  C CB  . SER E 2 203 ? -33.952 64.837  74.799  1.00 88.33  ? 203 SER E CB  1 
ATOM 7384  O OG  . SER E 2 203 ? -33.250 63.934  75.647  1.00 89.23  ? 203 SER E OG  1 
ATOM 7385  N N   . PRO E 2 204 ? -33.290 64.026  71.316  1.00 74.69  ? 204 PRO E N   1 
ATOM 7386  C CA  . PRO E 2 204 ? -32.250 63.812  70.303  1.00 73.34  ? 204 PRO E CA  1 
ATOM 7387  C C   . PRO E 2 204 ? -30.922 64.502  70.505  1.00 72.90  ? 204 PRO E C   1 
ATOM 7388  O O   . PRO E 2 204 ? -30.855 65.627  70.998  1.00 74.41  ? 204 PRO E O   1 
ATOM 7389  C CB  . PRO E 2 204 ? -32.902 64.305  69.025  1.00 69.83  ? 204 PRO E CB  1 
ATOM 7390  C CG  . PRO E 2 204 ? -33.870 65.308  69.515  1.00 69.11  ? 204 PRO E CG  1 
ATOM 7391  C CD  . PRO E 2 204 ? -34.485 64.615  70.697  1.00 72.98  ? 204 PRO E CD  1 
ATOM 7392  N N   . ILE E 2 205 ? -29.871 63.817  70.066  1.00 72.18  ? 205 ILE E N   1 
ATOM 7393  C CA  . ILE E 2 205 ? -28.519 64.336  70.138  1.00 70.00  ? 205 ILE E CA  1 
ATOM 7394  C C   . ILE E 2 205 ? -28.344 65.216  68.913  1.00 68.75  ? 205 ILE E C   1 
ATOM 7395  O O   . ILE E 2 205 ? -28.655 64.815  67.788  1.00 66.38  ? 205 ILE E O   1 
ATOM 7396  C CB  . ILE E 2 205 ? -27.438 63.218  70.096  1.00 70.51  ? 205 ILE E CB  1 
ATOM 7397  C CG1 . ILE E 2 205 ? -27.616 62.239  71.265  1.00 74.50  ? 205 ILE E CG1 1 
ATOM 7398  C CG2 . ILE E 2 205 ? -26.062 63.841  70.213  1.00 71.40  ? 205 ILE E CG2 1 
ATOM 7399  C CD1 . ILE E 2 205 ? -28.797 61.287  71.144  1.00 72.99  ? 205 ILE E CD1 1 
ATOM 7400  N N   . VAL E 2 206 ? -27.848 66.425  69.139  1.00 71.24  ? 206 VAL E N   1 
ATOM 7401  C CA  . VAL E 2 206 ? -27.644 67.371  68.050  1.00 69.40  ? 206 VAL E CA  1 
ATOM 7402  C C   . VAL E 2 206 ? -26.214 67.914  67.992  1.00 71.10  ? 206 VAL E C   1 
ATOM 7403  O O   . VAL E 2 206 ? -25.546 68.085  69.025  1.00 70.58  ? 206 VAL E O   1 
ATOM 7404  C CB  . VAL E 2 206 ? -28.600 68.565  68.179  1.00 64.30  ? 206 VAL E CB  1 
ATOM 7405  C CG1 . VAL E 2 206 ? -28.586 69.363  66.907  1.00 60.77  ? 206 VAL E CG1 1 
ATOM 7406  C CG2 . VAL E 2 206 ? -29.987 68.076  68.504  1.00 58.83  ? 206 VAL E CG2 1 
ATOM 7407  N N   . LYS E 2 207 ? -25.753 68.165  66.771  1.00 69.95  ? 207 LYS E N   1 
ATOM 7408  C CA  . LYS E 2 207 ? -24.433 68.721  66.539  1.00 71.43  ? 207 LYS E CA  1 
ATOM 7409  C C   . LYS E 2 207 ? -24.524 69.590  65.311  1.00 74.00  ? 207 LYS E C   1 
ATOM 7410  O O   . LYS E 2 207 ? -25.152 69.215  64.321  1.00 72.60  ? 207 LYS E O   1 
ATOM 7411  C CB  . LYS E 2 207 ? -23.386 67.625  66.323  1.00 68.02  ? 207 LYS E CB  1 
ATOM 7412  C CG  . LYS E 2 207 ? -22.995 66.903  67.594  1.00 64.44  ? 207 LYS E CG  1 
ATOM 7413  C CD  . LYS E 2 207 ? -22.770 67.890  68.718  1.00 65.46  ? 207 LYS E CD  1 
ATOM 7414  C CE  . LYS E 2 207 ? -22.235 67.213  69.951  1.00 64.64  ? 207 LYS E CE  1 
ATOM 7415  N NZ  . LYS E 2 207 ? -20.823 66.803  69.720  1.00 69.74  ? 207 LYS E NZ  1 
ATOM 7416  N N   . SER E 2 208 ? -23.914 70.766  65.382  1.00 77.19  ? 208 SER E N   1 
ATOM 7417  C CA  . SER E 2 208 ? -23.938 71.677  64.251  1.00 79.73  ? 208 SER E CA  1 
ATOM 7418  C C   . SER E 2 208 ? -22.867 72.750  64.325  1.00 80.38  ? 208 SER E C   1 
ATOM 7419  O O   . SER E 2 208 ? -22.229 72.953  65.355  1.00 80.09  ? 208 SER E O   1 
ATOM 7420  C CB  . SER E 2 208 ? -25.311 72.340  64.134  1.00 78.87  ? 208 SER E CB  1 
ATOM 7421  O OG  . SER E 2 208 ? -25.550 73.257  65.181  1.00 83.56  ? 208 SER E OG  1 
ATOM 7422  N N   . PHE E 2 209 ? -22.668 73.423  63.204  1.00 82.91  ? 209 PHE E N   1 
ATOM 7423  C CA  . PHE E 2 209 ? -21.696 74.490  63.125  1.00 86.22  ? 209 PHE E CA  1 
ATOM 7424  C C   . PHE E 2 209 ? -22.359 75.634  62.384  1.00 90.75  ? 209 PHE E C   1 
ATOM 7425  O O   . PHE E 2 209 ? -23.418 75.456  61.778  1.00 91.74  ? 209 PHE E O   1 
ATOM 7426  C CB  . PHE E 2 209 ? -20.434 74.041  62.380  1.00 85.11  ? 209 PHE E CB  1 
ATOM 7427  C CG  . PHE E 2 209 ? -20.664 73.688  60.937  1.00 83.08  ? 209 PHE E CG  1 
ATOM 7428  C CD1 . PHE E 2 209 ? -21.176 72.448  60.581  1.00 84.75  ? 209 PHE E CD1 1 
ATOM 7429  C CD2 . PHE E 2 209 ? -20.369 74.601  59.932  1.00 79.87  ? 209 PHE E CD2 1 
ATOM 7430  C CE1 . PHE E 2 209 ? -21.387 72.123  59.242  1.00 84.64  ? 209 PHE E CE1 1 
ATOM 7431  C CE2 . PHE E 2 209 ? -20.578 74.288  58.588  1.00 79.44  ? 209 PHE E CE2 1 
ATOM 7432  C CZ  . PHE E 2 209 ? -21.087 73.049  58.243  1.00 82.00  ? 209 PHE E CZ  1 
ATOM 7433  N N   . ASN E 2 210 ? -21.732 76.805  62.447  1.00 96.34  ? 210 ASN E N   1 
ATOM 7434  C CA  . ASN E 2 210 ? -22.244 78.003  61.791  1.00 99.71  ? 210 ASN E CA  1 
ATOM 7435  C C   . ASN E 2 210 ? -21.226 78.446  60.743  1.00 99.59  ? 210 ASN E C   1 
ATOM 7436  O O   . ASN E 2 210 ? -20.153 78.944  61.080  1.00 101.47 ? 210 ASN E O   1 
ATOM 7437  C CB  . ASN E 2 210 ? -22.459 79.108  62.830  1.00 102.09 ? 210 ASN E CB  1 
ATOM 7438  C CG  . ASN E 2 210 ? -23.452 80.157  62.365  1.00 105.23 ? 210 ASN E CG  1 
ATOM 7439  O OD1 . ASN E 2 210 ? -23.161 80.976  61.484  1.00 108.49 ? 210 ASN E OD1 1 
ATOM 7440  N ND2 . ASN E 2 210 ? -24.647 80.129  62.951  1.00 104.66 ? 210 ASN E ND2 1 
ATOM 7441  N N   . ARG E 2 211 ? -21.573 78.246  59.475  1.00 98.85  ? 211 ARG E N   1 
ATOM 7442  C CA  . ARG E 2 211 ? -20.705 78.587  58.351  1.00 99.20  ? 211 ARG E CA  1 
ATOM 7443  C C   . ARG E 2 211 ? -20.060 79.948  58.508  1.00 104.01 ? 211 ARG E C   1 
ATOM 7444  O O   . ARG E 2 211 ? -18.924 80.170  58.085  1.00 103.23 ? 211 ARG E O   1 
ATOM 7445  C CB  . ARG E 2 211 ? -21.504 78.583  57.057  1.00 92.74  ? 211 ARG E CB  1 
ATOM 7446  C CG  . ARG E 2 211 ? -20.662 78.421  55.825  1.00 87.29  ? 211 ARG E CG  1 
ATOM 7447  C CD  . ARG E 2 211 ? -21.506 78.622  54.601  1.00 82.19  ? 211 ARG E CD  1 
ATOM 7448  N NE  . ARG E 2 211 ? -21.852 80.024  54.458  1.00 78.37  ? 211 ARG E NE  1 
ATOM 7449  C CZ  . ARG E 2 211 ? -20.963 80.976  54.220  1.00 75.78  ? 211 ARG E CZ  1 
ATOM 7450  N NH1 . ARG E 2 211 ? -19.681 80.658  54.094  1.00 72.73  ? 211 ARG E NH1 1 
ATOM 7451  N NH2 . ARG E 2 211 ? -21.358 82.240  54.124  1.00 72.88  ? 211 ARG E NH2 1 
ATOM 7452  N N   . ASN E 2 212 ? -20.806 80.857  59.120  1.00 111.78 ? 212 ASN E N   1 
ATOM 7453  C CA  . ASN E 2 212 ? -20.370 82.233  59.333  1.00 119.35 ? 212 ASN E CA  1 
ATOM 7454  C C   . ASN E 2 212 ? -19.398 82.395  60.489  1.00 120.43 ? 212 ASN E C   1 
ATOM 7455  O O   . ASN E 2 212 ? -18.434 83.157  60.396  1.00 121.53 ? 212 ASN E O   1 
ATOM 7456  C CB  . ASN E 2 212 ? -21.596 83.121  59.581  1.00 124.69 ? 212 ASN E CB  1 
ATOM 7457  C CG  . ASN E 2 212 ? -22.695 82.895  58.550  1.00 130.29 ? 212 ASN E CG  1 
ATOM 7458  O OD1 . ASN E 2 212 ? -22.587 83.318  57.388  1.00 132.83 ? 212 ASN E OD1 1 
ATOM 7459  N ND2 . ASN E 2 212 ? -23.755 82.206  58.969  1.00 131.18 ? 212 ASN E ND2 1 
ATOM 7460  N N   . GLU E 2 213 ? -19.665 81.679  61.575  1.00 121.37 ? 213 GLU E N   1 
ATOM 7461  C CA  . GLU E 2 213 ? -18.840 81.729  62.776  1.00 122.87 ? 213 GLU E CA  1 
ATOM 7462  C C   . GLU E 2 213 ? -17.456 81.125  62.556  1.00 125.20 ? 213 GLU E C   1 
ATOM 7463  O O   . GLU E 2 213 ? -16.643 81.039  63.479  1.00 125.15 ? 213 GLU E O   1 
ATOM 7464  C CB  . GLU E 2 213 ? -19.550 80.993  63.901  1.00 121.98 ? 213 GLU E CB  1 
ATOM 7465  C CG  . GLU E 2 213 ? -18.867 81.074  65.239  1.00 122.49 ? 213 GLU E CG  1 
ATOM 7466  C CD  . GLU E 2 213 ? -19.668 80.363  66.301  1.00 125.09 ? 213 GLU E CD  1 
ATOM 7467  O OE1 . GLU E 2 213 ? -20.704 79.759  65.941  1.00 126.14 ? 213 GLU E OE1 1 
ATOM 7468  O OE2 . GLU E 2 213 ? -19.267 80.403  67.486  1.00 126.22 ? 213 GLU E OE2 1 
ATOM 7469  N N   . CYS E 2 214 ? -17.204 80.713  61.317  1.00 128.17 ? 214 CYS E N   1 
ATOM 7470  C CA  . CYS E 2 214 ? -15.924 80.114  60.934  1.00 131.12 ? 214 CYS E CA  1 
ATOM 7471  C C   . CYS E 2 214 ? -14.694 80.848  61.450  1.00 133.47 ? 214 CYS E C   1 
ATOM 7472  O O   . CYS E 2 214 ? -14.355 81.904  60.869  1.00 135.19 ? 214 CYS E O   1 
ATOM 7473  C CB  . CYS E 2 214 ? -15.830 79.994  59.422  1.00 130.49 ? 214 CYS E CB  1 
ATOM 7474  S SG  . CYS E 2 214 ? -16.192 78.334  58.860  1.00 129.17 ? 214 CYS E SG  1 
ATOM 7475  O OXT . CYS E 2 214 ? -14.087 80.357  62.430  1.00 135.81 ? 214 CYS E OXT 1 
ATOM 7476  N N   . GLN F 3 1   ? 4.195   28.999  53.590  1.00 53.59  ? 1   GLN F N   1 
ATOM 7477  C CA  . GLN F 3 1   ? 3.495   29.495  52.389  1.00 56.66  ? 1   GLN F CA  1 
ATOM 7478  C C   . GLN F 3 1   ? 2.792   28.440  51.578  1.00 55.89  ? 1   GLN F C   1 
ATOM 7479  O O   . GLN F 3 1   ? 3.241   27.305  51.478  1.00 60.02  ? 1   GLN F O   1 
ATOM 7480  C CB  . GLN F 3 1   ? 4.455   30.171  51.420  1.00 64.38  ? 1   GLN F CB  1 
ATOM 7481  C CG  . GLN F 3 1   ? 3.943   30.070  49.953  1.00 74.53  ? 1   GLN F CG  1 
ATOM 7482  C CD  . GLN F 3 1   ? 4.927   30.596  48.916  1.00 80.17  ? 1   GLN F CD  1 
ATOM 7483  O OE1 . GLN F 3 1   ? 6.135   30.349  49.006  1.00 84.01  ? 1   GLN F OE1 1 
ATOM 7484  N NE2 . GLN F 3 1   ? 4.412   31.311  47.915  1.00 80.50  ? 1   GLN F NE2 1 
ATOM 7485  N N   . VAL F 3 2   ? 1.718   28.883  50.945  1.00 52.00  ? 2   VAL F N   1 
ATOM 7486  C CA  . VAL F 3 2   ? 0.886   28.115  50.029  1.00 47.83  ? 2   VAL F CA  1 
ATOM 7487  C C   . VAL F 3 2   ? -0.159  29.178  49.784  1.00 49.23  ? 2   VAL F C   1 
ATOM 7488  O O   . VAL F 3 2   ? -1.016  29.419  50.636  1.00 46.90  ? 2   VAL F O   1 
ATOM 7489  C CB  . VAL F 3 2   ? 0.256   26.841  50.653  1.00 42.17  ? 2   VAL F CB  1 
ATOM 7490  C CG1 . VAL F 3 2   ? 0.226   26.950  52.171  1.00 41.97  ? 2   VAL F CG1 1 
ATOM 7491  C CG2 . VAL F 3 2   ? -1.135  26.595  50.055  1.00 28.81  ? 2   VAL F CG2 1 
ATOM 7492  N N   . GLN F 3 3   ? -0.059  29.833  48.626  1.00 47.13  ? 3   GLN F N   1 
ATOM 7493  C CA  . GLN F 3 3   ? -0.947  30.937  48.299  1.00 46.16  ? 3   GLN F CA  1 
ATOM 7494  C C   . GLN F 3 3   ? -1.610  30.955  46.928  1.00 44.08  ? 3   GLN F C   1 
ATOM 7495  O O   . GLN F 3 3   ? -1.078  30.423  45.956  1.00 41.78  ? 3   GLN F O   1 
ATOM 7496  C CB  . GLN F 3 3   ? -0.165  32.220  48.529  1.00 49.21  ? 3   GLN F CB  1 
ATOM 7497  C CG  . GLN F 3 3   ? 0.478   32.225  49.901  1.00 55.27  ? 3   GLN F CG  1 
ATOM 7498  C CD  . GLN F 3 3   ? 1.611   33.228  50.032  1.00 58.86  ? 3   GLN F CD  1 
ATOM 7499  O OE1 . GLN F 3 3   ? 2.610   33.159  49.305  1.00 62.24  ? 3   GLN F OE1 1 
ATOM 7500  N NE2 . GLN F 3 3   ? 1.467   34.164  50.968  1.00 58.63  ? 3   GLN F NE2 1 
ATOM 7501  N N   . LEU F 3 4   ? -2.792  31.567  46.883  1.00 39.42  ? 4   LEU F N   1 
ATOM 7502  C CA  . LEU F 3 4   ? -3.561  31.700  45.657  1.00 37.00  ? 4   LEU F CA  1 
ATOM 7503  C C   . LEU F 3 4   ? -3.732  33.176  45.373  1.00 38.78  ? 4   LEU F C   1 
ATOM 7504  O O   . LEU F 3 4   ? -4.622  33.841  45.936  1.00 41.35  ? 4   LEU F O   1 
ATOM 7505  C CB  . LEU F 3 4   ? -4.925  31.045  45.814  1.00 30.86  ? 4   LEU F CB  1 
ATOM 7506  C CG  . LEU F 3 4   ? -4.829  29.576  46.248  1.00 25.05  ? 4   LEU F CG  1 
ATOM 7507  C CD1 . LEU F 3 4   ? -6.230  28.934  46.259  1.00 23.83  ? 4   LEU F CD1 1 
ATOM 7508  C CD2 . LEU F 3 4   ? -3.895  28.831  45.307  1.00 18.31  ? 4   LEU F CD2 1 
ATOM 7509  N N   . GLN F 3 5   ? -2.878  33.690  44.495  1.00 37.34  ? 5   GLN F N   1 
ATOM 7510  C CA  . GLN F 3 5   ? -2.916  35.105  44.151  1.00 39.67  ? 5   GLN F CA  1 
ATOM 7511  C C   . GLN F 3 5   ? -3.852  35.494  43.001  1.00 39.29  ? 5   GLN F C   1 
ATOM 7512  O O   . GLN F 3 5   ? -3.752  34.969  41.880  1.00 40.47  ? 5   GLN F O   1 
ATOM 7513  C CB  . GLN F 3 5   ? -1.509  35.581  43.817  1.00 43.25  ? 5   GLN F CB  1 
ATOM 7514  C CG  . GLN F 3 5   ? -1.286  37.041  44.116  1.00 49.17  ? 5   GLN F CG  1 
ATOM 7515  C CD  . GLN F 3 5   ? -0.386  37.706  43.098  1.00 58.57  ? 5   GLN F CD  1 
ATOM 7516  O OE1 . GLN F 3 5   ? 0.700   37.197  42.766  1.00 60.39  ? 5   GLN F OE1 1 
ATOM 7517  N NE2 . GLN F 3 5   ? -0.828  38.860  42.592  1.00 63.04  ? 5   GLN F NE2 1 
ATOM 7518  N N   . GLN F 3 6   ? -4.763  36.421  43.278  1.00 37.73  ? 6   GLN F N   1 
ATOM 7519  C CA  . GLN F 3 6   ? -5.667  36.895  42.239  1.00 36.89  ? 6   GLN F CA  1 
ATOM 7520  C C   . GLN F 3 6   ? -6.051  38.389  42.326  1.00 35.96  ? 6   GLN F C   1 
ATOM 7521  O O   . GLN F 3 6   ? -6.319  38.925  43.397  1.00 41.23  ? 6   GLN F O   1 
ATOM 7522  C CB  . GLN F 3 6   ? -6.923  36.002  42.163  1.00 32.89  ? 6   GLN F CB  1 
ATOM 7523  C CG  . GLN F 3 6   ? -7.495  35.486  43.471  1.00 25.21  ? 6   GLN F CG  1 
ATOM 7524  C CD  . GLN F 3 6   ? -8.840  34.800  43.250  1.00 29.42  ? 6   GLN F CD  1 
ATOM 7525  O OE1 . GLN F 3 6   ? -9.421  34.192  44.162  1.00 24.36  ? 6   GLN F OE1 1 
ATOM 7526  N NE2 . GLN F 3 6   ? -9.347  34.902  42.020  1.00 39.78  ? 6   GLN F NE2 1 
ATOM 7527  N N   . PRO F 3 7   ? -6.049  39.082  41.186  1.00 33.51  ? 7   PRO F N   1 
ATOM 7528  C CA  . PRO F 3 7   ? -6.387  40.494  41.075  1.00 35.80  ? 7   PRO F CA  1 
ATOM 7529  C C   . PRO F 3 7   ? -7.568  40.873  41.932  1.00 37.79  ? 7   PRO F C   1 
ATOM 7530  O O   . PRO F 3 7   ? -8.491  40.084  42.105  1.00 44.40  ? 7   PRO F O   1 
ATOM 7531  C CB  . PRO F 3 7   ? -6.690  40.637  39.602  1.00 36.85  ? 7   PRO F CB  1 
ATOM 7532  C CG  . PRO F 3 7   ? -5.637  39.797  39.012  1.00 39.81  ? 7   PRO F CG  1 
ATOM 7533  C CD  . PRO F 3 7   ? -5.660  38.548  39.872  1.00 40.53  ? 7   PRO F CD  1 
ATOM 7534  N N   . GLY F 3 8   ? -7.551  42.092  42.455  1.00 36.11  ? 8   GLY F N   1 
ATOM 7535  C CA  . GLY F 3 8   ? -8.650  42.523  43.296  1.00 35.31  ? 8   GLY F CA  1 
ATOM 7536  C C   . GLY F 3 8   ? -9.896  42.915  42.528  1.00 36.59  ? 8   GLY F C   1 
ATOM 7537  O O   . GLY F 3 8   ? -11.020 42.686  43.000  1.00 26.76  ? 8   GLY F O   1 
ATOM 7538  N N   . THR F 3 9   ? -9.706  43.501  41.345  1.00 38.71  ? 9   THR F N   1 
ATOM 7539  C CA  . THR F 3 9   ? -10.848 43.943  40.557  1.00 42.15  ? 9   THR F CA  1 
ATOM 7540  C C   . THR F 3 9   ? -10.721 43.722  39.068  1.00 40.70  ? 9   THR F C   1 
ATOM 7541  O O   . THR F 3 9   ? -9.623  43.630  38.529  1.00 35.26  ? 9   THR F O   1 
ATOM 7542  C CB  . THR F 3 9   ? -11.117 45.453  40.736  1.00 44.05  ? 9   THR F CB  1 
ATOM 7543  O OG1 . THR F 3 9   ? -10.327 45.961  41.819  1.00 47.77  ? 9   THR F OG1 1 
ATOM 7544  C CG2 . THR F 3 9   ? -12.618 45.707  41.008  1.00 47.77  ? 9   THR F CG2 1 
ATOM 7545  N N   . GLU F 3 10  ? -11.877 43.662  38.416  1.00 41.78  ? 10  GLU F N   1 
ATOM 7546  C CA  . GLU F 3 10  ? -11.968 43.505  36.969  1.00 44.81  ? 10  GLU F CA  1 
ATOM 7547  C C   . GLU F 3 10  ? -13.214 44.249  36.525  1.00 44.12  ? 10  GLU F C   1 
ATOM 7548  O O   . GLU F 3 10  ? -14.310 44.018  37.052  1.00 43.59  ? 10  GLU F O   1 
ATOM 7549  C CB  . GLU F 3 10  ? -12.098 42.034  36.584  1.00 50.28  ? 10  GLU F CB  1 
ATOM 7550  C CG  . GLU F 3 10  ? -10.838 41.242  36.792  1.00 61.14  ? 10  GLU F CG  1 
ATOM 7551  C CD  . GLU F 3 10  ? -10.014 41.134  35.536  1.00 68.13  ? 10  GLU F CD  1 
ATOM 7552  O OE1 . GLU F 3 10  ? -8.793  41.453  35.584  1.00 70.37  ? 10  GLU F OE1 1 
ATOM 7553  O OE2 . GLU F 3 10  ? -10.604 40.718  34.506  1.00 70.05  ? 10  GLU F OE2 1 
ATOM 7554  N N   . LEU F 3 11  ? -13.044 45.170  35.584  1.00 43.15  ? 11  LEU F N   1 
ATOM 7555  C CA  . LEU F 3 11  ? -14.180 45.923  35.066  1.00 46.31  ? 11  LEU F CA  1 
ATOM 7556  C C   . LEU F 3 11  ? -14.328 45.461  33.641  1.00 47.67  ? 11  LEU F C   1 
ATOM 7557  O O   . LEU F 3 11  ? -13.340 45.330  32.917  1.00 45.66  ? 11  LEU F O   1 
ATOM 7558  C CB  . LEU F 3 11  ? -13.926 47.438  35.100  1.00 46.89  ? 11  LEU F CB  1 
ATOM 7559  C CG  . LEU F 3 11  ? -14.996 48.381  34.517  1.00 49.95  ? 11  LEU F CG  1 
ATOM 7560  C CD1 . LEU F 3 11  ? -16.359 48.123  35.159  1.00 49.28  ? 11  LEU F CD1 1 
ATOM 7561  C CD2 . LEU F 3 11  ? -14.578 49.827  34.745  1.00 49.69  ? 11  LEU F CD2 1 
ATOM 7562  N N   . VAL F 3 12  ? -15.558 45.194  33.231  1.00 52.06  ? 12  VAL F N   1 
ATOM 7563  C CA  . VAL F 3 12  ? -15.746 44.734  31.878  1.00 57.24  ? 12  VAL F CA  1 
ATOM 7564  C C   . VAL F 3 12  ? -17.062 45.206  31.275  1.00 59.56  ? 12  VAL F C   1 
ATOM 7565  O O   . VAL F 3 12  ? -18.103 45.267  31.946  1.00 56.97  ? 12  VAL F O   1 
ATOM 7566  C CB  . VAL F 3 12  ? -15.621 43.188  31.824  1.00 56.74  ? 12  VAL F CB  1 
ATOM 7567  C CG1 . VAL F 3 12  ? -16.939 42.528  32.240  1.00 51.21  ? 12  VAL F CG1 1 
ATOM 7568  C CG2 . VAL F 3 12  ? -15.158 42.761  30.446  1.00 59.77  ? 12  VAL F CG2 1 
ATOM 7569  N N   . ARG F 3 13  ? -16.994 45.566  30.002  1.00 63.13  ? 13  ARG F N   1 
ATOM 7570  C CA  . ARG F 3 13  ? -18.163 46.033  29.290  1.00 67.76  ? 13  ARG F CA  1 
ATOM 7571  C C   . ARG F 3 13  ? -19.078 44.841  29.081  1.00 65.51  ? 13  ARG F C   1 
ATOM 7572  O O   . ARG F 3 13  ? -18.618 43.761  28.702  1.00 64.56  ? 13  ARG F O   1 
ATOM 7573  C CB  . ARG F 3 13  ? -17.736 46.613  27.944  1.00 75.76  ? 13  ARG F CB  1 
ATOM 7574  C CG  . ARG F 3 13  ? -16.812 47.808  28.072  1.00 86.78  ? 13  ARG F CG  1 
ATOM 7575  C CD  . ARG F 3 13  ? -17.512 49.084  27.634  1.00 95.36  ? 13  ARG F CD  1 
ATOM 7576  N NE  . ARG F 3 13  ? -17.967 48.947  26.252  1.00 106.30 ? 13  ARG F NE  1 
ATOM 7577  C CZ  . ARG F 3 13  ? -18.387 49.953  25.488  1.00 110.26 ? 13  ARG F CZ  1 
ATOM 7578  N NH1 . ARG F 3 13  ? -18.414 51.193  25.973  1.00 111.02 ? 13  ARG F NH1 1 
ATOM 7579  N NH2 . ARG F 3 13  ? -18.770 49.718  24.232  1.00 113.62 ? 13  ARG F NH2 1 
ATOM 7580  N N   . PRO F 3 14  ? -20.380 45.002  29.363  1.00 65.26  ? 14  PRO F N   1 
ATOM 7581  C CA  . PRO F 3 14  ? -21.273 43.863  29.155  1.00 66.17  ? 14  PRO F CA  1 
ATOM 7582  C C   . PRO F 3 14  ? -20.979 43.182  27.821  1.00 65.49  ? 14  PRO F C   1 
ATOM 7583  O O   . PRO F 3 14  ? -20.714 43.843  26.818  1.00 70.33  ? 14  PRO F O   1 
ATOM 7584  C CB  . PRO F 3 14  ? -22.674 44.491  29.226  1.00 64.50  ? 14  PRO F CB  1 
ATOM 7585  C CG  . PRO F 3 14  ? -22.425 46.011  29.390  1.00 64.54  ? 14  PRO F CG  1 
ATOM 7586  C CD  . PRO F 3 14  ? -21.088 46.092  30.045  1.00 63.92  ? 14  PRO F CD  1 
ATOM 7587  N N   . GLY F 3 15  ? -20.989 41.857  27.835  1.00 63.01  ? 15  GLY F N   1 
ATOM 7588  C CA  . GLY F 3 15  ? -20.715 41.113  26.627  1.00 64.04  ? 15  GLY F CA  1 
ATOM 7589  C C   . GLY F 3 15  ? -19.265 41.168  26.193  1.00 65.54  ? 15  GLY F C   1 
ATOM 7590  O O   . GLY F 3 15  ? -18.965 41.155  25.002  1.00 71.11  ? 15  GLY F O   1 
ATOM 7591  N N   . ALA F 3 16  ? -18.355 41.244  27.151  1.00 64.39  ? 16  ALA F N   1 
ATOM 7592  C CA  . ALA F 3 16  ? -16.938 41.262  26.834  1.00 62.94  ? 16  ALA F CA  1 
ATOM 7593  C C   . ALA F 3 16  ? -16.371 40.039  27.538  1.00 63.63  ? 16  ALA F C   1 
ATOM 7594  O O   . ALA F 3 16  ? -16.945 39.558  28.515  1.00 58.71  ? 16  ALA F O   1 
ATOM 7595  C CB  . ALA F 3 16  ? -16.300 42.528  27.356  1.00 62.93  ? 16  ALA F CB  1 
ATOM 7596  N N   . SER F 3 17  ? -15.259 39.510  27.053  1.00 66.60  ? 17  SER F N   1 
ATOM 7597  C CA  . SER F 3 17  ? -14.718 38.331  27.709  1.00 69.10  ? 17  SER F CA  1 
ATOM 7598  C C   . SER F 3 17  ? -13.947 38.730  28.955  1.00 67.22  ? 17  SER F C   1 
ATOM 7599  O O   . SER F 3 17  ? -13.136 39.655  28.940  1.00 67.54  ? 17  SER F O   1 
ATOM 7600  C CB  . SER F 3 17  ? -13.814 37.536  26.767  1.00 71.86  ? 17  SER F CB  1 
ATOM 7601  O OG  . SER F 3 17  ? -13.655 36.213  27.250  1.00 75.59  ? 17  SER F OG  1 
ATOM 7602  N N   . VAL F 3 18  ? -14.218 38.012  30.037  1.00 65.12  ? 18  VAL F N   1 
ATOM 7603  C CA  . VAL F 3 18  ? -13.583 38.263  31.319  1.00 59.64  ? 18  VAL F CA  1 
ATOM 7604  C C   . VAL F 3 18  ? -12.677 37.130  31.717  1.00 57.13  ? 18  VAL F C   1 
ATOM 7605  O O   . VAL F 3 18  ? -13.121 35.987  31.780  1.00 59.05  ? 18  VAL F O   1 
ATOM 7606  C CB  . VAL F 3 18  ? -14.623 38.397  32.426  1.00 57.29  ? 18  VAL F CB  1 
ATOM 7607  C CG1 . VAL F 3 18  ? -13.946 38.276  33.774  1.00 62.29  ? 18  VAL F CG1 1 
ATOM 7608  C CG2 . VAL F 3 18  ? -15.322 39.718  32.311  1.00 55.86  ? 18  VAL F CG2 1 
ATOM 7609  N N   . ILE F 3 19  ? -11.421 37.435  32.004  1.00 51.91  ? 19  ILE F N   1 
ATOM 7610  C CA  . ILE F 3 19  ? -10.515 36.384  32.424  1.00 49.19  ? 19  ILE F CA  1 
ATOM 7611  C C   . ILE F 3 19  ? -10.063 36.544  33.861  1.00 50.38  ? 19  ILE F C   1 
ATOM 7612  O O   . ILE F 3 19  ? -9.525  37.579  34.259  1.00 54.68  ? 19  ILE F O   1 
ATOM 7613  C CB  . ILE F 3 19  ? -9.287  36.308  31.545  1.00 47.01  ? 19  ILE F CB  1 
ATOM 7614  C CG1 . ILE F 3 19  ? -9.635  35.540  30.272  1.00 44.90  ? 19  ILE F CG1 1 
ATOM 7615  C CG2 . ILE F 3 19  ? -8.140  35.653  32.311  1.00 41.57  ? 19  ILE F CG2 1 
ATOM 7616  C CD1 . ILE F 3 19  ? -10.722 36.196  29.457  1.00 46.35  ? 19  ILE F CD1 1 
ATOM 7617  N N   . LEU F 3 20  ? -10.279 35.498  34.640  1.00 46.12  ? 20  LEU F N   1 
ATOM 7618  C CA  . LEU F 3 20  ? -9.890  35.525  36.022  1.00 40.87  ? 20  LEU F CA  1 
ATOM 7619  C C   . LEU F 3 20  ? -8.665  34.660  36.172  1.00 41.90  ? 20  LEU F C   1 
ATOM 7620  O O   . LEU F 3 20  ? -8.704  33.461  35.902  1.00 44.89  ? 20  LEU F O   1 
ATOM 7621  C CB  . LEU F 3 20  ? -11.032 35.002  36.883  1.00 38.48  ? 20  LEU F CB  1 
ATOM 7622  C CG  . LEU F 3 20  ? -12.344 35.730  36.605  1.00 40.19  ? 20  LEU F CG  1 
ATOM 7623  C CD1 . LEU F 3 20  ? -13.401 35.249  37.552  1.00 36.94  ? 20  LEU F CD1 1 
ATOM 7624  C CD2 . LEU F 3 20  ? -12.152 37.225  36.768  1.00 40.54  ? 20  LEU F CD2 1 
ATOM 7625  N N   . SER F 3 21  ? -7.563  35.277  36.572  1.00 41.49  ? 21  SER F N   1 
ATOM 7626  C CA  . SER F 3 21  ? -6.332  34.532  36.767  1.00 38.33  ? 21  SER F CA  1 
ATOM 7627  C C   . SER F 3 21  ? -6.176  34.242  38.250  1.00 39.62  ? 21  SER F C   1 
ATOM 7628  O O   . SER F 3 21  ? -6.647  35.008  39.098  1.00 37.68  ? 21  SER F O   1 
ATOM 7629  C CB  . SER F 3 21  ? -5.142  35.348  36.299  1.00 39.93  ? 21  SER F CB  1 
ATOM 7630  O OG  . SER F 3 21  ? -4.915  36.425  37.192  1.00 42.54  ? 21  SER F OG  1 
ATOM 7631  N N   . CYS F 3 22  ? -5.527  33.122  38.551  1.00 37.49  ? 22  CYS F N   1 
ATOM 7632  C CA  . CYS F 3 22  ? -5.280  32.708  39.923  1.00 31.21  ? 22  CYS F CA  1 
ATOM 7633  C C   . CYS F 3 22  ? -3.936  32.034  39.886  1.00 33.61  ? 22  CYS F C   1 
ATOM 7634  O O   . CYS F 3 22  ? -3.810  30.980  39.289  1.00 34.31  ? 22  CYS F O   1 
ATOM 7635  C CB  . CYS F 3 22  ? -6.331  31.706  40.392  1.00 30.41  ? 22  CYS F CB  1 
ATOM 7636  S SG  . CYS F 3 22  ? -5.839  30.852  41.913  1.00 30.98  ? 22  CYS F SG  1 
ATOM 7637  N N   . LYS F 3 23  ? -2.932  32.628  40.517  1.00 37.43  ? 23  LYS F N   1 
ATOM 7638  C CA  . LYS F 3 23  ? -1.596  32.050  40.481  1.00 39.80  ? 23  LYS F CA  1 
ATOM 7639  C C   . LYS F 3 23  ? -1.175  31.375  41.771  1.00 40.59  ? 23  LYS F C   1 
ATOM 7640  O O   . LYS F 3 23  ? -1.086  32.021  42.824  1.00 42.13  ? 23  LYS F O   1 
ATOM 7641  C CB  . LYS F 3 23  ? -0.574  33.119  40.107  1.00 43.56  ? 23  LYS F CB  1 
ATOM 7642  C CG  . LYS F 3 23  ? 0.861   32.612  40.114  1.00 57.93  ? 23  LYS F CG  1 
ATOM 7643  C CD  . LYS F 3 23  ? 1.853   33.711  39.724  1.00 65.02  ? 23  LYS F CD  1 
ATOM 7644  C CE  . LYS F 3 23  ? 3.295   33.237  39.906  1.00 68.39  ? 23  LYS F CE  1 
ATOM 7645  N NZ  . LYS F 3 23  ? 3.556   31.946  39.186  1.00 73.26  ? 23  LYS F NZ  1 
ATOM 7646  N N   . ALA F 3 24  ? -0.894  30.076  41.668  1.00 38.18  ? 24  ALA F N   1 
ATOM 7647  C CA  . ALA F 3 24  ? -0.481  29.262  42.812  1.00 38.66  ? 24  ALA F CA  1 
ATOM 7648  C C   . ALA F 3 24  ? 0.966   29.504  43.180  1.00 40.72  ? 24  ALA F C   1 
ATOM 7649  O O   . ALA F 3 24  ? 1.711   30.116  42.417  1.00 47.87  ? 24  ALA F O   1 
ATOM 7650  C CB  . ALA F 3 24  ? -0.682  27.794  42.510  1.00 35.00  ? 24  ALA F CB  1 
ATOM 7651  N N   . SER F 3 25  ? 1.351   29.022  44.359  1.00 40.33  ? 25  SER F N   1 
ATOM 7652  C CA  . SER F 3 25  ? 2.712   29.145  44.879  1.00 37.32  ? 25  SER F CA  1 
ATOM 7653  C C   . SER F 3 25  ? 2.754   28.445  46.223  1.00 38.88  ? 25  SER F C   1 
ATOM 7654  O O   . SER F 3 25  ? 1.733   28.332  46.900  1.00 40.89  ? 25  SER F O   1 
ATOM 7655  C CB  . SER F 3 25  ? 3.106   30.614  45.054  1.00 33.37  ? 25  SER F CB  1 
ATOM 7656  O OG  . SER F 3 25  ? 2.147   31.330  45.808  1.00 39.88  ? 25  SER F OG  1 
ATOM 7657  N N   . GLY F 3 26  ? 3.924   27.950  46.601  1.00 39.89  ? 26  GLY F N   1 
ATOM 7658  C CA  . GLY F 3 26  ? 4.047   27.292  47.889  1.00 43.01  ? 26  GLY F CA  1 
ATOM 7659  C C   . GLY F 3 26  ? 3.711   25.817  47.896  1.00 42.36  ? 26  GLY F C   1 
ATOM 7660  O O   . GLY F 3 26  ? 3.858   25.159  48.927  1.00 42.61  ? 26  GLY F O   1 
ATOM 7661  N N   . TYR F 3 27  ? 3.259   25.291  46.764  1.00 42.26  ? 27  TYR F N   1 
ATOM 7662  C CA  . TYR F 3 27  ? 2.925   23.869  46.677  1.00 41.98  ? 27  TYR F CA  1 
ATOM 7663  C C   . TYR F 3 27  ? 3.068   23.380  45.235  1.00 42.82  ? 27  TYR F C   1 
ATOM 7664  O O   . TYR F 3 27  ? 3.248   24.188  44.311  1.00 42.65  ? 27  TYR F O   1 
ATOM 7665  C CB  . TYR F 3 27  ? 1.492   23.615  47.180  1.00 40.87  ? 27  TYR F CB  1 
ATOM 7666  C CG  . TYR F 3 27  ? 0.382   23.932  46.191  1.00 35.16  ? 27  TYR F CG  1 
ATOM 7667  C CD1 . TYR F 3 27  ? 0.030   25.247  45.886  1.00 39.33  ? 27  TYR F CD1 1 
ATOM 7668  C CD2 . TYR F 3 27  ? -0.304  22.909  45.553  1.00 36.59  ? 27  TYR F CD2 1 
ATOM 7669  C CE1 . TYR F 3 27  ? -0.992  25.530  44.957  1.00 39.70  ? 27  TYR F CE1 1 
ATOM 7670  C CE2 . TYR F 3 27  ? -1.322  23.174  44.631  1.00 42.38  ? 27  TYR F CE2 1 
ATOM 7671  C CZ  . TYR F 3 27  ? -1.662  24.484  44.335  1.00 43.87  ? 27  TYR F CZ  1 
ATOM 7672  O OH  . TYR F 3 27  ? -2.666  24.723  43.415  1.00 47.13  ? 27  TYR F OH  1 
ATOM 7673  N N   . THR F 3 28  ? 2.997   22.067  45.034  1.00 40.74  ? 28  THR F N   1 
ATOM 7674  C CA  . THR F 3 28  ? 3.113   21.537  43.685  1.00 41.58  ? 28  THR F CA  1 
ATOM 7675  C C   . THR F 3 28  ? 1.785   21.661  42.936  1.00 41.52  ? 28  THR F C   1 
ATOM 7676  O O   . THR F 3 28  ? 0.885   20.826  43.071  1.00 39.47  ? 28  THR F O   1 
ATOM 7677  C CB  . THR F 3 28  ? 3.572   20.083  43.706  1.00 40.04  ? 28  THR F CB  1 
ATOM 7678  O OG1 . THR F 3 28  ? 4.945   20.037  44.099  1.00 39.40  ? 28  THR F OG1 1 
ATOM 7679  C CG2 . THR F 3 28  ? 3.419   19.457  42.325  1.00 45.21  ? 28  THR F CG2 1 
ATOM 7680  N N   . PHE F 3 29  ? 1.698   22.721  42.140  1.00 40.22  ? 29  PHE F N   1 
ATOM 7681  C CA  . PHE F 3 29  ? 0.518   23.067  41.364  1.00 41.27  ? 29  PHE F CA  1 
ATOM 7682  C C   . PHE F 3 29  ? -0.302  21.925  40.771  1.00 42.12  ? 29  PHE F C   1 
ATOM 7683  O O   . PHE F 3 29  ? -1.524  21.874  40.932  1.00 42.69  ? 29  PHE F O   1 
ATOM 7684  C CB  . PHE F 3 29  ? 0.934   24.025  40.249  1.00 44.50  ? 29  PHE F CB  1 
ATOM 7685  C CG  . PHE F 3 29  ? -0.219  24.577  39.464  1.00 44.87  ? 29  PHE F CG  1 
ATOM 7686  C CD1 . PHE F 3 29  ? -1.185  25.356  40.077  1.00 46.48  ? 29  PHE F CD1 1 
ATOM 7687  C CD2 . PHE F 3 29  ? -0.342  24.314  38.109  1.00 48.29  ? 29  PHE F CD2 1 
ATOM 7688  C CE1 . PHE F 3 29  ? -2.263  25.866  39.348  1.00 46.32  ? 29  PHE F CE1 1 
ATOM 7689  C CE2 . PHE F 3 29  ? -1.422  24.820  37.370  1.00 49.92  ? 29  PHE F CE2 1 
ATOM 7690  C CZ  . PHE F 3 29  ? -2.380  25.596  37.993  1.00 46.71  ? 29  PHE F CZ  1 
ATOM 7691  N N   . THR F 3 30  ? 0.379   21.015  40.088  1.00 43.53  ? 30  THR F N   1 
ATOM 7692  C CA  . THR F 3 30  ? -0.256  19.872  39.424  1.00 41.45  ? 30  THR F CA  1 
ATOM 7693  C C   . THR F 3 30  ? -0.715  18.741  40.315  1.00 37.00  ? 30  THR F C   1 
ATOM 7694  O O   . THR F 3 30  ? -1.274  17.758  39.826  1.00 35.85  ? 30  THR F O   1 
ATOM 7695  C CB  . THR F 3 30  ? 0.689   19.238  38.432  1.00 42.35  ? 30  THR F CB  1 
ATOM 7696  O OG1 . THR F 3 30  ? 1.953   19.005  39.082  1.00 44.35  ? 30  THR F OG1 1 
ATOM 7697  C CG2 . THR F 3 30  ? 0.855   20.134  37.228  1.00 36.46  ? 30  THR F CG2 1 
ATOM 7698  N N   . SER F 3 31  ? -0.457  18.855  41.608  1.00 33.88  ? 31  SER F N   1 
ATOM 7699  C CA  . SER F 3 31  ? -0.865  17.807  42.523  1.00 31.68  ? 31  SER F CA  1 
ATOM 7700  C C   . SER F 3 31  ? -2.188  18.137  43.193  1.00 30.33  ? 31  SER F C   1 
ATOM 7701  O O   . SER F 3 31  ? -2.744  17.302  43.881  1.00 27.82  ? 31  SER F O   1 
ATOM 7702  C CB  . SER F 3 31  ? 0.212   17.598  43.587  1.00 33.58  ? 31  SER F CB  1 
ATOM 7703  O OG  . SER F 3 31  ? 1.469   17.297  42.994  1.00 35.60  ? 31  SER F OG  1 
ATOM 7704  N N   . TYR F 3 32  ? -2.714  19.340  42.972  1.00 31.96  ? 32  TYR F N   1 
ATOM 7705  C CA  . TYR F 3 32  ? -3.955  19.738  43.629  1.00 32.99  ? 32  TYR F CA  1 
ATOM 7706  C C   . TYR F 3 32  ? -5.033  20.353  42.774  1.00 36.19  ? 32  TYR F C   1 
ATOM 7707  O O   . TYR F 3 32  ? -4.747  21.054  41.804  1.00 41.82  ? 32  TYR F O   1 
ATOM 7708  C CB  . TYR F 3 32  ? -3.640  20.738  44.733  1.00 33.30  ? 32  TYR F CB  1 
ATOM 7709  C CG  . TYR F 3 32  ? -2.973  20.128  45.931  1.00 29.95  ? 32  TYR F CG  1 
ATOM 7710  C CD1 . TYR F 3 32  ? -3.731  19.600  46.976  1.00 28.76  ? 32  TYR F CD1 1 
ATOM 7711  C CD2 . TYR F 3 32  ? -1.582  20.078  46.028  1.00 26.25  ? 32  TYR F CD2 1 
ATOM 7712  C CE1 . TYR F 3 32  ? -3.124  19.045  48.083  1.00 25.22  ? 32  TYR F CE1 1 
ATOM 7713  C CE2 . TYR F 3 32  ? -0.963  19.527  47.137  1.00 21.79  ? 32  TYR F CE2 1 
ATOM 7714  C CZ  . TYR F 3 32  ? -1.738  19.013  48.157  1.00 25.53  ? 32  TYR F CZ  1 
ATOM 7715  O OH  . TYR F 3 32  ? -1.136  18.464  49.262  1.00 31.01  ? 32  TYR F OH  1 
ATOM 7716  N N   . TRP F 3 33  ? -6.276  20.115  43.176  1.00 33.24  ? 33  TRP F N   1 
ATOM 7717  C CA  . TRP F 3 33  ? -7.437  20.676  42.501  1.00 33.56  ? 33  TRP F CA  1 
ATOM 7718  C C   . TRP F 3 33  ? -7.529  22.174  42.772  1.00 36.28  ? 33  TRP F C   1 
ATOM 7719  O O   . TRP F 3 33  ? -6.891  22.690  43.697  1.00 40.13  ? 33  TRP F O   1 
ATOM 7720  C CB  . TRP F 3 33  ? -8.716  20.085  43.061  1.00 37.39  ? 33  TRP F CB  1 
ATOM 7721  C CG  . TRP F 3 33  ? -9.116  18.817  42.486  1.00 42.32  ? 33  TRP F CG  1 
ATOM 7722  C CD1 . TRP F 3 33  ? -8.887  17.576  42.996  1.00 41.83  ? 33  TRP F CD1 1 
ATOM 7723  C CD2 . TRP F 3 33  ? -9.882  18.633  41.294  1.00 47.53  ? 33  TRP F CD2 1 
ATOM 7724  N NE1 . TRP F 3 33  ? -9.473  16.622  42.196  1.00 43.29  ? 33  TRP F NE1 1 
ATOM 7725  C CE2 . TRP F 3 33  ? -10.091 17.246  41.144  1.00 47.00  ? 33  TRP F CE2 1 
ATOM 7726  C CE3 . TRP F 3 33  ? -10.416 19.506  40.340  1.00 45.75  ? 33  TRP F CE3 1 
ATOM 7727  C CZ2 . TRP F 3 33  ? -10.813 16.715  40.083  1.00 46.90  ? 33  TRP F CZ2 1 
ATOM 7728  C CZ3 . TRP F 3 33  ? -11.131 18.976  39.290  1.00 46.24  ? 33  TRP F CZ3 1 
ATOM 7729  C CH2 . TRP F 3 33  ? -11.325 17.593  39.169  1.00 49.46  ? 33  TRP F CH2 1 
ATOM 7730  N N   . ILE F 3 34  ? -8.351  22.852  41.968  1.00 31.55  ? 34  ILE F N   1 
ATOM 7731  C CA  . ILE F 3 34  ? -8.631  24.282  42.119  1.00 25.98  ? 34  ILE F CA  1 
ATOM 7732  C C   . ILE F 3 34  ? -10.142 24.407  42.007  1.00 29.14  ? 34  ILE F C   1 
ATOM 7733  O O   . ILE F 3 34  ? -10.728 24.089  40.973  1.00 31.95  ? 34  ILE F O   1 
ATOM 7734  C CB  . ILE F 3 34  ? -7.991  25.146  41.025  1.00 17.45  ? 34  ILE F CB  1 
ATOM 7735  C CG1 . ILE F 3 34  ? -6.475  25.132  41.167  1.00 21.72  ? 34  ILE F CG1 1 
ATOM 7736  C CG2 . ILE F 3 34  ? -8.485  26.571  41.134  1.00 13.67  ? 34  ILE F CG2 1 
ATOM 7737  C CD1 . ILE F 3 34  ? -5.952  25.669  42.488  1.00 23.80  ? 34  ILE F CD1 1 
ATOM 7738  N N   . ASN F 3 35  ? -10.781 24.848  43.078  1.00 29.07  ? 35  ASN F N   1 
ATOM 7739  C CA  . ASN F 3 35  ? -12.218 24.976  43.057  1.00 28.84  ? 35  ASN F CA  1 
ATOM 7740  C C   . ASN F 3 35  ? -12.605 26.408  43.021  1.00 33.26  ? 35  ASN F C   1 
ATOM 7741  O O   . ASN F 3 35  ? -12.176 27.195  43.862  1.00 38.01  ? 35  ASN F O   1 
ATOM 7742  C CB  . ASN F 3 35  ? -12.822 24.314  44.272  1.00 28.86  ? 35  ASN F CB  1 
ATOM 7743  C CG  . ASN F 3 35  ? -12.884 22.823  44.125  1.00 34.67  ? 35  ASN F CG  1 
ATOM 7744  O OD1 . ASN F 3 35  ? -13.937 22.262  43.777  1.00 33.91  ? 35  ASN F OD1 1 
ATOM 7745  N ND2 . ASN F 3 35  ? -11.744 22.157  44.360  1.00 40.68  ? 35  ASN F ND2 1 
ATOM 7746  N N   . TRP F 3 36  ? -13.430 26.748  42.043  1.00 33.50  ? 36  TRP F N   1 
ATOM 7747  C CA  . TRP F 3 36  ? -13.870 28.111  41.893  1.00 31.77  ? 36  TRP F CA  1 
ATOM 7748  C C   . TRP F 3 36  ? -15.262 28.302  42.447  1.00 32.67  ? 36  TRP F C   1 
ATOM 7749  O O   . TRP F 3 36  ? -16.191 27.585  42.087  1.00 32.70  ? 36  TRP F O   1 
ATOM 7750  C CB  . TRP F 3 36  ? -13.837 28.525  40.421  1.00 31.41  ? 36  TRP F CB  1 
ATOM 7751  C CG  . TRP F 3 36  ? -12.438 28.599  39.835  1.00 30.88  ? 36  TRP F CG  1 
ATOM 7752  C CD1 . TRP F 3 36  ? -11.663 27.546  39.443  1.00 31.54  ? 36  TRP F CD1 1 
ATOM 7753  C CD2 . TRP F 3 36  ? -11.658 29.788  39.572  1.00 28.86  ? 36  TRP F CD2 1 
ATOM 7754  N NE1 . TRP F 3 36  ? -10.454 27.997  38.949  1.00 32.63  ? 36  TRP F NE1 1 
ATOM 7755  C CE2 . TRP F 3 36  ? -10.422 29.366  39.017  1.00 29.50  ? 36  TRP F CE2 1 
ATOM 7756  C CE3 . TRP F 3 36  ? -11.882 31.160  39.750  1.00 25.15  ? 36  TRP F CE3 1 
ATOM 7757  C CZ2 . TRP F 3 36  ? -9.409  30.272  38.633  1.00 26.61  ? 36  TRP F CZ2 1 
ATOM 7758  C CZ3 . TRP F 3 36  ? -10.872 32.061  39.367  1.00 29.73  ? 36  TRP F CZ3 1 
ATOM 7759  C CH2 . TRP F 3 36  ? -9.652  31.607  38.815  1.00 23.09  ? 36  TRP F CH2 1 
ATOM 7760  N N   . VAL F 3 37  ? -15.392 29.262  43.353  1.00 29.89  ? 37  VAL F N   1 
ATOM 7761  C CA  . VAL F 3 37  ? -16.683 29.571  43.914  1.00 28.04  ? 37  VAL F CA  1 
ATOM 7762  C C   . VAL F 3 37  ? -16.926 31.059  43.706  1.00 30.23  ? 37  VAL F C   1 
ATOM 7763  O O   . VAL F 3 37  ? -16.024 31.891  43.868  1.00 29.39  ? 37  VAL F O   1 
ATOM 7764  C CB  . VAL F 3 37  ? -16.762 29.191  45.401  1.00 26.69  ? 37  VAL F CB  1 
ATOM 7765  C CG1 . VAL F 3 37  ? -15.500 29.555  46.087  1.00 30.73  ? 37  VAL F CG1 1 
ATOM 7766  C CG2 . VAL F 3 37  ? -17.928 29.891  46.048  1.00 25.91  ? 37  VAL F CG2 1 
ATOM 7767  N N   . LYS F 3 38  ? -18.150 31.369  43.298  1.00 32.82  ? 38  LYS F N   1 
ATOM 7768  C CA  . LYS F 3 38  ? -18.584 32.731  43.022  1.00 36.70  ? 38  LYS F CA  1 
ATOM 7769  C C   . LYS F 3 38  ? -19.561 33.195  44.092  1.00 38.96  ? 38  LYS F C   1 
ATOM 7770  O O   . LYS F 3 38  ? -20.361 32.409  44.597  1.00 40.52  ? 38  LYS F O   1 
ATOM 7771  C CB  . LYS F 3 38  ? -19.248 32.790  41.636  1.00 37.53  ? 38  LYS F CB  1 
ATOM 7772  C CG  . LYS F 3 38  ? -20.484 33.683  41.543  1.00 39.47  ? 38  LYS F CG  1 
ATOM 7773  C CD  . LYS F 3 38  ? -20.929 33.901  40.093  1.00 33.92  ? 38  LYS F CD  1 
ATOM 7774  C CE  . LYS F 3 38  ? -22.326 34.524  40.024  1.00 28.67  ? 38  LYS F CE  1 
ATOM 7775  N NZ  . LYS F 3 38  ? -22.778 34.712  38.615  1.00 33.47  ? 38  LYS F NZ  1 
ATOM 7776  N N   . GLN F 3 39  ? -19.502 34.475  44.433  1.00 42.69  ? 39  GLN F N   1 
ATOM 7777  C CA  . GLN F 3 39  ? -20.387 35.013  45.456  1.00 46.37  ? 39  GLN F CA  1 
ATOM 7778  C C   . GLN F 3 39  ? -20.790 36.447  45.151  1.00 51.17  ? 39  GLN F C   1 
ATOM 7779  O O   . GLN F 3 39  ? -19.943 37.321  44.922  1.00 47.90  ? 39  GLN F O   1 
ATOM 7780  C CB  . GLN F 3 39  ? -19.705 34.938  46.823  1.00 43.47  ? 39  GLN F CB  1 
ATOM 7781  C CG  . GLN F 3 39  ? -20.441 35.656  47.931  1.00 35.03  ? 39  GLN F CG  1 
ATOM 7782  C CD  . GLN F 3 39  ? -19.729 35.546  49.278  1.00 30.90  ? 39  GLN F CD  1 
ATOM 7783  O OE1 . GLN F 3 39  ? -18.506 35.738  49.381  1.00 30.86  ? 39  GLN F OE1 1 
ATOM 7784  N NE2 . GLN F 3 39  ? -20.499 35.250  50.320  1.00 21.54  ? 39  GLN F NE2 1 
ATOM 7785  N N   . ARG F 3 40  ? -22.098 36.674  45.142  1.00 58.68  ? 40  ARG F N   1 
ATOM 7786  C CA  . ARG F 3 40  ? -22.632 37.994  44.860  1.00 68.55  ? 40  ARG F CA  1 
ATOM 7787  C C   . ARG F 3 40  ? -22.845 38.743  46.160  1.00 73.56  ? 40  ARG F C   1 
ATOM 7788  O O   . ARG F 3 40  ? -23.101 38.126  47.189  1.00 73.06  ? 40  ARG F O   1 
ATOM 7789  C CB  . ARG F 3 40  ? -23.938 37.876  44.061  1.00 68.44  ? 40  ARG F CB  1 
ATOM 7790  C CG  . ARG F 3 40  ? -23.718 38.041  42.549  1.00 70.51  ? 40  ARG F CG  1 
ATOM 7791  C CD  . ARG F 3 40  ? -24.793 37.373  41.727  1.00 69.36  ? 40  ARG F CD  1 
ATOM 7792  N NE  . ARG F 3 40  ? -26.110 37.640  42.274  1.00 76.40  ? 40  ARG F NE  1 
ATOM 7793  C CZ  . ARG F 3 40  ? -27.231 37.114  41.796  1.00 81.66  ? 40  ARG F CZ  1 
ATOM 7794  N NH1 . ARG F 3 40  ? -27.180 36.292  40.752  1.00 80.51  ? 40  ARG F NH1 1 
ATOM 7795  N NH2 . ARG F 3 40  ? -28.401 37.401  42.368  1.00 85.12  ? 40  ARG F NH2 1 
ATOM 7796  N N   . PRO F 3 41  ? -22.720 40.089  46.131  1.00 79.46  ? 41  PRO F N   1 
ATOM 7797  C CA  . PRO F 3 41  ? -22.895 40.943  47.315  1.00 80.00  ? 41  PRO F CA  1 
ATOM 7798  C C   . PRO F 3 41  ? -23.986 40.447  48.265  1.00 80.17  ? 41  PRO F C   1 
ATOM 7799  O O   . PRO F 3 41  ? -25.165 40.361  47.888  1.00 75.24  ? 41  PRO F O   1 
ATOM 7800  C CB  . PRO F 3 41  ? -23.214 42.302  46.702  1.00 81.98  ? 41  PRO F CB  1 
ATOM 7801  C CG  . PRO F 3 41  ? -22.327 42.311  45.484  1.00 80.44  ? 41  PRO F CG  1 
ATOM 7802  C CD  . PRO F 3 41  ? -22.542 40.916  44.916  1.00 79.03  ? 41  PRO F CD  1 
ATOM 7803  N N   . GLY F 3 42  ? -23.578 40.113  49.492  1.00 81.01  ? 42  GLY F N   1 
ATOM 7804  C CA  . GLY F 3 42  ? -24.516 39.619  50.489  1.00 82.96  ? 42  GLY F CA  1 
ATOM 7805  C C   . GLY F 3 42  ? -25.367 38.491  49.938  1.00 83.95  ? 42  GLY F C   1 
ATOM 7806  O O   . GLY F 3 42  ? -26.591 38.597  49.839  1.00 85.90  ? 42  GLY F O   1 
ATOM 7807  N N   . GLN F 3 43  ? -24.709 37.399  49.574  1.00 83.08  ? 43  GLN F N   1 
ATOM 7808  C CA  . GLN F 3 43  ? -25.397 36.252  49.005  1.00 79.88  ? 43  GLN F CA  1 
ATOM 7809  C C   . GLN F 3 43  ? -24.646 34.986  49.385  1.00 76.42  ? 43  GLN F C   1 
ATOM 7810  O O   . GLN F 3 43  ? -23.491 35.039  49.824  1.00 72.44  ? 43  GLN F O   1 
ATOM 7811  C CB  . GLN F 3 43  ? -25.441 36.376  47.475  1.00 84.04  ? 43  GLN F CB  1 
ATOM 7812  C CG  . GLN F 3 43  ? -26.192 37.598  46.953  1.00 86.22  ? 43  GLN F CG  1 
ATOM 7813  C CD  . GLN F 3 43  ? -27.681 37.352  46.840  1.00 88.17  ? 43  GLN F CD  1 
ATOM 7814  O OE1 . GLN F 3 43  ? -28.146 36.692  45.905  1.00 89.33  ? 43  GLN F OE1 1 
ATOM 7815  N NE2 . GLN F 3 43  ? -28.439 37.869  47.799  1.00 90.46  ? 43  GLN F NE2 1 
ATOM 7816  N N   . GLY F 3 44  ? -25.315 33.851  49.212  1.00 72.91  ? 44  GLY F N   1 
ATOM 7817  C CA  . GLY F 3 44  ? -24.693 32.580  49.517  1.00 66.84  ? 44  GLY F CA  1 
ATOM 7818  C C   . GLY F 3 44  ? -23.598 32.308  48.504  1.00 62.16  ? 44  GLY F C   1 
ATOM 7819  O O   . GLY F 3 44  ? -23.474 32.996  47.478  1.00 61.46  ? 44  GLY F O   1 
ATOM 7820  N N   . LEU F 3 45  ? -22.794 31.299  48.797  1.00 56.65  ? 45  LEU F N   1 
ATOM 7821  C CA  . LEU F 3 45  ? -21.702 30.924  47.921  1.00 49.38  ? 45  LEU F CA  1 
ATOM 7822  C C   . LEU F 3 45  ? -22.243 30.019  46.819  1.00 46.33  ? 45  LEU F C   1 
ATOM 7823  O O   . LEU F 3 45  ? -23.321 29.446  46.944  1.00 41.27  ? 45  LEU F O   1 
ATOM 7824  C CB  . LEU F 3 45  ? -20.645 30.190  48.736  1.00 45.07  ? 45  LEU F CB  1 
ATOM 7825  C CG  . LEU F 3 45  ? -20.213 30.958  49.981  1.00 35.42  ? 45  LEU F CG  1 
ATOM 7826  C CD1 . LEU F 3 45  ? -19.385 30.085  50.898  1.00 36.93  ? 45  LEU F CD1 1 
ATOM 7827  C CD2 . LEU F 3 45  ? -19.426 32.146  49.550  1.00 30.17  ? 45  LEU F CD2 1 
ATOM 7828  N N   . GLU F 3 46  ? -21.495 29.892  45.737  1.00 43.71  ? 46  GLU F N   1 
ATOM 7829  C CA  . GLU F 3 46  ? -21.928 29.056  44.642  1.00 43.55  ? 46  GLU F CA  1 
ATOM 7830  C C   . GLU F 3 46  ? -20.760 28.308  44.055  1.00 43.10  ? 46  GLU F C   1 
ATOM 7831  O O   . GLU F 3 46  ? -19.845 28.931  43.523  1.00 47.15  ? 46  GLU F O   1 
ATOM 7832  C CB  . GLU F 3 46  ? -22.551 29.905  43.549  1.00 48.00  ? 46  GLU F CB  1 
ATOM 7833  C CG  . GLU F 3 46  ? -23.950 30.380  43.844  1.00 60.32  ? 46  GLU F CG  1 
ATOM 7834  C CD  . GLU F 3 46  ? -24.661 30.895  42.597  1.00 68.98  ? 46  GLU F CD  1 
ATOM 7835  O OE1 . GLU F 3 46  ? -25.844 31.285  42.702  1.00 73.82  ? 46  GLU F OE1 1 
ATOM 7836  O OE2 . GLU F 3 46  ? -24.042 30.909  41.506  1.00 77.94  ? 46  GLU F OE2 1 
ATOM 7837  N N   . TRP F 3 47  ? -20.775 26.978  44.133  1.00 40.16  ? 47  TRP F N   1 
ATOM 7838  C CA  . TRP F 3 47  ? -19.665 26.226  43.558  1.00 34.60  ? 47  TRP F CA  1 
ATOM 7839  C C   . TRP F 3 47  ? -19.732 26.407  42.051  1.00 26.78  ? 47  TRP F C   1 
ATOM 7840  O O   . TRP F 3 47  ? -20.760 26.173  41.431  1.00 25.07  ? 47  TRP F O   1 
ATOM 7841  C CB  . TRP F 3 47  ? -19.748 24.737  43.907  1.00 34.13  ? 47  TRP F CB  1 
ATOM 7842  C CG  . TRP F 3 47  ? -18.537 23.983  43.446  1.00 32.67  ? 47  TRP F CG  1 
ATOM 7843  C CD1 . TRP F 3 47  ? -17.250 24.130  43.891  1.00 34.97  ? 47  TRP F CD1 1 
ATOM 7844  C CD2 . TRP F 3 47  ? -18.492 22.996  42.424  1.00 34.42  ? 47  TRP F CD2 1 
ATOM 7845  N NE1 . TRP F 3 47  ? -16.407 23.291  43.204  1.00 31.26  ? 47  TRP F NE1 1 
ATOM 7846  C CE2 . TRP F 3 47  ? -17.143 22.584  42.294  1.00 33.08  ? 47  TRP F CE2 1 
ATOM 7847  C CE3 . TRP F 3 47  ? -19.463 22.414  41.594  1.00 35.86  ? 47  TRP F CE3 1 
ATOM 7848  C CZ2 . TRP F 3 47  ? -16.743 21.619  41.373  1.00 34.74  ? 47  TRP F CZ2 1 
ATOM 7849  C CZ3 . TRP F 3 47  ? -19.067 21.454  40.680  1.00 32.68  ? 47  TRP F CZ3 1 
ATOM 7850  C CH2 . TRP F 3 47  ? -17.716 21.066  40.574  1.00 34.43  ? 47  TRP F CH2 1 
ATOM 7851  N N   . VAL F 3 48  ? -18.642 26.850  41.463  1.00 20.30  ? 48  VAL F N   1 
ATOM 7852  C CA  . VAL F 3 48  ? -18.635 27.051  40.030  1.00 18.31  ? 48  VAL F CA  1 
ATOM 7853  C C   . VAL F 3 48  ? -18.239 25.766  39.314  1.00 25.46  ? 48  VAL F C   1 
ATOM 7854  O O   . VAL F 3 48  ? -18.959 25.287  38.450  1.00 32.28  ? 48  VAL F O   1 
ATOM 7855  C CB  . VAL F 3 48  ? -17.671 28.180  39.637  1.00 14.26  ? 48  VAL F CB  1 
ATOM 7856  C CG1 . VAL F 3 48  ? -17.560 28.268  38.147  1.00 13.92  ? 48  VAL F CG1 1 
ATOM 7857  C CG2 . VAL F 3 48  ? -18.178 29.500  40.187  1.00 16.16  ? 48  VAL F CG2 1 
ATOM 7858  N N   . GLY F 3 49  ? -17.099 25.201  39.686  1.00 30.91  ? 49  GLY F N   1 
ATOM 7859  C CA  . GLY F 3 49  ? -16.632 23.983  39.058  1.00 30.83  ? 49  GLY F CA  1 
ATOM 7860  C C   . GLY F 3 49  ? -15.211 23.800  39.520  1.00 31.77  ? 49  GLY F C   1 
ATOM 7861  O O   . GLY F 3 49  ? -14.676 24.673  40.192  1.00 33.67  ? 49  GLY F O   1 
ATOM 7862  N N   . ASN F 3 50  ? -14.588 22.682  39.179  1.00 32.29  ? 50  ASN F N   1 
ATOM 7863  C CA  . ASN F 3 50  ? -13.216 22.449  39.608  1.00 32.59  ? 50  ASN F CA  1 
ATOM 7864  C C   . ASN F 3 50  ? -12.358 22.015  38.445  1.00 31.23  ? 50  ASN F C   1 
ATOM 7865  O O   . ASN F 3 50  ? -12.857 21.714  37.362  1.00 31.16  ? 50  ASN F O   1 
ATOM 7866  C CB  . ASN F 3 50  ? -13.165 21.379  40.691  1.00 33.47  ? 50  ASN F CB  1 
ATOM 7867  C CG  . ASN F 3 50  ? -13.731 20.052  40.223  1.00 34.61  ? 50  ASN F CG  1 
ATOM 7868  O OD1 . ASN F 3 50  ? -13.602 19.030  40.900  1.00 34.96  ? 50  ASN F OD1 1 
ATOM 7869  N ND2 . ASN F 3 50  ? -14.365 20.063  39.060  1.00 36.94  ? 50  ASN F ND2 1 
ATOM 7870  N N   . ILE F 3 51  ? -11.057 21.984  38.665  1.00 26.17  ? 51  ILE F N   1 
ATOM 7871  C CA  . ILE F 3 51  ? -10.175 21.580  37.599  1.00 31.23  ? 51  ILE F CA  1 
ATOM 7872  C C   . ILE F 3 51  ? -8.873  21.143  38.206  1.00 33.84  ? 51  ILE F C   1 
ATOM 7873  O O   . ILE F 3 51  ? -8.274  21.859  38.994  1.00 34.91  ? 51  ILE F O   1 
ATOM 7874  C CB  . ILE F 3 51  ? -9.926  22.726  36.576  1.00 31.53  ? 51  ILE F CB  1 
ATOM 7875  C CG1 . ILE F 3 51  ? -8.956  22.273  35.479  1.00 26.10  ? 51  ILE F CG1 1 
ATOM 7876  C CG2 . ILE F 3 51  ? -9.334  23.930  37.275  1.00 38.40  ? 51  ILE F CG2 1 
ATOM 7877  C CD1 . ILE F 3 51  ? -9.001  23.138  34.224  1.00 12.88  ? 51  ILE F CD1 1 
ATOM 7878  N N   . PHE F 3 52  ? -8.470  19.930  37.862  1.00 34.99  ? 52  PHE F N   1 
ATOM 7879  C CA  . PHE F 3 52  ? -7.231  19.386  38.353  1.00 32.89  ? 52  PHE F CA  1 
ATOM 7880  C C   . PHE F 3 52  ? -6.238  19.748  37.286  1.00 32.51  ? 52  PHE F C   1 
ATOM 7881  O O   . PHE F 3 52  ? -6.465  19.447  36.124  1.00 33.53  ? 52  PHE F O   1 
ATOM 7882  C CB  . PHE F 3 52  ? -7.314  17.860  38.457  1.00 30.89  ? 52  PHE F CB  1 
ATOM 7883  C CG  . PHE F 3 52  ? -6.245  17.271  39.304  1.00 28.43  ? 52  PHE F CG  1 
ATOM 7884  C CD1 . PHE F 3 52  ? -6.368  17.284  40.690  1.00 34.40  ? 52  PHE F CD1 1 
ATOM 7885  C CD2 . PHE F 3 52  ? -5.076  16.800  38.743  1.00 28.85  ? 52  PHE F CD2 1 
ATOM 7886  C CE1 . PHE F 3 52  ? -5.334  16.845  41.513  1.00 34.72  ? 52  PHE F CE1 1 
ATOM 7887  C CE2 . PHE F 3 52  ? -4.023  16.355  39.553  1.00 34.34  ? 52  PHE F CE2 1 
ATOM 7888  C CZ  . PHE F 3 52  ? -4.155  16.381  40.944  1.00 34.87  ? 52  PHE F CZ  1 
ATOM 7889  N N   . PRO F 3 53  ? -5.149  20.440  37.640  1.00 35.97  ? 53  PRO F N   1 
ATOM 7890  C CA  . PRO F 3 53  ? -4.175  20.776  36.592  1.00 38.54  ? 53  PRO F CA  1 
ATOM 7891  C C   . PRO F 3 53  ? -3.556  19.457  36.134  1.00 40.99  ? 53  PRO F C   1 
ATOM 7892  O O   . PRO F 3 53  ? -4.160  18.413  36.330  1.00 48.08  ? 53  PRO F O   1 
ATOM 7893  C CB  . PRO F 3 53  ? -3.187  21.693  37.320  1.00 40.01  ? 53  PRO F CB  1 
ATOM 7894  C CG  . PRO F 3 53  ? -3.282  21.252  38.755  1.00 35.98  ? 53  PRO F CG  1 
ATOM 7895  C CD  . PRO F 3 53  ? -4.772  21.043  38.929  1.00 34.60  ? 53  PRO F CD  1 
ATOM 7896  N N   . SER F 3 54  ? -2.368  19.472  35.546  1.00 42.11  ? 54  SER F N   1 
ATOM 7897  C CA  . SER F 3 54  ? -1.737  18.214  35.095  1.00 41.13  ? 54  SER F CA  1 
ATOM 7898  C C   . SER F 3 54  ? -2.483  17.601  33.901  1.00 42.60  ? 54  SER F C   1 
ATOM 7899  O O   . SER F 3 54  ? -1.979  17.625  32.779  1.00 47.47  ? 54  SER F O   1 
ATOM 7900  C CB  . SER F 3 54  ? -1.638  17.176  36.246  1.00 35.14  ? 54  SER F CB  1 
ATOM 7901  O OG  . SER F 3 54  ? -2.682  16.208  36.223  1.00 19.74  ? 54  SER F OG  1 
ATOM 7902  N N   . ASP F 3 55  ? -3.677  17.062  34.122  1.00 41.69  ? 55  ASP F N   1 
ATOM 7903  C CA  . ASP F 3 55  ? -4.421  16.472  33.020  1.00 41.08  ? 55  ASP F CA  1 
ATOM 7904  C C   . ASP F 3 55  ? -5.643  17.328  32.716  1.00 39.47  ? 55  ASP F C   1 
ATOM 7905  O O   . ASP F 3 55  ? -6.526  16.944  31.949  1.00 41.39  ? 55  ASP F O   1 
ATOM 7906  C CB  . ASP F 3 55  ? -4.836  15.039  33.372  1.00 42.38  ? 55  ASP F CB  1 
ATOM 7907  C CG  . ASP F 3 55  ? -6.156  14.982  34.086  1.00 44.11  ? 55  ASP F CG  1 
ATOM 7908  O OD1 . ASP F 3 55  ? -6.331  15.733  35.063  1.00 48.95  ? 55  ASP F OD1 1 
ATOM 7909  O OD2 . ASP F 3 55  ? -7.022  14.188  33.670  1.00 49.44  ? 55  ASP F OD2 1 
ATOM 7910  N N   . SER F 3 56  ? -5.674  18.504  33.323  1.00 35.72  ? 56  SER F N   1 
ATOM 7911  C CA  . SER F 3 56  ? -6.774  19.449  33.148  1.00 33.98  ? 56  SER F CA  1 
ATOM 7912  C C   . SER F 3 56  ? -8.195  18.865  33.188  1.00 30.37  ? 56  SER F C   1 
ATOM 7913  O O   . SER F 3 56  ? -9.085  19.326  32.477  1.00 31.17  ? 56  SER F O   1 
ATOM 7914  C CB  . SER F 3 56  ? -6.562  20.255  31.864  1.00 28.10  ? 56  SER F CB  1 
ATOM 7915  O OG  . SER F 3 56  ? -5.311  20.924  31.925  1.00 30.80  ? 56  SER F OG  1 
ATOM 7916  N N   . TYR F 3 57  ? -8.399  17.860  34.035  1.00 28.57  ? 57  TYR F N   1 
ATOM 7917  C CA  . TYR F 3 57  ? -9.720  17.238  34.198  1.00 33.80  ? 57  TYR F CA  1 
ATOM 7918  C C   . TYR F 3 57  ? -10.633 18.286  34.867  1.00 33.45  ? 57  TYR F C   1 
ATOM 7919  O O   . TYR F 3 57  ? -10.188 19.023  35.748  1.00 37.56  ? 57  TYR F O   1 
ATOM 7920  C CB  . TYR F 3 57  ? -9.601  15.954  35.064  1.00 33.81  ? 57  TYR F CB  1 
ATOM 7921  C CG  . TYR F 3 57  ? -10.892 15.153  35.220  1.00 35.58  ? 57  TYR F CG  1 
ATOM 7922  C CD1 . TYR F 3 57  ? -10.958 13.809  34.857  1.00 33.74  ? 57  TYR F CD1 1 
ATOM 7923  C CD2 . TYR F 3 57  ? -12.048 15.744  35.722  1.00 38.31  ? 57  TYR F CD2 1 
ATOM 7924  C CE1 . TYR F 3 57  ? -12.152 13.074  34.990  1.00 32.81  ? 57  TYR F CE1 1 
ATOM 7925  C CE2 . TYR F 3 57  ? -13.244 15.018  35.862  1.00 41.32  ? 57  TYR F CE2 1 
ATOM 7926  C CZ  . TYR F 3 57  ? -13.294 13.687  35.494  1.00 34.86  ? 57  TYR F CZ  1 
ATOM 7927  O OH  . TYR F 3 57  ? -14.488 12.997  35.629  1.00 25.73  ? 57  TYR F OH  1 
ATOM 7928  N N   . THR F 3 58  ? -11.899 18.358  34.466  1.00 30.69  ? 58  THR F N   1 
ATOM 7929  C CA  . THR F 3 58  ? -12.778 19.373  35.046  1.00 31.44  ? 58  THR F CA  1 
ATOM 7930  C C   . THR F 3 58  ? -14.216 18.929  35.273  1.00 33.31  ? 58  THR F C   1 
ATOM 7931  O O   . THR F 3 58  ? -14.705 18.033  34.597  1.00 40.68  ? 58  THR F O   1 
ATOM 7932  C CB  . THR F 3 58  ? -12.867 20.605  34.132  1.00 29.41  ? 58  THR F CB  1 
ATOM 7933  O OG1 . THR F 3 58  ? -13.952 20.426  33.216  1.00 25.37  ? 58  THR F OG1 1 
ATOM 7934  C CG2 . THR F 3 58  ? -11.588 20.778  33.330  1.00 28.73  ? 58  THR F CG2 1 
ATOM 7935  N N   . ASN F 3 59  ? -14.892 19.589  36.208  1.00 32.70  ? 59  ASN F N   1 
ATOM 7936  C CA  . ASN F 3 59  ? -16.287 19.314  36.517  1.00 34.14  ? 59  ASN F CA  1 
ATOM 7937  C C   . ASN F 3 59  ? -16.948 20.669  36.635  1.00 37.45  ? 59  ASN F C   1 
ATOM 7938  O O   . ASN F 3 59  ? -16.447 21.525  37.355  1.00 40.64  ? 59  ASN F O   1 
ATOM 7939  C CB  . ASN F 3 59  ? -16.443 18.589  37.857  1.00 36.64  ? 59  ASN F CB  1 
ATOM 7940  C CG  . ASN F 3 59  ? -15.986 17.146  37.811  1.00 39.38  ? 59  ASN F CG  1 
ATOM 7941  O OD1 . ASN F 3 59  ? -14.844 16.820  38.161  1.00 45.23  ? 59  ASN F OD1 1 
ATOM 7942  N ND2 . ASN F 3 59  ? -16.883 16.264  37.385  1.00 43.58  ? 59  ASN F ND2 1 
ATOM 7943  N N   . TYR F 3 60  ? -18.063 20.876  35.947  1.00 39.47  ? 60  TYR F N   1 
ATOM 7944  C CA  . TYR F 3 60  ? -18.747 22.163  36.019  1.00 41.46  ? 60  TYR F CA  1 
ATOM 7945  C C   . TYR F 3 60  ? -20.093 22.046  36.696  1.00 45.64  ? 60  TYR F C   1 
ATOM 7946  O O   . TYR F 3 60  ? -20.794 21.050  36.534  1.00 47.93  ? 60  TYR F O   1 
ATOM 7947  C CB  . TYR F 3 60  ? -18.987 22.757  34.621  1.00 36.16  ? 60  TYR F CB  1 
ATOM 7948  C CG  . TYR F 3 60  ? -17.752 23.243  33.886  1.00 33.91  ? 60  TYR F CG  1 
ATOM 7949  C CD1 . TYR F 3 60  ? -17.629 24.579  33.491  1.00 33.20  ? 60  TYR F CD1 1 
ATOM 7950  C CD2 . TYR F 3 60  ? -16.710 22.370  33.573  1.00 33.49  ? 60  TYR F CD2 1 
ATOM 7951  C CE1 . TYR F 3 60  ? -16.491 25.037  32.801  1.00 33.85  ? 60  TYR F CE1 1 
ATOM 7952  C CE2 . TYR F 3 60  ? -15.571 22.815  32.884  1.00 34.43  ? 60  TYR F CE2 1 
ATOM 7953  C CZ  . TYR F 3 60  ? -15.464 24.148  32.502  1.00 35.52  ? 60  TYR F CZ  1 
ATOM 7954  O OH  . TYR F 3 60  ? -14.318 24.579  31.849  1.00 38.25  ? 60  TYR F OH  1 
ATOM 7955  N N   . ASN F 3 61  ? -20.445 23.068  37.468  1.00 49.89  ? 61  ASN F N   1 
ATOM 7956  C CA  . ASN F 3 61  ? -21.746 23.116  38.113  1.00 49.31  ? 61  ASN F CA  1 
ATOM 7957  C C   . ASN F 3 61  ? -22.612 23.370  36.896  1.00 51.37  ? 61  ASN F C   1 
ATOM 7958  O O   . ASN F 3 61  ? -22.184 24.047  35.970  1.00 51.27  ? 61  ASN F O   1 
ATOM 7959  C CB  . ASN F 3 61  ? -21.831 24.307  39.063  1.00 48.57  ? 61  ASN F CB  1 
ATOM 7960  C CG  . ASN F 3 61  ? -23.223 24.509  39.612  1.00 48.38  ? 61  ASN F CG  1 
ATOM 7961  O OD1 . ASN F 3 61  ? -24.203 24.387  38.878  1.00 48.65  ? 61  ASN F OD1 1 
ATOM 7962  N ND2 . ASN F 3 61  ? -23.323 24.828  40.907  1.00 44.30  ? 61  ASN F ND2 1 
ATOM 7963  N N   . GLN F 3 62  ? -23.818 22.836  36.871  1.00 56.22  ? 62  GLN F N   1 
ATOM 7964  C CA  . GLN F 3 62  ? -24.658 23.036  35.702  1.00 59.65  ? 62  GLN F CA  1 
ATOM 7965  C C   . GLN F 3 62  ? -24.849 24.504  35.316  1.00 56.53  ? 62  GLN F C   1 
ATOM 7966  O O   . GLN F 3 62  ? -24.586 24.891  34.174  1.00 57.64  ? 62  GLN F O   1 
ATOM 7967  C CB  . GLN F 3 62  ? -26.018 22.370  35.919  1.00 68.19  ? 62  GLN F CB  1 
ATOM 7968  C CG  . GLN F 3 62  ? -26.699 21.996  34.617  1.00 81.84  ? 62  GLN F CG  1 
ATOM 7969  C CD  . GLN F 3 62  ? -25.759 21.232  33.683  1.00 90.19  ? 62  GLN F CD  1 
ATOM 7970  O OE1 . GLN F 3 62  ? -25.307 20.127  34.001  1.00 94.67  ? 62  GLN F OE1 1 
ATOM 7971  N NE2 . GLN F 3 62  ? -25.454 21.826  32.528  1.00 92.51  ? 62  GLN F NE2 1 
ATOM 7972  N N   . LYS F 3 63  ? -25.301 25.311  36.275  1.00 54.36  ? 63  LYS F N   1 
ATOM 7973  C CA  . LYS F 3 63  ? -25.562 26.739  36.067  1.00 51.99  ? 63  LYS F CA  1 
ATOM 7974  C C   . LYS F 3 63  ? -24.553 27.472  35.207  1.00 48.11  ? 63  LYS F C   1 
ATOM 7975  O O   . LYS F 3 63  ? -24.900 28.450  34.552  1.00 47.50  ? 63  LYS F O   1 
ATOM 7976  C CB  . LYS F 3 63  ? -25.664 27.472  37.412  1.00 55.98  ? 63  LYS F CB  1 
ATOM 7977  C CG  . LYS F 3 63  ? -27.076 27.581  38.015  1.00 64.57  ? 63  LYS F CG  1 
ATOM 7978  C CD  . LYS F 3 63  ? -27.732 26.209  38.275  1.00 71.64  ? 63  LYS F CD  1 
ATOM 7979  C CE  . LYS F 3 63  ? -27.008 25.390  39.359  1.00 74.99  ? 63  LYS F CE  1 
ATOM 7980  N NZ  . LYS F 3 63  ? -27.512 23.978  39.488  1.00 71.49  ? 63  LYS F NZ  1 
ATOM 7981  N N   . PHE F 3 64  ? -23.313 27.004  35.194  1.00 48.29  ? 64  PHE F N   1 
ATOM 7982  C CA  . PHE F 3 64  ? -22.269 27.679  34.432  1.00 52.62  ? 64  PHE F CA  1 
ATOM 7983  C C   . PHE F 3 64  ? -21.788 26.912  33.230  1.00 55.25  ? 64  PHE F C   1 
ATOM 7984  O O   . PHE F 3 64  ? -21.011 27.427  32.436  1.00 54.55  ? 64  PHE F O   1 
ATOM 7985  C CB  . PHE F 3 64  ? -21.079 27.977  35.347  1.00 54.07  ? 64  PHE F CB  1 
ATOM 7986  C CG  . PHE F 3 64  ? -21.470 28.669  36.621  1.00 56.03  ? 64  PHE F CG  1 
ATOM 7987  C CD1 . PHE F 3 64  ? -21.996 27.946  37.690  1.00 54.81  ? 64  PHE F CD1 1 
ATOM 7988  C CD2 . PHE F 3 64  ? -21.403 30.055  36.724  1.00 53.93  ? 64  PHE F CD2 1 
ATOM 7989  C CE1 . PHE F 3 64  ? -22.456 28.594  38.838  1.00 49.34  ? 64  PHE F CE1 1 
ATOM 7990  C CE2 . PHE F 3 64  ? -21.865 30.706  37.870  1.00 50.79  ? 64  PHE F CE2 1 
ATOM 7991  C CZ  . PHE F 3 64  ? -22.393 29.972  38.928  1.00 43.66  ? 64  PHE F CZ  1 
ATOM 7992  N N   . LYS F 3 65  ? -22.258 25.682  33.103  1.00 62.32  ? 65  LYS F N   1 
ATOM 7993  C CA  . LYS F 3 65  ? -21.866 24.805  32.010  1.00 69.09  ? 65  LYS F CA  1 
ATOM 7994  C C   . LYS F 3 65  ? -21.250 25.539  30.820  1.00 71.29  ? 65  LYS F C   1 
ATOM 7995  O O   . LYS F 3 65  ? -20.057 25.376  30.504  1.00 69.45  ? 65  LYS F O   1 
ATOM 7996  C CB  . LYS F 3 65  ? -23.080 24.005  31.524  1.00 73.43  ? 65  LYS F CB  1 
ATOM 7997  C CG  . LYS F 3 65  ? -22.711 22.801  30.650  1.00 80.42  ? 65  LYS F CG  1 
ATOM 7998  C CD  . LYS F 3 65  ? -23.584 22.688  29.402  1.00 86.09  ? 65  LYS F CD  1 
ATOM 7999  C CE  . LYS F 3 65  ? -25.057 22.547  29.753  1.00 90.82  ? 65  LYS F CE  1 
ATOM 8000  N NZ  . LYS F 3 65  ? -25.916 22.515  28.532  1.00 95.65  ? 65  LYS F NZ  1 
ATOM 8001  N N   . ASP F 3 66  ? -22.070 26.368  30.180  1.00 74.79  ? 66  ASP F N   1 
ATOM 8002  C CA  . ASP F 3 66  ? -21.635 27.084  28.990  1.00 78.60  ? 66  ASP F CA  1 
ATOM 8003  C C   . ASP F 3 66  ? -21.281 28.565  29.152  1.00 75.20  ? 66  ASP F C   1 
ATOM 8004  O O   . ASP F 3 66  ? -20.942 29.235  28.176  1.00 76.41  ? 66  ASP F O   1 
ATOM 8005  C CB  . ASP F 3 66  ? -22.679 26.872  27.884  1.00 87.82  ? 66  ASP F CB  1 
ATOM 8006  C CG  . ASP F 3 66  ? -22.629 25.446  27.306  1.00 96.19  ? 66  ASP F CG  1 
ATOM 8007  O OD1 . ASP F 3 66  ? -23.634 25.013  26.691  1.00 98.93  ? 66  ASP F OD1 1 
ATOM 8008  O OD2 . ASP F 3 66  ? -21.576 24.760  27.451  1.00 101.10 ? 66  ASP F OD2 1 
ATOM 8009  N N   . LYS F 3 67  ? -21.345 29.084  30.374  1.00 70.32  ? 67  LYS F N   1 
ATOM 8010  C CA  . LYS F 3 67  ? -20.956 30.475  30.607  1.00 66.24  ? 67  LYS F CA  1 
ATOM 8011  C C   . LYS F 3 67  ? -19.457 30.541  30.871  1.00 64.03  ? 67  LYS F C   1 
ATOM 8012  O O   . LYS F 3 67  ? -18.717 31.281  30.217  1.00 65.84  ? 67  LYS F O   1 
ATOM 8013  C CB  . LYS F 3 67  ? -21.660 31.042  31.832  1.00 65.58  ? 67  LYS F CB  1 
ATOM 8014  C CG  . LYS F 3 67  ? -23.074 31.506  31.603  1.00 73.03  ? 67  LYS F CG  1 
ATOM 8015  C CD  . LYS F 3 67  ? -23.423 32.637  32.565  1.00 71.50  ? 67  LYS F CD  1 
ATOM 8016  C CE  . LYS F 3 67  ? -22.452 33.814  32.401  1.00 68.63  ? 67  LYS F CE  1 
ATOM 8017  N NZ  . LYS F 3 67  ? -22.403 34.368  31.008  1.00 60.79  ? 67  LYS F NZ  1 
ATOM 8018  N N   . ALA F 3 68  ? -19.041 29.729  31.842  1.00 59.23  ? 68  ALA F N   1 
ATOM 8019  C CA  . ALA F 3 68  ? -17.663 29.652  32.307  1.00 50.81  ? 68  ALA F CA  1 
ATOM 8020  C C   . ALA F 3 68  ? -16.778 28.607  31.643  1.00 47.91  ? 68  ALA F C   1 
ATOM 8021  O O   . ALA F 3 68  ? -17.262 27.650  31.039  1.00 49.15  ? 68  ALA F O   1 
ATOM 8022  C CB  . ALA F 3 68  ? -17.665 29.427  33.799  1.00 48.38  ? 68  ALA F CB  1 
ATOM 8023  N N   . THR F 3 69  ? -15.470 28.794  31.795  1.00 44.61  ? 69  THR F N   1 
ATOM 8024  C CA  . THR F 3 69  ? -14.484 27.899  31.221  1.00 42.67  ? 69  THR F CA  1 
ATOM 8025  C C   . THR F 3 69  ? -13.157 27.926  31.975  1.00 44.40  ? 69  THR F C   1 
ATOM 8026  O O   . THR F 3 69  ? -12.339 28.854  31.819  1.00 42.90  ? 69  THR F O   1 
ATOM 8027  C CB  . THR F 3 69  ? -14.221 28.256  29.752  1.00 42.92  ? 69  THR F CB  1 
ATOM 8028  O OG1 . THR F 3 69  ? -15.373 27.922  28.972  1.00 45.17  ? 69  THR F OG1 1 
ATOM 8029  C CG2 . THR F 3 69  ? -13.014 27.495  29.217  1.00 44.34  ? 69  THR F CG2 1 
ATOM 8030  N N   . LEU F 3 70  ? -12.942 26.884  32.772  1.00 41.18  ? 70  LEU F N   1 
ATOM 8031  C CA  . LEU F 3 70  ? -11.727 26.760  33.561  1.00 40.13  ? 70  LEU F CA  1 
ATOM 8032  C C   . LEU F 3 70  ? -10.622 26.193  32.705  1.00 40.17  ? 70  LEU F C   1 
ATOM 8033  O O   . LEU F 3 70  ? -10.881 25.395  31.815  1.00 38.68  ? 70  LEU F O   1 
ATOM 8034  C CB  . LEU F 3 70  ? -11.961 25.822  34.735  1.00 36.80  ? 70  LEU F CB  1 
ATOM 8035  C CG  . LEU F 3 70  ? -13.340 25.941  35.374  1.00 35.13  ? 70  LEU F CG  1 
ATOM 8036  C CD1 . LEU F 3 70  ? -13.428 24.986  36.560  1.00 32.87  ? 70  LEU F CD1 1 
ATOM 8037  C CD2 . LEU F 3 70  ? -13.580 27.373  35.812  1.00 35.84  ? 70  LEU F CD2 1 
ATOM 8038  N N   . THR F 3 71  ? -9.390  26.599  32.990  1.00 39.81  ? 71  THR F N   1 
ATOM 8039  C CA  . THR F 3 71  ? -8.225  26.125  32.257  1.00 39.45  ? 71  THR F CA  1 
ATOM 8040  C C   . THR F 3 71  ? -7.029  26.445  33.121  1.00 37.60  ? 71  THR F C   1 
ATOM 8041  O O   . THR F 3 71  ? -7.166  27.139  34.134  1.00 36.93  ? 71  THR F O   1 
ATOM 8042  C CB  . THR F 3 71  ? -8.063  26.859  30.923  1.00 40.76  ? 71  THR F CB  1 
ATOM 8043  O OG1 . THR F 3 71  ? -7.886  28.257  31.175  1.00 42.05  ? 71  THR F OG1 1 
ATOM 8044  C CG2 . THR F 3 71  ? -9.295  26.674  30.054  1.00 43.46  ? 71  THR F CG2 1 
ATOM 8045  N N   . VAL F 3 72  ? -5.857  25.955  32.729  1.00 36.18  ? 72  VAL F N   1 
ATOM 8046  C CA  . VAL F 3 72  ? -4.655  26.204  33.513  1.00 37.64  ? 72  VAL F CA  1 
ATOM 8047  C C   . VAL F 3 72  ? -3.433  26.293  32.637  1.00 38.27  ? 72  VAL F C   1 
ATOM 8048  O O   . VAL F 3 72  ? -3.452  25.854  31.504  1.00 41.43  ? 72  VAL F O   1 
ATOM 8049  C CB  . VAL F 3 72  ? -4.387  25.067  34.537  1.00 39.95  ? 72  VAL F CB  1 
ATOM 8050  C CG1 . VAL F 3 72  ? -5.697  24.446  34.988  1.00 42.54  ? 72  VAL F CG1 1 
ATOM 8051  C CG2 . VAL F 3 72  ? -3.479  24.007  33.934  1.00 30.96  ? 72  VAL F CG2 1 
ATOM 8052  N N   . ASP F 3 73  ? -2.359  26.854  33.171  1.00 40.61  ? 73  ASP F N   1 
ATOM 8053  C CA  . ASP F 3 73  ? -1.131  26.941  32.414  1.00 44.23  ? 73  ASP F CA  1 
ATOM 8054  C C   . ASP F 3 73  ? -0.018  26.402  33.277  1.00 46.82  ? 73  ASP F C   1 
ATOM 8055  O O   . ASP F 3 73  ? 0.694   27.150  33.955  1.00 47.65  ? 73  ASP F O   1 
ATOM 8056  C CB  . ASP F 3 73  ? -0.815  28.374  32.010  1.00 48.46  ? 73  ASP F CB  1 
ATOM 8057  C CG  . ASP F 3 73  ? 0.624   28.531  31.560  1.00 54.20  ? 73  ASP F CG  1 
ATOM 8058  O OD1 . ASP F 3 73  ? 1.216   27.535  31.084  1.00 60.78  ? 73  ASP F OD1 1 
ATOM 8059  O OD2 . ASP F 3 73  ? 1.164   29.644  31.677  1.00 54.95  ? 73  ASP F OD2 1 
ATOM 8060  N N   . LYS F 3 74  ? 0.128   25.088  33.234  1.00 47.12  ? 74  LYS F N   1 
ATOM 8061  C CA  . LYS F 3 74  ? 1.128   24.398  34.026  1.00 50.94  ? 74  LYS F CA  1 
ATOM 8062  C C   . LYS F 3 74  ? 2.475   25.125  34.137  1.00 50.31  ? 74  LYS F C   1 
ATOM 8063  O O   . LYS F 3 74  ? 3.041   25.215  35.232  1.00 49.52  ? 74  LYS F O   1 
ATOM 8064  C CB  . LYS F 3 74  ? 1.299   22.969  33.479  1.00 52.12  ? 74  LYS F CB  1 
ATOM 8065  C CG  . LYS F 3 74  ? 0.004   22.129  33.597  1.00 54.28  ? 74  LYS F CG  1 
ATOM 8066  C CD  . LYS F 3 74  ? -0.055  20.892  32.677  1.00 53.59  ? 74  LYS F CD  1 
ATOM 8067  C CE  . LYS F 3 74  ? 0.877   19.775  33.131  1.00 58.86  ? 74  LYS F CE  1 
ATOM 8068  N NZ  . LYS F 3 74  ? 0.780   18.548  32.281  1.00 58.13  ? 74  LYS F NZ  1 
ATOM 8069  N N   . SER F 3 75  ? 2.977   25.670  33.032  1.00 48.43  ? 75  SER F N   1 
ATOM 8070  C CA  . SER F 3 75  ? 4.273   26.345  33.073  1.00 51.36  ? 75  SER F CA  1 
ATOM 8071  C C   . SER F 3 75  ? 4.349   27.421  34.148  1.00 53.30  ? 75  SER F C   1 
ATOM 8072  O O   . SER F 3 75  ? 5.189   27.346  35.047  1.00 52.22  ? 75  SER F O   1 
ATOM 8073  C CB  . SER F 3 75  ? 4.605   26.946  31.706  1.00 53.21  ? 75  SER F CB  1 
ATOM 8074  O OG  . SER F 3 75  ? 3.553   27.768  31.234  1.00 58.46  ? 75  SER F OG  1 
ATOM 8075  N N   . SER F 3 76  ? 3.461   28.411  34.057  1.00 54.95  ? 76  SER F N   1 
ATOM 8076  C CA  . SER F 3 76  ? 3.417   29.520  35.015  1.00 55.82  ? 76  SER F CA  1 
ATOM 8077  C C   . SER F 3 76  ? 2.565   29.149  36.223  1.00 53.74  ? 76  SER F C   1 
ATOM 8078  O O   . SER F 3 76  ? 2.178   30.008  37.028  1.00 51.18  ? 76  SER F O   1 
ATOM 8079  C CB  . SER F 3 76  ? 2.816   30.759  34.366  1.00 58.95  ? 76  SER F CB  1 
ATOM 8080  O OG  . SER F 3 76  ? 1.429   30.564  34.168  1.00 63.47  ? 76  SER F OG  1 
ATOM 8081  N N   . SER F 3 77  ? 2.270   27.861  36.332  1.00 48.12  ? 77  SER F N   1 
ATOM 8082  C CA  . SER F 3 77  ? 1.478   27.344  37.433  1.00 43.61  ? 77  SER F CA  1 
ATOM 8083  C C   . SER F 3 77  ? 0.373   28.280  37.903  1.00 38.74  ? 77  SER F C   1 
ATOM 8084  O O   . SER F 3 77  ? 0.390   28.754  39.028  1.00 39.19  ? 77  SER F O   1 
ATOM 8085  C CB  . SER F 3 77  ? 2.396   26.985  38.604  1.00 42.80  ? 77  SER F CB  1 
ATOM 8086  O OG  . SER F 3 77  ? 3.334   28.017  38.845  1.00 49.72  ? 77  SER F OG  1 
ATOM 8087  N N   . THR F 3 78  ? -0.584  28.558  37.028  1.00 35.22  ? 78  THR F N   1 
ATOM 8088  C CA  . THR F 3 78  ? -1.705  29.396  37.402  1.00 32.10  ? 78  THR F CA  1 
ATOM 8089  C C   . THR F 3 78  ? -2.950  28.928  36.652  1.00 33.31  ? 78  THR F C   1 
ATOM 8090  O O   . THR F 3 78  ? -2.849  28.377  35.555  1.00 37.93  ? 78  THR F O   1 
ATOM 8091  C CB  . THR F 3 78  ? -1.416  30.892  37.119  1.00 33.30  ? 78  THR F CB  1 
ATOM 8092  O OG1 . THR F 3 78  ? -2.502  31.460  36.381  1.00 31.24  ? 78  THR F OG1 1 
ATOM 8093  C CG2 . THR F 3 78  ? -0.133  31.057  36.355  1.00 27.43  ? 78  THR F CG2 1 
ATOM 8094  N N   . ALA F 3 79  ? -4.118  29.129  37.254  1.00 32.30  ? 79  ALA F N   1 
ATOM 8095  C CA  . ALA F 3 79  ? -5.376  28.702  36.656  1.00 34.03  ? 79  ALA F CA  1 
ATOM 8096  C C   . ALA F 3 79  ? -6.244  29.870  36.295  1.00 36.18  ? 79  ALA F C   1 
ATOM 8097  O O   . ALA F 3 79  ? -6.203  30.914  36.954  1.00 39.18  ? 79  ALA F O   1 
ATOM 8098  C CB  . ALA F 3 79  ? -6.124  27.816  37.610  1.00 33.03  ? 79  ALA F CB  1 
ATOM 8099  N N   . TYR F 3 80  ? -7.067  29.677  35.272  1.00 36.90  ? 80  TYR F N   1 
ATOM 8100  C CA  . TYR F 3 80  ? -7.929  30.746  34.824  1.00 35.89  ? 80  TYR F CA  1 
ATOM 8101  C C   . TYR F 3 80  ? -9.359  30.335  34.672  1.00 35.23  ? 80  TYR F C   1 
ATOM 8102  O O   . TYR F 3 80  ? -9.647  29.266  34.141  1.00 38.51  ? 80  TYR F O   1 
ATOM 8103  C CB  . TYR F 3 80  ? -7.476  31.273  33.469  1.00 38.30  ? 80  TYR F CB  1 
ATOM 8104  C CG  . TYR F 3 80  ? -6.021  31.689  33.373  1.00 44.01  ? 80  TYR F CG  1 
ATOM 8105  C CD1 . TYR F 3 80  ? -4.993  30.733  33.318  1.00 42.56  ? 80  TYR F CD1 1 
ATOM 8106  C CD2 . TYR F 3 80  ? -5.667  33.042  33.301  1.00 44.97  ? 80  TYR F CD2 1 
ATOM 8107  C CE1 . TYR F 3 80  ? -3.641  31.120  33.191  1.00 42.49  ? 80  TYR F CE1 1 
ATOM 8108  C CE2 . TYR F 3 80  ? -4.322  33.439  33.173  1.00 45.97  ? 80  TYR F CE2 1 
ATOM 8109  C CZ  . TYR F 3 80  ? -3.316  32.475  33.121  1.00 42.84  ? 80  TYR F CZ  1 
ATOM 8110  O OH  . TYR F 3 80  ? -1.995  32.870  33.021  1.00 38.70  ? 80  TYR F OH  1 
ATOM 8111  N N   . MET F 3 81  ? -10.253 31.192  35.147  1.00 33.62  ? 81  MET F N   1 
ATOM 8112  C CA  . MET F 3 81  ? -11.673 30.968  34.986  1.00 34.70  ? 81  MET F CA  1 
ATOM 8113  C C   . MET F 3 81  ? -12.072 32.044  34.005  1.00 39.72  ? 81  MET F C   1 
ATOM 8114  O O   . MET F 3 81  ? -11.779 33.222  34.219  1.00 39.96  ? 81  MET F O   1 
ATOM 8115  C CB  . MET F 3 81  ? -12.457 31.183  36.255  1.00 29.71  ? 81  MET F CB  1 
ATOM 8116  C CG  . MET F 3 81  ? -13.931 31.268  35.954  1.00 29.54  ? 81  MET F CG  1 
ATOM 8117  S SD  . MET F 3 81  ? -14.906 31.214  37.438  1.00 44.26  ? 81  MET F SD  1 
ATOM 8118  C CE  . MET F 3 81  ? -16.590 31.252  36.775  1.00 41.51  ? 81  MET F CE  1 
ATOM 8119  N N   . GLN F 3 82  ? -12.748 31.642  32.936  1.00 43.15  ? 82  GLN F N   1 
ATOM 8120  C CA  . GLN F 3 82  ? -13.142 32.580  31.909  1.00 45.91  ? 82  GLN F CA  1 
ATOM 8121  C C   . GLN F 3 82  ? -14.638 32.688  31.799  1.00 47.46  ? 82  GLN F C   1 
ATOM 8122  O O   . GLN F 3 82  ? -15.328 31.683  31.683  1.00 49.48  ? 82  GLN F O   1 
ATOM 8123  C CB  . GLN F 3 82  ? -12.573 32.129  30.581  1.00 50.85  ? 82  GLN F CB  1 
ATOM 8124  C CG  . GLN F 3 82  ? -12.266 33.257  29.642  1.00 58.62  ? 82  GLN F CG  1 
ATOM 8125  C CD  . GLN F 3 82  ? -12.926 33.072  28.306  1.00 58.35  ? 82  GLN F CD  1 
ATOM 8126  O OE1 . GLN F 3 82  ? -14.127 33.277  28.176  1.00 58.59  ? 82  GLN F OE1 1 
ATOM 8127  N NE2 . GLN F 3 82  ? -12.149 32.662  27.303  1.00 57.95  ? 82  GLN F NE2 1 
ATOM 8128  N N   . VAL F 3 83  ? -15.149 33.908  31.851  1.00 50.22  ? 83  VAL F N   1 
ATOM 8129  C CA  . VAL F 3 83  ? -16.582 34.087  31.729  1.00 53.81  ? 83  VAL F CA  1 
ATOM 8130  C C   . VAL F 3 83  ? -16.890 34.689  30.381  1.00 59.38  ? 83  VAL F C   1 
ATOM 8131  O O   . VAL F 3 83  ? -16.195 35.599  29.904  1.00 59.62  ? 83  VAL F O   1 
ATOM 8132  C CB  . VAL F 3 83  ? -17.135 35.001  32.778  1.00 51.12  ? 83  VAL F CB  1 
ATOM 8133  C CG1 . VAL F 3 83  ? -18.656 35.014  32.680  1.00 49.71  ? 83  VAL F CG1 1 
ATOM 8134  C CG2 . VAL F 3 83  ? -16.672 34.543  34.122  1.00 51.27  ? 83  VAL F CG2 1 
ATOM 8135  N N   . ASN F 3 84  ? -17.950 34.182  29.770  1.00 61.29  ? 84  ASN F N   1 
ATOM 8136  C CA  . ASN F 3 84  ? -18.327 34.639  28.455  1.00 62.97  ? 84  ASN F CA  1 
ATOM 8137  C C   . ASN F 3 84  ? -19.616 35.419  28.505  1.00 61.02  ? 84  ASN F C   1 
ATOM 8138  O O   . ASN F 3 84  ? -20.528 35.089  29.277  1.00 55.99  ? 84  ASN F O   1 
ATOM 8139  C CB  . ASN F 3 84  ? -18.453 33.429  27.533  1.00 67.87  ? 84  ASN F CB  1 
ATOM 8140  C CG  . ASN F 3 84  ? -17.169 32.616  27.472  1.00 72.01  ? 84  ASN F CG  1 
ATOM 8141  O OD1 . ASN F 3 84  ? -16.180 33.050  26.867  1.00 70.92  ? 84  ASN F OD1 1 
ATOM 8142  N ND2 . ASN F 3 84  ? -17.169 31.439  28.114  1.00 70.82  ? 84  ASN F ND2 1 
ATOM 8143  N N   . SER F 3 85  ? -19.667 36.463  27.679  1.00 60.97  ? 85  SER F N   1 
ATOM 8144  C CA  . SER F 3 85  ? -20.829 37.338  27.582  1.00 62.47  ? 85  SER F CA  1 
ATOM 8145  C C   . SER F 3 85  ? -21.410 37.714  28.938  1.00 59.58  ? 85  SER F C   1 
ATOM 8146  O O   . SER F 3 85  ? -22.532 37.338  29.292  1.00 61.37  ? 85  SER F O   1 
ATOM 8147  C CB  . SER F 3 85  ? -21.896 36.693  26.710  1.00 63.66  ? 85  SER F CB  1 
ATOM 8148  O OG  . SER F 3 85  ? -21.386 36.529  25.399  1.00 71.73  ? 85  SER F OG  1 
ATOM 8149  N N   . PRO F 3 86  ? -20.630 38.466  29.716  1.00 54.73  ? 86  PRO F N   1 
ATOM 8150  C CA  . PRO F 3 86  ? -20.944 38.964  31.051  1.00 52.21  ? 86  PRO F CA  1 
ATOM 8151  C C   . PRO F 3 86  ? -22.209 39.810  31.065  1.00 51.60  ? 86  PRO F C   1 
ATOM 8152  O O   . PRO F 3 86  ? -22.646 40.309  30.031  1.00 50.14  ? 86  PRO F O   1 
ATOM 8153  C CB  . PRO F 3 86  ? -19.709 39.779  31.394  1.00 51.46  ? 86  PRO F CB  1 
ATOM 8154  C CG  . PRO F 3 86  ? -18.618 39.020  30.687  1.00 53.53  ? 86  PRO F CG  1 
ATOM 8155  C CD  . PRO F 3 86  ? -19.234 38.770  29.359  1.00 51.85  ? 86  PRO F CD  1 
ATOM 8156  N N   . THR F 3 87  ? -22.793 39.956  32.247  1.00 50.84  ? 87  THR F N   1 
ATOM 8157  C CA  . THR F 3 87  ? -23.999 40.747  32.442  1.00 50.73  ? 87  THR F CA  1 
ATOM 8158  C C   . THR F 3 87  ? -24.030 41.061  33.933  1.00 54.63  ? 87  THR F C   1 
ATOM 8159  O O   . THR F 3 87  ? -23.275 40.467  34.697  1.00 58.49  ? 87  THR F O   1 
ATOM 8160  C CB  . THR F 3 87  ? -25.267 39.959  32.075  1.00 48.42  ? 87  THR F CB  1 
ATOM 8161  O OG1 . THR F 3 87  ? -25.652 39.117  33.173  1.00 52.14  ? 87  THR F OG1 1 
ATOM 8162  C CG2 . THR F 3 87  ? -25.014 39.097  30.853  1.00 43.13  ? 87  THR F CG2 1 
ATOM 8163  N N   . SER F 3 88  ? -24.892 41.979  34.356  1.00 57.10  ? 88  SER F N   1 
ATOM 8164  C CA  . SER F 3 88  ? -24.966 42.333  35.769  1.00 59.87  ? 88  SER F CA  1 
ATOM 8165  C C   . SER F 3 88  ? -25.102 41.106  36.676  1.00 62.24  ? 88  SER F C   1 
ATOM 8166  O O   . SER F 3 88  ? -24.631 41.123  37.818  1.00 63.96  ? 88  SER F O   1 
ATOM 8167  C CB  . SER F 3 88  ? -26.140 43.281  36.015  1.00 61.58  ? 88  SER F CB  1 
ATOM 8168  O OG  . SER F 3 88  ? -27.370 42.663  35.669  1.00 69.68  ? 88  SER F OG  1 
ATOM 8169  N N   . GLU F 3 89  ? -25.747 40.048  36.176  1.00 63.36  ? 89  GLU F N   1 
ATOM 8170  C CA  . GLU F 3 89  ? -25.933 38.822  36.954  1.00 61.92  ? 89  GLU F CA  1 
ATOM 8171  C C   . GLU F 3 89  ? -24.543 38.255  37.247  1.00 59.19  ? 89  GLU F C   1 
ATOM 8172  O O   . GLU F 3 89  ? -24.362 37.490  38.193  1.00 61.11  ? 89  GLU F O   1 
ATOM 8173  C CB  . GLU F 3 89  ? -26.780 37.805  36.165  1.00 65.78  ? 89  GLU F CB  1 
ATOM 8174  C CG  . GLU F 3 89  ? -27.635 36.824  37.022  1.00 75.28  ? 89  GLU F CG  1 
ATOM 8175  C CD  . GLU F 3 89  ? -27.011 35.414  37.225  1.00 80.20  ? 89  GLU F CD  1 
ATOM 8176  O OE1 . GLU F 3 89  ? -26.665 34.731  36.223  1.00 80.53  ? 89  GLU F OE1 1 
ATOM 8177  O OE2 . GLU F 3 89  ? -26.883 34.977  38.396  1.00 79.10  ? 89  GLU F OE2 1 
ATOM 8178  N N   . ASP F 3 90  ? -23.558 38.661  36.448  1.00 56.22  ? 90  ASP F N   1 
ATOM 8179  C CA  . ASP F 3 90  ? -22.187 38.192  36.615  1.00 54.83  ? 90  ASP F CA  1 
ATOM 8180  C C   . ASP F 3 90  ? -21.298 39.037  37.514  1.00 53.17  ? 90  ASP F C   1 
ATOM 8181  O O   . ASP F 3 90  ? -20.288 38.551  38.006  1.00 53.42  ? 90  ASP F O   1 
ATOM 8182  C CB  . ASP F 3 90  ? -21.513 38.032  35.264  1.00 52.86  ? 90  ASP F CB  1 
ATOM 8183  C CG  . ASP F 3 90  ? -22.159 36.961  34.438  1.00 59.25  ? 90  ASP F CG  1 
ATOM 8184  O OD1 . ASP F 3 90  ? -22.640 35.970  35.037  1.00 61.77  ? 90  ASP F OD1 1 
ATOM 8185  O OD2 . ASP F 3 90  ? -22.177 37.098  33.195  1.00 66.52  ? 90  ASP F OD2 1 
ATOM 8186  N N   . SER F 3 91  ? -21.637 40.303  37.718  1.00 51.75  ? 91  SER F N   1 
ATOM 8187  C CA  . SER F 3 91  ? -20.825 41.111  38.611  1.00 47.90  ? 91  SER F CA  1 
ATOM 8188  C C   . SER F 3 91  ? -20.893 40.424  39.965  1.00 47.48  ? 91  SER F C   1 
ATOM 8189  O O   . SER F 3 91  ? -21.975 40.213  40.515  1.00 45.82  ? 91  SER F O   1 
ATOM 8190  C CB  . SER F 3 91  ? -21.365 42.534  38.726  1.00 45.48  ? 91  SER F CB  1 
ATOM 8191  O OG  . SER F 3 91  ? -20.892 43.350  37.668  1.00 49.03  ? 91  SER F OG  1 
ATOM 8192  N N   . ALA F 3 92  ? -19.724 40.052  40.476  1.00 46.81  ? 92  ALA F N   1 
ATOM 8193  C CA  . ALA F 3 92  ? -19.601 39.384  41.765  1.00 42.13  ? 92  ALA F CA  1 
ATOM 8194  C C   . ALA F 3 92  ? -18.117 39.163  42.067  1.00 40.14  ? 92  ALA F C   1 
ATOM 8195  O O   . ALA F 3 92  ? -17.233 39.619  41.323  1.00 33.34  ? 92  ALA F O   1 
ATOM 8196  C CB  . ALA F 3 92  ? -20.338 38.054  41.735  1.00 34.95  ? 92  ALA F CB  1 
ATOM 8197  N N   . VAL F 3 93  ? -17.843 38.480  43.172  1.00 38.01  ? 93  VAL F N   1 
ATOM 8198  C CA  . VAL F 3 93  ? -16.467 38.194  43.527  1.00 38.06  ? 93  VAL F CA  1 
ATOM 8199  C C   . VAL F 3 93  ? -16.230 36.697  43.325  1.00 33.73  ? 93  VAL F C   1 
ATOM 8200  O O   . VAL F 3 93  ? -17.068 35.867  43.663  1.00 27.19  ? 93  VAL F O   1 
ATOM 8201  C CB  . VAL F 3 93  ? -16.164 38.620  44.978  1.00 38.00  ? 93  VAL F CB  1 
ATOM 8202  C CG1 . VAL F 3 93  ? -17.256 38.137  45.902  1.00 41.36  ? 93  VAL F CG1 1 
ATOM 8203  C CG2 . VAL F 3 93  ? -14.814 38.076  45.410  1.00 36.53  ? 93  VAL F CG2 1 
ATOM 8204  N N   . TYR F 3 94  ? -15.079 36.374  42.753  1.00 32.65  ? 94  TYR F N   1 
ATOM 8205  C CA  . TYR F 3 94  ? -14.707 35.009  42.431  1.00 32.35  ? 94  TYR F CA  1 
ATOM 8206  C C   . TYR F 3 94  ? -13.449 34.521  43.141  1.00 32.80  ? 94  TYR F C   1 
ATOM 8207  O O   . TYR F 3 94  ? -12.347 35.053  42.933  1.00 30.28  ? 94  TYR F O   1 
ATOM 8208  C CB  . TYR F 3 94  ? -14.493 34.920  40.924  1.00 34.04  ? 94  TYR F CB  1 
ATOM 8209  C CG  . TYR F 3 94  ? -15.742 35.190  40.124  1.00 31.67  ? 94  TYR F CG  1 
ATOM 8210  C CD1 . TYR F 3 94  ? -16.571 34.145  39.729  1.00 30.76  ? 94  TYR F CD1 1 
ATOM 8211  C CD2 . TYR F 3 94  ? -16.123 36.492  39.817  1.00 28.97  ? 94  TYR F CD2 1 
ATOM 8212  C CE1 . TYR F 3 94  ? -17.755 34.385  39.051  1.00 30.16  ? 94  TYR F CE1 1 
ATOM 8213  C CE2 . TYR F 3 94  ? -17.306 36.749  39.135  1.00 28.90  ? 94  TYR F CE2 1 
ATOM 8214  C CZ  . TYR F 3 94  ? -18.123 35.689  38.756  1.00 34.54  ? 94  TYR F CZ  1 
ATOM 8215  O OH  . TYR F 3 94  ? -19.318 35.924  38.096  1.00 37.92  ? 94  TYR F OH  1 
ATOM 8216  N N   . TYR F 3 95  ? -13.610 33.494  43.970  1.00 30.21  ? 95  TYR F N   1 
ATOM 8217  C CA  . TYR F 3 95  ? -12.470 32.947  44.673  1.00 28.55  ? 95  TYR F CA  1 
ATOM 8218  C C   . TYR F 3 95  ? -12.027 31.650  44.057  1.00 24.01  ? 95  TYR F C   1 
ATOM 8219  O O   . TYR F 3 95  ? -12.855 30.821  43.669  1.00 21.66  ? 95  TYR F O   1 
ATOM 8220  C CB  . TYR F 3 95  ? -12.794 32.630  46.120  1.00 32.57  ? 95  TYR F CB  1 
ATOM 8221  C CG  . TYR F 3 95  ? -13.404 33.741  46.891  1.00 37.70  ? 95  TYR F CG  1 
ATOM 8222  C CD1 . TYR F 3 95  ? -14.780 33.886  46.938  1.00 41.70  ? 95  TYR F CD1 1 
ATOM 8223  C CD2 . TYR F 3 95  ? -12.617 34.617  47.635  1.00 41.42  ? 95  TYR F CD2 1 
ATOM 8224  C CE1 . TYR F 3 95  ? -15.373 34.873  47.722  1.00 43.43  ? 95  TYR F CE1 1 
ATOM 8225  C CE2 . TYR F 3 95  ? -13.198 35.609  48.422  1.00 44.74  ? 95  TYR F CE2 1 
ATOM 8226  C CZ  . TYR F 3 95  ? -14.581 35.725  48.462  1.00 41.90  ? 95  TYR F CZ  1 
ATOM 8227  O OH  . TYR F 3 95  ? -15.193 36.654  49.267  1.00 47.45  ? 95  TYR F OH  1 
ATOM 8228  N N   . CYS F 3 96  ? -10.718 31.478  43.969  1.00 15.54  ? 96  CYS F N   1 
ATOM 8229  C CA  . CYS F 3 96  ? -10.195 30.231  43.484  1.00 21.15  ? 96  CYS F CA  1 
ATOM 8230  C C   . CYS F 3 96  ? -9.733  29.627  44.810  1.00 19.93  ? 96  CYS F C   1 
ATOM 8231  O O   . CYS F 3 96  ? -9.261  30.347  45.674  1.00 25.95  ? 96  CYS F O   1 
ATOM 8232  C CB  . CYS F 3 96  ? -9.035  30.471  42.537  1.00 19.77  ? 96  CYS F CB  1 
ATOM 8233  S SG  . CYS F 3 96  ? -7.677  31.246  43.329  1.00 13.99  ? 96  CYS F SG  1 
ATOM 8234  N N   . THR F 3 97  ? -9.892  28.328  44.994  1.00 17.23  ? 97  THR F N   1 
ATOM 8235  C CA  . THR F 3 97  ? -9.519  27.712  46.252  1.00 19.36  ? 97  THR F CA  1 
ATOM 8236  C C   . THR F 3 97  ? -8.791  26.417  46.056  1.00 23.69  ? 97  THR F C   1 
ATOM 8237  O O   . THR F 3 97  ? -8.846  25.814  44.992  1.00 24.32  ? 97  THR F O   1 
ATOM 8238  C CB  . THR F 3 97  ? -10.743 27.362  47.097  1.00 19.39  ? 97  THR F CB  1 
ATOM 8239  O OG1 . THR F 3 97  ? -11.344 26.156  46.592  1.00 19.32  ? 97  THR F OG1 1 
ATOM 8240  C CG2 . THR F 3 97  ? -11.743 28.494  47.053  1.00 23.97  ? 97  THR F CG2 1 
ATOM 8241  N N   . ARG F 3 98  ? -8.148  25.975  47.127  1.00 23.52  ? 98  ARG F N   1 
ATOM 8242  C CA  . ARG F 3 98  ? -7.390  24.740  47.137  1.00 25.61  ? 98  ARG F CA  1 
ATOM 8243  C C   . ARG F 3 98  ? -7.697  24.099  48.465  1.00 24.52  ? 98  ARG F C   1 
ATOM 8244  O O   . ARG F 3 98  ? -7.778  24.788  49.478  1.00 29.61  ? 98  ARG F O   1 
ATOM 8245  C CB  . ARG F 3 98  ? -5.897  25.046  47.038  1.00 29.57  ? 98  ARG F CB  1 
ATOM 8246  C CG  . ARG F 3 98  ? -5.020  23.852  46.697  1.00 30.86  ? 98  ARG F CG  1 
ATOM 8247  C CD  . ARG F 3 98  ? -4.520  23.150  47.929  1.00 33.51  ? 98  ARG F CD  1 
ATOM 8248  N NE  . ARG F 3 98  ? -3.068  23.276  48.081  1.00 34.80  ? 98  ARG F NE  1 
ATOM 8249  C CZ  . ARG F 3 98  ? -2.369  22.729  49.081  1.00 34.81  ? 98  ARG F CZ  1 
ATOM 8250  N NH1 . ARG F 3 98  ? -2.995  22.012  50.025  1.00 18.23  ? 98  ARG F NH1 1 
ATOM 8251  N NH2 . ARG F 3 98  ? -1.050  22.894  49.129  1.00 30.06  ? 98  ARG F NH2 1 
ATOM 8252  N N   . GLY F 3 99  ? -7.875  22.786  48.472  1.00 25.42  ? 99  GLY F N   1 
ATOM 8253  C CA  . GLY F 3 99  ? -8.185  22.118  49.716  1.00 20.83  ? 99  GLY F CA  1 
ATOM 8254  C C   . GLY F 3 99  ? -6.915  21.662  50.388  1.00 24.53  ? 99  GLY F C   1 
ATOM 8255  O O   . GLY F 3 99  ? -5.850  22.262  50.232  1.00 24.04  ? 99  GLY F O   1 
ATOM 8256  N N   . ALA F 3 100 ? -7.034  20.589  51.156  1.00 26.11  ? 100 ALA F N   1 
ATOM 8257  C CA  . ALA F 3 100 ? -5.893  20.030  51.851  1.00 26.18  ? 100 ALA F CA  1 
ATOM 8258  C C   . ALA F 3 100 ? -6.304  18.765  52.577  1.00 28.36  ? 100 ALA F C   1 
ATOM 8259  O O   . ALA F 3 100 ? -7.471  18.376  52.543  1.00 32.40  ? 100 ALA F O   1 
ATOM 8260  C CB  . ALA F 3 100 ? -5.325  21.034  52.829  1.00 27.97  ? 100 ALA F CB  1 
ATOM 8261  N N   . ARG F 3 101 ? -5.324  18.145  53.230  1.00 29.68  ? 101 ARG F N   1 
ATOM 8262  C CA  . ARG F 3 101 ? -5.493  16.909  53.984  1.00 28.20  ? 101 ARG F CA  1 
ATOM 8263  C C   . ARG F 3 101 ? -6.850  16.754  54.640  1.00 25.57  ? 101 ARG F C   1 
ATOM 8264  O O   . ARG F 3 101 ? -7.073  17.275  55.730  1.00 28.20  ? 101 ARG F O   1 
ATOM 8265  C CB  . ARG F 3 101 ? -4.412  16.826  55.056  1.00 37.35  ? 101 ARG F CB  1 
ATOM 8266  C CG  . ARG F 3 101 ? -4.507  15.607  55.952  1.00 47.32  ? 101 ARG F CG  1 
ATOM 8267  C CD  . ARG F 3 101 ? -4.078  14.327  55.249  1.00 60.46  ? 101 ARG F CD  1 
ATOM 8268  N NE  . ARG F 3 101 ? -3.627  13.329  56.224  1.00 68.58  ? 101 ARG F NE  1 
ATOM 8269  C CZ  . ARG F 3 101 ? -2.482  13.409  56.902  1.00 73.24  ? 101 ARG F CZ  1 
ATOM 8270  N NH1 . ARG F 3 101 ? -1.660  14.441  56.705  1.00 75.96  ? 101 ARG F NH1 1 
ATOM 8271  N NH2 . ARG F 3 101 ? -2.169  12.472  57.791  1.00 72.22  ? 101 ARG F NH2 1 
ATOM 8272  N N   . ASP F 3 102 ? -7.747  16.044  53.970  1.00 19.60  ? 102 ASP F N   1 
ATOM 8273  C CA  . ASP F 3 102 ? -9.085  15.771  54.469  1.00 19.48  ? 102 ASP F CA  1 
ATOM 8274  C C   . ASP F 3 102 ? -10.213 16.745  54.236  1.00 21.43  ? 102 ASP F C   1 
ATOM 8275  O O   . ASP F 3 102 ? -11.267 16.602  54.864  1.00 16.92  ? 102 ASP F O   1 
ATOM 8276  C CB  . ASP F 3 102 ? -9.047  15.456  55.944  1.00 29.79  ? 102 ASP F CB  1 
ATOM 8277  C CG  . ASP F 3 102 ? -8.381  14.150  56.220  1.00 40.22  ? 102 ASP F CG  1 
ATOM 8278  O OD1 . ASP F 3 102 ? -7.155  14.138  56.514  1.00 42.70  ? 102 ASP F OD1 1 
ATOM 8279  O OD2 . ASP F 3 102 ? -9.097  13.130  56.116  1.00 46.47  ? 102 ASP F OD2 1 
ATOM 8280  N N   . THR F 3 103 ? -9.999  17.732  53.364  1.00 24.85  ? 103 THR F N   1 
ATOM 8281  C CA  . THR F 3 103 ? -11.043 18.698  52.995  1.00 27.04  ? 103 THR F CA  1 
ATOM 8282  C C   . THR F 3 103 ? -10.758 19.451  51.767  1.00 28.94  ? 103 THR F C   1 
ATOM 8283  O O   . THR F 3 103 ? -9.707  19.336  51.142  1.00 27.48  ? 103 THR F O   1 
ATOM 8284  C CB  . THR F 3 103 ? -11.267 19.847  53.939  1.00 24.99  ? 103 THR F CB  1 
ATOM 8285  O OG1 . THR F 3 103 ? -10.027 20.189  54.559  1.00 16.95  ? 103 THR F OG1 1 
ATOM 8286  C CG2 . THR F 3 103 ? -12.397 19.547  54.876  1.00 25.91  ? 103 THR F CG2 1 
ATOM 8287  N N   . TRP F 3 104 ? -11.724 20.310  51.507  1.00 28.43  ? 104 TRP F N   1 
ATOM 8288  C CA  . TRP F 3 104 ? -11.693 21.190  50.385  1.00 27.78  ? 104 TRP F CA  1 
ATOM 8289  C C   . TRP F 3 104 ? -11.743 22.584  50.982  1.00 28.13  ? 104 TRP F C   1 
ATOM 8290  O O   . TRP F 3 104 ? -12.046 22.737  52.158  1.00 27.25  ? 104 TRP F O   1 
ATOM 8291  C CB  . TRP F 3 104 ? -12.936 20.942  49.546  1.00 27.78  ? 104 TRP F CB  1 
ATOM 8292  C CG  . TRP F 3 104 ? -13.064 19.549  49.068  1.00 24.81  ? 104 TRP F CG  1 
ATOM 8293  C CD1 . TRP F 3 104 ? -14.009 18.647  49.430  1.00 27.30  ? 104 TRP F CD1 1 
ATOM 8294  C CD2 . TRP F 3 104 ? -12.258 18.913  48.077  1.00 24.01  ? 104 TRP F CD2 1 
ATOM 8295  N NE1 . TRP F 3 104 ? -13.851 17.482  48.718  1.00 25.49  ? 104 TRP F NE1 1 
ATOM 8296  C CE2 . TRP F 3 104 ? -12.776 17.622  47.884  1.00 23.35  ? 104 TRP F CE2 1 
ATOM 8297  C CE3 . TRP F 3 104 ? -11.141 19.312  47.330  1.00 28.60  ? 104 TRP F CE3 1 
ATOM 8298  C CZ2 . TRP F 3 104 ? -12.221 16.726  46.969  1.00 25.86  ? 104 TRP F CZ2 1 
ATOM 8299  C CZ3 . TRP F 3 104 ? -10.591 18.422  46.418  1.00 23.39  ? 104 TRP F CZ3 1 
ATOM 8300  C CH2 . TRP F 3 104 ? -11.131 17.144  46.248  1.00 21.95  ? 104 TRP F CH2 1 
ATOM 8301  N N   . PHE F 3 105 ? -11.410 23.597  50.193  1.00 28.77  ? 105 PHE F N   1 
ATOM 8302  C CA  . PHE F 3 105 ? -11.529 24.959  50.677  1.00 25.84  ? 105 PHE F CA  1 
ATOM 8303  C C   . PHE F 3 105 ? -10.734 25.297  51.919  1.00 27.40  ? 105 PHE F C   1 
ATOM 8304  O O   . PHE F 3 105 ? -11.208 26.025  52.791  1.00 28.85  ? 105 PHE F O   1 
ATOM 8305  C CB  . PHE F 3 105 ? -12.997 25.220  50.928  1.00 22.97  ? 105 PHE F CB  1 
ATOM 8306  C CG  . PHE F 3 105 ? -13.862 24.845  49.766  1.00 23.93  ? 105 PHE F CG  1 
ATOM 8307  C CD1 . PHE F 3 105 ? -14.948 23.984  49.933  1.00 21.95  ? 105 PHE F CD1 1 
ATOM 8308  C CD2 . PHE F 3 105 ? -13.625 25.399  48.500  1.00 20.54  ? 105 PHE F CD2 1 
ATOM 8309  C CE1 . PHE F 3 105 ? -15.795 23.685  48.868  1.00 17.10  ? 105 PHE F CE1 1 
ATOM 8310  C CE2 . PHE F 3 105 ? -14.465 25.108  47.426  1.00 15.90  ? 105 PHE F CE2 1 
ATOM 8311  C CZ  . PHE F 3 105 ? -15.555 24.251  47.610  1.00 19.46  ? 105 PHE F CZ  1 
ATOM 8312  N N   . ALA F 3 106 ? -9.528  24.764  52.006  1.00 24.67  ? 106 ALA F N   1 
ATOM 8313  C CA  . ALA F 3 106 ? -8.693  25.060  53.139  1.00 21.05  ? 106 ALA F CA  1 
ATOM 8314  C C   . ALA F 3 106 ? -8.011  26.377  52.843  1.00 19.80  ? 106 ALA F C   1 
ATOM 8315  O O   . ALA F 3 106 ? -7.759  27.167  53.744  1.00 28.29  ? 106 ALA F O   1 
ATOM 8316  C CB  . ALA F 3 106 ? -7.673  23.981  53.331  1.00 22.59  ? 106 ALA F CB  1 
ATOM 8317  N N   . TYR F 3 107 ? -7.717  26.629  51.583  1.00 13.49  ? 107 TYR F N   1 
ATOM 8318  C CA  . TYR F 3 107 ? -7.052  27.867  51.232  1.00 18.07  ? 107 TYR F CA  1 
ATOM 8319  C C   . TYR F 3 107 ? -7.879  28.660  50.251  1.00 21.10  ? 107 TYR F C   1 
ATOM 8320  O O   . TYR F 3 107 ? -8.471  28.090  49.333  1.00 27.69  ? 107 TYR F O   1 
ATOM 8321  C CB  . TYR F 3 107 ? -5.705  27.566  50.619  1.00 20.82  ? 107 TYR F CB  1 
ATOM 8322  C CG  . TYR F 3 107 ? -4.740  26.903  51.568  1.00 30.92  ? 107 TYR F CG  1 
ATOM 8323  C CD1 . TYR F 3 107 ? -3.724  27.635  52.179  1.00 38.64  ? 107 TYR F CD1 1 
ATOM 8324  C CD2 . TYR F 3 107 ? -4.823  25.540  51.843  1.00 32.24  ? 107 TYR F CD2 1 
ATOM 8325  C CE1 . TYR F 3 107 ? -2.817  27.033  53.032  1.00 35.52  ? 107 TYR F CE1 1 
ATOM 8326  C CE2 . TYR F 3 107 ? -3.914  24.928  52.696  1.00 34.72  ? 107 TYR F CE2 1 
ATOM 8327  C CZ  . TYR F 3 107 ? -2.912  25.683  53.284  1.00 33.82  ? 107 TYR F CZ  1 
ATOM 8328  O OH  . TYR F 3 107 ? -1.986  25.086  54.109  1.00 36.20  ? 107 TYR F OH  1 
ATOM 8329  N N   . TRP F 3 108 ? -7.918  29.977  50.430  1.00 18.38  ? 108 TRP F N   1 
ATOM 8330  C CA  . TRP F 3 108 ? -8.696  30.820  49.538  1.00 17.48  ? 108 TRP F CA  1 
ATOM 8331  C C   . TRP F 3 108 ? -7.916  31.926  48.885  1.00 23.38  ? 108 TRP F C   1 
ATOM 8332  O O   . TRP F 3 108 ? -7.025  32.507  49.495  1.00 28.76  ? 108 TRP F O   1 
ATOM 8333  C CB  . TRP F 3 108 ? -9.853  31.448  50.283  1.00 16.57  ? 108 TRP F CB  1 
ATOM 8334  C CG  . TRP F 3 108 ? -10.875 30.468  50.714  1.00 14.80  ? 108 TRP F CG  1 
ATOM 8335  C CD1 . TRP F 3 108 ? -10.728 29.482  51.654  1.00 9.84   ? 108 TRP F CD1 1 
ATOM 8336  C CD2 . TRP F 3 108 ? -12.227 30.407  50.272  1.00 9.54   ? 108 TRP F CD2 1 
ATOM 8337  N NE1 . TRP F 3 108 ? -11.910 28.821  51.827  1.00 8.02   ? 108 TRP F NE1 1 
ATOM 8338  C CE2 . TRP F 3 108 ? -12.850 29.365  50.991  1.00 10.79  ? 108 TRP F CE2 1 
ATOM 8339  C CE3 . TRP F 3 108 ? -12.974 31.133  49.337  1.00 9.01   ? 108 TRP F CE3 1 
ATOM 8340  C CZ2 . TRP F 3 108 ? -14.201 29.030  50.811  1.00 10.86  ? 108 TRP F CZ2 1 
ATOM 8341  C CZ3 . TRP F 3 108 ? -14.318 30.804  49.158  1.00 10.74  ? 108 TRP F CZ3 1 
ATOM 8342  C CH2 . TRP F 3 108 ? -14.917 29.758  49.894  1.00 10.93  ? 108 TRP F CH2 1 
ATOM 8343  N N   . GLY F 3 109 ? -8.240  32.211  47.628  1.00 26.37  ? 109 GLY F N   1 
ATOM 8344  C CA  . GLY F 3 109 ? -7.576  33.295  46.943  1.00 25.27  ? 109 GLY F CA  1 
ATOM 8345  C C   . GLY F 3 109 ? -8.188  34.548  47.549  1.00 33.25  ? 109 GLY F C   1 
ATOM 8346  O O   . GLY F 3 109 ? -9.197  34.505  48.279  1.00 27.79  ? 109 GLY F O   1 
ATOM 8347  N N   . GLN F 3 110 ? -7.573  35.682  47.263  1.00 39.33  ? 110 GLN F N   1 
ATOM 8348  C CA  . GLN F 3 110 ? -8.071  36.947  47.782  1.00 43.38  ? 110 GLN F CA  1 
ATOM 8349  C C   . GLN F 3 110 ? -9.534  37.211  47.361  1.00 39.84  ? 110 GLN F C   1 
ATOM 8350  O O   . GLN F 3 110 ? -10.339 37.718  48.144  1.00 37.29  ? 110 GLN F O   1 
ATOM 8351  C CB  . GLN F 3 110 ? -7.153  38.058  47.271  1.00 53.07  ? 110 GLN F CB  1 
ATOM 8352  C CG  . GLN F 3 110 ? -7.663  39.462  47.516  1.00 64.90  ? 110 GLN F CG  1 
ATOM 8353  C CD  . GLN F 3 110 ? -6.953  40.483  46.650  1.00 69.85  ? 110 GLN F CD  1 
ATOM 8354  O OE1 . GLN F 3 110 ? -7.274  41.675  46.679  1.00 73.03  ? 110 GLN F OE1 1 
ATOM 8355  N NE2 . GLN F 3 110 ? -5.978  40.019  45.868  1.00 76.06  ? 110 GLN F NE2 1 
ATOM 8356  N N   . GLY F 3 111 ? -9.858  36.838  46.123  1.00 38.74  ? 111 GLY F N   1 
ATOM 8357  C CA  . GLY F 3 111 ? -11.177 37.050  45.563  1.00 35.99  ? 111 GLY F CA  1 
ATOM 8358  C C   . GLY F 3 111 ? -11.072 38.200  44.568  1.00 38.94  ? 111 GLY F C   1 
ATOM 8359  O O   . GLY F 3 111 ? -10.416 39.194  44.852  1.00 42.43  ? 111 GLY F O   1 
ATOM 8360  N N   . THR F 3 112 ? -11.673 38.074  43.389  1.00 37.71  ? 112 THR F N   1 
ATOM 8361  C CA  . THR F 3 112 ? -11.618 39.163  42.428  1.00 38.33  ? 112 THR F CA  1 
ATOM 8362  C C   . THR F 3 112 ? -13.005 39.753  42.256  1.00 38.26  ? 112 THR F C   1 
ATOM 8363  O O   . THR F 3 112 ? -13.995 39.038  42.131  1.00 35.30  ? 112 THR F O   1 
ATOM 8364  C CB  . THR F 3 112 ? -11.119 38.711  41.051  1.00 41.66  ? 112 THR F CB  1 
ATOM 8365  O OG1 . THR F 3 112 ? -9.729  38.366  41.118  1.00 49.79  ? 112 THR F OG1 1 
ATOM 8366  C CG2 . THR F 3 112 ? -11.298 39.833  40.046  1.00 45.48  ? 112 THR F CG2 1 
ATOM 8367  N N   . LEU F 3 113 ? -13.081 41.073  42.252  1.00 39.94  ? 113 LEU F N   1 
ATOM 8368  C CA  . LEU F 3 113 ? -14.372 41.702  42.100  1.00 40.49  ? 113 LEU F CA  1 
ATOM 8369  C C   . LEU F 3 113 ? -14.574 42.109  40.668  1.00 43.37  ? 113 LEU F C   1 
ATOM 8370  O O   . LEU F 3 113 ? -13.880 43.000  40.166  1.00 40.56  ? 113 LEU F O   1 
ATOM 8371  C CB  . LEU F 3 113 ? -14.489 42.930  42.990  1.00 36.59  ? 113 LEU F CB  1 
ATOM 8372  C CG  . LEU F 3 113 ? -15.826 43.660  42.860  1.00 32.81  ? 113 LEU F CG  1 
ATOM 8373  C CD1 . LEU F 3 113 ? -16.984 42.698  43.052  1.00 31.49  ? 113 LEU F CD1 1 
ATOM 8374  C CD2 . LEU F 3 113 ? -15.882 44.759  43.898  1.00 30.77  ? 113 LEU F CD2 1 
ATOM 8375  N N   . VAL F 3 114 ? -15.507 41.437  39.999  1.00 45.61  ? 114 VAL F N   1 
ATOM 8376  C CA  . VAL F 3 114 ? -15.792 41.791  38.625  1.00 43.66  ? 114 VAL F CA  1 
ATOM 8377  C C   . VAL F 3 114 ? -16.986 42.701  38.654  1.00 46.63  ? 114 VAL F C   1 
ATOM 8378  O O   . VAL F 3 114 ? -17.960 42.480  39.391  1.00 44.38  ? 114 VAL F O   1 
ATOM 8379  C CB  . VAL F 3 114 ? -16.133 40.599  37.747  1.00 38.15  ? 114 VAL F CB  1 
ATOM 8380  C CG1 . VAL F 3 114 ? -14.996 39.613  37.761  1.00 38.58  ? 114 VAL F CG1 1 
ATOM 8381  C CG2 . VAL F 3 114 ? -17.417 39.976  38.221  1.00 40.02  ? 114 VAL F CG2 1 
ATOM 8382  N N   . THR F 3 115 ? -16.872 43.749  37.853  1.00 49.17  ? 115 THR F N   1 
ATOM 8383  C CA  . THR F 3 115 ? -17.906 44.745  37.715  1.00 51.14  ? 115 THR F CA  1 
ATOM 8384  C C   . THR F 3 115 ? -18.121 44.774  36.202  1.00 52.50  ? 115 THR F C   1 
ATOM 8385  O O   . THR F 3 115 ? -17.168 44.977  35.439  1.00 47.59  ? 115 THR F O   1 
ATOM 8386  C CB  . THR F 3 115 ? -17.411 46.142  38.244  1.00 53.22  ? 115 THR F CB  1 
ATOM 8387  O OG1 . THR F 3 115 ? -16.850 46.002  39.564  1.00 50.79  ? 115 THR F OG1 1 
ATOM 8388  C CG2 . THR F 3 115 ? -18.564 47.134  38.309  1.00 51.01  ? 115 THR F CG2 1 
ATOM 8389  N N   . VAL F 3 116 ? -19.354 44.491  35.776  1.00 57.49  ? 116 VAL F N   1 
ATOM 8390  C CA  . VAL F 3 116 ? -19.714 44.518  34.353  1.00 61.74  ? 116 VAL F CA  1 
ATOM 8391  C C   . VAL F 3 116 ? -20.471 45.820  34.160  1.00 62.67  ? 116 VAL F C   1 
ATOM 8392  O O   . VAL F 3 116 ? -21.576 45.980  34.688  1.00 63.40  ? 116 VAL F O   1 
ATOM 8393  C CB  . VAL F 3 116 ? -20.651 43.354  33.949  1.00 61.47  ? 116 VAL F CB  1 
ATOM 8394  C CG1 . VAL F 3 116 ? -19.872 42.070  33.831  1.00 59.86  ? 116 VAL F CG1 1 
ATOM 8395  C CG2 . VAL F 3 116 ? -21.758 43.204  34.978  1.00 63.59  ? 116 VAL F CG2 1 
ATOM 8396  N N   . SER F 3 117 ? -19.869 46.755  33.430  1.00 61.67  ? 117 SER F N   1 
ATOM 8397  C CA  . SER F 3 117 ? -20.498 48.043  33.203  1.00 59.97  ? 117 SER F CA  1 
ATOM 8398  C C   . SER F 3 117 ? -19.842 48.829  32.092  1.00 61.61  ? 117 SER F C   1 
ATOM 8399  O O   . SER F 3 117 ? -18.678 48.617  31.737  1.00 59.50  ? 117 SER F O   1 
ATOM 8400  C CB  . SER F 3 117 ? -20.478 48.888  34.478  1.00 57.66  ? 117 SER F CB  1 
ATOM 8401  O OG  . SER F 3 117 ? -21.269 50.055  34.323  1.00 59.62  ? 117 SER F OG  1 
ATOM 8402  N N   . VAL F 3 118 ? -20.623 49.753  31.549  1.00 64.24  ? 118 VAL F N   1 
ATOM 8403  C CA  . VAL F 3 118 ? -20.174 50.622  30.474  1.00 61.75  ? 118 VAL F CA  1 
ATOM 8404  C C   . VAL F 3 118 ? -19.459 51.799  31.118  1.00 62.45  ? 118 VAL F C   1 
ATOM 8405  O O   . VAL F 3 118 ? -18.587 52.430  30.497  1.00 65.10  ? 118 VAL F O   1 
ATOM 8406  C CB  . VAL F 3 118 ? -21.377 51.113  29.654  1.00 55.60  ? 118 VAL F CB  1 
ATOM 8407  C CG1 . VAL F 3 118 ? -21.654 50.137  28.517  1.00 51.66  ? 118 VAL F CG1 1 
ATOM 8408  C CG2 . VAL F 3 118 ? -22.610 51.239  30.576  1.00 52.72  ? 118 VAL F CG2 1 
ATOM 8409  N N   . ALA F 3 119 ? -19.836 52.061  32.373  1.00 61.00  ? 119 ALA F N   1 
ATOM 8410  C CA  . ALA F 3 119 ? -19.258 53.139  33.170  1.00 61.58  ? 119 ALA F CA  1 
ATOM 8411  C C   . ALA F 3 119 ? -17.739 53.139  33.057  1.00 60.13  ? 119 ALA F C   1 
ATOM 8412  O O   . ALA F 3 119 ? -17.093 52.083  32.994  1.00 60.23  ? 119 ALA F O   1 
ATOM 8413  C CB  . ALA F 3 119 ? -19.674 52.993  34.622  1.00 61.74  ? 119 ALA F CB  1 
ATOM 8414  N N   . LYS F 3 120 ? -17.170 54.336  33.022  1.00 58.38  ? 120 LYS F N   1 
ATOM 8415  C CA  . LYS F 3 120 ? -15.734 54.468  32.891  1.00 56.84  ? 120 LYS F CA  1 
ATOM 8416  C C   . LYS F 3 120 ? -15.064 54.549  34.250  1.00 55.43  ? 120 LYS F C   1 
ATOM 8417  O O   . LYS F 3 120 ? -15.564 55.184  35.184  1.00 50.57  ? 120 LYS F O   1 
ATOM 8418  C CB  . LYS F 3 120 ? -15.397 55.711  32.062  1.00 59.51  ? 120 LYS F CB  1 
ATOM 8419  C CG  . LYS F 3 120 ? -15.869 55.662  30.607  1.00 58.82  ? 120 LYS F CG  1 
ATOM 8420  C CD  . LYS F 3 120 ? -15.072 54.646  29.799  1.00 60.93  ? 120 LYS F CD  1 
ATOM 8421  C CE  . LYS F 3 120 ? -15.526 54.599  28.346  1.00 61.08  ? 120 LYS F CE  1 
ATOM 8422  N NZ  . LYS F 3 120 ? -14.777 53.574  27.558  1.00 59.61  ? 120 LYS F NZ  1 
ATOM 8423  N N   . THR F 3 121 ? -13.927 53.882  34.359  1.00 54.43  ? 121 THR F N   1 
ATOM 8424  C CA  . THR F 3 121 ? -13.191 53.894  35.604  1.00 52.30  ? 121 THR F CA  1 
ATOM 8425  C C   . THR F 3 121 ? -12.645 55.309  35.892  1.00 52.86  ? 121 THR F C   1 
ATOM 8426  O O   . THR F 3 121 ? -11.989 55.927  35.052  1.00 50.87  ? 121 THR F O   1 
ATOM 8427  C CB  . THR F 3 121 ? -12.043 52.840  35.566  1.00 48.86  ? 121 THR F CB  1 
ATOM 8428  O OG1 . THR F 3 121 ? -10.911 53.345  36.287  1.00 43.30  ? 121 THR F OG1 1 
ATOM 8429  C CG2 . THR F 3 121 ? -11.659 52.488  34.113  1.00 39.13  ? 121 THR F CG2 1 
ATOM 8430  N N   . THR F 3 122 ? -12.953 55.827  37.077  1.00 53.63  ? 122 THR F N   1 
ATOM 8431  C CA  . THR F 3 122 ? -12.489 57.152  37.467  1.00 53.92  ? 122 THR F CA  1 
ATOM 8432  C C   . THR F 3 122 ? -11.919 57.113  38.881  1.00 50.67  ? 122 THR F C   1 
ATOM 8433  O O   . THR F 3 122 ? -12.502 56.506  39.785  1.00 45.47  ? 122 THR F O   1 
ATOM 8434  C CB  . THR F 3 122 ? -13.628 58.188  37.416  1.00 57.88  ? 122 THR F CB  1 
ATOM 8435  O OG1 . THR F 3 122 ? -14.522 57.979  38.518  1.00 59.40  ? 122 THR F OG1 1 
ATOM 8436  C CG2 . THR F 3 122 ? -14.402 58.053  36.113  1.00 62.20  ? 122 THR F CG2 1 
ATOM 8437  N N   . PRO F 3 123 ? -10.764 57.764  39.089  1.00 49.64  ? 123 PRO F N   1 
ATOM 8438  C CA  . PRO F 3 123 ? -10.130 57.786  40.406  1.00 48.07  ? 123 PRO F CA  1 
ATOM 8439  C C   . PRO F 3 123 ? -10.910 58.616  41.401  1.00 48.53  ? 123 PRO F C   1 
ATOM 8440  O O   . PRO F 3 123 ? -11.702 59.474  41.031  1.00 49.75  ? 123 PRO F O   1 
ATOM 8441  C CB  . PRO F 3 123 ? -8.748  58.354  40.115  1.00 48.00  ? 123 PRO F CB  1 
ATOM 8442  C CG  . PRO F 3 123 ? -9.006  59.285  38.996  1.00 49.79  ? 123 PRO F CG  1 
ATOM 8443  C CD  . PRO F 3 123 ? -9.956  58.511  38.108  1.00 51.25  ? 123 PRO F CD  1 
ATOM 8444  N N   . PRO F 3 124 ? -10.683 58.373  42.690  1.00 50.37  ? 124 PRO F N   1 
ATOM 8445  C CA  . PRO F 3 124 ? -11.363 59.086  43.767  1.00 52.02  ? 124 PRO F CA  1 
ATOM 8446  C C   . PRO F 3 124 ? -10.738 60.442  44.080  1.00 55.45  ? 124 PRO F C   1 
ATOM 8447  O O   . PRO F 3 124 ? -9.588  60.718  43.713  1.00 56.93  ? 124 PRO F O   1 
ATOM 8448  C CB  . PRO F 3 124 ? -11.193 58.136  44.935  1.00 49.94  ? 124 PRO F CB  1 
ATOM 8449  C CG  . PRO F 3 124 ? -9.764  57.722  44.750  1.00 49.06  ? 124 PRO F CG  1 
ATOM 8450  C CD  . PRO F 3 124 ? -9.665  57.460  43.241  1.00 50.64  ? 124 PRO F CD  1 
ATOM 8451  N N   . SER F 3 125 ? -11.515 61.281  44.757  1.00 55.80  ? 125 SER F N   1 
ATOM 8452  C CA  . SER F 3 125 ? -11.053 62.587  45.204  1.00 55.70  ? 125 SER F CA  1 
ATOM 8453  C C   . SER F 3 125 ? -11.188 62.455  46.697  1.00 53.33  ? 125 SER F C   1 
ATOM 8454  O O   . SER F 3 125 ? -12.276 62.187  47.205  1.00 54.54  ? 125 SER F O   1 
ATOM 8455  C CB  . SER F 3 125 ? -11.955 63.711  44.702  1.00 55.45  ? 125 SER F CB  1 
ATOM 8456  O OG  . SER F 3 125 ? -11.753 63.906  43.318  1.00 62.46  ? 125 SER F OG  1 
ATOM 8457  N N   . VAL F 3 126 ? -10.087 62.608  47.407  1.00 50.60  ? 126 VAL F N   1 
ATOM 8458  C CA  . VAL F 3 126 ? -10.163 62.464  48.839  1.00 51.34  ? 126 VAL F CA  1 
ATOM 8459  C C   . VAL F 3 126 ? -9.994  63.799  49.570  1.00 49.28  ? 126 VAL F C   1 
ATOM 8460  O O   . VAL F 3 126 ? -8.966  64.477  49.474  1.00 47.65  ? 126 VAL F O   1 
ATOM 8461  C CB  . VAL F 3 126 ? -9.163  61.347  49.312  1.00 52.98  ? 126 VAL F CB  1 
ATOM 8462  C CG1 . VAL F 3 126 ? -8.042  61.189  48.300  1.00 52.52  ? 126 VAL F CG1 1 
ATOM 8463  C CG2 . VAL F 3 126 ? -8.618  61.653  50.696  1.00 56.12  ? 126 VAL F CG2 1 
ATOM 8464  N N   . PHE F 3 127 ? -11.048 64.173  50.283  1.00 47.61  ? 127 PHE F N   1 
ATOM 8465  C CA  . PHE F 3 127 ? -11.081 65.417  51.020  1.00 48.27  ? 127 PHE F CA  1 
ATOM 8466  C C   . PHE F 3 127 ? -11.005 65.106  52.507  1.00 49.28  ? 127 PHE F C   1 
ATOM 8467  O O   . PHE F 3 127 ? -11.813 64.336  53.029  1.00 53.61  ? 127 PHE F O   1 
ATOM 8468  C CB  . PHE F 3 127 ? -12.372 66.159  50.680  1.00 48.12  ? 127 PHE F CB  1 
ATOM 8469  C CG  . PHE F 3 127 ? -12.582 66.366  49.194  1.00 54.72  ? 127 PHE F CG  1 
ATOM 8470  C CD1 . PHE F 3 127 ? -11.583 66.946  48.398  1.00 57.59  ? 127 PHE F CD1 1 
ATOM 8471  C CD2 . PHE F 3 127 ? -13.794 66.019  48.589  1.00 53.34  ? 127 PHE F CD2 1 
ATOM 8472  C CE1 . PHE F 3 127 ? -11.799 67.183  47.003  1.00 58.81  ? 127 PHE F CE1 1 
ATOM 8473  C CE2 . PHE F 3 127 ? -14.018 66.251  47.199  1.00 55.51  ? 127 PHE F CE2 1 
ATOM 8474  C CZ  . PHE F 3 127 ? -13.022 66.834  46.409  1.00 54.86  ? 127 PHE F CZ  1 
ATOM 8475  N N   . PRO F 3 128 ? -10.029 65.703  53.216  1.00 47.82  ? 128 PRO F N   1 
ATOM 8476  C CA  . PRO F 3 128 ? -9.850  65.476  54.651  1.00 44.51  ? 128 PRO F CA  1 
ATOM 8477  C C   . PRO F 3 128 ? -10.949 66.126  55.465  1.00 44.82  ? 128 PRO F C   1 
ATOM 8478  O O   . PRO F 3 128 ? -11.492 67.154  55.070  1.00 45.38  ? 128 PRO F O   1 
ATOM 8479  C CB  . PRO F 3 128 ? -8.490  66.101  54.920  1.00 41.05  ? 128 PRO F CB  1 
ATOM 8480  C CG  . PRO F 3 128 ? -8.534  67.293  54.049  1.00 43.90  ? 128 PRO F CG  1 
ATOM 8481  C CD  . PRO F 3 128 ? -9.103  66.748  52.746  1.00 46.65  ? 128 PRO F CD  1 
ATOM 8482  N N   . LEU F 3 129 ? -11.277 65.525  56.603  1.00 49.41  ? 129 LEU F N   1 
ATOM 8483  C CA  . LEU F 3 129 ? -12.308 66.070  57.477  1.00 50.99  ? 129 LEU F CA  1 
ATOM 8484  C C   . LEU F 3 129 ? -11.766 66.274  58.883  1.00 53.33  ? 129 LEU F C   1 
ATOM 8485  O O   . LEU F 3 129 ? -11.621 65.316  59.653  1.00 51.30  ? 129 LEU F O   1 
ATOM 8486  C CB  . LEU F 3 129 ? -13.517 65.139  57.533  1.00 50.10  ? 129 LEU F CB  1 
ATOM 8487  C CG  . LEU F 3 129 ? -14.062 64.650  56.188  1.00 48.82  ? 129 LEU F CG  1 
ATOM 8488  C CD1 . LEU F 3 129 ? -15.325 63.858  56.457  1.00 45.11  ? 129 LEU F CD1 1 
ATOM 8489  C CD2 . LEU F 3 129 ? -14.340 65.825  55.245  1.00 46.67  ? 129 LEU F CD2 1 
ATOM 8490  N N   . ALA F 3 130 ? -11.454 67.532  59.200  1.00 56.55  ? 130 ALA F N   1 
ATOM 8491  C CA  . ALA F 3 130 ? -10.945 67.910  60.519  1.00 57.07  ? 130 ALA F CA  1 
ATOM 8492  C C   . ALA F 3 130 ? -12.081 68.612  61.265  1.00 58.84  ? 130 ALA F C   1 
ATOM 8493  O O   . ALA F 3 130 ? -13.043 69.079  60.649  1.00 61.31  ? 130 ALA F O   1 
ATOM 8494  C CB  . ALA F 3 130 ? -9.742  68.838  60.378  1.00 55.96  ? 130 ALA F CB  1 
ATOM 8495  N N   . PRO F 3 131 ? -11.999 68.688  62.600  1.00 61.71  ? 131 PRO F N   1 
ATOM 8496  C CA  . PRO F 3 131 ? -13.080 69.352  63.332  1.00 65.98  ? 131 PRO F CA  1 
ATOM 8497  C C   . PRO F 3 131 ? -13.005 70.843  63.036  1.00 71.74  ? 131 PRO F C   1 
ATOM 8498  O O   . PRO F 3 131 ? -11.905 71.401  62.938  1.00 72.32  ? 131 PRO F O   1 
ATOM 8499  C CB  . PRO F 3 131 ? -12.754 69.042  64.794  1.00 63.66  ? 131 PRO F CB  1 
ATOM 8500  C CG  . PRO F 3 131 ? -11.807 67.858  64.717  1.00 61.84  ? 131 PRO F CG  1 
ATOM 8501  C CD  . PRO F 3 131 ? -10.974 68.189  63.525  1.00 61.52  ? 131 PRO F CD  1 
ATOM 8502  N N   . GLY F 3 132 ? -14.154 71.493  62.885  1.00 75.39  ? 132 GLY F N   1 
ATOM 8503  C CA  . GLY F 3 132 ? -14.136 72.919  62.606  1.00 81.00  ? 132 GLY F CA  1 
ATOM 8504  C C   . GLY F 3 132 ? -13.480 73.769  63.694  1.00 84.87  ? 132 GLY F C   1 
ATOM 8505  O O   . GLY F 3 132 ? -13.305 73.316  64.837  1.00 82.66  ? 132 GLY F O   1 
ATOM 8506  N N   . SER F 3 133 ? -13.105 75.003  63.344  1.00 88.74  ? 133 SER F N   1 
ATOM 8507  C CA  . SER F 3 133 ? -12.491 75.912  64.319  1.00 92.90  ? 133 SER F CA  1 
ATOM 8508  C C   . SER F 3 133 ? -13.573 76.113  65.368  1.00 95.99  ? 133 SER F C   1 
ATOM 8509  O O   . SER F 3 133 ? -13.321 76.101  66.582  1.00 94.84  ? 133 SER F O   1 
ATOM 8510  C CB  . SER F 3 133 ? -12.139 77.259  63.668  1.00 91.64  ? 133 SER F CB  1 
ATOM 8511  O OG  . SER F 3 133 ? -13.278 77.847  63.049  1.00 91.78  ? 133 SER F OG  1 
ATOM 8512  N N   . ALA F 3 134 ? -14.793 76.278  64.859  1.00 100.09 ? 134 ALA F N   1 
ATOM 8513  C CA  . ALA F 3 134 ? -15.983 76.452  65.676  1.00 103.34 ? 134 ALA F CA  1 
ATOM 8514  C C   . ALA F 3 134 ? -16.296 75.103  66.347  1.00 105.68 ? 134 ALA F C   1 
ATOM 8515  O O   . ALA F 3 134 ? -17.438 74.643  66.323  1.00 106.42 ? 134 ALA F O   1 
ATOM 8516  C CB  . ALA F 3 134 ? -17.160 76.903  64.785  1.00 101.05 ? 134 ALA F CB  1 
ATOM 8517  N N   . ALA F 3 135 ? -15.270 74.477  66.930  1.00 108.62 ? 135 ALA F N   1 
ATOM 8518  C CA  . ALA F 3 135 ? -15.411 73.185  67.607  1.00 111.51 ? 135 ALA F CA  1 
ATOM 8519  C C   . ALA F 3 135 ? -14.834 73.219  69.021  1.00 113.10 ? 135 ALA F C   1 
ATOM 8520  O O   . ALA F 3 135 ? -13.853 73.926  69.292  1.00 114.48 ? 135 ALA F O   1 
ATOM 8521  C CB  . ALA F 3 135 ? -14.726 72.086  66.800  1.00 109.90 ? 135 ALA F CB  1 
ATOM 8522  N N   . GLN F 3 136 ? -15.431 72.433  69.915  1.00 113.27 ? 136 GLN F N   1 
ATOM 8523  C CA  . GLN F 3 136 ? -14.975 72.396  71.294  1.00 113.65 ? 136 GLN F CA  1 
ATOM 8524  C C   . GLN F 3 136 ? -14.443 71.073  71.805  1.00 112.70 ? 136 GLN F C   1 
ATOM 8525  O O   . GLN F 3 136 ? -14.895 69.990  71.422  1.00 112.15 ? 136 GLN F O   1 
ATOM 8526  C CB  . GLN F 3 136 ? -16.073 72.892  72.240  1.00 116.56 ? 136 GLN F CB  1 
ATOM 8527  C CG  . GLN F 3 136 ? -16.308 74.399  72.153  1.00 120.17 ? 136 GLN F CG  1 
ATOM 8528  C CD  . GLN F 3 136 ? -16.533 75.049  73.514  1.00 121.09 ? 136 GLN F CD  1 
ATOM 8529  O OE1 . GLN F 3 136 ? -17.414 74.638  74.270  1.00 122.94 ? 136 GLN F OE1 1 
ATOM 8530  N NE2 . GLN F 3 136 ? -15.738 76.074  73.827  1.00 118.07 ? 136 GLN F NE2 1 
ATOM 8531  N N   . THR F 3 137 ? -13.472 71.209  72.698  1.00 111.70 ? 137 THR F N   1 
ATOM 8532  C CA  . THR F 3 137 ? -12.786 70.101  73.350  1.00 110.63 ? 137 THR F CA  1 
ATOM 8533  C C   . THR F 3 137 ? -13.690 68.995  73.904  1.00 109.69 ? 137 THR F C   1 
ATOM 8534  O O   . THR F 3 137 ? -14.811 69.252  74.358  1.00 109.96 ? 137 THR F O   1 
ATOM 8535  C CB  . THR F 3 137 ? -11.934 70.634  74.523  1.00 110.74 ? 137 THR F CB  1 
ATOM 8536  O OG1 . THR F 3 137 ? -11.801 72.054  74.405  1.00 113.18 ? 137 THR F OG1 1 
ATOM 8537  C CG2 . THR F 3 137 ? -10.560 70.005  74.517  1.00 109.90 ? 137 THR F CG2 1 
ATOM 8538  N N   . ASN F 3 138 ? -13.178 67.763  73.855  1.00 107.77 ? 138 ASN F N   1 
ATOM 8539  C CA  . ASN F 3 138 ? -13.839 66.560  74.392  1.00 103.17 ? 138 ASN F CA  1 
ATOM 8540  C C   . ASN F 3 138 ? -12.720 65.724  74.996  1.00 97.71  ? 138 ASN F C   1 
ATOM 8541  O O   . ASN F 3 138 ? -11.554 66.128  74.986  1.00 95.63  ? 138 ASN F O   1 
ATOM 8542  C CB  . ASN F 3 138 ? -14.533 65.732  73.305  1.00 104.83 ? 138 ASN F CB  1 
ATOM 8543  C CG  . ASN F 3 138 ? -15.835 66.345  72.847  1.00 106.37 ? 138 ASN F CG  1 
ATOM 8544  O OD1 . ASN F 3 138 ? -16.684 66.702  73.668  1.00 106.17 ? 138 ASN F OD1 1 
ATOM 8545  N ND2 . ASN F 3 138 ? -16.008 66.464  71.532  1.00 106.77 ? 138 ASN F ND2 1 
ATOM 8546  N N   . SER F 3 139 ? -13.054 64.560  75.525  1.00 91.05  ? 139 SER F N   1 
ATOM 8547  C CA  . SER F 3 139 ? -12.018 63.717  76.097  1.00 85.06  ? 139 SER F CA  1 
ATOM 8548  C C   . SER F 3 139 ? -11.253 63.073  74.944  1.00 81.52  ? 139 SER F C   1 
ATOM 8549  O O   . SER F 3 139 ? -10.030 62.883  74.988  1.00 79.02  ? 139 SER F O   1 
ATOM 8550  C CB  . SER F 3 139 ? -12.653 62.640  76.969  1.00 84.16  ? 139 SER F CB  1 
ATOM 8551  O OG  . SER F 3 139 ? -11.743 61.583  77.214  1.00 79.48  ? 139 SER F OG  1 
ATOM 8552  N N   . MET F 3 140 ? -12.014 62.754  73.905  1.00 77.62  ? 140 MET F N   1 
ATOM 8553  C CA  . MET F 3 140 ? -11.501 62.123  72.711  1.00 71.95  ? 140 MET F CA  1 
ATOM 8554  C C   . MET F 3 140 ? -11.699 63.073  71.549  1.00 69.88  ? 140 MET F C   1 
ATOM 8555  O O   . MET F 3 140 ? -12.393 64.087  71.664  1.00 69.85  ? 140 MET F O   1 
ATOM 8556  C CB  . MET F 3 140 ? -12.287 60.852  72.435  1.00 73.44  ? 140 MET F CB  1 
ATOM 8557  C CG  . MET F 3 140 ? -11.449 59.737  71.907  1.00 75.82  ? 140 MET F CG  1 
ATOM 8558  S SD  . MET F 3 140 ? -10.514 59.042  73.248  1.00 78.65  ? 140 MET F SD  1 
ATOM 8559  C CE  . MET F 3 140 ? -11.769 57.937  73.930  1.00 74.63  ? 140 MET F CE  1 
ATOM 8560  N N   . VAL F 3 141 ? -11.102 62.730  70.421  1.00 67.40  ? 141 VAL F N   1 
ATOM 8561  C CA  . VAL F 3 141 ? -11.228 63.544  69.227  1.00 64.13  ? 141 VAL F CA  1 
ATOM 8562  C C   . VAL F 3 141 ? -11.413 62.636  68.028  1.00 62.59  ? 141 VAL F C   1 
ATOM 8563  O O   . VAL F 3 141 ? -10.750 61.607  67.912  1.00 61.32  ? 141 VAL F O   1 
ATOM 8564  C CB  . VAL F 3 141 ? -9.981  64.414  69.023  1.00 63.74  ? 141 VAL F CB  1 
ATOM 8565  C CG1 . VAL F 3 141 ? -8.729  63.559  69.130  1.00 64.71  ? 141 VAL F CG1 1 
ATOM 8566  C CG2 . VAL F 3 141 ? -10.055 65.110  67.685  1.00 59.87  ? 141 VAL F CG2 1 
ATOM 8567  N N   . THR F 3 142 ? -12.326 62.999  67.137  1.00 61.26  ? 142 THR F N   1 
ATOM 8568  C CA  . THR F 3 142 ? -12.539 62.168  65.966  1.00 59.01  ? 142 THR F CA  1 
ATOM 8569  C C   . THR F 3 142 ? -12.351 62.939  64.664  1.00 59.01  ? 142 THR F C   1 
ATOM 8570  O O   . THR F 3 142 ? -12.864 64.051  64.487  1.00 58.81  ? 142 THR F O   1 
ATOM 8571  C CB  . THR F 3 142 ? -13.942 61.511  65.969  1.00 56.33  ? 142 THR F CB  1 
ATOM 8572  O OG1 . THR F 3 142 ? -14.902 62.425  65.425  1.00 55.34  ? 142 THR F OG1 1 
ATOM 8573  C CG2 . THR F 3 142 ? -14.347 61.114  67.386  1.00 51.58  ? 142 THR F CG2 1 
ATOM 8574  N N   . LEU F 3 143 ? -11.593 62.330  63.760  1.00 58.40  ? 143 LEU F N   1 
ATOM 8575  C CA  . LEU F 3 143 ? -11.313 62.910  62.455  1.00 54.88  ? 143 LEU F CA  1 
ATOM 8576  C C   . LEU F 3 143 ? -11.923 62.016  61.395  1.00 51.74  ? 143 LEU F C   1 
ATOM 8577  O O   . LEU F 3 143 ? -12.971 61.419  61.593  1.00 53.48  ? 143 LEU F O   1 
ATOM 8578  C CB  . LEU F 3 143 ? -9.811  62.987  62.230  1.00 55.15  ? 143 LEU F CB  1 
ATOM 8579  C CG  . LEU F 3 143 ? -9.054  63.564  63.414  1.00 54.91  ? 143 LEU F CG  1 
ATOM 8580  C CD1 . LEU F 3 143 ? -7.559  63.441  63.190  1.00 53.55  ? 143 LEU F CD1 1 
ATOM 8581  C CD2 . LEU F 3 143 ? -9.472  65.007  63.589  1.00 56.19  ? 143 LEU F CD2 1 
ATOM 8582  N N   . GLY F 3 144 ? -11.245 61.912  60.269  1.00 49.45  ? 144 GLY F N   1 
ATOM 8583  C CA  . GLY F 3 144 ? -11.749 61.080  59.204  1.00 50.83  ? 144 GLY F CA  1 
ATOM 8584  C C   . GLY F 3 144 ? -11.736 61.893  57.944  1.00 51.06  ? 144 GLY F C   1 
ATOM 8585  O O   . GLY F 3 144 ? -11.680 63.115  58.004  1.00 54.71  ? 144 GLY F O   1 
ATOM 8586  N N   . CYS F 3 145 ? -11.763 61.227  56.801  1.00 50.04  ? 145 CYS F N   1 
ATOM 8587  C CA  . CYS F 3 145 ? -11.781 61.943  55.542  1.00 46.44  ? 145 CYS F CA  1 
ATOM 8588  C C   . CYS F 3 145 ? -12.762 61.229  54.641  1.00 45.04  ? 145 CYS F C   1 
ATOM 8589  O O   . CYS F 3 145 ? -13.196 60.122  54.949  1.00 46.65  ? 145 CYS F O   1 
ATOM 8590  C CB  . CYS F 3 145 ? -10.398 61.945  54.927  1.00 43.57  ? 145 CYS F CB  1 
ATOM 8591  S SG  . CYS F 3 145 ? -9.822  60.306  54.654  1.00 49.14  ? 145 CYS F SG  1 
ATOM 8592  N N   . LEU F 3 146 ? -13.128 61.850  53.533  1.00 43.20  ? 146 LEU F N   1 
ATOM 8593  C CA  . LEU F 3 146 ? -14.080 61.205  52.659  1.00 45.09  ? 146 LEU F CA  1 
ATOM 8594  C C   . LEU F 3 146 ? -13.575 61.033  51.236  1.00 44.87  ? 146 LEU F C   1 
ATOM 8595  O O   . LEU F 3 146 ? -12.966 61.937  50.660  1.00 38.44  ? 146 LEU F O   1 
ATOM 8596  C CB  . LEU F 3 146 ? -15.410 61.970  52.655  1.00 46.59  ? 146 LEU F CB  1 
ATOM 8597  C CG  . LEU F 3 146 ? -15.675 62.858  51.437  1.00 48.08  ? 146 LEU F CG  1 
ATOM 8598  C CD1 . LEU F 3 146 ? -17.126 63.296  51.405  1.00 47.43  ? 146 LEU F CD1 1 
ATOM 8599  C CD2 . LEU F 3 146 ? -14.736 64.055  51.473  1.00 53.93  ? 146 LEU F CD2 1 
ATOM 8600  N N   . VAL F 3 147 ? -13.836 59.846  50.687  1.00 47.63  ? 147 VAL F N   1 
ATOM 8601  C CA  . VAL F 3 147 ? -13.444 59.492  49.330  1.00 46.00  ? 147 VAL F CA  1 
ATOM 8602  C C   . VAL F 3 147 ? -14.662 59.639  48.446  1.00 46.27  ? 147 VAL F C   1 
ATOM 8603  O O   . VAL F 3 147 ? -15.666 58.941  48.631  1.00 40.76  ? 147 VAL F O   1 
ATOM 8604  C CB  . VAL F 3 147 ? -12.969 58.051  49.254  1.00 45.13  ? 147 VAL F CB  1 
ATOM 8605  C CG1 . VAL F 3 147 ? -12.597 57.713  47.821  1.00 45.20  ? 147 VAL F CG1 1 
ATOM 8606  C CG2 . VAL F 3 147 ? -11.788 57.854  50.185  1.00 38.62  ? 147 VAL F CG2 1 
ATOM 8607  N N   . LYS F 3 148 ? -14.563 60.524  47.463  1.00 47.92  ? 148 LYS F N   1 
ATOM 8608  C CA  . LYS F 3 148 ? -15.703 60.776  46.608  1.00 52.54  ? 148 LYS F CA  1 
ATOM 8609  C C   . LYS F 3 148 ? -15.498 60.601  45.105  1.00 55.45  ? 148 LYS F C   1 
ATOM 8610  O O   . LYS F 3 148 ? -14.380 60.747  44.595  1.00 54.87  ? 148 LYS F O   1 
ATOM 8611  C CB  . LYS F 3 148 ? -16.214 62.189  46.894  1.00 50.84  ? 148 LYS F CB  1 
ATOM 8612  C CG  . LYS F 3 148 ? -17.549 62.514  46.251  1.00 52.91  ? 148 LYS F CG  1 
ATOM 8613  C CD  . LYS F 3 148 ? -18.029 63.903  46.631  1.00 49.76  ? 148 LYS F CD  1 
ATOM 8614  C CE  . LYS F 3 148 ? -19.500 64.071  46.284  1.00 50.67  ? 148 LYS F CE  1 
ATOM 8615  N NZ  . LYS F 3 148 ? -20.357 63.087  47.019  1.00 51.69  ? 148 LYS F NZ  1 
ATOM 8616  N N   . GLY F 3 149 ? -16.605 60.276  44.424  1.00 54.75  ? 149 GLY F N   1 
ATOM 8617  C CA  . GLY F 3 149 ? -16.644 60.110  42.974  1.00 52.22  ? 149 GLY F CA  1 
ATOM 8618  C C   . GLY F 3 149 ? -15.649 59.241  42.218  1.00 49.57  ? 149 GLY F C   1 
ATOM 8619  O O   . GLY F 3 149 ? -15.019 59.699  41.258  1.00 47.53  ? 149 GLY F O   1 
ATOM 8620  N N   . TYR F 3 150 ? -15.515 57.985  42.625  1.00 48.14  ? 150 TYR F N   1 
ATOM 8621  C CA  . TYR F 3 150 ? -14.594 57.078  41.949  1.00 46.88  ? 150 TYR F CA  1 
ATOM 8622  C C   . TYR F 3 150 ? -15.346 55.873  41.404  1.00 46.13  ? 150 TYR F C   1 
ATOM 8623  O O   . TYR F 3 150 ? -16.512 55.608  41.751  1.00 46.16  ? 150 TYR F O   1 
ATOM 8624  C CB  . TYR F 3 150 ? -13.528 56.568  42.903  1.00 44.96  ? 150 TYR F CB  1 
ATOM 8625  C CG  . TYR F 3 150 ? -14.126 55.716  44.001  1.00 45.65  ? 150 TYR F CG  1 
ATOM 8626  C CD1 . TYR F 3 150 ? -14.793 56.302  45.081  1.00 45.65  ? 150 TYR F CD1 1 
ATOM 8627  C CD2 . TYR F 3 150 ? -14.032 54.326  43.962  1.00 40.05  ? 150 TYR F CD2 1 
ATOM 8628  C CE1 . TYR F 3 150 ? -15.339 55.526  46.093  1.00 44.53  ? 150 TYR F CE1 1 
ATOM 8629  C CE2 . TYR F 3 150 ? -14.581 53.543  44.969  1.00 38.15  ? 150 TYR F CE2 1 
ATOM 8630  C CZ  . TYR F 3 150 ? -15.228 54.146  46.031  1.00 41.43  ? 150 TYR F CZ  1 
ATOM 8631  O OH  . TYR F 3 150 ? -15.748 53.375  47.050  1.00 42.40  ? 150 TYR F OH  1 
ATOM 8632  N N   . PHE F 3 151 ? -14.647 55.130  40.563  1.00 41.72  ? 151 PHE F N   1 
ATOM 8633  C CA  . PHE F 3 151 ? -15.220 53.955  39.956  1.00 41.88  ? 151 PHE F CA  1 
ATOM 8634  C C   . PHE F 3 151 ? -14.111 53.131  39.295  1.00 42.29  ? 151 PHE F C   1 
ATOM 8635  O O   . PHE F 3 151 ? -13.193 53.674  38.671  1.00 43.68  ? 151 PHE F O   1 
ATOM 8636  C CB  . PHE F 3 151 ? -16.259 54.379  38.927  1.00 41.42  ? 151 PHE F CB  1 
ATOM 8637  C CG  . PHE F 3 151 ? -17.046 53.245  38.368  1.00 39.06  ? 151 PHE F CG  1 
ATOM 8638  C CD1 . PHE F 3 151 ? -18.191 52.800  39.014  1.00 35.99  ? 151 PHE F CD1 1 
ATOM 8639  C CD2 . PHE F 3 151 ? -16.639 52.619  37.192  1.00 39.54  ? 151 PHE F CD2 1 
ATOM 8640  C CE1 . PHE F 3 151 ? -18.930 51.750  38.503  1.00 38.35  ? 151 PHE F CE1 1 
ATOM 8641  C CE2 . PHE F 3 151 ? -17.367 51.566  36.665  1.00 44.21  ? 151 PHE F CE2 1 
ATOM 8642  C CZ  . PHE F 3 151 ? -18.521 51.127  37.324  1.00 45.84  ? 151 PHE F CZ  1 
ATOM 8643  N N   . PRO F 3 152 ? -14.193 51.799  39.413  1.00 39.73  ? 152 PRO F N   1 
ATOM 8644  C CA  . PRO F 3 152 ? -15.259 51.069  40.104  1.00 39.46  ? 152 PRO F CA  1 
ATOM 8645  C C   . PRO F 3 152 ? -14.865 50.729  41.522  1.00 39.08  ? 152 PRO F C   1 
ATOM 8646  O O   . PRO F 3 152 ? -13.873 51.234  42.042  1.00 37.97  ? 152 PRO F O   1 
ATOM 8647  C CB  . PRO F 3 152 ? -15.360 49.810  39.286  1.00 36.81  ? 152 PRO F CB  1 
ATOM 8648  C CG  . PRO F 3 152 ? -13.884 49.509  39.090  1.00 33.25  ? 152 PRO F CG  1 
ATOM 8649  C CD  . PRO F 3 152 ? -13.301 50.860  38.711  1.00 35.82  ? 152 PRO F CD  1 
ATOM 8650  N N   . GLU F 3 153 ? -15.659 49.863  42.137  1.00 39.06  ? 153 GLU F N   1 
ATOM 8651  C CA  . GLU F 3 153 ? -15.352 49.380  43.465  1.00 41.73  ? 153 GLU F CA  1 
ATOM 8652  C C   . GLU F 3 153 ? -14.139 48.458  43.242  1.00 45.46  ? 153 GLU F C   1 
ATOM 8653  O O   . GLU F 3 153 ? -13.971 47.893  42.157  1.00 46.98  ? 153 GLU F O   1 
ATOM 8654  C CB  . GLU F 3 153 ? -16.527 48.570  43.979  1.00 43.27  ? 153 GLU F CB  1 
ATOM 8655  C CG  . GLU F 3 153 ? -17.582 49.365  44.695  1.00 47.44  ? 153 GLU F CG  1 
ATOM 8656  C CD  . GLU F 3 153 ? -17.150 49.745  46.099  1.00 52.89  ? 153 GLU F CD  1 
ATOM 8657  O OE1 . GLU F 3 153 ? -18.034 49.757  46.986  1.00 55.33  ? 153 GLU F OE1 1 
ATOM 8658  O OE2 . GLU F 3 153 ? -15.940 50.030  46.319  1.00 54.11  ? 153 GLU F OE2 1 
ATOM 8659  N N   . PRO F 3 154 ? -13.296 48.261  44.261  1.00 45.64  ? 154 PRO F N   1 
ATOM 8660  C CA  . PRO F 3 154 ? -13.365 48.804  45.613  1.00 45.40  ? 154 PRO F CA  1 
ATOM 8661  C C   . PRO F 3 154 ? -12.245 49.791  45.862  1.00 47.47  ? 154 PRO F C   1 
ATOM 8662  O O   . PRO F 3 154 ? -11.407 50.071  44.983  1.00 50.57  ? 154 PRO F O   1 
ATOM 8663  C CB  . PRO F 3 154 ? -13.143 47.577  46.456  1.00 43.89  ? 154 PRO F CB  1 
ATOM 8664  C CG  . PRO F 3 154 ? -11.961 46.966  45.708  1.00 44.14  ? 154 PRO F CG  1 
ATOM 8665  C CD  . PRO F 3 154 ? -12.324 47.152  44.218  1.00 44.71  ? 154 PRO F CD  1 
ATOM 8666  N N   . VAL F 3 155 ? -12.229 50.271  47.099  1.00 46.70  ? 155 VAL F N   1 
ATOM 8667  C CA  . VAL F 3 155 ? -11.223 51.199  47.566  1.00 44.48  ? 155 VAL F CA  1 
ATOM 8668  C C   . VAL F 3 155 ? -10.869 50.800  48.987  1.00 44.91  ? 155 VAL F C   1 
ATOM 8669  O O   . VAL F 3 155 ? -11.732 50.426  49.788  1.00 40.29  ? 155 VAL F O   1 
ATOM 8670  C CB  . VAL F 3 155 ? -11.738 52.652  47.537  1.00 42.95  ? 155 VAL F CB  1 
ATOM 8671  C CG1 . VAL F 3 155 ? -11.656 53.277  48.908  1.00 39.54  ? 155 VAL F CG1 1 
ATOM 8672  C CG2 . VAL F 3 155 ? -10.919 53.454  46.549  1.00 41.67  ? 155 VAL F CG2 1 
ATOM 8673  N N   . THR F 3 156 ? -9.588  50.872  49.295  1.00 47.27  ? 156 THR F N   1 
ATOM 8674  C CA  . THR F 3 156 ? -9.140  50.505  50.616  1.00 49.08  ? 156 THR F CA  1 
ATOM 8675  C C   . THR F 3 156 ? -8.544  51.736  51.263  1.00 50.54  ? 156 THR F C   1 
ATOM 8676  O O   . THR F 3 156 ? -7.815  52.510  50.625  1.00 48.83  ? 156 THR F O   1 
ATOM 8677  C CB  . THR F 3 156 ? -8.053  49.451  50.550  1.00 49.20  ? 156 THR F CB  1 
ATOM 8678  O OG1 . THR F 3 156 ? -6.781  50.109  50.511  1.00 50.89  ? 156 THR F OG1 1 
ATOM 8679  C CG2 . THR F 3 156 ? -8.207  48.609  49.285  1.00 45.15  ? 156 THR F CG2 1 
ATOM 8680  N N   . VAL F 3 157 ? -8.841  51.905  52.542  1.00 49.24  ? 157 VAL F N   1 
ATOM 8681  C CA  . VAL F 3 157 ? -8.322  53.046  53.262  1.00 48.28  ? 157 VAL F CA  1 
ATOM 8682  C C   . VAL F 3 157 ? -7.774  52.617  54.617  1.00 48.28  ? 157 VAL F C   1 
ATOM 8683  O O   . VAL F 3 157 ? -8.311  51.721  55.279  1.00 45.59  ? 157 VAL F O   1 
ATOM 8684  C CB  . VAL F 3 157 ? -9.427  54.110  53.456  1.00 45.37  ? 157 VAL F CB  1 
ATOM 8685  C CG1 . VAL F 3 157 ? -10.399 54.056  52.294  1.00 41.60  ? 157 VAL F CG1 1 
ATOM 8686  C CG2 . VAL F 3 157 ? -10.159 53.886  54.751  1.00 44.78  ? 157 VAL F CG2 1 
ATOM 8687  N N   . THR F 3 158 ? -6.686  53.254  55.017  1.00 48.89  ? 158 THR F N   1 
ATOM 8688  C CA  . THR F 3 158 ? -6.083  52.958  56.300  1.00 49.04  ? 158 THR F CA  1 
ATOM 8689  C C   . THR F 3 158 ? -5.565  54.248  56.883  1.00 50.84  ? 158 THR F C   1 
ATOM 8690  O O   . THR F 3 158 ? -5.327  55.217  56.157  1.00 51.23  ? 158 THR F O   1 
ATOM 8691  C CB  . THR F 3 158 ? -4.921  51.993  56.162  1.00 46.21  ? 158 THR F CB  1 
ATOM 8692  O OG1 . THR F 3 158 ? -3.998  52.494  55.186  1.00 42.16  ? 158 THR F OG1 1 
ATOM 8693  C CG2 . THR F 3 158 ? -5.432  50.633  55.753  1.00 49.16  ? 158 THR F CG2 1 
ATOM 8694  N N   . TRP F 3 159 ? -5.395  54.261  58.198  1.00 49.56  ? 159 TRP F N   1 
ATOM 8695  C CA  . TRP F 3 159 ? -4.894  55.447  58.859  1.00 47.12  ? 159 TRP F CA  1 
ATOM 8696  C C   . TRP F 3 159 ? -3.474  55.261  59.356  1.00 44.63  ? 159 TRP F C   1 
ATOM 8697  O O   . TRP F 3 159 ? -3.157  54.284  60.036  1.00 35.21  ? 159 TRP F O   1 
ATOM 8698  C CB  . TRP F 3 159 ? -5.815  55.831  60.002  1.00 48.54  ? 159 TRP F CB  1 
ATOM 8699  C CG  . TRP F 3 159 ? -7.149  56.275  59.523  1.00 46.17  ? 159 TRP F CG  1 
ATOM 8700  C CD1 . TRP F 3 159 ? -8.234  55.488  59.255  1.00 46.08  ? 159 TRP F CD1 1 
ATOM 8701  C CD2 . TRP F 3 159 ? -7.546  57.620  59.246  1.00 43.86  ? 159 TRP F CD2 1 
ATOM 8702  N NE1 . TRP F 3 159 ? -9.291  56.266  58.829  1.00 47.78  ? 159 TRP F NE1 1 
ATOM 8703  C CE2 . TRP F 3 159 ? -8.894  57.578  58.811  1.00 45.15  ? 159 TRP F CE2 1 
ATOM 8704  C CE3 . TRP F 3 159 ? -6.892  58.857  59.318  1.00 38.22  ? 159 TRP F CE3 1 
ATOM 8705  C CZ2 . TRP F 3 159 ? -9.600  58.726  58.457  1.00 42.14  ? 159 TRP F CZ2 1 
ATOM 8706  C CZ3 . TRP F 3 159 ? -7.589  59.995  58.968  1.00 40.09  ? 159 TRP F CZ3 1 
ATOM 8707  C CH2 . TRP F 3 159 ? -8.933  59.922  58.539  1.00 45.67  ? 159 TRP F CH2 1 
ATOM 8708  N N   . ASN F 3 160 ? -2.629  56.224  59.009  1.00 45.11  ? 160 ASN F N   1 
ATOM 8709  C CA  . ASN F 3 160 ? -1.230  56.189  59.378  1.00 47.69  ? 160 ASN F CA  1 
ATOM 8710  C C   . ASN F 3 160 ? -0.688  54.863  58.917  1.00 49.74  ? 160 ASN F C   1 
ATOM 8711  O O   . ASN F 3 160 ? -0.109  54.104  59.694  1.00 53.50  ? 160 ASN F O   1 
ATOM 8712  C CB  . ASN F 3 160 ? -1.049  56.335  60.887  1.00 48.34  ? 160 ASN F CB  1 
ATOM 8713  C CG  . ASN F 3 160 ? -1.227  57.763  61.352  1.00 49.65  ? 160 ASN F CG  1 
ATOM 8714  O OD1 . ASN F 3 160 ? -1.074  58.708  60.572  1.00 50.23  ? 160 ASN F OD1 1 
ATOM 8715  N ND2 . ASN F 3 160 ? -1.537  57.933  62.632  1.00 52.22  ? 160 ASN F ND2 1 
ATOM 8716  N N   . SER F 3 161 ? -0.920  54.579  57.643  1.00 48.25  ? 161 SER F N   1 
ATOM 8717  C CA  . SER F 3 161 ? -0.446  53.351  57.029  1.00 47.18  ? 161 SER F CA  1 
ATOM 8718  C C   . SER F 3 161 ? -0.775  52.091  57.827  1.00 47.53  ? 161 SER F C   1 
ATOM 8719  O O   . SER F 3 161 ? 0.050   51.195  57.916  1.00 48.24  ? 161 SER F O   1 
ATOM 8720  C CB  . SER F 3 161 ? 1.063   53.444  56.833  1.00 43.71  ? 161 SER F CB  1 
ATOM 8721  O OG  . SER F 3 161 ? 1.427   54.769  56.481  1.00 45.09  ? 161 SER F OG  1 
ATOM 8722  N N   . GLY F 3 162 ? -1.963  52.019  58.418  1.00 48.06  ? 162 GLY F N   1 
ATOM 8723  C CA  . GLY F 3 162 ? -2.320  50.825  59.162  1.00 48.91  ? 162 GLY F CA  1 
ATOM 8724  C C   . GLY F 3 162 ? -2.025  50.821  60.653  1.00 50.29  ? 162 GLY F C   1 
ATOM 8725  O O   . GLY F 3 162 ? -2.578  49.989  61.380  1.00 51.89  ? 162 GLY F O   1 
ATOM 8726  N N   . SER F 3 163 ? -1.158  51.720  61.118  1.00 50.98  ? 163 SER F N   1 
ATOM 8727  C CA  . SER F 3 163 ? -0.822  51.794  62.544  1.00 49.32  ? 163 SER F CA  1 
ATOM 8728  C C   . SER F 3 163 ? -2.102  51.935  63.351  1.00 51.20  ? 163 SER F C   1 
ATOM 8729  O O   . SER F 3 163 ? -2.319  51.232  64.345  1.00 54.15  ? 163 SER F O   1 
ATOM 8730  C CB  . SER F 3 163 ? 0.082   52.987  62.808  1.00 43.54  ? 163 SER F CB  1 
ATOM 8731  O OG  . SER F 3 163 ? 1.292   52.832  62.090  1.00 42.69  ? 163 SER F OG  1 
ATOM 8732  N N   . LEU F 3 164 ? -2.949  52.855  62.910  1.00 52.71  ? 164 LEU F N   1 
ATOM 8733  C CA  . LEU F 3 164 ? -4.232  53.080  63.557  1.00 54.18  ? 164 LEU F CA  1 
ATOM 8734  C C   . LEU F 3 164 ? -5.276  52.118  63.028  1.00 56.40  ? 164 LEU F C   1 
ATOM 8735  O O   . LEU F 3 164 ? -5.701  52.232  61.873  1.00 56.55  ? 164 LEU F O   1 
ATOM 8736  C CB  . LEU F 3 164 ? -4.730  54.483  63.291  1.00 51.95  ? 164 LEU F CB  1 
ATOM 8737  C CG  . LEU F 3 164 ? -3.989  55.570  64.031  1.00 53.41  ? 164 LEU F CG  1 
ATOM 8738  C CD1 . LEU F 3 164 ? -4.799  56.841  63.915  1.00 54.73  ? 164 LEU F CD1 1 
ATOM 8739  C CD2 . LEU F 3 164 ? -3.830  55.165  65.493  1.00 55.55  ? 164 LEU F CD2 1 
ATOM 8740  N N   . SER F 3 165 ? -5.704  51.187  63.871  1.00 58.42  ? 165 SER F N   1 
ATOM 8741  C CA  . SER F 3 165 ? -6.705  50.210  63.466  1.00 59.67  ? 165 SER F CA  1 
ATOM 8742  C C   . SER F 3 165 ? -7.889  50.221  64.420  1.00 59.31  ? 165 SER F C   1 
ATOM 8743  O O   . SER F 3 165 ? -9.020  49.891  64.038  1.00 58.68  ? 165 SER F O   1 
ATOM 8744  C CB  . SER F 3 165 ? -6.078  48.814  63.421  1.00 60.73  ? 165 SER F CB  1 
ATOM 8745  O OG  . SER F 3 165 ? -5.309  48.581  64.583  1.00 62.09  ? 165 SER F OG  1 
ATOM 8746  N N   . SER F 3 166 ? -7.620  50.604  65.664  1.00 58.91  ? 166 SER F N   1 
ATOM 8747  C CA  . SER F 3 166 ? -8.654  50.670  66.687  1.00 58.86  ? 166 SER F CA  1 
ATOM 8748  C C   . SER F 3 166 ? -9.278  52.053  66.650  1.00 57.90  ? 166 SER F C   1 
ATOM 8749  O O   . SER F 3 166 ? -8.563  53.064  66.682  1.00 56.06  ? 166 SER F O   1 
ATOM 8750  C CB  . SER F 3 166 ? -8.037  50.423  68.061  1.00 61.30  ? 166 SER F CB  1 
ATOM 8751  O OG  . SER F 3 166 ? -6.871  51.216  68.212  1.00 68.46  ? 166 SER F OG  1 
ATOM 8752  N N   . GLY F 3 167 ? -10.606 52.099  66.568  1.00 57.28  ? 167 GLY F N   1 
ATOM 8753  C CA  . GLY F 3 167 ? -11.295 53.377  66.545  1.00 55.38  ? 167 GLY F CA  1 
ATOM 8754  C C   . GLY F 3 167 ? -11.563 53.930  65.160  1.00 54.60  ? 167 GLY F C   1 
ATOM 8755  O O   . GLY F 3 167 ? -11.983 55.083  65.006  1.00 56.32  ? 167 GLY F O   1 
ATOM 8756  N N   . VAL F 3 168 ? -11.319 53.113  64.143  1.00 51.43  ? 168 VAL F N   1 
ATOM 8757  C CA  . VAL F 3 168 ? -11.550 53.530  62.774  1.00 46.89  ? 168 VAL F CA  1 
ATOM 8758  C C   . VAL F 3 168 ? -12.841 52.900  62.323  1.00 45.74  ? 168 VAL F C   1 
ATOM 8759  O O   . VAL F 3 168 ? -13.129 51.757  62.671  1.00 47.57  ? 168 VAL F O   1 
ATOM 8760  C CB  . VAL F 3 168 ? -10.453 53.024  61.854  1.00 45.69  ? 168 VAL F CB  1 
ATOM 8761  C CG1 . VAL F 3 168 ? -9.111  53.576  62.284  1.00 46.17  ? 168 VAL F CG1 1 
ATOM 8762  C CG2 . VAL F 3 168 ? -10.420 51.511  61.909  1.00 48.53  ? 168 VAL F CG2 1 
ATOM 8763  N N   . HIS F 3 169 ? -13.630 53.647  61.569  1.00 45.32  ? 169 HIS F N   1 
ATOM 8764  C CA  . HIS F 3 169 ? -14.880 53.126  61.038  1.00 45.93  ? 169 HIS F CA  1 
ATOM 8765  C C   . HIS F 3 169 ? -14.923 53.564  59.601  1.00 45.71  ? 169 HIS F C   1 
ATOM 8766  O O   . HIS F 3 169 ? -14.968 54.761  59.323  1.00 45.48  ? 169 HIS F O   1 
ATOM 8767  C CB  . HIS F 3 169 ? -16.102 53.714  61.737  1.00 46.41  ? 169 HIS F CB  1 
ATOM 8768  C CG  . HIS F 3 169 ? -16.281 53.256  63.147  1.00 48.14  ? 169 HIS F CG  1 
ATOM 8769  N ND1 . HIS F 3 169 ? -17.410 53.545  63.880  1.00 50.36  ? 169 HIS F ND1 1 
ATOM 8770  C CD2 . HIS F 3 169 ? -15.465 52.559  63.971  1.00 48.85  ? 169 HIS F CD2 1 
ATOM 8771  C CE1 . HIS F 3 169 ? -17.282 53.048  65.098  1.00 49.53  ? 169 HIS F CE1 1 
ATOM 8772  N NE2 . HIS F 3 169 ? -16.110 52.446  65.179  1.00 50.77  ? 169 HIS F NE2 1 
ATOM 8773  N N   . THR F 3 170 ? -14.875 52.609  58.683  1.00 46.02  ? 170 THR F N   1 
ATOM 8774  C CA  . THR F 3 170 ? -14.949 52.941  57.271  1.00 47.84  ? 170 THR F CA  1 
ATOM 8775  C C   . THR F 3 170 ? -16.324 52.509  56.810  1.00 46.97  ? 170 THR F C   1 
ATOM 8776  O O   . THR F 3 170 ? -16.757 51.387  57.055  1.00 47.73  ? 170 THR F O   1 
ATOM 8777  C CB  . THR F 3 170 ? -13.894 52.220  56.460  1.00 50.22  ? 170 THR F CB  1 
ATOM 8778  O OG1 . THR F 3 170 ? -12.596 52.634  56.905  1.00 50.40  ? 170 THR F OG1 1 
ATOM 8779  C CG2 . THR F 3 170 ? -14.066 52.547  54.981  1.00 51.57  ? 170 THR F CG2 1 
ATOM 8780  N N   . PHE F 3 171 ? -17.018 53.400  56.132  1.00 47.09  ? 171 PHE F N   1 
ATOM 8781  C CA  . PHE F 3 171 ? -18.361 53.077  55.736  1.00 46.53  ? 171 PHE F CA  1 
ATOM 8782  C C   . PHE F 3 171 ? -18.506 52.530  54.343  1.00 45.93  ? 171 PHE F C   1 
ATOM 8783  O O   . PHE F 3 171 ? -17.753 52.877  53.426  1.00 45.40  ? 171 PHE F O   1 
ATOM 8784  C CB  . PHE F 3 171 ? -19.252 54.310  55.927  1.00 45.77  ? 171 PHE F CB  1 
ATOM 8785  C CG  . PHE F 3 171 ? -19.357 54.760  57.364  1.00 45.35  ? 171 PHE F CG  1 
ATOM 8786  C CD1 . PHE F 3 171 ? -20.560 54.655  58.056  1.00 44.30  ? 171 PHE F CD1 1 
ATOM 8787  C CD2 . PHE F 3 171 ? -18.232 55.221  58.046  1.00 43.21  ? 171 PHE F CD2 1 
ATOM 8788  C CE1 . PHE F 3 171 ? -20.636 54.996  59.409  1.00 43.35  ? 171 PHE F CE1 1 
ATOM 8789  C CE2 . PHE F 3 171 ? -18.298 55.561  59.393  1.00 42.41  ? 171 PHE F CE2 1 
ATOM 8790  C CZ  . PHE F 3 171 ? -19.499 55.448  60.076  1.00 43.83  ? 171 PHE F CZ  1 
ATOM 8791  N N   . PRO F 3 172 ? -19.478 51.631  54.173  1.00 43.90  ? 172 PRO F N   1 
ATOM 8792  C CA  . PRO F 3 172 ? -19.748 51.020  52.877  1.00 41.50  ? 172 PRO F CA  1 
ATOM 8793  C C   . PRO F 3 172 ? -20.083 52.108  51.865  1.00 40.77  ? 172 PRO F C   1 
ATOM 8794  O O   . PRO F 3 172 ? -20.885 53.007  52.143  1.00 41.62  ? 172 PRO F O   1 
ATOM 8795  C CB  . PRO F 3 172 ? -20.929 50.090  53.173  1.00 40.86  ? 172 PRO F CB  1 
ATOM 8796  C CG  . PRO F 3 172 ? -21.582 50.704  54.380  1.00 42.82  ? 172 PRO F CG  1 
ATOM 8797  C CD  . PRO F 3 172 ? -20.382 51.096  55.204  1.00 42.98  ? 172 PRO F CD  1 
ATOM 8798  N N   . ALA F 3 173 ? -19.462 52.026  50.696  1.00 39.46  ? 173 ALA F N   1 
ATOM 8799  C CA  . ALA F 3 173 ? -19.690 53.011  49.656  1.00 40.79  ? 173 ALA F CA  1 
ATOM 8800  C C   . ALA F 3 173 ? -21.130 53.036  49.166  1.00 41.65  ? 173 ALA F C   1 
ATOM 8801  O O   . ALA F 3 173 ? -21.907 52.110  49.411  1.00 37.30  ? 173 ALA F O   1 
ATOM 8802  C CB  . ALA F 3 173 ? -18.759 52.757  48.485  1.00 40.99  ? 173 ALA F CB  1 
ATOM 8803  N N   . VAL F 3 174 ? -21.467 54.131  48.483  1.00 46.32  ? 174 VAL F N   1 
ATOM 8804  C CA  . VAL F 3 174 ? -22.785 54.342  47.897  1.00 47.05  ? 174 VAL F CA  1 
ATOM 8805  C C   . VAL F 3 174 ? -22.566 54.748  46.448  1.00 49.36  ? 174 VAL F C   1 
ATOM 8806  O O   . VAL F 3 174 ? -21.637 55.500  46.124  1.00 42.96  ? 174 VAL F O   1 
ATOM 8807  C CB  . VAL F 3 174 ? -23.573 55.445  48.617  1.00 43.58  ? 174 VAL F CB  1 
ATOM 8808  C CG1 . VAL F 3 174 ? -23.804 55.052  50.062  1.00 46.81  ? 174 VAL F CG1 1 
ATOM 8809  C CG2 . VAL F 3 174 ? -22.820 56.753  48.539  1.00 48.97  ? 174 VAL F CG2 1 
ATOM 8810  N N   . LEU F 3 175 ? -23.424 54.237  45.575  1.00 55.87  ? 175 LEU F N   1 
ATOM 8811  C CA  . LEU F 3 175 ? -23.293 54.520  44.163  1.00 60.86  ? 175 LEU F CA  1 
ATOM 8812  C C   . LEU F 3 175 ? -24.147 55.694  43.735  1.00 67.77  ? 175 LEU F C   1 
ATOM 8813  O O   . LEU F 3 175 ? -25.374 55.606  43.713  1.00 70.13  ? 175 LEU F O   1 
ATOM 8814  C CB  . LEU F 3 175 ? -23.649 53.270  43.350  1.00 59.82  ? 175 LEU F CB  1 
ATOM 8815  C CG  . LEU F 3 175 ? -23.389 53.266  41.838  1.00 60.85  ? 175 LEU F CG  1 
ATOM 8816  C CD1 . LEU F 3 175 ? -24.456 54.073  41.106  1.00 66.49  ? 175 LEU F CD1 1 
ATOM 8817  C CD2 . LEU F 3 175 ? -22.008 53.825  41.571  1.00 57.15  ? 175 LEU F CD2 1 
ATOM 8818  N N   . GLN F 3 176 ? -23.482 56.798  43.400  1.00 72.92  ? 176 GLN F N   1 
ATOM 8819  C CA  . GLN F 3 176 ? -24.159 58.006  42.941  1.00 74.76  ? 176 GLN F CA  1 
ATOM 8820  C C   . GLN F 3 176 ? -23.966 58.067  41.429  1.00 71.53  ? 176 GLN F C   1 
ATOM 8821  O O   . GLN F 3 176 ? -22.847 58.240  40.937  1.00 72.62  ? 176 GLN F O   1 
ATOM 8822  C CB  . GLN F 3 176 ? -23.554 59.250  43.617  1.00 84.82  ? 176 GLN F CB  1 
ATOM 8823  C CG  . GLN F 3 176 ? -24.295 60.561  43.321  1.00 95.09  ? 176 GLN F CG  1 
ATOM 8824  C CD  . GLN F 3 176 ? -25.827 60.388  43.289  1.00 101.02 ? 176 GLN F CD  1 
ATOM 8825  O OE1 . GLN F 3 176 ? -26.446 59.928  44.260  1.00 103.85 ? 176 GLN F OE1 1 
ATOM 8826  N NE2 . GLN F 3 176 ? -26.436 60.754  42.161  1.00 103.28 ? 176 GLN F NE2 1 
ATOM 8827  N N   . SER F 3 177 ? -25.058 57.893  40.702  1.00 68.18  ? 177 SER F N   1 
ATOM 8828  C CA  . SER F 3 177 ? -25.016 57.915  39.256  1.00 70.14  ? 177 SER F CA  1 
ATOM 8829  C C   . SER F 3 177 ? -23.653 57.521  38.709  1.00 67.94  ? 177 SER F C   1 
ATOM 8830  O O   . SER F 3 177 ? -22.893 58.371  38.254  1.00 65.90  ? 177 SER F O   1 
ATOM 8831  C CB  . SER F 3 177 ? -25.386 59.300  38.733  1.00 73.17  ? 177 SER F CB  1 
ATOM 8832  O OG  . SER F 3 177 ? -25.502 59.271  37.320  1.00 82.50  ? 177 SER F OG  1 
ATOM 8833  N N   . ASP F 3 178 ? -23.345 56.230  38.778  1.00 67.54  ? 178 ASP F N   1 
ATOM 8834  C CA  . ASP F 3 178 ? -22.088 55.688  38.266  1.00 67.11  ? 178 ASP F CA  1 
ATOM 8835  C C   . ASP F 3 178 ? -20.810 56.142  38.936  1.00 66.74  ? 178 ASP F C   1 
ATOM 8836  O O   . ASP F 3 178 ? -19.741 56.082  38.320  1.00 68.40  ? 178 ASP F O   1 
ATOM 8837  C CB  . ASP F 3 178 ? -21.964 55.959  36.774  1.00 69.56  ? 178 ASP F CB  1 
ATOM 8838  C CG  . ASP F 3 178 ? -22.944 55.155  35.973  1.00 72.48  ? 178 ASP F CG  1 
ATOM 8839  O OD1 . ASP F 3 178 ? -22.933 55.280  34.732  1.00 74.13  ? 178 ASP F OD1 1 
ATOM 8840  O OD2 . ASP F 3 178 ? -23.729 54.394  36.590  1.00 73.55  ? 178 ASP F OD2 1 
ATOM 8841  N N   . LEU F 3 179 ? -20.906 56.597  40.182  1.00 62.85  ? 179 LEU F N   1 
ATOM 8842  C CA  . LEU F 3 179 ? -19.721 57.019  40.919  1.00 57.73  ? 179 LEU F CA  1 
ATOM 8843  C C   . LEU F 3 179 ? -19.882 56.746  42.388  1.00 55.19  ? 179 LEU F C   1 
ATOM 8844  O O   . LEU F 3 179 ? -20.775 57.280  43.037  1.00 52.65  ? 179 LEU F O   1 
ATOM 8845  C CB  . LEU F 3 179 ? -19.422 58.501  40.717  1.00 56.19  ? 179 LEU F CB  1 
ATOM 8846  C CG  . LEU F 3 179 ? -18.747 58.873  39.391  1.00 58.57  ? 179 LEU F CG  1 
ATOM 8847  C CD1 . LEU F 3 179 ? -18.026 60.193  39.569  1.00 63.26  ? 179 LEU F CD1 1 
ATOM 8848  C CD2 . LEU F 3 179 ? -17.734 57.815  38.968  1.00 57.70  ? 179 LEU F CD2 1 
ATOM 8849  N N   . TYR F 3 180 ? -19.002 55.909  42.912  1.00 53.86  ? 180 TYR F N   1 
ATOM 8850  C CA  . TYR F 3 180 ? -19.069 55.567  44.314  1.00 53.73  ? 180 TYR F CA  1 
ATOM 8851  C C   . TYR F 3 180 ? -18.465 56.647  45.163  1.00 53.67  ? 180 TYR F C   1 
ATOM 8852  O O   . TYR F 3 180 ? -17.708 57.500  44.689  1.00 53.81  ? 180 TYR F O   1 
ATOM 8853  C CB  . TYR F 3 180 ? -18.335 54.259  44.604  1.00 54.02  ? 180 TYR F CB  1 
ATOM 8854  C CG  . TYR F 3 180 ? -18.973 53.043  43.982  1.00 52.17  ? 180 TYR F CG  1 
ATOM 8855  C CD1 . TYR F 3 180 ? -18.623 52.628  42.699  1.00 48.35  ? 180 TYR F CD1 1 
ATOM 8856  C CD2 . TYR F 3 180 ? -19.921 52.308  44.682  1.00 50.39  ? 180 TYR F CD2 1 
ATOM 8857  C CE1 . TYR F 3 180 ? -19.202 51.505  42.132  1.00 49.12  ? 180 TYR F CE1 1 
ATOM 8858  C CE2 . TYR F 3 180 ? -20.506 51.182  44.123  1.00 51.37  ? 180 TYR F CE2 1 
ATOM 8859  C CZ  . TYR F 3 180 ? -20.141 50.784  42.851  1.00 52.85  ? 180 TYR F CZ  1 
ATOM 8860  O OH  . TYR F 3 180 ? -20.700 49.643  42.316  1.00 63.85  ? 180 TYR F OH  1 
ATOM 8861  N N   . THR F 3 181 ? -18.807 56.600  46.438  1.00 51.46  ? 181 THR F N   1 
ATOM 8862  C CA  . THR F 3 181 ? -18.285 57.562  47.374  1.00 50.01  ? 181 THR F CA  1 
ATOM 8863  C C   . THR F 3 181 ? -18.484 57.010  48.781  1.00 49.21  ? 181 THR F C   1 
ATOM 8864  O O   . THR F 3 181 ? -19.570 56.555  49.141  1.00 45.61  ? 181 THR F O   1 
ATOM 8865  C CB  . THR F 3 181 ? -18.963 58.959  47.174  1.00 48.34  ? 181 THR F CB  1 
ATOM 8866  O OG1 . THR F 3 181 ? -19.205 59.557  48.444  1.00 42.47  ? 181 THR F OG1 1 
ATOM 8867  C CG2 . THR F 3 181 ? -20.284 58.844  46.401  1.00 52.53  ? 181 THR F CG2 1 
ATOM 8868  N N   . LEU F 3 182 ? -17.407 56.996  49.558  1.00 50.19  ? 182 LEU F N   1 
ATOM 8869  C CA  . LEU F 3 182 ? -17.483 56.501  50.923  1.00 50.78  ? 182 LEU F CA  1 
ATOM 8870  C C   . LEU F 3 182 ? -16.639 57.374  51.826  1.00 50.89  ? 182 LEU F C   1 
ATOM 8871  O O   . LEU F 3 182 ? -15.851 58.199  51.356  1.00 49.87  ? 182 LEU F O   1 
ATOM 8872  C CB  . LEU F 3 182 ? -16.996 55.054  51.016  1.00 54.10  ? 182 LEU F CB  1 
ATOM 8873  C CG  . LEU F 3 182 ? -15.492 54.754  50.965  1.00 54.84  ? 182 LEU F CG  1 
ATOM 8874  C CD1 . LEU F 3 182 ? -14.753 55.224  52.216  1.00 54.88  ? 182 LEU F CD1 1 
ATOM 8875  C CD2 . LEU F 3 182 ? -15.348 53.267  50.842  1.00 56.44  ? 182 LEU F CD2 1 
ATOM 8876  N N   . SER F 3 183 ? -16.768 57.138  53.124  1.00 48.99  ? 183 SER F N   1 
ATOM 8877  C CA  . SER F 3 183 ? -16.069 57.925  54.124  1.00 48.16  ? 183 SER F CA  1 
ATOM 8878  C C   . SER F 3 183 ? -15.569 57.074  55.274  1.00 45.90  ? 183 SER F C   1 
ATOM 8879  O O   . SER F 3 183 ? -16.198 56.088  55.636  1.00 47.42  ? 183 SER F O   1 
ATOM 8880  C CB  . SER F 3 183 ? -17.055 58.932  54.671  1.00 51.55  ? 183 SER F CB  1 
ATOM 8881  O OG  . SER F 3 183 ? -18.271 58.243  54.968  1.00 52.67  ? 183 SER F OG  1 
ATOM 8882  N N   . SER F 3 184 ? -14.452 57.469  55.864  1.00 42.99  ? 184 SER F N   1 
ATOM 8883  C CA  . SER F 3 184 ? -13.915 56.740  56.998  1.00 43.52  ? 184 SER F CA  1 
ATOM 8884  C C   . SER F 3 184 ? -13.528 57.715  58.094  1.00 43.59  ? 184 SER F C   1 
ATOM 8885  O O   . SER F 3 184 ? -12.957 58.772  57.817  1.00 41.92  ? 184 SER F O   1 
ATOM 8886  C CB  . SER F 3 184 ? -12.689 55.933  56.591  1.00 46.70  ? 184 SER F CB  1 
ATOM 8887  O OG  . SER F 3 184 ? -12.089 55.324  57.726  1.00 52.32  ? 184 SER F OG  1 
ATOM 8888  N N   . SER F 3 185 ? -13.824 57.346  59.338  1.00 42.59  ? 185 SER F N   1 
ATOM 8889  C CA  . SER F 3 185 ? -13.519 58.191  60.484  1.00 40.89  ? 185 SER F CA  1 
ATOM 8890  C C   . SER F 3 185 ? -12.572 57.522  61.445  1.00 37.51  ? 185 SER F C   1 
ATOM 8891  O O   . SER F 3 185 ? -12.412 56.313  61.425  1.00 36.78  ? 185 SER F O   1 
ATOM 8892  C CB  . SER F 3 185 ? -14.801 58.518  61.248  1.00 43.46  ? 185 SER F CB  1 
ATOM 8893  O OG  . SER F 3 185 ? -15.205 57.438  62.077  1.00 41.30  ? 185 SER F OG  1 
ATOM 8894  N N   . VAL F 3 186 ? -11.952 58.316  62.301  1.00 40.97  ? 186 VAL F N   1 
ATOM 8895  C CA  . VAL F 3 186 ? -11.054 57.776  63.314  1.00 46.64  ? 186 VAL F CA  1 
ATOM 8896  C C   . VAL F 3 186 ? -11.425 58.457  64.611  1.00 49.34  ? 186 VAL F C   1 
ATOM 8897  O O   . VAL F 3 186 ? -12.322 59.287  64.638  1.00 54.32  ? 186 VAL F O   1 
ATOM 8898  C CB  . VAL F 3 186 ? -9.597  58.120  63.060  1.00 44.34  ? 186 VAL F CB  1 
ATOM 8899  C CG1 . VAL F 3 186 ? -8.730  56.920  63.374  1.00 39.86  ? 186 VAL F CG1 1 
ATOM 8900  C CG2 . VAL F 3 186 ? -9.420  58.600  61.655  1.00 46.22  ? 186 VAL F CG2 1 
ATOM 8901  N N   . THR F 3 187 ? -10.725 58.118  65.682  1.00 51.35  ? 187 THR F N   1 
ATOM 8902  C CA  . THR F 3 187 ? -10.986 58.724  66.974  1.00 50.83  ? 187 THR F CA  1 
ATOM 8903  C C   . THR F 3 187 ? -9.789  58.419  67.825  1.00 50.60  ? 187 THR F C   1 
ATOM 8904  O O   . THR F 3 187 ? -9.322  57.283  67.831  1.00 45.52  ? 187 THR F O   1 
ATOM 8905  C CB  . THR F 3 187 ? -12.208 58.126  67.643  1.00 52.23  ? 187 THR F CB  1 
ATOM 8906  O OG1 . THR F 3 187 ? -13.332 58.202  66.752  1.00 53.98  ? 187 THR F OG1 1 
ATOM 8907  C CG2 . THR F 3 187 ? -12.517 58.890  68.912  1.00 47.97  ? 187 THR F CG2 1 
ATOM 8908  N N   . VAL F 3 188 ? -9.299  59.432  68.539  1.00 54.89  ? 188 VAL F N   1 
ATOM 8909  C CA  . VAL F 3 188 ? -8.111  59.292  69.391  1.00 58.89  ? 188 VAL F CA  1 
ATOM 8910  C C   . VAL F 3 188 ? -8.083  60.238  70.595  1.00 61.04  ? 188 VAL F C   1 
ATOM 8911  O O   . VAL F 3 188 ? -8.931  61.122  70.738  1.00 61.37  ? 188 VAL F O   1 
ATOM 8912  C CB  . VAL F 3 188 ? -6.817  59.588  68.598  1.00 57.07  ? 188 VAL F CB  1 
ATOM 8913  C CG1 . VAL F 3 188 ? -6.755  58.743  67.343  1.00 55.46  ? 188 VAL F CG1 1 
ATOM 8914  C CG2 . VAL F 3 188 ? -6.757  61.072  68.261  1.00 54.27  ? 188 VAL F CG2 1 
ATOM 8915  N N   . PRO F 3 189 ? -7.091  60.052  71.478  1.00 62.11  ? 189 PRO F N   1 
ATOM 8916  C CA  . PRO F 3 189 ? -6.948  60.900  72.658  1.00 63.84  ? 189 PRO F CA  1 
ATOM 8917  C C   . PRO F 3 189 ? -6.718  62.336  72.191  1.00 65.82  ? 189 PRO F C   1 
ATOM 8918  O O   . PRO F 3 189 ? -5.840  62.598  71.364  1.00 64.22  ? 189 PRO F O   1 
ATOM 8919  C CB  . PRO F 3 189 ? -5.723  60.316  73.340  1.00 64.53  ? 189 PRO F CB  1 
ATOM 8920  C CG  . PRO F 3 189 ? -5.850  58.862  73.024  1.00 64.68  ? 189 PRO F CG  1 
ATOM 8921  C CD  . PRO F 3 189 ? -6.179  58.898  71.561  1.00 63.93  ? 189 PRO F CD  1 
ATOM 8922  N N   . SER F 3 190 ? -7.516  63.259  72.715  1.00 67.03  ? 190 SER F N   1 
ATOM 8923  C CA  . SER F 3 190 ? -7.403  64.662  72.342  1.00 64.59  ? 190 SER F CA  1 
ATOM 8924  C C   . SER F 3 190 ? -5.954  65.096  72.473  1.00 62.56  ? 190 SER F C   1 
ATOM 8925  O O   . SER F 3 190 ? -5.504  66.025  71.801  1.00 59.08  ? 190 SER F O   1 
ATOM 8926  C CB  . SER F 3 190 ? -8.294  65.496  73.250  1.00 67.18  ? 190 SER F CB  1 
ATOM 8927  O OG  . SER F 3 190 ? -9.593  64.927  73.323  1.00 69.88  ? 190 SER F OG  1 
ATOM 8928  N N   . SER F 3 191 ? -5.235  64.405  73.350  1.00 63.02  ? 191 SER F N   1 
ATOM 8929  C CA  . SER F 3 191 ? -3.822  64.666  73.581  1.00 64.79  ? 191 SER F CA  1 
ATOM 8930  C C   . SER F 3 191 ? -3.050  64.451  72.281  1.00 66.86  ? 191 SER F C   1 
ATOM 8931  O O   . SER F 3 191 ? -2.505  65.389  71.701  1.00 67.77  ? 191 SER F O   1 
ATOM 8932  C CB  . SER F 3 191 ? -3.289  63.708  74.651  1.00 64.56  ? 191 SER F CB  1 
ATOM 8933  O OG  . SER F 3 191 ? -3.447  62.350  74.268  1.00 64.68  ? 191 SER F OG  1 
ATOM 8934  N N   . THR F 3 192 ? -3.041  63.195  71.838  1.00 68.45  ? 192 THR F N   1 
ATOM 8935  C CA  . THR F 3 192 ? -2.361  62.732  70.626  1.00 68.73  ? 192 THR F CA  1 
ATOM 8936  C C   . THR F 3 192 ? -2.497  63.582  69.352  1.00 66.36  ? 192 THR F C   1 
ATOM 8937  O O   . THR F 3 192 ? -1.637  63.520  68.471  1.00 67.18  ? 192 THR F O   1 
ATOM 8938  C CB  . THR F 3 192 ? -2.820  61.308  70.278  1.00 69.13  ? 192 THR F CB  1 
ATOM 8939  O OG1 . THR F 3 192 ? -4.187  61.350  69.858  1.00 74.16  ? 192 THR F OG1 1 
ATOM 8940  C CG2 . THR F 3 192 ? -2.719  60.401  71.497  1.00 69.68  ? 192 THR F CG2 1 
ATOM 8941  N N   . TRP F 3 193 ? -3.571  64.354  69.234  1.00 61.73  ? 193 TRP F N   1 
ATOM 8942  C CA  . TRP F 3 193 ? -3.749  65.184  68.049  1.00 57.47  ? 193 TRP F CA  1 
ATOM 8943  C C   . TRP F 3 193 ? -4.089  66.614  68.428  1.00 54.69  ? 193 TRP F C   1 
ATOM 8944  O O   . TRP F 3 193 ? -4.844  66.852  69.367  1.00 54.77  ? 193 TRP F O   1 
ATOM 8945  C CB  . TRP F 3 193 ? -4.865  64.624  67.168  1.00 59.51  ? 193 TRP F CB  1 
ATOM 8946  C CG  . TRP F 3 193 ? -4.944  65.268  65.803  1.00 57.65  ? 193 TRP F CG  1 
ATOM 8947  C CD1 . TRP F 3 193 ? -4.113  65.046  64.735  1.00 58.81  ? 193 TRP F CD1 1 
ATOM 8948  C CD2 . TRP F 3 193 ? -5.880  66.260  65.377  1.00 55.68  ? 193 TRP F CD2 1 
ATOM 8949  N NE1 . TRP F 3 193 ? -4.476  65.842  63.673  1.00 55.79  ? 193 TRP F NE1 1 
ATOM 8950  C CE2 . TRP F 3 193 ? -5.558  66.597  64.041  1.00 56.12  ? 193 TRP F CE2 1 
ATOM 8951  C CE3 . TRP F 3 193 ? -6.961  66.900  65.992  1.00 55.00  ? 193 TRP F CE3 1 
ATOM 8952  C CZ2 . TRP F 3 193 ? -6.278  67.548  63.315  1.00 54.79  ? 193 TRP F CZ2 1 
ATOM 8953  C CZ3 . TRP F 3 193 ? -7.680  67.848  65.264  1.00 52.91  ? 193 TRP F CZ3 1 
ATOM 8954  C CH2 . TRP F 3 193 ? -7.334  68.160  63.942  1.00 54.42  ? 193 TRP F CH2 1 
ATOM 8955  N N   . PRO F 3 194 ? -3.546  67.587  67.691  1.00 52.39  ? 194 PRO F N   1 
ATOM 8956  C CA  . PRO F 3 194 ? -2.649  67.393  66.556  1.00 53.13  ? 194 PRO F CA  1 
ATOM 8957  C C   . PRO F 3 194 ? -1.206  67.406  67.004  1.00 55.72  ? 194 PRO F C   1 
ATOM 8958  O O   . PRO F 3 194 ? -0.300  67.662  66.209  1.00 53.45  ? 194 PRO F O   1 
ATOM 8959  C CB  . PRO F 3 194 ? -2.979  68.573  65.663  1.00 52.72  ? 194 PRO F CB  1 
ATOM 8960  C CG  . PRO F 3 194 ? -3.160  69.646  66.658  1.00 51.21  ? 194 PRO F CG  1 
ATOM 8961  C CD  . PRO F 3 194 ? -4.007  68.983  67.739  1.00 52.02  ? 194 PRO F CD  1 
ATOM 8962  N N   . SER F 3 195 ? -0.992  67.158  68.289  1.00 58.79  ? 195 SER F N   1 
ATOM 8963  C CA  . SER F 3 195 ? 0.367   67.119  68.801  1.00 64.24  ? 195 SER F CA  1 
ATOM 8964  C C   . SER F 3 195 ? 1.119   66.109  67.934  1.00 67.76  ? 195 SER F C   1 
ATOM 8965  O O   . SER F 3 195 ? 2.222   66.369  67.456  1.00 70.34  ? 195 SER F O   1 
ATOM 8966  C CB  . SER F 3 195 ? 0.362   66.684  70.267  1.00 65.13  ? 195 SER F CB  1 
ATOM 8967  O OG  . SER F 3 195 ? -0.462  65.550  70.457  1.00 65.78  ? 195 SER F OG  1 
ATOM 8968  N N   . GLU F 3 196 ? 0.507   64.950  67.734  1.00 70.29  ? 196 GLU F N   1 
ATOM 8969  C CA  . GLU F 3 196 ? 1.096   63.934  66.887  1.00 70.75  ? 196 GLU F CA  1 
ATOM 8970  C C   . GLU F 3 196 ? 0.401   64.084  65.552  1.00 69.78  ? 196 GLU F C   1 
ATOM 8971  O O   . GLU F 3 196 ? -0.549  64.857  65.424  1.00 70.74  ? 196 GLU F O   1 
ATOM 8972  C CB  . GLU F 3 196 ? 0.847   62.547  67.446  1.00 73.81  ? 196 GLU F CB  1 
ATOM 8973  C CG  . GLU F 3 196 ? 1.582   62.276  68.728  1.00 83.31  ? 196 GLU F CG  1 
ATOM 8974  C CD  . GLU F 3 196 ? 1.229   60.917  69.302  1.00 89.79  ? 196 GLU F CD  1 
ATOM 8975  O OE1 . GLU F 3 196 ? 1.473   59.892  68.620  1.00 93.40  ? 196 GLU F OE1 1 
ATOM 8976  O OE2 . GLU F 3 196 ? 0.700   60.874  70.435  1.00 94.33  ? 196 GLU F OE2 1 
ATOM 8977  N N   . THR F 3 197 ? 0.861   63.343  64.556  1.00 68.76  ? 197 THR F N   1 
ATOM 8978  C CA  . THR F 3 197 ? 0.272   63.455  63.236  1.00 65.19  ? 197 THR F CA  1 
ATOM 8979  C C   . THR F 3 197 ? -0.592  62.278  62.816  1.00 62.52  ? 197 THR F C   1 
ATOM 8980  O O   . THR F 3 197 ? -0.285  61.124  63.101  1.00 63.45  ? 197 THR F O   1 
ATOM 8981  C CB  . THR F 3 197 ? 1.367   63.683  62.183  1.00 64.96  ? 197 THR F CB  1 
ATOM 8982  O OG1 . THR F 3 197 ? 0.874   63.293  60.900  1.00 69.97  ? 197 THR F OG1 1 
ATOM 8983  C CG2 . THR F 3 197 ? 2.628   62.890  62.529  1.00 66.81  ? 197 THR F CG2 1 
ATOM 8984  N N   . VAL F 3 198 ? -1.688  62.593  62.139  1.00 60.13  ? 198 VAL F N   1 
ATOM 8985  C CA  . VAL F 3 198 ? -2.622  61.592  61.645  1.00 57.34  ? 198 VAL F CA  1 
ATOM 8986  C C   . VAL F 3 198 ? -2.877  61.804  60.166  1.00 60.00  ? 198 VAL F C   1 
ATOM 8987  O O   . VAL F 3 198 ? -3.009  62.939  59.690  1.00 61.86  ? 198 VAL F O   1 
ATOM 8988  C CB  . VAL F 3 198 ? -3.953  61.672  62.377  1.00 52.54  ? 198 VAL F CB  1 
ATOM 8989  C CG1 . VAL F 3 198 ? -5.041  60.988  61.573  1.00 47.15  ? 198 VAL F CG1 1 
ATOM 8990  C CG2 . VAL F 3 198 ? -3.802  61.036  63.728  1.00 52.21  ? 198 VAL F CG2 1 
ATOM 8991  N N   . THR F 3 199 ? -2.971  60.703  59.439  1.00 60.97  ? 199 THR F N   1 
ATOM 8992  C CA  . THR F 3 199 ? -3.193  60.792  58.011  1.00 59.01  ? 199 THR F CA  1 
ATOM 8993  C C   . THR F 3 199 ? -3.840  59.525  57.454  1.00 57.29  ? 199 THR F C   1 
ATOM 8994  O O   . THR F 3 199 ? -3.479  58.413  57.846  1.00 58.90  ? 199 THR F O   1 
ATOM 8995  C CB  . THR F 3 199 ? -1.856  61.067  57.320  1.00 57.30  ? 199 THR F CB  1 
ATOM 8996  O OG1 . THR F 3 199 ? -1.963  60.763  55.928  1.00 62.24  ? 199 THR F OG1 1 
ATOM 8997  C CG2 . THR F 3 199 ? -0.761  60.233  57.952  1.00 55.33  ? 199 THR F CG2 1 
ATOM 8998  N N   . CYS F 3 200 ? -4.810  59.692  56.556  1.00 52.69  ? 200 CYS F N   1 
ATOM 8999  C CA  . CYS F 3 200 ? -5.487  58.539  55.956  1.00 46.76  ? 200 CYS F CA  1 
ATOM 9000  C C   . CYS F 3 200 ? -4.843  58.202  54.626  1.00 45.39  ? 200 CYS F C   1 
ATOM 9001  O O   . CYS F 3 200 ? -4.538  59.089  53.818  1.00 41.92  ? 200 CYS F O   1 
ATOM 9002  C CB  . CYS F 3 200 ? -6.971  58.823  55.732  1.00 40.59  ? 200 CYS F CB  1 
ATOM 9003  S SG  . CYS F 3 200 ? -7.234  60.116  54.538  1.00 34.82  ? 200 CYS F SG  1 
ATOM 9004  N N   . ASN F 3 201 ? -4.633  56.908  54.415  1.00 47.04  ? 201 ASN F N   1 
ATOM 9005  C CA  . ASN F 3 201 ? -4.018  56.414  53.195  1.00 47.79  ? 201 ASN F CA  1 
ATOM 9006  C C   . ASN F 3 201 ? -5.097  55.692  52.421  1.00 49.16  ? 201 ASN F C   1 
ATOM 9007  O O   . ASN F 3 201 ? -5.492  54.568  52.761  1.00 50.01  ? 201 ASN F O   1 
ATOM 9008  C CB  . ASN F 3 201 ? -2.900  55.441  53.530  1.00 46.28  ? 201 ASN F CB  1 
ATOM 9009  C CG  . ASN F 3 201 ? -2.328  55.672  54.908  1.00 44.92  ? 201 ASN F CG  1 
ATOM 9010  O OD1 . ASN F 3 201 ? -1.604  56.641  55.134  1.00 48.33  ? 201 ASN F OD1 1 
ATOM 9011  N ND2 . ASN F 3 201 ? -2.663  54.786  55.848  1.00 39.26  ? 201 ASN F ND2 1 
ATOM 9012  N N   . VAL F 3 202 ? -5.583  56.344  51.380  1.00 48.76  ? 202 VAL F N   1 
ATOM 9013  C CA  . VAL F 3 202 ? -6.621  55.747  50.575  1.00 50.06  ? 202 VAL F CA  1 
ATOM 9014  C C   . VAL F 3 202 ? -6.023  55.202  49.282  1.00 49.28  ? 202 VAL F C   1 
ATOM 9015  O O   . VAL F 3 202 ? -5.235  55.882  48.610  1.00 43.71  ? 202 VAL F O   1 
ATOM 9016  C CB  . VAL F 3 202 ? -7.709  56.774  50.254  1.00 50.27  ? 202 VAL F CB  1 
ATOM 9017  C CG1 . VAL F 3 202 ? -7.071  58.009  49.671  1.00 55.13  ? 202 VAL F CG1 1 
ATOM 9018  C CG2 . VAL F 3 202 ? -8.714  56.187  49.277  1.00 52.37  ? 202 VAL F CG2 1 
ATOM 9019  N N   . ALA F 3 203 ? -6.392  53.964  48.952  1.00 47.57  ? 203 ALA F N   1 
ATOM 9020  C CA  . ALA F 3 203 ? -5.897  53.318  47.745  1.00 45.99  ? 203 ALA F CA  1 
ATOM 9021  C C   . ALA F 3 203 ? -7.028  52.793  46.884  1.00 47.83  ? 203 ALA F C   1 
ATOM 9022  O O   . ALA F 3 203 ? -7.981  52.173  47.390  1.00 50.57  ? 203 ALA F O   1 
ATOM 9023  C CB  . ALA F 3 203 ? -4.979  52.191  48.107  1.00 44.66  ? 203 ALA F CB  1 
ATOM 9024  N N   . HIS F 3 204 ? -6.905  53.064  45.584  1.00 46.86  ? 204 HIS F N   1 
ATOM 9025  C CA  . HIS F 3 204 ? -7.864  52.640  44.560  1.00 46.36  ? 204 HIS F CA  1 
ATOM 9026  C C   . HIS F 3 204 ? -7.025  51.996  43.470  1.00 48.12  ? 204 HIS F C   1 
ATOM 9027  O O   . HIS F 3 204 ? -6.660  52.641  42.480  1.00 42.89  ? 204 HIS F O   1 
ATOM 9028  C CB  . HIS F 3 204 ? -8.604  53.831  43.975  1.00 45.34  ? 204 HIS F CB  1 
ATOM 9029  C CG  . HIS F 3 204 ? -9.660  53.464  42.977  1.00 48.91  ? 204 HIS F CG  1 
ATOM 9030  N ND1 . HIS F 3 204 ? -9.590  53.838  41.650  1.00 47.66  ? 204 HIS F ND1 1 
ATOM 9031  C CD2 . HIS F 3 204 ? -10.850 52.832  43.128  1.00 50.39  ? 204 HIS F CD2 1 
ATOM 9032  C CE1 . HIS F 3 204 ? -10.694 53.458  41.030  1.00 46.79  ? 204 HIS F CE1 1 
ATOM 9033  N NE2 . HIS F 3 204 ? -11.475 52.846  41.905  1.00 51.01  ? 204 HIS F NE2 1 
ATOM 9034  N N   . PRO F 3 205 ? -6.736  50.695  43.635  1.00 50.41  ? 205 PRO F N   1 
ATOM 9035  C CA  . PRO F 3 205 ? -5.934  49.896  42.710  1.00 50.23  ? 205 PRO F CA  1 
ATOM 9036  C C   . PRO F 3 205 ? -6.498  50.049  41.309  1.00 50.61  ? 205 PRO F C   1 
ATOM 9037  O O   . PRO F 3 205 ? -5.763  50.289  40.345  1.00 50.72  ? 205 PRO F O   1 
ATOM 9038  C CB  . PRO F 3 205 ? -6.115  48.492  43.253  1.00 49.25  ? 205 PRO F CB  1 
ATOM 9039  C CG  . PRO F 3 205 ? -7.574  48.518  43.647  1.00 51.19  ? 205 PRO F CG  1 
ATOM 9040  C CD  . PRO F 3 205 ? -7.653  49.822  44.400  1.00 49.63  ? 205 PRO F CD  1 
ATOM 9041  N N   . ALA F 3 206 ? -7.821  49.920  41.224  1.00 49.82  ? 206 ALA F N   1 
ATOM 9042  C CA  . ALA F 3 206 ? -8.545  50.033  39.969  1.00 48.34  ? 206 ALA F CA  1 
ATOM 9043  C C   . ALA F 3 206 ? -7.996  51.153  39.063  1.00 49.68  ? 206 ALA F C   1 
ATOM 9044  O O   . ALA F 3 206 ? -7.769  50.935  37.875  1.00 50.84  ? 206 ALA F O   1 
ATOM 9045  C CB  . ALA F 3 206 ? -10.035 50.241  40.262  1.00 42.15  ? 206 ALA F CB  1 
ATOM 9046  N N   . SER F 3 207 ? -7.766  52.342  39.620  1.00 50.71  ? 207 SER F N   1 
ATOM 9047  C CA  . SER F 3 207 ? -7.247  53.460  38.832  1.00 47.48  ? 207 SER F CA  1 
ATOM 9048  C C   . SER F 3 207 ? -5.750  53.646  39.057  1.00 49.47  ? 207 SER F C   1 
ATOM 9049  O O   . SER F 3 207 ? -5.172  54.668  38.669  1.00 44.38  ? 207 SER F O   1 
ATOM 9050  C CB  . SER F 3 207 ? -7.983  54.754  39.184  1.00 43.72  ? 207 SER F CB  1 
ATOM 9051  O OG  . SER F 3 207 ? -7.677  55.185  40.498  1.00 42.95  ? 207 SER F OG  1 
ATOM 9052  N N   . SER F 3 208 ? -5.128  52.653  39.688  1.00 52.60  ? 208 SER F N   1 
ATOM 9053  C CA  . SER F 3 208 ? -3.696  52.701  39.956  1.00 55.39  ? 208 SER F CA  1 
ATOM 9054  C C   . SER F 3 208 ? -3.339  54.012  40.649  1.00 55.61  ? 208 SER F C   1 
ATOM 9055  O O   . SER F 3 208 ? -2.363  54.675  40.295  1.00 54.57  ? 208 SER F O   1 
ATOM 9056  C CB  . SER F 3 208 ? -2.940  52.585  38.643  1.00 56.30  ? 208 SER F CB  1 
ATOM 9057  O OG  . SER F 3 208 ? -3.492  51.531  37.874  1.00 57.00  ? 208 SER F OG  1 
ATOM 9058  N N   . THR F 3 209 ? -4.149  54.372  41.638  1.00 54.21  ? 209 THR F N   1 
ATOM 9059  C CA  . THR F 3 209 ? -3.955  55.599  42.388  1.00 51.19  ? 209 THR F CA  1 
ATOM 9060  C C   . THR F 3 209 ? -3.879  55.329  43.876  1.00 54.63  ? 209 THR F C   1 
ATOM 9061  O O   . THR F 3 209 ? -4.507  54.397  44.392  1.00 53.66  ? 209 THR F O   1 
ATOM 9062  C CB  . THR F 3 209 ? -5.116  56.572  42.175  1.00 47.64  ? 209 THR F CB  1 
ATOM 9063  O OG1 . THR F 3 209 ? -5.345  56.751  40.774  1.00 44.89  ? 209 THR F OG1 1 
ATOM 9064  C CG2 . THR F 3 209 ? -4.799  57.906  42.806  1.00 44.36  ? 209 THR F CG2 1 
ATOM 9065  N N   . LYS F 3 210 ? -3.102  56.157  44.562  1.00 57.82  ? 210 LYS F N   1 
ATOM 9066  C CA  . LYS F 3 210 ? -2.954  56.055  46.004  1.00 60.87  ? 210 LYS F CA  1 
ATOM 9067  C C   . LYS F 3 210 ? -2.800  57.474  46.490  1.00 60.14  ? 210 LYS F C   1 
ATOM 9068  O O   . LYS F 3 210 ? -2.001  58.250  45.954  1.00 63.11  ? 210 LYS F O   1 
ATOM 9069  C CB  . LYS F 3 210 ? -1.727  55.234  46.379  1.00 65.02  ? 210 LYS F CB  1 
ATOM 9070  C CG  . LYS F 3 210 ? -1.926  54.393  47.627  1.00 70.62  ? 210 LYS F CG  1 
ATOM 9071  C CD  . LYS F 3 210 ? -1.094  53.100  47.527  1.00 76.49  ? 210 LYS F CD  1 
ATOM 9072  C CE  . LYS F 3 210 ? -1.438  52.082  48.634  1.00 78.84  ? 210 LYS F CE  1 
ATOM 9073  N NZ  . LYS F 3 210 ? -0.669  50.792  48.532  1.00 78.79  ? 210 LYS F NZ  1 
ATOM 9074  N N   . VAL F 3 211 ? -3.589  57.817  47.496  1.00 59.80  ? 211 VAL F N   1 
ATOM 9075  C CA  . VAL F 3 211 ? -3.552  59.159  48.044  1.00 56.96  ? 211 VAL F CA  1 
ATOM 9076  C C   . VAL F 3 211 ? -3.448  59.176  49.556  1.00 57.08  ? 211 VAL F C   1 
ATOM 9077  O O   . VAL F 3 211 ? -4.014  58.320  50.257  1.00 56.56  ? 211 VAL F O   1 
ATOM 9078  C CB  . VAL F 3 211 ? -4.799  59.942  47.647  1.00 51.77  ? 211 VAL F CB  1 
ATOM 9079  C CG1 . VAL F 3 211 ? -4.760  61.304  48.271  1.00 48.67  ? 211 VAL F CG1 1 
ATOM 9080  C CG2 . VAL F 3 211 ? -4.874  60.045  46.149  1.00 49.10  ? 211 VAL F CG2 1 
ATOM 9081  N N   . ASP F 3 212 ? -2.708  60.163  50.046  1.00 56.30  ? 212 ASP F N   1 
ATOM 9082  C CA  . ASP F 3 212 ? -2.531  60.345  51.468  1.00 56.28  ? 212 ASP F CA  1 
ATOM 9083  C C   . ASP F 3 212 ? -2.875  61.776  51.823  1.00 57.05  ? 212 ASP F C   1 
ATOM 9084  O O   . ASP F 3 212 ? -2.319  62.721  51.258  1.00 57.76  ? 212 ASP F O   1 
ATOM 9085  C CB  . ASP F 3 212 ? -1.098  60.050  51.852  1.00 55.51  ? 212 ASP F CB  1 
ATOM 9086  C CG  . ASP F 3 212 ? -0.690  58.663  51.474  1.00 56.29  ? 212 ASP F CG  1 
ATOM 9087  O OD1 . ASP F 3 212 ? -1.319  57.703  51.981  1.00 55.06  ? 212 ASP F OD1 1 
ATOM 9088  O OD2 . ASP F 3 212 ? 0.251   58.536  50.666  1.00 57.42  ? 212 ASP F OD2 1 
ATOM 9089  N N   . LYS F 3 213 ? -3.820  61.927  52.740  1.00 56.22  ? 213 LYS F N   1 
ATOM 9090  C CA  . LYS F 3 213 ? -4.236  63.235  53.205  1.00 55.02  ? 213 LYS F CA  1 
ATOM 9091  C C   . LYS F 3 213 ? -3.898  63.327  54.674  1.00 54.08  ? 213 LYS F C   1 
ATOM 9092  O O   . LYS F 3 213 ? -4.295  62.474  55.459  1.00 54.33  ? 213 LYS F O   1 
ATOM 9093  C CB  . LYS F 3 213 ? -5.739  63.421  53.031  1.00 56.33  ? 213 LYS F CB  1 
ATOM 9094  C CG  . LYS F 3 213 ? -6.132  63.970  51.688  1.00 58.86  ? 213 LYS F CG  1 
ATOM 9095  C CD  . LYS F 3 213 ? -5.672  65.401  51.542  1.00 58.51  ? 213 LYS F CD  1 
ATOM 9096  C CE  . LYS F 3 213 ? -6.105  65.973  50.206  1.00 59.95  ? 213 LYS F CE  1 
ATOM 9097  N NZ  . LYS F 3 213 ? -5.791  67.428  50.108  1.00 60.59  ? 213 LYS F NZ  1 
ATOM 9098  N N   . LYS F 3 214 ? -3.137  64.342  55.046  1.00 54.96  ? 214 LYS F N   1 
ATOM 9099  C CA  . LYS F 3 214 ? -2.801  64.524  56.443  1.00 56.04  ? 214 LYS F CA  1 
ATOM 9100  C C   . LYS F 3 214 ? -3.916  65.367  57.015  1.00 58.62  ? 214 LYS F C   1 
ATOM 9101  O O   . LYS F 3 214 ? -4.228  66.444  56.495  1.00 57.64  ? 214 LYS F O   1 
ATOM 9102  C CB  . LYS F 3 214 ? -1.482  65.265  56.589  1.00 58.30  ? 214 LYS F CB  1 
ATOM 9103  C CG  . LYS F 3 214 ? -1.124  65.651  58.017  1.00 63.52  ? 214 LYS F CG  1 
ATOM 9104  C CD  . LYS F 3 214 ? 0.292   66.244  58.068  1.00 67.62  ? 214 LYS F CD  1 
ATOM 9105  C CE  . LYS F 3 214 ? 0.725   66.625  59.483  1.00 69.62  ? 214 LYS F CE  1 
ATOM 9106  N NZ  . LYS F 3 214 ? 2.171   66.989  59.524  1.00 67.39  ? 214 LYS F NZ  1 
ATOM 9107  N N   . ILE F 3 215 ? -4.550  64.868  58.064  1.00 60.84  ? 215 ILE F N   1 
ATOM 9108  C CA  . ILE F 3 215 ? -5.610  65.638  58.669  1.00 63.40  ? 215 ILE F CA  1 
ATOM 9109  C C   . ILE F 3 215 ? -4.931  66.670  59.552  1.00 65.24  ? 215 ILE F C   1 
ATOM 9110  O O   . ILE F 3 215 ? -4.250  66.341  60.532  1.00 64.35  ? 215 ILE F O   1 
ATOM 9111  C CB  . ILE F 3 215 ? -6.542  64.762  59.504  1.00 63.06  ? 215 ILE F CB  1 
ATOM 9112  C CG1 . ILE F 3 215 ? -7.160  63.683  58.614  1.00 64.10  ? 215 ILE F CG1 1 
ATOM 9113  C CG2 . ILE F 3 215 ? -7.639  65.621  60.126  1.00 57.72  ? 215 ILE F CG2 1 
ATOM 9114  C CD1 . ILE F 3 215 ? -8.054  64.227  57.511  1.00 70.03  ? 215 ILE F CD1 1 
ATOM 9115  N N   . VAL F 3 216 ? -5.093  67.924  59.166  1.00 67.42  ? 216 VAL F N   1 
ATOM 9116  C CA  . VAL F 3 216 ? -4.507  69.016  59.907  1.00 69.15  ? 216 VAL F CA  1 
ATOM 9117  C C   . VAL F 3 216 ? -5.602  69.943  60.368  1.00 73.28  ? 216 VAL F C   1 
ATOM 9118  O O   . VAL F 3 216 ? -6.536  70.240  59.616  1.00 72.54  ? 216 VAL F O   1 
ATOM 9119  C CB  . VAL F 3 216 ? -3.541  69.795  59.046  1.00 67.34  ? 216 VAL F CB  1 
ATOM 9120  C CG1 . VAL F 3 216 ? -2.310  68.944  58.774  1.00 69.75  ? 216 VAL F CG1 1 
ATOM 9121  C CG2 . VAL F 3 216 ? -4.231  70.204  57.747  1.00 61.47  ? 216 VAL F CG2 1 
ATOM 9122  N N   . PRO F 3 217 ? -5.496  70.419  61.620  1.00 78.18  ? 217 PRO F N   1 
ATOM 9123  C CA  . PRO F 3 217 ? -6.465  71.326  62.238  1.00 78.96  ? 217 PRO F CA  1 
ATOM 9124  C C   . PRO F 3 217 ? -6.796  72.469  61.310  1.00 79.78  ? 217 PRO F C   1 
ATOM 9125  O O   . PRO F 3 217 ? -5.921  73.252  60.940  1.00 73.15  ? 217 PRO F O   1 
ATOM 9126  C CB  . PRO F 3 217 ? -5.751  71.777  63.509  1.00 79.55  ? 217 PRO F CB  1 
ATOM 9127  C CG  . PRO F 3 217 ? -4.297  71.640  63.158  1.00 79.48  ? 217 PRO F CG  1 
ATOM 9128  C CD  . PRO F 3 217 ? -4.280  70.325  62.449  1.00 80.08  ? 217 PRO F CD  1 
ATOM 9129  N N   . ARG F 3 218 ? -8.065  72.542  60.921  1.00 86.73  ? 218 ARG F N   1 
ATOM 9130  C CA  . ARG F 3 218 ? -8.511  73.588  60.016  1.00 96.35  ? 218 ARG F CA  1 
ATOM 9131  C C   . ARG F 3 218 ? -8.452  74.930  60.736  1.00 103.11 ? 218 ARG F C   1 
ATOM 9132  O O   . ARG F 3 218 ? -8.977  75.078  61.846  1.00 104.84 ? 218 ARG F O   1 
ATOM 9133  C CB  . ARG F 3 218 ? -9.929  73.279  59.477  1.00 94.41  ? 218 ARG F CB  1 
ATOM 9134  C CG  . ARG F 3 218 ? -11.073 73.249  60.491  1.00 93.86  ? 218 ARG F CG  1 
ATOM 9135  C CD  . ARG F 3 218 ? -12.178 72.234  60.099  1.00 95.58  ? 218 ARG F CD  1 
ATOM 9136  N NE  . ARG F 3 218 ? -12.636 72.320  58.707  1.00 97.97  ? 218 ARG F NE  1 
ATOM 9137  C CZ  . ARG F 3 218 ? -13.493 71.469  58.131  1.00 98.54  ? 218 ARG F CZ  1 
ATOM 9138  N NH1 . ARG F 3 218 ? -14.008 70.452  58.813  1.00 98.37  ? 218 ARG F NH1 1 
ATOM 9139  N NH2 . ARG F 3 218 ? -13.831 71.624  56.857  1.00 97.25  ? 218 ARG F NH2 1 
ATOM 9140  N N   . ASP F 3 219 ? -7.774  75.892  60.108  1.00 108.76 ? 219 ASP F N   1 
ATOM 9141  C CA  . ASP F 3 219 ? -7.608  77.227  60.673  1.00 112.86 ? 219 ASP F CA  1 
ATOM 9142  C C   . ASP F 3 219 ? -8.284  78.299  59.822  1.00 115.05 ? 219 ASP F C   1 
ATOM 9143  O O   . ASP F 3 219 ? -8.420  78.148  58.605  1.00 113.83 ? 219 ASP F O   1 
ATOM 9144  C CB  . ASP F 3 219 ? -6.117  77.555  60.818  1.00 115.20 ? 219 ASP F CB  1 
ATOM 9145  C CG  . ASP F 3 219 ? -5.723  77.864  62.254  1.00 118.14 ? 219 ASP F CG  1 
ATOM 9146  O OD1 . ASP F 3 219 ? -5.799  76.948  63.106  1.00 119.14 ? 219 ASP F OD1 1 
ATOM 9147  O OD2 . ASP F 3 219 ? -5.340  79.023  62.530  1.00 118.40 ? 219 ASP F OD2 1 
ATOM 9148  N N   . CYS F 3 220 ? -8.706  79.380  60.476  1.00 118.32 ? 220 CYS F N   1 
ATOM 9149  C CA  . CYS F 3 220 ? -9.368  80.493  59.801  1.00 121.19 ? 220 CYS F CA  1 
ATOM 9150  C C   . CYS F 3 220 ? -8.801  81.822  60.316  1.00 121.84 ? 220 CYS F C   1 
ATOM 9151  O O   . CYS F 3 220 ? -7.962  81.781  61.245  1.00 120.47 ? 220 CYS F O   1 
ATOM 9152  C CB  . CYS F 3 220 ? -10.883 80.432  60.049  1.00 122.14 ? 220 CYS F CB  1 
ATOM 9153  S SG  . CYS F 3 220 ? -11.891 81.460  58.940  1.00 121.40 ? 220 CYS F SG  1 
ATOM 9154  O OXT . CYS F 3 220 ? -9.197  82.886  59.787  1.00 124.19 ? 220 CYS F OXT 1 
ATOM 9155  N N   . GLY G 1 1   ? 22.587  92.527  87.739  1.00 72.18  ? 1   GLY G N   1 
ATOM 9156  C CA  . GLY G 1 1   ? 23.371  93.762  87.971  1.00 71.82  ? 1   GLY G CA  1 
ATOM 9157  C C   . GLY G 1 1   ? 24.175  94.118  86.742  1.00 72.18  ? 1   GLY G C   1 
ATOM 9158  O O   . GLY G 1 1   ? 24.411  93.265  85.899  1.00 74.55  ? 1   GLY G O   1 
ATOM 9159  N N   . VAL G 1 2   ? 24.590  95.374  86.638  1.00 72.51  ? 2   VAL G N   1 
ATOM 9160  C CA  . VAL G 1 2   ? 25.375  95.852  85.502  1.00 74.70  ? 2   VAL G CA  1 
ATOM 9161  C C   . VAL G 1 2   ? 26.347  96.932  85.978  1.00 78.60  ? 2   VAL G C   1 
ATOM 9162  O O   . VAL G 1 2   ? 26.091  98.137  85.809  1.00 78.88  ? 2   VAL G O   1 
ATOM 9163  C CB  . VAL G 1 2   ? 24.472  96.470  84.417  1.00 74.59  ? 2   VAL G CB  1 
ATOM 9164  C CG1 . VAL G 1 2   ? 25.302  96.873  83.206  1.00 72.85  ? 2   VAL G CG1 1 
ATOM 9165  C CG2 . VAL G 1 2   ? 23.393  95.493  84.031  1.00 75.13  ? 2   VAL G CG2 1 
ATOM 9166  N N   . PHE G 1 3   ? 27.465  96.495  86.556  1.00 81.46  ? 3   PHE G N   1 
ATOM 9167  C CA  . PHE G 1 3   ? 28.485  97.404  87.085  1.00 83.18  ? 3   PHE G CA  1 
ATOM 9168  C C   . PHE G 1 3   ? 29.661  97.684  86.148  1.00 83.13  ? 3   PHE G C   1 
ATOM 9169  O O   . PHE G 1 3   ? 30.458  96.789  85.858  1.00 83.71  ? 3   PHE G O   1 
ATOM 9170  C CB  . PHE G 1 3   ? 29.044  96.840  88.391  1.00 86.34  ? 3   PHE G CB  1 
ATOM 9171  C CG  . PHE G 1 3   ? 27.993  96.408  89.362  1.00 90.20  ? 3   PHE G CG  1 
ATOM 9172  C CD1 . PHE G 1 3   ? 27.107  97.335  89.905  1.00 90.43  ? 3   PHE G CD1 1 
ATOM 9173  C CD2 . PHE G 1 3   ? 27.889  95.070  89.739  1.00 93.08  ? 3   PHE G CD2 1 
ATOM 9174  C CE1 . PHE G 1 3   ? 26.137  96.936  90.806  1.00 91.84  ? 3   PHE G CE1 1 
ATOM 9175  C CE2 . PHE G 1 3   ? 26.920  94.655  90.642  1.00 96.28  ? 3   PHE G CE2 1 
ATOM 9176  C CZ  . PHE G 1 3   ? 26.040  95.591  91.179  1.00 95.27  ? 3   PHE G CZ  1 
ATOM 9177  N N   . ASN G 1 4   ? 29.778  98.928  85.693  1.00 82.34  ? 4   ASN G N   1 
ATOM 9178  C CA  . ASN G 1 4   ? 30.885  99.315  84.825  1.00 83.92  ? 4   ASN G CA  1 
ATOM 9179  C C   . ASN G 1 4   ? 32.173  99.478  85.649  1.00 85.26  ? 4   ASN G C   1 
ATOM 9180  O O   . ASN G 1 4   ? 32.124  99.588  86.867  1.00 86.90  ? 4   ASN G O   1 
ATOM 9181  C CB  . ASN G 1 4   ? 30.571  100.634 84.132  1.00 84.17  ? 4   ASN G CB  1 
ATOM 9182  C CG  . ASN G 1 4   ? 31.781  101.220 83.443  1.00 87.43  ? 4   ASN G CG  1 
ATOM 9183  O OD1 . ASN G 1 4   ? 32.232  100.713 82.411  1.00 88.66  ? 4   ASN G OD1 1 
ATOM 9184  N ND2 . ASN G 1 4   ? 32.336  102.278 84.024  1.00 88.21  ? 4   ASN G ND2 1 
ATOM 9185  N N   . TYR G 1 5   ? 33.325  99.490  84.990  1.00 86.79  ? 5   TYR G N   1 
ATOM 9186  C CA  . TYR G 1 5   ? 34.602  99.656  85.680  1.00 86.93  ? 5   TYR G CA  1 
ATOM 9187  C C   . TYR G 1 5   ? 35.664  100.125 84.692  1.00 88.71  ? 5   TYR G C   1 
ATOM 9188  O O   . TYR G 1 5   ? 36.552  99.349  84.341  1.00 89.97  ? 5   TYR G O   1 
ATOM 9189  C CB  . TYR G 1 5   ? 35.080  98.338  86.302  1.00 86.24  ? 5   TYR G CB  1 
ATOM 9190  C CG  . TYR G 1 5   ? 34.384  97.890  87.573  1.00 88.58  ? 5   TYR G CG  1 
ATOM 9191  C CD1 . TYR G 1 5   ? 34.276  98.735  88.680  1.00 91.47  ? 5   TYR G CD1 1 
ATOM 9192  C CD2 . TYR G 1 5   ? 33.895  96.592  87.694  1.00 89.62  ? 5   TYR G CD2 1 
ATOM 9193  C CE1 . TYR G 1 5   ? 33.694  98.286  89.890  1.00 94.09  ? 5   TYR G CE1 1 
ATOM 9194  C CE2 . TYR G 1 5   ? 33.318  96.132  88.892  1.00 93.35  ? 5   TYR G CE2 1 
ATOM 9195  C CZ  . TYR G 1 5   ? 33.220  96.978  89.985  1.00 94.71  ? 5   TYR G CZ  1 
ATOM 9196  O OH  . TYR G 1 5   ? 32.663  96.505  91.161  1.00 95.97  ? 5   TYR G OH  1 
ATOM 9197  N N   . GLU G 1 6   ? 35.584  101.378 84.243  1.00 89.71  ? 6   GLU G N   1 
ATOM 9198  C CA  . GLU G 1 6   ? 36.566  101.911 83.290  1.00 91.26  ? 6   GLU G CA  1 
ATOM 9199  C C   . GLU G 1 6   ? 38.032  101.811 83.745  1.00 92.16  ? 6   GLU G C   1 
ATOM 9200  O O   . GLU G 1 6   ? 38.328  101.467 84.893  1.00 93.13  ? 6   GLU G O   1 
ATOM 9201  C CB  . GLU G 1 6   ? 36.253  103.364 82.952  1.00 91.08  ? 6   GLU G CB  1 
ATOM 9202  C CG  . GLU G 1 6   ? 34.916  103.555 82.291  1.00 98.77  ? 6   GLU G CG  1 
ATOM 9203  C CD  . GLU G 1 6   ? 34.634  105.015 81.987  1.00 104.67 ? 6   GLU G CD  1 
ATOM 9204  O OE1 . GLU G 1 6   ? 34.581  105.830 82.939  1.00 107.76 ? 6   GLU G OE1 1 
ATOM 9205  O OE2 . GLU G 1 6   ? 34.466  105.348 80.792  1.00 109.53 ? 6   GLU G OE2 1 
ATOM 9206  N N   . THR G 1 7   ? 38.944  102.118 82.824  1.00 91.58  ? 7   THR G N   1 
ATOM 9207  C CA  . THR G 1 7   ? 40.385  102.060 83.075  1.00 88.41  ? 7   THR G CA  1 
ATOM 9208  C C   . THR G 1 7   ? 41.096  102.861 81.995  1.00 91.51  ? 7   THR G C   1 
ATOM 9209  O O   . THR G 1 7   ? 40.494  103.243 80.990  1.00 91.87  ? 7   THR G O   1 
ATOM 9210  C CB  . THR G 1 7   ? 40.918  100.597 83.029  1.00 83.77  ? 7   THR G CB  1 
ATOM 9211  O OG1 . THR G 1 7   ? 40.371  99.848  84.121  1.00 81.80  ? 7   THR G OG1 1 
ATOM 9212  C CG2 . THR G 1 7   ? 42.434  100.569 83.123  1.00 81.67  ? 7   THR G CG2 1 
ATOM 9213  N N   . GLU G 1 8   ? 42.375  103.136 82.222  1.00 94.48  ? 8   GLU G N   1 
ATOM 9214  C CA  . GLU G 1 8   ? 43.190  103.865 81.259  1.00 96.00  ? 8   GLU G CA  1 
ATOM 9215  C C   . GLU G 1 8   ? 44.658  103.539 81.411  1.00 94.53  ? 8   GLU G C   1 
ATOM 9216  O O   . GLU G 1 8   ? 45.095  102.987 82.430  1.00 92.54  ? 8   GLU G O   1 
ATOM 9217  C CB  . GLU G 1 8   ? 42.981  105.375 81.368  1.00 97.05  ? 8   GLU G CB  1 
ATOM 9218  C CG  . GLU G 1 8   ? 41.788  105.849 80.582  1.00 99.82  ? 8   GLU G CG  1 
ATOM 9219  C CD  . GLU G 1 8   ? 41.784  107.345 80.394  1.00 103.84 ? 8   GLU G CD  1 
ATOM 9220  O OE1 . GLU G 1 8   ? 42.827  107.893 79.969  1.00 102.68 ? 8   GLU G OE1 1 
ATOM 9221  O OE2 . GLU G 1 8   ? 40.735  107.971 80.661  1.00 107.40 ? 8   GLU G OE2 1 
ATOM 9222  N N   . THR G 1 9   ? 45.411  103.864 80.369  1.00 92.84  ? 9   THR G N   1 
ATOM 9223  C CA  . THR G 1 9   ? 46.832  103.604 80.365  1.00 91.37  ? 9   THR G CA  1 
ATOM 9224  C C   . THR G 1 9   ? 47.427  104.226 79.118  1.00 90.27  ? 9   THR G C   1 
ATOM 9225  O O   . THR G 1 9   ? 46.718  104.525 78.157  1.00 86.82  ? 9   THR G O   1 
ATOM 9226  C CB  . THR G 1 9   ? 47.124  102.087 80.400  1.00 90.62  ? 9   THR G CB  1 
ATOM 9227  O OG1 . THR G 1 9   ? 48.541  101.864 80.391  1.00 90.20  ? 9   THR G OG1 1 
ATOM 9228  C CG2 . THR G 1 9   ? 46.488  101.404 79.207  1.00 94.13  ? 9   THR G CG2 1 
ATOM 9229  N N   . THR G 1 10  ? 48.739  104.425 79.151  1.00 91.42  ? 10  THR G N   1 
ATOM 9230  C CA  . THR G 1 10  ? 49.444  105.045 78.040  1.00 91.02  ? 10  THR G CA  1 
ATOM 9231  C C   . THR G 1 10  ? 50.436  104.120 77.379  1.00 88.85  ? 10  THR G C   1 
ATOM 9232  O O   . THR G 1 10  ? 50.811  103.071 77.918  1.00 86.19  ? 10  THR G O   1 
ATOM 9233  C CB  . THR G 1 10  ? 50.227  106.288 78.507  1.00 93.02  ? 10  THR G CB  1 
ATOM 9234  O OG1 . THR G 1 10  ? 50.109  106.416 79.932  1.00 94.78  ? 10  THR G OG1 1 
ATOM 9235  C CG2 . THR G 1 10  ? 49.714  107.542 77.809  1.00 92.45  ? 10  THR G CG2 1 
ATOM 9236  N N   . SER G 1 11  ? 50.856  104.535 76.195  1.00 86.16  ? 11  SER G N   1 
ATOM 9237  C CA  . SER G 1 11  ? 51.835  103.792 75.442  1.00 83.53  ? 11  SER G CA  1 
ATOM 9238  C C   . SER G 1 11  ? 52.504  104.710 74.454  1.00 79.85  ? 11  SER G C   1 
ATOM 9239  O O   . SER G 1 11  ? 51.952  105.736 74.035  1.00 76.59  ? 11  SER G O   1 
ATOM 9240  C CB  . SER G 1 11  ? 51.209  102.622 74.694  1.00 86.54  ? 11  SER G CB  1 
ATOM 9241  O OG  . SER G 1 11  ? 52.204  101.942 73.940  1.00 90.08  ? 11  SER G OG  1 
ATOM 9242  N N   . VAL G 1 12  ? 53.710  104.312 74.088  1.00 76.74  ? 12  VAL G N   1 
ATOM 9243  C CA  . VAL G 1 12  ? 54.534  105.049 73.157  1.00 74.95  ? 12  VAL G CA  1 
ATOM 9244  C C   . VAL G 1 12  ? 54.035  104.861 71.723  1.00 74.84  ? 12  VAL G C   1 
ATOM 9245  O O   . VAL G 1 12  ? 53.959  105.821 70.949  1.00 71.68  ? 12  VAL G O   1 
ATOM 9246  C CB  . VAL G 1 12  ? 55.968  104.553 73.291  1.00 74.11  ? 12  VAL G CB  1 
ATOM 9247  C CG1 . VAL G 1 12  ? 56.411  104.708 74.727  1.00 77.46  ? 12  VAL G CG1 1 
ATOM 9248  C CG2 . VAL G 1 12  ? 56.046  103.081 72.927  1.00 71.82  ? 12  VAL G CG2 1 
ATOM 9249  N N   . ILE G 1 13  ? 53.684  103.614 71.399  1.00 73.59  ? 13  ILE G N   1 
ATOM 9250  C CA  . ILE G 1 13  ? 53.194  103.211 70.082  1.00 67.97  ? 13  ILE G CA  1 
ATOM 9251  C C   . ILE G 1 13  ? 52.035  104.072 69.613  1.00 67.00  ? 13  ILE G C   1 
ATOM 9252  O O   . ILE G 1 13  ? 51.043  104.208 70.326  1.00 64.42  ? 13  ILE G O   1 
ATOM 9253  C CB  . ILE G 1 13  ? 52.662  101.775 70.110  1.00 68.17  ? 13  ILE G CB  1 
ATOM 9254  C CG1 . ILE G 1 13  ? 53.088  101.056 71.406  1.00 66.36  ? 13  ILE G CG1 1 
ATOM 9255  C CG2 . ILE G 1 13  ? 53.079  101.063 68.836  1.00 68.63  ? 13  ILE G CG2 1 
ATOM 9256  C CD1 . ILE G 1 13  ? 54.486  100.444 71.423  1.00 65.44  ? 13  ILE G CD1 1 
ATOM 9257  N N   . PRO G 1 14  ? 52.125  104.649 68.404  1.00 68.10  ? 14  PRO G N   1 
ATOM 9258  C CA  . PRO G 1 14  ? 51.003  105.477 67.944  1.00 73.20  ? 14  PRO G CA  1 
ATOM 9259  C C   . PRO G 1 14  ? 49.736  104.623 67.902  1.00 78.52  ? 14  PRO G C   1 
ATOM 9260  O O   . PRO G 1 14  ? 49.791  103.443 67.532  1.00 83.32  ? 14  PRO G O   1 
ATOM 9261  C CB  . PRO G 1 14  ? 51.440  105.919 66.548  1.00 70.78  ? 14  PRO G CB  1 
ATOM 9262  C CG  . PRO G 1 14  ? 52.928  105.901 66.633  1.00 67.59  ? 14  PRO G CG  1 
ATOM 9263  C CD  . PRO G 1 14  ? 53.202  104.630 67.404  1.00 67.45  ? 14  PRO G CD  1 
ATOM 9264  N N   . ALA G 1 15  ? 48.605  105.207 68.296  1.00 80.60  ? 15  ALA G N   1 
ATOM 9265  C CA  . ALA G 1 15  ? 47.321  104.494 68.303  1.00 78.79  ? 15  ALA G CA  1 
ATOM 9266  C C   . ALA G 1 15  ? 47.192  103.596 67.079  1.00 76.85  ? 15  ALA G C   1 
ATOM 9267  O O   . ALA G 1 15  ? 47.085  102.367 67.197  1.00 72.84  ? 15  ALA G O   1 
ATOM 9268  C CB  . ALA G 1 15  ? 46.174  105.492 68.322  1.00 80.24  ? 15  ALA G CB  1 
ATOM 9269  N N   . ALA G 1 16  ? 47.198  104.234 65.910  1.00 73.18  ? 16  ALA G N   1 
ATOM 9270  C CA  . ALA G 1 16  ? 47.100  103.538 64.641  1.00 71.53  ? 16  ALA G CA  1 
ATOM 9271  C C   . ALA G 1 16  ? 47.726  102.150 64.740  1.00 69.56  ? 16  ALA G C   1 
ATOM 9272  O O   . ALA G 1 16  ? 47.029  101.136 64.833  1.00 71.10  ? 16  ALA G O   1 
ATOM 9273  C CB  . ALA G 1 16  ? 47.800  104.348 63.574  1.00 69.64  ? 16  ALA G CB  1 
ATOM 9274  N N   . ARG G 1 17  ? 49.050  102.120 64.736  1.00 66.36  ? 17  ARG G N   1 
ATOM 9275  C CA  . ARG G 1 17  ? 49.791  100.876 64.817  1.00 67.73  ? 17  ARG G CA  1 
ATOM 9276  C C   . ARG G 1 17  ? 49.405  99.973  65.989  1.00 67.28  ? 17  ARG G C   1 
ATOM 9277  O O   . ARG G 1 17  ? 49.097  98.792  65.800  1.00 67.98  ? 17  ARG G O   1 
ATOM 9278  C CB  . ARG G 1 17  ? 51.289  101.190 64.863  1.00 73.57  ? 17  ARG G CB  1 
ATOM 9279  C CG  . ARG G 1 17  ? 52.175  100.033 65.315  1.00 80.54  ? 17  ARG G CG  1 
ATOM 9280  C CD  . ARG G 1 17  ? 53.581  100.128 64.697  1.00 83.58  ? 17  ARG G CD  1 
ATOM 9281  N NE  . ARG G 1 17  ? 54.600  99.512  65.547  1.00 86.17  ? 17  ARG G NE  1 
ATOM 9282  C CZ  . ARG G 1 17  ? 55.867  99.339  65.190  1.00 86.21  ? 17  ARG G CZ  1 
ATOM 9283  N NH1 . ARG G 1 17  ? 56.274  99.730  63.984  1.00 81.70  ? 17  ARG G NH1 1 
ATOM 9284  N NH2 . ARG G 1 17  ? 56.727  98.797  66.048  1.00 86.92  ? 17  ARG G NH2 1 
ATOM 9285  N N   . LEU G 1 18  ? 49.424  100.517 67.200  1.00 67.17  ? 18  LEU G N   1 
ATOM 9286  C CA  . LEU G 1 18  ? 49.080  99.715  68.365  1.00 65.75  ? 18  LEU G CA  1 
ATOM 9287  C C   . LEU G 1 18  ? 47.733  99.023  68.179  1.00 66.95  ? 18  LEU G C   1 
ATOM 9288  O O   . LEU G 1 18  ? 47.530  97.895  68.632  1.00 63.04  ? 18  LEU G O   1 
ATOM 9289  C CB  . LEU G 1 18  ? 49.035  100.584 69.622  1.00 61.54  ? 18  LEU G CB  1 
ATOM 9290  C CG  . LEU G 1 18  ? 48.601  99.790  70.857  1.00 60.73  ? 18  LEU G CG  1 
ATOM 9291  C CD1 . LEU G 1 18  ? 49.648  98.745  71.198  1.00 57.29  ? 18  LEU G CD1 1 
ATOM 9292  C CD2 . LEU G 1 18  ? 48.380  100.723 72.019  1.00 60.92  ? 18  LEU G CD2 1 
ATOM 9293  N N   . PHE G 1 19  ? 46.807  99.704  67.511  1.00 70.63  ? 19  PHE G N   1 
ATOM 9294  C CA  . PHE G 1 19  ? 45.486  99.129  67.291  1.00 74.79  ? 19  PHE G CA  1 
ATOM 9295  C C   . PHE G 1 19  ? 45.600  97.874  66.463  1.00 73.06  ? 19  PHE G C   1 
ATOM 9296  O O   . PHE G 1 19  ? 45.160  96.794  66.878  1.00 73.37  ? 19  PHE G O   1 
ATOM 9297  C CB  . PHE G 1 19  ? 44.567  100.104 66.560  1.00 80.81  ? 19  PHE G CB  1 
ATOM 9298  C CG  . PHE G 1 19  ? 43.174  99.570  66.360  1.00 85.88  ? 19  PHE G CG  1 
ATOM 9299  C CD1 . PHE G 1 19  ? 42.427  99.121  67.451  1.00 86.49  ? 19  PHE G CD1 1 
ATOM 9300  C CD2 . PHE G 1 19  ? 42.612  99.497  65.089  1.00 88.42  ? 19  PHE G CD2 1 
ATOM 9301  C CE1 . PHE G 1 19  ? 41.146  98.608  67.280  1.00 86.84  ? 19  PHE G CE1 1 
ATOM 9302  C CE2 . PHE G 1 19  ? 41.323  98.984  64.907  1.00 90.07  ? 19  PHE G CE2 1 
ATOM 9303  C CZ  . PHE G 1 19  ? 40.593  98.540  66.006  1.00 89.89  ? 19  PHE G CZ  1 
ATOM 9304  N N   . LYS G 1 20  ? 46.174  98.042  65.276  1.00 67.45  ? 20  LYS G N   1 
ATOM 9305  C CA  . LYS G 1 20  ? 46.379  96.931  64.370  1.00 64.61  ? 20  LYS G CA  1 
ATOM 9306  C C   . LYS G 1 20  ? 46.993  95.811  65.178  1.00 61.50  ? 20  LYS G C   1 
ATOM 9307  O O   . LYS G 1 20  ? 46.428  94.735  65.327  1.00 62.98  ? 20  LYS G O   1 
ATOM 9308  C CB  . LYS G 1 20  ? 47.335  97.333  63.253  1.00 61.83  ? 20  LYS G CB  1 
ATOM 9309  C CG  . LYS G 1 20  ? 46.839  98.511  62.434  1.00 66.84  ? 20  LYS G CG  1 
ATOM 9310  C CD  . LYS G 1 20  ? 47.905  99.027  61.463  1.00 69.46  ? 20  LYS G CD  1 
ATOM 9311  C CE  . LYS G 1 20  ? 48.385  97.955  60.485  1.00 71.16  ? 20  LYS G CE  1 
ATOM 9312  N NZ  . LYS G 1 20  ? 49.314  98.506  59.445  1.00 74.60  ? 20  LYS G NZ  1 
ATOM 9313  N N   . ALA G 1 21  ? 48.151  96.099  65.732  1.00 62.16  ? 21  ALA G N   1 
ATOM 9314  C CA  . ALA G 1 21  ? 48.873  95.130  66.520  1.00 66.25  ? 21  ALA G CA  1 
ATOM 9315  C C   . ALA G 1 21  ? 48.073  94.457  67.642  1.00 68.37  ? 21  ALA G C   1 
ATOM 9316  O O   . ALA G 1 21  ? 47.611  93.327  67.499  1.00 69.12  ? 21  ALA G O   1 
ATOM 9317  C CB  . ALA G 1 21  ? 50.109  95.793  67.092  1.00 67.19  ? 21  ALA G CB  1 
ATOM 9318  N N   . PHE G 1 22  ? 47.917  95.173  68.751  1.00 69.65  ? 22  PHE G N   1 
ATOM 9319  C CA  . PHE G 1 22  ? 47.242  94.687  69.954  1.00 69.50  ? 22  PHE G CA  1 
ATOM 9320  C C   . PHE G 1 22  ? 45.829  94.126  69.803  1.00 69.48  ? 22  PHE G C   1 
ATOM 9321  O O   . PHE G 1 22  ? 45.445  93.170  70.492  1.00 69.98  ? 22  PHE G O   1 
ATOM 9322  C CB  . PHE G 1 22  ? 47.238  95.805  71.004  1.00 68.66  ? 22  PHE G CB  1 
ATOM 9323  C CG  . PHE G 1 22  ? 46.771  95.365  72.355  1.00 69.89  ? 22  PHE G CG  1 
ATOM 9324  C CD1 . PHE G 1 22  ? 47.436  94.351  73.044  1.00 68.87  ? 22  PHE G CD1 1 
ATOM 9325  C CD2 . PHE G 1 22  ? 45.652  95.948  72.935  1.00 71.47  ? 22  PHE G CD2 1 
ATOM 9326  C CE1 . PHE G 1 22  ? 46.987  93.918  74.305  1.00 67.95  ? 22  PHE G CE1 1 
ATOM 9327  C CE2 . PHE G 1 22  ? 45.192  95.525  74.195  1.00 73.70  ? 22  PHE G CE2 1 
ATOM 9328  C CZ  . PHE G 1 22  ? 45.862  94.506  74.879  1.00 70.04  ? 22  PHE G CZ  1 
ATOM 9329  N N   . ILE G 1 23  ? 45.055  94.718  68.907  1.00 67.78  ? 23  ILE G N   1 
ATOM 9330  C CA  . ILE G 1 23  ? 43.685  94.280  68.708  1.00 64.32  ? 23  ILE G CA  1 
ATOM 9331  C C   . ILE G 1 23  ? 43.501  93.387  67.494  1.00 62.12  ? 23  ILE G C   1 
ATOM 9332  O O   . ILE G 1 23  ? 43.347  92.166  67.623  1.00 56.98  ? 23  ILE G O   1 
ATOM 9333  C CB  . ILE G 1 23  ? 42.758  95.493  68.570  1.00 64.13  ? 23  ILE G CB  1 
ATOM 9334  C CG1 . ILE G 1 23  ? 42.755  96.276  69.881  1.00 63.04  ? 23  ILE G CG1 1 
ATOM 9335  C CG2 . ILE G 1 23  ? 41.359  95.043  68.190  1.00 65.37  ? 23  ILE G CG2 1 
ATOM 9336  C CD1 . ILE G 1 23  ? 42.374  95.429  71.080  1.00 58.86  ? 23  ILE G CD1 1 
ATOM 9337  N N   . LEU G 1 24  ? 43.518  94.013  66.319  1.00 59.35  ? 24  LEU G N   1 
ATOM 9338  C CA  . LEU G 1 24  ? 43.327  93.300  65.068  1.00 58.70  ? 24  LEU G CA  1 
ATOM 9339  C C   . LEU G 1 24  ? 44.062  91.971  64.991  1.00 63.19  ? 24  LEU G C   1 
ATOM 9340  O O   . LEU G 1 24  ? 43.423  90.930  64.872  1.00 69.65  ? 24  LEU G O   1 
ATOM 9341  C CB  . LEU G 1 24  ? 43.711  94.179  63.875  1.00 50.11  ? 24  LEU G CB  1 
ATOM 9342  C CG  . LEU G 1 24  ? 43.024  95.559  63.847  1.00 46.70  ? 24  LEU G CG  1 
ATOM 9343  C CD1 . LEU G 1 24  ? 43.097  96.155  62.446  1.00 38.83  ? 24  LEU G CD1 1 
ATOM 9344  C CD2 . LEU G 1 24  ? 41.574  95.440  64.264  1.00 42.76  ? 24  LEU G CD2 1 
ATOM 9345  N N   . ASP G 1 25  ? 45.386  91.975  65.068  1.00 63.68  ? 25  ASP G N   1 
ATOM 9346  C CA  . ASP G 1 25  ? 46.108  90.711  64.973  1.00 64.62  ? 25  ASP G CA  1 
ATOM 9347  C C   . ASP G 1 25  ? 46.510  90.143  66.328  1.00 63.29  ? 25  ASP G C   1 
ATOM 9348  O O   . ASP G 1 25  ? 47.039  89.029  66.442  1.00 60.09  ? 25  ASP G O   1 
ATOM 9349  C CB  . ASP G 1 25  ? 47.355  90.871  64.125  1.00 68.24  ? 25  ASP G CB  1 
ATOM 9350  C CG  . ASP G 1 25  ? 47.992  89.536  63.811  1.00 73.52  ? 25  ASP G CG  1 
ATOM 9351  O OD1 . ASP G 1 25  ? 47.392  88.772  63.019  1.00 79.70  ? 25  ASP G OD1 1 
ATOM 9352  O OD2 . ASP G 1 25  ? 49.071  89.232  64.367  1.00 71.71  ? 25  ASP G OD2 1 
ATOM 9353  N N   . GLY G 1 26  ? 46.222  90.912  67.361  1.00 63.47  ? 26  GLY G N   1 
ATOM 9354  C CA  . GLY G 1 26  ? 46.584  90.510  68.700  1.00 65.17  ? 26  GLY G CA  1 
ATOM 9355  C C   . GLY G 1 26  ? 46.312  89.086  69.105  1.00 64.43  ? 26  GLY G C   1 
ATOM 9356  O O   . GLY G 1 26  ? 47.137  88.450  69.738  1.00 61.54  ? 26  GLY G O   1 
ATOM 9357  N N   . ASP G 1 27  ? 45.156  88.572  68.735  1.00 71.49  ? 27  ASP G N   1 
ATOM 9358  C CA  . ASP G 1 27  ? 44.777  87.235  69.163  1.00 77.05  ? 27  ASP G CA  1 
ATOM 9359  C C   . ASP G 1 27  ? 45.611  86.047  68.674  1.00 75.97  ? 27  ASP G C   1 
ATOM 9360  O O   . ASP G 1 27  ? 45.249  84.897  68.915  1.00 75.72  ? 27  ASP G O   1 
ATOM 9361  C CB  . ASP G 1 27  ? 43.280  87.017  68.887  1.00 83.36  ? 27  ASP G CB  1 
ATOM 9362  C CG  . ASP G 1 27  ? 42.391  88.031  69.648  1.00 88.36  ? 27  ASP G CG  1 
ATOM 9363  O OD1 . ASP G 1 27  ? 42.224  89.183  69.163  1.00 89.54  ? 27  ASP G OD1 1 
ATOM 9364  O OD2 . ASP G 1 27  ? 41.871  87.685  70.742  1.00 90.77  ? 27  ASP G OD2 1 
ATOM 9365  N N   . ASN G 1 28  ? 46.735  86.320  68.018  1.00 74.41  ? 28  ASN G N   1 
ATOM 9366  C CA  . ASN G 1 28  ? 47.627  85.252  67.543  1.00 75.40  ? 28  ASN G CA  1 
ATOM 9367  C C   . ASN G 1 28  ? 49.042  85.656  67.946  1.00 75.55  ? 28  ASN G C   1 
ATOM 9368  O O   . ASN G 1 28  ? 50.000  84.868  67.911  1.00 76.10  ? 28  ASN G O   1 
ATOM 9369  C CB  . ASN G 1 28  ? 47.545  85.118  66.024  1.00 79.00  ? 28  ASN G CB  1 
ATOM 9370  C CG  . ASN G 1 28  ? 48.265  86.242  65.291  1.00 81.80  ? 28  ASN G CG  1 
ATOM 9371  O OD1 . ASN G 1 28  ? 49.481  86.426  65.425  1.00 83.24  ? 28  ASN G OD1 1 
ATOM 9372  N ND2 . ASN G 1 28  ? 47.513  86.995  64.508  1.00 83.72  ? 28  ASN G ND2 1 
ATOM 9373  N N   . LEU G 1 29  ? 49.134  86.922  68.323  1.00 73.29  ? 29  LEU G N   1 
ATOM 9374  C CA  . LEU G 1 29  ? 50.358  87.549  68.761  1.00 65.85  ? 29  LEU G CA  1 
ATOM 9375  C C   . LEU G 1 29  ? 50.561  87.225  70.231  1.00 63.29  ? 29  LEU G C   1 
ATOM 9376  O O   . LEU G 1 29  ? 51.670  86.998  70.688  1.00 60.95  ? 29  LEU G O   1 
ATOM 9377  C CB  . LEU G 1 29  ? 50.207  89.043  68.582  1.00 66.41  ? 29  LEU G CB  1 
ATOM 9378  C CG  . LEU G 1 29  ? 51.451  89.869  68.795  1.00 68.74  ? 29  LEU G CG  1 
ATOM 9379  C CD1 . LEU G 1 29  ? 52.621  89.144  68.170  1.00 73.14  ? 29  LEU G CD1 1 
ATOM 9380  C CD2 . LEU G 1 29  ? 51.256  91.238  68.164  1.00 70.09  ? 29  LEU G CD2 1 
ATOM 9381  N N   . PHE G 1 30  ? 49.462  87.178  70.966  1.00 62.92  ? 30  PHE G N   1 
ATOM 9382  C CA  . PHE G 1 30  ? 49.522  86.900  72.385  1.00 63.64  ? 30  PHE G CA  1 
ATOM 9383  C C   . PHE G 1 30  ? 50.181  85.588  72.778  1.00 62.39  ? 30  PHE G C   1 
ATOM 9384  O O   . PHE G 1 30  ? 51.032  85.573  73.647  1.00 63.72  ? 30  PHE G O   1 
ATOM 9385  C CB  . PHE G 1 30  ? 48.122  86.977  73.014  1.00 66.13  ? 30  PHE G CB  1 
ATOM 9386  C CG  . PHE G 1 30  ? 47.477  88.341  72.916  1.00 67.14  ? 30  PHE G CG  1 
ATOM 9387  C CD1 . PHE G 1 30  ? 48.240  89.496  73.009  1.00 68.27  ? 30  PHE G CD1 1 
ATOM 9388  C CD2 . PHE G 1 30  ? 46.108  88.471  72.718  1.00 66.81  ? 30  PHE G CD2 1 
ATOM 9389  C CE1 . PHE G 1 30  ? 47.649  90.764  72.898  1.00 69.39  ? 30  PHE G CE1 1 
ATOM 9390  C CE2 . PHE G 1 30  ? 45.510  89.736  72.606  1.00 68.33  ? 30  PHE G CE2 1 
ATOM 9391  C CZ  . PHE G 1 30  ? 46.284  90.881  72.696  1.00 66.57  ? 30  PHE G CZ  1 
ATOM 9392  N N   . PRO G 1 31  ? 49.809  84.468  72.152  1.00 64.07  ? 31  PRO G N   1 
ATOM 9393  C CA  . PRO G 1 31  ? 50.486  83.242  72.595  1.00 65.67  ? 31  PRO G CA  1 
ATOM 9394  C C   . PRO G 1 31  ? 51.978  83.309  72.272  1.00 65.89  ? 31  PRO G C   1 
ATOM 9395  O O   . PRO G 1 31  ? 52.788  82.550  72.819  1.00 63.48  ? 31  PRO G O   1 
ATOM 9396  C CB  . PRO G 1 31  ? 49.772  82.133  71.813  1.00 62.56  ? 31  PRO G CB  1 
ATOM 9397  C CG  . PRO G 1 31  ? 48.468  82.756  71.417  1.00 66.70  ? 31  PRO G CG  1 
ATOM 9398  C CD  . PRO G 1 31  ? 48.852  84.178  71.079  1.00 63.97  ? 31  PRO G CD  1 
ATOM 9399  N N   . LYS G 1 32  ? 52.330  84.223  71.372  1.00 65.61  ? 32  LYS G N   1 
ATOM 9400  C CA  . LYS G 1 32  ? 53.719  84.397  70.972  1.00 66.70  ? 32  LYS G CA  1 
ATOM 9401  C C   . LYS G 1 32  ? 54.463  85.187  72.057  1.00 66.44  ? 32  LYS G C   1 
ATOM 9402  O O   . LYS G 1 32  ? 55.381  84.671  72.700  1.00 66.19  ? 32  LYS G O   1 
ATOM 9403  C CB  . LYS G 1 32  ? 53.787  85.132  69.621  1.00 68.30  ? 32  LYS G CB  1 
ATOM 9404  C CG  . LYS G 1 32  ? 55.204  85.446  69.123  1.00 72.36  ? 32  LYS G CG  1 
ATOM 9405  C CD  . LYS G 1 32  ? 55.235  86.216  67.779  1.00 73.54  ? 32  LYS G CD  1 
ATOM 9406  C CE  . LYS G 1 32  ? 54.939  85.329  66.556  1.00 77.28  ? 32  LYS G CE  1 
ATOM 9407  N NZ  . LYS G 1 32  ? 53.556  84.754  66.540  1.00 77.54  ? 32  LYS G NZ  1 
ATOM 9408  N N   . VAL G 1 33  ? 54.031  86.425  72.284  1.00 61.87  ? 33  VAL G N   1 
ATOM 9409  C CA  . VAL G 1 33  ? 54.656  87.294  73.270  1.00 53.10  ? 33  VAL G CA  1 
ATOM 9410  C C   . VAL G 1 33  ? 54.299  87.074  74.746  1.00 52.80  ? 33  VAL G C   1 
ATOM 9411  O O   . VAL G 1 33  ? 55.113  87.347  75.611  1.00 57.43  ? 33  VAL G O   1 
ATOM 9412  C CB  . VAL G 1 33  ? 54.374  88.765  72.937  1.00 48.36  ? 33  VAL G CB  1 
ATOM 9413  C CG1 . VAL G 1 33  ? 54.771  89.055  71.497  1.00 45.11  ? 33  VAL G CG1 1 
ATOM 9414  C CG2 . VAL G 1 33  ? 52.906  89.070  73.155  1.00 49.96  ? 33  VAL G CG2 1 
ATOM 9415  N N   . ALA G 1 34  ? 53.107  86.585  75.057  1.00 49.91  ? 34  ALA G N   1 
ATOM 9416  C CA  . ALA G 1 34  ? 52.737  86.399  76.460  1.00 49.48  ? 34  ALA G CA  1 
ATOM 9417  C C   . ALA G 1 34  ? 52.328  84.969  76.859  1.00 48.37  ? 34  ALA G C   1 
ATOM 9418  O O   . ALA G 1 34  ? 51.333  84.762  77.555  1.00 45.11  ? 34  ALA G O   1 
ATOM 9419  C CB  . ALA G 1 34  ? 51.627  87.370  76.800  1.00 49.73  ? 34  ALA G CB  1 
ATOM 9420  N N   . PRO G 1 35  ? 53.124  83.975  76.457  1.00 49.17  ? 35  PRO G N   1 
ATOM 9421  C CA  . PRO G 1 35  ? 52.983  82.529  76.675  1.00 53.40  ? 35  PRO G CA  1 
ATOM 9422  C C   . PRO G 1 35  ? 52.473  82.030  78.013  1.00 58.20  ? 35  PRO G C   1 
ATOM 9423  O O   . PRO G 1 35  ? 51.881  80.953  78.089  1.00 56.18  ? 35  PRO G O   1 
ATOM 9424  C CB  . PRO G 1 35  ? 54.382  82.009  76.402  1.00 55.36  ? 35  PRO G CB  1 
ATOM 9425  C CG  . PRO G 1 35  ? 54.864  82.942  75.333  1.00 57.33  ? 35  PRO G CG  1 
ATOM 9426  C CD  . PRO G 1 35  ? 54.439  84.278  75.867  1.00 49.72  ? 35  PRO G CD  1 
ATOM 9427  N N   . GLN G 1 36  ? 52.721  82.792  79.072  1.00 66.22  ? 36  GLN G N   1 
ATOM 9428  C CA  . GLN G 1 36  ? 52.301  82.381  80.411  1.00 73.86  ? 36  GLN G CA  1 
ATOM 9429  C C   . GLN G 1 36  ? 50.882  82.827  80.735  1.00 79.37  ? 36  GLN G C   1 
ATOM 9430  O O   . GLN G 1 36  ? 50.288  82.381  81.723  1.00 81.04  ? 36  GLN G O   1 
ATOM 9431  C CB  . GLN G 1 36  ? 53.273  82.931  81.465  1.00 71.00  ? 36  GLN G CB  1 
ATOM 9432  C CG  . GLN G 1 36  ? 53.312  84.458  81.586  1.00 71.91  ? 36  GLN G CG  1 
ATOM 9433  C CD  . GLN G 1 36  ? 53.755  85.162  80.307  1.00 73.13  ? 36  GLN G CD  1 
ATOM 9434  O OE1 . GLN G 1 36  ? 54.578  84.649  79.550  1.00 75.66  ? 36  GLN G OE1 1 
ATOM 9435  N NE2 . GLN G 1 36  ? 53.225  86.356  80.078  1.00 72.36  ? 36  GLN G NE2 1 
ATOM 9436  N N   . ALA G 1 37  ? 50.342  83.707  79.895  1.00 83.89  ? 37  ALA G N   1 
ATOM 9437  C CA  . ALA G 1 37  ? 48.989  84.226  80.080  1.00 86.21  ? 37  ALA G CA  1 
ATOM 9438  C C   . ALA G 1 37  ? 48.022  83.476  79.168  1.00 86.44  ? 37  ALA G C   1 
ATOM 9439  O O   . ALA G 1 37  ? 47.072  82.822  79.627  1.00 83.86  ? 37  ALA G O   1 
ATOM 9440  C CB  . ALA G 1 37  ? 48.963  85.723  79.750  1.00 86.08  ? 37  ALA G CB  1 
ATOM 9441  N N   . ILE G 1 38  ? 48.296  83.586  77.869  1.00 86.67  ? 38  ILE G N   1 
ATOM 9442  C CA  . ILE G 1 38  ? 47.499  82.963  76.823  1.00 84.98  ? 38  ILE G CA  1 
ATOM 9443  C C   . ILE G 1 38  ? 48.243  81.840  76.134  1.00 83.55  ? 38  ILE G C   1 
ATOM 9444  O O   . ILE G 1 38  ? 49.290  82.054  75.516  1.00 84.25  ? 38  ILE G O   1 
ATOM 9445  C CB  . ILE G 1 38  ? 47.124  83.968  75.733  1.00 82.83  ? 38  ILE G CB  1 
ATOM 9446  C CG1 . ILE G 1 38  ? 46.249  85.068  76.316  1.00 80.47  ? 38  ILE G CG1 1 
ATOM 9447  C CG2 . ILE G 1 38  ? 46.388  83.262  74.618  1.00 85.50  ? 38  ILE G CG2 1 
ATOM 9448  C CD1 . ILE G 1 38  ? 46.091  86.251  75.395  1.00 77.84  ? 38  ILE G CD1 1 
ATOM 9449  N N   . SER G 1 39  ? 47.672  80.649  76.233  1.00 81.04  ? 39  SER G N   1 
ATOM 9450  C CA  . SER G 1 39  ? 48.228  79.464  75.610  1.00 79.24  ? 39  SER G CA  1 
ATOM 9451  C C   . SER G 1 39  ? 47.986  79.526  74.088  1.00 79.14  ? 39  SER G C   1 
ATOM 9452  O O   . SER G 1 39  ? 48.932  79.595  73.291  1.00 78.20  ? 39  SER G O   1 
ATOM 9453  C CB  . SER G 1 39  ? 47.553  78.232  76.217  1.00 76.78  ? 39  SER G CB  1 
ATOM 9454  O OG  . SER G 1 39  ? 47.782  77.076  75.441  1.00 73.63  ? 39  SER G OG  1 
ATOM 9455  N N   . SER G 1 40  ? 46.710  79.532  73.702  1.00 79.22  ? 40  SER G N   1 
ATOM 9456  C CA  . SER G 1 40  ? 46.305  79.568  72.292  1.00 75.54  ? 40  SER G CA  1 
ATOM 9457  C C   . SER G 1 40  ? 44.892  80.125  72.117  1.00 73.75  ? 40  SER G C   1 
ATOM 9458  O O   . SER G 1 40  ? 44.051  80.001  73.006  1.00 73.79  ? 40  SER G O   1 
ATOM 9459  C CB  . SER G 1 40  ? 46.336  78.155  71.717  1.00 76.14  ? 40  SER G CB  1 
ATOM 9460  O OG  . SER G 1 40  ? 45.461  77.307  72.447  1.00 72.33  ? 40  SER G OG  1 
ATOM 9461  N N   . VAL G 1 41  ? 44.635  80.719  70.958  1.00 70.96  ? 41  VAL G N   1 
ATOM 9462  C CA  . VAL G 1 41  ? 43.324  81.289  70.646  1.00 70.70  ? 41  VAL G CA  1 
ATOM 9463  C C   . VAL G 1 41  ? 42.784  80.667  69.351  1.00 73.19  ? 41  VAL G C   1 
ATOM 9464  O O   . VAL G 1 41  ? 43.523  80.542  68.371  1.00 75.57  ? 41  VAL G O   1 
ATOM 9465  C CB  . VAL G 1 41  ? 43.425  82.816  70.431  1.00 67.78  ? 41  VAL G CB  1 
ATOM 9466  C CG1 . VAL G 1 41  ? 42.057  83.406  70.185  1.00 67.53  ? 41  VAL G CG1 1 
ATOM 9467  C CG2 . VAL G 1 41  ? 44.069  83.456  71.625  1.00 66.06  ? 41  VAL G CG2 1 
ATOM 9468  N N   . GLU G 1 42  ? 41.510  80.274  69.330  1.00 73.32  ? 42  GLU G N   1 
ATOM 9469  C CA  . GLU G 1 42  ? 40.952  79.699  68.103  1.00 71.14  ? 42  GLU G CA  1 
ATOM 9470  C C   . GLU G 1 42  ? 39.535  80.181  67.794  1.00 65.26  ? 42  GLU G C   1 
ATOM 9471  O O   . GLU G 1 42  ? 38.749  80.414  68.707  1.00 67.27  ? 42  GLU G O   1 
ATOM 9472  C CB  . GLU G 1 42  ? 40.976  78.171  68.171  1.00 76.24  ? 42  GLU G CB  1 
ATOM 9473  C CG  . GLU G 1 42  ? 39.959  77.569  69.109  1.00 85.38  ? 42  GLU G CG  1 
ATOM 9474  C CD  . GLU G 1 42  ? 39.937  76.046  69.046  1.00 91.93  ? 42  GLU G CD  1 
ATOM 9475  O OE1 . GLU G 1 42  ? 40.847  75.399  69.632  1.00 93.17  ? 42  GLU G OE1 1 
ATOM 9476  O OE2 . GLU G 1 42  ? 39.008  75.502  68.400  1.00 94.71  ? 42  GLU G OE2 1 
ATOM 9477  N N   . ASN G 1 43  ? 39.221  80.319  66.503  1.00 58.17  ? 43  ASN G N   1 
ATOM 9478  C CA  . ASN G 1 43  ? 37.906  80.773  66.043  1.00 51.74  ? 43  ASN G CA  1 
ATOM 9479  C C   . ASN G 1 43  ? 36.831  79.694  65.980  1.00 49.25  ? 43  ASN G C   1 
ATOM 9480  O O   . ASN G 1 43  ? 36.616  79.098  64.934  1.00 47.29  ? 43  ASN G O   1 
ATOM 9481  C CB  . ASN G 1 43  ? 38.032  81.420  64.670  1.00 47.98  ? 43  ASN G CB  1 
ATOM 9482  C CG  . ASN G 1 43  ? 38.780  82.729  64.723  1.00 52.34  ? 43  ASN G CG  1 
ATOM 9483  O OD1 . ASN G 1 43  ? 39.373  83.068  65.751  1.00 55.07  ? 43  ASN G OD1 1 
ATOM 9484  N ND2 . ASN G 1 43  ? 38.765  83.477  63.618  1.00 51.43  ? 43  ASN G ND2 1 
ATOM 9485  N N   . ILE G 1 44  ? 36.171  79.460  67.112  1.00 46.38  ? 44  ILE G N   1 
ATOM 9486  C CA  . ILE G 1 44  ? 35.084  78.491  67.243  1.00 41.48  ? 44  ILE G CA  1 
ATOM 9487  C C   . ILE G 1 44  ? 34.007  78.629  66.147  1.00 38.10  ? 44  ILE G C   1 
ATOM 9488  O O   . ILE G 1 44  ? 33.434  77.631  65.715  1.00 33.44  ? 44  ILE G O   1 
ATOM 9489  C CB  . ILE G 1 44  ? 34.411  78.657  68.603  1.00 42.96  ? 44  ILE G CB  1 
ATOM 9490  C CG1 . ILE G 1 44  ? 35.406  78.324  69.704  1.00 46.18  ? 44  ILE G CG1 1 
ATOM 9491  C CG2 . ILE G 1 44  ? 33.214  77.739  68.712  1.00 40.81  ? 44  ILE G CG2 1 
ATOM 9492  C CD1 . ILE G 1 44  ? 35.513  76.833  69.996  1.00 44.99  ? 44  ILE G CD1 1 
ATOM 9493  N N   . GLU G 1 45  ? 33.711  79.867  65.744  1.00 34.19  ? 45  GLU G N   1 
ATOM 9494  C CA  . GLU G 1 45  ? 32.754  80.160  64.673  1.00 34.78  ? 45  GLU G CA  1 
ATOM 9495  C C   . GLU G 1 45  ? 33.124  81.491  64.020  1.00 33.15  ? 45  GLU G C   1 
ATOM 9496  O O   . GLU G 1 45  ? 33.401  82.465  64.702  1.00 38.28  ? 45  GLU G O   1 
ATOM 9497  C CB  . GLU G 1 45  ? 31.290  80.237  65.182  1.00 39.64  ? 45  GLU G CB  1 
ATOM 9498  C CG  . GLU G 1 45  ? 30.340  81.059  64.220  1.00 45.12  ? 45  GLU G CG  1 
ATOM 9499  C CD  . GLU G 1 45  ? 28.825  80.832  64.405  1.00 43.88  ? 45  GLU G CD  1 
ATOM 9500  O OE1 . GLU G 1 45  ? 28.349  80.782  65.562  1.00 42.78  ? 45  GLU G OE1 1 
ATOM 9501  O OE2 . GLU G 1 45  ? 28.102  80.730  63.378  1.00 45.32  ? 45  GLU G OE2 1 
ATOM 9502  N N   . GLY G 1 46  ? 33.136  81.547  62.699  1.00 30.19  ? 46  GLY G N   1 
ATOM 9503  C CA  . GLY G 1 46  ? 33.462  82.802  62.062  1.00 28.12  ? 46  GLY G CA  1 
ATOM 9504  C C   . GLY G 1 46  ? 34.892  82.823  61.593  1.00 30.33  ? 46  GLY G C   1 
ATOM 9505  O O   . GLY G 1 46  ? 35.717  82.024  62.035  1.00 29.92  ? 46  GLY G O   1 
ATOM 9506  N N   . ASN G 1 47  ? 35.191  83.758  60.703  1.00 29.01  ? 47  ASN G N   1 
ATOM 9507  C CA  . ASN G 1 47  ? 36.514  83.863  60.150  1.00 28.72  ? 47  ASN G CA  1 
ATOM 9508  C C   . ASN G 1 47  ? 37.343  84.999  60.758  1.00 31.03  ? 47  ASN G C   1 
ATOM 9509  O O   . ASN G 1 47  ? 38.260  85.523  60.117  1.00 30.77  ? 47  ASN G O   1 
ATOM 9510  C CB  . ASN G 1 47  ? 36.396  84.052  58.643  1.00 29.89  ? 47  ASN G CB  1 
ATOM 9511  C CG  . ASN G 1 47  ? 35.699  85.340  58.279  1.00 27.07  ? 47  ASN G CG  1 
ATOM 9512  O OD1 . ASN G 1 47  ? 35.716  85.775  57.119  1.00 28.06  ? 47  ASN G OD1 1 
ATOM 9513  N ND2 . ASN G 1 47  ? 35.077  85.963  59.268  1.00 28.15  ? 47  ASN G ND2 1 
ATOM 9514  N N   . GLY G 1 48  ? 37.024  85.399  61.981  1.00 29.89  ? 48  GLY G N   1 
ATOM 9515  C CA  . GLY G 1 48  ? 37.803  86.453  62.595  1.00 34.94  ? 48  GLY G CA  1 
ATOM 9516  C C   . GLY G 1 48  ? 37.312  87.880  62.445  1.00 38.67  ? 48  GLY G C   1 
ATOM 9517  O O   . GLY G 1 48  ? 37.838  88.783  63.101  1.00 46.93  ? 48  GLY G O   1 
ATOM 9518  N N   . GLY G 1 49  ? 36.332  88.118  61.587  1.00 36.41  ? 49  GLY G N   1 
ATOM 9519  C CA  . GLY G 1 49  ? 35.817  89.474  61.458  1.00 31.01  ? 49  GLY G CA  1 
ATOM 9520  C C   . GLY G 1 49  ? 34.732  89.666  62.512  1.00 31.53  ? 49  GLY G C   1 
ATOM 9521  O O   . GLY G 1 49  ? 34.567  88.825  63.422  1.00 26.03  ? 49  GLY G O   1 
ATOM 9522  N N   . PRO G 1 50  ? 33.964  90.765  62.426  1.00 32.56  ? 50  PRO G N   1 
ATOM 9523  C CA  . PRO G 1 50  ? 32.887  91.050  63.388  1.00 27.35  ? 50  PRO G CA  1 
ATOM 9524  C C   . PRO G 1 50  ? 32.011  89.816  63.630  1.00 27.20  ? 50  PRO G C   1 
ATOM 9525  O O   . PRO G 1 50  ? 31.687  89.079  62.700  1.00 28.37  ? 50  PRO G O   1 
ATOM 9526  C CB  . PRO G 1 50  ? 32.107  92.169  62.713  1.00 25.68  ? 50  PRO G CB  1 
ATOM 9527  C CG  . PRO G 1 50  ? 33.153  92.898  61.944  1.00 28.51  ? 50  PRO G CG  1 
ATOM 9528  C CD  . PRO G 1 50  ? 34.019  91.786  61.366  1.00 30.19  ? 50  PRO G CD  1 
ATOM 9529  N N   . GLY G 1 51  ? 31.644  89.594  64.883  1.00 26.12  ? 51  GLY G N   1 
ATOM 9530  C CA  . GLY G 1 51  ? 30.812  88.460  65.213  1.00 25.09  ? 51  GLY G CA  1 
ATOM 9531  C C   . GLY G 1 51  ? 31.605  87.220  65.569  1.00 28.05  ? 51  GLY G C   1 
ATOM 9532  O O   . GLY G 1 51  ? 31.123  86.372  66.321  1.00 27.03  ? 51  GLY G O   1 
ATOM 9533  N N   . THR G 1 52  ? 32.821  87.096  65.048  1.00 29.89  ? 52  THR G N   1 
ATOM 9534  C CA  . THR G 1 52  ? 33.625  85.906  65.337  1.00 30.66  ? 52  THR G CA  1 
ATOM 9535  C C   . THR G 1 52  ? 33.623  85.480  66.820  1.00 31.19  ? 52  THR G C   1 
ATOM 9536  O O   . THR G 1 52  ? 33.719  86.327  67.712  1.00 34.55  ? 52  THR G O   1 
ATOM 9537  C CB  . THR G 1 52  ? 35.081  86.122  64.895  1.00 31.00  ? 52  THR G CB  1 
ATOM 9538  O OG1 . THR G 1 52  ? 35.112  86.480  63.508  1.00 27.58  ? 52  THR G OG1 1 
ATOM 9539  C CG2 . THR G 1 52  ? 35.890  84.851  65.107  1.00 35.08  ? 52  THR G CG2 1 
ATOM 9540  N N   . ILE G 1 53  ? 33.500  84.177  67.074  1.00 27.67  ? 53  ILE G N   1 
ATOM 9541  C CA  . ILE G 1 53  ? 33.529  83.624  68.435  1.00 30.94  ? 53  ILE G CA  1 
ATOM 9542  C C   . ILE G 1 53  ? 34.857  82.884  68.654  1.00 35.88  ? 53  ILE G C   1 
ATOM 9543  O O   . ILE G 1 53  ? 35.131  81.876  67.988  1.00 33.03  ? 53  ILE G O   1 
ATOM 9544  C CB  . ILE G 1 53  ? 32.382  82.609  68.697  1.00 31.57  ? 53  ILE G CB  1 
ATOM 9545  C CG1 . ILE G 1 53  ? 31.118  83.335  69.154  1.00 27.27  ? 53  ILE G CG1 1 
ATOM 9546  C CG2 . ILE G 1 53  ? 32.793  81.614  69.785  1.00 26.96  ? 53  ILE G CG2 1 
ATOM 9547  C CD1 . ILE G 1 53  ? 30.696  84.416  68.234  1.00 32.16  ? 53  ILE G CD1 1 
ATOM 9548  N N   . LYS G 1 54  ? 35.654  83.376  69.613  1.00 39.42  ? 54  LYS G N   1 
ATOM 9549  C CA  . LYS G 1 54  ? 36.970  82.813  69.934  1.00 35.82  ? 54  LYS G CA  1 
ATOM 9550  C C   . LYS G 1 54  ? 37.054  82.042  71.252  1.00 36.25  ? 54  LYS G C   1 
ATOM 9551  O O   . LYS G 1 54  ? 36.439  82.410  72.251  1.00 40.68  ? 54  LYS G O   1 
ATOM 9552  C CB  . LYS G 1 54  ? 38.008  83.941  69.932  1.00 31.24  ? 54  LYS G CB  1 
ATOM 9553  C CG  . LYS G 1 54  ? 37.852  84.878  68.735  1.00 33.26  ? 54  LYS G CG  1 
ATOM 9554  C CD  . LYS G 1 54  ? 39.041  85.813  68.484  1.00 40.69  ? 54  LYS G CD  1 
ATOM 9555  C CE  . LYS G 1 54  ? 38.844  86.594  67.166  1.00 41.50  ? 54  LYS G CE  1 
ATOM 9556  N NZ  . LYS G 1 54  ? 39.998  87.440  66.693  1.00 44.84  ? 54  LYS G NZ  1 
ATOM 9557  N N   . LYS G 1 55  ? 37.803  80.949  71.236  1.00 38.59  ? 55  LYS G N   1 
ATOM 9558  C CA  . LYS G 1 55  ? 38.014  80.156  72.434  1.00 43.63  ? 55  LYS G CA  1 
ATOM 9559  C C   . LYS G 1 55  ? 39.480  80.418  72.801  1.00 50.87  ? 55  LYS G C   1 
ATOM 9560  O O   . LYS G 1 55  ? 40.405  79.954  72.112  1.00 53.28  ? 55  LYS G O   1 
ATOM 9561  C CB  . LYS G 1 55  ? 37.796  78.664  72.160  1.00 40.87  ? 55  LYS G CB  1 
ATOM 9562  C CG  . LYS G 1 55  ? 37.605  77.808  73.421  1.00 38.82  ? 55  LYS G CG  1 
ATOM 9563  C CD  . LYS G 1 55  ? 38.640  76.680  73.541  1.00 40.91  ? 55  LYS G CD  1 
ATOM 9564  C CE  . LYS G 1 55  ? 38.074  75.303  73.172  1.00 45.11  ? 55  LYS G CE  1 
ATOM 9565  N NZ  . LYS G 1 55  ? 37.141  74.721  74.195  1.00 52.58  ? 55  LYS G NZ  1 
ATOM 9566  N N   . ILE G 1 56  ? 39.676  81.198  73.865  1.00 52.87  ? 56  ILE G N   1 
ATOM 9567  C CA  . ILE G 1 56  ? 41.003  81.540  74.356  1.00 51.88  ? 56  ILE G CA  1 
ATOM 9568  C C   . ILE G 1 56  ? 41.421  80.545  75.433  1.00 53.97  ? 56  ILE G C   1 
ATOM 9569  O O   . ILE G 1 56  ? 40.755  80.416  76.462  1.00 52.81  ? 56  ILE G O   1 
ATOM 9570  C CB  . ILE G 1 56  ? 41.011  82.947  74.942  1.00 48.65  ? 56  ILE G CB  1 
ATOM 9571  C CG1 . ILE G 1 56  ? 40.600  83.946  73.862  1.00 49.35  ? 56  ILE G CG1 1 
ATOM 9572  C CG2 . ILE G 1 56  ? 42.381  83.269  75.473  1.00 44.51  ? 56  ILE G CG2 1 
ATOM 9573  C CD1 . ILE G 1 56  ? 40.785  85.405  74.249  1.00 46.46  ? 56  ILE G CD1 1 
ATOM 9574  N N   . SER G 1 57  ? 42.523  79.841  75.181  1.00 58.22  ? 57  SER G N   1 
ATOM 9575  C CA  . SER G 1 57  ? 43.040  78.834  76.106  1.00 62.85  ? 57  SER G CA  1 
ATOM 9576  C C   . SER G 1 57  ? 44.190  79.347  76.973  1.00 67.01  ? 57  SER G C   1 
ATOM 9577  O O   . SER G 1 57  ? 45.023  80.151  76.521  1.00 66.60  ? 57  SER G O   1 
ATOM 9578  C CB  . SER G 1 57  ? 43.498  77.604  75.329  1.00 59.50  ? 57  SER G CB  1 
ATOM 9579  O OG  . SER G 1 57  ? 42.408  77.027  74.639  1.00 60.45  ? 57  SER G OG  1 
ATOM 9580  N N   . PHE G 1 58  ? 44.226  78.855  78.214  1.00 68.94  ? 58  PHE G N   1 
ATOM 9581  C CA  . PHE G 1 58  ? 45.234  79.255  79.191  1.00 74.38  ? 58  PHE G CA  1 
ATOM 9582  C C   . PHE G 1 58  ? 46.218  78.154  79.564  1.00 77.36  ? 58  PHE G C   1 
ATOM 9583  O O   . PHE G 1 58  ? 45.856  76.972  79.611  1.00 77.38  ? 58  PHE G O   1 
ATOM 9584  C CB  . PHE G 1 58  ? 44.550  79.763  80.460  1.00 73.00  ? 58  PHE G CB  1 
ATOM 9585  C CG  . PHE G 1 58  ? 43.692  80.960  80.231  1.00 71.50  ? 58  PHE G CG  1 
ATOM 9586  C CD1 . PHE G 1 58  ? 44.231  82.120  79.666  1.00 68.45  ? 58  PHE G CD1 1 
ATOM 9587  C CD2 . PHE G 1 58  ? 42.338  80.926  80.554  1.00 69.23  ? 58  PHE G CD2 1 
ATOM 9588  C CE1 . PHE G 1 58  ? 43.429  83.236  79.420  1.00 65.84  ? 58  PHE G CE1 1 
ATOM 9589  C CE2 . PHE G 1 58  ? 41.526  82.033  80.312  1.00 68.19  ? 58  PHE G CE2 1 
ATOM 9590  C CZ  . PHE G 1 58  ? 42.073  83.195  79.743  1.00 66.79  ? 58  PHE G CZ  1 
ATOM 9591  N N   . PRO G 1 59  ? 47.484  78.541  79.836  1.00 78.00  ? 59  PRO G N   1 
ATOM 9592  C CA  . PRO G 1 59  ? 48.530  77.588  80.209  1.00 76.40  ? 59  PRO G CA  1 
ATOM 9593  C C   . PRO G 1 59  ? 48.103  76.869  81.487  1.00 79.82  ? 59  PRO G C   1 
ATOM 9594  O O   . PRO G 1 59  ? 47.585  77.485  82.427  1.00 80.87  ? 59  PRO G O   1 
ATOM 9595  C CB  . PRO G 1 59  ? 49.757  78.481  80.385  1.00 74.70  ? 59  PRO G CB  1 
ATOM 9596  C CG  . PRO G 1 59  ? 49.460  79.662  79.475  1.00 71.68  ? 59  PRO G CG  1 
ATOM 9597  C CD  . PRO G 1 59  ? 48.020  79.915  79.756  1.00 73.72  ? 59  PRO G CD  1 
ATOM 9598  N N   . GLU G 1 60  ? 48.282  75.553  81.497  1.00 83.79  ? 60  GLU G N   1 
ATOM 9599  C CA  . GLU G 1 60  ? 47.907  74.743  82.647  1.00 87.08  ? 60  GLU G CA  1 
ATOM 9600  C C   . GLU G 1 60  ? 48.524  75.342  83.904  1.00 88.61  ? 60  GLU G C   1 
ATOM 9601  O O   . GLU G 1 60  ? 49.728  75.610  83.960  1.00 90.98  ? 60  GLU G O   1 
ATOM 9602  C CB  . GLU G 1 60  ? 48.358  73.293  82.426  1.00 87.24  ? 60  GLU G CB  1 
ATOM 9603  C CG  . GLU G 1 60  ? 48.407  72.420  83.671  1.00 92.61  ? 60  GLU G CG  1 
ATOM 9604  C CD  . GLU G 1 60  ? 49.820  71.931  83.969  1.00 97.90  ? 60  GLU G CD  1 
ATOM 9605  O OE1 . GLU G 1 60  ? 50.671  71.994  83.056  1.00 100.60 ? 60  GLU G OE1 1 
ATOM 9606  O OE2 . GLU G 1 60  ? 50.079  71.473  85.104  1.00 98.71  ? 60  GLU G OE2 1 
ATOM 9607  N N   . GLY G 1 61  ? 47.683  75.580  84.904  1.00 88.67  ? 61  GLY G N   1 
ATOM 9608  C CA  . GLY G 1 61  ? 48.165  76.167  86.138  1.00 89.41  ? 61  GLY G CA  1 
ATOM 9609  C C   . GLY G 1 61  ? 47.361  77.387  86.545  1.00 90.62  ? 61  GLY G C   1 
ATOM 9610  O O   . GLY G 1 61  ? 46.963  77.512  87.707  1.00 91.14  ? 61  GLY G O   1 
ATOM 9611  N N   . LEU G 1 62  ? 47.124  78.294  85.599  1.00 89.74  ? 62  LEU G N   1 
ATOM 9612  C CA  . LEU G 1 62  ? 46.352  79.505  85.880  1.00 88.55  ? 62  LEU G CA  1 
ATOM 9613  C C   . LEU G 1 62  ? 44.983  79.131  86.457  1.00 90.97  ? 62  LEU G C   1 
ATOM 9614  O O   . LEU G 1 62  ? 44.621  77.943  86.514  1.00 89.48  ? 62  LEU G O   1 
ATOM 9615  C CB  . LEU G 1 62  ? 46.173  80.335  84.608  1.00 86.26  ? 62  LEU G CB  1 
ATOM 9616  C CG  . LEU G 1 62  ? 47.412  81.047  84.052  1.00 85.49  ? 62  LEU G CG  1 
ATOM 9617  C CD1 . LEU G 1 62  ? 48.442  80.009  83.613  1.00 85.09  ? 62  LEU G CD1 1 
ATOM 9618  C CD2 . LEU G 1 62  ? 47.022  81.948  82.879  1.00 86.36  ? 62  LEU G CD2 1 
ATOM 9619  N N   . PRO G 1 63  ? 44.195  80.135  86.887  1.00 93.97  ? 63  PRO G N   1 
ATOM 9620  C CA  . PRO G 1 63  ? 42.871  79.842  87.457  1.00 96.29  ? 63  PRO G CA  1 
ATOM 9621  C C   . PRO G 1 63  ? 41.901  79.128  86.525  1.00 97.90  ? 63  PRO G C   1 
ATOM 9622  O O   . PRO G 1 63  ? 41.273  78.138  86.916  1.00 96.80  ? 63  PRO G O   1 
ATOM 9623  C CB  . PRO G 1 63  ? 42.348  81.217  87.855  1.00 94.20  ? 63  PRO G CB  1 
ATOM 9624  C CG  . PRO G 1 63  ? 42.992  82.130  86.857  1.00 93.32  ? 63  PRO G CG  1 
ATOM 9625  C CD  . PRO G 1 63  ? 44.409  81.592  86.780  1.00 93.12  ? 63  PRO G CD  1 
ATOM 9626  N N   . PHE G 1 64  ? 41.771  79.646  85.302  1.00 98.60  ? 64  PHE G N   1 
ATOM 9627  C CA  . PHE G 1 64  ? 40.858  79.075  84.314  1.00 96.77  ? 64  PHE G CA  1 
ATOM 9628  C C   . PHE G 1 64  ? 41.568  78.382  83.170  1.00 95.96  ? 64  PHE G C   1 
ATOM 9629  O O   . PHE G 1 64  ? 42.702  78.724  82.817  1.00 93.57  ? 64  PHE G O   1 
ATOM 9630  C CB  . PHE G 1 64  ? 39.978  80.158  83.700  1.00 96.93  ? 64  PHE G CB  1 
ATOM 9631  C CG  . PHE G 1 64  ? 39.258  81.000  84.701  1.00 95.88  ? 64  PHE G CG  1 
ATOM 9632  C CD1 . PHE G 1 64  ? 38.381  80.424  85.618  1.00 94.64  ? 64  PHE G CD1 1 
ATOM 9633  C CD2 . PHE G 1 64  ? 39.445  82.384  84.713  1.00 93.84  ? 64  PHE G CD2 1 
ATOM 9634  C CE1 . PHE G 1 64  ? 37.698  81.215  86.532  1.00 93.61  ? 64  PHE G CE1 1 
ATOM 9635  C CE2 . PHE G 1 64  ? 38.771  83.185  85.618  1.00 94.06  ? 64  PHE G CE2 1 
ATOM 9636  C CZ  . PHE G 1 64  ? 37.892  82.600  86.535  1.00 94.54  ? 64  PHE G CZ  1 
ATOM 9637  N N   . LYS G 1 65  ? 40.867  77.423  82.573  1.00 94.89  ? 65  LYS G N   1 
ATOM 9638  C CA  . LYS G 1 65  ? 41.409  76.694  81.444  1.00 94.49  ? 65  LYS G CA  1 
ATOM 9639  C C   . LYS G 1 65  ? 41.181  77.450  80.123  1.00 93.61  ? 65  LYS G C   1 
ATOM 9640  O O   . LYS G 1 65  ? 42.112  77.609  79.319  1.00 93.77  ? 65  LYS G O   1 
ATOM 9641  C CB  . LYS G 1 65  ? 40.782  75.298  81.346  1.00 94.05  ? 65  LYS G CB  1 
ATOM 9642  C CG  . LYS G 1 65  ? 41.372  74.487  80.185  1.00 99.20  ? 65  LYS G CG  1 
ATOM 9643  C CD  . LYS G 1 65  ? 40.686  73.136  79.959  1.00 102.75 ? 65  LYS G CD  1 
ATOM 9644  C CE  . LYS G 1 65  ? 41.214  72.440  78.687  1.00 104.49 ? 65  LYS G CE  1 
ATOM 9645  N NZ  . LYS G 1 65  ? 40.583  71.103  78.447  1.00 107.62 ? 65  LYS G NZ  1 
ATOM 9646  N N   . TYR G 1 66  ? 39.949  77.919  79.910  1.00 91.15  ? 66  TYR G N   1 
ATOM 9647  C CA  . TYR G 1 66  ? 39.588  78.634  78.684  1.00 86.19  ? 66  TYR G CA  1 
ATOM 9648  C C   . TYR G 1 66  ? 38.530  79.701  78.936  1.00 81.02  ? 66  TYR G C   1 
ATOM 9649  O O   . TYR G 1 66  ? 38.013  79.834  80.043  1.00 79.69  ? 66  TYR G O   1 
ATOM 9650  C CB  . TYR G 1 66  ? 39.012  77.656  77.664  1.00 90.23  ? 66  TYR G CB  1 
ATOM 9651  C CG  . TYR G 1 66  ? 37.585  77.251  77.988  1.00 92.07  ? 66  TYR G CG  1 
ATOM 9652  C CD1 . TYR G 1 66  ? 37.299  76.400  79.056  1.00 90.36  ? 66  TYR G CD1 1 
ATOM 9653  C CD2 . TYR G 1 66  ? 36.515  77.760  77.248  1.00 94.82  ? 66  TYR G CD2 1 
ATOM 9654  C CE1 . TYR G 1 66  ? 35.981  76.070  79.379  1.00 92.31  ? 66  TYR G CE1 1 
ATOM 9655  C CE2 . TYR G 1 66  ? 35.195  77.437  77.563  1.00 96.47  ? 66  TYR G CE2 1 
ATOM 9656  C CZ  . TYR G 1 66  ? 34.932  76.593  78.627  1.00 94.07  ? 66  TYR G CZ  1 
ATOM 9657  O OH  . TYR G 1 66  ? 33.621  76.284  78.924  1.00 91.95  ? 66  TYR G OH  1 
ATOM 9658  N N   . VAL G 1 67  ? 38.194  80.431  77.879  1.00 74.61  ? 67  VAL G N   1 
ATOM 9659  C CA  . VAL G 1 67  ? 37.179  81.474  77.938  1.00 70.01  ? 67  VAL G CA  1 
ATOM 9660  C C   . VAL G 1 67  ? 36.788  81.833  76.509  1.00 69.38  ? 67  VAL G C   1 
ATOM 9661  O O   . VAL G 1 67  ? 37.654  81.912  75.630  1.00 71.52  ? 67  VAL G O   1 
ATOM 9662  C CB  . VAL G 1 67  ? 37.702  82.749  78.624  1.00 64.80  ? 67  VAL G CB  1 
ATOM 9663  C CG1 . VAL G 1 67  ? 38.789  83.389  77.769  1.00 58.07  ? 67  VAL G CG1 1 
ATOM 9664  C CG2 . VAL G 1 67  ? 36.551  83.723  78.847  1.00 64.05  ? 67  VAL G CG2 1 
ATOM 9665  N N   . LYS G 1 68  ? 35.497  82.058  76.273  1.00 63.22  ? 68  LYS G N   1 
ATOM 9666  C CA  . LYS G 1 68  ? 35.041  82.410  74.934  1.00 56.16  ? 68  LYS G CA  1 
ATOM 9667  C C   . LYS G 1 68  ? 34.524  83.838  74.885  1.00 51.97  ? 68  LYS G C   1 
ATOM 9668  O O   . LYS G 1 68  ? 33.624  84.203  75.633  1.00 58.45  ? 68  LYS G O   1 
ATOM 9669  C CB  . LYS G 1 68  ? 33.948  81.437  74.479  1.00 55.67  ? 68  LYS G CB  1 
ATOM 9670  C CG  . LYS G 1 68  ? 34.382  79.973  74.477  1.00 56.10  ? 68  LYS G CG  1 
ATOM 9671  C CD  . LYS G 1 68  ? 33.249  79.034  74.074  1.00 52.51  ? 68  LYS G CD  1 
ATOM 9672  C CE  . LYS G 1 68  ? 33.663  77.563  74.197  1.00 49.55  ? 68  LYS G CE  1 
ATOM 9673  N NZ  . LYS G 1 68  ? 32.536  76.614  73.921  1.00 56.10  ? 68  LYS G NZ  1 
ATOM 9674  N N   . ASP G 1 69  ? 35.118  84.648  74.022  1.00 45.26  ? 69  ASP G N   1 
ATOM 9675  C CA  . ASP G 1 69  ? 34.693  86.029  73.862  1.00 44.99  ? 69  ASP G CA  1 
ATOM 9676  C C   . ASP G 1 69  ? 33.993  86.089  72.514  1.00 41.10  ? 69  ASP G C   1 
ATOM 9677  O O   . ASP G 1 69  ? 34.016  85.127  71.761  1.00 41.11  ? 69  ASP G O   1 
ATOM 9678  C CB  . ASP G 1 69  ? 35.884  86.990  73.831  1.00 48.41  ? 69  ASP G CB  1 
ATOM 9679  C CG  . ASP G 1 69  ? 36.823  86.812  74.998  1.00 52.28  ? 69  ASP G CG  1 
ATOM 9680  O OD1 . ASP G 1 69  ? 36.545  85.979  75.901  1.00 57.52  ? 69  ASP G OD1 1 
ATOM 9681  O OD2 . ASP G 1 69  ? 37.854  87.517  74.999  1.00 51.28  ? 69  ASP G OD2 1 
ATOM 9682  N N   . ARG G 1 70  ? 33.408  87.231  72.192  1.00 32.10  ? 70  ARG G N   1 
ATOM 9683  C CA  . ARG G 1 70  ? 32.704  87.368  70.945  1.00 27.29  ? 70  ARG G CA  1 
ATOM 9684  C C   . ARG G 1 70  ? 32.864  88.762  70.368  1.00 26.46  ? 70  ARG G C   1 
ATOM 9685  O O   . ARG G 1 70  ? 32.323  89.731  70.895  1.00 21.79  ? 70  ARG G O   1 
ATOM 9686  C CB  . ARG G 1 70  ? 31.233  87.052  71.191  1.00 35.21  ? 70  ARG G CB  1 
ATOM 9687  C CG  . ARG G 1 70  ? 30.238  87.926  70.424  1.00 39.91  ? 70  ARG G CG  1 
ATOM 9688  C CD  . ARG G 1 70  ? 28.867  87.661  70.976  1.00 45.34  ? 70  ARG G CD  1 
ATOM 9689  N NE  . ARG G 1 70  ? 28.187  88.838  71.505  1.00 46.48  ? 70  ARG G NE  1 
ATOM 9690  C CZ  . ARG G 1 70  ? 27.198  88.764  72.392  1.00 49.40  ? 70  ARG G CZ  1 
ATOM 9691  N NH1 . ARG G 1 70  ? 26.810  87.577  72.839  1.00 49.40  ? 70  ARG G NH1 1 
ATOM 9692  N NH2 . ARG G 1 70  ? 26.573  89.860  72.803  1.00 51.17  ? 70  ARG G NH2 1 
ATOM 9693  N N   . VAL G 1 71  ? 33.605  88.868  69.276  1.00 26.42  ? 71  VAL G N   1 
ATOM 9694  C CA  . VAL G 1 71  ? 33.811  90.167  68.664  1.00 29.36  ? 71  VAL G CA  1 
ATOM 9695  C C   . VAL G 1 71  ? 32.439  90.735  68.422  1.00 34.23  ? 71  VAL G C   1 
ATOM 9696  O O   . VAL G 1 71  ? 31.621  90.072  67.805  1.00 43.57  ? 71  VAL G O   1 
ATOM 9697  C CB  . VAL G 1 71  ? 34.522  90.040  67.331  1.00 24.34  ? 71  VAL G CB  1 
ATOM 9698  C CG1 . VAL G 1 71  ? 34.864  91.424  66.808  1.00 27.23  ? 71  VAL G CG1 1 
ATOM 9699  C CG2 . VAL G 1 71  ? 35.765  89.183  67.488  1.00 26.27  ? 71  VAL G CG2 1 
ATOM 9700  N N   . ASP G 1 72  ? 32.176  91.944  68.900  1.00 39.37  ? 72  ASP G N   1 
ATOM 9701  C CA  . ASP G 1 72  ? 30.863  92.545  68.725  1.00 44.65  ? 72  ASP G CA  1 
ATOM 9702  C C   . ASP G 1 72  ? 30.815  93.669  67.738  1.00 47.58  ? 72  ASP G C   1 
ATOM 9703  O O   . ASP G 1 72  ? 29.851  93.816  66.990  1.00 53.83  ? 72  ASP G O   1 
ATOM 9704  C CB  . ASP G 1 72  ? 30.343  93.041  70.053  1.00 45.76  ? 72  ASP G CB  1 
ATOM 9705  C CG  . ASP G 1 72  ? 29.969  91.909  70.960  1.00 54.96  ? 72  ASP G CG  1 
ATOM 9706  O OD1 . ASP G 1 72  ? 29.194  91.025  70.503  1.00 56.81  ? 72  ASP G OD1 1 
ATOM 9707  O OD2 . ASP G 1 72  ? 30.444  91.900  72.118  1.00 57.92  ? 72  ASP G OD2 1 
ATOM 9708  N N   . GLU G 1 73  ? 31.841  94.493  67.746  1.00 50.27  ? 73  GLU G N   1 
ATOM 9709  C CA  . GLU G 1 73  ? 31.868  95.593  66.816  1.00 54.88  ? 73  GLU G CA  1 
ATOM 9710  C C   . GLU G 1 73  ? 33.324  95.981  66.657  1.00 54.67  ? 73  GLU G C   1 
ATOM 9711  O O   . GLU G 1 73  ? 34.115  95.829  67.589  1.00 54.88  ? 73  GLU G O   1 
ATOM 9712  C CB  . GLU G 1 73  ? 31.020  96.749  67.360  1.00 60.34  ? 73  GLU G CB  1 
ATOM 9713  C CG  . GLU G 1 73  ? 30.731  97.863  66.341  1.00 74.81  ? 73  GLU G CG  1 
ATOM 9714  C CD  . GLU G 1 73  ? 31.776  99.010  66.334  1.00 82.89  ? 73  GLU G CD  1 
ATOM 9715  O OE1 . GLU G 1 73  ? 31.783  99.804  65.354  1.00 83.11  ? 73  GLU G OE1 1 
ATOM 9716  O OE2 . GLU G 1 73  ? 32.573  99.131  67.304  1.00 86.77  ? 73  GLU G OE2 1 
ATOM 9717  N N   . VAL G 1 74  ? 33.681  96.461  65.475  1.00 53.14  ? 74  VAL G N   1 
ATOM 9718  C CA  . VAL G 1 74  ? 35.046  96.852  65.218  1.00 54.68  ? 74  VAL G CA  1 
ATOM 9719  C C   . VAL G 1 74  ? 35.150  98.091  64.347  1.00 61.09  ? 74  VAL G C   1 
ATOM 9720  O O   . VAL G 1 74  ? 35.079  97.989  63.127  1.00 60.69  ? 74  VAL G O   1 
ATOM 9721  C CB  . VAL G 1 74  ? 35.796  95.735  64.521  1.00 51.53  ? 74  VAL G CB  1 
ATOM 9722  C CG1 . VAL G 1 74  ? 37.199  96.197  64.168  1.00 55.23  ? 74  VAL G CG1 1 
ATOM 9723  C CG2 . VAL G 1 74  ? 35.808  94.506  65.401  1.00 46.59  ? 74  VAL G CG2 1 
ATOM 9724  N N   . ASP G 1 75  ? 35.312  99.264  64.957  1.00 66.04  ? 75  ASP G N   1 
ATOM 9725  C CA  . ASP G 1 75  ? 35.453  100.463 64.148  1.00 68.39  ? 75  ASP G CA  1 
ATOM 9726  C C   . ASP G 1 75  ? 36.902  100.561 63.771  1.00 70.53  ? 75  ASP G C   1 
ATOM 9727  O O   . ASP G 1 75  ? 37.768  100.682 64.634  1.00 71.30  ? 75  ASP G O   1 
ATOM 9728  C CB  . ASP G 1 75  ? 35.083  101.734 64.886  1.00 69.06  ? 75  ASP G CB  1 
ATOM 9729  C CG  . ASP G 1 75  ? 35.106  102.942 63.957  1.00 73.93  ? 75  ASP G CG  1 
ATOM 9730  O OD1 . ASP G 1 75  ? 36.111  103.112 63.217  1.00 72.35  ? 75  ASP G OD1 1 
ATOM 9731  O OD2 . ASP G 1 75  ? 34.117  103.709 63.955  1.00 76.81  ? 75  ASP G OD2 1 
ATOM 9732  N N   . HIS G 1 76  ? 37.164  100.523 62.476  1.00 72.88  ? 76  HIS G N   1 
ATOM 9733  C CA  . HIS G 1 76  ? 38.528  100.580 62.010  1.00 75.36  ? 76  HIS G CA  1 
ATOM 9734  C C   . HIS G 1 76  ? 39.131  101.967 62.066  1.00 74.12  ? 76  HIS G C   1 
ATOM 9735  O O   . HIS G 1 76  ? 40.214  102.148 62.618  1.00 74.73  ? 76  HIS G O   1 
ATOM 9736  C CB  . HIS G 1 76  ? 38.607  99.989  60.603  1.00 77.02  ? 76  HIS G CB  1 
ATOM 9737  C CG  . HIS G 1 76  ? 38.458  98.500  60.585  1.00 78.55  ? 76  HIS G CG  1 
ATOM 9738  N ND1 . HIS G 1 76  ? 39.405  97.655  61.123  1.00 79.13  ? 76  HIS G ND1 1 
ATOM 9739  C CD2 . HIS G 1 76  ? 37.444  97.709  60.163  1.00 80.16  ? 76  HIS G CD2 1 
ATOM 9740  C CE1 . HIS G 1 76  ? 38.980  96.407  61.035  1.00 79.61  ? 76  HIS G CE1 1 
ATOM 9741  N NE2 . HIS G 1 76  ? 37.794  96.412  60.458  1.00 81.10  ? 76  HIS G NE2 1 
ATOM 9742  N N   . THR G 1 77  ? 38.431  102.950 61.523  1.00 74.39  ? 77  THR G N   1 
ATOM 9743  C CA  . THR G 1 77  ? 38.958  104.307 61.526  1.00 77.10  ? 77  THR G CA  1 
ATOM 9744  C C   . THR G 1 77  ? 39.217  104.879 62.932  1.00 77.52  ? 77  THR G C   1 
ATOM 9745  O O   . THR G 1 77  ? 40.255  105.495 63.174  1.00 82.29  ? 77  THR G O   1 
ATOM 9746  C CB  . THR G 1 77  ? 38.022  105.251 60.757  1.00 77.34  ? 77  THR G CB  1 
ATOM 9747  O OG1 . THR G 1 77  ? 36.727  105.242 61.373  1.00 83.86  ? 77  THR G OG1 1 
ATOM 9748  C CG2 . THR G 1 77  ? 37.899  104.799 59.303  1.00 74.31  ? 77  THR G CG2 1 
ATOM 9749  N N   . ASN G 1 78  ? 38.295  104.657 63.862  1.00 74.62  ? 78  ASN G N   1 
ATOM 9750  C CA  . ASN G 1 78  ? 38.442  105.184 65.214  1.00 70.12  ? 78  ASN G CA  1 
ATOM 9751  C C   . ASN G 1 78  ? 39.098  104.274 66.234  1.00 69.38  ? 78  ASN G C   1 
ATOM 9752  O O   . ASN G 1 78  ? 39.173  104.617 67.405  1.00 68.92  ? 78  ASN G O   1 
ATOM 9753  C CB  . ASN G 1 78  ? 37.080  105.620 65.735  1.00 68.97  ? 78  ASN G CB  1 
ATOM 9754  C CG  . ASN G 1 78  ? 36.533  106.788 64.970  1.00 69.15  ? 78  ASN G CG  1 
ATOM 9755  O OD1 . ASN G 1 78  ? 37.027  107.905 65.100  1.00 75.60  ? 78  ASN G OD1 1 
ATOM 9756  N ND2 . ASN G 1 78  ? 35.525  106.542 64.146  1.00 69.31  ? 78  ASN G ND2 1 
ATOM 9757  N N   . PHE G 1 79  ? 39.567  103.114 65.802  1.00 68.98  ? 79  PHE G N   1 
ATOM 9758  C CA  . PHE G 1 79  ? 40.226  102.184 66.709  1.00 72.57  ? 79  PHE G CA  1 
ATOM 9759  C C   . PHE G 1 79  ? 39.380  101.782 67.912  1.00 73.80  ? 79  PHE G C   1 
ATOM 9760  O O   . PHE G 1 79  ? 39.912  101.562 69.004  1.00 73.32  ? 79  PHE G O   1 
ATOM 9761  C CB  . PHE G 1 79  ? 41.529  102.788 67.208  1.00 76.52  ? 79  PHE G CB  1 
ATOM 9762  C CG  . PHE G 1 79  ? 42.348  103.417 66.127  1.00 83.32  ? 79  PHE G CG  1 
ATOM 9763  C CD1 . PHE G 1 79  ? 42.685  102.697 64.987  1.00 84.23  ? 79  PHE G CD1 1 
ATOM 9764  C CD2 . PHE G 1 79  ? 42.799  104.728 66.253  1.00 86.07  ? 79  PHE G CD2 1 
ATOM 9765  C CE1 . PHE G 1 79  ? 43.461  103.271 63.985  1.00 86.96  ? 79  PHE G CE1 1 
ATOM 9766  C CE2 . PHE G 1 79  ? 43.580  105.314 65.254  1.00 86.62  ? 79  PHE G CE2 1 
ATOM 9767  C CZ  . PHE G 1 79  ? 43.912  104.584 64.119  1.00 86.10  ? 79  PHE G CZ  1 
ATOM 9768  N N   . LYS G 1 80  ? 38.064  101.702 67.724  1.00 73.95  ? 80  LYS G N   1 
ATOM 9769  C CA  . LYS G 1 80  ? 37.175  101.279 68.803  1.00 68.56  ? 80  LYS G CA  1 
ATOM 9770  C C   . LYS G 1 80  ? 36.880  99.802  68.555  1.00 61.91  ? 80  LYS G C   1 
ATOM 9771  O O   . LYS G 1 80  ? 36.638  99.388  67.423  1.00 59.38  ? 80  LYS G O   1 
ATOM 9772  C CB  . LYS G 1 80  ? 35.882  102.093 68.794  1.00 72.01  ? 80  LYS G CB  1 
ATOM 9773  C CG  . LYS G 1 80  ? 34.923  101.737 69.935  1.00 83.24  ? 80  LYS G CG  1 
ATOM 9774  C CD  . LYS G 1 80  ? 33.680  102.650 69.942  1.00 89.75  ? 80  LYS G CD  1 
ATOM 9775  C CE  . LYS G 1 80  ? 32.629  102.198 70.967  1.00 94.57  ? 80  LYS G CE  1 
ATOM 9776  N NZ  . LYS G 1 80  ? 31.540  103.202 71.202  1.00 94.76  ? 80  LYS G NZ  1 
ATOM 9777  N N   . TYR G 1 81  ? 36.902  99.008  69.611  1.00 53.28  ? 81  TYR G N   1 
ATOM 9778  C CA  . TYR G 1 81  ? 36.676  97.592  69.459  1.00 50.39  ? 81  TYR G CA  1 
ATOM 9779  C C   . TYR G 1 81  ? 35.947  97.026  70.669  1.00 51.13  ? 81  TYR G C   1 
ATOM 9780  O O   . TYR G 1 81  ? 36.432  97.109  71.796  1.00 49.83  ? 81  TYR G O   1 
ATOM 9781  C CB  . TYR G 1 81  ? 38.020  96.917  69.279  1.00 47.21  ? 81  TYR G CB  1 
ATOM 9782  C CG  . TYR G 1 81  ? 38.024  95.432  69.528  1.00 50.70  ? 81  TYR G CG  1 
ATOM 9783  C CD1 . TYR G 1 81  ? 37.907  94.527  68.475  1.00 51.12  ? 81  TYR G CD1 1 
ATOM 9784  C CD2 . TYR G 1 81  ? 38.194  94.925  70.811  1.00 50.09  ? 81  TYR G CD2 1 
ATOM 9785  C CE1 . TYR G 1 81  ? 37.972  93.141  68.695  1.00 49.38  ? 81  TYR G CE1 1 
ATOM 9786  C CE2 . TYR G 1 81  ? 38.260  93.547  71.042  1.00 51.79  ? 81  TYR G CE2 1 
ATOM 9787  C CZ  . TYR G 1 81  ? 38.154  92.654  69.979  1.00 51.23  ? 81  TYR G CZ  1 
ATOM 9788  O OH  . TYR G 1 81  ? 38.278  91.287  70.197  1.00 45.92  ? 81  TYR G OH  1 
ATOM 9789  N N   . ASN G 1 82  ? 34.785  96.427  70.429  1.00 49.75  ? 82  ASN G N   1 
ATOM 9790  C CA  . ASN G 1 82  ? 33.994  95.876  71.512  1.00 46.73  ? 82  ASN G CA  1 
ATOM 9791  C C   . ASN G 1 82  ? 33.901  94.387  71.386  1.00 44.40  ? 82  ASN G C   1 
ATOM 9792  O O   . ASN G 1 82  ? 33.984  93.862  70.286  1.00 43.28  ? 82  ASN G O   1 
ATOM 9793  C CB  . ASN G 1 82  ? 32.602  96.463  71.460  1.00 49.82  ? 82  ASN G CB  1 
ATOM 9794  C CG  . ASN G 1 82  ? 32.618  97.938  71.123  1.00 52.71  ? 82  ASN G CG  1 
ATOM 9795  O OD1 . ASN G 1 82  ? 33.115  98.348  70.065  1.00 48.75  ? 82  ASN G OD1 1 
ATOM 9796  N ND2 . ASN G 1 82  ? 32.081  98.749  72.022  1.00 53.73  ? 82  ASN G ND2 1 
ATOM 9797  N N   . TYR G 1 83  ? 33.732  93.714  72.517  1.00 41.78  ? 83  TYR G N   1 
ATOM 9798  C CA  . TYR G 1 83  ? 33.600  92.271  72.521  1.00 41.31  ? 83  TYR G CA  1 
ATOM 9799  C C   . TYR G 1 83  ? 33.004  91.828  73.849  1.00 43.48  ? 83  TYR G C   1 
ATOM 9800  O O   . TYR G 1 83  ? 32.881  92.635  74.766  1.00 43.98  ? 83  TYR G O   1 
ATOM 9801  C CB  . TYR G 1 83  ? 34.948  91.604  72.285  1.00 40.77  ? 83  TYR G CB  1 
ATOM 9802  C CG  . TYR G 1 83  ? 35.892  91.689  73.449  1.00 40.19  ? 83  TYR G CG  1 
ATOM 9803  C CD1 . TYR G 1 83  ? 36.588  92.869  73.725  1.00 36.54  ? 83  TYR G CD1 1 
ATOM 9804  C CD2 . TYR G 1 83  ? 36.085  90.583  74.279  1.00 41.08  ? 83  TYR G CD2 1 
ATOM 9805  C CE1 . TYR G 1 83  ? 37.461  92.946  74.801  1.00 41.60  ? 83  TYR G CE1 1 
ATOM 9806  C CE2 . TYR G 1 83  ? 36.943  90.640  75.355  1.00 43.63  ? 83  TYR G CE2 1 
ATOM 9807  C CZ  . TYR G 1 83  ? 37.639  91.824  75.626  1.00 46.32  ? 83  TYR G CZ  1 
ATOM 9808  O OH  . TYR G 1 83  ? 38.495  91.875  76.729  1.00 42.42  ? 83  TYR G OH  1 
ATOM 9809  N N   . SER G 1 84  ? 32.653  90.549  73.962  1.00 44.02  ? 84  SER G N   1 
ATOM 9810  C CA  . SER G 1 84  ? 32.006  90.063  75.175  1.00 47.57  ? 84  SER G CA  1 
ATOM 9811  C C   . SER G 1 84  ? 32.488  88.714  75.660  1.00 48.17  ? 84  SER G C   1 
ATOM 9812  O O   . SER G 1 84  ? 32.582  87.761  74.894  1.00 49.05  ? 84  SER G O   1 
ATOM 9813  C CB  . SER G 1 84  ? 30.490  89.946  74.946  1.00 51.20  ? 84  SER G CB  1 
ATOM 9814  O OG  . SER G 1 84  ? 29.971  91.073  74.259  1.00 54.37  ? 84  SER G OG  1 
ATOM 9815  N N   . VAL G 1 85  ? 32.788  88.620  76.943  1.00 49.09  ? 85  VAL G N   1 
ATOM 9816  C CA  . VAL G 1 85  ? 33.188  87.334  77.481  1.00 52.47  ? 85  VAL G CA  1 
ATOM 9817  C C   . VAL G 1 85  ? 31.851  86.647  77.656  1.00 52.42  ? 85  VAL G C   1 
ATOM 9818  O O   . VAL G 1 85  ? 30.932  87.246  78.195  1.00 57.04  ? 85  VAL G O   1 
ATOM 9819  C CB  . VAL G 1 85  ? 33.854  87.482  78.824  1.00 56.41  ? 85  VAL G CB  1 
ATOM 9820  C CG1 . VAL G 1 85  ? 34.250  86.101  79.343  1.00 56.11  ? 85  VAL G CG1 1 
ATOM 9821  C CG2 . VAL G 1 85  ? 35.053  88.405  78.685  1.00 59.25  ? 85  VAL G CG2 1 
ATOM 9822  N N   . ILE G 1 86  ? 31.724  85.402  77.219  1.00 51.07  ? 86  ILE G N   1 
ATOM 9823  C CA  . ILE G 1 86  ? 30.422  84.761  77.312  1.00 49.62  ? 86  ILE G CA  1 
ATOM 9824  C C   . ILE G 1 86  ? 30.393  83.343  77.824  1.00 53.23  ? 86  ILE G C   1 
ATOM 9825  O O   . ILE G 1 86  ? 29.325  82.805  78.078  1.00 56.34  ? 86  ILE G O   1 
ATOM 9826  C CB  . ILE G 1 86  ? 29.723  84.800  75.951  1.00 44.97  ? 86  ILE G CB  1 
ATOM 9827  C CG1 . ILE G 1 86  ? 30.460  83.884  74.973  1.00 42.31  ? 86  ILE G CG1 1 
ATOM 9828  C CG2 . ILE G 1 86  ? 29.739  86.248  75.405  1.00 41.95  ? 86  ILE G CG2 1 
ATOM 9829  C CD1 . ILE G 1 86  ? 30.102  84.129  73.521  1.00 39.01  ? 86  ILE G CD1 1 
ATOM 9830  N N   . GLU G 1 87  ? 31.545  82.712  77.969  1.00 56.85  ? 87  GLU G N   1 
ATOM 9831  C CA  . GLU G 1 87  ? 31.530  81.355  78.488  1.00 63.05  ? 87  GLU G CA  1 
ATOM 9832  C C   . GLU G 1 87  ? 32.880  81.012  79.080  1.00 66.48  ? 87  GLU G C   1 
ATOM 9833  O O   . GLU G 1 87  ? 33.913  81.502  78.606  1.00 66.62  ? 87  GLU G O   1 
ATOM 9834  C CB  . GLU G 1 87  ? 31.169  80.359  77.389  1.00 64.67  ? 87  GLU G CB  1 
ATOM 9835  C CG  . GLU G 1 87  ? 30.656  79.029  77.925  1.00 70.06  ? 87  GLU G CG  1 
ATOM 9836  C CD  . GLU G 1 87  ? 30.649  77.920  76.871  1.00 77.79  ? 87  GLU G CD  1 
ATOM 9837  O OE1 . GLU G 1 87  ? 29.942  78.049  75.838  1.00 78.21  ? 87  GLU G OE1 1 
ATOM 9838  O OE2 . GLU G 1 87  ? 31.358  76.908  77.082  1.00 83.55  ? 87  GLU G OE2 1 
ATOM 9839  N N   . GLY G 1 88  ? 32.850  80.179  80.122  1.00 68.65  ? 88  GLY G N   1 
ATOM 9840  C CA  . GLY G 1 88  ? 34.061  79.752  80.802  1.00 71.84  ? 88  GLY G CA  1 
ATOM 9841  C C   . GLY G 1 88  ? 34.798  80.866  81.532  1.00 73.99  ? 88  GLY G C   1 
ATOM 9842  O O   . GLY G 1 88  ? 34.775  82.032  81.105  1.00 75.85  ? 88  GLY G O   1 
ATOM 9843  N N   . GLY G 1 89  ? 35.457  80.512  82.635  1.00 72.68  ? 89  GLY G N   1 
ATOM 9844  C CA  . GLY G 1 89  ? 36.200  81.497  83.402  1.00 71.55  ? 89  GLY G CA  1 
ATOM 9845  C C   . GLY G 1 89  ? 35.343  82.261  84.394  1.00 71.36  ? 89  GLY G C   1 
ATOM 9846  O O   . GLY G 1 89  ? 34.560  81.657  85.137  1.00 70.34  ? 89  GLY G O   1 
ATOM 9847  N N   . PRO G 1 90  ? 35.465  83.601  84.426  1.00 70.12  ? 90  PRO G N   1 
ATOM 9848  C CA  . PRO G 1 90  ? 34.693  84.452  85.338  1.00 70.24  ? 90  PRO G CA  1 
ATOM 9849  C C   . PRO G 1 90  ? 33.191  84.253  85.173  1.00 72.87  ? 90  PRO G C   1 
ATOM 9850  O O   . PRO G 1 90  ? 32.397  84.577  86.061  1.00 75.31  ? 90  PRO G O   1 
ATOM 9851  C CB  . PRO G 1 90  ? 35.131  85.864  84.945  1.00 66.69  ? 90  PRO G CB  1 
ATOM 9852  C CG  . PRO G 1 90  ? 35.451  85.727  83.505  1.00 67.46  ? 90  PRO G CG  1 
ATOM 9853  C CD  . PRO G 1 90  ? 36.226  84.429  83.475  1.00 68.47  ? 90  PRO G CD  1 
ATOM 9854  N N   . ILE G 1 91  ? 32.806  83.717  84.022  1.00 74.74  ? 91  ILE G N   1 
ATOM 9855  C CA  . ILE G 1 91  ? 31.406  83.491  83.728  1.00 74.08  ? 91  ILE G CA  1 
ATOM 9856  C C   . ILE G 1 91  ? 30.838  82.309  84.506  1.00 76.76  ? 91  ILE G C   1 
ATOM 9857  O O   . ILE G 1 91  ? 31.479  81.266  84.637  1.00 76.81  ? 91  ILE G O   1 
ATOM 9858  C CB  . ILE G 1 91  ? 31.204  83.258  82.230  1.00 69.26  ? 91  ILE G CB  1 
ATOM 9859  C CG1 . ILE G 1 91  ? 31.796  84.430  81.439  1.00 64.22  ? 91  ILE G CG1 1 
ATOM 9860  C CG2 . ILE G 1 91  ? 29.736  83.109  81.936  1.00 69.57  ? 91  ILE G CG2 1 
ATOM 9861  C CD1 . ILE G 1 91  ? 31.205  85.780  81.795  1.00 56.63  ? 91  ILE G CD1 1 
ATOM 9862  N N   . GLY G 1 92  ? 29.632  82.495  85.033  1.00 79.00  ? 92  GLY G N   1 
ATOM 9863  C CA  . GLY G 1 92  ? 28.981  81.440  85.784  1.00 81.01  ? 92  GLY G CA  1 
ATOM 9864  C C   . GLY G 1 92  ? 28.402  81.901  87.106  1.00 82.50  ? 92  GLY G C   1 
ATOM 9865  O O   . GLY G 1 92  ? 29.035  82.678  87.828  1.00 81.60  ? 92  GLY G O   1 
ATOM 9866  N N   . ASP G 1 93  ? 27.194  81.422  87.410  1.00 84.24  ? 93  ASP G N   1 
ATOM 9867  C CA  . ASP G 1 93  ? 26.495  81.747  88.657  1.00 84.72  ? 93  ASP G CA  1 
ATOM 9868  C C   . ASP G 1 93  ? 26.326  83.245  88.861  1.00 84.10  ? 93  ASP G C   1 
ATOM 9869  O O   . ASP G 1 93  ? 25.359  83.854  88.404  1.00 84.29  ? 93  ASP G O   1 
ATOM 9870  C CB  . ASP G 1 93  ? 27.266  81.175  89.848  1.00 87.49  ? 93  ASP G CB  1 
ATOM 9871  C CG  . ASP G 1 93  ? 27.551  79.694  89.698  1.00 90.85  ? 93  ASP G CG  1 
ATOM 9872  O OD1 . ASP G 1 93  ? 26.595  78.899  89.816  1.00 89.97  ? 93  ASP G OD1 1 
ATOM 9873  O OD2 . ASP G 1 93  ? 28.726  79.327  89.452  1.00 92.50  ? 93  ASP G OD2 1 
ATOM 9874  N N   . THR G 1 94  ? 27.289  83.822  89.563  1.00 82.68  ? 94  THR G N   1 
ATOM 9875  C CA  . THR G 1 94  ? 27.306  85.241  89.868  1.00 83.09  ? 94  THR G CA  1 
ATOM 9876  C C   . THR G 1 94  ? 27.384  86.128  88.616  1.00 81.92  ? 94  THR G C   1 
ATOM 9877  O O   . THR G 1 94  ? 26.709  87.160  88.525  1.00 79.88  ? 94  THR G O   1 
ATOM 9878  C CB  . THR G 1 94  ? 28.502  85.539  90.791  1.00 85.01  ? 94  THR G CB  1 
ATOM 9879  O OG1 . THR G 1 94  ? 29.712  85.119  90.146  1.00 88.77  ? 94  THR G OG1 1 
ATOM 9880  C CG2 . THR G 1 94  ? 28.365  84.766  92.108  1.00 84.19  ? 94  THR G CG2 1 
ATOM 9881  N N   . LEU G 1 95  ? 28.206  85.717  87.652  1.00 80.78  ? 95  LEU G N   1 
ATOM 9882  C CA  . LEU G 1 95  ? 28.390  86.476  86.418  1.00 78.23  ? 95  LEU G CA  1 
ATOM 9883  C C   . LEU G 1 95  ? 27.714  85.831  85.218  1.00 78.16  ? 95  LEU G C   1 
ATOM 9884  O O   . LEU G 1 95  ? 27.800  84.615  85.028  1.00 79.09  ? 95  LEU G O   1 
ATOM 9885  C CB  . LEU G 1 95  ? 29.880  86.622  86.111  1.00 76.45  ? 95  LEU G CB  1 
ATOM 9886  C CG  . LEU G 1 95  ? 30.441  88.038  85.983  1.00 76.82  ? 95  LEU G CG  1 
ATOM 9887  C CD1 . LEU G 1 95  ? 31.848  87.943  85.398  1.00 77.45  ? 95  LEU G CD1 1 
ATOM 9888  C CD2 . LEU G 1 95  ? 29.543  88.906  85.105  1.00 72.73  ? 95  LEU G CD2 1 
ATOM 9889  N N   . GLU G 1 96  ? 27.051  86.659  84.410  1.00 78.19  ? 96  GLU G N   1 
ATOM 9890  C CA  . GLU G 1 96  ? 26.361  86.208  83.191  1.00 76.70  ? 96  GLU G CA  1 
ATOM 9891  C C   . GLU G 1 96  ? 27.299  86.362  81.997  1.00 73.41  ? 96  GLU G C   1 
ATOM 9892  O O   . GLU G 1 96  ? 27.670  85.384  81.353  1.00 72.95  ? 96  GLU G O   1 
ATOM 9893  C CB  . GLU G 1 96  ? 25.100  87.046  82.917  1.00 80.27  ? 96  GLU G CB  1 
ATOM 9894  C CG  . GLU G 1 96  ? 23.855  86.688  83.733  1.00 84.42  ? 96  GLU G CG  1 
ATOM 9895  C CD  . GLU G 1 96  ? 22.643  87.549  83.363  1.00 88.05  ? 96  GLU G CD  1 
ATOM 9896  O OE1 . GLU G 1 96  ? 21.553  87.327  83.946  1.00 88.42  ? 96  GLU G OE1 1 
ATOM 9897  O OE2 . GLU G 1 96  ? 22.782  88.446  82.492  1.00 91.64  ? 96  GLU G OE2 1 
ATOM 9898  N N   . LYS G 1 97  ? 27.667  87.608  81.709  1.00 70.03  ? 97  LYS G N   1 
ATOM 9899  C CA  . LYS G 1 97  ? 28.561  87.916  80.603  1.00 67.29  ? 97  LYS G CA  1 
ATOM 9900  C C   . LYS G 1 97  ? 29.220  89.265  80.858  1.00 64.71  ? 97  LYS G C   1 
ATOM 9901  O O   . LYS G 1 97  ? 28.641  90.110  81.522  1.00 66.27  ? 97  LYS G O   1 
ATOM 9902  C CB  . LYS G 1 97  ? 27.773  87.966  79.278  1.00 64.99  ? 97  LYS G CB  1 
ATOM 9903  C CG  . LYS G 1 97  ? 27.263  89.357  78.849  1.00 59.64  ? 97  LYS G CG  1 
ATOM 9904  C CD  . LYS G 1 97  ? 26.224  89.232  77.739  1.00 59.78  ? 97  LYS G CD  1 
ATOM 9905  C CE  . LYS G 1 97  ? 25.756  90.580  77.220  1.00 55.63  ? 97  LYS G CE  1 
ATOM 9906  N NZ  . LYS G 1 97  ? 26.784  91.191  76.342  1.00 52.27  ? 97  LYS G NZ  1 
ATOM 9907  N N   . ILE G 1 98  ? 30.422  89.465  80.323  1.00 61.27  ? 98  ILE G N   1 
ATOM 9908  C CA  . ILE G 1 98  ? 31.131  90.732  80.485  1.00 54.67  ? 98  ILE G CA  1 
ATOM 9909  C C   . ILE G 1 98  ? 31.283  91.428  79.147  1.00 55.95  ? 98  ILE G C   1 
ATOM 9910  O O   . ILE G 1 98  ? 31.872  90.883  78.214  1.00 57.43  ? 98  ILE G O   1 
ATOM 9911  C CB  . ILE G 1 98  ? 32.542  90.528  81.056  1.00 47.25  ? 98  ILE G CB  1 
ATOM 9912  C CG1 . ILE G 1 98  ? 32.465  89.660  82.316  1.00 41.91  ? 98  ILE G CG1 1 
ATOM 9913  C CG2 . ILE G 1 98  ? 33.174  91.878  81.347  1.00 36.92  ? 98  ILE G CG2 1 
ATOM 9914  C CD1 . ILE G 1 98  ? 33.803  89.118  82.777  1.00 36.07  ? 98  ILE G CD1 1 
ATOM 9915  N N   . SER G 1 99  ? 30.742  92.628  79.046  1.00 55.55  ? 99  SER G N   1 
ATOM 9916  C CA  . SER G 1 99  ? 30.867  93.375  77.813  1.00 59.25  ? 99  SER G CA  1 
ATOM 9917  C C   . SER G 1 99  ? 32.105  94.198  78.010  1.00 60.03  ? 99  SER G C   1 
ATOM 9918  O O   . SER G 1 99  ? 32.377  94.641  79.118  1.00 63.01  ? 99  SER G O   1 
ATOM 9919  C CB  . SER G 1 99  ? 29.691  94.312  77.625  1.00 63.28  ? 99  SER G CB  1 
ATOM 9920  O OG  . SER G 1 99  ? 28.524  93.726  78.155  1.00 72.02  ? 99  SER G OG  1 
ATOM 9921  N N   . ASN G 1 100 ? 32.859  94.412  76.943  1.00 59.90  ? 100 ASN G N   1 
ATOM 9922  C CA  . ASN G 1 100 ? 34.067  95.196  77.050  1.00 57.77  ? 100 ASN G CA  1 
ATOM 9923  C C   . ASN G 1 100 ? 34.198  96.096  75.864  1.00 60.53  ? 100 ASN G C   1 
ATOM 9924  O O   . ASN G 1 100 ? 33.680  95.807  74.784  1.00 60.12  ? 100 ASN G O   1 
ATOM 9925  C CB  . ASN G 1 100 ? 35.271  94.281  77.120  1.00 55.44  ? 100 ASN G CB  1 
ATOM 9926  C CG  . ASN G 1 100 ? 35.117  93.229  78.179  1.00 57.91  ? 100 ASN G CG  1 
ATOM 9927  O OD1 . ASN G 1 100 ? 34.785  93.537  79.322  1.00 63.78  ? 100 ASN G OD1 1 
ATOM 9928  N ND2 . ASN G 1 100 ? 35.352  91.976  77.816  1.00 58.00  ? 100 ASN G ND2 1 
ATOM 9929  N N   . GLU G 1 101 ? 34.880  97.206  76.072  1.00 63.46  ? 101 GLU G N   1 
ATOM 9930  C CA  . GLU G 1 101 ? 35.100  98.138  74.995  1.00 67.61  ? 101 GLU G CA  1 
ATOM 9931  C C   . GLU G 1 101 ? 36.483  98.741  75.147  1.00 70.12  ? 101 GLU G C   1 
ATOM 9932  O O   . GLU G 1 101 ? 36.843  99.232  76.216  1.00 74.11  ? 101 GLU G O   1 
ATOM 9933  C CB  . GLU G 1 101 ? 34.067  99.249  75.001  1.00 65.09  ? 101 GLU G CB  1 
ATOM 9934  C CG  . GLU G 1 101 ? 34.296  100.183 73.848  1.00 70.46  ? 101 GLU G CG  1 
ATOM 9935  C CD  . GLU G 1 101 ? 33.335  101.337 73.833  1.00 76.25  ? 101 GLU G CD  1 
ATOM 9936  O OE1 . GLU G 1 101 ? 32.117  101.105 74.039  1.00 76.42  ? 101 GLU G OE1 1 
ATOM 9937  O OE2 . GLU G 1 101 ? 33.799  102.478 73.599  1.00 79.30  ? 101 GLU G OE2 1 
ATOM 9938  N N   . ILE G 1 102 ? 37.259  98.697  74.074  1.00 69.38  ? 102 ILE G N   1 
ATOM 9939  C CA  . ILE G 1 102 ? 38.598  99.237  74.093  1.00 65.88  ? 102 ILE G CA  1 
ATOM 9940  C C   . ILE G 1 102 ? 38.733  100.269 72.996  1.00 69.17  ? 102 ILE G C   1 
ATOM 9941  O O   . ILE G 1 102 ? 38.522  99.993  71.817  1.00 69.39  ? 102 ILE G O   1 
ATOM 9942  C CB  . ILE G 1 102 ? 39.635  98.138  73.883  1.00 61.76  ? 102 ILE G CB  1 
ATOM 9943  C CG1 . ILE G 1 102 ? 39.478  97.074  74.968  1.00 59.85  ? 102 ILE G CG1 1 
ATOM 9944  C CG2 . ILE G 1 102 ? 41.024  98.737  73.911  1.00 62.13  ? 102 ILE G CG2 1 
ATOM 9945  C CD1 . ILE G 1 102 ? 40.445  95.922  74.849  1.00 57.35  ? 102 ILE G CD1 1 
ATOM 9946  N N   . LYS G 1 103 ? 39.079  101.477 73.394  1.00 72.24  ? 103 LYS G N   1 
ATOM 9947  C CA  . LYS G 1 103 ? 39.235  102.543 72.439  1.00 75.68  ? 103 LYS G CA  1 
ATOM 9948  C C   . LYS G 1 103 ? 40.680  103.035 72.561  1.00 77.49  ? 103 LYS G C   1 
ATOM 9949  O O   . LYS G 1 103 ? 41.213  103.136 73.672  1.00 76.76  ? 103 LYS G O   1 
ATOM 9950  C CB  . LYS G 1 103 ? 38.231  103.644 72.776  1.00 77.54  ? 103 LYS G CB  1 
ATOM 9951  C CG  . LYS G 1 103 ? 37.947  104.593 71.644  1.00 80.65  ? 103 LYS G CG  1 
ATOM 9952  C CD  . LYS G 1 103 ? 39.162  105.438 71.285  1.00 85.61  ? 103 LYS G CD  1 
ATOM 9953  C CE  . LYS G 1 103 ? 38.859  106.352 70.098  1.00 92.83  ? 103 LYS G CE  1 
ATOM 9954  N NZ  . LYS G 1 103 ? 37.605  107.163 70.305  1.00 99.12  ? 103 LYS G NZ  1 
ATOM 9955  N N   . ILE G 1 104 ? 41.316  103.319 71.425  1.00 77.67  ? 104 ILE G N   1 
ATOM 9956  C CA  . ILE G 1 104 ? 42.694  103.795 71.424  1.00 76.95  ? 104 ILE G CA  1 
ATOM 9957  C C   . ILE G 1 104 ? 42.799  105.162 70.762  1.00 80.31  ? 104 ILE G C   1 
ATOM 9958  O O   . ILE G 1 104 ? 42.458  105.336 69.586  1.00 77.72  ? 104 ILE G O   1 
ATOM 9959  C CB  . ILE G 1 104 ? 43.627  102.781 70.729  1.00 74.01  ? 104 ILE G CB  1 
ATOM 9960  C CG1 . ILE G 1 104 ? 43.669  101.489 71.552  1.00 71.34  ? 104 ILE G CG1 1 
ATOM 9961  C CG2 . ILE G 1 104 ? 45.023  103.346 70.610  1.00 73.45  ? 104 ILE G CG2 1 
ATOM 9962  C CD1 . ILE G 1 104 ? 44.534  100.404 70.974  1.00 68.85  ? 104 ILE G CD1 1 
ATOM 9963  N N   . VAL G 1 105 ? 43.273  106.127 71.553  1.00 87.11  ? 105 VAL G N   1 
ATOM 9964  C CA  . VAL G 1 105 ? 43.433  107.530 71.145  1.00 91.18  ? 105 VAL G CA  1 
ATOM 9965  C C   . VAL G 1 105 ? 44.885  107.980 71.013  1.00 92.53  ? 105 VAL G C   1 
ATOM 9966  O O   . VAL G 1 105 ? 45.711  107.759 71.911  1.00 88.56  ? 105 VAL G O   1 
ATOM 9967  C CB  . VAL G 1 105 ? 42.765  108.466 72.158  1.00 93.70  ? 105 VAL G CB  1 
ATOM 9968  C CG1 . VAL G 1 105 ? 41.248  108.330 72.080  1.00 93.21  ? 105 VAL G CG1 1 
ATOM 9969  C CG2 . VAL G 1 105 ? 43.274  108.128 73.572  1.00 94.97  ? 105 VAL G CG2 1 
ATOM 9970  N N   . ALA G 1 106 ? 45.178  108.645 69.901  1.00 96.20  ? 106 ALA G N   1 
ATOM 9971  C CA  . ALA G 1 106 ? 46.528  109.118 69.634  1.00 101.12 ? 106 ALA G CA  1 
ATOM 9972  C C   . ALA G 1 106 ? 46.825  110.460 70.308  1.00 103.77 ? 106 ALA G C   1 
ATOM 9973  O O   . ALA G 1 106 ? 46.245  111.494 69.946  1.00 104.95 ? 106 ALA G O   1 
ATOM 9974  C CB  . ALA G 1 106 ? 46.755  109.225 68.119  1.00 98.61  ? 106 ALA G CB  1 
ATOM 9975  N N   . THR G 1 107 ? 47.727  110.432 71.291  1.00 102.90 ? 107 THR G N   1 
ATOM 9976  C CA  . THR G 1 107 ? 48.134  111.637 72.006  1.00 99.83  ? 107 THR G CA  1 
ATOM 9977  C C   . THR G 1 107 ? 49.060  112.458 71.103  1.00 101.12 ? 107 THR G C   1 
ATOM 9978  O O   . THR G 1 107 ? 49.772  111.903 70.267  1.00 100.73 ? 107 THR G O   1 
ATOM 9979  C CB  . THR G 1 107 ? 48.848  111.276 73.314  1.00 96.42  ? 107 THR G CB  1 
ATOM 9980  O OG1 . THR G 1 107 ? 49.760  110.199 73.078  1.00 95.30  ? 107 THR G OG1 1 
ATOM 9981  C CG2 . THR G 1 107 ? 47.845  110.844 74.354  1.00 95.03  ? 107 THR G CG2 1 
ATOM 9982  N N   . PRO G 1 108 ? 49.057  113.794 71.259  1.00 102.82 ? 108 PRO G N   1 
ATOM 9983  C CA  . PRO G 1 108 ? 49.866  114.744 70.480  1.00 103.58 ? 108 PRO G CA  1 
ATOM 9984  C C   . PRO G 1 108 ? 51.361  114.431 70.391  1.00 104.19 ? 108 PRO G C   1 
ATOM 9985  O O   . PRO G 1 108 ? 52.017  114.741 69.390  1.00 101.67 ? 108 PRO G O   1 
ATOM 9986  C CB  . PRO G 1 108 ? 49.601  116.075 71.182  1.00 104.02 ? 108 PRO G CB  1 
ATOM 9987  C CG  . PRO G 1 108 ? 48.218  115.902 71.713  1.00 103.83 ? 108 PRO G CG  1 
ATOM 9988  C CD  . PRO G 1 108 ? 48.283  114.508 72.288  1.00 103.66 ? 108 PRO G CD  1 
ATOM 9989  N N   . ASP G 1 109 ? 51.889  113.824 71.447  1.00 105.21 ? 109 ASP G N   1 
ATOM 9990  C CA  . ASP G 1 109 ? 53.298  113.463 71.506  1.00 106.83 ? 109 ASP G CA  1 
ATOM 9991  C C   . ASP G 1 109 ? 53.636  112.242 70.654  1.00 107.64 ? 109 ASP G C   1 
ATOM 9992  O O   . ASP G 1 109 ? 54.782  111.794 70.645  1.00 110.88 ? 109 ASP G O   1 
ATOM 9993  C CB  . ASP G 1 109 ? 53.695  113.187 72.954  1.00 106.86 ? 109 ASP G CB  1 
ATOM 9994  C CG  . ASP G 1 109 ? 52.713  112.273 73.655  1.00 108.67 ? 109 ASP G CG  1 
ATOM 9995  O OD1 . ASP G 1 109 ? 51.546  112.698 73.839  1.00 110.03 ? 109 ASP G OD1 1 
ATOM 9996  O OD2 . ASP G 1 109 ? 53.105  111.134 74.010  1.00 105.73 ? 109 ASP G OD2 1 
ATOM 9997  N N   . GLY G 1 110 ? 52.644  111.704 69.947  1.00 106.96 ? 110 GLY G N   1 
ATOM 9998  C CA  . GLY G 1 110 ? 52.871  110.533 69.116  1.00 105.79 ? 110 GLY G CA  1 
ATOM 9999  C C   . GLY G 1 110 ? 52.395  109.230 69.750  1.00 105.83 ? 110 GLY G C   1 
ATOM 10000 O O   . GLY G 1 110 ? 51.901  108.342 69.050  1.00 109.12 ? 110 GLY G O   1 
ATOM 10001 N N   . GLY G 1 111 ? 52.542  109.114 71.071  1.00 104.67 ? 111 GLY G N   1 
ATOM 10002 C CA  . GLY G 1 111 ? 52.122  107.915 71.784  1.00 101.20 ? 111 GLY G CA  1 
ATOM 10003 C C   . GLY G 1 111 ? 50.624  107.658 71.727  1.00 99.54  ? 111 GLY G C   1 
ATOM 10004 O O   . GLY G 1 111 ? 49.965  107.973 70.732  1.00 98.72  ? 111 GLY G O   1 
ATOM 10005 N N   . SER G 1 112 ? 50.068  107.093 72.793  1.00 97.64  ? 112 SER G N   1 
ATOM 10006 C CA  . SER G 1 112 ? 48.642  106.805 72.794  1.00 96.50  ? 112 SER G CA  1 
ATOM 10007 C C   . SER G 1 112 ? 48.079  106.402 74.152  1.00 95.08  ? 112 SER G C   1 
ATOM 10008 O O   . SER G 1 112 ? 48.828  106.163 75.112  1.00 92.31  ? 112 SER G O   1 
ATOM 10009 C CB  . SER G 1 112 ? 48.342  105.702 71.770  1.00 99.05  ? 112 SER G CB  1 
ATOM 10010 O OG  . SER G 1 112 ? 49.064  104.508 72.057  1.00 99.01  ? 112 SER G OG  1 
ATOM 10011 N N   . ILE G 1 113 ? 46.747  106.322 74.207  1.00 93.54  ? 113 ILE G N   1 
ATOM 10012 C CA  . ILE G 1 113 ? 46.019  105.952 75.423  1.00 91.64  ? 113 ILE G CA  1 
ATOM 10013 C C   . ILE G 1 113 ? 44.931  104.906 75.146  1.00 87.79  ? 113 ILE G C   1 
ATOM 10014 O O   . ILE G 1 113 ? 44.221  104.981 74.141  1.00 84.39  ? 113 ILE G O   1 
ATOM 10015 C CB  . ILE G 1 113 ? 45.313  107.166 76.053  1.00 93.87  ? 113 ILE G CB  1 
ATOM 10016 C CG1 . ILE G 1 113 ? 46.130  108.437 75.816  1.00 95.07  ? 113 ILE G CG1 1 
ATOM 10017 C CG2 . ILE G 1 113 ? 45.130  106.929 77.550  1.00 95.83  ? 113 ILE G CG2 1 
ATOM 10018 C CD1 . ILE G 1 113 ? 45.358  109.708 76.092  1.00 92.76  ? 113 ILE G CD1 1 
ATOM 10019 N N   . LEU G 1 114 ? 44.795  103.952 76.063  1.00 84.96  ? 114 LEU G N   1 
ATOM 10020 C CA  . LEU G 1 114 ? 43.810  102.892 75.932  1.00 83.14  ? 114 LEU G CA  1 
ATOM 10021 C C   . LEU G 1 114 ? 42.734  102.945 76.987  1.00 83.29  ? 114 LEU G C   1 
ATOM 10022 O O   . LEU G 1 114 ? 42.968  102.515 78.112  1.00 83.58  ? 114 LEU G O   1 
ATOM 10023 C CB  . LEU G 1 114 ? 44.456  101.522 76.063  1.00 81.85  ? 114 LEU G CB  1 
ATOM 10024 C CG  . LEU G 1 114 ? 45.512  101.091 75.070  1.00 83.00  ? 114 LEU G CG  1 
ATOM 10025 C CD1 . LEU G 1 114 ? 46.819  101.806 75.368  1.00 85.96  ? 114 LEU G CD1 1 
ATOM 10026 C CD2 . LEU G 1 114 ? 45.680  99.588  75.194  1.00 81.39  ? 114 LEU G CD2 1 
ATOM 10027 N N   . LYS G 1 115 ? 41.552  103.435 76.635  1.00 81.05  ? 115 LYS G N   1 
ATOM 10028 C CA  . LYS G 1 115 ? 40.451  103.469 77.589  1.00 76.96  ? 115 LYS G CA  1 
ATOM 10029 C C   . LYS G 1 115 ? 39.832  102.054 77.588  1.00 74.86  ? 115 LYS G C   1 
ATOM 10030 O O   . LYS G 1 115 ? 39.894  101.364 76.578  1.00 73.48  ? 115 LYS G O   1 
ATOM 10031 C CB  . LYS G 1 115 ? 39.464  104.537 77.151  1.00 76.91  ? 115 LYS G CB  1 
ATOM 10032 C CG  . LYS G 1 115 ? 40.156  105.848 76.817  1.00 78.19  ? 115 LYS G CG  1 
ATOM 10033 C CD  . LYS G 1 115 ? 39.150  106.945 76.516  1.00 84.63  ? 115 LYS G CD  1 
ATOM 10034 C CE  . LYS G 1 115 ? 39.835  108.270 76.180  1.00 88.84  ? 115 LYS G CE  1 
ATOM 10035 N NZ  . LYS G 1 115 ? 38.861  109.339 75.753  1.00 90.26  ? 115 LYS G NZ  1 
ATOM 10036 N N   . ILE G 1 116 ? 39.236  101.618 78.697  1.00 74.06  ? 116 ILE G N   1 
ATOM 10037 C CA  . ILE G 1 116 ? 38.698  100.250 78.774  1.00 75.94  ? 116 ILE G CA  1 
ATOM 10038 C C   . ILE G 1 116 ? 37.496  99.983  79.708  1.00 77.37  ? 116 ILE G C   1 
ATOM 10039 O O   . ILE G 1 116 ? 37.676  99.880  80.926  1.00 78.08  ? 116 ILE G O   1 
ATOM 10040 C CB  . ILE G 1 116 ? 39.828  99.281  79.212  1.00 75.78  ? 116 ILE G CB  1 
ATOM 10041 C CG1 . ILE G 1 116 ? 40.876  99.158  78.110  1.00 74.32  ? 116 ILE G CG1 1 
ATOM 10042 C CG2 . ILE G 1 116 ? 39.260  97.913  79.561  1.00 76.73  ? 116 ILE G CG2 1 
ATOM 10043 C CD1 . ILE G 1 116 ? 42.060  98.307  78.519  1.00 73.28  ? 116 ILE G CD1 1 
ATOM 10044 N N   . SER G 1 117 ? 36.293  99.812  79.148  1.00 76.59  ? 117 SER G N   1 
ATOM 10045 C CA  . SER G 1 117 ? 35.101  99.546  79.966  1.00 75.48  ? 117 SER G CA  1 
ATOM 10046 C C   . SER G 1 117 ? 35.009  98.089  80.374  1.00 72.46  ? 117 SER G C   1 
ATOM 10047 O O   . SER G 1 117 ? 35.770  97.261  79.892  1.00 71.34  ? 117 SER G O   1 
ATOM 10048 C CB  . SER G 1 117 ? 33.837  99.922  79.207  1.00 77.78  ? 117 SER G CB  1 
ATOM 10049 O OG  . SER G 1 117 ? 33.939  101.249 78.727  1.00 82.52  ? 117 SER G OG  1 
ATOM 10050 N N   . ASN G 1 118 ? 34.063  97.774  81.249  1.00 70.64  ? 118 ASN G N   1 
ATOM 10051 C CA  . ASN G 1 118 ? 33.917  96.399  81.710  1.00 74.11  ? 118 ASN G CA  1 
ATOM 10052 C C   . ASN G 1 118 ? 32.579  96.105  82.387  1.00 73.39  ? 118 ASN G C   1 
ATOM 10053 O O   . ASN G 1 118 ? 32.550  95.640  83.532  1.00 74.98  ? 118 ASN G O   1 
ATOM 10054 C CB  . ASN G 1 118 ? 35.039  96.060  82.696  1.00 79.76  ? 118 ASN G CB  1 
ATOM 10055 C CG  . ASN G 1 118 ? 36.344  95.730  82.010  1.00 83.91  ? 118 ASN G CG  1 
ATOM 10056 O OD1 . ASN G 1 118 ? 36.505  94.645  81.448  1.00 83.10  ? 118 ASN G OD1 1 
ATOM 10057 N ND2 . ASN G 1 118 ? 37.290  96.673  82.047  1.00 87.21  ? 118 ASN G ND2 1 
ATOM 10058 N N   . LYS G 1 119 ? 31.475  96.354  81.694  1.00 69.15  ? 119 LYS G N   1 
ATOM 10059 C CA  . LYS G 1 119 ? 30.176  96.100  82.297  1.00 64.12  ? 119 LYS G CA  1 
ATOM 10060 C C   . LYS G 1 119 ? 30.049  94.623  82.641  1.00 59.40  ? 119 LYS G C   1 
ATOM 10061 O O   . LYS G 1 119 ? 30.062  93.772  81.760  1.00 58.07  ? 119 LYS G O   1 
ATOM 10062 C CB  . LYS G 1 119 ? 29.055  96.536  81.349  1.00 66.24  ? 119 LYS G CB  1 
ATOM 10063 C CG  . LYS G 1 119 ? 29.167  97.983  80.862  1.00 68.05  ? 119 LYS G CG  1 
ATOM 10064 C CD  . LYS G 1 119 ? 30.425  98.196  79.993  1.00 76.16  ? 119 LYS G CD  1 
ATOM 10065 C CE  . LYS G 1 119 ? 30.442  97.262  78.751  1.00 78.75  ? 119 LYS G CE  1 
ATOM 10066 N NZ  . LYS G 1 119 ? 31.658  97.338  77.868  1.00 73.36  ? 119 LYS G NZ  1 
ATOM 10067 N N   . TYR G 1 120 ? 29.980  94.320  83.930  1.00 57.55  ? 120 TYR G N   1 
ATOM 10068 C CA  . TYR G 1 120 ? 29.825  92.942  84.361  1.00 61.92  ? 120 TYR G CA  1 
ATOM 10069 C C   . TYR G 1 120 ? 28.344  92.679  84.602  1.00 66.86  ? 120 TYR G C   1 
ATOM 10070 O O   . TYR G 1 120 ? 27.789  93.095  85.619  1.00 68.39  ? 120 TYR G O   1 
ATOM 10071 C CB  . TYR G 1 120 ? 30.568  92.660  85.669  1.00 60.72  ? 120 TYR G CB  1 
ATOM 10072 C CG  . TYR G 1 120 ? 32.074  92.567  85.586  1.00 62.37  ? 120 TYR G CG  1 
ATOM 10073 C CD1 . TYR G 1 120 ? 32.837  93.657  85.158  1.00 65.44  ? 120 TYR G CD1 1 
ATOM 10074 C CD2 . TYR G 1 120 ? 32.748  91.404  86.002  1.00 60.15  ? 120 TYR G CD2 1 
ATOM 10075 C CE1 . TYR G 1 120 ? 34.247  93.608  85.146  1.00 66.33  ? 120 TYR G CE1 1 
ATOM 10076 C CE2 . TYR G 1 120 ? 34.159  91.334  86.000  1.00 63.59  ? 120 TYR G CE2 1 
ATOM 10077 C CZ  . TYR G 1 120 ? 34.902  92.446  85.570  1.00 67.29  ? 120 TYR G CZ  1 
ATOM 10078 O OH  . TYR G 1 120 ? 36.287  92.416  85.570  1.00 66.55  ? 120 TYR G OH  1 
ATOM 10079 N N   . HIS G 1 121 ? 27.696  92.005  83.659  1.00 71.20  ? 121 HIS G N   1 
ATOM 10080 C CA  . HIS G 1 121 ? 26.289  91.661  83.807  1.00 71.05  ? 121 HIS G CA  1 
ATOM 10081 C C   . HIS G 1 121 ? 26.226  90.542  84.849  1.00 74.82  ? 121 HIS G C   1 
ATOM 10082 O O   . HIS G 1 121 ? 26.639  89.406  84.608  1.00 71.96  ? 121 HIS G O   1 
ATOM 10083 C CB  . HIS G 1 121 ? 25.720  91.223  82.456  1.00 67.74  ? 121 HIS G CB  1 
ATOM 10084 C CG  . HIS G 1 121 ? 25.739  92.312  81.429  1.00 68.32  ? 121 HIS G CG  1 
ATOM 10085 N ND1 . HIS G 1 121 ? 26.902  92.930  81.023  1.00 66.81  ? 121 HIS G ND1 1 
ATOM 10086 C CD2 . HIS G 1 121 ? 24.733  92.940  80.773  1.00 70.67  ? 121 HIS G CD2 1 
ATOM 10087 C CE1 . HIS G 1 121 ? 26.614  93.894  80.165  1.00 66.24  ? 121 HIS G CE1 1 
ATOM 10088 N NE2 . HIS G 1 121 ? 25.304  93.921  79.996  1.00 69.84  ? 121 HIS G NE2 1 
ATOM 10089 N N   . THR G 1 122 ? 25.747  90.895  86.034  1.00 80.93  ? 122 THR G N   1 
ATOM 10090 C CA  . THR G 1 122 ? 25.647  89.949  87.128  1.00 87.56  ? 122 THR G CA  1 
ATOM 10091 C C   . THR G 1 122 ? 24.238  89.423  87.268  1.00 93.24  ? 122 THR G C   1 
ATOM 10092 O O   . THR G 1 122 ? 23.275  90.031  86.779  1.00 94.76  ? 122 THR G O   1 
ATOM 10093 C CB  . THR G 1 122 ? 26.054  90.596  88.446  1.00 86.83  ? 122 THR G CB  1 
ATOM 10094 O OG1 . THR G 1 122 ? 25.307  91.807  88.635  1.00 86.34  ? 122 THR G OG1 1 
ATOM 10095 C CG2 . THR G 1 122 ? 27.535  90.912  88.432  1.00 89.32  ? 122 THR G CG2 1 
ATOM 10096 N N   . LYS G 1 123 ? 24.128  88.282  87.939  1.00 99.11  ? 123 LYS G N   1 
ATOM 10097 C CA  . LYS G 1 123 ? 22.840  87.650  88.153  1.00 105.48 ? 123 LYS G CA  1 
ATOM 10098 C C   . LYS G 1 123 ? 22.019  88.428  89.174  1.00 108.74 ? 123 LYS G C   1 
ATOM 10099 O O   . LYS G 1 123 ? 22.362  88.479  90.364  1.00 108.94 ? 123 LYS G O   1 
ATOM 10100 C CB  . LYS G 1 123 ? 23.030  86.204  88.617  1.00 108.06 ? 123 LYS G CB  1 
ATOM 10101 C CG  . LYS G 1 123 ? 22.568  85.137  87.608  1.00 110.93 ? 123 LYS G CG  1 
ATOM 10102 C CD  . LYS G 1 123 ? 21.030  85.026  87.492  1.00 112.75 ? 123 LYS G CD  1 
ATOM 10103 C CE  . LYS G 1 123 ? 20.403  86.132  86.632  1.00 112.56 ? 123 LYS G CE  1 
ATOM 10104 N NZ  . LYS G 1 123 ? 18.914  86.014  86.523  1.00 109.57 ? 123 LYS G NZ  1 
ATOM 10105 N N   . GLY G 1 124 ? 20.935  89.034  88.686  1.00 112.26 ? 124 GLY G N   1 
ATOM 10106 C CA  . GLY G 1 124 ? 20.055  89.811  89.537  1.00 116.37 ? 124 GLY G CA  1 
ATOM 10107 C C   . GLY G 1 124 ? 20.806  90.974  90.142  1.00 119.30 ? 124 GLY G C   1 
ATOM 10108 O O   . GLY G 1 124 ? 20.700  92.107  89.660  1.00 117.66 ? 124 GLY G O   1 
ATOM 10109 N N   . ASP G 1 125 ? 21.566  90.695  91.199  1.00 122.26 ? 125 ASP G N   1 
ATOM 10110 C CA  . ASP G 1 125 ? 22.338  91.740  91.843  1.00 123.34 ? 125 ASP G CA  1 
ATOM 10111 C C   . ASP G 1 125 ? 23.475  91.277  92.746  1.00 123.44 ? 125 ASP G C   1 
ATOM 10112 O O   . ASP G 1 125 ? 23.868  92.016  93.645  1.00 123.77 ? 125 ASP G O   1 
ATOM 10113 C CB  . ASP G 1 125 ? 21.410  92.669  92.629  1.00 122.23 ? 125 ASP G CB  1 
ATOM 10114 C CG  . ASP G 1 125 ? 21.652  94.131  92.306  1.00 119.70 ? 125 ASP G CG  1 
ATOM 10115 O OD1 . ASP G 1 125 ? 21.385  94.542  91.155  1.00 118.01 ? 125 ASP G OD1 1 
ATOM 10116 O OD2 . ASP G 1 125 ? 22.117  94.864  93.203  1.00 116.97 ? 125 ASP G OD2 1 
ATOM 10117 N N   . HIS G 1 126 ? 24.003  90.072  92.533  1.00 122.77 ? 126 HIS G N   1 
ATOM 10118 C CA  . HIS G 1 126 ? 25.126  89.640  93.359  1.00 121.98 ? 126 HIS G CA  1 
ATOM 10119 C C   . HIS G 1 126 ? 26.244  90.635  93.001  1.00 121.75 ? 126 HIS G C   1 
ATOM 10120 O O   . HIS G 1 126 ? 26.128  91.365  92.010  1.00 120.62 ? 126 HIS G O   1 
ATOM 10121 C CB  . HIS G 1 126 ? 25.536  88.197  93.031  1.00 122.41 ? 126 HIS G CB  1 
ATOM 10122 C CG  . HIS G 1 126 ? 26.436  87.573  94.060  1.00 124.96 ? 126 HIS G CG  1 
ATOM 10123 N ND1 . HIS G 1 126 ? 27.671  88.096  94.389  1.00 124.97 ? 126 HIS G ND1 1 
ATOM 10124 C CD2 . HIS G 1 126 ? 26.279  86.471  94.832  1.00 125.80 ? 126 HIS G CD2 1 
ATOM 10125 C CE1 . HIS G 1 126 ? 28.234  87.343  95.319  1.00 124.44 ? 126 HIS G CE1 1 
ATOM 10126 N NE2 . HIS G 1 126 ? 27.411  86.352  95.605  1.00 125.78 ? 126 HIS G NE2 1 
ATOM 10127 N N   . GLU G 1 127 ? 27.311  90.684  93.796  1.00 121.88 ? 127 GLU G N   1 
ATOM 10128 C CA  . GLU G 1 127 ? 28.400  91.636  93.543  1.00 122.88 ? 127 GLU G CA  1 
ATOM 10129 C C   . GLU G 1 127 ? 29.612  91.141  92.755  1.00 120.51 ? 127 GLU G C   1 
ATOM 10130 O O   . GLU G 1 127 ? 29.858  89.937  92.631  1.00 120.64 ? 127 GLU G O   1 
ATOM 10131 C CB  . GLU G 1 127 ? 28.905  92.241  94.866  1.00 126.61 ? 127 GLU G CB  1 
ATOM 10132 C CG  . GLU G 1 127 ? 28.107  93.436  95.409  1.00 132.18 ? 127 GLU G CG  1 
ATOM 10133 C CD  . GLU G 1 127 ? 28.339  94.745  94.640  1.00 134.71 ? 127 GLU G CD  1 
ATOM 10134 O OE1 . GLU G 1 127 ? 27.880  95.807  95.122  1.00 136.13 ? 127 GLU G OE1 1 
ATOM 10135 O OE2 . GLU G 1 127 ? 28.968  94.718  93.558  1.00 134.38 ? 127 GLU G OE2 1 
ATOM 10136 N N   . VAL G 1 128 ? 30.364  92.117  92.248  1.00 116.97 ? 128 VAL G N   1 
ATOM 10137 C CA  . VAL G 1 128 ? 31.583  91.905  91.478  1.00 114.60 ? 128 VAL G CA  1 
ATOM 10138 C C   . VAL G 1 128 ? 32.751  91.715  92.433  1.00 113.50 ? 128 VAL G C   1 
ATOM 10139 O O   . VAL G 1 128 ? 33.318  92.697  92.924  1.00 112.47 ? 128 VAL G O   1 
ATOM 10140 C CB  . VAL G 1 128 ? 31.910  93.132  90.620  1.00 114.31 ? 128 VAL G CB  1 
ATOM 10141 C CG1 . VAL G 1 128 ? 33.148  92.863  89.804  1.00 114.90 ? 128 VAL G CG1 1 
ATOM 10142 C CG2 . VAL G 1 128 ? 30.736  93.484  89.742  1.00 113.38 ? 128 VAL G CG2 1 
ATOM 10143 N N   . LYS G 1 129 ? 33.115  90.468  92.705  1.00 112.60 ? 129 LYS G N   1 
ATOM 10144 C CA  . LYS G 1 129 ? 34.227  90.214  93.607  1.00 111.69 ? 129 LYS G CA  1 
ATOM 10145 C C   . LYS G 1 129 ? 35.462  90.978  93.139  1.00 112.96 ? 129 LYS G C   1 
ATOM 10146 O O   . LYS G 1 129 ? 36.005  90.685  92.075  1.00 115.01 ? 129 LYS G O   1 
ATOM 10147 C CB  . LYS G 1 129 ? 34.515  88.713  93.679  1.00 107.46 ? 129 LYS G CB  1 
ATOM 10148 C CG  . LYS G 1 129 ? 34.041  88.046  94.970  1.00 105.17 ? 129 LYS G CG  1 
ATOM 10149 C CD  . LYS G 1 129 ? 32.564  88.314  95.299  1.00 105.42 ? 129 LYS G CD  1 
ATOM 10150 C CE  . LYS G 1 129 ? 32.352  89.628  96.064  1.00 103.33 ? 129 LYS G CE  1 
ATOM 10151 N NZ  . LYS G 1 129 ? 30.927  89.843  96.457  1.00 100.42 ? 129 LYS G NZ  1 
ATOM 10152 N N   . ALA G 1 130 ? 35.885  91.969  93.925  1.00 112.83 ? 130 ALA G N   1 
ATOM 10153 C CA  . ALA G 1 130 ? 37.053  92.790  93.599  1.00 111.04 ? 130 ALA G CA  1 
ATOM 10154 C C   . ALA G 1 130 ? 38.171  91.926  93.044  1.00 110.52 ? 130 ALA G C   1 
ATOM 10155 O O   . ALA G 1 130 ? 39.118  92.424  92.433  1.00 109.07 ? 130 ALA G O   1 
ATOM 10156 C CB  . ALA G 1 130 ? 37.525  93.518  94.825  1.00 111.92 ? 130 ALA G CB  1 
ATOM 10157 N N   . GLU G 1 131 ? 38.044  90.625  93.278  1.00 110.40 ? 131 GLU G N   1 
ATOM 10158 C CA  . GLU G 1 131 ? 38.989  89.636  92.788  1.00 109.32 ? 131 GLU G CA  1 
ATOM 10159 C C   . GLU G 1 131 ? 39.177  89.841  91.303  1.00 105.86 ? 131 GLU G C   1 
ATOM 10160 O O   . GLU G 1 131 ? 40.267  90.142  90.827  1.00 105.62 ? 131 GLU G O   1 
ATOM 10161 C CB  . GLU G 1 131 ? 38.433  88.233  93.006  1.00 111.19 ? 131 GLU G CB  1 
ATOM 10162 C CG  . GLU G 1 131 ? 39.416  87.320  93.653  1.00 115.88 ? 131 GLU G CG  1 
ATOM 10163 C CD  . GLU G 1 131 ? 39.954  87.929  94.928  1.00 119.85 ? 131 GLU G CD  1 
ATOM 10164 O OE1 . GLU G 1 131 ? 40.664  88.959  94.850  1.00 120.94 ? 131 GLU G OE1 1 
ATOM 10165 O OE2 . GLU G 1 131 ? 39.655  87.385  96.011  1.00 122.96 ? 131 GLU G OE2 1 
ATOM 10166 N N   . GLN G 1 132 ? 38.081  89.664  90.582  1.00 101.88 ? 132 GLN G N   1 
ATOM 10167 C CA  . GLN G 1 132 ? 38.071  89.812  89.148  1.00 99.88  ? 132 GLN G CA  1 
ATOM 10168 C C   . GLN G 1 132 ? 38.546  91.166  88.684  1.00 96.07  ? 132 GLN G C   1 
ATOM 10169 O O   . GLN G 1 132 ? 39.526  91.253  87.953  1.00 98.22  ? 132 GLN G O   1 
ATOM 10170 C CB  . GLN G 1 132 ? 36.669  89.546  88.607  1.00 103.90 ? 132 GLN G CB  1 
ATOM 10171 C CG  . GLN G 1 132 ? 36.362  88.079  88.536  1.00 108.93 ? 132 GLN G CG  1 
ATOM 10172 C CD  . GLN G 1 132 ? 37.300  87.372  87.580  1.00 112.67 ? 132 GLN G CD  1 
ATOM 10173 O OE1 . GLN G 1 132 ? 37.634  86.198  87.768  1.00 114.64 ? 132 GLN G OE1 1 
ATOM 10174 N NE2 . GLN G 1 132 ? 37.728  88.085  86.538  1.00 113.99 ? 132 GLN G NE2 1 
ATOM 10175 N N   . VAL G 1 133 ? 37.870  92.224  89.107  1.00 90.77  ? 133 VAL G N   1 
ATOM 10176 C CA  . VAL G 1 133 ? 38.253  93.556  88.666  1.00 88.59  ? 133 VAL G CA  1 
ATOM 10177 C C   . VAL G 1 133 ? 39.760  93.737  88.761  1.00 88.24  ? 133 VAL G C   1 
ATOM 10178 O O   . VAL G 1 133 ? 40.348  94.548  88.036  1.00 84.44  ? 133 VAL G O   1 
ATOM 10179 C CB  . VAL G 1 133 ? 37.570  94.641  89.496  1.00 88.23  ? 133 VAL G CB  1 
ATOM 10180 C CG1 . VAL G 1 133 ? 37.546  95.950  88.709  1.00 83.71  ? 133 VAL G CG1 1 
ATOM 10181 C CG2 . VAL G 1 133 ? 36.172  94.195  89.873  1.00 86.34  ? 133 VAL G CG2 1 
ATOM 10182 N N   . LYS G 1 134 ? 40.370  92.957  89.655  1.00 88.53  ? 134 LYS G N   1 
ATOM 10183 C CA  . LYS G 1 134 ? 41.815  92.978  89.886  1.00 87.72  ? 134 LYS G CA  1 
ATOM 10184 C C   . LYS G 1 134 ? 42.567  92.286  88.746  1.00 86.22  ? 134 LYS G C   1 
ATOM 10185 O O   . LYS G 1 134 ? 43.394  92.903  88.072  1.00 86.24  ? 134 LYS G O   1 
ATOM 10186 C CB  . LYS G 1 134 ? 42.138  92.281  91.215  1.00 89.28  ? 134 LYS G CB  1 
ATOM 10187 C CG  . LYS G 1 134 ? 43.587  92.412  91.688  1.00 88.93  ? 134 LYS G CG  1 
ATOM 10188 C CD  . LYS G 1 134 ? 43.766  91.746  93.055  1.00 88.40  ? 134 LYS G CD  1 
ATOM 10189 C CE  . LYS G 1 134 ? 45.074  92.149  93.736  1.00 87.33  ? 134 LYS G CE  1 
ATOM 10190 N NZ  . LYS G 1 134 ? 46.291  91.674  93.021  1.00 88.14  ? 134 LYS G NZ  1 
ATOM 10191 N N   . ALA G 1 135 ? 42.273  91.004  88.539  1.00 83.78  ? 135 ALA G N   1 
ATOM 10192 C CA  . ALA G 1 135 ? 42.907  90.219  87.486  1.00 80.78  ? 135 ALA G CA  1 
ATOM 10193 C C   . ALA G 1 135 ? 42.724  90.859  86.109  1.00 79.65  ? 135 ALA G C   1 
ATOM 10194 O O   . ALA G 1 135 ? 43.690  91.065  85.380  1.00 76.50  ? 135 ALA G O   1 
ATOM 10195 C CB  . ALA G 1 135 ? 42.340  88.813  87.485  1.00 78.62  ? 135 ALA G CB  1 
ATOM 10196 N N   . SER G 1 136 ? 41.480  91.169  85.764  1.00 80.79  ? 136 SER G N   1 
ATOM 10197 C CA  . SER G 1 136 ? 41.160  91.784  84.479  1.00 82.88  ? 136 SER G CA  1 
ATOM 10198 C C   . SER G 1 136 ? 42.089  92.944  84.165  1.00 84.12  ? 136 SER G C   1 
ATOM 10199 O O   . SER G 1 136 ? 42.406  93.200  83.002  1.00 83.89  ? 136 SER G O   1 
ATOM 10200 C CB  . SER G 1 136 ? 39.716  92.295  84.477  1.00 83.16  ? 136 SER G CB  1 
ATOM 10201 O OG  . SER G 1 136 ? 38.799  91.246  84.743  1.00 86.26  ? 136 SER G OG  1 
ATOM 10202 N N   . LYS G 1 137 ? 42.515  93.644  85.211  1.00 86.28  ? 137 LYS G N   1 
ATOM 10203 C CA  . LYS G 1 137 ? 43.406  94.793  85.075  1.00 88.81  ? 137 LYS G CA  1 
ATOM 10204 C C   . LYS G 1 137 ? 44.852  94.396  84.799  1.00 87.15  ? 137 LYS G C   1 
ATOM 10205 O O   . LYS G 1 137 ? 45.536  95.028  83.992  1.00 80.64  ? 137 LYS G O   1 
ATOM 10206 C CB  . LYS G 1 137 ? 43.338  95.640  86.346  1.00 92.31  ? 137 LYS G CB  1 
ATOM 10207 C CG  . LYS G 1 137 ? 42.456  96.885  86.235  1.00 98.19  ? 137 LYS G CG  1 
ATOM 10208 C CD  . LYS G 1 137 ? 43.230  98.075  85.656  1.00 101.88 ? 137 LYS G CD  1 
ATOM 10209 C CE  . LYS G 1 137 ? 44.376  98.501  86.584  1.00 108.22 ? 137 LYS G CE  1 
ATOM 10210 N NZ  . LYS G 1 137 ? 45.179  99.640  86.042  1.00 114.25 ? 137 LYS G NZ  1 
ATOM 10211 N N   . GLU G 1 138 ? 45.302  93.346  85.481  1.00 89.70  ? 138 GLU G N   1 
ATOM 10212 C CA  . GLU G 1 138 ? 46.663  92.829  85.346  1.00 92.92  ? 138 GLU G CA  1 
ATOM 10213 C C   . GLU G 1 138 ? 46.788  92.004  84.073  1.00 92.02  ? 138 GLU G C   1 
ATOM 10214 O O   . GLU G 1 138 ? 47.776  92.109  83.340  1.00 94.07  ? 138 GLU G O   1 
ATOM 10215 C CB  . GLU G 1 138 ? 47.009  91.974  86.568  1.00 96.61  ? 138 GLU G CB  1 
ATOM 10216 C CG  . GLU G 1 138 ? 46.988  92.769  87.883  1.00 102.23 ? 138 GLU G CG  1 
ATOM 10217 C CD  . GLU G 1 138 ? 47.085  91.899  89.138  1.00 103.83 ? 138 GLU G CD  1 
ATOM 10218 O OE1 . GLU G 1 138 ? 47.115  92.468  90.257  1.00 104.49 ? 138 GLU G OE1 1 
ATOM 10219 O OE2 . GLU G 1 138 ? 47.128  90.654  89.011  1.00 102.60 ? 138 GLU G OE2 1 
ATOM 10220 N N   . MET G 1 139 ? 45.778  91.174  83.827  1.00 88.59  ? 139 MET G N   1 
ATOM 10221 C CA  . MET G 1 139 ? 45.726  90.346  82.630  1.00 83.70  ? 139 MET G CA  1 
ATOM 10222 C C   . MET G 1 139 ? 45.992  91.292  81.466  1.00 80.28  ? 139 MET G C   1 
ATOM 10223 O O   . MET G 1 139 ? 47.047  91.248  80.848  1.00 76.92  ? 139 MET G O   1 
ATOM 10224 C CB  . MET G 1 139 ? 44.332  89.714  82.509  1.00 85.94  ? 139 MET G CB  1 
ATOM 10225 C CG  . MET G 1 139 ? 44.105  88.795  81.306  1.00 86.06  ? 139 MET G CG  1 
ATOM 10226 S SD  . MET G 1 139 ? 45.254  87.399  81.211  1.00 90.20  ? 139 MET G SD  1 
ATOM 10227 C CE  . MET G 1 139 ? 44.511  86.162  82.331  1.00 85.78  ? 139 MET G CE  1 
ATOM 10228 N N   . GLY G 1 140 ? 45.038  92.174  81.197  1.00 80.34  ? 140 GLY G N   1 
ATOM 10229 C CA  . GLY G 1 140 ? 45.198  93.122  80.113  1.00 82.50  ? 140 GLY G CA  1 
ATOM 10230 C C   . GLY G 1 140 ? 46.408  94.023  80.273  1.00 82.84  ? 140 GLY G C   1 
ATOM 10231 O O   . GLY G 1 140 ? 46.888  94.612  79.305  1.00 83.40  ? 140 GLY G O   1 
ATOM 10232 N N   . GLU G 1 141 ? 46.910  94.135  81.494  1.00 82.89  ? 141 GLU G N   1 
ATOM 10233 C CA  . GLU G 1 141 ? 48.065  94.985  81.742  1.00 84.78  ? 141 GLU G CA  1 
ATOM 10234 C C   . GLU G 1 141 ? 49.316  94.401  81.094  1.00 80.87  ? 141 GLU G C   1 
ATOM 10235 O O   . GLU G 1 141 ? 49.920  95.004  80.197  1.00 78.23  ? 141 GLU G O   1 
ATOM 10236 C CB  . GLU G 1 141 ? 48.302  95.136  83.250  1.00 92.96  ? 141 GLU G CB  1 
ATOM 10237 C CG  . GLU G 1 141 ? 49.292  96.248  83.613  1.00 101.98 ? 141 GLU G CG  1 
ATOM 10238 C CD  . GLU G 1 141 ? 48.763  97.645  83.262  1.00 106.52 ? 141 GLU G CD  1 
ATOM 10239 O OE1 . GLU G 1 141 ? 47.822  98.119  83.948  1.00 108.56 ? 141 GLU G OE1 1 
ATOM 10240 O OE2 . GLU G 1 141 ? 49.283  98.263  82.299  1.00 106.78 ? 141 GLU G OE2 1 
ATOM 10241 N N   . THR G 1 142 ? 49.698  93.220  81.563  1.00 75.12  ? 142 THR G N   1 
ATOM 10242 C CA  . THR G 1 142 ? 50.874  92.550  81.050  1.00 69.97  ? 142 THR G CA  1 
ATOM 10243 C C   . THR G 1 142 ? 50.820  92.513  79.524  1.00 70.31  ? 142 THR G C   1 
ATOM 10244 O O   . THR G 1 142 ? 51.778  92.907  78.857  1.00 69.74  ? 142 THR G O   1 
ATOM 10245 C CB  . THR G 1 142 ? 50.961  91.116  81.589  1.00 67.35  ? 142 THR G CB  1 
ATOM 10246 O OG1 . THR G 1 142 ? 50.198  90.247  80.750  1.00 63.84  ? 142 THR G OG1 1 
ATOM 10247 C CG2 . THR G 1 142 ? 50.399  91.044  83.006  1.00 65.14  ? 142 THR G CG2 1 
ATOM 10248 N N   . LEU G 1 143 ? 49.686  92.059  78.984  1.00 69.76  ? 143 LEU G N   1 
ATOM 10249 C CA  . LEU G 1 143 ? 49.494  91.951  77.537  1.00 68.50  ? 143 LEU G CA  1 
ATOM 10250 C C   . LEU G 1 143 ? 49.859  93.222  76.811  1.00 67.67  ? 143 LEU G C   1 
ATOM 10251 O O   . LEU G 1 143 ? 50.674  93.184  75.901  1.00 67.54  ? 143 LEU G O   1 
ATOM 10252 C CB  . LEU G 1 143 ? 48.049  91.579  77.183  1.00 71.09  ? 143 LEU G CB  1 
ATOM 10253 C CG  . LEU G 1 143 ? 47.442  90.269  77.716  1.00 73.08  ? 143 LEU G CG  1 
ATOM 10254 C CD1 . LEU G 1 143 ? 46.152  89.995  76.962  1.00 76.04  ? 143 LEU G CD1 1 
ATOM 10255 C CD2 . LEU G 1 143 ? 48.392  89.099  77.538  1.00 68.68  ? 143 LEU G CD2 1 
ATOM 10256 N N   . LEU G 1 144 ? 49.264  94.348  77.187  1.00 70.26  ? 144 LEU G N   1 
ATOM 10257 C CA  . LEU G 1 144 ? 49.621  95.582  76.509  1.00 73.97  ? 144 LEU G CA  1 
ATOM 10258 C C   . LEU G 1 144 ? 51.126  95.752  76.600  1.00 79.44  ? 144 LEU G C   1 
ATOM 10259 O O   . LEU G 1 144 ? 51.773  96.200  75.653  1.00 79.50  ? 144 LEU G O   1 
ATOM 10260 C CB  . LEU G 1 144 ? 48.948  96.799  77.136  1.00 69.94  ? 144 LEU G CB  1 
ATOM 10261 C CG  . LEU G 1 144 ? 49.545  98.131  76.636  1.00 71.40  ? 144 LEU G CG  1 
ATOM 10262 C CD1 . LEU G 1 144 ? 49.593  98.178  75.122  1.00 74.58  ? 144 LEU G CD1 1 
ATOM 10263 C CD2 . LEU G 1 144 ? 48.721  99.292  77.147  1.00 71.86  ? 144 LEU G CD2 1 
ATOM 10264 N N   . ARG G 1 145 ? 51.690  95.391  77.746  1.00 83.81  ? 145 ARG G N   1 
ATOM 10265 C CA  . ARG G 1 145 ? 53.129  95.514  77.925  1.00 85.31  ? 145 ARG G CA  1 
ATOM 10266 C C   . ARG G 1 145 ? 53.896  94.588  76.971  1.00 83.11  ? 145 ARG G C   1 
ATOM 10267 O O   . ARG G 1 145 ? 54.708  95.060  76.167  1.00 82.42  ? 145 ARG G O   1 
ATOM 10268 C CB  . ARG G 1 145 ? 53.493  95.228  79.385  1.00 88.43  ? 145 ARG G CB  1 
ATOM 10269 C CG  . ARG G 1 145 ? 53.613  96.488  80.265  1.00 92.10  ? 145 ARG G CG  1 
ATOM 10270 C CD  . ARG G 1 145 ? 52.363  97.410  80.278  1.00 93.02  ? 145 ARG G CD  1 
ATOM 10271 N NE  . ARG G 1 145 ? 52.500  98.614  79.439  1.00 92.64  ? 145 ARG G NE  1 
ATOM 10272 C CZ  . ARG G 1 145 ? 51.869  99.778  79.653  1.00 93.68  ? 145 ARG G CZ  1 
ATOM 10273 N NH1 . ARG G 1 145 ? 51.043  99.929  80.687  1.00 92.93  ? 145 ARG G NH1 1 
ATOM 10274 N NH2 . ARG G 1 145 ? 52.056  100.804 78.824  1.00 91.87  ? 145 ARG G NH2 1 
ATOM 10275 N N   . ALA G 1 146 ? 53.626  93.283  77.051  1.00 79.02  ? 146 ALA G N   1 
ATOM 10276 C CA  . ALA G 1 146 ? 54.285  92.294  76.196  1.00 77.46  ? 146 ALA G CA  1 
ATOM 10277 C C   . ALA G 1 146 ? 54.279  92.710  74.724  1.00 78.38  ? 146 ALA G C   1 
ATOM 10278 O O   . ALA G 1 146 ? 55.214  92.428  73.982  1.00 80.42  ? 146 ALA G O   1 
ATOM 10279 C CB  . ALA G 1 146 ? 53.615  90.938  76.352  1.00 73.19  ? 146 ALA G CB  1 
ATOM 10280 N N   . VAL G 1 147 ? 53.222  93.384  74.299  1.00 79.50  ? 147 VAL G N   1 
ATOM 10281 C CA  . VAL G 1 147 ? 53.124  93.825  72.916  1.00 82.83  ? 147 VAL G CA  1 
ATOM 10282 C C   . VAL G 1 147 ? 53.951  95.092  72.686  1.00 85.69  ? 147 VAL G C   1 
ATOM 10283 O O   . VAL G 1 147 ? 54.600  95.237  71.647  1.00 86.65  ? 147 VAL G O   1 
ATOM 10284 C CB  . VAL G 1 147 ? 51.635  94.071  72.514  1.00 82.67  ? 147 VAL G CB  1 
ATOM 10285 C CG1 . VAL G 1 147 ? 51.551  94.862  71.212  1.00 81.10  ? 147 VAL G CG1 1 
ATOM 10286 C CG2 . VAL G 1 147 ? 50.912  92.732  72.369  1.00 77.37  ? 147 VAL G CG2 1 
ATOM 10287 N N   . GLU G 1 148 ? 53.930  96.007  73.652  1.00 88.88  ? 148 GLU G N   1 
ATOM 10288 C CA  . GLU G 1 148 ? 54.698  97.246  73.524  1.00 90.41  ? 148 GLU G CA  1 
ATOM 10289 C C   . GLU G 1 148 ? 56.157  96.902  73.269  1.00 89.68  ? 148 GLU G C   1 
ATOM 10290 O O   . GLU G 1 148 ? 56.790  97.428  72.343  1.00 89.42  ? 148 GLU G O   1 
ATOM 10291 C CB  . GLU G 1 148 ? 54.607  98.069  74.801  1.00 92.49  ? 148 GLU G CB  1 
ATOM 10292 C CG  . GLU G 1 148 ? 53.415  98.982  74.895  1.00 95.71  ? 148 GLU G CG  1 
ATOM 10293 C CD  . GLU G 1 148 ? 53.496  99.842  76.131  1.00 98.86  ? 148 GLU G CD  1 
ATOM 10294 O OE1 . GLU G 1 148 ? 53.631  99.256  77.227  1.00 100.58 ? 148 GLU G OE1 1 
ATOM 10295 O OE2 . GLU G 1 148 ? 53.438  101.089 76.014  1.00 99.43  ? 148 GLU G OE2 1 
ATOM 10296 N N   . SER G 1 149 ? 56.681  96.015  74.111  1.00 86.72  ? 149 SER G N   1 
ATOM 10297 C CA  . SER G 1 149 ? 58.059  95.573  73.998  1.00 83.33  ? 149 SER G CA  1 
ATOM 10298 C C   . SER G 1 149 ? 58.295  95.020  72.596  1.00 82.98  ? 149 SER G C   1 
ATOM 10299 O O   . SER G 1 149 ? 59.076  95.583  71.823  1.00 81.84  ? 149 SER G O   1 
ATOM 10300 C CB  . SER G 1 149 ? 58.338  94.492  75.036  1.00 79.53  ? 149 SER G CB  1 
ATOM 10301 O OG  . SER G 1 149 ? 57.493  93.381  74.829  1.00 79.12  ? 149 SER G OG  1 
ATOM 10302 N N   . TYR G 1 150 ? 57.609  93.921  72.278  1.00 79.98  ? 150 TYR G N   1 
ATOM 10303 C CA  . TYR G 1 150 ? 57.728  93.287  70.971  1.00 77.60  ? 150 TYR G CA  1 
ATOM 10304 C C   . TYR G 1 150 ? 57.652  94.332  69.869  1.00 76.02  ? 150 TYR G C   1 
ATOM 10305 O O   . TYR G 1 150 ? 58.536  94.423  69.022  1.00 78.21  ? 150 TYR G O   1 
ATOM 10306 C CB  . TYR G 1 150 ? 56.610  92.270  70.752  1.00 79.08  ? 150 TYR G CB  1 
ATOM 10307 C CG  . TYR G 1 150 ? 56.696  91.570  69.410  1.00 81.69  ? 150 TYR G CG  1 
ATOM 10308 C CD1 . TYR G 1 150 ? 57.102  90.238  69.327  1.00 81.67  ? 150 TYR G CD1 1 
ATOM 10309 C CD2 . TYR G 1 150 ? 56.424  92.254  68.214  1.00 80.15  ? 150 TYR G CD2 1 
ATOM 10310 C CE1 . TYR G 1 150 ? 57.242  89.598  68.089  1.00 83.14  ? 150 TYR G CE1 1 
ATOM 10311 C CE2 . TYR G 1 150 ? 56.564  91.627  66.971  1.00 80.69  ? 150 TYR G CE2 1 
ATOM 10312 C CZ  . TYR G 1 150 ? 56.976  90.297  66.919  1.00 83.13  ? 150 TYR G CZ  1 
ATOM 10313 O OH  . TYR G 1 150 ? 57.147  89.662  65.710  1.00 84.69  ? 150 TYR G OH  1 
ATOM 10314 N N   . LEU G 1 151 ? 56.581  95.108  69.868  1.00 73.68  ? 151 LEU G N   1 
ATOM 10315 C CA  . LEU G 1 151 ? 56.414  96.135  68.860  1.00 76.11  ? 151 LEU G CA  1 
ATOM 10316 C C   . LEU G 1 151 ? 57.649  96.995  68.727  1.00 75.45  ? 151 LEU G C   1 
ATOM 10317 O O   . LEU G 1 151 ? 58.032  97.382  67.626  1.00 73.65  ? 151 LEU G O   1 
ATOM 10318 C CB  . LEU G 1 151 ? 55.223  97.018  69.203  1.00 80.88  ? 151 LEU G CB  1 
ATOM 10319 C CG  . LEU G 1 151 ? 53.913  96.508  68.610  1.00 85.52  ? 151 LEU G CG  1 
ATOM 10320 C CD1 . LEU G 1 151 ? 52.747  97.412  69.021  1.00 89.62  ? 151 LEU G CD1 1 
ATOM 10321 C CD2 . LEU G 1 151 ? 54.062  96.460  67.091  1.00 84.65  ? 151 LEU G CD2 1 
ATOM 10322 N N   . LEU G 1 152 ? 58.268  97.291  69.863  1.00 77.34  ? 152 LEU G N   1 
ATOM 10323 C CA  . LEU G 1 152 ? 59.466  98.122  69.894  1.00 77.92  ? 152 LEU G CA  1 
ATOM 10324 C C   . LEU G 1 152 ? 60.669  97.452  69.255  1.00 76.22  ? 152 LEU G C   1 
ATOM 10325 O O   . LEU G 1 152 ? 61.320  98.023  68.366  1.00 74.02  ? 152 LEU G O   1 
ATOM 10326 C CB  . LEU G 1 152 ? 59.791  98.491  71.338  1.00 80.66  ? 152 LEU G CB  1 
ATOM 10327 C CG  . LEU G 1 152 ? 58.937  99.657  71.830  1.00 83.03  ? 152 LEU G CG  1 
ATOM 10328 C CD1 . LEU G 1 152 ? 59.154  99.868  73.319  1.00 84.68  ? 152 LEU G CD1 1 
ATOM 10329 C CD2 . LEU G 1 152 ? 59.296  100.916 71.017  1.00 81.44  ? 152 LEU G CD2 1 
ATOM 10330 N N   . ALA G 1 153 ? 60.952  96.240  69.724  1.00 74.78  ? 153 ALA G N   1 
ATOM 10331 C CA  . ALA G 1 153 ? 62.070  95.443  69.231  1.00 74.37  ? 153 ALA G CA  1 
ATOM 10332 C C   . ALA G 1 153 ? 61.964  95.107  67.736  1.00 74.66  ? 153 ALA G C   1 
ATOM 10333 O O   . ALA G 1 153 ? 62.976  94.813  67.094  1.00 78.48  ? 153 ALA G O   1 
ATOM 10334 C CB  . ALA G 1 153 ? 62.184  94.153  70.050  1.00 68.09  ? 153 ALA G CB  1 
ATOM 10335 N N   . HIS G 1 154 ? 60.752  95.155  67.180  1.00 68.28  ? 154 HIS G N   1 
ATOM 10336 C CA  . HIS G 1 154 ? 60.556  94.831  65.776  1.00 61.07  ? 154 HIS G CA  1 
ATOM 10337 C C   . HIS G 1 154 ? 59.914  95.974  65.014  1.00 62.77  ? 154 HIS G C   1 
ATOM 10338 O O   . HIS G 1 154 ? 58.857  95.832  64.412  1.00 63.03  ? 154 HIS G O   1 
ATOM 10339 C CB  . HIS G 1 154 ? 59.719  93.575  65.676  1.00 54.30  ? 154 HIS G CB  1 
ATOM 10340 C CG  . HIS G 1 154 ? 60.276  92.435  66.463  1.00 50.87  ? 154 HIS G CG  1 
ATOM 10341 N ND1 . HIS G 1 154 ? 60.493  92.509  67.819  1.00 49.13  ? 154 HIS G ND1 1 
ATOM 10342 C CD2 . HIS G 1 154 ? 60.666  91.191  66.089  1.00 57.98  ? 154 HIS G CD2 1 
ATOM 10343 C CE1 . HIS G 1 154 ? 60.990  91.362  68.251  1.00 54.63  ? 154 HIS G CE1 1 
ATOM 10344 N NE2 . HIS G 1 154 ? 61.104  90.543  67.220  1.00 56.96  ? 154 HIS G NE2 1 
ATOM 10345 N N   . SER G 1 155 ? 60.598  97.105  65.051  1.00 65.07  ? 155 SER G N   1 
ATOM 10346 C CA  . SER G 1 155 ? 60.194  98.347  64.410  1.00 69.09  ? 155 SER G CA  1 
ATOM 10347 C C   . SER G 1 155 ? 59.574  98.314  63.002  1.00 70.90  ? 155 SER G C   1 
ATOM 10348 O O   . SER G 1 155 ? 58.842  99.237  62.632  1.00 68.78  ? 155 SER G O   1 
ATOM 10349 C CB  . SER G 1 155 ? 61.404  99.268  64.404  1.00 72.07  ? 155 SER G CB  1 
ATOM 10350 O OG  . SER G 1 155 ? 62.568  98.523  64.076  1.00 74.30  ? 155 SER G OG  1 
ATOM 10351 N N   . ASP G 1 156 ? 59.866  97.279  62.215  1.00 74.31  ? 156 ASP G N   1 
ATOM 10352 C CA  . ASP G 1 156 ? 59.324  97.177  60.846  1.00 78.01  ? 156 ASP G CA  1 
ATOM 10353 C C   . ASP G 1 156 ? 57.959  96.484  60.781  1.00 78.70  ? 156 ASP G C   1 
ATOM 10354 O O   . ASP G 1 156 ? 57.295  96.473  59.733  1.00 75.79  ? 156 ASP G O   1 
ATOM 10355 C CB  . ASP G 1 156 ? 60.306  96.430  59.932  1.00 78.43  ? 156 ASP G CB  1 
ATOM 10356 C CG  . ASP G 1 156 ? 60.726  95.088  60.499  1.00 80.77  ? 156 ASP G CG  1 
ATOM 10357 O OD1 . ASP G 1 156 ? 59.842  94.270  60.816  1.00 83.58  ? 156 ASP G OD1 1 
ATOM 10358 O OD2 . ASP G 1 156 ? 61.944  94.848  60.630  1.00 86.94  ? 156 ASP G OD2 1 
ATOM 10359 N N   . ALA G 1 157 ? 57.559  95.912  61.915  1.00 78.02  ? 157 ALA G N   1 
ATOM 10360 C CA  . ALA G 1 157 ? 56.298  95.201  62.051  1.00 75.55  ? 157 ALA G CA  1 
ATOM 10361 C C   . ALA G 1 157 ? 55.086  96.118  61.959  1.00 75.41  ? 157 ALA G C   1 
ATOM 10362 O O   . ALA G 1 157 ? 55.207  97.344  61.971  1.00 74.91  ? 157 ALA G O   1 
ATOM 10363 C CB  . ALA G 1 157 ? 56.277  94.452  63.376  1.00 74.33  ? 157 ALA G CB  1 
ATOM 10364 N N   . TYR G 1 158 ? 53.918  95.489  61.862  1.00 76.98  ? 158 TYR G N   1 
ATOM 10365 C CA  . TYR G 1 158 ? 52.624  96.162  61.782  1.00 77.93  ? 158 TYR G CA  1 
ATOM 10366 C C   . TYR G 1 158 ? 52.668  97.576  61.221  1.00 79.13  ? 158 TYR G C   1 
ATOM 10367 O O   . TYR G 1 158 ? 52.219  98.527  61.867  1.00 74.48  ? 158 TYR G O   1 
ATOM 10368 C CB  . TYR G 1 158 ? 51.977  96.144  63.164  1.00 74.47  ? 158 TYR G CB  1 
ATOM 10369 C CG  . TYR G 1 158 ? 51.877  94.733  63.690  1.00 71.77  ? 158 TYR G CG  1 
ATOM 10370 C CD1 . TYR G 1 158 ? 50.728  93.975  63.503  1.00 71.12  ? 158 TYR G CD1 1 
ATOM 10371 C CD2 . TYR G 1 158 ? 52.965  94.127  64.304  1.00 71.15  ? 158 TYR G CD2 1 
ATOM 10372 C CE1 . TYR G 1 158 ? 50.671  92.646  63.914  1.00 71.40  ? 158 TYR G CE1 1 
ATOM 10373 C CE2 . TYR G 1 158 ? 52.917  92.802  64.714  1.00 71.57  ? 158 TYR G CE2 1 
ATOM 10374 C CZ  . TYR G 1 158 ? 51.771  92.066  64.518  1.00 70.68  ? 158 TYR G CZ  1 
ATOM 10375 O OH  . TYR G 1 158 ? 51.731  90.749  64.931  1.00 71.62  ? 158 TYR G OH  1 
ATOM 10376 N N   . ASN G 1 159 ? 53.199  97.684  60.002  1.00 82.55  ? 159 ASN G N   1 
ATOM 10377 C CA  . ASN G 1 159 ? 53.330  98.952  59.302  1.00 85.44  ? 159 ASN G CA  1 
ATOM 10378 C C   . ASN G 1 159 ? 54.667  99.594  59.691  1.00 86.49  ? 159 ASN G C   1 
ATOM 10379 O O   . ASN G 1 159 ? 54.668  100.660 60.348  1.00 85.47  ? 159 ASN G O   1 
ATOM 10380 C CB  . ASN G 1 159 ? 52.155  99.863  59.668  1.00 88.01  ? 159 ASN G CB  1 
ATOM 10381 C CG  . ASN G 1 159 ? 51.774  100.800 58.551  1.00 92.13  ? 159 ASN G CG  1 
ATOM 10382 O OD1 . ASN G 1 159 ? 52.524  101.718 58.211  1.00 94.32  ? 159 ASN G OD1 1 
ATOM 10383 N ND2 . ASN G 1 159 ? 50.599  100.574 57.965  1.00 94.38  ? 159 ASN G ND2 1 
ATOM 10384 O OXT . ASN G 1 159 ? 55.710  98.997  59.339  1.00 90.36  ? 159 ASN G OXT 1 
ATOM 10385 N N   . ASN H 2 1   ? 29.207  99.197  54.623  1.00 90.15  ? 1   ASN H N   1 
ATOM 10386 C CA  . ASN H 2 1   ? 28.525  98.476  53.507  1.00 89.22  ? 1   ASN H CA  1 
ATOM 10387 C C   . ASN H 2 1   ? 29.447  98.299  52.287  1.00 86.57  ? 1   ASN H C   1 
ATOM 10388 O O   . ASN H 2 1   ? 29.622  99.218  51.488  1.00 83.80  ? 1   ASN H O   1 
ATOM 10389 C CB  . ASN H 2 1   ? 27.264  99.245  53.090  1.00 92.08  ? 1   ASN H CB  1 
ATOM 10390 C CG  . ASN H 2 1   ? 26.227  98.352  52.415  1.00 95.37  ? 1   ASN H CG  1 
ATOM 10391 O OD1 . ASN H 2 1   ? 25.355  97.780  53.084  1.00 93.48  ? 1   ASN H OD1 1 
ATOM 10392 N ND2 . ASN H 2 1   ? 26.324  98.217  51.087  1.00 97.00  ? 1   ASN H ND2 1 
ATOM 10393 N N   . ILE H 2 2   ? 30.026  97.110  52.146  1.00 84.94  ? 2   ILE H N   1 
ATOM 10394 C CA  . ILE H 2 2   ? 30.924  96.804  51.033  1.00 84.15  ? 2   ILE H CA  1 
ATOM 10395 C C   . ILE H 2 2   ? 30.193  96.234  49.819  1.00 82.93  ? 2   ILE H C   1 
ATOM 10396 O O   . ILE H 2 2   ? 29.031  95.837  49.914  1.00 85.09  ? 2   ILE H O   1 
ATOM 10397 C CB  . ILE H 2 2   ? 31.982  95.789  51.480  1.00 85.53  ? 2   ILE H CB  1 
ATOM 10398 C CG1 . ILE H 2 2   ? 32.958  96.470  52.435  1.00 88.44  ? 2   ILE H CG1 1 
ATOM 10399 C CG2 . ILE H 2 2   ? 32.706  95.204  50.282  1.00 85.06  ? 2   ILE H CG2 1 
ATOM 10400 C CD1 . ILE H 2 2   ? 34.061  95.562  52.940  1.00 88.20  ? 2   ILE H CD1 1 
ATOM 10401 N N   . VAL H 2 3   ? 30.871  96.196  48.675  1.00 80.52  ? 3   VAL H N   1 
ATOM 10402 C CA  . VAL H 2 3   ? 30.273  95.649  47.463  1.00 78.51  ? 3   VAL H CA  1 
ATOM 10403 C C   . VAL H 2 3   ? 31.199  94.663  46.765  1.00 78.71  ? 3   VAL H C   1 
ATOM 10404 O O   . VAL H 2 3   ? 32.263  95.029  46.273  1.00 80.10  ? 3   VAL H O   1 
ATOM 10405 C CB  . VAL H 2 3   ? 29.883  96.762  46.458  1.00 77.39  ? 3   VAL H CB  1 
ATOM 10406 C CG1 . VAL H 2 3   ? 29.084  97.839  47.172  1.00 76.17  ? 3   VAL H CG1 1 
ATOM 10407 C CG2 . VAL H 2 3   ? 31.116  97.354  45.804  1.00 78.18  ? 3   VAL H CG2 1 
ATOM 10408 N N   . LEU H 2 4   ? 30.788  93.405  46.731  1.00 82.01  ? 4   LEU H N   1 
ATOM 10409 C CA  . LEU H 2 4   ? 31.573  92.355  46.089  1.00 88.40  ? 4   LEU H CA  1 
ATOM 10410 C C   . LEU H 2 4   ? 31.136  92.262  44.641  1.00 91.84  ? 4   LEU H C   1 
ATOM 10411 O O   . LEU H 2 4   ? 29.970  91.976  44.354  1.00 96.39  ? 4   LEU H O   1 
ATOM 10412 C CB  . LEU H 2 4   ? 31.340  91.015  46.785  1.00 85.84  ? 4   LEU H CB  1 
ATOM 10413 C CG  . LEU H 2 4   ? 31.524  91.132  48.296  1.00 86.84  ? 4   LEU H CG  1 
ATOM 10414 C CD1 . LEU H 2 4   ? 31.161  89.829  49.005  1.00 86.08  ? 4   LEU H CD1 1 
ATOM 10415 C CD2 . LEU H 2 4   ? 32.964  91.522  48.559  1.00 88.25  ? 4   LEU H CD2 1 
ATOM 10416 N N   . THR H 2 5   ? 32.068  92.503  43.725  1.00 92.54  ? 5   THR H N   1 
ATOM 10417 C CA  . THR H 2 5   ? 31.734  92.450  42.311  1.00 90.05  ? 5   THR H CA  1 
ATOM 10418 C C   . THR H 2 5   ? 32.304  91.231  41.588  1.00 93.69  ? 5   THR H C   1 
ATOM 10419 O O   . THR H 2 5   ? 33.525  91.024  41.531  1.00 94.75  ? 5   THR H O   1 
ATOM 10420 C CB  . THR H 2 5   ? 32.173  93.738  41.606  1.00 86.08  ? 5   THR H CB  1 
ATOM 10421 O OG1 . THR H 2 5   ? 31.491  94.853  42.194  1.00 79.47  ? 5   THR H OG1 1 
ATOM 10422 C CG2 . THR H 2 5   ? 31.831  93.677  40.131  1.00 84.95  ? 5   THR H CG2 1 
ATOM 10423 N N   . GLN H 2 6   ? 31.397  90.433  41.028  1.00 95.75  ? 6   GLN H N   1 
ATOM 10424 C CA  . GLN H 2 6   ? 31.763  89.226  40.311  1.00 98.15  ? 6   GLN H CA  1 
ATOM 10425 C C   . GLN H 2 6   ? 31.693  89.397  38.806  1.00 101.21 ? 6   GLN H C   1 
ATOM 10426 O O   . GLN H 2 6   ? 30.777  90.043  38.272  1.00 101.11 ? 6   GLN H O   1 
ATOM 10427 C CB  . GLN H 2 6   ? 30.851  88.086  40.718  1.00 94.85  ? 6   GLN H CB  1 
ATOM 10428 C CG  . GLN H 2 6   ? 30.800  87.864  42.197  1.00 94.84  ? 6   GLN H CG  1 
ATOM 10429 C CD  . GLN H 2 6   ? 30.601  86.396  42.516  1.00 96.26  ? 6   GLN H CD  1 
ATOM 10430 O OE1 . GLN H 2 6   ? 31.356  85.536  42.025  1.00 97.09  ? 6   GLN H OE1 1 
ATOM 10431 N NE2 . GLN H 2 6   ? 29.592  86.090  43.339  1.00 94.14  ? 6   GLN H NE2 1 
ATOM 10432 N N   . SER H 2 7   ? 32.674  88.812  38.124  1.00 104.83 ? 7   SER H N   1 
ATOM 10433 C CA  . SER H 2 7   ? 32.745  88.880  36.665  1.00 107.00 ? 7   SER H CA  1 
ATOM 10434 C C   . SER H 2 7   ? 33.490  87.707  36.062  1.00 108.23 ? 7   SER H C   1 
ATOM 10435 O O   . SER H 2 7   ? 34.483  87.229  36.622  1.00 108.12 ? 7   SER H O   1 
ATOM 10436 C CB  . SER H 2 7   ? 33.447  90.159  36.251  1.00 106.56 ? 7   SER H CB  1 
ATOM 10437 O OG  . SER H 2 7   ? 34.649  90.264  36.974  1.00 107.06 ? 7   SER H OG  1 
ATOM 10438 N N   . PRO H 2 8   ? 33.028  87.234  34.894  1.00 107.98 ? 8   PRO H N   1 
ATOM 10439 C CA  . PRO H 2 8   ? 31.878  87.734  34.133  1.00 106.62 ? 8   PRO H CA  1 
ATOM 10440 C C   . PRO H 2 8   ? 30.535  87.316  34.716  1.00 106.21 ? 8   PRO H C   1 
ATOM 10441 O O   . PRO H 2 8   ? 30.472  86.597  35.714  1.00 107.05 ? 8   PRO H O   1 
ATOM 10442 C CB  . PRO H 2 8   ? 32.114  87.132  32.776  1.00 105.56 ? 8   PRO H CB  1 
ATOM 10443 C CG  . PRO H 2 8   ? 32.649  85.779  33.131  1.00 106.31 ? 8   PRO H CG  1 
ATOM 10444 C CD  . PRO H 2 8   ? 33.615  86.040  34.271  1.00 107.02 ? 8   PRO H CD  1 
ATOM 10445 N N   . LYS H 2 9   ? 29.452  87.734  34.093  1.00 104.24 ? 9   LYS H N   1 
ATOM 10446 C CA  . LYS H 2 9   ? 28.167  87.350  34.609  1.00 100.56 ? 9   LYS H CA  1 
ATOM 10447 C C   . LYS H 2 9   ? 28.017  85.840  34.455  1.00 99.62  ? 9   LYS H C   1 
ATOM 10448 O O   . LYS H 2 9   ? 27.321  85.214  35.245  1.00 97.75  ? 9   LYS H O   1 
ATOM 10449 C CB  . LYS H 2 9   ? 27.079  88.095  33.855  1.00 99.08  ? 9   LYS H CB  1 
ATOM 10450 C CG  . LYS H 2 9   ? 25.791  88.255  34.634  1.00 97.55  ? 9   LYS H CG  1 
ATOM 10451 C CD  . LYS H 2 9   ? 25.986  89.167  35.833  1.00 96.29  ? 9   LYS H CD  1 
ATOM 10452 C CE  . LYS H 2 9   ? 24.656  89.430  36.570  1.00 95.88  ? 9   LYS H CE  1 
ATOM 10453 N NZ  . LYS H 2 9   ? 24.886  90.280  37.788  1.00 95.59  ? 9   LYS H NZ  1 
ATOM 10454 N N   . SER H 2 10  ? 28.693  85.264  33.457  1.00 99.50  ? 10  SER H N   1 
ATOM 10455 C CA  . SER H 2 10  ? 28.642  83.816  33.213  1.00 100.69 ? 10  SER H CA  1 
ATOM 10456 C C   . SER H 2 10  ? 29.851  83.308  32.425  1.00 101.60 ? 10  SER H C   1 
ATOM 10457 O O   . SER H 2 10  ? 30.515  84.064  31.725  1.00 101.71 ? 10  SER H O   1 
ATOM 10458 C CB  . SER H 2 10  ? 27.381  83.448  32.442  1.00 101.08 ? 10  SER H CB  1 
ATOM 10459 O OG  . SER H 2 10  ? 27.573  83.707  31.066  1.00 101.06 ? 10  SER H OG  1 
ATOM 10460 N N   . MET H 2 11  ? 30.122  82.015  32.541  1.00 103.53 ? 11  MET H N   1 
ATOM 10461 C CA  . MET H 2 11  ? 31.246  81.394  31.859  1.00 106.40 ? 11  MET H CA  1 
ATOM 10462 C C   . MET H 2 11  ? 30.844  80.081  31.225  1.00 104.68 ? 11  MET H C   1 
ATOM 10463 O O   . MET H 2 11  ? 30.076  79.313  31.808  1.00 106.27 ? 11  MET H O   1 
ATOM 10464 C CB  . MET H 2 11  ? 32.384  81.119  32.839  1.00 112.48 ? 11  MET H CB  1 
ATOM 10465 C CG  . MET H 2 11  ? 33.238  82.314  33.159  1.00 119.03 ? 11  MET H CG  1 
ATOM 10466 S SD  . MET H 2 11  ? 34.763  81.753  33.930  1.00 125.97 ? 11  MET H SD  1 
ATOM 10467 C CE  . MET H 2 11  ? 35.806  81.415  32.471  1.00 124.96 ? 11  MET H CE  1 
ATOM 10468 N N   . SER H 2 12  ? 31.380  79.824  30.034  1.00 99.91  ? 12  SER H N   1 
ATOM 10469 C CA  . SER H 2 12  ? 31.096  78.590  29.316  1.00 95.09  ? 12  SER H CA  1 
ATOM 10470 C C   . SER H 2 12  ? 32.389  77.915  28.917  1.00 90.27  ? 12  SER H C   1 
ATOM 10471 O O   . SER H 2 12  ? 33.181  78.459  28.157  1.00 89.51  ? 12  SER H O   1 
ATOM 10472 C CB  . SER H 2 12  ? 30.243  78.878  28.081  1.00 99.52  ? 12  SER H CB  1 
ATOM 10473 O OG  . SER H 2 12  ? 28.940  79.298  28.467  1.00 104.66 ? 12  SER H OG  1 
ATOM 10474 N N   . VAL H 2 13  ? 32.604  76.725  29.453  1.00 86.86  ? 13  VAL H N   1 
ATOM 10475 C CA  . VAL H 2 13  ? 33.813  75.978  29.160  1.00 85.99  ? 13  VAL H CA  1 
ATOM 10476 C C   . VAL H 2 13  ? 33.468  74.516  29.023  1.00 80.85  ? 13  VAL H C   1 
ATOM 10477 O O   . VAL H 2 13  ? 32.402  74.079  29.425  1.00 77.02  ? 13  VAL H O   1 
ATOM 10478 C CB  . VAL H 2 13  ? 34.870  76.145  30.273  1.00 90.84  ? 13  VAL H CB  1 
ATOM 10479 C CG1 . VAL H 2 13  ? 35.096  77.631  30.534  1.00 92.29  ? 13  VAL H CG1 1 
ATOM 10480 C CG2 . VAL H 2 13  ? 34.432  75.405  31.543  1.00 93.65  ? 13  VAL H CG2 1 
ATOM 10481 N N   . SER H 2 14  ? 34.389  73.754  28.467  1.00 78.68  ? 14  SER H N   1 
ATOM 10482 C CA  . SER H 2 14  ? 34.146  72.349  28.249  1.00 77.76  ? 14  SER H CA  1 
ATOM 10483 C C   . SER H 2 14  ? 34.656  71.524  29.378  1.00 74.58  ? 14  SER H C   1 
ATOM 10484 O O   . SER H 2 14  ? 35.628  71.877  30.025  1.00 72.43  ? 14  SER H O   1 
ATOM 10485 C CB  . SER H 2 14  ? 34.807  71.923  26.953  1.00 82.36  ? 14  SER H CB  1 
ATOM 10486 O OG  . SER H 2 14  ? 34.590  72.923  25.969  1.00 89.25  ? 14  SER H OG  1 
ATOM 10487 N N   . VAL H 2 15  ? 34.002  70.405  29.603  1.00 75.79  ? 15  VAL H N   1 
ATOM 10488 C CA  . VAL H 2 15  ? 34.407  69.544  30.690  1.00 80.43  ? 15  VAL H CA  1 
ATOM 10489 C C   . VAL H 2 15  ? 35.833  68.995  30.535  1.00 81.12  ? 15  VAL H C   1 
ATOM 10490 O O   . VAL H 2 15  ? 36.138  68.232  29.617  1.00 79.17  ? 15  VAL H O   1 
ATOM 10491 C CB  . VAL H 2 15  ? 33.388  68.403  30.881  1.00 81.59  ? 15  VAL H CB  1 
ATOM 10492 C CG1 . VAL H 2 15  ? 32.587  68.212  29.598  1.00 82.00  ? 15  VAL H CG1 1 
ATOM 10493 C CG2 . VAL H 2 15  ? 34.096  67.117  31.310  1.00 82.39  ? 15  VAL H CG2 1 
ATOM 10494 N N   . GLY H 2 16  ? 36.690  69.418  31.464  1.00 83.17  ? 16  GLY H N   1 
ATOM 10495 C CA  . GLY H 2 16  ? 38.091  69.033  31.504  1.00 80.68  ? 16  GLY H CA  1 
ATOM 10496 C C   . GLY H 2 16  ? 38.885  70.325  31.588  1.00 82.42  ? 16  GLY H C   1 
ATOM 10497 O O   . GLY H 2 16  ? 39.974  70.372  32.162  1.00 79.52  ? 16  GLY H O   1 
ATOM 10498 N N   . GLU H 2 17  ? 38.300  71.378  31.011  1.00 83.99  ? 17  GLU H N   1 
ATOM 10499 C CA  . GLU H 2 17  ? 38.880  72.717  30.967  1.00 85.76  ? 17  GLU H CA  1 
ATOM 10500 C C   . GLU H 2 17  ? 39.241  73.303  32.320  1.00 85.48  ? 17  GLU H C   1 
ATOM 10501 O O   . GLU H 2 17  ? 38.922  72.752  33.368  1.00 87.47  ? 17  GLU H O   1 
ATOM 10502 C CB  . GLU H 2 17  ? 37.911  73.692  30.308  1.00 87.68  ? 17  GLU H CB  1 
ATOM 10503 C CG  . GLU H 2 17  ? 37.920  73.689  28.805  1.00 94.05  ? 17  GLU H CG  1 
ATOM 10504 C CD  . GLU H 2 17  ? 37.675  75.086  28.244  1.00 100.21 ? 17  GLU H CD  1 
ATOM 10505 O OE1 . GLU H 2 17  ? 37.503  75.219  27.008  1.00 102.76 ? 17  GLU H OE1 1 
ATOM 10506 O OE2 . GLU H 2 17  ? 37.668  76.055  29.044  1.00 104.49 ? 17  GLU H OE2 1 
ATOM 10507 N N   . ARG H 2 18  ? 39.887  74.457  32.284  1.00 83.27  ? 18  ARG H N   1 
ATOM 10508 C CA  . ARG H 2 18  ? 40.266  75.140  33.502  1.00 81.28  ? 18  ARG H CA  1 
ATOM 10509 C C   . ARG H 2 18  ? 39.567  76.484  33.523  1.00 79.86  ? 18  ARG H C   1 
ATOM 10510 O O   . ARG H 2 18  ? 39.428  77.145  32.493  1.00 77.10  ? 18  ARG H O   1 
ATOM 10511 C CB  . ARG H 2 18  ? 41.769  75.341  33.553  1.00 82.69  ? 18  ARG H CB  1 
ATOM 10512 C CG  . ARG H 2 18  ? 42.225  76.170  34.717  1.00 82.46  ? 18  ARG H CG  1 
ATOM 10513 C CD  . ARG H 2 18  ? 43.172  77.250  34.249  1.00 80.41  ? 18  ARG H CD  1 
ATOM 10514 N NE  . ARG H 2 18  ? 44.073  77.681  35.311  1.00 82.67  ? 18  ARG H NE  1 
ATOM 10515 C CZ  . ARG H 2 18  ? 44.820  76.853  36.039  1.00 85.06  ? 18  ARG H CZ  1 
ATOM 10516 N NH1 . ARG H 2 18  ? 44.774  75.538  35.827  1.00 83.84  ? 18  ARG H NH1 1 
ATOM 10517 N NH2 . ARG H 2 18  ? 45.623  77.342  36.975  1.00 85.80  ? 18  ARG H NH2 1 
ATOM 10518 N N   . VAL H 2 19  ? 39.129  76.890  34.705  1.00 79.24  ? 19  VAL H N   1 
ATOM 10519 C CA  . VAL H 2 19  ? 38.419  78.145  34.827  1.00 78.93  ? 19  VAL H CA  1 
ATOM 10520 C C   . VAL H 2 19  ? 38.804  78.860  36.093  1.00 77.87  ? 19  VAL H C   1 
ATOM 10521 O O   . VAL H 2 19  ? 39.236  78.240  37.071  1.00 76.73  ? 19  VAL H O   1 
ATOM 10522 C CB  . VAL H 2 19  ? 36.876  77.922  34.852  1.00 80.22  ? 19  VAL H CB  1 
ATOM 10523 C CG1 . VAL H 2 19  ? 36.156  79.242  34.988  1.00 78.66  ? 19  VAL H CG1 1 
ATOM 10524 C CG2 . VAL H 2 19  ? 36.424  77.244  33.590  1.00 82.87  ? 19  VAL H CG2 1 
ATOM 10525 N N   . THR H 2 20  ? 38.635  80.177  36.049  1.00 77.33  ? 20  THR H N   1 
ATOM 10526 C CA  . THR H 2 20  ? 38.910  81.028  37.181  1.00 78.90  ? 20  THR H CA  1 
ATOM 10527 C C   . THR H 2 20  ? 37.873  82.133  37.240  1.00 77.47  ? 20  THR H C   1 
ATOM 10528 O O   . THR H 2 20  ? 37.672  82.867  36.268  1.00 73.36  ? 20  THR H O   1 
ATOM 10529 C CB  . THR H 2 20  ? 40.296  81.659  37.093  1.00 82.91  ? 20  THR H CB  1 
ATOM 10530 O OG1 . THR H 2 20  ? 41.295  80.642  37.261  1.00 85.79  ? 20  THR H OG1 1 
ATOM 10531 C CG2 . THR H 2 20  ? 40.455  82.705  38.177  1.00 85.66  ? 20  THR H CG2 1 
ATOM 10532 N N   . LEU H 2 21  ? 37.223  82.227  38.399  1.00 79.94  ? 21  LEU H N   1 
ATOM 10533 C CA  . LEU H 2 21  ? 36.192  83.227  38.672  1.00 81.52  ? 21  LEU H CA  1 
ATOM 10534 C C   . LEU H 2 21  ? 36.824  84.343  39.486  1.00 82.63  ? 21  LEU H C   1 
ATOM 10535 O O   . LEU H 2 21  ? 37.788  84.113  40.219  1.00 81.72  ? 21  LEU H O   1 
ATOM 10536 C CB  . LEU H 2 21  ? 35.047  82.619  39.492  1.00 82.55  ? 21  LEU H CB  1 
ATOM 10537 C CG  . LEU H 2 21  ? 34.186  81.485  38.930  1.00 81.38  ? 21  LEU H CG  1 
ATOM 10538 C CD1 . LEU H 2 21  ? 33.430  81.990  37.728  1.00 83.37  ? 21  LEU H CD1 1 
ATOM 10539 C CD2 . LEU H 2 21  ? 35.045  80.298  38.562  1.00 81.34  ? 21  LEU H CD2 1 
ATOM 10540 N N   . SER H 2 22  ? 36.258  85.541  39.374  1.00 83.53  ? 22  SER H N   1 
ATOM 10541 C CA  . SER H 2 22  ? 36.777  86.696  40.091  1.00 85.91  ? 22  SER H CA  1 
ATOM 10542 C C   . SER H 2 22  ? 35.762  87.383  40.992  1.00 87.97  ? 22  SER H C   1 
ATOM 10543 O O   . SER H 2 22  ? 34.574  87.469  40.664  1.00 88.58  ? 22  SER H O   1 
ATOM 10544 C CB  . SER H 2 22  ? 37.295  87.748  39.108  1.00 86.38  ? 22  SER H CB  1 
ATOM 10545 O OG  . SER H 2 22  ? 36.435  88.886  39.087  1.00 80.93  ? 22  SER H OG  1 
ATOM 10546 N N   . CYS H 2 23  ? 36.252  87.876  42.126  1.00 89.89  ? 23  CYS H N   1 
ATOM 10547 C CA  . CYS H 2 23  ? 35.434  88.628  43.065  1.00 90.40  ? 23  CYS H CA  1 
ATOM 10548 C C   . CYS H 2 23  ? 36.281  89.815  43.465  1.00 87.81  ? 23  CYS H C   1 
ATOM 10549 O O   . CYS H 2 23  ? 37.403  89.636  43.941  1.00 87.89  ? 23  CYS H O   1 
ATOM 10550 C CB  . CYS H 2 23  ? 35.090  87.821  44.317  1.00 93.96  ? 23  CYS H CB  1 
ATOM 10551 S SG  . CYS H 2 23  ? 33.682  88.560  45.267  1.00 99.05  ? 23  CYS H SG  1 
ATOM 10552 N N   . LYS H 2 24  ? 35.750  91.016  43.253  1.00 84.53  ? 24  LYS H N   1 
ATOM 10553 C CA  . LYS H 2 24  ? 36.455  92.251  43.591  1.00 85.12  ? 24  LYS H CA  1 
ATOM 10554 C C   . LYS H 2 24  ? 35.602  93.109  44.523  1.00 83.45  ? 24  LYS H C   1 
ATOM 10555 O O   . LYS H 2 24  ? 34.477  93.481  44.180  1.00 83.33  ? 24  LYS H O   1 
ATOM 10556 C CB  . LYS H 2 24  ? 36.768  93.066  42.332  1.00 88.36  ? 24  LYS H CB  1 
ATOM 10557 C CG  . LYS H 2 24  ? 37.291  92.267  41.150  1.00 93.52  ? 24  LYS H CG  1 
ATOM 10558 C CD  . LYS H 2 24  ? 38.603  91.569  41.455  1.00 97.96  ? 24  LYS H CD  1 
ATOM 10559 C CE  . LYS H 2 24  ? 39.221  91.050  40.169  1.00 100.03 ? 24  LYS H CE  1 
ATOM 10560 N NZ  . LYS H 2 24  ? 39.392  92.173  39.191  1.00 100.01 ? 24  LYS H NZ  1 
ATOM 10561 N N   . ALA H 2 25  ? 36.155  93.438  45.689  1.00 81.55  ? 25  ALA H N   1 
ATOM 10562 C CA  . ALA H 2 25  ? 35.451  94.239  46.684  1.00 79.86  ? 25  ALA H CA  1 
ATOM 10563 C C   . ALA H 2 25  ? 35.782  95.720  46.572  1.00 80.89  ? 25  ALA H C   1 
ATOM 10564 O O   . ALA H 2 25  ? 36.852  96.092  46.093  1.00 82.55  ? 25  ALA H O   1 
ATOM 10565 C CB  . ALA H 2 25  ? 35.788  93.740  48.077  1.00 79.00  ? 25  ALA H CB  1 
ATOM 10566 N N   . SER H 2 26  ? 34.860  96.560  47.031  1.00 81.23  ? 26  SER H N   1 
ATOM 10567 C CA  . SER H 2 26  ? 35.042  98.004  46.982  1.00 80.69  ? 26  SER H CA  1 
ATOM 10568 C C   . SER H 2 26  ? 36.044  98.536  48.010  1.00 81.42  ? 26  SER H C   1 
ATOM 10569 O O   . SER H 2 26  ? 36.306  99.735  48.060  1.00 82.50  ? 26  SER H O   1 
ATOM 10570 C CB  . SER H 2 26  ? 33.694  98.708  47.171  1.00 79.81  ? 26  SER H CB  1 
ATOM 10571 O OG  . SER H 2 26  ? 33.085  98.362  48.403  1.00 80.73  ? 26  SER H OG  1 
ATOM 10572 N N   . GLU H 2 27  ? 36.603  97.649  48.829  1.00 80.10  ? 27  GLU H N   1 
ATOM 10573 C CA  . GLU H 2 27  ? 37.576  98.049  49.840  1.00 77.13  ? 27  GLU H CA  1 
ATOM 10574 C C   . GLU H 2 27  ? 38.414  96.859  50.213  1.00 74.24  ? 27  GLU H C   1 
ATOM 10575 O O   . GLU H 2 27  ? 38.329  95.801  49.597  1.00 72.99  ? 27  GLU H O   1 
ATOM 10576 C CB  . GLU H 2 27  ? 36.883  98.524  51.102  1.00 78.93  ? 27  GLU H CB  1 
ATOM 10577 C CG  . GLU H 2 27  ? 36.016  99.733  50.925  1.00 89.30  ? 27  GLU H CG  1 
ATOM 10578 C CD  . GLU H 2 27  ? 35.017  99.865  52.054  1.00 95.81  ? 27  GLU H CD  1 
ATOM 10579 O OE1 . GLU H 2 27  ? 35.435  99.708  53.227  1.00 98.65  ? 27  GLU H OE1 1 
ATOM 10580 O OE2 . GLU H 2 27  ? 33.821  100.122 51.769  1.00 100.99 ? 27  GLU H OE2 1 
ATOM 10581 N N   . ASN H 2 28  ? 39.233  97.035  51.234  1.00 71.56  ? 28  ASN H N   1 
ATOM 10582 C CA  . ASN H 2 28  ? 40.048  95.932  51.689  1.00 69.18  ? 28  ASN H CA  1 
ATOM 10583 C C   . ASN H 2 28  ? 39.140  95.155  52.623  1.00 66.80  ? 28  ASN H C   1 
ATOM 10584 O O   . ASN H 2 28  ? 38.338  95.741  53.362  1.00 65.36  ? 28  ASN H O   1 
ATOM 10585 C CB  . ASN H 2 28  ? 41.302  96.436  52.426  1.00 68.63  ? 28  ASN H CB  1 
ATOM 10586 C CG  . ASN H 2 28  ? 42.015  95.334  53.208  1.00 65.95  ? 28  ASN H CG  1 
ATOM 10587 O OD1 . ASN H 2 28  ? 41.570  94.953  54.286  1.00 63.62  ? 28  ASN H OD1 1 
ATOM 10588 N ND2 . ASN H 2 28  ? 43.119  94.818  52.665  1.00 64.21  ? 28  ASN H ND2 1 
ATOM 10589 N N   . VAL H 2 29  ? 39.236  93.834  52.552  1.00 63.11  ? 29  VAL H N   1 
ATOM 10590 C CA  . VAL H 2 29  ? 38.437  92.976  53.404  1.00 61.40  ? 29  VAL H CA  1 
ATOM 10591 C C   . VAL H 2 29  ? 39.396  91.954  53.961  1.00 58.09  ? 29  VAL H C   1 
ATOM 10592 O O   . VAL H 2 29  ? 39.009  91.006  54.637  1.00 54.59  ? 29  VAL H O   1 
ATOM 10593 C CB  . VAL H 2 29  ? 37.321  92.279  52.610  1.00 65.33  ? 29  VAL H CB  1 
ATOM 10594 C CG1 . VAL H 2 29  ? 36.382  93.319  52.020  1.00 65.24  ? 29  VAL H CG1 1 
ATOM 10595 C CG2 . VAL H 2 29  ? 37.919  91.431  51.511  1.00 67.49  ? 29  VAL H CG2 1 
ATOM 10596 N N   . ASP H 2 30  ? 40.667  92.158  53.650  1.00 58.14  ? 30  ASP H N   1 
ATOM 10597 C CA  . ASP H 2 30  ? 41.712  91.285  54.141  1.00 60.82  ? 30  ASP H CA  1 
ATOM 10598 C C   . ASP H 2 30  ? 41.557  89.852  53.694  1.00 61.68  ? 30  ASP H C   1 
ATOM 10599 O O   . ASP H 2 30  ? 41.963  89.507  52.589  1.00 65.42  ? 30  ASP H O   1 
ATOM 10600 C CB  . ASP H 2 30  ? 41.759  91.346  55.662  1.00 60.16  ? 30  ASP H CB  1 
ATOM 10601 C CG  . ASP H 2 30  ? 41.960  92.756  56.164  1.00 61.34  ? 30  ASP H CG  1 
ATOM 10602 O OD1 . ASP H 2 30  ? 42.875  93.437  55.641  1.00 59.59  ? 30  ASP H OD1 1 
ATOM 10603 O OD2 . ASP H 2 30  ? 41.208  93.183  57.071  1.00 65.00  ? 30  ASP H OD2 1 
ATOM 10604 N N   . THR H 2 31  ? 40.987  89.010  54.542  1.00 60.09  ? 31  THR H N   1 
ATOM 10605 C CA  . THR H 2 31  ? 40.822  87.614  54.166  1.00 60.33  ? 31  THR H CA  1 
ATOM 10606 C C   . THR H 2 31  ? 39.458  87.061  54.556  1.00 60.33  ? 31  THR H C   1 
ATOM 10607 O O   . THR H 2 31  ? 39.216  85.845  54.524  1.00 58.59  ? 31  THR H O   1 
ATOM 10608 C CB  . THR H 2 31  ? 41.930  86.771  54.803  1.00 58.64  ? 31  THR H CB  1 
ATOM 10609 O OG1 . THR H 2 31  ? 42.058  87.121  56.184  1.00 57.70  ? 31  THR H OG1 1 
ATOM 10610 C CG2 . THR H 2 31  ? 43.247  87.030  54.105  1.00 58.56  ? 31  THR H CG2 1 
ATOM 10611 N N   . TYR H 2 32  ? 38.565  87.979  54.904  1.00 60.88  ? 32  TYR H N   1 
ATOM 10612 C CA  . TYR H 2 32  ? 37.221  87.634  55.328  1.00 65.83  ? 32  TYR H CA  1 
ATOM 10613 C C   . TYR H 2 32  ? 36.305  87.391  54.141  1.00 65.50  ? 32  TYR H C   1 
ATOM 10614 O O   . TYR H 2 32  ? 35.184  87.900  54.063  1.00 66.94  ? 32  TYR H O   1 
ATOM 10615 C CB  . TYR H 2 32  ? 36.705  88.749  56.236  1.00 69.91  ? 32  TYR H CB  1 
ATOM 10616 C CG  . TYR H 2 32  ? 37.643  88.949  57.407  1.00 74.38  ? 32  TYR H CG  1 
ATOM 10617 C CD1 . TYR H 2 32  ? 38.194  90.196  57.695  1.00 71.79  ? 32  TYR H CD1 1 
ATOM 10618 C CD2 . TYR H 2 32  ? 38.023  87.862  58.200  1.00 76.09  ? 32  TYR H CD2 1 
ATOM 10619 C CE1 . TYR H 2 32  ? 39.099  90.345  58.736  1.00 70.40  ? 32  TYR H CE1 1 
ATOM 10620 C CE2 . TYR H 2 32  ? 38.918  88.002  59.234  1.00 73.48  ? 32  TYR H CE2 1 
ATOM 10621 C CZ  . TYR H 2 32  ? 39.454  89.237  59.499  1.00 73.50  ? 32  TYR H CZ  1 
ATOM 10622 O OH  . TYR H 2 32  ? 40.357  89.345  60.532  1.00 78.62  ? 32  TYR H OH  1 
ATOM 10623 N N   . VAL H 2 33  ? 36.810  86.589  53.216  1.00 61.47  ? 33  VAL H N   1 
ATOM 10624 C CA  . VAL H 2 33  ? 36.081  86.249  52.023  1.00 53.89  ? 33  VAL H CA  1 
ATOM 10625 C C   . VAL H 2 33  ? 35.916  84.743  51.953  1.00 55.71  ? 33  VAL H C   1 
ATOM 10626 O O   . VAL H 2 33  ? 36.719  84.000  52.523  1.00 53.82  ? 33  VAL H O   1 
ATOM 10627 C CB  . VAL H 2 33  ? 36.815  86.766  50.820  1.00 49.65  ? 33  VAL H CB  1 
ATOM 10628 C CG1 . VAL H 2 33  ? 36.145  86.306  49.571  1.00 47.59  ? 33  VAL H CG1 1 
ATOM 10629 C CG2 . VAL H 2 33  ? 36.823  88.270  50.874  1.00 49.31  ? 33  VAL H CG2 1 
ATOM 10630 N N   . PHE H 2 34  ? 34.855  84.306  51.273  1.00 56.07  ? 34  PHE H N   1 
ATOM 10631 C CA  . PHE H 2 34  ? 34.531  82.887  51.136  1.00 53.89  ? 34  PHE H CA  1 
ATOM 10632 C C   . PHE H 2 34  ? 33.629  82.651  49.928  1.00 52.85  ? 34  PHE H C   1 
ATOM 10633 O O   . PHE H 2 34  ? 32.909  83.555  49.483  1.00 48.52  ? 34  PHE H O   1 
ATOM 10634 C CB  . PHE H 2 34  ? 33.847  82.408  52.413  1.00 53.26  ? 34  PHE H CB  1 
ATOM 10635 C CG  . PHE H 2 34  ? 32.825  83.373  52.933  1.00 49.39  ? 34  PHE H CG  1 
ATOM 10636 C CD1 . PHE H 2 34  ? 31.498  83.276  52.546  1.00 47.75  ? 34  PHE H CD1 1 
ATOM 10637 C CD2 . PHE H 2 34  ? 33.204  84.420  53.764  1.00 49.92  ? 34  PHE H CD2 1 
ATOM 10638 C CE1 . PHE H 2 34  ? 30.563  84.204  52.976  1.00 48.04  ? 34  PHE H CE1 1 
ATOM 10639 C CE2 . PHE H 2 34  ? 32.274  85.358  54.198  1.00 49.40  ? 34  PHE H CE2 1 
ATOM 10640 C CZ  . PHE H 2 34  ? 30.951  85.246  53.800  1.00 50.93  ? 34  PHE H CZ  1 
ATOM 10641 N N   . TRP H 2 35  ? 33.665  81.422  49.417  1.00 55.57  ? 35  TRP H N   1 
ATOM 10642 C CA  . TRP H 2 35  ? 32.896  81.055  48.233  1.00 57.97  ? 35  TRP H CA  1 
ATOM 10643 C C   . TRP H 2 35  ? 31.831  80.004  48.420  1.00 54.26  ? 35  TRP H C   1 
ATOM 10644 O O   . TRP H 2 35  ? 32.007  79.040  49.172  1.00 50.09  ? 35  TRP H O   1 
ATOM 10645 C CB  . TRP H 2 35  ? 33.829  80.558  47.127  1.00 64.24  ? 35  TRP H CB  1 
ATOM 10646 C CG  . TRP H 2 35  ? 34.848  81.559  46.668  1.00 66.86  ? 35  TRP H CG  1 
ATOM 10647 C CD1 . TRP H 2 35  ? 36.053  81.820  47.248  1.00 67.04  ? 35  TRP H CD1 1 
ATOM 10648 C CD2 . TRP H 2 35  ? 34.759  82.419  45.517  1.00 64.93  ? 35  TRP H CD2 1 
ATOM 10649 N NE1 . TRP H 2 35  ? 36.724  82.788  46.529  1.00 66.97  ? 35  TRP H NE1 1 
ATOM 10650 C CE2 . TRP H 2 35  ? 35.953  83.172  45.464  1.00 65.10  ? 35  TRP H CE2 1 
ATOM 10651 C CE3 . TRP H 2 35  ? 33.789  82.621  44.528  1.00 64.75  ? 35  TRP H CE3 1 
ATOM 10652 C CZ2 . TRP H 2 35  ? 36.205  84.119  44.455  1.00 64.84  ? 35  TRP H CZ2 1 
ATOM 10653 C CZ3 . TRP H 2 35  ? 34.040  83.562  43.522  1.00 64.29  ? 35  TRP H CZ3 1 
ATOM 10654 C CH2 . TRP H 2 35  ? 35.240  84.299  43.498  1.00 63.08  ? 35  TRP H CH2 1 
ATOM 10655 N N   . PHE H 2 36  ? 30.738  80.191  47.686  1.00 53.42  ? 36  PHE H N   1 
ATOM 10656 C CA  . PHE H 2 36  ? 29.609  79.267  47.709  1.00 54.64  ? 36  PHE H CA  1 
ATOM 10657 C C   . PHE H 2 36  ? 29.384  78.670  46.332  1.00 52.09  ? 36  PHE H C   1 
ATOM 10658 O O   . PHE H 2 36  ? 29.621  79.327  45.315  1.00 46.56  ? 36  PHE H O   1 
ATOM 10659 C CB  . PHE H 2 36  ? 28.315  79.981  48.107  1.00 55.98  ? 36  PHE H CB  1 
ATOM 10660 C CG  . PHE H 2 36  ? 28.317  80.527  49.503  1.00 57.15  ? 36  PHE H CG  1 
ATOM 10661 C CD1 . PHE H 2 36  ? 28.240  81.903  49.725  1.00 57.73  ? 36  PHE H CD1 1 
ATOM 10662 C CD2 . PHE H 2 36  ? 28.378  79.671  50.599  1.00 54.86  ? 36  PHE H CD2 1 
ATOM 10663 C CE1 . PHE H 2 36  ? 28.223  82.413  51.014  1.00 55.34  ? 36  PHE H CE1 1 
ATOM 10664 C CE2 . PHE H 2 36  ? 28.362  80.173  51.896  1.00 53.45  ? 36  PHE H CE2 1 
ATOM 10665 C CZ  . PHE H 2 36  ? 28.284  81.541  52.104  1.00 56.77  ? 36  PHE H CZ  1 
ATOM 10666 N N   . GLN H 2 37  ? 28.924  77.423  46.309  1.00 52.83  ? 37  GLN H N   1 
ATOM 10667 C CA  . GLN H 2 37  ? 28.602  76.745  45.055  1.00 55.37  ? 37  GLN H CA  1 
ATOM 10668 C C   . GLN H 2 37  ? 27.134  76.348  45.119  1.00 57.90  ? 37  GLN H C   1 
ATOM 10669 O O   . GLN H 2 37  ? 26.769  75.436  45.862  1.00 56.27  ? 37  GLN H O   1 
ATOM 10670 C CB  . GLN H 2 37  ? 29.422  75.474  44.866  1.00 53.28  ? 37  GLN H CB  1 
ATOM 10671 C CG  . GLN H 2 37  ? 28.972  74.669  43.654  1.00 50.90  ? 37  GLN H CG  1 
ATOM 10672 C CD  . GLN H 2 37  ? 29.308  73.192  43.764  1.00 53.33  ? 37  GLN H CD  1 
ATOM 10673 O OE1 . GLN H 2 37  ? 28.817  72.501  44.662  1.00 52.06  ? 37  GLN H OE1 1 
ATOM 10674 N NE2 . GLN H 2 37  ? 30.146  72.696  42.850  1.00 53.27  ? 37  GLN H NE2 1 
ATOM 10675 N N   . GLN H 2 38  ? 26.290  77.025  44.351  1.00 59.55  ? 38  GLN H N   1 
ATOM 10676 C CA  . GLN H 2 38  ? 24.874  76.699  44.376  1.00 63.02  ? 38  GLN H CA  1 
ATOM 10677 C C   . GLN H 2 38  ? 24.378  76.065  43.074  1.00 68.66  ? 38  GLN H C   1 
ATOM 10678 O O   . GLN H 2 38  ? 24.214  76.746  42.054  1.00 69.62  ? 38  GLN H O   1 
ATOM 10679 C CB  . GLN H 2 38  ? 24.057  77.947  44.681  1.00 59.36  ? 38  GLN H CB  1 
ATOM 10680 C CG  . GLN H 2 38  ? 22.561  77.679  44.727  1.00 54.95  ? 38  GLN H CG  1 
ATOM 10681 C CD  . GLN H 2 38  ? 21.745  78.901  45.142  1.00 56.18  ? 38  GLN H CD  1 
ATOM 10682 O OE1 . GLN H 2 38  ? 22.022  80.023  44.708  1.00 55.14  ? 38  GLN H OE1 1 
ATOM 10683 N NE2 . GLN H 2 38  ? 20.725  78.688  45.976  1.00 56.96  ? 38  GLN H NE2 1 
ATOM 10684 N N   . LYS H 2 39  ? 24.145  74.755  43.124  1.00 70.67  ? 39  LYS H N   1 
ATOM 10685 C CA  . LYS H 2 39  ? 23.656  73.999  41.975  1.00 73.30  ? 39  LYS H CA  1 
ATOM 10686 C C   . LYS H 2 39  ? 22.166  74.291  41.812  1.00 80.53  ? 39  LYS H C   1 
ATOM 10687 O O   . LYS H 2 39  ? 21.542  74.845  42.717  1.00 83.93  ? 39  LYS H O   1 
ATOM 10688 C CB  . LYS H 2 39  ? 23.879  72.498  42.201  1.00 64.98  ? 39  LYS H CB  1 
ATOM 10689 C CG  . LYS H 2 39  ? 25.321  72.045  41.993  1.00 58.01  ? 39  LYS H CG  1 
ATOM 10690 C CD  . LYS H 2 39  ? 25.520  70.598  42.441  1.00 50.21  ? 39  LYS H CD  1 
ATOM 10691 C CE  . LYS H 2 39  ? 26.904  70.058  42.060  1.00 49.29  ? 39  LYS H CE  1 
ATOM 10692 N NZ  . LYS H 2 39  ? 27.162  68.660  42.553  1.00 48.09  ? 39  LYS H NZ  1 
ATOM 10693 N N   . PRO H 2 40  ? 21.574  73.930  40.656  1.00 84.64  ? 40  PRO H N   1 
ATOM 10694 C CA  . PRO H 2 40  ? 20.143  74.180  40.432  1.00 84.13  ? 40  PRO H CA  1 
ATOM 10695 C C   . PRO H 2 40  ? 19.264  73.418  41.429  1.00 84.45  ? 40  PRO H C   1 
ATOM 10696 O O   . PRO H 2 40  ? 19.420  72.201  41.609  1.00 80.95  ? 40  PRO H O   1 
ATOM 10697 C CB  . PRO H 2 40  ? 19.944  73.710  39.000  1.00 84.91  ? 40  PRO H CB  1 
ATOM 10698 C CG  . PRO H 2 40  ? 20.921  72.556  38.901  1.00 83.43  ? 40  PRO H CG  1 
ATOM 10699 C CD  . PRO H 2 40  ? 22.150  73.155  39.538  1.00 84.66  ? 40  PRO H CD  1 
ATOM 10700 N N   . ASP H 2 41  ? 18.352  74.152  42.069  1.00 85.89  ? 41  ASP H N   1 
ATOM 10701 C CA  . ASP H 2 41  ? 17.429  73.607  43.073  1.00 88.25  ? 41  ASP H CA  1 
ATOM 10702 C C   . ASP H 2 41  ? 18.120  73.077  44.318  1.00 85.17  ? 41  ASP H C   1 
ATOM 10703 O O   . ASP H 2 41  ? 17.839  71.959  44.759  1.00 85.75  ? 41  ASP H O   1 
ATOM 10704 C CB  . ASP H 2 41  ? 16.566  72.478  42.501  1.00 95.11  ? 41  ASP H CB  1 
ATOM 10705 C CG  . ASP H 2 41  ? 15.581  72.965  41.458  1.00 100.91 ? 41  ASP H CG  1 
ATOM 10706 O OD1 . ASP H 2 41  ? 14.996  74.059  41.650  1.00 102.80 ? 41  ASP H OD1 1 
ATOM 10707 O OD2 . ASP H 2 41  ? 15.384  72.242  40.454  1.00 102.58 ? 41  ASP H OD2 1 
ATOM 10708 N N   . GLN H 2 42  ? 19.017  73.883  44.880  1.00 80.38  ? 42  GLN H N   1 
ATOM 10709 C CA  . GLN H 2 42  ? 19.752  73.510  46.082  1.00 75.00  ? 42  GLN H CA  1 
ATOM 10710 C C   . GLN H 2 42  ? 20.161  74.745  46.856  1.00 72.66  ? 42  GLN H C   1 
ATOM 10711 O O   . GLN H 2 42  ? 20.490  75.775  46.268  1.00 75.56  ? 42  GLN H O   1 
ATOM 10712 C CB  . GLN H 2 42  ? 21.016  72.751  45.721  1.00 74.03  ? 42  GLN H CB  1 
ATOM 10713 C CG  . GLN H 2 42  ? 20.791  71.464  45.002  1.00 74.92  ? 42  GLN H CG  1 
ATOM 10714 C CD  . GLN H 2 42  ? 22.003  70.581  45.099  1.00 78.85  ? 42  GLN H CD  1 
ATOM 10715 O OE1 . GLN H 2 42  ? 23.106  70.980  44.722  1.00 83.94  ? 42  GLN H OE1 1 
ATOM 10716 N NE2 . GLN H 2 42  ? 21.818  69.376  45.621  1.00 78.49  ? 42  GLN H NE2 1 
ATOM 10717 N N   . SER H 2 43  ? 20.151  74.655  48.176  1.00 66.73  ? 43  SER H N   1 
ATOM 10718 C CA  . SER H 2 43  ? 20.571  75.795  48.973  1.00 60.38  ? 43  SER H CA  1 
ATOM 10719 C C   . SER H 2 43  ? 22.069  75.950  48.699  1.00 55.68  ? 43  SER H C   1 
ATOM 10720 O O   . SER H 2 43  ? 22.728  74.984  48.320  1.00 55.87  ? 43  SER H O   1 
ATOM 10721 C CB  . SER H 2 43  ? 20.329  75.502  50.448  1.00 59.10  ? 43  SER H CB  1 
ATOM 10722 O OG  . SER H 2 43  ? 20.971  74.297  50.822  1.00 57.66  ? 43  SER H OG  1 
ATOM 10723 N N   . PRO H 2 44  ? 22.626  77.161  48.859  1.00 48.95  ? 44  PRO H N   1 
ATOM 10724 C CA  . PRO H 2 44  ? 24.061  77.298  48.597  1.00 44.27  ? 44  PRO H CA  1 
ATOM 10725 C C   . PRO H 2 44  ? 24.858  76.337  49.464  1.00 42.18  ? 44  PRO H C   1 
ATOM 10726 O O   . PRO H 2 44  ? 24.380  75.861  50.491  1.00 39.26  ? 44  PRO H O   1 
ATOM 10727 C CB  . PRO H 2 44  ? 24.347  78.750  48.960  1.00 42.64  ? 44  PRO H CB  1 
ATOM 10728 C CG  . PRO H 2 44  ? 23.074  79.435  48.641  1.00 44.64  ? 44  PRO H CG  1 
ATOM 10729 C CD  . PRO H 2 44  ? 22.022  78.466  49.166  1.00 46.03  ? 44  PRO H CD  1 
ATOM 10730 N N   . LYS H 2 45  ? 26.071  76.037  49.032  1.00 44.10  ? 45  LYS H N   1 
ATOM 10731 C CA  . LYS H 2 45  ? 26.946  75.151  49.777  1.00 48.30  ? 45  LYS H CA  1 
ATOM 10732 C C   . LYS H 2 45  ? 28.261  75.887  49.942  1.00 51.03  ? 45  LYS H C   1 
ATOM 10733 O O   . LYS H 2 45  ? 28.732  76.580  49.024  1.00 51.05  ? 45  LYS H O   1 
ATOM 10734 C CB  . LYS H 2 45  ? 27.174  73.836  49.027  1.00 49.78  ? 45  LYS H CB  1 
ATOM 10735 C CG  . LYS H 2 45  ? 25.950  72.930  48.973  1.00 54.53  ? 45  LYS H CG  1 
ATOM 10736 C CD  . LYS H 2 45  ? 25.993  71.938  47.767  1.00 63.35  ? 45  LYS H CD  1 
ATOM 10737 C CE  . LYS H 2 45  ? 25.813  72.608  46.355  1.00 63.14  ? 45  LYS H CE  1 
ATOM 10738 N NZ  . LYS H 2 45  ? 24.456  73.226  46.059  1.00 52.46  ? 45  LYS H NZ  1 
ATOM 10739 N N   . LEU H 2 46  ? 28.846  75.750  51.124  1.00 52.58  ? 46  LEU H N   1 
ATOM 10740 C CA  . LEU H 2 46  ? 30.108  76.408  51.409  1.00 50.93  ? 46  LEU H CA  1 
ATOM 10741 C C   . LEU H 2 46  ? 31.212  75.707  50.636  1.00 49.29  ? 46  LEU H C   1 
ATOM 10742 O O   . LEU H 2 46  ? 31.540  74.546  50.902  1.00 44.00  ? 46  LEU H O   1 
ATOM 10743 C CB  . LEU H 2 46  ? 30.392  76.353  52.902  1.00 51.50  ? 46  LEU H CB  1 
ATOM 10744 C CG  . LEU H 2 46  ? 31.605  77.146  53.361  1.00 49.64  ? 46  LEU H CG  1 
ATOM 10745 C CD1 . LEU H 2 46  ? 31.438  78.630  53.010  1.00 47.84  ? 46  LEU H CD1 1 
ATOM 10746 C CD2 . LEU H 2 46  ? 31.752  76.943  54.848  1.00 48.05  ? 46  LEU H CD2 1 
ATOM 10747 N N   . LEU H 2 47  ? 31.775  76.420  49.675  1.00 48.83  ? 47  LEU H N   1 
ATOM 10748 C CA  . LEU H 2 47  ? 32.823  75.857  48.843  1.00 54.69  ? 47  LEU H CA  1 
ATOM 10749 C C   . LEU H 2 47  ? 34.192  76.146  49.452  1.00 56.27  ? 47  LEU H C   1 
ATOM 10750 O O   . LEU H 2 47  ? 34.860  75.264  49.995  1.00 55.93  ? 47  LEU H O   1 
ATOM 10751 C CB  . LEU H 2 47  ? 32.726  76.476  47.448  1.00 56.94  ? 47  LEU H CB  1 
ATOM 10752 C CG  . LEU H 2 47  ? 33.498  75.757  46.348  1.00 54.64  ? 47  LEU H CG  1 
ATOM 10753 C CD1 . LEU H 2 47  ? 32.918  74.359  46.190  1.00 42.79  ? 47  LEU H CD1 1 
ATOM 10754 C CD2 . LEU H 2 47  ? 33.432  76.565  45.051  1.00 48.05  ? 47  LEU H CD2 1 
ATOM 10755 N N   . LEU H 2 48  ? 34.596  77.404  49.347  1.00 57.27  ? 48  LEU H N   1 
ATOM 10756 C CA  . LEU H 2 48  ? 35.858  77.856  49.888  1.00 56.45  ? 48  LEU H CA  1 
ATOM 10757 C C   . LEU H 2 48  ? 35.557  78.784  51.065  1.00 58.01  ? 48  LEU H C   1 
ATOM 10758 O O   . LEU H 2 48  ? 35.041  79.894  50.877  1.00 55.97  ? 48  LEU H O   1 
ATOM 10759 C CB  . LEU H 2 48  ? 36.635  78.607  48.803  1.00 53.94  ? 48  LEU H CB  1 
ATOM 10760 C CG  . LEU H 2 48  ? 37.968  77.999  48.347  1.00 52.25  ? 48  LEU H CG  1 
ATOM 10761 C CD1 . LEU H 2 48  ? 37.896  76.470  48.318  1.00 47.03  ? 48  LEU H CD1 1 
ATOM 10762 C CD2 . LEU H 2 48  ? 38.317  78.562  46.980  1.00 45.34  ? 48  LEU H CD2 1 
ATOM 10763 N N   . TYR H 2 49  ? 35.835  78.313  52.280  1.00 59.86  ? 49  TYR H N   1 
ATOM 10764 C CA  . TYR H 2 49  ? 35.625  79.125  53.484  1.00 62.43  ? 49  TYR H CA  1 
ATOM 10765 C C   . TYR H 2 49  ? 36.949  79.874  53.592  1.00 64.01  ? 49  TYR H C   1 
ATOM 10766 O O   . TYR H 2 49  ? 37.995  79.241  53.619  1.00 64.16  ? 49  TYR H O   1 
ATOM 10767 C CB  . TYR H 2 49  ? 35.393  78.208  54.682  1.00 59.48  ? 49  TYR H CB  1 
ATOM 10768 C CG  . TYR H 2 49  ? 36.621  77.512  55.183  1.00 60.78  ? 49  TYR H CG  1 
ATOM 10769 C CD1 . TYR H 2 49  ? 37.525  78.176  56.003  1.00 63.92  ? 49  TYR H CD1 1 
ATOM 10770 C CD2 . TYR H 2 49  ? 36.902  76.200  54.820  1.00 59.91  ? 49  TYR H CD2 1 
ATOM 10771 C CE1 . TYR H 2 49  ? 38.684  77.554  56.447  1.00 66.59  ? 49  TYR H CE1 1 
ATOM 10772 C CE2 . TYR H 2 49  ? 38.060  75.567  55.262  1.00 62.28  ? 49  TYR H CE2 1 
ATOM 10773 C CZ  . TYR H 2 49  ? 38.943  76.256  56.073  1.00 63.87  ? 49  TYR H CZ  1 
ATOM 10774 O OH  . TYR H 2 49  ? 40.098  75.669  56.508  1.00 67.80  ? 49  TYR H OH  1 
ATOM 10775 N N   . GLY H 2 50  ? 36.933  81.204  53.632  1.00 65.54  ? 50  GLY H N   1 
ATOM 10776 C CA  . GLY H 2 50  ? 38.212  81.909  53.641  1.00 68.76  ? 50  GLY H CA  1 
ATOM 10777 C C   . GLY H 2 50  ? 38.906  81.639  52.293  1.00 69.56  ? 50  GLY H C   1 
ATOM 10778 O O   . GLY H 2 50  ? 38.933  80.481  51.844  1.00 66.33  ? 50  GLY H O   1 
ATOM 10779 N N   . PRO H 2 51  ? 39.493  82.659  51.620  1.00 70.43  ? 51  PRO H N   1 
ATOM 10780 C CA  . PRO H 2 51  ? 40.140  82.379  50.324  1.00 68.41  ? 51  PRO H CA  1 
ATOM 10781 C C   . PRO H 2 51  ? 41.100  81.196  50.362  1.00 68.17  ? 51  PRO H C   1 
ATOM 10782 O O   . PRO H 2 51  ? 41.604  80.825  51.424  1.00 73.22  ? 51  PRO H O   1 
ATOM 10783 C CB  . PRO H 2 51  ? 40.834  83.699  49.985  1.00 66.50  ? 51  PRO H CB  1 
ATOM 10784 C CG  . PRO H 2 51  ? 41.139  84.280  51.339  1.00 68.44  ? 51  PRO H CG  1 
ATOM 10785 C CD  . PRO H 2 51  ? 39.871  83.999  52.113  1.00 69.63  ? 51  PRO H CD  1 
ATOM 10786 N N   . SER H 2 52  ? 41.328  80.587  49.209  1.00 63.31  ? 52  SER H N   1 
ATOM 10787 C CA  . SER H 2 52  ? 42.237  79.447  49.116  1.00 61.96  ? 52  SER H CA  1 
ATOM 10788 C C   . SER H 2 52  ? 42.090  78.365  50.193  1.00 59.60  ? 52  SER H C   1 
ATOM 10789 O O   . SER H 2 52  ? 43.096  77.805  50.628  1.00 61.90  ? 52  SER H O   1 
ATOM 10790 C CB  . SER H 2 52  ? 43.676  79.930  49.161  1.00 65.39  ? 52  SER H CB  1 
ATOM 10791 O OG  . SER H 2 52  ? 44.085  80.081  50.508  1.00 69.32  ? 52  SER H OG  1 
ATOM 10792 N N   . ASN H 2 53  ? 40.868  78.058  50.618  1.00 54.89  ? 53  ASN H N   1 
ATOM 10793 C CA  . ASN H 2 53  ? 40.667  77.021  51.634  1.00 53.52  ? 53  ASN H CA  1 
ATOM 10794 C C   . ASN H 2 53  ? 39.455  76.131  51.404  1.00 52.95  ? 53  ASN H C   1 
ATOM 10795 O O   . ASN H 2 53  ? 38.326  76.537  51.664  1.00 54.96  ? 53  ASN H O   1 
ATOM 10796 C CB  . ASN H 2 53  ? 40.558  77.672  52.997  1.00 50.78  ? 53  ASN H CB  1 
ATOM 10797 C CG  . ASN H 2 53  ? 41.899  77.983  53.579  1.00 45.06  ? 53  ASN H CG  1 
ATOM 10798 O OD1 . ASN H 2 53  ? 42.610  77.070  53.998  1.00 40.18  ? 53  ASN H OD1 1 
ATOM 10799 N ND2 . ASN H 2 53  ? 42.273  79.268  53.592  1.00 38.25  ? 53  ASN H ND2 1 
ATOM 10800 N N   . ARG H 2 54  ? 39.684  74.909  50.943  1.00 50.85  ? 54  ARG H N   1 
ATOM 10801 C CA  . ARG H 2 54  ? 38.571  74.017  50.667  1.00 52.20  ? 54  ARG H CA  1 
ATOM 10802 C C   . ARG H 2 54  ? 37.846  73.529  51.906  1.00 49.65  ? 54  ARG H C   1 
ATOM 10803 O O   . ARG H 2 54  ? 38.440  72.898  52.774  1.00 46.43  ? 54  ARG H O   1 
ATOM 10804 C CB  . ARG H 2 54  ? 39.044  72.822  49.825  1.00 59.11  ? 54  ARG H CB  1 
ATOM 10805 C CG  . ARG H 2 54  ? 39.291  73.192  48.356  1.00 64.05  ? 54  ARG H CG  1 
ATOM 10806 C CD  . ARG H 2 54  ? 39.800  72.036  47.492  1.00 65.71  ? 54  ARG H CD  1 
ATOM 10807 N NE  . ARG H 2 54  ? 41.230  71.786  47.648  1.00 69.34  ? 54  ARG H NE  1 
ATOM 10808 C CZ  . ARG H 2 54  ? 41.745  70.848  48.439  1.00 72.94  ? 54  ARG H CZ  1 
ATOM 10809 N NH1 . ARG H 2 54  ? 40.950  70.058  49.156  1.00 72.72  ? 54  ARG H NH1 1 
ATOM 10810 N NH2 . ARG H 2 54  ? 43.062  70.694  48.509  1.00 80.50  ? 54  ARG H NH2 1 
ATOM 10811 N N   . TYR H 2 55  ? 36.552  73.830  51.983  1.00 49.56  ? 55  TYR H N   1 
ATOM 10812 C CA  . TYR H 2 55  ? 35.746  73.404  53.115  1.00 51.95  ? 55  TYR H CA  1 
ATOM 10813 C C   . TYR H 2 55  ? 35.604  71.884  53.063  1.00 50.72  ? 55  TYR H C   1 
ATOM 10814 O O   . TYR H 2 55  ? 35.864  71.271  52.039  1.00 50.16  ? 55  TYR H O   1 
ATOM 10815 C CB  . TYR H 2 55  ? 34.360  74.071  53.073  1.00 53.63  ? 55  TYR H CB  1 
ATOM 10816 C CG  . TYR H 2 55  ? 33.452  73.717  54.251  1.00 57.87  ? 55  TYR H CG  1 
ATOM 10817 C CD1 . TYR H 2 55  ? 32.130  73.336  54.051  1.00 56.61  ? 55  TYR H CD1 1 
ATOM 10818 C CD2 . TYR H 2 55  ? 33.933  73.733  55.560  1.00 58.86  ? 55  TYR H CD2 1 
ATOM 10819 C CE1 . TYR H 2 55  ? 31.318  72.974  55.121  1.00 58.31  ? 55  TYR H CE1 1 
ATOM 10820 C CE2 . TYR H 2 55  ? 33.124  73.374  56.640  1.00 57.06  ? 55  TYR H CE2 1 
ATOM 10821 C CZ  . TYR H 2 55  ? 31.820  72.992  56.415  1.00 57.87  ? 55  TYR H CZ  1 
ATOM 10822 O OH  . TYR H 2 55  ? 31.030  72.607  57.482  1.00 58.57  ? 55  TYR H OH  1 
ATOM 10823 N N   . THR H 2 56  ? 35.206  71.281  54.175  1.00 53.58  ? 56  THR H N   1 
ATOM 10824 C CA  . THR H 2 56  ? 35.024  69.843  54.245  1.00 58.15  ? 56  THR H CA  1 
ATOM 10825 C C   . THR H 2 56  ? 34.324  69.305  53.011  1.00 62.81  ? 56  THR H C   1 
ATOM 10826 O O   . THR H 2 56  ? 33.218  69.750  52.678  1.00 65.77  ? 56  THR H O   1 
ATOM 10827 C CB  . THR H 2 56  ? 34.186  69.466  55.461  1.00 55.88  ? 56  THR H CB  1 
ATOM 10828 O OG1 . THR H 2 56  ? 34.954  69.696  56.644  1.00 54.97  ? 56  THR H OG1 1 
ATOM 10829 C CG2 . THR H 2 56  ? 33.762  68.003  55.391  1.00 56.52  ? 56  THR H CG2 1 
ATOM 10830 N N   . GLY H 2 57  ? 34.963  68.337  52.351  1.00 65.20  ? 57  GLY H N   1 
ATOM 10831 C CA  . GLY H 2 57  ? 34.390  67.736  51.154  1.00 65.42  ? 57  GLY H CA  1 
ATOM 10832 C C   . GLY H 2 57  ? 35.085  68.199  49.889  1.00 64.93  ? 57  GLY H C   1 
ATOM 10833 O O   . GLY H 2 57  ? 35.946  67.502  49.357  1.00 64.69  ? 57  GLY H O   1 
ATOM 10834 N N   . VAL H 2 58  ? 34.711  69.385  49.424  1.00 65.68  ? 58  VAL H N   1 
ATOM 10835 C CA  . VAL H 2 58  ? 35.273  70.001  48.224  1.00 69.50  ? 58  VAL H CA  1 
ATOM 10836 C C   . VAL H 2 58  ? 36.553  69.350  47.663  1.00 73.67  ? 58  VAL H C   1 
ATOM 10837 O O   . VAL H 2 58  ? 37.599  69.320  48.325  1.00 76.20  ? 58  VAL H O   1 
ATOM 10838 C CB  . VAL H 2 58  ? 35.572  71.492  48.476  1.00 67.00  ? 58  VAL H CB  1 
ATOM 10839 C CG1 . VAL H 2 58  ? 35.754  72.216  47.156  1.00 70.52  ? 58  VAL H CG1 1 
ATOM 10840 C CG2 . VAL H 2 58  ? 34.457  72.121  49.275  1.00 68.48  ? 58  VAL H CG2 1 
ATOM 10841 N N   . PRO H 2 59  ? 36.482  68.825  46.424  1.00 75.37  ? 59  PRO H N   1 
ATOM 10842 C CA  . PRO H 2 59  ? 37.608  68.173  45.740  1.00 72.87  ? 59  PRO H CA  1 
ATOM 10843 C C   . PRO H 2 59  ? 38.729  69.150  45.368  1.00 69.94  ? 59  PRO H C   1 
ATOM 10844 O O   . PRO H 2 59  ? 38.478  70.319  45.035  1.00 65.12  ? 59  PRO H O   1 
ATOM 10845 C CB  . PRO H 2 59  ? 36.943  67.549  44.520  1.00 76.24  ? 59  PRO H CB  1 
ATOM 10846 C CG  . PRO H 2 59  ? 35.814  68.531  44.227  1.00 75.33  ? 59  PRO H CG  1 
ATOM 10847 C CD  . PRO H 2 59  ? 35.257  68.750  45.603  1.00 76.56  ? 59  PRO H CD  1 
ATOM 10848 N N   . ASP H 2 60  ? 39.961  68.650  45.400  1.00 69.17  ? 60  ASP H N   1 
ATOM 10849 C CA  . ASP H 2 60  ? 41.140  69.467  45.120  1.00 69.40  ? 60  ASP H CA  1 
ATOM 10850 C C   . ASP H 2 60  ? 41.168  70.161  43.777  1.00 65.55  ? 60  ASP H C   1 
ATOM 10851 O O   . ASP H 2 60  ? 42.129  70.849  43.449  1.00 66.17  ? 60  ASP H O   1 
ATOM 10852 C CB  . ASP H 2 60  ? 42.419  68.640  45.296  1.00 73.82  ? 60  ASP H CB  1 
ATOM 10853 C CG  . ASP H 2 60  ? 42.146  67.149  45.372  1.00 77.24  ? 60  ASP H CG  1 
ATOM 10854 O OD1 . ASP H 2 60  ? 41.441  66.709  46.312  1.00 82.70  ? 60  ASP H OD1 1 
ATOM 10855 O OD2 . ASP H 2 60  ? 42.639  66.417  44.491  1.00 78.54  ? 60  ASP H OD2 1 
ATOM 10856 N N   . ARG H 2 61  ? 40.108  69.997  43.008  1.00 64.75  ? 61  ARG H N   1 
ATOM 10857 C CA  . ARG H 2 61  ? 40.007  70.621  41.693  1.00 65.75  ? 61  ARG H CA  1 
ATOM 10858 C C   . ARG H 2 61  ? 39.708  72.101  41.946  1.00 65.60  ? 61  ARG H C   1 
ATOM 10859 O O   . ARG H 2 61  ? 39.914  72.978  41.082  1.00 61.55  ? 61  ARG H O   1 
ATOM 10860 C CB  . ARG H 2 61  ? 38.875  69.922  40.935  1.00 64.33  ? 61  ARG H CB  1 
ATOM 10861 C CG  . ARG H 2 61  ? 38.601  68.554  41.584  1.00 63.01  ? 61  ARG H CG  1 
ATOM 10862 C CD  . ARG H 2 61  ? 37.900  67.529  40.712  1.00 61.62  ? 61  ARG H CD  1 
ATOM 10863 N NE  . ARG H 2 61  ? 36.441  67.540  40.812  1.00 61.96  ? 61  ARG H NE  1 
ATOM 10864 C CZ  . ARG H 2 61  ? 35.678  68.563  40.439  1.00 62.40  ? 61  ARG H CZ  1 
ATOM 10865 N NH1 . ARG H 2 61  ? 36.247  69.673  39.948  1.00 61.48  ? 61  ARG H NH1 1 
ATOM 10866 N NH2 . ARG H 2 61  ? 34.351  68.453  40.522  1.00 51.84  ? 61  ARG H NH2 1 
ATOM 10867 N N   . PHE H 2 62  ? 39.246  72.353  43.171  1.00 65.93  ? 62  PHE H N   1 
ATOM 10868 C CA  . PHE H 2 62  ? 38.877  73.689  43.635  1.00 68.54  ? 62  PHE H CA  1 
ATOM 10869 C C   . PHE H 2 62  ? 39.989  74.357  44.461  1.00 68.82  ? 62  PHE H C   1 
ATOM 10870 O O   . PHE H 2 62  ? 40.607  73.734  45.339  1.00 65.31  ? 62  PHE H O   1 
ATOM 10871 C CB  . PHE H 2 62  ? 37.600  73.604  44.484  1.00 67.90  ? 62  PHE H CB  1 
ATOM 10872 C CG  . PHE H 2 62  ? 36.366  73.214  43.710  1.00 61.25  ? 62  PHE H CG  1 
ATOM 10873 C CD1 . PHE H 2 62  ? 35.666  74.167  42.962  1.00 57.99  ? 62  PHE H CD1 1 
ATOM 10874 C CD2 . PHE H 2 62  ? 35.887  71.900  43.753  1.00 54.39  ? 62  PHE H CD2 1 
ATOM 10875 C CE1 . PHE H 2 62  ? 34.499  73.822  42.268  1.00 53.76  ? 62  PHE H CE1 1 
ATOM 10876 C CE2 . PHE H 2 62  ? 34.729  71.543  43.069  1.00 52.50  ? 62  PHE H CE2 1 
ATOM 10877 C CZ  . PHE H 2 62  ? 34.029  72.509  42.322  1.00 53.09  ? 62  PHE H CZ  1 
ATOM 10878 N N   . THR H 2 63  ? 40.232  75.633  44.182  1.00 67.72  ? 63  THR H N   1 
ATOM 10879 C CA  . THR H 2 63  ? 41.255  76.379  44.897  1.00 65.85  ? 63  THR H CA  1 
ATOM 10880 C C   . THR H 2 63  ? 40.975  77.848  44.676  1.00 66.66  ? 63  THR H C   1 
ATOM 10881 O O   . THR H 2 63  ? 40.200  78.217  43.787  1.00 65.12  ? 63  THR H O   1 
ATOM 10882 C CB  . THR H 2 63  ? 42.676  76.077  44.365  1.00 65.84  ? 63  THR H CB  1 
ATOM 10883 O OG1 . THR H 2 63  ? 42.754  76.450  42.983  1.00 61.06  ? 63  THR H OG1 1 
ATOM 10884 C CG2 . THR H 2 63  ? 43.021  74.587  44.521  1.00 63.79  ? 63  THR H CG2 1 
ATOM 10885 N N   . GLY H 2 64  ? 41.611  78.692  45.477  1.00 68.11  ? 64  GLY H N   1 
ATOM 10886 C CA  . GLY H 2 64  ? 41.386  80.112  45.320  1.00 68.13  ? 64  GLY H CA  1 
ATOM 10887 C C   . GLY H 2 64  ? 42.483  80.925  45.953  1.00 69.15  ? 64  GLY H C   1 
ATOM 10888 O O   . GLY H 2 64  ? 43.429  80.372  46.512  1.00 66.84  ? 64  GLY H O   1 
ATOM 10889 N N   . SER H 2 65  ? 42.360  82.244  45.864  1.00 70.72  ? 65  SER H N   1 
ATOM 10890 C CA  . SER H 2 65  ? 43.370  83.112  46.439  1.00 74.56  ? 65  SER H CA  1 
ATOM 10891 C C   . SER H 2 65  ? 43.040  84.603  46.381  1.00 75.17  ? 65  SER H C   1 
ATOM 10892 O O   . SER H 2 65  ? 42.143  85.062  45.653  1.00 72.46  ? 65  SER H O   1 
ATOM 10893 C CB  . SER H 2 65  ? 44.709  82.895  45.740  1.00 76.35  ? 65  SER H CB  1 
ATOM 10894 O OG  . SER H 2 65  ? 44.752  83.638  44.528  1.00 79.16  ? 65  SER H OG  1 
ATOM 10895 N N   . GLY H 2 66  ? 43.812  85.352  47.157  1.00 74.83  ? 66  GLY H N   1 
ATOM 10896 C CA  . GLY H 2 66  ? 43.637  86.778  47.211  1.00 74.99  ? 66  GLY H CA  1 
ATOM 10897 C C   . GLY H 2 66  ? 43.626  87.277  48.633  1.00 75.84  ? 66  GLY H C   1 
ATOM 10898 O O   . GLY H 2 66  ? 43.757  86.527  49.607  1.00 74.16  ? 66  GLY H O   1 
ATOM 10899 N N   . SER H 2 67  ? 43.474  88.585  48.727  1.00 77.41  ? 67  SER H N   1 
ATOM 10900 C CA  . SER H 2 67  ? 43.414  89.282  49.989  1.00 80.46  ? 67  SER H CA  1 
ATOM 10901 C C   . SER H 2 67  ? 43.322  90.726  49.558  1.00 81.49  ? 67  SER H C   1 
ATOM 10902 O O   . SER H 2 67  ? 43.442  91.032  48.365  1.00 81.05  ? 67  SER H O   1 
ATOM 10903 C CB  . SER H 2 67  ? 44.685  89.058  50.807  1.00 82.51  ? 67  SER H CB  1 
ATOM 10904 O OG  . SER H 2 67  ? 45.764  89.787  50.256  1.00 86.89  ? 67  SER H OG  1 
ATOM 10905 N N   . THR H 2 68  ? 43.097  91.611  50.517  1.00 83.52  ? 68  THR H N   1 
ATOM 10906 C CA  . THR H 2 68  ? 42.994  93.020  50.201  1.00 85.98  ? 68  THR H CA  1 
ATOM 10907 C C   . THR H 2 68  ? 41.714  93.322  49.445  1.00 84.16  ? 68  THR H C   1 
ATOM 10908 O O   . THR H 2 68  ? 40.689  93.640  50.048  1.00 82.07  ? 68  THR H O   1 
ATOM 10909 C CB  . THR H 2 68  ? 44.203  93.474  49.359  1.00 88.36  ? 68  THR H CB  1 
ATOM 10910 O OG1 . THR H 2 68  ? 45.381  93.429  50.176  1.00 91.44  ? 68  THR H OG1 1 
ATOM 10911 C CG2 . THR H 2 68  ? 43.992  94.884  48.799  1.00 87.96  ? 68  THR H CG2 1 
ATOM 10912 N N   . THR H 2 69  ? 41.757  93.195  48.126  1.00 82.31  ? 69  THR H N   1 
ATOM 10913 C CA  . THR H 2 69  ? 40.576  93.522  47.357  1.00 83.11  ? 69  THR H CA  1 
ATOM 10914 C C   . THR H 2 69  ? 40.200  92.591  46.192  1.00 84.38  ? 69  THR H C   1 
ATOM 10915 O O   . THR H 2 69  ? 39.033  92.556  45.788  1.00 84.46  ? 69  THR H O   1 
ATOM 10916 C CB  . THR H 2 69  ? 40.695  94.974  46.846  1.00 81.86  ? 69  THR H CB  1 
ATOM 10917 O OG1 . THR H 2 69  ? 39.491  95.351  46.170  1.00 81.90  ? 69  THR H OG1 1 
ATOM 10918 C CG2 . THR H 2 69  ? 41.885  95.109  45.901  1.00 79.44  ? 69  THR H CG2 1 
ATOM 10919 N N   . ASP H 2 70  ? 41.158  91.833  45.657  1.00 83.11  ? 70  ASP H N   1 
ATOM 10920 C CA  . ASP H 2 70  ? 40.863  90.940  44.532  1.00 80.06  ? 70  ASP H CA  1 
ATOM 10921 C C   . ASP H 2 70  ? 41.043  89.459  44.879  1.00 78.71  ? 70  ASP H C   1 
ATOM 10922 O O   . ASP H 2 70  ? 42.081  89.053  45.403  1.00 77.88  ? 70  ASP H O   1 
ATOM 10923 C CB  . ASP H 2 70  ? 41.731  91.320  43.320  1.00 81.99  ? 70  ASP H CB  1 
ATOM 10924 C CG  . ASP H 2 70  ? 41.553  92.794  42.896  1.00 86.63  ? 70  ASP H CG  1 
ATOM 10925 O OD1 . ASP H 2 70  ? 40.624  93.471  43.394  1.00 87.43  ? 70  ASP H OD1 1 
ATOM 10926 O OD2 . ASP H 2 70  ? 42.339  93.282  42.053  1.00 89.54  ? 70  ASP H OD2 1 
ATOM 10927 N N   . PHE H 2 71  ? 40.019  88.657  44.584  1.00 77.64  ? 71  PHE H N   1 
ATOM 10928 C CA  . PHE H 2 71  ? 40.038  87.218  44.881  1.00 73.65  ? 71  PHE H CA  1 
ATOM 10929 C C   . PHE H 2 71  ? 39.568  86.377  43.707  1.00 72.47  ? 71  PHE H C   1 
ATOM 10930 O O   . PHE H 2 71  ? 38.860  86.863  42.820  1.00 69.41  ? 71  PHE H O   1 
ATOM 10931 C CB  . PHE H 2 71  ? 39.131  86.901  46.067  1.00 69.50  ? 71  PHE H CB  1 
ATOM 10932 C CG  . PHE H 2 71  ? 39.359  87.778  47.253  1.00 67.01  ? 71  PHE H CG  1 
ATOM 10933 C CD1 . PHE H 2 71  ? 39.835  87.238  48.446  1.00 66.49  ? 71  PHE H CD1 1 
ATOM 10934 C CD2 . PHE H 2 71  ? 39.095  89.146  47.183  1.00 64.60  ? 71  PHE H CD2 1 
ATOM 10935 C CE1 . PHE H 2 71  ? 40.045  88.049  49.554  1.00 64.34  ? 71  PHE H CE1 1 
ATOM 10936 C CE2 . PHE H 2 71  ? 39.300  89.967  48.275  1.00 63.10  ? 71  PHE H CE2 1 
ATOM 10937 C CZ  . PHE H 2 71  ? 39.776  89.423  49.466  1.00 65.65  ? 71  PHE H CZ  1 
ATOM 10938 N N   . THR H 2 72  ? 39.935  85.098  43.732  1.00 72.98  ? 72  THR H N   1 
ATOM 10939 C CA  . THR H 2 72  ? 39.568  84.193  42.653  1.00 72.78  ? 72  THR H CA  1 
ATOM 10940 C C   . THR H 2 72  ? 39.411  82.731  43.017  1.00 73.49  ? 72  THR H C   1 
ATOM 10941 O O   . THR H 2 72  ? 40.222  82.156  43.754  1.00 71.68  ? 72  THR H O   1 
ATOM 10942 C CB  . THR H 2 72  ? 40.610  84.179  41.544  1.00 73.71  ? 72  THR H CB  1 
ATOM 10943 O OG1 . THR H 2 72  ? 41.757  83.436  41.993  1.00 70.45  ? 72  THR H OG1 1 
ATOM 10944 C CG2 . THR H 2 72  ? 41.007  85.596  41.161  1.00 71.86  ? 72  THR H CG2 1 
ATOM 10945 N N   . LEU H 2 73  ? 38.378  82.130  42.436  1.00 74.30  ? 73  LEU H N   1 
ATOM 10946 C CA  . LEU H 2 73  ? 38.101  80.716  42.613  1.00 73.69  ? 73  LEU H CA  1 
ATOM 10947 C C   . LEU H 2 73  ? 38.533  80.100  41.304  1.00 72.09  ? 73  LEU H C   1 
ATOM 10948 O O   . LEU H 2 73  ? 38.273  80.663  40.239  1.00 69.11  ? 73  LEU H O   1 
ATOM 10949 C CB  . LEU H 2 73  ? 36.607  80.472  42.807  1.00 75.48  ? 73  LEU H CB  1 
ATOM 10950 C CG  . LEU H 2 73  ? 36.190  78.997  42.775  1.00 78.56  ? 73  LEU H CG  1 
ATOM 10951 C CD1 . LEU H 2 73  ? 37.050  78.147  43.727  1.00 77.09  ? 73  LEU H CD1 1 
ATOM 10952 C CD2 . LEU H 2 73  ? 34.719  78.914  43.134  1.00 78.85  ? 73  LEU H CD2 1 
ATOM 10953 N N   . THR H 2 74  ? 39.204  78.959  41.365  1.00 72.52  ? 74  THR H N   1 
ATOM 10954 C CA  . THR H 2 74  ? 39.633  78.324  40.134  1.00 73.32  ? 74  THR H CA  1 
ATOM 10955 C C   . THR H 2 74  ? 39.443  76.814  40.152  1.00 72.21  ? 74  THR H C   1 
ATOM 10956 O O   . THR H 2 74  ? 39.712  76.123  41.149  1.00 67.58  ? 74  THR H O   1 
ATOM 10957 C CB  . THR H 2 74  ? 41.119  78.622  39.820  1.00 76.08  ? 74  THR H CB  1 
ATOM 10958 O OG1 . THR H 2 74  ? 41.957  77.796  40.637  1.00 75.06  ? 74  THR H OG1 1 
ATOM 10959 C CG2 . THR H 2 74  ? 41.445  80.086  40.107  1.00 78.55  ? 74  THR H CG2 1 
ATOM 10960 N N   . ILE H 2 75  ? 38.943  76.301  39.040  1.00 72.59  ? 75  ILE H N   1 
ATOM 10961 C CA  . ILE H 2 75  ? 38.772  74.873  38.937  1.00 71.66  ? 75  ILE H CA  1 
ATOM 10962 C C   . ILE H 2 75  ? 39.766  74.477  37.864  1.00 72.06  ? 75  ILE H C   1 
ATOM 10963 O O   . ILE H 2 75  ? 39.754  75.013  36.744  1.00 67.13  ? 75  ILE H O   1 
ATOM 10964 C CB  . ILE H 2 75  ? 37.342  74.477  38.529  1.00 70.65  ? 75  ILE H CB  1 
ATOM 10965 C CG1 . ILE H 2 75  ? 36.339  75.430  39.182  1.00 67.32  ? 75  ILE H CG1 1 
ATOM 10966 C CG2 . ILE H 2 75  ? 37.065  73.030  38.981  1.00 65.66  ? 75  ILE H CG2 1 
ATOM 10967 C CD1 . ILE H 2 75  ? 34.904  75.048  38.966  1.00 67.49  ? 75  ILE H CD1 1 
ATOM 10968 N N   . SER H 2 76  ? 40.656  73.572  38.249  1.00 72.79  ? 76  SER H N   1 
ATOM 10969 C CA  . SER H 2 76  ? 41.697  73.072  37.373  1.00 73.76  ? 76  SER H CA  1 
ATOM 10970 C C   . SER H 2 76  ? 41.080  72.498  36.109  1.00 75.96  ? 76  SER H C   1 
ATOM 10971 O O   . SER H 2 76  ? 41.381  72.944  34.997  1.00 77.67  ? 76  SER H O   1 
ATOM 10972 C CB  . SER H 2 76  ? 42.498  71.993  38.102  1.00 72.53  ? 76  SER H CB  1 
ATOM 10973 O OG  . SER H 2 76  ? 41.648  70.966  38.582  1.00 69.91  ? 76  SER H OG  1 
ATOM 10974 N N   . SER H 2 77  ? 40.216  71.501  36.296  1.00 77.72  ? 77  SER H N   1 
ATOM 10975 C CA  . SER H 2 77  ? 39.531  70.844  35.185  1.00 76.33  ? 77  SER H CA  1 
ATOM 10976 C C   . SER H 2 77  ? 38.044  70.574  35.493  1.00 74.76  ? 77  SER H C   1 
ATOM 10977 O O   . SER H 2 77  ? 37.679  69.535  36.058  1.00 71.32  ? 77  SER H O   1 
ATOM 10978 C CB  . SER H 2 77  ? 40.264  69.542  34.807  1.00 76.76  ? 77  SER H CB  1 
ATOM 10979 O OG  . SER H 2 77  ? 40.385  68.665  35.911  1.00 74.40  ? 77  SER H OG  1 
ATOM 10980 N N   . VAL H 2 78  ? 37.206  71.538  35.108  1.00 72.16  ? 78  VAL H N   1 
ATOM 10981 C CA  . VAL H 2 78  ? 35.756  71.500  35.295  1.00 71.02  ? 78  VAL H CA  1 
ATOM 10982 C C   . VAL H 2 78  ? 35.111  70.139  34.993  1.00 72.30  ? 78  VAL H C   1 
ATOM 10983 O O   . VAL H 2 78  ? 35.530  69.444  34.085  1.00 71.68  ? 78  VAL H O   1 
ATOM 10984 C CB  . VAL H 2 78  ? 35.095  72.555  34.390  1.00 69.33  ? 78  VAL H CB  1 
ATOM 10985 C CG1 . VAL H 2 78  ? 33.609  72.634  34.673  1.00 67.78  ? 78  VAL H CG1 1 
ATOM 10986 C CG2 . VAL H 2 78  ? 35.766  73.901  34.592  1.00 65.28  ? 78  VAL H CG2 1 
ATOM 10987 N N   . GLN H 2 79  ? 34.093  69.756  35.756  1.00 74.28  ? 79  GLN H N   1 
ATOM 10988 C CA  . GLN H 2 79  ? 33.401  68.489  35.516  1.00 79.31  ? 79  GLN H CA  1 
ATOM 10989 C C   . GLN H 2 79  ? 31.988  68.838  35.118  1.00 79.42  ? 79  GLN H C   1 
ATOM 10990 O O   . GLN H 2 79  ? 31.619  70.014  35.120  1.00 79.70  ? 79  GLN H O   1 
ATOM 10991 C CB  . GLN H 2 79  ? 33.329  67.632  36.773  1.00 85.02  ? 79  GLN H CB  1 
ATOM 10992 C CG  . GLN H 2 79  ? 34.657  67.233  37.342  1.00 93.06  ? 79  GLN H CG  1 
ATOM 10993 C CD  . GLN H 2 79  ? 35.567  66.638  36.300  1.00 96.87  ? 79  GLN H CD  1 
ATOM 10994 O OE1 . GLN H 2 79  ? 36.218  67.359  35.543  1.00 98.19  ? 79  GLN H OE1 1 
ATOM 10995 N NE2 . GLN H 2 79  ? 35.610  65.313  36.244  1.00 98.13  ? 79  GLN H NE2 1 
ATOM 10996 N N   . ALA H 2 80  ? 31.186  67.831  34.791  1.00 77.47  ? 80  ALA H N   1 
ATOM 10997 C CA  . ALA H 2 80  ? 29.812  68.115  34.407  1.00 76.46  ? 80  ALA H CA  1 
ATOM 10998 C C   . ALA H 2 80  ? 28.957  68.477  35.626  1.00 75.18  ? 80  ALA H C   1 
ATOM 10999 O O   . ALA H 2 80  ? 27.891  69.082  35.486  1.00 73.71  ? 80  ALA H O   1 
ATOM 11000 C CB  . ALA H 2 80  ? 29.214  66.926  33.673  1.00 75.98  ? 80  ALA H CB  1 
ATOM 11001 N N   . GLU H 2 81  ? 29.446  68.114  36.812  1.00 74.47  ? 81  GLU H N   1 
ATOM 11002 C CA  . GLU H 2 81  ? 28.758  68.358  38.081  1.00 72.89  ? 81  GLU H CA  1 
ATOM 11003 C C   . GLU H 2 81  ? 28.931  69.801  38.483  1.00 70.80  ? 81  GLU H C   1 
ATOM 11004 O O   . GLU H 2 81  ? 27.978  70.472  38.862  1.00 68.61  ? 81  GLU H O   1 
ATOM 11005 C CB  . GLU H 2 81  ? 29.349  67.493  39.200  1.00 73.23  ? 81  GLU H CB  1 
ATOM 11006 C CG  . GLU H 2 81  ? 29.466  66.004  38.906  1.00 79.38  ? 81  GLU H CG  1 
ATOM 11007 C CD  . GLU H 2 81  ? 30.213  65.696  37.603  1.00 83.86  ? 81  GLU H CD  1 
ATOM 11008 O OE1 . GLU H 2 81  ? 29.585  65.770  36.520  1.00 83.54  ? 81  GLU H OE1 1 
ATOM 11009 O OE2 . GLU H 2 81  ? 31.427  65.385  37.652  1.00 86.79  ? 81  GLU H OE2 1 
ATOM 11010 N N   . ASP H 2 82  ? 30.175  70.255  38.395  1.00 70.13  ? 82  ASP H N   1 
ATOM 11011 C CA  . ASP H 2 82  ? 30.576  71.600  38.755  1.00 67.77  ? 82  ASP H CA  1 
ATOM 11012 C C   . ASP H 2 82  ? 29.758  72.675  38.083  1.00 66.56  ? 82  ASP H C   1 
ATOM 11013 O O   . ASP H 2 82  ? 30.023  73.871  38.209  1.00 67.36  ? 82  ASP H O   1 
ATOM 11014 C CB  . ASP H 2 82  ? 32.050  71.759  38.454  1.00 68.14  ? 82  ASP H CB  1 
ATOM 11015 C CG  . ASP H 2 82  ? 32.857  70.639  39.051  1.00 69.76  ? 82  ASP H CG  1 
ATOM 11016 O OD1 . ASP H 2 82  ? 32.320  69.959  39.954  1.00 72.58  ? 82  ASP H OD1 1 
ATOM 11017 O OD2 . ASP H 2 82  ? 34.009  70.433  38.634  1.00 69.57  ? 82  ASP H OD2 1 
ATOM 11018 N N   . LEU H 2 83  ? 28.755  72.238  37.352  1.00 64.69  ? 83  LEU H N   1 
ATOM 11019 C CA  . LEU H 2 83  ? 27.860  73.165  36.716  1.00 67.44  ? 83  LEU H CA  1 
ATOM 11020 C C   . LEU H 2 83  ? 27.103  73.787  37.887  1.00 68.05  ? 83  LEU H C   1 
ATOM 11021 O O   . LEU H 2 83  ? 26.425  73.073  38.639  1.00 71.64  ? 83  LEU H O   1 
ATOM 11022 C CB  . LEU H 2 83  ? 26.923  72.377  35.815  1.00 71.91  ? 83  LEU H CB  1 
ATOM 11023 C CG  . LEU H 2 83  ? 25.677  73.015  35.219  1.00 74.60  ? 83  LEU H CG  1 
ATOM 11024 C CD1 . LEU H 2 83  ? 25.928  74.452  34.759  1.00 77.22  ? 83  LEU H CD1 1 
ATOM 11025 C CD2 . LEU H 2 83  ? 25.256  72.121  34.070  1.00 72.54  ? 83  LEU H CD2 1 
ATOM 11026 N N   . ALA H 2 84  ? 27.227  75.098  38.068  1.00 63.79  ? 84  ALA H N   1 
ATOM 11027 C CA  . ALA H 2 84  ? 26.535  75.742  39.178  1.00 61.99  ? 84  ALA H CA  1 
ATOM 11028 C C   . ALA H 2 84  ? 26.637  77.244  39.129  1.00 62.99  ? 84  ALA H C   1 
ATOM 11029 O O   . ALA H 2 84  ? 27.192  77.816  38.193  1.00 65.04  ? 84  ALA H O   1 
ATOM 11030 C CB  . ALA H 2 84  ? 27.110  75.253  40.491  1.00 56.16  ? 84  ALA H CB  1 
ATOM 11031 N N   . ASP H 2 85  ? 26.064  77.887  40.138  1.00 64.62  ? 85  ASP H N   1 
ATOM 11032 C CA  . ASP H 2 85  ? 26.164  79.327  40.253  1.00 66.09  ? 85  ASP H CA  1 
ATOM 11033 C C   . ASP H 2 85  ? 27.103  79.521  41.443  1.00 70.11  ? 85  ASP H C   1 
ATOM 11034 O O   . ASP H 2 85  ? 26.818  79.064  42.560  1.00 72.53  ? 85  ASP H O   1 
ATOM 11035 C CB  . ASP H 2 85  ? 24.817  79.981  40.535  1.00 61.73  ? 85  ASP H CB  1 
ATOM 11036 C CG  . ASP H 2 85  ? 24.919  81.500  40.548  1.00 61.86  ? 85  ASP H CG  1 
ATOM 11037 O OD1 . ASP H 2 85  ? 25.997  81.999  40.161  1.00 63.76  ? 85  ASP H OD1 1 
ATOM 11038 O OD2 . ASP H 2 85  ? 23.948  82.199  40.927  1.00 57.58  ? 85  ASP H OD2 1 
ATOM 11039 N N   . TYR H 2 86  ? 28.232  80.178  41.189  1.00 70.43  ? 86  TYR H N   1 
ATOM 11040 C CA  . TYR H 2 86  ? 29.239  80.396  42.211  1.00 67.63  ? 86  TYR H CA  1 
ATOM 11041 C C   . TYR H 2 86  ? 29.162  81.777  42.861  1.00 69.17  ? 86  TYR H C   1 
ATOM 11042 O O   . TYR H 2 86  ? 29.095  82.804  42.179  1.00 66.46  ? 86  TYR H O   1 
ATOM 11043 C CB  . TYR H 2 86  ? 30.601  80.110  41.598  1.00 65.11  ? 86  TYR H CB  1 
ATOM 11044 C CG  . TYR H 2 86  ? 30.767  78.635  41.273  1.00 63.17  ? 86  TYR H CG  1 
ATOM 11045 C CD1 . TYR H 2 86  ? 30.314  78.090  40.062  1.00 63.25  ? 86  TYR H CD1 1 
ATOM 11046 C CD2 . TYR H 2 86  ? 31.341  77.771  42.205  1.00 65.78  ? 86  TYR H CD2 1 
ATOM 11047 C CE1 . TYR H 2 86  ? 30.433  76.701  39.800  1.00 66.57  ? 86  TYR H CE1 1 
ATOM 11048 C CE2 . TYR H 2 86  ? 31.466  76.402  41.961  1.00 65.26  ? 86  TYR H CE2 1 
ATOM 11049 C CZ  . TYR H 2 86  ? 31.015  75.868  40.769  1.00 66.39  ? 86  TYR H CZ  1 
ATOM 11050 O OH  . TYR H 2 86  ? 31.152  74.502  40.595  1.00 64.99  ? 86  TYR H OH  1 
ATOM 11051 N N   . HIS H 2 87  ? 29.185  81.782  44.195  1.00 73.28  ? 87  HIS H N   1 
ATOM 11052 C CA  . HIS H 2 87  ? 29.038  83.008  44.973  1.00 77.09  ? 87  HIS H CA  1 
ATOM 11053 C C   . HIS H 2 87  ? 30.169  83.492  45.873  1.00 76.95  ? 87  HIS H C   1 
ATOM 11054 O O   . HIS H 2 87  ? 31.029  82.730  46.326  1.00 76.06  ? 87  HIS H O   1 
ATOM 11055 C CB  . HIS H 2 87  ? 27.794  82.897  45.849  1.00 83.20  ? 87  HIS H CB  1 
ATOM 11056 C CG  . HIS H 2 87  ? 26.512  82.776  45.085  1.00 88.94  ? 87  HIS H CG  1 
ATOM 11057 N ND1 . HIS H 2 87  ? 25.984  83.814  44.344  1.00 89.75  ? 87  HIS H ND1 1 
ATOM 11058 C CD2 . HIS H 2 87  ? 25.633  81.749  44.977  1.00 88.41  ? 87  HIS H CD2 1 
ATOM 11059 C CE1 . HIS H 2 87  ? 24.834  83.430  43.816  1.00 89.79  ? 87  HIS H CE1 1 
ATOM 11060 N NE2 . HIS H 2 87  ? 24.599  82.181  44.184  1.00 88.05  ? 87  HIS H NE2 1 
ATOM 11061 N N   . CYS H 2 88  ? 30.088  84.788  46.170  1.00 76.06  ? 88  CYS H N   1 
ATOM 11062 C CA  . CYS H 2 88  ? 31.040  85.487  47.014  1.00 72.27  ? 88  CYS H CA  1 
ATOM 11063 C C   . CYS H 2 88  ? 30.468  86.213  48.212  1.00 68.55  ? 88  CYS H C   1 
ATOM 11064 O O   . CYS H 2 88  ? 29.426  86.875  48.128  1.00 62.79  ? 88  CYS H O   1 
ATOM 11065 C CB  . CYS H 2 88  ? 31.806  86.493  46.198  1.00 72.81  ? 88  CYS H CB  1 
ATOM 11066 S SG  . CYS H 2 88  ? 33.443  85.895  46.022  1.00 80.71  ? 88  CYS H SG  1 
ATOM 11067 N N   . GLY H 2 89  ? 31.184  86.109  49.326  1.00 66.68  ? 89  GLY H N   1 
ATOM 11068 C CA  . GLY H 2 89  ? 30.745  86.769  50.535  1.00 62.82  ? 89  GLY H CA  1 
ATOM 11069 C C   . GLY H 2 89  ? 31.887  87.232  51.406  1.00 61.06  ? 89  GLY H C   1 
ATOM 11070 O O   . GLY H 2 89  ? 32.938  86.591  51.452  1.00 62.94  ? 89  GLY H O   1 
ATOM 11071 N N   . GLN H 2 90  ? 31.670  88.353  52.087  1.00 59.01  ? 90  GLN H N   1 
ATOM 11072 C CA  . GLN H 2 90  ? 32.652  88.930  52.993  1.00 58.62  ? 90  GLN H CA  1 
ATOM 11073 C C   . GLN H 2 90  ? 32.008  89.152  54.345  1.00 58.41  ? 90  GLN H C   1 
ATOM 11074 O O   . GLN H 2 90  ? 30.807  89.381  54.442  1.00 61.10  ? 90  GLN H O   1 
ATOM 11075 C CB  . GLN H 2 90  ? 33.176  90.264  52.458  1.00 57.56  ? 90  GLN H CB  1 
ATOM 11076 C CG  . GLN H 2 90  ? 32.150  91.396  52.328  1.00